1KENL

Influenza virus hemagglutinin complexed with an antibody that prevents the hemagglutinin low ph fusogenic transition
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
213
structure length
213
Chain Sequence
QIVLTQSPAIMSASPGEKVTLTCSASSTITSSFLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSLEAEDGASYFCHQWETFPRTFGGGTKLEIKRADAAPTVSIFPPSKIQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords hemagglutinin HA1
publication title An Antibody that Prevents the Hemagglutinin Low pH Fusogenic Transition
pubmed doi rcsb
total genus 32
structure length 213
sequence length 213
chains with identical sequence U
ec nomenclature
pdb deposition date 2001-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kenL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kenL01
4I77L 5CEXB 5GS0L 3VD3A 2CRYA 1XGRA 4J3SA 4PJBF 4ZFZA 2V5TA 4M03A 3B5GA 4PJEB 3CFJB 5F8QC 1KCUL 4G6AC 2J12B 4OGAC 5J9PB 4GO6B 4MVBD 3HZVA 4I48A 1BQLL 1P7QB 3KYOB 2YBRB 3BKCL 2HTKD 5E1AA 2H1PL 4LQ1A 1RUKL 4LLWB 3E0GA 4C57C 1GC1H 3CVHL 3P9MA 3FQNA 3QJHB 3DX8B 4ZS6C 4ELMA 2X1WL 3CFKB 1CFVH 3MLUL 1MJ7H 4LVEA 1J1OL 2CJUH 2P44B 4LOUC 3B9KC 3BPLB 1MUJA 3IETA 4O2CA 4XNXL 3HFMH 2XPGB 1A14L 4V1DD 2BY1A 3CC5B 4GAFB 5DK3A 2QQQA 3M07A 4JG1L 4KKBD 4TRPL 5E4EB 4NO5B 4MA3B 4W70A 5HYJA 1U8QA 3GSNA 2KZWA 1CICD 4WFFE 2AEPL 4E5XA 4YWGH 2CKNA 4U2YA 2DI7A 2DM7A 1OF2A 2ZOKB 3I2CH 3DVNA 2FO4A 4PJ7E 5C0DB 1RVFL 1CDBA 5ISZD 32C2B 2FX9H 3FRUA 1C7TA 2P45B 1B6UA 4IS6B 4LARH 1D6EA 1P9MA 4G6AD 2J3SA 1T5XB 4OGAD 4JRYD 1P5UA 2J8UF 5EDXA 1A22B 3VXPA 2PN5A 3J8F7 1S7RB 4Y16C 3MSPA 5DSCA 5KW9L 4ZS6D 2L4OA 2FBJH 4OFVA 4U1HA 2ZG2A 1OW0A 5T1LD 4M7JH 1H3GA 2HJLA 4LOUD 3B9KD 4Y5VC 5HTSA 1CL7L 4L4VB 4GMSL 5DS8B 1OAUH 1NDGA 5C0AB 2JB6A 4RAUA 3JWDC 5E8OA 4OSUH 1D3CA 3MNZB 2E7LC 4XI5D 4W81A 5IHBA 4NPYA 1EGJA 2XOTA 2FX7L 1RZ8A 4OI9A 5FYKD 5A2FA 4CW1B 1IGIL 3N1MC 4AEHL 1VKXA 3LQAH 1BIIB 2A6KA 1BLNA 3TPKA 5K93A 1MAML 3OXSB 1NAKL 4H8WC 1YPZB 4V1DE 2DWEB 1N6QL 1S7QB 4WHTB 1DBJL 5EA0L 2RCSH 2F58H 3SY0A 2NX5D 4BH7A 5LJYH 3U7WL 1FL3B 1MELA 3BKJH 4K7FB 3NCFB 4Y16D 4Y89A 4KK6C 3RWCB 1QYGL 4P2QD 5I15L 3EOAA 1D5MB 3AS2A 1MPAH 2BK8A 4MCYA 3SDCC 4QT5B 5IM7A 3FRPA 4NP4H 4WO4B 4ZUSA 5ISZE 3RNQA 2HN7A 4X5LA 4PJBA 5HY9A 1QFUH 2FZ3B 3BJ91 4FQXB 4F9PA 3MLZH 4CVZB 2PKDA 2H45A 3BP4B 3L5IA 3QA3B 1CDHA 4YPJA 1H8NA 1S9VA 1IL1A 4N1CA 4W4OC 4F8TA 1MLCA 1QSFB 4EKXA 4TVPD 2VERN 4IMLB 4UNUA 2H41A 1FAIL 1I7UB 2YWZA 1KB5A 1UM4L 1AIFB 3SQOH 4UBDC 1T0MA 1XZ0A 4OLEA 1H3PH 3QIBD 2ZKHH 1H3XA 4NQEA 5I19H 4D0CA 5JW4R 2Q3AA 3SOBL 5CP3H 3ZT5A 1JTTA 4D2NA 4JREB 3INUH 1MCPL 2YPVL 2OM5A 1L6XA 5K9KA 5D7IE 2DIJA 1O0VA 4QRPB 5JXEA 2CO6B 4KK6D 4HQQL 5EOTB 4NDMB 5EU3B 1CXKA 5FYKE 5D7LB 3SDCD 2A83A 1IGMH 2R2BA 3MZTA 4XNZC 3VA2C 2F19L 3OG4B 2IG2H 1MH5B 1FH5H 4GSDH 3JV4A 5HGAB 4GRWB 2P7TB 2NX5E 5D71H 2B5IB 3WEXA 3EDJA 4AMKH 4RWYH 3OZ9H 5DJ6A 4KKNA 5J12C 2QEJA 2A2QT 2IBBA 4P2QE 5GISL 3C9NB 2F53D 4UIMB 3P4NA 2F5AL 5IK3B 1ZHKA 5DHVH 3MFFA 3MJ8A 1FPTH 5ALBH 1LEGB 4PIRF 4U6HB 2KDGA 2ED7A 5C71A 1JPFB 4OCRH 4IIQB 3T77A 1GHFL 3BPOC 1U3YA 4UQ3B 3QUKB 1P4BH 1ZV5A 3HNVL 4FN0A 1ACYL 1IQDB 3MLXL 1QRNB 2W07A 1UB5A 4JPIB 3M45A 3GJFK 2CIIA 4XCFL 2VJXA 4ZSOE 2VDOL 5F7DB 4RISH 5DVLA 4MB4A 1JF6A 1EH9A 2R1YB 4ODSH 3TH3T 4HPOH 1KEGH 1EBAA 2AGJH 4GRLC 1IGTB 3LEVL 5JOPD 1MCSA 5T3XH 3WKMH 2UUDK 3SE9L 3BPCB 1X3DA 4I3SL 4MNQA 4QYOA 4Z78A 1MHPL 2AQ2A 2YWYA 2G60L 4M6OH 2W59A 1AXSA 6FABL 1MCOL 5FA3B 5H37H 3GSQB 4QRUB 5CWSA 3TVMB 1IGFH 1AR2A 3JWNC 5A16B 3R0NA 4NGHL 4OF7A 4O2FB 1TITA 25C8L 3OB0H 4YDIL 5KN5B 3QUMB 4D9QD 4OLUH 2NY6C 5MENE 1JYXA 5JW3L 4HXAH 5FHBH 2VC2L 3BH9B 3P4MB 5DWUH 4ONHB 5CCKH 2F53E 1PKQB 3NCCB 3L6FA 5D1XA 3OR7B 2ZNXA 3DX9A 1GZPB 4LLDB 3NA4A 3MRPA 2NY2C 3P73A 4NO3A 2VDKL 1S8DB 4ZUWA 4LRIC 1IC7L 2AXGB 2EDOA 3AS3A 3KYAA 4JPWL 2UWEB 5F1IB 1DANU 3C6SB 2BMKA 4PGEB 3WLBA 5ESVA 4HLJA 3N9GL 4Y5YB 3BI9X 2V5RA 4GMTL 1NKOA 2D9CA 3ROOB 4X9GA 1RURH 5C86A 4WFHD 3QXDA 4I13B 3MODL 4R2GD 3B8SA 1I1AD 5B8CC 3VXUB 5CUSH 5EOQL 5DGRA 3QWOB 5D5MF 4R4FH 5HYIA 4K9EH 4JFZL 3KYKL 2Q87A 3KJ4B 2BSSA 1T1YA 2NY6D 3BHBA 4NN7B 5CFHA 1S9YB 5JOPE 1TTUA 3T4AA 3VFSA 1KXQE 2D31A 3H9HB 3QEQE 2HFEB 4QXGH 1CLZH 4UDTB 4L5FH 3S7GA 3QIUA 3LV3A 4UMGA 4U1SB 3VGDA 1XF3B 1BMGA 2BVTA 2NY2D 3QIWA 3P0VL 5ALCH 1DQDH 1CD1B 1I85C 2P8PA 4ALAH 5MI0B 2WSKA 4XAWL 1KJVB 1XCTA 4S2SB 5F1KC 4J7RA 1ZE3C 1XF4B 3GKWL 5IB4B 2H2PD 2VXQL 2NY0D 2P46B 1DBBH 1JPST 1FORL 1T5WA 3I02B 1G1YA 4XPGH 2L0DA 2QJDA 1VFAA 3CK0H 2Y7QB 2CLVB 4U1KB 1HXYB 1N26A 3ULVC 2WM0A 5EORH 5DJAB 4QXUL 4HGKC 3RNKB 1QLRB 1YEEL 3QBTB 2FSEB 3C5SB 2Q7NA 1FNAA 4LLYA 5KVGH 4YHKH 5IIEA 5BVJB 1FZJA 3EOTH 3EO9H 3MREB 3QI9C 1AH1A 4FNLL 5K59F 1VACB 1F4XL 4XAKD 1JWSA 1W72B 3EDEA 4MAYA 1CDCA 4UV7L 3C2AL 3KPSE 5AYQA 2X4TA 4JFOA 2VQ1B 2HVJB 4J3OC 4N9GB 3SE8H 3E6HA 3C87A 2VZUA 4O2EA 2OTWA 3ARFC 4L29B 4LNVA 4MXWL 4U49A 5E6IA 3ZDXF 1I7TA 4O51B 2X09A 2EKSA 2IANE 4GS7B 1ADQL 4X4XA 1JZ3A 3NMEA 1HWGB 3ULVD 4LKCA 3T3PF 5C0GB 2ITDB 3QUYB 1KIRB 4O5LH 1S7VB 5JOEA 4PRBB 3KPNB 1EV2E 1WZ1H 4X0KB 3D18B 3IS1X 5E70A 