4WWID

Crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
207
structure length
201
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREERVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 33
structure length 201
sequence length 207
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wwiD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wwiD01
2FJGA 4NPYB 3VXUB 4JKPL 3JSSA 3NAAL 2EKSB 2EDTA 4OM0L 5HYQB 3EZJB 2KQMA 3THMH 4WCYL 3U0PB 3PWUA 3MUGA 4NBZB 4NKIL 3NFSH 4NHUA 2AXGA 3Q6GH 1INQB 5HVWA 1FLRL 5CEXA 3O4LA 1ETZA 12E8H 2EDJA 5D70H 3D48R 4HKXB 1MHHA 1G1YA 5HI3C 2A9NH 2WUBL 2VXSL 5KOVC 3MQIA 4DCQA 1FGVH 1L0YA 3T1WA 1KPRA 1AGCA 2R4SL 3WDIA 4Q6YA 4JY4B 4I13B 3BH8A 3HG1A 1GGUA 5LWYH 2P5WD 2AGJL 2CDFA 4Y4HD 5FUOH 3EYFA 3OXSA 1OCWL 3TA3D 4KI5D 3DSFH 1PQZB 2ZKHL 5HYSB 1BIHA 5FCUH 5FM5M 3LKRA 4LGSB 4JFED 5HHXL 1EHLH 1MREL 4GRWB 2ZG3A 1U8IA 3MNZA 1JWUB 4HIHA 5IW6B 4HUXB 4OGYL 1JRHI 5FYJU 3S97C 4ZSOA 3BUTA 5BW7A 3VFOA 1F2QA 3AC0A 5JPNA 4Y4KC 2NY4B 5C9KA 3HAEG 4NC1C 5DJ8A 3SDDD 5JHDA 4PGCB 1JI1A 3VW3L 2ZP0T 1OQOA 4KUZL 5BRZE 2Q8AH 1MQKL 5ESVA 2ZUSA 5B4MD 1DUZA 4PJEB 4NC1E 3KPRE 1FZMA 1DJSA 2BSSA 2B39A 2XFXA 4YHLL 1WSST 3LY6A 1FCGA 1MJ7L 3G08A 4UAOB 4XHQA 4ZUTA 3UC0H 3VFTA 2XZCL 1I1YA 1FDLL 4UI2A 4S1SH 2FX9L 4PP1C 1DLHB 5HDBE 1CT8B 1J1OL 4JY6A 4K9EC 5BO1H 2YUWA 2FYYB 5IMMA 4YNYB 1UA6H 5GGSB 3WIIH 5B38A 1JZ4A 3WO3B 1A9EA 2HFEB 3IF1A 1RZKL 5KSAA 2WLYA 1HEZB 3MA7A 1YNLL 5IESH 3TO2A 4NO2B 1OM3H 3ZKSD 5E9DA 1IAII 4N9OB 5CINL 4O2CB 1YEFH 4FQXB 1Y6MR 1D5ZA 4QOKE 1NQBA 3JTTB 4AEHH 4LCWB 3WN5C 1XH3A 1IC7H 4P9HC 1YY8B 3Q1SH 3QFJB 5E7FA 3OR7A 4ZUVA 4JFDE 5D1QB 3BD5A 2K3TA 1BF8A 2XN9B 5HVGB 1T5WB 2YHGA 1KIPA 2YA2A 3B83A 4E5XB 4YAQA 4Z0XB 2IFGA 3OWEA 3ELAT 4I0PC 3NA9H 4HUVB 4OZ4A 3OKMB 1A5FL 1C5CH 1C7TA 3U0TB 3ZHLA 4LF3B 2X10A 1OT2A 5KBNC 2JCCB 2JF1A 4HMDA 3LD8B 4K94L 1HN1A 3MLYL 3GSVB 2C7UA 1GGCH 2MWCA 4QHNB 1JTOA 1WBXA 2WBKA 2ATKB 1ZVYA 4ZFFA 4PRHE 4HXBL 3MJ9L 1MCOL 2GT9B 4P23D 3O3DA 4FG6D 2F54D 2O5XH 4TYUA 4PGJA 3DX7B 4M7JL 3GIZL 4XP5H 1WIPA 1X5IA 2GTZB 4P9ML 5ALBL 1EUUA 4RAUA 3OF6D 1Q38A 5EPMA 5CEZL 4CW1A 4M61A 1V05A 4KJYA 4OI9A 2AKRB 1LO0H 2NR6D 4U6VH 4OF8A 4IRJA 3SBWC 3WJLC 3BVNA 2VIRA 3VFNB 3NH7H 4ODHL 4EVNA 3IDMA 3OGCB 3QIUA 2HTKC 5BS0A 1DDHA 1XCTA 5KJRL 3MACH 1GIGH 1YMMD 5IHBA 5ACZB 3DROA 3EZ8A 2C5DC 1QEWB 7FABH 5FECA 4WW2C 4X6FA 5BJTA 4MNGA 5A2KH 4OF5A 1RZJC 3QA3B 3DECA 4M7KH 5ERWB 1A1OA 5MP6L 1RJLA 1LO4L 5GZNC 1T5XB 5DS8A 2EXWC 4EXPX 1NMAH 1Z9OA 3OHXB 3NPSC 2E6QA 3OBAA 3V5HB 4Z7OF 5L2KE 3MNWB 3MRRB 4P4KC 1QFUH 2J88L 1XR9A 3P0YH 2E7BA 2AK1H 4K8RC 2BFVL 2V17H 5H37G 2QQLH 2V7NB 5I1EL 5I1GH 2HG5B 1I1AD 2DQUH 3V4PL 5FYKH 3V6FA 1AKJD 4X9BA 4PJDA 3GSXB 1MFBH 1ITCA 5DGQA 3RGHA 4LSSH 4P2OB 1CICC 2DQTL 4PJXE 5CBAB 3VH8A 4I2XE 2APFA 5D1ZA 3VXOA 5LGJA 4Q0XL 5CGYD 3O2VL 3QEGL 4Z18A 4PTUB 3ARSA 5LGHL 1BZQK 2B2XL 2GITB 4G6KL 4AL8H 5ANMB 3SKMA 2HN7A 5ISZA 3QUXD 4LSPH 3KYAA 1B4JL 1CXEA 1IFHL 2Q7NA 1GGYA 2E7CA 4WHTA 1AQDB 5DD6B 1IKNA 5I16B 3OKEB 4URTB 4QXTB 2WUCL 4PYHA 3ZKQD 4HGWA 4DGYL 2HJLB 3CXHJ 3CFDA 3VMNA 4HPYL 4PJ9A 5IUSA 4BJLA 1PSKH 3RY4A 3EW3B 4FMKA 3GSOA 1JYNA 2HFGH 2NZ9C 4LAQL 5CWSA 4QY8A 4P3DB 4O2EB 1BZ9B 4L1HA 2BOBB 4G42A 3WD5L 3BPCB 1KEMH 4TVPL 2VN4A 1H5BA 5D7JD 4YIQA 3P4OB 3K4AA 3DYOA 3GKWH 2DQDH 1JGEA 1J1PL 2DBJA 1KN4H 3LQAH 4PLKD 3QWOB 5IB1A 2VITA 2GAZA 5TF1H 5AYUH 1LHZA 3OAYK 1U3JA 1P7QD 32C2A 3KPOB 4KY1H 1QP1A 3SKNA 5FUZH 1AGDA 4HS8H 4APQB 5D71H 1M71A 1KNOA 2BSED 4XNQB 2VC2H 1TLKA 4HV8B 3IFPA 4JANB 1N2RB 1S9YA 3F7VB 4POUB 3MLUL 4D0BA 2FBJH 4U0RB 2CLZB 4QOKA 4HD9A 5IT2L 3ZKND 4AEIL 4E41B 4LLWB 3V4UH 2ID5A 4KJQC 4WV1B 1G7LA 3GB7B 4N8CH 5TDPA 1NCCL 1FG2B 2AEIT 1IM9A 4PJ8B 5D7SH 3SKJH 2ZUXA 3PGDA 1HQ4B 4XPBL 5DHXB 4Y2DD 3IDNB 3JZ7A 3NIFF 4ZXBB 1EX0A 5DRWA 5SX4H 2VL5B 2HT2D 2CKBA 4AK1A 5ESAB 4M8QA 4NQCD 2GFBA 1U8LA 2H6PA 3AY4C 3HUJB 5FYKD 1XCQB 1MEXL 4M5YH 4LNRA 1BQSA 2ADIB 1GOGA 2IPTH 4JPKL 5KSVA 3DX9A 3DX8A 1EFQA 2FRGP 1GOFA 3BI9X 2OXGA 4KKBC 3VFSA 4H26A 2P5EB 1AC6A 2VDOH 3PIQA 2X1PA 3F7YB 1RUQH 3M17A 3F65A 2H1PL 4Y88A 2WWMD 3BP4B 1J1XH 4HUUB 4NCDA 4MQ7B 5IQ9B 1BFSA 1OSZA 3L5WA 4KZEL 3UROR 2VQ1A 2UZYB 1W0VA 1KCUL 3O41A 3O8XB 3VI4E 5INCB 5F89B 1DVFA 5F6IC 1TCRA 4Q97A 5L2JB 4AEEA 1FNEB 3QG7L 3RUGA 1T80A 3B43A 3TT1L 1N5AB 1VKXA 3MO1A 1QQDA 4HFWB 1HZHH 2C1PB 1C5BL 4CMHB 3P9MA 4GS7B 3J7HA 4WW2A 2DI7A 1ZT7A 2DM2A 4NNPL 4JQVC 1P69B 4M6NL 2CUIA 1RZ7H 4WW1B 4MHHI 1KTLB 1QA9A 4HEME 5KSBB 4LKXA 5K9KA 1PAMA 3D39D 3SKOB 1V3KA 1TZHB 2NY1D 5LQBH 5AWNL 2DQEH 2CLRB 2IAMA 3IKCA 5EFIA 4EUPH 3QISA 5CSZA 3O2WH 2AABL 5DD1L 5C0EA 1D6VL 2I26N 3NCMA 3KR3H 5TDNB 2VR5A 4UV4H 1A6VL 1MCWW 3X12A 5MEOA 1JZ2A 4IDLA 3HE7B 4Q9BA 2NW3A 4Y5XA 3O3AB 3T1FB 1R5WB 2NX5A 3CFJA 4I48B 2MMXA 2CLVA 3MRLA 4Q2ZA 2WBJD 4C59B 2W9DL 4IHOB 1E28B 1MRFH 2FR4A 4F8TA 4NWUH 1U91A 2H32H 3O3UN 1DQJA 2EIDA 5I74C 1OHQA 2D0HA 43CAB 2ZOLA 3CCHA 1ND0A 4U4BA 5DDHB 5AG8A 3FOMB 4F7PA 4RISH 4F2MB 4ETYA 2VE6A 3X13B 3S36L 3LQZA 5EZOH 5IGXL 5JPMB 3MBEC 1KTDB 2AJVL 1NGQL 2MOVA 1JNJA 