4WWID

Crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
207
structure length
201
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREERVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 33
structure length 201
sequence length 207
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wwiD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wwiD01
2YD6A 3VD4A 4PJHE 4PJCF 5CJBA 5IB3B 4NQVA 3GHEH 5LQBL 3OXSB 1KCKA 2R23A 4I77H 1F4XL 1HQRB 1NEZA 3MJ8B 5TDNB 1B6DA 3NIDF 3VFWA 1DFBH 1IE5A 4O51B 4XPAH 1VGEL 3R06B 5CGYC 1KCVL 2GJ6A 3UPRA 4OSUH 1JWMA 4KK6C 3G6DH 3PWJA 5GSRA 2DQIL 1K2DB 1VPOL 3RIFK 3I3EA 3S36L 3V79C 4RMWA 4NHUB 5CJ5A 1MEXL 4LKXB 2V2WA 5EULV 2YHGA 3VH8B 1IBGH 5LXGH 4M6OL 2C3VA 3HMWH 5BRZE 1HH9A 3IRPX 4AZ8A 1IGYA 2W07A 4NKDB 1NCDH 2I24N 3E6HA 4JRXD 5KVDL 4ZYKA 2R69H 1JWSA 1IT9L 4OCRL 1AKJA 4CAGA 5FHAH 4JQVC 1Q72L 4E41D 5D72H 2BVEA 3AS0A 5C6TL 5EU6D 3AXLA 1FFPA 1YJDL 4PB9L 4O2EA 5DK3A 1R5WA 4NKIH 1HSBB 3O6FD 4WUUE 4ZAKC 1A4KB 2B2XL 1T4KA 2J5LC 2DQIH 4F57L 5JLZB 4HKJB 2Y6SD 4P9HL 2Q8BH 1HQRA 3OHXB 4HKXB 1D5IL 1G84A 4MQXC 4Q7DA 5DWUH 1L6XA 1S9WA 1DLFL 2J8OA 5CKGA 3WCYA 3SE8H 2IAMA 4QF1B 3D3VD 4PJ8B 2ZUUA 2IAMC 1QNZL 1WK0A 1S7QB 1U8KB 1OW0C 2EXYC 3CU1A 4KMTH 4TNVK 4XC3L 4MA7L 2IFFL 1OB1B 2MPAL 4TPRH 4OGYH 5FYLH 5F88B 2NY1C 3L6FB 4WI4A 1IGCH 4IM8A 4YHYB 1FE8H 4WVRA 1BJ8A 3W39B 3STZB 4HX1B 5C3TA 5JO5B 4QRPD 5L0QC 4MA1B 3PHQB 1X44A 4JO2L 2I60L 3HKFA 4OZHA 1IGJB 4OLZH 4GAJH 4PRAA 3LZFL 2B0SL 3RWHB 1J1XH 1RUPH 1ZHBB 4X4ME 2NY2D 5DS8B 3S8WA 3P0VL 1V05A 4CMHC 5D96C 4G6JH 4Z7WA 2WINA 5DT1H 4BSWB 5I66B 1TETL 1YY9D 4BA8A 2ICEB 1CXFA 4R96B 3BEWA 4KK6D 3KJ4C 4Q6IA 5SX4H 4EUPG 3UPAA 1UFUA 3IKKA 3V4UH 3QWOA 5K9JH 3VFGL 5E2WH 2DRUA 3KAAA 5JXAL 1AH1A 3DMMB 1RV6X 2O61A 4PJ9B 3H0TA 4ZMAT 1FV1A 2DD8H 2I07A 3L3GB 4X6BB 3MRIA 1FP5A 3NZHH 2B4CC 4NYLB 4H20L 3WNMA 4JZNB 2XN9B 1MCQA 3HNTL 1JV5A 2Y06H 4JGMA 5E6IA 3WD5H 4LSUL 4YBLC 3BD5A 1BX2B 4HUMB 4K3EH 2Y07H 5F1NB 5HHOE 1EV2E 1F6FB 1MHCA 4JHBA 1OAXL 4U3CA 3OKMA 2A6DB 4IIQA 1JF1A 3FOMA 1AP2B 4PJFE 2I9TB 5IK3B 2BVOA 3WKMH 4ZTPH 2HJLB 3VRIA 4WFEE 3MRBB 4CRPA 5SWQA 2GSGB 2FIRT 5D71L 1TVBA 3UTOA 4F58H 3MLYL 3PWPE 3RIFF 4LQFH 4XPTH 3SQOL 3G08B 3QPQD 2JB5L 2DQTL 4YIQB 2HVKB 3LN5A 5DJXB 3C9NA 3K3QA 3HPJB 1F8TL 1T0NB 4CDHA 4QHLA 5FUZH 2JIXB 4OD3L 3IFNL 1SEBA 2BSRB 4Y89A 1OARH 1M4KA 1DLHA 1KPVA 4U0QB 3VI3E 3E8UH 3WLWC 1AGBB 3GJFA 5CJXA 5CS7A 3KPQA 1HH6A 3RA7H 4KTEH 4L9DA 5JORA 1J0IA 4Q0XL 2VR9A 4UT6H 4BQ8A 3HC4L 4O2CA 4F37F 2ICWA 4V2BA 1KF9B 4M9OA 4OLUH 1FNEA 4M7JL 2IEPA 4NJAH 4OJFL 4FQHA 3V9FA 5JXEA 4NN6B 2RAMA 3CMOL 4L8BB 5DMGC 4IJ3B 1YY9C 2IPTL 3T65A 3DBXA 1SM3L 1TNNA 2QSCL 4KTEL 4Y5YB 1QSEB 4JN2B 2BDNH 1AE6L 3RY5A 3KPOB 3MJ6A 5IBUB 1A1NB 1CGSH 2X4SA 3RI5K 4BKLB 3FN3A 3ZE0F 1VHPA 3EFFA 4UV4L 1NAML 2VDMH 4HAFA 3U2SB 2CIIB 1DBAH 5EU7C 4DW2L 4G9FD 5EOCJ 5B38G 1BFTA 4NN7B 1WAAA 1BFVH 2NY4B 1B2WH 1KCRH 3WUZA 1DCLA 5GZNC 4JFEA 1L0XA 4YHML 4MYWB 1Y6NR 1ZWIA 1UH2A 2HJKB 3TP4A 4XNZC 1XZ0A 1MRCL 1MJJB 1AXTL 1GZQB 4OAWA 1Q94A 4DKEH 2PTUA 1BQHG 4ZSOE 2FRGP 3ABZA 2JCCE 2NNAA 3NPZB 5I30L 1NSNH 3VFTA 2BJMH 1RQ5A 3GHBL 1CFVH 4Y19B 4MJ5A 4PRIB 1J8HD 1BQLH 3DHJA 1AP2A 5DHYA 4QRRD 4XAWH 3H7BB 32C2B 5JMOC 1QFUH 4PJGF 3HNTH 5ICXA 1D5XA 1DEDA 4F7CB 1CN4A 1ZGLM 1OGAE 1FL3B 1FG9C 5FYKH 5C0GA 5EFIA 3BYYA 2VLJA 5H35B 1OAQL 4MAYC 3QO1B 35C8L 2AEPH 4OV5A 1RZ7L 2OSLA 3BPOB 4QRPA 3VFMB 4P5KA 2OJZH 5EZIH 1QHPA 2ADIA 1W0VA 4OLWH 1DBBH 4NZRH 4YWGH 4Y8AA 3K2MC 1LP9A 3PJSB 5TE7H 2V9QA 5C0NC 2X1QA 1CFBA 2E7LA 1NGWB 3IU4L 4KDWA 4F33A 2Y5TB 3O2WH 3STZA 4MA8L 2P8PA 3UTTA 2P49B 3CVHH 4KMLB 3F7QA 2CDFA 5MERA 1OL0A 4XVSH 5BMFL 1QEWA 2I5YL 4GRLB 4QXTA 5SV4A 5F3BB 3PP3H 1F58L 2DYPA 3QQ9C 4G9DB 4HAGA 1FGNH 4WV1A 5C09E 2VKXA 4I13B 3UBXG 1H5BA 2I26N 1Z9LA 3P4NB 4N0CC 4N9GA 3TGXA 4KKBC 4ZAKA 3HUJE 1T1WA 4JY5H 3PP4H 3MGOB 5HHOD 4X9GA 3QG7H 5FYLD 2CR6A 4PJ5D 3GJEA 1ROWA 4KROD 4P5TB 1RD6A 4MLSA 5C0BD 5FO7A 1OAQH 4FTVE 3CX5K 4WO4A 2EEAA 2IPKA 3MJ9H 3ISWA 3HMXA 1S7WB 2AJZA 4XVSL 3GSOB 1KPRA 4PBXA 4AT6B 1T0MB 1A6TA 3J8F7 5ID0A 2DB8A 4MNQD 2DIAA 3RVXD 5L88H 5L2KE 4KAQH 4ZNEE 5B8CA 4X8XA 1D6VL 2DQHH 2W0FA 2VAAB 4RA0C 4OTXL 3V5HB 1YN7B 4Y5XC 3TT1H 4KKAD 4FNLH 3G6JB 4I3SH 4HLZH 5FM8A 5IVXA 2A0LC 2X4OB 1AXTH 1GOFA 4H25B 1K2DA 4RFNC 4EBQH 3L3JA 3WXVH 3QXUA 5ANMB 4UT9L 1KLGA 1F4AA 4EVNB 5I1CH 4NC1E 1EFXD 3MLRL 1RVFL 2B1AL 1WLHA 3VH8A 5E6ZA 5JW4N 2BNRB 2P24A 1XF4A 4N0FA 3OAYH 4WHTA 1WT5A 3KS0J 3O4LA 1U8JB 5AZ2H 4OCWH 5J1AB 3LKRB 5ID0B 1MVUB 1P1ZA 4P23B 2RIKA 3ZHKA 4POZD 2BJML 2RCSH 3V0AC 3ZE0E 1GPOL 1V5JA 3H2WA 4P5TC 4MSWB 3CNKA 3MLTA 3AAZA 3ZL4L 5DJ2B 1HNGA 3C87A 4P5TA 1N2RB 2DM2A 3HS0B 4KPHH 4X0KB 5ADOL 2XZAL 4YDLC 1YPZF 4FG6D 2BNQB 3NCEB 3EYUL 3GMRA 1T83C 3JWOH 2NY2B 2I9LB 3H8NA 5T1KA 2BP3A 3JWDH 3RNQB 1FBIH 2VLJE 4NRZA 2WUBL 1G7QA 1DQLL 1T1XA 1UACL 2FJHA 2NZ9C 3H3KA 3MJGX 5CINL 5A16A 1WWBX 3QJFA 4H8WL 5BRZA 4E41E 2X70B 3WE6B 5IM7A 2RJMA 3U30B 2AXFA 2EDJA 2EEDA 2KH2B 5EOQH 1OPGH 4LPYA 5CSBA 1KIQB 2PR4H 3JXAA 3DXAA 3F6IA 2VE6B 2QQNL 5T1MA 