4WWID

Crystal structure of the c domain of staphylococcal protein a in complex with the fc fragment of human igg at 2.3 angstrom resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
207
structure length
201
Chain Sequence
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREERVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
publication title Suppression of conformational heterogeneity at a protein-protein interface.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 33
structure length 201
sequence length 207
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wwiD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wwiD01
1VDGA 1U2CA 4OZGB 1MCLA 1E6JL 1Q9LB 1ACYL 4YE4L 2DBJA 4LRIA 1LO0H 5EBMA 2GSIB 4P4RB 4QRRB 1RV6X 2AEWA 3O9WC 4KI5F 3CDCA 3PNWA 4RGND 2DM2A 2JCCB 3A0OA 2YD3A 3PF2A 4OV5B 1QSFA 3DX9B 1EEZB 3K2UL 3ARWA 4WI2A 5FHBH 2DN7A 4JAMB 3IFOA 3BP6B 4HWZB 1EHLL 4XPGL 5J57B 5IJKA 1EUTA 4TQEL 1GGBL 5HYJE 2EYTA 2VN7A 5F7HA 3MROA 4UILH 2GCYA 3FN9A 1QA9A 3QXVA 1U91B 4KGJA 1KTRL 2R56L 4Y4HB 5JPNA 2JJUA 2IADB 3AXLB 5F7MC 1WAAF 4KAQH 4TNWK 1IT9H 1RZJL 3OWEA 5E08L 1Q94B 4XAWL 1W72H 3K8LA 4NM4L 1G1CA 3B9VA 4Z8FH 4EN3D 3PWPB 4WI9A 1F4HA 1SMAA 3TT3L 4KVNH 4O4YH 1TNNA 3G6JA 3O6ML 1JGLH 1G7IB 1XR9A 1YMHB 5EPMB 5HHOA 4AENB 1JHLH 3WHXB 3PP4L 4PLKC 4WGWB 5DVMA 4PJ9A 3MRFB 1QFWH 2CGRH 2R4RL 2V2XB 2Y7QA 3LAFA 1QP1A 3EW3B 4ZFFA 3MRDB 4I5BA 4KKBC 3WYRA 3DX7A 2GITA 4LVOB 4AL8H 5CAYB 2C1PB 4Y88A 1NMAH 4KRPD 1FBIL 2DLIA 1FSKC 4LU5H 1OF2B 1WCBB 1MCDA 1S7QA 3BKCL 3L3DB 3B8SA 3VXRD 4HCRL 2R1WA 3GSVA 4PJCB 4RGOH 1IAMA 1DVFC 1YJDC 5IW1A 2OZ4H 3P9WB 4P2OB 5FDYA 3RY5A 3ZL4L 5I19H 3K1KC 1A7RH 4XCFH 3QIWA 4MQSB 3U7YH 2BOBA 4FTVA 3MX0A 2HFGL 3SOBH 3P0GB 1P4IL 4Y2DD 2Y36H 1NMBL 3O2VH 1TPXC 1MCNA 3S4SA 2C4FU 2HRLA 4ZD3L 5L88L 2EIDA 3D85A 1MI5A 4GAFB 1M7DB 2B1AL 3IFNH 1IGTB 4EOWL 4Y4KA 3RP1A 1ZVYA 3X12A 4KXZH 4RMSA 43CAB 4NWUH 4OM0H 3WXVL 2JELL 3CDYA 3FJTA 1QRNA 4X8JB 1EIBA 2MCG1 1GCFA 3VFTA 4ZDHA 5ACMA 3U4EB 2QSTA 3LKOA 4IBLT 5F7DA 2HJFA 1U6AL 4OF0A 5KVFH 3MV7D 4C4KT 1LVEA 2D7PA 4ODSH 4PJEA 3LB6C 1CXKA 3BXNB 2HKHL 1YY9C 2OK0H 2NW2B 1EBPA 1P2CA 5F9DC 3N85H 2R8SH 4YX2H 2ZPKL 1MCRA 4Y5YC 1B2WL 1B3JA 3TBYB 3U1SH 2X9XA 3STBA 1BZ9A 4GAGH 2EDYA 1HQRB 4DQOL 4PJ8B 25C8H 5T1KA 1I9RH 4ELMA 4APQA 5HY9B 1Z9MA 3IDJB 1JGDA 4JO1L 3L3GB 2G60L 4K55A 1MHHB 1ZHKA 2H8PA 3KS0H 2I9TB 2ORBH 4QXUL 3W11D 3RDTA 1U8PA 1YYML 4R0LC 2V5TA 1KG0A 3VGEA 1OY3B 5EU7E 3HI6L 2B0SH 3ZYIA 2VLJA 3UYOD 4YDKH 4K7PL 1U8IA 1ONQB 2DBLL 4YHML 1KB5A 1FO0L 4XVJH 5GSRB 3MGTB 5I17B 4HJJL 1BF8A 5BJTB 2DF3A 5EIIB 3FQWB 3DVIA 3TJHC 3NPSB 1WFTA 1W72A 2FLRT 2X09A 2X10A 2XN9E 3F65A 4HAGA 1QSEA 4NUGH 3D0LB 2E5EA 4ZXBB 4OLXL 2OR9L 1YEDA 2XOTA 4WW2C 3VFNA 3KS0J 5E8OA 2QQNL 3QUXD 1PY9A 1QBBA 3TBTA 2B2XL 2WWKT 2ZSWB 3PP3H 4HLZG 3S8WA 1BX2B 3HMWL 4LFHG 3BHBA 3STZA 3EO1B 1T0NA 3O11A 5FV2A 4KZDL 4OAWB 2HA1A 1XCQB 3WFCL 5CZKA 1LP9F 5DEGA 4JPKL 4K2UH 4OCWL 5F93C 2YD5A 4FQXD 2OZ4A 2XPGA 4OCSL 1XGRA 3WNOA 1HXYA 1T66C 4Q6IC 4OJFL 3JUYA 4MA7L 4CMMA 3UTSD 1TETL 4W70A 1NANH 5JNYB 1MFDL 4ZUVB 1FGVH 1N0LA 2NYYC 4HUVB 5L2KE 3ULSB 4XP1H 3GSOA 4PRNB 3AS2A 5BRZE 3NZHH 5DI8B 2HKFH 2BFVL 5A16A 3N9GL 2MQ3A 1U8NA 4V1DD 5F7NC 4BQ8A 3BPLC 3ARBD 3SJVA 2VZ1A 4Z9KB 3EJJX 3VFSB 4OCXH 4G6JL 1Z3GH 4PGBB 3BYTA 1QYGH 3JTSA 1FV1B 3QDME 1KT2B 1Q9KB 4C56B 4L4TE 2F8VA 3MRRB 1KN4H 2X4OB 3VG0H 1V7MH 1ZGLP 3GFUA 4JB9L 2XWJA 5GRZA 3VXPA 4DAGH 1RUKL 3NIDE 4TSBL 4MQXD 3BW9A 3DVGA 4X6CB 3ARQA 2P8MB 3V2AR 4PJDB 2VDQH 2VLKA 4MD0A 5E8DH 4OZIB 3ZT5A 2YOCA 4P4KA 5IESH 4EI5D 3OMZA 5I30H 4DEPC 5F6IB 5H37G 1YEGH 3D6GA 4IRJB 3VWJB 1VACA 2WLYA 3Q6FB 3MJ9L 1PW3A 3EYSL 1H5BB 1FAIL 4NN6B 1WJ3A 4NQCE 1AKJB 2AJZB 2IQ9L 4OKVA 3MRNA 2PCPA 1EAPB 2O5ZL 4GBXD 1MPAH 2DQEL 3AVEA 1QTYT 4GRLC 1BVKB 3P4NA 3LKRB 1NGQH 1MELA 3HC0A 1I1AC 1ZEAH 5BO1H 3RNKB 3QFJB 4JFOB 4NQXB 5CEYA 3VXSE 2ICEA 2VH5H 3HRZB 2MCPL 4LBEB 3HPJB 4HKBB 5F72S 1L0YA 5EU3B 2HMID 2DDQH 3VG9B 1HH6A 5DRWA 5DTFA 2FGWH 1JGEA 2MPAL 3O4OB 3GMOB 1Q72L 2I07B 2YC1B 4CNIA 1DDHA 3L1OL 3GRWL 4KDTA 2VDKH 5GHWH 1CYGA 1QVOB 3ZDZE 4M7LH 2R1XA 3ESVF 2YZ1A 4XXDB 1QG3A 5TQ2L 4H1LB 4KPHH 4CVZA 4DZBB 4HUMB 1JHKL 3VWKD 4HWEL 5F6HI 4XC1L 1UJTA 4EUPG 5DJCB 3CFKB 3GEWB 4FFWC 5C1MB 4Q9QH 4S1QL 5I76B 2XIDA 3N06B 2EDBA 5GS0D 2E7LC 1QR1A 3SKNA 2X4RA 1EFXB 5EBGA 2BRRL 3PWUA 2BC4A 4R4BB 4Y1AE 4I0PA 2HJKB 3T0VA 3QQ4B 4M5ZL 1EHNA 3S5LA 3RU8H 3TV3H 1NC4B 5E2TH 5IQ7L 1OAQL 3GSXA 4YFLF 3UTTA 1FGNL 4OBRA 3QXWA 5FYJD 1L9MA 1UEMA 1RZKL 4OT1L 1A6ZB 1AD0B 3QUZA 4XVUD 3ZO0A 4DVBA 5DUPH 2AQ1A 1G7QA 4JQXC 4LIQH 4LSPH 3EFFB 3MV9A 4PJXA 3LH2H 1PY4A 4JDTL 3TLRA 2IH1B 4TUJA 3MLTB 4WHYH 1LK3H 4Z5RA 4U1MA 3G6AB 1YQVH 4LSRL 3HR5A 5D7JB 4OLVH 3FOMA 2QHRL 3OAUL 1A3QA 4LHUD 1HH9A 5KOVC 1A6AA 1JF1A 1AJ7L 2HYMA 4GAJL 5E95B 4XBGB 3QT2A 1G7LA 3VXTB 1RK0A 2VO5A 2VRAA 3ZHKA 3NAAL 4X6DB 1KB9K 3LKNA 1NBYB 1G0YR 2AJVL 2NX5E 1T3FB 5FO7B 5GRWA 3U6RB 1T7VA 3E3QC 1JPGB 3FONA 5KJRL 3BKYL 1Q9WA 4KTEL 1R5IB 2OL3B 4B41A 2Q7YA 1SJHB 4NQED 3BKMH 5CMAB 4MJ2A 4PGEB 5DO2D 3KPMA 1U58A 4KJPC 4NKMB 