2FSEA

Crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
178
structure length
178
Chain Sequence
EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFASFEAQGALANIAVDKANLEIMTKRSNYTPITNVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Crystallographic Structure of a Rheumatoid Arthritis MHC Susceptibility Allele, HLA-DR1 (DRB1*0101), Complexed with the Immunodominant Determinant of Human Type II Collagen.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system, structural protein
total genus 32
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fseA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2fseA01
5FV1L 4PJHF 4JFDE 3KYMA 4KJQD 3O8XC 4L3EA 4R0LC 3NH7H 2YPLD 1QSZA 4X9GA 5CD3B 3O41B 2EIBA 3MOBH 3VXNA 2GTWA 3CXDL 4KPHH 5SWZA 4JM2A 3FT2A 2VDKL 3CZFA 1ERNA 4MA8H 1RJZA 3D85A 1PY9A 4Z7NE 2D7MA 2K1MA 4JCLA 2Q8AH 1J05B 3CFJB 1RUQH 2ESVD 4MQXC 4U6XB 5EUOF 4FRWA 5IV2A 5EN2B 4ZMAT 3NPSC 1UVQA 3CSYA 3HNTL 4J4PC 5ADOL 5F7MC 4LPWA 3T65B 3MCG1 1C16B 4WV1A 1C08A 4OM0L 3GBMH 3K7UA 3RWJA 1P4LA 1KNOB 3U4AA 3S5LG 2YKLH 1C5BH 2BRRH 4YHKH 4N9GB 4JKPH 2FGZA 5TFSH 3VD7A 2ZCKL 3MLXH 4LL9A 5ESVA 3BISA 3Q5YA 1B3JA 3CVHH 1J8HD 3UTTD 5C6WH 5K59F 1LQSR 3ZT6A 3U82B 2GIYA 3NCYS 1AJ7H 3QUKA 5C0EA 3MRGA 1UA6L 3EFDL 3I75B 1UWGH 1I8LC 4YFDB 4BSVA 4DN3H 3O9WC 1D5IH 4I77L 1U8OB 5C09E 2DJ4A 1DEDA 5FO7B 5JHLH 2W0KA 1OTSC 3GSNA 1MCWM 4LEXH 5T3XH 3NZHH 5F44A 2N7AA 3ZDYE 4HIIB 1G7QA 2PW2B 3MGTA 1KPRB 4V2BA 2HJFB 4PJAA 1I7ZB 5DUBA 5L8KB 1S9VA 1RK1B 5I6XC 5F89B 1SEBB 3AY4A 3BI9X 3FO1A 3HCVB 4G80B 5C3TA 3RBGA 5DK3A 2HVJB 4P23A 2FHCA 1CGUA 4KMTH 2V7HB 4GRWB 2DBJA 1HOCA 2CK0L 4P2OA 5M95B 3AM8A 1GXEA 4JDZB 1JWMA 4KK8C 2QQLH 5CGYD 5ID0B 3M1BB 4I5BB 3SDXF 4HIXH 5E6IC 5E08L 4RNRA 2X4TB 2X4OB 4Y4HD 3RBSA 3C5JB 1N2RA 1XEDA 4UT9L 5F1KC 3GB7B 4GXVL 4OZIB 5B3JF 3A0OA 3IDGB 1UC6A 2OTPA 3QJFB 1QA9B 3ARFD 1T3FB 1JGVH 2H8PA 1QUNA 2OZ4H 4LSVH 4U2YA 1MJUH 4WTZG 5EOCH 3FQWB 1X6NA 3I84A 5T1LA 5JO5A 4P99A 4EVNA 3N85L 1HHJA 4L1HA 1F11A 4QOKD 2PYEE 4DW2H 1NMBL 12E8H 5FM5O 5EWIH 1NBQA 3NIFF 2YXMA 3VWJD 3GSOB 4XB8A 2VDLH 1FE8L 3CDGB 5BV7H 5LGJA 1H3XA 3UBXA 4N9OB 3GMNB 3ARQA 3BDBA 3SGKC 4LVNC 1UT9A 3BP6A 5JXAL 4XX1G 1AO7D 5GISL 5CD5C 1NFDB 1KEGH 2FEDC 4GJTB 2LAGB 5JIPA 4ZG1A 4F80A 1KPVA 3TYFA 5CJQH 2GY5A 4KK6D 3GJFB 4PJIE 3BKJL 2PO6B 3SBWC 2YRZA 5J13C 1CLYL 1NCDL 3RKDD 4MJ5A 1KCKA 3ZHDA 4Z7OE 4HH9B 1F4AA 2EO9A 4ODHL 1TLKA 2VZ3A 2F8XC 4NPYB 3BT2L 1ZXQA 3LMJH 3PL6B 4CDHA 2VZTA 3BPNB 4HIEB 4K2UH 3MRKB 3F12B 3NCJH 3FQTB 3GKZA 5LWYH 3U7AA 3P0GB 1E27B 5D8JL 1W72B 4NT6A 5AYUH 1CFBA 1AI1L 4FQIL 4LPUA 3FFCE 4XP9L 4C4KO 1T2JA 2VAJA 2PETA 3D2UA 1XF2A 1LP9B 4NUJA 3RWHB 5L2KA 2WANA 2YD7A 2HKFH 3TBYA 3DURB 4RFNB 1A7RL 1JGDB 1W72L 4XCNB 5E2UL 5EU7C 3OXRB 5E5MB 5D6DA 4J1UA 3HE6A 2Z8RA 1I8IB 1AGBA 1DQDL 5D2LA 3UO1H 1RVFH 3VGDA 4JZJC 1G6RA 4P2RA 2G5BA 4RMSA 1DZBA 2P5EA 3QIWD 5HGAA 4FXKA 1JPGA 2VXUL 4PRID 3V4PL 4CVUA 3GSWB 2NCMA 4LVOB 2XN9E 2YWYA 4MNGB 4M5YL 5FO8B 2O61A 3MR9A 3CH8A 1G7IA 1MRDH 4D9LL 1BBJA 4ERSL 4RGND 3SCMC 3NZ8B 3VXQB 1KYOK 4EBQH 4X83A 1GOGA 3DVGB 1E4WH 3WUZA 3MOQA 4F58L 2BNQE 4KKBD 5J6HA 5A16B 1N6QL 4Z7UE 5TGBB 1JHTB 1RMFL 4XX1E 4XNYH 4Y2DA 3VG9C 5B39B 1U95B 4KMQA 3IFPA 1CD9B 5E0QA 3WIHL 5EZJA 3TV3H 4MCZA 1NMAL 4APQC 4EQ3A 1AKJA 2QADB 4XI5C 4X5LA 2BP3A 4NBYB 1JZ8A 2FHFA 3O4LD 4XVTL 3WHXB 4DGVH 5DJCB 4YH6A 4S1SL 3U4EA 4UMGA 3O3BB 3BGMA 4MXQC 3FTGA 4PLKD 4X6CB 3PWUA 3WLWC 3UTSE 3L5XH 4HWBL 3MRJB 1FLRH 2G60H 2JCCA 3ARDB 4R7NA 1X7QB 3BP5A 4A6YH 1FAIH 3CUPB 3I3EA 3QEHB 5MEPB 3ZTJH 4Y5XB 3CFEB 2CPCA 3H9ZA 3EW3B 1EO8H 4GXUN 3OAUL 3TNNA 1IBGL 4MLSA 4I0KA 4I0PB 1T1WB 3G6JB 5K9JL 3X11B 5AD0A 4G6AC 3MXVH 1ZVHA 5ICZB 3FZUC 2H32H 4G7VL 4C56D 2PNDA 4NZDA 4D9QE 5E00A 4YDIL 3D87B 2AJUH 4X7CC 2P7TB 1ZLWH 4YDLB 2P8LB 4D0DA 5HI4D 1KGCE 5GSRA 5H37H 4ZD3H 4PP2B 3ABZA 4P3CL 4L8BB 3QH3A 1HZHH 4FXGA 1IVLA 2CLZA 4MVBC 1MNUH 1NCTA 4NQED 3LS5L 1QBAA 1S7VA 4OF7A 1MCIA 4J23A 3DX7A 1K6QL 4CVZB 2BVOB 1D3CA 2DD8H 4LQFH 4Y4HB 4JRXD 4QTHB 5HTSA 2IPTL 4NQCB 5DDHA 4XMPH 4FQXA 2UZIL 3MLRH 2A6DB 3U4BH 3MRFB 1UADC 1YYLH 2HTLD 2DJUA 4HJJH 2VXVL 1VCAA 4X6DB 1BFVL 5HYJE 4QOKB 1TVHA 3X12A 5CJOL 4YXKH 2B5IB 2VABB 1TQBC 1I1AC 4OFYD 1FGVH 5KJRL 1G9MH 1IKNA 1MWAA 1F90H 5HYSB 1VADA 3NA9L 1KYOJ 5H35B 5JHDE 4HWEL 4U6VH 1S9XA 4NO2B 1WEJL 3B9KB 1AHWA 3ARGD 2XWJB 5JW4M 5CP7B 4YHZH 4M02A 4DOHE 5IVXB 5LBSH 3O3EA 3VG0H 3MNWA 4LCIL 4LKXA 1L0YA 2GSGA 3T3PF 3MV7E 5IBLD 4R4FL 5AG8A 2DIBA 4OGYH 4HSQA 2B7DT 2ID5A 3LDBB 4HKJA 3QSKB 3DNKA 4R8WL 1QLRA 4JVPA 1IE5A 2F54E 2AK4D 1PEWA 2VN4A 1R5IA 2ZKHH 3C5ZA 1BBDL 1PZ5A 5C0BD 2AEQH 4YHML 2DB8A 4JJHA 1KOAA 1RD6A 3HB3C 3KPOA 3HG1E 3QHFL 4WFFE 4PGCB 3RVUD 5D7IB 5JUEH 1KPUA 1VDGA 1NEZB 1OSZA 4J3UA 2VDOL 5DURB 4FQCL 5BW7A 1AGCA 3O6FD 4KHTH 4XBGB 3U7WL 1K4DA 1KJMB 4NM4L 3ZLQC 1P7QA 1S7RA 1J7VR 2MQ0A 2MKWA 1XAUA 1B0RB 2ZG3A 3MGAA 4LNRB 3F6LA 1X5IA 4HPYL 5ALBL 5IVZA 1E4KC 1FN4A 1IGYA 5DJZA 5HHPB 4ODTL 4DWHA 5I1KH 1AXSA 3SDCC 1HKLH 4OM1H 5E99H 4KFZC 2HKHL 1ZLSL 1EEQA 4U0RC 3SE9L 5C08D 3QIWB 1KCUH 1L9MA 