4P2RD 1GHFH 4X6EA 3QXWA 2BMKA 2I9TB 3HNTL 1XIWC 1XF4B 3MV8E 3BGMA 1RMFH 1MHEB 3I6KB 1F45A 3WIFB 4U1GB 2F53D 4BQBA 4OCRL 5FO9A 1A7PH 4OZFG 2Z31D 3K80A 4JN1L 1S7RB 2WLZA 3NFPA 3OZ9H 2I5YH 5EA0L 4XCEA 5E2UH 3MSPA 4TOYL 3EHBC 3VXQA 3MJ7B 2FGWH 2HJFB 3RWCB 2V9TA 3HKFA 3ILQD 3TWCH 4OD3L 3CDYA 3QXAA 3GJFB 4U1IA 4YGVA 3MNVB 1BLNA 2A2QT 1IBGL 1RZKC 4NZRL 2ED8A 3L3JA 1YZZA 4P46B 2LTQC 4PJ5D 1LDPH 4JHWH 1YEJL 2MTPA 3VXTA 2EYRB 3F5WB 2Y5EA 3P73A 3BXNA 1RQ5A 4QHUA 4EOWH 2DJSA 3GBLA 2IC2A 1KBGH 1FG9C 4NRYB 5SWZB 3RTQD 5C0ND 3L3OA 3S35X 2I9LA 4R7DB 4LCCC 3DMMD 5HYSG 4OGAC 3WS6A 2XACC 1JE6A 1KV3A 5TGBB 3TESA 2DWEB 3BAEL 1MY7A 3RUGF 4WUKL 1CL7I 3P4MB 4K94C 5GRJL 1RZ8A 3T0EA 3MRNA 1YEDB 4WW2F 5HYEA 4OFYA 5DA0B 5E8EA 5IOPB 4L8BA 2IWGA 4CBPA 1RK1B 3JVGC 3N1GC 4BZ1H 5MHSE 3D3VE 5IB4A 1T7XA 2ERJB 8CGTA 4Z0BL 4DWHA 2H8PA 2OSLB 1QSED 3W0WB 3V6ZA 4JRXA 3KYMA 2ED7A 1KLUA 4JFYB 3C6LC 3NCJH 2PW2B 1T3FB 1B88A 1RV6X 4PP2B 4U6YB 1YQ2A 5DMYA 5CEZE 1BZ7A 4LSRH 3CAFA 2OR7A 4HJJH 1XGYL 3HMXA 1JN6A 1K5NB 5F88A 3NTCL 4J6RL 5E2WH 1FYTE 5JMRA 3V52L 1YNKL 4HT1L 1IEHA 5J1AA 4FQJH 1MUJB 1LNUB 3NIDE 3MUZ1 5F1NB 4XPHH 1BJ1J 2OJZH 4WFHE 5TQ2L 4LCYA 1MAJA 5D93C 3QDJA 4JRYA 2GEEA 2OLDA 1RULH 3QXVA 2RFXB 4NHCH 2X4TA 2C3GA 5CKGA 4B7LA 3WFDL 1I4FA 4G3YL 1FHGA 3EFFB 3UAJC 3HS0B 3B9KD 3T0WA 1A6UH 1MLCB 4NO5B 1J5OL 1F02I 5DF0A 2E7MA 4JFXA 2D7QA 2BVOB 3LN9A 3I75B 4L4VB 1JFQL 5F7WC 4BSVB 3UJIL 1Z9SA 4QKXB 2F8XC 2ESVD 1LO5B 5GSVA 5GZOD 4AG4L 4N0CC 3QUKB 1H3UA 5IG7A 4W6YB 4LSQL 2N56A 3GSWB 5FB8B 4F33B 1YNTB 4HK3J 4R9HA 3ZHDA 2D7OA 1JTTA 4UT9L 1S7XA 4HUWB 4MJID 4S0SD 4L1DA 2HKHL 3REWB 4FZEH 3RDTA 2D7TH 3UJJL 1PLGH 3MRDB 3P4NB 5DVMA 1GZQB 3BISA 3VXUE 5IHUL 4PGDB 5GS3A 4MSWA 1MJUL 2AK4D 5HHNA 1XR8B 2Y07L 3C6SB 1DBJL 3CXDH 5C2BL 3GHBL 1JNLH 2IBBA 3C9NA 2V2TA 4GBXD 5D8JL 2DOCA 3F7QA 4YXKL 3MRJA 3VD7A 5E8DH 1CDGA 3ULUD 3IYLW 4OB5L 2HKFL 1RD6A 4U7SA 4UILL 2YA1A 4KK8D 1QVOA 5B21A 2A6DB 3U48A 2ATPA 3R1GL 2C1OA 1OWRM 5D2NA 2V7HA 3UO1H 5DQJB 3FN0H 2ZJSL 4MB4A 3T0VA 4MXVE 1NGWA 1BOGA 1WFOA 3MPCA 1FV1A 3QXDA 4X7SL 3IFNL 2VXTL 5FDWB 3RWJA 4UBDC 1RZGA 3HB3C 3MRIA 3UTTD 5CZVL 1AE6L 1H15A 2JELL 2EH8H 3O3BB 1CDCA 1J0JA 4TVPE 1OARH 1DBML 3HFML 3KLAA 2YEZB 1WZKA 2ARJA 2HLFC 4GRWE 5TE7L 5TFSL 1P53A 2YS4A 4M43L 3IVKB 4EBQL 2MSPA 2E3VA 5DO2C 5HY9A 1OTUC 1QFHA 4OFDA 3ZTNL 3L3GB 3DJ9A 5C0BB 4PJAB 4PIRF 1C5DA 5FGSA 1OW0C 5I1IL 2FWOB 2A6KA 3U0WL 3L7EB 5TE4L 4LLYB 1I7TB 2JIXA 1CS6A 3U9UB 4X6BB 1JNHA 2ADFL 5MENB 5LBSL 1PX3A 3EFDH 4QF1B 1P4LB 4LSUL 1F58H 4PJEE 2BRRL 3BYTA 3VI4F 3WLBA 1J0YA 4JB9H 1QYGH 3H2WA 1QBLL 5LJYH 2B20A 2V2XB 3KYOB 3QDMD 4GO6B 1VERA 3WL9B 3DURB 2VDRL 1P1ZA 2QV2A 2XZZA 3F8UB 5F7MC 1DANT 4CAGA 4WI2A 1C16A 1K8IB 4RFNB 3IDJA 4TSCH 4X80H 2G5BA 1HI6A 3VG9C 1N4XL 1QLRA 4X5XA 5SWSD 3FAXA 1A9BB 4FQXC 4I0CC 3BO8A 3EYUH 4EQ3A 2NY5L 1UB5B 3D3VA 3E6FA 2R23A 2ILLA 4AH2B 2A6IA 3BSZL 3EOTL 3SOBL 3I85A 3VE0A 3C60D 5I76A 3WIHL 1FFQA 4YDJA 5D1QC 4U6XA 2VDLH 1U8MA 5I15H 1RU9L 1U8HA 1VGEH 4JPWL 4S1RH 1MHPL 4LCWE 3HG1D 1Q9WB 3VFPB 4U7MA 1IC4H 2XKNA 4FFZL 2F5AL 5ITBH 3UZVB 1X4YA 3QFJE 4KQ4L 4ZUSB 1BVKB 3MRHB 1RAMA 4NNYB 4L4JA 3LD8C 1HSAB 2XN9E 4U1SB 4F8QA 2FJHB 3DUHA 3MJGX 1MVUB 5IVXB 4F58H 5FK9A 2ICES 2ADJA 5I8CA 3TH2T 1NLBH 3HR5B 3PXJA 3CSGA 5BMFL 1ZKAA 3VJ6B 3VWJB 4M7LL 1R0AH 2C3VA 4PY8I 3RGVD 2JCCE 3G6DH 3LKOA 1JWMA 4I0KA 4FFWC 1R24A 2EDWA 1JPTH 2BSTA 2N7BA 4FTVD 1OAXL 3VGDA 4NP4H 3MR9A 4HDIA 4HUNB 5E5MB 1LO2H 2LU3A 4J3XA 3CSPA 1ZANL 5EBLB 2HH0H 3A0OA 4YHNA 4ZOEA 3AS3A 3FB8A 2DLFH 5JHDD 1ZVSA 2IFFL 5EWIH 2A9ML 1PZUB 3P30L 3FTGB 3MFFB 1T1ZA 3MLTB 1TTGA 4XNUH 5DQDH 1HNFA 5SV3A 5C86A 1NKRA 1U8NB 1ULVA 2R2HB 4U0QB 1PDKA 3WBDA 1AP2B 1RJCA 5BVJB 1E4WH 3N1FC 1UWEH 3R06A 5DRZA 4JVUA 1K2DA 1AGBA 4GW1B 2YUXA 4KPHL 3EYSL 3ARGB 2A73A 4CRPA 3FT2B 2P7TB 4P3WA 4X83A 1BD2B 1NGXB 4HWUA 2EIZB 1EPFA 4FQIH 4TUJA 3QR2A 3P2TA 1I9JL 2L7JA 2Q6WB 4HWBL 5T3ZL 3KLHC 4HQQL 4ZUUB 3QQNA 3P3YA 2HMID 4NN6B 4PV8A 1WJ3A 2ICEA 4ZTPL 4WVRA 5E9DD 1MVFA 2UWEB 1VEPA 2Y5TB 4HWEL 4XXCC 3U0PA 5EUOA 3SJVD 3O6ML 1T7WA 5SWQA 1MCEA 1XGUB 2NY2B 35C8L 4GG8A 3RVTD 3S35L 5I1KL 1B6DA 4KJWC 4J3WA 5C0AB 5IIEA 4P2OC 2IAND 1J18A 1CF8H 3N1QC 2AJYH 4XWOD 2OZ4L 4YX2H 2OR9H 5F21B 4M4RA 1IGTB 3NCBB 2V2WB 2FATH 1UH2A 1JZ6A 3QUYA 3TBWB 1SVZA 1SYSA 4MNQB 3U4BH 1ONQB 4J1UB 4NBYB 3ULSA 2XWBB 2MKWA 4Z6AT 4XVUD 4YPGA 1U3HC 3M8OL 3U46A 2BNRA 1FFPA 2Q7YB 3PHOB 5HYJB 3GMRB 1DQDH 1SJEB 3MREA 1BJ8A 4P48A 5ANME 5JA9A 1IAOB 1AHWA 1RJZA 4XBEL 5T3XL 1PQZA 5HYSA 3Q5OA 5F7DB 1RZFH 2QEJA 3D2UD 2FZ3B 5IROC 1UC6A 5J9PA 4K3JL 1JCKA 3JWOL 1GGBH 1YYML 1AQKL 5IW6A 2R39A 5I1JH 5AZEH 4PJCB 4OCWL 3DWTA 5D6DC 3WV0A 3HZYA 1CQYA 3QIUD 1A21A 4JAMB 1DBKH 5AZ2L 5BS0D 4DGIH 1T22B 4UNTA 1E27B 2DRUA 3LPWA 2CK0L 1AJ7L 4LIQL 3WMSA 4HKJA 2FH8A 5CIPH 3KXFD 3JUZA 3T04D 5DJZB 4ZO7A 3RIAK 2P8PB 4JJHA 4LPUA 2XWTB 1E6OH 3MTRA 4PUBL 4MB5A 5JOEA 3E8UL 5I1AB 5DYOB 4K3EH 1W72B 5EO9A 2P5WB 2GKIA 5DEFB 2A1WH 4Y4HB 4APQC 3NIDF 2GSIA 1JPST 2WK2A 2NMSA 4BSWB 2WINA 3TA3B 3JWDH 2CKBH 4ONHA 5TH2B 4U0RC 3QDHA 