4IBLT

Rubidium sites in blood coagulation factor viia
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
198
Chain Sequence
b'TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Sodium Site in blood Coagulation Factor VIIa: Absence of occupancy by Rubidium
rcsb
molecule tags Hydrolase
total genus 43
structure length 198
sequence length 205
ec nomenclature
pdb deposition date 2012-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iblT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iblT02
1TTFA 2YBRA 1E6OH 2VMFA 3MZTA 4UINH 3HLAA 2NR6D 4LGRB 4XP4H 4R26L 4KUZH 3VXRE 5LVEA 1ZOXA 3M1BA 4OF8A 4LLVB 4P2OA 2YPLD 5LKNA 3JBG7 1FLTX 1QFUL 4FOMA 1NCWL 3HNVL 4IRSD 1N0XL 1A2YB 2AJSH 1T89C 4Y0GA 4DN4H 3DARA 1J10A 3HC3L 4ORZC 3NN8A 4GAGH 4X9HA 2HG5B 4F3FA 5EBWA 4RAHA 2IPUG 1RVFL 2Q6WA 5EU3B 3F12B 3SGKA 1RIVH 5TE7L 2QJDA 2QSCH 5EC1A 1LD9B 3IFLL 4LF3A 4P4RB 3WL9A 2X44D 3WFDL 1F3JA 2W59A 2K3TA 4MA7L 3RWFA 4C56B 4JFPB 1CYGA 2VWEC 2R0ZL 4R26H 4WW2B 4G6KL 5EIIB 2NX5A 5HY9A 1UB6A 1QFUH 1NCWH 1N0XH 2HTKC 3OXSB 1NSNL 3K74B 3EO1A 4I9WE 4JRYB 3H0TB 5EU4A 5IROC 3T04D 3SKOB 1FAKT 1IE5A 1RVFH 43CAB 4PRPD 1HHGB 3KPLA 3KPOA 3SDXA 4U1JB 5TE7H 4OFVA 4Y19B 5JQHC 3TVMA 3MLVL 2W0FA 4M6ML 5EBLB 4MB3A 3WFDH 4I2XB 4HUWB 5FDYA 2V2TB 3RPIA 4NC0B 4MA7H 2ZJSL 4YE4H 1CD1B 4M48L 2R0ZH 2X4OA 1LEIB 4QHNB 3REWA 1QRNB 3VFTA 4U49A 4PJ5E 3B83A 4JFEE 4MJ5A 4OJFL 3WHE0 3QO0B 1CN4A 1NSNH 4P2OD 3Q0HA 1M05B 1ED3B 1DDHB 5T5NG 2DJUA 2IAMC 2K7QA 4NOFA 3FQUB 2ATKB 4D9QD 1ZA6A 1AKJB 3BW9A 4ZAKA 1G9EA 3RHWF 4F7MA 2P7TA 4EN3C 4QWWD 3F7QA 3QDMB 3MLVH 1O5DT 1GZQB 3RI5K 1UM4H 1KENL 1YPZF 5EBMA 5FM5O 2ZJSH 4M48H 4JN1L 3S97C 4QTHB 1OAYL 3QB7C 5DJ2B 1G84A 4I3RL 4NFCA 3CVHB 4OJFH 4KXZI 3BWUC 3MBXL 5BW7C 5ESAB 2NX5D 4L8SC 5EZOL 4QKXB 4HCRA 1NC4A 5GS0L 1IKNC 1Z0MA 2UY6A 4K8RL 2P46B 5FYJL 5F9AC 1BX2B 4NNXA 2CDEB 1FZJB 1XF4B 1DANT 1WEJH 4Z7OF 5E6YA 1T0MB 4OZGE 3S8WA 1UZ8A 1HE7A 2JIXA 2XNAA 1KENH 4H1LH 2R23A 1SVCP 1A4JA 3ORJA 4ISVB 3TVMD 3ZE2E 2Y5TB 4X6CB 4PV9A 1DQLL 1TCRA 3TO4C 2WAHA 3KYOA 1NGXB 1Z3GL 3R0NA 3CLFL 4JN1H 1BBJA 1OAYH 1WCQA 5JXEC 5T1MA 1I1AA 4I3RH 4QCIB 4PRAA 4NJ9L 5ALCL 4QXTA 3B3IB 3MBXH 5IK3B 5EZOH 3QXAB 3ALWA 2NY1B 1ONQB 3U1SL 2R1XA 4NHUB 3ES6B 4K8RH 2D31B 3BWAA 3AM8C 3BZFB 3QUXA 3D87B 1I75A 4PJXB 1EPFA 4ZAKD 1F11B 2JLLA 2VLJE 5I15H 2P5WB 4YQXL 3TBYA 2NY6C 2AXGB 1FYHB 1Z9OA 1DQLH 4XXDA 3MJ9L 2X1OA 1Z3GH 3CLFH 4JREC 4PGDB 4JPIA 4KDWA 2DKMA 1MQ8A 3WN5B 1BGXL 4GO6B 4NJ9H 5ALCH 4NZUL 4U1SA 2BOBB 3TWCL 5GS1A 2Y36L 4GAYB 4Z18A 4LLAA 2O5YL 3PWUB 1S7XB 4NUJA 2BX5A 2OXHA 1T2JA 3MRIB 1X5HA 2YMXL 4ZMAT 3U1SH 2PYEE 2FIKB 5TFSH 3BHBA 3QEUB 4Q7DA 3WIHA 1INQA 2OCFD 1NC4D 2L0DA 4JVWA 5D7LA 5GRVL 4FTVB 4GRMB 3NABH 1RUKL 1RJZB 3MV7B 4QRPA 4YQXH 3ULUL 4C57C 3OWEA 4PD4K 1JI1A 5EOTB 5D4QA 2HT2C 4TSAL 5E0QA 2JIXD 1F4WL 1DE4B 1NBQA 2XWJA 5HHME 3WUWB 1QSZA 2Q7YA 1UA6L 2EYRB 3GSUA 4ZDHA 2VDQL 5CGYD 2WBJB 3VFOA 3B9KB 4NZUH 3TWCH 1UG9A 5C0DA 2O5YH 3N06B 1I1AD 3BPLC 1JV5A 4J3UA 3VXUB 3BKJL 3NBNA 2YMXH 5GSRB 4JKKA 4KU1A 3QIWA 3TP4A 4E5XB 4X7DC 3L5WA 2HFEB 3X12B 4Z76A 4NN5B 3WNMA 5EZLA 2BNRA 4TN9A 1QEWA 1RUKH 3QUXD 1S9YB 1IC4L 4HH9A 3ARUA 3H9HB 3K0WA 1V7NL 4TSAH 1K4CA 1F4WH 2BJML 1UA6H 1FCGA 4LCWB 1BFOB 2ZNXA 9CGTA 3O11B 2VDQH 2N56A 4OFIA 5SX4H 2AXJA 1JI2A 4OUUA 3IDMA 2B5IC 1S7WB 2FECL 3DURB 1XCQA 2I07A 3NCEB 3OZ9L 4YFDB 4L4VB 3W9DB 3BKJH 4UDTB 3L3GA 1YYLL 4WI3A 3IJHA 1R3HA 4DWHA 4LVNC 3CXDH 4M6AA 3GIZH 1SY6A 4OGAC 4OD1L 4M9PA 3QXDA 3P4MB 5EU5A 4NZJA 4K3HA 1G7QA 1IC4H 2APFA 4HZLB 5D7LD 2NQCA 1V7NH 4O02L 1JNJA 4ELKB 1OP5K 3LEVL 2WINB 5CJ5A 4JG1L 4NPYB 4QRPD 4GRWH 4Q6IC 4RNRB 3TBSA 2BJMH 4U6VL 3QAZB 4O2FA 4I18C 1YEJL 3UEZA 1KNOA 2X40A 4HIJB 3BGMA 2FJHB 4BUHA 3OZ9H 4NRXA 4GRLA 3SDDD 1FE8L 4NQTA 2N7AA 1YYLH 3KS0H 4P48A 1C16A 2EIDA 4U1IB 4P23C 4HZAA 3STZB 1NUDA 2YKLL 4OD1H 3QIWD 1OGTB 1QZ1A 5IBUG 3NZ8B 4R8WL 3O4OB 1J0ZA 3C6LA 1ZLUK 4LSDA 5IFAL 3LEVH 2BNRD 2DQFB 3ALPA 3PWJA 1KPUB 4NN6B 2XTLA 4JG1H 2IALB 3QQ3B 4NP4L 4U6VH 4GUPA 2XXCB 3B6SB 4GXVL 2P43B 4LLVA 2DICA 4KUCF 1CL7I 2QL1A 2X42A 5DMJB 2PXYC 2J12B 1FE8H 4J2XA 2HG5A 5GGRB 3VXRB 5TE6L 3FOMA 5EU3A 3F12A 2QSVA 4FQXB 1CG9B 2AK4E 2NY5C 2YKLH 4NQCB 4ZPTB 5EUOB 3BN9D 4BSJA 2DKSA 2EDHA 3OF6A 4FQ1L 1FP5A 1MCJA 1RUAH 2VR5A 2YC1B 4P4RA 4PJ7F 4Y88A 5KAQF 5IFAH 3TNNB 3LZFH 3EOTL 4C56A 4JFPA 2BNQE 5MERB 4NP4H 4XI5D 5KZCB 4WW2A 1U8IB 4GXVH 2HLAB 3GMRB 5EIIA 1FFOA 2BHYA 1YQ2A 1WFNA 1IAII 4JR9L 3MRBB 3CSYB 4KI5F 3OXSA 5HHVL 4JRYA 3H0TA 3VFGL 5D1QB 4DGVH 3P9WB 2AV1B 2PW2A 4MZ2A 4YJZL 5TE6H 4Y1AB 4OM1H 1HHGA 1MOEA 4GRLD 4YIQB 3GMPB 4U1JA 3MUZ1 4NWUH 4Y19A 2O5XL 3OG6B 5E1AB 3EJZC 5EBLA 3SKMB 3V6OE 4I2XA 3H7BB 1E4XI 4HUWA 2V2TA 3BP7A 2CD0A 5DJZB 3EOTH 3TGXA 1CD1A 3LPGA 5HYSG 3CIQA 1LEIA 3C6LD 1FVDB 4QHNA 3CCHB 4MJ6B 1NLDL 1QRNA 4OIAA 5GZOD 3K7UA 1A7PL 5A3IC 3MV9E 1CZ8L 1UJ3C 5I6XC 2VISB 4M93B 3QO0A 4L29B 2VDOL 1T1ZB 4YC2B 5HHVH 3RWGB 4W6WB 3VFGH 5KTEL 1T7WA 1M05A 5TJWK 3UJJL 3FQUA 2ATKA 4ZUTB 1AKJA 1VFMA 2PKDA 3ARWA 4QF1A 4PJ5B 3UBXG 3QDMA 2O5XH 1LEGB 5T1LA 1GZQA 