2UWEB 4TOYH 5ICYB 3LMJL 4P5MB 1ZT7B 5TDPB 4GOSA 2XZAL 3PWNB 5D7LE 5HPMB 4ZOBA 1RJCA 3HE7C 1NFKA 4GLRI 4XZUA 5KAQF 1NDGB 1YN7A 4I77L 4YDIH 4ZUWB 2YKLH 4H26A 1U3HC 4NCDA 1D3CA 1XGYH 4J6RL 3P2TA 4PRPA 1U8KA 5EC2B 5E2WH 3ULUL 1JPSL 1AH1A 2IPKB 1E6JH 4PGCB 1ACYH 3HAEH 4YE4H 3I3EA 5HXMA 3EYFA 4NO5A 5C0FA 3QDJA 4OF7A 3KPLB 2AKRB 3LN9A 1BD2B 1J18A 1G9NL 3BMVA 5HHPA 4X6BA 1U92A 3ZKMD 4ZYKB 2FX8L 5L9DL 4YQXL 4P5TC 3K8MA 1FL6B 2BVQB 3K2UH 5DDHB 1KJ2B 1BWWA 1EHLH 1IGIL 5EZLB 4XPGH 3U7AA 3NZ8B 1GGBH 4TQEH 3GSUB 4LPTA 1NFIA 4AEHL 3C2AL 2R15A 4CU6A 1KIRB 5F1OB 5J7CC 2R56H 1CD8A 1RK1B 2OQJA 2F54B 3X13B 1RZJH 2EIEA 1V3LA 5E08H 4JFDB 3NCEB 4XAWH 4QOKA 2GTZA 4I18B 4KMQA 5I2IA 1UWXK 4NM4H 4L29B 4UNUA 2HLFC 2HG5A 1NCDL 3TT3H 3ULUF 3MRPA 3O6MH 3UROR 1XF3A 1MHCA 4BZ1L 2V7HA 3BMWA 1S9YB 2ZOKB 3PP4H 2WLZA 2A0LC 4L3EA 4AT6A 5L2JA 3BZFA 2DLEA 2R4RH 3O6KL 1GHFL 2CR3A 1FYTB 3K81A 1K2DA 2GJ6B 4LPCA 1FFRA 2BOCB 2Y5TA 4D0BA 1ZVSA 5EOQL 1AR1C 2BX5A 4X7TB 3ZDXF 4M4RA 3CFIC 3MBED 1FBIH 3M07A 1GL4B 2H41A 1AQDA 5EO9A 3RTQD 3S3SA 4DZ8B 5SWQA 3BKCH 3RWHA 5JMRA 4HCRH 1OQOA 1L7IL 2XKNA 2QSQA 1IBGL 3QUYC 1X5LA 2E7MA 2FZ3B 2C26A 3QWRD 4U1HA 3ZL4H 1X5ZA 4U1KA 4YBLB 3WXWL 5BVPL 2Q8AL 2HFGH 2W9EL 1YY8B 5BV7B 1P4IH 5DQDL 1NMBH 2AK4D 1F3JA 5L88H 4ZD3H 3T04D 1M1SA 1CFSA 1BM3L 1X5JA 2B1AH 5FUZL 2AJUL 4MB5A 1DBML 4EOWH 5DVLA 2E9JA 2N7AA 2BVOA 3RWEA 1DUYB 3WXVH 2JELH 3S35L 3CMGA 3MPCA 3MV01 1WAAA 3W81A 1DFBL 3ZKND 4OFVA 2QL1A 1U6AH 2GW5A 4RA3A 4X5LA 1EA9C 5FKPB 1T03L 4LNVA 1X5HA 4EDXB 2HKHH 5C0IA 4W6YB 3VMOA 4RFEA 2OSLA 1ZA3A 2LFGA 3MNVA 4P2CG 3QNZA 4RRPA 3SDCB 2GY7B 4PRHE 3T0WA 2DWDB 2NXZC 1ZOXA 2ZPKH 3QZWA 1B2WH 2YUXA 4FQCL 4DQOH 2B5IC 4GW4A 3OB0H 5MEPB 3RIAK 5GGRB 4LHQB 4MXWL 5D1XA 3EO0A 1A6WL 4JO1H 2H32H 2G60H 3UZEA 1F2XK 1K4DB 1SEBB 4QXUH 4PJ7E 3QRFM 1P1ZA 1YYMH 4DKAA 4PJBA 4HK0A 3HI6H 1TDQA 4K7PH 4QLRA 2XNAB 3IJSB 2DBLH 4YHMH 1FO0H 2EZ0C 4HJJH 1GOGA 5IF0B 2VKWA 3BGFC 3PDDA 5FKAB 3VH8B 5SWZE 1V3JA 3TVMA 2C7UB 5CEXA 3FB5B 1I8LA 4OLXH 2OR9H 1EXUB 3IXAA 3F7RA 4HK3N 4LGRB 1LEIB 3V0AC 4PTTB 1J87A 4LGSB 2XFXA 4KJWC 4M7ZC 2B2XH 3DURB 1AQKL 1CG9B 2WWMD 4HUWA 3HMWH 1S7VA 3Q2CA 5C6WH 1X3DA 2WINA 2QKIA 4JRXA 4KZDH 1FIEA 3GHEL 3WFCH 4HCRA 4JPKH 4OCWH 2D31B 2EC9T 4G80A 4NFBA 2P5WE 2WUCL 4OCSH 1N2RA 1WBXA 1IEAA 1U3ZA 4OJFH 5TFSL 4MA7H 1TETH 4BK5A 1MFDH 4U05A 3LV3A 5DMJB 1PLGL 5ESQB 4HWBA 3O2WL 4JVWA 3CH8A 3MSPA 3FO9B 2BFVH 4PJ5E 4AIXA 3N9GH 1ZLUK 4J3VA 4MJIA 1EJ6A 4LEXL 4Y7MA 3UCRA 3O9WB 4ZTOL 1MCBA 3H8NA 1KCKA 4G6JH 1X7QB 1F4XL 2I9LB 2NMSA 3WSQL 1AXIB 2FJHA 3D3VB 5KSBB 3BN9D 4FXKA 4ZOEA 1ORQB 1FNAA 3MRIA 2B20A 5CS7A 4JB9H 5JQHC 2DJ4A 4JG1H 2H45A 4ODXA 1RUKH 4NN5C 4TSBH 3V4UL 3SCMD 4GFTB 4FMKA 5J11C 4R26L 3I6KB 5FYKE 3GMRA 2PO6A 1FZJB 1SY6H 5I18L 3FB8A 2BY2A 3OJMB 3MJ9H 1IQWL 4CGTA 3DXAE 4ZFOL 3EYSH 3GNML 1S9KC 4WJ5B 1FAIH 2NY2B 3MROB 2WQRA 5GZND 3VDAA 1XGPB 2OLDA 2IQ9H 1GRWA 1LP9A 1QA9B 5JPNB 3AMKA 4GW5A 1OP9A 2O5ZH 4HXBL 5IFAL 4G7YL 3LCYA 3TIEA 5SX4I 1B0GB 2DQEH 4YHIB 1KELH 3OKEA 4BSVA 3V7AE 1OD7A 4N8CL 4AMKL 3Q1SL 3BD4A 3TO4A 3TH2T 4QRPE 1OLZA 2CK0L 3BEVA 1JI1A 1KLUA 5TDOA 2XQYK 4XRCA 3T0EE 5T3XD 3PWLB 2VQUA 5F1NB 1AXSA 3G6JB 3CAFA 1XR9B 3BSZL 5HHOB 3PGCA 2MCPH 1DVFB 1V5JA 1XT5A 2VLRE 2W07A 4NZUL 4PJ9B 5KZCD 2EDLA 2Y7QB 1ITBB 3L3JA 2R2BA 4ZFFB 2F74A 4P9HL 2MPAH 2P5EB 5CGMA 1J5OL 4X98A 1MCWM 1Q72H 3AM8A 1TPXB 1JP5A 3CH1A 3L1OH 5C8JB 2ZG3A 2LE9A 3GRWH 1U8QB 4UV4H 5CCKL 1S7QB 2NZIA 1DLHB 4B5EA 5KSUA 1YEEL 3NCMA 2A77L 4PJHB 4MMZC 5FYKU 4WUUD 5IW1B 3VXQA 3ZLQC 5TQ2H 4QRSA 3OR7B 5E8EA 3RBGA 1JHKH 2GSGB 4HWEH 4XC1H 4KROC 1A4JA 4LLQB 3QIWB 4JY4A 4S1QH 3V0WL 5C6TL 4LPUA 5SWSD 2L0DA 3D85B 5HHNA 5IV2B 4NQSB 4DCQA 4MWFB 2J8UE 2BRRH 4XTRC 1FZOA 1E4XI 3I3BA 1CFBA 1JTPA 4Y4KB 1T6VN 2WIIA 3X12B 3PQYB 4O51B 1KCVL 4PP1D 1QRNB 3U30B 1IM9B 4M5ZH 1JNHB 1UXSA 4LLYA 4M93C 2VISA 2ZCLL 5IQ7H 4NQDE 1OAQH 3VFTB 1YZZA 4RWHA 3OKOB 5C0CD 2AP2A 3LKOB 1FGNH 5F7DB 3D69B 5TDNB 4NNYB 1RZKH 5C08A 4OT1H 4CN4A 3MLUL 3BZEA 2GTWA 5C09B 3KPNA 4M7LT 3BRFA 2Q87A 1MFAL 1DJSA 2Y6SD 4JLRB 3U9UA 5DHVB 1P6FA 1SYVA 1Q9OB 4PRBA 1P2CB 2Q3AA 4JDTH 4R0LB 1A47A 1JNLL 3OKMA 5DQ9A 2EEAA 3GIVB 1ZK9A 3H3KA 5DLMH 3HMXA 1JTTA 4FMFA 3O81A 4LSRH 3OF6A 2CIKA 2HTKD 2QHRH 3OAUH 1JGDB 3ARGA 3TBVA 3OSKA 2FD6L 4Z7VF 3G08A 2FBJL 4JM2D 1AJ7H 1ZHKB 2H8PB 4GAJH 1OTUD 1SY6A 4M00A 2IAMC 3OTTA 1GVIA 2H2SD 3NAAH 2AJVH 3BZDA 3QDGA 3QNYA 2LU3A 2PETA 3HI1A 1SJEA 1NEZA 1SYSA 4PJGF 5KJRH 3BKYH 4KTEH 4OLZL 1U8IB 2EDOA 5LWYL 1AI1L 1FVDA 4XAKD 3HNVL 1RULL 3QP3A 3BP5A 4OGAD 3MBXL 4F2MA 2EXWD 4HUXB 1DEDA 3NGBC 1PKQA 3CVHL 3RWFA 1WWCA 3HZMA 2D0GA 5FXCH 1X5GA 4LAQL 3LMJH 4Y4FD 2XZAH 4ZAKD 4WFFE 2Z9TA 4MHHI 3DRQB 4ZUUA 4N8VA 1BOYA 3VFNB 4BZYA 2MQCA 4JEGB 5MEND 4I77H 43C9A 5TPWL 3GSWA 4CW1A 2PR4L 4N0FA 4J6RH 4Q6IB 1HYSD 1U8OA 2UYLB 5JHDA 1J0HA 3ULUH 1JPSH 3CFBA 4OZFH 3BHBB 3STZB 3IXTB 1OSZB 4D2NA 1Y6KR 4H5SA 5BOZG 3SKOB 2BHYA 3ZDZF 4WO4D 1GOHA 1G9NH 3M17A 2WWKO 5B4MD 1AP2B 5DEGB 1KFAL 2AAVA 4PTUA 3MTRA 4U0RC 3BPLB 4HZAA 2FX8H 1INDL 4WFHE 5L9DH 4YQXH 3CXHJ 1BZ7A 4WW1B 2LTQC 4AY0A 1GGCL 1F4AA 