3NJHA

D37a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
b'PQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGAITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDPQIINRPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 20
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njhA00
1L9QA 3CDZB 2FT8A 2YAFA 1QNIA 2PPCA 1PNCA 1AACA 1FA4A 2BHFA 2VSMB 1XB3A 5AZUA 1X9UA 3X2QB 1L9TA 1SNRA 4HALA 2FJSA 1M56B 4A2GA 2YAHA 2RACA 2Q5BA 3OMIB 4BWTA 1ZIAA 5FC9A 1J9TA 5F7BA 4DP4X 3UAEA 4DP2X 3SBPA 3ERXA 3QJSB 3UAAA 2IH9A 1TKWA 3TASA 2OCCB 1HAUA 1N68A 2IWEA 1M57B 2JFCA 3T71A 2JXMA 4AX3A 2HZHA 3ZIYA 1JZFA 3AG4B 3NJMA 3X1EA 4YSRA 4HZ1A 4KO5A 1AS8A 2QDVA 1F56A 3AG1B 3FQ1A 1KDJA 2J5WA 2IAAC 3AZUA 5B1JA 2FQGA 3NJKA 4A2EA 4W1TA 1XB6A 1FWXA 1RZQA 1WS8A 2P80A 4GYBA 1NIFA 3X1FA 1T5KA 3AW5A 2ZOOA 8PAZA 2HX7A 4N8UA 4A68A 4ENZA 2PP9A 5B3SB 3ASNB 4A2DA 1EZLA 2UXTA 2I85A 2UXFA 4G7SB 4GY4A 3EH3B 2VW7A 4DP0X 4WTQA 1ET5A 1IUZA 1A3ZA 3L45A 5F7AA 4DP6X 3V9CA 2R7EB 3QJRB 1BYPA 3JTBA 2MTAA 3IN2A 1JOIA 2HX9A 3QQXA 2B3IA 2AZAA 1OCRB 3EH5B 1IKOP 4AZUA 1N70A 3UGEA 1ZIBA 3OMNB 1V54B 1AR1B 3KW7A 4G71B 3ASOB 2XYBA 1AS7A 4GP8B 2B08A 4NB7A 5EHFA 4GP5B 3FQ2A 1A4AA 3EH4B 1OF0A 2YAOA 2WO3B 3PAZA 1JZGA 1ET7A 3CG8A 3T6XA 3D12B 4HCIA 3PCYA 4QLWA 2YXWA 3V9EA 1MG3C 1JXFA 2AANA 2XX1A 2BP8A 2W88A 1GYCA 1KGYE 2BW4A 3AG2B 3NYKA 1GY2A 1J9QA 2DY2A 2XVBA 3QJVB 3PLYA 4P5SA 1SHWA 2EIMB 3DIVA 1EHKB 2A3TA 1PZAA 2P80D 2GC7C 1RCYA 1MG2C 3NSCA 3FPYA 2EIJB 4EF3A 3G5WA 4TXVB 2AFNA 2FT7A 1DYZA 1ASQA 3FU8A 2N0MA 3ABKB 3TU6A 1AZRA 3AG3B 3GXUB 4BDVA 1OCOB 3FSVA 1KV7A 2PCYA 3BQVA 3QJQB 3TA4D 4AKQA 2DWTA 1KYAA 5I5IA 1B3IA 3T6WA 4X4KA 1JZIA 1L9PA 1X9RA 1UATA 2UXGA 1JXDA 2X87A 4HCFA 4UF7C 5LDUA 1OCZB 5B7FA 2BP0A 2YAEA 3OD3A 1J5CA 2VN3A 2AVFA 2XUWA 1SFHA 4G70B 1NICA 3T6VA 2EILB 2IWKA 2UXVA 4UANA 4YSQA 4DPCX 4E9TA 1PMYA 3WI9A 1XB8A 1W6WA 2BZ7A 5I6NA 3NJNA 4PAZA 4YSSA 4KO6A 4E9RA 1L9SA 4GP4B 2FTAA 2XWZA 4YSTA 1JZJA 2OJ1A 2VM4A 2VW6A 4KNSA 1GY1A 2EIKB 4KNUA 3JT2A 2J56A 2IDUA 1QLEB 2PP7A 2YAQA 3FSWA 1QHQA 3IE9A 1WAEA 3S8FB 3IBOA 3OMAB 1SDDA 2H5UA 4FA7B 3NJFA 3PAVA 2YQBA 1M9WA 4BDVB 3FQYA 3N2JA 3OQRA 4AI7A 3MX0B 2WSDA 5B1JC 1OV8A 1ZV2A 1J5DA 4GXFA 2YAMA 1TEGA 3CZUB 1ZDSA 3HB3B 4YSUA 9PCYA 1OE2A 4A67A 1OE3A 4E9QA 1NPJA 2LLNA 2DV6A 1XMEB 1GR7A 2XX0A 1NWOA 1V10A 1W6LA 2PPEA 4YSEA 1CYWA 1AZCA 2OV0A 5B1AB 2WO2B 5I6LA 2FQEA 1JVOA 6PCYA 3FPXA 2PP8A 3NJLA 4AKPA 2J57A 4KOCA 1JERA 4HHGA 2IDQA 5I26A 4HCGA 3SQRA 2ZWNA 2YARA 3OM3B 5IY5B 5AKRA 4E9SA 1KCBA 4MFHA 1E30A 4YSOA 3X1GA 5AFAA 4JHVA 2DYSB 1PZCA 2VM3A 2XV3A 2ZONA 4QKTA 1SDDB 4DP7X 1BQ5A 2CUAA 1R1CA 1KBWA 2CBPA 1ETJA 2DWSA 4HIPA 1AZNA 4E9WA 3S8GB 4DPBX 1A65A 3EHBB 4YVNA 3T9WA 3ZBMA 4DP1X 5I6KA 3PPSA 4WKXA 1ZPUA 1AAJA 1I53A 1AANA 3RYMA 3QJTB 1NTDA 2XLLA 5ANHA 2HRHA 3FU7A 1URIA 3NT0A 5TK2A 1RZPA 5I5JA 2XV0A 4G72B 3EF4A 5I6PA 1WA0X 1JVLA 2GIMA 3FYIB 4CSPA 1E67A 4YVUA 3NP4A 2BWIA 5I6MA 1OE1A 2NRDA 3ZX1A 2BWDA 1KBVA 2XXFA 4ZK8A 4M4RB 1NINA 2UX6A 3CVDA 1CC3A 4L0PB 1TEFA 1HFUA 2J55A 4DP9X 4BK5C 1ASOA 2PPAA 2BO0A 4F2EA 1CURA 1CUOA 2BZCA 2GSMB 1IC0A 1NIEA 3NP3A 4JHUA 3IN0A 2JKWA 1VLXA 5PCYA 1PF3A 3GDCA 4BWUA 2QDWA 3FYEB 4NAJA 1OCCB 1E5ZA 2HLEB 4NERA 2W8CA 5I5MA 4W9ZA 1PLBA 2TSBA 3SBQA 3SBRA 3S3BB 2DYRB 1GS8A 1L9RA 1PY0A 3DKHA 3KW8A 3UABA 2QPEB 1V55B 3WKPA 2BP8B 3IEAA 1GS6X 1NIBA 2QT6A 1A4BA 2GB2A 2X88A 2IH8A 1HAWA 2FT6A 1AZBA 1GW0A 3T6ZA 2YAPA 3ABLB 2ZXWB 1NIAA 4YSPA 1PCSA 2VW4A 1ZDQA 3FU7B 3NSYA 1PLAA 1J9SA 4YL4A 3U25A 1JZHA 3CVBA 1AZUA 2YXVA 4N4YB 2FQFA 1IBYA 1WA1X 2MRYA 2GC4C 5B1KA 1ASPA 2FQDA 5I28A 1PZBA 1PAZA 2R7EA 2GHZA 4G7RB 1W8EA 3ABGA 3GYRA 1KCWA 2PPFA 1NDTA 3ABMB 5D4HA 4F7KA 2H47C 1SFDA 1PLCA 1MDAA 1KDIA 2IWFA 2Y69B 3DTUB 4Q89A 3S3CB 3C75A 4KOBA 4Q8BA 1BXUA 1E5YA 1NIDA 1WS7A 1BEXA 4KNTA 4RH4A 2BP0B 4BWWA 1ADWA 1SHXA 1ID2A 4JKNA 4HHWA 1NPNA 3HEIB 4E9VA 3X1NA 2E86A 1JZEA 1AOZA 1AS6A 2EINB 4CSZA 2PPDA 3AY2A 5D4IA 1SJMA 2FNWA 4DPAX 4A2HA 1AIZA 3WIAA 1AG6A 4YSDA 5PAZA 3WG7B 1PNDA 3FS9A 3NJGA 2HRGA 7PAZA 4M3HA 1A4CA 7PCYA 4PCYA 2XU9A 2H3XC 4BXSV 1L9OA 1NWPA 1ILUA 2AZUA 1BXAA 2VSKB 1DZ0A 1YLBB 4FAAB 1NZRA 5B7MA 6PAZA 1GSKA 2IDTA 4KO9A 4YSCA 2Q9OA 5I6OA 2PCFA 4KO7A 1BXVA 2GI0A 3WNIA 4E9YA 2BW5A 5B7EA 1E65A 2TSAA 3N55A 1CYXA 2CJ3A 3TBCA 5E9NA 3MBWB 3WKQA 1SF5A 1MZYA 2Y1AA 3NJHA 2CALA 4A2FA 3CDZA 3FSZA 4AKOA 1JXGA 1WA2X 2HXAA 2UX7A 4DP5X 5D4JA 2HX8A 4A66A 3CVCA 1SF3A 3UACA 3PAUA 1ET8A 3S3DB 4YSAA 1MZZA 3FU9A 1BYOA 3BVDB 1TU2A 5B1BB 1GS7A 3NJIA 3H4HA 2CAKA 3PXLA 3H4FA 2I7SA 1OOWA 1BAWA 1AQ8A 1J9RA 1FFTB 1A8ZA 4HAKA 3NSDA 4G7QB 3TBBA 1IBZA 2FWLB 1RKRA 3ZDWA 2XXGA 2GBAA 3QJUB 2CCWA 4UAHA 3FSAA 4F2FA 3WNJA 1BQRA 4K9JA 1BQKA 2I7OA 4P5RA 2QPDB 2XV2A 2PLTA 5TK4A 2VMJA 1AG0A 3UADA 2IDFA 4E9XA 3QPKA 3NJJA 3H56A 1ILSA 3NSFA 3X1BA 3FT0A 4DP8X 4BXVA 5A7EA 2IDSA
chains in the Genus database with same CATH superfamily
