3NJHA

D37a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
PQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGAITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDPQIINRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 20
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njhA00
4NAJA 2WSDA 4KOBA 2HRGA 2UXFA 1TU2A 4YL4A 3AW5A 4YSEA 5TK2A 3FU7B 1AACA 4GP5B 2GSMB 2IDQA 1KCBA 1E67A 1SHWA 1AOZA 3EH4B 4A2FA 3OMNB 3FYIB 4DP8X 3NJLA 1XB3A 2PPCA 3TU6A 1L9RA 1HAUA 3NP3A 1JZIA 4NB7A 2GI0A 1M9WA 1PMYA 1GS6X 1L9QA 3L45A 3N55A 3QJRB 2GIMA 4KO6A 3FSWA 2IWFA 3PCYA 3GYRA 1AS6A 1A3ZA 1GY2A 2FWLB 3X1FA 3EF4A 5B7MA 4BDVA 1OOWA 2HRHA 1CYWA 3DIVA 1TKWA 3FPXA 1J9QA 3FQ1A 2LLNA 1BXUA 3IN2A 5E9NA 4DP4X 4E9XA 3MBWB 1AS8A 2OJ1A 1I53A 3ASOB 4M3HA 4G70B 1JERA 5B3SB 4WKXA 3PAVA 2ZONA 3IBOA 8PAZA 2Y1AA 1BEXA 4KOCA 2IWEA 4HHGA 3CZUB 2XYBA 1L9TA 2CAKA 2FJSA 1AAJA 1E5YA 1BAWA 2VW6A 3PLYA 4P5RA 3S8FB 2XVBA 2XV3A 1E65A 1JZGA 1ZDSA 2HX7A 1R1CA 4PAZA 3NJKA 3CVBA 4TXVB 2XV2A 2CUAA 2EIJB 2H5UA 5EHFA 1PCSA 1URIA 2AANA 1IBYA 3KW7A 2PPAA 1A65A 2XX0A 2PCYA 2VSMB 1HAWA 2YXVA 6PCYA 2XV0A 2BP0B 3NJFA 1V10A 4E9VA 5F7BA 3TA4D 1JXFA 1L9PA 3PXLA 4L0PB 3QQXA 3NYKA 1RZPA 3EH3B 1GR7A 2TSBA 2I7OA 1AZCA 1OV8A 3U25A 4W9ZA 4E9YA 1PNCA 1ZV2A 3C75A 4ZK8A 3T6WA 3ABGA 4YSUA 3GXUB 2XUWA 1FA4A 4CSPA 1M57B 2ZXWB 1UATA 3WNJA 1NZRA 3ABLB 1WAEA 1JXGA 5I6PA 4E9RA 3JTBA 1ASOA 1X9RA 3H4HA 4G7SB 3S3CB 3S8GB 3ZX1A 4DP2X 4FAAB 1AG6A 4JHVA 4WTQA 4YVNA 2BWIA 1GW0A 2IAAC 2CALA 2YXWA 3ABKB 1ASPA 1ZDQA 3PAZA 1B3IA 1SJMA 3SBRA 1NPNA 4Q8BA 1BQKA 1GS7A 5LDUA 5I28A 3JT2A 3ZBMA 3FS9A 2H47C 4HCIA 2VM4A 4A2GA 1AIZA 1ET7A 3QJUB 1ADWA 2P80D 2FQFA 4AZUA 2MTAA 4HALA 4KNSA 2CJ3A 3BVDB 1W6LA 3CVDA 2BWDA 2CCWA 2I85A 1JVLA 5I26A 3CVCA 2Q5BA 2PLTA 2DWTA 1SNRA 2XWZA 2YAEA 4E9QA 1W6WA 3N2JA 3S3DB 2H3XC 3DKHA 5FC9A 2XXGA 1NIEA 1PLCA 4CSZA 3T6VA 1OF0A 5I5IA 1FFTB 4AX3A 2E86A 3CG8A 1JOIA 3WKQA 1BXAA 1QLEB 1N68A 3T6ZA 1E5ZA 3MX0B 1AANA 1ILSA 2YARA 3PAUA 1T5KA 2UXTA 1GY1A 3NSDA 2YAOA 1JZFA 1OE3A 1V54B 1OCRB 2FT8A 4HIPA 2W8CA 5TK4A 1NIFA 2PCFA 4YSPA 2B3IA 2VMJA 2R7EA 4A66A 2J5WA 4YSOA 4A68A 5D4IA 1A4AA 2BO0A 4QLWA 3G5WA 4BWUA 1IC0A 2OCCB 1SFDA 4BXVA 5D4JA 3GDCA 4JHUA 3DTUB 1WS8A 4AI7A 4YSCA 5B7FA 1WA2X 2BP0A 2EILB 4QKTA 3BQVA 4HHWA 3NJHA 3WIAA 3T9WA 4EF3A 1OCOB 5AKRA 1AZUA 3NSYA 2R7EB 1JZJA 2DYRB 2IDTA 5I5MA 4PCYA 2DWSA 1SDDA 4A2EA 1XB8A 5A7EA 4HCFA 2IDSA 5I6LA 4KNUA 2XXFA 5PCYA 4A2DA 3OMIB 4YSRA 9PCYA 2BP8A 1TEFA 2GB2A 3UAEA 3X2QB 2AZAA 1JVOA 2GHZA 4K9JA 3H56A 3FQ2A 3T6XA 5B1AB 4BK5C 3PPSA 3FQYA 4UF7C 2YAMA 1AZBA 1RCYA 2QDWA 5B1BB 1PLAA 2XLLA 1OCCB 1SDDB 4ENZA 4F7KA 1VLXA 1AZRA 1AS7A 2AZUA 2BW5A 1AQ8A 2FT6A 6PAZA 1ASQA 5I6MA 3NSFA 2XX1A 3NJJA 2BP8B 5I6KA 3NSCA 4YSQA 1GSKA 4JKNA 4GY4A 3WKPA 3IEAA 2FT7A 2HLEB 3WI9A 5IY5B 1NICA 4GP4B 4X4KA 1SF5A 1PY0A 1PAZA 1XMEB 2AFNA 3ZDWA 4DPAX 1XB6A 1PLBA 1QNIA 4FA7B 1KDIA 3AG4B 2HZHA 2VM3A 3UABA 4N8UA 2FQEA 2UX6A 1KBVA 1CURA 2W88A 4GYBA 1RZQA 4HCGA 4E9WA 4G7RB 1A8ZA 3QJQB 1SFHA 5ANHA 3TASA 4YSDA 1A4BA 1OE1A 4G71B 3ABMB 4YSAA 2IH9A 5AZUA 1KV7A 2BHFA 2JKWA 5I5JA 1JXDA 1BXVA 2IWKA 3FSAA 1IUZA 2YAPA 2BZCA 2X88A 1NWOA 2VSKB 3NT0A 4P5SA 4DP1X 4AKOA 2N0MA 1KYAA 2WO3B 5PAZA 2PP8A 5I6OA 1DZ0A 3OD3A 3QPKA 1M56B 3UADA 3X1GA 1TEGA 3ASNB 3AY2A 2EIKB 1J9TA 4E9SA 4W1TA 2XU9A 2FQDA 3FSVA 4G7QB 2HXAA 4DP9X 4AKQA 2GC7C 2OV0A 2YAFA 1ZPUA 1J9RA 4Q89A 1ILUA 1WA0X 4E9TA 2P80A 1ET5A 3FU9A 4DPCX 1AR1B 3FPYA 4GXFA 3EHBB 2HX8A 4KO7A 2WO2B 1L9SA 1J5DA 2PPEA 2A3TA 5I6NA 3HB3B 1MG3C 1EZLA 1EHKB 1KDJA 1PZCA 2TSAA 2YAHA 1NTDA 1JZHA 4UAHA 3IN0A 2I7SA 3IE9A 1ID2A 1ZIAA 1BYOA 3AG1B 1V55B 2ZWNA 2B08A 1SF3A 1PZBA 3NJGA 2QPEB 3QJVB 3WG7B 1MDAA 1SHXA 1KBWA 3OQRA 1A4CA 1HFUA 2FQGA 4YSSA 3UGEA 2ZOOA 1MG2C 1ET8A 2IDUA 2PP9A 1WA1X 3RYMA 1NIBA 3QJTB 2FNWA 2UXVA 2QDVA 4DP5X 1J5CA 2DY2A 2VN3A 3SQRA 2UX7A 2PPFA 3CDZA 4KO9A 1W8EA 1RKRA 2EINB 4DPBX 1ZIBA 3QJSB 1NIDA 4N4YB 3HEIB 2FTAA 3T71A 4BDVB 3AG3B 3NJNA 2CBPA 3UAAA 2Y69B 1OCZB 3KW8A 1KCWA 3TBBA 1J9SA 2PP7A 4A2HA 1BQRA 1MZZA 4BWTA 4BWWA 1ETJA 3AG2B 2IH8A 2UXGA 2VW4A 4NERA 1IKOP 1PZAA 4YVUA 1QHQA 3CDZB 4YSTA 1L9OA 1AZNA 1NDTA 2AVFA 3FYEB 3FU8A 3NP4A 5F7AA 1BQ5A 2QT6A 1CUOA 1FWXA 1GS8A 2MRYA 1N70A 3WNIA 4G72B 4HZ1A 4DP6X 4DP7X 1AG0A 2YQBA 3V9CA 1CYXA 5B1JC 3H4FA 3S3BB 2BW4A 3TBCA 3X1BA 1X9UA 4KNTA 1KGYE 5D4HA 4A67A 7PCYA 5B1KA 2HX9A 4KO5A 4GP8B 4MFHA 1CC3A 1GYCA 4M4RB 3SBQA 3FSZA 2X87A 2Q9OA 3FT0A 2DV6A 5B7EA 1NINA 2JFCA 3ZIYA 4AKPA 1E30A 1PF3A 2NRDA 2VW7A 4F2FA 2J57A 3EH5B 3NJIA 3SBPA 5B1JA 1IBZA 2YAQA 1JZEA 1F56A 4BXSV 1BYPA 3D12B 2J55A 1YLBB 3FU7A 2PPDA 7PAZA 2BZ7A 3X1NA 3NJMA 2GC4C 2DYSB 2J56A 1NWPA 2GBAA 2QPDB 2RACA 3ERXA 4F2EA 2JXMA 3X1EA 3OMAB 4DP0X 5AFAA 2IDFA 2EIMB 3UACA 1NPJA 1WS7A 4UANA 1NIAA 1PNDA 4RH4A 1OE2A 4HAKA 3V9EA 1DYZA 3OM3B 1MZYA 3AZUA
chains in the Genus database with same CATH superfamily
