4IBLT

Rubidium sites in blood coagulation factor viia
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
198
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Coagulation factor VII
publication title Sodium Site in blood Coagulation Factor VIIa: Absence of occupancy by Rubidium
rcsb
total genus 43
structure length 198
sequence length 205
ec nomenclature
pdb deposition date 2012-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iblT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4iblT02
3Q3GA 3ZKQD 5I74C 3L5XH 4R4BB 4LSUH 4NKMB 1F45A 3ZYZA 3BUYB 4JRYB 3QFJD 3GJFK 1D3CA 4K3JL 1V3MA 1N4XH 1U3HD 4HKXB 1MFAH 3UEZA 4FZEH 1I3RA 2FBJH 2VDMH 3ILPA 4MJ2A 4F9PC 4PGJA 4PPTA 3BZEA 5E8OB 5D7IE 4PJGE 5TQ2L 3S98A 5SWSB 2FHCA 1CGYA 3O4LD 2F58H 4MHHG 3TEUA 2VDKL 3IDYB 2V2XA 1Q9WB 3W2DL 4BK5A 2DIBA 4U0RB 5E08L 4YK4B 2W65A 2BSED 4QOKD 2PETA 4LVOB 2EKJA 5E00B 5I1AA 1A5FL 1T3FB 3KPRB 4XP1H 4KY1L 4Q7DA 5FUOL 4OCRH 4AQOA 2PW2A 1YN7A 3DUSA 1UWGL 1Z0MA 5TGBB 6CGTA 1RVFL 3VDBA 2EH7L 2GJJA 3S5LG 5IROA 4ERSH 4ZAKD 2R2EB 3NCMA 1RUPH 2R1YB 4JPKL 3HG1E 3LEVH 4FNLL 1CTOA 4FMKA 2W9EL 3GSQA 3NCEB 4JANB 4WTZA 4WY7L 1U3HA 5HHOB 4BYHA 1GHFH 1S7TB 1NMBH 2CKBH 5IVZB 3DVGA 3U30B 4KZEL 4HULB 4I48B 4CVXB 2PXYA 1ETZA 2EC9U 2AQ1A 2DDQL 2WW8A 2FL5B 3QCVL 1KENH 4IRSB 2EDDA 3D0LB 2QQLH 1YY8B 4NZDA 3GUTB 3D39A 4OZ4A 2X4SA 2GJ6D 3DETC 4NFBA 3S3PA 3S8WA 4QOKA 5JPMB 1JGEB 1UG9A 4OZIE 5BRZB 5IEHA 2A9NL 3EO1B 3BKML 2A0LC 4KAQH 3NFPA 5L9DL 4J3WA 4Q6IA 5KVFL 1F58H 4PV8A 1NDGA 4RNRB 4ZSOB 4IDLA 3QDGE 1EGJH 1TCRB 2XI9A 3GRWA 1PKQA 2AXFA 4MCZA 4W6WB 3TBSA 4MS8C 3WFCL 5DC9B 2EXYD 2EDNA 2XXCB 3K7UA 4PS4L 2VERN 3HE7A 1V3LA 4JFOB 1UXSA 3CFCL 5CJOH 5BQ7B 3S88L 1S9KC 3T4YB 4RWHA 1YUHA 4LPYA 5EUOA 3L7EB 2JELL 5K9OA 4YQXH 3C8KA 1ZSDB 1NEZB 1WEJH 3X17A 1KJMA 1M7XA 1PGRB 2D7NA 3U0PA 4PRAA 1RK0B 3FKUS 4KPHH 3PJSA 4O58L 4YX2H 5K59E 4HXBH 3G6JE 4TUKH 3MGTA 1V3JA 5IB3B 3FQRA 4Y2DD 3OKOA 4HK3N 1CI5A 3GI9L 1ZT4A 1G9EA 3BW9B 3JWOL 2GJ6A 1CVRA 3DO3A 2YSSB 4MNGA 5HHMD 4N0CD 4FFYL 1OT1A 3O3BA 1TNMA 4MNHB 5D2NE 3VG0H 1CZ8L 4FABH 1IJ9A 4EQ3A 2DKSA 4X9GA 4S1SH 1QFOA 3T09A 3IKKA 4KHTL 5DJ6B 4WU5B 3DV6A 4X6CF 5I0ZA 4AENB 3VWKB 4NQDE 2NY6B 4BZ2H 3EAKA 4X6DA 2ZKHL 2W60B 1AXSB 2RGSA 3FMGL 1N8ZA 1GGIL 2X4RA 4P0DA 2YRLA 3ARDA 3AS2A 4QT5B 2CIKA 2HVKA 5AUMB 1IGJA 4WI2A 1BQSA 1T2XA 4LLUB 3CXDH 5ENWB 4LEXL 1SYSA 1GIGL 2FECL 2YD3A 3GSNH 3MCLH 4NCC2 2HN7B 2NY2C 3UTOA 4IOSD 2I9LA 5TFSH 4CU8A 4M8VA 3UTTA 1FBIH 1ACZA 1NCBL 3NZ8A 1NGYA 1F2QA 1R5IA 2HTLD 1XF2A 5LQBH 4R26H 5BO1L 4YHML 4P5TB 4P2YA 3RX7A 1LD9A 2R15A 3G9VA 3H9HB 4Y2DA 5BJTB 5CJBA 3DYOA 1UB5A 3X14A 4EXPX 3RDTA 4L4VD 5EBLB 4I77L 4H25A 3JV4A 5C09D 3RVUD 5I9QC 1U41A 1V7ML 3IDXH 3BH8B 5IBUG 1C08A 1BF8A 4N0YH 4GAYB 4QXTB 5M94B 1YZZA 4P9ML 2ZPKL 35C8H 5GQBA 2NZIA 4APQA 3FN9A 4NNXA 5MERB 1Y18B 2UZXB 2WANA 1HINH 5IW1A 4WNQA 4GBXB 4IMKC 2Y36H 1MCQA 2D4FA 3TM6A 3WHXB 1KLGA 4HC1A 3OJDB 3P11L 2XTJD 5HYIA 4HIEA 3P30H 5I8CB 1G7IA 1X5IA 2H9GB 4NRYB 4Z76B 1QFHA 1ZWIB 4DN3L 1JFQH 4FQCH 4U31A 1S7UB 5ETUB 2XQYG 3GHEL 5C1MB 1KIUA 3PXHA 4U6XB 3EYUH 5ICXB 5IVXE 2ZCHL 1RPQA 2FB4H 4M43L 3BXNB 2GI7A 2NXZB 4WUUA 3V6OA 4E9LA 3B9KB 4LBEB 3VRIB 3ABZA 4QRSA 1T7XA 4L4VA 4HBQA 3V4UH 1KB5L 5C09A 4KKCC 2P4AB 2O5YL 4I13B 5CGYC 3QXWA 2OP4H 1R3HB 4PG9A 3AXLA 4X6BB 5GGVL 1F90L 3SDDC 3HE6D 4AYFA 3ARGA 2R56H 5DJCA 3J8F7 3IDYC 3RGHA 1ZA6B 4B5EA 4YXHH 3FFDA 4W68A 1BQHG 1OD7A 1TIUA 3VA6A 2XXMB 1FNEA 2WIMA 3GIZH 3KPPA 5GS2H 4E42A 4YK4C 4GRLC 1RJYA 4S1DD 4Y5VC 3CDGA 3ULUF 4GUPB 3HR5A 3BH9A 3PXJA 1I3VA 4WW1A 1CFSA 2XY1A 5HXMA 5BV7L 5TDOB 4M3JA 3D39E 4PJ5D 4RAVB 4OAWA 3EOTL 3QB7C 1IQWL 3MR9A 2C3VA 4UDUA 1MEXH 3CFEA 2NR6D 2VDQH 3KPLA 1P4BL 1F8TL 2GITB 5BVJB 3HZMA 2XZAL 3SE4C 3TT1H 1QRNB 5KSVA 1VACB 1OGTB 3U4EB 1MCPL 4ELMA 3KVQA 1NCWL 1AP2B 3RWHA 3U30C 4DZBA 3Q6GH 1OPGH 4Z7VB 1BWWA 4Z7NF 1DBJL 2V17H 5EUOE 3BX7C 4FZ8L 3GNMH 3LHPH 1MQKH 1TNNA 4LLVA 5C7XL 1NCAL 3HE6A 4IRSC 4M4PA 4P2OD 4J7RA 2Q6WB 1FFPB 3AM8A 2GTWB 1IT9H 2CJUL 5CD5D 4HFWB 1H5BB 3NIFE 5EZJB 2RJMA 1X5YA 4L5FL 2JJWA 3WFBH 3TBWA 2V5MA 5B3NA 1JZ8A 3VFRA 4RGOH 3IETB 1JNNL 1L0YA 5DVKA 4PJ5A 5K33A 3QQ4A 4K2UH 1QD0A 4MNGE 4LSTH 3MRKB 1S9XA 3KPTA 2J6EA 4NQTA 5LGJB 3BKJL 4N8VA 5TPWH 1U2HA 4GAGL 2YZ1A 3MJ7B 4DW2H 3QDJE 3MLXH 4KI5E 4X6DE 3MRBB 2J8OA 4N1HB 3WE6A 2VWEC 3DX6A 5E1AB 1NGZB 2LTQB 3AVEA 4QXGH 3FQUA 4X0KA 3QI9D 1EMTH 1I4FB 5E7FA 4WI8A 5C0EB 4WUKL 1KGCD 2Y6SC 3VFWA 2FHFA 2ORBL 1LNUA 5T1KA 3UBXI 1R0AL 2DICA 2BXYA 4PB9H 5IIEB 3E8UL 4Z7QF 1FFOB 4KFZC 5ESAB 2MTPA 1KCSL 4ZPVB 5E6ZA 1FL6B 1YYLH 3FRUA 4JFYA 3UTTE 3ZE0F 2F54D 1MELA 4F3FA 4IOIB 2C5DC 1DEDA 4HGMA 3MJ8A 5FYLE 3SDXA 25C8L 3RPIB 4M1CD 5FYJH 5CEZL 4J8RB 1RY7B 4WV1B 4TPRL 4RMTA 1CK0H 4XCEA 3VWKC 1H3GA 5FA3B 4XWGH 5JW4M 3UC0H 2NY6C 2XWJB 3KLHC 2IANB 5C08A 4Z8FL 1AQDA 4OQ1A 2A83A 1U8KA 1KB9J 3GBNL 3CH1A 4I0PC 2EIZB 4RGMB 1A9EA 4GXUM 4XI5C 3QJFB 3SJVD 4C56D 4RGND 3BEVA 4UV4L 3WUWB 5FYKU 5DHYA 1HH9A 3QEGH 3WD5H 4N0UB 5DD6A 1VDGA 1FVEB 4R7DB 4XNMA 4HUUA 2ZUWA 1Q9LB 1OB1A 4LGPB 3WEXB 