2D7PA 1QNIA 5C0GB 1ZT4A 1Z9LA 1YAIA 2RTTA 3EZJB 3EJYD 1FA4A 4M1DH 4YSSA 3CLEL 3AAZA 2MPAH 4P9HL 4K7FB 4P2OC 4WHTA 5AZUA 4PGDA 1CXHA 3RHWK 3N9GH 3PJNA 5L7XL 1QNZL 3TZVC 4J3WA 4BWTA 1WFIA 2CJUL 2VLJD 3ERXA 4F91B 5AZEH 1JWUA 3QZPA 4NRXB 4LE8A 2JFCA 2AV1A 1K6QH 4X6FA 1BBJA 3ASWA 1KXHA 5BUPA 2ZCZA 2K0RA 1FVEB 1VGEL 3N1MC 3SCMB 3U4EA 1F6FB 4DKFH 2ZYIA 4NKMA 2EC9U 4PRIA 4WW1B 4Y9EA 5IESL 3NQKA 4RAVA 2IPKA 5F71A 1J8HD 5IQ9B 4D9LH 3K6IA 1M2VB 4KGLA 4O02A 4W9FC 4AJWA 3KH3A 4GB9A 5B39G 2JIXB 1WS8A 3QXDA 4XPFH 5ITBH 5JQIB 1M7XA 1CD8A 2E75C 2HVKB 5E6IA 3KM2A 3V4UL 3O3AA 5EA0H 2ZPKL 4PJ9B 4RFEB 4JN2B 2L8AA 4PJ5E 3FBQA 1YY9C 3NZUA 4XODA 3NBNA 4KI5F 5E08H 1JGLL 3HHSB 3PWPB 5GS0H 1IUZA 3RGBA 3TVMD 5C97A 1MJ8H 4HS6A 5EORL 4AQAA 3QZLA 5JW4Q 5C09D 3ZDYF 4CN6A 1SGKA 3IN2A 4Z3EA 4HUWA 1VACB 1VDGA 2NY5L 3DJTA 3IRCA 3DRTB 3WN5C 3BIKA 5DTFB 3ESUF 4ZPVB 3W0WB 4M8RA 4YHZH 3VRLE 3Q5OA 1OXYA 2AEQH 2ZAGA 4B7IA 1QYGL 3G5YA 2HWZH 3V4VB 3G08B 1RIUH 1MW3A 4NAMA 3UC0H 4HA1A 4JPVL 4KK8C 4NQSB 5GZNC 1WCQA 4UCFA 2OMWB 2WZPD 4CGUB 4HCIA 5ERWB 4A63A 2AABL 1RULH 4EI5D 5K39B 5T1LA 2WTOA 3WY4A 1YPZE 1QWNA 5EO1B 3RZCC 3WD5H 2EXSA 4P9ML 2W88A 5J06A 3C09B 1MIEH 1T89A 4KDTA 4NHUA 5GS2D 2BW4A 3WO4C 2EYTB 4GRLB 4DKEL 4U6YB 2NZIA 2W0FA 1S3RA 1QR4A 3D39E 3ZTDC 4OSUH 2Z8VC 3RGVA 1B4JH 2MCPH 4NZUL 3RIKA 5IUCA 1JVKA 1PLGH 4G1MA 3VTTA 3DIVA 2A3TA 2WLYA 3BH8B 3CLFL 5D1ZI 5HHOE 3F7LA 2EXWD 4PWIA 3I50L 2XA8L 3QB7C 5CIPH 2WGXA 5J57B 3QUMH 2H6OA 2TRHA 5K9KB 3GBML 4YHLH 2ZYRA 3KVPA 2EKSA 4BDVA 3TEZA 3RG1C 2WAHA 1OTTC 1R24A 5FUCE 1X5HA 5I74B 3VD9A 2DWTA 2Z34A 5GJTH 2YRZA 3ML8A 3FAXA 4IKNA 4OZIA 1QI5A 4ZS6D 3GKWL 1R3IH 1J0ZA 2GJJA 5FUOH 4MD0B 2I07A 3P9MB 4UINH 1IEAB 4JAMB 2KPWA 3DX0A 1RFDL 3LEXA 3FO9A 1EHNA 5AOIA 4IU2B 3RY6A 1KTLA 1SM3L 3PNRB 3W9DA 1QFWI 1FJ1A 4JR9H 3PGCA 3CH1B 4XPTH 2WUBH 4L9DA 5GJSH 3D0VA 5FEBA 3TF4A 3ZDZE 4NKIL 3OKNA 2ZT9C 4C55A 2DL2A 2LV4A 5GS1C 4O5LH 4ELMA 3BP6B 5MEPA 1DSFH 1E5UI 1OT2A 4U1GC 4ENED 3NOIA 3CK0L 2P5PA 3IXAA 1AR1C 2J56A 1RZFH 4QRPE 3WGVB 1CD0A 4ZRGA 3O2DL 3LSOB 4G9DB 3PWNB 1X9LA 4LVOC 4JPSA 1MN4A 4MS6A 4N2EA 3C8KA 3MJ9A 1OTUC 4R4BA 2IF7A 5FHBL 3VE0A 1LO3L 3TBYA 3D9AL 2IFFL 1OPGL 2IMMA 4N2DA 3FUMA 4QR7A 5GGSB 1CFQA 1D6VL 4DN4L 5FO8B 4WU5B 5D7LA 7FABH 4PJFA 4RX4A 3MUZ1 5L6YL 1NSNL 4IGBB 5FB8B 4X5WA 3GSVB 1LTXA 3HG1A 5ECJE 1QPXA 4G43A 4UU9A 1NCUA 1ERNA 2HLAA 2NY1D 1ES0B 4QD2E 3QUMA 5DJCB 1KJMA 5DMKA 3WFEL 3LKRB 5JW3L 1NWOA 1IL1A 3FCBA 2YEQA 3AREC 2FL5A 1AO7B 1VZHA 2H6PA 5LBSL 3QH3A 4LSQL 4JRXA 5F7DB 4I5BB 2OMVB 3RQ3A 4P4KC 2OXGB 3N3EA 1JVOA 1RUQL 1MAMH 2F8VA 4XRCA 3WCYA 4FFZL 1JERA 2BNQD 3OWEA 3QJFB 3EDJA 3H2WA 2VR7A 1GJWA 2IPUK 2QQLH 4YS4A 2YARA 3G5XA 3OM3B 4N20A 4PJ8A 2CR0A 4R96B 2BM3A 1F58L 4P5TA 4G6ML 3JWOH 3DVNB 1YDPA 3IKKA 2XV3A 2HJLA 4B50A 3BP5A 1KBWA 1PYWA 4HPYH 2H8PB 3N5AA 4TULL 2YRPA 1RSYA 3QZOA 4UBDC 5GGTA 4BGLA 1MVUA 3T9WA 1FYTE 4MJ2A 5DC9B 4AIOA 1QP1A 2D7OA 5DQ9A 4ADJA 4APXA 5BV7C 1OK8A 4KDWA 1TETH 2GJPA 3I3BA 2I9LB 2Q0ZX 5F3BA 4NZRL 1VEMA 3AACA 3DX8A 3A67L 4MAYD 1A5FL 3RWEB 3F7VA 4Z3IA 1RERA 5TK2A 2ZCKL 1JZ5A 3ILEA 5FGRA 1KJ2L 1GPOL 1JPGA 2H32H 1SRDA 3W11D 4EZKA 5IB4B 4S1DC 1HE7A 4Z7OF 5CAYB 4JG1H 1T21A 1J11A 5FV2A 1E3ZA 2V2WA 3F7YB 1Z9MA 5CR8A 3CFCL 2O5NA 4YFLF 1U6AL 2JLPA 3MJ6A 3OLDA 4OF7A 2QGEA 4FQ2H 2VLKE 3EBIA 3MAWA 4JCLA 2H0EA 2XNAB 4PPTA 3UAFA 4A6YH 4WEBH 3PABB 2VLMD 1CGVA 3IN0A 4C4BA 3BZFA 2QDWA 3BGAA 3D2UB 4KKLC 3BZEA 3M46A 4YE4L 5J9PA 1IAOB 1LJMA 4RFNB 3WLBA 3G6DH 3I9GH 2NW3A 3QULA 4AZ8B 5EF2A 4GLRH 3UMNA 1GS8A 3L1EA 1JRHL 3ATDA 2X4SA 3ZHFA 5TH2A 4Y16C 1CDGA 1DQJA 4O2EA 1XSKA 5F0MB 2Z4TA 1KBBA 1QW9A 2H1PH 4K2UL 1F3DJ 4N0CD 1R4XA 3FUJA 4G6AD 1HVXA 1U92A 2EZ0C 4TV3A 1JV5B 3KLAA 4FTVE 4CSSA 3U1SH 4KXCA 5F8RC 5I1LB 5GPRA 1YQ2A 4OZGB 3C5XA 2CG9X 3ZUCA 5MEND 2VXVH 3E1ZA 5HVFB 2G9HA 3BVNA 3FCTA 1S7QA 4OBRA 3U0PA 2Y6SC 3IU3A 2FX7H 5D1XE 2QZQA 2XCMC 5AOMA 1IB5A 1K4DA 4AQ1C 4NWUH 4KZ0A 4PTTB 4JBSA 2ADJA 3TJEH 1HSAA 2A73B 5E5MA 4JKPL 3HUJB 2Y1YA 4OCWL 4WJG3 5EZIH 1ZE3H 4L8BB 4JO2H 5DD0H 1BZ9B 4EI6A 1MY5A 2EDKA 5FM5O 3VXSE 3CHSA 1D5MA 4V1DD 3GGWB 1RIHH 5D4HA 3MLUH 5GRWA 2NDFA 4DZBA 4GRWE 4F80A 4OIIH 2OP4H 2H32A 2ZUYA 1T5XB 1JF1B 4I4WB 3H42H 1BEXA 1E4WH 2ZWKA 2NMSA 3SBWC 4YH6A 5D7JA 2X1WL 4QYAA 4Y1SA 3TH2T 3ZUNC 3FULA 4I9XA 1ICTA 3L7FA 4G8FA 3CSYA 3T77B 2CU9A 2E86A 4PP2A 1DE4A 3ZOAA 3DSNB 1QR1A 5FW8A 5DJ8A 4A6YA 3SDDD 3ARGB 4OFDA 1K2DA 3DV6A 5B3JF 2OR9L 4TVPL 3GZKA 3ROLA 4AG4H 4ZMTA 2M83A 2XTJD 1AXTH 4L1BA 4YSDA 4Z7WB 3FQNA 3UPRA 3VFPA 5CR1A 3NRPA 4PJ5A 4ZO7A 3HOGA 3VXRE 1UOWA 3CDYA 2X89D 3GJEA 4MVBC 3V0IA 2X9WA 1NWPA 4M6OL 5IW1B 2YD0A 5E6SB 3NCJL 4HX1B 1DDHB 4NHCH 2VSKB 2WIIB 2JJSA 3T08A 1U91A 4I3GA 1CICA 5E1IA 4C59B 2XPGA 1QTYT 4AJVA 3VVWA 1BHGA 1JPFA 3BE1L 4GEIA 4NQUA 4ODWA 3GXDA 2NYZA 1T04B 2YOCA 2XSKA 1RZJC 1HHIA 2QELA 4Y1AD 4F1SA 3NABH 2CJTA 4XBEL 5ESQB 1EFXD 4PTUB 1T6WA 3IDUA 5AKSA 3S2CA 3CFUA 4LT7A 2XWXA 2X7LB 4M7LH 3R8BB 5DJYA 4LCCB 2V9TA 4PB0H 3Q6GL 4JG0L 1S9XB 1G9EA 1YPZA 3ARFB 3LH9A 1WA2X 1GOHA 2NY0D 2ZNXA 4PJHE 4PJIF 4PU2A 4KUZL 5EBWB 1A22B 2VC2B 1FNSL 