2FSEA

Crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
178
structure length
178
Chain Sequence
EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, structural protein
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Crystallographic Structure of a Rheumatoid Arthritis MHC Susceptibility Allele, HLA-DR1 (DRB1*0101), Complexed with the Immunodominant Determinant of Human Type II Collagen.
pubmed rcsb
source organism Homo sapiens
total genus 32
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fseA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2fseA01
4N9GB 4X0KA 4H1LG 3B6SA 4HIXH 1IGYB 4LHUA 1H0DA 4OZHF 1UWEH 3WEXA 2VISB 5EO9A 3VI3F 2PN5A 3MRFB 5D2LE 4LARL 4PLNC 1MJJB 3PXJA 3TFKC 2A83B 2LQRA 3BMWA 3BVNB 1I9JL 1PEZA 4P23C 2AABL 2P45B 5BQ7B 3NA9L 4FN0A 1JPST 1IJ9A 2FX7H 4NNYA 1A3LH 4FQ1L 2VDKL 2BVQB 4D9LH 1YYLL 2PYEA 1EHLL 4AIZB 4Q6IA 2ZPKL 5EN2B 5T3ZH 1NLBH 3PNWB 1N64L 1ZHKB 4HBQA 2VABB 5D7JD 1Z9SA 2BHYA 4ODUB 5T1MA 4WW2F 1LP9A 1VACB 3AAZB 2DQUL 2VR4A 1CTNA 5JNYB 1DEEA 3P40A 2M8XA 4OF5A 2H3NA 4NO2A 1MOEA 3CX5K 4QF1A 3U7YL 3WJLA 1JV5B 4XNZC 3RAJL 3D0VA 4OGXL 3QDJB 2VDMH 1FJ1A 5BS0E 1IC7L 2VDOH 3QPXH 5E6ID 1XAUA 1DQJB 1BQHB 3EFDH 4RWYL 2P47B 4Y4KB 4HKZA 4HIEB 5GGVY 4KI5C 3MZGB 1WCBB 4N0YL 5ESVA 4U1IB 3TIEB 4M03A 4Z7VB 4BFBD 2ARWA 3SGDI 4KU1A 2VIRA 3IKCA 4L9LC 2Q86A 5EU3B 2J4WL 4HH9A 4L3AA 1CVSC 2A9NL 4Z0BL 3JWDL 5FOBA 1UXWA 4YHML 2YPLE 4UOW1 1QSFA 5I17A 3HR6A 2NCMA 2H32B 4PJXE 1T0NA 5C9JA 4X5XB 3ZKND 3NTCL 2DTML 1RIVH 2ORBH 2BERA 2X4UB 5AEAA 3QEUB 3TN0A 2AXFB 1F90H 5FYLH 1FSKB 2H9GB 1WQVT 3B9DA 4NJ9L 1YEDB 4C59B 3ARZA 2DQJH 2HN7A 3O4OB 2DMCA 3QJHA 2J6EL 5C0BD 3AY4C 1QR4A 4QGYA 4NN7B 5E70A 4JFEE 3G5ZB 1KJ2A 4PRBA 5GGRA 3MRCB 3GGWB 3HG1E 4ZAKA 2I9TB 2R56L 3T4YB 3GMLB 1DP0A 2C3WA 3UTZA 4FFWD 3V6OA 1OLZA 4JFZH 4NT6A 5JO5A 1IT9L 2X89D 3NACL 1RUQL 4OZ4A 1QUNA 5F7EL 2VLKD 2ZNXA 1ACYL 1TZGL 1XR8A 1FCCA 3WIFA 4LMQI 3X11A 3NGBB 2DS4A 3LKQB 1T20B 1ZKAA 3SJVD 5DD1L 3T0EE 3P73A 2NW2A 4U6YB 1ZA3A 4WJ5B 2IADA 4MNQE 5ALCL 3OKEA 2V2XA 3EOTL 4K55A 4C56B 3GHBL 4FQPA 4P5KA 3VG9B 4GW1B 3VGEA 5IFHL 1MCFA 1BJ1J 3AUVA 4HKBA 4OIIH 1OAYH 4EOWH 3N1GC 1HHGA 4GRWE 3R1GH 4Y1AA 2WV3A 5MEPB 4OGYH 2XY1A 4EI5B 4NP4L 1NGWA 4F58L 4LHJB 5B22A 4ZUTA 4FQCL 5T5FL 5I73B 5FCSH 5ICXA 4M5YL 4A2LA 2WSKA 2NY6D 3GB7A 1FSKC 5KSAD 3IRZA 2FBJL 1E4XL 4JY4B 4E5XA 2LVCA 4HUVA 1ZLUK 4Z5RA 3O4OC 3MRGA 3BPCB 3KPRB 4ODTH 1GH7A 1YNTA 3MTRA 4ONHA 4NN7C 2AQ1A 1RIHL 4U1HA 3HNSL 1MHHA 2CKBH 1VGEH 2CLRA 1NCWL 4KMLB 4XPBH 4TUOA 4TNVK 2AJVL 1EERB 8FABA 2PXYA 1F8TL 5K33A 5FIEA 4AJ0A 1PY4A 1F4AA 1AFVL 3OB0K 2V2WB 4LPTA 5JORB 1OTTC 5FGCB 5DURB 5ESAA 3BGMB 5DYOB 1MCRA 3RKDD 3UMTA 2XI9A 4PJDB 5JPNA 1UZ6E 5K9QI 1UM4H 3NGBC 4M1CD 5C0GB 1PG7X 4JQXA 1NLDH 2VZUA 3OHXA 3PWUB 3SGEI 3OF6A 3CD4A 4OGAC 3LN4B 2VLJE 4OJFL 2XN9E 2YD2A 4HWBA 5IHUH 2GITB 2CD0A 4LRIA 3OJ2C 2HRLA 1UM5H 3G08B 1TPXB 3SPVA 5AG8A 4BZ1L 3FN3A 1DQMH 1IZKA 1FZKA 1N8ZA 4WENB 4O2CA 2XQYK 3VG9C 4ZOEA 3O2VH 3CFKB 1U8MB 3VCLA 2UY6A 1M6OA 5IEHA 1E0OB 4G5ZH 3I6GB 4QRRB 4HQQH 1U6AH 2KBGA 1OP9A 4KHTH 2DYPB 35C8L 3LH2L 4JDZA 4EI5C 3ZKMD 1LE5B 1L6XA 2W0LA 1HNFA 4UTBH 1VFBB 2OZ4H 2IAND 4Z18A 5I73C 3PQYE 3MACL 1FORH 3EO9L 3SDYH 1BQHG 3V0WH 5GSVB 4WFHD 4MNGB 5HI4D 2CK2A 1G7HA 4N0UB 1P7QD 2R15A 4ODSL 1D5XA 4PP1C 4X80H 5FDWB 1Q9KA 4JANB 2BSTA 4CU6A 5F7KC 4TULH 4NBZB 4BUHA 2BNRA 2IG2H 5IVNA 3N1PC 1BOYA 1CU4L 4YDVA 3C5ZD 3GI8L 5IB1B 1J0YA 2APWA 3BYYA 1GGCH 1YUHB 3UBXB 3LSOB 3WIHL 5FKAB 2BX5A 2WZPD 1JNHA 2H2PC 2CRMA 4XPGL 3VRJA 5CD5C 1UH2A 1Q94B 5CMAA 1L9NA 1EFQA 2XKUA 2BNQB 4HKJB 2XICA 5C0EA 1NGYB 4LSVH 5HGBB 1MCPH 4PJEA 2ARJA 4JFOB 2Y25A 3AU1B 2QLVB 4HFWA 4KK5C 4C55A 4DQOH 3QHFH 3J7HA 2F19L 1CLOH 2DI9A 2LVEA 1U42A 2NQCA 4MA7H 1NDGB 2AV1B 2ICWJ 2C3HA 4HUMB 1JHKL 3C6SA 4UIKH 3H3KA 1TPXC 3FB5B 4EDXB 3D2UB 4WHTA 1TZIA 4PJFB 5EULV 4O4YL 3BIKA 3FB7A 3FQRB 2NZIA 3U46B 4TUJA 2X4RA 3D9AH 1MWAA 4NOBA 2P8PB 2OI9C 1FAIL 4LDOB 5IFAH 3DUUA 3D0LA 4XVSL 1QLEH 5EUOA 3RX7A 5E6IB 1DZBA 3ILQC 4KH2A 3LKOB 3OL2A 5TF1L 3KYNB 1PVHA 1R5IB 1II4E 4Y16D 1A47A 1QZ1A 1T5XB 1DBKH 2HT4D 5C09D 4I3RH 1XR9B 4PJEF 5B21A 5ETUB 5I0ZA 2ESVA 4LLAA 2EDEA 4L5FL 2GFBB 4L3ED 3MLYH 3K8LA 1I3VA 4IDJL 3CVHA 3UYOD 3O6FD 3S34L 2VE6A 3NCYS 1JK8B 5HHNA 3VFTB 4DGIL 1B0GB 2IMNA 5INDB 2OJZH 2AI0H 1DBAH 1MNUH 2YD5A 4RCAA 3MO1B 3KR3H 1DLHB 4GKNA 2Z8WC 4JRYA 5E7BA 5IR1A 4WCYL 2VAAB 1G9MC 1KENH 3BRGC 3CAFA 5IQ7L 4BA8A 4PRDA 4QHUA 3S7GA 2ADGB 4ORGA 2WBWB 5L88L 5C0BB 1X5YA 4LHUD 5EUOF 3EO1B 4V2BA 4K8RD 4HT1H 1OSPH 3KPQA 5ACZA 2F9BT 3O11A 4GH7B 4XCNB 2D7OA 1G7PB 5HVFB 5HYQA 1I4FA 5KANG 4PJ7A 2VH5L 3QO0B 2FCBA 3GDBA 3CFDA 3HA0A 1B6DA 4ZG1A 1XGQA 3G04A 2GK0B 4XPTH 2PYED 5E6IC 1X5FA 4M4PA 5C6TL 1ZANL 3ZHLA 2BJML 4R2GD 1BQLH 2IQAB 4KAQH 4LCIH 1TCMA 5DFWH 1CT8A 1RJLA 1UCBH 3NFSH 5IGXH 3X12A 3FQUB 2Z8VC 5DS8A 5K93A 2W60A 5EIVA 3E8UH 2VR5A 4H26A 3VXME 1FG2B 3D69B 1SM3H 3MLZL 3OAYK 2FWOA 5FXCH 2IGFL 5HI5D 4Z7WA 2YK1H 1U3ZA 3NIDF 1H3WM 4XNMA 1XCTA 2EYTA 3QFJB 3ZKNC 3W9EB 2VLRA 2ZSVB 2DRUA 1LO3H 