1NMCC 4MNQA 2G9HA 4PRIB 4JM4H 3FN0H 2UWEE 1KJ3H 4ZXBD 1KUMA 3HLAB 1HDMB 4ZDHB 1SEQH 4P4KD 4S2SA 4LGRB 1EV2E 3W2DL 3NBNA 1IQDB 5FB8B 3SPVA 3L3GB 3DMMB 4Z7WA 3V0WL 1JGUL 2DAVA 2VLRD 3OMZA 5GRVK 2Q87A 2AW2A 5CEXB 2GK2A 1A6VL 4X9FA 1OHQA 4GLRH 4QRPA 2I9TA 4OZFH 2E9JA 4GBXC 5FDWB 1QSED 4LEOB 5D1QA 1DFBH 3QUZD 4GW5B 1GGCL 2P24A 4BSJA 1XZ0A 5HYSG 4TUJB 1NPUA 4Z77B 3PGCA 4P4RA 2ED7A 1JCKA 1TMCB 1CE1L 1EGJH 1BQLL 1AGFA 2RQ8A 3VXOB 3MJ9L 3IJYB 1SY6H 1A2YA 5GGSB 4UU9A 4K3EL 3VJ6B 1FGNL 3IDNB 1IGFH 3LN5A 4KTEL 2ZUYA 3FB8B 4PJ5E 2V5RA 4RGMB 4X6CE 3O6KL 4I1NB 5SWZD 2F58H 4X4XA 4PJCB 3QXDA 1OF2A 4R0LA 3O8XA 3BP7B 5ESAA 5L8LB 1NEUA 5C0IB 1JYVA 3PWPA 1QR4A 2X9YA 4PJBE 1ROWA 5HGDB 4BQ9A 2FJFA 32C2B 3CMGA 4NYLA 4A2LA 3UZVB 3KLHC 4JHAH 1WC7A 4ETQB 4XAKD 3VXPB 1S9YB 4N0UB 4ODXB 1DDHA 1TETL 4M7KH 1GGBH 2VUOA 1CXEA 2CK2A 4CN1A 2Z31B 2DQHH 4J4PA 5EC2A 2VNCA 1YC8A 3BZ4B 5IGXH 3GI8L 1IGCH 5EBLB 3AVEA 5A3ID 5ID1A 4EI5C 3AREB 1LEIA 1KELH 4HKBB 3PWNA 3EYOA 3FQXA 3HAEA 4Z76A 1DCLA 5SX4I 2A6JB 2EH7H 1MVUA 3OR6B 5IQ7L 3ULUE 4FHBD 4G9FA 4JRXB 1TVBA 5D7JC 3TEUA 1VGKA 4TSBH 3GGWB 4NO3A 5GHWL 4JGUA 1M4KA 1I8LA 1D5XA 3IVKB 1MCLA 4O5LL 5C9JA 3NCYP 3O9WA 3UZQA 2DWDA 5FKPA 4KI5D 1BEYH 3BP4A 1Q8MA 1KENH 3CAFA 5F9WC 2JB6A 4Y88A 1GHFL 4ODUA 5EDXA 1FNSH 3V6OC 3Q6FA 5IOPA 4L8DA 4XPBL 3BZEA 4P23D 2NY6D 4GW1A 5CEZD 3SGJC 1EJ6A 2QSCL 4P2OD 5GS2D 2OK0L 5KSAD 4H0IA 4QO1A 2AJXL 3WIFB 4XPGL 2J5LB 3MZGB 5E8NA 5JA8B 4GOSA 4PJXA 1D5BA 4X8JA 4JPKH 3BWAB 5ADPL 4IDJL 4HXAH 2C3GA 4U1LA 2BFVH 3RZWA 1XMWA 2OX5A 4C58B 2H6PA 4WW2F 5BXFA 4M8VA 4FNLL 2IALA 5E6IA 5J57B 3ALXA 3IDUA 1A3RH 1WWAX 1FL6B 5E2WL 4S1QL 1YPZA 5C0BB 5JXEC 4E5XB 1MQ8A 1A7QH 1MI5E 2JJVA 4QRQA 4MAYC 1QFOA 5F88A 3WUWA 2ITCA 2VL5A 4GAJL 5L9DL 1UXSB 5IR1B 4G8GB 2GJ6E 3ULVE 1NFIA 1CLCA 2R69H 5IHUH 3QEQE 2BVQA 1IRAY 5B8CC 4HAFA 1X4ZA 5JDSA 1F3JA 4K7FA 3TA3B 5D6CA 3ORJA 2WBJB 4MMXC 4WFEE 1VFAA 4WNQB 1YEJH 4ZFOB 3SGKA 3LD8B 4L8SC 4DAGL 1R0AL 2NY3B 4CDGC 1ETZA 2V2TA 3WNNA 5TDPA 4U6TA 4RQQA 3GMLA 1KTDA 2W0FB 4YDJA 5F7DB 2A1WL 5HHVL 4ZFOL 4PJXF 5ISZA 2BCKA 5IB1A 5CEYA 2DOCA 3SBWA 5D71H 4NHUA 3C8KB 1UQSB 5DD1L 4ZXBB 1JWSA 3RAJH 1BFOB 1DQQB 3B5TA 3C60C 4F7EA 1UB6B 3NTCL 4AEIL 3G6AA 4P46D 1BVLA 1RU9H 1OT1A 2VKXA 2A83B 1SJEA 2IANA 2GT9B 2XTJB 4O2FB 2COQA 1JZ7A 1ZANL 5EFIB 2IGFH 2VLRB 3ROOB 5TPWL 5I17A 4LFHG 1IZKA 4NRYA 1J8KA 3KXFE 1SQ2N 4LAQL 3P9LA 3BSZL 1A7OL 2Y5TB 5JOFA 2VZSA 3RVXD 4JFYB 1QSEB 4EDWL 3CFDA 3QUZB 4NKQB 5T33L 3SJVA 4ONHA 5C71A 1G9NC 5KVGH 4OUOA 4KJWC 3K2UL 2BOBA 3VXME 3FAWA 2BY2A 3VRJA 2YK1H 3KYMB 1IKFL 4L3EB 5KVMC 1KFAL 4JZJA 4ZTPL 4YXLL 1IC7H 2NMSA 2OXGA 3VXNB 2GTWB 3WNOA 3VFUA 2AJZA 4LOUC 5SWZB 1K8DA 4JM2B 3FT2B 3QI9D 1J11A 3MLZL 1PAMA 1RJZB 1H15A 3D85B 1MAKA 4M61A 4AEHL 3CXDH 4OLVL 2YHGA 2WM0A 4QXGL 5CGTA 5TH2A 2VDKH 3ZTJG 5IV2B 3SCMA 3K8MA 2RB8A 4Y2DD 4RX4A 1EFXA 1UVQB 3CSYB 5IJKC 3GZKA 4X9BA 4CRPA 1BHGA 4WIQA 4WV1B 5GRZA 1C08B 4FG6D 3BN9C 2XXCB 3RWJB 1P4LB 1AKJD 1AY1L 1GJIA 3M8OL 3HNTH 5ADOH 1SYVA 1GVIA 3U9UA 5ESVB 4DUVA 1P9MC 2Y7QA 5H37G 4APQA 4OM0H 5E94A 1VEMA 2CD0A 4ZPVA 1ONQA 2ZUQC 3DXAD 3QUKB 1IFHL 3EHBC 4PYGA 2NX5E 2WUBL 3MRGB 5C0EB 3MFGB 2W65A 2ZCKH 1T1ZA 2UYLA 1JPFA 5IMKB 5GJTL 3RA7L 1X5YA 4BSVB 5I71C 3HC3L 2CKBA 3QJHA 2NXZC 4U1IA 1UA6H 3EFDH 3MRLA 4HLZG 3OJDA 3GSNB 4G9DA 2NXYC 1NAKL 1IAKA 1J1PL 3MZTA 5IB3A 3MGTB 3T1FA 2Q86A 5I74B 4IMKC 4I77H 1Z5LA 1I7RA 4PJAB 5DUBB 1S9VB 3GSNL 1B90A 1YY9C 1TZGL 2X4UA 3FO1B 3P40A 5CGMA 1JNNL 2BC4A 3D9AL 1HOCB 1QZ1A 4P2OB 4U3XA 1DN2A 5FHAL 2C3VA 1XT5A 4RNRB 2R0KL 5E8DL 1N2RB 4XP4L 5CEZL 4X99A 2CK0H 2EDKA 3A67L 3CLEL 3VI4F 2YSSA 1OTUC 3QPXL 1MFBL 1ZA3A 1IMHC 4XVUC 3Q1SL 4BKLA 4A2MA 4M1CC 5E08H 5T1LB 5JO5B 3OAZH 4EVNB 4HZAA 1HHJB 4UT9H 1F11B 4GRWH 4K55A 4GXVH 1SVCP 1MFDL 2QBWA 4KDWA 3MV9A 4X4ZA 3V2AR 4QWWC 1QFUL 3V7AG 3N85H 5LGJB 4LCWD 3HZMA 3UBXB 3B5HA 2EIDA 3S4SA 1I1AA 1NMBH 3BP6B 1XFPA 5EIVA 1J0YA 3HFML 5DRXA 5GSVA 4HGMA 1FE8H 4WWKC 2HT3D 3WNLA 4Q0XL 5F6IB 4WVRA 1KPVB 3VWKC 3TYFB 4K8RD 2KZWA 4HIJA 1RY7B 3MA9L 4MJ5B 5JXAH 4LSRL 5GISH 1FPTL 3D69A 3VXUE 2D4DA 1RZJL 3C5ZD 3X3GL 1KJ2A 2YMXL 2JE8A 2G5RA 1OCWL 3BKJH 1FYTA 4N8VA 5F7UA 1TFHA 4OZGB 1CLYH 1NCDH 2KH2B 3TO2A 1I3GL 4CMMA 4FTVE 4ODHH 4NT6B 2X4SA 3BT2H 1JRHI 2APXA 1D5MA 2YRPA 1MPAL 3D2UB 3U7YL 1XF2B 4NUJB 4QHLA 5L2KB 3ZDXF 2VL4A 1IAMA 4U33A 3TBYB 4R6UA 5D8JH 2VMFA 2FJHA 1AI1H 2FYYA 4FQIH 3HE6B 4XP9H 4P2CG 1OWWA 1AGBB 1JUFA 5D2LB 4Z0XA 4QNPE 2CDGA 2HMID 2A9NL 1T2QL 1F3DJ 6CGTA 1T66C 1LDPL 5LCVL 5E2UH 1A7RH 1G6RB 1W72H 2G5BB 4P2RB 2PUQT 3BD5A 3BIAX 3QXAA 4HMDA 2P5EB 4GH7B 1E4KA 4MA1B 5HGAB 1DQDH 4FXKB 1JPGB 4LARL 4PBVC 3SDCA 4LLVA 1VB9A 1MCEA 3BPLC 4LRNL 5FHBL 1HWGB 1G6RL 2LE9A 2O61B 4PJ9C 5JPNA 3MR9B 4JRYD 1G7IB 1PD6A 3LKOA 3V7AE 2P1YA 4NCC2 2VXUH 3H3KA 3V4PH 3V6FA 2L4OA 1HYRC 4JFFE 1T7VA 4M5YH 4ZTOL 5J6HB 1CQKA 1XR9A 1A6AA 5E4EC 5E8PA 5FF6A 4D9LH 4Y2DB 4ERSH 1T7ZA 1JTTA 3IRZA 3GIZL 5IF0A 3PXJA 1EA9C 1AFVL 2X05A 4IDLA 3IFPB 5EZJB 4F58H 3T77A 4KH2A 3D0VA 4MCZB 5D7SL 3UBXG 5DC4B 1N6QH 4GBXA 1KIQA 4PLJD 1AKJB 2XZCL 1RMFH 3RL1A 