3CVCA 3G04B 4MDJB 1KEGH 4N8VG 3EO9L 2CBMA 2NY6B 3IJYA 5FFGA 3RA7H 1XF3B 3D39A 4HG4J 3JQOB 3PXLA 3K6SB 4A1RA 2BPBA 1AQ8A 4F1ZA 4MA8L 4Y4KC 1PX4A 5FM8A 5HHOA 1Z3GH 3WUWA 3FB7A 1C7SA 1OAYH 3HN3A 3MA9H 2FWLB 4P46C 5LGKA 4HS3B 2BIIA 2GITB 1DZBA 4HEME 2Q2LA 1CLYH 2IC2A 3H53A 4JREC 1S2EA 3GMPA 2C4XA 3EFDL 1BQRA 5B4MD 5CLWA 1KULA 3LH2L 1UOKA 3CIAA 4E2OA 2UWEE 2R2HA 5I1HH 1GSMA 5E2TL 2Y3NA 1NCBH 5DEGB 1LVEA 2OTUA 2OZNA 4PJDE 3QPKA 3HPLB 4R5VA 3LN9A 3H56A 2AJVL 5F93C 4J3OH 4ERSL 1AE6H 1BGXL 1R6VA 3MUUA 2OW6A 5MI0C 4ZT1A 2PW2B 2N7BA 4Y8AA 3UTTE 4OU3A 1DUZA 3BAEH 4FFTA 1L9QA 1KLUB 1UEYA 2BSED 1MELA 2XWTA 1DVQA 3CDZB 3LPGA 3MFFA 4N26A 3WFBL 4HD5A 3WN6A 5LGHL 1EAPA 1K3IA 4PYHA 4XXWA 3P9LA 2BHFA 3BVUA 2V0AA 4MXQD 2VC2L 1I7UA 3K4ZA 2VLJB 1SNRA 2CHDA 3MKGA 3O3DA 5G4MA 3L3JA 3RFZB 1VKXA 1NFIB 5D7IE 3BFOA 1QUNA 2HFEB 1Y07A 1WC7B 3T3ME 1HH6A 3VFRB 3TASA 1OM3L 2VMFA 1HKFA 2ZX7A 4Z6AT 3QIWA 4QRPA 1IAII 2H2SC 3JTSB 1AS8A 1DCEA 1J8HB 2XG5A 1X6LA 3CX2A 1F56A 1YEGL 3QRGH 4ADGA 4LKCA 4H8WC 3JYBA 5SWQB 3CVHB 1X7QA 1QBMH 3AZUA 2VDNL 2DTSA 4BKLB 1VFAB 3OKKB 3ZRSA 3PQYD 1QSVA 1RZQA 3BAWA 3FQRB 3Q9QA 5JMRA 5LWYL 1GZPB 3U36A 1CXIA 4GO9A 2XBDA 4GKOA 3TVMB 5E8PB 5C09B 4FADA 1SVZA 3P69A 5LBVA 1S5HA 2CK0H 2QSTA 4Z7QF 5M95B 4P23C 4JG9A 1ZHNA 2CHXA 5A6MA 4X4YA 4AL8L 1BYNA 2R0KH 4AUUA 1I1YB 4XP1L 2FDBP 2VQTA 3GXMA 1TVDA 1I8MB 2QVIA 1B0RA 1M05A 1BLNB 2ZXEB 3RILA 3TCLA 3OMNB 3QIBD 3IXTB 5F7KC 1OOAA 2R4SL 3O6ML 3HAEA 3KW7A 4PJXB 4EBQL 3Q3GA 3MV11 3IRPX 3L9RA 2FX8L 3PJLA 4GP5B 1N7ML 5CO1A 4EI5B 2VMDA 4X80L 3KCPB 5J6GA 4YQXH 1H6TA 3ZE1B 1QLFA 3ILPB 3FB6A 1WCBB 1KIUA 1YYML 2EACA 3OAUL 3Q8BA 4ZMXA 1LO4H 1UASA 2Z7WA 1FYTA 4BH8A 4Q9QH 3CVHL 1MRFH 1O0VA 2F0CA 1U8OB 5IROA 3SB3A 4KROC 4L3FA 2KDYA 3VSTA 3H3PH 3SDCB 1GY2A 1BZ7B 4M7ZC 4PJCE 2QQKH 4BRJA 3MLRH 2BHZA 2XICA 4KH2A 3GBEA 1YCSA 1T3FB 4WSJA 2V37A 2WHVA 3CFKA 5E6ID 5CBAB 1ACYL 5MEQA 1BAFL 2V7HA 3AXHA 1JF6A 1JDDA 2KPNA 4ZW6A 2C8NA 4BZ1H 4B5EA 3GI8L 2K8MA 4FXKA 5E6ZA 4RWYL 1NOLA 1AI1L 1TCRA 3T2OA 3NIDB 3CZNA 3VGFA 4Y9CA 4AMXA 1EEZB 1U8CA 2VLKA 2PCFB 2JJTC 3GI9H 2ILLA 4AKQA 3GZOA 4YFDB 2B1AH 4LOEA 1B3IA 2WWNA 5GGRY 2X87A 4JRWA 4JO4H 1SZNA 2WIMA 5TE7H 2HG5B 4S2SA 5I19L 4QPEA 3ARWA 2DICA 4KY2A 4Z3JA 5LGJB 3P4NA 1G0YR 4W93A 1RP8A 4IBTA 3MRKB 2KS0A 2GSIA 3R4DA 5EU4B 3ZL4L 2ARJQ 4NNXB 2BVOA 1FG2A 2AJSL 4X6CF 3WTXA 4L5FE 2ICEC 4FTVA 5MEOB 5T1LD 5KSBE 1WBZA 1PD1A 4RBPK 1MRDL 4GP4B 3ZDXF 5IKCB 1A7RH 1LHZA 4L4TD 4NOBA 5D1XA 4Z7UB 2XN2A 1UURA 2CPCA 5FUZL 5DYOB 2VW6A 3ZU8A 2BERA 2RBLA 5AB0A 1IT9L 2M2DA 4PBXA 4M03A 1DHKA 5E4IA 1E27A 1YN6B 1RU9L 3RGVD 1DVFC 3H9YA 4M8VA 1SBBA 4I48A 5A2AA 4AIZA 4F8OA 1OP4A 3P4OA 2HT2D 1FNLA 3QEHB 5DZ9A 3MXVH 1CBJA 1ROCA 5C1MB 1OGAD 3PHQB 1AH1A 1KIRB 3T1FA 1N6QL 3N42F 3E9TA 3VXSA 4JDTL 2A2QT 2H3NB 1JHKL 4MYPA 4OZFA 2VOTA 4GXVL 5B1JC 5IQLA 3M7FB 3LS4L 3QG7H 3NCWA 3RDTC 2GK0B 2NY1B 3T0DA 4AM0A 2EVJA 3T0EE 4GG6B 1MEXH 2JK5B 1E2VA 2GABA 4NQEB 2LU4A 5J3HD 1YMHB 1TPXB 1I1AA 3OXSA 3EFOA 1AC6A 3KPQB 1MFDL 3SYQA 3TIDB 5J11C 2ZF9A 1V10A 2F68X 4AV0A 2YFNA 3O6KL 2KERA 1P4IH 2F5BL 5IWLC 3HJEA 1ZXQA 3T8VA 4FZEL 4L23A 2VCOA 4G5ZH 5DJZA 3WXVH 4WSKA 3NJLA 5IJBC 1X5GA 4HIEB 4OJEH 1QSZA 2WJ7A 3GEWB 2P24B 3TJHC 1OP3K 15C8L 1DANT 4J8RA 3VXRA 5C6PB 4M62H 2FH8A 3CN4A 4TOYH 6FABL 1SN0A 3T2QA 2GQHA 2NXZC 2B0SL 3KM1A 4LCYA 5JQ6L 2CR6A 4YDKH 1KOAA 4YBLC 5I8CB 4YGVB 3KLKA 1Q9WB 3FO2A 4YX2H 1E5BA 1R5IB 2XZAL 2LFGA 2WBXA 1AP2A 2VDLB 4MAYB 1JPST 4GI9A 1NUFA 2FLBT 3AUVA 3FO1B 3INUL 1T83A 2PWHA 5D7LD 5EWIL 4DKTA 4NDMB 2EDMA 4TLKA 4RX4D 3SYPA 1CLOL 3C6LC 3EF4A 1P5VA 2J43A 3C9NA 3HG1D 3RWHB 1NBZA 3G6JE 4GUOA 4P07A 4PJHA 3EBGA 1HZHL 1MCPL 4R8WL 1JGVH 1UWYA 2J6WA 4GIPD 4TNFA 5ITFB 5FYKU 2JNZA 2JE8A 4DESA 3K74B 4ZTPL 1KT2B 3IDYB 4PN6A 2R23A 1KTKE 2ZX6A 4DP9X 2BO0A 4JRXD 4L8DA 4NKDA 4A7SA 4MZ3A 5DVLA 2GAZA 2KYIA 4Z7VE 1T0MB 1KFAL 2NSMA 2E7LC 5JMOC 3SE4A 4ANKA 2N01B 4HJEA 2IJ0C 4PJAE 4PJ8D 1Q9KA 2DLHA 4HEMA 2APFA 2C3VB 4P5TD 2EDDA 4KKRA 1KGXA 5KYUB 4PG9A 1CFSB 2A9AA 5TQ0L 2XXMB 2GCYA 2UWEA 4PJ7E 5MENB 1NCDH 4AMWA 1SOXA 3RI5F 3QJHA 1OHQA 3RFRA 2UY6A 4PJDA 1E4KC 3ABLB 2JB5H 2ZXWB 4ZMPA 3RX8A 1F4YH 2ODIA 1JK8A 3UTTA 1EGJA 4POZC 2CNYA 5BQ7B 4B9KC 3DECA 2ZNWA 5MERA 1BVLB 2BY1A 4FFYL 2LABA 2DLEA 4KK5C 5LCVH 2BSSA 3TGXA 4GT7A 4JFZH 1EERB 2ENSA 2OI9B 5DGRA 3QIUC 1L0YA 5DYFA 1NDGA 1C1EH 2WC7A 4V1DB 1S9WA 1W8EA 3BDBA 2YKLH 3CFJA 4K71C 1TYEB 4OY9A 5D7IA 5JPNA 5C9JB 1NDTA 1CGUA 2F74A 3ABMB 2DMBA 1CF8L 1Q0XH 4K94L 3LVEA 5DC2A 5LXGH 4HDIB 3CSGA 5DHDA 5EIQA 3ULSB 1DEEB 4XP4H 4MXVE 3UC2A 5I1CL 4WW2A 3U46A 1L7IL 3WE6A 5HHMD 4RH4A 3PNWA 1ADWA 1ID2A 4KKBD 1J8RA 3TNMB 3X12A 3SDDB 2CK2A 1YEJL 3L3GA 4XMPH 1C12B 3HLAB 2PO6C 2Q76B 5DK0B 4GKNB 3WJLA 3AT9A 4CSZA 3HE7C 5BO0D 2UUDH 5KTEL 2XTJB 5EZJB 1OGPA 2FEJA 1HKLL 4GQRA 4L3AA 1SLVA 4YAQA 5AOJA 5PAZA 2G3NA 2JVUA 2Y4SA 1H0DB 1QBAA 1MJUH 2WCGA 4IRZH 5AEAA 2CZNA 3D05A 3AS1A 5AVQB 1IKNC 2DD8L 2CLVA 3JVFC 1QFPA 3QUZA 4FQQB 2XYCA 4NYLA 4FG6D 4QRSA 4FKEA 2A74A 