2ZSVB 1WAAA 3IJYA 3JWDL 5IP4A 4PJEB 5IMMB 1CFVL 3H6JA 1ZVHA 1S78D 4MWFB 5D1QD 3AUVA 1AO7D 4P5TC 1XGYH 4WHTA 1YJDC 5INDA 5FHAL 1U8IB 3LMJL 4M7JL 5EPMB 3WFDH 5CBAB 1Z9OA 5KSBB 2CO6B 3B9VA 3GMLB 3QH3B 1P7KA 43C9A 2YPVL 3BIKB 4HT1L 4JQIL 4HKBB 1CGXA 4LCIL 2G9HA 1QFWM 2NY7H 2X1WL 3CSYB 3ZTNL 3IU4L 4JFFB 2X4UB 4RAHA 4ODWB 5GSVB 4I2XA 4CN1A 1UCBL 2DTSA 4XCFH 4P2QE 2FEDC 3EO9L 5EU6D 3S96A 1QLEH 2B0SH 2YN3A 4LRIC 2XTLA 2AABL 3F5WA 4P9HL 5J9PA 2GAZB 4GBXC 3SJVA 2CUHA 1T2JA 2AJUH 3GKWL 1T0PB 4X6FA 4XPHH 4JM2B 2ZZUT 3QEQB 4QRPA 4EDWL 4HFUH 4LPTA 5DGQA 4GKOA 1KFAL 3PGDA 3C60B 4KRLB 3VFGH 2R23B 5D1XB 1DLHB 1F4YH 4FFWC 2YPLD 2A6IA 2E27H 5D1QA 2YD2A 4NJAH 5JO5A 1RURL 2ESVB 4YDKL 4DWHA 1FGVH 2E7LA 2F74A 4D8PB 3CX5K 5TDPA 5CEXA 1FG2A 1CQYA 1KNOA 2P8LB 1WCQA 3FTGB 5F8QC 2HJLB 4W6XB 3NCCB 1IL1A 1F6FB 2FZ3B 4GAJH 5K93A 1IM3B 4JLRA 5HY9A 3SGDI 2QADB 2Z93B 3T77B 1MRDL 1U3ZA 1U8HA 2LU7A 5E2JA 4F58L 4HW6A 4ZTPH 1GRWA 4KTDH 3O8XA 4PLNC 3OKYA 3QHFL 5GGSA 5GRJL 1OP9A 3DTXA 2PKDA 3C5ZC 1B0WA 1J9CT 1DDHB 5KSUA 4M9PA 4PJIB 1LEKA 4ALAL 5IR1B 1A7OH 1EEQA 3HR6A 4UILL 3C6LB 2A6JB 1YJDH 5JW3H 4R9HA 4LIQH 4Y2OA 3QUYB 1Q94A 3I6GA 2BVUA 4LKCA 3DLQR 5KVMC 1LMKA 2WBKA 4P5MB 1CD1B 3MXVL 1VADA 2YPLA 3MJ6A 4NFCA 3U79A 4GG8B 4O4YL 1QHOA 5DD1L 5CJ8A 4S0TD 2H8PA 5K9JL 3G5XB 1JHTA 2X7LB 2P7TB 5D8JH 1S7RB 1ORSB 2IAMB 4OLUH 4NBXB 2KQMA 3FN0H 4HUXA 3TYGH 3AU1B 1ZMYA 4POUB 1QKZH 5HI5D 2F5BL 2DQFB 3TCXA 5CJXA 1P2CB 3QRGL 1AY1L 4IDJL 4XVSH 4JFQB 2LABA 3UJTH 5IFJA 5JZ7C 1W0YT 2ARJA 4OZFA 1UJTA 5F9OH 5JPNB 1A7NH 1H5BC 1CR9L 1REIA 3BGMA 4JREB 1RFDH 1YDPB 1QBLH 5HSFA 5KJRH 5D9SA 1DVFC 3C5JA 4JB9L 2DKUA 4OKVA 3EIFA 2CDEA 3MYJA 1K4CA 2O93L 3B2VH 3VH8A 2E9JA 5D1ZD 1EEZA 4KVNL 1OAQH 1M7IB 2OTWB 4L4TD 1OAUH 5E2WH 1RUQL 2R4RH 3SDXE 4HS6B 4YHZH 1Z3GL 1UC6A 5IF0B 4KXZH 4LF3B 5T3XH 3E1F1 3QCTL 2P8MB 5C08E 2BOBB 3RWGB 4U1IA 5CEYB 3BGFB 3TV3H 1HZHL 3D3VD 5C2BL 1A6VL 1CU4L 1LK2B 4NO5A 1UXWB 3RIFF 1A6AB 1KBGL 1JPGB 4LPVA 4MNQE 2LU3A 2WAHA 2NTFA 3DURA 4OIIL 2QEJA 5DJ8B 5IGXL 4QEGA 5DQDL 3TO4B 2MHAB 3MCKA 3ALWA 1C5BH 2VL5A 2FSEA 1P84K 3HHRB 2V9RA 3IFPB 1DSFL 4I18A 4HG4K 5HYSB 3TJEH 3NABL 5IK3B 4E41D 1J7VR 2DLIA 3RRQA 3VCLB 1A6PA 2VDPH 2BSRB 1KB5A 1B0RA 1UCTA 4WV1C 3QIWB 4R90L 4BQ6A 3TWCL 3L3IA 3O2VL 4LAQH 3T4AB 1AGCA 1G7JA 1U91A 3T0AA 1PQZA 3QXVA 3T0XA 1WITA 4N5ED 3ZKMD 1D5IL 1TJIL 4V2BA 1BJMA 4L4TA 4Q0XH 1AQKL 4RGMC 5DJ0A 2BVOB 4L3CB 3HZVB 3R4DA 3FQXB 2BJML 4NQEE 3WIFB 3LEXB 4HV8B 4XZUA 1N3NA 4I2XE 3PABA 1BFSA 2B4CC 4U3CA 2P5WB 3DWTA 2VR9A 4P3CL 1EO7A 4U7MA 3CPLA 3K2MC 1YEIL 2DWDA 3D3VA 5EO9A 1IBGL 4OB5L 5J1AA 4P48A 5LWYH 1Q1JL 1FFNB 4KV5F 4GMSL 5J6GB 4FP8L 4RFEB 3I3DA 3OZ9L 4QRPE 2AKRB 1GYAA 3RI5F 4GW4A 1AC6A 3MV01 3PDOA 4N8CL 3G5ZA 4AG4L 1QQDA 4M03A 2IPKA 4IJ3C 1FJ1A 3BPCB 5DK0A 3OKDB 4FQIL 4XGZB 4XPTH 4E41A 4F7PA 4PJXE 3F6IA 1G9NC 1G9MH 4NRXA 3RIAF 3S3JA 4YDIL 2IH1B 2PTTB 4OGAD 5I1EL 3IAPA 4LPWA 5FDYA 1VPOL 4YHNA 3W9EA 4G9DA 5GGTL 4KQ3H 4KROC 5FGRA 3VXME 3I6KB 3OR7A 3OR6B 1A7RL 2EH8L 3DSFL 1GGTA 2NW2A 4Y5YB 3GSUA 3HCVA 4B50A 3PGFL 2VL4A 2BVQB 4U6YB 1GGBL 3TLRA 4WHYH 3C60C 1YYML 1YMHA 3ZSSA 5CEZD 4CMMA 3RUGB 1AGFB 5D1XC 2BNUB 5EOQL 1FORL 1T1YB 1JYNA 4OTXH 3KJ4C 1HQ4A 1UZ8A 4GAFB 3CZFB 2VLJD 2DBLH 4V2CB 3T0ED 2GCYB 4HMCA 5AG8A 3LQAL 2FD6L 3VFUB 3MRLA 4R4ND 4LCUA 3O0RL 5IBLC 5F89B 3L5IA 1XEDA 4YR6B 4HKJA 2DQUL 5I15H 1E4XH 1RU9H 4XXCC 5JDSA 4ZOCA 3ULVC 3VI4F 4F8TA 2B4CH 4ODUB 1R5VA 2F5AH 2V2WA 3QNYB 2JCCB 4N9GA 4XMPL 3T1WA 5DT1H 5FKPB 2BNRB 1MCOH 4M6ML 4KQ4L 3O11A 4OI7A 3SGKC 5HHPB 1CLZH 2AJZB 5I1CL 3H3PH 1HYSD 1N0XH 3OJVC 2EYSB 4NKOA 5DUBA 5B4MD 3BD5A 5C0FA 4DKAA 4NKQB 3QUYC 2R2BA 5EZIL 3MUGA 3EFFA 2VZ1A 3VXRB 3D6GA 5HHXL 1OVZA 4KMQA 3KPNA 4JAMA 3ZTJH 4PJGB 3W5NA 1HH6B 2YXMA 3U7YL 5JXED 2VLJA 1BFVL 1FAIL 5KSAC 1S7WA 1OSPL 3FOLB 1RUKL 5E8EB 1I8MB 4XVUC 3MOAL 3DMMC 2DQTH 4ODVL 1OTUC 1VKXA 4KJWC 2IAMC 5CIPA 4PGBB 1PG7L 3HKFA 3OAYK 4BQCA 4YWGL 4P4KB 4YHIA 1PSKH 3LSOB 3IDMA 3PWVB 3SQBA 1KYOJ 2ATPB 1YNLH 2GSIB 4J6RH 3V6FA 2ZCLL 4OIAA 4MJ5B 4TVPL 1CD9B 1WFNA 2Q7YA 1INDH 3WNOA 4O2FB 1CLCA 1W0VB 2AV7A 4NNPH 1HSAB 2X05A 1ADQL 3ZMRA 4C58B 1S9VA 2AJVL 5J06A 1XGQB 2W0FA 1HILA 1UGNA 3F7YA 3VXQA 4JREC 5D7SH 2VXVH 3IAQA 2AEIT 1BD2A 1JUFB 4JDTL 5BS0A 4G8GD 5FB8A 1EJOL 1SVCP 3J7HA 3TN0B 1JWMA 4MVBD 5CBEA 3MNZB 1A64A 3B4NA 1JN6A 1GOGA 1F6AA 5L2KD 1OAZL 1S7XB 5I1DA 4P5KA 2HKHH 4TSCL 1AGDA 1JRHI 1LHZA 3KPMA 3D87B 1J05B 4FXGB 5HGHB 3MV7D 3NFSH 3DVNA 7FABH 3BGFC 4WFED 3SE3C 4UINH 2HAZA 3RU8L 4TNWK 4JZJA 3JTTA 4G9FD 2DI7A 3UJJH 4IS6B 5D70L 3QNZA 3LQMA 1AFVH 4U3HA 3L3JB 5FUCE 3MRNA 5E5UB 1CXLA 2NLJB 4ZFGH 4U1SA 5TH2A 4H8WL 1AXIB 4O51B 1NLDL 3O3DA 3S97C 3O9WD 5J3HC 5E0QA 5E2VL 3QIWC 5T1MA 2V9TA 1WK0A 3SO5A 1TQCB 4MSWA 1R3LA 1VFAA 1IRAY 4OV6F 4GS7B 1R3JA 1YMMD 2ADJA 3MYZA 3MRGA 3QXAA 3ZE1F 4L1DA 2EDWA 1RZ7H 1RZIB 3ROOB 1TZIA 3P0YL 4JFHD 4XCYB 1L7TH 3VXUE 4TQEL 3OG4B 4I3SL 1I1AA 1YNTB 5E5MA 4XC3H 3LKQA 1WWCA 2Z92A 3QZWG 2YA2A 3I3EA 3GBMH 1P1ZB 4P3DA 3RVVD 5JIHA 3QRFM 3VWJD 4S1RH 5MHSD 3EYSH 1XGRB 1XIWD 2FJFB 3X3FH 1QNZL 