1E8WA 3P0YH 1NCDH 3CZEA 2OZNA 4PJDB 3C6LD 1F1DA 4RESB 4KPHH 5DSCB 2D7MA 2XY1A 3FU7B 4CKQA 3IMBA 4NHCH 1AACA 3CHRA 5FM8A 3KR3L 3C5ZC 1QUPA 1LMKA 1RV6X 4CKVX 4JRYA 1KENH 1ZVYA 4A2FA 4WFFE 3SQOL 4YR6B 4JZJA 2JXMB 4OGYH 2X4PA 5E03A 3L1OL 4KXDA 4CW1B 2PPCA 4TLSA 4NB7A 3VAEA 4NZUH 1UA7A 4LLUB 3EGXA 1QSEE 3GXMA 4WW2A 5GS0C 2IWFA 1GCFA 4MXWH 4C56A 4Y5XA 4JFXB 4Q2ZB 4TNVK 2M1KA 3HOGA 4LHUD 3U4BH 4LAQH 2XWXA 4HJ1A 1H3TA 1F4AA 4M3HA 4JK0D 4XMPL 3QAZC 2DS4A 4JRXB 4MGXA 4RX4A 3H9SD 4Z77B 4JM2C 5DO2C 5I74B 1PKQB 2CK0L 1WBYA 2ZONA 4LLDB 1G5GA 1XZ0A 4XN5A 5MEPA 2ZWSA 2NX5E 1QRKA 3QDJA 1GW6A 4HJGB 1BQUA 4H26B 3QO0B 2B15A 1F4YL 4YDVA 4D0CB 2ED7A 4KVPA 1QVOA 4DKDC 5DUBA 1CXLA 1SEQL 4IMLA 3I9AA 5EC1B 4X83A 4NUQA 4ZSOA 5EHFA 2Q2EB 1C5BH 1IT9L 5F93C 3R4RA 5IWLC 3N42F 1M6OA 2J43A 1HYSC 4UB0L 1FL3A 2DLGA 2EH8H 3SY6A 1TTRA 4J5VA 4MHHI 1EMTL 4UM8A 4XE0A 5K39A 3DV4B 4WK2B 3N40F 3CVHH 3NQIA 5DR5L 3QJZA 3EO1B 2FCBA 2WSPA 5BV7B 2I7OA 4F27A 2X1QA 4O00A 2EO7A 5JZ7D 1ZTMA 4QAWA 3P3UA 3B9KD 2ATPA 4KX8A 2D9CA 2EEAA 4E9YA 1MREH 2FWUA 4Z76A 1N64H 2ICCA 4FFZL 4DKFH 1A1NA 4DQAA 5I0WA 4MB4A 5FO8B 1MI5B 1UZ6E 3MA9L 1G84A 4AQ1C 1FYTA 5C97A 4ECNA 3E1F1 3VGBA 5I6PA 2VUOA 4G7SB 3T08A 2YMTA 1CFVL 3BSGA 4PWHA 4IMKC 5BVPL 1AI1L 4FZ8H 1EUUA 4ELMF 4L8SB 2E7LA 1WFJA 1H15B 4X2UA 4NN6C 1DDHB 4YZFE 1ZDQA 2ZOLA 1AIFA 3SKJH 3L7FA 1QSFB 3ROLB 3WXVL 1M7UA 2IOOA 3GIVA 3JT2A 2Q20A 3J2PA 5DHXB 2GTZA 2HTKD 3EOAA 4JM2F 1H9DA 1XFPA 2D31A 3SDCD 1XTMA 1YEEH 3B1TA 1IIIA 5AOLA 4WUKL 2F7PA 4AZUA 2HN7A 1XX9C 2MPAH 5AYQA 4PJFE 4FFZA 4QHLB 2H32A 2I85A 4JGMA 4QHKJ 3G6JA 3RAJL 2GHWB 1YEIH 5H94A 2LU3A 3HRPA 4FKKA 3ZTEA 3M17A 1U8MA 2ESVD 5EIIB 1LEKA 1OSZA 2B4CL 2F0CA 3LKSB 2IALA 3LRSA 5L2KB 1PLCA 2ZCHH 4LLMB 1QPPA 2YEQA 4C4KT 3B2VH 1ZT1B 4BINA 2A4ZA 1RK0A 1K8IA 1LO3L 4I48A 3DX7B 3GBLA 2BSSA 2DIAA 2V2WB 4P5TA 4LCWA 4I9XA 3OJVC 3SDXB 3VI4E 1WFMA 3WBDA 4F5CA 4Z0BH 4Z7OF 1JFQH 3V0EA 5D9SA 1HNFA 1U3HC 1NCWH 1TQBC 3E3QE 4JFZH 4LASL 4N6RA 1JGVL 3GSUB 3PWLB 3TJPA 2NMSA 4K9EC 4O2FB 4OZGA 3GXTA 5I2IA 1RSFA 4UNTA 2AQNA 4GFXA 3BVNB 5F1SA 3O6FA 2Y36H 3GB7A 5IHZA 3ARBA 2R83A 3EYUL 2NY1B 3HN5A 1UD6A 3SDAC 2C7UB 5HHVH 2YPVH 3UTQB 1UUNA 3QNZB 3B8YA 4UT9L 1DL7H 1PJWA 2XG4B 4HMDA 2OX5B 4OZIB 4K5LA 5HGDA 1FZMA 1XH3B 5CLTA 2IXQA 1UWFA 3BZFA 4RVBA 2HVJA 1B0RA 1T5XB 3QJHB 4PRHA 2Q2LA 1QBMH 3QEQD 2DYRB 2VISA 5DC0A 1RJZB 4A2EA 3MRNB 3WAJA 4XXWA 1J10A 5JQIB 4B0MB 3L4TA 5IHBA 3S4SA 1WQVT 1HSAB 3LZFL 3WL9A 3CBJB 4ZBJA 1L9MA 3OMIB 2E7DA 5DC2A 1RFDL 1NUDA 3T0WA 2WVTA 5FYJH 3TEYA 1A5FL 1H5BA 1PX3A 2CBMA 5B22A 4PWGA 2B39A 3H3PL 3UJJL 4WSGA 3HFML 5D1XD 1NAML 2ARJA 1P84K 4OD3L 4ODWB 3WU1A 4XOCA 4DKTA 4G8GE 1MAJA 4M00A 4O4YL 4X80L 2E27L 4YEEA 1AGDB 2HFFA 4UT9A 2X0VA 3FO0H 4MA8L 4IKLA 3QDHA 1HS6A 1YYLL 3FONA 4AQ8C 2VXQL 2R0WH 2JTYA 2F8VA 1C7TA 5TDPA 3MUHL 5CHNA 5HHQA 1TLKA 5D6DA 3MLRL 4Z7NB 3CC5A 5IY5B 3BN3B 3QARA 1M6UA 2PYFA 2ZZUT 4I9WD 3RGVA 2KUTA 3NGBC 3O6KH 5D1ZA 5FHBH 5HYSG 1VAHA 3RX7A 1XMEB 4FZEL 4P46D 3HZYB 4FA7B 2X4SA 3GEFA 3FHQA 1IGTA 4NOFA 4U6VL 1J0ZA 3OG6B 1WG3A 1F4XH 2AQTA 3DX6B 5KSAC 3K8MA 5EBWB 2W88A 3CH1B 4ZW6A 1RZIB 4JO3H 1OM3H 5D2LE 1SFHA 4NKMA 5C0DA 2WJ5A 4WENB 4U1GC 4L0YA 3RPIB 3TV8A 1IGFL 2QV4A 3MJ8B 3VWKD 4IRJD 1CGXA 2VXQA 2BHFA 5I5JA 3NTCL 4K55A 4KKPA 4ANVA 2YAPA 3UGXA 3ZRFC 4B9CA 4OLEA 4UOJA 5EA0L 5E6ZA 5I1IH 1KYAA 2YGNA 2XWBB 4P59H 4YHYC 1MCOL 3APFA 1KFGA 1R19A 3SHSA 3GK8H 4JY5L 4YHZH 1TEGA 2AQ2A 3CTTA 5JPNC 3ALXA 4MJ6A 3T65A 5DT1L 2Y06H 3CX5J 4NIKB 2XQBL 2Y0SA 1A3LH 3OHXA 3G04A 2EDQA 3FTWA 1GOGA 3L3IB 4G7QB 4KKBC 1G1YA 2MOQA 4Y4HC 2YMXH 2W9DH 2NYYC 4MS8D 2O61A 2WLKA 3O0LA 4MNQA 3U7AA 4KK9D 2G30A 3RIFF 3PHQB 2AC0A 4UUJB 2CO2A 4E9TA 1DJYA 1R5VA 3QA3A 3IGAA 2GJZA 3FU9A 3VFVA 1OAKH 2DD8H 1T0MB 2ADJA 4G7VL 5E1HB 2JSFA 1VZIA 4EDXA 2HFEB 2NY5H 4KJYA 5ISZD 2BCKB 1KDJA 4U6YB 1PZCA 4BFFA 1NCOA 1XDTT 2AQSA 4IBQA 2NY6B 3PHOB 5AVWB 1Y0LB 4H1LA 1CG9A 3LN5A 1J8KA 1TIUA 3P1VA 4BE6A 3STLB 2ITCB 2A6KA 3QRGL 3QW9A 2QPEB 3QJVB 4G9FB 2DQUH 5I5RA 1P4IL 3GSNH 3RTLA 3VD0A 2H2SC 4FEIA 2WLYA 4P5KB 3MYJB 3SJVE 5EU6D 3VFOA 5DJ8B 1A6ZB 1RQ5A 1R5WB 3MLZL 1FE8H 1VFBB 1LGVA 1PLGL 1A21A 4LBEA 5HI3D 4R5VA 4O5LL 1XXFC 4BZ1H 4DGIH 1CI3M 4HPYH 2XIIA 1RZGB 2P46B 2O6FA 3A67H 3CVIL 1RKRA 1AXSA 2QKIA 5FCSH 4DPBX 5KBNC 2VIRA 4LHUA 3V95A 3HKFA 4AQEA 3IFOA 3C6SB 4F1ZA 1KCWA 1F58H 3B2UC 1YY8B 3GRWA 3N9GH 2YXMA 1OAXH 1E4XI 1BAFH 2FD6H 4JG1L 4PY7B 3H9SA 4OLYL 2VQ4A 2X38A 2O26U 2B2XH 3MNWA 2DAVA 3PWJA 4NERA 4ODHL 3L3DA 4UT6L 4XN9A 3SIKA 2DLHA 3CDGB 1XD0A 2FSEB 4CMMA 3EOBA 4B9FA 3TVMC 1JWUB 2A0LC 2K3TA 2EYRA 1AKJB 4YXKH 5FR3A 1GS8A 3MJ9H 1DQKA 5KSBB 2FJGA 4Y2DB 3I2CH 1RURH 2OR9H 2CGZA 2YQBA 3OL2A 4WUUE 3V9CA 1XR9A 1FZKA 2EIBA 3N50A 1CJYA 3A4DA 1JNHA 5TE7H 3KPTA 3EBIA 4HQQH 2VRKA 1VZHA 3SE4A 2FLBT 3EJYC 3FTGA 2Y2TA 2GY5A 3NZSA 4HULB 1KWKA 1ZK5A 2O72A 5L88L 2FJHA 3ZO9A 4ZMYA 1MPAL 4V2CB 4FYRA 4Q6IA 1IGIL 1WVZA 1YYMH 2X70A 4HF5L 2WBJB 2QVTA 4GH7B 4X42A 3Q7JA 2N56A 2X87A 2R4RH 4C58B 3GBNH 2Y3NA 1TEYA 5FW8A 2L04A 4F91B 1QFOA 4XVTH 3HAEA 2JJVA 1N5YH 3B9KA 4UT6A 1CLOH 4WWKA 3ULVD 2Y2YA 4Z18A 1OB1A 2MPVA 4XNMA 3UFIA 1JZEA 3GJFB 1XGRB 2MEJB 1A4KA 4FLQA 4KPHL 1NLBH 4U6HB 