4UDTA 4GQZA 2CJSA 4UT9A 5F6HJ 3VO0A 1CXFA 1P6FA 1V7ML 2X4NB 1EFXB 3RX9A 5KVEL 5AYUL 5EV7A 3GRWA 4XB3A 3DGCR 3OPZH 4ODUA 3BGFB 2WY3B 5IW3A 1Z3RA 5GGVY 5B7EA 3MODL 4NN7B 1USQA 4Z7NE 2WQUA 1IE4A 2P1YA 2RH0A 2ENYA 4YHYC 3MV8E 2NY0B 4HF5H 4NIKB 3V0FA 2CALA 4CL7A 2MQGA 5C0CB 3FQTB 1EDHA 2MSPA 2ADFL 5C6TH 3K0WA 3DX9B 1EAJA 3B3IB 3RTQB 1UCBH 5D7JD 1I3RB 5D4JA 4QHLB 4WO4C 1Q72L 1SEQH 3UBXB 1CIUA 5HDLA 3NACH 2MOVA 1GS7A 4PJCA 1VPOL 1UWEL 4OLXL 3KCWA 2EEAA 1DR9A 3Q13A 4QHMB 4Z18A 3BQUC 4HWNA 3LB6D 3DURA 1A6ZA 2BS71 1BD2E 3I02A 5BW7C 2XFXA 4L9LC 2ITFA 4LL1A 1FZJA 3NSDA 5FCUH 4PJ5D 3LV3A 1JWSA 5CZXC 5BUGA 1A6WL 4LPWA 2XXGA 3DMMA 4EIUA 2YOAA 4F2FA 1INQB 3E6HB 4JPWL 1KIQB 4OCRL 1I8KB 2D3VA 4WWKB 4GW4A 5AUMB 1A1MA 3VFOB 3FT9A 4N90D 1CICD 2XJKA 1Y6NR 3QI9A 5A1AA 4IRZA 4UTAH 2CHZA 2OMZA 4LEOA 4E9XA 2CXKA 4HUXB 1UHVA 1QWHA 3KG5A 3QHZH 1MQ8A 3D07A 1T1XA 1OARL 2AK1H 5A7EA 3QUYC 2VN6A 1RXLA 5ABZA 1R0AL 1T0NA 1U3HA 4JJ5A 1RAMA 1ZSDB 1OZUA 3Q8FA 1EEUA 1PNCA 3IDGB 2ATAA 1HCFX 3HS9A 1UYWH 1XCTB 4FFVD 5TF1H 1V05A 2YQGA 1ZA6B 4M48H 4Y5XC 4JPKH 5IP4A 4EN3A 3K0YA 5KSBA 1I85C 1A7NH 3F83A 3VFWA 4BA8A 3PDGA 5FGSA 3T2PA 4L1DA 4RIRB 3UAAA 1UXSB 2IH9A 3P9WB 4I2XB 4JANA 1HNFA 4LEXH 1N68A 1M1XB 1UM5L 1VGKB 2DKUA 2KBGA 2NY3C 2X41A 3Q44A 4MXWH 4OLVL 5HHPB 5DUJA 5EOCH 3TBSB 1THAA 4JL1A 1T66C 1SOKA 2C1OB 3LEVL 4HZ1A 5E56A 3ULVF 5HHOD 2AAVA 3ZYZA 1SLUA 1AD9A 1R3JB 4UT6A 3EOTH 3U9PH 3CU1A 4P2RE 1NAMA 2WSPA 2B7DT 4OUUA 1TO4A 2YFOA 2CR3A 3BJ91 1T2JA 3LZFH 1LE9B 4TQEH 4XWOC 1SBSH 3T0EA 4OLWL 2R0WL 4YUEH 4ZPTA 4WTZA 5GRVL 3MQIA 3P54A 4JKKA 1W72B 1IGCL 1N8OE 1WPCA 5KSAA 1D3CA 2JJWA 5B21A 2BC4A 5B38A 1YQVL 1FL3A 1ZT4B 3MCYA 3VRJA 2HP4A 3PUUA 3F8UB 5I8KL 1ET5A 2OW7A 3AAZB 4X6BA 3GIZH 1P7KB 3K1DA 3HTLX 1XGUB 4PWEA 4B0MB 3QIBB 3E3QE 4FXTA 3WJJC 3JWDC 2ERJB 1FVDA 4FP8L 2X2JA 3EH5B 5IV2A 2IAMC 3MLWL 4DGWC 1B6DA 3KJ4C 3WIIH 2WMPA 1D5IL 4A7UA 4AVHA 3TN0B 1JWUB 5KYYA 4KV5F 1EXHA 4BZ2A 2AV1B 2R2EB 3B9KC 4MA3A 5CU9A 2BVPA 2DQJL 5AZ2H 1YEKH 3BUIA 3GC3A 3FQ2A 1BQLL 5I30H 1PJWA 3HUJF 3QIWD 4QRPD 1JSYA 4LHUA 5CN2A 4NKMB 3UJTH 4ZXBB 4M5ZH 4TQHA 1Z5LA 3P30L 1ED3B 2IPKB 2J8UB 3QS2A 1JD9A 2OZ4H 2VJXA 4HIIB 4RAVB 3VU1A 4MNQB 4RGOL 3US0A 3UO1L 1A9EA 4OTXL 3M1BA 2DQFA 3JV4B 3V95A 3SEPA 3HG5A 1FBIH 4GKSB 1HCVA 5E6IB 1BOGA 3O3AB 4DK5A 1KCSL 3CQPA 5HJBA 2KC0A 5F9OH 5T8IA 3VSQA 5DD3H 2XZQH 4OGQC 1D9KA 5F9AC 2EIMB 4CBZA 4D8OA 5M94B 5FM4A 1FZMA 3V0AC 1MG2C 1I1FB 3G6JA 5D1QC 3NCYS 5EMYA 5EUOE 1RK1A 2GY5A 2EH8L 4WI0B 5DR5H 2ARJB 3ZN6A 4AQAB 1J0IA 5CM1A 3MRMA 4CDHA 4HSQA 1OT1A 1NAKL 3ABKB 3NVQA 4Z7WF 1EQWA 3KPLB 2BSRA 1KV7A 3QDME 4U2ZA 4EEEA 3BIKB 3E2HB 1FIEA 4AQ8C 2K8QA 4H2CA 4Z7VA 1ZS2A 1Z66A 2E9BA 5TPWH 1PD0A 2H2PD 2IIJA 4D3CL 1ODUA 1A7QH 3G5YB 5IVZA 1YNLH 1GC1C 4XB7A 3SDYH 1WHPA 1DJWA 3CMOH 2BP0A 4PJAA 4O9HH 4EIZC 4C47A 4WEMB 2XUWA 3HNTH 3EF7A 2JF1A 4ETQA 4G70B 5T1LB 3BUTA 2WLNA 1FL6A 4PJ7A 4WK2B 3OG6B 4OAWB 4QDGA 2BZ7A 4L4TB 2HH0H 4O02L 4PAZA 1KGIA 3ISYA 3V52H 4YGAB 1G9ML 1A0QH 1FYTD 2P8PA 1SY6A 2W0FB 5IROD 4I77L 5IMOA 5K9JL 3RGVB 3WMPA 3PL6A 4HK3N 1A02N 5CJQL 5F7EH 3CBKB 3E9UA 2VDRB 5DUPH 4ZTOH 3ROOB 4ESKA 1TCMA 4HJJH 4NT6A 1OGAB 2OZ4A 5D72L 5E8NB 1IGIL 2VWEC 4HPOH 1IMHC 4U49A 4BDVB 1U8QA 4IDJL 1H8SA 1FLRL 2B59A 1U21A 3DLQR 3GHEL 2WYZA 3WU1A 4UT7L 1MW0A 3QO0A 5HGDA 4NO3A 4NOFA 2VLKD 4U0QB 2P8MB 2GEEA 1J1XH 2YAMA 3QNZA 2JQMA 3NH7H 2I07B 3WFHA 4FTDA 2F7OA 2MPAL 3VMNA 1MCWW 3FO9B 1AGFA 3RWCA 4AK2A 3QZNA 2Q7NA 3T4YA 4ZQKA 3MLXH 1BM3H 3N9GL 3ZE2F 1KTLB 4FABL 3W9DB 3RNQA 1FJ1B 5CEXA 5LQBH 1ZLSH 3HE6C 4HKXB 2APSA 3D0VB 3FTUA 1A4KB 3FPXA 2YPLE 2Y6TE 4LK4A 4FTVD 3CHQA 2OR7A 3SKOA 3ENEA 5JNYB 3KR3H 3PHOA 2FSDA 3SQRA 5IB1B 5MEPB 3S7GA 2FX9L 3HMWL 3TO4A 1QG3A 2VDRL 5D1XD 3ULUF 3MU3A 3ZVVA 3J8F7 3TONA 5AALA 2XIIA 4GMSH 1PZCA 4D9LL 1QZNA 5DO2C 3P3YA 3AQYA 4R4BB 1TJHH 3TBYB 5T3XE 4XPFL 4KI5E 5ITBL 4YVNA 1TNMA 5D7LB 5EA0L 3QZBA 4PJFB 1KB9J 3ZDYE 1AANA 3WENA 3KS0J 3QJTB 3VXSD 1NTDA 4X5WB 3HG1B 1UZ8B 1QFWH 2YD1A 3AS3A 5E08L 3NT0A 3MV8A 5GS0L 2HLAB 2HMID 1HHKA 4K7PH 3K6NA 5EOQH 5DMKB 1DJSA 1HILA 1KJMB 3KMDA 2X09A 1DQMH 1WVZA 5CWSA 1IL1B 2P44B 4GW1B 4IBUA 2FL5B 3QEGH 5EDXA 5I6MA 5L88H 5HJ3A 2H6PB 1I1AD 1K4CA 3RVXC 3CFTA 5D8JL 2MCMA 4CRPA 1BF8A 3BEWA 4NP9A 1OWWA 3IGLA 1KPUA 4FG0A 4DPRA 4BK5C 3ETBJ 2JCWA 5ENWA 4PMFA 4ZUUA 1ZJBA 1RIUL 3AM8A 5JIHA 3RVTD 2JKWA 3UC0L 3FN0L 3G5XB 1BD2A 3GDCA 1WUNT 1JNHB 4MZRA 4P5TB 4W9EC 1UZGA 3O0LA 4W9ZA 3BUDA 1YDPB 3BAYA 4N8CH 3RI5K 4QY8A 2Z1KA 1MIEL 3L5JA 3MJ9L 5DC4B 4HT1L 3DKHA 1IC7L 1KNOB 3CFDB 4JRYE 4FQXA 4XVUC 5DQ9B 4P2CG 2JTDA 4OSUL 2QMJA 1FDLL 2KLTA 1B4JL 2J21A 2IH8A 4PJXF 1OZTG 1WUZA 1PLGL 4RRPA 4O51A 5KSVA 1SOQA 1Z5HA 4FRWA 4Q52A 1PLAA 1E8ZA 1KBGH 4YOKA 3D30A 4LIQE 3U25A 3ZE1F 3WFDH 2BCMA 4U3CA 4PP1C 3QA3B 3V8OA 5HVHB 1BBDL 1T4WA 2ZOKB 3L6FA 3QUML 2ZIDA 1JPGB 4NZ8A 4ELKB 4G6JH 3JWNH 4BM7A 1CFVH 5F1OB 3X13A 4WUUE 1T21B 2SEBA 5IJDC 1WEJH 4TTGA 4KK6C 2V2WB 4KHTL 1BPLB 4G7RB 3GHBL 5GJTL 2MHAA 3ABGA 4HZAA 4LVHC 1TVBA 5IBUG 