5IV2A 2G75B 1EIBA 2GJZB 4AENA 2HP4A 5ALBH 1TPXB 5DEFB 1U8LB 3FQNB 3RDTC 1FO0B 4G7VH 1ZT4A 4V1DB 3VG0L 5HGHA 5BVPH 2BNUA 4M7ZC 1AO7E 4HUNB 4KKAC 1HILB 2EC8A 1A6UH 2F54B 2HWZL 4ETQA 3ZTJH 1G0YR 3MZTA 3U46A 1H0DB 1QQDA 1G7JA 2XPGA 3LS4L 3T0AA 1BEYH 1U41A 2MWCA 3L3KA 2EDHA 3K0WA 2C3XA 2G9HB 5DHYB 3V5DB 1UZ6F 1YPZA 4PJFB 4NQCA 1FC1A 3VCLA 4OFPA 1IAIM 1UG9A 2VJXA 4M4PA 3D2UB 5CJQH 5IKCA 3UTSD 3CVIH 4PGBA 5DJCB 2C5DC 3DSFH 5FO8A 2X6MA 2BVUA 5DUPH 4ACPA 1F97A 1GZQA 4TOYH 5EBGA 3O6LH 5F93C 4HXBL 1TVHA 5I17B 3MRKA 3ETBF 3LS5L 4N5EC 3Q2CA 3S5LG 1JRHH 3EW3B 2EDQA 4WFFD 1FO0A 3MV7B 3VXPA 3T0EC 3VD9A 1G9NL 2HT2C 4P2QB 3Q5YA 5TH2B 1T2QL 2VXUL 1W72B 3EYFB 5GIRB 3GNML 3O8XC 1A5FL 5GGSA 3CDGB 4YQXL 1L4IA 1Q0XL 3O0RL 4JFHD 4MXVE 4PYHA 1JZ5A 3WD5L 4H1LB 1F4WH 5T1KD 3GSRA 1GXEA 4RBPK 1H9VA 2VABA 1IARB 4OUOA 4E41A 3OKNA 4F9LC 1ZA3A 5FO9B 3IFOB 2APBA 2BX5A 2CRIA 3RGVB 4P9ML 5DJYB 5GRWA 4PS4L 5I71C 3WSQL 2R15A 3VI3F 2C1OA 1EAJA 5FM4A 4JLRB 4JM2C 3RL1B 3T2QA 4Y5XA 3FO9A 3MOAH 5KZCD 3GMRB 1ZHKB 3RNKB 4XCCL 2EDXA 3OMZA 4NRXB 5C09D 4E5XB 2F53B 4FQ2H 3DUSB 5TE6H 2FR4B 2NY4D 4JFPA 3CPLB 4GAJL 4NQSB 5BV7C 2WBJB 4KKLD 3AAZB 3C5SA 4YO0A 2QLVB 4OBSA 1AGBA 1A2YA 4UB0L 3TM6A 1LK3H 4HMDA 4X80H 4ONGH 1K3ZA 43C9B 1JYXA 3MBED 1KBGL 3GKZA 4QXGH 4BK4A 5J1SC 4QOKB 3RJDA 5KVEL 1IEAB 4HULB 1D7FA 4DQOL 3FHQA 4PRPD 4EN3B 4KU1A 3QCVL 4QYOB 5MI0C 2E7CA 2P24B 5FCUL 1NUFA 5INCB 1PG7H 1RIVL 3B4NA 1QPPA 4GW1A 3ULVE 2A6IA 1E27A 1FIGL 3QH3B 2YC1A 3ZLQC 3U6RB 3JBG7 4DN4L 1Q1JL 2PUQT 1CR9H 2YD9A 2YPVH 4UOW1 4JFFD 3RIAF 5HBBA 3PHOB 1T83A 5A1AA 1J0JA 1YYMH 1BZ7A 3V0VB 1EZVX 2IBZX 3VWKC 5L2JB 3TZVC 1OAZH 3AREA 2GHWB 1KB9J 1GOGA 1LEIB 4N0RA 3MODL 3K1KC 5EB9A 1DE4B 1L7TH 3HMXH 3MV8D 4HPYL 4E42B 5GS1A 3QUZA 1A4JB 4Z95L 4ZXBD 1QSFB 3O45B 2ADFL 2NCMA 3QNXA 3U9PH 3QUZC 4PLJC 1CIDA 1OSZA 3FZUD 5D7JD 1GC1H 4DGIH 4KHTL 4MA3B 1KXVC 4U1LB 5DO2D 1AY1H 3JZ7A 3WHXB 3CSBA 3H3PH 3GFUA 4U31A 4RNRA 1FGNL 4GKOA 5GRUH 4BSWA 5LG1A 3K81A 2Q8AL 3ZT5A 2J6EL 4ODHH 4S11A 5BZWB 3U9PL 1JWUA 1M7DA 2F74B 4J12A 3VWKD 2HT4C 2VXSL 4GFTB 1JTOA 3TT3H 5IEKB 5A3ID 1H3PL 3MCG1 2DBJA 1U8HB 3PXJA 4P0DA 4LL9A 2W9EL 5B39B 3B2VH 5DTFB 1AIFB 1TQBC 1A2YB 1U3HC 4GO6B 4P4KD 4PP2A 4QO1A 2FD6H 3LPFA 3L6FA 4FQCL 4PJAE 3TZVB 3T2NH 1J5OH 4LK4A 1JGLH 5C0EA 1K85A 5F1OB 4APQA 2WBKA 1FRGH 2YUXA 4CBPA 3OWEA 3ESUF 3FQXA 3EDEA 1OWRM 3M1BA 4P4KA 1BIIA 3MGTB 5KN5A 2DYPD 4WWKD 4R97C 4LLAA 4DGVH 3HC4H 2C4FT 3HC0B 4OLEA 5IFHL 2JJTC 1GIGH 4TSAL 3VW3H 2VRAA 5HDQH 3V6FB 1KBGH 2JJTA 2VC2H 4J3UA 2Y1VA 2H6PA 3PWPD 4K7PH 5ICYA 1EUUA 3IAQA 4H5SA 1LGVA 2F8VA 1DQDL 2DIJA 3DV6B 4WGVB 5E08H 2J12B 5C0BA 3LKOA 5DRZA 4K3JL 1NUDA 3FFCA 1ZTXL 4LLUB 4O2EB 4LLVA 1ZT7A 1MIML 4HWEL 3C2AL 1JHKH 4K9EL 4BH8B 4MA1C 3HTLX 4PJCB 2BOCB 4P2OA 5BMFH 4G9FA 3FT3A 2FSEA 1YEKL 3OR7B 1CS6A 1IM9D 3IFLL 4L4TD 3MCLH 2MOVA 3TCLA 3SY0B 1HWGB 2HRPL 1CD0A 1EMTL 4JB9L 4LIQL 4QRTA 5AD0B 3ULUL 4LRIA 4MAYA 3WUWG 2NZ9D 4QOKA 4RWHA 2BNQD 2WQ8A 4OD2A 4WU5A 4F80A 1LNUB 4JQXC 4YC2B 2PN5A 3ULVC 2JJSA 2WIIB 5CEZE 1TJHH 2EKSA 1YEGH 3BGMA 3LIZH 1IGIH 4ZPVA 1GC1L 1SVZA 2X4SB 1RZ7H 3P77B 2VL4A 1N59B 3TIDB 4XXDB 2BRRH 4RAUA 3HI1B 1YEJL 1A7NL 2B5IC 5IVZA 1P7KA 2XFXB 3QQ3A 1HWHB 4KKCD 4OZGA 1IKFH 4WJ5A 3B2UC 3GDBA 2AEQH 2J4WH 4YHZL 1OAKL 2CLVA 1FZMB 2DQDL 2Z8SA 5C0DA 3V4PH 3VXOB 5DD0H 4G8FA 1NGPH 3BXNA 2X4UB 5GJTH 4FQHB 2YXFA 2FATL 5IVOA 4HPOH 3OKOB 3SDXB 1RIHH 4JFXB 3QFDB 5FHBH 3QPXL 1ZVSA 3X11A 4KGJA 3TO4C 4J4PD 3DXAB 4KI5F 4LCUA 2P8LB 4EIGB 1HKLL 1YECL 3ZHLA 5HVWA 1IAMA 2HLAA 5K9QI 1ZLUH 3W9EA 4F15C 2G5BB 3THMH 3CH1A 1N0LA 4ERSH 2QV2A 1EMTH 5D1QA 3VMOA 1DBML 5GGRY 2YRPA 2AJYL 4GUPA 2GJ6D 1KIPA 3GMPB 5I73B 4HGMA 4PTTA 4O2FB 5EO1A 3VFSB 2UWEA 4LBEB 4MD4A 4ODBD 2Z31D 1HINL 1S9VB 2V5YA 5HYJB 5FOBB 3CVHB 3ZZ1A 4HWBL 4ELKB 2FJGB 3NCJL 3ZL4H 4QHKI 5ITBL 4JR9H 1XIWB 5EPMA 3QDMD 3DVGA 3RUGF 1ZMYA 2XYCA 4L3AA 3QBTB 2F5BH 5D7LB 4GSDH 4IHOA 1ZGLB 1BBDH 4HPOL 2R2HA 4QRUA 2QL1A 3WYRA 2X5PA 4OCWL 4JE4B 3BQUA 1ZKAA 1CXEA 1FZKB 1QOKA 3MRNB 1DQLH 1NDMB 2WIMA 4EOWL 1XGYH 1DQMH 3KXFA 4JKPH 3SOBL 2BXZA 4XBEH 3ELAT 4L4VE 2VWEE 3FB8B 1W2KT 2AXGA 4LPTA 5HGHB 4MVBD 2JK5B 3EGSB 3SCMC 2BSTA 3X12A 1XCTA 3VXUB 4LHUA 1FSKB 1NGQL 2GEEA 3NFNA 3RGVD 3P40A 1NFDF 4JPWL 2BOBB 3GIVB 4O5LL 3WXWH 5JOFB 2PYFA 3QDGE 1KYOJ 3S4SB 1UKSA 2ZP0T 1KNOB 4NQEE 4KKLC 2Y6SC 1V8HA 4URTB 2R0LH 1C5DB 5HHQB 1CGXA 4XNXL 3C5ZB 4ZDHB 4XPTL 1BECA 3ARFB 5INDB 5GRVL 4XPAL 1V3JA 3GSNA 5C1MB 3DOSA 3KNBB 2H2PD 4QT5A 4HZLB 3T08A 4JDVA 5D6CA 4EIZC 2QADB 1I9RH 3DV4A 4LCIH 3GJFH 3DNKA 3IDMB 1LEGA 4QGTA 3WO4C 3AS2A 4ORZC 3BN9C 1T5WA 3V7AG 4I0KA 4UQ3B 1EVUA 3ARBB 1NLBL 5D1ZC 1KJ2L 5LJYH 1BEYL 1ACYH 5ESQA 5F7WC 4HW6A 1LEGB 4MZ2A 5ANME 3PV6A 5E2TH 4KVCH 4WV1B 4Z78B 2YEZB 4PJBB 4YUEH 2VDLL 4P46C 5L88L 5E8NB 1CLOL 1SBSH 5HHMD 5F7YC 2A73B 5FF6A 5DZOA 3VXTA 2B2XH 2HN7A 1LK2B 3DI2B 1FFRA 3O4LB 2FZ3A 4HUXB 4HS6A 2OS7A 3AU1A 4PG9A 1AD0B 2O5XH 2ICWI 2CLRA 1EEQA 3ZSTA 5JQ6L 1LNUA 4PLJD 5EU6E 1YY8A 2OCFD 2QKIB 2WBJC 5DMJB 3BZFB 3ME0A 1EGJA 2UVFA 1W0VB 1MFBH 1I1AA 3ARZA 