4S11A 2AQ2A 3T4AA 4MHHI 4AG4L 5D7LA 4JN2A 3WFZA 3U4EB 2ICWJ 3WIHH 1NMAH 3BGMB 5JQHC 5LGKA 3FTGB 5IFAL 3PWUB 3OGCA 1PJ9A 3QXTA 2LVCA 3MRIA 4XVTH 3PWVA 2E9IA 1FH5L 3PWPD 4S1SH 4R7NB 2JCCB 3BRFA 3BP5B 4Z0BL 2FO1A 3FB7A 3GNML 3N9GL 3HR5A 3TNNB 5I30L 4HWBH 2EIEA 1FQ9C 4MQXD 5DD5L 3MJGX 5HSFA 5AZEL 1EH9A 3G5XA 3B43A 3BE1L 4J4PD 5E00B 3SO3B 1IAIM 1ULVA 3ZKMC 1CU4L 3OAUH 1QBBA 3PNWA 1IBGH 2X40A 4D0DB 5GSRB 4LHUG 4UNTA 5K9JH 3QH3B 4FXGB 4KMLB 4LLWA 2CLZB 4G7VH 2W9DL 3DUHA 1S7VB 4DN4L 4YDIH 3RX8A 4G9FD 2APFA 4EI5A 3DX7B 4PJEF 2UVFA 4P3CH 5DDHB 2WIIA 4FQXB 4Q7DA 5FA3A 5AG9A 3LS5H 5IW1A 2VLJD 3IAQA 2YD8A 1K6QH 3J8F7 1T80A 2R4RL 2IPTH 3O9WD 5D7JA 1TVHB 3X12B 4Q6IC 3M07A 3R0MA 4X6BA 1S8DA 2UZIH 5I1LB 4OCXL 2AAVA 4ONFL 1MWAB 3QRGL 5D7KD 1QD0A 1UM6L 2V9QA 3O11A 1VADB 5DEFA 1JZ2A 1NC2D 4NO0A 2DKSA 2VXVH 1BFVH 5CJOH 1FFOA 1S9XB 3B9AA 1P69B 3QQ4A 2CMRL 1AHWB 5KJRH 1AC6A 1X5AA 3STZA 1TXKA 3V6OA 3O3EB 3ARBD 3MNWB 3NA9H 1MSPA 3UC0L 4LKXB 5IMOA 2GSGB 1N8ZA 3S37X 3SGJA 1W2KT 4GKNB 1NGQL 3IDXL 4HWEH 3P30L 4JREB 2P8MA 2CRIA 1VESA 1ODAA 1WEJH 4TSAL 4HKJB 4YE4L 2VXSL 1T89C 1R5IB 1ZA6A 4LCIH 4PV9A 3C5ZB 3TO4C 3L9RA 3ARZA 4HMEA 4OZGE 5DRWA 3P9WB 4R4FH 1HSAA 1PZ5B 2HT4C 2VLLA 3BKCL 4HWZA 4YHPA 1VEOA 3PDGA 1EO7A 3ZE0F 5HDQL 4R8WH 5GRUL 3KPOB 3DROA 4XNUL 1KPUB 4XHQA 1OSZB 2V5MA 5JXEA 4HJ0C 1BBDH 4HFWA 3K81A 4W81A 3U1SH 2VUYA 1AGCB 3C2SA 4YHMH 2YA1A 4NQDE 4MJ2A 1K4DB 4MAYA 2NY5C 2FX8L 3LEVL 1BQHA 4LHJB 5KTEL 4ORZC 4UQ2A 1P7QB 3QDMD 3QHFH 1S7RB 5EZOL 2A0LD 1E4JA 2VDOH 2DIAA 3GM0A 4FQCH 1G7HB 5IVZB 5I1EL 4PRPA 1FN4B 1IGYB 5DJZB 5C6PB 5B8CA 1X5KA 3U7WH 1AXSB 2ENSA 4WJ5A 2P5EE 3K80A 4NM4H 4L8SA 4J3SA 1MCOL 4GUPA 3MNVA 4HPYH 4YGVA 5ALBH 4MNQB 2G9HB 2XXMB 2VLKA 1SMAA 4ODTH 4HK0A 1WWCA 2HKHH 3MPCA 4S2SB 5C07A 1ZLSH 1AQKH 3SE9H 3SPVB 1YEDA 4LGSB 3H9SA 4Z7WB 3SE8L 1HH6A 5EO0A 2XZZA 4IHOA 1O7VA 1LE9A 3C60A 2J8UF 5EULV 1RUPL 3P2TA 4QRPB 4Y19A 3W2DH 2I9TB 3WKML 5D2NE 4MQ7A 4S0TD 2CUIA 5D1QB 2YPVL 3ETBF 3SJVD 3V0WH 2P24B 3JWNC 1JGUH 1XZ0B 1CDUA 1VFUA 3PV6A 5FUOL 3PGCB 4P4RB 1A6VH 2EO1A 1AGFB 4HMCA 1PBYA 4O00A 1A2YB 4AY0A 1GGCH 4UU9B 1JE6A 2MQCA 5CJ5A 3LN5B 4EUPA 1CE1H 1YEIL 1ZHBA 1BQLH 4NZJA 4X4XB 4B7IA 3QXDB 1UB5A 1OF2B 4R0LB 3O8XB 3FHQA 3MRMA 3MJ9H 5ESAB 4LCUA 4BFIA 4K3EH 1DLFL 1FGNH 3GSQA 3PWPB 4KTEH 4LP5A 3O6KH 3EOTL 5I75C 4S1DD 4X7TA 2FJFB 3N1PC 4JHBA 4Y5VC 2EH8L 1YMHA 4PJFE 4Z7VE 3T4YA 4NYLB 1EFXD 3RWEA 1WC7B 2HYMA 1BF8A 2AEIT 1DDHB 3NGBC 4JDTL 5F3BA 4XZUA 1U91A 3GUTB 3GSRA 4MWFA 3EJZC 3NPSB 1GGTA 3SE3C 3BMVA 1Y6KR 1MJJA 5EC2B 5ECJE 5JIKA 1FNGA 1Z2KA 3SDAD 5ID1B 1LEIB 1TETH 4ODWA 3PWNB 3NFNA 3EYOB 3FQXB 1T4KA 4TNWK 3HAEB 4Z76B 3WIIL 1JZ4A 4HK3J 1MVUB 3JV0A 4G9FB 3GI8H 5DFVD 1P9MA 4DUWA 1TVBB 5F1OB 4MXQD 1FNEB 4W6WB 4I8DA 1NAMA 1VGKB 3WLWD 5IQ7H 1JNHA 4L4TA 4YR6A 4E9LA 1GC1L 1AR1C 4WFHD 1D5XB 4NNXA 5C9JB 3O9WB 2DWDB 3D48R 4YFLI 3OX8B 5FKPB 3BP4B 3BDXA 2FLBT 1OD7A 5GHWH 5HPOA 2JB6B 2VJXA 4ODUB 3Q6FB 3KPNA 3MOAL 4L8DB 4O5LH 3WXVL 5IOPB 3FZUD 4GW1B 4IMKA 4NN6C 2P5WE 2XYCA 1EHLL 4UV7L 5MEND 2FH6A 5E8NB 5I6XB 2VDML 4YFLF 1DJSA 1D5BB 1GHFH 4X8JB 3IDYC 3PQYE 1NKRA 4U1LB 1K3ZA 4XPBH 1OQXA 1IILE 4GKSA 5A43C 5FECA 1JZ5A 2H6PB 2QSCH 2OK0H 5BXFB 5K9KA 4AIZA 2AJXH 2E7MA 4XPGH 1OOAA 1N4XL 2IALB 5E6IB 1T7WA 1Z9SA 4Q97A 3QO0A 4YO0A 5JOPE 5ADPH 3GHEL 4HF5L 4IDJH 1PFCA 4FFVC 1SJHB 6FABL 3VGBA 1CFQA 1YPZB 3KS0H 3MV9D 3RVVC 1I9EA 4FNLH 4OKDA 1WUNT 5KSBF 5SWSA 4QRQB 4PRDA 1CR9L 5F88B 3WUWB 5F7KC 2ITCB 5H2BA 2VL5B 4JFEA 1EUUA 1FNHA 5E2WH 2DMKA 4S1QH 3JTSA 1U0QA 4PRHA 4PJDF 1I1AD 2C3HA 3D3VD 5KN5A 2YWZA 3WKNA 1T83A 2BVQB 3IKCA 5DO2C 4NC1E 5JDSB 1OP3H 1F3JB 4K7FB 5D6CB 3V95A 4GAJH 2DQFA 5I8EA 1VFAB 2NY0C 3MCKA 1T20A 3T09A 4LVNB 1ETZB 3C09C 3STLA 2V2TB 3LN4A 5TDPB 2HFTA 4F8QA 1Q0XL 2D9CA 2EDTA 4WWKA 4RQQB 3GMLB 1X3DA 1KTDB 3KLAA 4P9ML 4MNQE 1DR9A 4YDJB 3VWKA 5I15L 1W8NA 5ISZB 2BCKB 3MRHA 4DAGH 1NGPL 5CEYB 5IB1B 1R0AH 2PXYD 4NHUB 2IF7A 5J13B 1FYTD 4IOFD 2YD4A 4JO2L 1JWSB 2WWKT 4DGIL 5D1XC 4F7EB 1WVZA 3G6AB 4PRNB 3UTPD 1BVLB 3ZE2E 2A1WH 5HHVH 2JIXA 1SJEB 2IANB 4I2XE 1RUKL 5IWLC 5DD1H 5I19L 4Q9BA 3L3DA 4LLYA 2PF6A 4PG9A 3SQBA 5I17B 3HB3D 3B9VA 3QDGA 4NRYB 3NTCH 4AEIH 5T3ZD 3P9LB 1D5ZA 5JOFB 2FGWL 3CFDB 1CD0A 1DEEA 3SJVB 1HQ4A 1OLZA 4ONHB 4WI7A 1ZANH 5CAYB 5LVEA 5TPWH 1ZVYA 4D0BA 5JPMA 4KKAC 3CSBA 4LAQH 3HI6L 4RDQG 3HMXA 2BOBB 3BSZH 1A7OH 5HVFB 4EDWH 5I1IL 3VRJB 1CWVA 2ADJA 5T33H 1DVFC 3IAGC 4X80L 3SDCD 5MI0C 4JZJB 4JB9L 1Z6JT 5C6TL 2EDNA 3K2UH 3VFUB 2AJZB 1HKFA 1K8DB 2XQYG 4NOBA 1AGEA 1A6ZA 2J12B 4FOMA 3S37L 1IKFH 1H15B 5HPMA 5BCAA 4WGWB 2BY1A 1KFAH 4QT5A 4ZTPH 4YXLH 4M61B 1EEYA 4PJ9A 5DF0A 3N1GC 3N0PB 1K8IA 5J9PA 3X17A 5TH2B 5K9QG 4EEEA 1KXQE 3HN3A 3SCMB 4Z95L 4EXPX 1EFXB 2AQ3A 2R0WL 1KCSL 2HJKA 5FM5M 4AEHH 4OLVH 3SKMA 4GBXD 2IFGA 4QXGH 4RA3A 3RWDA 3VG9B 3MREA 2H2SD 2AP2A 1SYVB 2BERA 5D7LD 3U9UB 3BUTA 2Y7QB 3JV5A 4APQB 4MJIE 4AK1A 1F6AA 5E94B 3IU4L 4ZPVB 2VN7A 1WCBA 3S96A 1AY1H 5E56A 5MEOA 3M8OH 1A0QL 2Q8BL 2W65B 4ZNCD 1T1ZB 1JPFB 2EKJA 2IH3A 1MHEA 2IAMC 3VH8G 2X9XA 2K7PA 2QQKL 3OAYH 4P2QE 5EZLA 