3J7HA 4G42A 5C70A 5GSVA 1ZT7A 3QJZA 5BS0E 5TFSH 4M6NH 5MHSE 4OZ4A 3P77B 4UINL 5IHZA 4JM2A 3D0AA 2IWFA 3RLSA 4D8PB 3R1GH 32C2A 1FIGL 3WL9A 3EJUA 5DRXA 4K23H 5J9PB 4G6KH 3MBWA 1SXNA 3QULB 4JKNA 5JDSA 3NIDF 1NPNA 4JR9L 5TH2B 4FJZA 4O2EB 4P2RA 5GJSL 2WUBL 1EZSA 2CLRB 3D4CA 5GGTL 2VE6B 4PHZA 1UKTA 2F1BA 4NZDA 3KLAB 1QD0A 4JO5A 4A2HA 1OANA 3BWAB 2G3MA 2YBRA 4MCYA 3WIAA 2GI7A 1XR9A 2X9XA 3BMVA 5HYIA 2G9HB 1RPUA 3AABA 1S7QB 4MNGB 4YXHH 2WTRA 3EJZD 4RA3A 4FJYA 4DZ8A 2R8SH 4EAEA 1DN0A 4HJGB 5HHQA 1IRAY 2H3XC 3UTTD 4MWFB 5B8CA 1Z9SA 4L8SC 4BELD 3PHAA 1HSAB 5CFAA 5E5MB 5I2IB 3B7TA 2B5IC 4YHOL 1LYQA 4OF0A 3I6KB 3WAKA 3GLAA 2DI9A 5AVVB 1IBBA 4EI6B 1BMZA 3TFKC 5JXAH 4Z7UF 5AVXB 1JPTH 3MJ8B 1CD1B 2D7MA 3S0PA 4DZBB 4R3SA 1PU0A 4YJZL 2ZWZA 1A6UL 1CYXA 1A1OA 5F72S 3NN8B 3DYMA 3WKQA 4HWEL 5F3FA 4DIXA 2ZUQC 4GBXC 5D7JB 4A2FA 1JWMA 1T1YB 5GIRA 1CDBA 3L7FB 5IMMB 4G8FB 3CSYB 2VDOH 4PP2B 1JXGA 1QR1B 5DJ8B 4WNSA 3QQDA 4GFXA 5HJDA 3DV6B 1ET8A 4WFHE 4I89A 3SQBA 5DQDL 5TE4L 3ROLB 3DJ9A 3FMGH 2QQLL 3IGAB 3NPSB 1I8IA 2QSQA 4GG6F 2R2BA 3NA4A 4TS6A 5AW2B 3TH4T 1RVFH 3JWOL 4O4YH 4PJ5B 5J1SC 1B9KA 2CD0A 4CW1B 1J9RA 1FCGA 3QQ9C 5ABAA 4PM1A 3MZGB 4M5TA 1AFVH 5EUOA 3TBTA 1F42A 1IM9A 1CDCA 1A14H 1WLHA 3FT3A 5DS1A 1D2PA 1U91B 2CCWA 1CICB 2ZCLH 2XPGB 2DOCA 1JPFB 3QUZD 5CKAA 3HLKA 1CXKA 4H0LC 1OP5H 1C8PA 3QDMA 2V7NA 4R97B 5T1MB 4F9PC 4Z7OE 2XTLA 3H0TA 4F7CA 2NZ9D 4LDCA 2HVJB 3G5ZA 3L16A 4KKPA 1AZZC 1ZXKA 3F62A 1TQSA 3RPKA 2Y0SA 3LS5H 3NJXA 4MZIA 4JQXC 2G60L 4IIZA 3T0XA 3JUYA 2YGQA 1F41A 5DJ0A 4GSXA 4X50A 2A83A 3LIUA 4NC1C 2DQHH 2VXUH 4X9FA 2HSIA 2V2XA 1E28A 1CVRA 1KLFA 2X6UA 2XKNB 4YDIH 5LNEA 1WG3A 2JKNA 1ZLWK 2G5BA 3D69A 3K4AA 5IVOA 1VFBA 3V4LA 4FQ2L 1BMWA 4A6YL 1Q1JH 4FYRA 3Q2LA 1L9TA 4MDIB 2HT4D 4A2GA 1SXBA 3Q05A 1RHFA 2W60B 4Z77A 4N86A 4I87A 4RAHA 5GS1A 4S1QH 2WVSA 3C5ZA 3AB0C 1AIFB 1Q9LA 3IU4L 4GQQA 3DHUA 5LNGA 2UYLB 3T4AA 3I9GL 1ZVYA 3IDIA 4FCAA 2LU7A 3QC5X 3EOAB 4ES8A 3VD5A 4WNQA 1ECYA 5CZVL 2H1PL 4W70A 2OULB 2QPUA 2WLLB 4JPIA 5FYKE 4FNLL 1J0HA 1XF1A 4JFEE 4I1NB 3U1SL 5BO1L 1FFOA 3DMMD 1N19A 4NRYA 1T7VA 3ELQA 5I0WA 2R2HB 3TWYA 4M43L 1CYGA 1JTPA 2OTUB 2EICA 1ZA3A 1SYVB 1ORSA 2AI0H 1DLHA 4H8HA 4NWUL 4TUKH 2W95A 3DTDA 2WANA 4KPHH 1IEHA 4CN1A 2ZOOA 1ZEAH 1DUZB 1U3JA 3OHXA 4N8UA 5DUML 2ATPA 1CBVH 5K93A 1E6JL 2Z91A 2FJGA 4IMKA 2I85A 3FFOA 3GF8A 3VG0L 1EAPB 1XQ4A 3MFGB 3RWDB 4GY4A 5DD0L 4PV8B 4UWQB 5D93C 3P9LB 1KCRH 2CBQA 1FP5A 4GSRA 5DS8A 4FL4C 5IQ7L 1OL0A 1U3HD 5IJVA 1RIHL 3O3DB 1F6AA 3ZDZB 1G7QA 1VCBC 3ALPA 3L3JB 1QFUL 3VRIB 2YPLA 4ZI8A 5CEZE 1VKXB 1GYVA 5D71L 4PIBA 3GIVA 3O8XA 3ARBC 1SXAA 1QUNB 3H42L 3MLZH 3QPXH 3I6GA 1ZHKA 1HH6B 3SE8L 4QRQA 3GLEA 5CGBA 5B3JE 5KJRH 1SQ2N 3RTLA 5GZOA 3QIWB 4H0IA 4QRPB 3EJPA 2R59A 4XI5D 4BE5A 5DD6A 4LIQH 5CJ8A 3BUYA 4ZDHA 1OB1A 2AJZB 4P2QE 5F7MC 3A4EA 3ZZLA 4FNTA 4X9HA 1TFPA 4HIXL 4XX1G 1JXFA 3HBPA 1S7XB 4N2AA 2IFGA 1A6VH 4KRNA 4EPSA 1SMOA 3VUAA 1ZTXH 4AEEA 2Z93A 4XCCH 1NUGA 2NYYC 3GUTA 3GXTA 3PWJB 1E4JA 5IB3B 1TZGL 1YUHB 4F7MA 5H94B 1JHLH 5IHLB 4LCWB 3U36B 4OLUL 1MI5E 4IBZA 4PRPE 2YEVB 1EHKB 4N2GA 1TJIH 2I5YL 3T0ED 4OF8A 2WLJA 2KZBA 1A2YA 2ZOUA 5IVNA 4MDRA 4NUPA 5KSAD 2HAZA 1MKFA 1IAIH 2JJVA 5CD5D 1ZHNB 1LK2B 1FFRA 3IDNA 2R4RH 4X4YB 1RJCA 4U05A 1OGTA 3QCVL 3FRUA 4WK4B 3TCLB 2PWGA 2GTWA 3A6CH 1B90A 2WXLA 1YMME 3WV0A 1WTLA 1R3KB 3HAEB 2VZVA 4UF7C 5AENA 1R3LA 3Q3GB 4Y4FA 2P45B 4NO5B 2NY4C 3L9RB 2AEIT 3DHPA 4JRFA 1S8DA 3N40F 5J56B 5J6GB 4Y2OA 3IRZA 3QORC 4G8GE 3FB6B 2X2HA 4YK4B 1YEFL 4JRYA 2VMEA 5I1GL 3FK3A 1FYTB 3IMRA 5K9OB 1MLCA 5F96H 4AEHH 3BEVA 4LHUD 4IIQA 3AQZA 1F4AA 1LO0H 4U2YA 5E6RB 3BXNB 5C0NC 3CTTA 3ATEA 1Z3GL 2ZUUA 4A37A 5ICZA 4Q9RH 4NZJA 3MA9L 4IOFD 4OD1H 1WGOA 1W9XA 2CCVA 4EZMA 1X6NA 2CQVA 3VD4A 4XP9H 3VD3A 3MVSA 4FXLA 4XNZC 1OTSC 4WUUA 1FHNA 1H5BC 1MFAL 2H45A 4EMZA 1IV8A 4FXKB 1MRCH 3RVVC 3EOYG 1AC0A 4RDQF 6TAAA 1NCBL 1TCRB 1RK0A 3ABZA 1NLDH 1NCCH 4LLQA 2HFGH 5BS0A 1NFAA 1AE6L 4RGNE 4X9YA 3LOWA 1OP3H 1CU4L 1MLBA 1J5DA 4GXFA 1IKFL 1Q94B 2WJ5A 1BM7A 1DBAH 1Q9OA 1TEGA 1ZDSA 3CZUB 5DFVD 3K6DA 1SXCA 1J1PH 1BVZA 3CXDL 4RZCA 3VH8G 4IW4C 1OSPH 3L08A 1GR7A 3HB3D 1LILA 3STLA 2GSIB 3ZHKA 2DW5A 1EJFA 3EYVB 4J4PC 3C08H 5IB5A 5DJXB 4W9KC 5JIKA 5TJWK 1FG2B 4U4IA 2Y5EA 1KPVA 3RX5A 4FTVB 2XHNA 3V6FB 3WTYA 3FUDA 3F05A 1MWAA 3VD2A 4LNRA 1YJDL 2WLIB 5D1XB 1J9CT 4UTBH 3IBEA 3PFUA 1TITA 1YECH 2XWRA 3LNEA 4U1JA 4XAWL 5CZKA 1KIPB 4EOWH 4M7JL 1G7JA 1E27B 3U30C 3PL6D 3NTCL 4I48B 3ESPA 1IBHA 5AFAA 3P4OB 4XO5A 2WWMC 4HIPA 1ETJA 1JUFB 1RSFA 1XGRB 3F01A 3QPQD 4E9WA 1MFVA 2AXGA 3MKKA 1FYHB 4ONFL 1SN5A 5D5MB 3T1FB 1ZHLA 3CPLB 2X4OB 4UV4L 4HBCH 4PCSA 4Z7QE 5KG9A 2W81C 3AY4A 4HLZH 4CC0A 4OZFB 4GRWB 4LXFA 4KKAD 3N0AA 2FGZA 3FU7A 3QWOB 1G7MA 4PD4J 2CK0L 3RY5A 4R4FL 1IFHH 1I1AB 3EFOB 1CPUA 1LEGA 2CMRL 2NXYD 3MA7A 4HIJA 1V8HA 2O72A 3ISRA 3B7YA 4KY1L 4Q6YA 3PV6A 4YDVA 2MCAA 1ZLVH 2R0KL 4PVLA 5AVRB 3WS6A 2OMUA 3HFFA 4HOXA 4WI2A 5I76B 2Z31D 4ZK8A 2MH4A 5FYKH 4YBQD 5FIEA 3FCSA 3OR6B 4DQOH 3BKCH 