4G3YH 3SDCD 1MEXH 1GGTA 1IILE 1JPSL 4PJGA 1KLGB 3ZT6A 3U4BH 4EVNA 5I1AA 4WUUB 1KSRA 5ACZA 5C7XH 3DO7A 2VLJB 2YOCA 3HB3D 2VR4A 1AQDB 1ZV5A 4PJAB 4QHMA 4N1EA 3MRPA 4OI9A 3L5XL 3BZ4B 1UXWA 1FZKA 5K9KB 5D1XB 4PB0H 3V4VH 5I8EA 3GI8H 1X5KA 1I1YA 1U3HD 2G60L 4WO4B 1W8NA 4DGIL 3R0NA 1A6VH 5IHUL 2VLRB 2FLRT 3RU8L 4PJ9C 2EIBA 5C0CD 2SEBA 1T0MA 1MCOL 3PDOB 1AO7D 1MHPL 3T1FB 5E8NA 4TULL 2X4QA 3M1BB 4P4KB 3BX7C 5FO7B 2VDPH 4PTTB 2RBLA 1VFBB 1BVZA 2FX8L 4MNQA 1BBJA 4S1SH 4Z7UA 2DQCH 1NCAH 4NKIL 4QXTB 1NMCC 1WZKA 3DX6A 2X9WA 5F7FA 1NCBH 3TN0A 5EOCH 2BC4A 1QRNE 4ZUSA 2YD7A 1MJ7H 5I74B 3FT2B 5J6GA 1QRKA 3KNBA 4X6FA 1EEUA 2ZJSH 5L6YL 4JN2A 4GG8B 1CDBA 3HAEB 4FFWD 4Q9RL 4HQQL 1JBJA 2APXA 3MC0A 1SYVA 3SDAA 3HHRB 3SEPA 2N4IA 4WW2B 5HHQA 4LEOA 3BDXA 1J0KA 1TZGH 4NWTL 2IANE 3GMQB 5F7EL 5HYJE 4XP4L 4QRQB 5JOFA 1RZKC 4F58L 1FYTB 2CLVB 3O81A 3VXOA 3WLBB 1S7TA 4ZS7H 5BO1L 2H32H 1P7KB 4KI1A 4HWBA 3LKNB 5IVZB 2H26B 1PKOA 1MJUL 5JZ7D 4FZEH 5EUKB 1YEIL 4DOHE 3DGCR 4UI2A 4O00A 1CU4L 4NQDE 1ZLSL 2EE2A 4D2NA 3PABA 1A21A 1MOEA 4WI9A 5H35A 3LS4H 3KXFB 2E7HA 4WY7L 3RWEB 4OM0L 2W38A 2AQ3A 3D69B 1EXUB 1NBZB 3VDAA 5AD0A 4M1CD 3T4YA 1H5BC 2DJ4A 4HFUL 1A7PH 2B4CL 5D4QA 3SE9L 2AP2A 4ZNCD 2V17L 4OFIA 5K9JL 3LSOA 3O4OC 4HS3B 1ZLWH 5I1KL 2NNAB 5E9DE 4G6ML 3GNMH 3MRFB 3T2NL 2XT1B 3GO1H 3L3IA 3LCYA 1VADB 2O5YL 1IAIH 1U8OB 5FOBA 4UV7H 4LBEA 2VDRH 1N64L 3FTGB 4QHNA 3C60B 1F3JA 3DV6A 4PR5A 5IW6B 3MYJA 3MFFB 3R8QA 1P2CA 5HPOA 3MO1A 3WNKA 2FO4B 4PV8A 3SKJH 5F1NA 3RWDB 1BX2A 4HK3N 4FQXB 1NL0H 2X44D 43C9A 4Y5YA 4KDTA 3IDJA 5KS9A 1RULL 2CK0L 3HC0A 1JPST 1MQ8A 4X99A 3N85L 5F3HB 4WWID 3LEYH 3MLSL 3P9LA 2BY0A 4PJEF 4NRXA 3DYOA 2XWJA 4FFWC 5DMGD 3PL6D 5HVHC 2M8XA 1RJLA 4XCYB 5CCKL 4QRQA 2WINB 3HI5H 4KFZC 4HWBH 4EI5B 5DJYA 1SEQH 4PJBE 1N7ML 4RMRA 2HT3D 2Z31B 5IMKB 2YD4A 2BSSB 3HC3L 5B39A 3BH8A 1KCRL 1CGWA 2YR3A 4JKWA 4MQ7B 4XC1L 1MHHB 2P46B 2VH5H 3D9AH 3NH7L 4JFQB 4BSVA 2IBZY 2NY5H 2A6JA 1P2CB 2ZSWB 5DUML 2LTQB 3NZHL 3IDIB 3LV3B 4OGYL 4HX1A 3KPQB 1F6AB 3WLWD 3MNWA 3LQAC 4Q9QL 4KI5C 1VADA 4TRPL 4KWUA 5SWSD 4UTAH 5KVFH 3TYGH 3EYVB 1BBJB 1NMAH 3EYQC 3MYJB 3DPBA 4KROC 3KPNA 4G8EA 1DANU 3GSQB 1BZ9A 4HJ0D 3HG1A 5FA4B 3S36H 1CWVA 1JF1B 1K4CA 2GTWA 2VSCA 1FORL 1S5HB 1WC7B 4NNPH 4L8DA 4E42A 2XQYK 3K7UA 3QHFH 7CGTA 1A7NH 4PRDB 1XGQA 3FFCB 3D0VB 4HFWA 5M94B 2YD3A 5D2LE 3P30H 2UZIH 2C4XA 3X3GL 2LU4A 4S10A 2WP3O 4X8JB 3VXSE 1R3JA 5IP4A 4CVXA 3D5OF 3STBA 1AKJB 4KJPC 4ZUWB 3IKCA 2O5ZL 1HILA 4U7KA 5F9JA 2P5WD 1IC7L 4M6NH 4JDTH 5J4MA 4CJ1A 2BNUB 4CNIB 3L3GA 1P69B 3QR2A 3RDTA 1F8TH 2I5YH 2X40A 4HDIB 3FQXB 5CJXC 3INUL 1GGBL 4F7MB 3LY6A 4R2GB 1JHLL 2D03L 2BVQA 4TVPH 5IV2B 3FQRA 4R0LB 3MNZB 4JRXA 3GM8A 3JWNC 3DI3B 4V1DD 1S7TB 4U1GB 4JFHE 3X3FH 2VDKH 3HFMH 2ZOLB 5J6GB 2F54D 1IAOB 3WUWB 1BD2D 3W39A 1K8DB 1UGNA 4OZGE 4YHKH 2AK1L 3H9YA 3HZYB 1QLEH 2D0GA 4LCCB 5HGBA 1PZUB 3AC0A 5CEZH 5A16B 1S9KC 4AMKH 2PW2A 3G6JF 4ONHB 2F53A 1S7QA 5KVMC 4MNQB 3NABH 4M6OH 3DSNA 5EIVA 2AK4A 1CXLA 1T5XA 1ZSDA 4MJID 5IFHH 4OQTH 4JKPL 5CD5D 3ZTNL 5F7UA 4NQCD 5DDHB 3OAZK 4UILH 4JDZA 5DMIH 4MNGA 3JSSA 4ZFGL 5E2JA 1PKQE 2VXTL 3NTCL 4LHJB 1FFOA 3CX5J 3MRJA 2NY3D 1N4XL 2VOTA 4PD4J 4LSQL 1T5WB 1XGTB 3GBML 3CIQA 2R29H 2FB4H 3E6FB 4QF1A 4BZYA 3KHOA 4MSWA 3VXMD 5JHLL 4BK5A 3RVXC 4LCYB 4QT5B 5C9KA 5EH1A 4PJIE 5T3ZE 4DAGL 5IJKC 1RIUH 1LO0H 1U92B 4GRMB 1HSBA 1UJTA 2K7QA 1UEYA 4KTDL 4WHDA 3LQZB 2B0SH 5DD5L 1F58H 1K4DA 5ADPH 1N3NB 1U0QA 3QHZH 4ELMB 5C71A 1NEUA 2H3NA 2JJUA 5DXWA 4O02H 3RVVD 5ILTH 1HSAB 1J10A 1BZQK 4NNXB 1KTLA 5I1LA 5C07D 1XF3A 1WWWX 3ARTA 5FM5O 4KKBD 4NHUA 1EK3A 4LCCC 1KB5B 4MXQC 4HC1A 3EO9H 3SDAC 3CC5B 1FPTH 1F2XK 4NQED 3VXSB 3NIGE 1KPUA 2A6IB 3QH3A 3BI9X 3QUKA 4UTBL 1NFKA 2J88H 1A9BB 3LEVL 4Y4HB 5HJ3A 5KZCB 1HN1A 2R4RL 2Z93A 3VXQB 2V2WB 4LSTH 4GXUN 3GSVB 3G9AB 4EN3A 1HQ4A 4JFYB 4LRNH 3MRNA 2O93L 2BERA 2ZCLL 2XXMB 3VXME 4QRRA 2QSTA 1YY8B 3MA7A 2MFNA 4PY8I 2VDNH 1R3LB 2QSVA 4NZUL 4I3GA 5TQ0H 1ZGLA 3KDMA 1T20A 2L7JA 2CQVA 4LARL 3ULVF 2PW1B 4LP5A 4HIHA 4QCIB 1S3KH 4P46B 1FG2A 3BJ91 3P4MB 4QRRE 2VE6A 1C1EL 3OAZH 3NCBB 3EOBA 4MXQD 4XNYL 4R9HA 5C8JA 3L3HA 5I18H 4NC2B 2CPCA 1HEZA 4WFFE 5DQJB 1F3DJ 2E5EA 1IM9A 5LXGL 3QEUB 4DVRH 2HFGL 2V5MA 5EDXA 5CP7B 4ZD3L 5BV7H 2QJDA 4RCAA 4WI5A 1OP5K 1XCQB 5E8DL 3VD7A 3OKNB 4RQQB 3W2DL 3ZKSD 3RVUD 2GITA 3DV4B 5D1ZA 4NRZB 2UZYB 4XC1H 1FJ1A 4J7RA 2PYFB 3EYOB 2VR5A 3QHTC 1NQBA 1DVFA 3OF6A 3OPZL 4RMTA 1BLNB 1D5BA 5HHXL 1MWAB 4FG6C 1U8NB 3TPUA 5HD8C 3O41A 3MRMB 2Y4SA 4ZUUB 3UZEA 1R3LA 4MXVF 2AW2A 4Y4FB 1S9XB 3V8OA 4JEGB 2E8YA 1VKXB 4ZSOB 4MAUL 2NLJB 4P9MH 2EYRB 5BOPA 2NQCA 5A2LH 1E4JA 1HI6B 1JGUH 2QQKH 3QDJA 4C56D 1QFPA 2AXGB 3VG9C 1ZEAL 3SDXF 4Z7VF 4F37K 4PRIA 1KULA 3KS0H 4IDLA 4R26L 4AEHL 3SGEI 2YRZA 4YFEA 2XA3A 4KJQD 4XX1G 3VXRD 5B38A 1YMMB 2WWKT 4AG4H 4AIZA 2Z35A 3ORJA 2VO5A 1MJJA 2HKFH 2NXYD 1JJUA 3GM0A 5CJOL 1QFWM 1QBLH 1FH5H 3PL6C 1J1XL 1UA6H 4ODVL 4M02A 1I9IL 4OFKA 5C9JA 1IGMH 2ESVB 3NACL 3ZE2F 4L5FH 4KRNA 3FB6A 3BDYL 2W60A 4Y1AE 3NCMA 3EBAA 2FJGA 1QFOA 3LQMA 1QSZA 3HI6L 3IAGC 3EO1A 