3WFHB 4TUOA 3BDYH 5C0CD 1OCWL 3B9EA 4P46A 1K5NA 3CJJA 4G7YL 4OSUL 4YHOH 4OUUA 3B8YA 5T1DL 1P5VA 1FO0B 4CNIA 1XGPB 4J3OC 3G6DL 5I0DA 3NCFB 1KPVB 4PJDE 3DXAD 3NCBB 5EIQA 4JDZB 5DMIL 4HGWA 5IB1A 1AXTH 4LGRB 4LMQI 4X7EC 3BQUB 3LY6A 2R0LL 3P9LB 2Q3AA 3PQYB 4P4RB 4M6AA 1JGVH 3BZDA 4Z7VF 2X2YA 2B1HH 1P4IH 4Y5YC 3K1KC 5HPOA 4P2RE 4XXDB 1FRGH 1AR2A 4K9EC 2OSLB 1L9MA 3RVWD 1D9KD 4LDOB 4Q9RL 3DHMA 2CPCA 1KJ2B 1LE5A 3MCG1 2PO6A 1LO4H 3DPBA 3IDJA 4WHYG 4XTRC 2VXTH 4ZFOA 3Q3GB 2FX9L 3VWJA 3CVHH 5BZWA 5I18L 4E5XA 5GS1A 3MRCA 2BRRH 1HKLL 5D2LA 1HOCA 1JPSH 1EDQA 5F44A 4DTGL 1WWBX 1R3IH 5B38A 3ILPB 2DLFL 3FZUD 3KDMA 3BZEB 2AV1A 2MCG1 4XP9H 1OAKL 3EJYC 3IFLL 3MPCA 3HUJA 3PWJA 4HS8L 5ADOH 3DXAA 4NPYA 4V1DA 3WUWG 3RX8A 2V2XB 3BP4A 1KN4L 4U6VH 2DIAA 1RULH 4HX1A 2XACC 2DLHA 1A8JH 1J5OL 5D6CA 2W65B 4X83A 5I1IL 3QPXL 5EORL 1ZLUK 4C55A 4AEFA 3BN3B 2X44D 4RDQG 3MLYL 5I1AB 5LG1A 1NLBH 4HLZH 4KRPD 5DR5H 4LLMA 1KN2L 4M1DH 3LS5H 3QHZH 1U8OA 3D48R 2PW2B 1NUNB 1YN7B 3DUSB 1CF8H 2ICWI 1U93A 1SJXA 5KAQG 3BPLB 2HLAA 2EEBA 3HFML 1Q0XL 2WINA 3ZTJG 4F7TA 2WNGA 3WXWL 4AEIH 3QR2A 1BD2E 4J3XA 4MHHI 5BS0E 3GSQB 1U3HB 4J3VA 4UBDC 4NQCE 2XNAA 1CICD 3D69A 3KYAA 3U4BH 3DVGB 3I6LD 1OP3H 3X3GH 1JE6A 3IDNA 2PR4H 1OGAA 5J1TC 3JV0A 3TNMA 1RUAH 2PXYB 1ETZB 3WL9A 4LQFH 4P4KC 1AI1L 3GMNA 4K9EH 4KI1A 1MFDH 3D39B 2EDHA 4OZ4B 4PTUA 2X4SB 2DJSA 5FF6A 4R97B 2F53D 4QOKB 3EYVA 1FGNL 4RDQF 3SCMD 1MCKA 5LAXA 2GQHA 5IEHB 3CVIL 1J8HE 3NFPB 3I9GH 4D3CH 4PV8B 1NDGB 2CLVA 4ZO9A 2BOCA 3MLSH 2XN9D 4DEPB 5F7DA 1PKQB 2AXFB 1IGFL 4MCZB 3KLDA 5KSBF 5E94A 1VCAA 3S35H 5D7JA 1GVIA 4PJCF 3TBSB 1RSFA 2HT2C 3DV4A 3HE7B 1UXSB 1OAXL 1YUHB 5EUOB 5K9OB 1UVQB 3D2UA 3C8KB 5GGTA 3VDCA 3H9SD 1CQKA 1KJMB 4CADA 3M8OH 3ULUD 4P2CG 3U0PB 5KG9A 5MENE 1CICA 1B9ZA 4PRAB 5JHDE 5I71B 4M6OL 2VXSH 4PBWD 5E8NA 1KC5H 2Y1VA 3PJSB 5EOCJ 4ZXBD 3V0WH 1UYWH 2WLYA 1UKQA 3AS1A 3MGTB 4MAYD 1RMFL 5IJKA 1J0ZA 3FQRB 3OKOB 3FB7A 1AGBA 1CBVH 4OGYH 5TE4L 3C5SA 2GJ6B 4U1GC 3H42L 4MNGB 3UTSD 5DO2D 5E6IA 3O3BB 5E9DD 4O5LH 2FX8H 5F1IA 2F15A 3MNVA 3SCMA 1J1XH 4HBCH 2ZUTA 2EDBA 2J8UA 2MCPH 5I8OH 1TMCB 3DV6B 3L1OL 3QUXA 2JF1A 5FYKH 4X6DB 1DQLH 1I9RL 4NO3A 2NNAA 1ZT7A 4OQTL 3OQ3B 1N8ZB 4XAKE 4PJAE 1I9IH 2X4RB 1TQCC 4ZUSA 3ARDB 4OLYL 5AZ2H 4Y88A 2GYSA 3RY6A 4GXVL 2CIKB 2HVKB 1CGTA 1IGJB 4GS7C 1DQJA 1WZ1L 3WN5A 2SEBA 1LP9E 1SYSB 4G6AC 1CXEA 3H9SA 1C12A 3QJHA 2OTPA 1U9KA 5IT2H 3ULVF 1NL0H 5T33H 1C5CH 2WK2A 3TFKD 4EBQH 3L3HB 2I9LB 4NZRH 2ICCA 4R8WL 3UTTB 1SJEA 3V4VH 4ODHL 3NZ8B 1NGYB 1PZUB 4S1QL 1R5IB 3SGJC 1KYOK 1T0MA 4DUVA 1XF2B 4PJIF 4TSBH 5F7WC 1QZ1A 2B2XL 4ZO6A 4MAYA 1ZV5A 1WT5A 1RZJL 1VGEH 1LD9B 4Y2DB 1IILE 1FLRH 1UKTA 2JB5H 2XWBA 4JKWA 2GJZB 1HDMA 1UB5B 3JXAA 3X14B 4ZNEA 1DQDH 2FEEL 5GRYA 3UTSA 1UA6H 4H25B 3JV4B 4RWYL 4RFOH 1DUZA 3N85L 1AE6L 3IU3A 3OJMB 1C08B 4KJQC 4J2XA 4D9QE 3NACH 5T1LD 2Y07H 5FM5M 1YPZF 3VXNA 4APQB 5D2LE 2J8HA 4NNXB 5I17A 1E4KC 1UM6L 1WIPA 5CAYB 5IW1B 1KIPA 3FO2A 4WNQB 3MOBL 2FATL 1T0NA 3HTLX 1JV5A 1KLGB 3MRIA 12E8H 2DLEA 1RUMH 4HIEB 4JRXE 2ARJQ 3HUJE 2ZG3A 4ONGL 4BJLA 1ADQA 1G7IB 1MVFA 4KTEH 4V1DE 1MFBL 1G6RL 1HSBB 5ESVA 4MDIA 4TULL 4Y19A 4PUBH 3LKNA 4JN2A 2QQKH 2ADGA 5HYSG 4L8SA 1MCRA 2IFFL 5I8EA 1BFTA 5CINL 2R9HC 4WUUB 1FN4A 2DQCL 3AMLA 2XFXA 4QRSB 3R8QA 4NC0B 5C9KA 4L4VB 4AL8H 5C09B 1B3JA 2FLBT 4Z7WE 4K94C 5F7HA 2NXYB 3QP3A 3QDMD 4JGJA 1FZJA 3C2AH 3P4MA 4DGYL 4PG9B 1CLYL 3AXLB 1Y0LB 4Y0GA 2PYEE 3ARGB 5DJCB 3K80A 3OAZH 1XMWA 4RX4A 4DFHA 2HKFH 3HI5H 4ODSL 3LV3A 3FFDB 1Y6MR 4XBEL 2LAGB 3ARYA 4UT9L 1NSNL 4G42A 1E4WH 1FNEB 3KPPB 4E42B 2YD1A 3LIZH 1RJYB 3NCJL 3CDGB 2YEZA 4DVBA 4LASH 3HR5B 3MMEA 3BH9B 1MIEH 5H94A 2XKNA 1JZ4A 4WW1B 2DQEL 1CFSB 3WJLA 1ZTXL 3S37X 4HLZG 1BZ7A 1RHHA 4YDJB 4OAWB 3MR9B 3RWIA 2C3VB 2X1QA 4UDUB 1UJ3A 3CFEB 3KPLB 3BPLC 5IROC 3MLWL 1FO0H 1XCQA 4GRWF 4MAUH 1DFBL 3HZMB 4JJHA 4H1LA 3MLTA 4M7ZC 5KSVB 4JKPH 4ELMB 3F7QA 3BD4A 3RWHB 4DZBB 2I60L 1AJ7L 3V6ZA 4OCYL 3O6LL 1A0QH 3WIIH 1NFDE 2APTA 2PXYC 1YEKH 1HWHB 4ZOBA 5F7EH 1GC1H 5DEFA 3DETD 2VC2L 4LLVB 2MFNA 3HE6B 5CD3A 4XB7A 3S7GA 2A0LD 1KJ2H 4R97C 3UYPA 1UENA 1FIGL 2LVEA 4Q9QL 1NAML 3TBWB 1RZKL 4MS8D 4K8RC 4OCXL 4WEBH 3NPZB 2H32H 4Q6IC 4S2SA 3PDDA 1OSZA 4XAWL 4YBLB 3VFRB 4FQ2L 2X42A 4WHCA 1EV2E 1KPRA 3U82B 4AMKL 3K1DA 4PJ5B 4DEPC 4M7KL 3QQ4B 4K94H 4G8FA 2EE3A 3JZ7A 3HE7C 1IGIH 1MIML 3OAUH 1S9XB 2G60L 4N8VB 2J8UE 4CJ0A 1DQML 2ARWA 2ID5A 4GMTL 5D7LE 3T2NH 3QO0A 4QNPE 1C16A 3IFNH 3WE6B 3TT3H 3DX6B 3FQUB 4X0KB 1WZMA 1T1XB 4WWID 3QAZC 5I71C 1CT8A 1FAKT 4F7MA 2R0WH 4TOYH 3VFWB 1DBML 5T1KB 1LNUB 4ZD3L 4UT6L 3FT3A 4NUGL 2OMNA 2IJ0C 1SY6H 3LZFL 1A9BA 1W72L 3QSKB 3FRUB 4JFYB 4F3FB 3MJ8B 5SV3A 3SDXB 4MX7A 4BZ1H 1R5WA 4NJ9H 4XCEB 3HRPA 2OBGA 4MJ6A 4A2LA 1UACH 4KI5C 2AAVA 5C08B 1AQDB 1FH5L 2A83B 5HD8C 5C0BE 1U8KB 4AT6A 3CH1B 3ARDC 3B83A 2D2OA 2EXYC 1H8SA 3RWEA 5HHME 1A9EB 4LHUD 4LK4A 2NY2D 2FGWL 3BEVB 4RISH 3ARED 3ESVF 3OF6D 4LSPH 4PIRF 5DHYB 5CZXC 5GGRA 4LL9A 1HH9B 2CK0H 2APXA 5DD6B 5B3JE 4PY8I 5E4IA 3S34L 4HIXH 4XNMB 4GT7A 4HUUB 2JCCF 1OB1B 2FX7H 3IJYB 1O7SA 4TVPE 3DROA 