3PUCA 1A7OH 2NXZD 3ROLB 2ERJB 1LK2A 3V9FA 2NY6B 2R2EA 1LK3L 3MV7E 5KSAB 4PJ7F 1N2RA 3T2PA 3MA7A 5C08B 3E3QE 5I18L 4PY7A 1NC4A 3HFMH 1BHGA 2DQGL 1WIUA 3RBGA 32C2A 4QTHA 1WICA 3MLVH 4YUEL 4HF5L 3QISA 4AZ8A 4XWOD 3IF1B 2PYFA 1QSFD 3VXRE 2OSLB 4I0PA 3X14A 3CCHB 4GMTL 3C60B 1OAKH 5IB4A 1SVCP 3UBXG 1EJOH 1T1ZA 4FFWC 1T1XB 1LWRA 4LEOA 4EIGB 4JHAL 3TN0D 4FQXB 4OCXL 3QNZA 1AXTH 3S4SB 1QACA 3VFVA 3VXNB 2KH2B 3BZFB 1U8KA 2QR0A 4OB5H 4TSCL 3IJHA 4G42A 1JRHL 3BW9A 2OL3H 3MFFA 1T03L 2ED7A 2C4FT 1VFAA 4RISL 3O6ML 4WUKL 4ZAKD 5JDSB 4G8GB 4L4JA 3DX7A 4JB9L 3GSWB 2E7CA 4QXTB 5DSCA 5F9DC 3GZKA 1S3KH 1TTGA 2P44B 2X4QA 1A2YA 1KIPA 2NY1D 4ZOBA 5I1AA 4HFUH 3BKYL 4W68A 1KF9B 2J8UE 4H1LH 4YE4L 5JXED 3ROOB 2KL6A 5I8KH 3UZEA 1EEYB 5JW4M 4PJCB 5JW3L 2IANB 2ERJC 2ATKA 3RU8L 3F7QA 5KVFL 3WMSA 2NY6C 5KSAC 3SE4C 1A9EB 3ETBF 1E6OL 2HLFD 2DQHL 5ANME 2WP3T 1P7QB 1HHKA 4WV1B 2KZ1B 4Q9CA 4YX2H 3VFMA 3QSKB 5FO7B 8CGTA 2CDEB 2AP2A 2DLTA 5L9DH 2GJZB 2HVJA 3DYPA 1QQDB 2V17H 2FYYB 4OTXH 4Y1AD 4CMMA 1BX2B 1YEFL 3C60C 3EOAB 1KC5L 2DQCL 4U3XA 5GS1A 1MRDL 5B38A 4LSQH 2WBJA 4JCLA 3DUHA 3RWJA 2EZ0D 2VDNH 2W38A 4FQXC 2CRZA 2P42B 4V1DA 2H8PB 2O5ZL 3G9VA 3QCUL 3KLHC 2G9HB 5EO0A 4GW4A 1GC1L 1A7PH 3D39B 3RKDC 1TDQA 3V6ZB 4RAHA 1S7UA 5HGHA 3MZTA 3C5SB 4XT1C 5LQBH 2ITDB 4U7MA 3DMMB 4MJ5A 4JPKH 4HCRL 5IVXF 2R0WL 2ZJSL 3RNKA 3FB6A 3PWLB 2HJLB 2IBZX 1BJ8A 1YYML 3B2UD 1A7BA 1FL3B 1JCKA 3L1OH 1CG9B 2PXYD 3E6FB 3OX8A 4KTYA 4LPWA 4WWKA 3RWDB 3C9NA 5EFIB 43C9B 4GW5B 3FRPA 3LVEA 5CS7A 4XBEH 4HJGB 1BBJA 3TV3L 3ULUC 3MNVA 3AS2A 1RZJC 1FIEA 5FCUH 5EC2A 3UTTA 1A1NA 3W9DA 4OZHB 3JV6A 1MI5A 3OF6D 3OKKA 5HI4C 3QEQE 3O6KH 5EOCJ 4MDIA 1HHHB 4PFEA 3L9RB 4WV1C 1Q9LA 1CLZH 5HI3D 1UWEL 2VWEE 3QWOA 1IM9B 3PABA 4BK4A 4C4KO 4RNRA 3IT8D 4LCWA 1AI1L 1DL7H 1I7ZB 2IBGA 3C5ZC 5IW6A 5EOQL 2EYRA 3LCYA 4OUOA 4XBGA 3R0MA 1K8DB 1A3LL 1KB5B 3FQTB 5F93C 3O6FB 5I1HH 1X7QB 2PTUA 4P49A 4XCEA 4D9LL 2JJVA 1LEGB 1R24B 1D6EA 3SHSA 4X6CE 5T3ZL 4KK9D 5L8JB 2O26U 4KTEL 4O9HL 2HJKB 2QHRH 3IFLH 5F1SA 3V0VB 4QXGL 1UCTA 3HCVB 3HRZA 4IMKA 5E8OA 4XAWL 5FYKE 5DZOA 1TNMA 5AYUH 2BNRD 2GW5A 4PJGE 4RBPK 3DMMC 4X0KB 3ZDYF 3VMOA 1TJGL 3B6SB 3HS0A 2J6EA 3JV4A 3HTLX 3F7PC 2X4NA 5EO9B 4XBPA 1D5BA 4QCIA 3ILPA 5DJ6A 3SCMA 4ETQB 2VDOL 1BVKA 1MH5A 2QSCL 4ZUWB 1CFSA 2KDGA 1EFXB 3PL6A 5CEZH 3GIZL 1WC7B 2YA1A 1U95B 4NNYB 4GKSA 5E2JA 1S8DA 3N85L 1BAFH 1Q72H 5JOFA 3S4SG 2F54B 2IAMA 5IP4A 2WIIA 2PYEB 4I1NB 1GGBH 4U6HA 1EDQA 1B4RA 3DGGA 1FO0B 1I85A 1KV3A 5KS9B 2AJSH 1YEJH 5IG7A 3I2CH 4LNVA 1X5IA 4OT1H 4W70A 3HI6H 1RIVL 2VUYA 2ORBL 2D0HA 3W2DH 3GNMH 3QQ9C 1F90L 5FYLL 4RGND 1FJ1B 5DD6A 3O6FC 4JR9H 1BFOA 4FQQB 4NYLA 2DQJL 3B2VL 4WW2C 4OIBA 3WNMA 4HKZB 5EU6B 2F53B 4K3DH 3GRWH 1IGMH 1V8HA 2APVA 4LPUA 1E4KA 3WDIA 1CIUA 1FN4B 2VIRB 3IKCB 2CDFB 2RCSH 3B5HA 1IGJA 2Q86B 2VZOA 1C1EH 1QO3B 1J8HB 1AIFB 2ESVD 4AQOA 2CUHA 1UXWB 3HAEA 2QQKL 4ODVH 3SKNB 2BSSA 1S7WB 5I17B 3DURA 1M1SA 5A16A 1T0NB 2DQIH 3JWOC 4PIRF 4JQVC 1WEJH 1CIDA 2FIKA 2JJSC 2HFGH 4Z7OF 4LKXA 4X7TA 4ZSOA 4NBYB 2NXYD 1YY9D 3TH3T 4D2NA 5BVJB 5DJCA 4JRYD 2D31B 3V0AC 5CLTA 4KKLC 3MJ8A 4QRPB 3DVNA 1T83A 3R06A 3LEYH 1GGIH 2FJGB 4Z7NE 4KWUA 4G80A 4YHNA 4R2GC 2N1KA 4M7JH 1KJ2B 4NQVA 2COQA 4ZAKB 5CZKA 4CN4A 3QXAA 4EOWL 1OAYL 5C3LD 3UTZB 4NFDA 4OGYL 2X4OB 4XP1H 4JKPH 5JO5B 2P7TA 3RZCB 1MLBA 1WWCA 1MCLA 1FZJA 4XWGL 1L7IH 2CRIA 1XZ0A 2EXWD 4U6XA 4GT7A 4ZOCA 5F71A 1XR8B 1PYWA 5CGYD 2VJXA 3V4UH 1QVOA 2W07A 5B4MD 4P2RE 2CIIA 2H32H 3FQWB 1HOCA 1U36A 4ZDHB 1U8HB 5C0ND 3U30B 4KJYB 2NW2B 1WTLA 3F65A 5C07B 4KK8D 1JNLH 2JTDA 2CKBL 1VGEL 3ZYOA 4XPBL 1X6NA 3U9UB 5AWNH 5GISH 4I2XA 4UOW0 1J1PH 4HXAH 5HHVH 1JYVA 1YC7A 4UT6L 2HAZA 1HHGB 3KYAA 2I25N 1OQOA 4Y1AB 1A1MA 3ARDA 3IJYA 2VLRD 1ODAA 4C54A 4AENB 1HCFX 3WIHA 4DWHA 3IFOA 3ZE0E 5GXBB 5ICXB 1IKNC 1NLDL 2ZCKH 2NMSA 3KPOA 5CJXA 4MXVE 5INCA 3Q6FA 2YMXH 4ELMA 4Z5RB 1NC4D 3QPQD 4QHKI 5IHUL 3MRGB 4YHOH 1BMGA 2BRRH 2YUWA 3ORJA 1DQML 1A21A 4ONHB 1WGOA 4D9RD 2JJTC 3VXSE 4ZAKC 4BSWA 1IRAY 4W6WB 1MLCB 2A1WL 3B9EA 4HS8H 2XWJA 3HZKA 1ZLWK 4HQQL 1U6AL 4KHTL 1X5HA 3NIFF 3BKML 1N3NA 3ZE2E 3LDBB 3RZCC 2JCCF 1JBJA 3E6HA 4WEBH 3MGTA 1RPQA 1QBLH 3SDYL 3V0WL 3KPMB 5HPMB 3MODH 4MGXA 5ESAB 2Q7YA 5JPNB 3LKPB 2Z35B 4X80L 4PGBA 3FMGL 1EGJH 1Y6MR 1QR1B 2XQYG 3OHXB 3U30C 5C0JB 4RAVB 4LCUA 2LU3A 2IG2L 4MZ3A 3TT1H 3KDMA 2GY5A 4JO1L 5DQ9A 1ZA6B 3Q2CA 4JCMA 2YUVA 4M43H 1GGCL 3I3EA 3O4LA 4WNQA 4O2CB 2X5PA 1IQWH 1MJ7H 4OUUB 3RL2B 4HWUA 3VCLB 4ELMF 1QRNE 1M6OB 5IEHB 3QQ4A 2DD8L 4JGMA 2VLLB 3ZT7A 3ARPA 1JN6B 4R6UA 4ALAL 2EH8H 4BFIB 2GUOB 3MRPB 1MCPL 3WFHA 3LOWA 4MAUL 2M1KA 1J0KA 2EZ0C 5B3NA 4MWFB 4UILH 5IEKB 1YEEL 3QHFL 1CLOL 4YAQB 5MI0C 3F7VA 4UINH 1D5XB 1Q9KB 3ARSA 4YHPA 5E9DB 3S96B 1AC0A 2BSTB 2FHBA 1ONQA 5DMJB 5J7CC 5D7IE 1KCRL 1P2CA 2BNRB 3RX8A 5HSFA 3SDXE 3PHOB 3IFNH 4S1RH 1JPFB 3D9AL 2Q76A 3BPLB 2X4PA 3LDBC 3LN5A 4OM0H 5GGRY 2WBJD 1H3GA 4K7PL 3VRJB 1HYSD 5IFAL 4JM2B 5CJ8A 5CMAB 4FTVA 4V1DD 4ZPVA 1A9BA 1KTRL 1QLEL 3MRIA 5FHBH 2R69H 5KW9H 5L0QC 2WQ8A 3T08A 4GXUM 3OB8A 4AEHL 2BY3A 4K3EH 4I3RL 2GTWB 5DTFA 