4MA3B 3EFDL 1KFAL 3U6RB 1WWWX 3OKDB 3OF6D 4FXKB 3W11D 3QHFL 2QADC 4JFOB 4QTHA 1NLDH 4C56D 2YD7A 4X7EC 5DJ2A 3DGCR 4OFYA 1A7PH 3O6KL 4GBXC 1CZ8H 2X1XR 3CVHA 3Q5TA 4PUBL 2VDOH 4LMQE 1JF6A 5ESAA 5SWQA 2YA2A 2D2OA 2M1KA 1P7KB 3VFRB 3CXHJ 1V7ML 5E2WL 4U2ZA 3DYOA 4DGYL 3AC0A 3I3DA 1A22B 4AENB 5T3ZD 3UJJH 4G9FE 4RRPA 2HVKB 3NCJL 1BX2A 4JRYD 4DW2L 2CXGA 2DRUA 4OCSL 2CDEA 3W5NA 1FZJA 1XF4A 4H5SB 1WZMA 3EDKA 4DK3A 1T0MA 1RZKL 4R3SB 3GEWB 2CIKA 1QSFB 3EFDH 1KFAH 3ILQC 4G6JL 1NFKA 4Z7VA 4Y19D 4HFWB 2JJVA 4X6CA 3QHFH 4JVUA 1NGXA 4PJ8B 1D6VL 5AYUL 1KLUB 3KJ4B 4LLQB 1FRGL 3TT3L 2IFFL 1ODAA 3V5DB 5HPOA 1RUPL 4NOBA 2IBBA 4LLWB 4JQVA 4PUBH 3GBNL 3B3IA 3F58L 1QRND 5CHNA 3TZVC 5IK3A 3QXAA 2R69L 2DM4A 1V7MH 5E2WH 1HSBA 2ED9A 1ADQL 3T3ME 5JQ6H 1ONQA 4NHUA 3ES6A 5LWYL 2D31A 4DZ8B 3ESVF 1KIPB 2EIZB 3BZFA 3NCJH 3I6LE 4X6EB 4DW2H 5C8JB 2P49B 3RVXD 5DZLA 1SJHB 5CEYA 4DUXA 1RZKH 1AKJD 5HI4C 1F11A 4MNQB 2P5WA 3FO0L 3WO3B 3QDMD 3LKPB 2AXGA 4JFZH 5T1LD 2N4IA 1YN7A 2B39A 1YEDB 4Z7VF 2E9WA 5DFVD 1D6VH 5C07E 3B9VA 3VI3E 5AYUH 4PGDA 4DEPC 1FRGH 4X98B 3TT3H 2IFFH 1PFCA 3WN5A 3T2OA 1RUPH 4ODBD 4MA1B 2BOBA 3GBNH 4GAYA 3F58H 3PWUA 5E7BA 5HI5D 1S7XA 3DLQR 4OFYD 1AE6L 3ARDC 3MRIA 1ADQH 4FP8L 4GG6E 1JTOA 5LWYH 3QEUA 3ZTJG 4LDOB 2HWZL 4R97C 4FTVA 2CJUH 5D1ZA 2JE8A 4IOIA 4GRMA 4XCYB 1RJZA 2YD4A 5J56B 3MV7A 3FO0H 1YECL 2VXTL 3D18B 3AREB 3DV6B 5DDHB 1X4ZA 3UTSB 2PYEB 3VGAC 5EOTA 5C0IB 2PTUA 4LKXA 1C5DB 4HWUA 1DE4A 4XVSL 3ARGB 1KELL 4XVUC 3SJVB 5BZDB 1T1XB 3WLBB 4PV8B 1J12A 3QUYC 2WBJA 3B9KA 3SQOL 1G9NC 3Q2CA 4ACPA 3D3VB 4IHOB 5ICYB 3VXUA 2D0GA 4FP8H 5DHVB 4JZNA 2VLKB 5GSRA 4JKLA 4E5XA 4I48A 3QA3B 3LQZB 4YHYC 2HFEA 3UJIL 2Y6SD 2NY1D 2HWZH 4K3EL 3X12A 5ACZA 2LTQB 4MHHI 1NH6A 3PDGA 1S9YA 5F1NB 4HLZG 1YECH 2VXTH 4L9LC 5IHZB 5KSVB 3H9HA 3H3KA 1EZVX 5I73C 3EYVB 1S7QB 4K9EH 3ELAT 2G2RB 1T7VA 2P5WD 4RWYL 2X9XA 4XVSH 1KIRB 1NKOA 1KELH 4HG4K 4LCWA 4MVBD 1BFOA 4B7LA 3V7AE 1U8NB 4OBRA 3SQOH 2AQ1A 4LSVL 3V6ZB 2HRLA 1S7WA 3ARVA 1U3HC 3TA3C 3LEXB 5E4EB 1U2HA 4NN7B 1QFOA 3VRLE 2YRPA 4L4VA 4UDTA 3BDXA 3VFMB 5DXWA 4JG0H 1MRFL 3JUYA 1HHKB 3UJIH 1JBJA 1MJ7L 4GW4A 3P4MA 4U2YA 4HZLA 3E3QC 1S7RA 4FTVD 5D1ZD 2QHRL 4WTZA 4NPYA 3MV7D 4RNRA 4XNYL 4RWYH 4UV4L 3NOIA 3TBTB 5IJKA 1FIEA 2O61B 3BGAA 1PY9A 1IGYB 4IRZH 1EEUA 5EU6E 4P4KB 3WJLA 4O00A 4HIJA 1CXLA 4W70A 5EZJB 1N26A 4NM4L 4KGJA 2FJHA 4QXGL 4YZFE 3IU3B 4OZHE 3LCYA 2I25N 2WBJD 5LBSH 2I9LA 3B9KD 1NBZB 2CMRL 4Q2ZB 4QRSB 3MRKB 1MRFH 4U1IA 1LO4L 3VXUD 1JPFB 3STZA 1UJTA 1MJ7H 3GUTB 2R1WA 1OLZA 2I26N 4OV5B 3GRWA 3BUTA 3RIAF 3S34L 4YXHH 5FCSH 1KPUA 3EO0B 2VYRE 3WKML 2IALA 3QQ3A 4DKAA 2DS4A 4RQQB 3B6SA 4D0BB 1TQCB 4L8BB 1CVRA 2V17L 3U0TB 1YEIL 4NM4H 4LCWD 4LSRL 4ZTPL 4QXGH 3DRQB 3OJMB 5KSUB 1UM5L 2CMRH 4UT7L 3WD5H 5GGRA 3VXRA 2O5ZH 1FFPA 5KSBF 3KPPB 1LO4H 4FQXA 4L4VD 1CG9A 1G1YA 1LDSA 4NQCA 4MS8D 4ZPTA 2WP3T 5EUOA 3TLRA 2YC1A 3I9GL 3ARRA 3QWOA 4C54A 3WHE1 2MOVA 5C86A 4L8CB 4JM2B 3S34H 2B0SL 3FFDB 2WZPD 3TNNA 5DVNA 1U92B 3MLWH 1U8PB 3OBAA 3WKMH 5MERA 1T7XA 3L7FB 5FUOL 1F5WA 1U8IA 2AK4B 2HLAA 3GMRA 1P5UA 1QHPA 4NKDB 1YEIH 3MRBA 4RMSA 3S98A 3ZSSA 3CSYA 5J7CC 3HUJE 2BRRH 1L6XA 1RV6X 4LSRH 4ZTPH 5DMYA 3OJ2C 1UM5H 2BNQB 5D1QA 1D7FA 4UT7H 2AV1A 4LASL 1CI5A 4Y1AA 3Q6GH 4XGZB 1MELA 3KWWB 4I13B 4YIQA 2NTSP 1S7SB 2Z8SA 5F96L 2P47B 5E24E 1ZAGA 3I9GH 5E1AA 3H7BA 2DDQL 2B0SH 5HGHB 1KUMA 4NQEE 4HK0B 5DJZA 2HT3C 2OXGA 5D93C 4Z7UF 4X8XA 1FVDA 2V5SA 5IB4B 1YNTB 2J5LB 5FUOH 1CF8L 2R4SH 4QLRA 3CCHA 4MJ6A 3FQRB 4G8GB 2VISA 3GSRB 4H0HB 5CINL 4OKDA 1YY9D 1T1ZA 2EYSB 4PJEE 5B3NA 5F97E 1UZ6F 3RWGA 3GHEL 3JWOH 4OIBA 4LASH 3TPKA 2UUDK 4EUPG 5INDB 3ZE0E 1I1RA 3SCMB 3R0MA 4ZUTA 3IAQA 3I6GB 4PJ5A 5A40E 3MV9B 1FG2B 3VXRD 5F96H 2J4WL 1CXFA 2AEPL 1ZHBB 1LEGA 3GBLA 4LCUB 1NGZB 4FQXD 4MA3A 4URTB 2DDQH 5IB3B 3U6RA 5BV7L 4NQCD 3W82A 1B4RA 2XXMB 3OKDA 4GW1B 4FXKA 4KKAD 1CF8H 5HHNB 5IBLD 2EYTA 5ACMA 3RZWA 4KK8D 5KZCD 4ONGL 5F3BA 2EDQA 4N0CD 2WWKO 4H26A 1CDHA 4NFDA 5CINH 3VGGA 1P7KA 3VFRA 3GHEH 3NCYS 4HUKB 3UDWC 4FABL 4AENA 4Y2DA 2C3XA 2HVKA 4YH6A 3WNPA 3V79C 5D1QD 5TF0A 4H5SA 4HWNA 3EOAB 4RDQF 4N1CA 3MA7A 4Y1AD 3EHBC 4R3SA 1QSFA 4HLJA 4WWKB 5B4MD 3V4PL 3ARXA 2BSRB 4HFWA 5CBEB 4BQ9A 4KKBD 4PGJA 3ZKNC 4M62H 4PJ8A 4X9IA 3D39E 5DF0A 1KLUA 4LLQA 3V5DA 3X17A 4ONGH 4P3CL 1NAMB 4LLWA 1BM3L 4MCYB 4NNPL 4WI4A 2LVEA 3PWNA 4WV1C 5CJXC 3G5ZA 4W4OA 2VL4A 4FABH 1K4DB 1NL0L 1D5IL 1KIPA 2EIZA 1UWXK 5C8JA 1TJHL 2IFGA 3MV8E 3FZUD 2CXKA 1SJHA 4X7CC 2YD5A 3NIFE 5EO0B 1Y6NR 3O6LL 4MNQA 3IFOB 4PJ5D 2YSSB 2YOCA 3G6AB 1KJ2B 3LKPA 3K8MA 3RU8L 3MOAL 1M6OB 4R7DB 4AEHL 3K1KC 4J3OC 3T0VA 3VH8B 4YHKL 5SX4I 4KRPB 5E56A 4P3CH 4HCRL 1BM3H 3Q48A 5TGBB 3AU1B 4NNPH 4FS0A 3QXTA 4JO2H 2VTFA 4PJBE 1L9NA 3TFKD 5C07B 1NL0H 1CD0A 1PZUB 1D5IH 1JGDB 1LVEA 1TJHH 2QR0B 5DGQA 4BZYA 4IOSD 5GZNC 2G5RA 4Y2DD 3VJ6B 4TNWK 3ZLQC 3D18A 1VADB 3AREA 3L5HA 3DV6A 5DDHA 3UTSA 3PQYE 3MOAH 5C0IA 2H2SD 1QSFD 5DS8B 1C5DA 4AEHH 2J8HA 4NQDE 1GGBL 1WLHA 3SJVA 1T1XA 3WLBA 5DHXB 4YHKH 2VSCA 4PJ8D 4HCRH 1Q0XL 2XOTA 3DYPA 2FECI 4AIZB 3LQAC 1WZ1L 3DETD 1HYSD 