4YFLF 4WHTB 3KS0H 5INDB 3M1BA 4LARH 3I2CH 3U2SA 3GRWH 4F57H 2RCSH 4MMXC 3RDTC 1P7KB 43C9B 2IG2H 1CFTA 5FUZH 4Y19E 4EI5D 3OKLA 2G9HB 4MJIE 3HS0A 2NCMA 4JG0H 3FN3A 2ZCKL 2VLRD 4PRBA 4PJGF 1BECA 5T5NG 5IHBA 1QSFE 5MEQA 4I2XB 2HWZH 4LRNH 3S96B 1JNHA 4APQC 1B90A 1CDBA 4JM4H 5B39A 3F5WB 4AEEA 5J9PB 1KELL 3SJVB 1V05A 3AREA 1FHGA 4QRPB 2E7BA 3LN4A 1SEQL 3UO1H 1WBYA 4QXUL 3PGDB 1RZGB 2R2HA 3KPOA 5KVDH 1UWEH 4WFFD 4JRYD 1MOEA 1ULVA 4JR9H 4OZGA 4WU7A 2A6IB 2RFXA 4KKCD 1RJLA 4D9RD 4LHQB 5D1QB 5JO5B 1NGWA 5DWUL 2F74B 4H20L 5CGYD 5TDPB 5CEXB 4F8QA 1FG2B 4NN5B 1KNOB 4PJ7E 2DQJL 5SWSD 3RVUC 1JGLL 1IL1B 4QHKI 4DKFL 3SDDD 4EI5A 2NXYC 5GGVY 3ZZ1A 4JLRB 5HY9B 2XPGA 4J3UA 3MC0A 4JPWL 2BVYA 1GJIA 5ABDE 3MFFA 4IMKA 5EBMA 1U8HB 3HI1A 3B3IA 3O8XB 4GRLD 3ARGC 4XC1H 3DTXB 1QFWL 5KSUB 4WHDA 5GGQL 1LEKB 4HPOH 3KPRD 5CP3A 4PTTA 4G3YL 2EECA 1MI5E 5C0NC 5LGKA 4NHCH 4X80L 1A6UL 1ZK9A 5E03A 1BJ1H 4GKNB 2IQAA 1Q94B 2WQRA 3I6GB 3MV9E 4LKCB 5JW4N 2UZIL 4G6KL 4Z95H 4X7SL 3CXHJ 3V6BR 1VADB 2YPLB 5K9KA 3DHJA 4ZUUA 5CCKL 4I8DA 1A3QA 4GXUN 3REVA 4Y8DC 4OQTA 4G5ZH 2DQGL 3WDHA 2YRZA 5ICYA 3QPQC 4OCLC 5ERWA 2H8PB 1JL8A 3E3QE 2CLRA 1JHTB 4W4OC 4ZFFA 4XPBH 3UYRL 4H26A 3SDDA 5DLML 2QL1A 4IRSD 5EZOL 4HUXB 4M6NH 2HTKC 2JB6A 1BHGA 4HC1H 2DKMA 3K8MA 3VFNA 5DD5L 2VIRA 1TDQA 4JFZL 5C6TH 5CILH 5T3ZD 5LBSL 5IHZA 5MP6H 4GRLA 4Y5VA 1JHLH 1NCDL 5I1KH 15C8H 2OYPA 4DUWA 1NBVL 4MQSB 5IFJB 2VN7A 3O45A 1KCRH 2ARJB 3LCYA 4NO2A 4OZFB 4AH2A 2BY0A 4KMTH 1MNUH 3WJJC 4JQVC 1X5XA 2R4SL 3MODL 5D9SB 1U8LA 3QWOA 3C5JB 1IC5H 2E9BA 4NBYB 4WCYL 4YBLC 5FEBA 5CP7A 3KPSD 2OXHA 4OKVB 2CDEB 3MYJB 1INQA 1K4CB 3CC5A 3VH8B 3SE4A 1EEZB 2IQ9L 1F6LL 5EOCL 2MOVA 5FV1L 5A2LH 3HLAA 3RWFA 4F2MA 2YHGA 3MRQA 5DMJB 3VXOA 1VEOA 4OI9A 2XRAL 3ZDYF 3GSVA 3Q6FA 3L3GA 2BDNL 3BSZL 5A2JH 5J11B 4JHBA 4U1IB 5I1GH 4OZHE 4DGVH 1FVDA 4DZ8A 1HCVA 1LEIA 4OGZA 4NO5B 5SX5H 4PGCA 3TPUA 4BUHA 4H5SA 4BFGA 2NTFB 3DURB 4Z9KB 4LVEA 5TF1H 1G6RA 4TTDC 4OGXL 1NQBA 3H9YA 3MCKB 5KVEH 2EDRA 2FSEB 2VL5B 3CFIC 2H1PH 5C6PB 2CMRL 2WLZA 5CJQL 3OKNA 3DRQA 4I18B 4U6TA 2MWCA 5F96L 2NY6D 3KLHD 1B2WL 5DFVC 3Q5OA 1N5AA 1C1EH 1DL7H 3D85A 5F7MC 4I0PD 1KB5B 1B0RB 4XNZB 3KPSA 4HJJH 4XI5D 3L3IB 2A9ML 1IKFL 1AGCB 1G7JB 1U91B 4HZLA 3MX0A 5IUSA 4Y5XB 1PQZB 5L88H 1L7IH 3DO7A 4L4TB 4KTYA 4WTZG 5E56A 2GHWB 5JNYA 1HIMH 5DJ0B 5A16A 4LVHB 5TQ0L 2X4PA 2EKSA 3IRZA 4M3KB 4XZUB 1N3NB 2DF3A 2XQYK 3PIQA 3PABB 3C8DA 3MACL 2HH0L 1N5YH 4HIIA 9CGTA 3W0WE 3NH7H 4P5TD 3CPLB 2DWDB 3D3VB 5EO9B 5GRWA 5J1AB 5JQ6H 2I25N 3EYFA 2AVGA 4HDIA 1LO2L 5F7LB 3FO9A 5BV7B 2E9IA 5I6XB 1A47A 1EBAA 1J0JA 4D0CA 5DDHA 3RAJL 4GW4B 4M48L 2Y7QA 3PDOB 3G5ZB 4KWUA 1QQDB 2IPKB 3U48A 1FJ1B 1I8IA 4U1MA 1ZHLA 5DK0B 5HHVH 1M1SA 2VLLA 4E41B 4K3GA 3LS4H 4BK4A 4F7PB 2D03H 4OZGE 3VXSA 1HXMA 4X5WA 4NRXB 1OW0C 1GL4B 4I0PA 4Y4KA 4MD4A 5DUPH 1AO7E 2Q8AH 1SBSH 2WMPA 4JO2L 1YEEL 3A6BL 2E7CA 3O2DH 4ZUTA 4YHNB 3W9EB 5HYQA 1ZEAH 4G9DB 4DN4L 1YEHL 3CLEH 5AWNH 4ENEC 2EE6A 3SPVA 2NW2B 1I1CA 3OPZH 3GSUB 3HCVB 2JIXD 1H3VA 5D72H 3VD7A 4FFWD 4U7KA 1NAMA 1MCDA 1YMHB 4CMMB 5EWIL 2Z4QA 4ZO8A 5CSZA 4HWBL 5EC1A 1FE8L 5D1QC 1UZ8B 1GCFA 4YXLH 2E7LC 5L7XH 4NN5C 1VFUA 2VZOA 4M5ZH 4YHKL 4AEHH 4LCUB 5FKAA 1K8IA 1JNLL 5EUOF 4HKJB 3SGDH 3C5ZD 2QSCH 2OJZH 5JDSB 4QTIL 4OLEA 3O8XC 1R5VB 2VXUL 3HNSH 2V2WB 4N9GB 4GSDL 2ICES 6FABL 2EIDA 3P73A 3S36L 4I1NB 3O11B 2NY4D 2JIXA 4HSQA 5FUOH 1W72A 3F7RA 1Z0NA 4OM1L 2JJVA 1UWGH 3JWOC 4FXKA 4NKOB 5DUBB 5C0FB 1IAII 4U2ZA 1RVFH 2R2BB 3JV5A 1NMAH 2EH7H 2DBJA 4H88L 3MUGB 3EFFB 5GRXG 5IHUH 5JA8B 3KLSA 1MFEL 3F62A 1IAKA 3KPNB 1MCWW 2IFGA 4JAMB 5C0GA 4WI7A 2X70A 3L5XL 4LSUL 2VLJB 5F6HI 4K71B 4KI5F 1S7WB 4X6DF 2V6HA 1N4XL 2X89D 1MFAL 1VKXB 3MLVL 2O26U 2FBJL 2VDML 3V0VA 2XG5A 5CIPB 1QSED 4IRZL 5HDQL 2YUZA 4OLVH 3B9AA 4XNYL 3QYCA 4YHIB 5CLTA 2W9LA 1BJ8A 5JZ7D 3IDMB 1FFRA 2JJTC 5EIIA 3V6FB 5CJXC 2Q7YB 2AV7B 3CGTA 2IBGA 1DVFD 5L9DH 3TYFA 3T8XA 1UH4A 5KVFH 5EN2A 1S9VB 1VESA 2JKXA 3NFNA 4JO4H 3RJQB 2W0FB 1HILB 3VXQB 3MRFA 1BD2B 4XP1L 4KMLB 5J57B 5BS0B 4OCRL 5FB8B 3IDIA 1JWMB 3S4SG 2VXQL 2L7JA 4FQJL 2R29L 4U2YA 2V2TA 1JN6B 1RUPL 3EZ8A 3LEVL 1T1WA 4HJGA 5FO9A 3VFSB 1WISA 5I1DB 4P5KB 4S0SD 4LSQH 5F7YC 1AGDB 3KPMB 3THML 4NUJA 5F7NC 3BP6A 5J11C 3DVNB 1GHFL 1URLA 2CKBL 1C7SA 5JUEH 3DVIA 2OL3A 1QSEA 5F71A 3SKMA 4UNVA 4QXWA 3V52H 3GHBH 4JZJB 3JTTB 3JWOH 3DGCR 1MY5A 5JA9A 1KENL 4AK1A 3UBXG 4NWTL 3QNZB 1CWVA 4LOUC 2QQLL 4FN0A 1KT2A 2N7AA 2PW1A 5FO8A 5IESL 5DXWA 5IMOA 3U1SL 1DVFA 3MRNB 1ZLUH 1DLFH 1IZJA 5J8OA 4I18C 1BZQK 4QRTA 2UWEA 2V5YA 5A40E 3UAJC 2IAND 3L95A 1H0DB 2ZKHH 5KS9E 3P77A 4U1SB 3RKDC 5TH2B 4KAQL 1D5BA 1GGIH 3O3DB 4XNZC 1FYTD 4RQQA 5HI4C 5T1MB 1F3DH 1MREL 3WDIA 1EGJL 3M17A 4MSWB 1R3LB 5FOJA 1VFAB 1BVZA 4LEXH 1GIGH 1R3JB 1Q0YH 5CJOL 2ADJB 1A6WH 3MRGB 3QXAB 3VXSE 4LVHC 2WV3A 1TZIB 5ITBH 1I1AB 5E5MB 4PJHA 3TESA 1X5KA 2Z92B 2HVJA 1CXIA 2LU4A 5BO1H 4CRPA 5FUCC 1NCCH 3TJHC 4OZFH 4P3DB 3P4LA 3BN9C 4YX2L 2R1WA 4HXBL 3UZVB 5BV7C 5I6XC 2ADFL 4I77H 4A6YA 1UB6B 5CUSH 2WBJA 4TUOB 3BYTA 5JIIA 1JF6A 1MUJA 5J0BA 4PR5B 4P46B 1K5NB 4XH2A 