2R23A 1OCWH 3NCJH 5SV3A 2BNUA 5KSBA 3GUTA 2P46B 2R2BA 1FBIH 5IB2B 4NNPH 3ARVA 4WHTB 4LSSL 3VU2A 4WWKD 4Y0GA 3VXUA 1VGKA 3MV9E 4HK3J 1TZIB 3EJYC 1J8KA 5DR5H 4R4BA 3RZWA 2OJZL 2AI0L 1DBAL 1MNUL 2VOTA 5DJ8A 1N0XH 2F8VA 4YEEA 1K2DA 3UTTD 4M8QA 4R7NA 3GJEA 1KENL 5HDOA 3DUUB 3P11L 3D0LB 2PR4H 4S2SA 3C87A 5EUOB 1MI5D 3UCRA 5EZLA 1RMFH 4H20H 4LLVB 3RY6C 1AR1D 1NBYA 4OV5A 1LD9A 4OF7A 4G6MH 2FSEB 4NRYA 4MHHG 4HUUA 4HT1L 1OSPL 4YK4B 2DM3A 4LCWD 5T1KD 3CZFB 1KTDA 5IQ9A 1G9MH 5CZVH 1HCVA 2ESVB 2UWEE 1MCBA 4FG6C 1ND0B 1RZIA 2EDWA 4DVBA 1IQDA 3BPLC 4QKXB 4EEEA 4BSVA 1NCAH 1NGQL 4PS4H 4XPTL 5AAWA 3ZHDA 3MRBA 2NXYB 2V5SA 3IDGA 1RZ7H 5LWYH 4JRYB 3ABZA 1BQLL 3DHJA 5T3XE 4UU9A 5GRYA 4LCIL 1E4XI 3W39B 1KB9J 5HYFA 4XI5C 1QTYT 4PRDB 1K4CA 4NM8L 3CFJA 2FGWH 4ORGB 3TBTA 3VA6A 4IRSA 1CTOA 1SM3L 2VDPH 4Z0XA 3OGCB 1S7VA 4MS8D 1U9KA 1ZGLP 1F4WH 4BM7A 3KPQB 1C5BH 3VGFA 3L5HA 3SCMD 2LU7A 4PJ7B 3W11C 3BIAX 2YXMA 1ZHNA 3PL6D 1LO3L 1A7OL 3EYFA 5KOMC 5SWSE 3FFDA 3QZWA 1QA9B 1XGQB 3G04B 2IAMD 4KROD 4W6XB 4KRMB 4TVPH 1E27A 4HIHA 3RVXD 2OR7A 4XP5H 1RJZB 4Y19A 1J10A 2OLDA 1RJLB 2HP4A 4WTZA 1HIMH 3MLVL 4BELD 4FP8L 4P9MH 3HI5H 5JR1H 4H0IA 4YK4C 2XTJB 1NBZA 1OAKL 3PGDA 1UH4A 4OZGB 2FWOB 3WXVL 2YWZA 1T1WB 4X83A 4NQXB 2Z4QB 2EYTB 5D1XB 1L0YA 3ARFA 4HK0A 4BH7A 3ES6A 4PGDB 4X8XA 3MGOB 5FGBC 5HHMB 1LK2B 2OBGA 2NXYC 2YD4A 4BZYA 1YY9C 2OL3L 1U92B 3LV3A 1N59B 1DBBH 3X3FL 1N2RB 5IBTH 4AIXA 4ZNEE 4CVXA 1TENA 2AXHA 4U1JA 2FGZA 1P4IH 3BPNB 2GAZA 4HLZG 4YXKH 1EUUA 1BOGB 32C2B 5CLWA 1CFNB 3ZYZA 2GJ6A 1W0YT 2PYFB 3UAJD 2VQ1A 4LCCB 1F4XH 4NBXB 5BZDB 4HCRA 4I0PB 5HYJE 2WWKT 3LY6A 5IB4B 4ONOA 2H26A 1T1ZB 1KT2A 5I8KL 1CGWA 4XVJH 4DKFH 2DI8A 5DZLA 3FQNA 2HA1A 1XGRA 1T04B 5D9SB 3SGDH 4CW1B 2PNDA 4L4TE 5DVKA 4HUNB 3FT2A 4P59H 6FABH 1U8KB 3EFFB 5JHDE 3D3VE 3MBEB 4LFHG 4AMKH 5B4MC 2ZG1A 3IJHB 4X9FA 2D3VA 2VXTL 4X5WA 3BW9B 4RGOH 2QJDA 3MFFB 1CD8A 3GK8H 3O3UN 4J4PA 4NO0A 5I1DA 3S36L 4D8PA 3T2OA 4WU7B 5HVHB 5L2JB 1CDGA 2DWDB 2DLEA 1ZT4A 3DX7B 2BOCA 5DSCB 2EDDA 2V17L 2DJUA 5F21B 5B8CB 2ICEB 2XTJC 4JFDE 1ZT7A 2R8SH 2X4QB 5IJKA 5FUZH 1A2YB 3A6CH 3ZE1E 2LV4A 4LSQL 1SJVA 4H5SA 3D85B 4NKIL 2VDNL 4H25A 1MF2L 1K8IA 5CBEB 4MA8L 5D1XC 1OF2A 1PQZA 1X5ZA 2DQEH 3EKCA 5IVXB 3EDKA 3PP4L 3QEHA 5HHOA 5E00B 5LQBL 5EIQA 4KUZH 4NPYB 2Z9TA 4PR5B 3QPQC 4I3GA 5BS0A 1NBVH 5DVOA 3L1OL 1J05A 5EPMA 2YOCA 4PJBE 5D2LF 1ZVYA 4WDIB 4MJIA 3MRHB 4ZS6D 4CGTA 5CAYB 1MVUB 3TCXA 2HVJB 4MAYA 4I0PC 3WJJC 3ARDD 4PG2C 5T1LB 4KUCF 5J0BA 4Z8FL 4P3CH 1T7YA 3O2DH 5GS1B 1ZEAH 5DRNA 5FCUL 1T0PB 4KGJA 1RQ5A 3RWJB 4F3FA 4AM0A 5FGSA 5C0AA 3CC5A 4I9WD 5H94A 2PETA 4X7SH 3MPCA 1G0XA 3SDDA 3MBEC 4DW2L 3RWEB 1CLZL 5HGHB 3ULUH 4OCMC 5IMLA 3EJZC 5J9PB 5CIPB 1RZJH 5HVHC 2JK5B 3BIBX 3L95B 1W72H 4LVHC 3INUH 5I2IA 3RNKB 5IM7A 1DL7L 4LLWA 1F2QA 4YO0A 5GRWA 4XNUH 1T21B 2XYCA 5B8CC 1CGYA 1JHLH 3OX8B 4O5LH 3SGJC 1IILE 1ZK9A 2V7HA 3C9NB 2XXMB 5I1HL 5FK9B 4BSJA 5D8JH 2YZ8A 1ZHLA 3BFOA 5EU5B 2IFGA 3V6FB 5A1AA 4NGHH 5E4EB 1FC1A 4WO4D 4Q9QH 2QHRL 4LHQB 3HZVA 1U8PB 3W9DB 4ZS7L 3OKOB 4JKWA 1I9IH 1DN2A 3JV6B 5DEGB 4JFYB 2EE2A 4ESKA 2IH3A 5DUMH 5F44A 3OKKB 5AYUL 3BQUB 1MPAH 2HMID 4BH8B 5DFVD 3B3IA 3QO1B 3CXHJ 5FA3B 2EDRA 5F8QC 4O2EA 4ZO7A 3UJTH 3NPZB 4NZDA 3O4LD 1T4KA 3D25B 2DKSA 2E6QA 2YZ1A 4RNRB 3SKJH 2E5EA 4LCWB 1P69B 1WBXA 5EH1A 3V5HA 1I1FA 2OP4H 5IW6B 1F4HA 4J6RL 5JPMA 1C16B 3NOIA 4E42B 5D5MA 5DHXB 4TUKL 2DM2A 3DGCR 3IDYB 5GS1C 3SGEH 1EVUA 1BAFL 1Q72L 2WBJC 1Q0YH 4B7LA 1CE6A 3JWNC 1DSFL 3MFGB 1PKQE 3L3OA 3IB4A 2RFXA 3U9PH 4CU8A 5CP3A 3TJHD 3RDTB 1MHEB 1EEZA 1OQXA 4JDVA 5J4MA 4S10A 1KXQE 2AJSL 1CI5A 5E8OB 4F7CB 3BD4A 1OW0A 2FJFB 4OT1L 3RWIB 5D6CB 4Q0XH 3M17A 3UYPA 3HI6L 3HS0B 1P1ZA 3RRQA 3JTTB 1JFQH 4G7YH 3G5VB 3C6LA 3W2DL 3GNML 5E8PA 1K9TA 5FOJA 2D7MA 4JFFE 1PDKA 3QULB 5D7LB 5DJ6B 3SCMB 4FTVD 4I18B 1HQRA 1MH5B 5JIHA 3QUXB 1KLUA 3UZVB 1XGUA 5JQHC 5E4EC 1S8DB 4NQCE 4AEIH 4UQ2B 1WAAE 4K3DL 3GRWL 2WIIB 1BZ9A 4IHOA 5MERA 2AJUH 2APTA 5GGTL 3F62A 1KJ3H 4U6HB 4Q9RH 3ZDXE 3UJJH 1KB5H 2RCSL 3BQUC 4ZYKB 3X17A 1JRHI 3DYMA 4MLSA 1SYSB 3RWFA 2P8LB 4ODVL 1BFVH 2DQTH 3VXUD 3MNWB 3FAWA 4GRWF 5HDQH 5KN5A 2CKBA 3P0GB 4DGVL 4MQXD 3L3DB 1SMOA 4PB0H 1WEJL 3TGXA 1B2WH 2OTWB 1MY5A 2VZ1A 4YHKH 1QFUH 2OTUA 3OG4B 5D2NE 1JI1A 4UZGA 3OB0H 3IDYC 4YR6A 3U2SA 4WFGE 4MDJA 5KG9B 1MHPH 1G1CA 2D7QA 5F89B 1KCVH 3ESUF 3MUGA 3OR6A 4MVBD 4NJAL 3JWOH 3RDTC 1P9MC 3QG6A 4WWID 3TO4A 1U91B 1HSBA 4RMTA 3C2SA 1KPRA 1QLRA 1UYWH 3UJIH 1EAPB 4HZAA 2I27N 4NRZB 1UADC 1X3DA 5FFLA 1YMHA 3QUKB 1A3RL 1LO0H 4M48L 4U3CA 4N8VA 3OG6B 4JKPL 5ADPL 2BXYA 2Y5TA 4MD0A 3T2NL 1FCGA 2X4SB 2BSSB 1FO0H 5FO9A 5DMIH 5A16B 2F5AH 1T80A 4Z95H 1MIMH 3X13B 1NUFA 3HZYA 3SCMC 2FIKB 3KPLA 1JGUL 4I18C 4J3XA 3V4UL 1UZ6F 3L5XL 3QUXC 4X7TB 2D4FA 4ZSOB 7FABH 4KDWA 4JRXA 1B0WA 5EIIA 3MCG1 3MJ8B 5DJZB 3MXVL 3ZL4H 2AEPL 2JIXB 4XVUC 3L7EB 3UROR 2MFNA 3SDCA 1XIWB 4LU5H 5CGTA 2E7LC 4G80B 4IRSD 4XC1H 1K4DA 5GISL 2GSGA 1EO8L 5F8RC 4NQVB 4HXAL 5HHVL 1IFHH 2G5RA 4P5TA 3QXAB 4ZUSB 3TYFA 4NZRH 3WNPA 5E1AA 2P7TB 1MLBB 5CKAA 1MUJA 4LCYA 3UPRA 1Q0XH 4GQ9L 