2EDWA 4GRWE 2YSSA 1ERNA 4GG6A 3QUXB 2V5SA 5TE7L 3WIFA 4ODUB 1Z5LB 4ZTPL 1G7HA 4LCUB 1TJIL 1P7QD 1OOAA 4X98B 2DLFL 1M05B 4FXGA 5CP7A 4PRHB 3SE8L 3CXDL 1W8OA 4M1DH 1OAXH 3T0XA 1C1EH 4LVOC 4OKDA 4JDZB 4YXLH 2JCCB 1YC8A 3BJLA 4YE4H 3P4NA 4LSVL 3KYKL 1GIGL 3REVA 4NUGL 3MJ7B 3GMOA 1FVCB 4HPYH 1EO5A 3OGCA 4APQB 2VXVH 4EXKA 1UWXH 4QXUH 5ID1B 1MF2L 2J7LA 1OAKH 3V4PL 3BPLC 3VXRA 4LSPL 1WBYB 2OZ4L 4TULH 3IJSB 4RBPH 1OD9A 4JZJB 3QXTA 43CAA 2PW1A 2VDOL 4U1MB 5D7SH 1P9MC 3MLTB 5IVXF 1UM4H 3JV5A 4U1NB 1M1SA 4AMKL 1I8IA 1UJ3B 4JO1H 2WLZA 2FGWL 1LP9B 4LEXH 1CL7L 3T0WA 2H9GB 1E4WH 4PJ8C 4R0LA 5T3ZL 2F19L 3F8UB 3CZJA 3PGFH 3GSVA 3G5VA 1TCRA 1TTGA 2OMNA 1XR8A 2ZNXA 3MSPA 3VXQA 1K8DA 1VACB 5BZWA 2JJVA 5FIEA 3L5IA 3WUWA 1QKZH 2V2XB 4E0RB 3SKUD 3TO2A 3OKKA 4JJ5A 4KGLA 3QDGB 1QSFE 1HYRC 2YZ1A 2W59A 1MIEH 3WHXA 4BH8A 9CGTA 2DQUL 5HDLA 1P84J 5F7DB 4JDTL 2LVCA 4U1JA 4HUVB 2PYEE 3X17A 4OCMC 4XCNA 3SBWA 3KYOA 5EC2B 1HIML 4XXCA 1XGUA 3QEHA 3GSWA 4K8RD 1E4WL 3UC0L 1QSFA 3O45A 3OJDB 3FRUB 3OKMB 5HI5C 1A7RL 1MCPL 5AG8A 4F8TA 1G9NC 5IFAH 1J87A 1DLFH 2IMNA 3SE4A 3V6FA 4Q2ZB 1LO2H 2FIKA 5DEZA 3QI9C 4Z7VE 1MRDL 1NCCH 4NZJA 5EC2A 3C08L 4BSJA 3OBAA 4H5SB 5I0ZA 4KK9C 1DDHB 1FVEA 4XPHL 2O61B 4R97B 4N0UA 5TQ0L 4GRWB 1WBZA 4UDTB 1A14L 4NO5A 2GTWB 3O2DL 5KVGH 4DKFH 1LD9B 5F96H 3MGTA 5KN5B 2AERT 2J8UE 1I1AD 1TZIB 3BUTA 3EFFB 4Z8FH 3UBXB 4JY5L 1LHZA 3BDBA 4DTGL 1MI5A 3QNYB 2DYPB 3P11L 4Y4KC 1INDL 2XZCH 3U82B 2F53E 2P5EB 3EZ8A 3IETB 4YHKL 3TBVB 1FCCA 3PQYA 4EDXA 3GSUA 4LVNB 3ZYJA 3HE7A 1ORQB 5IMKA 1R5IA 4XMLL 2XKNA 2P8PB 1H8SA 1RY7B 1ITCA 1KENH 5ISZE 1GJIA 4DEPC 2DWDB 3LV3A 1WUNT 1FVDA 2VXVL 3MUGB 1AC6A 3RVVC 2FECL 5BS0E 1P9MA 2R1XB 3V5KA 2Z8RA 4QTIL 1J05A 3OGCB 5GRUL 1ZA6B 3ARGC 3CZFB 5E94B 2O5ZH 3MJ7A 4HDIA 4J1UB 3CXDH 3CMGA 3K80A 2C1OB 2XTLA 5D7IA 3RGHA 4M5YH 3VFMA 1CE6B 1U93B 5F3HA 1UKQA 3QAZB 4P3DA 1ZOXA 1RZJH 4YH6A 2MQ0A 3A6CH 4GW4A 1MAMH 2XWJB 3MGAA 2CJUL 4XP9L 5JLZA 1A3QA 5BV7B 4Q6IC 3C60A 3NFPB 1A6PA 4ZOEA 3MODH 3C9NB 4OIBA 5CBEB 1BF2A 1JGVL 1LVEA 1S78D 3EYFA 3HG1E 1EAPA 3NACH 5I9QC 4U05A 4Z0XA 1AFVL 5F9DC 5B4MC 5CEZD 5DJ0B 2Y72A 2YA2A 1JWSB 1IAIL 2E7BA 4MQTB 2DDQL 5I17A 3KWWB 4TTGA 3TYGL 3EJYC 2GT9A 1IVLA 5BJTB 4WCYL 2XZZA 3D48R 4I0PC 1OTUD 5CHNA 2VDKL 2VTFA 4LLQB 4X7SH 2WLYA 2HH0H 4WGWB 4C83A 2GQHA 1TLKA 2V2XA 4E0RA 4GW1B 3VFWB 3FN0H 5TFSL 4YHLH 2CSPA 4K3GA 1G1CA 2WBJA 2P5EE 4JCMA 2DQGH 4KKCC 3NAAH 2HFFB 1WBXB 1P6FA 2NXZB 4N5ED 4YHPA 1QSEA 4I18B 3WS6C 4XPBH 4JHWL 1UH4A 4R96A 4I3RH 3P9MB 5D6DC 2NY0C 3QFJD 3SJVB 5I66A 2ARJB 3WJJA 5FKPA 1U8LA 3FQNA 1IFHL 3DJ9A 1WBYA 2F8XC 2P5WA 3VMPA 1SYVB 1I3UA 5E94A 4W4NA 3RVWC 2L0DA 1TZHB 2EYTA 1JGDA 4NN6C 4OUUB 4OF7A 4JHZA 5ETUA 3EJZD 4HS8H 3KJ6L 2CKBH 4HQQH 4GQPH 3G04B 1UT9A 2VDML 4LGPB 1KXTB 2C26A 4IBLT 3BWUC 3C09B 5C6TH 1OAYH 1I9JH 4FQXA 3BESR 4YK4C 2FO4A 4PV8B 1Z5LA 1R3IL 5JOEA 5E4EC 4XCEA 1OCWL 1CL7H 1MI5B 4NKOA 1QVOB 3RUGA 3WIIL 4J3VA 5C8JB 4LSSH 1CFNB 4OFDA 5DQDL 2NY4C 2HMIC 5MHSE 4JFED 2IJ0C 2BHZA 3U7YL 2VLKE 5D7KD 4HF5H 2ORBL 2XWBA 5KSAC 4KVNH 1E4XL 1NCUA 5JR1L 2YD5A 3ES6B 5KG9B 3T0EB 3BKYL 1UB6A 5ADOH 2OK0L 1A6VL 5IHUH 1VFAA 5GRXG 3FQUA 1H3XA 3ZKNC 3JTTA 4JHAH 3QIBD 3LKSA 4AH2A 3MREA 4U3XA 3B9KD 1MH5A 4GKNA 2GFBA 2QQLH 3ARFD 1LO4L 1B6UA 3W11C 5JUEH 3GMNA 4YDKH 2FEDD 1YPZB 1FPTL 1EA9C 1QYGL 3CUPA 2B7DT 4R90L 5I1AB 2IC2A 3VWJA 3QDJB 2YPLA 5J9PA 1WZMA 4MWFB 2QADD 5I2IA 2OZ4A 2JB5H 3RI5F 3T2OA 3QWOB 4OCLC 5DJDB 4O02L 3R8BB 5GRJH 3X13B 5HGAA 4XRCA 4ZUUA 2V7HA 1X5AA 4X9IA 3U7AA 3PWJB 4PRHD 1JWMB 3KLDA 4XVUC 3TO2B 4K8RH 1YEDB 2VAAA 4OLVL 4RRPA 4BQ9A 3TJHD 1LE5A 3ECBA 2AJSL 4HLJA 1X9QA 4OLWL 1WIOA 4JM4H 3T77A 4WTZA 1DBKL 1T22A 4P9HC 4XP1H 5T5FH 3DMMD 4XPGH 3NCCB 1FL5A 1LDPH 3S7GA 5J7CC 2FBJH 3KXFD 2DKUA 4JG0H 3CLFH 3SKOA 1PSKH 4JPIB 3V8CA 3JWDL 3KYAA 3PWUA 3JWOL 2PKDA 2E27H 3ARQA 4FQPA 5DJ6A 3QA3A 3QUML 3RNQA 3V0WL 2GY7B 3SKOB 5DJ8B 3LN9A 1T1ZA 4YDKL 2I9LA 1S7XA 3RGVC 3MOQA 2OL3A 2R0ZL 1DL7H 2OM5A 1S9WB 2YD1A 3BP7B 1S9YB 3O6FA 4EJ1C 1QG3A 3PWUB 4P46A 4OLXH 1LO5B 4WW1A 3HS0A 4M43H 4WFGD 5CP3A 1N2RA 3NCYP 2B1HL 1HDMB 5IWLC 3VFPA 5EO9B 2BNRA 1E6JH 2VYRE 3DVIA 3GGWA 3MXVL 2Z4QB 3ZYIA 3QI9D 3B3IA 3DMMC 5B8CC 5D1XA 3TPKA 4P59H 3ZKND 2OQJB 3NFNB 3FQTA 4LHUB 2BHYA 4ZO8A 5HYQA 3HPLA 2AAVA 5FFLA 1AQKL 1UKTA 1KIRA 2Q76B 1AQDA 1TENA 1UADC 1C5DA 3OF6D 4P5KB 5CKAA 5ACZB 1SJVA 4Y4HA 5J9PB 5FYKD 2R0ZH 1HXYA 2V5TA 1M71B 3K2UH 5HI4C 1U8MB 2W0FB 5HHVL 3U83A 4LKXA 4TN9A 4UOW0 3ULUC 3OZ9L 4G80A 3LEXB 1NAMA 4JFZL 5F7KC 1G7LB 4WEBH 3CMOH 1N0XL 3FQUB 3Q48A 5I1GH 4HBCL 1VENA 3CLEH 3MRCA 1HSAA 1DBJL 3QUYC 4XCFL 2CLRB 4Z7NE 1XH3A 1REIA 1G0XA 3TH2T 4MJ5B 4AEEA 5TDNA 3MBEB 5DVKA 4HKZA 3MV01 3VFTB 3C2SA 4UB0H 2XWBB 2VQUA 3IDYC 4NO0D 4PUBL 5IEHB 4AT6A 3L7FA 4YE4L 2H8PA 3HI5L 2IAMD 1T1WB 5GGUB 1XZ0B 4JO3H 2X42A 3UYOD 4QRUB 5FYJE 2NY5C 1QO3B 3E6FA 5KW9H 1X5FA 2L7UA 4K8RL 5SWSE 1CFTB 4CVWA 2F54E 3MV9E 4A6YH 2KPNA 3GJEB 3U4EB 1GYAA 5HDOA 4OCXH 3NA4A 4LVHB 3GB7A 4UMGA 4P2YA 1IEBA 4G5ZL 3FN0L 5TFSH 2DQUH 3JV4A 1BAFH 1FL6A 1AGEB 2JTDA 1WCBB 1H5BB 