3VDCA 5D1QC 1VEPA 2AW2A 1BF2A 5F3BA 5F7LB 1IGIH 1VFBB 4R3SA 3O45B 4FNLH 4XP6L 4AEHH 3C2AH 5E1HB 5JA8B 1MCEA 1UB5A 2D7TL 3VFPB 1A4KA 3IAQA 5DJYA 2BNRE 2IALA 4WHYG 1FZMA 4KC3B 1OTTD 2CMRL 3TN0C 1J1OL 2EDNA 1XIWA 2UVFA 3LN5A 3U7WL 3DMMD 1I1CA 1PD6A 4DEPB 4PJCE 1NCDH 4PPTA 1LO4L 3F7YA 4OGYL 3BP7A 4HWNA 2VUOA 5AUMA 1HEZA 4G8GB 4QHKJ 4BZ1H 3BH8A 4K3JL 3U36B 4IRSC 1YUHA 3ULVD 5ETUA 3DVGB 2V5MA 3O6KH 1GHFH 1VA9A 2VLKB 1CT8A 3TCXA 5DMKA 5C0BE 3O3EB 5C07A 4Q97A 4P4KB 4YHYB 5EOQH 3NN8B 1TJGL 4AG4L 4BQ6A 4GRLB 3UTZB 3NA9L 4BM7A 3L7EA 4YAQB 3REWA 1L7IH 5JXEA 3K1DA 1I1AB 1IBGH 4OIBA 1OPGL 2WNGA 1CLCA 3BIKA 2JJVA 4JPIB 4OKVB 3MRNB 5BVPH 2Q8AH 2W9EH 3WJJC 4HS6B 5CJXC 1IARB 4JZJC 5DQDH 2K1MA 1DBAL 4J12A 1DN0A 3P4NB 1BM3H 2Q6WB 5FUZH 2AJUH 1JZ5A 4LCWA 5MI0B 1DBMH 1WSST 3PWJB 3HAEG 4EBQL 5CEYB 3LRGA 1PYWA 3VD5A 4JN1L 3TA3D 3EOBB 2ED9A 3S35H 2FDBP 1GC1C 3E8UL 2F8XC 3I6GA 3G9AB 1DFBH 5DRWB 3C09C 1JGEB 5EFIB 3DECA 2R4SL 2WUBL 1U8LA 1T03H 2YSSA 3I6LD 5DSCA 1BQHG 3RWJB 1CBVL 3L7FA 1G7HB 5T1MA 1I8IB 2CSPA 2DQTL 3FHAA 1EV2E 3RWDB 3FFCA 4WWKD 4OB5L 4FQCH 5HDBE 2FEEL 8FABA 4OM1L 1QR1B 5T3ZD 3SKNB 4HH9B 4MXWH 1L0QA 1A6WH 4HIXL 3VXNA 3PWUB 5FOJA 2CKBA 4WHDA 35C8L 3F12B 1T5XA 1OP5K 1A2YB 1PEWA 4UUJA 4IIQC 3TYFA 3S5LB 3T0XA 3PABA 2DLTA 4TYUA 5KTEL 5D5MB 3W9DB 4U3HA 1CFTA 4BZ2L 2FJFA 4DVBB 4MD4A 4XCNB 4OF3A 4MA1C 3ISWA 1GGIL 3MV9B 1EEYA 2IMMA 4DN3H 1CLZL 4F7PA 1CI5A 1TMCB 3KPQB 2VZOA 3IS0X 4J3WA 1WC7B 3HR5B 3OB8A 4QHUA 3FOMB 1AQKH 2IANB 2IQAB 1BWMA 1HH9B 2J3SA 4QHNA 4LSDA 3EJZC 4QY8B 4ZFZB 3HA0A 1RK0B 2PYFB 3GHEH 5T5NG 5KSVA 5F7FA 2ZUVA 3W2DL 4MS8D 3KWWA 2WUCH 2XKUA 5TFSH 5BOPA 1JHTA 4EN3C 1FG2A 1U3HB 4UQ2B 5LBSL 2Q3ZA 2FHBA 5I1GL 1PLGH 4XPTL 3VXRA 1HQ4B 3TPUA 3O2WH 2DYPB 3ARSA 5C3LD 4X6CE 4BKLB 3DHMA 4LEXH 4ZTOH 5ADOL 4OZIE 4XZUB 1VADA 4D0CA 1T04A 2ZG1A 4Y2DA 2NY1D 1SHMA 1RZ8A 1F4XH 3T3ME 5A2JH 4P5TB 3I50L 4JREB 3UPCA 3WSQH 1FL3B 5ID0A 3QXAA 1K9TA 4PB0L 4LKXA 4WFGE 5IQ9A 4JQVA 3EYFB 4NO5B 5I1AA 1ZLWK 5JA9A 4N1CA 3RPKA 3V4UH 1TVHB 3JWDC 5HHPB 5J1AB 2J6EL 3IU3B 1N8ZB 2X6MA 2BSTB 1NDMA 3PHOA 4ZSOE 3DOSA 4R26H 2JIXD 1FZKB 2OI9C 1RI8A 5DD1L 3S88L 2ZCHL 3MRHB 1T0PB 2PXYC 3MV7A 5I18H 1KIPA 4C56D 4PY7A 3MV8B 1XGUA 4X9BA 4CKVX 1IQWH 1KPUB 4AM0A 1BBJB 3GNMH 4X7EC 5MEQA 2FX7L 4U6VL 1B6DA 4PJ7F 1NFIB 4POUB 3SE8L 3HE6D 1QZ1A 2B4CC 3MGOA 2JLLA 2OQJB 4HXBH 5IFAH 3QUKB 4GKZA 2YD4A 4XNMA 2EKSA 4QRQA 1A1MA 5CEZE 3TWCL 4QOKB 4AMKH 2GTZB 3Q1SH 3RL2A 3W0WA 5I2IB 1HCVA 2GHWB 1VKXB 4FQIL 2H26A 3MMEA 2CK0H 2XXMB 2HG5B 4G9FA 5E5UB 2ESVB 2HRPL 3MRPB 1XF3B 2DLFH 3BSZH 5ACZB 1UM5L 4NKQB 3QQ9D 3QUYB 1S5HA 4L3EB 1KXQE 2E7BA 4NZUH 5L2JB 1M6OA 5TJWK 4P9HH 1NSNL 4Z7UB 1Q38A 1J5OH 3X17A 3BO8A 2IG2L 3MRMB 1WTLA 2EXYD 5CCKH 3RWHB 4L3CA 1YEEH 1KGCD 2A77H 5GS3A 5D6CB 2P8LA 3RUGB 3QR2A 2NR6D 2P4AB 3CIQA 2WV3A 5FYKL 5J3HC 4Z18A 3V0WH 5C6TH 1CTNA 1P53A 3VGFA 4B7IA 2A6JA 4TRPL 4ISVB 4LLMA 3WKNA 5B38G 3KR3L 4PLJC 1KCVH 2BVOB 3RWEB 1FH5L 2CUIA 3ABZA 5CSGA 5L6YL 2ICWI 2NZ9C 3QUXC 1QLRB 4FQXA 2NXZB 1G0DA 5EU5A 2ZCLH 1JZ6A 1T1YB 3QI9D 1M71B 5E94A 4TVSa 3DROB 2HLAA 4NO0B 4LLVB 3QULB 2WBJB 3TH3T 3OQ3B 1LEGA 1JZ2A 1MVUB 4PRIE 3MLUH 1OCWL 4JN2A 4X6DE 1MFAH 3BQUC 5J0BA 4V1DA 3QNZB 4I2XB 3J8F7 1BPVA 3RZCB 3ARBA 1JNLH 3QZWB 4HBCL 3ME0A 1KIUA 4GW4B 5HHQA 2ENYA 5HVGB 3UJTL 5H35A 1ZS8A 1VB9A 4FQQA 2EE2A 3EO0B 4DGYL 1W8NA 3QCVL 1CDCA 3QIBD 4OLYL 2FBJH 4WUKL 5C0JA 1P1ZB 2DIAA 3ZMRA 4LSSL 4PJBB 3AFLA 4P23D 4ZFOA 1MH5A 1MY5A 3NCBB 5EBWA 4QCIA 4DWHA 4OLZH 5DJZA 5LWYH 1AI1H 4NCC2 4EI5A 3HNVH 4HFWB 1RULH 3MBXH 1I1FB 2H6PB 3V5HA 4HV8B 1MVFA 3CVHH 1U8HA 3K7UA 4FFYL 3BUYB 4LAQH 1T89C 5L2KA 4MQXC 3LKPA 3GHBL 1SVCP 5EC1B 4K8RD 4WI5A 2NTFA 4UDUA 2CKNA 5CLTA 5F6HJ 3RIFK 3BPNC 5DEFB 1Z9SA 5TPWH 4X4ME 1XMWA 2PR4H 2CLRB 2NLJA 3O8XA 2XFXB 5GGQH 4YHPB 4IJ3B 3UXFA 4KUZL 4D0DA 4L4TA 1S7VB 2FO4A 2NY4D 1A02N 2WINB 5K9QG 2F54E 1UH4A 4P57A 3MRJA 4GBXC 1KFAH 4LGPB 4JFDE 4JCMA 5DJ2B 4G80B 1INDH 1N2RB 1A8JH 3B2VL 1BQUA 1JIBA 1GGCH 4GKSA 2CK2A 4ZS6D 4LLUA 5BCAA 4Z7VA 3LV3B 2VR4A 2J8UF 3ARFD 4KV5E 4XP6H 1QQDB 1FG9C 3TEUA 1JMXA 2BY0A 2YN3A 5EO1A 2P24A 3VWKA 2HMIC 2D7TH 4MJIB 5C0AD 5KAQG 1FYTE 4HXAL 4NQCA 2GJ6E 1CD9B 2UZXB 4HZLB 1P84K 4PJGA 3QWOB 5C0RL 2KL6A 2HTLD 3DO3A 3V6FA 2CMRH 1J1OH 3OV6A 1VENA 3U7WH 4FXKB 4PB9L 4XI5D 3MRIB 1LO4H 5F70A 5DHYB 4OGYH 4GLRH 2C1OB 3FMGL 4MNQD 1D5BA 2EYSB 4K3JH 3ROLA 5KW9L 4F33A 4CL7A 1VFOA 3IDMA 3VXSA 5LGKA 1VEOA 3ORJA 4Z76A 1CVSC 2N4IA 1F58L 3QFDB 5GS0C 4WU7A 1YEJH 5I1CL 2FRGP 3K4ZA 2PO6B 2F15A 3KPRB 5K9OA 1IZJA 1OTSC 1TJGH 4AG4H 2ATKA 2P47B 4P5KB 3FB8B 3NA9H 3ARZA 3L5JA 5I74B 4R97B 1GYAA 4TPRL 1OD9A 5TQ0L 5ISZB 1OPGH 3E2HC 3P73B 4RAHA 1U8JA 5FUCE 4RMUA 5DURD 3C5ZD 1LP9B 3PG2A 1N26A 1T4KB 3ZT7A 2P43B 4HG4J 1DBAH 2GJZB 5KANG 4X4XB 4KK5C 3BEVB 3R0NA 4OZGF 5TDOB 3RI5F 3MREA 3M45A 4XRCB 4MLSA 3TZVC 4OZFG 5JQ6L 4EBQH 4JN1H 3PGCB 3CGTA 1TVDA 1WITA 3IDGA 3E8UH 2CDEA 2JCCF 2F74B 4YLQT 4X4YB 4NQEA 2N1KA 4X98B 3T09A 2R4SH 4ZFGL 3V0VA 2WUBH 1S7WB 3CH1B 1P9MA 1CBVH 3EYOA 5KS9B 4JHWL 5KSUB 4OQTA 2YXFA 4JO2L 1F3DH 2DQTH 5CIPA 3D2UA 4EIGB 1A4JB 