3C5SB 3D3VA 4IHOA 5IW1B 5ICYA 3ZDZE 4OV6F 2VLKA 4G7YH 5FYLL 4D8PB 1IGTB 3QA3A 3ILPB 3LQZA 3MGOB 3UZEA 2C1PB 3T0BA 2IMNA 5C09B 1BIHA 4OD3L 3DUUB 1QUNA 4LL9A 5F1NA 1CCZA 2IH1B 5IHZA 5IEHB 4PP2B 2HH0L 5I18L 1A6TB 4HAGA 3BEVB 3DX8B 1S7QA 1NCUA 2G2RA 4MNQD 4WNQB 4N5ED 3H8NA 1KIRA 3SGJC 3RNQB 1KEGL 1I9JL 3G9AB 2VZSA 1U8NA 1Q0XH 1VSCA 3V6ZA 3T0EE 1S8DB 5I71B 1WZ1H 5DJDB 3DO7B 5HGBB 1QR1B 3WIHL 5DMIL 4X99B 5HHPB 3VFMA 1KIUA 1GGYA 5DVOA 1HHKA 1WVZA 2FRGP 4PP1D 4GAJL 5L88L 3RUGE 4OD3H 1XR9A 4QXUL 4FFVC 1EHNA 5GGRY 5KVGL 3N0PB 2JTDA 2VLRB 4HJGB 4R96B 2RR3A 2HH0H 2YRLA 4UMGA 4PG9B 5M94B 4MQSB 5ICZB 3ARED 1IM9A 3TBTA 2VABB 5IMOB 3UTSD 2DQUL 3NAAL 2O61A 2FSEB 4HUNB 1IGYA 1A7RL 3WO4B 4P4KA 5KS9F 5JMOC 2XTJE 4LNVA 5EZJA 3SJVD 3BEWB 1RHFA 3IU3A 5D7IE 4KH2A 3WIHH 5DMIH 1C08B 1NBZA 1S5HB 4Q2ZA 4EVNB 2EDEA 2DQHL 1SJEB 4QRSA 4DTGL 3MRKA 2FX8L 3D3VD 2D7PA 1E28B 1HI6A 2EO1A 1JPFA 4B7IA 5L88H 4GAJH 1IQWL 1BQUA 2VLKD 1C12B 1NCDL 4QXUH 5F9JB 4JFHE 4OV5A 5KVGH 1QG3A 4QTIL 5DEGB 4YBHA 5DO2C 3QDGE 2R2EB 4RQQA 4RMUA 4M1GH 4YDKH 2DQUH 4Q6YA 4YK4C 4AYFA 4D0BA 1KLGB 5L8JB 1A7RH 4L8BA 4JO1L 4RAVB 4HS3B 3VWKB 2OMNA 3U0TA 2GTZA 3RZCC 3T77B 1N64H 1YEFL 1WSST 4DZBB 3DRQA 3P77B 1TENA 5KSUA 3L3DB 2BVOB 1U3JA 3EAKA 4BQ8A 2DQHH 1WAAA 4DTGH 2FX8H 2FO4B 3KPPA 5IIEB 3QXUA 4NQXB 4LFHD 3GI9H 1IQWH 3Q5OA 1NCDH 4HXBL 5DD0L 1KCSL 2NPLX 2FWOB 5I1DB 3EW3B 4ODSL 3RVUD 3HAEG 4FG6D 3FFDA 2W91A 4GXUN 4QTIH 3G5YB 1U92A 4RGMB 1U8PA 5H37G 3MRFB 3L7FA 1OPGL 2AK4A 4HUUB 4YHPB 3DYMA 2EDFA 4DKFH 4JO1H 1JE6A 4XXCA 1YY8B 2ADFL 4NKDA 5ABDE 1IM9D 3IKCA 1YEFH 1A5FL 4P4KD 2FNBA 3HE6B 1AHWC 1SY6H 2BNQA 2X10A 4QNPE 1KG0B 3I85A 4XGZA 2ZSVB 5LAXB 3MNWB 3KWWA 3AB0C 1WAAF 1F2QA 1S7VB 1S7SA 4YXKL 2N7BA 4HXBH 5DD0H 1OB1B 1KCSH 4HUXA 4G7VL 2PO6B 4ODSH 4YPGA 3RY6C 1KCLA 4BH7B 5HGHA 4MD4B 4HK0A 1KN2L 5SWSA 1KOAA 1R5IA 4MXQC 1TVDA 2OSLB 5IB4A 4HUVB 2D7OA 1YNTA 2BC4A 2ZUWA 1WF5A 1IAKB 4ZFFA 4TRPL 1DANU 3SGDI 3FQRA 2CUIA 5F9DC 4G8GA 1EGJA 2ADFH 3V6OA 3VWJC 3GSRA 4FXGB 5IBTL 5JPNA 3MQIA 3QQNA 1L0QA 2UZYB 1HYRC 4KK6D 5INDA 2ID5A 3SCMA 3DXAE 3BMWA 5F7YC 3I6GA 3MV9A 4NQVB 4YXKH 1FG2A 5HI3C 5LGHL 1CVSC 4QO1A 1ZHBA 4LCUA 4G7VH 1NGZA 5FDWA 1BMGA 4YBQC 2X9YA 2BVUA 5IB3A 1J11A 1I7ZB 1KN2H 4M3JA 1KEMH 3HMWL 3FCTB 3V6FB 5GRWA 1FGNL 1MCCA 1NDMB 3C09B 4TRPH 1HWHB 4Y5VC 5T3ZL 4KI5C 3FFCA 5HDBF 4QOKB 3LOWA 4NO0B 2XY1A 4M1CD 4XVJL 5IBTH 3LIZH 2YEZB 5E6ZA 3MCLL 1NC2B 3Q5YA 4WEUD 5E08L 1P6FA 4EIZC 2BNUA 3NZHL 4KVCL 4M43L 2ERJC 5ADOL 3KPMB 4Q9RH 2VQUA 5GXBB 2BNQD 5GS0C 4MXVF 3EOAA 5LGHH 5IHLB 3U7YL 1EVTC 4OCLC 1JRHL 4WWKA 2H2PC 4S1SL 5DJ8B 5HDQL 5CBEA 2WK2A 1FGNH 4H8WL 4M9OA 3MYJB 1OAUH 4PJ9D 5E5RB 1N59B 5I75B 5T3ZH 4H88H 5SWSD 1NAMA 3WDIA 4MCYA 1U8JB 4XVJH 1GIGL 4HDIB 4L1HA 2W9DL 3MCLH 4G8GD 4MA8L 3MRNB 5TE4L 5EDXA 5E08H 3NZHH 4KVCH 1K4DA 3GKZA 3SDCB 5ADOH 4OLZL 2C9AA 3OB8A 2WM0A 4UQ2B 4OTXL 3U7YH 3QIUB 3SCMD 4MWFB 5EO0A 3QDHA 1URLA 3IFOA 1JRHH 3HE7C 2YSSA 3EOYG 3MFGB 2VUYA 4S1SH 3G6AA 3L3OB 3T0AA 1KJ2A 5HDQH 1AGDB 5D72L 4H8WH 1M6OA 3RQ3A 3GKWL 4R7DA 2X7LB 1QFPA 4I4WB 3CVHL 4RFNC 5B39B 1A6ZA 4KJPD 5LGJB 3OKEB 1T6WA 5ALBH 3VH8A 1AD0A 5TGBA 5HHXL 1GIGH 4OZFB 3KJ6L 3FFCD 4MA8H 3CXHK 5IVXE 4OLZH 3OAZK 4S2SB 4ZOEA 4FN0A 1X5ZA 1JGDA 4YAQB 3LN5B 1CLYL 1FO0B 5E6IB 3OKKB 2R0WL 5JIIA 4OTXH 3ULVF 3DVFA 1LE5B 1W0WB 5F7LB 3V5KB 3VJ6A 3OKLB 1QLEL 4IS6A 4LQFL 3ROLA 4PJBB 1Z6JT 1GGCH 1IILE 1VADA 5A16B 1NANH 5BZWB 1BQHG 2M2DA 4GG8B 3ULUC 4WWKD 3CVHH 3DECA 3S36L 3BGFB 1J18A 4K2UL 5SWZE 1HSAB 1SYVB 4AIZA 4QHMA 5HHXH 4WHTB 3C5SA 3KJ6H 3UJTH 5IW1A 5L6YL 3PQYB 3RWCB 3MUJA 4R4ND 1EAPB 1A0QL 3OQ3B 2IANB 1TZIB 1F4XH 4NQDB 3RVVC 1OP3H 4NJAL 3ILPA 1TZHB 3MGOA 1CLYH 1T83A 2R0WH 3RHWK 5C09A 1S78C 4MB5A 5DJXB 5HYSA 2MQCA 2XQBL 2EKSB 5I8KH 1QLEH 4LQFH 2IH1A 4JVPA 5IEHA 3QRGL 2R2BA 4PP2A 3RWDB 3QRFM 4XPFL 3BOVA 1A6TA 4PJDE 1I3GL 5JW4N 3BEVA 3DX8A 5CZKA 5EU7E 1NDGB 4WNQA 1ORSB 3S36H 5K9JL 1MAML 3TEUA 2JCCB 4K2UH 4TUOA 3CDFA 1LO5B 3RNQA 4HULB 3NA9L 3UTTE 1GYAA 5F9WB 4G6AC 4RGNB 4PRIE 3D0LB 1M1SA 3FO2A 4MX7B 4EUPB 4ONHB 3E1F1 1S8DA 5FGRA 2A73B 4WEBL 5DJDA 2A1WL 3DO7A 3QHZL 5L6YH 3CH8A 1JN6B 2R9HC 5HGBA 4KRPD 5TQ2L 1QR1A 3EJYD 1A0QH 4X99A 1OTTD 3W39B 5HHPA 3ETBF 5D71L 3CGTA 3O2WL 1TZGL 4NJAH 3MUY1 5JHDE 3G6JF 5JIHA 2GJ6E 4NO2B 5DD5L 3PXHA 2AJUL 4R2GD 1D9KB 2XQBH 3T0EB 3KLHD 3WFEL 3WS6C 2VLRA 4HJGA 3QRGH 4GRWE 4XPFH 1I3GH 4JZJB 4WENB 3INUL 4PG9A 3VG9B 4UOJA 5ICZA 5K9JH 1MAMH 5IMOA 2IQ9L 3ARPA 1V5JA 3BEWA 2A1WH 5F8RC 3QHZH 5TQ2H 5L0QB 1SJEA 5D71H 3O2WH 1TZGH 3FN3A 1WITA 4N0UE 4UNUA 5DD5H 3DI2B 3DRTB 5KG9B 2AJUH 1C12A 1SYSB 4N9GB 1X3DA 2HT4D 3DBXB 2EDRA 4PRBB 5F9JA 4X83A 4Y5XC 3WFEH 1I8MA 5D7IB 5F7UA 4YHIB 5C09D 3EOBA 5DEGA 3FAWA 1FIGL 2ZCKL 1JZ6A 2IH3B 2DYPB 2IQ9H 5E2JA 1KLGA 5L2KB 1AGEB 3ARZA 1QFWL 3I6KB 2Z31C 3K4AA 4RAVA 4HS3A 1AP2B 3KPTA 3T77A 3TN0C 3C5ZC 5H35B 3L3DA 2BMKB 3UTZB 2FO4A 4PLKC 4NQXA 2IPTL 1NFDB 1OT1A 1RK0B 3FQWB 1BJ1H 3H9SE 4HIHB 4U05A 5I1DA 4EI5B 5JTWA 4RBPH 5BXFB 1F45A 4FNLL 4I5BB 3G5YA 1OTSD 2FHBA 2J1KA 1FIGH 2VLRD 2ZCKH 3MRFA 3IS0X 2MPAL 