5JA9A 5DJZB 3U82B 4ALAH 3MJGX 4HQQL 3BAIA 1NMAH 1ODAA 4LMQE 1JNLL 3OJDA 2CO7A 3CN0A 8FABB 1DVUA 3VD0A 1H8OA 3HRZC 4FYSA 3HG4A 5L2JB 4NERA 2JKJA 2Y2YA 5CJXA 4Z7AA 4LCYB 4WAFA 3FUKA 4GSUA 3ZT6A 4P49A 4J8QA 3UJIH 4Q9QL 1GCFA 3TO4D 5DHXB 1MRFL 3BVWA 4MQXD 2FAUA 4BQ9A 5HD8C 2A5UA 2ESVE 4S1RL 3PJSA 3WE1A 2BP8B 4ZD3L 4FHBD 1IQWH 1T80A 1AP2B 1XIWA 5L4MA 1BREA 2XETA 4HWBA 3DX1A 4UTBA 2E9WA 3VDAA 1G0XA 2YUZA 1YEIL 5HDQL 2MWCA 3LRMA 3VWKC 2FE0A 4QXUL 1RIVH 4IOSA 2BHYA 1XD1A 4JQVA 2EIBA 3MUHL 1FNAA 4XNDA 5I1EH 1AQDB 3OPUA 3D7PA 2CXGA 1CGYA 3GWJA 1IBYA 2CGZA 2J8UF 4MNHB 4PJHB 3MV8D 1I9JL 2CO4A 5FA3A 4H26B 3GI9L 5DHYA 3BX7C 2X42A 4LU5H 1NMBH 4DN3L 3ZJAA 2XACC 4N5EC 2R1WB 2P8LA 4P3WA 1OQXA 3KBFA 4ALAC 3E7JA 3GM0A 4L8DB 1NC4A 4NKDB 4OR1A 2H1XA 4X6CE 1IGTB 3NIFF 4GMTH 1QA9A 4F2MB 5EIIB 3DDGA 4KOBA 4KHXH 4APQA 1YN7A 1I9EA 3ZDXE 1CL7L 5F7WC 1B4RA 1Q9KB 3DV4B 1IU1A 4L29A 4KKZA 4JFEA 2OYLA 4H1LH 4YNYA 3X1NA 5D6DA 3FRPB 1AS6A 1ZANH 2B2XL 3LKSA 3QUXD 3HNSL 5HGAA 2UWEB 4PVBA 5JA8B 1IQDA 2GJ6D 3W2DL 2E7CA 4K5MA 1DJHA 4FQXD 4BKSC 4TN9A 3WG7B 1MFCH 5A2IH 3UTTB 2QGDA 3BPOC 4Z5RA 3WELA 3RRQA 3D4GA 4TTDD 2ZX5A 2V8LA 3VG9C 3ZZQA 4NBYB 2DTML 5MERB 1BZDA 4HFUL 1L9OA 2VUKA 2YUXA 4KVPA 4NCC1 5GHWL 2BSSB 4AGQA 4XX5A 1IJNA 1NDGB 1YNKH 1NGYB 2LGNA 5FK9A 2IG2L 2EVIA 2GK2A 4IRJA 3QRFM 3FQ4A 1OO2A 5D7IB 4PJGF 4E9LA 2F74B 5DC0A 3IJEA 3WOVA 3T3MB 3K81A 4MGXA 5FW6A 3QWQB 5IF0B 3GO1H 3GLDA 1E65A 5DJ6A 5IFHL 4UNUA 2G75A 4JJHA 3CGTA 3WE6B 2FB4L 1DQIA 4JM2D 2IDCA 4OCMC 4P2QA 2YEZA 1P4IL 2VL5B 1LEKA 2D31A 4MBOA 3QQ3A 4XN7A 3L3GB 4WI9A 1VA9A 4A66A 5IJCC 4PH8A 4P2RD 3S3DB 3KLSA 3KD4A 4YSAA 5HYSG 1NBVH 3S5YA 1NCAH 1GIGH 1I3VA 1KELH 4M62L 1NFDF 4TOYL 4YAQB 3NJIA 5FYLE 4IDLA 3TXAA 4OJFH 3H4HA 3EGXB 4J3XA 4WWPA 4CVZA 1SVCP 4BBWA 5E7FA 2O6DA 3RL1A 1MI5A 4GINA 1EGJL 1G7LB 4PRPA 4PG2A 3MNZA 4OM1L 1ZHBA 1DQLL 3FTGA 1BIIA 5CJOH 3LZQA 2VJ8A 5DMIL 4MD4A 4NYLB 4QRSB 2GBAA 1BG1A 2C9VA 1M2OA 2ITDB 2WVVB 3DGDA 4K8RH 3GSQB 4UDTB 2JJTA 4LVNC 3ZMEA 2NNAB 4PJIA 4YBHA 2YXMA 5TK4A 3TA3C 43CAA 1YMMA 3WKYA 5DK2A 3NDZE 5FO9A 5L4IA 1A3QA 4HYTB 2FUQA 4H44C 4L4VB 2FYYA 2OM5A 5A16B 1JGVL 5B39B 4N0YH 3EYFB 1CLZL 1NBYA 4G8GA 4NJAH 4KK8D 3N85H 1AHWA 4NXKA 3ZYOA 2Q86A 3N1GC 2X70A 3O0RL 4AC2A 1PJ9A 1U8JA 2ADYA 4OF5A 3HS8A 3RZCD 2CO6B 1LO5A 1ZS8B 4PJCB 5IM7A 1ACZA 2QADC 3ES6A 3T8XA 3RWFA 2NSXA 2QVFB 3DIFA 5CSGA 4WK0B 3SQOL 1UQSA 3DURB 3L3OB 1UXLA 2AQPA 3I02B 4BZYA 5KAQG 4BFBD 2HZHA 2CUHA 1FZJB 2AERT 5CD3B 2CO3A 2XWJA 4PMEA 1YYLH 4XNYH 3SSGA 1NCDL 3WEAA 1C7TA 3V5HA 1KC5L 4LSVL 4FQCH 2V17H 3UBXI 5F88A 4R5XA 4UT9L 1T7ZA 5D70H 1A1MB 4CILA 4LCIH 3MLSL 2DQTH 5B1JA 4A55A 3GRWL 4HBQA 4MA1B 4LEOB 3QJXA 2AJXH 1FWXA 2DQCL 3QDMD 1XFPA 2VITA 1I8AA 3QCTH 3T1WA 2YZ1A 4ZUWB 5F3HB 1EXUA 2XFGB 1J86A 2K45A 4AGPA 4ENZA 4BFIB 2DIBA 3ASNB 1DFBL 4Y7OC 2NY2C 1U3HB 1TZIA 5E99H 3LRSA 1MHCA 4G7SB 2YKLL 3D52A 3LHAA 3QUHA 3B6SA 4JFHE 1JGUH 4X7TA 3BD5A 5KSBB 4NNPH 2DMKA 1FH2A 4HJSA 4XC3H 1OCRB 2VR8A 2OSXA 1IKOP 1I31A 2DEWX 4WHYG 4J3TA 2APTA 2FHBA 3W37A 2K7QA 1DJGA 3Q6FB 5JO5A 3C6SA 3SHSA 2N3JA 1OCWH 3G6AA 3C5ZD 1RQ5A 1CZ8H 3OXRA 4X0KB 4XMPL 5D7SL 1A6AB 1AR1D 3E1F1 5D9SA 4CC4C 4DEUA 3GBLA 3VTAA 3WNNA 3CG8A 4LSUH 3O6FC 3DSFL 4YPJA 1NAMB 2XQYK 1OTUD 4ZFOA 4ZJ9A 4Z7IA 3E6FB 2D73A 1DBKH 5DURB 1I75A 1TDQA 3OC5A 4OUUB 4PGJA 5BUAA 4LLAA 5I1DB 2OA9A 2BJMH 5KVGH 4IRZL 3NYKA 2PW1A 5JIPA 3LEYL 1BG9A 3T0EB 5IFAL 2EIZB 3QJVB 4FQLH 1XGQA 2NUPB 3ARQA 4P5SA 5DJDB 2COVD 1LEIA 2HTKC 4LASH 1CE1L 4BEIA 1HNYA 5KSAB 3S5LA 5B38B 5D1QE 2BC4B 3V5KA 2HT3C 4LO9A 2XKSA 4XOEA 3VRJB 2CRYA 1I7RB 1F4XL 2WWKT 3C5JA 3FT2A 4WIQA 1COBA 3N1FC 4PRBA 5IREA 3WKML 4L5FL 3KBHE 1JHTA 2A6IB 2H0PA 3OPZL 12E8L 5IV2B 2PCYA 3ESNA 1Q0YL 3CCHB 3O9WA 2WMPB 1UKSA 2VB5A 5I8EA 4LLWB 3T6WA 1LP9F 2E7LA 3CFQA 4YC2C 3C2SA 2YPLD 4HF5L 5CUSL 5L7XH 1QNZH 4AYFB 4EVNB 1SHMA 2YMXH 1M53A 2CJUH 3AQXA 3QQNA 1EUUA 1NKGA 2ZXCA 3PU7A 1UCBL 1HQRA 2YGPA 3V0WL 2J44A 5HYQA 4JFVA 1MW1A 4Q4EA 2ESVA 4X4XA 1JXKA 4UT6L 1VGEH 2YSSB 1KJVA 1NAML 3KPPA 5I18L 4LPYA 3RUGF 1A9EB 4RFOL 3M1BB 5T3XD 3VGAB 4HGMA 4KI5D 1IFRA 4YEFA 4OCXL 5I9QB 3GSOB 2H26B 5DMGC 2VM4A 1NKRA 4N6RA 3FHAA 1FZMB 2EIKB 3GS0A 3OB0H 3EGDA 5JHLA 4XVJH 1RK1B 3OBAA 3QIUA 3F6LA 2VWEE 3U7AA 1LO2H 5EZOL 1A4JB 4NRZA 3MOQA 4QJ4B 3REVA 3KHOA 1JGLH 3S97C 5J13B 2IBBA 2BSRB 1MAJA 4Y2DA 1C5CL 1GYWA 2J8HA 4P9HC 4X6CA 4HKBA 4M7LT 4Z7VB 3SY0A 2NY5H 4U6HA 2J1KA 1BQUA 5A7BA 3M6DA 5FYLH 4BZ2L 2ZCHL 5IVZB 3HZMB 3HB3B 3KBEA 4U1KB 5D2NE 5DFWH 4GAYB 4A67A 4PD4K 4U3XA 3H9ZA 1OAXL 3KGRA 1U8KA 1QYGH 4PGEB 4PWGA 1P1VA 5TF1L 2PO6A 4JPKL 4ETQB 4NGHL 2BDNL 4XNXH 3HE7A 3TPUB 1WO2A 1M7IA 2DAVA 4K15A 3MHZA 3WNLA 4JPVH 5FM5M 1A7NL 4OD2A 4PJ7B 2B77A 2G4EA 2DMCA 4LRIC 5JW5B 2AABH 3ULVE 1OB0A 2R1YA 1SJEB 3PE9A 4LLYB 1I4FA 2P8PB 4RRPM 6PCYA 3NCEB 4P9MH 4MXWL 3ZKNC 5EOCL 4ZMWA 1QVOA 4F8PA 3A4FA 5FKPA 4ACTA 3PL6B 3GT6A 2EABA 1PEZA 4DKEH 4U1IA 2Y6SD 4DEPB 3CHPA 4E9SA 1KB5A 1JYNA 3PGDB 1GZHC 3K91A 3NEOA 4UAOC 4ONGH 2V9QA 4NZUH 3GSUA 