4Z7UB 1TG8A 3NDYE 2D7PA 3UG3A 1ZHKB 2QHRH 2YRLA 1ZLWK 1Z32X 4U1KA 5K1VA 2DYSB 1CLZL 3N5AA 4NO2B 2I26N 5IROC 1IRAY 2BVTA 2JCCB 1S5HA 3ZGHA 3EO0A 1BDYA 3GSRB 4RH4A 3DVNB 4QRTA 1AQDA 2OMNA 4NI3A 5GSVA 5HYSB 5DQDL 2GITB 3FCBA 1MFEL 2IBBA 4KAQH 5E00A 3K6FA 4PFEA 3FU3A 4XBGA 1LEGB 3WNMA 4K23L 1W72A 3ATDA 2IANA 2HSIA 5DUMH 3U4BL 1AXIB 2GSMB 2J8UA 2ITDA 4X9GA 1QFUL 3GMLA 4ZQKA 3IDGA 1SHWA 3DDFA 4UDTA 3PWUB 3SDCA 4C57C 1MFUA 3MBWA 3ZE2E 1G4RA 1KELH 1OP3H 4UOZA 3OJ2C 3ZSSA 4E5XB 1RHFA 1XB3A 4QHMB 5F7NC 1R3LA 2ZOKB 2VL5A 5F6HJ 5HGAB 3DHPA 5IZ7A 2XKSA 2GIMA 4C54A 4FFVC 4ZMXA 5D1QA 4EN3D 2XZQL 1BOGB 2ZXCA 4MD5B 4XNXH 3OAZK 4PJIF 2R2HA 1GZPA 1PL3A 1J18A 2ERJB 3CSYA 3AMLA 4WY7H 3BZ4A 1S7XA 2APWA 3DIVA 5HHOB 4E9XA 1Z9SB 3EOYG 3GLEA 2IH3A 5D7IB 2VDRB 1KYOJ 1I1AB 5J3HC 1C5BL 2FGZA 2X4NA 4PRPB 5IF0B 4KUZH 3WHE1 3QNYA 2ZUQB 2YN3A 1ZLWH 2YD0A 4DZ8A 2NDGA 3IBOA 2Y1VA 5AW4B 3BZEB 3CZNA 4CU6A 3WELA 2G9HA 1MAKA 1MQKL 1E5YA 1I75A 3BT0A 4FNUA 3FB7A 2XV3A 1E65A 1FBIH 3U9PH 5FF6A 3RL1A 5HYJE 3JTTA 2VABA 1NKOA 2X53A 1CWVA 4J3WA 3BKCL 4KTGA 3CQPA 4ZXBB 4BFEA 3DMMC 4AYGA 4Q97A 2X41A 5I23A 4PRIB 3IPBA 3BUIA 2WWMD 4HDIA 3KW7A 1P7KA 5EUKA 2EDOA 2PPAA 4HV8B 3O0RL 3ZE1E 4YFEA 5CAYB 4EUPA 3ES6B 3O45A 3I3DA 2KL6A 4H0IA 1L9PA 5GGTL 3KBPA 3SCMB 2ZUVA 3QEQA 3I02A 4UI2A 3P9LB 1NBVH 1C16B 4DTGH 4Q6KA 5KZCB 3O9WB 1FFPB 1LO2H 5J89A 3ZYIA 2XWJB 4JO2H 2R2CA 2QQQA 4QRPB 3D3VB 5ELIA 4I87A 4Y5VC 2HVKA 5C0BD 4PJBB 2AXFB 4WI0A 1UWGH 4R7DA 3T3PB 2NXYD 4YOKA 3IFPB 3O3EB 4LCYA 4M7JL 3OAZH 4Q7DA 2BIHA 5EPMB 2CM5A 2ICEA 5DZJA 4EI5D 2IQ9H 3GKWL 3X13A 1HOEA 5F3BA 4NQDD 3ZU8A 1T66C 2CJTA 2DIBA 4U1HB 4YXLH 1E5AA 2F1AA 5L2JB 5TPWH 3Q44A 1JGEA 5IJDC 3B7UX 5D5ME 1S7VB 2ZSVA 4KMQA 3VD3A 1XSKA 4UZUA 4L5FH 5ICUA 2OMYA 3IS1X 3R8QA 2AK4E 3VDCA 5IMOB 2AQPA 2CALA 2ZWYA 1U2YA 3HB3D 3Q2CA 4KFZC 3KEHA 2R15A 5IW6B 4M62L 3UG4A 2YKLH 2FIKA 3TEUA 3JTSB 1E8XA 2BVUA 5GGTA 5I28A 1RJYA 2XBTA 2ZCHL 3DROA 4HWBL 2VDOB 1FL6A 1G6RL 4ZFGL 2Y2WA 4JQXC 2OYPA 5IVZA 3B2VL 4KRPC 1A9EB 3L3OB 5CD5D 4FFYL 5I0VA 2NXZB 3TNNB 4FXGA 4FL4C 4B5EA 4L3CB 1U8QA 4BD4A 4HG4J 3LZOA 3L08A 4WFHD 2BOCA 2H45A 1OANA 2MNUA 4P46A 1JFQL 4PIRF 1OGAB 2NOYA 4ZO7A 3QORD 3ESNA 1WGVA 1ZVHA 3ARED 2VZTA 3BI9X 3IXAA 1NCWL 3N91A 3BN9D 4JFZL 8FABB 1SNRA 4PJ9B 4K7FA 3VXMA 1CU4L 1ZXKA 3S3DB 4FMKA 2D3VA 3X11A 1FYHB 3QDME 1D5BA 1I31A 1OF0A 3L95A 1DJHA 4XZUA 3RP1A 2D0HA 5JW4M 1JMXA 2Y36L 2B4CC 3NSXA 2VZ3A 1OW0C 4ISVA 3X14B 1MFBH 4IRJA 4Y19B 4P9HH 3BH4A 3AB0C 4JHBA 5EB9A 3TZVD 1IC4L 2X6VA 5EO0B 5F96H 4FG6C 5KBMA 1OCWH 4YIQA 2LVCA 5IP4A 5LN8A 1J0JA 1G6RA 1V54B 2FEDC 3LIZL 1FN4B 1OCRB 5E8PB 2EVIA 1AGEA 3CC1A 4BH7B 4FFYA 4C4KO 4XXWC 5LG1A 4ELKB 5MP6L 3ZKNC 1FFQA 1F1AA 2W0FB 4PLKC 4Z7WB 3I9PA 2VXSH 1KJ2L 2HJFA 4BFJA 5EUOB 2MOGA 5LLIC 3DXAD 2IADA 4QXUL 4GBXC 2VXVH 3NFSH 3DTUB 5IKCB 4L4VD 3UTZB 1SY6L 2VZUA 2X4UA 3UOAB 3QFJB 5AEAA 4C4BA 3BQVA 1YYCA 4NFCA 2GY7B 2WUBL 3MNVA 4M1DL 3QZWA 1JPTH 4EF3A 5FOBB 3EDKA 3RWCB 4O2EB 2R7EB 3SB3A 4KROC 1BVZA 2AV1B 2DWSA 1TVBA 2BNQB 2ZF9A 1F2XK 5ISZA 4PJGA 5FYJE 2LLLA 2VZ1A 2VUKA 1A1MB 3LIZA 2J12B 2NCEA 2EDBA 3POHA 5EEVA 3G5ZB 4PJFF 1USZA 1CVSC 3QUMB 4TSCH 2XETA 5KSUA 4PTUA 4WO4D 4XX1G 3H56A 5C7ZA 2OXHA 5J11B 1UWEH 4AVIA 4JPQA 4K4KA 4KJPD 3ZKMD 1E27B 4UM9B 1KJ2A 1Q0YH 2XLLA 5FW7A 1EO8L 2X4TA 2IH1B 4WNJA 2A77H 4JDTH 2HT2D 1S9YB 1E3ZA 1SY6A 1YAZA 1YMMA 2EQDA 4Z3HA 2E8ZA 3LN9A 3RU8H 1AQ8A 3GHEH 4MDJA 4OLWH 2P24A 1HYRC 5I6MA 1NFDE 2N7BA 5I1LA 5IVXB 2XX1A 1IKFL 3H3BC 3E8UH 1FF5A 5DMGD 4AIZA 1S7RA 4HUMB 1TMCB 3VGAB 4JO3L 4DSYA 3F5WA 1WD8A 3EDEA 2LFGA 1IJNA 3CE1A 1I85C 2TRYA 4JKWA 1JPGA 5FO9B 3RB5A 1VFMA 2FJUB 1TQCC 5IBUB 5GGQH 5EOCJ 4XN2A 1EJFA 2ZTBA 4W93A 2CLRB 1HXMB 3FCSB 1G7HB 3GS0A 1V3KA 4FD0A 5HGGS 5JHAA 4XN8A 3WS6A 2WJ7A 3BCFA 2DL9A 5KVEH 4F9LC 3D18B 5FK9A 3KXFD 1ZS8B 1JL8A 1CURA 4AZ8A 3N40P 1M3IA 4TQPA 3RVXC 4WHDA 1DLFH 5CJXC 5ANME 4W9CC 4E9WA 5F71A 1S5IL 4K3HA 4ZDHA 3E9UA 3MJWA 5DFWH 2C34A 1ZK9A 3RB7A 5AENA 2XACC 1R33A 4OBSA 1NDGA 4UIKH 2F5BH 1O7DC 4HA1A 5I1EL 2Z7ZA 2Q7YA 4QD2E 4CJ1A 4HGWB 3CPLB 2W9DL 3IGKA 5CILL 3ZL2A 1BX2B 5ESQB 3AWGA 3FSAA 2G75A 3QE5A 3VGFA 2Q1EA 1NWOA 3GEWB 1N8ZA 3D09A 4AEEA 1S4IA 5CGTA 5K1JA 1XGYH 1S9KC 3FN0H 3QZNA 2X40A 4JR9H 4X8JA 3AAZB 4XR8C 5I1AB 5IVNA 3RWHA 2W38A 5T1KD 5ESAB 2BDNL 4P2QE 4ZW5A 1CIUA 1EA9C 2AEOA 3T0VA 1EFXB 5DZPA 1G5AA 3TLRA 5JPMB 5MI0C 1A64A 1B0WA 3BD3A 1TJXA 4C55A 3CUPB 1GL4B 1HNGA 1JGDA 1GYUA 4OFPA 2AAVA 3LPWA 3SDDC 5C2BL 2DLIA 3B34A 3MRLB 5GXBB 2XI9A 1Z0MA 3SO3C 4WI5A 3KDMB 3I9IA 2E6PA 1EHKB 1ZHNA 4JLRA 2LU4A 1FE8L 3EYQC 4W68A 2A6DA 1AFVL 3A67L 5ABZA 2D2CC 1T03H 1BYOA 3EYOA 3ALPA 5INDA 1V55B 4DOHE 1SJEB 4GW5B 5CXPA 4GO6B 4EKJA 1TO5A 3HMWH 1M7DB 4MAUH 5F9WC 2HP4A 2ZUTA 4P05A 2WNGA 2VOTA 4NM4H 4MNGA 8CGTA 4JG0H 4DP5X 4LQFL 3HUJA 4EN3A 4MAYA 4XXDB 3VWJB 2B1AL 3D4YA 2XFXB 3VXSE 2YPKB 3MJ9L 3OPZH 4XMZA 4JFSA 3KPSD 2FEJA 4L05A 1RURL 4F7CB 2UZYB 3KD4A 4XCYB 2OSWA 5HYQA 4U3HA 1A7NH 1S7WA 5F1NA 2HLFC 4KMTH 3DA0A 4HQQL 5HI5C 5KVDH 1IAMA 1CL7I 3DI3B 3RDTD 1RZ7H 4QCIA 