3NVQA 4HIXH 2UZXB 4HKBB 1KG0A 4RDQG 3DSFL 1A7OH 3D0LA 1A6UL 1MIMH 1MREL 4BZYA 3MXWH 3MV8A 5E2JA 3WNOA 3WDHA 3MMEA 4OD3H 5ACLA 4GW5A 4J1UA 4ZPVA 4HWBL 3H3PL 3MO1B 1MCDA 3UJJL 3L3KB 4KRNA 1WAAA 3RU8H 1J1XH 3JTTB 3HUJE 3BPNB 2C3VA 1PFCA 2RIKA 3VFRA 1I7ZB 4LDOB 3B9DA 4G80A 1G7PB 5I8CB 2MQCA 4K94C 4QXTA 5SV4A 1MJJB 3TYGL 1CI5A 1ZHNA 2VZ1A 3ARFD 4KHXH 4FTVD 4FQHB 3S6CA 4X4MA 3CDYA 4E0RA 3IDJB 3S9DB 3QWRA 3H3BC 3FFDB 4XAKE 4JKPH 3S36X 2BFVL 4TUJA 1SEQH 1BGXL 1HHIA 2ARJQ 5FIEA 3MYJA 4NQSA 4K8RH 4PJ5A 5C9JB 1UZ8B 3QNXA 3G08A 4LCCB 2AK4B 1G6RH 4PRAA 5DZNA 3C5ZC 5DR5L 3SDDA 3WL9B 4PJCF 3RGVB 1KC5H 3LPWA 4Y4HA 4QXWA 4JG0L 3O6FC 3ULVE 3VFTB 4B53A 4CDGC 4RZCA 3MRRB 1IGYB 2DN7A 2X1XR 1UKSA 4NT6B 5IW6B 2FWOB 3LSOB 2PTUA 2C3HA 1L4IA 2IAMA 5F7KC 2Q8BH 4L3EA 4IM8A 5ID1A 3GSVA 4LU5L 4ZUTA 3BVNA 2X42A 1LEIA 1KULA 3QWQB 3D39A 1YY8A 4NUGH 4YC2C 1OSPL 3ULSA 2R0LH 5IWLA 1GPOL 4WI6A 3W0WA 3QQ3B 1GC1C 3QZWG 3UPCA 1ZLUK 1JNHA 3C5ZD 3NCJH 1OARH 3Q6GH 4LLAA 3F6LA 4FTVE 5BRZD 4GQ9L 2GAZB 3QAZB 4P0DA 5F89B 4H1LA 3K46A 3O6FD 5ADOH 3ELAT 1JPTH 2MQ0A 3CMOL 1J0ZA 1IM9A 2BSRB 3GSXB 4G9DB 1JHKH 3F6IA 3QDMD 5CJBA 4HC1A 1EHXA 3NCEB 1NAMH 1OAZL 1MCWW 1FJ1A 3VMPA 2AABL 3SE3C 3T65B 2VDPH 2KZ1B 4PYHA 3PL6B 5DRWB 1TJHH 3P11L 1AQKL 3I3BA 2VLMD 4Z0XA 1NFDF 2XI9A 3GNML 2YD4A 2WP3T 1C5CL 2CGRL 2ESVB 1QVOB 4MJ2A 5IFJA 1IQWH 4FP8L 2A6IA 5F44A 1B4JL 3IAQA 2WUCH 2BNQB 4L8CB 1GIGL 4NNYA 5IT2L 3BZ4B 1BBDH 4WUUB 1AC0A 4PP1C 2XNAB 4U3CA 2PF6A 1PQZB 4FZ8L 1BFOB 1FZMB 3FONB 3RUGF 4P5KA 1KCRL 5TDOA 2OL3A 3CLFL 5EFIB 1QR1B 4ZAKB 4F33A 4S0SD 4ODXB 1FFOB 1I8IA 2W0FA 1F6AB 5ILTL 1Q72H 2D0HA 1I9IL 3EO0B 5BRZE 4PTTA 3MA9L 3LQAC 4JZJB 4UINH 2VDLH 1YEJL 4P23B 1T04B 3T0EA 3DVGA 1NLBL 4YHOH 3GSWB 1KJ3H 2E6PA 3PNWB 4AH2B 5TDNB 3QDME 1V5JA 3QDJB 2I25N 2YR3A 4PJHE 2GTWB 1A9BB 1XGPA 2X89A 3WN5C 1A6AB 1QLFA 2EECA 4PG9A 1DUZB 2IADA 3DLQR 1OP3H 3FN0H 3RWFA 3BKMH 4HCRH 4S1SL 4Z7UA 4PP1D 3VE0A 2VLME 3LAFA 4OM0L 3LPFA 2X4UB 1WFUA 5AZ2L 3IDNA 3ARZA 1V3JA 4CL7A 1CCZA 5DC9B 4OZFB 4OFYA 1ZGLA 4JEGB 4HS3A 5F6IB 4P2RD 5DJXA 4N8VA 1KXTB 3DI3B 4M43L 4HJ0C 4JFHE 4HD9A 2NQCA 5EB9A 1UEMA 1FGVL 5CD5C 3O2VL 2L7UA 3F7QA 1P2CA 1OLLA 1OL0A 1PSKH 1BX2B 4LNRB 5IJVA 3VWKC 2J7LA 2DKSA 4WFED 1LMKA 4WJ5B 3UTTA 2EC9U 1OGAB 4IRJA 3UJTH 4HSQA 1S9WB 3V6ZB 2NW3B 2QADC 2B8OT 4JHAL 4PJFE 2K7PA 2F8VA 5HPMB 1E4WL 4JFQB 5I2IB 1T1XB 1GZQB 5IR1A 3WIIL 3OF6A 4J6RL 5MP6L 4OIIL 2FEDC 4WGVB 5C6TL 3VI3F 1OAYH 1P53A 3EKCA 3CD4A 1EJOH 1HH9B 4ACPA 1QBMH 4D0BB 1JTPA 4AENA 2NY4D 1MCCA 1PEZA 2E6QA 1JRHI 5JA9A 4HJ0D 2ERJB 1TNMA 1HH6B 1UVQB 2P1YA 1YQVH 2EDLA 3S88L 1LHZA 4R6UA 3P2TA 1TZIB 5FYJL 5IG7B 2Q76A 3TM6A 1XMWA 4XB8A 4DOHB 5KVDH 3ZKXC 3P4LA 3BQUC 1GXEA 4PG2A 3VWKD 5C0EA 4JFXB 3G6JF 1Q94B 1UZ6E 3MV9B 2BZDA 4HZAA 4YGVB 3C08H 3BO8A 3V5DA 4P2RE 4F80A 4UI2A 4JDVB 3W39A 1ZAGA 4FFVC 3GO1H 3KS0J 5HVHB 2Y06H 4OGYH 1MSPA 4AEFA 4XP6L 2LV4A 2OTUA 3S97C 4F3FA 3LKQB 2FEDD 5MEPB 2LABA 4ZUUB 4WFEE 2IALB 1ZOXA 3VGGA 3BFOA 2HAZA 1AGCB 1T7WA 4Z8FH 1R0AH 4K3HA 1ZT4A 3B83A 2BSTB 2VSDA 4MDIB 1N64L 5F21B 4L9LA 1MWAA 1XF1A 2ID5A 3G5VB 3LN9A 4YPGB 3HE6A 3VRLE 2B4CH 1XR9A 5IQ9A 1IFHH 2I9TB 4JPKH 5I1KH 4I77H 2NW2A 4HUNB 1DEEA 5GS0H 2GTZB 4M7ZB 5IFHL 3VRIA 3VD4A 1VENA 2NCMA 3WXVL 5DMKB 5JPMA 3DUUB 5DURB 1S7UA 2WBJB 3WIHA 4XX1G 1X4ZA 4WV1B 2VLLB 2BY3A 2R23A 1KCUH 3MACL 3M1BB 3BWAA 1Z5LA 1I8LC 2WLZA 1BQLH 1FNHA 3BKCH 4OKVA 2H1PH 1RUKH 1Z2KA 4YUEL 1TVBB 4NQXB 3L3GA 3CVHH 3JVGC 3OKKB 5CBAA 4LLQA 3OJVC 4Z7VA 3MLUH 5D7JA 1J1OH 5T3XD 3M8OL 3PJSA 4AIZA 3RTQC 1PZUB 1KELL 3ARGC 1RJLB 1S7WA 1A14H 4OQTA 4XNXH 5KS9F 4JVUA 5TGBA 5HYJD 2A74B 4JG1H 3QH3A 4TRPH 3GSUB 4PJIF 1CBVL 1RIVL 1MI5E 4WTWA 3HC0A 4K9EC 2HT3C 1U8OB 2AEPH 3MRFA 5AUMA 4ISVB 2CRMA 2MKWA 1RJZA 4XHJD 5GRVL 4LLVA 1NMAL 1RVFH 5C2UB 5EPMA 4Q2ZA 3C60A 4V1DB 3RI5K 5H37G 4WHCA 4N0FB 4XX1E 5C09E 4ZFGL 2J6EL 3CFBA 3F62A 3VFOA 1CICB 3T0BA 3G5XB 1D5XB 5FOJA 1RZIA 1CDJA 3GMRA 5KW9H 4S1QL 1QTYT 1Z9SA 3ZKND 4F9PC 2Z93A 1WWAX 3RTQD 3TPUA 1CL7H 4GMSH 1U3HA 2IPUK 3HLAA 1A4JB 1WIOA 1DN0B 3ARGD 2HJFB 4JRYB 1RK0A 5F9JA 2X7LB 1T21A 1ERNA 1AQDA 2HRPL 3G5ZB 4I5BA 5C08A 3OKDB 2NY7L 2HT3D 1HILB 3SKMA 2QSQA 5BZDA 5CEYA 2DYPA 4QOKA 4NZJA 5T1LB 2FX7H 5T3XE 2BOBB 1IGIH 3JXAA 4AEHH 1T20A 1UB6B 3B9KB 1MAMH 1MCNA 4BA8A 5EBGA 1NAKH 2HFGL 1N6QH 4FXGA 4PPTA 3HZMA 3QUZA 5HYJE 1DBJH 5EA0H 3PF2A 5F1NA 3VFUA 3U7WH 4OZHF 3U46A 4NKQB 5D7IB 1S5IL 5EC1B 5T3ZL 3FB5B 4I9WD 1QYGH 1BZ7B 1B2WL 2R0KL 1I8KB 5I15H 5JOFA 1AO7E 4OCLC 4RX4A 3IS0X 1QEWB 2YC1B 1MCHA 3MRHA 1U8JA 2ICWJ 3KPQB 1YUHB 3PWPA 4A6YA 4GBXA 1RK1A 3PGCA 3AU1B 2E7BA 1RPQA 2ARJB 2EEDA 2NX5B 3TBTB 2JELL 3VGBA 3ZTNL 4CVUA 5I66A 2OJEB 4P3DA 5GIRA 4LF3B 4G6KL 4Y16B 1EHLL 1Y18B 1DVFA 1FAIH 3PWLA 1UM4H 3ZSSA 4JGMA 2X44D 1URLA 3CSYB 3LKNB 5SWQB 1A0QL 5JHDD 4R96B 4YHNA 3V4PL 1G0DA 3SOBH 1AXIB 1A6WL 1MCPH 1QQDA 2YPVH 5JTWA 3HRPA 4YLQT 4KJYB 4JVWA 1DE4A 4BM7A 2BX5A 5D1QA 4HQQH 5FUZL 4XCCL 3IJYB 2HVKA 4WTZG 3T0AA 2GYSA 3QIBB 1FIEA 4ZSOB 2X4QB 3AXLA 4PP2A 4YHIB 1YYML 1UWEL 2W0KA 2F19H 5BZWB 4QHMA 5D6DA 4NBYB 5D2LF 1BVLB 5CIPA 3S4SG 4LLUA 1OP5K 