3X3FH 4YNYA 1LEKA 5HGAA 1T1YA 3VGGA 1P5UA 4G5ZL 2HFEA 1WBZB 1HEZA 4WV1C 1T03H 3QQ4A 4JZNB 1UZ8B 4LQFH 5EU4B 4PJ8C 2WP3T 4H88H 3UTPD 4NZTH 3WKML 1CFTA 4PB0H 5D1ZD 3TT3L 4E41E 1ES0B 4ZTOL 5JQ6L 4O5LL 3ARUA 4G6MH 2D4DA 5DJAB 3RBSA 5HHVL 2EEAA 3SDDB 4GLRH 1WT5C 4ZQKB 1T5WA 3GBNL 5ISZD 4HJGB 1S7WB 4E5XA 3QEHB 1M05A 4Z0XA 1S8DB 3GK8L 4MXQD 3LCYA 1ED3B 4NM8L 3SE8H 3WHXA 4HUVA 3OKMA 2PYFA 2EC9U 5TDOB 5DFTA 3U0TA 3LPGA 4FQ2L 4HG4J 1UG9A 2ICWJ 3FQTA 3KYKL 5J6GB 3FFCD 2X2YA 3HUJE 1TZGL 1B0GB 4DVBB 4R97B 1VPOH 4ODVH 4NN7B 1RZIB 4O4YH 1FBIH 1A7NL 3IGAA 4OLEA 3PL6D 4KMQA 4ZPTB 1PD6A 4P59L 3KAAA 1GZPA 2E8ZA 2Z8VC 2GTZA 2VZ1A 4PJGA 4R4NC 4HBCH 3CFCL 2P5EE 2IQ9H 4H8WL 4RGOL 1GPOH 3QPQC 2ZSWA 2AKRA 2BSRA 3O8XC 3QULB 2IGFH 2VRAA 4YQXH 5K93A 3S4SA 1GCFA 3H3PH 1Q0XL 3OGCA 4NWTH 4PY8J 4Z7UB 4QRSB 3L95A 2R9HD 2BVQA 1XGTB 2AS5M 4F57H 2G60H 4RSVA 5ACZA 3DRTB 2UUDH 2GK0B 1KIQA 1QBML 5GS0H 5FF6B 1Z0MA 4QXUL 1FORL 3R0NA 4WWKA 1CZ8H 2X40A 4PY7B 5EIIB 3GNMH 3D85D 1W0WA 4NIKB 2OP4H 2W60B 4NO0D 1I3RB 3D0LB 4OGZA 4GRWF 4CVZB 4JO4L 4K71B 1XGRA 1E4XL 3LHPH 1RUMH 2CDEB 3BIAX 4P23B 5JW3H 3MRRA 5IWLA 1PBYA 1W2KT 2F54B 3EUUA 4QT5B 3KHOA 1CE6B 1YECL 1IM9D 1IGCH 3NFNB 2X1XR 5KSBE 2PR4L 4HXAL 2V7NA 2DS4A 4HS3B 1U6AH 3RL2B 2FEEI 3GFUA 4MAYD 5IVZA 3S96B 2CD0A 2R1WA 2BDNH 3MLRL 3HE7C 6FABL 1FIGL 3P0GB 2VXUL 1YDPB 1I1FA 4X6CB 5IFJA 2DLIA 3RPKA 5FGBC 2H2SD 1AY1L 1H8SA 4PS4L 5T5FH 3U79A 5INDA 5FXCH 3V9FA 3BRDA 1MWAH 1CGSH 4TUKH 4Q6IB 5I8OH 3CLFH 1SEBB 2P8LB 5DD6A 4XXDA 1NEZB 4NFCA 1L7TL 5EU6A 1NAKH 2L0DA 4LPYA 2PXYA 3I50L 1V8HA 3T3PE 2Z35A 5D7IB 5HHPB 3RU8L 3BGFB 5KG9B 4K7PH 4RRPG 4OSUL 1VESA 2W0KA 3HC3L 4ZNCD 4XVJH 1LD9B 4GUPB 5DT1H 5F1IB 4PV9B 1K6QH 3O2DH 3PGCB 1Q72H 4RMQA 3OX8B 5C2UB 3UXFA 4NDMB 2Q86B 3VFWA 4U1GC 4P3DA 3S3SA 1BZ9A 1YYLL 3U36A 4HX1A 2A77L 2BOBA 1R5VB 4NQED 5F7LB 5GHWL 4NCC2 3BPCA 5IMLB 2PYED 1AKJB 4LP5A 3RY6C 1JZ8A 4PJHB 4MGXA 4WTZG 3MROA 4IBLT 4MCYA 5HGDB 4PLJD 2JCCF 2FJFB 2E8YA 3VXSA 3O6FD 1K8DB 4I3RL 5C3TA 5AD0B 2X44D 4U1MA 3EDJA 1SY6H 3QUXB 3S88H 2FNBA 3RA7H 5D7KE 4XHJD 5D2LE 3U9PL 1MFNA 4P46C 1OSPH 4KKCD 5TE6L 4M62H 4QTIH 1CLYH 2R2EB 4HV8A 2NY5C 2YC1B 3FMGL 4GJTB 4PJGF 1N2RA 2OYPA 1IZKA 3BKJL 5GS0D 5JIPA 4GAGL 4OF7A 4XNMB 2VZOA 1UACL 4E41A 1NAMH 4NRXA 2QSCH 5ETUB 1EUTA 3AMKA 4JM4L 3REVA 5F44A 2AP2A 1W72L 2JB5L 1FG2A 1LILA 3F7RA 4IRSD 5E2TL 3LKPB 4OQTA 2XOTA 5HYIA 2AJUL 2NX5D 1FE8L 2ZCHH 4FABL 5BZWB 1WFNA 2AEPH 5SWZE 3IDNA 4OI8A 4YHKH 5TQ0L 3WDJA 4HPOL 2IG2L 4ZXBA 3B3IB 3O6KL 3T09A 4LPWA 5D7JB 5LKNA 1A7QL 1HH6B 4M6OL 3QEUB 3TP4A 1QLFB 1NSNH 1YJDH 3V7AG 2DLHA 2ERJC 3HMXH 4ERSL 5D7LD 3MXWL 1V3LA 5D6CB 4P5TA 3ZYZA 5H94A 1P7QB 1UYWL 1FNHA 4EEEA 2Y7QB 3PV6A 5DQ9A 3TO4A 2P5EA 4G9DB 3CIQA 3TPKA 2QQNL 4IS6A 1IGIH 2VABB 4QHLB 4AENA 3BP4A 3W0WE 1F4YH 4GKSA 4LFHD 5IJKA 3ULVC 5J6HA 4JG0H 3DVNB 2VMFA 5JXAH 4WENB 1NDMB 1N0LA 4L8SB 1A14L 4OM0H 1EO7A 3VDCA 5KVDL 5INCA 2R0ZL 5F89A 1FNLA 5MERA 1DEDA 3BW9B 4C4KT 1FLRH 4O58L 2MCPH 4MNHB 5DK0A 4RDQG 4HFWA 5CP3H 2W91A 1QRKA 3AXLB 4U3HA 1MNUL 3N9GL 2YD6A 3W5NA 3PG2A 5SX5K 5CD5C 2I60L 1Q8MA 3RKPA 2R4SH 3BPNB 5DUBB 5T3ZE 1Q1JH 4J4PC 3CH8A 4XI5D 4XVSL 3OAZK 5KSBA 1EO5A 3SKOA 5D9SB 4YDVB 2ENYA 4OFPA 4NT6A 1J05B 2DIBA 3C8DA 1UT9A 4U33A 2V9QA 3THML 4L4VE 2NYYD 4C56D 3AU1B 3KJ6H 1REIA 3V6OA 3ARDD 4MVBD 3NFSL 5FIEA 3Q6GL 5T1LA 2CUHA 1AO7A 3RVUC 4PG2C 1A6TB 1T66C 3IXAA 5D70L 3T0ED 8FABB 1QSFA 3FL7A 4EIGB 3T1FA 3O3AA 4OFYD 3JV5A 3TCXA 1MIMH 2IPKB 1E28A 3Q3GB 1N64H 1F90H 3R0MA 5LWYL 4M1CC 3VG0L 1HYRC 5FUOL 3D1MC 4FZ8H 3ARWA 2APXA 2QJDA 3DBXA 3BEWA 2NY0D 3Q5YA 1S7QB 4NKQB 2DWDB 5IBLD 2DICA 4TUOB 5EZJB 5T3XE 4FQ1H 3UDWC 5FCUL 2DDQH 4F2MA 1MJ7H 3X13A 1S9XB 2JK5A 1EHLL 1MSPA 1UH4A 5JPMA 1NFDB 1MQ8A 1KTDA 2ED9A 1FDLH 5JXEA 1MCFA 1AXSA 3X11B 1RFDH 4M93B 3D39B 1AFVH 2I9TA 2NY1B 3JWNC 4ZNEE 4NRZA 4IDJL 4X4ME 2DQJH 3I6KA 3B5TA 4YDKL 2GUOB 3SDAD 4AZ8A 3BP5A 4KTEH 1VFBB 1I85C 1T6WA 2R1XA 4XB8A 4Y4FD 1NH6A 4KKAC 4LIQE 4JR9L 1S7RA 3QDJD 4JRYD 4QHKJ 2VLKA 1EFXA 2Q8AL 5EBWA 3QDAA 3QAZC 1JGLH 4FQCL 5D2LA 3OAUL 1CFNA 3W81A 1PKOA 5HXMA 3V7AE 3CSYA 2WBJB 2J6EA 5AUMB 3UC0L 3TH3T 2Y4SA 5I1DA 3AM8C 1CXFA 1FH5H 3GJFA 3MNVA 5EIQA 4KRPD 4S1SL 5C0BE 4PJAE 4HJ0D 1MHCA 5FCSH 5BO1L 3CX2A 3D69B 2EZ0C 4Y1AA 1OLZA 3V5DB 4H1LH 1J86A 1UA6L 3TIEA 3SCMD 2QBWA 3OAYH 3F5WA 5FKAB 1HHHB 5MI0B 2YXMA 1WZMA 4GSDH 3KDMB 2CK2A 3WIHA 1NBZB 1OM3L 5MENE 5GRUH 4P2RB 4XP1L 4KK6D 4X9FA 4JZOB 1YEFL 1UM6L 1PG7H 4RFNC 1U8QB 4N0UB 4AEHL 3GIZH 1I1CA 1N3NA 3ES6A 1NC2B 4V2CB 4WFFD 1IC7L 5TGBA 2VLRA 3Q1SL 3RIFK 2F53B 1VEOA 3PNWA 2Q76B 1BF2A 2Z31B 3W82A 2EECA 1C7SA 5DJXA 5J8OA 5GISH 3AS0A 5E2VH 3F58H 3NA9L 4D0DA 5IOPA 5GGVL 1C5CL 3N50A 3STLB 5KJRH 1L6ZA 4W6WB 2Q8BH 3VXRA 4HMEA 2APVA 1GGCL 4ENEC 3UTOA 4YXLL 2E7LC 5CHNB 2E9WA 2ICWB 3MGOB 4PG9B 3DHJA 5KSBF 2VJXA 1J0KA 3EYVA 2XPGA 4LKCB 1WWWX 1I3UA 4H8WC 3VRLE 4DKDC 4KMTH 1FNGB 4HIJB 4LSVH 1RURH 3VWJC 4XP5L 4X4XB 4ETQB 2XI9A 1MRCH 3FRUB 5GPRA 1FC2D 4WJ5B 3UYRH 3SY0A 1EZVY 5IVXE 4ONGH 3BESR 4R3SA 4EDXB 3RTQB 1T1WA 2B7DT 4BFIA 5I75C 