2GSGB 3ML9A 1R9FA 2JKLA 1R5IB 3AG2B 2AEWA 3MNDA 2B5IB 4OV5B 3S2AA 2AXWA 3C5XA 3BVWA 3OKKA 4HS6A 3T5WA 4N8PA 1Y1UA 1CGYA 3D4GA 3IU3B 4PY8I 5DD6A 5K9JL 2MCAA 5BS0B 3RJDA 1P4BL 3BC9A 3FU6A 4HSAC 2UY6B 3ECWA 3QCVL 4WWKC 4WI3A 3FT2B 3GC3A 4PWJA 3ARDB 3MRHB 4YGVB 1KBBA 1CLOL 1YEKH 3K8LA 4LOUC 1DN0A 2VSDA 3JV6A 4TULH 3L4ZA 3L7EA 1F4WL 2GJ6B 2J71A 3DIFB 3EJTA 4IS6A 2ZIDA 3BPOC 4PJXE 3LQZB 2XXCB 2PYEB 4Z0XB 5I82A 4RFOH 2C4FU 5B8CA 5GZNA 3RKDC 4GOSA 5E99H 4Y89A 3OBAA 4R3SA 3OR7A 1FH5H 1SZNA 3I84A 1KPVA 4GW4A 3NOIA 2WMPA 3ULUH 2VLJD 1MW1A 4JQVA 1IARB 3SPVA 3D0VB 4EI5A 3NFNA 1QA9B 4Y16B 5C0CE 4X98A 4BFNA 4PG2A 3W0WB 4NQDA 3KYNA 4Y5YA 2Y6TE 4NJAH 4DEPB 3KS0J 4GQRA 3UJTH 5B1CA 3O2WH 1JWSA 3MXVL 4M43L 4XC3H 4IM8A 4KJWC 1T83C 3GZOA 4W9DC 2X4OB 2EIMB 2RQ8A 4J3UA 4Q4IA 1NPJA 1WS7A 4WFFD 5D1QC 1ZLUK 4BH8A 5TDOA 5DA0B 4P2OC 1NIAA 4OSUL 4TSAH 4XRCA 5LBSH 3REWA 1Q9OA 4P3CH 4NCC1 5HHNB 43C9B 3ILPA 2G5BB 3NQKA 1QSED 1XCQA 3T3MF 4A6YL 4XP4H 3MFGB 1T1WA 3D05A 2YUZA 3GSVB 3PGFH 1TU2A 3QWRD 4YL4A 2XC8A 1ZGLM 4ENED 5TFSH 5I1JL 1IQWH 3QEHB 2CMRL 3UEZA 3RIKA 2J2ZA 4AIOA 3FYIB 4XO4A 2WQ8A 3FO1A 3DGCR 3QORA 3L9RB 5I19L 3AREA 1HOCA 2A9AA 2DB8A 1E43A 2GUOA 3N44F 3NZ8B 4GUPB 4PCTA 4OKDA 4JBSA 1NMCB 3QJRB 4LCCC 3RQ3A 1IAOA 2OK0H 4ERSH 5KYUB 1NMAH 2FWLB 3IDIA 3ISYA 3SN6N 4YHNB 1LP9A 2K45A 2LU7A 2PTTA 3O3DB 1F11A 1NMBH 3PDGA 5C08B 2X2JA 2NX5D 4TRPL 3FPXA 1H3UA 3B2PA 5FWRA 3NIDB 2OJ1A 2KMWA 1EEUA 5JR1L 2F19L 5E9AA 4H8WH 3TZVA 2JKJA 4A6YA 2BC4B 1G7IA 3INUL 3P4MA 4PJ7F 3F62A 4JREC 7FABL 2CKBH 2UYLA 3TN0A 1Z9LA 1YJDL 2WLJA 1HKLL 5AZ2L 5T33L 3VFWA 1H3WM 2CLVA 5DEFB 1ZLUH 3QCTH 1CN4A 4GB9A 1Z3GH 3FOMB 1R1CA 2J8UF 2GJRA 5JYMA 3L2LA 2DW5A 2O1AA 3Q1SH 4N0UA 5TDNB 1KXVA 1UM4L 4TUJA 4ZI8A 3EXJA 1L7TH 3VTMA 3D50A 3LTVA 4L4VA 4UBDC 4MMYB 1CQKA 4PI0A 4O9HH 3QQ3B 1LO0H 3SY0A 3SPJA 3MNZB 4IOFD 1P6AB 4FXKB 5F7BA 4XX1E 4S1DC 3IT8D 1ZGLP 4JY4A 3NA9L 4NHUB 2APSA 4G8FA 2J21A 2C9AA 5CZVL 4E0RA 1CLYH 5CN1A 4OCXH 4Q0XH 3NCBB 4ADJA 3ZE2F 2W9LA 5EN2A 4PP1D 4HLEA 5JA8B 1X6NA 4HUUA 1XAKA 1VEMA 4IDJL 3T8XA 5CP7A 4WO4A 5DS1A 2VLKA 4FNLL 4JX0A 5C0AA 4UNVA 2VZVA 3SGEH 5A2BA 2BX5A 3WNJA 2FR4A 1WAEA 1JXGA 3AUVA 4MB1A 2EKSB 3V7AG 3VI3E 4B50A 1JN6A 1KG0A 4E9RA 1VKXB 1ICTA 2EEDA 4L5FE 4AMWA 2W0PA 4TSBH 4LRIA 4MJHA 4K5MA 1S3RA 5DRWB 3KYOB 4FAAB 4HETA 2A1WL 3CX2A 4WTQA 2EC9U 2BWIA 2OR7A 3HN3A 2YXWA 5KEZA 4CU8A 3C5JA 3NIFE 3EAKA 1EH9A 4G6FB 4HWZB 3FMGL 4Q8BA 5CZRA 5FGRA 1Z66A 4CVXB 5EEYA 1BQHB 4Y9GA 4I88A 4UQ2A 2DLFH 2VT0A 2B59A 2AW2A 1QLRA 1UXLA 2CHZA 3MRPB 4JO1H 5B39A 1ADWA 1Y18B 5B3JF 3FFDB 3MLVH 1MFBL 2HG5B 4EOWL 2BOLA 2EE2A 1XF4B 4HALA 4U3SA 3MRQB 4JRXD 2D7TL 1FNSL 4XOAA 2ISDA 2NY3B 5EZLA 4NQXB 3VFRA 1M42A 2AEPL 5LCVH 2YAEA 1W6WA 2C3VB 2VJXA 3KXFA 4DGWC 1V05A 3CFCH 3VXQB 5ICXA 1MF2L 3N1PC 1QLFA 4KUCD 1WO2A 3ZE1F 5JUEH 2X4RA 5E6UB 1R3JB 3MRMA 5I66B 2MOVA 3U1SH 4OZ4A 4OZFH 4X7TB 4PJ8A 1UWXK 1SXBA 4WV1B 4ZOEA 4GKZB 2R29H 1FAIL 2VXVL 3A6CH 3LH9A 3NFSL 4TNVF 1JUFB 4ZUWB 1ES0A 1T5KA 3ARPA 3T0EE 3ULAB 3QXDA 1T21A 1BQLL 2YAOA 1JZFA 1BIHA 4D0DA 3Q6GL 1AD0A 2BNRB 4ZS6D 2DQHL 4PP2A 1HHJA 3S3JA 2F53B 5LN4A 5GGUB 2WKLA 5FKAB 5AW9B 5CUSH 3TEWA 2RMNA 1MXGA 1KB5B 2QQNH 3GKZA 5T1KA 4QLWA 1CXKA 2VLRE 3C09C 1TTGA 5D5MF 3PP4H 5D8JH 4UILH 4WF7A 3TNMB 1W0YT 3QYMA 3F12A 1MQ8A 3D85B 4MMZA 2JQAA 1OQXA 2CUHA 5I0ZA 1H6FA 1NGWB 3BWAA 4LU5L 3R7QA 3JWNC 3QIUC 1G43A 1K5WA 3NSYA 2H3KA 3H6JA 4N25A 3L5XH 4ZFZA 1TPXC 1MCWM 1N12A 2PTUA 4NZTH 4YDLC 2M2DA 1CQYA 4G8GD 3DHMA 2BY0A 3V5DA 1KIUB 1NBZA 1RUAL 3BXNB 4OJFL 4OLWL 1FZOB 3GBMH 1ZANH 2BP8A 1QSFD 2AJZB 5FYKD 2AZAA 5IK3B 5SWSE 3UTSB 3PWPE 3BP7A 1I82A 3BP4A 3AU1A 2NW2B 5BXFB 1NJ9B 1UWXH 5B1AB 4BK5C 4X8CA 1KBGH 1J1XH 4BBWA 1MIMH 4AENA 1D5XB 3HW7A 3LXAA 2XFGB 2UZXA 4URTB 5D71H 3W81A 2F74A 3WS6C 4OY9A 4F7KA 2I69A 3U2SA 1N3NB 2PR4H 2XVGA 4GI9A 3WJJA 3F7PC 4M7KH 5FGBA 2WNXA 4TS6A 5CBAA 2YSSA 5C0RH 4YHMH 2CPUA 3OR6B 3ECUA 3QGVA 4QYOA 1KFAH 4XCEB 4ZFOL 1TF4A 1NCUA 3ESUF 2Z34A 3KL5A 5DU7A 1YN7B 5DRXA 3OKOA 4X6CA 1A7OH 2NUTB 2YUVA 5KVEE 2AFNA 2AXGA 2ZPKH 1KDIA 2GUYA 3K0YA 1WWAX 4JAMB 1AD9A 3AWFA 4UIMB 4HIXH 1MY5A 5IEHB 1IEHA 1QZNA 1JZDC 4U1IB 2BVQA 1IGML 3TF4A 1I3GL 1KGXA 1ADQH 5DZNA 4ALAL 3FN0L 1M9SA 1A7QL 5I8EA 4G42B 4U1NA 3RUGE 4BJLA 2CA4A 2R23B 1S7QB 3FTSA 3IMTA 3IXTA 1T0PB 5K69A 2K4WA 4R97B 4PBWD 2NNXA 2CCLA 2WXMA 5GSRA 2DWDB 3MGTA 3AC0A 4OT1L 3LH8A 1F8TL 1WBZB 3ECBB 4OZFG 3WHXB 3S88H 2BJMH 2WWKO 2I9LB 2H7WA 2J3SA 2VDMH 3OXRB 4XN7A 3CJJA 4AV4A 1JZ6A 3UADA 1RY7B 4OIAA 2Z4QB 3BW9B 5D96B 3QQDB 5FEBA 1U58B 5C0ND 5IFAH 1FNGB 3IJHA 1CD9B 3BAXA 1WIUA 4R0LA 4M93B 4AGMA 4A2MA 1YAIA 3ZIMA 5IBLD 3FT3B 1EHLH 2NY5C 3ATFA 3MRGA 3GMMA 4FLOA 1KJMB 4KXCA 5IQNA 3JWDH 3QCUH 5L6YL 3HMWL 4HKBA 1BBJB 5DJ0B 1DQMH 2P80A 3KPPA 1KIPA 4AOFA 4MAYC 3BJ91 5BRZA 4KO7A 2WUCL 3TYFA 2PPEA 5DHEA 3MRFA 1TVHA 1JZ2A 1E9OA 1SYSB 1M7IB 4QHUB 2YA0A 1IAIH 4YDIH 3SPIA 1EERB 4FQXB 5IJBC 1TQVA 3QWRA 1ZIAA 4FFWC 3CH8A 3MV8B 4OCWL 3GIZH 3A4FA 4QXVA 3ZHFA 3LCYA 1YC8A 1UXSB 1MFAH 3IKKA 3FO9B 5JTWA 1TZIA 3MV9A 