1H15B 1GC1C 4HUUA 4YHPA 3EGSB 4APQC 4U31A 4XMPL 1YY8A 5K9OB 4XRCA 4XP9L 1G7HB 3I2CH 3JUZA 4O51A 1WCBA 4HX1B 4XHJD 1M7DB 4G42B 4HC1A 3F7YB 4ZS6C 2ZSVA 5LAXA 3MNWA 2IPTH 3MZGB 4I0PA 3WV0A 1S7VA 3GRWL 5CJQL 5D1XB 2VNCA 4LARL 1G0YR 4LP5A 1ZLVK 2PO6A 3MXVL 4PJIB 1XH3B 4MD4A 4FNLH 4JFXB 3SKNB 5C0RL 1ZHLB 1BWWA 1ZTXL 2OSLA 4HUVA 2MPAH 3BD5A 3N1FC 1IAKA 1W0VB 4UILL 3B8YA 4NKMB 4XMPH 1K3ZA 2IWGA 4FMKA 4XP9H 5C08E 1QA9A 1PZ5B 5D7KE 4FXGA 3GGWA 4M00A 4IJ3C 3U30C 1KJVB 2BY0A 4WHYH 2UZIL 4WGVB 4Y16C 4OF5A 3GRWH 2EDXA 3W81A 3DVNA 4NQVA 2H1PL 4LARH 5GHWL 4YBLC 3MXVH 3QCVL 1H5BC 1I7ZA 1H8SA 5IP4A 5C0RH 3FCTA 3V6FA 4HH8A 1MLCB 1T7ZA 1NDMA 3NMEA 4UILH 5A2LH 4P3DB 1H9VA 3EYQD 3PWVB 4JAMB 4QOKA 4NO0A 4XHQA 2WSKA 4GMTL 3BP5B 1M71B 4TUJB 1NC2A 2YXMA 5CP3A 4WFFD 4IMKA 2PYFB 4GOSA 5ECJE 4L8SB 3KPMA 4O9HH 3PGCB 5HYFA 2F5BL 1UQSB 3QFJE 5DMGC 2E8ZA 2H1PH 4S1DC 5DHYB 5I1HL 2ZPKL 4BFEA 3NIGE 5GHWH 3UP1A 1A02N 4I0PD 1MUJB 3QCVH 3LB6D 5FCUL 4U6TA 5DJ8A 1A7OL 4GKSB 2PO6D 1DSFL 1T66C 2VAJA 4XMKL 4XNZB 3MYJA 1JYWA 3O8XC 3OR7B 5EN2A 4NZDA 2Q8AL 4KI1A 3O4LE 4GMTH 3FB8B 5IESL 4ODUB 3L5JA 4EDXB 3MRNA 1MAJA 1P84J 1RULL 4DOHE 4FFWC 5IFJB 3SDCA 2V6HA 4OLWL 2DQTL 1DCLA 3HI5L 2F5BH 4Z9KB 5GQBA 1F6AB 4N0YL 5I1HH 1JZ4A 3QIUA 2ZPKH 2ZCLL 1TNMA 3IDGB 4MWFA 4I0KA 3UAJC 4UT6H 5FCUH 5E95B 1A7OH 1AGDA 4R7NB 1DSFH 1T2QL 4XMKH 4I4WA 4QHLA 3OJDB 5DUBB 5LGJA 3OKEA 4RMTA 3MLRL 5I1EL 2Q8AH 1AH1A 3VXTB 4JREB 1FL3B 5IESH 3DMMC 4OQ1A 2YA1A 2Y23A 3FT2B 4JM4L 3VD3A 1XT5A 4QOKD 4NO0D 1RULH 3WXVH 4WFEE 3IDXH 4S2SA 4W81A 1S7TB 4OLWH 2DQTH 1G6RB 4G9DB 1HZHL 4YAQA 3LN5A 4NYLB 3HI5H 1FO0A 1NC2D 5E6IA 3OKKA 5AEAA 4N0YH 3CFCH 4Z7WE 1WFOA 1LE5A 1W0WA 4MQ7B 4HJJH 3UX9B 5FKPB 4D3CL 3OKLA 4ERSL 3CMOL 3QDJE 4PJBA 3T3PF 5IVXB 5A16A 2CO6B 1S9VB 1MFNA 4YFEA 2FZ3B 1N4XL 3ISWA 5BZWA 4GG8A 1T2QH 4ENED 1EH9A 5D2LF 2B1AL 4KHXH 4EQ2A 1NEZG 4KJWD 2KQNA 3CDCA 5I1EH 3MLRH 4KV5E 1HSAA 3FQTB 3KYAA 1SYVA 1VPOL 5K9QI 4WHTA 4U6XB 5KJRL 4JM4H 3PQYA 3RWCA 3A67L 2X4SB 1EAPA 2GJZB 3EO9L 2IANA 2NNAA 4NQDA 1RSFA 4AQOA 4CADB 3UYRL 1JYNA 4ZOAA 5EO1B 3SDCD 2X41A 1P2CB 3HCVA 3OTTA 4D3CH 4F33A 2EKSA 4ERSH 2EEAA 3CMOH 1MRDH 1HKFA 2E3VA 2ENSA 1IAIM 3RWDA 3FOLB 3QIUD 2C4FT 2CR6A 1N4XH 3NFNB 3BRDA 5C6TH 1G7JB 1ORSA 1I85C 2B1AH 2JCCA 1JMXA 1LO5A 2LQRA 3VFVB 1KTDB 3R4DA 1XCTB 3D0LA 3W0WE 4MX7A 4EUPA 4ONHA 1HINL 3C60C 1VPOH 1J8HE 3BE1L 2A73A 4GKZB 1DQJB 3IYLW 5KJRH 1HHJB 1JN6A 1RZJC 1YUHB 3A67H 3EO9H 2B5IB 2V9TA 4QRQA 3W39A 5JORA 2Z9TA 4XAWL 2DWDB 1FVCB 2JJWA 1QLFB 2ZZUT 5H94B 3QUKB 3UYRH 4PRIB 2J8UF 2ICCA 4NO2A 5F1KC 5JOEA 4LVNB 3SO5A 4RIRB 4ONFL 1D9KA 3T0EA 1N6QL 3MUHL 5E6ID 3QNZB 4P2RE 1JPSL 6FABL 4LBEB 4M7ZB 4XPGL 3JWDL 5BRZE 3BKML 3IFNH 5F7WC 5E70A 5DVMA 2NZ9D 1I3UA 5MEQA 1UYWH 1OSZB 1MCRA 1CLOL 1A1MA 2KUTA 3C6SB 3VFPA 4Q6IB 4PTUB 4L3EB 3MJ8B 5EPMB 2JCCF 2VXSH 1HINH 5DJYA 1I3RB 3BE1H 4I18B 1Z2KA 1J0YA 5J1SC 4M4PA 4XAWH 4CMMB 3OAYH 2WP3O 4S0TD 3PQYD 4PJAE 2VDKL 2ENYA 3DRTA 5KG9A 2IAND 2OLDA 2H32B 4NQDD 4N9GA 4ONFH 3CU7A 4PRBA 3DBXA 1N6QH 4J4PC 1PG7W 3BSZL 5SV3A 6FABH 4YHIA 1MJJB 1CICC 2Y4SA 4XPGH 5EIVA 3JWDH 4YHLL 2BVEA 3BKMH 2NYYD 3IGAB 4Z7QE 4N0UB 1LGVA 5JW4Q 1CLOH 2IH3A 5IEKB 1P69B 2DYPA 2EXWD 4HFUL 5L2KA 1AGEA 3PE9A 3I6KA 1QBBA 4BQBA 1AP2A 1H3PL 1MHPL 2NXYC 2X4UB 1G9ML 5H35A 4RGND 4IIQC 1WT5C 1T89A 3IT8D 2BMKA 3UTZA 2PXYB 2HN7A 3QEGL 1NFDA 2VDKH 3HPLB 5C2UB 2YPLE 2FEDC 3LKNB 2VDLL 3QWQB 4JB9L 1RK0A 3FQWA 2HLFC 4HIHA 4XCNB 3BSZH 2FR4B 1H8NA 2CRZA 2MKLC 5BXFA 1JL8A 3ZKXB 3MBEC 5CIPB 1D9KD 4I5BA 4NCC1 3T0ED 3SBWC 2VDNL 3CDYA 1H15A 2BY3A 4HFUH 3EGSA 1W2KT 1H3PH 1MHPH 5T1KB 1PY4A 3G04B 3GMLB 1MCNA 3B4NA 1G7HA 1C1EL 2YD2A 4HX1A 5CEXB 1M7DA 4LNRB 1XF2B 4G42A 1DBML 2X4QB 1Q1JH 3F7YA 3LKSB 3QEGH 1WC7B 5GRZA 3BQUB 4POUB 2MMXA 3BD3A 4X8JA 5IROA 4O58L 1WICA 5GJTL 1DEEB 2VDLH 4JB9H 3KAAA 3RX5A 3OKNB 4PJGF 2FBJL 1ZGLP 4PJIA 1XH3A 1EO8L 3NFPB 2F74B 4JFXA 5F1IB 5D6CA 3SKNA 1ZHLA 2VDNH 1IKFL 1FFNB 3BFOA 5F6HI 4M5ZL 5C92A 4NKMA 1CBVL 4PRNB 2P24B 4P5MB 3S36X 1HQ4B 1PZ5A 2CUHA 2DYPD 2EH7L 5AWNL 5L2KD 1UJ3B 1C1EH 4XPBL 5I6XB 4JFHD 1FSKB 4F15C 1KJVA 3UTQA 1ZGLB 1DBMH 2CKBB 5DRZB 4WFHD 5GJTH 5FF6B 2IAMA 5D6DC 2ZUSA 2DJSA 4NCDA 1G7LB 1JRHI 2FBJH 3IETB 4EN3A 5KSAC 4M8VA 1EO8H 4NM8H 2A6JB 1ZVSB 4JFDB 4PJIF 1MLCA 1OTUC 1KXVC 5BV7C 4D9QE 3N1GC 3M45A 3IDJB 2KZWA 2A74B 2QADB 1A1NB 3PWVA 4S10A 2YD6A 5JO5A 4JAMA 2WW8A 1W72B 4PJHF 4BA8A 2EH7H 5AWNH 1N7ML 2E9JA 1JGUL 4XPBH 1M71A 2ICWA 4TUJA 5TDPA 2E7MA 3BAEL 5BW7A 2DOCA 2PYFA 4N8PA 4L8SA 1DLFL 1PG7H 3RJQB 1IKNA 3PGCA 4C83B 2HTKD 4N8CL 1BECA 1UQSA 3RDTC 2DD8L 5DHYA 4U7MA 2VKWA 2ARWA 4LKCB 3T1WA 1A3LH 1BZ7B 1MUJA 4XWOC 3VGFA 2NX5E 1OM3L 1WFUA 1NANI 3RIAK 4GKSA 5ERWB 1KXQE 1EGJL 2OR9L 2P5EB 3QFJB 3TO4A 1I7UB 4YFLF 2F5AL 5JDJA 3OR7A 5DLML 3CC5A 5JXEA 3FB8A 1N7MH 4ODUA 4OZGF 1PSKL 2P45B 4EDXA 1LILA 3BAEH 5LGKA 3TZVB 5IFJA 3H6JA 4UIMB 3ZE2F 1DLFH 2Z91B 5I74B 5EO9B 4N8CH 3KPSA 1JPGA 1F6AA 1NUGA 2DD8H 3GFUA 4KC3B 5DA4A 1MF2L 3AM8A 3O4LB 1CDGA 5T33L 4LRNL 3IDGA 3STBA 2IAMD 1OM3H 3IF1B 4DOHB 2NY2C 1EFQA 4R7NA 4EN3D 