4I13B 2HJKA 1EBAA 2X1OA 3B3BA 3CLFH 3S5ZA 1BQ5A 3UL4A 3VXOA 5AAPA 3UOAB 3HS0C 3MBEA 3LZFL 1FVCA 4WUUD 1NCIA 3EHBB 5C92A 5KW9L 1JGDA 5TDNA 3PP4L 2B59B 3RY4A 2HRLA 3FT1A 1QFWM 5C7ZA 3GBMH 3FOLA 1N9PA 2R29A 5BS0D 4DAGH 2VDPB 4E41E 2NXYB 3P0YH 1U8PA 5MHSD 2XA3A 3AT0A 4XMLL 4RMSA 4OCSL 3UZEA 1C08B 1T6BX 4KK9D 2H9GA 1DJXA 1T0PB 3QFJB 5H4YA 4HLZG 1WA0X 2Z31B 3QR1A 2GIMA 3RWCB 2A1WL 3GKWH 4KV5E 3NP4A 2YN3A 3FOMA 3T4YB 4ZQKB 4OFPA 1OAUH 1D7BA 1RFDH 3GSWB 4K7FA 1OAQH 5GGRA 3RNQB 3HUJE 3HHRB 1KZYA 5EULV 5F1KC 2J5LB 2C3WA 4YLCA 4JPQA 3O45B 1K3ZA 1SY6L 1SM3H 4R84A 5HI4C 1HS6A 2BZCA 1IC0A 3PHOB 2Y7LA 1KFGA 3IFLL 5I30L 2YD7A 3PWUA 3WTSA 4NKIH 4NRXA 1QSEB 5KOVC 5CGMA 1KV3A 3TO4B 2YBGA 2R56L 4WENB 2WN3A 4IQHA 2KI6A 1E90A 4M5ZL 1E6OL 2AJUH 3VXQB 5C0IA 4MVBD 2OZ4L 3SCMA 2A4CA 2EKJA 2D4FA 3CK0H 2PXYC 3NUKA 1O75A 1U8NA 3SO3C 3VNYA 5CSZB 2XG4A 3B2PA 4D9QE 2LTQB 3IEAA 4WEUD 3O3EA 3GM8A 3D87B 3ZQWA 3D9AH 2IFFH 3G5VB 5DD3L 1OPGH 5FYJE 3IMTA 4DN4H 5BZWB 2VDPL 5GSRA 4RFEA 4Z7WE 3JBG7 5L6YH 3QUYA 3MV8B 1NSNH 3PGFL 5CWSB 2B14A 1XT5A 4RDQG 2WUCL 4AV4A 1BWWA 3PFQA 5HJ3B 1K4CB 1P4UA 2F53E 2YPVA 4M6AA 2OMTA 1QTSA 2F8IA 1MXDA 3WFEH 5JW3H 3BEWB 4GH7B 1QMUA 1KPUB 2ZUXA 2ZUVA 5LBSH 3DRTA 4U1LA 4LSQH 3MRRB 5KBMA 4WFHD 3RWJA 1D2OA 1XZWA 5ENWB 4ZPVA 4ZUUB 3SDYL 4FYQA 3DI3B 1RUQH 5A2LH 1MCSA 1BFOB 4FFZH 1B0WA 2QLYA 5LDSA 5CCGE 3V4VA 2NPLX 3G08A 4WKZB 4KNTA 3BKJL 4KTGA 1SHXA 3QUXB 4NQSA 1MPAL 4QY8B 2C9PA 2SODB 5ERWA 3GDBA 1FRGL 2GJ6B 4P46D 2WQWA 5DEFA 4N6QA 1DQDL 5ESVB 5K39A 1JZ8A 4FQXB 5EO1A 5I5RA 4LCUB 3N41F 2OK0L 5EU7C 3I3EA 3VGHA 4YL9A 4GRLA 4O51B 4U1HB 4Y5VC 3Q2NA 5A43C 4H1LG 2WYHA 3GNMH 1XIWD 3FKUS 4EI0A 3D25B 5DUPL 2VERA 4ZTOL 1PNDA 1ZK5A 4HJJL 2ZYSA 5I74C 1X9QA 3PG2A 5BVPL 4N8VB 5AKVA 2EEDA 3A67H 3L6FB 1A5FH 4W6WB 2KHAA 3RB7A 4BXSV 3BC9A 3WHXA 4F20A 2ZCKH 4P2OB 3MN8A 2VLLB 1GPOH 2O5ZL 1ZJAA 4JLRA 4P5KB 2IWGA 2MHAB 1RZIB 3CZFA 4MQ7A 5H37H 1TVBB 3TZVB 4G42B 3A3YB 5GSVB 4LOUC 1CE6A 1FZKA 3HMXH 1YUKB 1TFHA 1EV2E 3ZE2E 1PL3A 2NUTB 4OZ4B 1A9VA 3CFCH 3B9KA 2BW5A 4D94A 4JFOA 3WL9B 5DRXB 1Q1PA 5JHAA 3MBWB 3P9MA 2VABB 1BM3L 3MLXL 4JAMA 5AWNL 2YD2A 4WI8A 5HY9B 2J7LA 3PS6A 2GBTA 1JCVA 4YE4H 2HXAA 4IU2A 3S37X 4DP5X 3ULUE 4PY8J 3UACA 2B15A 3NA9L 3U2SB 4XAKE 3CH1A 4W9JC 1BYOA 4W4OA 4F3FB 2WXNA 3X3FH 1XR9B 2QV2A 5KYNA 3B2VL 3NRFA 2F15A 4UQBA 4DZ8B 3BP6A 4GMSL 5D1QA 3FC8A 5HHQB 1ZWIA 3IFOB 4G7QB 3B2UC 2PETA 2AGJH 1MJ7H 5B8CB 2AS5M 3FU3A 3PWNA 3TJPA 2IH1B 2Z65C 4DETA 1IGFL 2APXA 1MQKH 3V55A 5I16A 1FSKB 3WN5B 3ZKSD 3IVKB 5F7NC 4XN4A 5KZCD 3NGBC 2NNCA 5FO8A 4JKPH 4WU5A 3S6CA 4W9GC 3MRNA 4WI6A 4IRJD 3QUKB 4QGTA 1WFUA 4ZG1A 5CEZD 1E2WA 1WAAF 4IGBA 4PFEA 3QYNA 3GSVA 1P4LB 1DQML 3X1BA 1MCJA 3FT0A 5CZRA 3QEGL 1C5DA 4Y88A 2IGTA 3WHE0 2FECL 5DJCA 5GIRB 4NM8L 1E7VA 2X1PA 2WXMA 5D5MF 5C09E 2D8KA 3RZCB 1I9RL 1KCKA 1QRNE 4P2QD 1N8ZB 3HMXA 5F7DA 3S96B 3WO4B 4I5BA 2OMVA 1ZTMA 2WQRA 3F5WB 1WD8A 3NFNB 3I9AA 2RACA 4JG5A 4C4UA 4XVTL 4ES9A 3M88A 3T0AA 4ZMVA 2BHUA 1FQ9C 3QJFA 4PBVC 2OR9H 4B60A 3Q06A 4N8CL 2Y36L 2J6EA 3OGOE 4EZJA 1QKZL 2XRAL 4PJXE 4ZW5A 1VSCA 4R96A 4DHLA 4M6ML 1TXKA 4XBMA 5JOPE 5EUOB 4Y7MA 1MI5D 4PRPD 43C9A 5L2KB 5F1NB 1KXVC 3MLYL 2W1NA 3ZE1E 1KDJA 3V0HA 2H8PA 3V7AG 4M6OH 3GK8L 3P40A 4FKHA 4DGVL 2EXTA 3NCJH 3QDMB 1KWGA 3H0TB 3VU2A 4MMXA 4F7CB 1G43A 1KBGL 4U6TA 3G5ZB 3BE1H 3GMMB 2I9LA 1SMDA 4MA7H 3WFDL 4NKQB 5D2NA 4G6JL 1T5KA 4W6YB 1YMMD 3U4AA 1B2WL 5DJ0B 4XBEH 2RQEA 3ZKMC 5B3SB 4LL4A 1ZVNA 2UXTA 2NTFA 1E28B 2V2XB 4WTXA 3ARDC 3D69B 3L45A 4R7NA 1VFBB 2EIDA 4G8GD 1ESOA 4DO5A 5TFSL 5JORA 1E4XL 3JTBA 3Q6GH 4JG0H 3NIDE 1GMEA 4ETYA 5GS1B 1FNSH 3R7RA 4D0BB 3C5ZB 5E00B 3AUWB 2CM5A 1Q9LB 1ZIBA 3PABA 3S37L 3EO9H 2DQUL 4PWHA 1DBJL 1AR1B 2X6AA 4RQQA 4BE6A 3N44F 3ASOB 4WEEA 2ZICA 4TUUA 1P5UC 1AS7A 1W16A 4GP8B 4LZKA 5C2UB 1HK6A 1IAOA 3W9EB 2NY7L 2P42B 4LVOB 3U9WA 3C60C 1II4E 1NEZA 1U58B 1O5DT 1RD6A 2GIYA 2FBJL 1EDQA 4MA8H 4TUOA 1PAMA 5AVZB 4JPIB 1FZOA 3U0TB 3SGJA 2YXWA 1U4FA 2ZG1A 2XX1A 1FFOB 3RE0A 4NRYB 4LSSL 2JWYA 4R2GD 3UEZA 1IGJB 3AGVA 1JV5A 5I1LA 2VDQB 1ZA3B 2R8SL 3EFDH 2VRKA 1LM8V 3GXPA 4AENB 4E41A 4L8CB 1ORSB 3FUEA 1RUAL 5E2TH 3RDTD 4Z7UE 2ATPB 4AM0Q 1HYSC 4H5SA 3UROR 3NSCA 2QGBA 2AJVH 2Z91B 3IT8D 1G9NH 3QNXB 5SV4A 3RVUD 4PTTA 1IAIM 4ERSH 2ZG3A 3TIEA 4KJPC 4ZMNA 2A9NL 4RMUA 5DS8B 2A73A 2Y1VA 2B4CC 4TXVB 2DWDA 3WY3A 3T0BA 1OY3B 3ECBA 3HUJA 3LPPA 3WFBH 1B4LA 4BK5A 5LGHH 4XVSH 4GI6A 4TVUA 1P4BH 3AG3B 2ODHA 1RY7B 1JK9B 2VC2H 3BQVA 3GIVB 4KQ3L 3I6GB 3K2MC 1ZHKB 4QRQB 2B1HL 3L5XH 3IDJB 4GG6E 2JI2A 5DD6B 4B6ZA 4FQJL 2ADGB 2J1WA 2YMOA 3N06B 4NUGH 1T03L 3BT2H 4NQEE 4ZDHB 1OM3H 2NXZD 1GTFA 5T5FH 1F4WL 3L7EB 2NYKA 4WY7L 1CMOA 1JG9A 1OLLA 3T77A 4AQEB 1U2HA 1XSJA 1WZ1L 2IWKA 1TF4A 5BV7B 3QFDA 1TOXA 3OVUB 3ARGA 1YEGH 2A9CA 3IGFA 4LNVA 1RVFL 1XB8A 2Z93B 5A2BA 1J48A 1DBMH 4N87A 3GUTB 3IJHB 4OCNC 4Z7WA 5FECB 1AFVL 2GEQA 4F7MB 4KBPA 4NQCB 4DQAA 5JW4N 1A14L 4ZO8A 5C9KA 1A2YB 3C6LD 4AYEC 2ZCLL 5IQOA 2ZKYA 5LWYH 1FORH 4XNUL 5IW1A 4FHJA 4TNGA 