1GGTA 3IJEA 4NS0A 4F7MA 1IC7L 4YSSA 2W9EL 5F0PB 4FYQA 3UMTA 5JW5B 4ACPA 5LKNA 1P7QB 3NIGB 4MNHB 3IVKB 3CCHA 1XSIA 1WAAA 1E9QB 4BSVB 3MBXL 1YA5A 1RI8A 3RJQB 3ZSTA 5KVDE 2NX5A 4TM9A 1UQSA 4HK3N 4F8TA 4HOMA 4YDKH 1CYGA 2CRMA 5MHSE 4F8QA 5BW7C 2OMTB 4G6KH 1R3KB 3KW8A 4JEGB 2Z31C 4WUUD 2AAAA 2N7AA 4OGXH 2ITFA 4YXHH 4BWTA 4GG8B 3DRTB 4QO1A 4HMCA 1RJCA 1K4CB 2Y7MA 1NCIA 4MD0A 4F2ME 2JJTA 5B8CC 5GZNC 1HINL 2AVFA 3DWTA 2EIZA 1XF2B 4NUPA 1JMZA 5I30L 5IT2L 1TTBA 4GS7C 4KQ4L 4RFOL 2BS71 3U30B 5E99L 2NZ9D 3OJDB 4ZD3H 5CKAA 2GT9B 4HZAA 1N59B 1FH5L 3S96B 3TBCA 3SKMA 3FT1A 1BECA 3ZE0B 1LE9A 3EGDA 4JFDE 4L8CB 2AS5M 4LLAA 4YL9A 3OKDA 4GKSB 2CNZA 5BOZG 3K2UL 1QX1A 3LEYH 3RZWA 2FATL 4CVZA 1QFWH 3SKNB 5JIKA 3B43A 3QIBC 4KXZH 4LSPL 4M48H 4MVBD 2GEEA 3IFNH 5AL0A 3FSZA 1RP8A 3V7AE 5CR1A 4YAQA 3ULUE 1SBSH 3VB9A 1CCZA 5IM7A 3CK0L 4NKOA 4EO5A 2JQZA 2NZ1A 2N59A 1S9XA 1RJLA 3QZLA 4OCNC 4POZD 2Z1PA 5EU3B 5F44A 3VNZA 4I0PC 4TTDD 4P3CL 2IPKB 3WV0A 2YRZA 3BDYH 1IKNA 2CH8A 2OTWB 4XP4L 1G9NL 3RY4A 4PJDA 2NY6D 3PGFL 1ZSDB 3MCLH 5EF2A 2MQ3A 4UOW1 5DSCA 2BZDA 1EZVY 3FU7A 4W9GC 3LNIA 3X1NA 1X9QA 4X7SL 1TLMA 1IGJB 1P2CB 3K8KA 4G9FD 4G80A 4YR6A 2JXMA 3IKCB 5ID0B 5DK3A 4OZHE 3Q5OA 4CW1A 4H7VA 1FFNB 3EOTH 2DWYA 2Q86B 5T5FL 4LLUA 1EUTA 1DP0A 4FQ2L 1WZ1L 2APXA 2EH7H 3CN4A 4HIEB 4QT5B 4ERSL 3D2UD 2WLHA 2OK0L 3DX0A 2WBWB 3HMXA 5E5LA 4RNRA 4Q2ZA 3G08B 5ADPL 3VJ6A 3K3QA 1MY7A 1CK0L 3QK0A 4ZMLA 4KK6D 1IL1A 4OLZL 4H8WL 3P30L 4JRXA 1YHPA 4S1QH 2BERA 1L9RA 1DBBL 4I3SL 3TN0C 4Z77A 5BV7L 1NDMB 1R3HB 3BSZH 3TH3T 1M9WA 1PKQA 1PZ3A 4LP4A 2XWDA 3MACH 5E70A 4LLDA 4RGNB 5ALBH 3V8OA 4KKNA 3BH8B 4R96B 2VC2H 1PZDA 1HHGA 2XTJB 4HJGA 4Q74A 4EXKA 5B4MD 3ME0A 4Y2DD 3RVTC 4NNYB 5TQ2H 5FS5A 1J9QA 1EV2E 4Z8FL 2A4EA 2JB5H 4A7TA 3VXTB 3ZTDC 2CJUH 5EC1A 5DLMH 5T5FA 2HRPH 1L7TL 1GHFL 5AVSB 4PBXA 5HYJD 4Y4KB 4GXVL 1R24B 2N7SA 1JERA 1UA6H 1A25A 4HCRH 2K4AA 3V5KB 4GINA 3PRZA 5L9DL 1S7SA 3TBWB 1NAKH 2VDQB 4DVBB 1JJUA 3NCXA 5FYKL 3K71A 3BDBA 4NN7B 5E6IB 5FCUL 1IO4C 3LMJL 4ORGB 2PMZA 2WBJD 1P7HL 3QPQC 1WTGT 3P4OB 4OJYA 3STBA 3PIQB 3AQDA 3ELAT 1GYWA 1MWAA 2DKMA 3EG9B 3EO1A 3O6LH 1Q72L 4UQ3A 3LRHA 2CUAA 2Z7UA 1YJDC 5FDWB 2XN9E 5BVJA 1JS4A 2FUQA 4XAWL 5E2UH 2J8OA 2BFVH 4ZMNA 1QMUA 3MRKA 4LOVA 1I7TB 2JKNA 2XX0A 3V52H 1AMXA 3N43F 6PCYA 3GGWA 2BXYA 1A6UH 1MI5A 4QRAA 4APXB 1QNZL 1RERA 4YC2B 1D5IL 4AMKL 5CEXB 1LP9F 3FL7A 3GMRB 2CWRA 4L23A 1P0SE 4DAGL 5JW4R 4L8SA 1YDPB 4G8GA 1H15A 3B9EA 2GYSA 1DDHA 3D5OF 2ZP8A 4P4KD 2VWEC 2AK4D 3T6WA 3ABGA 1QSFA 3ROLA 4PV8A 3HTLX 4MB3A 1BJ8A 1HI6B 1FA4A 4DEWA 2AJVH 3BEWB 3QQ9D 1NZRA 2VQUA 1ITCA 5IB2B 4NAQA 1ASOA 3MRBB 4U7KA 4F58L 3V4PH 5FWQA 3WEXB 1FC1A 1ED3B 3TT3H 2A9MH 5GISH 1BMZA 5ABAA 1IMHC 4G8AC 4CSSA 2BINA 2Y6SD 3BCDA 3MUJA 3WLWD 3U9WA 1NFIB 4FCAA 4A1RA 5JHDB 3TONA 2X9ZA 3W11C 5EIIA 2O93L 1BQKA 2RQEA 3LKSA 4LE8A 5JUEL 1NQBA 3KLAB 4LLMA 3F3HA 3QRBA 4PJ8C 3QDMD 2VM4A 1WZKA 5E4EC 1XIWD 3I9GL 1NGPH 2A2QT 1F2QA 4C47A 3IDXL 3M8OH 5I16B 4X4XA 2V2WA 3SDXA 4BZ2L 1QHOA 2Q8BL 3LH2L 5J1AA 1UG9A 5EWIL 4KKAD 3RZCB 5JIHA 2WLZA 3V0AC 1LK3H 1JBJA 3GSUA 2XWZA 2JKTM 3C08L 4H4NA 4P9HC 2DI8A 1L5GB 2QSVA 2PWHA 4MJIE 4F37K 5KG9B 3LNHA 1ETA1 1DBML 4MCMA 3S6CA 3TL5A 1I1YA 5DD5L 3CBRA 1UASA 3HI6H 3CG8A 2QQNL 1X9LA 2CKNA 3MCKB 4PW3A 4NO3A 4GKLA 2P7TB 2NW3B 35C8L 3BKYH 1FVCA 4UILL 1E5ZA 4ZXBD 3WUWB 1ZCRA 2BP5M 2C7UA 1HVXA 1X5IA 3BAIA 2WXIA 3F2LA 3UTQA 3VFGH 2XG4A 4OZIA 1MVFA 2LTQC 1XH3A 5BJTA 4M7LH 3WTVA 5I75C 4GIPD 3VX0A 4ZMAT 4ANWA 1T5XA 3QJHA 3WFBL 4KTEH 4WHTB 4ZO8A 2H0EA 4LRNH 4BZ2A 3O9WD 3SGKC 1A4AA 1RJZA 2G3XA 2BO0A 4WFED 3BAEH 1N5AB 1HSAA 1KEML 1DSYA 1KIRA 4PWEA 5FYJD 3BKML 4U1SB 3QJOA 5D7KE 4MWFA 4QKTA 2DQFB 4YE4H 5JO5A 3BLPX 4EN2A 3NJXA 2Q8AL 2B9BA 2XKNB 5DD1L 3MMEA 1QPXA 2DTSA 1K6QL 1J1XL 2WXPA 4PB9L 1G9HA 4WSKA 4X99B 2BSTB 4ODWA 1K8DB 2VR7A 3RL2B 3Q8EA 2VDNB 1AGDA 4M7KL 4H5SA 1U8NA 4QWWC 2P49B 2MCG1 3ZDXE 4Q9QL 1U2HA 2R56H 4HEME 4K3EL 3L1GA 3RWGB 4HH9B 1CE6B 2BPBA 3WFHB 5D93C 2PXYC 4UAOB 4AM0B 3K2IA 1IM9B 3FQYA 3CLEH 4Z3TA 1I8KB 2R0LH 1U33A 1A7OL 1SDDB 1A9BA 1UGKA 2SODB 3LPFA 5IMLA 5IJKA 3HZYA 3NABH 2F6AA 4ANKA 1V3LA 6PAZA 1BGXH 1P5VA 1HCZA 2KBGA 1C08B 2K6YA 4APQB 3DX6A 2AQ1A 1FSKC 3APDA 2X89D 4JKNA 4NI6A 5CZXD 3CH1A 2G3MA 3DX3A 3ARGC 3LQAH 2OZ4L 2XPYA 3DUUA 4PI2A 3UC0L 2XCMC 1NC2B 1NICA 4WUUA 3U82B 3RPIA 4X4KA 3M1CA 2KH2B 5DYOB 3MROB 5LXGH 2QFPA 2MNJB 5C07E 1AR1C 1KBVA 2MJWA 1RLBA 2X28A 3KPMB 2XWBA 4QLRA 1BV8A 2W0LA 4PJAF 2AK1L 4WJKB 2EO9A 4I1PA 4GRLD 3S35X 3UJIL 5TH2B 2Q76B 3MZGB 2DDQL 4DGYL 1CIDA 1WGOA 1C12A 4JGUA 3BD4A 5L4IA 3IJ7A 3R1GH 2Z91B 5EV7A 4AJWA 4NRZA 4DGUA 4OUOA 4NNPH 1I8MA 1Q9KB 5DF0A 1JXDA 1BXVA 1KLFA 1OTUC 3FAXA 4NNXB 4P2QD 5I1HH 4LIQE 3PHQA 4UUJA 2OZ4A 2NY2B 4JKPH 4RISL 3V6OA 3WKML 1GKOA 4P3WA 5E8EA 1IVLA 1CFMA 3K91A 4IW4C 3B4NA 1T0MA 1R6VA 3HZMB 4X0KA 4BXSV 2DYPD 1L3NA 1ZEAL 3E0GA 3RA7L 2C9UA 1N7MH 1WWCA 1YY9C 1J9TA 2HFEA 1OTTD 2BCKA 2W92A 4U6YA 4YDIL 2YC1B 1JTTA 5AUMB 5F89B 3GI8H 5ENWB 2E59A 4M5ZH 1UXWB 1ZRUA 2AQ3A 3B5GA 3BH9B 1GC1L 4J28A 2NR6D 