4U6XB 3RNQA 2ZCKL 4ZFFA 4OFKA 1RU9H 3QI9B 4QHNA 1D5MA 3DXAA 5ENWA 5IJVA 3CUPB 1S9YB 4FFZL 5ADOH 4UDUA 4G6FB 2BRRL 3P4OB 4MA1B 4NQSA 3N50A 4HX1A 3UO1L 1E4KC 2JCCB 4UV7H 3KYOA 3QDGE 3QUZA 1UWXK 3V7AG 2VXQH 4HD9A 3LQZA 2C5DC 4HS8L 5SWZE 3PIQB 4TTDD 3OKLA 3TO2A 1UWGL 4X8JA 4L4VB 2P8MA 1FNEA 2GHWB 4EVNA 4OCRH 2AJYH 1G7JB 3UAJC 4MD5A 3TBYB 4LGPB 1QBLL 2Q8BH 1BJMA 2H6PA 3ARFD 5D1ZA 1KJ2H 1GZQB 5DK2A 3RVTD 5H2BA 3U7AA 2EDBA 3TZVA 1T3FA 1EGJL 3AC0A 5E03A 1JPTL 4ZOAA 3Q6FB 3Q6GL 5SX4I 2VQTA 1YY8A 3MLTB 4ELMB 3E0GA 4NQEA 3DX9B 2XY2A 1GOHA 1XIWC 3WFEH 5EZJA 3MUJA 1NMBH 4BKLA 4DZBB 4M43L 1YECL 1FNGB 1U8IA 5BZWA 2NTSP 5E2TH 2GJ6D 5C7XL 1IQWL 4MX7A 2H45A 1CE1H 3WFDL 4FQJH 4XPAH 5F9AC 3KYKL 2EH8L 1N3NB 5DGRA 2AW2A 5F88B 3BWAA 4FA8A 1G84A 1I75A 5IHBA 4UILL 3CH1A 2QL1A 3QI9C 2Q7YB 4UINL 4FRWA 5E6YA 3FO2A 5C0DA 4PRHE 2G75A 4PPTA 4J4PD 4NO0D 4MA1C 2VDLL 4LCUB 1D9KB 1MRCH 3DO7A 3KDMB 5K9JL 1UXSA 3OAUH 1J0ZA 4NO3B 4Y2DA 2YKLH 5EORL 3O4LB 3MUY1 4OM0L 1FGVH 2BVPA 1AGFA 3SKOA 4ZS6C 3QQ4B 3MR9A 5F3HA 5FHBL 3ULSA 2HVKA 2R69L 2ILLA 2NY4D 3HMWH 5KW9L 1BD2B 4IIQB 3U79A 2FD6L 1BFTA 4HJ0D 3T1WA 1Z5LB 2A6KA 4K3EL 5HHOD 1E6JL 2N7BA 5A2JH 3VMPA 1CN4A 5T3ZD 4IJ3B 1OCWL 1ORSA 3NCJL 5BS0D 4LNRB 1CLYL 2EKSB 4NNPL 4RFOH 4MD4A 4LP4A 3K1KC 4JREB 4LLYA 1I1AA 4HIIA 5HPOA 4MJID 4F9LA 5BMFH 5FM8A 3KXFA 5ESQA 4MAYD 3F5WB 5DR5L 1IEAB 3OAYH 2FZ3A 4J23A 4LL9A 3FFCE 3TYGH 3PWPA 1EEQA 5ABDE 1ERNA 4KJPD 4PD4J 1FYTE 1AJ7H 1A6UH 4ZO8A 2WP3O 5C0IB 1WFTA 1A9BB 2PR4L 4Q9BA 5C0AD 1EJ6A 1MJUL 4Q7DA 1I8KB 4EN3A 1HDMA 4DKDC 1RMFL 1JI2A 2CK0H 3UDWA 4TRPH 4R0LA 4UIMA 3SDDD 1V5JA 3VRIB 4NKDA 4G6ML 5KBNC 4FFVD 4X98B 4GG8B 1QPPA 4DCQA 2EE9A 5JOEA 1KB9K 5DTFB 2R23B 5DFVC 4POUB 2ZUVA 1G9ML 5CZVL 2BNUB 3GUTB 2DL2A 2R2BB 1RURL 4PRIA 5ISZE 4WEUD 3O45A 1I7UA 2ZUQB 4HLZH 2YWYA 1NAML 4FFYL 4HWEH 3DROA 1NCAL 4NO5B 4UUJA 4JZJB 3O9WA 4JAMB 4YPGA 4H0GA 3GSVB 3IDXL 1S9XB 2O5XL 4U7SA 4Z9KB 3OAZH 1K2DB 2AEIT 4IIQC 5A2KH 5FYLD 4R7NB 5BVPH 5F7DA 4QXWA 1MFCH 3OKYA 5EZLB 1YMMA 3DUSB 2FGWL 4D0CA 1IC4H 1MREH 1DE4B 2J8UA 3T2QA 4AH2A 4OV5B 4IJ3C 1LD9B 4ZO6A 1WT5C 2VDPL 2OL3A 5ALBH 1TJIL 4MXWL 1G6RB 3VW3H 4HIJB 4HUUB 1F4WL 1U3HB 1C5BL 4GFTB 4YH6A 3GMOA 4PV8B 3OPZL 4X4MA 1KTDB 5IQ9B 1E28A 1HXMA 3ULVE 3PGFL 3E1F1 5EBWA 3GBNL 5DF0A 3PWVA 4LSPH 2P5EE 4PJAE 4BSVB 3CX2A 4D9QD 1CXLA 5C8JA 2X70A 4TVPL 1MHCA 1CQYA 4RAUA 3BUYA 1KG0B 4XP5L 5BJTA 2AK4A 2PW1A 5EBGA 3RIAK 4YDIH 3SQOL 4OI8A 4YHIA 1TLKA 3MV8E 1HEZA 1V7NH 3RUGE 1JHTA 4P9ML 1P5UA 3CFJB 5FDYA 2AJXH 4YXLH 3TBTB 3HI5L 1B88A 5CEZE 4M6NH 4IRSB 4G9FE 5IKCB 1OWWA 1VEMA 2G2RB 1C5DA 3QDMB 4Z0XB 3C6LD 2DAVA 2D9CA 3FCTB 4I77H 4NQDB 4QOKE 5IROA 4WY7H 2WUCH 2PCPB 2J8UF 2UYLA 5DD0L 4PLKD 2ZUQC 3FT3A 1QSEE 4OCLC 3F6IA 1UKQA 3NN8A 1NGXA 4JZJC 4QHMA 1IAMA 2XA3A 1OAUH 1RZ8A 2OMNA 1ACZA 1IKFH 1FL6A 3AS1A 4PJIE 3SE8H 2A0LD 5DJDB 5DK0A 2XFXB 4OCNC 1LEKB 1DBBL 4ZODA 1UJ3A 4XGZB 2DQFB 3T65A 3DBXB 3PDOB 4Y19B 4WI2A 1UFUA 2IEPA 4WI9A 4U6VH 2ED8A 2KQNA 1S7RA 3DTXB 1NPUA 1U3HC 1F4XL 3UTSB 5TE6H 4HPOH 3TVMA 1NBZB 4R7DA 4WGWB 4N0FB 4JM4L 3HR5B 4GOSA 4XVJL 4DKFL 2EXYC 2VITB 3MLXH 3QNXB 5EO1B 2CPCA 4PRNA 1I7TB 4FXLA 3TBSB 1NQBA 4HK0B 4FXGB 4P59L 3H9SB 4XB7A 4ODHH 5FYJU 3KPPA 2R4SH 2W59A 4AMKL 5L2KA 2FLRT 4LLMA 5JUEH 4RGOL 4CJ0A 4NHUA 3PP3H 3TO4D 4P46B 4PTUA 4N0CD 4QTIH 1KJMB 4CVXB 3JUYA 1KGCD 1R3JA 4MA3A 5EUKB 4YNYB 2K7QA 5GIRA 5EC1B 1T7XA 4IRSC 3RY5A 1Z3GH 2R8SL 4X6CA 1ROWA 2GJ6B 5FUZL 3B9AA 3A6CL 5C2BH 1FVEB 2IPTL 2YA2A 4KGLA 4GG6A 1WWAX 3N9GH 3EZ8A 3FQXB 2J88H 2H26B 4HBCH 3BH9A 4PJGA 5CD3A 2DQEL 3CXDL 4YWGH 5H35B 4JRXD 2J3SA 5F1OB 2WINA 1FZOA 3SDCD 2Y6SD 3IDJA 5I0DA 5D2LB 1DQQA 2IBBA 1FFNA 2E7BA 4Z7VE 4FS0A 1BEYH 1NEUA 5KSVA 4K7PX 1AXIB 1BBDH 5H37G 4ONFH 5I1DB 4D8PB 3T0XA 2I9LA 3P9LA 2KZWA 3QCTH 4P5TD 4RBPH 3UTPD 4M1GL 2VZSA 3DX6B 1J1XL 4P3CL 4JRWA 5F7NC 2CMRH 4H5SB 2A74A 2ICES 1DCLA 4M7LT 3CPLA 4HDIA 4H25B 4QRTA 3VXQA 3GMQA 3DXAD 1IL1B 4X6CF 5IBLD 3BMVA 4GMSH 2NY4B 12E8H 2B1HL 3WKML 4X7SL 3RVTC 4MXQD 1A14H 4R26L 1JP5A 3BRDA 3VWJA 2OQJB 3WHXB 3CNKA 3ULUL 1RZJL 2XACC 2O61B 4PJGF 4P46C 2XZZA 5C2UB 3NFNB 3FB8A 3INUL 3O3DA 2YEZA 1GC1C 4NC0B 4G8FB 3QUZD 4ISVA 3QRGH 5BS0B 5MEOA 1O0VA 3SN6N 4OD1L 5DDHA 1OGAE 4QRQB 3O41A 4F7PA 4X7EC 1JHLL 3L3IA 3TWCL 2EC8A 5IB5A 3CXHK 3FN9A 4O5LL 4DKEH 3MOQA 1RZKC 1LDPL 5HDBE 3MNZA 5IESH 5D8JL 4MAYB 4P2QA 5D1ZD 2SEBB 2CR3A 2E8ZA 3TA3B 4HWNA 5E5UB 4NGHL 5DRNB 4L9LA 4Q9QL 1YEKH 3O0RH 2YS4A 3TZVD 5DJYA 4F3FB 4N9GA 4AM0B 1I9IL 1KBGH 3PHSA 2XZQH 5GRVK 1NKRA 2VISA 3HC4H 5CP7A 4PJXB 4U7KA 4NQED 3MRFA 5GGSY 4JY6A 1INDL 3UJTL 2A83A 2RB8A 3ARBD 3BVNA 3NZ8A 2V6HA 3GRWA 5IMLB 4F33B 5BQ7A 4J4PC 5GGTA 3SKJL 4LLWB 1DANT 2E9BA 4YLQT 4MJ4A 1N4XH 5DJXB 2OP4L 2BVQA 1YEHH 4IRJB 5E8NA 4E41D 4AIZA 3MV11 2V7HB 5CZXD 5EN2A 5DD5H 1ITCA 1Q0YL 4LPCA 2VABA 4JFEB 3VJ6A 3BD5A 4ODUA 3CLEH 3HG1B 1FVDB 4PY8J 4TNWF 3U9PL 3DRQA 2NY4C 3AAZA 3RI5F 4DVRH 5JNYA 1V7MH 1CFTB 2IH3B 4LASH 4NCC2 4BFEA 4N68A 4LIQH 1JV5A 4LARH 4G7YL 4Y2DD 1ZHBB 1BM3H 1T4KB 4P2RA 2N7AA 1DQJA 5IW1B 5HYSB 4Y4KA 1WBXB 2VLMD 3V5HB 