1S7VB 5FA4B 3DMMB 4QRUB 3QO0B 3WUWB 1D3CA 4DUWA 1MUJA 3PQYA 4HSQA 5EZLA 2B5IC 5F1NA 1GIGL 1OGAA 3GUTB 4MZ2A 4TNWK 3T3PF 1EBPA 4DFIA 1I8MA 1YEIH 1NDGB 1IT9L 3U4AA 4CJ1A 4PJIB 7FABL 3WNNA 4YDIH 4HWBA 4RMTA 4EUPB 4Q0XH 3RWDB 3O2VH 3QEGH 4CADB 2W0FA 5IB3A 2JIXD 3G5XB 4P2CG 1S7UA 4M7KL 3BWUC 2V5SA 4AM0B 4L8DB 3ARGC 4NO5A 4RWYH 4UV7L 4MAUH 3L9RA 1NMAL 5IHZA 3O6LH 3H9SD 3QXTA 4PRAB 3ISWA 3OQ3B 1QSEB 3QH3A 4BSVA 1F11A 2AK1L 4MA1B 4NN6C 3BHBA 1IEAB 2V17L 3T8XB 1BD2E 1LEGA 1G7IB 2QQLL 4PJ7A 2H32B 2OZ4A 5I1GL 2DQUL 4RIRA 4F33A 3BPLB 1MFBL 3LEVL 4PJFA 4OV6F 3ZDZE 4LSSL 4LLQB 2X4RB 2NY2C 4YFLF 3DO7A 3MRDA 5D2LF 4NKOB 1NPUA 1H3PH 3FRPG 1UJ3B 4PGDA 4PRID 1OB1B 2V9RA 2ZOKB 4OCNC 1CGTA 5C0CD 4RFOL 4AL8L 1XR8A 4U1LA 2FEDD 4LSPL 3SDYH 1NJ9B 3U4EB 5F1OB 4BFEA 1T21A 3QPXH 1OP3K 5C0AE 2IBZY 5EN2B 4J23A 1QOKA 2H9GB 3B9KB 3DARA 1NMBL 2IEPA 3IS0X 4ZNEA 4MNQE 1PSKL 1YEEH 2X4QB 4HUMB 3QEQD 5DQJA 4DZBB 5HJ3A 2HFGL 1FLTX 1AR1C 1X6NA 5F1KC 4BQ9A 4N9GB 3IXTB 2ESVB 3RIAF 5HYJE 3MLUH 1MCWM 1RJYB 3PGFH 4OFIA 1NFIB 3G9AB 1K4CB 4M1GH 4YHPB 1I85A 2VZ3A 3IU3B 1XAUA 4MD5B 1KYOK 1F6AB 3GKWL 4MJIB 5B3JE 5KN5B 2DQDL 4MWFB 1JGVH 2X4SA 4R8WH 1KN4L 1KJMB 1WLHA 3GMLA 3LQAL 3MV7A 4DVRH 2BVEA 5TF1L 2AK4B 4PJAA 5AYUL 4PJCE 3SE9H 1NCBH 3MC0A 3FFDB 4BQCA 2NPLX 4MQXC 2DYPD 3IKKA 1A7OH 4LAJH 4KY1L 3FB7B 3FCTB 3P9WB 4QWWD 5FUZL 1D9KA 1IGFH 4HS8L 1AGFB 4GBXB 5EC1B 1I7TA 4PRDA 5D71L 4HIEA 2E9BA 3L5JA 4LLDB 2VC2L 3IAQA 4X6BA 5MENA 1Q0YL 2Q3ZA 2EE3A 3K2UH 4Y4HC 3NN8A 2FBJL 3TV3H 2LV4A 4PJBA 3TA3C 1EXUB 3V4UL 3IDGB 3TBYA 3KYOA 3LRSB 1DP0A 1NEZG 4WFGD 3DURA 3MJ8B 3K8MA 4N8CL 2P5WE 3BFOA 5E08H 1OVZA 2VUOA 1AIFA 3LMJL 5CEYA 1QUNA 4JQXA 3UTTB 4KI5E 3BGAA 3HLAA 3CC5B 3RY5A 1BEYH 1BAFH 3MV9D 4CNIA 2C3WA 4JFEE 4TNVF 2Y9RT 5J3HD 3T4AA 2E9IA 3QUYD 4FXLA 1JPFA 2EO1A 2RB8A 4M5ZH 4ODUB 1JYXA 4M5YL 1EEZA 3GMMB 3A6BH 1CQKA 1KLGA 5GRVL 3WNMA 3G6JA 2IPTL 3FT3A 5B4MC 2BNRD 3P11H 3ZL4H 3PDOB 3LZFL 1HSAA 1MCDA 5J89A 5E5RB 4MD4B 2VDOL 1BFTA 5IVXA 1G9MC 1RUQL 3F12B 4M6NH 1G7PA 4PJ7F 1E0OB 1J1XL 1NC4D 1RVFH 4HLZH 1MLBA 3RBGA 5T33H 2FJGB 5HI4C 3QDMB 4N0YH 2O5YH 3FHQA 5JNYA 3ET9F 2HP4A 3PWUB 3LV3B 1B0RA 3HTLX 3MUGB 2E5EA 2AABH 4RA0C 1ORSA 3P9LA 1YPZA 2UVEA 1D6VH 4JRWA 3BZDA 5SWSB 2X41A 4OLVH 3MFFA 1E4KC 1HZHL 1T20A 4FFVD 1U8NA 1MHHB 4M1DH 3C60B 1ZTXH 2R2HA 3U2SB 2ZCLH 3OMZA 1F3RB 1KPRB 1S78D 1AGCB 5D96B 4H20H 1INDH 4CN4A 3HG1B 4Z7UE 2CDFB 5J12B 1T0PB 3FT2A 2P7TA 3OXSB 1RHFA 3NABH 4R6UA 2EIZA 5LQBL 1NGZA 2AQ2A 2DQEL 1FNFA 3HNVH 4K71C 4WHDA 4JZJA 3VA6A 1MCHA 3LKRB 3O2WL 4YLQT 4W6XB 4RAVB 4YDLB 3G04A 2OL3H 3U7YH 4P23C 4FG6C 3MNZB 3KR3L 3BZEB 4HIHB 4LRNH 1VSCA 2ZG2A 4ZSOB 3MUHL 3VFOB 4R90H 4BQ6A 3U7WH 5I1HH 5JPNB 4PJAF 1N59A 2F54E 1W0YT 2VDPH 5DJ8B 2NR6C 2DQFA 5JHDB 1MRFL 4NWUL 2PTTB 3WXVH 1IGTA 2HVJA 1T4KA 5ESVB 1UM4H 3TYGH 4XH2A 1YY9D 1DUZB 3L5IA 2W1NA 2BSSB 4RISL 2XFXB 4X6CE 4I4WB 4D9RD 4ZUTB 4XPTH 4Z78A 3VFTB 4PJBF 4BZ2H 4AYFA 4DGVL 2KDGA 3KPLA 5EZOL 4AIZB 1I1YB 3PHOA 1LGVA 1GHFL 1IAOA 3BGFC 1IILE 2ITDA 2X4PA 1RMFL 5IMMB 2OTPA 4PGEB 5B38B 2FZ3A 1A9EB 1CVSC 3IF1B 3S7GA 1A7PL 1QFWH 5D7IE 3DRQA 3BQUD 4EDWH 5E9DB 3OZ9L 3I3DA 2YZ1A 1U92A 1YEKH 4RMWA 4PJCA 1Q9LA 1D5ZB 3O45B 1SJVA 3CDCA 3GSUA 4JAMA 2J2ZA 1AD0A 4KGLA 1T22A 1URLA 3BAEH 3INUH 3VRLF 3OR7B 4WUKH 3G6JF 2IANB 4XBGB 1QFOA 3TWCL 4C58B 2Z91B 1T2QH 1KIPB 3K81A 5DJZA 4EI5A 4YAQB 3MA9H 5E00A 3QBTB 5CGYC 4JY5H 4OZ4B 4WWKD 4F37K 1KG0A 1TETL 5IVXF 4PJHE 5IEKA 2D03L 1LDPL 2X4OB 4JHWL 2MNUA 5DYOA 2C7UB 3GO1H 1T0MA 1W72A 1WBXB 4OQTH 2P5WA 4ZFFB 2V5MA 4R4BA 1UXSA 1FL3A 5E03A 4EOWL 3MMEA 3OSKA 3SE3A 1KBGL 1KACB 2ZUQB 5HDOA 4PB9H 3O3DB 4U6HB 2RQ8A 4POYA 3H3BC 1U36A 3BDXA 4LPTA 4XNXH 2YD5A 4NC2B 1WBZA 2WNGA 3DUSA 4JFEA 4RAUB 3ULUL 1KXQE 4CW1B 3ZTJH 4M61B 4NUJA 4KJYB 1FL6A 5J1SC 5EO1A 4P2YA 2K7QA 3VFGH 3E6HB 1ES0A 1PJ9A 2YPKB 4EVNB 2VZTA 3QIUB 3M07A 3VXNA 5DJAA 1DDHB 1XCTB 4BZ1L 5BS0B 1X44A 4QRRA 5D7JC 1F4AA 3SDDA 2DTMH 2I27N 4S0TD 3DROB 3KXFB 3HC4H 3QEHA 5E4EC 1F4WH 4FXGB 1S8DA 2BCKA 1PGRB 4XZUA 5FECB 3CU7A 1UEYA 4PLKC 4X6FB 5BJTB 4UQ2A 1I1RA 4MNGB 2CRIA 2X1WL 3O9WA 1QPPA 5EU6D 3UMTA 2PXYD 3NCJL 3ZDZF 4KDTA 4E0RA 1A1OB 1RJLB 5J6GA 2OQJA 3ARED 4O9HL 3IJSA 4LSRL 5E5UB 4DUVA 2XG4A 5HBBA 1RZIA 4YHMH 4BFGA 1Y0LA 4KK5D 1PEZA 4NSKA 3IDUA 1UCTA 3QUZA 1XR9B 1O0VA 4FQJL 2JB6A 3K0WA 1L7IH 5CBEB 5DJ2B 4X5LA 3V6FB 2OJZL 2W9LA 4L8SC 4PJDB 5KAQF 2Q1EA 2NNAA 3SQOH 1RULL 3VH8B 4JN2B 5ID1B 4NHCL 5D1ZB 1ZK9A 3VXOB 5LGJB 4Z7UA 4ZFZB 4HC1H 1XGTA 3VXSD 4RWHA 5GGUB 1MJUH 2HT2C 1BQHA 1TQCC 1ZV5A 4OLZH 1A6UL 4YBLB 2GK0A 2HN7B 5ISZB 4HW6A 5FF6A 1XF5B 3GHBH 4WHTB 3DUUA 4PY7A 5DD3H 3BPNC 4ZG1A 1P6AB 3HI5H 5EOTB 1LK2B 3DSNA 2DI8A 5CGTA 3FFCB 4CVZA 4HGWB 5IHLB 1JHKH 4M48H 3CFDB 5FYKE 4OCXH 5DR5H 1ZXQA 5KSUA 3EBAA 1KCKA 3X17A 2D9QB 3GSOB 4PJCF 5C6TH 2F54A 3PL6B 2WWMC 2C3HA 3IT8D 1CE6A 4LLUA 1RPQA 2CJUH 4FZEL 2MJWA 4N8VA 5GXBB 4F15B 3SGDI 4HS3A 5HD8D 2VXQH 2PW1A 3OF6A 1XMWA 3RI5F 4OLXH 2EC9T 4G42B 2JELH 2QADD 5IVNA 1H5BB 4YIQB 4H5SA 5KW9H 3CXDL 1JNLL 4EXKA 3MBXH 4X6CA 3UTZA 4OIBA 5TE7H 