1ZLSL 2VDLL 4OB5H 3T8XB 4JY4B 2YEZB 2DQDL 5FCUL 5DO2C 4OM1H 3RVXD 1HKFA 4LRNL 4WVRA 1I7ZB 3IF1A 4BH8A 3SO3C 1EK3A 1FQ9C 4HIXH 1UZ8B 3B5HA 3V8OA 2C4FT 3FRPA 4WV1A 5C71A 3GUTB 3H9YA 3DNKA 2WIIB 5FO8A 1QSVA 5J89A 1YA5A 35C8H 4P2QB 1F4WL 4YIQA 4F9PA 1T1ZA 4CN6A 3VI3E 1UXSB 4LLYB 5C92A 4BELD 4BQ9A 3B5TA 3LQZA 5IK3A 5KTEH 5L7XL 2NX5D 2FH8A 3RAJL 1F3DJ 1F11A 2AS5M 5AD0B 1VCAA 1Y18A 4BZ2H 1BVZA 1KYOJ 3UZVB 3BZEB 2W9DL 3MQIA 5CBAA 4PJCF 1FCGA 1KJMB 1YEKL 3C6LB 1NUDA 3U9UB 1GGIH 3ZKMC 3SPVA 4JJHA 3WFEL 4D9QE 1CLZH 1MCHA 3WNMA 1BREA 4JJ5A 4JGMA 2Z31D 1FJ1B 1HXMA 5D7LD 5F9WB 4WIQA 3MODL 1RUPL 1CGTA 1MCFA 1F6AA 4NPYA 4KJQC 1B0RB 3ZKXC 1NCAL 3NGBB 4U6XA 1R5WA 4L1HA 5IP4A 2CLZB 3WEXA 5I8EB 1JI2A 1BECA 2NQCA 4WI7A 3QDGB 1PX4A 1CL7I 1RU9L 5IB4A 1SJEB 2VUYA 4LOUD 3JVGA 3W2DH 3IAGC 4HUUA 4I1NB 3OKDA 5E99L 2P44B 2DAVA 1Z0NA 3PIQA 3UTQA 1QLEL 3CDGA 3VXMB 5LBSH 2O61A 3C2SA 2ADGB 5I1GH 5DMGD 3W9EB 2E27L 4XPTH 4Y0GA 4OF6A 1A3LL 1BOGA 3IDYB 2K7QA 4YGVA 1NGPL 4UAOC 1MLBA 4RAUA 4WHTB 3MYJA 3S3JA 3QWRA 1DQQA 5IMKB 5ADOH 3SDAD 4JZNB 3ZHDA 3WHE1 43C9B 2Q76A 1QSFE 4U0RB 3DBXA 3GSWB 4S0TD 3O6LL 2MWCA 3MBEC 5CD3A 3I50H 1U8OB 4HX1A 1XF4A 1IKNA 4LP5A 3S98A 1VERA 2E9BA 3C8DA 3OKLA 3QH3A 1UJ3A 4PB0H 3S6CA 4KRMB 4M8QA 4UOJA 5D6DA 5SV3A 3B9KB 3QPQD 4L8CA 4QRTA 2FJGA 3M17B 2J6EH 3FQRA 4OFYD 1X6NA 4GS7C 5ICXA 5INDA 4U1NA 1IAII 5HDBF 4M1DL 5JIKA 1EEUA 2ZCHH 5BS0A 5DJ6A 4JDVB 3TN0B 4J23A 3G6JE 5F3BB 4H0GA 5HHOE 4O58L 1H15B 1E28A 4R3SB 2BNQB 4G8EB 1CN4A 2FX7H 4U6VH 4F57L 2P46B 2QADC 1IC5L 3R06A 3SE8H 1A1OA 3T0DA 4XCEB 4IRSB 2Y07L 4WI3A 1J10A 2AJYL 4GXVL 3H42L 2VC2L 2F19L 3KLSA 3TWCH 3QPXL 3HZVA 4M9OA 1HOCA 2V5RA 4FQIH 5DFVD 4X7DC 4DUXA 3MLYL 4GO6B 2CD0A 4H8WL 5D71L 3F7YB 3MR9A 5FGCB 3BP7B 2C4XA 2HRPH 2O26U 3QEHA 3HC4L 2CIIA 4KJYA 1UM5H 3V7MA 1YUHB 1QBAA 3GMQA 3MCLL 4PLKD 5ITBL 5HJ3A 1CICA 3TBWB 1NSNH 3C6SB 5DMKB 2X44D 4JFYA 1D5MB 5C07B 1MI5E 4JZJB 4EUPB 1D5XB 3CUPB 1ZWIB 2IG2H 4BFGA 2W92A 4KKBD 5DZNA 3UYPA 3V5KA 3AROA 5MHSE 3S7GA 2VABA 4PG2C 2VR5A 3MRLB 1QRNE 3RY6A 1RHFA 1TCRA 4FQHA 2KQNA 3BIKB 4JFEB 2NNAA 1D9KC 4E42A 4FQPA 4E5XB 4IMKA 1A7BA 4PRHD 2P5ED 3BDYL 3L3KA 3D87B 1DN0B 4ZUSA 2BMKA 1RZJC 1WT5A 3ZT6A 4G5ZL 3MJ8B 4LCWB 1ZLWH 3SQOL 2Z93A 4TRPH 1OGAB 2Z8VC 4G42A 4MJ4A 2A6IB 1PYWB 1M7XA 3KR3H 4PJ7A 5IHZA 1FH5H 5IMMA 5L6YH 4X6CF 3TC9A 1KENL 1U42A 4PJDF 2BVEA 3I6GB 5DA4A 1HIML 2W0FB 5HGGS 4PS4L 5CEZL 4OZIF 1PQZA 1HSBA 3CU7A 3PWVB 1F2QA 2YPVL 2WWMC 1AY1L 3LDBC 3QB7C 5HHME 3T3MF 1Q0XL 1OCWH 4UOW1 4YO0A 5DSCB 2Z8SA 3EOTL 5SWZA 3LB6D 6CGTA 1UQSA 2VLJE 4KDWA 5T1MB 3KG5A 2Z92A 4EQ2A 1YY9D 1JF5A 3PL6B 3BT2L 2Z91A 3SE9L 5HI5C 4HBCH 4L5FL 1IM9D 2E8YA 4ODWA 3WUWG 4IIQB 4XH2B 8FABB 4Z77A 3QXDA 5ELIA 3UJTH 5JTWA 1OP3K 3VXNB 4DGYH 1A3RL 4MDIB 3FAXA 3QCVH 4G3YL 4OLYH 4WUKH 4NO3B 3AREA 3P0VL 1FIGL 3FT4A 4LSSH 5CJBA 5E2VL 3HG1D 3SDDA 4LCCA 5GRJL 4RGNB 4NJ9L 4OI9A 1T5XB 2DQFB 3RL1A 1G6RA 2D4FA 4LDOB 3VRIB 1HSAA 1LD9A 3S3PA 4KTDL 3DO7A 1CFTB 2WBWB 3BEWA 2FJFB 3TJHD 4FFYH 1KIQA 4MD4B 5JOPD 2CO7B 3GHBH 1DEEB 1EEYB 4Y19D 3TCLA 4F7PB 1C08A 1J1PL 1LDPL 5IMOA 3FKUS 1I1YB 3O3BA 1NMCB 1GGTA 3TH4T 4ZUTA 4EN3B 4KUZH 5E8PB 2JJTA 5GQBA 2XG5A 4F7MA 3RVUD 3VGAC 5HGDA 3G04A 4WTXA 5I0ZA 4OF8A 5JO5A 4JPWL 2VZVA 3SJVE 1BIHA 3ARDC 3AS1A 5KSVB 5EH1A 3DWTA 3SBWA 3KWWB 2H3NA 1HK6A 4KXZI 4YUEL 1W2KT 3B2VH 1CLYL 1FL5B 4LCUA 2Q20A 4LCIL 3S97C 1T66D 4KRPB 1R3LA 3OJDA 3L6FA 4LSQL 5FYKD 2A1WL 3VXRB 4M61B 1EVTC 2OTWB 2NYYD 3OJVC 5EU6D 4N0UA 3DX6A 1N7ML 3WLWD 2FLBT 3RA7L 2VLKE 2GK0A 2ZP0T 2BHUA 4HXAH 1OOAA 2X4NA 4L8SA 5FM5O 1VADB 4D0CB 4HMDA 5C0RH 4Y2DB 5SWSA 3R4DA 1KSRA 2P8PB 2OI9B 4LQFL 4MSWB 4ONOA 4PUBL 5HGBA 5IROA 4PB9H 2XQYG 4EXKA 4QRPA 4Z7NF 5ID0B 2DOCA 5IQ9B 3QIUC 5I1AB 4X6DF 5KW9H 4K3EL 1F3RB 5D9SB 3T0ED 3D5OF 2X4TA 2YPKA 3IFPB 4R7DB 1F58H 1GSMA 1NDMB 5EIVA 3C08L 3AB0C 3WN5C 2VLRA 4H25A 5I1CH 4U6HA 1KJ2L 3SGJC 5EZJB 1RZ7L 3B8YA 3MV7B 4PY7B 1XGUB 3HUJA 2FL5B 4MQ7A 2UWEF 4TPRH 4TVPE 1DZBA 5TQ0H 2RAMA 5MEQB 4NKDA 3WNLA 5JW5B 1A0QL 3DPBA 1NAML 3MGOB 3TO2A 3QNXB 1T1XB 1OAXL 5F7WC 4R4NC 4XNMB 4N5EC 4NC0B 4F7TB 3RL2B 2UV3A 1EPFA 2W9LA 3ECBA 2Y6SC 3WNNA 3QO1B 1TQBC 3DUUA 3D39D 5JQ6H 5D7IA 3HNSL 4XP9L 1IAOA 3RGVC 4XVTL 1Q8MA 4WTZA 3UAJD 1M6OB 5K9KA 5KSAA 2OTPA 2X42A 2VR9A 2L4OA 12E8L 3JTTB 3ROOA 4NQDA 4ZFGH 3FRPG 3BO8B 1I8MB 4JM2C 4NRXA 1OTUC 5EULV 3ARGC 4L8DB 1IGFL 2LVEA 2L7JA 3U46A 2AEIT 4Y4FA 1I9JL 4U6TA 4ZAKA 4JHWH 4JO2H 2H9GB 4HGKC 4HIHA 4JDZA 1MWAB 5BV7L 5MENA 5DRZA 1ZLSH 3KLAA 2VDLH 4PG9A 5D5ME 3QUXB 3UTTE 3EYQC 4F80A 2DQDH 5FCUH 2CLVB 4FFWD 1T1WA 4LRNH 2Y1VA 4O9HL 1F45A 1QUNA 4L8BA 1HHKB 4ZMAT 1RJYA 1NGYA 4P46A 3MV9E 4LLMB 1AE6L 1EFQA 3BRGC 1F4WH 2AEPL 3UX9B 5BZDA 1IZKA 3BDBA 4FQXB 1ND0A 1HHHA 4D9LL 4HGMA 1XZ0A 4U6YA 4JFFA 5L7XH 1IILE 3S9DB 3UTSB 3RAJH 2IANE 5E0QA 1LEGB 5E5MA 1J8HD 4OZGA 4XXCA 2W9DH 1Q9LA 2VXVL 3LPFA 4WO4C 2EDJA 2HWZL 1MNUH 1YEKH 4P4RA 3WIHA 4QRRA 4NRYA 4P0DA 4V1DB 5HI3C 3JBG7 3WFEH 3ARBB 5HDOA 4GUPB 3UTPE 3U0TB 3B3IA 3KJ6L 2JCCA 5FFLA 5DJDB 1RIVL 3T2NL 3DV6B 2AJXL 5I75B 4OV5A 3DX9A 4XT1C 3MODH 3WDIA 1EEZA 5C0GB 