4AV5A 4HBCL 1MAMH 2JI2A 4NC2B 4G9FA 1RZJH 4UM9D 4W70A 3EHBB 3MYJA 2I07B 5AQ0A 3FN9A 1FLRL 5DJ8A 1A6ZA 2F54E 2MWCA 5GRWA 3HI1A 4HIHB 3U9UB 3D2UA 5EEZA 1EZUA 1NC4B 4EVNA 2UVFA 3IE9A 1RZGA 1ID2A 3RWJB 4JW3A 5TE4L 5TE6H 1BF5A 4QTFA 4H20H 1F0LA 3BSHA 1AHMA 3TBSB 4JMNA 3VXSD 3TA3C 3GZPA 1B4JH 2H2PD 4I1RA 2DMGA 5HI4C 4YLCA 1XCWA 3C6SA 2H6PA 5I1KH 1CLVA 4I2XE 3ZDZB 1AR2A 4JZJB 2VXUH 3GSWA 3EFDH 2BSBA 2CUMA 1MCBA 2X4PB 4PY7A 2YGVA 2VLME 4JMXA 3UL4A 2QDVA 2DY2A 1ROWA 2VN3A 5DEGB 3CDGA 3EGXB 3EUUA 2PPFA 4KO9A 4V2BA 2D73A 3US1A 3QH3A 4C56B 1AKJA 3GZKA 1MJUH 4Y5XB 3L6FB 4Y2DA 3GBEA 3BUBA 1NCBL 4HS8H 1F3DJ 2W80C 4ZD3L 3FRPG 3MU3A 4PW4A 3WO4C 5E94A 4HJUA 3HVNA 1LEIB 1BQRA 1INQB 1MZZA 4Y9CA 4CMHB 4J39A 2MCPL 4PLJC 3DSFL 1KCUH 4FMFA 4LNVA 3WDJA 2ZQKA 4C59B 1X3DA 3CVHA 3R0NA 4JANA 4KMLB 1OM9A 1ZA3A 4ODSH 5IB5A 1DFXA 4JKKA 1Y7VA 2WBJA 4M8QB 3FTZA 4RDQF 3WD5H 4KHXL 3VA2C 2ETWA 5HGHB 2NDFA 1VPOL 2Y7LA 1QVOB 3SYCA 1RIHH 5DUBB 3RRQA 4FNPA 1IKNC 2N01B 1X9UA 3LEVH 1G0XA 1GMEA 1AO7E 4QRFA 1MH5B 5DK0B 2YJQA 3GJFA 4G3YL 3ELQA 4M9OA 1WFNA 1LILA 3WMSA 3L9YA 1FL3B 5EOQL 4U6HA 1PX8A 4Z7UA 3LNGA 4ZUSB 1Z9PA 4RWYL 1WAAF 1UB5B 1ZHKA 4KV5F 5KVFL 2X1WL 1EZVX 4LOEA 1M2OA 1AGBA 1KTJA 4NO2A 3VVVA 1A6VH 2EADA 5SWZB 3UO1L 1OKEA 5K59F 1VGEH 2CDEB 1A14H 3A4EA 5LO7A 2WINA 2V17H 4OCMC 3GSRA 3CQQA 4AIEA 2GCYB 4QTIH 2VDRL 2AK4A 3UZVB 3ZL4L 5HYSA 2GITA 2Q6WA 5BCAA 3NCCB 3RJOA 4N87A 4Z76B 1LEGA 1BZ9A 3ZT5A 4K71B 3NCWA 4FKEA 2J1WA 5JOPE 1U36A 3CGTA 3LPPA 5HHOE 1FRGH 4JPKH 4GSRA 1WDAA 3O2DL 1G9NC 3QI9B 5I74C 1COBA 2IFGA 4S1QL 4JE4B 3HBZA 2F8XC 4GNKB 5C1MB 4QHMA 4LSUL 1OE2A 2FBOJ 5T3XD 1PIGA 4PIBA 3MACL 3UYRH 2ZOLB 1RULH 5ALBL 2A73A 3VWJD 3LY6A 4H2CA 2UWEB 4AEHL 4MD5A 4Z7QE 3ZR5A 5JW3H 3ZDYE 3ECQA 2OCFD 3QDMA 5TK2A 1E7VA 3F01A 3QUXB 4PJCB 1XIWA 5TQ2L 2JJSA 2JB5L 3AVEA 1BWMA 1THAA 2I9TA 1Z9SA 2D31B 2CJUL 4PG9A 5DLML 3P3SA 4N0FB 1I1AA 4DP8X 2HN7B 1UA6L 3AT0A 5B3NA 2P42B 4HAGA 4ONHB 4HCRL 5A40E 1JZIA 5IF0A 5J1TC 4S1SH 3G6JB 4M9PA 4MXVF 3BZEA 1U8MB 1I9RH 1X5KA 4H8WC 1CICB 5L7XL 3MLUL 1WHPA 5BV7C 4U49A 5B7MA 5BS0D 1QKZH 4GUQA 1QRNE 1D7FA 4OM0L 4J8QA 3O6LL 5JW4Q 3JVGA 3UYPB 5E9DE 3QFDB 3FCUB 4J3OH 5IOKA 2YPVA 3DJRA 2BSSB 4ZXBA 3VRLE 2NLJB 4N28A 2DMCA 3FB8B 1IGCH 2EIEA 3V52L 3FF8A 4FQPA 2GJ6D 2EVGA 1A6UL 3ES6A 1UCBH 4WNQB 3QSKB 1L9TA 3SCMA 1PBYA 4X9FA 1AAJA 2EXSA 3DJTA 4L8SC 4OZGB 5CJ5A 5DHVH 2VDOL 2PYED 1C16A 3P9LA 4WCYH 3S8FB 1GIGH 2BM3A 1FFPA 3O9WA 4MXQC 4NEHB 5AL8A 2D0GA 1RZFL 4PAZA 1H6EA 4WTZG 3D3VA 3O6FB 3Q0HA 4R2GB 4LP5A 3H7BB 3W2DL 4ZNEE 5IHZB 1YRKA 3ARBB 4PJBA 3C2AL 3IFPA 1QWNA 3R0MA 3RI5F 3O3EA 1UA3A 5EPMA 2YXVA 5JXED 3W0WD 4JN1H 3TA4D 2R9HC 1FAKT 2IXQB 4U1HA 3BZFB 1TMQA 1TJMA 2HVJB 5GJSH 3RVUC 3ARQA 1S7VA 5HHXH 3UIZA 1GZHA 3WL9B 2JMRA 2BVPB 2XQYK 4ZUVB 5CP3A 3S8WA 2FYVA 5IFJB 1DUZB 4XT1C 5AVTB 1TDQA 3JTSA 5EF3A 1NFDA 3VH8G 4CNIB 5CN2A 1QABA 4LARH 3QWNA 4FADA 5E08H 1A9EA 3L3OA 3V0IA 4BFIA 1NGPL 2NY4B 2Y5EA 4XNUH 1SBBA 3TNNA 4L3CA 5CJQH 3JV5A 5JQHC 4H44C 4DP2X 3FRPB 2Q87A 1I7UB 3E6HB 2WYZA 1OGAA 2ENQA 1J88A 2IAAC 1VGKA 2JQMA 3ABKB 1LK3L 4AWJC 3QZPA 4RMUA 4KKLD 5K9OB 4TV3A 1B3IA 4PJ9A 8FABA 4Z7VB 1YPZB 3MLSL 1FNHA 3UDWC 2X89A 1CBVH 1X4XA 3QRLA 3GUTA 5CHNB 2DKSA 5DMKA 4HH8A 5C08D 2I60H 2NY1C 2EO1A 1JTPA 3X14A 4UTBA 3ZMEA 4Y19A 5K1NA 3LHPL 4R4BB 5D1ZB 2ADGB 3BVDB 3WIFB 3VFGL 2BWDA 5GS2D 1I1CA 3ESPA 5EO0A 1DQIA 5F8QC 4CGTA 3B6SB 1XF5B 5E8PA 1IGTB 4K3JH 3T0ED 4M7LL 3HZKA 3QUML 3RVWD 1NIEA 2VJ8A 4KDTC 4ELKA 4L2YA 2WNWA 3KLLA 5F9AC 3GWJA 4ZMWA 1KXTA 1XSJA 4RZCB 1E6JL 1SUHA 1NCNA 4Z7WA 5F21B 1B0GB 1QLEB 1T3FA 2WQRA 3BFQG 4XC1H 2N4IA 5EUOA 4OJCA 1UM6H 3LXCA 4O02H 2VLRD 2K9FB 3TJHD 5IKCA 2UXTA 1U92A 3UTZA 4TKWA 3PE9A 4P2QA 5HP5A 4HJJL 5LNDA 4YE4L 1DJZA 5FHAL 2HT4D 5H2BA 1AQKL 2AJXL 2BIIA 5IEKB 4YSPA 4O2EA 2R7EA 5I24A 4KK8D 2DM7A 2DYPA 4FQLL 3NCJH 4IRZL 3U0TA 4A68A 4NCDA 1GGBL 4M8RA 3S34H 1MNNA 2P5EE 3G5WA 4NC1E 5F6IC 4HU8A 1YCSA 3SDXF 3KPOA 4KRLB 1PKOA 3OHXB 3G04B 3HC4H 4JHUA 3G5ZA 3PABB 3QUMA 4PD4J 4KY1H 3D9AL 2F61A 4A7GA 4MNQB 4MQSB 4HHWA 1J7VR 2NR6A 5IBTL 1MJ8L 1E4XH 3IM1A 1E27A 1JPEA 3CLEL 4UM9A 3P2TA 5AKRA 1R5VB 1WICA 2GJZB 3L13A 1NM4A 3QXAA 4ONGH 4FA8A 2X1PA 3FFCE 2ZUUA 3S36X 4X5QA 5ES4B 2IH1A 3MRRA 4NDMB 1OPGL 4PJHE 5ESVB 2VMEA 1VADB 4OV6F 3HNSL 5IVXA 3OAUH 2C1OB 1HCYA 2RB8A 2COQA 4LLQB 2H6UA 4F8PA 5D2NE 5AAPA 3C6LB 5LG6A 5IHLB 4H1LB 1CG9B 3DI2B 4L1BA 4OZIF 2VDPH 4LEOB 2Z92A 2VZOA 4IRZA 5J13B 5I73B 4RDBA 2FX8H 3LKRB 1T7ZA 1HWWA 2RBLA 3CXHJ 4X6DE 3QQNA 1AS7A 2AZUA 2CLRA 3FCSA 1CDIA 1UYWL 4DEUA 2NY0D 2VITA 3UAJD 1CFNB 4F9PC 3D18A 1WTLA 1GJWA 1AXSB 5DJ2A 4J3BA 4PJEB 3S48A 5KS9E 4XP6H 3TYGH 2D0FA 4AQEB 3IFOB 2XHNA 3EBGA 5LUMA 3R1GL 2WKGA 3ML8A 4R8WH 3JZ7A 4AG4L 2OJZH 2Y72A 3FN3A 1N6VA 3H9SB 4HGWA 3CPLA 1JTOA 3MJGX 3PWJB 3F58H 1BX2A 5ESQA 1C5CL 2DQ6A 1ESOA 3F6LA 1VB9A 5JXAL 3FQRB 3EOBB 2RJMA 4FG4A 4LVNB 2BNRD 3LKOB 4JKPL 3AGVA 4P23C 1QSZA 4PJXA 4GYBA 4MZ2A 4NQUA 1RZQA 4HCGA 1SN2A 1E6OH 3O4LB 1J8HB 3AADB 3PL6C 4TOYH 3IWVA 3OKEA 2XNAA 4JPWH 4HWUA 1T04B 4Z7NF 