4LASH 2HLAB 1DBAL 5FGCB 1CLYL 3A67L 1QKZL 1L0YA 5CZXD 2PYEA 4MQ7A 1A7QH 2VLKD 4MS8D 2E9WA 4S1DD 3TVMD 5IB2B 4K94L 1WF5A 4GS7B 2FHCA 2CDFB 3FFCD 1CI5A 4LCCA 3O2VL 4L8SB 4OT1L 2GAZA 4YHYC 1KELL 4U2ZA 3HCVA 3F12A 5LGJA 1HHJB 4ODXB 3KPPB 1MCKA 1WFUA 1AFVH 3FMGL 3QQ3B 4ODTL 2BVTA 2CKBB 4J8RB 3SGKC 2AEPL 4I0PD 2P5WB 5I2IB 4PLNC 1FNGA 3M8OH 3U7YH 5E8PB 2J1KA 4OZIF 5MHSD 5K9OA 2RHEA 4MMZC 3SJVA 3CSYB 1I9EA 3BFOA 4TUJB 3SKJL 3GSNL 3S96A 4KI5D 3L5HA 4GKNB 2LE9A 3RWDA 2AEIT 1NDMA 1DUYB 1CK0L 4G6AC 3S9DB 2PCPB 1IGTB 3JVGA 4QRTB 2D31B 3ZDYF 5EC1B 3UJIH 1MCEA 4GAGL 5CBAA 3HA0A 4C83B 2QR0A 4Y5VA 2WUCL 3RWJB 2XACC 5KANI 3HZKA 4UIKH 4Z0XB 4HXBH 3BVNA 3FT4B 4GXUM 5EU3B 4OCYH 3CFDB 4XNQA 1XF3B 1YQVL 2AJYH 3DX7A 5EC1A 3UROR 3QQNA 4JQVA 5C2BH 5EO1B 3VFSA 2V9TA 1NAMH 1KN4L 1RHHA 5ICYB 3LOWA 1N3NA 1LO4H 4PGCB 1N5YL 5HHOB 4R4FL 1HKLH 1WZLA 3PE9A 3CH1B 1UM5H 1IRAY 4B53A 4PJHF 4EQ3A 4IMKA 2XN9A 2ZKHH 1O0VA 5C0BB 3MOBL 4P3CH 5J6HB 1JPTH 1FNGB 1K9TA 3BT2H 5ETUB 3GSNH 3DETD 4K7FB 2H26A 1FBIL 4JM2A 1D5IH 4ZS6D 3SDXE 2P47B 2K7PA 3HE7C 4NIKB 4Z6AT 4CVUA 3X14B 1T03L 5T3XD 5CGYD 1B0RA 3AM8A 1OW0A 1J8HE 4XP6H 4LCWE 1IMHC 1ND0A 1X5YA 3JV6B 3CZFA 4WJ5B 5DTFA 3ARPA 5E7FA 3PQYB 4EDXB 1IGIL 4G8GD 3QEQA 5DD6A 4MXWL 5BQ7A 2W9DL 1NH6A 5ITBH 1Z3GL 2JIXA 3SDYL 3OPZH 5LBSL 4ZUSB 4HHAB 3BKJL 5CZKA 1H3PH 5AZ2L 3OKEA 1IAOA 3IDJB 5KS9B 4XI5C 1IEBB 2BNRD 3KYNA 1DLHB 4YHLL 2X4RB 1U8KA 2HTLD 2GSGA 4FXKB 3U1SH 3B9VA 4ZAKD 1EEYB 1WBZB 4GQ9L 4OGXH 1VGEH 3CXHK 3QXDB 4EBQL 5D96B 1AKJD 5DVOA 1K3IA 5DJXA 1KIUA 4YIQA 1XR9B 3FCTB 4KPHL 1OSZB 5IK3A 1A3RH 3S37L 1HYSD 3PDOA 3BP6B 2ED8A 1SMAA 3IYLW 3ZO0A 4LAJH 5JHLH 5E6IB 1LEIA 4X83A 4LLUA 2D9CA 5F9WC 2FATH 2UUDK 1BMGA 3KG5A 2OP4H 2F9BT 4JZNA 5I8EB 3MRIB 1NBVH 3QQ4B 4NGHL 1BZ7B 1RMFH 1WQVT 3V0VA 5TQ2L 5I19H 3CAFA 4GW4B 5IWLA 2YKLH 1LDPL 3BEWB 4Q6IB 5EZLA 4NKDA 1FNSL 3EOTL 3UYRL 4WU7A 3RWIB 1DEEB 4DTGH 2DM3A 2I07B 5I1DB 1KB5H 1VACA 4XAKE 2ADGA 4J1UA 5INCA 5EU6A 4WI7A 3WN5B 4FNLL 1KIRB 2C9AA 2DMKA 1ZA6A 4W6WB 2X9YA 1XIWD 1IKNA 5BW7A 4PREB 5H37H 4PLKD 4KAQL 1IJ9A 1Y18B 2D7OA 1RMFL 4KQ4H 1SYSB 4PP1C 4ZFOB 3G5VB 1KCVH 5ILTL 3HAEA 2G2RA 3MXWH 2Q6WA 1QR1B 3TBVA 1INEL 4HJJL 3W81A 1ZHKA 4K3DH 4ZQKA 5JHDD 3QG7L 1LWRA 3DVFA 4FQ2L 3UBXA 2VITB 1EFQA 2OI9C 3TN0B 1B0RB 3U4AA 4HIEB 5BS0D 3D2UD 3ZSSA 5B39G 1CLCA 5EU4B 3IDXH 4UDTA 4OFVA 4U1LA 5DRWB 3RVUC 5EOTA 3PWVB 5F89B 5J3HC 5CZVH 2JB6A 1T4KB 3F58L 1EO8H 1A8JH 3SO3C 1AI1L 3C5ZD 4PTUB 4Y1AD 2ZOKB 4HCRA 2YD2A 5T33H 3RX7A 1M05A 2YS4A 2WNGA 1L0QA 4HBCH 3I50H 4IMKC 4YQXH 2J5LB 1A5FH 2W65A 4XTRC 4PB9H 3MFFA 5I16A 1KG0B 5B3JE 4OF5A 3U48A 1IGYB 1JNHB 5C70A 4JO4L 4F15B 3SDAD 1BJMA 1X4ZA 2R9HD 1V7ML 3HE6A 5IMMA 3CXHJ 3EDKA 5EOCL 3B43A 3I9GL 1A3RL 3S37H 3BD3A 1QRNB 4AIZB 1YMMA 4OZGF 3HZKB 3K4AA 3D18B 1Y6KR 3MV7A 1KV3A 5F6IC 2XOTA 5C9JB 5I8KL 5LVEA 1RUKH 1JK8B 4Y88A 3DRQA 5TQ2H 1QFUL 4LAQL 1RZIB 2Q8AH 2G9HA 4XX1E 4LIQE 1ZLUK 4ZFFA 3U0PA 3S98A 2YPLE 1FZOA 3ZYOA 3MCKA 4RGNE 4OD1H 1QQDB 1ORSB 5F9OL 2XXCB 5C6WH 4YX2H 5KG9A 4IHOB 4ONFL 3CSYA 4TUJA 2MNUA 3QDJE 2V9RA 4YO0B 3H3BC 5FHBL 3LKPA 4KUZL 5KSBF 1N5AA 5HGDA 4JREC 3NAAL 1G9MH 3L5XH 2OTPA 3LEYL 4J8RA 2VLKB 2ITDB 4HUUA 1GAFL 4CKVX 5ALCH 3WNOA 4K2UH 3TA3A 4AL8H 5HYJA 4P3WA 5KTEL 3S3SA 3TPUB 4MHHG 1S7RA 4ZUVB 1BWMA 4QNPF 4OGAD 4OF3A 5CIPA 3OQ3B 1R6VA 4MQSB 4WW2A 1G9MC 1PX3A 1CFSB 4FS0A 4UV4H 4Z76B 5MENE 2EDLA 3H9SB 1KCUL 4E41B 2IPUK 4FQLH 3KPMA 5T3ZH 2NY2C 4WEMB 1GSMA 1QBML 5F6IB 3DVNB 1E28B 5CWSB 5KAQF 1PG7L 1RIVH 4G6MH 1MNUH 3FO0H 4RQQA 5DHVH 3QXWA 2P45B 4KC3B 4MDIB 3N50A 3HI6H 4X0KA 5EN2B 1UWGL 2VDLH 1TTFA 5DJ2A 3PDDA 4X6EB 4PJAF 5F71A 3P9MA 3QP3A 4GW5B 2A9MH 1SHMA 3MACH 2R0WL 1SY6H 3BAEH 2M2DA 1JPFA 2BSTB 3D3VE 2EDDA 4FP8L 3TBSA 3EHBC 3OR6A 2BZDA 2SEBB 2JK5A 4L3EE 5CJOH 2YN3A 4H26B 4M1DL 2IQAB 1GZPA 1T6VN 4RGND 1F4YH 2GIYA 3QFJA 1T20B 5KSBA 1FAIL 2HLFC 3BGMB 5E1AA 4HIJA 5H2BA 7FABH 2FB4L 1YDPA 3I6LE 3MLUL 3MLSH 3RTQD 5JQHC 3A67H 4JHAL 4UAOB 2P5ED 2OTWB 3N1MC 4YDJB 1MUJA 3VWKB 1G7LA 3O3BB 4JFYA 5D5MA 1U8JA 4EXPX 1QRNA 1UWGH 5I8KH 4WHTB 4B0MM 4UIKL 3ULVH 2EO1A 2D7QA 4XZUA 4LSRL 2D4FA 3O41B 1OAUH 2BHUA 4G9FB 3PL6A 3NMEA 1Q0XH 4ODVH 1ZT1A 1MY7A 2IBBA 3FB5B 4I3SL 3BSZH 5HXMA 1EGJL 1K4DB 1INDH 2XZCL 3D85D 1UWEL 3LQZA 4X6CF 3WS3A 5DRNB 2DMBA 4KUCF 3EOAA 4J23A 4N0CD 5IESH 1MCJA 4XH2B 1FFNA 4YFLI 1Z6JT 2OR9H 3LD8B 1JL8A 1OY3B 1YEEL 3C6LC 1MCBA 1MRFL 1A7QL 3REWA 1JNLH 2HLFD 2CGRH 3VFPB 2UY7A 4KJWC 1J8KA 1ZGLP 3P3YA 4YZFF 5TGBB 4G6KL 3B5HA 5I1GL 4Y19D 5DJZB 1N0XH 1F3DH 3MV9B 1J8HB 4GMTH 2CDGB 1T1XB 1MCDA 4WY7H 5ALCL 3EYQD 1S7WA 3O6MH 4NDMB 3S3PA 2P8LA 7FABL 1JYVA 4LF3A 3QIWC 4YDVA 4EEEA 4RA3A 4GBXB 3MRJB 2BNQA 5FUOL 3ZE1E 2Q6WB 2IADA 3SGDI 4XNZB 1CDGA 4ZUTA 2X4UA 4CL7A 2WP3T 3A0OA 1NDGA 2VITA 5DA0B 1R5IB 5MEPB 1OLLA 3MUHL 3VXNB 2UWEF 5IG7A 1TZGL 3ARVA 5I1JL 2R56H 5IROA 3TFKC 4XXDA 1BAFL 5IIEB 1ODAA 3B5GA 1LEKA 3VFNB 1ES0B 2CO7B 4KTDH 4N0FB 1HHKB 1SYSA 1KLFA 4RAVA 4NC0B 2NY3C 2WIIA 1B9ZA 2X1XR 4BUHA 1DEEA 2E6PA 3QWRA 3BGFC 2NXZD 1NGYA 3CD4A 2R29L 1J9CT 4IEFB 4LNVA 