3VG0L 5ID0A 2ZPKH 4FABL 4OUUB 2GY5A 5GZNC 5CZKA 2X9XA 4S1SL 4CNIB 3DYPA 4XWOD 1N59A 3O9WB 1IM9D 4KROD 1FYTA 43CAA 4N8VG 4OT1H 1NUDA 4BZ2L 2P42B 5LVEA 2NX5A 2AJSH 4HGWB 4ELMF 5IB1B 2W1NA 3QEQD 3ZKMC 4I9WD 5C3LD 1ZOXA 3F7PC 4U7SA 3CXDL 3Q0HA 2BMKB 3C60D 2VLMD 3GM0A 3GSNL 3MCLL 4D0DA 5M7QA 3GHEH 5D1XD 1MH5A 5F3BA 2ENYA 2ZCHH 3MBXH 1LE5B 2ESVD 4M43H 1FBIL 3T0BA 5M95B 2PO6B 3IDJB 3RZWA 2BNQD 5LQBL 4ZFOB 5D4QA 1M6OA 4PJCA 3VWJB 4KVCH 1Y6NR 5BZWB 1KB5H 4E5XB 5GS1B 1TJHH 3MRCB 3CAFA 4XX1G 5JW5B 5IBLD 1IGMH 5D2LB 3Q1SH 4RCAA 4U6HA 2Q3ZA 5B38B 3RIFK 1VFOA 2LQRA 5C0CB 1YN6A 4HGKC 5IKCA 1A21A 3ULVD 4PRPA 4JY4A 2FIRT 4WWKA 4N0FA 5GGVH 5FCUH 5HYJE 3KDMB 1ZLVH 2VR4A 3L3OA 4N0YL 1IM9A 5FM8A 3HUJB 3PWJB 5GISH 1I7TA 3LPWA 4OGAC 3DXAB 35C8L 4NPYB 4V1DB 1WFOA 3BRDA 5DMKA 3BP4B 3DBXA 1T5WA 1TPXB 2Q7NA 1HINL 2AI0H 3N1MC 4HX1B 4NQXA 1JK8A 2Y36L 5BZDA 5D6CB 5EG6C 7CGTA 5BV7H 1BM3H 1FZKA 3L9RA 4LPCA 4BA8A 3FCTA 1G84A 4LLMB 4YHLL 3EOTH 1ZE3C 1GGCL 4JO1H 4KJPC 3RA7H 2Q76A 1QA9A 4DKDC 2MPAH 4FQCL 5HVHB 3OXSA 2BNQA 1U93B 5KSAD 2IMNA 3WS3A 1A2YA 2HLAB 1G1YA 4XVUD 2K9UA 3DMMD 3SDXF 1HNFA 4JHWL 5AEAA 1OTUD 2WINB 4F7TB 4YFEA 4KJWD 1QPPA 5HGBA 2IAMD 4K71C 2N56A 3V4UL 1EO8H 1QRKA 2XNAB 3D69B 4XXCA 3DUHA 4FZ8H 4ODBD 1FL5A 3IDNB 1OGAB 4ETYA 5C7XH 3ZLQC 1NCAH 3TNMB 1X5GA 3WL9B 1WF5A 1B4JH 1T6WA 3DARA 4M93C 5CZVH 1A1OA 3GMNB 2CJUH 1BVLA 3PP4L 2DMKA 3JWDC 4PTUB 5FF6B 4YXHL 4QRRE 3RIAK 1YEDA 2OZ4A 3GIZL 3WO4B 3EYVB 5D5ME 5LAXB 2XKUA 3B5GA 4LQ1A 1JNNH 1ZGLA 5LXGH 3NZHH 2CLVB 2IALA 4C4KT 2BOCB 4Z7UE 5F7DB 1DE4A 1V7NH 4HH9A 5E94B 5D7JB 3TVMC 1YPZA 1I7RA 3LN5A 3BEWA 3DV4B 3V7AE 1OM3L 5KSAA 1MEXL 2VDQL 5C0AD 3MRRA 3WNPA 3VXTA 4OJFH 2EDYA 3P0VH 3D2UB 3LKSA 4LCWD 3P4NA 4CADB 4P9HC 1NGQH 5C07A 1CD0A 4WGWB 1R0AH 1JRHH 2ORBH 2VSDA 5KG9B 5ISZD 1CICB 1ACYH 2ADIA 2XT1B 3RP1A 5IMKA 3Q6GL 5E8NB 1X6NA 2UUDH 4RBPH 3W11C 3G5YA 3GNML 4ZOEA 4UNUA 3LHPL 4JZJC 1RIHL 1GH7A 3FB7B 4LSDA 1AGBB 4JKLA 3UZQA 1BX2A 4QWWC 4NIKB 3C5SB 3H7BA 25C8H 5CEZH 1IT9L 5E6IB 5J3HD 4KHXH 3FB5A 2KDGA 4L8BA 3GSXB 5C71A 5F1IB 3SCMB 3MNVB 3EYQC 4PJXF 2J8UB 3WFBL 4C4KO 2DS4A 4AM0A 4M61A 3QUXB 1P7HL 1IFHH 4RGOL 2X1OA 2NNAB 4NO3B 1ZT7B 5ESQA 3FQTA 4ZUSB 4K2UL 2AXJA 3HI6H 4UV4H 4JHZA 3RVXC 1DQJB 5C0AA 3LH2H 3WN5B 1NC4A 4FQ1H 5TPWL 2P5WD 2SEBB 3SE3A 4LCWA 2QKIA 4LSRH 5KANG 3H9SB 1C12B 3QJHB 4DW2L 4AQ1B 2BY1A 3MLXL 1I1AC 2G5BA 1WICA 2FRGP 2NX5E 2P5EE 4LCYA 5ISZA 1JJUA 1SJEB 1HHJA 1EMTL 1T0MB 3LMJH 4WFHD 4ZYKA 3LD8C 4W81A 4MAYB 4O9HH 4OZFG 4NRZA 1T5XB 2XWBB 3LQZA 1BAFH 1HDMB 4NWUL 3PUCA 4LCIH 3UTSB 3W81A 1DUZB 4HHAA 4LVNB 3G08A 2OCFD 4P46C 3VH8G 3IU3B 3ARFC 5FHBH 4QGYA 2WSKA 1MJ8L 1U95A 3VGEA 5FYJL 1WSST 2YC1A 5FAAA 1CK0L 1BEYL 4LLYA 4P9HH 4XWGL 3UC0L 3VXNB 4G8EA 2W07A 3FO0L 5I17B 3GKWH 3LDBB 1KIPB 3FO2B 5J6HA 1RIUL 1T0NB 4JE4B 1JV5B 3MRIB 3KXFA 1BQHA 5HTSA 5CSGA 5INCA 1BIHA 4XTRD 2E9WA 3OB8A 4LCCA 1EUUA 2M26A 5ESVB 4MDIB 1RURH 4Y19B 3FT4A 2PO6C 3LKNB 4JN2B 4U1HA 4L8SB 5I8EB 1FN4B 5GS1C 2D31A 2XFXB 2LFGA 1QR1A 3V5KA 3TBTA 3EJYD 4BQ8A 2Y06H 2Z91A 4K7PX 4RIRA 1HEZA 1MRFL 2NY7L 4FRWA 5TE7H 3VD5A 5GSRA 1FZJB 3P4MB 4WIQA 3QHFH 5GGRY 2CKBA 1YA5A 3W39A 4Y7MA 1NC2A 1DQQA 4JFDA 4QYOA 2B0SL 4ALAH 3P0GB 3LV3B 4NCC1 1TPXC 5JMOC 4G42B 5DMYA 2AJUL 3LRGA 4DVBB 4XPHL 2YEZB 3MMEB 4NC2B 4PJFA 3VXRD 5H94B 2XKNB 3B43A 3BOVA 5IBTH 2FJGA 2VH5H 1PBYA 3BHBA 5AYUH 1BZ7B 1RHHB 1DN2A 2AGJH 5HVHC 1J1PL 4OF8A 4PJBE 4PLOB 3RWIB 1UJ3B 1OQOA 3P40A 5IFHL 2IH3A 1SYVA 4UBDD 1EGJA 2E27L 4NJAL 1XCQB 3BMVA 2P1YA 2VDOH 2APWA 1FGVL 4FQLH 3MLTB 4H1LB 3SO3C 1XAUA 2Y9RT 4EOWL 4CMHB 4P4KD 4BFIA 4I3GA 3VGFA 4GAJL 4FTVE 3V6ZB 2AP2A 4G8IA 4MDJA 5I76A 4IDJH 5DEFB 2VLKE 3FFCE 3B2UC 3V8CA 4ZTPL 1G7PA 1F11A 4DVRL 5CD3B 4KTDL 1BMGA 1EA9C 1P6AB 5ANME 2H2SC 2FNBA 3HG1D 1KXTB 1ES0A 2C4XA 3P3YA 1LO5A 1YEJH 2CLZA 4WENB 5F9WC 1WZLA 2OMBA 1G7QA 3BKYH 1Z6JT 2HT2D 3QA3A 4S2SB 5ITFB 5JW3L 1FYHB 1NJ9A 1OSZB 2VDNH 4B7LA 1KPRB 4KDWA 4Y16D 1F02I 5D7IA 3KYKH 4YZFE 5HYFA 1Z5LA 1A1NA 3G6AA 4G8FB 5D7JC 5GJSL 1EFXA 2J5LC 1AKJD 1VFBA 3SKJL 3QCTH 2P46B 1JGDA 4RA3A 4JCLA 1HZHH 3QO0B 4GG6E 1C16B 5GHWH 5JQHC 1CU4H 5GRVK 1KBGH 4G43A 1MCIA 3ZYJA 1N7MH 4OLUL 1CT8B 4F7MB 3FN0L 4L9LA 3GSNA 4FHBD 4XP4L 2J7LA 3QDGD 4Z0XA 2R69H 1OARH 4CVZA 4EN3A 1S9YA 4X8JA 3FT3B 4M7LH 1QKZL 5IJKC 1A9BB 3PHQA 3VE0A 1JF1A 3PL6C 1SEBA 3KYNA 3HG1A 3ULUE 3UJTL 3HMWL 4GW1A 4ZTOL 5E6IC 3BI9X 4LP4A 5F9OL 1RJCA 1A7NL 1DUYA 4MX7B 3RNQA 3TWCH 2J2ZA 5DZLA 1R5WB 1QBLL 5KJRL 1NBYA 3LQAC 4MJ6B 4G6JH 3QUXC 4N1CA 4D9LH 1TJIH 4Y16A 1AQKH 4DJMA 2NY5H 3B2VL 2AEWA 4G6AD 3RBGA 4AT6B 4YDVA 2N1KA 2DYPD 3RWEB 1OAQL 2BJMH 2XICA 2R1XA 5E2WL 1AKJA 1PX4A 5E9DE 3UROR 2EDEA 2EYRA 5GRUH 2R4RL 3WN5C 3QUKA 1R24A 4YHZL 3ZDXE 5FM4A 1ZKAA 1X5FA 4KUZL 4P3CH 4UOW0 5BXFA 1YEIH 5GGRB 5T3XL 4OZIA 4Z7NE 2HP4A 3MUY1 4GMSH 3TV3L 2K3TA 4FP8H 1ZT1A 5E6YA 4NQDD 4MZ2A 3QDGA 2V5RA 3RNKA 3DROB 3KXFE 2AXHA 4MAYC 1L0XA 3M1BB 4DOHE 1C5BL 4MA3A 5A1AA 5E4EC 4KJQD 3U2SB 3NPSB 3OKMA 3HA0A 1CFTB 4LVNC 3U9UA 3K46A 3OKLB 4BKLA 5FGSA 3HS0B 1B6DA 3T65A 5DSCA 1TVBA 4PRBB 5IG7A 