1BBDL 1EGJH 3OJDA 3OB0H 5DUBA 1VFBB 4YNYB 3VXTA 3KYNB 5DLMH 3HB3C 4DEPB 3BP6B 1NBVL 5EA0H 4Z7OE 1FL3A 1XGPB 1WBZB 2X70B 1PSKH 1JWUB 3FT2A 3JV6B 5A2JH 2BXZA 1UENA 3OAUH 3L1OL 4U0RB 2Q3AA 1DBBL 4XX1E 2OP4L 4RZCB 1S7TA 1G6RA 3HAEA 4G9DA 4NYLA 3SOBL 3PDDA 3TIDB 4A6YB 2VSDA 2CLZB 4BK5A 1MF2H 5T33H 4MQ7A 4X7FC 4ELMF 5FKPA 2X6MA 1LQSR 2Y1VA 1II4E 5IB5B 5B8CC 4G80B 1S9VA 2AJ3B 2FZ3A 5IQ7L 1MQKH 1BBDH 2D7TL 3UO1L 1NAML 3ARBC 3VGAB 3V8CA 3IXTB 5IJVB 1FGVL 1NLBL 3WSQL 2ZUQC 4PJCB 3AMKA 5DRNB 3ZDXF 1NBVH 1F90L 2MWCA 3LV3B 3OV6A 4KFZC 3TO4D 4U6XA 2DM7A 1U0QA 3AS1A 4J12A 2GJZA 3L1OH 1DBBH 5JXED 3BJ91 2G75B 2OP4H 1FL5A 1IT9L 3SOBH 4CADA 1JNHB 2RB8A 5EO1A 1IEHA 1P2CA 1KJ2L 3R8QA 5I1IL 1Q9WB 4ZOCA 2XI9A 1C7SA 3KPSD 5IB1A 3FOLA 3NFNA 5IQ7H 3UC0L 3MX0A 4MJIB 4L9LB 2D7TH 3UO1H 2D4DA 1MJ8L 1NAMH 4PD4J 4MLSA 5I73B 5KAQG 4P57B 1FGVH 1NLBH 3WSQH 6CGTA 3CNKA 1KTDA 1XCTA 4ZFOB 5E1HB 1F90H 2GTWB 1UVQB 2VDPL 4GKZA 1DQJA 1YUHA 4H1LG 3QUMB 2DLFL 3TA3B 2DWDA 1IT9H 3GI8L 1FVCA 5CZXC 3U4AA 1QLFA 4M02A 5H94A 3ULVC 1Q38A 3QUKA 2YXFA 1G7MB 2Z92B 4PRIA 4CRPA 3W0WB 2CDGB 5F7EL 4HGKC 1U3ZA 4RIRA 1R3IL 1KJ2H 1EBAA 2ZG2A 2AQ3A 2C3VB 3QNZA 3BISA 4LBEA 5HGAA 4F58L 3WNNA 3X3FL 1MJ8H 1OSZA 3BKYL 2OL3B 4RFEB 1YEGL 1QFWI 3C6SA 4Q6IA 1TPXC 4PTUA 4L3EA 3C08L 5EPMA 1DUZB 1I3RA 3LRSB 2VDPH 3MRPB 2HT2D 3PV7A 4I18A 1XGYL 4GS7C 5DD6B 4F2MB 4YHOL 4ODWA 2DLFH 4QRPE 3BDBA 1ZLWH 1CDJA 4Q74A 3ZHKA 4HPYL 1BFSA 4XB7A 4OCRL 3F8UB 5F70A 1LK3L 4JGUA 2W92A 5F7EH 2H32A 1R3IH 4P23A 1YJDL 4LHUB 3MLZL 1MJJA 2A9NH 4F58H 2MSPA 1L7IL 2VE6B 3PIQB 1B2WL 3X3FH 3IGAA 3KYKL 1JWMB 3BKYH 2KBGA 1YEGH 3VRJB 3PF2A 4LIQL 3TNMB 5F88B 3VXOB 3C08H 5GGSB 4LLUB 2X4UA 4N90E 3ZO0A 1XGYH 3C8KB 4QT5A 4YHOH 2BNRE 5ILTL 1JHKL 2PXYA 3L95B 3M17B 4M5YH 5J13C 4LGSB 4LSSL 3BN9C 4HPYH 1H3VA 4K94H 4OCRH 5K59F 4Z78B 1IGML 1LK3H 2YRZA 4G8EB 1XF5B 3NTCL 2FATL 3LKNA 1W8OA 3MCG1 4X7TA 1YJDH 2FD6L 4XCNA 3MLZH 2FR4A 1MVUB 2W60B 4PRID 4BFIB 5FGBC 3FMGL 1L7IH 1GPOH 5CIPA 1B2WH 5GRYA 1YQVL 4OGAD 3KYKH 2BRQA 1KB5B 4OCXL 4LIQH 1LP9B 3GBML 3KYMB 3G04A 3GMLA 2R4RL 5EFIB 2I60L 5FUCC 43C9B 4L3ED 1JUFB 5ILTH 1FYTB 2IPUK 1JHKH 5CEXA 2C3GA 4LNRA 1XF2A 2X4QA 4LSSH 4BUGA 1WC7A 4XNUL 1IGMH 3NTCH 4R9HA 2FATH 1QBML 4KK9C 1DEEA 1G7IA 1BLNA 1BQHA 3OKNA 5DR5H 2ILLA 4Q0XL 3RPKA 1ACYL 5DT1L 3FMGH 1NEZB 5BO1L 3NFPA 1U8LA 2F74A 4WO4C 4P23D 1YQVH 5F1IA 5IV2B 1QTYT 4GQPH 1RZ7L 3K3QA 1X44A 1FFNA 4OCXH 2YK1L 5D93B 4MMXC 4ZNCD 4PRNA 1BEYL 1WQVT 4LOUC 2P24A 3GBMH 1EUUA 1HQ4A 1HK6A 4L4TE 2WNGA 2I60H 3UYPA 1U8KB 4NKQB 1UJ3A 2PW1B 3FAXA 1JZ2A 5IR1B 4WCYH 1ZGLA 1EEYB 1U6AL 1WUNT 3LRGA 2X4RB 2CK0L 2CKBA 5DRZA 2YPVL 1N6VA 4XNUH 5FF6A 4MNHB 2PXYD 1QBMH 5IUSA 2F9BT 1G7LA 4Q0XH 2JKXA 1ACYH 3IETA 3I50L 5DT1H 1PLGL 5IHUL 3GSVB 1HKLL 4KI5E 5BO1H 5C9KA 4WI2A 2A6JA 2AK1L 4NZTL 1VGKA 1ZVSA 4JFDA 1KULA 1RZ7H 1ZS8B 2YK1H 3IDJA 4AEIL 3HLAB 1JTPA 5E8EB 2A2QT 1A1NA 1BEYH 3M1BB 1W72A 3RBSA 1CTOA 2XN9B 5E9DB 4TOYL 2VR4A 3C87A 1A9EB 2LU7A 1AC6A 4X0KB 1CXKA 5LQBL 2AS5M 5EBGA 3O2DA 1U6AH 4NUGH 3RKDC 2CK0H 3LMJL 2YPVH 4C83A 1P9MC 3BVNB 2LVCA 5JR1L 4LKCA 1FZKB 1BZ7A 5BS0A 3I50H 1PLGH 5IHUH 4OAWB 1HKLH 3PJSB 2AK1H 2ZNWA 4NZTH 1FV1B 5ERWA 2WQRA 2HJFB 2AEWA 4NRYB 5T3ZE 4POZC 1TQBC 4JRYE 2P5EA 3QFJA 1I7UA 3EJZD 1PX3A 4GJTB 1I7RB 3ZTJH 1NEUA 1MRCL 2ZKHL 5I1JL 1MCEA 1MREL 4TOYH 1MIML 3V7MA 5HY9B 4HC1H 3AS2A 5LQBH 2VJXA 3IDYB 4DN3L 3TZVA 2CRMA 4UIMA 3LMJH 4I2XE 2Z91A 1BREA 2GI7A 3IU4L 3ZL4L 1Y6KR 4AEFA 5EO9A 3VGEA 4TQEH 5D5MF 2VQ1A 5JR1H 4PR5A 2BHZA 2XRAL 2W65B 1QRNE 3TVMB 3C2SA 1YPZB 1DN2A 3IF1A 5JXAL 3L9RB 2CUMA 4S0SD 3RPIB 1F4AA 3WIIL 5GGQL 1VFBA 4JFDD 3REWB 2WANA 3LN4B 4YNYA 2ZKHH 3KYNA 5I1JH 1MREH 3BP6A 1MIMH 3BD4A 1XGPA 1WBZA 2QADD 1KIQB 2X70A 3QNXB 4HLZH 3JV6A 3S6CA 4DN3H 3B2UC 4ZUVB 5FV1L 2XZQL 5I1KL 3IU4H 3ZL4H 1X5YA 2Y9RT 1NKRA 3TIDA 4A6YA 2CLZA 4NQUA 1CGSL 1ZA6B 2XRAH 1RZ8B 1TITA 3LSOB 3VGBA 4ZUWB 1JGVL 3L7EA 4ODXB 4LAJH 5IB5A 5JXAH 4G80A 3RWHB 3B5GA 1FORL 5BS0D 3ZHLA 2YPKB 5HHOB 4GG6F 3WIIH 2I24N 5GGQH 3IXTA 5IJVA 4UIKL 4PJCA 3ILQD 1GH7A 5DRNA 3VMOA 2EEDA 3BPOC 5CP3H 2P5ED 3QFJD 2C3HA 3QUYA 4KZDL 1U41A 1OARH 1RAMA 1ZKAA 2G75A 3VA6A 5FO8B 3F5WB 1DVFC 1K8DB 1OD9A 5I1KH 4O2EB 2ICWJ 4Z7VE 2V7NA 4X6CE 1JNHA 3RWJB 3TZVD 1CGSH 3EDJA 5GS2D 4CNIB 1JGVH 1Q9WA 2AABL 1GZPB 4QHUB 3U4BL 5I8CB 4Q97A 1ZV5A 1FORH 4UI2A 2XNAB 4MJIA 1FNEB 4L9LA 2IBZY 4YWGL 2CIIB 5HVFB 2UWEB 4PV9B 2YS4A 4UIKH 5HI4D 4ZFOA 12E8L 4R6UA 2GTWA 1UVQA 1JGLL 4ZODA 3U7AA 4ALAL 3ZYOA 4KZDH 3N9GL 3IJYB 4MAUH 2DKUA 1FO0L 3P40A 3QUMA 5GRJL 2AVGA 2VLME 4KJQC 3TA3A 4AL8L 2P5WE 4MCZB 4KK5C 2FIRT 2Z92A 3W0WA 1BFVL 5D96C 4U1NB 2D03L 4IOFC 5I1CH 2AABH 2C3VA 2E9IA 2KL6A 4UV7H 5EOQL 3U4BH 3CFBB 2VXVL 1AC0A 2YD3A 3QEQB 3TBYB 3V0WL 1BPVA 2Y06L 4UTBL 2XA3A 1UWGL 4YWGH 2OL3A 4RFEA 2FH8A 2QQKL 1EFXB 3FTGB 5F6IC 3WEXB 5I1GL 12E8H 1DUZA 1J0KA 3LRSA 1JGLH 3VGDA 1P7HL 4ALAH 4F2MA 3N9GH 4FTVE 3F62A 1FO0H 1J1OH 2DMKA 4XVUD 5DJ6B 5GRJH 4AL8H 2M26A 3MV7E 4J3SA 4GLRH 3QUYD 4AZ8A 2R0LL 5I2IB 4XCFL 4QRRB 1KB9K 3UMTA 1OP5H 4B53A 1BFVH 4DFHA 1RU9H 2D03H 