5EBWA 4OTXH 3ARRA 4HIXH 2FO1A 1FNSH 3WFDL 2Y7QA 2J8HA 4X8JA 2KDGA 3HNSH 3Q0HA 4WFHD 2PNDA 5GISH 3NPSB 2LABA 3VGBA 2CDEB 1S78C 2R56L 4ZUWA 3MRHB 4Q2ZA 4ELMA 2ZUVA 4PJ5B 1NBVL 5IVNA 2EH8L 2AV7B 5HI3D 5T1LB 5B4MD 5JDSB 4N8PA 1GC1C 3I6KA 2P44B 3GSWB 1GGYA 1U92A 2KZWA 4I4WB 4HD9A 2IH1A 3AREB 3C6LD 3D39A 2AK1H 3KLHC 4AIXA 3PP4L 4IOIA 4XWOC 4ODSH 4UT7H 1P7HL 5EORH 3QULB 5DFVD 2YC1B 1NANH 4BH7A 1AHWB 4POUB 3U1SL 3AMLA 5GGRB 2GCYB 5DUBB 1GGIH 3IFLH 4V2CB 5DA4A 4YEFA 4PFEA 3VRJB 5I1EL 5F3BA 5EU7E 3UDWC 3HNVH 3E2HB 4YDIL 1KUMA 2BVPB 4L8CA 1MIMH 4JGUA 4HWEH 1WIUA 1DTUA 2DLEA 2CXKA 2BDNL 3ARSA 4F33B 4JO1L 1JZ2A 3QIBB 1NGWA 3QRFM 3KPOA 3TT1L 4CGTA 1MHEA 1T3FA 2OJZL 5EZIL 4KRMB 4P2OC 1TZHA 3U9UB 5DRXA 5JR1H 4WWKC 4IOFD 2VMFA 4GBXA 4RX4A 3AGVA 3ULVD 1NAKH 1E4KC 1GL4B 3V2AR 3REVB 4LSPH 1VGKA 5J6HA 4Y19E 4DFHA 4P4RB 3CFCL 3PUCA 3DX9A 1DUZB 4ZOAA 1U42A 1KEGL 2HYMA 1CD1A 1CG9B 1IC7H 1QRND 1BQUA 3P0YH 4L1HA 3UTTD 5HHPB 5BOZG 1ZVHA 3QZWA 2ZUSA 1T0PB 4NQDD 1MY5A 4JM4L 1NBQA 1G1YA 4TRPH 1YEIH 1CVSC 1VFOA 5FGBA 2C7UB 1W72A 2D0HA 3RKDC 2AEWA 1P4BL 3MLWH 5HHOA 1GH7A 1Y6MR 2BSED 3GZKA 1SEBB 5EBMA 4RGMC 5GQBA 3DO3A 4Y5VB 2XRAL 3TVMA 5CHNB 3KPRB 2RB8A 3ARGD 2HJLA 3VRIB 3TC9A 1LDSA 2HJKA 2HVKA 1FORH 3QIUD 4IJ3C 3WJLC 1OTSD 2FHBA 1UQSB 1QD0A 4NQXB 4W4OC 5DD3L 2D31A 4OGAC 4KHXH 3VWKA 3ARBD 3MRGA 3S35X 4GXVH 3U2SA 1QSVA 3VXMB 4KK5C 2DI9A 4KROB 4P5TD 4XNYH 2I9TA 1O7SA 3C6SA 3P9WB 4EI6A 5BZDA 4OLYL 4YAQA 2EYRA 5GGSY 3DMMA 4H26A 4ZG1A 2H6PB 1A6UL 2HWZH 4MD0A 1IM3A 1VKXA 3RKDD 2KQNA 1NC2D 4QGYA 3VG0H 4C57C 1C7TA 2DD8L 4KJYB 4MMXC 1JV5B 1WISA 3CFBB 4MAUH 3ARDD 4NGHH 4K2UL 2JELL 5IGXL 1QP1A 3HC3H 4IRZL 4LHUD 2F5AH 3QDMA 4J4PC 1C08A 4XCYA 2NY6B 1CE1L 1RJLB 5L9DH 1AGCA 4FMKA 2X4NB 4LSTL 3HZMB 2VZTA 5D5ME 3OAUH 5B22A 4FQLL 2MKLC 4Y4HD 5LGJB 5DD3H 4PJDE 3HCVB 1WZ1H 3MRDA 4N8VG 5F6HJ 3QDME 4J2XA 3EO9L 1T80A 1CDYA 5T1DL 3D0LA 2FCBA 4CJ0A 3IXAA 4QHLB 1K6QH 1K8IB 4WNQB 1J0HA 4X80L 4PJDA 1J7VR 4G3YL 1KFAH 1BVLB 4D8PA 2NXYC 4DVRL 3QCUH 3QUMA 3PNWA 1IC4L 4I9WE 3WV0A 4JFDE 3GB7B 1I7ZA 4MJ6A 1FG2B 5GGTA 2EDNA 4XHQA 5GZOD 2OXHA 5IR1A 3FZUC 2K3TA 5C08D 4XCCH 4P57A 1AO7B 4HKJA 3PWLB 4NCC2 5D70H 1K5NA 3K4DA 1NC4B 1YMME 2X2YA 2H8PB 4LSQH 3FQWB 4PS4H 3CK0H 5EA0H 4X6DF 3SKMA 1E4XI 1QTYT 4CADA 5HYSA 2VLRE 4NNYA 2DWEB 1MCRA 3I3DA 1G6RL 5DGRA 4IRJC 4JFZH 3VGDA 5EBLB 5EZJB 5F6HI 1J11A 3MYZA 1WSST 1HXYB 5E5MA 5A3IC 3BZEA 2FX9L 3P73A 3IFPB 3K8KA 5C0AD 3TNNA 3TJEH 4UV7L 2PF6A 1G7PA 2FYYA 4HUVA 3FFCE 4RDQF 4H25A 2NTFB 3CFEB 3S6CA 2DQFB 2EYSB 4GXVL 4X7EC 3EYSH 3U36A 3WFHB 3E6HB 2YKLL 5HI5D 2Z92B 4JJ5B 5KSAD 1BOYA 3UP1A 1SVCP 4BQCA 3R06A 5AEAA 5M7QA 4S1QH 5GHWL 3I85A 5B8CB 3QUZD 3VGGA 4QTHB 3RVTC 2Q3AA 2XTJB 4OCYL 1YEFH 2HN7B 3OKYA 1GRWA 3L1OH 4JPVH 1S9YA 3O6FB 4ETYA 4PTUA 3OV6A 2XY1A 4YR6A 2JB6B 4NWUL 4M7LL 3IVKA 2IPKB 5HSFA 2KKQA 5JPNB 5A43C 2X70A 4JG1H 5DJ8A 4P2RB 5BXFB 4ZUTB 43CAB 2KQMA 2ZUYA 4ZXBB 2C4FU 1S7VA 3VXRB 3L95A 4ELME 1I1AC 1RUMH 4RFNB 3MZGB 3HZVA 5IMOB 4C4KT 1YNKH 2YEZA 4HJJH 3FAWA 4P2RA 2CUIA 3I6GB 3TBTA 4Y16A 1S3KL 3AS1A 5EUOE 1A7BA 1L7TL 4ZQKB 4PJXB 3NCYS 2EE3A 5C86A 4GRLA 3D87B 3ROLA 3WFDH 4XPGL 3TJHC 1N6UA 3MMEA 1ED3B 1KJVB 1CICA 4WI8A 1NJ9B 1PKQB 2N1KA 3WIFB 2EZ0D 4AM0A 4BJLA 1SMOA 4ENED 2EXYD 4LU5L 4YR6B 1OWWA 1MCPH 4NQTA 5MEQA 4UINL 2Q7YA 4GT7A 3LRSB 1MCFA 3X13A 5L2KD 1KT2B 2MMXA 4JPKL 2B39A 1U8QA 2UVEA 2NY1D 3EGSA 3WN5A 4QTHA 4FQXD 1BP3B 1UM6H 2ADGB 5IMLB 5BCAA 3DURB 3IB4A 4PV9A 2OSLB 1K6QL 3WDJA 2HFTA 3RPKA 4KQ3L 4LSVH 3U4BL 4PPTA 4ONGL 1Y0LB 3CH8A 1LK3L 3QUYD 4J6RH 2AJ3B 1HHHB 2ZKHL 1MCSA 1XF5A 5CMAB 1DFBL 3UTQA 1RUML 1I7TA 5FUOH 3H3PL 5L8KB 3RU8H 1VFAB 3GKWH 1JNJA 2OTWA 1M7IB 4A6YL 2P8MA 4PJFA 3RAJL 1QFHA 1G0DA 1PFCA 2DM7A 3U0WH 4PRDA 3PQYD 1F02I 1XGRB 3SDDC 4M5ZH 4B7LA 3MREB 1MRCH 1D5MA 1CE1H 5L9DL 2BFVL 2A2QT 1JNNH 4X7CC 2YPLD 4MJ6B 3Q5TA 3FFDB 1BM3L 3PF2A 5FA4A 2ZUWA 3NA9H 1UB6B 4KH2A 4Z78A 1BZ9B 2P42B 4Z5RB 1QVOA 3QDGD 3GK8H 5HTSA 3E0GA 4NZDA 2E3VA 3IXAB 4OQTL 1KEML 3MGOA 5FGCE 2HKFL 2VQ1A 2GJZA 1RK0A 4UQ3A 3S4SG 4YXHH 3QUMB 2OTUA 25C8L 5A2JH 3IDGB 1E28A 2YPVL 4ISVB 5IQ9A 2DLFH 2BNQE 1BIHA 2ZSWA 1PYWA 4JG1L 2GITB 3D0LB 5L7XH 2Z91A 3RJQB 5BRZB 2XZQL 5I1KH 2X4TB 2XI9A 2NMSA 3BH8B 3KJ6H 4ZDHA 2CD0A 5SX5K 3MCLL 1YQVH 3PG2A 4L4TE 3UTTB 5EU5A 5FKPB 2HFEA 4X6DA 1NAKL 1QUNA 2A1WH 1B88A 4IRJA 3ZKQD 4Q6YA 2OJEA 2HA1A 1BBDL 2EYTB 1EUTA 2XFXA 3PWPA 3V6OA 5ICZB 4YXLL 1YC7A 4TSCH 2BK8A 4LDOB 4Q74A 4CW1B 2Z0BA 4R4FH 1OF2B 1HHIB 4UNVA 5JW3H 1MJUH 3WFEL 2EKSB 3OTTA 5C08A 1CD8A 4XI5D 1I1FA 5FK9A 3P30L 1FL3A 3R1GH 1GGIL 5JIKA 4X9BA 1P1ZB 1V3KA 3STLB 4JKKA 5CZXC 1RHHB 2XKSA 4YAQB 3QEQE 3Q5OA 3MLZL 4MJIA 2AKRA 4F7TB 3LH2H 3MRRB 3L9RA 4RIRA 3TCLB 3DRQB 5D2NE 1LO3H 4XNQB 2EIEA 1BD2B 4PY7B 2EEBA 5D7LA 4LPCA 3V4UL 1KPUB 2ED7A 1I7UB 1YECH 2AK4D 1IQWL 4N5UA 5EU3A 5C09A 1VEOA 1N64H 4W6XB 5DJ0A 3ARYA 4KY1H 4XWGH 2YA0A 2Z8VC 1ZT7B 1Q9OB 5DYOA 5IVXE 3Q6FA 1RJCA 1FLRH 1NC2B 1SQ2N 3KWWA 5GJSH 1KTLB 5I1LB 1FLTX 3LQAH 2F5AL 1WGOA 2WQRA 1LE9B 1B3JA 5E5UB 3ARFC 4UZGA 5J13C 1NBYA 3BN3B 