5C70A 2FEDC 4XHJD 2HWZH 4HIEA 3T0EB 2NX5E 4XCCH 1I1FB 4MAYC 3VGGA 4MNQB 4U1IA 1YYLH 4OZIE 5CIPH 3TIEA 4K9EL 3TA3C 4OAWA 3OXRB 2ZPKH 4AEIL 3FAXA 4KJPC 1FQ9C 5EU3A 1FHGA 2DTSA 5KVGH 1KJ3L 3O3EB 4Z6AT 4Q9RL 4Z7NF 2Y5EA 3NCCB 3UJJL 3NAAH 1KB5L 5J06A 4GRWB 2X7LB 4JDVB 1PKOA 1FLRH 2H32A 3KJ6L 4X5XA 2Q8AL 2FATL 4DGYL 1BFVL 1PZ5B 2X4UA 4PGEB 5D6DC 2DQTL 4AY0A 2AXFA 3U7YH 2LAGB 3BJ91 3KXFD 1P1ZB 3RAJH 2H9GA 2IH1A 4OGXH 3C6LB 4YHKL 1GYAA 4IRJC 4NKOB 3PWPD 4QRRE 2X41A 1OSZB 4EBQL 1IARB 1P6FA 3L5IA 2UZIH 1EAJA 3G5ZA 3JV5A 4EN3D 3MX0A 1AQKH 5HHXH 5GS2D 5F1NB 2I9TA 3T4YA 3GMLA 4IHOB 2HT3D 4NN6B 3P4MB 4FHBD 3UJIL 4Z0BH 4DN3L 4XMKL 2HTLC 1LO0L 2B4CL 4W4NA 3NTCH 3HE6B 4FNLL 4PRID 4S0SD 1FO0L 4OF8A 2XTLA 2B5IB 4U1NB 2F5AL 4Z95L 5EZOL 3LKQA 3GI9L 1ZLWH 3T0EC 3LS5H 4LAJH 3O9WD 2VLJB 5HD8D 2XN9B 3S36X 3HNVH 2OTUB 4WJ5A 5I16B 4DJMA 4RA0C 3O3BA 2J6EH 4MXVF 3ZL4L 3MRKA 5MHSD 4RRPG 1INEL 2VL5A 3MUGB 1YMMD 3OR6B 4GW1A 4LGSB 5F9WB 1A7QL 1KPVA 1WBZB 5IBUB 6CGTA 4XC1L 3HHRB 4BQ8A 1VPOL 4NSKA 1EGJA 2VNCA 3S9DB 1IFHL 5GRUL 2HJFB 3MRRB 5IT2H 1JMZA 3W5MA 2ADIB 3PQYB 1YMHB 3WN5A 4M5ZL 4NDMA 5F7EH 4NZRL 4J3UA 1OLLA 2FECL 3UX9B 1ACYH 1WWWX 3C6LC 1XT5A 4JY4A 2YN5A 1JF1B 1F3DJ 1RU9L 1M05B 4FZEH 3BPCA 1SBBA 5D7IA 3KPLB 5DD1H 5ADOL 4TNWK 3TEUA 2AK4D 4JRXB 1VA9A 5ALCH 3RI5K 4Z77B 2A0LC 3GHBH 2NY5L 3SDCB 4NN6C 2WAHA 1G1YA 4UV7L 5IFHH 4QWWC 1TETL 2VXQL 1JIBA 2V2WA 5JORA 2VSCA 5JIPA 2VDRL 3FHAA 3OKNB 1I9RH 1UEMA 3HE6C 4NP4H 3BGMA 5F7WC 3C2AL 5KZCD 4PJDA 5HDLA 5TE4H 2AJYL 2MQCA 1U58B 4FQCH 2H41A 2Q8BL 5C0GA 4M5YH 3IETB 5I1IH 3GKZA 2FBJH 3VFNA 1E4XH 3R0NA 2XT1B 3UPRB 5I1LB 3RNQB 1QBML 4ZFFB 4IS6B 1D5MB 3G08A 4R90H 5IJVB 3OKMB 5MENA 1RIHH 4ZD3H 5CINL 5F9WC 3CFKA 1U8MA 3HNSH 1NMBL 4MMXC 4NQSB 3TNMB 4YZFE 4J3WA 5C0BE 3LB6D 2LFGA 3I6GA 5D7IF 2W9DH 3VXPB 1P84K 3VFUB 1FPTH 2FIRT 1T6VN 5FGRA 3SDXF 4S1DC 3G6DH 3CSGA 4CVZB 1CE1L 3TVMD 2EIEA 3LQZB 3AMLA 4PYHA 3O3AB 4J7RA 4NUJB 4XPAL 5DMGD 1FNEB 5GSVA 5HYSG 1JWUA 4EVNB 1Z6JT 3CDCA 5FDWA 3EHBD 4JPVL 1BVZA 5D1ZB 5TPWH 2VLKE 3SKMB 4PLJD 2V5MA 4JANA 5H2BB 1NAKH 4PJDF 5L2KD 3TZVB 2OTPA 3TM6A 5IB1A 3EUUA 4R96B 4JVPA 4BQ9A 4HUXB 3SDCC 3SJVE 1DVFB 1MRCL 5KAQF 1J11A 3LSOA 2AK1H 5FKAA 4XNYH 5J11B 5TGBA 4KRNA 5EBMA 2YD6A 1Q94A 2F8XC 4D0BB 2BNQA 35C8H 4Y5YA 1FGVL 2CLZA 1T66C 1XGPB 5HGBA 5J3HD 1F58L 4YDJB 3AU1A 4OFYA 3QUMB 1AGCB 3EO9H 2BY1A 2J2ZA 1EZVX 4WTXA 3BWAB 2BVTA 4ODSH 2QV2A 2AV1A 3L3KA 1NAMA 3HRPA 4PD4K 3MA9L 3FB5A 1Z9OA 5DI8B 4EDXA 5JDJA 3D2UA 1TNNA 1KIQA 1MQKH 1R5WB 3FO2B 3BDYL 3TFKD 4MXQC 2VC2H 5J8OA 4PJFA 1CU4H 3AVEA 3GI8H 4RFOL 3MOBH 2EO1A 1CFBA 3U46A 5DUBA 3AXLB 2P8PA 4OLVH 3TJEH 1LO5B 3TBVA 3BESR 3WXWH 1W0WA 3LKOA 1AJ7L 1A6UL 3SKOB 1JZ5A 2VO5A 3KYNA 4RFNB 5GSRA 3ULSB 1F3JB 4YGAB 5D1ZC 2J5LB 3MYJA 1KELH 4U3HA 2F19H 5CHNB 3VXMB 1XR9A 3VWJD 2C9AA 4P57B 2JE8A 4P5MB 3TZVC 3BH8A 5ETUA 4LMQE 3IFPB 2XPGB 4FQHB 4YFLI 4TTGA 4OLZH 4RIRA 5IBUG 5C0CA 1ORSB 1UKSA 4HC1H 4JG0L 5J11C 4O4YH 4AQ1B 1JK8A 3VFTA 4LLYB 1I1AB 1FDLL 4HIIB 4OGZA 3F8UB 3MO1A 3K4AA 2AXJA 3MV7B 3SE9H 2F58H 1DLHA 4KI5D 4P2YA 4PJFF 4K3HA 2GKIA 4P2QD 1MY7A 3JVGC 1AO7D 2FZ3B 4OQTH 1V3JA 3DNKA 1FFPB 1A4KB 5AZEH 3G5YB 2ADGA 3VE0B 3MRDB 5F7LB 3RGVB 1MFCL 3VXRB 4EN3B 1T0MA 1DFBH 4UBDD 2AGJH 3EO1A 1IC4L 3HPLA 4WFHE 2K3TA 3PWNB 4R0LB 4XCNA 4PREB 1G7PA 5ALBL 4NKDB 1KYOK 3VW3L 4L5FH 2NYYD 2XG4A 1M4KA 4WFED 3RJQB 3QO0A 4BQ6A 3FRUA 5K59E 1T89C 5I1CH 3QUYB 3U4EB 3S34H 3I9GH 2MKLC 5I19H 3EO0A 4XNQB 2GK0A 1GGUA 3HI1B 4XNXH 5I15H 5FEBA 2CKNA 1NL0H 3QCVH 4UNUA 2IQAA 4UUJB 5ICZB 4RFNC 3O9WB 4WCYH 5IQ7H 4DUWA 4YDIL 2J5LC 3I02A 3FQUA 5J56B 4X6DA 5L88H 4YJZL 4JFDA 3VFWB 2A38A 1FG2A 1YMMB 4YXLL 3P9WB 4CBPA 1NFDE 4M6NL 1QFPA 2J8UB 3TBWB 4MMZC 5J6HB 3QAZB 3QFJA 2L7JA 1R3KB 3W9EA 4I77L 3BUTA 2WUCL 2ZSVA 5CGMA 4UT9H 4UTAH 2Y07H 1I1AC 3K81A 5KOVC 5CJ5A 5ID0B 4Y4KD 3ROLA 1CDJA 2XZAL 5EBWB 5MEQB 1GRWA 5H37H 5ANMB 3VD7A 3E3QC 5C08A 2ZSWB 1IKFL 4ODWB 4Z7UE 3AGVA 3SE8L 1WLHA 3BP6B 3IAPA 5C8JB 3CGTA 4OF3A 1MHCB 2QQNL 3QFDB 3RGVC 3BUYB 1SBSH 4OZHE 4R4NC 5FECB 4EN3C 4OCYL 1JZ2A 1WZ1H 2OSLA 4R0LC 4U6VL 3CCHA 1EHXA 3C60A 2Q20A 5IVOA 2HT3C 1KN2H 4OLWH 5C09E 4X6DF 4FQXA 3EIFA 4G6JH 3O81A 1T6WA 3S4SA 2DF3A 3ZE1F 4M1DL 1K5NA 2Z31B 3VXNA 1JZ4A 4IOIB 3CK0L 5KZCB 4L3EE 1KXTB 5C92A 1TJHH 1RUAL 2WNGA 1RUKH 2EC9T 3ET9F 4ODHL 1A6VL 1G6RH 1I1RA 1SQ2N 3O9WC 5HD8C 5IIEB 1YN7B 1RZ8B 4G8GA 1A0QH 5BO1H 5JUEL 2DQGH 3GSWA 3BDXA 4QXTA 5DK0B 5DC0A 4QTIL 4OSUH 3T65B 2X2YA 1TVDA 4F7TA 1A3QA 2V7NB 1X5AA 4PJBF 1OTTD 5E56A 1Z3GL 3QAZC 2H2SD 3LRHA 5HHQB 3EGSB 5BXFB 2J7LA 3N9GL 3BN3B 4PJCA 4P4RA 3GSXB 2J88L 4R7DB 3RPKA 2XRAH 2MTPA 3QEQB 4YWGL 4B50A 3EW3B 1A9EA 4PRNB 4TSCH 1MFAL 4WV1A 1IAOB 1NMCB 4C56D 1VFUA 5T1DH 2EEBA 1K6QH 1JRHH 5C0FB 5FO7A 3KPPB 2CDEA 4M00A 3P3YA 4WUKH 2P4AB 4LLMB 4JB9H 5D70L 4AEEA 4HEME 2FYYA 1GOFA 5J13B 2HKHL 1M7IB 5JIIA 1BX2A 1HK6A 3EOAA 4JKMA 1NCBH 1LP9E 4HS6B 3NZHH 4LF3B 5T33H 3CFCH 4PJ5E 3UXFA 1JUFB 2H8PA 4HMCA 4X6CB 1N5AA 3MRLB 1HSAB 1LGVA 2Z31C 5IROC 3EYQC 3I50L 3TH2T 4XC3H 3KPRD 5KVFH 4ZPTA 2WLYA 5DZNA 4PJGB 