2D7TL 2G5BB 5HI5D 43C9A 5I17A 4I9WE 3FQXB 4K8RC 5DUPL 5GISH 3DYPA 2F5AH 3SDCB 3O3BA 4KTYA 4OUUA 5HGHB 4PJBE 3V6FB 1H3UA 2OXGA 2GJ6A 1RULL 4NCDA 2PW1A 1Z3GL 3ARVA 1GHFH 2FHCA 5F9DC 1HXMA 4UT9L 1K4CA 5EUKB 3GGWA 3IDIB 1E28B 3HNVH 1ACYH 3MLXH 3RWJA 1QHPA 2F53B 5TQ0L 2H3NB 1K8IA 3L3DB 1Q0YL 1A1OA 4IRSA 4XBGA 5I75C 4XCFH 4K7PY 5JHDE 3W9EB 2VDOH 4AT6A 5I1DA 1KT2B 2Y6SD 2YHGA 1DQQA 4J3VA 4UTAL 3LHPL 3IDXL 5C9KA 1UEYA 2GY5A 5GJTL 2EDRA 5D96C 2ZJSL 3LEVH 3RVWC 3GSRA 2ICEA 4MNQD 1BFSA 4UOW1 3KYMB 3SE9H 4I3SH 2CK0L 2RB8A 1MHPH 2G60H 4M48L 4HBCL 6FABH 1MCOH 2MFNA 4XNZB 1KLGB 3QDHA 1BVZA 4NGHH 2C4XA 2EYSB 25C8H 4YDIH 4YAQA 2CDFA 4PJXF 1JK8A 4HWNA 2J8UE 3U2SB 1JPGB 2DQDL 2X9WA 5JW3H 5J12B 4CMMB 3SO3C 2VC2H 4ZQKA 5GGRA 1WC7B 1RV6X 3HPJA 1N6UA 3RVXC 2V2TA 2VDKH 3CPLA 3RX7A 1IC7H 3BPOB 5EO9A 4JPWH 2QSCL 1QFWI 3MJ9L 4LFHG 4LHUA 1YN7A 3N9GH 4GMTH 4XPHL 2YRLA 1A8JH 4M6NL 3GJFH 2UYLA 3MRQB 3Q5TA 2X41A 2DD8L 4PS4L 3MODH 1AKJA 2XZAL 2VQUA 2OYPA 5EOQH 5GGQL 4NCC1 5DRXB 4G7VL 4JFZH 3KYKH 4JANB 5LCVL 2Q6WA 1BIHA 2ADFL 3QPQD 4JRXA 1FSKC 3P9LB 5EUOA 5IESL 2BHUA 4M9OA 4NWTL 1NUGA 3QIWD 4R2GB 3RVXD 4LCYA 1I1AB 1YNTB 3LEXB 3P0VH 4APQB 4ETQB 3TT3L 1X4XA 4PREB 1EDQA 2AV7B 3MROB 2B0SL 1FNEB 2XWJA 4XAWH 3UTSA 3KNBB 2NY6B 5AG9A 3GKWH 5E5MA 3KLAB 2VXQH 1WUNT 4LCWA 5IW1B 1KIUA 4NQDA 2EIDA 1FORH 2V9QA 1IZJA 2OQJB 4NRXB 4U2ZA 3RKDC 4CGTA 4OCMC 2NY2B 1E27B 4O58L 1WCQA 2I9LB 2ATKB 2XKNB 4L1HA 3V8OA 3KPMA 3ZO0A 3BYYA 4QXUH 1Q38A 2JTDA 4U6XA 4PGZA 1ZVSB 4MX7B 3ZYJA 3F5WA 1YEEH 2NY0B 1SYSA 5IW3A 2A73A 1H8SA 3RY5A 3C2SA 4BZ1L 4NHUB 3CCHA 4NNPL 2Z35B 3ECBB 5B8CB 4FNLH 1F4XH 3REVA 2APFA 5ITBL 4UV7H 3C2AH 3BDYL 4F15C 3QEUA 1JUFA 4R90L 5CZKA 3HUJB 3K8LA 4GG6A 5T5NF 1X5KA 4BH8B 5E6ID 3AGVA 4PJAA 4MXWH 3AB0C 4Z5RA 5I1LB 3DUSB 1W8OA 4YDVA 3WUWB 3T1FA 1IM3A 4HKJA 1ADQH 4EEEA 4U05A 3QISA 1F4WL 1J7VR 4KAQL 4XTRC 1GRWA 3LD8C 3DIFA 3IXAB 1T22B 3SKNA 2HLAB 1F42A 4CMHC 5KANI 4M61B 4PRIE 1JIBA 5ETUA 4MNGB 3QCTL 1A6UH 4Y4HC 1MREH 1HEZB 2F8XC 4CVXB 2FECI 1JZ8A 4KRPC 4HWBH 3H3PH 2ICWA 3UJJH 1DQLL 3FJTA 3G6AB 1QACA 4U6TA 4P3WA 1KJ2L 1ZSDB 2W60A 1D5ZB 3JTSA 4QLRA 2OK0L 3CFJA 4GG8B 1EEZB 3TYGH 3ILPA 5J9PA 4WI8A 1AP2A 2Z9TA 4XP1L 1P7QA 4B41A 3KYOA 3WJLC 3D5OF 4HV8B 1A7QL 2BFVH 3V52L 3S37L 5I1HL 4JHWL 2NNAA 4XNQA 1R5WB 3VDBA 3QJHA 1BGXH 5DXWA 5IWLC 4XTRD 4PJ5D 5ELIA 4KRLB 2EKJA 3KPRA 3CFEA 4OGZA 4Z9KB 5D6CA 1P6FA 4WEBL 2OI9C 1J9CT 2VIRA 4H0GA 3SDDD 4OBRA 5DR5H 3T3ME 2XFXB 4MD0A 3ARFB 1ZT1B 2XPGA 4FTVB 5FGRA 1LO5B 4JJ5B 4Y4HD 3UP1A 3LPGA 4MA3A 3QG7L 4JG0H 1PYWB 4U7MA 1HNFA 4HGWB 1YNKL 4JFDA 4RMSA 1CLOL 3GMNA 2B4CC 3B8YA 5IB2B 5GS0C 3CU7A 3PIQB 4L3ED 4PJDF 5C6WH 3PE9A 4FABH 2VLKE 4XP4L 4LU5H 3D39D 1S7RA 3TH4T 5D5ME 2HH0L 1UH4A 1OSPH 3HCVB 1IGCL 1WTGT 3L95B 1GPOH 3F7VA 1ZHLB 1INQB 3WD5L 4GKOA 1E4JA 4R8WL 5JW5B 3U4EA 1HYSC 4JQIL 4NKMB 2BVOB 4GQ9H 3RWGB 5C0AA 3RL1A 2VLRE 4I3RL 2B7DT 1IM9D 3MNZA 4YEFA 4N0UA 3DROB 3LQZB 3CMOH 2Q1EA 2ZUQC 3GBNL 3OKNA 1OAZH 1BIIA 3BIKB 1MQKL 2AABH 3C5ZB 2DWEA 4H1LG 5BRZB 5C0JB 4CJ0A 3UMTA 4YIQA 1S7QA 4MLIA 5H94A 1MFCL 3P11H 1AC6A 1AQKH 3O6FB 3HA0A 5BV7L 5FB8B 3GNMH 1BREA 4K7FA 5IHLB 1HQRB 5FA4A 1C5CH 3QDMB 2CGRH 1OAQL 1D5MA 3JV6A 3D3VA 1PY4A 1QSEA 2DQIL 4LEOA 4QT5A 4FP8H 4OZGF 5HVWA 2O61B 4Y2DC 3X3GL 1B4JH 2FZ3A 1FFNB 4FQXA 4L3EE 3S35X 1GIGH 4CVZA 1HYSD 2LU7A 3BP4A 4WI3A 5IT2H 5GGUA 2J5LC 3I9GL 1K8DA 5GGTA 3D39E 4FZ8H 5K59E 2AJVL 3RHWF 3GDBA 1KCRH 1I7UA 3CLFH 4R4ND 4G3YL 3O9WA 3CGTA 4ZFOB 5ILTH 4KI5F 1I9IH 1HE7A 1TPXC 4P5TC 4WW2F 4CN1A 3MA9H 2DLFL 1S7XA 3ZDXE 1U8KB 4EI5B 3VGFA 1D9KA 1YEJH 5FXCH 4KUZL 2NYYD 2AV1B 1NLBH 4ENED 5MEOB 1WTLA 1JMZA 2OMBA 3T3PE 4NDMA 4IMKC 3OTTA 5D7LA 4PJFB 2PCPB 2X89D 3HR5A 5E24E 4PRDB 3TFKD 1OHQA 4XCEB 4ZTOL 4NJAL 4Y2DD 1E4XI 2MPAL 5KG9B 5A1AA 4LSQL 4JKKA 5EBMB 2D4DA 2NR6C 2P7TA 5AZEL 4S1SH 1BQHG 3EZ8A 3ZKQD 2VAAB 4OM0H 2A77L 5AZ2H 2O5YL 4OFYD 5E99L 1XR8A 9CGTA 3C9NA 4MAUL 5IK3A 4LHQB 1HN1A 4X7TA 4M43H 5E8PB 3U7YL 3ZT7A 4U6HA 3EBAA 1JCKA 4KV5E 1VB9A 1FGVH 1JPFA 3O2VH 4MS8C 4P5TD 4HIEB 4F7PB 2CXKA 5DD3L 3UJIL 3QUKA 3UBXG 3UTTD 3NZHL 3IKCB 1C12A 1IQDA 4IRJD 2PYEB 5F7NC 3FTGA 3MCKA 5CD3B 4N8VG 2VTFA 4LPWA 5FF6A 2AK1L 2WIMA 5L2KA 4P2RB 2V2XB 3HE7C 4JHAH 1J05B 3LN5B 5F7DA 4XH2A 5L2JA 2VB5A 1E4WH 3OF6D 4U1GC 1AGEA 3VH8A 3WIIH 2NR6D 4PJCE 4J6RH 1CU4L 4PLNC 5MP6H 4OIIH 4NRZA 1IGTA 5C6TH 3CX5K 1H3WM 4P4RA 2X4PA 5ADPL 4L3CB 4UU9B 2HWZL 5EIIB 1Q9OA 5ACMA 2VZ3A 2GSIB 5FA3A 4PLOB 3SDXA 3WN5B 3BP6A 3GSQA 3WJJA 3S88H 4OZGA 4MS8D 4O2FA 5FYJH 1XGTB 1JJUA 1VERA 4M7KL 1WT5A 1MJ8L 4OF3A 5KN5A 4ODHL 3QUMA 1Q8MA 2DJUA 2YPLA 3KYNB 2X1PA 3BYTA 2NY4B 3WKNA 4G9FD 2PXYA 1VA9A 4LHJB 4XP5L 4LLDA 3HE7D 3U36B 4HW6A 3L7FB 2AXGA 1RMFL 1U8LB 1CD0A 3MRLB 2UWEA 4XP6H 3VWKB 1NC4A 1K5NA 3L5HA 4CJ1A 3HI6L 1MNUL 1TQCC 1B0GA 3RWIA 3ROOA 3M17A 3EIFA 4DK3A 5D7JC 1X5XA 5HHOD 5GRUL 5A2IH 1N64H 3OKLA 4OFDA 4X9IA 5D7SL 3BSZL 2QQLL 4RMRA 5C0FB 1OOAA 3HMXL 3HE6D 3PWJA 5IMMB 2ED9A 4ELKB 3H9HA 4M1GL 2DLHA 2LE9A 4RA3A 4LGSB 1TFHA 3BKYL 5IFHH 2KKQA 3WXVH 4PJ8C 2CKBA 4S1DD 1CD1A 1RFDL 4BFIA 1XH3B 3HR6A 3MACH 1U8HA 2EIZA 