5F3HA 1XR9B 5J6GB 1JNHB 5I1AA 4NWUL 3DHUA 4QOKE 1IAKB 2XWEA 3MX0A 4LSQL 4ONOA 5I71B 1OT4A 1L0PA 3S35L 5T3XL 4NZFA 3KZ8A 1E4KC 3D85D 3NCMA 1EFXA 3AU0A 3EYVA 4G6MH 5JPMA 4DP1X 2XQYG 3OGOE 3ZDXF 5AAWA 5E8NB 3CUPA 3KCPB 2X70B 2P8PB 3INOA 3RURA 3MRLA 3OD3A 3D33A 3HNVL 2R59A 3KLHC 3KDMA 3PGCA 1JWMB 4URKA 2C9RA 3HAEB 3JWDC 1H8NA 2F15A 2R51A 3B9KB 1JPST 4DKEH 1TITA 2HXAA 3H0TA 4XNMB 4AKQA 5T1JA 4W9EC 5EBGA 2YLHA 4FQQA 4HXBL 4WJG3 3T2OA 1A1OA 4XWGH 4FNQA 2VAJA 7CGTA 4WK0B 4M1CC 4GW5A 5AYTA 2H9GB 2PWDA 4QRQA 4DW2L 5CZKA 1M7DA 4UZGA 2QZ5A 2VXUL 3EFDL 2A74B 1G7PB 1KB9J 2NUPB 3B7SA 1S5HB 1WITA 1Q94B 4P07A 3L4UA 2ZICA 2ZUWA 3H9YA 1A6TA 3IJ8A 2OSXA 3VWJA 3WTUA 4IIQB 4XNZC 3L3JB 3RGHA 5E00B 2F5AH 2XFXA 4A39A 3CBKB 3WFEL 2YPKA 4IKJA 4KC3B 4ZMZA 5F1KC 2WIIB 1BMWA 1OAZH 1W72B 5CJOL 4F7CA 1PZBA 2UZYA 4XCYA 4XP1H 3GMLB 4YGAB 3IDGB 4UDTB 1JI1A 2IOMA 3OQRA 4R4FL 5MHSD 1V5JA 4N0CD 4CL7A 3IMSA 3TO4C 5GS0H 5J7CC 1MLCA 5CKGA 2GSGA 1R5IA 3CZKA 4OV5A 4U1MA 1H8OA 4BFRA 1DDTA 4Z1PA 1TZGH 2ESVB 5DFAA 5EZJB 3B7YA 1XCXA 2NQCA 2PABA 3QUZB 3SDYH 3IU3A 1HHHB 3BWUC 4V1DB 5HVHB 1A3RL 5BS0A 3WTXA 2ZX9A 1Z3RA 1WLHA 2R2HB 2UY6A 2X12A 1JIBA 1FG9C 4UTAH 4BUHA 4GG6E 1RIHL 2CO7B 2QQLH 3VXUE 3ARDA 32C2A 3MRHA 2KYIA 4YGVA 3TBBA 1KZQA 1V7NH 3LEVL 4F80A 3WJLA 4JZOA 1X5AA 4GSDL 1MVYA 4BWWA 2GJ6A 4LPCA 5IFHL 2JKIS 4KJQD 4K5OA 2J88L 4Y9FA 4Y1AE 1NDTA 3FRUA 2EXWC 2YPLE 1CUOA 1CPUA 2PYEA 3FHEA 3QUHA 4HOXA 2ATKA 2DBLH 4G72B 4KZCA 4R7NB 3WUZA 1A6VL 4L48A 1T7YA 4OJDH 2ADFL 1A14L 3ULUD 2VABB 1BMGA 2P28B 4QTIL 3L2MA 4GIOA 4XCCL 4BKTC 3WTSA 1DVFD 1ZJBA 3DHJA 5EO9B 1BZDA 5D4HA 2XT1B 5KTEL 5LGJB 2X0UA 1QA9A 4K94H 4Y16A 5CIPH 3IRPX 4FTVB 5EUKB 4CN6A 3W0WA 1ZJAA 4W6WB 3PXJA 2OM5A 1X6LA 3RTQD 4AL8L 2C1PB 1QASA 3SPHA 4FN0A 1ZA6A 3W3BA 1FRGL 4JPKL 1CZ8L 5BO1H 5L8LB 3K6DA 4JL2A 3VI3A 5KSBF 4O51A 4QAMB 1A02N 1IC5L 2XJLA 2X4OA 4EZJA 1NGQH 1I8IB 2R39A 2AJUH 4LCUB 4R7DB 3UYRL 3GZQA 1RULL 4MQXD 3OMZA 5HY9A 4GEIA 5D72H 43C9A 5HHNA 5FO7B 5GGVH 4PHZA 2I32A 4D3CL 4FQXD 2JH2A 2J55A 4X7CC 3X13B 4QXTA 1P69B 1I1AC 3KPLB 2BZ7A 3PQYE 5D1XB 1OTSD 1NANI 2VXTH 1DBAH 5AKVA 2GBAA 1JGEB 4H8PA 2RACA 3QBTB 4O2CA 2ZUQC 5AFAA 3BWUF 2ZSVB 2OS7A 3UACA 3L9RA 1OALA 4QRRB 5SV3A 4GUPA 3NZ8A 1NGYB 2EDTA 2VQ1B 4Y88A 1TQWA 2XWCA 1CFBA 2HPOA 3ET9F 4JZNB 1NGXB 3GSXA 3O41A 4YHNA 4MMXB 5CBEB 1PG7W 1RJYB 5IUCA 3DROB 3ILQD 4N2CA 5C08A 3IFLH 5IVZB 5DGRA 2IDQA 3CMGA 3IWUA 2APTA 4FXGB 5C9JB 1D7BA 2WC7A 2XRAL 4BUGA 3ZZLA 2WLIB 3KWVA 3KM1A 4R9HA 2BOCB 2JCCF 2EECA 1HAUA 1I4FA 4BE5A 2BC4A 4JNXA 1FO0H 3SCMC 1L9QA 1FC2D 3L45A 5AYUL 2VRAA 1UCBL 3P69A 3NVQA 4K7FB 4D9QE 3X11B 1ZWIB 1OLZA 5D70H 3W9DA 4JN2B 4HVBA 1QWUA 3L95B 5SWQB 2HRHA 1UEYA 3FOMA 15C8H 4NGHH 1HK6A 4L3EB 1KPRA 4MS6A 5TDNA 1X5LA 1DHKA 3RIFK 4MCZB 4FI7A 3KBHE 4LGSB 3VWKB 1F6AB 3MOBH 1YMHA 1SMDA 3IU4L 2VLRA 5ECGA 1BEYL 2KHAA 2X0WA 4MMYA 4TLUA 2XN9D 3QQ3A 4M3KB 5DHYB 4ZO9A 5J8OA 1WC7B 4Z7IA 2IGLA 2K8QA 3MNZA 1AGEB 4AYID 2C4FT 3B3IA 2CAKA 1JV5B 4TPRL 4NHUA 2JK5A 2UZIH 4L9DA 3II2A 5HHXL 2HJFB 5AZEH 5D7IF 1TQUA 2Z9TA 1OP5K 1UOLA 1GVIA 3UERA 3IMUA 1BPVA 2X1XR 2NXZC 4QHNA 4ZTPH 2E9GA 1EAQA 1EDYA 4BRJA 2H0PA 1QZ1A 3CZLA 3EJJX 3VB8A 2EKSA 5CJQL 2QGCA 1A6WL 3PUUA 1INDH 4NBYB 1G9EA 5DRWA 4YBQD 4LGRB 1TFHA 4PJ9C 1DBJL 4WW1A 2L8AA 1BP3B 1KTDB 4BIKA 2L7JA 3WN6A 5ISZB 1J0HA 4PJGB 4KQ0A 1LO4L 1ZV2A 2YZ8A 4HWZA 2LE9A 4YSUA 3GXUB 5HD8C 3FDWA 1CBVL 1GGIL 3ZGIA 3EZ8A 1ACCA 1S46A 4ORZC 2V33A 2P5WE 5KSUB 4RSYA 1E28A 1HJBC 3P0VL 1X9RA 3MRPA 3S3CB 1F6FB 5DJCB 3FFDA 3BIKB 2V5SA 3D07A 2HG5A 4GT0A 1ZKAA 1XF4A 2V9RA 2X4TB 5EU6B 3S37H 3MRQA 3Q06A 2F7IA 1KB5L 3HPJA 2FB4H 1B2WH 3T3PF 3HC3H 2ZKHH 3UAJA 1SJMA 4K3JL 4MDJB 5CSZA 2C3VA 2KPWA 3CXDH 5I1LB 3VXQA 3IMRA 1FDLL 3ZBMA 3VGHA 2CIKB 4MJID 5DJAB 3F5WB 1AVAA 3FQUB 3V6ZB 5EDSA 4ODBD 4L4TE 2K1MA 4G5ZH 1OP5H 2OFQA 4XC1L 3MLXL 4WV1A 3O3UN 3P73B 2G0LA 1VIWA 4AGPA 1K3ZA 4Y4KD 3CVDA 5E2TH 1JUFA 4ZUWA 1AY1L 2BVOB 3EJQA 2HAZA 4FLHA 4YDZA 2XPGB 3CDFA 4WTXA 2BNRA 3LSOB 1QFPA 5EOCH 3VG0H 4QHPA 3MFFA 5FK9B 4FFTA 4CSZA 5GGUA 4AZ8B 3T6VA 5FKAA 1L6ZA 4ZDHB 1MRDH 5J0BA 4FQJH 1YEJH 3C8HA 4Y7MA 1X5YA 2WZAA 1KB5A 4HUVB 1NDGB 2X3CA 4NCC2 5A1AA 3HC4L 4FXTA 1YECH 2D7QA 2Q7YB 3C60D 1LO5A 3D85A 2XZAL 5CU9A 1NGWA 5D7KD 5FOJA 4U33A 2KDYA 4JDEA 3BUDA 4ZUTB 4YSOA 5D4IA 2WIMA 3N85H 5D7LE 2ZCZA 4OAWB 1HH9B 4G9DB 2J5LB 2V2XB 2DEXX 4X8JB 3P02A 4LL1A 2XA3A 2OCCB 3FUNA 2XVKA 1KIUA 3NACL 3BXNA 1QQDB 3OHMB 5AW6B 3VGAC 3WLBB 5HJGA 2ENSA 1FZOA 5EDXA 1K4DA 4WEBL 3GS4A 4KKCC 3MZTA 5IK3A 3G7TA 3UTSA 3QDGE 4N2FA 43CAB 5LJYH 4EIGB 1WT5C 2NW2A 4UQIM 1NJ9A 3THML 3U83A 5BXFA 1XD1A 5I18L 4IOIA 2FX8L 1JZJA 4K7PX 3PHAA 5HDBE 3W38A 1Z0NA 3CLFL 3K72A 5DEJA 2QR0A 3KGUA 5FLUA 2OL3H 3KE0A 3DVGA 5KYYB 4D8PB 1EQWA 3G6AB 5C6TH 1CF8H 5B21A 2A6DB 3S36L 3DETC 4FABH 5JQ6H 3F04A 5EH1A 3P9WB 1MCPL 1JHLH 1E3FA 1GGCL 2XZCH 3EYOB 3J7HA 4XZ4A 4XP6L 5C09E 2FIRT 2A5UA 4XHJD 4UF7C 1G6VK 2E74C 2DQMA 4KKRA 4ELMB 3BDXA 3SYAA 2VN7A 4ICXA 5EEUA 1ZHBB 2BWQA 1TJIH 2EDJA 1SLXA 2NUTA 2FECI 5LVEA 2E75C 1KNOB 1J5OH 