4ELMF 2W65B 1UCTA 1WV7T 5D1QB 2VSDA 2FWOB 5GISL 1I1FB 4HK0A 4HS8L 4PRID 4LASL 2C7UA 1P7QA 3OZ9H 3PABB 5CEXA 5KSAA 4Y1AB 4U0RC 4ZS6C 4LOUC 3CCHA 4HJGA 3VJ6B 1CBVL 3PWVA 3C8DA 3T0EE 5JHDA 2XA8L 1NPUA 4CMHB 4M5ZL 4TTDC 4WHCA 5DD1L 5J8OA 4K71C 1MQKL 3UDWA 4D0BA 2KL6A 3TZVA 3MUGA 5I1IL 1INEH 3KPPA 4ZAKB 5DLML 3QRGH 4X6DB 1T5XB 1ZSDB 4AEIH 4PY8J 1ZHBA 5DS8A 3DLQR 4L4TB 3UTTE 3NIDE 1RUKL 2R4SL 3KPSA 3WL9B 4ZO6A 1DQTA 4L8CB 1EX0A 1JF5A 1E4XH 4O2CB 4IS6B 2X89D 2Z91B 4HCRL 2M1KA 2PW2B 3N1PC 4LDEB 1PYWB 3O4LE 5IEKA 3P77A 1ZHLB 3QIBA 2Q87A 4OCSH 2ZCLH 3TH4T 2XKNB 1HCFX 3W11D 4HWNA 2MSPA 5C0RH 1UB5B 3BH9A 1J88A 3TNMB 1NC4D 5E08L 2ZOLA 3KR3L 1MJ7L 2C3WA 2VQ1B 4RNRB 3Q1SL 4MAYB 4CDGC 3U4EA 1EHXA 2EDBA 1HYSC 4DVBB 4TTDD 2XNAB 2PXYC 5GGVH 1SM3H 2QSCH 3BIBX 1RUAH 3RDTB 4ZFGH 2EDEA 4WU7B 3FT3B 4BH7B 3ZTNH 4P2OB 1T7XA 5IB4B 3QULA 2GK0B 4UBDC 1KLUB 4F57H 5JDSA 2VLRA 4X5WA 1DE4A 3RL2B 1IC5L 3OG4B 3V6ZB 1T04B 5EWIH 5FEBA 3FRUA 5CZVL 1TIUA 5JXEC 4J3SA 2BFVH 3QQ4A 2VL5A 5E2UL 2BMKB 4GAYA 4JQIL 5LGHL 4KUZH 2ATPB 3QCTH 4I4WA 1ACYL 2QBWA 1Z0MA 3R4DA 5K9KA 1A7RH 4GRLC 1YEGL 4G43B 1T04A 4OB5L 4DAGH 1CLZL 1CFQB 3B83A 5IHZB 12E8L 4PJ5A 1JHTB 3ZDXF 4Y2OA 3N1GC 4HMEA 3I02B 2EICA 5CGMA 2X7LA 2PXYD 1VPOH 4M7LT 4RAVB 4QY8B 3IDNB 4JFEB 3CFCH 4I48B 5I9QB 2Q76A 5HYJD 3TN0D 1PSKL 1BJ1J 3KPLB 1KT2A 5C0EB 5GGVL 4K07A 1ZS8A 2P7TB 5E4IA 4C54A 1G7IB 1E27B 3HRZB 4FTVA 1VSCA 4R8WH 2R1YA 5ADPL 4MCZA 1I8IB 4M00A 4Z7WB 2CMRH 4L4JA 4PJIF 5B3JF 2MQ3A 5I76B 2LQRA 1CICB 4MCYA 1HDMA 4YWGL 2IH3B 1XT5A 2Y36H 4HH9B 4IRSC 2ZUQB 3VXTB 4OZFA 1IEAA 1TQBB 2IADB 1IAKB 2XICA 1A6WH 1EDQA 1MWAL 1H8OA 5D1XD 3RNKA 3BOVA 3JV6A 2BXYA 3F7YA 1U3HB 5CAYB 1WFTA 1MF2H 3O2DH 4WDIB 2VERN 1G6RH 1F4HA 3D39D 4M61B 2CDGA 3D25B 4ZXBA 1T7ZA 3Q6GL 1FVCA 3FL7A 1YMMD 4NSKB 1O7VA 3O6KL 4PJGE 3NIGF 4MA3A 3BIKB 4TNWK 3WBDA 1OAYL 3NN8B 5HVHB 2VWEC 5D93B 4Z7QF 1T22B 3VXUE 1KFAL 4MDJA 4FXGB 3MV9A 1BFOA 4HIIA 3C8KB 1Q0YH 3ARFA 4NO2A 4R7NB 1OSPL 4X98A 4IRSD 3ZDXE 4U49A 3FB6B 2JE8A 5D2LF 5ABDE 5JXED 2AABH 1GAFH 3VFVA 4H0HB 2YSSB 2ITCB 4GH7B 3BP4B 3BDYH 3TV3H 1TDQA 5GIRA 1R3KA 4DK6A 3O9WB 3CDYA 5T1DH 1Q9KA 1NCWH 5FECA 4LLWA 3T3PE 3RWJA 3WIIH 2EDYA 4YBQD 1QFWL 5JTWA 2YPLB 3LDBB 4A6YB 1NUGA 4DK3A 2DM4A 3MOAL 2V2TB 1D9KB 3V5DA 4HIJB 2NY7L 3MRRA 4WTXA 4WI2A 3N85H 3VE0B 3C5ZC 3OB0H 1JUFB 2IPTH 2IG2L 4XBEL 5IW3A 2QQKL 3W9DA 2NW3A 3ROOA 3QEQD 4RGOL 5IGXH 3H9SD 4JKLA 2HT3C 1UZ8B 4LFHD 3PWLA 3PGCB 2FX7H 5GGVY 5KSBB 4QXGL 3DXAE 3BHBA 3G6JE 4ODTH 4RISL 4DWHA 1F5WA 3LAFA 4ZFOL 1OAZL 4NUGH 3JTSA 4JANA 3K4ZA 2DLGA 4FZ8L 1UM5L 5MI0B 1FLRL 1YYML 2VIRB 4J4PA 5BRZD 5T1MB 1TCMA 4S1RL 5DR5H 1N6QL 3HUJA 3MOBH 4P3CL 5EZOH 4LDLB 1OGAA 1CFNA 5IB5B 3ARWA 6FABH 4JLRA 4I1NB 4B41A 4NKOB 1DQJA 4B5EA 1JE6A 5I8CB 1I4FB 1MREL 4ZOCA 4JAMA 4P2RE 2VLJD 3SQBA 3VGAC 1ZHNA 1MJ8L 1BOGB 2J8UB 4I2XB 1C16A 4OM0H 3P4LA 1P53A 5CWSA 4M62L 4JJHA 4H0GA 4DUVA 4G6AD 5LWYL 2DBLL 1HEZB 5T1KB 5BV7L 3EZJB 5DK2B 3VMNA 4OUUA 5F88A 4CU7A 1ZHNB 4LLYA 5C0FB 3X11B 3PIQB 2X4NA 4NO0B 3RKPA 4P2QA 4JFXA 5JIHA 6FABL 5B21A 1UA6L 1A9EA 2EIZA 3QXAA 1FNAA 3NCFB 1WFOA 2LV4A 5DMYA 5SWZA 2OL3H 4M6ML 4U7SA 5GS3A 4HKBB 3LPGA 1EHAA 4I18C 2R2EB 1FZMA 3DECA 5GS0L 1TVHB 2CRMA 1I75A 2XWTB 1MFEL 4P23A 4NBYB 5IEHA 2AJUL 5J1AA 1PBYA 5JOPE 4Q9RH 4RZCB 2D7MA 2QSQA 5I8OH 1AC0A 5DUPL 3V52H 1PQZB 2VUYA 1UVQB 4UQ2A 3BT2L 4YHIB 2R8SL 4HXAH 4YPJA 4OCNC 4DJMA 1FZOB 4LLQA 3G5ZA 4HJ0C 1JFQH 3L3KB 1HQ4B 1JIBA 1G7JB 1RZIA 3MROA 1N5YH 3QPQC 3O9WA 5L2KA 2Y23A 3ULSA 3G6JA 1X7QB 1E4KA 5DURD 5IBTL 2GW5A 4V1DA 4YDIH 1C5CL 4PRBA 4PJBF 5A2FA 2EECA 5HYQB 4GBXD 2CR3A 4HIIB 4L29B 3FQTB 4N68A 5DVLA 5EORL 1HXMA 4U1IB 3PDGA 1KPRB 1OT1A 1JHKL 1KIQA 4K9EH 4PBVC 3RWGB 1KG0A 1JI1A 4GKSB 3TA3C 2HFGH 4ONFH 3A6CL 5E1HB 1N8ZA 2AQ2A 4WHYH 5DRWA 4PGEB 5D7IF 1LK2A 4UU9B 3GKWL 1CD1B 5E99H 1G7MB 5KOVC 1RJZA 1DUZA 2HJFA 3GSOA 1G7QB 3W0WD 5D7JB 1BREA 5DMKB 4ONOA 4LCYA 3ARUA 4Y16B 4G6FD 3PV6B 5KSVA 3I6GA 1KEGH 4MJ4A 5H37G 2WM0A 4XP4H 4TNVF 5DRXB 3G5XB 2E6JA 2CIKA 1S7VB 4YFLF 2FLBT 1LP9E 2IPUG 3I75B 3VFGH 4ZFOA 2F19H 3T1WA 1A0QH 1DBKH 4UDUA 1CF8H 4PP2B 2K1MA 3RIAK 1O5DT 2OBGA 1OPGL 4W81A 5EUOA 4J3TA 5C0RL 3V7MA 1EHNA 1D6VH 4P2OD 3T77B 3HAEG 2Q20A 1IQWH 4DN4H 3FQRB 2EC9T 4JFDD 5JPMA 5DI8B 5AZEH 2WV3A 1IBGL 5T1LD 1JWUB 1U8PB 5D2LA 3FKUS 1PGRB 1XF4B 4I9WD 5KVGL 1A02N 2WWKO 1T7YA 1R5VB 3O6FC 2D03H 3IS0X 3MXVH 4TVPD 2Z92A 2ATKB 4D0DB 1AR1D 5EZLB 2V7HB 4YHOL 1XF2B 4NM8L 5HGAB 2VAJA 4FFVD 4GAFB 4IRSA 3TN0C 2ICES 5EU6B 5GGQL 3MX0A 2DLTA 1F11A 1WTLA 3BP5B 3P73B 1F4YL 1CGSL 5AZEL 2NY6D 5GXBB 4EZMA 3ZE1F 2Q86A 1JHTA 4X4XB 2APFA 1S8DB 5C0GB 4OBRA 4RSVA 3BQUC 3TF7C 3ZE2E 4PP1D 1GHFL 1V3MA 2MHAA 5T3ZD 1BHGA 1KLUA 3LKSB 3VGEA 1FO0H 2CDEA 2VLMD 1IQDB 4M3KB 4UUJA 1X4YA 3HR5B 1RZJC 3KYOB 1UWXK 4HFWB 2BMKA 5EA0L 4UAOC 3KPNB 4G8EB 5IBTH 4DVBA 2ZUTA 1KJ2B 3TH3T 4LSSL 4FXKA 1OP3H 5IB4A 4U3HA 4F7EA 3CGTA 3VI4F 4L3EB 4PJ7A 5CSZB 1MI5D 2NW2A 1C5BL 1ES0A 2ZCHL 1OAUL 1F13A 4U6XB 2X4RA 4G8IA 4GUPB 1IC1A 2XTJE 1RU9L 1QLRB 3CFJA 3QDHA 4TQEL 3O4OB 4XP5L 3LN4A 