3RUGE 3V4UL 5L0QB 4G9FE 4YUEH 4OZ4B 1BD2D 4ZFZB 5EZOL 5D7JD 2FJFB 2QLVB 4I2XE 2CLVA 1JI1A 1HXYA 3M8OH 3HZVB 4I48B 2FATL 5IKCA 1QLRA 3NIDE 5E1AB 1FYHB 2IC2A 3CFCL 4TSAL 2FSEA 4X5WB 2CIKA 1CR9L 4FMFA 3FQNB 4JM2A 1RIVH 4DWHA 1CBVH 3NIFF 4ELMB 3BRFA 1NEZG 4Q6IA 4QRTB 4Z77B 3QDGA 5HHOE 1GCFA 3MREA 1MUJB 5F1SA 1N8ZA 3IETB 4O2CB 1W72A 1NMAH 3C60D 2ICCA 3QUZC 4LVOC 1MCEA 4ZFGH 2J6EH 5HYJB 1U8QB 4M6ML 3RAJL 4UTBL 4N9GA 5DC0A 3SBWA 2BVEA 4E5XB 1CFQA 2VMFA 4M93C 1KXVC 2WBKA 4S1QH 1WICA 1MJUL 3AC0A 3FRUB 2QBWA 3B2UC 5C0GA 5AG8A 3QUYA 5ID0B 1SY6L 1EUTA 1KIRA 2M26A 1S7VA 2EO9A 4X0KA 3VXPB 4XXDB 3VFVA 3PGDB 5J1AA 5HGDB 2HRPH 3NCMA 4JHBA 3GFUA 2NY5L 1BD2E 3TJEL 2NY7H 2EZ0C 4U1HB 4QOKD 1F2QA 1JV5A 2HJLB 1AGBB 4P49A 3HNTL 1S7SB 3RTQB 1REIA 2HFGH 3L3KA 2YD3A 4U1LB 3WXWL 3QUZD 4LKXA 4JAMB 3ARGB 2JB6B 4RAUB 5DYOB 5I16B 3JTTA 3MXVL 3VI3E 4NPYB 1G7PA 4JN2B 3TP4A 4M1CC 1S5IH 5T3ZH 1VFBA 1VKXB 3JV0A 1B2WH 2A6KB 1BLNB 2R0KH 3W11D 4G8IB 2FECL 3L3IB 3ZYZA 5CJ5A 2ZUUA 1C8PA 2CRZA 3B2UD 4OKDA 1KPVA 3PDOA 1AR1D 3SGJA 3SY0B 4BH7B 1UZ8A 2JELH 2AK4A 3O11A 3ZTNH 3G6JE 3GHBL 4G6KH 3EOAB 1DVFD 4JZOB 3T2QA 1EHLH 2AERT 5IM7B 2BERA 4QEGA 4ZUSB 8FABA 3RNQB 2HN7B 4PJBB 3VFTA 1U6AL 1VGEL 3MRRA 4LRNL 1A0QH 1IGYA 2E3VA 4BUHA 4L8DB 4CUCA 1PX4A 3V4PH 1IL1B 2NZ9C 1A6WH 3LSOA 1FO0L 5H35B 5JLZA 5IP4A 1J86A 1T2QL 1HYRC 2DQEL 3HAEH 1T0MB 1X5ZA 1XZ0B 5FUZH 4XCCH 4UOJA 1CDYA 2EDDA 3UZQA 5F88A 4QCIA 1MFEL 4I8DA 4LPXA 5IVXA 5JHDB 3RVTC 4X6EA 1YYMH 1UWEH 5GRXG 2F9BT 2Z91A 3H3KA 1UH2A 5SX4H 5K9KB 3QQ3A 3CXHK 1ZEAL 1HSBB 4MA7L 3S4SB 1MFAL 3VXOB 4H20L 2D7TH 2M1KA 4Y2OA 1R5VB 4E41E 3RKPA 5DUPH 2GAZA 3NCYP 1DL7L 4YHZL 5F89A 5I76B 5IBUG 2EDKA 2R2BB 4J23A 1VESA 2GJ6D 4WY7L 1XF2B 1RULH 4FQ1L 4GT7A 3ZDYF 2CO7B 5IMOA 1Z3GH 3I85A 5IHUL 2NZ9D 4UT9H 3WEXB 2E5EA 4BZ2L 1I8MB 3P4NB 5KSBF 1UM5L 4R26L 5TQ0H 4KY1L 1JWMA 3P0GB 3VCLA 4IRSD 3O4LA 1Q0YH 3TIEB 5DRNA 1HHJA 3RVTD 1QNZL 3O8XC 5KS9E 4UTAH 3LHPH 3IDXH 3MV7D 2X4NA 4XCYA 3CZJA 3VD9A 4M4RA 3RIAK 5GJTH 4HWZA 1YDPA 1UB5B 5GZNC 4PJIE 2ZJSH 1PKOA 2J1KA 1F2XK 2CIIB 3O4OC 2VXVL 2CK0H 1E6OL 3FL7A 2XNAA 1PQZA 2DDQL 4M48H 4HBCH 1T0PB 4O4YL 3RVVC 3IRPX 2R4SL 1QR1A 4BSVB 2YRZA 4BQ8A 1FFOA 4KKCC 2ZUWA 1N2RB 4LCIL 2DQDH 4MNQB 4C54A 3DHMA 35C8L 4QYOB 5DHXB 4Z78B 3DNKA 5CEZL 2NXZD 5JXAL 1AXSB 1G6RB 1GGUA 4P23A 1ED3A 2GJ6E 5CWSB 2LTQC 4Z7WF 3PNWA 4AH2A 5TDNA 5F7HA 1U92A 5H8DA 2QSCH 3O8XD 3MJ9H 4DVBA 2GTWA 2XQBL 5GZND 1A6AA 3MRNA 4XPHH 3L6FB 1CTOA 1WCBB 3DX9B 4KVNL 4M6NH 4PY8I 1JI2A 2DQFA 3N1GC 4NO3B 5I75B 4MJIE 2DD8H 2X4UA 4PS4H 1AGFB 1T6WA 1HOCA 5F1OB 1XFPA 2XZAH 1L0XA 3RVVD 5ESQA 5ESVB 5GGQH 2DIBA 3WLBB 5DK2A 3MV7E 4G7VH 1UADC 4KKCD 2R39A 1KUMA 5LCVH 3PDDA 4JRXD 1AY1L 5D1ZC 2ADFH 5DF0A 1E4XL 4QHNA 5EZIL 5IESH 1NGQL 2GSGA 4NWTH 4LNRA 1FBIL 4G5ZL 2FHBA 2HMIC 4NNXA 1X6LA 1OGAA 3E2HC 1A7BA 4I0PA 3TT3H 2BSSB 1T1YB 2NW3A 4DCQA 3IT8D 2B0SH 3V7AG 3MBEC 4KGLA 4LCWD 3VFSB 2D31B 5HPMA 2E7CA 1BBJA 4NQDD 3SO3B 1T1XA 3EDFA 3UAJD 5I2IA 3LV3B 3SJVD 1B88A 1FLTX 4POUB 3QIWB 4MXQC 2UZYB 3TCXA 4O58H 1N5YL 3QULA 4D0BA 5IMKB 2P8PB 1TTFA 1BECA 3DSNA 4RGNB 1XCTB 2JJTC 3Q2CA 3I75A 3HZYA 4RAVA 4P57A 5CZVL 4PBVC 3X13B 5KSAA 1T5WB 2A9ML 5IG7A 1VFAB 1G7QA 4BZ1H 3WO3B 3QEGL 3OX8A 4RWHA 1FFQA 2YKLL 4NNPH 5TE6L 1FN4A 4UV4L 5ITBH 1BZ9A 1E6JL 3BDYH 4S0TD 4Z18A 4MMZC 5DLML 4FFZL 5D2LE 3V7AE 1JGUL 4R90H 4LLYB 1B90A 3MBED 3RDTC 1FSKB 5IIEB 2BY2A 3X14B 1FZJB 2JCCF 3LKQA 5MEPA 4ZUUA 2IALA 5DEZA 4R7DB 1F4WH 3K1DA 4KAQH 4GLRI 5IVOA 5IEKB 5SWSD 1IVLA 2MMXA 3E6HB 3DBXA 3CNKA 4O2EB 3FMGL 2IPTL 2OTWB 5E6IB 3DRQA 3SJVE 3QCTH 3RWEA 4X4XB 5J4MA 4NN6C 2I9TA 3VDAA 3GIZL 3OXRB 4F7CA 2AXJA 5J3HC 4X6CF 1DQLH 5DEFB 4QF1B 1KJ2H 3PUCA 1JBJA 4PJ7A 4D3CL 4OV5B 3RDTD 1CYGA 5DMKA 3EHBC 3D0LB 4OZIF 2OK0H 4LPCA 2VLLA 4KQ4L 4ONOA 4WV1A 3MMEB 4KH2A 1DBAL 4GW5B 4J1UB 5E0QA 4XP1H 1A7QH 3V52H 3S37H 5I1HH 4NQXA 4JHWH 2GY7B 2DQCL 5D5MB 2Z8SA 3K0WA 4U7SA 2C3VB 4QGTA 5D93C 3VFRB 4PJXE 4GRMA 3UYRL 1U9KA 3OKOA 4WEBH 3ZHDA 3NH7L 3D87B 3QXTA 4LAJH 2ICES 2BP3A 3DX6B 4TN9A 4DEPB 1RJLA 3AB0B 5CLTA 1A1MA 3GSUA 4TUJB 4X6DF 3QG7H 1U8OA 3FO9A 4JFDD 3MYJB 1BFTA 4PJ5B 5T5FL 1YNKH 5SWSE 1CLOH 2YD2A 3QNXB 3G08B 4PRAB 4CMHB 4X7SL 2C26A 5LWYL 2PTTA 3AY4C 5GRWA 3OAYH 3IAGC 2FGWL 3ARYA 3EHBD 3SDDB 2BSED 2ZPKL 2AEWA 4V1DA 4N0FA 4Y4HB 1C7SA 4CN4A 2YSSA 2QKIA 2CUHA 4HPYL 1UCTA 3B9EA 1NJ9B 2APVA 1NBYA 1JYVA 4RZCB 4XP4H 4G42B 1CICA 2ZUTA 2RBLA 3CDGB 1D5XA 5E56A 2HH0H 3VGAB 3TEUA 1IGCH 1I3VA 2Q86B 5DI8A 5ISZA 3WD5H 3WNPA 1NGYB 4POYA 4FRWA 4R8WH 1MCIA 4L3EB 2PUQT 2R1XA 3GSVB 4JQIH 2UY7A 3PHQA 3LMJL 2MCG1 3G5ZA 1CQKA 2HTLC 1LEIB 3D39B 4I3RH 1YY8B 3OKDA 4NM8L 4PLKC 1KYOK 2D0GA 3ULSB 1HILA 3MJ6A 3W0WB 4K55A 4WUKL 3GBNH 3AREC 4YHPA 3B9KA 5T5NG 1MQKH 1IAII 4H1LB 1II4E 2AEQL 1EJ6A 1MFCH 2UVFA 1IM9B 5FYJE 5BV7H 5D7IA 3NFSL 2V7NB 4YZFF 4KJWC 4LCUA 1F13A 1BZ7A 3EYVA 2EEAA 3D3VD 1EO5A 1FJ1B 1OAQH 1QSED 4UUJA 4MDJA 2DQIH 3DXAD 1P4IL 4G8FB 1BOGA 3WE6A 3P9WB 4XP9L 3X3GH 2G9HB 3RZWA 3UTQA 1N5AA 5C0CD 4PUBL 3AU1A 2ARJA 2NX5A 1KOAA 3TBTA 3I9GH 4LF3A 4Y16A 4PLKD 1VEOA 2AJVH 3JUZA 4P2QA 1LP9A 5IFJB 