2EEXA 3P77B 4GAYB 1OHZA 1OT1A 2XQ0A 1HEHC 3EGSA 2FT6A 4HAFA 2ZOWA 4EN3B 3HUJB 4K7PH 4K73A 1X7QB 5IEHA 4F2MA 2O5ZL 2EXYD 4YSQA 5C07D 3ZZQA 4EBQL 1NBCA 4A7GF 3H7LA 4OI8A 1MCDA 4Q56A 4OGAD 1A2YA 4GEJA 1NSNL 3PWVB 2FT7A 4HEPG 1JYXA 1S7WB 2EYSB 2MSPA 4Y2NA 3VFPB 1VZGA 1KYFA 4TVPH 5A3ID 4G42A 3LD8B 1J86A 4EDWL 3DO7A 3ARZA 1PY0A 3OKLB 2R23A 5F7FA 5JPMC 4PHXA 3AQXA 1TCRA 1A4JA 5A2JH 2DTML 3BP6B 4P2RE 3MBED 3OKKB 3BQUC 5IVXF 2QSCL 1RLWA 1WBZA 3ECBA 5F7EH 1RUPH 4J3XA 1E4WH 3QPXH 2I9LA 4G6AC 3L5JA 3OXRA 4OBRA 4P0DA 2ARJQ 1DQLH 3EYSL 2P8MB 2Z4QA 3BW9A 4X8XA 2APBA 3QQDA 2BS8A 4UQEA 1RUQH 1DVFA 1FNGA 1BD2E 1B3JA 1DN0B 3QDAA 2ZX6A 5E8DH 2X1OA 4Q14A 4PJHF 4E41E 1S8DB 3W5MA 3U2IA 1MJ7L 1FVDA 2X88A 3FT3A 2FX7H 3ETSA 3M45A 5AOMA 5HDQL 4YX2H 1FH2A 3I6LE 3UPAA 4TQEH 3TJEL 1M56B 2PN5A 5AAMA 4R3SB 4HJSA 3OR7B 5C0BB 5LBSA 3RWEA 4W1TA 2NXYB 4YBLB 5AKSA 5FB8B 1RZJC 1SYSA 2WMPB 4M5TA 4QHUA 5B38G 1S9WB 5I76B 1JHKL 3FZUD 2YAFA 3NFNB 4FQXA 4CC4C 4X98B 2E7MA 3LQMA 4NQDB 4B9GA 4NN6B 3APMA 1BZ7A 3MV8A 4HK3J 2L7QA 3IDMB 3K1DA 4X7FC 1JWSB 1UXSA 1NCAH 3FO9A 4AYEC 5KS9F 3GNML 3LOWA 2WZ0A 4Z3EA 4OIBA 3U7YH 4LEXH 2WO2B 3U36B 4BH8B 5JOEA 5JW5A 3B7TA 3HB3B 2EAEA 3QUYC 4LEEA 3WEBA 3E8VA 2VLMD 2LLGA 1D9KC 1NTDA 1VFUA 4MNHA 4JFVA 3IVKA 3ZN6A 3REWB 4NUJB 1Q9OB 3SDYL 5HYEA 1P5UC 1E9QA 3ILPB 4BSVA 1SXNA 1XCQB 4H25B 2FZ3A 3ARDC 3WGVB 2WLLB 2WVVA 4GAAA 3FUFA 1SF3A 5KVGL 4JB9L 3EDJA 3WJLC 2EUZA 3KR3H 2OMTA 3BMWA 1R3KA 5DMIL 1BHGA 2J2ZB 1SLVA 3WSQH 3ZK0A 2JWYA 2GW5A 3EYFB 4LEBA 3SQOH 4B0MM 3C87A 4WK4B 4BKLB 3NFPB 4GG8A 3DRTA 4PCKA 3L1OH 1HOCB 1K4CA 3M7FB 3VGEA 3U0PB 4HMEA 3L4XA 2JI3A 1XF2A 3K4ZA 1ZSHA 3HE6D 3IDIB 1FZJB 1G9MH 1S7UB 2DBLL 1KN4H 2PTTB 1ZIBA 3ARYA 5A16A 1F11B 2R0KL 3G9VA 5CEZE 4P06A 4HZLB 2ZUSA 2GT9A 1MRFL 1N59A 5E6SB 1RH8A 3S96A 4Y16C 1A7RH 1U21A 3ZHKA 1VENA 5IW1B 2WM0A 4KI1A 3CFKA 4XMPH 3TZVB 4DEPC 3KLKA 1JRHL 2IH8A 2XN9A 1FIGL 4NKIL 3TFKC 3GJEA 4YVUA 2CK0H 4GKSA 1L9OA 4JUSA 5LAPA 1MHPH 4PGJA 4WTWA 2UYLB 3MUUA 3GT6A 4Z3GA 3SKNA 2CSPA 1FWXA 3SDAB 4WI2A 6CGTA 2OI9B 4HZ1A 5E1AB 1IQDB 2CLVB 3DBXA 3QXWA 1AG0A 4X5LA 1WK0A 2CR0A 4X6FA 3VXPB 3WEMA 4Z7OE 1UT9A 2AJUL 2JNZA 1L0XA 5IVOA 1SEQH 4DGVL 3DXAB 4WU5B 2H0FA 4A67A 1Y6MR 1IT9H 5F7HA 2OTWA 2EDFA 4UB0H 1ZSDA 2ZYIA 3SY0B 3D6GA 1DFBL 4CN4A 3AY4A 4UINL 4WQOA 1DBAL 4Q9CA 1IGJA 5JOPD 1G0YR 2ZP0T 3V6BR 2JFCA 3BPLC 4ZRGA 1I7RB 1NMCC 3IKCA 3TEZA 2ICES 3H42L 1FFNA 4XX5A 3ATBA 1NLDH 2Z65C 1BG1A 4BK4A 1LM8V 4UTCA 1PEZA 4FNRA 4QT5A 4HIEA 2Z35B 2JJUA 4ZMTA 3VD1A 4HUUB 1NC4D 2QVFB 2H32H 4FFZH 4WO4B 1PQZB 5F7KC 5JNYB 3JWOL 4R4NC 1BLIA 3G08A 2VDQL 3WTTA 4B27A 1CFTB 3F7VB 1HQ4A 4AYDC 2Q3XA 3ULSA 4PTTB 4P4RB 5HJDA 5BVPH 1AI1H 5FYJU 3ARFD 1WH0A 1SDYA 2JB6A 3D4CA 3FUKA 4JFEE 4XPTL 4KK5D 5DJZB 1MELA 3ECVA 4B9PA 4I3RL 3W9EB 3QEGL 3V9EA 5HPOA 1MZYA 2V3EA 2ZKXA 4WI8A 3VFMA 2WSDA 3BH8A 4AGOA 3WXVH 3DUSB 4GRWB 5D70L 3LKPA 4XMKL 4YSEA 1LE5B 2WOBA 1ZGLB 1QRND 4NXKA 5CO1A 1A3QA 2WCPA 3VXTA 5FUZL 1OL0A 1WHOA 1O75A 3MOBL 3FSOA 4WUKH 4Y4KA 4MQ7A 1R24A 3HZVA 2CBOA 3IJSA 5CLYA 4DFHA 4FXKC 4XVJL 5EZLB 1GS6X 3HG1E 3RAJH 3QR2A 4YHKL 5INCB 1TR7A 2PTVA 1VEOA 1GY2A 2B4CH 2Z6FA 2X3BA 5CLXA 5ICXB 2E9WA 1IM3D 2A6JA 1OOWA 3N41F 3P4OA 1UADC 4FOMA 2HTLC 2X05A 4CJ0A 3PIQA 3FQ1A 4PJ5E 2YSTA 3EG9A 3NK4A 1AKPA 1DSWA 1I53A 1LO3H 2YS4A 4OZ4B 4NQCB 3T2QA 4YO0B 2K7QA 4N2NA 2O6CA 2X6CA 1I7TA 5B38B 1L9NA 4ZTPL 2AI0H 3QXDB 4QR7A 3U4KA 4B9YA 1AD0B 4LASH 1BEXA 1JGVH 4HHGA 4APXA 3V0WL 1GMIA 3ARRA 3IMVA 1XCTB 4HK0B 5FA3A 2VE6B 2JIXD 4L1SA 1N4XH 4TNGA 5CEXA 2VW6A 3PLYA 4MTMA 1JGLL 3SGJC 2EXTA 3GMRA 4GAGL 3AM8A 4A7SA 5SWZD 2YRPA 1R47A 1IAIM 1LDSA 2XV2A 4J4PA 2LVEA 5T1KB 3NIDF 2IO5A 4XO5A 3DJZA 1XGPB 3EYUH 1R34A 4QTHB 5F0JB 2X9XA 1HI6A 3MRCA 4UT9H 2XV0A 3OLIA 3BEWA 3BWAB 3L17A 3US0A 2VDKB 2KQMA 5FDYA 1MLBA 1MCWW 5IUSA 4G59C 4J8RB 3MRBA 2NY3C 2ZX8A 3NYKA 4KTDL 4JFTA 3WEXA 1DQJB 3QI9D 3VD2A 1GR7A 4XP5H 2TSBA 2DQDL 3WFDH 3TP4A 2ZKHL 1P84J 3LZFH 1AE6H 5G5DB 5GRUL 1NBZB 1F02I 2MCMA 2OMBA 5JHDA 3OB8A 3CXDL 3VFUB 1EIBA 5K5YA 1RFDH 4N26A 3KLAA 3FNKA 1A5FH 1DN2A 1L7IL 1AGFA 2DQIH 4OF7A 3H3PH 3JTBA 4XCFH 3UJJH 3D0AA 3ZT6A 3HFMH 4FNSA 4Z6AT 5DK2A 1AXTL 5I16A 4JO5A 4AENB 1OQOA 3RNKA 2UZXB 1AG6A 4OD3H 2E46A 1Y6NR 2J1YA 3BO8A 3KPRE 1FPTL 4O4YH 4X80H 2E27H 1O0VA 4R7LA 4OM1L 1U8PB 1CB4A 4MA8H 3CFQA 1UB6B 3T1FA 3UP1A 3VG0L 5LDUA 4ES9A 3E2HC 2XPZA 1RUKL 1ZHLB 1DQDL 2VXQH 2YGQA 3KPSB 3EJZD 3FS9A 5KG9A 3MCG1 4HC1L 3RVVC 2QHLA 3OKNB 1PVHA 1S2EA 4N2EA 3BVTA 4W9KC 4LL4A 4XI5C 2Q7NA 1LXMA 3TVMB 3GUFA 2EVJA 3DPBB 5DURB 2FQFA 5CWSB 2NW3A 2SEBB 3RDTB 3VM5A 1EEYB 5FGCB 3AQYA 3QJFB 4F92B 4ETYA 2VDNL 3M7OA 4FZEH 1SMOA 3KLSA 4IBTA 4X9BA 3MBEA 3RNQB 4EKXA 4WIQA 5JMRA 1TUPA 1AD9B 1PAMA 2H3XC 1YSOA 2P5PA 3DKHA 4F7TB 2PNDA 5KWYC 3EBAA 4FX5A 4WHTA 4GXUM 1OY3B 2KLTA 4LT7A 4PVMA 5HYIA 5I0YA 3CFEB 1NEZG 3N85L 5DZOA 1NEPA 4W6YB 4ABUA 3WN5C 4PWIA 4ONFL 1EGJA 3F6IA 1KYUA 3TBYB 4BCYA 1N68A 1N5AA 2BY2A 1QUNB 1IGFH 4AUJA 2P5ED 5KYNA 5CGYD 4P5MA 1N10A 2Z7YA 4U1SA 3NTCH 3MO1B 4HC1A 4AVJA 5EA0H 1ZS2A