2CKBB 3QJHB 4G3YL 1IFHH 2GY7B 2WUBH 1G7PA 1BECA 4U1IB 2I5YL 3MRLB 4ZS6C 3OJDB 4ZOAA 2LU4A 1S7UA 4G9DB 5T1KA 5GJTH 3RA7H 4KAQL 3FN3A 3OAZK 3ES6A 1IM9A 5IB3B 3T1FB 3KR3L 2CKBL 1NCBL 3HC3H 2Q86B 1Z5LB 3D18A 1I7RB 3KLHD 3W5MA 1OAUL 1MCNA 4ZUWA 2V7NA 2X4UB 1CVSC 1NAKH 1IC5L 4ZODA 1J1PH 2BC4B 4X6FA 1F8TL 4XB7A 1AXTL 4XHJC 2C3VB 2ESVE 3T2OA 3GSNH 4EI5D 1TZGH 2J2ZA 1PY4A 4WDIA 1JNNH 1Z3GL 4R96A 3D9AH 2YSSB 2X6MA 5EIQA 5FHAH 1OP5H 2QEJA 3NPZB 4BKLB 2XACC 2R0KH 5E8DH 2HJLB 1GZQA 4XP4H 1DBBL 4BSWA 5CEZH 5D7JD 1CZ8L 5AEAA 5GS2H 3A67H 1U8MA 3MV9B 3CLEH 3MV8A 3UTTE 1J8HE 3QPXH 1MFBH 4JPVL 1XCQA 3Q1SH 5CP3A 3MLVL 1H9VA 4Q6IA 2DBLL 2P8PA 1MFDH 3CLFL 4V1DE 4GKOA 3S4SB 1C7TA 1I1AB 1TQBB 3GJFK 3EZ8A 3CVIL 4OCMC 4QRRD 1QFUH 5IW3A 3DBXA 1PYWA 3M17A 5DRXB 5GSVB 3UYRL 1X5XA 2IH1A 1V3LA 4JDVA 2XKSA 4U1MB 3VDAA 1JRHL 4TPRL 3UP1A 1IM3A 4HIJB 1YEHL 2B1AL 5I0ZA 3MQIA 3HFMH 5EG6C 2E7BA 1FL5A 3D69B 3VFPA 1KJ2B 4Q0XH 4KRPC 4GMSL 3MRDA 1FYTB 1X5ZA 4N8VB 4YBLC 3MA9H 1KCVL 4WCYL 2AV7A 1T89A 4LSRH 3TO2B 1FPTH 4CMMB 3TO4A 3JTTA 3UAJC 1S7TA 3ZDZF 1RZJH 3X3GH 1MELA 2YMXH 2X4SB 1YEGL 1CIUA 5JXED 3MTRA 2VZVA 5CBEB 1OCWH 4ZNEE 1EBAA 3VGFA 4WU5A 3GHBL 4QHLB 4ZSOE 1I3GH 3PIQA 2FJHB 1XGUA 4OV5A 2FYYB 2BNRE 4JO1L 4I3GA 5CS7A 1N5AA 4Z0XB 2CDGB 1MPAH 3U7YH 1J1OL 4HLJA 4MA7H 4DFIA 1PLGL 4OZHA 4RISL 5T3ZL 3MACL 4JO4H 4FQ2L 1CS6A 1MOEA 3RUGF 3G9AB 2L0DA 4UNVA 3BDYL 3RFZC 4HHAA 5F71A 3R8BB 4POYA 3SDCB 2A9NH 1T2QH 2C4FU 2VLKD 4LLVB 4M4RA 1I9JL 1LDPH 5LCVH 5BOPA 5JPNB 5C07D 4U0RB 1BM3L 3GMOA 4P9HC 4EDXA 3DYPA 5EU4A 1NMCB 5I8KL 3LKOB 4C83A 1AO7E 5LXGL 3H9SD 1KG0A 1KTRL 3QPQC 2WUCL 4LARH 3V6FB 1H3VA 1ZE3C 3F7RA 2I9LA 4ZYKA 2DJSA 4JHWL 4LRNH 5FHBH 1G6RH 2FX7L 4WO4C 1I1RA 1J12A 1XR9B 1A6AB 1BREA 4Y19D 5E8PB 2H1PL 5FF6B 2A74A 2CRZA 3LN9A 3PL6C 5IF0B 1UEYA 3GMPA 1RIHL 1UXWA 4UTAL 3T77B 2ATPA 3CPLA 4ZTOH 1NUDA 4GBXB 1KIQB 3RQ3A 3VMNA 5CKGA 3RL1B 4FQ1L 5CCKL 3HNVL 3T4AB 3GIZH 3BJLA 3QWRA 4KUCF 1AFVH 5D7LB 4KJWD 1UEMA 4JN2B 4MNHA 5D7SH 2X1PA 2XZCH 2H41A 4RRPG 3OGCB 4AG4H 3MUHL 3MRIB 3OV6A 3PWVB 4PFEA 3CFKA 2FBOJ 2PW1A 1GSMA 4LOUD 5IK3A 3FB7B 4X7DC 1WAAA 4LU5L 5IFAH 4WTXA 4JKKA 2OLDA 3HR5B 2EIZA 1FH5H 1SBBA 4Z0BH 2DQDL 5KAQF 4Y5VA 4GQ9L 2RJMA 1KLGA 3G5XB 3QQNA 3GNMH 3N9GH 3STBA 2FRGP 5I30H 3PNWB 2IPUG 4M7ZC 3BN9D 3NIGF 4PR5A 4RGNE 4JR9L 5DD5H 4HX1A 2DL9A 4MLIA 2R2HB 4LLWB 5AZEH 4YLQT 3SE3A 4TUOA 3BE1H 4QHNA 5IFHL 3EO1A 4WHCA 4KUZL 4EI5B 1CU4H 4U1GC 3L3KA 1PKQA 4LASL 3W0WA 2WIIB 4GRLC 5JA9A 3EHBD 5FA3B 2W9DH 1UFUA 3AGVA 5IW1B 4L4TD 4DN4H 4CMHC 4OIIL 3KPSA 4DK6A 1ADQA 3IU3A 4LLUA 3MUY1 4H0HB 5D7JB 3RVTC 4JO3L 4MD5A 4X6BB 1S8DB 2QSTA 5KW9L 5I1CL 3O11B 1MCPL 1OAZL 4JFDA 1QQDA 4M00A 5DEFB 4NO0B 2R4RH 4O4YL 3B6SA 5DRNA 1FFOB 3QQ4B 4B41A 4OCXH 5DC0A 4ONFH 4WI9A 3QRGH 3MGOA 1UM6H 3STZB 1YY9D 4U7MA 3NN8A 4NC2B 5D9SA 5IMOB 4CVXA 3FAXA 2P8MB 3T2NL 5HGBA 2CMRH 5DZNA 4CJ1A 5C0FA 5IG7A 3AS0A 4BK4A 3VXSE 4C56E 1ZA6B 4PV9B 3UC0H 3IXTA 3GO1L 3L9RB 5DRWB 1NGQH 3IDXH 3SO5A 1HSAB 3P30H 1EIBA 2GFBA 2VLLB 5T5NF 1OTUD 4HWZB 4TSAH 4YBQC 4D9RD 4F15B 1A7NL 3WS3A 4YE4H 3SGEH 1PDKA 2VXSH 4M3KB 3DROB 3JUZA 5A2IH 4WFGE 3ULUC 4HFWB 4TTDC 3BKCH 1G7MB 5DHVA 5HDQH 4QWWD 4MAYB 1BQHB 1FZJA 5GRUH 5MHSD 2FSEA 4UQ2B 1EVUA 1U8LA 4XNUH 2EXYC 1GAFL 4PRPB 4OCLC 5BO1L 5B8CB 2B5IC 5IBUB 4GMTL 1FRGL 1JN6A 4WJ5B 4OIAA 2FX8H 3LEVH 4WWKD 5E9DA 5KTEH 2YOCA 3TN0A 5C09A 1X5LA 3VWKD 5EZOH 4L8SB 2YEZA 2I27N 4GUPB 5CUSL 1LILA 3MNVB 4YGVB 5I1EH 2DM2A 4Q9QL 5KS9E 2VLKB 1HH9A 1MCKA 5DA4A 3EJYC 5C07B 4JFOA 4G6JL 5C2BL 1TTUA 4MS8C 2JIXD 1MCOH 1YEDB 3MX0A 1EFQA 1HH6B 3BW9A 4IHOB 1BQUA 3OG4B 3C60B 3VFGL 5D1XA 5LGHL 2FLRT 2APVA 4EXKA 4XNQA 2APWA 1QRNE 4Y19B 2VSCA 4UI2A 4MQ7B 5IWLA 2VTFA 5KOVC 2AK4E 3SE8H 3MCLL 5FK9A 1RUPH 2B0SL 3QUMA 5IVNA 5BMFL 2R23A 1D9KC 3WKMH 1PKOA 2YPVH 1DQML 1KIRB 4N0FA 3W5NA 1T1XA 4TNWF 4ZOBA 1T66D 2F74A 2PYEA 4GG6E 2XFXA 5FUOH 1EHNA 1Q0YL 1WZ1L 3W9EA 1FG2A 4EUPB 3ULVC 4I0CC 2X89A 1ZHBB 1JF1A 1CFSA 1UB5B 4PJHE 3S5LA 1DVFA 2CIIB 5BS0E 3MRMB 1BZ7A 2EC8A 4LCUB 4LPTA 4BFIB 2Y06L 4JANB 3OHXA 5F70A 3GSQB 3OZ9L 2BSTA 1YEIH 2X70A 3QWQB 4X7TB 3SE4A 1CE6A 5HHOE 5MERA 1YMHB 3T4YB 1CGXA 3RWEB 1DLFH 1U58A 4Y1AE 3BQUD 5C08E 5F3BB 3EOTH 4XZUB 3J7HA 2A2QT 3GSRB 4PBWD 5EUOE 5SX4H 4MWFB 3U48A 5HGGS 2EH8H 3TC9A 1UCTA 1MJJB 1OVZA 3CFBA 3LY6A 5E5UB 1V7ML 2YPKA 3B83A 3ILPA 2G75A 2VDQL 2HLFC 5F8QC 4ODWB 4JDTH 5KG9A 3NFNB 1T4KB 4U7SA 2ZOLA 2ILLA 1KT2A 1U8HA 1OGAE 4MSWA 4OCYL 4KTYA 3FFCA 3HC0A 4JZOA 5K59E 3LOWA 2ZUQB 3WIIH 1NAMB 2AJYL 5LJYH 5E8OA 1CFNA 2OP4L 4MYWB 1AP2A 2WWKO 1JNHB 4L4TB 4LLQA 4YR6B 3T2QA 4Q9RL 3ALWA 1FVDA 1L6XA 1DBJL 4NNXB 5T1KD 4OT1L 3GMRA 3O2WL 3KLSA 5IHBA 4CW1A 5I71B 4NJAL 3HAEH 5I66A 4Y8AA 2MPAL 1NAML 2NXZB 2ZG1A 4CAGA 1N3NA 5C0CD 1ND0A 3O2DA 2NXYB 1GC1H 4WTZA 3VFNA 3V0VA 3KPNB 3TESA 4PV8B 1RJCA 3UMTA 3F8UB 3KG5A 3TT1L 1BD2A 4IRZL 5IQ9A 1BVZA 2QJDA 4NKIL 2FH8A 2XN9A 3DHJA 4PJIF 3RGVC 3HMWL 2XY1A 3TFKC 4M7LL 3ZKQD 2AXHA 2D7QA 1OP3K 3MOAH 3WXVH 4Z7OF 4X5XA 2VKWA 4GKSB 2DN7A 5FECB 1MJ7L 1MLBB 3MBED 4X4MA 3H7BB 2FR4B 2WWMC 1EHLH 4UV7H 