1DUYA 3O9WD 3MJ7A 2A6IB 4G3YH 3ARED 3HC4L 1HQ4A 3CVHB 4Y5VA 3LKNA 1F4YL 1SM3L 3KDMB 4NNYB 4MQXC 4R96A 3BEWA 2DLFH 1D9KD 5EZLA 4P5KB 4XPTL 5JQ6L 3SPVB 4PRHD 2E7LA 1MHCB 4KUZH 2LVCA 4KJYA 4L1DA 5E2VL 1OTSC 2FD6L 5A40E 4L4JA 3T4YA 1NANI 1I8IB 3IJYA 5ESAA 2W0FB 2EICA 4M1DL 5AD0A 2R1WB 3OB8A 4ZSOA 2X4QA 2H8PA 3HI5L 2WINB 4ZTOH 4NJAH 5BZWA 4KJPC 4NUJB 2MPAH 3S36L 3VXMA 3T0EB 1BAFL 4LSQH 3LB6D 4WDIA 5AZEH 4DZBA 3PV7A 4TUOB 2G5BA 1JYNA 2A77H 4PJEF 2O5YH 3D3VE 5E99H 1RZKC 4MAUH 3S96A 3SDCA 3ARBC 1OGTA 5DJ2A 5HGHA 1TJGL 4PG9B 3DXAE 2IADB 4LDEB 4JVPA 3U7YH 4MQXD 3RWFB 3OB0K 4Z7UB 5C0CE 3VE0B 5I1GL 2J5LB 5DD3H 5EUKA 3UJIH 4AJ0A 3UTZA 1SJHA 4FHBD 5MENA 3IDNB 5JORA 3UBXB 1E28A 3NZHH 3DWTA 3S34L 5LGJA 1IC1A 1OTSD 1U2CA 4KVCL 1ZGLB 5L2KD 5DJXB 4N8VB 2WUBL 1KN2L 3MTRA 2AK1H 4YHYB 3PV6A 2OMNA 4I18C 3DJ9A 5HHQB 1TPXB 4P99A 4P5TB 4KJPD 5IJVB 4KI5C 4R97C 3QEHA 4WW2C 1LO0L 1CU4H 3UTTB 4PRHE 1NL0L 4IRJB 3CU1A 4YFEA 5ADPH 4YBLB 1YMMA 5I73B 2HWZH 3ARBD 4I1NB 3QXVA 2NXYD 5CJOL 5IR1B 4Y7MA 4HG4K 3UPRB 1KLGA 3QHTC 2O5ZL 1TNNA 1U42A 2EYSA 5I1CL 4M7KH 4PJDE 1MJ8H 2YPLD 4ODHH 4DKFL 3ZE1F 4TOYL 3TYFA 1JPGA 2X9XA 4LQFL 1F5WA 5FO8B 3QEQA 1WC7A 5CSZA 2P42B 2Z0BA 2W0PA 4K23L 4XP5H 1CXFA 5GGVY 4FQCL 1I3GL 1RMFH 3BZEA 1KPRB 4ODTL 1NC4D 1O7VA 5IF0A 2IPUG 1TDQA 4NQCE 5FKAB 3HI6H 2V7HA 1MNUH 4WW1A 3BO8B 3V5DB 1YC7A 4G9FB 4DUWA 1YPZF 5IJKC 1VGKB 3CH1B 3HE7B 3W39B 5GRUH 4I2XB 2XQYG 3HAEG 5T3ZE 4HEPG 4Z95L 2OTUB 5EOCL 1T0NB 4GXVL 5DRXA 5D7SH 1FG2A 1ORSA 1WFTA 5IB1A 3BSZH 4GRLA 2QQLH 2DMCA 3HMXH 5BS0E 3LS4L 4P2OA 4GUPB 4Q6IC 3BMVA 4M1GH 5AEAA 1KACB 5HHOB 2NY1D 3BKYH 1F4HA 4YDKL 3MGAA 3O2DL 3ZE2F 1YNTA 2QHRL 4MYWB 4YE4L 4OZGE 1XAUA 2WNGA 3IJSB 1RFDH 4RBPH 5DQJA 3FQWB 3KPSA 4UNTA 2YPLE 2O5XL 3HE6B 3WUZA 1NCAL 4PJ9C 5IQ9B 1DLFL 4MHHG 3KLAA 4LLMA 2NW2B 5IW1A 3V4UH 1EAPA 3VRIB 2OQJA 4NQTA 5I6XB 2QTEA 2KUTA 2QQNL 4PGBB 1H15B 5EZOH 1EMTL 2IANA 2ATKA 5GGSB 5CSGA 3VMNA 1EEQA 2R23B 3CZFA 2P8LB 4KI5E 3BWAB 1Z5LB 4NCC2 2FATH 1ZVSA 4K3JL 4OKVB 2IEPA 1TQCB 2C1OA 4JM2D 3CFCH 4I4WB 4TSAH 1OB1B 3L3GB 1EAJA 1CR9H 1BD2B 3QDGD 2EE6A 4LLQB 5F9OL 1NEZB 3VFWA 1K3ZA 5D7JB 2MOVA 4GRWF 3PJSB 2AP2A 2Z35A 3ECBA 4XPFL 5J7CC 1S7WB 1JNNL 2AVGA 5TGBB 1V7NL 2HJKB 4M6MH 3HUJA 4PJ9D 4UTBH 3RAJH 3HC0B 1MFNA 5JMRA 4J2XA 4X5XB 1J18A 5F93C 5DDHA 5D70L 3C8DA 1RJZB 3DUSA 5E2WL 4B0MM 4LLVB 5DHYB 3FQTA 1MJUH 5EPMB 1A21A 4Q2ZB 3C60B 1I85A 4UDUB 1SY6H 5DO2C 4D0DA 4KK5D 2RJMA 1C1EL 3IXAA 3VFOB 5HJ3A 4M61A 5HDLA 2CK2A 3PDGA 2DAVA 1I1YA 1X44A 3DARA 3G6JB 1RZIB 3K4AA 2NY5H 5EZJA 1W0WB 2XTJC 3KJ6L 3PHOB 3TJEH 4YFLI 5IV2B 4PR5A 4HMEA 4JFED 4EVNA 3HNTH 4CVXA 3GJFB 1UM6L 2BY0A 3TPUB 3HLAB 5HHXL 1RK0B 5F9JB 3WXWH 1GJIA 1T21B 1U8MB 1AQDB 4H88L 4K71B 4ZFFA 4XT1C 1D5ZA 3MXVH 3MJGX 2Y72A 3SKMB 5BMFL 1EEZA 5CEYB 4NZTL 4QOKB 5HPOA 1OAKL 3DVFA 1T6VN 1T20B 1EFQA 3QI9A 4HV8A 3IDYB 1CG9A 1MCRA 1S78C 1R5WA 3HZMB 3QUZB 4LL9A 5DO2D 3TBSB 4LVOB 2EH8L 4ZOEA 5DD1L 5F1NB 4H25B 4X6BA 1KCSL 3VFUB 2Y1VA 3U46B 3GMOA 1W8NA 3SKUD 1EUUA 4M93B 1C08A 1NBVL 3GHBH 3T2OA 3ARFA 1FDLL 2XTJD 3STZB 1LO5A 1VSCA 2MSPA 4LASL 3L1OL 1T7VA 4QTIL 3BP5A 1U8JB 1G7HB 1U6AH 3PWPB 1VGEH 4HGWA 4LRNH 3PGCB 4H5SB 5ABDE 1U36A 4R4BB 4P3DB 1V8HA 5GIRB 1WZLA 4HUKB 4LSSL 5HYSG 1NC2D 5J11C 1DVFB 1FO0H 3MA7A 4WI7A 4LPTA 1T2QH 3PIQA 3TBYA 3VXSD 2DQEH 4JFEE 1YJDC 3T0VA 1Q9KB 2HA1A 1MFEH 1RD6A 2CLZA 4YHNB 1KJMB 1X5HA 4TULL 1S78D 2DM2A 2OR9L 5KS9B 3ULUD 1ONQA 1DE4B 1ZEAH 3E6FB 3QJFA 4MA7H 3QZWA 4PJIB 3W82A 1MFAH 5EO1A 4H20H 5KVEL 4HKZB 3DO3A 2HVKB 4YHZH 1DL7H 1MFBL 2AQ3A 5DEGB 4C55A 3AXLB 4PP2B 5IBUB 3Q1SL 3DROA 2BXZA 3LQMA 4WY7H 4N1EA 2CLRA 4FQ1H 1T83C 4NKDB 1NCCL 5IHUH 3BIKA 4IOFD 43C9B 4BZ2H 5TE7L 3L5WB 3C5ZA 5B4MC 2XTJE 5C0JA 3O3BB 1UM5H 4OUUB 4R26H 3O4LD 4KY1H 1MVFA 1ITBB 3W2DL 5JPNA 5DJCB 3O6FA 2GJ6B 2PW1B 1UYWL 4IEFB 1A6PA 4PB0L 3S98A 4POZC 5EU5A 3QDMA 2VNCA 5B39G 3FO1A 1HXMB 1QNZH 3KLSA 3GGWB 4DZ8A 2EDJA 2K9UA 4XWOD 4PJHA 3SDAC 3EO1A 1OP3K 1FFNA 3NIFE 1K8IB 3VXSE 2ADGB 2XRAL 5LBSL 1A1OB 2VXVH 4IRSB 4XBGB 1E6OH 2JB5L 3ARXA 1EX0A 2ORBL 2DDQH 2WQ8A 4LSUL 4HG4J 5IB3A 3TNNB 1BWWA 3C8KA 5I71B 4DAGL 4C59B 4O4YH 1LWRA 2R4SH 3RWDB 2LU4A 5JO5B 3MV7B 3ULUE 4Z7QF 1RIHL 3LKOA 6CGTA 1M7DB 4ZFOA 2YD7A 4GKZA 4LCIH 5IFAL 5J6GA 2FLRT 5B4MD 35C8H 5E8NA 5CEZH 5JXAH 4ZUVA 2AV1A 2JJSC 5MEOA 3X3FL 4I0PC 4TPRL 3VFNA 1E0OB 1G7MA 1F11A 3IRZA 1QFPA 2CDFB 4V2CB 4YAQB 5GGRY 1JK8B 4JKMA 4PJFA 4PRDA 2D2OA 3SE3A 2NLJB 1FLRL 2XQBH 5GGRB 4ZG1A 5K9QG 3HPJB 4KVNH 2NXZB 2OBGA 3HTLX 5I74C 5CHNB 2V2TB 3R06B 1LK2A 4UNVA 5E9DE 3O6ML 4AEIL 1DZBA 3U0PB 2ZSWA 3O8XB 4Q9BA 3MRMA 4ETYA 3QNYB 5E8PA 4OAWB 3HS0A 4ODVL 1AY1H 3FB8B 3KPPB 1E4XH 5F6HI 4YJZL 5EZIH 3SKJL 1H3TA 4HIEA 5EU4A 3GSOA 3ZYIA 1A4KA 3UTPD 1NGQH 4KROC 4RRPG 3OAZH 2NTFA 1A5FL 1FBIH 4YXHL 4G5ZH 5E8DL 5I1AA 1RU9L 2HP4A 2OR7A 4I0PD 2JLLA 3I6GA 1QFHA 4JRXB 4HXBL 3LN5A 3V0AC 5EUOB 5T1DL 4PRPD 1UA6L 1WZKA 4JB9L 1UJ3C 2X10A 3TESA 4LCYB 2P4AB 2JJUA 2DRUA 3S3SA 1N5YH 2FYYB 4QWWD 5LG1A 3AM8A 4HKXA 4KMTL 4UU9A 1FFRA 2XWJB 1CF8L 2D7OA 3FAXA 5E5MB 3WO4B 5CZVH 4LCWB 5KSAD 3RGHA 1RZ7L 2YOCA 4NQDB 