3SOBH 4OCSL 4P23C 2VDOH 5D7SL 3G5YA 5HYFA 4GKZB 3RTQA 1RSFA 2GJ6E 4ESKA 4ZPTB 3ALXA 2G5BA 5C0BE 3ARDC 3T4AA 2VLLB 4U6HA 1NDGB 4YGVB 3TO4B 2YK1L 1TITA 3IDIA 4JZJA 2MKWA 4JFPB 1AGFB 2OP4L 2FR4A 5BQ7B 5GS1C 5ENWA 2R0KL 2GY5A 4AEIL 3QB7C 2QQLL 5CD3B 1HHGB 4WW2F 2AV1A 4X4MA 3WXWL 4R90H 4LF3B 5GGTL 1CL7I 4LVOB 2IANA 5DQ9B 4RFEA 4TVSa 3GMLA 1YUHA 3NIFF 4OV5B 1KTKE 3GJFB 1RJZB 1ZLVH 4Z9KB 1G7MA 3LPWA 2DTMH 5FA3A 3BAEL 2DJUA 1G7HB 1NBYB 4ODUA 2X05A 1YN6A 3MV8E 4N0YL 3IJYB 3QYCA 3HPJA 1FFNB 1UM6L 1WFNA 3DX7B 2XTJD 3BPCB 3JWDC 4J3XA 5DRNA 1OP5H 2R1WA 4CN6A 5JIIA 3O0RH 4TUOA 3B8YA 3QNZA 1IGML 1AE6H 4QHKJ 1H3GA 5E00A 3EAKA 4GSDL 5IQ7H 5SWQB 3BRDA 3LSOB 4HS3A 4NQXA 3TIEB 4MB3A 4TUKL 3BYTA 3L3OA 4MJIB 1IGTA 5J89A 5KOMC 3GIZH 1TVBB 5I6XC 1U3JA 5HYIA 1JGEA 5F7NC 1UCBH 1MUJB 1QA9B 4GLRI 1ZAGA 3WEXA 1YEJH 3N9GL 4BM7A 1NCTA 1TXKA 4CN4A 3O8XB 2ARWA 1U91B 4UT6L 4AL8L 3EDJA 1OF2A 1RZ8A 4RZCA 4CW1A 3ET9F 3PWNB 1JPGA 4JFFE 4PJ9A 1Q9LA 4YPGB 2Z8WC 4M8QA 3OR6B 1H0DA 4NN7C 3DX9B 3OB0K 1G6RB 3G6AA 4JB9H 4LIQH 1CE6A 1U93A 4LPVA 5SWZB 2MJWA 3ARDA 4NCDA 3RZCB 3TV3L 4U7MA 1D5BB 5CIPH 5F7EH 3NZ8A 3LKNA 2ICWB 1A3LH 4Z0BL 3T0BA 5DD0L 5AAWA 2FEDC 1HCVA 2PYEB 1T3FB 1UYWL 3DVNA 3F12B 2DI7A 3ILPB 4OKVA 4KMQA 4WEBL 3D3VA 5GZND 4CMMA 4JCLA 1IGFL 3WKML 1A1MB 2X09A 3QUYB 3SCMD 4FA8A 3S3JA 2BVPA 3SDDA 2ZCKL 3LEVH 4KZEL 4H8WH 2YUVA 5JO5A 2X41A 3HG1D 5E03A 1QO3A 4NPYA 5IB5A 3LB6C 3OXRA 4S1SL 5GGRA 4U6YA 4D0CA 4OF0A 2YUZA 3HUJB 3C6LA 4W6YB 1RK0B 3CLFL 2V17H 2AXJA 3M8OL 5HVFB 5CILH 1E6OH 2AVGA 2A6KB 1YNKL 1VFBA 2WAHA 2BY1A 3F58H 4P5MB 5CEYA 1PDKA 1X3DA 2ZPKL 1MHPH 4F7PA 1LO2L 4BFIA 3W5NA 1F4XH 3TFKD 5I1HL 2RR3A 5DURB 4P2CG 3RA7L 1BVKA 3OJMB 1S7SB 4BZ2H 4NQDA 2GKIA 1XF5B 4QHMB 3TWCL 3KPSD 3QUZB 4NWUH 1YEHH 3B2VL 4KJWD 3OG6B 1FYHB 4FFZL 3DROB 1CIUA 3O3AB 2PTTB 1I1YB 4M7KH 2A74B 1MFCH 4X5LA 2EXWC 2YN5A 4OD3H 1A4KA 3MRCB 1E6OL 4XCNB 5CILL 4H1LH 5DFWH 4U1JB 2AJ3A 3MLRH 4OFYD 2FJFB 5JW5B 2HT2D 2P48B 4D3CH 3PHOA 3TESA 3HNSL 2X4OA 1QLFB 5TJWK 5IVXB 3SDCB 4K8RC 1XF2A 5ACLA 3O2WL 3C5JA 3T0DA 5D71H 1EERB 2CLZB 3EYSL 1J1OH 4I5BB 2C3VB 4KZEH 5FV2A 3NGBB 5E5RB 3VFVB 3TBYB 4WUUD 2MTPA 3GBNH 3DURA 3O11A 4UINH 4LEXL 4Y16D 4FQQA 4OIIH 4LU5H 4DKFL 4QHUB 2A73A 2R2BA 5IB3A 3BP7A 4F8QA 2DIBA 2GTZB 1EEZB 3HMXL 2Z4QA 2HVJA 2LU3A 5JOPD 3X3FL 4NN5C 1AD0A 4L4VD 1JN6A 1NEZB 3MJ8A 4XCFH 4P5MA 5CEYB 1UXSB 2VLRD 4XVJH 4KVCL 2DMCA 3U30C 3BKCL 1X5GA 2CIKB 3MJ9A 4XPHH 3DHMA 3CX2A 4PJBA 2OL3B 1NMAL 3OXRB 2NY1B 4ZXBC 4M7KL 5MP6L 1JN6B 2D7NA 1FL5B 1U3HA 2EDTA 2XA8H 3TEUA 2VZOA 4XMPL 3AVEA 5FAAA 5KW9L 4OI7A 5DJ6B 1QR1A 5SWSA 3D85B 1OT2A 4DKEL 4HZAA 1RUPL 4QHUA 4M7LH 3QUYA 4ORGA 3BKYH 5TDOB 1N8ZB 3EIFA 4F3FA 3GSRB 2GK2A 1MJ8H 1TNMA 5J12B 3IVKB 5C07A 5ELIA 3TT3L 1I3GL 1P5VA 5GGSB 3KXFE 2CLZA 2WUCH 4XB7A 3QUXD 4OZHF 2WBWB 3DTXA 3QG6A 1MFDL 1XCTB 3VXUA 3MV9D 4JFEE 1TQCC 4Z7VA 2HT4D 1CDIA 4I48A 3FB5A 2WANA 4PJIB 5HI4D 4ZOBA 1ONQA 3MUJA 3ZMRA 3S4SA 3IDUA 3FN9A 2AJVL 4XMPH 4H0IA 1HH9B 3RY6C 2BOBA 1FYTD 3GIVA 4XZUB 4OF8A 3L3DB 2B20A 5H8DA 1NGZB 2EYSA 4PRNA 1M7XA 4CVXB 4NP4H 4D9QD 4Q9QH 4APQD 5IOPB 5ICXB 5F9AC 1BVKB 4F9PA 3JTTB 3H7BA 4JZOA 4P23D 1RZ8B 1XGYL 3W5MA 1J86A 2DTSA 1GOHA 5D7JC 1UCBL 1U91A 2AI0L 4M1GH 1P6AB 4R7DB 5L8JB 3P4OB 4YJZL 2GFBB 2HTKC 1JPTL 5JA8B 3DGGA 3U79A 2A9NL 5HYSB 3W0WE 2NR6D 4CADB 2XG4A 4AH2B 5KBNC 1T2XA 1IZKA 3EJZC 2B5IB 1YYLH 5DLMH 4R2GC 5I30H 1K5NB 3GHEL 2ZWLT 2VISA 1IT9H 4JQXA 4OCRH 4OLVH 5K93A 1R3HB 3ES6A 3F5WA 5AYQA 5KVFL 4U1GC 3JV0A 4L4VA 1HZHL 3S37X 1JVKA 4NOFA 1HIMH 3DVGB 1KIPB 1HINH 2MCPL 4KK8C 1CLYH 3MA9H 4UNTA 4OM1L 1I7ZB 3RX8A 4XVTH 5AUMB 3MLZH 4QOKE 5DC9B 3CVHA 1A1MA 4JY4A 2UYLA 5GPRA 2H32B 4S1DC 3TVMC 3R1GL 2C3GA 1NMBH 1W72H 4MA8H 4LKCA 1MHHA 4IS6A 3QT2A 1FFQA 3F7VB 4WCYH 1YEEH 5LQBH 5I8CA 5GJSL 1A47A 3ZDYE 3ARED 4FQJL 4U6TA 3U7WH 5CIPB 4OKVB 3UAJD 2DDQH 1A64A 3L3HB 1KEMH 1NLDL 4U33A 3MV11 4JY6B 5FB8A 1KCSL 4I18A 2ITDA 4HUUB 5AAMA 4M8QB 3QWQB 1DANT 1XMWA 5HGDB 5D1QC 5EIIA 4HIHB 2ARJA 5SWZE 1YQ2A 2OLDA 4EOWH 1DVFC 3CFBA 3K74B 2AGJH 5FYJH 4ZPTA 3O8XA 5CJQL 2QHRL 1RJYB 3LRHA 4HV8A 1ETZA 3MTRA 1EBAA 4PGCA 1C5BH 2R4RH 3DIFB 4YPGA 2ESVE 2J88L 1KB9K 3T8XA 1F3JB 3BKMH 3MR9B 2DQEL 1EJ6A 4Y4KA 3N0PB 1D9KA 1NGXA 3VGHA 3O8XD 1NC2A 3CFDA 1SJHA 3QUKB 3MRGB 1I8MA 2CKBL 3Q6FB 3EDFA 4Q97A 5SV3A 4DCQB 1WEJL 4HGWA 4P59L 1D6EB 1YNTB 2Y9RT 1CT8A 4TUOB 1W0YT 4P2QD 5J57B 3ILQD 2YWZA 1BD2A 1G9ML 1R3KB 3VWJC 4HF5L 3O3UN 3HE6B 5IMMB 3I2CH 4OV6F 2FSEB 1YN6B 4OI8A 1FIEA 1P4BH 3MLWL 5H94A 5I18L 1H3VA 2JJSC 5MEOB 1JI2A 5D1ZD 5MENB 2ADJB 4EQ2A 1J12A 2D9QB 3P11H 3S97C 4Z7OF 1PVHA 5BS0B 1RJYA 3M17A 1C8PA 4FZ8H 3O6ML 2PYED 3P0YL 3LKOB 5DRZB 1KCUH 1T1YB 3H9ZA 1PG7W 5T33L 1CZ8L 4IMLA 4PJ7E 4YBHA 1CXKA 1CG9A 1XGTA 3DRTB 1JTTA 4PJ9D 3WXVL 5C0AA 2VXQL 1GGCL 3C60C 3KPRD 5ENWB 2ATKA 2F53D 2ICEA 3CFIC 4D0DA 1I8LC 4HIEA 3AREC 5GZOC 5DDHA 4N9GB 5C92A 3I9GH 3O9WD 5IESL 2WBJD 3FMGH 3Q1SH 2W0LA 3SDAB 5L6YH 2AV1B 5JQ6H 3G5YB 2FD6L 4MX7A 1MLCB 2FECI 2R69L 4ONHA 1WJ3A 3GMMA 3LKQA 1D9KD 2FHFA 4PRPB 3H9HA 4UIMB 5DGQA