1RUPH 4KKAC 5H35B 1ZS8B 4FQQB 5EOTA 4K07A 4ZO8A 4JAMA 1NCAH 3FN3A 5JOFB 3BP6A 4HWZA 4NQVA 3VXUD 4TTDC 1HDMA 1MH5B 2G75A 5IHLB 1U91A 1BFOA 2BDNL 4S1RL 4Y4HA 4HIEA 1RU9H 4ZO6A 2IADA 3AXLA 4QCIB 4HQQL 1A6VL 1KTLA 3BDXA 5DJZB 5E99H 4DOHE 5J13C 1A6UL 5DC0A 2C9AA 4EI5B 1Q94A 3NIFE 3DMMC 1QLEH 1SMOA 1WZ1L 5BW7A 4I3SL 3PWPA 4U1JB 3WS6C 3LQAL 4WFHD 2E27H 3C5JB 3QDJE 4O00A 3H3BC 1A3LH 3LY6A 1K4CA 4DFIA 1NGPH 4Q9CA 3LKPB 3ULVC 1UCTA 4JG0L 4KJPD 4AENA 4LKCB 3WHXA 2NTFB 2RIKA 1N59B 4UDUB 3C60D 4H88L 2V2XA 4M43L 4GBXB 1T7WA 4ODBD 3HE7D 3MRDA 4A2LA 4NGHL 4U1IB 3O6LH 1I85C 1CGUA 1T20A 5DRXA 4F9LC 1OAKL 1OF2A 1WCBA 3L3DA 2X9WA 2EECA 4F7CB 2HT3D 2FO4B 3TA3A 5FGBA 3I75B 5E6ID 4XHQA 2PN5A 4P57B 1NBZB 4CVXB 1KLGB 2MNUA 5DF0A 4QOKE 4K71B 4M1DH 5HGAA 4GKSB 4P5TD 1PBYA 3X11B 1AGEB 1OM3L 1QEWB 1IGTA 4PYHA 5C0BD 4O58H 2X1PA 1X44A 5B8CA 2E9WA 4F57H 5EO1B 4POZC 2EYRA 4L3EE 4LVNB 3VWKB 5E6YA 5L8JB 3RWCA 2Y07H 2QHLA 5LGJB 4WWKA 5SX5H 1M05B 2AJYH 2EE3A 4GXVH 4YH6A 2F19H 1MLCB 3MYZA 3U4EA 3QPXH 3V6FB 4XC3L 4HS8L 5T1LD 1A7OL 1G9EA 3QISA 3MLYH 3WKML 4H8WH 2HLFD 4V2CB 3LRSB 5D71H 4HMEA 3CZFB 4K94C 3HC4H 4KI5E 3UBXB 3ULUC 4WFEE 4D8PB 3ROLB 4F33B 3BH9B 5GGTA 3WMSA 1Z9OA 1PX3A 4Y16D 3E2HB 4K3HA 2A0LD 5ITBH 2MKWA 4PJ8A 4IOSD 1G9NC 4WU7B 5HY9A 3TT1L 4P49A 3S34L 1CZ8L 1ZGLB 3IDJA 5K9OB 2CXGA 4HDIA 2CRZA 5J6HA 5D7KE 1AR1D 2I9TA 4TSAL 3CCHA 3JV0A 1XF2A 5TE4L 4Y5VA 2VDRL 1WAAE 4IMLB 3QUYD 5CZVL 1BBDL 2F8OA 3OAYH 4NJAL 5I17A 3CC5A 2AV7A 3BDYH 3FQWA 3TNNB 5KSBF 2DL2A 4LHUB 4D9RD 4G5ZH 5E00B 4WRLA 3FT2A 3SQOH 3MREB 3NVQA 4F37K 3D0LA 4J3UA 4ZXBA 4HKJB 4PBXA 1MFEL 4Q9RL 1AO7D 4XNQB 3IDGB 2W38A 4PBWD 1KENH 3CFDB 2CDEB 4U33A 5CEZH 1HIMH 1F02I 4PS4H 4Q0XL 5HVWA 1KUMA 3GSRA 4NQEB 2YPVH 1AY1H 2XWTA 3SO3B 2ZSWA 2I25N 1Q0XH 4NKOB 5KBNC 1BX2A 2ATPA 1VFUA 3EO1A 3EOTH 4PJBE 1RMFL 3CSBA 4DVRL 4OAWA 1XCQA 2X40A 1I8KB 1I3RB 3DVNA 3BT2H 2EDQA 3SE9H 1MY7A 4L5FH 4XPAL 4LASL 1JYVA 5L0QB 3H7LA 2XXCB 3IFLL 1MRFL 1AD9B 5JNYA 3IF1B 4BH8B 5CWSB 2D7QA 2HN7A 1A3RH 3DX8B 4G3YH 4PRNA 4WV1B 3OL2A 5DI8A 4UDTB 4UT7L 3P0VH 5BQ7A 5CSZB 3G6JF 5E2JA 2APVA 1FIGH 3WFBL 4RGMB 4HH8A 3RJDA 5E2VH 4YIQB 3JXAA 4NJ9H 2NY1C 1CDYA 2WAHA 5H2BB 3VFSA 1RQ5A 4QXGL 1DBJL 4PGBA 5IK3B 3O0RL 1FV1A 5DT1L 1KT2A 1Q9KA 3SO5A 4BFBD 2SEBB 3P9MB 2NY3D 3L5HA 4C56A 1DE4B 4HF5L 3MRRA 3RKDC 2HH0L 3LD8B 4EI6B 3P30L 2DMBA 4CJ0A 4JRXE 1WK0A 1ZKAA 5CJOL 4PJHF 4G6FD 1KNOB 1FNFA 3SPVB 3UYRL 3P4MB 4X6CA 2P8MA 4PJDA 1J1PH 3MA9L 1LDPH 4JGJA 3NACL 4FQ2L 3RFZC 2YPLD 4HLJA 3V6OC 1E4KC 2VE6B 3DETD 3EYUL 4IRJA 4KJWD 2ZG2A 1R5WB 3WEXB 4MJIE 1H5BA 5DUML 4JPWH 1AKJA 4UILL 4QT5B 2AJZA 5GJSL 1KB5L 2ITDB 2DTML 3NCCB 3G6DL 3DIFA 4HUUB 1K8IB 4YUEH 1CLYH 3V7AG 3H9ZA 4LCIH 2B1HL 4HPYL 5CFHA 3LKRA 3MBEB 4OGXL 3RTQB 4LSQH 4MDJB 2A1WH 4ZO9A 3TESA 3MRQA 4YGVB 3QFJA 4JFOA 4NQXA 1KTKE 3U0PA 4CMHB 1N7MH 3D25B 2W65B 3HRZA 3MYJB 4MB4A 3RA7H 5F9JB 4LBEA 1IRAY 2YD6A 1QFWM 3HPJA 3AS3A 4G7VL 4XPBL 2VQTA 5EU3A 3BVNB 1ETZA 3B9EA 5D1ZC 3KPRE 2AK4B 4MCZA 4LQFH 4Y8DC 5CD3B 3VFMA 4PUBH 4UBDD 1UKSA 3KPSD 3F8UB 3QH3B 5ISZE 3O2DA 3KJ4C 3IKKA 2DLHA 1LP9E 2BERA 1XF1A 2NR6C 4K3EH 4H1LA 4X5WA 1S5IL 1JTOA 1EO8L 3CFKA 3QI9A 3C08H 1IM3A 4U1NB 4CAGA 1KJ2H 3IRZA 5HYSB 1RZ7H 2PTTB 4CADA 1EFXA 1UB6B 5B3JE 4EIZC 4ZOAA 1ZVHA 3EIFA 4MXVF 2IBZX 1E28B 4R4BA 2IGFL 2HJKA 2W0LA 5EUOB 3MCKB 3R06B 4KTYA 1A0QH 2XY1A 4JY6B 3CFJA 4U4BA 5EU7C 2G2RA 1HHIA 1OAXH 4ODVL 3HZVB 5MEOB 1HOCB 3QEGL 1IMHC 1EGJA 3OHXB 5KS9E 1S9XB 3MR9B 3WL9B 3QEHB 1D6EA 2CIIB 1TZIB 3HNSH 3OG6B 3EFFA 4XP9H 2FIRT 4XVTH 1T0MA 2VAJA 3MLTA 1GGYA 3DYPA 5LAXB 1E6OL 3G6AA 5HJ3B 5HYFA 4DN4L 3QDAA 4U1SA 1D9KB 1UXWB 12E8H 5D7JA 2VLME 3RX5A 3QIBC 1IGFH 5DS8B 3V5KB 3KNBA 1I9JH 1QSZA 3BPOC 4X5XA 4P23C 4XBGA 4AJ0A 3O41A 3VXTA 2VABB 5BMFH 1NBYA 4J4PD 4PRID 1T3FA 5BV7H 2R0LL 1TTGA 4HC1L 1O7VA 3ZKSD 4FZ8H 2OL3A 4KROD 3CSYA 1NAKL 1ULVA 5C08E 4O9HH 1SJHA 3L3KB 5CMAA 4PGEA 4ZUSB 3B83A 3LDBB 4MHHG 4C55A 4F7EB 4TVPL 2UWEA 5ICYA 2JB6B 3J7HA 2Z93B 1A21A 4NUGL 3VA2C 5TDPA 1AE6H 1T6WA 4XTRD 4G42B 2DM4A 2L7UA 5IHZB 1RJZB 4YR6A 2AEPH 4Z7WB 1MIML 4D9LH 1NDGA 2Y5EA 4ZUWA 2X9YA 2IBBA 2D3VA 1NC2D 2GK2A 1PZ5B 1ZT1B 4UV7L 3A67L 1X5IA 3O8XC 5GS1C 5EC2A 1Y0LB 4P9HC 5J12C 2IPKA 4CVWA 4S10A 4PGCA 4HK3J 2HWZH 1K5NB 3KXFB 4OTXL 4NC1E 3QDGE 1UQSB 3KPLA 2AKRA 5C0AA 1BD2A 2Z92B 2FBOJ 4XHJD 2RBLA 4ZYKA 3KJ6H 3T2NH 2AJXH 4HAFA 1I1RA 4RFNC 2CQVA 1FL6A 2BVQA 3QEQD 3VXME 5A2KH 4X4MA 4Z77B 4NT6A 4HIJB 5T33L 4MNQA 5EZLA 5CP7B 1N6UA 1ZGLM 1YDPA 3FT4B 5FEBA 4J1UB 3SCMB 2G5RA 1FC1A 1GAFL 1LMKA 2IAMD 4S1RH 2D7MA 4LFHD 2F54A 1RZFL 4HQQH 1A6VH 4K7FB 3RWIB 3RL1B 3X13A 1G6RB 4OCXL 4OSUL 1A6UH 5JHDE 4ZPTB 4I18A 1HSAB 1LNUA 4L29A 1WZ1H 4HS3B 4I3SH 4YFLI 4LSVL 1DSFL 4NUJA 2F5AL 5E1AB 2V17L 5D2NB 4JG0H 4BSWA 3C5ZA 4NO2B 4GG6B 1OARL 4M43H 1J0YA 4UT9L 1ZLVH 4JM4L 4IDLA 4NGHH 3O3BB 2F53D 4GRWB 3MACL 4F7MB 2X4PB 2BNQE 1OAKH 2APWA 5D93C 5HGDB 1S9VA 1DQJA 3G04B 2Y25A 3VJ6B 4RCAA 2EDRA 5KZCB 4ONHA 5K9QI 3FL7A 3QYCA 1B6UA 3CX5K 5D5MF 1NFDB 1ADQA 5DJ8B 4HUNB 3ZE2E 4XNZB 2PTVA 1ZHLA 4NQUA 2ADJA 5FGCE 2M2DA 1OM3H 5HSFA 3L6FB 