2WMPA 1GOHA 3CLEL 2A9MH 3SJVB 2VZSA 4TVPL 3GRWL 4KROD 4XHQA 2YN5A 3QEGH 2GITB 3KPMB 3KXFD 1F90L 2YKLH 2YUXA 5TE6H 4IBLT 2ZOLB 4UV4H 1YEKL 1DN2A 1E6JH 5EWIL 4H8WL 1SYSB 3PP4L 3U36A 4HEME 5DLMH 3I3DA 4FFZH 4BUGA 3PHSA 1JGUH 1KF9B 4R3SA 2ZNWA 4GRWH 3MRLA 3H7BA 3UTPE 2KQMA 1BJ8A 2XG5A 3CCHB 4JQXA 5C0RL 1J8KA 4Q9CA 3REVB 2CPCA 1R3LA 5CP3A 4HDIA 5BXFB 4XNUL 1ES0A 4EUPH 3ZDYE 2EE9A 1JUFB 4HIHB 3NPSC 4U0RB 4CAGA 4Y4KC 2VLJD 4PJXB 4PRPE 3FMGH 2IPTH 1DDHB 4Z5RB 3QO0B 2P8MA 1ZLSL 3IFPB 5AAWA 2X1OA 3T1FB 5KSBE 1IM3B 3UCRA 5C0FA 1UXWA 1JL8A 1OPGL 5CBEB 1HSAA 5IMMA 4XRCB 1MI5A 4WFFD 4ELKA 5B3NA 1G7LB 4GXUN 3GIZH 4OLXL 5C0ND 1ZVYA 3SKNB 4KZEL 5SWSB 4HLZH 5I8KL 1V7ML 5ETUB 2YPKA 5E5UB 4D3CH 4K7PL 3NABL 5DHVA 3MOBL 1UENA 5C09A 4KQ4H 3FHAA 4G43B 5I9QC 3BQUA 3R8QA 1DBAH 2V17L 5ITFA 3KXFE 1MCKA 3DRTB 2ICWB 2VSCA 4J8RA 1CXIA 4AM0B 4F2MB 4OZ4A 2P5WE 4QRSA 4EI6B 1H5BA 5HI4D 2DQCH 4DN3L 2GK2A 4EJ1C 1UFUA 2W60B 2FJFA 3JTSB 2HT4C 4Y4KD 3UYRH 3RDTB 1YYLL 3RZCC 2B1HL 3NH7H 3ILPB 1U8NB 1AP2B 2R9HC 3HRZA 1QLEL 3FT2B 5SX5H 3GBML 2NNAB 4X5WA 3DVIA 4XNQB 4MA1B 5ANME 1KFAL 4Z7WE 4QRTA 2XWBA 3KPRB 3CFEB 4Z77A 4RIRA 5D6CB 1IAMA 5T5FH 1IAOA 4JCLA 1N0LA 2VLJE 5FUOL 4X7SH 5F7LB 5LWYH 2OZ4L 2VIRB 2Z92B 4MD0B 1J0HA 5TH2A 2FGWH 2ZPKH 3ORJA 3VI4E 4M62L 4HPYH 1FVEA 2VDQL 3KLDA 1NMCC 1BJMA 5CGTA 2ILLA 3K4ZA 4JFDB 3WIFA 3GMNB 2Q7YA 1AO7A 4MJ5A 3ARUA 1DSFL 2AJXL 2HT4D 3RZCD 3ESUF 5ID0A 2VQTA 1DCLA 3H6JA 5D9SA 4XMKL 5FGCE 1T1WB 1I8LA 3GBLA 4AG4L 4XXDA 4J4PC 5GSRB 3PGDA 3LMJH 5HGDA 4L8SA 4W4NA 4NM8H 4OCXL 1QFWM 3JVGA 1S5HA 2VE6A 2C9AA 3F7VB 4FFYL 5D93B 1AGBA 4WUKH 4ZTPL 1S7SA 1B0RA 4F7TB 3U4EB 3RTQA 3PQYE 2HG5A 3TCLA 4U1LA 3ILQC 1BEYL 3X12B 1NMBL 3ARGA 4JAMA 3RL1B 5DYOA 5HHVL 5IOPA 5I16A 1C16B 2AEQH 3PWVA 4N0UB 3U30C 2GEEA 4JN2A 3MC0A 4C56E 3NFSH 5FM4A 2UZIL 4U1NA 3OKNB 2BVPA 4JGJA 3TV3L 4G8IA 5HGGS 1NFKA 5EIQA 1J88A 3L3IA 5HHME 3I6KA 2C4FT 1P4IH 1CFNB 4UT7L 4YIQB 4KTEL 4XP9H 5H94B 5ERWA 2IQAB 1F97A 4PUBH 5CZXC 1ZKAA 5FA4B 5I1KL 3JV6B 4JZOA 1KEML 3D3VB 3EAKA 1QSEB 2ZCKL 4LEOB 2AQ1A 5ICZA 1IEHA 4PGJA 2QSVA 3DXAB 3HC4H 2NY5C 1J0IA 1CGWA 1F4YH 1RZGB 1SM3H 2JCCE 3ILQD 5GGUB 2V2WA 4L8DA 5C0CB 2XN9A 1EZVY 1K8DB 1ZT7A 5KSUB 5JIPA 1WWBX 5JQ6H 4XPTH 2E9JA 5H35A 3CUPA 1OTUC 5E2VH 2FD6H 3REWB 2GW5A 3O9WB 5KAQF 2D7QA 1HZHL 1BOYA 3AREB 4WTZA 4M1DH 1HIML 2OJZL 5I0ZA 1G84A 5JHDA 4X8JA 5JR1L 3HI5H 1S7XB 5E7BA 3VXMD 5CJXC 1I4FA 3IFOA 4M4PA 3V6BR 5F8RC 1D9KB 3S36H 3VD7A 1BAFH 1ROWA 4PRHB 4XBPA 5CZXD 1HSBA 3S4SA 2XTLA 3VXOA 4TTDC 3OV6A 1R5VA 5JIKA 3HR5B 4LAQL 4X6CE 5I76A 3ISWA 3E3QC 1TJGH 3EZJB 2G2RB 2G75B 1XF2A 1EZVX 5F3BA 5IGXL 5MEND 5I1GH 1I8MA 2J8UA 3TJHC 1LP9E 1XR8B 3LY6A 3S34H 1OTUD 4ORZC 4KVCH 2BCKB 4X7TB 4UBDD 1M71B 2WUBH 1KN2H 2IH3A 1JNJA 2PETA 2H6PA 3TIEA 3NGBC 4YDLB 5FDWA 3U6RA 4Q97A 5IQ7L 4QO1A 4YFDB 2VO5A 3WFBL 4UAOC 1L9NA 1C12B 1LO0H 3FTGB 1B6DA 3MCKB 1NL0H 1I1RA 2R2HA 4JDTL 4KUCD 4BQ9A 2HKFL 3RA7L 5FF6B 3OGCA 5KANG 5L2KB 2VWEC 1YMMD 1XT5A 4FQJL 5T33L 4XVTL 5EC2B 2H32H 5EIVA 4XH2B 5L2JB 2RAMA 3TIDB 1EBPA 2D9QB 5F97E 5CJOH 1G9NL 3VXME 1AGEB 3VH8B 2O5ZH 3MRIA 3ARPA 4NRZB 4WI2A 4TYUA 4DTGL 4BSVA 5I1CH 4P2OC 4P4RB 2X4PB 1N2RA 4DKFH 2A38A 3CX2A 4TOYH 3TJHD 1PVHA 3BOVA 1IAKB 1CGSL 3QEQD 1J11A 4LQFH 1P84K 1Q9OB 4HULB 3ARBB 1G6RA 4OIBA 4K23H 3SDXB 3BP6B 3DO7B 4DW2L 2NXYB 4FQCH 4OZGB 1PG7W 5C0BD 1I3GH 1OT1A 1AJ7L 4N9OB 4ODTH 2YPLB 4UILL 2JF1A 1VDGA 5DD5L 2PXYB 2BNUA 1A47A 1WCBA 4MNHA 1IBGL 2F74B 1BWMA 1NGZB 3S35L 3ZHKA 1AGFA 3CFDB 2KH2B 5E4EC 4KRMB 4Z95H 4MJ6B 5EOCH 2P49B 3MLSL 4GXVH 4GRLD 1NC4B 1K5NB 4R97B 4WW2B 4X83A 1B0GB 3RWIB 4HFWA 4Q9RL 1X5FA 3GMMB 4P2OD 3MNWB 4YDJA 3LS4H 3BUYB 3M17B 1YMME 2XZQL 4YZFE 1SQ2N 1F58L 1CFBA 3NPZB 3E3QE 4JQVC 3OKLB 3A0OA 5GJSL 1JF5A 2J8HA 4YDKH 3GZKA 3O2DH 3I3EA 2QHRH 2X4SA 4YE4H 1G6VK 1SHMA 3KPSD 4D9LL 3K3QA 1PGRB 3PWJB 3KPLA 2O5XH 5DK0B 1NCAH 1DLFH 3IAPA 1KLUB 1NAMA 1P7KB 1YN6A 2LAGB 2NY1B 2C5DC 5T1KA 2IAND 2QQNH 1EMTH 2CKBB 4PGCA 1J8HD 1QSZA 5C0BE 4BFIB 5IMKA 1RZFL 1U8HB 5J1SC 1CLYL 2EIZB 3PGFL 4HWEL 5TF0A 4K3JH 2FL5B 2R29L 1CE1L 4PRIA 3X13A 3BRDA 2VWEE 4KTDL 5F9OH 4EXKA 3BISA 4LSVL 5GHWL 2DL9A 4GJTB 4XPFH 2V5YA 3FZUC 5IKCB 3I6LE 1U8PA 1JNNH 1V7NH 5I8OL 2WK2A 2CIKB 4JM2B 3ZL4L 2AI0L 2Z31C 4Q6IB 3X14A 4WO4C 3QFJD 2KQNA 3QDGB 2HFTA 4PJEE 2N4IA 2CD0A 1V3MA 5BJTA 5D70H 1N8ZB 3GIVB 5E2WH 1JN6A 1OT2A 4EN3A 4OZFH 4R7DA 1S7TB 3MUZ1 3GJEB 3PWNA 1FP5A 1EO8L 1AD0B 4R0LA 4IJ3C 5E6YA 3AS0A 5IEKA 1C1EH 1PAMA 4WFGD 4PJ9B 1CFQB 1FNLA 1T2JA 1U2HA 4XMLL 4ZS7L 3QR2A 3DV4A 2DLGA 1CDUA 2QSTA 3KJ6H 5FM8A 3MGOA 4KC3B 3ARDA 4KQ3L 4F8QA 1J8HE 4BSJA 4JREC 1WISA 4LDLB 1UM6H 4HCRA 3OXRA 4OTXL 1KSRA 2AJZB 5HHXH 3VFVB 1ETZA 1A7NL 5J1AB 4H88H 5DEFA 4QF1A 4RNRA 4OV5A 2Z31D 5BMFH 1JV5B 2J2ZA 2JJVA 4NZTH 1A6ZA 1OAKH 3QI9D 4MMXC 4ZNEE 1Q1JL 2PR4L 4JFEB 2F5BL 4BYHA 4KJQC 2VLKA 5DMGC 2YXMA 1W0VB 3O3AB 4LKXB 1YEIL 5D5MA 2EH8H 5DD1H 4NKOB 1FL6B 1LE9A 1KCSH 2VZVA 5IEHA 3ZE1E 2AJYL 1NSNL 2BVUA 3FB6B 3QFJE 1VFBB 4XVUC 4AL8L 2BHZA 1NBVH 3DX6A 3HN3A 1FDLH 4IIQC 4PY7A 3EYUL 3LS5L 2VLRA 1CE6B 3IYLW 4LASH 3OGOE 3L1OH 