5ERWA 4IOIA 3WE6A 5K9KB 1CDCA 4AIZB 2BNQA 2VDMH 4CJ0A 2HRLA 4Z7UA 3QO0B 4YO0B 3GI9L 3K8LA 3G6DL 1CFQB 3K2MC 2FATL 5IB5A 4L1DA 5CZXD 2YD9A 3V4UL 3TZVD 3TBWA 1N4XH 3GFUA 5SWSB 4PRDB 3GHEH 4HF5H 4K94L 4M48L 4JFEB 5H2BB 2CXKA 6FABH 5GPRA 1K9TA 3JTSB 4PRHB 1QLFA 1U3ZA 5KN5B 3K46A 3NIFE 3VA6A 1U8QA 3IKCB 1MHCA 1CR9H 4FQJL 3KPRE 4NZUL 2CKNA 2DQFB 5I8EB 3KDMA 1YYML 5GS0C 3E0GA 3MCKB 3UTSA 1T20B 1ZKAA 3STLB 3LN4B 1MQKL 3ZKXC 4WWKB 1O5DT 2X42A 4OBRA 4YHLL 3KLAB 4QHUA 3VWKB 4KRNA 3QAZC 5F7HA 3MRHB 3DIFA 3VD9A 1RK1A 1Q9OA 1Q0XH 5F89A 1HXYA 4ZUSA 5F97E 4P9MH 1MCJA 1FFRA 2HT4D 5I15H 3MLWL 1NGPH 5KVEL 3V6ZA 3C6LD 3L3DB 3OKLA 4JO2H 3GM8A 4LLYB 4R2GC 1X4XA 4PG9B 2M8XA 1RZKC 1RURL 3QDGB 4DGIH 3VGHA 4P57A 4WHYG 5DQJA 1D5ZB 4KUCD 3D39D 4HJ0D 3BPCA 2YZ1A 5E24E 1DEEB 2QSVA 1RUKH 1HQ4B 3KS0J 4AL8L 5I19H 2W9LA 3LQZA 4QRTA 4R9HA 4D0BB 5JPMB 5GRXG 1Z9OA 1INEL 1WWBX 3OXSA 2FGWH 2UY6A 1LGVA 2ADJB 3S35X 2QV2A 5ACLA 2D0HA 2EDFA 5HYJA 2N4IA 4KK5C 4TRPL 3MRPA 4OUUA 1FV1A 3G08A 5L88L 4AEFA 3HI6H 3WNKA 2NNAA 4H0GA 1AGEB 4JCMA 3FOLA 1A6ZB 5SX5K 2FCBA 5I1IH 4GS7C 5JHDA 4X5WA 4CADA 5HPMB 2NY3C 2AXGA 1CT8A 2OJEA 4X80H 4Q74A 4JB9H 3PV7A 4QT5B 4RWHA 4Z5RA 1EEZA 1EEYB 5C6TH 4PJ9B 2Q6WA 1K8IB 3ZSTA 5J9PB 3OAYK 3GRWA 3S37H 2GITA 3MV7A 4GRWF 2HJKB 1MLCA 3HPJA 1S7WA 3SKOB 4WO4A 4W6XB 4KDTC 1JNJA 4I4WA 3SKMB 2JLLA 2ZSWA 4NPYA 3RWDB 2KQNA 3MREB 2F54A 1CDHA 4Z95H 3ESUF 3ARYA 3QWRD 2R0WH 3SGDI 1KCSH 4OZIF 1N5YL 1G9MC 1ZAGA 1I8MA 4OI7A 1QFWI 1F6AB 4LPVA 2ED8A 2E6PA 1WCBB 3S96B 5MEOB 4LLMA 3DRTA 3HG1A 3ALPA 3BEVA 2ZZUT 3BEWA 2IH3B 5FYKE 1MHEB 2DQGL 3IU4H 1QSVA 5EZLB 1I8IA 1ZEAL 1NGYA 1A0QH 4O2CA 2Q8BH 1G7PB 4M6AA 1OP5K 4M4PA 5HVGB 1S7UB 5T1KB 1JV5A 3ES6B 4X8XA 4MDJA 1IM9B 2QQKH 3TVMC 5A2FA 3IFOA 4TUKL 2XI9A 4G3YH 3D18B 5FO9A 1NFDF 1RAMA 2I5YH 4ZUWB 2V7NB 4GAYA 4KAQH 1UJTA 1MRFL 4W4NA 5C0NC 4TTGA 2UWEA 1UH2A 5CIPA 4X6FB 3KR3H 2CKBH 1NCBH 3MLSL 1KEML 1OAUH 1F4XL 4JFPA 2RCSL 2C3WA 4WDIB 1I9RL 1IC5H 4R96B 3BUYA 3DSFH 2B20A 3T0DA 1F8TH 3RY6C 1AXTH 5J1TC 3GDBA 2EE6A 2HTKD 3G5YA 1N59A 3KPSD 4HD9A 1N0XL 1GZQB 1Z3GH 4GRLA 4BSWB 1P4IL 4O02L 1LP9F 1U8MB 3MV8B 3P4LA 3RP1A 1XCQB 4PGEA 3NCFB 4JFDD 1F42A 5CZVL 4KY1L 3DXAE 2G60L 5TE4L 3EYUL 1DBBH 4Q6IB 1CZ8H 2P8PB 2AK1L 3KPQA 4K71B 5B3NA 2P46B 2UY7A 4PJ5A 4JPVH 1U6AL 3WJJC 4K9EL 3DBXB 1PYWB 3M17B 4XCEA 1BZQK 3MLVH 2Y6SC 2IH1B 4JDVB 5ICYA 4YGAB 1EO5A 2DBLH 3CLFH 4XCCL 1IM3B 2YA2A 5DFTA 3RWCA 1JL8A 5CJ8A 4PJBA 3CVIH 1F5WA 3FHAA 3UYRH 1TDQA 3VFPB 4KI1A 3T3PE 5EBGA 2J6EA 1JRHH 4TPRH 1YEHH 3MRDB 3IGAA 2B1AH 5EORL 2AV7B 1HIML 2CIKA 4FFVD 1NUNB 5E2TL 3TO4B 3JTTB 1S7TB 3QDJD 1OAKL 3IAPA 4OLUL 1EPFA 4GW4A 3RVVD 3V8CA 4GMSH 3VXRE 5DMJB 1BWMA 4QRSA 4MB5A 2X4PA 4WU5B 2ADIA 4XTRC 1KCVH 4WCYH 3IFLL 1FC2D 3PIQB 2NY1D 1XGUB 2KZ1B 4OV5B 1YEGH 2W38A 4JZNA 8FABA 4D2NA 1QSFD 4RWYL 4AT6A 3GHBH 4OZHB 5J56B 1JWUA 5C09D 4X6CF 2NY0D 4XMLL 3MLTA 4JO1H 2Z91A 4HHAB 1GL4B 1J1OH 1PLGH 5HYSA 3OKEA 4FZEL 4RISH 3MACH 5T3ZH 5GQBA 1T0NA 4FQ2H 1F45A 5DUPL 3GMOB 4O58L 4EDXB 3BO8A 4U3CA 5EU4B 3BDYH 4C83B 3UX9B 5LKNA 1KG0B 3G6JF 2XWJA 1CDJA 3EO0A 1I9JH 2I9LB 4ZYKB 2MQ3A 1BM3H 4U2ZA 1S9WB 3O6LL 2A74B 5I8KH 4Y16C 3RTQD 5LXGH 4YX2L 5CKAA 2WUCH 2Z8VC 3IJSA 4HAGA 3GMPB 3ZMRA 1UXWB 4HCRA 4JHWH 4HULB 2FX7H 3CPLB 3K1DA 2H1PH 2BVEA 5ICXA 3MRQA 1FAKT 5T1DL 4N1EA 1IC1A 1RIHH 4UTAH 4XPHL 5KZCD 4MNHB 4C57C 1YN7A 1D9KA 2X89D 4KK9C 5KSUA 1MI5A 4AYFA 2P4AB 4U1KA 1DVFD 4FQ1H 5CCKH 3HNVH 1OTTC 4X6DF 2XV6B 3CFKB 2GJ6A 1KJMA 2PW1B 2VITA 5IK3B 1AC0A 1NCNA 3OKDA 3OBAA 5DA0B 1NCUA 3QEQA 3DVNA 4OFDA 1JJUA 5BJTA 5ENWA 4MQTB 4X7FC 2EIZB 1OAXL 3TIDA 1A1OA 3HRZA 5I75B 3MMEA 4BFEA 3MRCA 5JIIA 5IVXF 4Y5VB 1KLGB 4LU5H 2DMBA 1Y18B 5EB9A 1OD9A 5DD0L 5HDBF 4NQVA 3NGBB 1XGTA 4PR5B 4HWUA 1S3KL 1F00I 4HX1B 3UJIL 4WWID 2DQDH 5ITFA 4GQ9H 4HGWA 4TUOB 4JFZL 1P5VA 4QHNB 4IOSD 3EO1B 1D7FA 5EU6A 3L3KB 5D2NC 3VW3L 1MCQA 1PKQB 4JR9H 3W0WB 2AERT 4XGZA 1RHHA 1C8PA 3KXFA 3VE0A 4B50A 5IFHH 1ZHLA 3RWFA 5D7IF 4KUZH 1T6VN 5I2IA 3KPSB 2IAMD 3IU3B 4LLUB 4ZOCA 4LASH 1EBPA 3EDJA 4DVRL 3QCUL 3T8XA 1MEXL 4MD5B 3ULVF 4K7PY 1K3IA 1IGJA 4ZS6D 3VXMA 1I3UA 4JFDB 2WQRA 1QQDB 4FS0A 4ELKB 1ADQL 4NC0B 1M6OA 2DM4A 5DS8A 4RFOL 1N7ML 1YJDC 3B6SB 4JO3H 3SQOL 1QYGL 2WNGA 4X6EA 3MGOB 5KW9H 5I1CH 5B38G 1MCPH 1OAZH 3NN8B 5D9SB 5JW4N 4O4YH 4NN6B 2OTWA 4F8TA 3RGVA 4XHJD 5F3HA 2N7BA 5IG7B 4ZFZA 5C0FB 5DFWH 3IDYB 5FFLA 3DWTA 2ICWA 4FQLL 2VXTL 3IXTB 3V52L 1MF2L 4ZO8A 2NTSP 2GFBB 3TPUA 3T2NH 2D9QB 4WW1A 4Y5YC 4KQ4L 3ARUA 3WS3B 4TSCL 4LCCC 3IS1X 4OFKA 3TH2T 1HN1A 4DTGL 5IESL 2YD3A 3GO1H 1NH6A 4R90L 4NO5A 4HQQL 1ZS8A 3QWOA 4LKCA 5DHVB 1A7NH 2YN3A 5HBBA 4NRZA 2VXQL 1FZJB 3RIAK 3LRGA 2FSEB 4JFHD 2NX5A 1U8LB 2AQ1A 2B2XL 2BSSA 5DK0A 3UTSD 2X9WA 4YZFF 2GQHA 2R1WA 2AGJL 1JN6B 3EYSL 5E9DB 4PJCF 1LO4L 3TN0B 2NY0B 5C0AE 2YEZB 5D7KE 1GAFH 4RAHA 1G7JA 4NDMA 5BO1H 1JMXA 4GMTH 2CLVA 1FRGH 4MXWL 3QQ9C 3QUYC 1HH9B 3CDFA 4KHXL 3LEYL 4JFOB 4D9QD 3V0AC 3UTZA 1RFDL 5JORA 5CUSH 5BVJA 1KGCD 4PJ8C 4Q9QH 2LQRA 5J11C 2CDEA 5D1XB 5EU5A 4R3SA 3ARWA 4XNQB 4LHQB 4G6JH 5C2BH 2MTPA 1V05A 4RSVA 