4JHAH 3P77A 4N5ED 5E8DL 3WUWG 4MMZC 2VITB 1UWGH 5JDSB 1YMMA 1ZOXA 5ILTL 4P5TD 3VMPA 3WSQH 4NQXA 4Q6IA 2AXFB 2XXMB 4LDOB 3SKNB 2WBWB 4KI5F 4EUPG 3TO4D 3UO1L 3Q6FA 1OOAA 1VHPA 3FN0L 4YHZH 1M71B 1Z5LA 1KNOB 1EVTC 5HHPA 5JIIA 5HI3D 4NO0B 5KG9A 5CIPB 4KVNH 1CGWA 2SEBA 5LBSH 1S9YB 4D0BB 4LL9A 3DTXA 1QACA 1RI8A 4X8JB 4M93C 1BIIA 4LU5H 2Y36H 3EOAB 2NY1C 1OARL 2J6EH 1NGYB 3OX8A 2R15A 4NDMA 5TDPB 1NFDE 4DW2H 1IM9B 5C08D 1F3DH 5CJ5A 3D39E 3PGDB 4OF3A 1I1AA 1HHKB 3DHMA 5C0JA 4R96A 2XA3A 4MAYB 5DC9B 5DRWB 4J3SA 3ZE1E 2CKBB 2CO6B 4M8QB 5HGDA 2GFBB 4KROD 1U8LB 2FJFA 1ZGLA 1K8DA 2VYRE 5AD0A 3C2SA 1GH7A 4HK0A 5E6IA 3EFDL 1MIEH 3QUXA 1F58L 1EJ6A 1WF5A 3OKYA 3Q2CA 4JB9L 5KSVB 3DX8B 1RZJH 1BGXL 1QYGL 2F5AH 3DX9B 1N5YH 4DTGH 5T1MA 3RIFF 5DHYA 1OF2B 1G7MA 3BKYL 3VFSB 3GMQB 5DEZA 2R2EA 3PIQB 1X3DA 5MI0C 5C0GA 4DZ8A 3M17B 4A6YA 4JM2A 4HZAA 4S1DD 4TSCL 4X80L 4OTXL 2CGRH 4M7LH 1SHMA 1YEHH 2XTJC 3ARTA 1AO7D 5CJXA 4NBXB 1OSZB 3L5WB 4K8RH 3EYUL 3BMWA 5HVHB 3FO9B 2FO4A 2XWJB 1W0VB 4Z7UF 1QSFD 3LKPA 3O41B 3QCTH 1SMAA 3VGBA 1FVEA 4P2RE 2VDLL 2Z31C 1S5IL 3K74B 4OIIH 4NQEB 5I15L 1VGEL 1TCRB 4GAYA 4S1RL 4N0UE 3SKUD 2PYEB 2UVFA 1CD1A 3RUGB 4K7FA 1IC4L 4AT6A 1VKXB 1HH6A 3MO1B 1QQDB 3SGKA 1FZJA 5HDQH 1QLFA 1MCCA 2F53E 4ZFGH 5FHBL 3P9MB 4JVPA 4BH7A 1ZT7B 1XF3A 3O6FB 4F58L 1P9MC 1F00I 1NLBL 1J0IA 5K9QG 3PV7A 1R0AL 3BUYB 2R29H 4OUUB 3NZHH 1MCBA 1QA9B 1IRAY 1K9TA 1RUPH 3G6DL 4LKXB 5K9KB 4I18A 5FV2A 1JPTL 3WJJC 4KK9D 2IAMB 3QHFH 4I0PD 5EFIB 4R0LB 2VABA 1LO2L 1KJ3H 4LLAA 2BOCA 5CSZB 4QYOB 3TYFA 2HH0L 4F9PC 1U8PB 5C0EB 3RTQC 2DLFL 3QIWA 5IB5B 5L7XH 5EWIL 4U1KA 4BK4A 4X6CF 2AI0H 4XNUL 2VLKD 1EFXD 1YEGH 1RIHH 2NW3B 2XZQH 1PKQA 2YWZA 2NX5B 4Y2DA 3CFJB 1E4WL 2CLVB 4LP4A 3S9DB 2HVKB 3MRLB 4Q2ZB 1F4HA 5F3BB 4MNHA 3DOSA 5DZLA 4NQDA 2UY6A 2OZ4H 1U91B 3WNOA 5A2FA 4QHMA 4NQCA 3AXLA 5D7IF 2ZOLB 3N85H 4PJIE 1HSBB 3CCHB 4FQIL 1ND0B 1TVBB 4Y1AD 5D7LB 4K3HA 4F7PB 3X14A 2VE6B 4IMKA 4YJZL 4L3CA 3M8OH 4M6MH 1KCVH 1ACYH 3BN3B 3HRPA 5D9SA 3LSOA 4X6EB 4MA1C 1J05A 2DMCA 2P1YA 2BMKB 4BA8A 1EZVX 3BGMB 3UTSD 1QSEE 4ORZC 5C70A 3F6LA 3BPLC 3H3KA 1MWAB 5EZIH 4GQPH 2VLRD 2IBGA 5GZND 1CF8L 1HDMA 2AJYL 4WTXA 1YYMH 3JV6A 3NFPB 4YX2L 2OR9L 4XCEB 2X1OA 4ZAKD 4LLMB 3VXQB 2FATL 4OCSL 1MFAH 1UJ3C 2R4RH 4JFZH 1D7FA 1P7KA 4IIQA 5AZ2H 4P4KD 4C4KO 3B6SA 3U4BL 3RHWK 1QFPA 1S9WA 3DGCR 4K8RD 5I1CH 3VXRD 5JTWA 3BN9D 1KOAA 3ECBB 3QNYA 3QXAB 1WTGT 1WGOA 2YOCA 4F9LA 2KZ1B 4YGVB 1BLNB 2D0GA 1S7QA 1DQDL 3L3IA 2DWDA 3RJQB 5EZJA 1FZKA 4JM2F 5EC2B 1RZFL 1M7IB 5BV7H 3MXVH 1NFDA 3P73B 1A6AB 4QHUB 4OLUH 3X11A 1GGBL 1WWCA 2DTSA 5I1JL 5CFHA 5AZEL 4MLSA 4V1DD 2I9LB 3PQYD 4C56B 2DM7A 3ARDB 4DGIL 1T04A 1OGAD 3EGSA 1VFBA 4J8RA 3QIBC 3QI9C 2FLRT 3IFLH 4JHBA 2EO9A 2ESVE 5GS2H 4X99B 1RZ8B 3T0EB 15C8H 3T2PA 1E6OL 2DQIH 5E8EB 4L8BB 4OD2B 5JQ6H 3MYZA 1NAMB 4MJIE 4U05A 1QHPA 2C9AA 2WBJA 3K2MC 2IBZX 3SDCA 4N1CA 5ICXB 2DB8A 2IPUK 5FM4A 2A1WL 5CMAA 4NQTA 2AK4E 2NY0B 3V6ZB 4JRXB 1KEGL 2CKNA 1ZLWK 3KYMB 3JWDL 2CKBL 4KK8C 3V5DA 1KLUB 3KYKH 1R3IH 2Y06L 5FKAA 1HHHA 2XRAH 4TRPH 5IV2B 1TZGH 3KDMA 1T03L 1BZ7B 4OAWA 3ZO0A 2YRZA 1P6FA 4LQFL 1ZLUK 3QZWA 1JN6B 3KYNA 4H88L 4NZTL 5F88B 1A7NH 1PYWB 3VDAA 1CN4A 4ODXB 4B41A 3M45A 5C8JB 3SDAB 4G6ML 5B38G 3CUPA 5GS1A 2YN3A 4LCYB 3QDJB 4JRYB 1KJ2A 4LCUA 4OGXH 3CZJA 3UTTE 3SE8L 1RHHB 4WDIA 4KJQD 1IAKA 5ALCH 3STLA 5GRWA 1I4FB 1U9KA 2F5BH 1D5XB 5CZXD 2LU4A 5CHNA 2BXZA 3MGOA 3MRKB 4OD1H 1QBMH 2PUQT 1QR4A 4JFXB 1VPOL 4OKVA 4QXUH 4KRPB 4Y0GA 4ODVL 2P48B 3RKDD 4O4YL 1FBIL 3GSRA 5C0IB 2OK0H 1IGJB 4PJ5A 3SCMB 5GSVB 3FRUA 4HBCL 5IG7B 2IQ9L 1X7QA 4FA8A 1GPOL 3TH4T 5FEBA 3OKLA 5ACMA 3D18B 3L3KB 1S9VA 1S7VA 3DMMA 4YQXL 3RDTB 3QO0A 3WUWA 3H3PL 4NWTL 5B22A 3MV7D 1SBBA 2MHAA 4GW4A 3QDME 9CGTA 4MSWB 2G60L 4F57L 3GMPB 5HHNB 2QHRH 3MLRH 3U6RA 5GS0L 5E4IA 1FIGH 1WFTA 4LEXH 1WK0A 4UNUA 3C9NB 1D9KD 3RWDA 5SWSE 4CADA 2YD7A 5D1XA 3MRJB 2VDQH 4ONOA 5D96C 4XAKD 4ZUWB 4AM0A 5FKPA 3M1BA 1QVOB 5CKAA 1AGEA 3DV4A 1NFDF 4GG6B 4G6JH 4JFPA 3LHPL 5F9OH 1RUML 2C1OB 3MZTA 2R2BA 1GGIH 5D2NB 2V7HB 5JW3L 3WXWH 3HG1E 1C12A 4L29B 5SX5H 1NGWB 1BOGB 4YDLC 3BZFA 1IGCL 2FO1A 3T8XA 3QXDB 1FV1B 4OLYL 1G7IA 4OCYH 2H32A 1U6AL 1KXVC 3MRIB 1ROWA 1GAFL 1SJXA 5C0FA 3OAZH 1H15B 4RMUA 2BDNL 3KLAB 5BW7C 1AXTH 2AV7A 5DMGD 3T4YA 5JIHA 2ARJB 2F8VA 4G6FB 3UBXA 3AGVA 1CD0A 2DQGL 1J8HA 1SJHB 4JKLA 5IQ7H 3V79C 1UJ3A 3N1PC 1IGMH 2A77H 5HY9B 2ZOKA 2BRQA 5T5FL 4H0GA 1E6JL 4ZSOE 5C07D 3K8KA 1C5DB 1CGSL 1MWAL 2C26A 4LDLB 4TUKL 5DHVA 3U4EA 4IOFD 3CLFL 1T2XA 2R1YA 4G8IA 1DUYB 5HTSA 3RAJH 5JHDE 1NAKL 4TTGA 2JIXB 4ZODA 2H9GA 3B9KA 1A6WH 1JNHB 4G8EA 4K7PL 3SQBA 4XVJL 5F8RC 3WLBB 5DT1L 3H9SB 2X4QA 1K6QL 3O2DL 4WI3A 4CVXA 4WWID 4DZBA 4OM1H 1Q72L 2Y25A 3DYPA 3NA4A 4N9GA 5T1KA 1UCBH 4NZUH 4JDZA 1PZ5A 3IDXH 2ESVA 5KSAC 2HMIC 1JYVA 1C16B 2EDDA 3BKJH 2G5BB 3JV0A 1HI6B 3EIFA 1QLRB 4X5XB 1K4CA 3W11D 3T77B 3H8NA 3IU3A 4MD5A 4H1LB 3MUY1 3E6FB 3PP3H 3ZT7A 4F7CA 3RVTC 4R7NA 4CMMA 1VFAB 4XP9H 3VE0B 4Q9CA 3PWPD 4FABH 5E9DE 4PRIB 1XIWD 1U8MB 4XWOC 2IG2H 4XWGH 2BZDA 1NGPL 5I30H 1SY6L 