1KPVB 3PDOB 4QTIH 1YECL 5JDJA 4EIGB 1GH7A 1WFNA 4OLZL 4WFGE 4CDHA 1U91A 3O11B 3EJYC 3E1F1 2RQ8A 2W38A 3SHSA 4LSSH 5HVFB 2XTJB 8FABB 1YPZE 1B0WA 5JW4M 1NJ9A 4Z7NF 4KJQD 5IROA 4G42A 3MV11 1KGCE 3CDGA 5DMGD 4TULH 1UWXH 5JDSA 1QO3A 2OR9H 5B21A 2Q86A 5JLZB 4KKLC 4ZD3L 2AJ3A 1NGYA 4BK4A 7FABL 5KVEH 4FABL 4B7LA 4IOIA 3TVMC 3VXSB 5B22A 5ACZB 5F88B 4QCIB 3WJLA 2HLFC 1MFBH 3MLVL 5IVXB 3ZE2E 4X6EB 3Q1SH 2APBA 2LQRA 5FFLA 1QSFE 2Z91B 2XICA 1BPVA 1YC8A 1QRND 2VOTA 1UQSB 3EFFB 1I9EA 4GXUM 3IVKB 3UXFA 3C5JA 1BJ1H 4YFLF 1NCCH 1T3FA 4OGXL 4EUPG 5TE7H 1WEJL 4G7YL 1CN4A 1DANT 4PRNA 3VW3L 2SEBA 3MRJB 1H0DB 3W2DH 1EK3A 4G8GD 4Y5YC 4DGVL 1DFBL 2V7NA 1UYWH 5IMOB 1IILE 4PB0H 3GMPA 4QRPE 4AIOA 5B39B 2EDNA 3LVEA 5BVPL 5A2LH 5AWNL 4KKLD 4QHKJ 4G8FA 4HLZG 4HUMB 4J3UA 1JWMB 3UYPA 5INCB 3VCLB 2G9HA 1KJ2B 1F45A 3O4LB 3LZFL 2XRAH 5LBSH 5KTEL 4GRWE 2EDBA 2HLFD 2JB5H 5DRNB 3WFDL 2ORBH 1HHJB 1J87A 4LSUH 2JK5A 4N0RA 2G5RA 2R8SL 4DAGH 4K3DL 3SQBA 4XCYB 2X4NB 4IHOA 3T09A 4HWZB 1YDPB 4JFHD 2DQTL 3F8UB 1RIHH 3CVHA 1BF8A 3G9VA 1A02N 2XZZA 3KDMA 1P84J 3GSNL 2BXYA 5IFAH 1JWUB 5C92A 4UQ2B 3C6LC 1HK6A 5JQHC 5DJYB 2WIIB 3SPVA 3EJJX 5MI0C 1MHCA 3EDDA 3X3FH 1QRNE 3BN9C 4TPRH 3VMOA 4Y4FA 2R1WA 4HK3J 5LGHL 3RPKA 1FLRH 2WINA 3MX0A 3HC3L 2J8OA 4N8CL 4NFDA 4NUJA 2Y36L 4MQ7A 2FLBT 4N1HB 1ED3B 4PJCA 3HMWL 4G8GE 3IXTA 1BQHA 4E42A 3AM8C 4TUOA 1VPOL 3O6MH 4AEIH 1LNUB 1U92B 4LSTL 1NANH 4DVBB 4FXLA 5L8LB 4MD5A 5K9OA 3MRNB 2YXFA 3KPOA 4Y2DA 1IMHC 2IBGA 2R4RL 1D5BA 4ODVH 3V9FA 1IJ9A 2DQFB 5DUML 3SKJH 1EGJL 3C6LD 3G5YB 1ND0B 4RGMB 1A5FH 1HOCB 3UBXA 4YXHH 1E4KC 5E8DH 1RU9H 2HT2C 5ESQB 1A3RL 5DK2B 3BN9D 3T1WA 1PKQE 4N90D 4QHNB 1HCVA 4HXBH 3L3HB 1MRCL 5T1DH 5HHQA 1UA6H 2GSGB 3KPTA 4P5TA 1MF2L 4JQXC 2CDEA 4JB9H 3NAAL 4GW1A 2XYCA 4PGDA 4CN6A 4NNXB 5KSVA 4I0PB 1R24A 1DBML 1XCQA 4HAFA 1P6AB 1SVZA 4KMTH 4DCQB 4IMKA 1CF8H 4NRYA 1BBJB 3SGKC 3K4DA 1SMOA 4PRPB 4P5MB 1RZ7H 3UPRA 2XIDA 3VXUE 1F3RB 3CLEH 1XGQA 2YA0A 3ALPA 2CUIA 3FKUS 4N0CC 4EQ3A 5KSBB 4RSVA 5I74B 4TVPH 3GRWH 1KB5L 3ARRA 1JP5A 3QULB 1G7IA 4MLSA 1NFDA 1F90H 2HT2D 5FO8A 4JHZA 3I75B 3HZYB 2I07A 4P57B 4RAVB 2YA2A 1YEKH 1HHHA 5EWIH 4H8WH 3RIFF 1ZANL 5CD5D 3PP4H 5KSAB 4JFYA 2WWKT 3VXRA 4D8PB 1KNOB 5FO7A 1G7QB 1KPRA 3OX8B 3BXNA 1Q9WA 4KROB 2C7UB 5C0RH 1CL7I 5FKAA 4DGIL 3KXFB 1G9ML 1FN4B 2GI7A 3NBNA 3RUGA 1H5BC 1BZ9B 3MLTA 2FO1A 4G9FA 4W6YB 3C8HA 2QADD 4XNUH 1VGKA 3CH1A 1MCLA 3HE7A 4HH9B 4F7EA 4N90E 4I2XA 5L8JB 5IB5A 1IKNC 3RGVC 2DLEA 5FV1L 4YO0B 4JY5L 1T0NA 4GAJL 4YHLL 4AYFA 1ZLSH 1UJ3B 4KPHL 4N0CD 3B5TA 1CK0L 3ROLA 1GGBL 1OPGH 1K4DB 1MI5D 4GUPA 3GM0A 5ANMB 3CVIL 4S1RL 4OLXH 3D69A 4CADA 4KZEH 3NFNA 5HHOA 2XA3A 1AI1L 3DBXB 5EG6C 5I8KH 5JHLL 3MV01 5GRVK 5I1EL 1CT8A 1TJIL 1V7MH 1X5AA 3DRQB 3Q48A 4K7PH 4XXCC 1FNSL 3IJSA 3NABH 1IEAA 5C09D 3OKEA 3RWEB 4PFEA 3FQWA 3MOBH 3BQUD 3N1FC 5GSVA 4HS8L 4QTHA 1A3QA 1MCFA 2VDML 4UB0L 2V17H 3BMWA 1ZS8A 4WENB 3VWJA 3MPCA 4BK5A 4F7CB 3C09C 3MBXL 4X98B 4XWGL 1ZLWH 3H9YA 4HJGA 4DN3H 2W65B 4PGBA 5HYQA 4FFVD 1H15A 4PJ7B 2I5YL 5EULV 2DTML 4MSWA 5GGSA 3OJMB 1YYLH 5L6YL 2EYTA 2B1HH 2P8LA 3GI8L 1Z9MA 4U3HA 1LO2L 1QLEH 4L8SC 4I4WA 1T7ZA 3GBMH 1OB1A 2GJZA 2FNBA 5KBNC 1KFAH 1BD2A 4F57L 5A3IC 4P2CG 1DP0A 4KWUA 1NEZA 3S5LG 4GRMB 3OKOB 4Y4KB 4N0YL 5FUOH 3PL6C 3G04A 5I1IL 2OZ4H 1WBYA 3MRKA 3UDWC 1N0XL 5HHPB 1YEFL 1A1MB 2HJKA 2R2CA 4M62H 1MIEL 2D7NA 2VDQH 4NO0A 3FO9B 2AW2A 3O81A 2AKRB 1RSFA 4X5XA 5LXGL 1AO7D 3OHXB 5ICYB 2OSLB 2PTTB 4HMCA 4OLVL 1DSFH 3KWWA 1QBBA 2AJXH 4IDLA 5DHYA 1DR9A 2A9NL 2IBZY 3DMMC 4PJ8A 4JR9L 5FYKU 3TBVA 4UDUA 2YSSB 2QKIB 3KLHC 5I9QB 4XMKH 1NBYB 4AG4H 4ZAKC 4NYLB 1MY5A 1OD7A 3G6JA 2B2XL 1PD6A 4Y0GA 4GQPH 1NDMA 3D48R 4OCXH 1W0WA 3PHOA 3WS6C 5FKPA 5IV2A 5DI8B 4FFYH 5ISZB 4QY8A 1YEGL 4JZJC 4ZTPH 5J13C 1NCUA 1BVKB 3GJFA 2R1XB 2JCCB 1TZHA 1BEYH 3PHQB 4FXKB 1NMBH 5DJ8A 1U8MA 4W68A 3UROR 5HHVH 1L7IL 3RHWK 1UJTA 2APWA 5K33A 5C0IA 2OTPA 1CFTB 2JE8A 2XQYK 3MUHL 2UZIH 1ITCA 4YHPB 3TV3H 2GT9B 4FA8A 1P4LB 3DMMD 1G7JB 1WGOA 2VL5B 3HI1A 4UT7H 4KTEH 5FYLL 3TBSA 4WU5A 4H25A 2PO6A 1K2DA 5F6IC 1OWWA 3D25A 4LCUB 4ODUB 3EYVB 3QXWA 4UUJB 2C3GA 1I7RB 2CXGA 3SKOA 3STZA 4E41A 1KEMH 4MDJB 1JVKA 2ZCKH 4YBHA 4X6CB 2EC9T 4Q74A 1BOGB 3WE6B 4CNIA 1G7HA 5EN2A 4EQ2A 3UTQB 1N5AB 2XN9D 3BIAX 5JIIA 4H5SA 4R4BA 2M2DA 4Y19D 3BD4A 1XIWC 4P2QB 1LP9B 2DMKA 1DUYB 1FZKA 2IF7A 3EGSB 3MJ7B 4DFIA 1YMHA 1HZHH 1HQ4B 4Y5VB 1Q9KA 3IFNL 3BJLA 3UC0L 4TUKL 1HIMH 2OJZH 5DD6B 4X99B 1KJMA 3S3PA 3BEWB 5JR1H 3FAWA 2XA8L 5EZLB 2Q8AL 1J12A 5IHZA 5KS9A 2M8XA 5BQ7B 3U30B 4DGYL 3E6FA 2R69L 4PJIA 3U1SL 3T4YB 5ESAB 2LU3A 4HKZA 1KPUA 1JYWA 2BNQE 1UT9A 5BW7C 1AHWC 3IF1B 4LAQH 5AD0B 4TVSa 5DEGA 4WUUE 2H8PB 2FJGB 1MRDL 1NGPL 3VXMB 5DJ0B 5EBWB 3CXDL 5IGXH 1KENL 4WDIB 1ADQA 4DZBB 4NKDA 3RRQA 4TQEL 1XIWD 3L5WA 4U1MB 4B50A 4XC3L 3KGRA 3H8NA 1PDKA 5HVHC 3S96B 2BOCA 2V5MA 1OGTB 5DJ2B 5DJCA 1R3JB 2X70A 5IQ7H 4PTUA 1V05A 2XN9E 5D2NA 4ELMF 2VDNL 3WFBH 4Y19E 3UTZB 1SJHB 5MENB 4HMDA 5JORB 2VISB 3QDJE 4HWBA 5LGJB 1JGEA 4JDTH 2YUVA 2HKFH 3CDCA 3RA7H 2HFFA 4P9HL 5IUSA 2ADGA 3PV6B 4FQJH 5T33H 1P1ZA 1D6VL 4XVTH 4R7NB 