1T0MA 5LGHH 3VFGH 2DI9A 5FK9B 1T03L 1CICC 2QR0A 3QUMB 5T5FL 2R23B 3F7YA 1KV3A 2BOCA 2P48B 4BK5A 1KLFA 1CGSL 2P47B 4N0FB 3MCLH 1T1XB 5HYJD 2F74B 2PYEB 2XFXB 5M7QA 2B0SH 3W9EB 1FG2B 3QUML 5KZCB 4PGBA 5BMFH 1JF1B 1CFSB 1U8PA 2OJZL 2H32A 1DVFB 1KB5A 4NC1C 1DQMH 1BZ7B 5MI0B 2Z35A 3OHXB 3KYKL 4GO6B 3IF1A 1QTYT 4OLXL 5F7LB 1Q0YH 1WZ1H 2BSTB 2X70B 5CJXC 1CE6B 2EDXA 3VGGA 2YD6A 5MERB 2ZSVA 1G9NH 2QQNL 4PB0L 2FWOA 1HILA 3P73A 1VHPA 2PO6D 2Y06H 3S3JA 5GZOC 3MV7D 1U58B 3KNBA 3MSPA 4WO4D 3OZ9H 4EUPH 5F7DA 1OY3B 3LHPL 1A5FL 2DRUA 2RFXA 2F54D 3PL6D 1TZHA 3VXUA 5J12B 2YPKB 3ILPB 4I48A 2G75B 4DKFL 4KDTA 2OI9C 4H1LG 3ZO0A 5KG9B 1MCBA 4NCC1 3U6RA 2ZOLB 1YEEL 1KT2B 1U8HB 2AKRA 4HUMB 2IPKA 5FV2A 5D1QC 4FTVA 3W0WE 5KVGL 1V7MH 4MSWB 3PABA 3FFCB 1T2XA 2VDQH 1BGXL 3HC0B 3VRIA 4F7CA 2KQMA 4JZOB 2YRLA 4RMTA 3PWJA 5E8OB 1CFNB 1AP2B 2R9HC 2V2WA 2KKQA 3B8SA 4LLQB 4Z78A 3EZJB 4OCYH 5IJVA 3OKMA 4LSQL 3GMRB 4CW1B 3S97C 4POZC 5I66B 2EICA 3L5WA 1Z0NA 3SKUD 2AJYH 1N3NB 2OP4H 1ND0B 1NCCL 4Q9RH 2ZPKL 2DM7A 1DBJH 1DUYA 3VFNB 4OT1H 3V0VB 3O2WH 2VZOA 3TVMA 4NJAH 1BD2B 5IQ9B 2MPAH 2XQYK 1NAMH 3U83A 2XN9B 1NBYA 3O2DL 3LEXA 1IAOA 3PGDA 2JF1A 3L3OA 4X5XB 2YR3A 3TT1H 4IRZH 4NRXA 3BVNA 3RPIA 4LVEA 5ERWB 4IOIB 4NKIH 3WE6B 1BIIA 1A6PA 4JFFA 4IMLA 1NBVL 2BNQB 3W39A 2NY4C 3HMWH 4U6YB 1WLHA 4M7LH 4Z7UB 4ZQKA 4BQ8A 1ZT4A 3F58L 4OI8A 1MJ7H 3V5HB 5IB5B 3RY6A 5I8CA 2DQEH 4ZS7L 2QADD 3ZZ1A 1JNLL 3CNKA 2EEAA 4WI6A 3TBWB 3CDCA 3OJ2C 5DR5L 2DYPA 3DRQA 3GI9H 4NJ9L 3T3ME 3L5JA 3SDDA 3G6DH 4L9DA 1QACA 2FATH 3KWWA 3WS6C 4YEFA 1QLFB 2E8YA 3V4UH 1U8QB 1XIWC 2OMBA 4MJ4A 1FLTX 1MHCB 5IMKA 4M48H 4K94H 2WIMA 3ARDD 3KDMB 1RJLA 4N1CA 3UTSB 5E9DE 4WFHE 3WJJA 5I1JL 4DKDC 5BVPL 4JM2F 1YMMA 4KJQC 4JHZA 5HHMB 4I0PD 4FQJH 4NZUH 4QHUB 3IKKA 1YYMH 5F7EL 3DIFB 1BQSA 5JQ6L 1Q9OB 1MQKH 4ODSL 1HXYB 4ZUSB 3LB6D 5MENE 4YHLH 3VFRA 2BNUA 4E41A 3LIZL 3LAFA 1OL0A 2OCFD 4KRPB 3MROA 1EGJA 1JHLH 3I85A 4YBQD 1ZGLA 2WK2A 4R97C 4YBLB 3TCLA 1ZT7A 3V6ZB 2IBBA 3OKLB 5DVOA 1SY6A 5IHZA 3CK0L 3FQUB 5E4IA 2R39A 1BLNA 4P57B 5DQJB 3VRLF 3ULUD 3BPCB 4NQCD 1G1YA 1QKZL 4HKZA 3MLWH 3P0VL 2R2CA 4UQ3A 5FYJD 3ZL4L 4MHHG 1CBVL 5KVEH 1S5IL 3WDHA 3LQZB 5FGCE 4QRTB 3ZKNC 1RURH 1B4RA 3ZDXE 1L0XA 2HT2D 3DARA 4AENA 2EXYD 3OXSB 2PKDA 3O81A 3QISA 1F3DH 4AL8H 5DJ2A 5HYJB 3MRPB 4OUUB 1FV1B 3G08B 3VGEA 2NNAB 3D3VE 3VA2C 1INEH 4YIQA 3FOLB 3T0VA 3WXWL 3F7PC 5JHDB 4X5WB 4CADB 3O3UN 3B9KD 3RZCC 2AXGB 1CT8B 1CXIA 2OJEB 1QO3A 4TRPH 3LS4L 2N1KA 5L88H 4Z5RB 1EEZB 3EJYD 4KI5F 1QFWL 2Q6WB 3NVQA 4PJAF 1FG9C 4E0RA 4DOHB 3K74B 5DEGA 1JHKL 1BVKA 1XF5A 3DETD 4EOWL 2X1WL 4XVSL 4OQ1A 2EYSA 2GITB 3MV7B 1LEGA 4M6ML 3UYPA 1MLCB 3HPJB 1S7WB 4WO4B 1GPOL 3KVQA 3MA7A 1WZMA 4I4WB 2ZSWB 4Y16A 3WV0A 2F54B 4ALAH 2MWCA 1LHZA 2FL5A 1MCCA 1DSFL 3B9EA 1M05A 4OZGA 1AIFA 3KYNA 3LKPB 1I8MB 3VMPA 2HAZA 3TJHC 3E8UL 1DQLL 3UBXI 5DURD 4LLMB 1G9EA 3DRTB 3HG1B 5DJ0A 4MQSB 1ES0A 3BEVB 3BEWB 1UACL 4FFWC 3ULVD 1N5YH 1UG9A 3SKNA 43CAA 4NQDA 4LHUA 3WMSA 3SDYL 1C5DA 1UM5L 4U31A 1NGYB 4O2CB 3DO3A 1U42A 5DJAA 1IQWL 4LSTL 3F7VA 4WFED 5LQBL 3VWJC 1JV5B 4OKVA 2DQGH 3S3PA 4DCQA 4OQTA 4MDJB 3VU2A 3IFOB 3OJVC 4OF5A 3W11C 1ZEAH 5FO9B 1BD2E 2R1XA 4G6FB 3A6CL 5J4MA 4DGYL 4GAYB 3INUL 4M03A 1VACA 1CD1A 2UWEB 1S7XA 5CIPB 4M9OA 1R3LA 4TUKH 2DLEA 3DMMD 5EA0L 4YEEA 1QEWA 4KK6C 4PY8J 3QYCA 2SEBA 4JFPB 4M7ZB 4X4ME 5HY9A 1TCMA 1MCRA 2AVGA 1MRFH 3L95A 3BUYB 2X41A 4OZGF 4QXUL 3MLSH 3KXFD 3S36X 1KEMH 5TJWK 4U1GB 2GEEA 1A4KA 1F4XH 1N59B 3G5YB 2RCSH 5D2NA 2F8OA 1KTLA 4PJEE 2B1HL 4OFVA 1I9RH 4GRLB 4NIKB 3QNZA 3AAZA 1I3RA 5GGTA 1RZGA 2IBGA 2PYFA 4CMHB 4PGEB 4HS6A 5GRYA 3UTQA 4K23L 1N0XH 2ARJQ 3QCVL 5D2LF 1P4IH 5DMGC 4O02H 1F13A 3KPQB 1CXLA 4YC2C 2BVPA 2ZOKA 4PJ5B 5DXWA 2NY2B 2DWEA 5DWUL 4RA0C 4XCEB 5CZVH 4KY1H 2H45A 1KXTB 4WHTA 3EDKA 3EYUH 5TE4H 5ICYB 3H0TA 4HBCL 2AK1H 1VERA 5HHME 2F53E 3RGVD 2A73A 4FXLA 3RWCB 2V5TA 2E5EA 4PJBB 1U6AH 3TFKD 5HHXL 4JY4A 2AXFA 5CP3H 4K9EH 5TQ2L 4XBPA 4PJFA 4Z7VA 1KBGL 4XCCH 2Z31D 1UWXH 3IGAB 4RGNC 2IG2L 1FVEA 1ZLUH 2CIKB 3ARED 1J88A 2J6EL 3OKKA 5GGVL 3FRPG 4KKBC 1AXIB 3PDDA 4GW4B 3CJJA 4Y5YA 1EMTL 3MJ6A 2G2RA 4LCCA 4QRSB 4RMVA 1VPOL 2X10A 5F7YC 1XCTB 2X4PB 2ADIB 5EORH 1HIMH 5E2TH 2J4WL 2I07A 1OAKH 4OLUH 5GRJL 1A3LL 4JZNB 8FABB 2HA1A 1YEKL 4XXCA 1IC4L 1XH3A 4AT6B 5KSVA 4CBPA 1DBML 1JWUB 3IFLH 4LFHD 2A9ML 3GKWL 4HZLB 5GS0D 4UOW0 4QHKJ 3ULUL 4HT1L 5FYJL 3MLTB 2Z91B 2JCCF 2OTUA 5I1LA 4RWYH 3HNSL 4ZFGL 3G04A 2E9WA 3OKEB 1T0NB 1ZT1A 3BO8B 4XMLH 4PGDA 4QRRE 2WP3O 1CLOL 3FRUA 4JRWA 5JDJA 1CDGA 4LMQI 4PJFF 3ET9F 4ISVA 3QUYA 2P5WA 3EO0B 4AIXA 2NTFB 1FC1A 4FZEH 4OLZL 5SV4A 5DUPH 4O58H 4GKNA 5EBMA 4YAQA 2K7QA 3PQYA 4MAUH 4PJ8A 5J6GA 3LKRA 1JI1A 3CMOL 3IJSB 5HVHC 2J8UE 4M6NL 5JLZA 2ZUUA 4FFZL 2OXHA 5ICXB 3O6LH 3MRQB 3U1SL 4YX2H 4NZRL 1IGIL 5EOQL 4JVUA 1CICA 4HCRL 3WFEL 1YEFL 1YN7B 4XBEL 1D9KB 5HDLA 4CL7A 5KSUB 2EDJA 1MI5B 4LCYA 4U1KB 4G8GD 4DEPC 2FECL 5T1DH 4B7LA 3FKUS 4KK5D 2NQCA 1O7SA 4L4JA 3SGEI 5HYIA 2GJ6B 4CKVX 2VITB 4XPHH 3TA3D 1UWEL 5L6YL 2HTLC 4KVNL 3OKDB 3QEQB 1MFEL 2WBJD 1T5WA 3DVNB 3B2VL 5BJTB 