4N90D 3S88L 2BNQA 3DPBA 3RA7L 1KXTB 2YD3A 2XKNB 1AGFA 4GBXA 4UT7L 4JFOA 4M62L 2IANE 1CLYL 3KJ4B 3EHBD 4XVUC 5FK9B 2ADJB 3G9VA 1KELH 4OLWH 2B8OT 1UYWH 2ZUQC 4PREA 2C3VB 4G7VL 2Z4QA 1NAML 4JLRB 3VFVA 2QSCL 3IDGA 2FL5A 4JREB 3LKOB 3QEQB 1JWMB 3LRSA 1R24B 3MJ8A 3PP4H 3CD4A 3MR9B 4HDIB 1KCLA 2ZCHL 2X9YA 5CS7A 2AEPL 4O51B 4YHKL 4YHNB 2NY3D 1G6RA 4PJIF 1ZVSB 1I8IA 2A38A 5ITFA 4PYGA 3KNBB 1A14H 1NSNL 3QIUC 4HUKB 1YJDL 5F7KC 4PRPD 1OT1A 2G2RB 5DI8A 4RX4A 4NN5B 4P2QA 1WC7B 2WIIA 4KDVA 1HINH 4IJ3B 4LRIA 2MPAH 1HH9A 3V0WH 2KQNA 2VLLB 3LIZL 4OGAD 5DRZB 4OZIB 1K2DB 1AGBB 2DYPB 1Z3GH 5BS0E 4OUOA 3H42H 3PDOA 4ALAH 3UYOD 3KXFE 1JMZA 1CDBA 4JPIB 4TUJB 1KJVB 4MNGE 1F4YL 4Z7VA 5CILH 1T7ZA 1P7HL 3TVMA 1FSKB 2ICEB 4JG0L 3QDMA 4P4RA 3HE6A 5JXAL 1TENA 5EUOB 4R4FH 3LV3A 5SWQB 4GG8B 5IBTH 4WNQB 3EJYD 5M95B 1A8JH 5JORA 3C6LD 3BRGC 5SWSA 5IIEB 2MCPL 5DWUH 3AVEA 1OTTD 2IMMA 5D1ZC 4EI5D 5A1AA 2QSTA 3MV9B 1TTUA 2W59A 3C60A 4X9HA 1JF6A 3U2SA 1F13A 3QUYB 4PJDE 4ZDHA 3MYJA 4Y16A 5LAXB 3VFUA 4YBLC 1SYSB 3UTPE 3N1MC 1R3JA 4ACPA 3ULSB 2VNCA 4HK3N 1T89A 4MXQC 1Q1JL 1VADB 4YPGB 3EJZD 3U46B 2BNRB 1IKNC 3VG0H 1ZT4A 1FFPB 1JHLH 3U7AA 3MREB 5DXWA 5ISZE 1AHWB 1RJZB 1B2WH 3B2UC 5DSCA 1HHJB 5K9JH 1U8KA 2FSEB 1RUKH 4PJ9C 3KJ6L 3PWVA 4RAVA 5HGHA 1F97A 2KL6A 4G8GA 5J9PB 4KV5E 1BWMA 1JBJA 3RGVA 4JCMA 3UAJD 3ARPA 1TXKA 3KVQA 5FOBA 3K46A 3C09B 2OMNA 4CDGC 3BZEA 3FFCE 1OP5H 4FTVA 4F15C 1G1CA 3WUZA 1OAUH 4K3GA 2HT4D 2XG5A 4IDJH 3HZYB 4YDKH 2HJKA 5EO0A 2Q20A 1LDSA 4QRRD 1H5BC 1KIRB 1MIML 2VLJA 4HKJB 4JR9H 1N64L 1F90L 5DFVD 3MRMB 2PTTA 5K59E 4FZ8L 2R9HC 5M94B 2YBRA 3ULUF 4FQCH 5A2JH 3O9WD 3OAUH 4FQ1L 2DDQL 4I4WA 5EG6C 4M3JA 4QRQA 2J1KA 5ADPL 5EO9B 1S7TA 5I9QB 4AIZA 2GSIB 1RFDL 2WINB 5E99H 2D7NA 3PABB 3WFHA 5FV1L 1AFVL 5DTFA 1EBAA 4ONHB 3QUZD 5E8NA 1LEKB 2DQJL 5HGAB 1T1YB 1WIOA 4PGEA 2W65A 4ODSH 3ZE2E 4KTEL 1HWHB 4YHYB 3QQ4B 3BP6B 4Y19A 2EDHA 4POZC 3TBTA 3ESUF 4XP1H 5C09D 5C0DB 1CFTB 1UM6H 3EDDA 3LEXB 3O45A 1Z6JT 1JGLL 2ZUTA 3SJVA 4A2MA 1U42A 1UWXK 4MAYC 2QKIA 1FAIL 3NZ8A 4GKZA 4LFHG 2EEBA 2Z92A 4XBGA 2IANA 2NTSP 2Z91A 2GY5A 4A6YH 1CDUA 1FH5L 4UBDD 1M05B 3HB3D 4ZS6C 1PVHA 5FYLL 3WHXB 3PDDA 4TTDD 2PYFB 5GGVH 1XFPA 3FQTB 5F93C 4HCRH 2HLFD 2X4OA 4PD4J 4W70A 3S36X 1U8JA 4Z7VF 4ZFOA 3WYRA 4YXLH 2OBGA 2VN7A 2FGZA 4Z7NE 5A16A 2BERA 5DMIH 3QNZA 4WHYH 4GSDL 4RGMB 3IFOA 1BBDH 1ZHKA 5GRUL 4DUXA 1RSFA 4U6HA 4X7CC 1VACA 3IGAB 4NFBA 5DJDA 5MEQB 1PG7L 1B0WA 1E4XI 3ARFA 1GZPB 3OB0K 3D2UA 4PJGB 4V2BA 2YK1H 1BVLA 3TZVA 3BQUB 1IMHC 2ZSWB 3ESVF 1IC5H 2IH1A 2BSRB 5GISL 5E2VL 3AROA 4IOSD 3FQRB 3F58L 1DVFC 3E6HA 2YPKA 3S4SB 2BY2A 3QCVL 4KQ3H 3L95B 2BVQB 3TFKC 1FPTH 2Q8BL 4ONFH 3FQNA 2JJWA 3KXFA 1NANI 1IT9H 4FXGA 1KIQB 4X0KB 1GC1H 4PLJC 2DKMA 3GI9H 1B9ZA 4NQEE 3FZUD 5H35A 3O6FC 4WWKB 1CLZL 2PYEE 3LS4H 3RUGE 3GKZA 4KMTL 1FNAA 1W0WB 4LSVL 1RURL 3QRFM 3GMNA 5JW5B 4CU8A 4WEBH 5IK3B 5C7XH 1MRCL 4UV7H 1XGRB 1BREA 4KKCC 3UYRL 2M1KA 2D3VA 4ONGL 1UKQA 1GL4B 2IAMC 5EIVA 2R0KH 5GS0C 3ME0A 1OD7A 4ZOAA 5CBEA 5DJ2A 5IVZB 1YEIL 2MQCA 2R1WB 3BWAB 3LEVH 4NQVA 1OAQH 4D2NA 5FM8A 4YDIL 4Y5XC 2GYSA 1I1FB 4JN2A 5ID1A 5CJ8A 5IFJB 2DJUA 2FIKA 2ITCA 4ZFZA 2OL3B 5FM5O 1Y18A 5GGUA 3MRQA 1T7YA 2FLBT 4RFOH 5E6ID 4RWYL 5INDB 4MAUL 1XF5A 2NX5E 3O6LL 5FOJA 4XNZB 3TJEH 4HAFA 1NCWL 4XXDB 3AS1A 5EU6B 1KCSH 2PXYB 2Z35B 5EOTA 1KPUA 4KTDH 1LK2A 4JM2D 2HTLC 3FFCA 4XCFH 1BJMA 4DN4H 3AREB 1NMBH 5GRVK 1CIDA 4FQHB 4QTHA 4P5MA 5D7LE 1WCBB 2E9JA 3PL6A 2EYTB 1Y6NR 5JUEL 3VFWB 1H3PL 4AIXA 1PEWA 3U36B 2VDMH 4HX1B 1A2YA 2NXYD 4HKBA 3T65A 3SDYL 2CIIA 2WV3A 5F6HJ 4TPRH 3QPXL 3MROB 4MCYB 1TDQA 3KPQB 4FFYH 1PX4A 3DI2B 4A2LA 1A4JB 5JDSA 5JQHC 3VXSB 3HRZA 1QR1B 4U1MB 4W4NA 5ENWA 3BDBA 4UOJA 1EEYA 1BFOA 4JGUA 3ZDYF 1FO0H 2AXFA 1YEEL 1WFUA 1MPAH 1R3LA 4L3AA 4RQQB 3C5ZA 4X8XA 3D85A 3FB5B 4KXZI 2EDQA 4BELD 3S5LA 4NO0A 5CIPA 4MXWH 1Q0YH 4XI5C 4X8JA 1MCJA 3PWNA 1QKZH 5IMOA 3RZCA 3PGFL 4XTRC 3D9AH 3EOAA 4NRXB 4NZDA 3QIWD 4M1GL 4F7TB 1JGDB 3REVB 1U3HD 1NGYA 5HPMA 3WS6C 2NYYC 2VERN 4U49A 5LCVH 1FRGL 4IOIB 2C4FU 4MVBC 1JGVL 4R8WL 3LMJH 4GMSH 4DVRL 5FYKU 1HHKA 4NO3A 1UKSA 4IMLA 3V5KA 3SE9L 4MAYA 5E8OA 1NCBL 2HT3D 3T0EC 1ZA3A 1GJIA 3G5VB 3S3PA 4C56E 4NQDD 1A7OL 1M1SA 4PGBA 3DVFA 1Z2KA 1IGFL 4OJFH 1QNZL 4D9LH 1IE5A 1G6VK 2MQ3A 3OKNA 3T0EE 4MA3A 5DUPH 3K2UL 4P5TB 1TTFA 5H94B 1MRDH 4I3SH 3TV3L 3LRGA 5HVFB 3QUMH 2NY0C 2OTUB 4DJMA 5FO7A 4WRLA 3PV6B 5DQ9B 1OF2A 3LZFH 3TO4B 4K23H 3GMQA 5E08L 1KJ2H 3VRIA 5DZOA 4IS6B 2WQRA 1YJDC 4AENB 4GKSB 4JRXE 3RNQA 4I9WD 3DYMA 4PJDF 5J6HB 4NNXB 3FO9A 1BEYL 2XWJA 1BAFL 4GRLD 2R69L 4APQD 2XYCA 4D9QD 5C08B 4PTTB 4XC1H 4M5ZL 1P4IH 4JFQA 5GGVY 1H0DA 4NQEA 4WGVB 5MERB 4NM4L 3A6BL 2PYEA 4BZYA 2H3NB 1QLEH 5DK0B 3WE6A 3KPMA 3P11L 3ZL4L 4H1LG 4P49A 3C5SA 4KV5F 4JPVL 4KROB 4S11A 2VDNL 3QDJE 4JRYE 3WFCL 3O6FA 5J56B 3MFGB 2FDBP 3K7UA 4HIIA 3OJMB 5CJOL 1OPGH 3BUYA 1EMTH 2R8SH 4MA8L 4HJ0C 1RVFL 3CK0H 4OUUA 5T33L 4YC2B 1IL1A 1ODAA 2VISB 4N0YL 2O5YL 4IEFB 1FFOB 4NT6B 4KDWA 4R0LA 4X6DB 2H41A 4LVOB 5K59F 5A3ID 4QYOA 1U8PA 5T1LB 5C92A 1RIVH 1AO7B 