4NN6B 5MEQB 4X8XA 5EU7E 2X1PA 3R06A 2IMMA 4O2CA 4LAQL 4XBPA 1JNHB 3G6JA 1I75A 2EH8H 3DSFH 4G7VL 2P47B 4NHUB 2DYPA 3LDBC 5B39B 4YGVA 1J1OL 2VZ3A 1AC0A 4Q0XL 4MD5A 1K4DA 4JFEE 3WS6A 32C2A 3CX2A 4YUEH 3AREB 5E5RB 5D2NA 3LN4B 4MB4A 4BFBD 3F8UB 1T7WA 2D0FA 5DI8A 1WBYB 4FFVC 3S3SA 3UP1A 4JFDE 2XA3A 2R2HB 1WIUA 3KPOB 5EA0H 1L4IA 3QXUA 4NQDA 5GRVL 3A0OA 4RZCA 4OZGB 1WFUA 4WU7B 3MBEA 3EOAA 2RFXB 1RJLB 4GO6B 1NGWB 4PJFE 2V9QA 2FD6H 3KYOA 5D93C 4FQQA 1NANH 3NA9L 3JTSA 1QPXA 3PWUA 1I1FA 1P5UA 1A4JA 3CFDA 4DQOH 2BRQA 2DQUH 4XPTL 4EI5B 1H3PH 5AG9A 1TZGL 3K4ZA 1D6VH 2XPGB 1BPVA 3BT2H 4OM0L 1G9ML 3N9GH 5JW4Q 5FDWA 4DK6A 3MFFB 5EBMB 5EU4A 3HI1B 5ILTL 3B3IB 3RX5A 4WEMB 1AD0A 4QLRA 1T20B 3WMSA 4KQ3L 5E8DL 5I73B 2W91A 4PTTB 4JGUA 4BELD 3BUTA 5DRZA 2YZ8A 4GLRI 1F4XH 2IQAB 3OB0H 2H45A 4Y4HC 1W2KT 4R7NA 3NIGF 3U7YH 1U8MA 4H8WC 1MCFA 2YKLH 3RZCC 5K9KB 1UJ3C 4ZUUB 3B5HA 4OTXL 3REVB 1RUKH 4L3EE 3IJSA 4P23C 1WQVT 5ICYB 2DBLL 5ERWB 5KVGL 3ZT5A 5JOPE 2CLRB 1NKRA 2PXYD 5CKGA 4ZFFB 5DJDA 2F8XC 4H26B 2QJDA 3FB8A 5E8OA 4CMHC 1N6QL 3VMPA 3SDDB 3SE8H 5D96B 4UIMA 5E1HB 1HXYA 2JB6B 1KCUH 2ZCLH 3D39D 1XCTA 3VFNB 1PZ5A 3R0MA 4QRUA 2D9QB 2VIRB 5I15L 1E4XL 1FQ9C 2XZQH 2E8YA 5IHZB 1LDPL 4GRLB 5IVXA 4Y5VB 1EHAA 1NMCB 2OI9B 1MLBA 4K8RD 5DT1L 4FFZH 3O45B 5EOTA 4NO2B 4AH2B 1P7QA 3ECBA 4OKDA 3H3PL 1N0XL 1OF2A 1U8LB 3QWOB 4HF5L 3HE7D 5CP7B 4Y1AE 3DSNA 1INQB 2F9BT 3E3QC 5HDBF 4JCMA 3CC5B 1QSZA 3GMOA 4PJAF 4F2MB 3HLAB 3RWFB 5B38G 3MRQB 3VXOB 3GSVB 5BVPH 2R0ZH 3WYRA 1LP9F 3Q6FB 3L3GB 4QTHA 5B21A 1DN0A 5DD3H 3M07A 2FH8A 4N90E 1FVDB 3IDUA 5IWLA 4DZ8B 2DQTL 2NW3A 2Q8BL 1LEIB 3HNVL 4OLXL 4BSVA 3TPUB 4PGCB 4JDVA 5I8KH 5C0IA 4MQ7A 4H5SB 1CL7L 1N2RA 1PSKL 1G6RB 3E0GA 4LU5H 4F7EA 4J6RL 1YNLL 1KCVH 4KK5D 1VERA 2OK0H 5HGAA 2R0KH 1INDL 4CU7A 4F33A 3OKNB 3DRQB 4NNPL 2E7HA 3OSKA 4NP4H 1NLDH 1MCEA 5I19L 4KI5D 3C08H 3BPNC 3PV7A 5HD8D 2IC2A 4PY7A 1N5AB 3D85B 5D7SL 2VXVL 3ARDD 4MXWL 3KPSB 4H1LH 4WFGE 4HZLB 3MRPA 3KHQA 3DUUA 5D2LF 4LFHD 5IMLA 3LPGA 3PWLA 3DO7B 3P0YH 1RZFH 5CZXD 3IYLW 1HHHA 5TJWK 5JNYB 5A16B 2DN7A 1KOAA 2X4PB 3EO0A 3UTTD 3ALPA 5DA4A 2EKSB 4I0CC 3GI8H 3PIQB 2HKHL 3HUJF 2VB5A 5FYLD 3AB0B 4HIIB 1ZA3A 2YA0A 5TE6L 1PD6A 1W8NA 4XP5H 1II4E 5GS3A 4HMEA 2DJ4A 3EYFB 4HDIB 4CDGC 3D9AL 3EBAA 3FO9B 1QNZH 3RDTD 4O02H 1WC7A 3VDAA 2EDJA 1GOFA 1T7VA 3U4AA 5DDHB 2YSSA 3CX5J 2CGRL 1CDJA 3HNTH 2DQDH 2Y7QB 3MLZL 1GAFH 4YEFA 3LKPA 4U1MB 1I8IB 3NPSC 4JZOA 1ZHLB 3QDJA 2VLLB 1Q72H 1T2QH 3G6DH 3HRZA 4UTAH 4ZFGL 4OD3H 4XCNA 4HUKB 4APQD 1HXMB 1UH2A 4X5WB 4X5XA 5IQ7H 3BAEH 3FO1A 4I0PB 2MQ0A 1QR4A 2IEPA 4NN6C 4Y4KB 5JOFB 1HHKA 4MD4B 5T5FH 2R0LH 1UADC 4HK0A 4ZUTB 5HYQB 1MRCH 3A67H 4TVSa 1VSCA 4X98A 3SPVB 1EEYA 4Q9RH 1UZ6F 3ARBD 3AREC 4L3AA 1PY9A 4MQTB 3WNLA 3GMQA 1P4LA 3RKPA 4XC3L 4ESKA 2OQJA 4NZTL 1NAMB 2VYRE 2Z4QB 3DGGA 3GBML 4WUUD 5I18H 5CSZB 4P2QD 5F9JA 1FSKB 5MEOA 4PRIE 4MD0A 5EC1B 4S1RL 2NXYD 1A3LH 3L5WA 2DLFH 2DQIH 4JO3H 1TETH 1TJGL 4NQVA 3GKZA 1OP3K 2VUOA 3BDYL 4EI5C 3IFLH 1LWRA 5FKAB 1K8IB 4XP6L 4JRYE 3ARGD 3FAWA 1I9EA 1NFDF 3Q2CA 4UDTA 1KN4H 4WI5A 3UPCA 5C0ND 1FDLL 4EQ2A 3BFOA 5E95B 1QUNA 1AXTL 2E6PA 1LE9A 5SWSE 1WBXA 2X4NA 1TENA 3P73B 2UVEA 5I73C 2WWMC 1JGVL 2R8SH 2JIXB 5FGBA 3S37H 1W72B 3ARBA 3AS0A 1H9VA 2W9DH 1FRGL 2D9CA 4FXKB 4EVNA 2WP3T 5AD0A 5TF0A 1VA9A 4PFEA 2A77H 5C8JA 2N7BA 5C70A 3QPQD 1Q0XH 1IAKB 1LO4L 1F97A 3ARVA 4TNVK 5DJZA 5E24E 4P2QA 2VXTL 5C0GB 1A7QH 2J8UF 2X70B 4KZDL 3CVHL 2AEPH 1TFHA 2HTKD 2BRRL 1JPSL 4QNPF 5EU5A 1R3IL 1E28A 5FYJE 3QCUH 3AGVA 3V0VB 5GIRA 5D96C 5IW6A 3C5ZB 3STZA 5HHOE 3WV0A 5ADOL 5EIIB 2HFGL 1P84J 3QO1A 2J12B 3UDWC 2PUQT 1NMCC 2OI9C 2C3HA 4UOW1 4HG4J 5JTWA 4UV7H 3CVIH 4IRJA 3TYFB 2XQBH 2HFFA 1ZHBA 2X9WA 1RZJC 4OCMC 5EN2B 2BXZA 2NY4B 3TO2A 4X4YA 2O5XH 3NFNB 5D71H 2WP3O 3RFZC 3ES6A 3MRFB 2Q1EA 4IIQC 5DR5L 4M1DL 3QHZL 3IDIB 2BFVL 3ZHKA 5BRZE 1CF8L 4OD2A 5EDXA 1ED3A 1JHKH 2EC8A 4UZGA 4W4OA 2V2TB 4ZSOE 3VD4A 1T03H 3WHE0 4HJGB 1T1WB 1X7QA 1U8QA 2X4OA 1HHIB 5FO9B 4XPFL 5DURD 4ODTL 3KNBA 1UKSA 5DZOA 5T1KD 4ZMAT 4NUJB 1BJ1J 3BP6B 1MVUA 5CGTA 3ULSA 5B3JF 4TTDD 1KCKA 2OL3B 5F7UA 5I2IA 3X3GL 1QSEB 1JYVA 2PR4L 4LNVA 3SKMB 3QZWA 1L0QA 3IVKA 3ZKSD 4HPYH 5DFVD 3WJJA 4JQVA 4OLZL 1KT2B 4HWZA 2PW1B 2KKQA 4M5YH 2GKIA 2B39A 5FO8B 5IMOB 2DOCA 1DVFB 3U9PL 4QRTB 2UWEB 3L1OH 4MZ3A 4XVJL 2X9YA 3EJZC 5C08D 3L95B 1HKFA 3P77B 2F19H 3T0WA 3I9GL 3C09B 1D5BB 3LKRA 4D3CL 1WWAX 3BZFA 4RQQB 3VI3E 3OXRA 3MLSL 2I5YH 3MRJA 1KTLA 4MNQD 3L6FA 3M17B 4WGVB 2DJUA 3D1MC 4H1LG 2V5SA 2B8OT 1AHWA 5LGJA 3VGBA 2QSVA 1FP5A 5CS7A 3UX9B 4XHJC 5DHVA 5E1AA 3AROA 4R8WH 1H15A 3M8OL 2ZG2A 4S1QH 4PJHB 5C0EA 4KDVA 3AB0C 1T04A 2HVJB 3N0PB 4OUOA 1AGEA 1KC5L 2DRUA 5B22A 2CSPA 2R1WB 3VXPA 2BHUA 5DS8A 3P9WB 5CLWA 5E2UH 4A6YB 3VGDA 3WCYA 1CD8A 2H3NA 1PAMA 2WBJB 1IC7H 1CBVL 4N8PA 1EEUA 3HC3L 1MUJB 4PJ7F 4NQED 4XH2B 4KU1A 5ID0B 1CGSL 2FX8L 4LIQE 1J1XL 1IZKA 3ZYOA 5I8OL 4HWNA 2B20A 1CDHA 1N59B 2ILLA 1FYTB 43CAB 4ENED 3OAZK 4Y4KC 3MOBH 4MXQC 1DQLL 5FYKL 3BP5A 2NX5B 1T6VN 4I5BA 4MNQA 4CVWA 2D7TH 1I9IL 1ZHKA 4QRPD 2EZ0C 1K2DA 