4JJHA 4JGMA 3B2VL 4LEXL 1MY5A 4IMLA 2XZAL 2VE6A 2GY5A 2VXVH 3PIQA 4K71B 4OZHF 3V0WH 2Y06H 4MDIB 4UTBH 4XTRC 3VA2C 1JWMA 1UWGH 4W6YB 3DTXB 4K3JL 2D0FA 4HWEL 3VRJA 2QQKH 3VXUE 3HI6H 4MJID 2GCYB 2XWJB 5F88A 1PJ9A 3ABZA 3VXOA 4BH8A 5I1GH 5GGSA 4LPWA 4N8VB 4LLUA 2V7HB 4YK4B 2ITDB 1DFBL 3MRRA 5CBAA 3QCTL 3SDDB 3VFOB 4U3CA 2I27N 1VHPA 4QGYA 3RZCB 1S3KL 3I02B 2R2CA 4JHWL 3L95A 1BP3B 3D25B 2R0LH 4C55A 1KC5L 4ZSOE 3FQXB 4XCFH 2YD9A 4LLMB 4Z78A 2DLEA 1ZLUH 1XF5A 3TA3D 1QO3B 1NGQL 4LCWE 1MVUA 2MQ0A 1HH6B 2W60A 4BFIA 3W0WD 5K9KB 3N50A 3NVQA 3KPRB 4LEXH 1LO0L 1A4KA 2XZAH 1QPPA 4RDQG 5SX5K 4EUPH 2L7UA 4K3JH 1KB5A 4HWEH 5CD5C 3HNSL 4XB8A 2WUBL 4WWID 4DVBB 3GJEB 2HJKB 4V1DE 1LP9A 3VDCA 5A2IH 3L5IA 1DFBH 5EORL 3QCTH 5EFIA 3ZYZA 4KY1L 43C9A 5KVEL 1JUFA 1S3KH 1FYTA 2E6JA 3TJHC 1FN4B 4JHWH 1E4KC 1LO2L 3VU2A 5DFTA 1AHWB 1D5BA 1KC5H 4CW1B 3HN3A 2C1OB 2ATPB 1UCBL 2DQEL 1AIFB 4U6YB 3WFCL 1NEZA 1LO0H 3HUJF 3PHOB 3KR3L 3GJFK 3MREA 4EKXA 5IV2A 5FYKU 2WUBH 5HBBA 1EK3A 3GZKA 4XWGL 1OQOA 2N1KA 3P30H 2G5BB 4WI5A 5C70A 4UAOC 1U8KA 5TDOB 2PW1A 1EEYA 2X4RA 1LO2H 4NRXB 1CD8A 4OZIF 2XPGB 1FNFA 1UCBH 2DQEH 3KLDA 1C16B 4MNHA 3ECBB 1AFVL 1VDGA 4XC3L 4L4TB 1WISA 5DQ9B 4PJ7B 3WFCH 3GSVA 3O41A 1BOGB 4ODVH 4E0RA 3KR3H 4E9LA 1UACL 3C6LB 4PJEF 3PP3K 5E03A 1ZS8A 2C7UB 5E8EA 4D9RE 4XWGH 4GUPB 2XN9A 5E9DA 4K07A 3CPLB 1A9EA 1HQRB 4X0KA 4NQCE 5EUOE 2WWMC 4H0GA 1MJUL 1F3DH 2BSED 2RFXB 4OD2B 4DK6A 4Z7UE 1FYTD 3BVNA 3UDWA 3OKOA 2ERJB 1AFVH 3FOMB 4G3YL 1HHHA 1LHZA 1P7QB 1XR8B 4XC3H 1RUML 1FZKA 3T8XB 4OUOA 2Q7NA 4OAWA 3OKMB 4XVTH 3PJSA 1T1WB 3C9NB 2AJZB 4AG4L 1UACH 1F6FB 1FV1A 2HJFA 2F8VA 4NRYA 1HEZB 5GPRA 3FONB 4YE4L 1B90A 4OCWH 3GSOA 4KRNA 1I7RA 2O26U 1P4BL 4Y1AE 5J12C 1FFOB 2DBJA 2HT3D 3AS3A 3SGEH 5AUMA 1ZWIB 4HF5L 3P0VH 3GMQB 1MJUH 4UUJB 1F02I 4AY0A 4LMQI 5DTFA 5HYQB 5CJXA 2PW2B 1WBYB 2RHEA 4G3YH 4XPAL 5TQ0H 1NPUA 4HBCL 1RUMH 2W65A 3MLTB 3SE8L 3AAZB 1EERB 5KOMC 1A8JH 1YPZA 4FXLA 4OLYL 4AG4H 1UM4L 3L9RA 3O3DB 3HE7B 3ZT6A 1UM6L 3BP7B 1MFAL 2VN4A 3OHXB 3VDBA 2OMBA 1P4BH 3LN4A 4RFNB 2XACC 2CQVA 1WFTA 2CGRL 3QNXA 1KIQA 3MLXL 3NIFF 2X9WA 3X11B 2C4FU 2ZOKB 4HF5H 2XN9D 5E9DD 2H8PB 5D7SL 4ZUVA 1WTLA 2JB5L 3PABB 1OAQH 1ORQB 4YR6B 3FN9A 4ZD3L 2XV6B 2W0KA 2ZUTA 4XPAH 4BELD 2W0LA 1NMBL 4HBCH 3NCMA 5L9DH 1RZ8A 3LSOA 4QF1B 4D2NA 1FC1A 4ZUWA 4P46C 3SE8H 1WEJL 5HVHB 1T2XA 3NPZB 4ODXA 3BJLA 4JQIL 4P9HC 4BKLB 5DWUL 4OLYH 2AXFB 5T1LB 3RWHA 2SEBB 2YPKA 4PLNC 1UM6H 5HHOA 1MFAH 3EHBD 4ZS7L 1AD9A 1IZJA 5DK0B 1ROWA 3TJEL 5BJTB 5CEZE 4K3DL 1H8OA 1IGIL 2CGRH 5IWLC 4J1UB 3MLXH 1ACZA 4JHAL 3TCXA 1JYVA 1KF9B 3M8OH 5DK2B 4KDVA 1T22A 5D7SH 2JB5H 1QSFE 5SWQB 5FO8A 3F5WA 1K8DA 3RP1A 4ZD3H 4O2EA 4JCLA 5GIRB 2OI9C 5AZEL 5JNYA 3VFSB 1FNHA 3RWJA 1B88A 2HTLC 1NMBH 4CNIA 1WTGT 1TETL 5JPMB 5E5MB 4XH2B 1H0DB 1GZPA 4JQIH 3DVIA 1TCMA 4QHUA 2KDGA 3HZKB 5DWUH 5JW3L 4Z95L 5I8CA 1UGNA 3HMXA 3RVWC 2CIKB 5I15L 1S7UB 1FNEA 4B5EA 5DGRA 4Z7VB 2CIIA 2UWEA 2LFGA 5T1DL 1MCLA 2OTUB 4ZS7H 4ZO7A 2EDWA 3TJEH 2LABA 5HD8C 1E0OB 3WNKA 3SGJA 1LO3H 2J6EA 4K3DH 4M6NL 1HN1A 1IGIH 4CKVX 5BOPA 4C58B 4NNYB 4B41A 1G6RL 4JHAH 3IJYA 5CHNB 3VGHA 3OL2A 4MNQE 1CFVL 4MCZA 2BVYA 5GGSY 1HSBB 2Z4QB 5AZEH 4RMRA 3RGVC 2XKUA 4U1MB 5TFSL 3MSPA 1TETH 1RZIB 1PKQB 4U1NA 2QKIB 3UTOA 4PYGA 5CEYB 3V0AC 5JW3H 3CFBA 4Z95H 3NABL 5C0CB 2EC8A 3QEQA 1RIHL 5GZND 3DVGA 4KHTL 3FL7A 1QP1A 4TYUA 3ARGC 3MV01 1YN7B 5T1DH 2NXZC 1EFXA 3V6BR 2CRIA 1N5YL 3FTGA 2UWEF 3WEXA 4M6NH 5HHOD 1Q0YL 4CVUA 3P4NB 3RUGF 1E4WH 3HI1B 2V5YA 4EXKA 2DJ4A 3WMSA 5F72S 1G6RH 3HAEH 1ZSDB 5DJ6A 4PB9H 3G5XB 1KCKA 1CFVH 5H37H 5I2IA 3T4AA 3VXNB 3UTSE 2WMPA 4QRRA 3E2HC 4AM0A 4M7LT 5I0ZA 1B6DA 4ZO9A 2V9RA 1H3WM 3SJVE 3HZMB 5D1ZB 2WLZA 4IOIB 2VAAB 1HOCB 1RIHH 4KHTH 4MDIA 3NA4A 3D3VE 3G9VA 3DTXA 3QUZC 1QRKA 1N5YH 4LKXB 2DQGL 3K80A 2VLKE 2GCYA 1XAUA 1Q0YH 3S96B 4N8VA 2V7HA 2ITDA 1UEYA 4KJYB 3D48R 5BOZG 3SDDA 3IB4A 1NCBL 5E4EC 3RZCA 3I02A 3EYOA 5HXMA 1G9MC 3C5ZB 3WE6B 2X4PB 3D25A 3NH7L 5C0NC 4JZNB 3FQXA 1WIOA 4LLMA 5J1TC 3CXDL 4I48B 1TXKA 3GIZL 1QO3A 3SPVA 5ACZB 1FC2D 1PQZB 1HH6A 4HIXL 5K9KA 2EZ0C 3KPRA 4M6OL 2FJGB 2NY7L 3LDBC 3HFML 4ZSOB 2CDFB 3KVQA 4FFVD 5JA8B 4DVBA 3L3IB 2DQGH 3GJEA 2HJKA 4NO5B 3QEQD 5DC9B 4WTWA 4UTAL 1AQKL 4X9FA 4APQB 3MC0A 4AIOA 1EFXD 1NCBH 4M3KB 1FN4A 1UXSB 2DIBA 4F80A 1AHWA 3K4ZA 4WI9A 3NH7H 4CW1A 5JLZA 2C1OA 4V1DB 2ATPA 2EDOA 3OJVC 1IEAB 3KG5A 3O3AB 1AIFA 3TV3L 1MFCL 4U6YA 4HIXH 4QRRD 1R0AH 4GW4B 3N1MC 4M6OH 1U91A 3PHOA 2CRYA 3EBAA 2NY7H 3HFMH 3RY6A 1S7RB 2G9HB 5IMLB 1WIPA 3U46A 1B0RB 4QNPF 4UU9B 1I1YB 3DX6A 4P5TC 4WI6A 1OL0A 1Q9OB 4QY8A 4UTAH 1AQKH 2X1PA 4HGWB 2DTML 2G5BA 4WGWB 2VH5H 5DO2D 1CT8B 1OAKL 4KK6C 2ZP0T 5TDOA 3AY4C 1OVZA 4Z8FL 5F7HA 2H32H 4U4BA 5KSBB 4IJ3B 3U30B 2I9LB 2XPGA 3RZCD 2NY5L 3P0YH 3ECBA 1X5FA 5FKAB 4HIEB 3TV3H 4Y16B 2PETA 1MFCH 4L4TA 1ZHKB 5DQ9A 4PJ7A 4LCYB 2R1WB 3QULB 1SMAA 3OGOE 1BOGA 4JM2C 3UZQA 2H41A 1RUAL 4PJFF 4N90D 5K9QG 4CMHC 3HZVB 2UYLB 1H5BB 3KPRD 3LZFL 2C7UA 2NY3C 3S35L 4LRIC 2FLRT 1WAAE 2PCPB 1T5XB 1T1YA 1XEDA 2DTMH 2J88L 1ULVA 2UUDH 2IPKB 4JDTH 