5BQ7A 4OLVL 5IB5A 2BP3A 1HILB 1DQQA 5EBGA 4KJPD 3RDTC 4Q9RH 3IXAB 4OZGA 3TN0A 2WM0A 1QSFB 3LKQA 4IRSA 4M1DL 1ZTXL 1IAMA 2ZCLL 5CSBA 2J8UA 3LKNB 2HVKA 3H9YA 1MF2H 4RCAA 4ESKA 5F3BA 4H20L 1INDL 3SDCD 3EO0A 1F5WA 4R4ND 1DN0A 4MS8D 4WFFE 5C6PB 3OV6A 1CK0H 1Z0NA 5DC0A 1KB9J 3NABL 3DBXB 3ZE2F 3BEWB 4ZO8A 3LEYL 5L8KB 1HSBA 4B0MM 1TVBA 5D7LA 4KRLB 4TSBH 3HNVL 2X05A 4QNPE 3GGWA 4L9LA 4XP6H 5AAWA 3LPFA 2OL3L 1T2JA 2JK5B 5D2NC 3U7YL 4DGVH 5EU3A 1MFDL 1EK3A 3VXMD 1AXSB 3VGHA 2GJ6D 4N0FA 3BX7C 4GG6E 4LRNL 5K9OA 2BHUA 5DHVH 4I0PB 2Z8RA 2AXHA 4R90L 4NRZB 2VR9A 3U7WL 1TJIH 5I1HL 1MWAA 2M2DA 5D2NE 3BDYH 3RRQA 5I2IA 3BP5B 3C8KA 2VDPL 1P84K 2R1XB 3DXAA 2AJSH 4PGZA 1JK8A 2VDKL 5ICYB 3JV4A 2A83A 3WXVL 1OLLA 3HZKA 2NQCA 1EFXB 2VLKB 4LLMA 5EBWB 1UM4L 3TYGL 4Z7NF 5HHMD 4YFDB 5D2LB 3TJHC 1CFNB 4PBWD 1U2HA 3O2DA 2O61A 5CJBA 3CSYB 3ZLQC 3ZDXE 1VDGA 4XPTL 1EHXA 3ECBA 4BZ2L 1A47A 5I1DB 1P4BH 3MCG1 3LOWA 2EDOA 3RPIB 1MHCB 2VH5L 3HE7D 5IW3A 1TETH 4MJ5A 5KVGH 2D03H 5EC2A 2YWYA 4Y1AB 4KVCH 3WEXB 4OFVA 1KCRH 3CMOH 3TIEB 1CYGA 2ZG1A 1M7XA 1M7IA 1A6PA 1G9NL 1A6AA 1T1XA 1QFWL 2N1KA 4WUUA 4EDWL 3H9ZA 5EUKA 1YEKL 3CH1A 3H9SE 4YUEH 3ULVH 1SY6A 1VGKB 4H25B 3UTSB 4C56A 1N3NB 3ES6B 3ARDA 2VLRB 3ULUH 3INUL 3PNWB 3HCVA 1T2QL 4X99A 5JIKA 5DJXB 3MA9L 4XB7A 4U1HA 4ZAKB 4JY5L 4D0DB 4RNRA 4OD2A 5D1XD 1DFBH 1NAMA 5E2JA 2I07B 3VXRB 3GO1L 5ICXA 4OQTL 2PTVA 4RFEA 4PRIE 5JW4M 2I24N 3EYVB 2XPGB 1CTOA 1G6RH 5C0CE 4PB9L 4LQ1A 2GQHA 4F7EB 1KFAL 1RIUL 2R56L 4XNXL 2BX5A 4XP4L 4JREC 5IV2A 4O9HH 3ILPA 3SY0B 1RUAL 4OZGF 4R3SB 1T1WB 1PYWA 4BFIB 3MLWH 3VFGL 3VCLA 4V1DB 4ODXA 3G6AB 2J8UF 5T5NG 3QHZH 4Q7DA 1J8HD 3PQYB 3QEQE 2EICA 5EZLB 3SDAA 5C8JA 3KGRA 1OGAB 2YD2A 2JE8A 1J12A 5HI5D 4Y4FA 2DTML 3LRHA 5CZKA 3HC4L 1I8MB 4PR5B 1F4WL 4UT6H 3RX7A 1RHHA 1JGUH 4IJ3C 2LU7A 1PY4A 2W0FB 4ZMAT 5IB3B 1S7UB 1D5XA 3TM6A 3GIVA 3MOAL 5IR1A 2AEQH 3CNKA 3MRKA 3LVEA 4QWWC 3L9RB 5IHZB 4BM7A 1ZE3C 4OZHA 4Z7QF 4YHML 4OZIE 4LCIL 3QH3B 4Q58C 1F11B 4G9FA 4Z76A 5C0IA 1IGJA 5T1KD 5GGQH 3HR6A 2EDRA 3SCMA 2CRYA 1FSKC 3SN6N 3BHBB 3VFRA 1AD9A 1LEGB 4PJ7B 2PO6A 5CP3A 3ARRA 4RIRB 1L7IL 2UYLA 3PF2A 5TF0A 5DA4A 4QRPD 2A0LC 4JHZA 4U7KA 1I8KA 2BVYA 3OKOA 3D18A 3L3KA 4PJFB 4JO1L 3SQOL 1LE9B 4HAGA 3DO7B 4JKKA 5DEGA 4HC1L 4UINH 4WFGE 4EN3D 1XF2B 2FIRT 3GMPA 4PRNB 3NCCB 5L9DH 3BMVA 4OLZL 4W81A 5EUOE 4U1LB 2BNQD 5JO5A 1TJGH 5EOCH 3QUYC 2ADGB 4F3FA 3ULVD 4LGPB 1WWBX 1T21B 3KPNA 5DD3L 4CVWA 3I2CH 3X3GH 3S4SG 2XZAL 2F9BT 4ELKB 3HI5L 4HLZG 1JRHH 4ZUWA 3MV9E 5ILTH 1WEJH 4K55A 1FFNA 4GG6A 1JHKL 3CMGA 4M48L 4OCXL 5DR5L 1IM3A 1AHWC 1FZOA 2YR3A 1HE7A 5HJ3B 2XQYK 4L29A 5C6TL 2ZUUA 2BNRE 2CJUL 4AMKH 3CX5J 2VXQL 5CD5D 4OLXL 3C09C 1Q9KB 4N1EA 2WSKA 3WO4B 3WLWD 5KW9L 2ENSA 1BM3H 2BNUA 3MBXL 4XX1G 4JHAL 1CDYA 5KS9E 2NY4C 2X4SB 1SJHA 3V8CA 3GMLB 3MV7B 5BV7B 4RX4D 4P2QD 3TF7C 1UWGL 4EQ2A 5SX4I 3ORJA 4Y5VA 3WSQL 2CUMA 3MLVH 3ZKMD 1DUYA 3RVUD 1D9KB 4YHZL 1S78C 1T66D 4PRDB 4Y5YA 1IAIH 4UAOC 2J7LA 2Z9TA 4HIEB 4KVNL 5I9QC 4I5BB 4CUCA 3NN8B 4UU9B 3G5ZB 3KPPA 1GOHA 3VD4A 3H9SA 3TVMD 5F6IB 1F2XK 1BGXH 4LU5L 4PJBB 2Y36L 5L8JB 3UPAA 2J6EL 3TBYB 3BKYH 3K8LA 5D5MA 3HE6D 3QQ9C 1JP5A 3QDGA 4HZLA 4DW2L 1LE5A 1OD9A 2OX5A 3TCLA 3S34H 1CLCA 1AIFB 5CEYB 4LHUA 4M7ZB 4U3CA 3ARBA 4OTXH 1N0XH 3ROOA 3HLAB 2ICWI 1ZSDB 3DIFA 3T77A 1DLFH 4H1LA 3VI3F 4CNIB 3Q5TA 2Z8WC 1VFAA 2DL9A 5FHAL 3T4AB 1JPFB 4Y16D 4PRIA 1QRND 1N6UA 1JV5A 3DGGA 1S5IH 4QCIA 1EEZB 5C0CA 1HHIA 1MIEL 1MJ8H 1KLGB 4LMQE 2OCFD 3FB6B 3G6JB 3FT3B 1RZJL 1N5YL 1ZT1B 4DTGL 5I19H 4KKAD 5FHBH 4H0IA 1EAJA 3MLXH 4PRBA 2X5PA 1G7PB 4UB0H 4RGMC 4X9IA 4JGMA 4TQEH 5J11B 2CGRL 4JG1H 4G8GD 1YEHL 3IRPX 3AUVA 4HMCA 4JLRA 4JVWA 4L8CA 1MLBB 5DJYA 2O5ZH 4UDUA 4K8RL 3QEQA 4UTAH 4D9RE 2OM5A 1MY5A 1ZLWH 3K4DA 2NY6B 3WFBL 3A6CH 5JNYB 3QCTL 1INEH 3P4LA 3LN4A 2HRPH 3QQ3A 2RCSH 4O51A 1B0RB 3BQUC 4OIIL 2FB4H 3ARVA 1ORSB 3P9LB 1YPZB 2VLJD 4CDHA 2V5TA 3CFEA 1ZLUH 1HIMH 4QNPF 5TPWL 4PJGE 1KLFA 1SM3L 3KNBA 5HDQL 1T20B 5L0QB 4KHTH 4ZFGL 4WO4A 2G2RA 3STZB 1EA9C 1WC7A 3BD3A 3PWPB 2OTWB 1ZHNA 1XIWB 2VLLA 4D8PA 1MCSA 4GG6F 1CLOL 4OZIA 2R29L 2DYPA 3PHQB 4WWKC 4JDVA 3NZHL 3HC0A 1RUPL 3HNSH 1I9RL 1CG9B 3MLZH 3WNKA 5E8PA 4GQ9H 4JPIA 1NGZB 5L6YH 3QHFL 1KJVA 3CFBA 3ZTJG 1KJ3L 2JTDA 4JZJB 5BOZG 3DX6B 4K2UH 3G04B 4XNYH 4PPTA 5IWLC 3W39B 5EU7C 4ENED 5L7XL 4Y19D 2AQ1A 2AI0L 3ZDXF 1YEGL 2BY1A 3L5XL 3W9EB 1RIHL 2XZQL 1U41A 4L9DA 1MCPH 4FXKB 1JZ7A 1XT5A 4WNQA 2LTQB 4HHAB 1QO3A 1N59B 3HMWH 5EU7E 4XX1E 3ZE0E 2CIKB 2NY3B 2DQFB 3MV9A 3V7MA 2HVJB 4LHJB 1T4KB 4OCSH 1D6EB 4PRPB 2GJJA 1KTKE 4XH2B 3N85L 3GBMH 2G75B 5LAXA 1M7DA 4XMKH 2ZNXA 2FX8H 3RWIA 2JJSA 4U1NB 3E3QC 4NCC1 4LCCB 4XNZC 1JPSH 1VADA 4Z78B 3LS5H 4M6ML 4W68A 1KCVL 3KPLB 2EDYA 2BJMH 5CCKH 1ACYL 3QP3A 2P45B 4YE4L 1KENH 2PXYC 5D5MF 4Y8AA 2R0LH 5F7EH 1K3ZA 2FD6H 3H0TA 3EOBB 4WTWA 3E3QE 5JOFA 2X4PB 2ITDB 3VXPA 1HHJA 4Y89A 3ARFD 2FSEA 3AREC 5DJ6A 4L4TD 5EZIL 1VFOA 1NC4A 1IKFH 5MEPA 2AJ3A 5EU6E 5K9QI 4X7FC 5C1MB 5KS9A 5IKCA 3DRQB 3TZVD 3ARGD 4KK5C 3GSQA 3LAFA 4XPFL 1EO8H 1ZS8A 25C8L 1U92B 1VA9A 4HS6B 