5EO1A 4PB0H 1TTFA 3ILQD 2RHEA 4NNYA 1CDYA 3ARZA 1MCWM 2FR4A 1MFBH 2Z31A 1G6RH 3OKEA 3VFOA 5T3ZH 4D0DB 4TULH 5IT2L 2XZZA 1MH5B 1NL0L 2MKLC 5F3BB 3ARWA 5T33L 4TTGA 1IKNA 1J88A 3VG9B 4EBQL 3IFOA 4NZRL 1ZLSL 3NIDE 3CSPA 2VDRH 1RZKC 1WTLA 2VAAA 4IJ3B 2QLVB 1M6OB 3QWRA 4PJCB 1JNJA 3RTQA 2I07A 1FSKC 3O2WH 4HXAH 3GO1H 1VGEL 3VXMD 1FLRL 1NFIA 2JB5L 5H2BA 1OW0A 2ITCA 1BGXH 4U6HB 4NQEA 1UA6L 4RFOL 1YN6B 3GIVA 4MA7L 4YXKH 5IKCB 4PRPB 4JY4B 3O8XD 4BZYA 2V7HA 3Q48A 1X44A 3OX8A 4KKLD 3L3OB 1IM9B 4KROB 4CJ1A 1I8LA 3NACL 3PP3H 1I7TB 2Y07L 4UT9H 1NSNH 1ZXQA 1H3WM 3TZVD 1IGCL 5DMKB 1INEL 2ZSWA 2UYLA 3DBXB 1T5WB 3NCJH 4IHOA 2NY1B 5KW9H 1K3ZA 4NQXB 1JK8B 5BZDB 3VMNA 4XNUL 4U0QB 5DF0A 5SWZA 2DQEH 3ALXA 5T3XE 3U6RA 1MHCA 12E8L 1FZKB 3CMGA 4P59H 3L9RB 3MREA 4FA8A 3FCTB 4KTEL 4PJXA 2Q76B 3KJ4B 1QA9B 1IAIH 4PYGA 3U0WL 4RMRA 5JHLH 2VTFA 4DKEH 1H3TA 4M62H 4PJ8A 2VISB 1F3JA 3MLWH 3OXSB 2BNQB 1ZHNA 3WS3B 1A2YB 2QQKL 3VXMA 3NTCH 1WUNT 5HGBB 3WSQH 3K3QA 2I60H 1AJ7H 1KUMA 2WUCL 4HKZA 4RMUA 2HT4D 4HUNB 4OZHF 3GJFA 3U0TA 1FL5B 5E70A 4XCCH 5B39G 1QRNE 1KTDA 2X09A 3BDBA 4LHUG 4LSSL 4RRPA 3C2AL 5KTEL 1A1OB 4Q6YA 1BVLB 3TZVA 1S5HA 2RB8A 3H3KA 4Z7VE 1FIGH 2HKFL 4Q9QH 1MJJA 1NAMH 4QY8A 4NM4L 1YEDB 2KPNA 4FQ2H 2NY4C 1Z2KA 3LIZL 2FO4A 2ZOKA 3PE9A 5JDJA 1ZGLB 3HAEA 4M7KH 4LASL 1GGUA 3IXTA 4JG1H 1MIEL 1CG9A 1KXVC 2IALB 2BX5A 1MIMH 1DE4B 4PGDA 2DTMH 3QIUC 1YPZB 1I7RB 3LN5B 3BEWB 5KSAB 4Z5RA 5JW4R 1B4RA 3MRRB 3DMMB 3VXTB 1FO0L 3LKSB 5DZNA 1KSRA 4MAUL 2OR9L 4X7FC 3P4NB 4JKPL 4N9OB 3BPOB 2APBA 5C07B 4LSVH 4RMQA 3U36A 4ZD3H 2ADIB 2JJTA 5IMKB 4XNQA 4NUGH 4G80A 4LOUD 2K7PA 1H8OA 3PWPA 3LZFH 2BY3A 2ITDA 3DI3B 3WIIL 5C0JA 1W72H 5F7EL 1WBZA 1GC1L 1AD9A 3G5YB 1K85A 5L0QB 3EKCA 3BZ4A 3UAJD 2Z9TA 2VN4A 3RKDD 2QQQA 2E6QA 2QQNL 3H7BB 4D0BA 1IQDA 1KJ2L 1QO3A 3FB5B 4IMLA 4HK3J 5EBWA 1X3DA 4L8BB 5HI4D 4OZGF 5CMAA 2XY2A 4C54A 3GB7A 3V4PH 4AM0B 4M61B 3C09C 3MV11 4HWEL 2PCPA 4WEBL 5MI0B 4JQXA 3AAZA 1KEGL 1XF1A 5ESQB 3FQTB 4HQQH 2FGWH 2OTUA 3VA2C 3F58H 3INUH 5C0AB 1IGIL 3OAUL 1ERNA 1NC4B 5KOVC 4BSJA 4POZC 5F1NA 4LCWB 2QKIB 1F4WH 5ALBL 3TJHD 2FHBA 3T2NL 4KUCD 1H3XA 2G5BB 3BN9D 5F1OB 3IFNL 3TT3L 4LCYB 5ISZB 4OLWL 3MRMA 1HHJB 3TA3D 3WFEH 1IEHA 4YBQC 4TOYL 3GFUA 3QUZA 4ZYKB 4LP5A 1JTOA 5IB5A 1T89C 4N0UE 4NRZB 4A2MA 5I30H 1U8NA 3WNKA 1SY6L 3LQZB 5GZND 4Z78A 2D7PA 1JPFA 2WBJC 3QDHA 4GRWB 3MJ9H 4PJEE 4B0MM 4HHAB 4LPUA 3CVHA 3G08B 3PHOA 4I4WA 1U95B 4WI3A 3QQ9C 4BZ1L 1H3UA 2FECI 2YC1B 5KANI 2VR5A 4R2GD 2VZTA 3ZKXB 1UACL 4G8EB 4URTB 1A4KA 5FYJU 1FL3B 4X7CC 3VFTA 4OCSH 3IB4A 4BQ9A 5F3HA 2YD4A 1OAYH 4YFDB 1QYGH 2C9AA 2OL3H 3QISA 1SM3H 4JFFE 5J6HB 3QQNA 4RISL 4QXUH 3KXFB 1BQHB 4UQ2A 5DC4B 5INCB 3T3ME 4LSPL 1KJ3H 2DQHL 4DOHB 2CRIA 4LCCB 2DMCA 5E99H 1PFCA 3T0DA 3VG9C 5JLZA 4HIXL 1F3DJ 4ZS7L 3TA3A 2FX7L 5KZCD 1EERB 1MHEA 1ONQB 3FT4B 2QR0A 4U1HB 5SWZE 3VJ6A 2X6MA 3SDYH 3MQIA 4LARL 2D31B 3I2CL 4K7PY 1QR1B 3HZKA 3V5KB 3TBTB 4JHAH 4CW1A 1UT9A 4F57L 2RCSL 2IG2L 4P2RD 3LRSA 3VXUA 2AERT 3F65A 3MZGB 1OLLA 5FUZL 2EDXA 2Z91B 2ERJB 4RIRB 2YN5A 1HEZB 4KGJA 4WWKC 3ZDZF 5GSRB 1NEZG 4NBZB 4XWOC 4DGIL 5BMFH 4UAOB 3MV8A 1BIIA 4LRNL 3W39B 1NC2B 1DQQB 4RAUA 4JFDB 4QYOB 4G3YH 4OCWL 4JM4L 2NY1C 2RAMA 4JFPA 4KJPD 1BOGA 1XF5B 3K8LA 2UZIH 4Z77A 3V8OA 4PJFB 4Y4FA 2HLFC 2VE6A 4A6YH 4JY5L 3K4DA 4X7SH 4JEGB 3QEHA 5IHLB 1FNGA 2FJGB 4PJIE 3BHBB 3ORJA 3I84A 4YAQA 3GSOA 4PGZA 5KVDL 3ROLA 3NA4A 2YD6A 1UWEL 2DQGH 4PJDA 4R6UA 4JR9L 2IH3B 2AXGA 1SYVB 1YQVH 3AS3A 3UYRH 4AZ8A 1N0LA 2FJHA 2YD8A 5DLMH 2C7UA 5DRWA 3NCYS 3GJEA 2O5ZL 3X13A 4YPGA 4P2RA 1PKOA 4MQXC 5SX5K 4BFIB 1YEFH 1LK3H 3BWAB 3BVNA 4G8IB 2VAJA 5CFHA 1OTSC 4MDJB 5I76B 2ICEA 5IW3A 2B1AH 3ARSA 2BHZA 1G7PB 1F11B 2KBGA 3EDJA 4HWUA 1S7SA 4UB0H 2CRMA 5HHPA 3DI2B 2WUBH 5IB4A 1PLGL 5GS0L 5DQJB 3MODH 4HPOL 1BD2D 1LO5B 2CLZB 3PWPE 4WCYH 2FIKA 5BS0D 3SKUD 4CL7A 1Z9SA 5KS9F 1K8DA 4HCRL 1G7QB 4NQCD 4NHCL 3TVMD 3V95A 1FV1A 3QA3B 1NJ9B 2IQ9H 1A14H 1G9NH 5D7IB 3L5HA 2XRAH 4Z95L 1A1NB 1U8JA 3G6AB 1D7FA 1EFXB 3QG7H 5DVOA 5LCVH 1EVTC 1VFBB 4RSVA 1MCJA 1JGDB 1G0YR 4G5ZL 1C8PA 2ATKA 3BPOC 5L8LB 3W11D 1QFUH 1WZKA 1GSMA 1J8HD 4G43B 1FPTH 1S9WA 3IF1A 2O61A 2OM5A 4L9LB 1MCHA 1N64H 3GSNB 4Z0XB 4NGHH 4QWWD 4CVZB 1S9YB 4X8JB 5CILL 5CJQH 5L0QC 3PHQB 5MP6L 5SWQA 3EYQD 4PLKC 3VE0B 5C0RH 1DBAL 1JF1B 1JHLL 4HJ0D 4PRDA 3RWCA 5L6YH 1SEBB 5I1KL 15C8L 3HG1B 4JVWA 4QGTA 1QLFA 2C3GA 4GW1B 1QEWA 1KCRL 3LVEA 4UQ3A 4KMTL 1MAMH 3RNQB 1DUYB 1JUFA 2A9MH 1MNUL 5MEND 3TVMA 4NQCA 1MWAL 1NBYB 3UYOD 5JHDD 3ZT6A 3IS1X 1IC5L 3RVXD 5MI0C 5DMGC 4Y16B 1BZ9A 4ETQA 3N06B 2R2CA 4YDVB 2GSGA 2WWKT 3ULVH 2VSCA 1I1AD 2R1XB 1AKJB 2P8PA 5JXAH 2EYRB 2HH0H 3QUKB 1R24B 5GPRA 3T04D 3REWA 2AK4A 1CXKA 5BXFB 1TVHA 3BD3A 4XNXL 4OZIB 4OI8A 4EUPA 5GXBB 2E5EA 4EIZC 3S6CA 1J8HA 5I1GL 1G1CA 4DGVL 1R3KA 1ZT1B 2NY3D 2OZ4H 3QDGB 4PRHA 3RAJH 2I27N 1J12A 4U1GB 1ND0A 4XAKD 3RNKB 3STBA 2D0HA 4PLJC 3RL1A 2ZUUA 3DX7A 3GZKA 1VEMA 4JPVH 4P46D 3RL2A 1MF2H 4MA3B 1A3RH 2QTEA 3ARFD 5FA4A 3MFGB 3EHBC 3WXVH 4IM8A 2H1PL 1NGPH 4X9FA 3CK0H 3OKMB 4U1KA 3TBYA 5J12C 3IDGA 3V5HA 