4Y5VA 1OAKH 3CPLA 1S9KC 1HQRA 1DQTA 1PGRB 4Z8FH 4KMQA 3E0GA 2BVQB 1JYXA 2HFFB 3GSWB 2VITB 1ZA3B 2RFXA 5FIEA 4OD2A 4ETYA 4DGVL 2NY5H 1FFPB 4OM1L 1P7QA 5CIPH 1XR8A 3T8XA 1ES0A 4NWUL 2V2WB 3OKMA 1T1WA 3C9NA 2AJZA 3QWOB 5IW6B 1JVKA 2XWTB 4JFQB 1HEZA 4Z7UB 1A6AB 3FONA 5ANME 4BFBD 4FQQA 3WFHA 1JHTB 3S35H 4AQ1B 2FO1A 3VMPA 2J88H 2XA8L 5DK3A 5FYKE 3MLPA 4K7PY 4MXQD 3V6OC 3QNYB 1AO7B 2CKBL 1ZWIA 4KUCD 3TPUB 4UUJA 3GMQA 2DI7A 3FQNA 1AR1C 4HD9A 3U0WL 4LSPL 2X4NB 5HYQA 1OW0C 1WBYA 5SWSE 4X6FB 1PYWB 3WYRA 1YEEL 3V5HA 1V3KA 2DBLL 5HGDB 5JUEH 3MLTA 3RKPA 3AAZA 1PBYA 4TVSa 4G8GE 4L4TD 2APWA 4YPJA 3O3DA 4V2CB 1FG9C 3HE7A 5HI3D 15C8H 4WUUA 1W72L 5JZ7C 3OHXA 3DV4B 3MO1A 4RCAA 2XA8H 1J5OL 2OTWB 3O2DL 3MJ9A 2CKBH 1UWXH 1VKXA 3X11A 2ZOKA 2EXYC 2H8PA 3DMMB 3PDOB 4KI5D 4PB0L 3PABA 1SM3L 3U0WH 1ORQA 4LSPH 4YR6A 2R8SL 1KN4L 4JRWA 1MH5A 4KRMB 1YEEH 2DBLH 1N2RA 4RISL 1I9RL 5DI8B 3LKRB 1R5VB 4Y2OA 5CKGA 4BKLA 3FFCE 4WWKC 3GMOB 1P7QD 2AXFA 2OR8A 2SEBA 5GS0D 5GGVY 2PUQT 2NMSA 4Y89A 1W72H 5FYJD 3V8OA 1YNLL 5DK0A 1Q94A 5BJTA 3QO1B 1TFHA 2H2PD 3BRGC 2B1HL 1J5OH 2EYTB 3O2DH 4AMKL 4LVHB 4J1UA 4JFFA 5F3BB 2DLTA 4H26B 3V4VL 1U42A 5DK2A 3WCYA 4GLRI 4PB0H 1ITBB 1SM3H 4JCMA 2R8SH 3DROB 3QIBB 1KN4H 5GIRA 5JQ6L 1XF1A 3VFSA 5DA0B 4Y2DB 5EIQA 2F53A 4RISH 5JPMA 5E5MA 1BVKB 1I9RH 4XH2A 1H0DA 2HFTA 3MA7B 4F9PC 2BFVL 2UZXB 3HZKA 4ZXBC 3HPJB 2D0HA 1S7UA 1EXUB 4JGJA 3QJHB 4JFZL 2GY7B 1CTNA 2OTUA 5T3XD 1YNLH 2W9LA 1FPTH 1IJ9A 3HE7D 4KRPC 4WUUD 2B1HH 2E9BA 4AMKH 3RWIB 3ULUF 3B9AA 2HP4A 5GS2H 2Q76B 5J8OA 4POYA 4NNYA 3C60B 4MD5B 3RWEB 3WDHA 3V4VH 2DQDL 5CSBA 3PWNB 4A6YL 1Q72L 4X9BA 2PNDA 1CGVA 3WS3B 3G5ZB 2Z4QA 4GMSL 4U1MA 1RZIA 1PKQA 4UQ3A 1YN6B 1FZMB 4WI7A 2QKIA 3MCKB 2BFVH 2CJUL 4BQ6A 4XZUB 3HG1B 4PY7B 4LDLB 4K7FB 5C0CA 1OWRM 3WS6A 1U8HB 2OK0H 1DLHB 3F65A 3VE0B 4P5KA 4X5LA 4Z0XB 3P4NA 1NCTA 3HI1A 5CZVL 1MFEL 3ULUD 1I9EA 3BP4A 1ZSDA 3IRZA 2ZUXA 1KCRH 2DQDH 3ZKMC 4A6YH 1Q72H 4GRWF 3G5XA 4X6DF 4JFFD 4HWZB 3VXNA 4GMSH 3V52L 3FT4A 4UZGA 1OGAB 1OWWA 2EDNA 1NMCC 2APXA 3HZMA 3RVVD 3BZDA 2F53D 5FA3A 3D0VB 4Y5XA 1T80A 2VAAA 1HOCA 4OFDA 4ZFOL 1CICB 1S78D 1KCUL 3UXFA 1DBAL 3UPRB 5ICXB 1CDIA 4K9EL 5FHBL 3KGRA 3BUYB 2P48B 2ZUYA 4LSTL 3S96A 3BO8B 1G9NH 4ZQKB 3TM6A 1GAFL 3QUML 4KJYA 1MFEH 5CZVH 4CU6A 1T03L 5C09E 2NXYB 1P4IL 4RA3A 4G6AD 3C5ZA 3WE6A 2X4PA 2IG2L 2F54B 3A0OA 1FNSL 2FGWL 4IIQB 3V52H 3OXRA 4JG0L 4F37F 2R9HD 2XFXB 5LG1A 1JMZA 1PQZA 2GQHA 5BMFL 4ZUSB 2FJGA 4WDIB 5FUZL 2PF6A 3BH8B 3PHQB 4LIQE 3MBEB 4ZSOA 1KCUH 1A7QL 1YC7A 5FUCE 1DBAH 5ISZE 3TCLB 2CDFA 5FHBH 2VLMD 5C0CD 1R3JA 3L3IA 3DHMA 4L9DA 4LSTH 4NO5A 4R0LC 2ZUVA 5KS9B 3RNKB 4KVNL 1FL6B 1GAFH 3QUMH 4APQA 4IRZL 1T03H 3U79A 4HKZB 4F8TA 1P4IH 4D9LL 4XP6L 1UXSA 2VLRE 1XGUA 5HSFA 2IG2H 5LBSL 1FNSH 2FGWH 4V1DA 4LGPB 1WBXB 1IEAA 3O3AA 1L6ZA 5BMFH 1XR9B 2OL3H 5FUZH 1AGCB 4Y5YC 2G9HA 2Q87A 5C7XH 5IMLA 3CFJB 1FJ1B 1A7QH 4YXHL 1B0RA 3S3JA 2WLYA 4UU9A 1I1YA 3ARTA 1Q9OA 4HGWA 1IM9B 3VWKC 2BDNL 4KVNH 3JTSB 1CT8A 4A2MA 3ROOA 3QG7L 2C3WA 4LCCC 3WHXB 4D9LH 4XP6H 2Z8RA 3S37L 5FXCH 1TVHB 4QHKI 5KSBA 5C6PB 5T5FL 1RZFL 3WD5L 2O5ZL 4MGXA 5FKAA 4HIEA 3C5ZD 4J8RB 1HI6B 4Y16A 3MFFB 4X4MA 1ZHKA 3K8KA 2NCMA 4LCYA 3ZZ1A 2YN3A 1FNGB 3QULA 3ZE1E 4PLKD 1WWAX 5ESQB 3PGFL 5A2FA 5KSAB 4RGMC 2X1WL 3HZVA 2UYLA 1H5BA 3ZDYF 3MLWL 2GJJA 2PCPA 5BV7B 4IRJC 1T5XA 4KQ4L 2HMIC 2BDNH 2IPKA 5FM4A 1NGPH 3QJFB 4ZPVB 1AJ7H 1QSVA 2GTZB 3QG7H 4FQLL 4R4FL 3HE6C 1ZT1B 2BVQA 2BRRL 2HFFA 3GSWA 4PRHA 2EC9T 4APQD 3S37H 3WUWG 1JZ3A 2VITA 5I8OL 1ZA3A 5T5FH 1RZFH 4LAQL 3D69B 1A3RL 3MRHB 3Q6GL 4FQCH 3LB6C 2E7CA 2AAVA 2IBGA 1L4IA 4V1DD 3MROB 3RDTB 2V2WA 1MSPA 1KJMB 2OM5A 1ZE3C 3O6ML 4ZS6D 1KB5H 3VXSE 4M4RA 3PGFH 5IW6A 4WFFE 2XWTA 4HUMB 4PY8I 4JFQA 4Y4FC 4ZTOL 4Z7UA 1A6AA 4KPHL 5EUKB 5I0DA 1JHTA 1N5AA 3TO2B 4KQ4H 2R4SL 3TBWB 3RIFK 1BF2A 3BT2H 3QNYA 1AO7A 4FQLH 3U9UA 4R4FH 1CL7H 4UBDC 3IKCB 3TPUA 1TIUA 5I8OH 5ANMB 1DTUA 4ZOBA 2X4NA 4LAQH 3JWOL 1A3RH 4LPYA 3H2WA 2Q3ZA 4X6FA 1PYWA 1QYGL 5HGDA 1V3JA 1QFWM 1S9XB 2BK8A 1Y6MR 4HUXB 4X4YB 2YR3A 3O6MH 3ET9F 5L8LB 2IADB 4FZ8L 4Y16D 4YPGB 2R2HB 4ZTOH 4PJ9B 4I77L 5F44A 4KPHH 2NY2B 2A6KB 5DEZA 3BI9X 5SWSB 1R5IB 1EUTA 1J88A 3DV4A 2BC4B 2V5TA 3QT2A 4ZFFB 5ITBL 5MENA 2OTWA 2W0PA 3D85B 4WTZG 1T7YA 1GOHA 1NQBA 1UT9A 2W07A 1IAIH 4PPTA 3VRIB 3DMMA 3PDOA 1X4YA 1KLFA 1KXTB 3WDJA 5JPNB 4FMFA 4P2CG 1SBSH 2YHGA 1MFBH 4PRHD 1QYGH 1R24B 3NCCB 4N1EA 1CXIA 5DI8A 1KTRL 4D9RD 3LKRA 1R5VA 1J1XH 2VB5A 3GMOA 4FZ8H 4QOKE 5GISL 5FDWB 4PG2C 4JPVL 5DMGD 2B8OT 4S1DD 4I77H 5B8CB 4CN6A 5I75C 1UEMA 1AXTH 4M62L 3QO1A 1CFBA 5ITBH 4KDTA 5EG6C 1L7TL 2ZUQB 4Z7WF 3FFCB 3OAZH 1CK0L 1T66D 3LD8C 3MRQB 3IJSA 4PGCB 3DROA 1Z5LB 5IVNA 1AO7D 3QIBA 2C5DC 2BNUB 3PG2A 3S3PA 2IBZX 1T20A 5D2NC 4HJ0D 1BVKA 4PBWD 2LE9A 4FFWD 3WLWC 3BZ4B 4LPUA 3HPJA 5GISH 3GO1L 3HR6A 1EHLL 1ZVHA 1EXUA 4JPVH 3QJHA 1FHGA 3V0VB 4L4JA 5DSCB 5F9OL 5AYQA 3LS4H 2ZOLB 4G43B 5FGSA 3UAJD 1I85A 2UVFA 4DFIA 3MYZA 5ID1B 1L7TH 3RWIA 3GMMB 1Y0LB 4Z0BL 2JK5B 1CK0H 2Q76A 5ENWB 1UKSA 1SQ2N 3C60A 4MD5A 3RWEA 2Q20A 5IVOA 5MEND 4KTEL 4JO2L 