1G7HA 2NY3D 3PP4L 5ENWB 1ORQA 1IARB 3UJJL 1GRWA 5KVFL 1A6TA 3TIDB 4JKWA 1A1OB 3ULVL 3HRZB 4RZCA 3MMEB 5CJXA 1HNFA 3MRCB 4GSDL 1AQKL 4XXDB 5IMLA 1P1ZA 3ARGC 1OAXH 1S5HA 4NQVB 1XGTB 4HUUA 3LKNA 4AH2A 4BZYA 3TT3L 4HBQA 2HFGL 3I6LD 5ITFB 5ITBL 3PHQA 4HGWB 1U36A 2XTJD 4FTVD 3WO3B 3O0RL 5F6HJ 5DD0H 3T0EE 1CD8A 3A6BL 5EU6B 2ZWLT 4BQBA 4D8PA 3I3BA 4I2XA 2C4FT 4AM0B 1S3KH 2Q7YA 3UJIH 4XGZB 1RHHB 4YNYA 4JFZH 3QG7L 3KXFB 3VE0B 2BMKA 1ZHLB 5FEBA 5ESQA 3CZJA 2QSQA 3RWFB 1A6WL 5I2IB 1NGZA 4M5ZL 1CG9A 3VW3H 3MC0A 5ANME 4L5FL 1DLHA 3T8XB 1OARL 1IGJB 3ISWA 4L3ED 5IIEA 2XRAL 4YDKL 3VXMB 3O6FC 4F7PA 1QVOB 1RZ8A 1M6OB 2I60L 5DS8B 3TVMD 4DVRH 4KKLC 3V5DA 4JM2D 3QCUH 1A6UL 1MEXH 3IXAB 4JKMA 1J0IA 2FBJL 3RIAF 4X6EB 3D85D 1LNUA 4ENEC 3UPCA 5CHNA 4LIQH 1ADQH 5C0ND 2OTWB 2NPLX 4YBHA 4RFOH 1LO0L 1N7MH 1MY7A 3SQOH 1QYGH 3ZE1F 3RGVB 4JFFD 1YQVL 4UDTA 5F3HB 1XR8A 4HUNB 4ZFZB 1C12A 2C1OA 2ICWB 5I76A 4Z7WF 1B0WA 1GOFA 2R15A 3QIBC 1G0XA 1NKOA 4P4KC 3GUTA 3TPUB 3RU8L 4WW1B 2MOVA 1HINL 1R5VA 4FQLH 2VXTH 3WNMA 4PUBL 3V52H 1MF2H 4XWOD 4GKZA 4NO5B 3REWA 4P49A 3GSVA 1HCFX 1ZS8B 3MJ7A 3QWOB 3QNYA 4LKCB 3JWDC 1J1XL 2IMNA 4KQ4H 4TSCH 4NRZB 4MJIA 5KSBE 4FABL 3B2UD 2V2XA 2XKNA 1FZMA 4DTGH 5IESH 1LO3L 2NX5B 1CF8L 1T1YA 3VDBA 4R90H 1FNEA 5E70A 4HQQH 1OAQL 3WS6A 2BSSB 5DK0B 3OR7A 2BDNL 4PJDE 2R1WB 4I9WE 4POUB 1XIWA 2PN5A 3U79A 2VISA 4P2QA 2VXQH 4NWTL 2Y6SD 4AZ8A 2D31A 2JJSC 2B2XH 1U8JA 4OJFL 4NSKA 2DI7A 1CDBA 3OX8A 2Z92A 1NLDL 2ICEB 1G7JB 4NDMB 3QEGL 2AGJH 3NACL 3ZKXB 2CLVB 2YPLA 2IBZY 3EYSH 3G5ZA 1J86A 3DGCR 3P4MA 1LO4H 4UNUA 3PE9A 4U4BA 1AD9A 3QAZB 5GS0L 1JYXA 3UTZB 1A21A 4CN6A 5JORB 5BVJB 2XWBA 3MLUL 4P0DA 2CDEB 4MXWH 5EU5B 4R3SB 3S36L 4KHXH 4OZ4A 4PJGE 4LVHC 3LEYH 2ESVA 1RFDH 2X09A 4MZ2A 2P42B 1T0MB 4QKXB 4R2GB 4F15C 5IEHA 3F5WA 5T1LD 2QR0B 3G5VA 3GBLA 1BJ1H 1TTGA 3GSXA 3REVA 1SJHA 3F7YB 2BOCB 3RIFK 2XT1B 5SV3A 3AROA 1P53A 5T3XE 4IIQC 1RZKL 4C59B 1T03H 3C9NA 5FDYA 3UTTA 1J8HA 4PGBB 3QRFM 5T5FH 5E5RB 4OTXL 3T0WA 1U8PB 1WT5C 3RY4A 1CGSH 1KB5B 2H32B 1HYSC 5MHSE 2JB5L 3HUJB 1PX3A 2Z35B 2DL2A 2W59A 3IF1B 4V1DA 2D0GA 3WFBL 3QUMH 5TDOA 3EOAA 2ZUWA 1ZGLM 4DZ8A 4GS7B 1KB5L 2OJZH 2ZSVB 1UKSA 3RZCA 2FWOB 1HILB 3P73B 4RDQF 3KNBB 2X2YA 3KYKH 5JW4R 1EDQA 4MGXA 4OLXH 2DDQL 1ZGLP 2E3VA 3FO0L 3VH8A 3L3HA 2D7PA 2ADFL 2NY6C 2RFXB 1TZHB 2QQNH 3QZWG 4PB0H 3VXUB 5K9QI 3IB4A 3QEUA 4WI8A 2F9BT 4J8RA 4I48B 5F1NA 4QCIA 4PRNA 5GIRA 3LHPH 1A5FH 1G0DA 3U6RB 4MJ6A 5DRZA 5EU6E 3G9VA 2Q1EA 2AKRB 2IPKB 3BKYL 4FTVB 3D2UD 2FD6L 3PABB 2P45B 3IYLW 1YPZF 3VRIB 4DKFH 5L2KD 4F7CB 3TGXA 3VD5A 4ZNEA 2XQBL 1W0WA 3PWJB 3VD3A 1YEEH 2GJJA 2HRPL 3HE6D 1CLZL 4ZSOA 1MRCL 2UUDH 2V2WB 4BFBD 2IQAA 4Z78B 1NGXA 4HEPG 5EIIA 2BNRA 5IJVB 3OKMB 1BGXH 1CQYA 1GGUA 4P2RD 3L5WB 3DTXB 4HS8L 2P5ED 4YDVA 3IFNH 2FNBA 3VWJA 1DUYB 1L4IA 4LSQH 3TVMB 5HHNA 5BRZE 3KPMA 4YHNA 3JSSA 2C1PA 1NBYB 1A8JH 3AUVA 3LEXB 4G8EA 1NCCH 4DKAA 4PP1C 1IAOB 2ZPKH 5DZLA 3PGDB 1AO7A 1FORL 1KB9K 3L3OB 4NRXB 3BVNB 3RPIB 1LK3L 1BIIB 1Q38A 4JFFB 4IMLB 4Z7QF 3ZHLA 3O2DH 3W39B 3EDFA 4RAUA 3AXLA 3OQ3B 3U2SB 4NKOA 4ZQKB 1ACZA 5CLWA 3MJ8A 1UCBL 1ZT4B 2EEBA 4CU8A 2X4RA 4P46C 5I8CB 4OLWL 4YQXL 1NBVH 1ZHKA 3P3YA 4PY8I 2GJZA 2BSED 4OGXL 2DYPB 3FCTA 3DRQB 4KJYA 5DSCB 3F58H 3LQAC 3SDDB 4U0QB 3KWWB 1YECL 3RVXC 4ZS7H 1HK6A 1JNLH 2C3XA 1BZ9A 5DR5H 1YY8A 2F15A 2Q76A 4NJ9H 1P2CA 5A2KH 1RJLB 4H8WC 2A6IA 3H9HA 3W9DA 4ZO7A 4NNYB 5I8OL 3LZFL 1YMMB 2BSRA 1HHGA 2IFFL 2DLFL 5KOMC 5C0CE 2NR6D 2DMCA 1QHPA 1FP5A 3R0NA 3X13A 3CIQA 5I1JH 1VFBB 5BVPH 2ZCHL 5J3HC 3DV6A 3VFRB 4KZEL 2BNUB 4E41B 2DQJL 3MROB 5F7EH 3KHOA 1ZGLB 3OWEA 3TCLB 1ZT7B 1WICA 1NSNL 5C1MB 5JQ6H 5IHZB 4ODSH 5CILL 2X1QA 1QOKA 1BLNB 3T0XA 3GSUA 3L6FA 3LIZH 2BY0A 1P5UA 2W0LA 4FG6C 1MAML 4HKZB 4FQXD 4UQ3B 5HJ3A 1A7PL 1Q1JL 2AEPL 1ZLVH 4I13B 3QFJE 4S1RL 5A40E 3DHMA 3CK0H 1JK8A 3RX7A 4H88L 2HJLA 4AENB 4GRMA 4U1NA 1QKZH 3P0VH 4KRLB 3ZL4H 5DGRA 1CBVH 1MCHA 1S5IH 5DJ2B 1FSKC 5KAQG 3VI3F 1T83C 4RIRB 3O4LA 3HUJE 1ORSA 4YIQB 1KB9J 2Z93A 3T08A 2W60A 4M8QA 1QO3B 3QQ9D 2P5WD 3DYMA 3HC4H 4QHKI 4E0RB 5DEGB 1BVKB 1E4XI 1RI8A 4U1MA 5ETUA 1XF5B 4BELD 3WXWH 4HIHA 3ILQC 3PQYD 1MCSA 4PJ8D 4Q9CA 1BPVA 4RRPA 3OF6A 4W68A 3SGDH 3H42L 1HEZA 2EYSB 1LEGB 5I9QC 3LS4H 3MA7B 1BX2A 1DN0A 1QFWH 3QIUB 4OLYL 5C8JA 1P7HL 4LPCA 1HSBA 3LRSA 1JHKH 4Y16B 3VXSA 4EOWH 2FL5B 4C56A 4XVSH 5IM7A 1M05B 4M6MH 1J5OL 1AIFB 3KYNB 4G6ML 1GPOH 3HZKA 3GMQA 4M43L 5A1AA 5AAWA 3AS1A 3Q48A 5CBEA 3GJFH 5DJ0B 1DSFH 1ES0B 4NQEA 2H2PC 1HWHB 3D39E 4MA7L 4PY7A 3SKNB 43CAB 1P7QD 4JO4L 4NQDB 2EZ0D 4RAVA 3E8UH 4LHUB 5AZ2L 1DQLH 3CFCH 4OZFG 1A47A 4HS3A 2DLGA 1C5DB 4P3WA 5C7XL 1MJ8L 5DJAB 4Y4FC 3F7VB 3E1F1 3PP3H 1B88A 4UIKL 2C5DC 1UACH 4OKVB 4IM8A 4DCQB 3WO4C 4LQ1A 4GAGH 2O5ZL 4DZBB 3SDYH 1UM5H 2QLVB 2ZP0T 1T04A 3PF2A 4MNQD 3GEWB 5GZOD 2R1XB 1IQWH 4LSTH 1JPSL 5D96C 3V8OA 5D5MB 5T5NG 5LQBH 2EE2A 1L6ZA 2F19L 4OQTL 2J88L 3KPLA 1VACB 1CD1B 5KS9A 1S7XB 1R3LB 1MIEL 1QNZL 4ELMA 4X4YA 1GZPA 1K4CA 4K8RC 3MUGA 5JZ7C 1QEWB 1NGWA 3ARGA 2SEBB 2YXFA 3DVFA 5HY9B 3A6CH 4DGYH 1XF4B 2B39A 1Q94A 3INUH 4N0YL 5ILTL 