1JNJA 2LAAA 12E8L 3BO8A 3WNNA 5E8DL 3DMMA 4ELKB 2WINB 1DTUA 2HJLA 1MQ8A 1FZOB 1FL3A 1CG9A 3E6FA 2CDGB 5TDNB 2H2PD 3RWDA 5KSVB 4U1SA 1WJ3A 5EFIA 1MRFL 5I8CB 43C9A 4GW5A 4HHAA 3LB6C 5FUOL 4HJGA 3P9LB 4DKEL 5IESL 3S98A 1MRDH 3BPOB 1QSFE 2LE9A 3ARYA 3QCUH 1GC1H 2X9XA 2O93L 3ARGA 3O0RL 5DHVA 2Y72A 1HHHA 4MQ7A 3CPLB 4HDIB 4NOFA 4L1HA 3DX8B 1KBGL 3AS3A 4KKNA 2VWEC 1NMCC 1P7HL 1DANU 4CRPA 2XZQL 3HC4L 1RZKH 1IM9A 5MEND 3H6JA 2P24A 1S9KC 4HCRH 1A1OA 4HG4J 1OAXH 4L8SB 5KVEL 2OX5A 5J13C 4YQXL 1PZUB 1K8DA 3NIGE 2YEZB 3O3DB 4YDKL 1KB5A 3FQTA 4ISVB 3REVB 1CDUA 1N4XL 1X7QA 1YEHL 5DDHB 3O41B 3ILQD 1LEGA 1R24A 3V6OE 1RUPH 3IU3A 4XCYB 3MNZB 4X9IA 3V0VA 4F80A 4G43A 3HCVA 2Z8RA 1UKTA 1HINH 2ID5A 4NZUH 5ICYB 3OSKA 4TQEH 1WAAF 4DVRL 5DJYB 4L29B 1V7ML 1CDCA 4U33A 5F1IB 2EDTA 1R3HB 4LASL 5CP7B 1GSMA 2Q3AA 4JY6B 4LIQL 1D7FA 3ARRA 4JQVA 4CN6A 3NZ8B 1AI1H 1FNFA 4ETQA 2JJSA 1BM3L 3U36B 5EOQH 4ZUWA 3F7YA 2CSPA 1KLFA 1EFXA 2BNQD 2UUDK 1WC7A 1U95A 2IQ9L 1FLTX 2HWZL 4OCWH 4S11A 1YPZA 2BY2A 3BPOC 4XCCL 2F54A 4OFYD 1JTPA 5E8NB 4K3JL 3D1MC 1KULA 4F37F 3TPKA 2WUBL 3GMPA 1FO0A 3L6FB 5SX4H 1J12A 4KTEH 4O9HH 3VJ6B 4QXGH 5KS9A 5GRJH 5KVGL 5MP6L 4XAWH 1FIGL 5IHLB 3QRFM 3DRQB 1QHOA 3NAAL 5CWSA 4ZTOL 3D2UD 4L8CA 1FLRL 4DOHE 5LCVL 4R4FH 4TNVF 3VWJC 1TJGH 3SE3A 4L8SC 4J1UB 4LQFH 4LKCB 5FHAL 3IGAA 3M45A 5IV2A 3DJ9A 5DMYA 2QSCH 2CGRH 2ICCA 4FQQA 4P2RB 3GIZH 4PJHE 4KRLB 2I5YL 2JELL 3U0WL 5JW4N 4UNVA 3N85H 5EU6A 2F53A 1S5IL 1ED3B 2UZIL 4KXZI 4R3SB 3TESA 4OAWB 1FN4A 1UJTA 1AQKL 5HHXL 2CDFA 1YPZF 1TIUA 1CGSL 1QO3A 1J8HA 1AIFA 1NDMA 4TVPD 1QBAA 4UBDC 3SKNA 3T0BA 1S7WA 5C0CD 3BEWA 5KS9F 1MEXL 1Y0LB 3BKJL 1AP2A 4JN2B 2E6JA 4Y88A 2NYYC 1TTUA 1IKNA 1UWXH 5BVJA 2D31A 2IH1B 4LSUH 4QRPA 3LS5L 3VD9A 3IKKA 2BSRA 1IC1A 3SBWA 1F11B 3HNVL 3RJDA 3B2VH 2FJGA 1MCEA 3RTQB 4NIKB 1EO5A 1F45A 3VXSB 2MNUA 3QR2A 3X3GH 2JJTA 4KKAC 4J3SA 4TYUA 1MJ8H 2QKIB 1AR2A 3QJFB 2R4RH 4LDEB 3LHPL 2X4OA 3JXAA 4QHLB 4JGUA 2DIJA 4JG1L 4DKAA 5IT2L 4WUUA 3RZCA 2QQKH 3S88H 2B8OT 4M7KH 2BNRE 4TPRL 5DEZA 1X6LA 5C0RL 1WBYA 1JMXA 3LKSA 3VFPB 5CP3H 3UPAA 1CD1B 4MYWB 4GRWH 2W1NA 1EX0A 4Y4KC 3FQWA 4FZEL 4HV8B 4ZDHA 1U8HA 5CJBA 2HH0H 4KJYA 4KJQC 1I3UA 5C07A 3ARUA 4JY5H 1EZVY 4KRPD 3O3BB 3MRKB 4PJEE 3U9UA 3V52H 2VL5B 1H3XA 2R2CA 3RPIA 1KPVB 3K1DA 2B20A 5JIKA 3QDHA 4WRLA 5AAMA 1XGTB 2F15A 3IDIB 4K23H 4NSKB 4GUPB 4AG4H 1OD9A 3QFJD 5GS0L 1I9RL 4FXKA 3L3JB 4P4KB 1VB9A 3RQ3A 4AENA 5FKPB 5TE4L 3DETC 4XWGH 3WN5B 4NDMB 3RP1A 5I1IL 1KIUA 4F37K 5C08D 1Q8MA 3HB3C 4U1MB 5F7FA 1JWMB 4BZ2H 4XTRC 3M8OL 3RTQC 4R90L 3BZEB 4RGNE 5D7IB 1CVRA 1WIPA 5D96B 4ZD3L 2EYSB 4OKVA 3SDXB 4KQ3H 4HWZA 4L1DA 4BFGA 3H3PH 2YPKB 1MLCA 2W9DL 3C60D 1ZWIB 5JW4R 1FPTL 1INQB 3G6DL 5D93B 4KTDH 2A77H 3WFCH 4UT6H 3EYUL 5D72H 4FQXD 3KLHD 3K0WA 3KPMA 1H15A 2ESVE 5HPMA 2EDLA 1JNNL 2H2SC 3LKPA 3KVQA 3DVGB 2W65B 2IWGA 2Z35A 3GEWB 1CGUA 4WFFD 5TPWL 5FYJL 3RBSA 4X6EB 5DMKB 1QR1A 3VFNB 3ZTJG 5C0JA 4RAVA 1VERA 1NAKL 4F15B 5E24E 4G8GD 4L8DB 2DQDH 4EQ3A 1XCQB 1ZA6A 5ISZA 3BZDA 1S7QB 5MENB 3MV9B 2AK1L 4XNYL 4KDVA 4OUUA 3RL2A 1T5WB 1C12B 2M26A 5FYKU 3FO1B 5FO8B 2A1WH 2VLLA 3ULUD 1JN6A 2MJWA 3QH3B 3BKMH 1RFDL 3GO1H 2GUOA 4BFIA 2W91A 4P4KC 3KPTA 1ADQL 3D6GA 3MRPA 3WN5C 4PJ9B 4MWFA 5IEKA 3IRPX 1U93B 2UVFA 4PJ7E 1JWUB 4YAQA 2OJEA 3RY6A 2BMKB 3FMGH 5E9DA 3S96A 2NTFA 1VKXB 3JV0A 5D96C 1MQKL 4YHYB 4IRZH 4ZNCD 2R29H 1UVQB 2VC2L 3PHOA 1L9MA 4JO1H 3MOBL 5TE7H 1JPFA 1IC5L 2P5EA 4OLVL 3MRMB 3TJEL 1P6AB 4HK3N 5D93C 5TGBB 5EBMB 4JM2A 2DD8H 2XIDA 3B9KB 4ALAH 3BXNB 4Y5YB 3PDGA 4CU7A 1K85A 2BK8A 2CLZB 3WXWL 2IPKA 3D39D 3OR7B 4Z7WE 3VDCA 4QT5B 4MAUH 1BP3B 2YC1B 1DUYB 2Y9RT 3B8YA 4YGVB 3STBA 1YEEH 1KELL 1CS6A 1Y18B 2VLRE 3DMMD 2GTWA 4F15C 4XVTL 2BCKB 3L3KB 1NAMB 1GL4B 2YD9A 4QOKA 3OZ9H 5ILTL 4MQSB 5IB2A 4OLZL 1KIQB 2JB5L 4N1CA 1KCRH 3EJJX 1PFCA 3BEVB 4HC1L 3CIQA 3QHZH 3R8QA 5HGGS 2I26N 5DC4B 5SWSB 5K9OB 5DUBB 3VD4A 4LPYA 4PJIA 3SE9L 3ULVF 2F58L 4D9RE 4K7PH 2ZUWA 3LEVH 4IOFC 4JVWA 4OQTL 1RK1B 4PJ9C 3TBVB 5AZEL 4JJ5B 3ARGD 1W0WB 4LLVA 3QEGL 4JM2F 5F6HI 5GSRB 4AEHH 4JFPB 5EWIH 1BZ7B 1DFBL 2FSEA 2AGJL 3MYJB 3P0VL 4POZC 4LBEA 3GBMH 1IM9D 1C7TA 2ADFL 5A3ID 1CD9B 4YHYC 2AAVA 3CZFA 3BH8B 2WWMC 2W0FA 3QQ9D 1ND0A 4J3VA 2BOBB 4RIRB 3QP3A 1DBML 4LSSH 5C0CB 5I1CL 3I9GL 5L8LB 5I19L 5IHZB 5GQBA 1S7TB 4XNXL 3B9KC 3ZKQD 5I15L 5FGBA 2VZ3A 4Y5YC 5HVWA 5GZND 2FECI 1NL0L 1XGYH 3QCVL 1EIBA 5GJTL 4YXHL 2AKRA 1CGVA 1Q38A 4M6AA 3W39A 4LPXA 3P11H 1HILB 2AJZB 1CFQA 4PJIF 4LPVA 2HFTA 4HGWB 5J12B 1FNAA 3CMGA 4I0KA 1AH1A 3VDBA 1T0MB 3OGCA 4Z78B 3HPLB 5HYJB 1ZLVH 5ID1B 5CEXA 1SJEB 3CMOH 1AXSA 4UT9L 4UTAL 1EFXD 2Y07L 4G7VH 3TF7C 3QYCA 3FRUB 4KKLD 1YEGH 1QA9A 3EO0B 4JO2H 2F54D 43CAB 1NGQH 3K8KA 5FA4B 2OK0L 5JHDB 3D3VB 3V95A 3VMNA 5ELIA 5I1GH 3QHTC 1FC2D 4QNPE 1KN4H 1RJZA 1A7NL 4ETYA 5GHWH 1AD0B 5KAQG 1SBSL 4V1DE 3I02B 4NM8H 1WZ1L 2JF1A 4KRPB 4X6DB 4ZXBB 4JFDB 5GJSL 3GSRA 1LHZA 3LKRA 3VG0H 2EC9U 1KN2L 4JVUA 5GRZA 4OZGA 5FAAA 3B5GA 5JZ7D 4I3SL 4OLWL 3HKFA 1UC6A 1T1WA 4NQXA 5E5MA 2Z4QA 4G6JL 5D1XA 3UC0H 1BZQK 5EU4B 1SEQH 2HRPH 4PGDA 