5FECA 3S35X 5D1QD 5BO1L 4ONFL 3DX6B 4WUUB 2VKXA 3QIUB 5E70A 2GK0B 2P7TB 3DTXA 5F1IB 4L8SB 5C07E 3AB0B 1H8OA 5SWSB 4XC3H 4HS8H 1FRGL 1A7OH 5HGBB 5FKPA 3WKMH 5IVXB 3NFNB 4EDXA 4KUCD 2XRAH 1ZSDA 3KGRA 1TTUA 3SDCA 2DWDA 2X4TB 1MF2L 3HS0B 1SJXA 4EJ1C 4RWYL 4H25B 4U6HB 5C0CB 3TT1H 3S34H 1CZ8H 5J1TC 4DKDC 2ZSVA 3EGSA 4LCWE 5E4EB 4KMTL 3ZYZA 3HUJB 3MRKB 4TSAH 1BJ1H 5DYOB 1TQBB 4CBPA 1JWSA 5TE4H 2D7OA 2VDRH 4F9PC 1WLHA 1N5YL 3RGVB 1JNJA 3TO2B 5B38B 3IJSA 5CZVH 1BBDH 1C16B 4NJAH 5EN2A 3IKCA 2FWOA 2JTDA 2UZIL 5IF0A 4RBPK 5FKAA 3VH8A 4YPGA 2X4SA 4JM2B 4S1DD 2C7UA 3ZZ1A 3DUUB 3FB5A 1PSKL 4U3CA 5D7IB 4Q9RH 1MFEH 3GI8L 3FFCE 1REIA 1IAOB 2BSED 1EXUA 1BQSA 4JFED 3MO1B 1OAZL 1BJ1J 2AI0L 4Q0XH 3ZDXE 1MSPA 3DURA 1DCLA 4RX4D 4I3RL 4NRXB 4PJAA 4UIMA 4U1LB 2I24N 1TENA 1C12A 2VDNL 4Y4FB 1RMFH 4ZAKB 1KCRL 4RGNE 4DVRH 2WK2A 1FNSL 1TFHA 1A9BA 2XA8L 3H7BA 4JDZB 3SDAA 5MENB 3BKJL 5D8JL 4XPAH 4YDJA 4LASH 1U41A 2XT1B 4KK9D 3IFLH 1MEXL 1MRFH 3IT8D 2XA3A 5I6XC 2ZOLB 3IETA 1T1WB 5LKNA 2IC2A 3O4LD 4I8DA 4L8BB 5FA3A 5CSBA 3MLVL 4UT7H 1H3UA 1RJYB 1NGYB 4MVBC 3WFBH 3FO9A 8CGTA 4WO4B 1A9EB 2IMNA 2YMXL 5IFJA 3O9WA 4OFYA 5BZDB 4X9FA 1TZGL 1TIUA 2OCFD 5JOEA 4QXGH 5H8DA 4U0QB 1DBJH 4HGWB 4Z7UF 1CXFA 2X1XR 3O0RH 4RZCA 3WIFA 2IEPA 1X7QA 5DT1H 3VD7A 3D3VA 4HF5H 5KSBA 1JE6A 1FNLA 2UY7A 2HH0H 1MJ7L 1ORQA 1V8HA 3P30H 1P6AB 5E5MB 2VDPL 3QPQC 1A1NA 5CJOH 4ZG1A 5GGSY 1DQTA 5HI4C 3RUGF 3FZUC 3SE4C 4NRYB 4X6EB 1K8DB 3UYRH 5IB2A 1HI6B 5DMYA 2BNUB 3MA9H 3B3IB 3B5GA 3NACH 4FQ2H 1T83C 3I6KA 3B9DA 2DI7A 1FZJA 5J13B 5CHNB 3EYUH 1OSPL 3DMMB 3VXRE 4M6NL 5EOTB 2YRPA 5F1KC 1QSFD 2YUZA 1QHPA 4NQVB 3ZYJA 5DUMH 2KH2B 1QHOA 4WJ5A 3EJZD 2PW1A 2X89A 4JZOB 5LG1A 1XGPA 5GJSH 1DQDL 1HDMB 1GZQB 2G75B 1KB5H 1BFOB 2DTMH 3HZYB 1BQLL 4HIEB 3G6DH 3N1MC 4MB3A 4O02L 2A6DA 1KTLB 2Z35B 1B0GA 1N6QL 4YHIA 5DFVC 2ICCA 2FO1A 2B1HH 2ZJSL 3K80A 4HPYH 4OGXH 5HBBA 3I02A 1UADC 3PWLA 5F1NA 1K4CB 3MA7B 2YXMA 3VFGL 4OUUB 3I2CL 3QA3B 1DVFA 3BJ91 2ARJB 3K4DA 2R2EB 3HLAB 4XPBH 4G7VH 4J3OC 5HVFB 5HYEA 4OZHB 4S0SD 1FYHB 4EEEA 5I0DA 4PREB 4JFHD 1YN6A 4HEME 1CICC 2Z4QB 3MV7E 2P5EA 4FRWA 5LJYH 5ANMA 1RUML 3THML 1T20B 5C8JA 3KLDA 1U8QA 5DRXB 1ZHNB 1AIFA 1DLHA 4PJHA 3TA3B 4PJBF 4X9IA 3OR7A 1S5IH 2GSGA 2QQQA 4KKNA 2MHAB 1EO8H 4LLQA 3HPLB 1MCIA 3W0WE 1WWAX 5GRVK 4FTVD 5HGAB 4HWBL 5IV2A 4NQSA 4G9FE 4MWFA 3G5ZB 4N90D 2PXYD 5LQBL 5IBLC 1OL0A 1MI5D 2IGFH 5B8CB 1JZ3A 3PQYA 1I9IL 4O51A 2EYRB 1TJHL 2ID5A 3RWCB 4WWKB 1IM9A 1JNHA 4JRYD 4M4PA 4AIOA 3RHWF 1CCZA 4Y5YA 1XCTA 2HJLB 2W59A 2D9CA 3OKOA 4ODVH 3SHSA 3D69A 4QXTB 5TDNA 3QEGH 2E8ZA 4NNYA 1TXKA 2OP4L 3F5WB 1KF9B 5C09A 4JFZL 4GAYA 4JLRA 5EDXA 5DHVA 1CD1A 3PHQA 1MFBH 1Q9OA 4R0LA 2XACC 3BWUC 3GIVA 4Z0BL 4CN1A 3T1FB 1E6OH 1WFNA 4DN4H 4R90L 2C3GA 4LVHC 2HFTA 3CPLB 4HDIB 5T1KD 5J6HB 1QBML 4APQD 4UT6L 3O6FC 5FYLL 1K3ZA 3A6CL 3AREC 1X4ZA 4KQ4L 3CCHB 4OLEA 4WTWA 4X6FB 1UM4L 4F15B 4LL9A 4Y19A 5HHMD 1XF2B 2AJ3A 1N64L 4Y5VB 2R0LH 4LCCC 3G5YA 3RDTD 3C8KA 4HC1H 4WW2A 3UTSE 2VNCA 2VLJD 1NAKH 3K0WA 1B9ZA 2NY5L 3CC5B 3L3IB 3PGFL 5J3HD 2AV7B 2G5BB 4XMPL 4RQQB 4HUXA 1ED3B 4HEPG 2W60A 4JHZA 2A9ML 3B4NA 1RURL 3FT2B 4TVPH 5FM5M 3LPGA 4V1DE 1ZA6A 1T7YA 4QF1A 3UC0L 2E7CA 5C6PB 3DRQA 1QSED 2WMPA 4PLJD 1MIMH 5D70L 1HHJB 3FO1B 3MLWL 2NZ9D 3VMPA 3ILPB 1K6QL 1EAJA 4TNWF 4UV7H 3GSRB 5IEHA 3A67H 4Q6IA 3MLSL 2UYLA 5DFWH 3RVUC 1IC7L 2XWTB 1ACZA 2ATPB 3IXTA 1OSZA 4M7JL 3SY0B 1OAUL 4OTXH 2CO6B 3V6BR 3SKOA 1FPTL 5IHUL 1YEHH 4OFKA 1EX0A 2XWBB 1AP2A 3DVNB 3BQUD 1FVCB 4U7MA 4BQBA 2Y23A 5HYJB 3BX7C 3SBWC 5EU4A 2NY1B 3GJFK 1IVLA 2BVYA 4WW1A 2PYED 2VWEE 3MLPA 3MUZ1 2HN7B 5T33H 3TNMA 1VFBA 3WLWC 1FVEB 3STLB 3O45A 5B3JF 5BQ7B 3WHE0 4L9LC 3N1QC 1GAFH 2UZYB 5AEAA 3VFPA 1RZFH 4HMCA 5FDWA 2JIXB 5EO0A 2C3WA 4OSUH 3OX8A 2VDML 3SJVD 1ZAGA 1WVZA 5F1SA 1ODAA 1R3JA 4F8QA 1MCWW 4YHLL 4PRAA 1RUQH 4J3TA 4RAVB 4LSVH 1DSFH 2F5AH 2JJSC 2V17H 4MLIA 5K9JL 5KS9F 4G8GA 5GGVY 4JG1L 4X9GA 3AU1B 3U36A 3T0EC 1JPTL 3HE6B 4MJ5A 4UMGA 1OARH 3HMXL 1CLOL 4ZNEA 3B9AA 3PDOA 1JRHL 1IGCL 1NUFA 4UT9H 4JM4H 3O3EA 1TCMA 2VERN 3G5XA 3NN8A 1NQBA 1Z6JT 3MACH 4Z7VE 5FCSH 1SY6L 3T1WA 4L4VD 4GRLA 3UTZA 5AYQA 4YAQA 3D39A 1I1AA 3FB7B 3SN6N 3HCVB 1II4E 1FE8L 4LSUL 2YBRA 4JPIA 4PJGE 3GB7A 2O5XL 3DV4B 3DIFB 1HNFA 5GGUA 1AGFB 5C0DA 4OIIL 4HS6A 1D6VL 1KELL 4HC1A 2P49B 2Y9RT 1O0VA 5B22A 2Q6WA 3PE9A 3ZTNL 3FN0L 5I15L 2V9RA 1P4BL 3MRQB 4ONFH 3PWJA 1PGRB 5F9OL 3U0PB 3KJ4B 3AY4C 3UAJC 2EDXA 2KPNA 3EOBA 3E6FB 4MQTB 4PGDA 2F5BL 2DQIL 5IMLA 1QKZL 1ETZB 2EIZB 5FYJE 5TGBA 4AEEA 5EFIA 4ENED 3FFDA 4MCZB 1FRGH 5JPMB 2E7LA 3VFMB 2ZUTA 4FP8L 3WE6B 1F6FB 4UV4L 3RWJA 4OKDA 1G7HA 1I8IA 4X5WB 1T2XA 2XTJE 2X5PA 3RWDA 1A6TA 1MF2H 1YMMD 3QI9B 5CZXC 1IM3B 2X41A 4RWYH 1AGDB 5IIEA 3ES6B 3PV6B 4HH9A 4CADB 1J8HA 4MNHB 4KMTH 4NIKB 3S37L 1OTSD 1ORSB 4O2CA 4NDMA 4JQXA 5T5FL 3N1PC 5C0NC 2XN9B 3F12A 4I0PD 1N5YH 3CFJB 1A2YA 4DW2L 2G2RB 1HHIB 4NQEE 4K3DL 4NYLA 4O2FB 1WEJL 4UOW0 5D5MA 3W9DA 2ZNWA 2UZIH 4CJ1A 4MYWB 4CDHA 3UTOA 4F8TA 4X8XA 2A9NL 3DRTA 2O5YL 3TGXA 4EQ3A 3QIBB 5C2BL 2VZSA 4X7CC 3VXUA 5JLZB 4KK5D 4XCNA 4HFUL 1PSKH 1D6EB 