1KUMA 2W92A 3P40A 4X98A 5DGRA 1Q9LB 2EDEA 1MFAL 2LVCA 3NACH 2R4RL 1UJTA 4JFZL 4J2XA 3GSUB 1AD0B 1KIRA 4KXZH 5I1CL 1DE4B 1UXWA 1F42A 3MRMA 4EI5B 5E00B 1R5IA 4GRMA 2D7MA 4GOSA 3FT4A 1MI5A 3FHAA 3EDFA 3R8BB 5LGKA 5FYJH 1KG0B 2AV1A 1CDIA 3VD5A 5IEKB 5EBMB 2X89A 3OJ2C 3QRGH 1T0MB 1CIUA 4AQOA 5BV7L 3MXVL 2CMRL 4R4BB 3W9DA 1UXSB 1FL3B 4OLUL 3VXSE 5HGBA 3MMEB 1G9MH 3PABA 1KEGH 4CU6A 4ISVA 5BOPA 5F7YC 2JJTA 4HF5H 3OJVC 2LE9A 2Y06H 1J8KA 1QZ1A 3DUSB 4JFEB 1S5HB 4P0DA 1JNNH 1IQWH 3HN3A 3FKUS 5CP7A 3IFLL 3BP6A 4NUJB 4YR6A 1FL6B 4KUCF 4JFFD 1O7SA 5EO1B 5C0DA 3LEXA 3WCYA 4XGZA 15C8L 2DQIL 3FQUA 4ZYKA 4ZXBC 3VXNB 4QRRB 4OZIF 1YC7A 5KVFH 3UX9B 5JOPD 2AVGA 2BCKB 3SDXB 4XZUB 4N5EC 3EKCA 2ORBL 3PHSA 4UQ2B 5J7CC 3O9WB 3ZKXB 4P5TC 5J13B 1R3IL 3EYOA 3K1KC 4DFHA 1JL8A 4HH9A 4E0RB 2OQJB 1F4XH 2XRAL 4TRPL 3T2NH 2B4CH 5I66A 3TO4C 3IJSB 1LEIA 1EHNA 1I8LA 4MQXD 1Y0LB 4WEMB 3HI6H 5F7FA 5MEQA 5EUOF 4NSKB 4WFEE 3KPSA 3QUZB 4NJAH 2EEDA 2PKDA 5IJKC 1OGTA 4BKLA 2JB6B 3GJEA 5AEAA 1NBYA 3BQUA 1QFWM 1T83A 1D5IL 2X70A 3AS2A 4OGXL 5C9JB 3LDBB 2NNAB 1SMOA 5C09B 5L88L 3FQRA 2OI9B 3GI8H 3UZEA 4NJ9H 4GXVH 4WI5A 4PFEA 2P24B 4WU7A 5ALCL 5E0QA 4JFHD 3QCUH 2F5BL 3MLPA 1X5KA 4K3DL 1HYSD 1BQHB 3B4NA 4FQPA 5C08E 2V6HA 4OD1L 4X0KA 1QHOA 4CMHC 5JR1H 2QLVB 4GS7C 4KROC 4JO2L 4XC3H 4R26H 3DUUB 1OP9A 3C5ZD 1RY7B 2OK0L 1A0QH 1CFVL 2VXVH 5JW5A 5CJQH 5IK3A 4YC2C 5E56A 1CU4H 5KS9F 3RZCD 1WCQA 4XRCA 2RR3A 5KSUB 5FYJD 4BQ8A 3G5YA 3MV11 4LVOC 1O7VA 4S1DC 4ELMA 4LLUB 3V6OC 1U2CA 4N8VB 4M9OA 3SGEI 4OLYH 4Z7WA 3B8YA 2IADA 2PW1B 3MX0A 4DAGL 1GAFH 4ZPVA 4X6DE 2QHRL 3BWAA 4XPAL 2Y23A 4H5SB 3V6OE 1B90A 4LEXL 3UTZB 3H7BB 4JE4B 4OI7A 1FVDA 2DQGH 3P77B 1A22B 1AO7E 5HI4D 2C4XA 2OL3A 4UTBH 2VDQL 1R3HA 1YMMB 1E6JH 1QSFE 5DMKA 1A7RL 1U95B 1V7MH 4FNLL 4G6JL 4NQXB 1AC0A 5GRXG 3VG9B 5F9OL 5EB9A 1GGIL 4ZS7H 3GRWA 3Q6FB 3WXWL 5T5NF 1Z5LB 3PWLB 4QHKI 1CE1H 2SEBB 4OCYL 3DTXB 4LARH 2GSGA 2JJUA 3AREA 5JXEC 2J3SA 1SBSH 3SEPA 4FQHA 1BIIB 1M6OB 1Q9OA 4RBPK 1WCBA 4KK9C 3UTQA 1WBYA 1AXTL 2EYTA 3MODH 4NKDA 5IQ7L 4S2SA 5H8DA 3WNLA 1Z9MA 2E27H 1IGML 1I1AB 4B53A 5C0JB 3NCFB 3UPRB 4R96B 4YHIA 4M9PA 3ZYIA 2HWZH 4BUGA 3O11A 2DMBA 2E6PA 3BKCH 3VGAB 3KG5A 4LASL 3KPQA 3RAJL 2P42B 1JHTB 1A4JA 2QL1A 1ZGLB 1A1NA 1A6WL 2VLKE 2Z8SA 5DK3A 1QR1A 5JZ7D 2NZIA 3RFZC 1NGPH 4HK0B 5E6IB 1N6QH 3BZ4A 3CJJA 4J3TA 3HHRB 1DBAH 1PW3A 1WITA 1CL7H 5T1MB 4UT7H 4OM1L 5DHYB 1G7MB 4RQQA 1FVCA 1I7UA 3FB5A 1UCBL 3FOLA 4KU1A 4NZUL 3IDXL 5C0GB 4UQ3B 4DZ8B 4E42A 5EORH 4A6YB 4JM2B 5EU5A 2DLGA 4ZO6A 4G7VH 4Y1AE 1CDJA 4F7TA 1JGDA 2G9HA 2X7LA 3P0VH 2FO4B 4HWZA 3TN0D 4OT1H 3RWHB 4IOIA 4KC3B 3NIGF 4XP9L 2HRLA 3BP7A 1FVEB 5F9JA 4DK6A 2PETA 4LLVA 3RQ3A 2NXYB 4XWGL 5KANI 4GAYB 2EDBA 1CFSA 2YUVA 5I30L 2X9WA 4ZAKC 3G5VA 1T0NA 1CD1B 3UTSE 4K7FB 4AT6B 4ODWA 2VLRE 4DEPB 1FZJB 5FA3A 4U3XA 2VLMD 5J57B 3HPLA 1UWXH 3C08H 4BH7B 4DN3H 3BN9C 4YWGH 1LQSR 1XF3B 1DQMH 2BC4A 2RBLA 2KZWA 1KELL 1ZLSH 5LXGH 3LIZH 4OLWL 1ZEAH 4WI9A 4MX7A 5CLWA 1DL7H 5CLTA 2OTUA 3IJYA 1N8ZB 3VXRE 3ZE0F 4I18B 4ELMF 3PP4L 2D31A 1EJOH 1S3KH 4N68A 5GGTH 4Z7WF 1MAMH 5ADOH 2GTWA 2BOCB 3TYFB 3HI1A 4YBQD 4MCZB 1X5HA 3DXAD 3GM0A 4NNXA 3QIWB 3PJSB 1WZ1H 4U1KB 3BKMH 1U3HB 1FQ9C 3GEWB 5EOQL 2LQRA 3O0RH 1OAYH 5C08A 1SYVB 2FBOJ 4PTTA 3OB0H 3MRPA 1PKQB 1HINL 4Y2DB 3TBSA 2MPAL 2ARWA 3Q48A 4HIXH 3V0WL 2QR0A 2H3NA 3DVGA 4V1DE 4OCLC 3PQYE 5GQBA 1Z3GL 4NQDB 2ZSVA 1OGAE 3H42L 2W38A 4ALAL 4QHMB 4NQCB 2X4NA 2Y1VA 2DL2A 3FN3A 1UB6A 2GY7B 3NVQA 4Y7MA 5GJTH 5BRZA 3VA2C 3X14B 3RVVC 4YO0A 5CILL 4Y4KA 3RL1B 3RVWC 2C4FT 4L3CB 3RNKA 3KPRA 2X09A 5J06A 4WUUD 2VISA 4HC1A 1FFOA 3LSOB 2NY7H 4XAWH 5EOCJ 1KB5A 4X6DA 1NCAH 4R4FL 5GIRA 2XKUA 5IBTL 3MRCA 3ROLA 4JJ5B 1HXYA 5DWUL 1HILA 1HDMB 1X5ZA 3JV6B 4PJ7E 4GRLB 2Q3AA 2XNAB 4KRMB 5I8KH 1P7KB 4IIQB 3LKNA 4PJFE 3B6SB 3CFKA 1S9WB 3NGBB 2XA8L 3WS3A 3A67H 2OS7A 3QNYB 5KZCD 5T1DL 3GHEH 5JW4N 1JHLL 4JFDA 3FONA 3L3IB 3MGAA 3JWOC 5CZXC 1B2WL 4CVUA 1FZKB 5K9JL 1RUKL 5GJSH 3WN5A 1HOCA 1BPVA 4RGND 5ADPH 2XKSA 3RKDC 5ESQA 4X7TA 3UJTH 4ODTH 2YD8A 4B5EA 2H2PD 4HKZB 1H8OA 1FL5B 3OR6B 1OAUL 1EEUA 4I0PA 1UVQA 4PRHA 2Y72A 3DV6B 1YUHB 1EGJA 4J3VA 3WO4C 1FO0B 1T04B 3EGSB 3TBVA 4J8RB 3OXRB 5ICYA 5F3HB 3KLDA 3DO3A 5BV7C 1HNGA 3B2VH 3QJFA 4DQOH 3MRBA 4G7YH 4GLRI 1V3MA 1FAIH 1B4RA 4R2GD 1BQLH 3SDCB 1EV2E 1FYHB 3MV7E 1D9KC 4K7PY 5DD5H 3BIKA 5CMAB 3SPVA 5FYLH 2YXFA 5KAQG 1WV7T 3BEVA 3RPIA 2DD8L 1BX2B 5E99L 3UP1A 1GXEA 4G9FD 2XT1B 1NBVH 3MRFA 1G0YR 1CXHA 3SBWA 3WJLA 3WEXA 2Z93A 4G80A 5DD0H 1L9NA 1RK0B 2PO6D 5IMKA 2HFFB 4ODSL 3RWEA 2P46B 3ARXA 4O2FB 4OAWB 4XAKE 5AAMA 3VXMB 2EE9A 2GJ6B 3QZWB 2XY1A 3KYNB 1NMCB 3LQMA 4M7ZC 4PJBE 1VGKA 4JQXC 2A6JB 4H25A 3UTSA 1OAZH 3EYQC 4ZD3H 3QUMB 3CU1A 3DETD 5L2KA 2X9XA 3CUPB 5DMJB 5GS1B 4LOUD 4FQLH 3MCLL 5FAAA 3O4OB 4GKNA 4G6AD 5DJ0A 5DMGC 4A6YL 3K4ZA 1KPVB 2YSSA 4X4YA 1KJ2B 3IAPA 4LCUB 5I8EA 4AIOA 1I9IL 4ZAKA 5HHMB 5JHLH 2WZPD 4WDIB 3GSNA 1IAKB 3QCVH 3I9GH 3OKKA 4P4KA 1CI5A 2I07A 4HCRL 5FDYA 4PJXA 3HAEA 4IOFC 4I2XA 5JDJA 3PDGA 2DLTA 3IU4L 5DMIL 5DJCA 1BBDL 1U58A 4OKVB