3NH7L 1CWVA 2VZTA 3HUJA 3MGOA 5GS2H 1KEGL 1TJHL 3B83A 1RUKL 3LD8B 5EU6D 1U92A 2F53D 1N59A 5SWQA 1G6RL 5DA4A 4MHHI 1N5YH 1A0QL 5BO1L 1JGEB 1BVLA 1RY7B 1OGAA 2E9WA 2P5WA 5J12C 4PJBB 1BOGA 3BP5A 1F3RB 3UTTE 1J8HD 3CX5J 4OSUL 3NPSB 4LRNH 1S9WB 1CFNA 1DLFL 3QB7C 4FP8H 4R8WL 1MI5E 1JVKA 4RMQA 2DN7A 5J1AA 5BZDA 4LCCA 4NZJA 3VGHA 3WJJA 1DUZA 4PG2A 1KIRB 2KQMA 4CKVX 3EDJA 1G7QB 2YA0A 3WXVH 1T04A 4OD3L 4LCWE 2XRAL 5D9SA 4CW1A 4QRPD 1K5NB 2J12B 4OZGF 3EFFA 3OXSB 1V3MA 3DECA 3MBEA 5T1DL 1K6QL 4GXUN 4EZMA 3EDEA 3X3FH 4WU7A 5L2JA 3QBTB 2DWDA 3HUJF 1REIA 1UACH 4U0RB 2A6IB 4KRPC 4ZXBC 3ZSTA 4CNIA 2NLJB 5B8CA 4RGMB 2ICEA 2IMMA 4F7TB 3SGJA 4WUUD 3RZCD 5HY9A 3RWCB 1NCBL 3NZHL 2CIKB 5T33L 3CFCL 1JZ6A 3D85A 4L3CB 4AK1A 1FL5B 1M71B 3OJDB 4HULB 5HDBF 5EU7E 5CBEA 4FABL 3DV4A 4G9DB 5IVXA 4K94L 2XXCB 3Q3GB 4P4RB 3L3GA 3MLSL 1A6PA 4XC3L 3LD8C 1RJYA 5E00A 4Z7QE 5C07D 1CQKA 4NPYA 5JW4Q 4PR5A 3JSSA 3FOMB 5CJOH 2VXTH 1U8NB 4Y4HA 5D1QB 3F12B 3S36H 3NPSC 1FRGL 4CJ1A 3IXTA 2E6PA 4WDIA 1T1YA 1QNZL 3MRHA 1MVUA 5CSGA 3NCMA 5T1LA 2XOTA 3PGCA 1TVHB 4M9OA 1FNSH 1CDIA 3K2UH 1JGDA 4NKIH 4OCSL 1MF2H 3ZT5A 4X5LA 1N5AB 4MA8H 2IPUK 4WW1B 1NCDL 1OTSC 4OV6F 1JGVL 4F8QA 4WI4A 4X9BA 1HI6A 1BQUA 1OT2A 3RWEA 4ZPTB 2CQVA 4KFZC 1RZKL 3PP4H 2Z0BA 3BO8B 5J9PA 5CIPA 2JK5A 3L95A 1QEWA 3V79C 4Q2ZB 1OAXL 4U0RC 4O02H 1B90A 3IDNB 3V4VL 5FV2A 4YEFA 1T21A 4JFFB 1M7XA 3C8HA 4RGMC 5JLZB 3GM0A 1WSST 4XP6H 2AVGA 1MFBH 3L7FB 4U1SB 5FK9A 3QXWA 4U49A 1MCCA 5E2WH 4HHAB 5TQ0L 5M95B 4XP9H 2HFFB 4PJ8A 1RUPL 5EU5A 4CUCA 4Z8FH 2OXHA 4NQCB 3V6FA 4MB3A 3L3HB 4CADB 4TVSa 2FEEL 3BSZH 1X4ZA 1U8PA 1J0IA 4OZIF 3OKOA 5DRWA 1HINL 3K3QA 5DEGA 4JFYA 1CFVL 4NZUL 2Y4SA 5L6YH 4JFHD 4JZOA 4TQEL 3ARGB 4XHQA 3BQUA 5DHVB 4BH8A 4MQ7B 3QO1A 5FA3A 4DW2H 5ISZD 4HKXA 4XPFH 2N56A 5I66A 5D1QC 4KDTC 3FHQA 3D25A 3B5TA 2V2TB 2P24B 5LBSH 1XF4B 1KNOA 3EJYD 3RVUD 1A1OB 4L8BB 5FYKH 2QTEA 1DJSA 2DLGA 1JF6A 3CFBB 2P1YA 2X1OA 2W9EL 5KVDL 1C16A 4RFEA 4E42A 3TT3L 4OCWL 3REWB 4KJWD 3KWWB 4M02A 3D5OF 1ZOXA 3VGAB 1FH5H 4K71B 3IU3B 4JQIL 1AGDB 3QQ3B 1KCKA 3RDTA 5JA9A 1MHEA 1FGNL 1P9MA 2D03L 5DFTA 4G43B 5GRJL 4ZS7H 3T8XB 1XMWA 3GHEL 5E9DD 4F7CA 1JJUA 2XKNA 3VRLE 2FJFA 3G5XA 3RWIA 2K1MA 5D6CA 3S35X 1NCUA 1WK0A 2BRQA 4R4FL 5E5RB 4BK5A 3JTTA 4FG6D 4JHBA 3G5VA 4I5BB 1A6WH 4LQFL 2P5ED 4PUBH 3DWTA 1Z9LA 3NIFE 3QULA 5D7LA 5BW7C 4P2CG 2VTFA 2FX8L 3PDDA 4MSWB 4JM2D 4M61B 4X99B 4I18A 2CGRL 3F7YB 1RV6X 3QUXA 4J6RH 3H7BB 4I2XE 2C1OB 3I6LD 4TUKH 1OP5H 1YPZB 2DM7A 4FQ2L 3T0WA 4UQ2A 2HYMA 4LFHD 4PB9L 4XI5D 2WIMA 4HZLB 2QADB 1DSFH 1ZXQA 2ICWA 1ES0B 1WFUA 2Z91A 3GMPB 2E7LA 3ARGC 4GAJH 4ZYKA 4M7ZB 4BYHA 4QOKD 3WYRA 1SYSA 2P8LA 1ZS8B 4WHCA 4W81A 5CWSB 5FB8B 1MELA 3NA4A 4I9WE 4YBLB 1OAQH 4L8CB 2CUMA 1VSCA 4K9EC 5A3IC 3MNWA 4MCZB 3L3DA 1HH6B 3W11D 2OTWA 3IGAB 4NUGH 5LGHH 5IV2B 4LSUL 1N7ML 3MRQA 4XPHH 5DT1H 3VGAC 5KG9A 1NGPL 5F89A 4K71C 4NNXA 1LNUB 3I75B 3HE7B 5GZNC 4FQLH 3VXTB 1U91A 3BWUC 2AS5M 3X3GL 1A6TA 5GGTH 3QDGB 2DL9A 1EAPA 1MJ8L 3EZJB 1JTTA 4NRZA 1EBPA 5SWZB 3U0TB 2V5YA 2R4RL 3O2WH 3QUKA 1NDMB 3M1BB 1UGNA 1CBVH 3S37L 2VR9A 5T5NF 3ZTJH 2X4SA 3WLBB 3S88L 1N26A 4QXUH 4JE4B 2GCYB 4M7KL 3BEWB 5F9JB 2Y06H 4DGVH 1QFWM 4L9DA 3X13A 3QXTA 3KPSE 1AP2B 3MQIA 3O4LE 1WITA 3ESVF 5BRZE 1YEIH 1N0LA 1P53A 3LQMA 5DJZA 3HN3A 1QFHA 2BSRB 2HH0L 2JIXA 2B4CC 3L7EA 1FFQA 2FBOJ 3HPJB 4JY5L 2MQ3A 1DDHB 1XIWA 3LIZH 5E94B 4NJAH 2FX9H 5JXAH 4M7ZC 3V52L 3MMEB 4P9HC 2EECA 1HXYB 4IOSD 3N1MC 1EPFA 3VWKB 1B6UA 1YJDC 2GJJA 4YBLC 4YZFF 4JHWH 4ZUSA 4K23L 4AG4L 1A3RH 4M48H 3SDAB 3SE3C 1LO4L 5ADPH 1BREA 4WUUB 2VSDA 3T2NH 5JHLH 1CDBA 1CK0H 1TQBB 3DARA 5JZ7C 4JPIA 1OM3L 3F6LA 2B2XH 5FM5O 4OFIA 3QI9A 4WU5A 4CN1A 3NFPA 4U1LB 1OARH 1WBYB 1JGUH 3CUPA 3LKSB 3L5XH 1S9YA 4YHZH 2R0ZH 2HT2D 3DSNA 3H2WA 3MBXL 4BZ2L 1ADQA 2ENSA 4Y7MA 3P4OA 3HE7C 3MRNB 3MXVH 2AEPH 1NFIB 1E4WH 5DQDH 4FTVE 1CD0A 4N8CL 4KQ3L 4A6YL 1FE8L 1X5JA 3BP7B 2JCCA 3H3PL 4ZFZA 2EEAA 1MCDA 2XWBB 2XTJD 1YZZA 1EO8H 3PIQA 2YD8A 2FJHB 4L4VA 3RPIB 1TTFA 4KTDL 2A77L 3WFCL 5D72L 5I75B 1G7JA 3TBYA 1T22A 3WDHA 5D1XD 5KSBE 4FXKB 1GZQA 2NY5C 4ACPA 5DRZA 5HHMD 4GQ9H 3VXUE 2A9MH 4QRSA 4UQ3A 2X9WA 3BP4A 2GT9B 3SBWC 3S5LG 4FFZH 3MLTA 2DQDL 3DIFA 3WUZA 3DX9A 3MJGX 1OGAD 2P5WD 3BE1L 3EYSH 4DZBA 1FNGA 5KTEH 3ZDZE 1NH6A 3UO1H 3GJFK 4OKVB 4HWZB 1FYHB 3VWKC 4F7MA 3CDYA 4I0PD 5LGJB 3FFCB 3SDAC 3GSNB 1SHMA 3GO1L 1OL0A 1UWGH 1RZGA 1C08B 4N5EC 1FYTB 2PO6B 1I8LC 2R2HB 4LLQB 5CILH 2C7UB 5F88A 1TQBC 2ZWLT 4HC1A 4HW6A 3DSFH 1H15B 4U0QB 1IM3B 5EZIL 4N90D 2BHZA 4O2FB 3MBED 3NCEB 1VESA 4NFBA 2XWTB 3EJZD 1JPTH 2EICA 2GEEA 4OQTA 3Q6GH 1D9KA 4IRZL 2R29L 4CMHB 4HAGA 2AJ3A 4M7LL 4ODXB 5ISZB 4NO3A 5TE7L 1YECH 4ZFOA 5F70A 4KY1L 4FZ8H 5C7XH 4NHCL 4HUWB 2D7PA 3P4LA 1KACB 1QPXA 3D85D 3IU4H 4UI2A 4HS3A 3WFDH 5I8OH 3VH8A 1CZ8H 3KYKH 2Q87A 4JLRB 1SJHB 1W0VA 2D7NA 1C8PA 1BD2A 4IIQA 1MCIA 4N1EA 3LPFA 1J87A 2VRAA 1Z5LA 3UEZA 2DBLL 4GBXB 1NFDA 1OWRM 4LSDA 1K3IA 2PKDA 1PSKH 4GAYA 2OJEB 2C3GA 2DMBA 2NW3B 1XEDA 1WT5A 4LNRA 3OZ9L 3Q0HA 1Q9OB 5CBAB 2NTFB 2QQQA 2EKSA 2VDLH 4LLDA 1J1OH 5I1KH 