3AXLB 1FFRA 2P8LB 3WS3A 5IBUB 3VW3L 2MNUA 5D2LE 5E6IC 3DMMD 5C0EB 3VFUB 4HKXB 2V9QA 2UVEA 1YN6A 1FZMA 4K7PL 3MCKA 3MTRA 4XZUA 3HG1A 4PY7A 4K7FA 3VFWB 1FVEB 3GO1H 1EHLH 3R8BB 1CFQB 1U8HA 5F9OH 1DLHA 3KLAB 3VE0A 3CZFB 4G8IB 4U1GC 1RURL 4Z0XA 1A6ZB 4NKIL 3LQAL 32C2B 5C0AB 1TPXB 2AV7B 4Z0BH 4HT1L 1AD0B 3S35X 3SN6N 3S9DB 4KTEH 4BFGA 4GS7B 4XBPB 2NY0C 4MAYC 1UC6A 3NCYP 4HWZA 3AGVA 1DBJL 2GITB 2JJTC 4G7YL 3VW3H 4R2GB 3KXFB 3FB5B 2K1MA 4CJ0A 3NCFB 1MCHA 3HMXL 3QIBD 1OGAA 3VXPB 4K7PH 4HIIB 5CEZD 1GGUA 2EE6A 4OT1L 1F00I 3GJFB 4J4PA 5D7JC 2MKWA 3D0VA 4IS6B 3ROLB 1CICA 4WIQA 3DX7B 3UPRA 5ICXA 3BUYA 5B38G 4MQTB 2IANE 1RURH 4XP1L 3BO8A 3GNML 4NKIH 4ZQKA 3LQAH 5C3TA 4HT1H 3C5JA 3CFEB 1P4LB 1PKOA 4QHMB 2IEPA 5GGVL 1QBLL 2F54A 3C60D 1DBJH 1WT5A 4IIQA 3G6JB 4OI7A 5J13B 2XFXA 1QKZL 3HMXH 4PFEA 2JF1A 1UH3A 5DJCB 2JCCE 5I1AB 1L0YA 4ZUSA 4OT1H 4RGNE 5HYSB 1MHCB 5DMKB 3QXWA 1BQSA 4JZJC 3S7GA 4WDIA 3BH8A 3PHQA 2R2BB 1RJYB 3MBEA 2OS7A 2J6EH 1HDMB 3HG1D 5KBNC 4GKOA 5D8JL 4LVOC 3TCLA 3B9EA 1HXYA 3SBWA 2C26A 4HGMA 2A6IB 5J06A 4XP1H 5KS9A 3GNMH 2E7LC 4TUOB 3RNKA 1FL6A 3FO2B 4HKZA 5F3HA 1DQML 1NCAL 4NBYB 5GGVH 2Z35B 1QSEB 3P3YA 4PLOB 4HAFA 5ISZB 1QBLH 3UBXB 3JWNC 2QHLA 1WBXA 1CDUA 2KKQA 4JY4A 2XTJC 1QKZH 4M7KL 5DQJA 3ZT5A 4HK3J 1CGYA 3I3BA 3MODL 3CVIL 1OGAD 1AGCA 3EYSL 3FB7B 3KS0J 3CFJA 3QHTC 1FJ1A 1GOGA 1F4HA 5D8JH 1LK2B 4J4PD 4Y8AA 1MCWW 2LV4A 5CWSB 5INCB 1CICD 4YDKL 4M1GL 1U8MB 3JTSA 1I8LC 1DQMH 3WHXA 1NCAH 1N64L 3QQ4B 3GHBL 1TVHA 1ERNA 1ZLVH 3OR6B 3IXAB 2NXYD 3BYTA 4JRXB 2W9EL 3ZHDA 3KHOA 4IEFB 4J8RA 5KVFL 3MFFA 4M7KH 2F54D 2LU3A 3GI9L 5L2KE 5D6DA 4EI5C 1FNGA 3MODH 3CVIH 5ESQA 1I8MB 3CFIC 4MYWB 5KSAA 4MDJB 2W1NA 3VG0L 1CGUA 3EYSH 4GSDL 1IC7H 3EOBB 2FEDD 5C0JB 2HLFD 2FH6A 1F97A 4WFHE 5IB2B 3DHJA 3TC9A 3DI3B 3MBED 1RZGB 3EZJB 4KROC 2D9QB 5E94A 1NFDE 2ESVE 4DKFL 2D7NA 5FB8B 4PJGE 3QJFA 4ZPVA 3HNVH 1ZT1A 4WI8A 1L0XA 3P4LA 3GHBH 3HC3H 3RA7L 4GKNB 1SY6L 2HFGL 3AMLA 4U1LB 3D69A 2W9EH 3MRHA 4N0FB 3CD4A 5KVFH 5D1XC 3RFZC 3MROA 2VWEE 3RDTA 1KJMA 1YYML 4TTDC 1O7SA 2OR7A 3ZTNL 3IFLH 3RVTC 3VG0H 2DWEA 3QCUL 4GSDH 3ARQA 4TSCL 5E99L 4G6FB 1C5BL 4LSUL 4HHAB 5EUKA 2JJSC 4YGVB 3CFKB 4YHNB 4YDLC 3TO2A 1TQBB 3HTLX 4G6KH 3TBWA 2G60L 2BVTA 3J7HA 1MY7A 3MR9B 3VXSB 1TMCB 3GIVB 4XRCB 4O51B 1WCBB 5ANMA 4PJIE 5F1SA 3RA7H 1C7TA 1RK1A 2HFGH 2WBWB 3T2PA 5HVGB 4I0PB 1S9XA 3QQ9C 3IDNB 4JDZB 4LFHG 1YYMH 1ZXQA 4PJHE 4X4YA 1F3RB 5JW4R 3ZTNH 2IADA 2L4OA 3SDXF 3P11L 3QCUH 4M6MH 3MLSL 2R2HA 4TSCH 5E99H 4BK4A 4PJ9A 1C5BH 4LSUH 3SE9L 2A6KA 2XG4A 1KEML 5KSAD 1IBGL 1RIUL 1EBPA 2RGSA 3RX8A 2PTTB 5KOVC 2G60H 2DF3A 4X7SL 4OGYL 3D85A 1OTUD 3KPQB 1QA9B 3VRIA 3GGWB 3LIZL 3VI4F 1F6LL 1S5IL 1PVHA 3QXVA 2GSIB 1DZBA 2E6PA 1R24A 4Q9RL 4OGZA 4PGZA 4NFBA 4OZ4B 3DVNB 2EDBA 1PDKA 4UOW0 3P11H 3MLSH 3RDTD 3SE9H 5B8CA 4XNZC 1XZ0B 2A38A 4Z6AT 1IBGH 4XWOD 1RIUH 4LEOB 3ARBA 1OAUL 4ZO6A 2J2ZA 4H88L 4X7SH 5L8KB 4OGYH 2HAZA 3BPOB 3BX7C 1KJ3L 2DN7A 3SE3C 1ZMYA 3MRQA 4PGCA 4PGEA 3REVB 4NBXB 5KW9L 1Z5LA 2QQQA 1S5IH 5GS0H 1HIML 1NGWB 1DVFB 5FYJH 4AEEA 4Z7NF 5I8EB 3QZWG 1QOKA 5T3XL 7CGTA 4K8RC 4ZYKB 4D0DB 3BZ4A 1Z9MA 5FYKD 1Q9KB 4U1KB 4KKLC 5IVZA 1U3YA 4XBGB 3V0VA 1T5WA 5DSCA 2AKRB 1A1OB 3LKQB 2ZOLA 4G43A 4B0MM 5ID1A 2NY2D 1ZT7B 3GMMA 1Y0LA 5EN2B 3O81A 4ELME 3D9AL 5ALBL 2JK5A 3KPSE 5ENWA 1TJGL 1KJ3H 4JJ5B 2UY7A 2QSQA 3AXLA 2P8LA 5KW9H 3D85D 3HB3D 5F89B 3BRFA 1HIMH 1J05B 4JANB 3T4YB 3S37X 5C0EA 3VFUA 1XIWC 4HKXA 3RAJL 3EFFB 3JV5A 5H2BB 5T3XH 5E8PB 1DL7L 4YEFA 4FFYL 3ZDXE 1SVZA 2ZWLT 3T0XA 5D96B 3CX5K 3VFWA 1FVEA 2HRPL 1CFQA 1GGCL 5TDNB 1Z0NA 3B8SA 3X13B 1CDYA 5D2LB 3KLAA 3CZFA 4G8IA 1KPVB 3MJ9H 4QHLB 2F19L 4QGTA 32C2A 5C0AA 4CN4A 3D9AH 2AV7A 4JKMA 5F6IB 1QHOA 1TJGH 1BGXH 1K2DB 3ARBD 5E2TL 1EEQA 2Y36H 5AG8A 4XBPA 3UJTL 1MCSA 1F2XK 1J1PL 2GITA 5HYJB 2D7MA 3KXFA 3FB5A 1F4XL 5CLWA 1MCOL 1NBYB 4OF6A 3RAJH 1DL7H 5KANI 3VXPA 4FFYH 1NFIB 2FJFA 4HIIA 4J23A 4P49A 4ZUUB 1OF2A 2HA1A 4JDVB 3BXNB 3GJFA 5I8KL 4MD0B 1PW3A 2HRPH 2CSPA 3ULUH 3RRQA 5FYLD 3BPNC 4O4YL 3DX7A 2D9CA 1GGIL 5HVWA 3MXWL 2F19H 2YZ1A 2EDDA 1NJ9B 1UH4A 2XWBA 3CFEA 2P8MB 5CSZB 1E6JL 1P4LA 3MRCA 5E2TH 5EU7C 3QFDB 3JVGC 3QBTB 1J1PH 4ODTL 4WY7L 2QEJA 3G6JA 2NNAB 2J8UB 1MCOH 5DJCA 1K8IA 3JV4B 4L3CB 5I1AA 3HCVB 3PWPA 5CZXD 4F33B 3ULVD 1MHCA 5DMKA 4M7ZC 3S4SG 5FGBA 1RJYA 2OX5A 1HDMA 4O4YH 2AGJL 3O45B 5J11C 2A6IA 1GGIH 3WBDA 4XMLL 3MXWH 3SHSA 2RJMA 3EYFA 1E6JH 3MNVB 2FDBP 1MHHA 5C0AD 2Z35A 1QSEA 5EULV 5ISZA 2V2XB 3UBXA 4ODTH 4WY7H 4WU7B 5HDOA 4QRQB 5JORB 2A77L 5I17B 5DJAB 3ZT7A 3WIFB 3KXFD 4X5WB 4L3EE 5F7FA 3SE4C 3FB7A 4O02H 4WO4A 1TTGA 1MCPL 2AGJH 1LK2A 5MEQB 3IS1X 3PNWB 4XMLH 5CWSA 5INCA 5K59E 1A1MB 3DX9B 3VFPB 2H6PB 1U8MA 5FEBA 3L3HB 3AFLA 1YEJH 4EDWL 5AAWA 1A6PA 5DJYB 1UB5B 1A2YA 4UAOB 3QQ4A 3WJJC 5FM5M 1MCFA 1U2CA 3OR6A 3IXAA 4JRXA 3VH8G 2WBKA 4FHBD 4W68A 2A77H 3MRLB 5KVDL 1VGEL 3KDMB 5EOCJ 3ZKXC 4EZMA 4R8WH 1LD9A 4MDJA 3PWPD 1GC1L 1MCPH 3S5LG 5C0JA 2A6DB 5IB2A 2QQNL 1RZGA 1UCTA 4LPVA 4U6HB 4EDWH 4YO0B 5FB8A 2FYYB 4FZEL 4JQXC 5HDLA 3I2CL 1XMWA 5DUML 4GKNA 4XAKD 4U1LA