5D93C 3NIGE 2X1XR 4QRPD 3L95B 3I2CL 5FIEA 1E6OL 1W8OA 5D1QD 4YWGL 5EA0H 3U30C 2AI0L 1QRNA 1A4KB 5D2NB 1KTLB 1RSFA 5DD6A 2AK4A 4N5ED 2EDOA 3QNZB 3AAZB 1I3RB 3DI3B 2R0LL 4QXUH 5CINL 1RZGB 4Z8FL 3KJ6L 1UWXK 2PYFB 5F6HI 4UINL 4HS6B 3PGFL 5IBTL 1ZLUK 3UTQB 2B1HH 4POZD 3V6BR 1R24A 3QULA 3A6OA 5GGTL 4GG6A 2BVPB 2ZOKB 3O8XD 1KIPA 3O6FA 2DWEB 1JGEA 1KSRA 2GUOA 3CU7A 3P77A 4PJHA 2HMIC 2EYTA 5BS0A 3RGHA 4K23H 3MRBA 4WHTB 3U0WL 2ED9A 3H0TB 3QCVH 4WI4A 1PX4A 1YMME 1TTFA 2A73B 2XA3A 4JY4B 2AXFB 4MCYA 5DWUH 2FEEI 2DQTL 4L4VB 5HHOA 4XBPB 4PJFB 4Z7VB 1NUFA 1YJDL 2DKUA 4HBCH 4R4BA 1A22B 3WD5L 4Y1AA 3QP3A 5DMIL 5C08A 2NY4D 4J3OC 4E41E 4AMKL 5HHXH 3K4ZA 1FVEB 1UZ6F 5EUOA 2W9EH 5TQ2H 2B4CC 3RDTC 3EOYG 1KBGH 3BIBX 3QIBA 4P4KA 3OKKB 2DQCL 1LD9A 3O3DB 4QXWA 5AWNL 4L9LA 2PCPA 2R2HA 2AJ3A 4Y5YB 2G2RB 4LCCB 3SOBL 4MJID 4AQ1B 2IG2H 5CZKA 4KU1A 4Z18A 1OGAA 4U1HA 2I07B 2J6EH 5GGVH 2OMNA 2CRMA 2KDGA 1EMTH 4WUUE 2ZUSA 1VPOH 1XIWD 4NHCL 1XH3B 1XGYL 5KSVB 5DUML 3WSQL 4KVCL 1UYWL 4FQQA 2J4WH 3K4DA 5F9AC 5GRJH 1A3LH 5IMMA 1LWRA 3DV4A 3HHRB 4K71C 2A77L 1YEKH 2OTUB 1IC4H 1OTSD 3G04B 3QHTC 1DBMH 3V4VL 2JJSA 4F37K 1ZT1B 2A9MH 1FVCA 2OL3A 3GKWH 3ULUH 4PGDB 4HT1H 5FYJH 2EDYA 1FZOA 3FB5A 3FRUB 4UUJA 1MWAL 1WZLA 4ISVB 5DJ8A 5B4MC 3QUYB 3HNSH 5JW5A 2P5WB 4ZFGH 5L7XL 1FCCA 5EBMB 4YAQB 4TVPD 1CLOH 1J9CT 3PQYB 4PJ8B 5J6GB 3LKRB 4KK8D 2YUVA 5J11B 1TVDA 5E6ID 3CCHA 5GS3A 4PGJA 5JLZB 2R0ZL 4WW2C 1G84A 2QTEA 4OLZH 1TPXC 1W0YT 4HGKC 3SDXA 4IS6A 2D7OA 4X0KA 3ZKND 5F7FA 3CMOH 3QDJE 5EZIL 1CICB 1YNTA 2BVUA 4M6NH 1GC1C 3DUUA 4F2MA 1JVKA 2H9GB 4FFZH 4JPIA 4LCYB 4UB0L 1RULL 4W4OC 2J8OA 1TNMA 1PG7X 3JWOL 1G7MA 3MYJA 4IIQA 2ZNXA 2FDBP 1IGIH 4NZRH 4MDIB 5EOQH 3QXWA 4XP1L 4V1DD 4HCRH 4XPTL 3WFEH 4JEGB 1YEFH 4XBEH 2ZCLL 4NN7C 1T5WB 1WT5A 1QSFE 3WFDL 3RZCD 1NANH 3KPRA 3HPLA 1JP5A 3E6HA 1ORQB 1A6TB 5CD5D 3N1MC 2HWZL 2BHUA 2FEDD 4RZCB 4LDOB 1UWEH 5L6YH 4KVNH 5IEKA 1MFEH 3WLBA 1INDL 1C1EL 3B2VH 5D5ME 5HI3C 5ISZD 5IMLB 4XCYA 4K3DL 3PP4H 2O5XL 4HJGA 1P1ZB 3E2HC 3UJJH 5KVFH 1S5HB 3ULVH 3HI5L 5JOEA 1CTOA 3LKNB 4HUUB 4AH2B 3AS2A 3ARBC 3TBTA 4GSDH 3TBSA 3PHQB 4F33A 2IAND 1CK0L 5A2JH 5KSAA 3VGAC 2OI9B 1S78C 4D8PB 3TJHD 3BGFC 4I2XB 5HGHA 3TT3H 2Q7YB 2HFGH 3FO9A 4PIRF 5ITBH 4OD1L 4YNYB 3U46A 2BMKB 3O0RH 5ESQB 1GYAA 2Z9TA 3A6BH 1KC5L 1UZ8A 4FFWD 4JKLA 4UT6L 3RI5K 2XG5A 2BNRD 1P4BL 1NGZB 1CG9B 1EVTC 3BHBA 1DLHB 4PRAA 2MSPA 3QG7H 1FBIL 3AU1A 1KIRA 4HPOL 5IIEB 4F7PB 3HZYA 1A6WH 1IAIL 3BMWA 3WFHA 1RZ8B 4X7SL 4M5ZH 1U3YA 1TQCC 3EYFA 1UJ3C 2OS7A 4L5FH 3V5DB 4K7PX 3W11D 1OARH 2A0LC 2CIIA 1LNUB 2WW8A 2XRAH 4YDKH 4JANA 5CHNB 2HFFA 4BFGA 7CGTA 2BJML 2I60H 1KACB 4XNMA 5DI8A 2W0PA 5GGQL 1A6UH 4L4VE 2FBJH 4TULL 3SCMD 4UDTB 4QRUA 1XR8B 4RX4D 3O4OC 1E28A 1C12B 2C1OB 3ARPA 5I76B 1DE4A 3RRQA 4EN3C 1N6VA 3CFIC 4OCRL 2X4NA 1LO0H 2MHAA 1IEAA 3BZFA 1YQVH 2NY4B 1P6FA 1L7TL 1M71A 4QY8A 3VDCA 1WBYA 1R5VB 2VSDA 1MFCL 4APQD 4GKZB 5AYQA 4P46A 3REWB 3W81A 5E1AA 3GSVB 3MJ7B 3RU8H 3QNYB 4XI5D 3L7EA 4MJIB 1HINH 4JGJA 4M7JL 1K5NA 2V2XB 2XKNB 1FZMB 4M93C 3SEPA 4PUBH 5DMGD 1T1YB 3HZVA 3BWUC 3E3QE 3OR7B 3ZYJA 1C5CL 2R2BA 1RZFL 4YHOL 1J1XH 1XIWB 2V9TA 3ARSA 1DQJA 5B22A 2VISB 2DF3A 3OJMB 4JQXC 3FMGL 4P2QB 3RIFF 4FABH 7FABL 2D31B 1LO3H 5J06A 1CF8H 4MA3A 1U8JB 1OAQH 4NSKB 4PJ7B 3H6JA 2BDNH 2Z92B 1ZMYA 2JJWA 2R56L 4AIOA 4KKCC 5DVMA 2YPLB 3G5ZB 3P4MB 2F5BL 4NWTH 3EGSA 4IJ3C 1AD9B 4PV8A 2GSIA 4G6AD 3VFVA 3L3IA 2R4SL 2DIJA 3QI9A 4OJFH 4S1DC 3MLPA 2OR7A 1NLDH 2C26A 2XWBB 2WMPA 3QEGH 3NACH 3S98A 4NQXA 1R3IL 2DLIA 4O51A 4OZ4B 5GS0H 2ESVB 4LPYA 4XC3L 1FNLA 1MLBA 1B4JL 4R97B 3H7BA 4DKEL 2FR4A 4MVBD 1RQ5A 2WAHA 3DGGA 1FZKA 2DTML 3MLUH 1SBSL 5FCSH 4K3JL 3VCLA 5IEHB 3BRGC 3NCEB 4LRIC 3F5WB 3K1KC 3S36H 3G5VB 3SDAC 3GSXB 3REVB 2ZJSL 4TVPL 2ZNWA 3O6ML 1J87A 2ERJB 2BX5A 3D25A 1J0HA 5I1DA 4KKNA 2O5YL 1FFNA 5IW6A 3C9NB 5DFVC 3UTTB 1J8HB 2Y72A 4MXVF 4XT1C 3DXAA 4OAWA 4JFHE 4NOFA 1RZKH 4V1DB 1C7SA 1P7KA 1XGRA 5DJ6A 5TDOB 3EOAB 4YUEL 3TN0C 3QT2A 4OTXH 4DZ8B 2R29L 3PHSA 5C3LD 1CGYA 2YD5A 3RZCB 2JB5H 1PGRB 2UUDK 3OF6D 4OD2A 4PLOB 4W6YB 1OPGL 3NA4A 3VFSA 2XA8L 3WFBH 1FIEA 3BH8A 1UKTA 1LMKA 4JLRA 1JMZA 4RMQA 4U05A 3VH8B 3L3HB 4B53A 1KB5H 4UAOC 3VXSD 5DJDB 2V17L 2VLMD 1CXKA 3QEUB 2GCYA 5E7BA 4J8RB 4GRWE 3E6FA 5F1NB 2DDQH 3B4NA 2DM3A 4QCIB 4NN5C 5GIRB 4D3CL 3FO0H 2C7UA 4MJ6B 1QP1A 5DRZB 2ADFH 4N90E 5DTFA 4TNVK 4LF3A 1I7TA 4WY7L 4WFGD 5JR1L 4OZIE 2M26A 1T5XA 3VXRA 4JY5L 1UGNA 1W0WB 4DQOL 5D70H 1BJ1J 4ZSOB 1MY5A 3BKYH 5HHQB 1NDMA 2IQAB 3ARFB 1NGXB 2FD6H 4HLZH 5EIIB 2EDLA 2BNRB 2V9RA 4LSDA 5B21A 3D1MC 2XQBH 2EDWA 3DLQR 2HRPH 1CLZH 3TP4A 3NIDE 1MRCH 4Y4FA 4YDVB 3VWJB 4NQSA 1U92A 5HHNB 4LCWA 3KPMB 4YHNB 1M7XA 3DX8B 4HS8H 2C1PB 3SE4C 4ZAKC 3WDIA 1ACYL 5B39G 3GMMA 1NFDE 1V5JA 4G8EB 4MD0A 3KYOA 4JG1L 4KV5F 1AO7B 2VQUA 2HG5A 1LO5A 4E42A 1QFPA 1L7IL 4RAUB 1QRND 2PXYC 3AXLB 4IOFC 4NKOB 5J12C 3SKOA 3MJ8B 4YK4C 1FORH 1NDGA 1ZWIA 5C2UB 1BFTA 4ODVL 2X4RB 1LK3H 5DK2A 1ZHKB 2GJZB 1PG7L 3L7FA 4NCDA 1E6JL 1F4WL 3FCTB 4WHDA 1UCBH 2W07A 4KJYB 5SX5H 2DI8A 1LP9E 4OLWH 4YQXH 3Q5OA 3QXUA 3KYAA