3BMWA 3U9UB 4BKLB 5MENA 3T65B 5DSCB 1TVBB 1YEEH 1C1EL 1MCSA 1F42A 5JHDA 5IG7B 1TCMA 5ELIA 4DN4H 1PDKA 3R06B 2I9TA 4HJJL 4O2CB 3JBG7 4XBPB 3ZKXC 4X9BA 2WWKO 3G6JB 1OWRM 5L88L 2DYPB 1L7IL 3VFMA 4YGVB 4U1LB 4MA1B 2CDFA 4TSAH 4MD5B 1HIML 1K4DB 3LB6D 32C2B 1YNTA 2BP3A 2VZSA 5D2NB 2PO6D 3MV8E 1MPAH 4XB8A 5DI8B 5EWIH 4LCCC 1N5YL 2WQ8A 4R3SA 3R0NA 5DRXA 4D9QD 3NH7L 3U46A 2HA1A 4UTBH 4NQDB 4Z0BL 3O6FD 5JQ6L 1Q9OA 4RZCB 3MBEB 4MJ4A 3EOAB 1LEGA 4PJAA 3LKOA 2GUOA 3DNKA 4WO4C 3KYOB 3FAXA 3OKKA 4FQQB 4NKIH 5ALCL 3ARFA 4F9LA 4YHKH 3RUGE 3JTSB 2C3WA 1LP9A 3PWUB 1I1FB 1A4JB 1JNLH 3CFDB 1UM5H 5HHVL 3NAAH 3UJIL 4JRXD 2C1OA 4AIZA 2D03L 3BP7A 4NO0A 2ERJC 4V1DD 3TIDB 1J87A 4QTIH 1KPVA 3MNWA 2HG5A 3SDAC 5DEGA 5FDWB 2VXUH 3QNXA 5EU4B 2ED8A 5DK3A 4NCDA 4UAOC 5DUPL 4ZFZB 5EBGA 1VENA 1SBSL 4WW2C 3O2DL 2PYFA 1AD0B 5BW7A 4YO0A 3MLRH 5AWNL 4OM1H 3U7WH 5D72L 3OGCA 2JCCE 3GBLA 3ETBF 2X41A 2BNRE 3H8NA 1NAKH 1ROWA 1IVLA 4GRWH 4R7NB 4GKSA 2GEEA 5EO0A 1U8MB 3O6FA 4GFTB 2H32A 4CGTA 2UWEF 2PYED 1SJHA 2CUIA 5HI3D 1GZQA 4PP2A 1L6ZA 1QHPA 3ZHDA 3IJSB 1X5LA 2AJYL 1I3RB 3O6KL 2A73A 4YXLL 3VXRE 3MLVH 1OGAD 3IAGC 3TC9A 5IOPA 1MAJA 5L7XL 4IRZH 5DJDB 5HDQH 4H0GA 3B2UD 3FB8B 1NUGA 4XNYH 4JRXA 2YK1H 1WTGT 4M5ZL 3GM8A 4UIMB 3RY4A 2FYYA 4QF1A 4AEHL 2QV2A 1HXYB 4UT7H 5FYKE 5IFAH 2H2SD 1WWWX 1XCTB 1PZ5B 4QRUB 4NC1E 3VFPA 2QSCL 2YMXH 4WJ5A 2D0GA 2OJZL 4MXVE 2DAVA 5IVXB 2ZG1A 4GQPH 1MLBB 1OOAA 3HNSL 4PJHF 5HVGB 3UTPE 4BQBA 3A6CH 1IGTA 5EOTB 1P7QB 1SY6A 3GMPA 3ECBB 3SDCD 4Z7WA 5D7JD 1OF2B 2G5RA 2VXQH 3KJ6H 4FQJH 4LDLB 2R29H 4PYHA 1NMAL 2K1MA 1TZHA 1FCCA 3GMOB 5IHUL 3D2UD 4MA8H 5FFLA 5TDNA 4M7ZB 1CE6A 5IM7A 2PYEA 1Q38A 3QFJA 4KDTA 1UM4H 5EU3A 1QLRA 5DRNA 3THMH 3MLUH 3HB3D 3MLPA 1MFCH 4QTHB 3E6FA 1CGWA 4KKAC 2VMFA 2DLTA 5CHNA 4W70A 1PG7X 1DN0B 1QBBA 1J0HA 2A1WH 3C9NA 1J0YA 2NW3B 3QIBD 3ZYIA 4BSVB 3O4LA 1S7VA 4JDVB 4L9LC 3PL6D 4ZPTA 5C0IB 4MQ7B 4NWTH 4OLVL 5E2TH 4TRPH 1N2RB 3I50L 1YNKH 4WTWA 2ICWJ 4EN3C 3RHWK 1RIVH 2AK4E 5E6ID 1LILA 3U1SH 5IESH 4F7EB 2CD0A 2NYYC 3D0VA 4K55A 5E7BA 3HPLA 5HGAB 2D3VA 1Q8MA 4F33B 1EHNA 4Q6IB 3QUXD 5D7LD 2ZJSH 3O41A 2EC9T 4PRHE 2YPKA 3SDCA 4JO4L 1MREH 4PY7B 2HT3C 3QUML 3MRPB 4Y16C 5ICZA 1NFDA 3DUUB 1T22A 2YS4A 3EOYG 4ZAKA 5IMLB 3PWLB 4KKBC 1UVQA 1HHHB 1HYRC 5IV2A 5DUMH 2HJFA 1X9QA 3EO0B 3QAZB 2XIDA 4LSQL 3ET9F 2YWZA 5GS0D 3ESUF 1ZA3B 2AK1L 3VRLF 5JUEL 3QIBA 3ARPA 2ADFH 1CFQA 3MJGX 3PL6A 4OIBA 4ZG1A 1ZT4B 3SHSA 4BH7A 3BJLA 2J4WH 5C0BD 4GQ9L 4M1GL 3TH4T 1WC7B 3V52L 5IJVA 3GHBL 3X12A 2DL2A 4F37K 1ZS8A 3LKPB 4JZOB 3QDJB 1DLFL 5D7LA 3ZL4H 3HRZB 3NGBC 1ZLVK 3SKOA 3HPJA 4XCNB 2C26A 2YA1A 4NQSA 4X5XB 4O00A 4RMWA 3SEPA 2HFEA 3FO1B 2X10A 2DI9A 2YD5A 4E0RA 2IBZX 2V5TA 3H2WA 3MRDA 1HHKB 3W5MA 4HK0B 4TVPD 3ZDYE 2VITA 3I02A 2XZCL 4QRQA 3KR3L 3GGWA 4X98B 5DJXA 5L2JA 4MA1C 1Q0YL 4FFVD 1A6WL 3WS6C 1EEYB 4LKXA 3HC4H 3IS0X 3L3HA 4F15B 1AR1C 4Y19D 5D2NC 5ITBL 3GMQB 4MJID 1EFQA 1P4LB 3MROA 3PQYE 2OQJB 5EIVA 1X5AA 1QSFD 4HCRA 3DGGB 3IJHA 1NCCL 3NN8A 4PJBF 1BOYA 2W59A 4K7FA 5F9JB 3RDTB 2NY0D 3MBEC 5C0BA 5MEOB 1SVZA 2GJZA 4MD0B 5DEZA 3WIHH 1FNSH 1S7QA 4XMLH 2DD8H 3VW3L 3L5WB 5CUSL 1G0XA 1LO0L 4K7PH 3QXTA 4DAGL 4NQVB 5JIPA 2AJXL 1WVZA 2VDLL 1BQLL 4R96A 4RX4D 4L8DA 2YOCA 3CFKA 4UDTB 3PGCA 1E6OH 3PHSA 4OT1L 2BVPA 1OP5K 2AJSL 3NVQA 1B0GA 1BWMA 2RBLA 1LE9B 4M4RA 4NZUL 1IAIM 1WBXB 2X4NB 5I1JH 2VQUA 5DFWH 4Y4HD 4YHLH 1RJZA 1GGCH 3ARBB 1HSBA 4GLRH 2YUWA 3D18A 5CGMA 4EVNB 1OQXA 3RZCD 3EDFA 4MJIA 2Z8SA 5KN5A 2YUVA 4RMSA 5AD0B 4YZFF 1QSFA 3MBXL 4P23D 5C8JB 1PEWA 1MWAA 4JHWH 1K6QH 1NANI 5DJZB 4P2QB 4MGXA 3S4SA 4JGMA 3TCLA 4KVCL 1NPUA 1TJHL 1HI6A 5D7KE 1IGML 1MI5D 1Q9KA 3Q1SL 5EU5B 1K9TA 4GG6F 2W0PA 2BC4A 1E28B 4ZS6C 4QHMA 1ZANH 1QVOA 4PJ9D 5GIRB 2UUDK 4RBPK 1P9MA 5IW6B 1UFUA 5FCUL 3MV9D 3PP4H 3QFJE 1Y0LA 3STZB 1MJUH 2CXGA 4L8CA 5GISL 2A6DA 1I9JH 3QO1B 3WKMH 4U0RC 4U3XA 1S3KH 4L29A 3UBXA 4IRJB 2AI0L 4LVOC 2GY7B 2HFFB 1ZHBB 1EIBA 3PDGA 3O4LE 4Y4HA 3MUZ1 3TO2B 4X4YB 4PJ7A 1BM3L 1I1YA 1JPST 1Z9MA 3W9DA 2AQ3A 3E2HB 3ES6B 5J7CC 3RZCA 4YDJA 4XPGH 3EYOA 4JO1L 3RA7L 1OM3H 1XH3A 4QOKE 2ZUXA 2MPAL 5I1HL 4P23A 3DIFA 4OD2B 5HPMA 1ED3B 4IOFC 1A6TA 2NQCA 4KRMB 5F70A 1X7QB 1PKQE 1U8QB 2X4OB 3ZDXF 4EJ1C 3KNBB 3EJJX 1MI5A 4EI6A 1XF4A 4UU9A 1MVUB 3ULSB 1WV7T 3UXFA 2M8XA 1EO8L 4PJ9A 5IWLC 5I2IB 1EBPA 1U3JA 1RIHH 1KCLA 1ORQA 3MV9A 5KOMC 3QZWB 3T3PF 1B4JL 5CZVL 4O2EA 1DQTA 3IVKB 3KLAA 4F7CA 1S5IL 5DGRA 1DBKH 4HWZB 1M7DA 3EDDA 3IRPX 3QG6A 1BVKA 1I85A 1YECH 1O5DT 1GGYA 5LXGL 3CSGA 3LKRB 2X5PA 3BZFB 2GJ6E 3BIAX 3OXRB 3NZHL 2I24N 3MRJB 1JZ5A 1FCGA 1KTLB 2Z8VC 3L6FB 1V7NL 2APVA 1AHWB 1E6JL 3G04A 1WCBA 1NKOA 2L4OA 4HUVA 2J88L 4P99A 4OFKA 5GGSY 4OJFL 1HQRA 4WVRA 3O2DA 5DHVB 3P0VL 5DURB 2G75A 1H15B 2Y4SA 3G5VA 1T1XA 3N1QC 1NGQL 4WW2F 3BO8A 1JRHL 3LN9A 3C6SA 1T04B 4GRMA 5JR1H 1ACYL 3OMZA 1AGEB 2E7MA 1OTTD 4P2OA 1JPTH 4JN1H 4NWUH 3VXPB 5DS8B 4PP1D 4PJFF 2H3NB 4KK5C 4Y89A 4BSWA 5DK2A 1MJ8H 2W92A 4KHXL 1T80A 1PYWA 1BEYH 1RK1A 2EO9A 4OZHA 1QBML 4Z18A 2X4QA 4G6ML 3W0WD 5J89A 3FO0H 2P45B 4YHPA 1ZLWH 1IFHL 3BP5B 4I5BB 4MNQB