4UDTB 5K9JH 3QHZL 2GI7A 3EOBB 3F5WA 1IEAA 5T1LD 5EORH 1I8MB 2P5EB 3QQNA 5IMMB 3WNOA 4YC2B 5K59F 2R0KL 1D5ZA 4HUKB 1P5VA 4WI6A 3LEVL 4OKDA 1TFHA 5C0IA 3ALWA 4X4ZA 1YQ2A 1I8KA 5LG1A 3MV8B 4PBVC 2IPKB 3LMJH 5C3TA 2FD6H 3S97C 1B0RA 1F00I 5FF6B 3VRIA 3JTSA 4NWUH 1NSNH 5EWIL 3A67L 5J6GB 3OTTA 3MLWH 3N0PB 3GBML 1E6JH 3I3BA 4X98A 4GG8A 4G9FB 3EAKA 4I0CC 5M94B 4KV5F 1T2JA 4I48B 4CMHC 1RIUH 1UZ8A 4TSBL 1CLYH 4QOKB 4KK6D 5C71A 3QUML 1NFDF 5I76A 3ARWA 1QSEB 2HLAB 3RVUC 2E3VA 3DV6B 2FO4B 4S1SH 3QIWB 4NO5A 3NCFB 4JZJA 4PJ8D 4JAMA 4PJIB 5I6XB 2GJ6E 3GSVA 1S9XA 3RFZC 1XGYL 4HJJH 4JKKA 2ICWI 4KJWC 4PRPA 3OWEA 2VAJA 3DUSA 1MJUH 4GBXC 3BQUD 1A4JA 3OBAA 1JPSH 1DE4A 3CSYA 1I1YB 1GHFL 1G6RA 4LBEB 1GGTA 4HIJA 1U3HA 5A2FA 3JBG7 1X4XA 3P9MB 3Q48A 5T3XH 1LEIB 4PV8A 3ULVC 4W4OA 2W0FB 2DDQH 3CMOL 1RURH 1ZAGA 4G7VL 4YC2C 5E99H 3TPUB 2NR6D 1YEGL 3HNTH 1NAMH 4FFYH 5JQ6H 4JO2L 4B53A 1KFAH 4JM2C 2IALB 2NY3B 1KG0A 3KJ4B 1MCOH 5I1GL 3H0TA 1KN4L 3RDTD 3IDXH 2O5XH 4LVEA 3RVWC 4RZCA 2AKRB 5EA0L 3V8CA 5TDOB 5GHWL 4OLYH 4JHZA 1RAMA 4XXCA 3T4AB 1CFQB 4PJ5A 1E4JA 4ERSL 5IKCA 1J88A 2G2RA 3VG0L 1KLGB 3QDMA 3KHOA 4LSRH 1W2KT 5E2UL 1TJIH 4MXWH 3FCTA 4NQDA 2YRZA 5HHOE 2A6JB 3DO3A 2PCPA 1QFOA 1YQVH 4EIZC 5D7LD 1I9EA 3OPZH 3WL9B 3WLWC 3UC0L 5CEXB 5T3ZE 3QIWC 3PGFH 1AXSB 1SEQL 2HRPL 3QUXD 4PTTB 3GBNH 1MAKA 1JZ3A 4OLXL 5I6XC 4MJIE 5DJDA 4XVUD 2XFXA 3FN0H 1LEKA 1JGLL 1FFOB 1QLFA 4OQ1A 4XGZA 2DQFA 1N5YL 3DBXA 1UQSB 3QG7L 3PDOA 3SQOH 3KHQA 2YD1A 1CL7I 3T0AA 4G6AC 4LRNL 2EKJA 2Q3ZA 4M4RA 5C0AE 3DTXA 4Y8AA 3UTSA 2OR9H 2RIKA 3GSRB 4DFIA 2RBLA 1YNLH 2W0KA 2AEQH 3LKRB 4N0FA 2BVOB 2IBZY 3HR5A 3WE6B 4U1GB 1LP9F 4GRLA 3BOVA 2C4FU 4WEMB 2VITA 3QNXA 3VI4E 1R5VB 5EO1A 4QYOB 3UP1A 5I74B 1I7TA 5E5MB 3TBSA 5DD0H 3V4PH 4FXGA 3H9SA 2A6DB 1AE6H 5GS0D 2NY3C 3HUJB 3KJ4C 2FLBT 25C8L 2EH7H 4M6OH 1BPVA 2EDFA 5SWQB 4P46A 4QEGA 1KJMA 5BV7B 4XX1G 1IAIH 5EUKA 1UACL 4YNYA 1BVLB 1T7VA 1OGAB 2P5WB 5EC1A 3BP5B 5GRVL 5FYLE 5I30H 5CSBA 5J1AB 1FVEA 1DUZB 3ZSSA 1IAKB 1PD6A 3FQXA 5JXEA 5K9KB 3MV01 1R3IH 4JM4H 3M07A 4PRAB 1CXHA 5H35A 4KXZH 3TIDB 3UPCA 2AERT 4Z76A 3BT2H 2XQBH 2DB8A 2JIXD 5D2LA 2GIYA 1XIWD 3BD3A 5D5ME 2HT2C 5CJOL 5E2VL 2XV6B 5FYJD 4D9QE 4YBQC 4P2OB 4QHKJ 3U83A 3V5DA 3DVFA 1LDSA 3O8XB 5HJ3A 1L4IA 4OD2A 3W0WE 4YFEA 1J7VR 3T3MF 4CNIB 1I8IB 3DX6A 3H42L 4U31A 5ITFB 3NIGF 1KCLA 1AHWB 1XF3B 4U1GC 5CUSL 5HY9B 4Y8DC 1FNSL 3QIBB 1OP3K 2OR8A 3K2UL 3GMRB 2IPTH 3CU7A 5I74C 2DLHA 2PW2A 5IF0A 3QI9D 1IL1A 4RRPA 2UUDH 1S78C 3CXDH 3DV4B 3QA3A 4ZMAT 2XNAA 4G6FD 2OQJA 3MJ9H 1Q1JH 3L3GB 2ATPB 2C1PB 3S3JA 3WHXA 2EEDA 1RJYB 4MCYA 5IVZB 2O61A 3NFNA 5F97E 5BV7C 1NGZB 1H8OA 4G8FA 3BPNC 3BISA 4XZUA 4O02L 2JB6B 3KS0J 1IEBB 4IDLA 4QY8A 4Y4HB 4KVNL 4QRQA 2WMPA 1ZV5A 1GVIA 4PJHA 3MRJB 5TQ2H 4L4VD 3IXTB 4XP6L 2NX5B 3RWHB 1PY9A 1L0XA 3PXHA 1T1YB 2EIZB 1MFBL 3KPNA 4LCCC 4M1GH 4OZIB 5E2WL 2QQLH 4XP9L 2SEBA 4KZDH 1J1XH 2IPUG 4XCFH 4KQ4H 3TA3A 1OAZH 3PGCB 1VFOA 4OM1H 4P3DA 3BSZL 1JGDB 1LQSR 5L7XH 3N06B 2YPLA 5L6YL 2B1HH 4PJXA 4HH8A 3WKMH 1IZJA 4R26H 1QYGL 1HI6B 4XPFL 3LEXB 1RULH 4F33A 5D6DA 5FUCC 5LBSL 1A7RH 4EUPB 1IVLA 1QEWB 4P2OC 5IUSA 4G6KH 5FYKL 5LJYH 5DJXA 3O8XC 3STZB 5IMOB 2YXFA 4OD1H 2NPLX 4IRJA 1GZPB 2OI9B 1RHHA 3TWCH 2V5TA 1AHWC 5TF0A 1KGCE 1LDPH 1EHAA 4F9PA 3QIBC 4LQ1A 1NKOA 2VXUL 4JFEA 3Q1SL 1V3LA 1FH5L 4XB8A 5FM5M 3FO9B 3HG1A 4PJ8B 4PJHF 1FVDA 1AD9B 4CDHA 1XH3A 1OPGH 5DRWB 1CFTA 1T2QL 5DLMH 4JZOB 1D9KD 1G9NC 1INDH 4JRXE 5JOPD 4HKXB 3WS3B 5I66B 4Y4HC 5DD3H 1A6WL 1ZHBA 1F3DH 3SGKA 4PUBL 3WD5H 4PJXF 5IW1A 3H9HB 1KNOB 5HYSA 3QIUA 3T0EA 3CVIH 4MNQA 4RFEB 1BD2D 3OXRA 4WHDA 1KOAA 3IDMB 1PW3A 5CSZB 1MSPA 3UTPE 3T77B 1CLCA 2JJWA 3FTGB 3GJFB 3O3EA 3RVVD 4GAJL 1YDPB 2X7LA 5D7JB 4WI7A 1HN1A 4GLRI 1SYVB 3NVQA 2XKNB 3DXAE 1OAQL 1PZ5A 3G5XB 4PGEA 3GSUA 3ELAT 2YBRB 2E9IA 1RUML 4KK6C 1X9QA 4PBWD 1HH9A 4E0RB 2FR4A 4NKOA 4G8IB 5DHVH 1OSZA 4NUGL 5F7HA 5LGHL 1A5FL 3MREB 5EOTA 2X4TA 3FONB 4XPHL 5DT1L 1HWGB 3J8F7 2D0GA 4PJ8C 4K9EH 1ZVSB 3TP4A 4YDLB 4ZQKB 5F1NA 1A6ZA 2R1XA 4FQLL 3P4MA 2ICWB 2Z91B 3TH4T 4KKBD 1ZLUH 4OZFA 3O2WL 2QEJA 4QLRA 1NMAH 3KJ6H 1YN6A 2D4DA 1CBVL 4RMWA 3HE6A 3T1FB 2Q8AH 5IFJA 2FATH 1BWMA 4DGYH 5F96H 3RA7L 4QXUL 3CLFL 3ALPA 4U1NA 4A6YA 2NY7H 3WO4B 2IFFL 2Y06L 4NQEE 5LKNA 2FNBA 2H1PH 3FO0L 1WZMA 2VLJA 2XN9A 4GXVH 4KHXL 4GO6B 1O7VA 5I16A 1YEIL 3MROA 4EBQH 3U7WL 4LEXL 2NR6C 4EXKA 4PRPD 2BHUA 3MRQB 5ERWA 1HHIB 3C5JB 4E41E 3LIZL 4NNXB 4XP4L 1WBZA 2FX9L 5JXAL 5D7JC 2HKFL 4KI1A 1A6TB 1P7KA 2HJFA 3MRRA 1U3HD 4YPJA 3AM8A 4DN3H 2ADIA 4XMKH 3PQYA 4JHWL 2ED9A 2B4CH 5JA8B 5D4QA 1H3VA 1HZHL 4M93B 2EXYD 4FNLH 5JHLL 1CK0L 4DUXA 3N1QC 3B43A 1KSRA 2APBA 1IGCH 2VLKB 2B2XL 2I07A 2UVEA 1JF1A 4P9HH 4AYFA 5EZOH 1M05A 3A6BH 5A43C 1B4JL 3GI9H 4JN1L 2P43B 2HFEB 4AT6A 1OARL 3GMNB 1GAFH 1QSVA 4YHZL 5SX5K 1YJDH 2R0ZL 3G6JE 4YDLC 4Z77A 4JFXB 2VLME 4HGMA 3SJVB 1E4WL 5DQDL 5D7KD 4XMPH 1INEH 3CFEA 4NM4H 4PJ5D 1A7QH 1U8QB 3NBNA 4F2MB 4X6FB 1KPUA 2DOCA 4LSTH 1VPOH 3QDMD 2ADJB 3OKNA 4EUPG 4NQDD 5GRUH 5EDXA 3KGRA 2YUZA 2F74B 1U58A 5E4IA 4FQIH 3WO4C 4M5ZH 1RZFH