3QUZD 4P2YA 4P23B 3GI8H 5F7KC 3TZVD 1C8PA 4U1GB 3H3PH 1T0MB 1PEZA 1OAZH 1YNKL 3KPQA 4M1CD 2R0WL 3V9FA 2AI0H 3Q3GA 2WIMA 5DLML 4U1SB 1WC7A 1RUAL 1S7UB 1G84A 1NBVL 3V6ZB 1GJIA 2RJMA 2IANA 2BK8A 4I3RH 2IQAA 3W39B 4P3DA 1QFPA 1UA6L 4R8WL 4QY8A 2VDNH 3KNBB 4ZFZA 1HN1A 4X5XB 1KCRH 3O41B 3OGCB 2PYFA 1UWGL 1FNSH 2XA8H 1CDJA 5BRZB 2J4WL 3BKJH 5D8JH 1FNHA 3EOAB 3HE7A 3FQNB 1LK2B 1MEXH 2UUDK 3CSYB 2AV1B 1U3HA 4OLUL 4UQ2A 5FA4B 2BVPA 3UTPD 5KVGL 3ZE2F 1CGWA 3EAKA 3MLVH 3LZFL 1FNEB 1HQ4A 2NY4B 2ED8A 5I1KL 2DYPA 2YMXH 4BKLA 3C60C 4YR6B 3EYVA 4P2RD 3QO0A 1TZGH 1I7UA 1VESA 3A6OA 4XX1E 5DQJA 1OW0C 3QEUB 4IOIB 1PG7L 2ZNXA 3OKNB 1TJIL 3ALWA 2ZUQB 4P5TA 4LVOC 1FL3A 1MJ7H 4LLDA 2R69H 2VDPH 2HT3C 3ARFB 4PRPD 1S3KL 2FEDC 5E6IC 4QO1A 1EJOL 3HZKA 4PD4K 5C0AB 1TVHA 3CLFL 5ECJE 4P2OC 3QDJD 5J1AA 1JYNA 3ZKQD 3IU3A 1N8ZA 2BSTA 4Z6AT 4FABL 4CVUA 1FZKA 4DKFL 4RBPH 5T1LA 3MRHA 1OSPH 4NT6B 2CKBL 2B39A 4M6NH 3MV8A 1R5VA 1I3VA 2Y72A 1KPUA 5DGQA 4MNQB 1BBJA 4X0KB 5DHXB 4KJQD 4FNLL 1YDPB 3EUUA 4YBQC 1DQDH 1KJVB 4TTGA 1BQLH 2P48B 3P40A 4PV9A 4O02H 1PDKA 3QUKA 5IUSA 2AK4E 1N6QH 3RY4A 3DJ9A 3V4PL 2ZJSH 1LNUB 1VKXA 3SGKC 4NUJB 5DA0B 4PBVC 5FAAA 4MA3A 4UU9A 1X5XA 2ESVA 3VFGH 5D93B 2EE6A 3I2CH 4Y16C 5ACZA 4BSWB 1IFHL 5DURB 3U4AA 3C5ZB 3IJHB 3QUYA 1CDHA 3WIIL 2ED7A 1B0WA 3S4SG 5BS0E 4PJ8C 4Z7UA 2VN4A 1RUMH 4Q9BA 2RHEA 3THMH 4D94A 3MRMA 1RSFA 1BAFL 3FTGA 1S9VB 1DQJB 2FEEI 1NKRA 1R3KB 5D6CA 1AO7A 3RUGA 2EDKA 1EHAA 4MX7A 3V8CA 3CVHB 4RMWA 3BAEL 2PW2B 4KI5D 4ONHB 2HFEB 2AXHA 3Q6GL 4WFED 4PJFF 3BRDA 4HWBH 1ZHLB 2PTUA 2ADJB 2KQMA 5LQBH 3NABL 5FECB 4ISVA 3QUMB 5IBUB 1I9IH 1H0DA 4X99A 4ZXBC 1TJHH 2BY1A 4JFPA 2QADD 1QLRA 5D7SL 3DTXB 1T1YA 4YDLB 1M71A 3DROA 4NO0A 3IDNB 4LLVA 3QULA 2WBJA 2QV2A 2OP4H 1MVUA 3BN3B 4NNXB 1BIIB 4MZ2A 5I8CA 4JFZH 1JWUB 3IRPX 2V2WB 2OMNA 1ZSDB 3EZJB 3MV11 1NLDL 4I2XA 5ESAA 3RZCA 5E9DD 7CGTA 4Z0BH 2VXSL 6FABL 4R90H 2NX5B 1MRDL 2XI9A 5A2FA 2ZSVB 3VRLF 3EGSB 3BPCB 4O2EB 1QBMH 4UT6H 2NW3A 5FYLH 4OIAA 1SVZA 3IDXL 3GMPB 4IOFD 4Q2ZA 3A6CH 5D1XD 3TBSB 4LDLB 2OX5A 4MAUL 4KQ4H 5HDQL 5IWLC 1UM4H 1JWSB 1T21B 1N64H 2Z31B 2YPLA 4M6OL 5D7LB 1FFNA 2NY3C 5EN2B 2NY5H 1HHGA 3IKCB 4HFWA 2FWOB 1D9KD 3PGFH 4XMPH 4UNVA 1I1FA 2E7HA 2H6PA 4PJIA 4XWOC 4YPGB 4HV8A 2X4SB 2A9MH 1RURH 1AHWB 3BUYA 2H2PC 2YWZA 3UC0H 1IGML 5EC1A 3TVMD 3NTCL 4H8WC 2V7NA 1IGJB 4DN3L 5D70H 5DEFA 3DETC 3MLWH 1ROWA 1MHPL 1K6QH 2CLRA 2MOVA 5E56A 3LIZL 1TNMA 3MLSH 3MUGB 4YHPA 2EH7L 5F6IC 1IC7H 4PJAB 4IRJC 4UIMB 3RRQA 1IAKB 3VWJC 3REVA 1S8DB 4M7JH 1C12B 1OAUH 2FIKB 1FPTH 1H5BC 5IHUH 1VPOL 4NN6C 3WNPA 5I1IL 1A9BB 1T22B 3H7BB 5DGRA 3G9VA 3SDAB 4JRXD 5DJ2A 4YDJB 3OBAA 4R6UA 2CJUL 5HI5D 3IETB 1L7TL 3KPSA 4A6YA 5FA3B 2OS7A 5D2NE 1I7TA 2ZUUA 4NOFA 3B2UD 1QQDA 3R0MA 1MCQA 3KXFD 4JGUA 5IFJB 3FO2B 1RY7B 2X70B 3VG9C 4HZLA 2R0ZL 3QWOA 4GRWE 3VFRB 4UBDC 2VDMH 1IJ9A 4RZCB 3WIFB 4YHLH 2CRYA 5T3XE 2HT2C 2ZCKL 4M3KB 3X14A 1S78D 2YRZA 4Y5XC 5DHYA 2C1OA 5K9JH 1A1NB 3CFEB 2EYSA 2CDGA 3PP3K 1JPTH 3HMXH 4KWUA 1CLOH 3QFDA 1JRHH 4NZJA 1IGCH 3RVWD 1P5VA 4XNYL 3K8KA 3KPRA 5E8NB 4P5KA 1EERB 4K23L 4N0UE 4QRUA 1UENA 4WUUE 2C3HA 1IL1A 3Q48A 5MERA 4GRMA 1FE8H 5ISZA 4LSUH 3WS3B 2PW1B 3P73A 5FIEA 2ICWA 2O5XH 2IPUG 1F6LL 4ETYA 2ZUSA 5SWSE 2A6DB 4XWGL 1T4KA 3ARDD 4OIIH 1D6VH 4QEGA 1W0WA 2MSPA 4S1SL 2GJZA 3RGHA 3GKZA 5IVXE 1Z0MA 3RIAF 4X4XA 5FOBB 3I02B 3TO4D 3ZTNH 3FN0H 5I15H 5F88A 4ELKA 1P4BH 4E41D 2FX9L 4AYFA 1FSKB 2E6QA 5F9OH 4PV8A 2DLFL 3BP4A 3QHZL 3ARYA 2ERJC 1Q1JL 3G5VA 2F5BH 2DQIH 1TVBA 4RA0C 1QKZH 1RAMA 3KPTA 5LXGL 2AABL 1YN6B 3U9PL 4PRHB 4X4YA 4WEMB 4YJZL 5CBEB 5CJQL 5D7JC 5ANMB 3TIDB 5I1DB 3HUJE 1S7WA 1CGSL 4FP8H 1G9MC 1AIFB 4J4PC 5KS9A 2CRMA 1XH3B 3QIUD 3S5LG 1DTUA 1OAYL 5ID1B 1H3PL 3FOLA 3T8XA 1G7JB 2YEZA 1F90L 2IFGA 1FORL 4HKXB 2WP3T 3S96A 1I7ZA 4KKLC 4PP2A 1VFAB 4HULB 1UZ8A 3S37H 5TF0A 1D5IH 4HD9A 5B3NA 5D7IE 3CFCL 3GUTA 1LE5B 1UYWL 1RVFL 1CU4L 5D2LB 4P2QA 5T5FH 4OCYL 5GS0L 4Y8AA 2YD1A 2DQCL 4DW2H 5JHLL 4K3DH 4Y5YB 3F7VA 1XCTB 1WEJH 4KKCC 4R4ND 2DS4A 2A9NH 2D2OA 2O5YH 4N5ED 5AD0A 5C2BH 3BZ4A 1JWMA 4H0IA 3W5NA 2YD7A 5DZLA 4HFUH 5C08D 1KJMA 4GAYB 3C6LA 4XHJC 3DGCR 4G8FB 4AQ1B 3HG1B 5MENE 2IAMA 1CD1B 2VXTL 3PHQB 4C4KO 1B90A 5FYJL 1YNKH 1FJ1A 2ICES 3RGVD 5HHVL 3KYMB 2R0WH 1UGNA 4UQ3A 1RUAH 2A73B 4FHBD 1NBVH 3GBLA 1FLTX 1KXVC 2W0KA 1B0RA 1UA6H 4R8WH 2CLZA 3ARGD 1GC1H 5I8EA 1UWGH 2R2HB 4Y19B 3MJ7B 4GXUN 2AJ3B 3N1GC 1CK0L 2J4WH 3G5YB 3C8KB 3WLBB 2D0HA 4Z78A 4JFFE 4WW2B 3VGGA 3OKKA 2F53A 3FQUB 2E9IA 3MOQA 3D48R 3CXDL 4I18C 4OLUH 4OZGE 1KN2L 3EYQD 1MJJB 4C54A 5KVGH 3VXMA 4FXLA 5I66B 2ADGA 4NHCL 2W60B 1NPUA 3LZFH 3W9EA 4QRRE 2R1YB 2APXA 2BSSB 2LAGB 1KPRB 5I1KH 4ZS7L 1S9WB 1ZA6B 3P0YL 3NPZB 4QF1B 4WHTA 2P1YA 3VD3A 1F4YL 5IMKA 2JCCE 3UEZA 2GFBB 4QHMA 4HJGA 4JZNA 5IG7B 4WNQB 5DUBA 1PG7H 1TJIH 3GJFA 5IEHB 3SE3C 5GGQL 4NBYB 4OQTL 5D1QA 5IVZB 1S3KH 5EU6B 1Z5LB 5JHDD 3LS4L 3ULVE 4R96A 3BFOA 1PKOA 1EJOH 4QWWD 3C9NB 3B9KA 3N0PB 3CLFH 3H0TA 1P69B 5HI3D 4YBLC 4I9WE 4EDWL 4FABH 1X6LA 3GMNB 5EU4B 3UZQA 4DKFH 3RVTD 5BV7C 5DK0B 1T7ZA 1KEGL 3PWPE 4JR9L 4C58B 4E0RB 2CKBH 4JDVA 