3BP7A 4MJIA 2R2EA 3EFDL 3FQUB 3TNNA 2ZSVA 3G6DL 1G9NH 3QEHB 4LIQL 3RWDA 1KCKA 5JO5A 3MV7A 4P4KA 4DTGH 3WCYA 4WNQA 1HNGA 1PG7L 2H9GA 1M7DA 5GS1C 5HBBA 2Y25A 4K8RD 5E6ZA 4OZHA 1YMMB 1CGSH 3D1MC 5ICXA 2D3VA 1WIPA 4X4YB 2WBJC 1QHOA 5D4QA 4DW2H 5T1MA 3N1PC 4RMTA 1INEL 4RQQB 1NEUA 2X5PA 1AJ7H 1ZA3A 5L8KB 4CRPA 3TYFB 4LFHD 5MERA 1JZ7A 4UILH 2NLJA 3QEQB 5CSZB 4YQXL 3DYOA 5DD5H 3HG1A 1BM3L 4K7PX 5CHNA 3HKFA 1MQ8A 3R06A 4YR6B 3NGBB 1IBGH 1PY9A 3H0TB 5FV2A 3S35H 5C0BB 1A2YA 3D9AL 3TC9A 3BZEB 1IZKA 3U0PA 4UAOB 1EHAA 5IF0B 3MLSH 3O8XA 3V7MA 2EDTA 2V7HB 4LBEA 4WW1B 4Q9RH 1AD9B 3QNYA 4HX1B 3RVWD 3FCTB 4OAWA 1UGNA 3FB8A 1WITA 3KPPA 2XZQH 2VZTA 3D85A 3Q3GB 5KAQG 1A7PL 1F58H 4XCNA 3T08A 2Z4QB 4HC1L 4M9PA 5GJSH 1TXKA 1Y6MR 1FG2B 1U3ZA 1ORSB 3MV9E 5IB1B 4OI7A 4GRLB 4D9LH 4P2OB 1RI8A 3OSKA 1YQ2A 2XACC 5IBLC 5D2LA 1ZLVH 1MEXL 3K2MC 3NN8B 4ONFL 5TDPB 1AGDA 4KK9C 3D2UD 1JZ4A 5T1KD 1JNLL 4EN3C 4OLYL 2EDFA 3LKRA 1VEPA 1G0YR 1LO3L 2FYYA 2QHLA 1O5DT 3DGGB 4R0LC 3KPSB 5DQJB 1IAIM 1RZFH 2DICA 2F54D 4LGPB 1INDL 1RHHA 4XBEL 1CLYH 2P48B 3PGFH 4LLMB 4PRID 4HWEH 2R29H 1CE1H 1EAPB 1A64A 4KTDH 3SJVA 3N0PB 4LGRB 1NH6A 3ARDC 4FQLL 2IANB 4HK3N 2QR0A 2OL3L 1WWCA 2GITA 1U8IA 3WNLA 1J8HB 3HZKA 4EDXA 4LSVH 4HUWB 5GHWH 3CZFB 2YD6A 2DWDA 2ZOLA 5TQ2L 3MOQA 4XI5C 4HZLA 2C1OB 4ERSL 5I8OH 4XC1L 5IBLD 5D1ZA 1I1FB 5CAYB 3ZL4H 2AI0H 1YA5A 2K1MA 3QQ4A 3VFWB 3BZDA 2A6JB 4KK9D 1Y6NR 4WI9A 1DTUA 1ZTXL 3N06B 2VH5L 4EN3D 4QGYA 2YK1L 1OM3L 4XVJL 4UOW0 4BKLA 5BOPA 5BXFA 3OWEA 4BFGA 1SYVA 1JRHL 1EO8H 2L7JA 5L7XL 4HIHA 3BD3A 2DI9A 5GQBA 4KMQA 3K81A 4PJXA 3MBEA 4P59L 2NZIA 4IDJL 4XMLH 4ZS7H 3QFJB 5DDHB 1DDHA 3FN9A 4X9BA 3QO0A 3IFPA 4MD4B 3RKDD 3ARDD 4P3CL 4GAYA 3MCLL 3FQTB 1D5IL 4NBZB 2MCPL 1OP9A 3QPXL 4KQ3H 5CBEA 2DJ4A 3OAUL 3L3JA 3H9SA 4XRCA 5KOVC 1G7LA 2F54E 4D0DB 2XV6B 2JJTA 1JGDB 4Q0XL 2YA1A 1EEYB 1R5IA 4OTXH 5GRJL 5HJ3B 2DM4A 3K2UL 3BGMA 5SWSA 5FAAA 1I1YB 1A7NH 5DTFA 3OAYK 2MJWA 5I1JL 1IKFL 3MZGB 4A2LA 1ACZA 4URTB 5EZJB 3QIBC 3VG9C 2MKLC 2Y5TA 4KXZH 5JZ7C 4G43A 4PR5B 1U93B 4EVNB 2VLKD 5IROC 1Q1JH 3CFIC 2PR4H 2F5BH 3DRTA 4AM0A 4F2MA 2ARWA 4EI6A 1YEIH 4ZFFB 3JWOL 1KBGL 1CDGA 2XG4A 1HHKB 3RDTA 2Z31B 3B6SB 2AJYH 2HYMA 1H8OA 1NSNH 1OAXL 2X9YA 4ZDHA 1U8NA 3TA3C 4AL8H 4U7KA 3QI9B 2VLRD 3FT2A 3EYUH 3LS5H 1LE5B 4JRYE 3V2AR 3WHE1 1CG9B 1X5IA 2BRQA 1YECH 4IJ3B 4X6BB 3FT4B 2APTA 2Q20A 3V6OC 3GMOB 2E9WA 4OLZH 2BC4A 2LFGA 4ONGL 2ADJA 4LVHC 5GGVL 3V5KB 2Z92A 3QNZA 1C08B 4OFPA 3TGXA 1CQYA 3TO4C 3SE4C 2V5SA 3L3OA 5JZ7D 4PB9L 2DMBA 3BP5B 4PV8B 4KRPD 2WW8A 1B9ZA 1FGNL 4OT1L 2AXFA 4WCYL 5KVMC 3OMZA 3J7HA 3MA7B 4ZD3H 1XGUA 4F9LC 1OD9A 3VJ6A 3CSBA 3TBYB 1FFPA 4HGMA 1VFMA 7FABH 1WK0A 3TA3D 4Q6YA 1T1WA 3T8XB 1MVUA 2DBJA 5GSRA 2ICWI 2CLZB 4JY4B 1YEDA 3V5HA 3MLVH 4JE4B 5E4IA 1PJ9A 2FR4B 3NFPA 1ONQB 4OBSA 3QJFB 1MWAL 3QZWB 4F7TA 5EO1B 4OGXH 1F3JA 4EUPB 3TO4D 1F6FB 1WEJH 5KVFL 3X12A 4G7YH 4A2MA 4XNMA 3DTXA 4GAGL 3VW3H 2FEEI 4WTXA 5D72L 1C16A 3IDGA 3BZFB 3U4BL 2X4OA 2CLRB 2YZ1A 4DGVH 1DFBH 4TVPE 4YNYA 2JIXD 1AE6L 4XNYL 4KU1A 4Y4FC 1CXLA 3WIHL 5BVPH 3Q5OA 3RBSA 3AY4A 4NM4L 5AWNH 5GS0D 1CFNA 3FO0L 2GKIA 5JPNB 2IQAA 2FIKA 4ORGB 1NGXA 1TENA 3LZFH 5DVKA 5KTEH 4G8GB 4JRWA 1SBBA 3WFDH 5EU5B 3FO1B 3LKSA 5CJQL 3O3DA 3LCYA 4DZ8B 2R8SH 4K3DH 4UT6L 3EYFA 4PJHB 1TQBC 4F7MB 4JO2L 4I0CC 4OQTL 3EO1B 2DQTH 3DXAA 2PYFA 3U4AA 4R2GC 4CU6A 4PD4J 1I1AC 1RZGA 3SGDI 3GSNH 4APQC 5C0CA 2EDQA 5KSUA 3T04D 5IB3B 1Q9LB 2DQHL 3C8KB 1QBLL 4YC2B 4TNVF 4F37F 3REWA 3H9ZA 4J3XA 4HK0A 3V6OE 3T3MF 4EDWL 4NZUL 4Y4FD 1I3RB 3LKOB 3AREA 3MLWL 3ARSA 4GKZB 3WHE0 1X5GA 3CAFA 5J6GB 5LGHH 2Y07L 1U58A 5E8NB 4IRZL 3N85L 3HC3H 4ZUVB 1J1PL 4N8CH 4AZ8A 1DLHA 4NSKB 2Y36H 3LIZL 3IDMB 3HMWH 4PRHA 2P43B 3OPZL 4OI8A 4HS6B 3VFNB 2EDWA 1VPOH 2H2PC 1G7MB 1F11B 2NY0C 2J6EA 4LSTH 4OIAA 3AFLA 4QNPF 4U1IA 3RWHA 4XZUA 4L4TD 1XF5A 1NBZA 1WLHA 1WFOA 2G2RA 2G75A 2R4RH 4WHDA 1WAAF 4APQD 5DUMH 1LK2B 3A67L 3B3IA 1EGJH 4PJDA 1T2XA 1T4KA 5DQ9A 4MQSB 3RX5A 2ZSWB 2BCKA 1A3RH 4PLJC 2IWGA 2AJUL 1M71A 3MRMB 2X40A 4MA8L 3HS0B 4TSBL 4ZYKA 4Y5XC 3FFCD 4JO3L 4X6FB 1MRCH 5EU4B 3GSOB 3WLWC 1A4KB 1MF2H 4Z7OF 2NTFB 3C6LB 3NAAH 3VRJA 5I1AB 4NQCA 1CLCA 2VXSL 4HIIB 4D9QE 2RR3A 5DZLA 4B5EA 4L3AA 3I6GB 3GUTA 3JUYA 1DBMH 4MB5A 4QRRD 5EC2A 5EU6D 4K2UL 1ORQB 4A6YL 1T66C 3TIDA 2AAVA 3AVEA 1DBKL 1MLBB 1A6TB 5FDYA 5I0DA 1J0YA 1KB5H 4KDTC 3SEPA 4Z7NE 5BS0A 2D4FA 4HKXB 1IAKA 4BQCA 3LRGA 1M7IB 4PLJD 2Y4SA 2P47B 3ARBA 4L4TE 4WFHE 3U83A 1ZANH 3VXRD 3DO7A 3QRGL 3WLWD 4RBPK 4MWFA 5F96L 4DN4H 4Y1AD 1M4KA 1RHFA 3VWJC 3OG6B 1ZA6A 4DGIH 1O7SA 3ARTA 1G9MH 3TN0C 1ZVHA 2F74A 1NGZA 3FFCE 4R3SB 1T66D 3OR6A 3WUWG 3CFDA 1WBXA 3H7BB 4PJGF 1QPXA 3HAEA 4I18A 3W5MA 4MJ6A 4JY5H 1NFIA 4GAJH 4YHLH 4WW2A 5IVZA 4KPHH 3WDJA 1CK0H 3GMMA 3MNWA 4NFBA 1GGBH 1R3LB 1G9NC 4HDIB 3BUYA 1ES0B 2ZUVA 3CVIH 2QADB 3BUTA 4S1RH 4QRRE 5EU6E 5I18L 3PWUA 1AI1H 3N50A 2OS7A 5JHLH 5KJRL 1QFWL 5I1EH 1TJIH 3LKPA 2P8MB 2V6HA 3FOLA 1FNSH 5D8JL 5B3JF 1UXWB 2D7MA 2VITA 4HS8H 1HSAB 4NZRL 4YXLL 4HUXB 4HT1L 1NFDE 5DC4B 2VDMH 5DK0A 1MI5B 4UB0H 5AAMA 3HHRB 3VWJD 3TN0D 4RFEB 1KLUA 3BW9A 4KV5F