3TN0A 4XPFL 4NKIL 4KKAD 2XICA 1GXEA 3TNMB 1H15A 4V2BA 1MCJA 2BNQA 4G8EA 2GI7A 4BYHA 5J56B 4XCEA 4IRSA 3T0EB 4TTDD 2ZKHL 2VQ1B 1QFOA 1S7TB 5FUCC 5FDWB 5EO0B 1CFQA 3OX8B 4OGZA 1T5WB 3PGDB 4OZ4B 3V4PH 2IH3A 1R3JB 4PRAB 1CS6A 1PFCA 5JW4N 1XIWD 5IT2L 4K7PY 1G7MB 2VZUA 1IFHH 4MJ5B 4FOMA 3WIIH 3U79A 3RKPA 1X5AA 3PDOB 3MNWB 3QJHA 3TBWA 1WCQA 1YEJL 3C6SA 3L9RB 3WJJA 1D5MA 2R2CA 1UACL 2EEBA 3UDWC 4JFXA 3G5XB 4JZJA 4EUPA 1D5XA 4RMRA 2EH8L 1ZWIA 3CUPA 5F7UA 5FM4A 1BAFH 3H6JA 3D39B 2GEEA 1XR8B 3CMOL 3WJLA 1FN4B 4NRZA 3MRLA 2AXGA 3LRHA 1S7RA 2YBRB 1H3XA 4JFEA 2OXGA 4OCRL 3GB7B 3BAEH 4LEOB 3FT3A 2DI9A 2K3TA 3GSNA 5GGUB 5C0DB 5T3ZE 1KB9J 3Q6GH 4E5XA 5IOPB 4S1DC 1R24A 5B39B 2K9UA 1F13A 1EDQA 3U83A 2X2YA 3MJ8A 3NABH 3EDDA 4RRPG 1OGAA 4MNGB 3JWDH 4DGIL 2A6IA 3LQAC 3VE0B 3K46A 2OJEA 3QZWG 3AMLA 4PGDB 4POZD 5D7SH 3E0GA 5IMLB 3QG6B 2W0FA 4XNUL 5TGBB 3O3UN 1TLKA 2EO1A 3PWVA 4PY8J 3VRJA 4BFIB 3FFDB 1LE9B 5ESVB 4BH7A 2BP3A 1CFVL 2GKIA 3FRUA 1YQ2A 1NCCL 1NLDH 1JGVH 1CFNB 5HHXL 3ULUD 3PL6A 4KK9C 1A6TB 4N9GA 3CNKA 2VXSH 3RVVC 6FABH 1UWXH 4IIQA 4XH2A 5ICZB 3FFCD 1MRDH 5IIEB 5F89A 5C2UB 4N9OB 4QYOB 2YD2A 5EZIL 5IB3A 1J8HB 4MDIA 3PJSB 4HIIA 5I73C 3IDXH 3BGAA 4NO3A 3DVFA 4MAUH 5JMOC 4O2CB 3MLXL 5HDQH 1MQ8A 2HVJA 4NDMB 2VLLA 4GKNB 2KZWA 4C83B 3F6LA 3H9SD 2DQFA 1KULA 1DBKL 3DYMA 4M6OH 1MAJA 4FS0A 4NYLB 4PJFA 4UB0L 1CE6A 3VRIA 4MAYC 1MCCA 3WDJA 3DRTB 1P7QD 4IRZL 4PFEA 3VXUB 1M4KA 1JVKA 4P48A 4LRIC 1IGMH 1KPVB 3NTCH 1DEEA 3MXWL 4TSCL 4HBQA 3JWOL 3RPIA 3HC3L 4M48L 4MJ6A 2JF1A 2DKUA 1MHPH 3Q3GB 1I1YA 3B43A 4X9HA 1UH2A 5HGHA 3MRBB 3LIZH 5FF6A 2EH7H 4EN3A 3OB0K 1UZ6E 2KUTA 4P3DB 4MA8L 4PLOB 1S7XA 5IM7B 1MWAH 4PRDB 5IJKC 4GXUM 1O7SA 3TFKC 1VPOH 1LHZA 5EUOF 5I1IH 2NY2C 3C60B 3EDKA 3ESUF 2WW8A 4OD3L 3HE7B 1U0QA 3NCYP 5F9AC 2CJUH 3SKMB 2UVEA 1M7IB 1FL5A 4YK4C 3V6OE 4C56E 1MOEA 2J8HA 1L7TH 2BVPB 4JANB 2BNRB 2G9HA 1FFPA 4P9ML 3MJGX 4M61A 2OTWA 2XTLA 5E6IB 1AR2A 4PJDE 3EYVB 3KYAA 3QO0B 1I7UB 4PJ9C 2R0ZH 5DJ0B 5DQJB 4KK6C 5HYJD 5IW6B 2X4UA 2P8PA 3T3PF 4GSDL 4MSWA 5DRNB 2ZCKH 4G43B 2PXYA 4LLDB 2MTPA 5C0BB 2IBZY 4TNVK 3RKDD 5BXFA 3HZKB 4HJ0D 4JRYA 5D9SA 3IFPA 4R7DA 3QIWC 3MJ6A 4XNYH 4MGXA 5T1LB 5EZJA 3MFFB 2OTUA 1RIUL 1KGCE 4K23H 1R5VB 3QFJE 2FL5A 1QFUL 3UO1L 2GYSA 2HT4D 4Y4KC 3HTLX 3VFWB 1G0XA 5IR1B 4ZPVB 2XV6B 4Y16B 5JW5A 3OXRB 1G6RL 1X5FA 5DZOA 4AIZB 1XGQB 2HFFB 4Z7WF 3LKSB 3U30C 1Z2KA 3QNXA 4PV9B 1T1XA 2JE8A 5JDSB 4XWGH 1MREH 5A3IC 3OKYA 1BGXL 4F7TA 4S1SH 1MHEB 5JW4M 1I4FB 3R1GL 5M7QA 3W0WD 1WZKA 3QO1A 1VGKA 2FX9H 4MA3B 4UU9B 4UZGA 3QHZH 5AWNL 2CPCA 5JZ7C 4G9FD 1IGYA 3O3AA 4XBPB 5I1EL 5KN5B 1Q1JH 5DD6A 2RGSA 3WO3B 5LXGH 2AABH 3U9PH 5T5NF 3JTTA 5T3XL 3WUZA 4APQC 1CXIA 5CJQH 5D1ZD 1QOKA 1I8MA 4URTB 1CGSH 1P7KB 4L8DA 3SGEI 4U7SA 3FTGB 2DLGA 2A2QT 1ZLUH 3KLHD 3RDTC 1AO7B 4R9HA 2H9GA 4MX7B 1MWAA 1OAYH 5ENWB 5DD3L 1H3PH 1T7XA 3ETBF 3QUXA 1F90H 1SBBA 1FORH 2CLVA 4NSKB 3EFDL 1HHKA 1L6ZA 2BSRB 4XP5L 3CFCH 3QQ3B 1LO5B 1UYWH 3LS5L 3M8OH 1RVFH 1H0DB 4X99B 1CU4H 4GG6F 1OWWA 3BQUA 4OCYH 5GS0H 4JFPB 4O5LL 3OGOE 2DQCH 1MFNA 5JHLH 1CD0A 1KV3A 2PYEA 3UTSA 4GRWF 2B5IB 4LSTL 2BCKB 3U4BL 3VFVB 3IDIA 5IJVA 4Z7NE 2VZ3A 2V5SA 1UM6L 5I8CB 1O5DT 2JJWA 2PKDA 1B4RA 3E1F1 4IDJL 1RZGB 2VXTH 4ZNCD 1NEZG 5ESAB 4E9LA 4GUPA 5FYJH 3U0TA 2XN9D 5HHVH 3MGAA 5DJDA 1NFDF 3DV6A 3EHBC 1BVLB 3Q5TA 2NY3B 5C0GA 3C5SB 1ZXQA 2UWEE 2NW3B 3BGFB 5JOFA 1E4WL 1Y6MR 4Q2ZB 5IB2B 2NPLX 4OD1L 4TNVF 3WFHB 4G6FB 4MD5B 1T89A 4N8VG 5K59F 5E24E 2NCMA 1CK0H 3VGBA 2YPLB 3WBDA 3RBSA 1FFNB 2RB8A 1HHGB 1HINL 3CXDH 1KN2H 4L4VA 4NZRL 2VXUL 2PUQT 4PJIB 4U1JA 4NHCH 5IVXF 4M7ZB 1BLNB 3C5JA 2GQHA 3KYOB 5C0AE 4ZS7H 1BD2E 3P0YH 2EC8A 2LVCA 1CDGA 4LKCA 4QTHB 1FNGA 1F4YH 5L2KD 1YPZB 1Q0YL 1N59A 2V7NB 3BOVA 5BRZD 3GGWB 3KYKL 4GBXA 4ODUA 3M1BA 3DSNA 3CZJA 1TITA 4U1IA 4P4KC 2WM0A 4YHYC 4IS6B 4ZSOB 4MNQE 1I3GH 2YUVA 5CGYC 4AEIL 4OQTH 3HUJF 2V2TA 3O8XD 3REVB 3H9HA 2CUHA 3LS4H 1J9CT 3QDMD 4F7CA 5CIPH 1IEHA 3I75A 4L4TD 2YWYA 1MAKA 1NBZA 5BZWB 4CVXA 1KLGA 3DI2B 4EDWH 3WD5L 5FM8A 3K2MC 3C87A 1KEGH 4JR9H 3KPPB 4HKZA 1DANU 4G9DB 3KPSB 3X11A 4A6YB 1AGEA 4I3GA 4JM2F 4XPFH 4NKIH 1I7TB 5MI0C 1QEWA 3IVKB 2RFXB 4Y5XB 5GISL 3D9AL 5D7IF 4OCNC 1BFSA 4NN5B 5HDLA 5LGJA 3R8BB 4JKKA 1YMMA 2ZKHH 1M05A 3SDXA 3CXHK 4LDEB 4YHNB 5J11B 3WFDL 4ENEC 1MLCA 4NQCD 2N56A 3T4AA 1AC6A 1JPST 5CILL 1GH7A 3WIHL 1BMGA 2JKXA 3X14B 4KDTC 4OCLC 3LRSA 5IT2H 3ZTJH 4Z7OE 2X05A 3CZFA 3UBXA 5F3HA 2CDGB 4D8PA 2BXYA 3BH9A 4YFDB 5I8KL 1MCKA 1ZHBB 5I71C 3BUTA 3VXSD 1UVQA 1UACH 1ZGLA 4MZ3A 2EH8H 4N8PA 4PGZA 4QRUB 1N0XL 1F8TL 3ULVL 1IL1B 1RHHA 3CMOH 4YHKL 5MERB 4GRMB 3TZVA 4I0PC 7FABL 1XF5A 2ICWB 4IMLA 1JUFB 4OCRH 5GIRB 1NL0L 2ERJB 4FXGA 3WFZA 4PLNC 1P5UA 3MUY1 1T80A 2XY2A 1WFOA 3UPAA 5EWIL 1W0WB 2XTJD 3TNNA 1J8KA 4LHUA 1DUZB 4R7NB 3P77A 2DQJL 5E00A 3QUZC 2FECI 5F88B 4ELKB 1WBYB 4GMSL 2GAZB 4DGIH 2DKMA 4W68A 4PV8B 4XGZB 4HKJA 4PRIB 3BP4B 2GY5A 3JV5A 4M1CC 4XNQA 3G5VB 2VJXA 4R2GD 3CFDA 2VITB 1TVBB 2CUMA 1E27B 4KROB 4XNUH 4MCYB 4Y1AD 3BE1L 2IJ0C 4WHCA 4NZDA 2DB8A 3P3YA 1SEQL 5LGHL 5FB8B 3QAZC 4NKOA 1CFVH 3IJYB 3ARRA 4QGTA