1DDHA 3GRGA 2WIIA 4F8TA 2DQMA 1RPQA 4LCCC 2FEDC 1MCQA 3TM6A 1T04A 4AI7A 3V0JA 3U83A 4YPGB 3QXVA 2Y06L 1VIWA 2W9DH 2WSDA 4MHHI 2W80C 3NCMA 4XP1H 4G80B 5I23A 2G5UA 3F58L 3J27A 4DVBB 4OJCA 2BMKB 5GGQL 2R4SH 4E9QA 1NPJA 3I6SA 2DV6A 2A4EA 3KYOA 4EBQH 3I2CH 1Q1JL 2EYRB 5DLLA 2FX8H 2BOLA 2R0ZL 2ZP0T 1N7MH 3L48A 5T3XL 5LKNA 1ANUA 4TSAH 1SLWA 3ALWA 5HTSA 1MLCB 4X80H 3LQAL 5BV7L 3BEVB 3G04A 3FSOA 2EP6A 4MDJA 4LSTL 2ESVD 4S1QL 3ZTJG 1JYXA 4JZJC 1YYMH 4K55A 4LQFL 1NGWA 1T7YA 3SGDI 5A6IA 3TT1L 1G94A 3CX5K 2CIKA 3CVHH 4PS3A 5DRNA 5E6YA 5ICZB 4L2LA 2E27L 1CN4A 1YA5A 4JM4L 2PCPB 3HKZA 4G3YH 2DEXX 2YWYA 4AQ1B 5AW0B 5T5FA 5SX4I 3K7UA 3UBHA 4POZD 3FHQA 3IDMB 4JX0A 4WUUB 4MQSB 3VYNA 4JHVA 3STZA 3EJYC 3PAYA 4KK5D 3GXFA 4WZ9A 1HIMH 1ACYH 3NAAL 1BAFH 1HEHC 1RK0B 3QIUD 5IFJA 4X7FC 3DOIA 3ZBMA 5BS0B 4BJLA 3FU5A 3GI8H 2XPYA 3APCA 3O4LE 4P48A 3ORJA 2JI1A 4RWYH 4TUKL 4KPHL 4WKXA 4AMKL 5DEGA 5MENE 1I53A 4CADA 4HSCX 1CBVL 3UJJL 3HPLA 4AL8C 3AXLA 4Y2DD 4PLNC 4Z78A 1CFTA 1Q9OB 5EF3A 5IJKC 1KN2L 4GBXA 2PW2A 5I0YA 1URLA 2IALB 2WQ8A 2XT1B 5I19H 4CSPA 4HU2A 4ZS7L 3STLB 2WKOF 1H9VA 5IB5B 1I9IH 3MRJB 4JY6A 3ZX1A 1Z1WA 1KPVB 2PO6D 3LIZA 3L3KA 3EH1A 4V1DE 3HE7D 3ZL4H 5GS2H 1MWAB 3RFZA 2ZXBA 4LNRB 1ORQA 4AEFA 1INEL 4L1LA 1CUOA 4WO0A 3Q2CA 1CDIA 1OW0A 1MOEA 2HFEA 1WC7A 4LIQL 4URTB 4X99B 1MRDH 2VSDA 3H85A 4U1JB 2ICWJ 3ARZA 3CSBA 2EC9T 4UDUB 1G7JB 4X5PA 5EFIB 5FUZH 3MCLL 3S3BB 4F24A 1BMGA 1IT9H 1JP5A 2F54E 3KW8A 4QTHB 2X4QB 5HYJB 3WKPA 1XX9C 1T4KB 1ZHLB 3GTTA 4BKLA 5KG9B 3MBED 1BZEA 2I69A 1VFAA 3OKKA 3ZPDA 4KZCA 1GW0A 1BVKB 4JY5H 1P53A 3FQRA 4HUVA 2V4LA 3FU7B 1KG0B 4ANUA 1A64A 1G7MB 1JHKH 1GZPA 4GXVH 4ZFGL 1XF2B 1O5PA 3LS4H 4JHWH 1JZHA 4R7DB 3TVMA 1LEGB 2E8ZA 1IAIL 1JS4A 4HIJB 5IZ7A 2Y9RT 5C09A 4N4YB 3V7MA 2Z7ZA 4YDVB 5JYMA 1QRNA 3EKCA 5L8LB 3FCSB 3B43A 3QXWA 4WO4D 4D0CB 1HXMA 1MWAL 3NRQA 3O6KH 4F7TB 4WUKL 1BLNA 3LDBC 2CUIA 3CHXA 1GJUA 4FZEH 4UQEA 2O61B 4Y4KB 4HUKB 5CINH 5FYLD 4AUJA 4PJXA 3MJ7A 1KYDA 2EDOA 4QRRD 2V8MA 1BXUA 4P46B 4I0PA 2EE9A 3M17B 5EEWA 1F86A 15C8H 5FHAL 4EI5A 1C5BL 4BWWA 2EXWC 2C9SA 3ARPA 4OBSA 6FABH 5F7FA 3BZ4A 2NR6A 1L0PA 3ILPA 5C0CE 4HJ1A 4HOMA 2B0SH 2C1PA 4LAJH 3U0WL 1SUHA 5JQ6H 4Z7OB 1RZJL 3IK2A 4K07A 3WNOA 4DPAX 1U8OA 4LCVA 1INDL 4LVEA 5F6IC 5MI0B 4ANVA 3SDCA 2XZAH 2X44D 3QE5A 3BWSA 4XP9L 2YWZA 1TTRA 2Q3XA 3FS9A 4AT6A 4NQDE 3INUH 1CL7I 4PJBF 1P69B 2ZSWB 3VQMA 3NZHL 4WGKA 3VGGA 3QUYD 5EO9B 4HPHA 5IOPB 5CHNA 1E7UA 1XSIA 4IKIA 2BVYA 4GQPH 5I73C 2HPOA 2BRRL 3R0MA 1HZHH 1MCPH 4R8WH 3BRFA 2EE6A 4PJEB 2PCFA 2FD6L 2EEXA 2OKMA 3NZ8B 3BLKA 4ZTPH 1DSWA 4PVMA 1EZVX 4BSWB 2HG5A 2DM4A 5H37G 2W9EL 3BN9C 4ENEC 5LGJA 4TSBH 2NY3D 4LPVA 1KFAH 4YLQT 5LLIC 1T66D 3V79C 4OT1H 4B95C 5EU4A 4YNYB 4AKOA 3IF1B 3ZT5A 3APNA 5HGAB 1IQDB 3PAUA 2UZXA 1UTDA 2O5XL 2KDGA 4HWBL 5C0FB 3FU9A 4UTBL 3BVDB 5C2BL 2MTPA 3D34A 5IKCA 1TSHA 4NZFA 1WFNA 2OMYA 3A21A 1Q90A 3KAAA 4Z7UA 1K8IA 4XMVA 4Z5RB 2JLLA 3CFEA 4I2XE 5DYOA 1XH1A 3FTYA 3FCGA 2BNUA 3CBJB 3ATAA 3GMQB 1YN6A 4WHDA 5FDWB 2BX5A 4P23B 1AHKA 2P47B 4HAFA 3VJ6A 5KZCB 5ILTL 3QEHA 1BECA 2HUHA 4FFYH 4IRJB 2DQEL 1F3JB 4FC3E 1KIRA 1ID5I 5DVMA 4JFHD 1BQKA 3L81A 3TT3L 3CZSA 2PLTA 2H3NA 3NESA 2IDFA 2OQJA 2IAMD 4S0SD 3P11L 1IFHL 1FNGA 2C7UA 3RURA 1EK3A 4GG6A 1CF8H 3IMVA 2VXSL 4K94H 2JK5A 3B9KD 1CG9A 4NQEA 4WFFE 4P2QB 3EYUH 4XCNA 3QORA 5E4AA 2YEZB 3APDA 1X5YA 1LEKB 5I1KH 5FYKL 5I1CH 3BIAX 3JZ7A 3TIDA 2D31B 4H8WL 4U6VH 3QQ3B 4DQOL 3BKCL 5IT2L 1L7IH 3MOBL 3VDCA 4OIAA 3QDAA 1L6ZA 3MLPA 1MJJA 2APWA 1YEJH 2KMWA 3FTVA 2DI7A 2BIMA 2Q5BA 5KTEH 4CVZB 4H4NA 4UQCA 1S7VA 2VN7A 2FUTA 4MAYC 3RJDA 3WBDA 1HKLH 1MI5B 4PRPB 5KANI 1XDTT 4X4ZA 3RBGA 1PFOA 1U8LB 2OCCB 1HAUA 3UJIL 3VFMA 1M57B 4FJ6A 5BRZB 4JK0D 5HVWA 2XQ0A 5HI3C 3FTGB 3J07A 3W11C 2O6PA 3FUNA 5D1QD 1FPTL 2F7IA 2QDVA 3AG1B 4YGVA 2VR3A 2DD8H 2J5WA 4MRCA 2D03H 2IAAC 4X5QA 2TAAA 4Z0BL 2XWCA 3P3TA 5CEZL 1LGVA 4PS8A 2J8UE 1PIGA 4MNQE 4A2EA 2BOBA 43CAB 3FO1A 1G7HA 2PTTA 1V7MH 5I1EL 1C8QA 1F2QA 1OWRM 5KVEH 2X2UA 3IGKA 2NLJB 3X1FA 1IJ9A 2FYYB 3OLGA 4NUQA 3DK0A 1F45A 1MNUL 3RIFF 3SDXF 1HCZA 3RWHA 3MODH 3NIFE 4G8GB 5FW7A 4LU5L 3OKEA 1UD2A 5L0QC 5CN1A 4ODHL 4CKQA 1SXSA 2Q86B 4KQ0A 2ICEB 1A3ZA 3SO5A 4N8PA 5ITFA 5DVNA 3KPOA 5ADPL 3V9CA 5KEZA 4DK6A 3BPNC 2WM0A 1P9MC 4GMTL 4GIOA 4JFYA 5IM7B 3ZRCC 3HI1B 4D0DA 1Q72H 3RWFB 2F8XC 1RUPL 5CCHE 5JDJA 3OAWA 3D09A 1T0MA 4PVNA 4C56E 3V7AE 2Y24A 3VACA 1V5JA 1DVFB 2O5YL 3LHPL 4XPHL 2DQDH 3F00A 2FWSA 2YAOA 3DUSB 4HUUA 3K3QA 5BMFL 2C3VA 4R2GB 3T6XA 2VQ1A 1NCNA 3V5HB 3QDGB 5KYUA 1CFSA 1AVAA 1A6WH 1EMTL 2X3CA 1UVQB 3O4LA 5EOTA 5MENA 3H2PA 1KGYE 3R0NA 1FF5A 4DEWA 4L4TE 3RDTB 4JPWH 4OB5L 1WF5A 4OCRH 2V5SA 2VITB 4EDWL 5LVEA 4PJGE 1EXUB 5JLZB 4HUMB 2E4FA 4UQ9A 2HB0A 5ANME 4KWUA 5J11B 3WEXB 5KS9B 5ISZD 2DN7A 3LRSB 5E94B 4AJYV 2G2NA 3G5WA 1OARH 1OGAE 3D0LB 3WGUB 4Y9BA 1R0AH 4Q6IC 3VI4B 4PLOB 4V1DA 1W0WA 1IX2A 3HZKA 4HXBL 1H3UA 1MCOH 3HC0A 1OCOB 3EJCA 5C9JA 4LAQH 4ISVB 4OQTA 3ULVD 1ND0A 1DLFL 2XTJC 1BXXA 5JO5B 3C6SB 1EPFA 1JXDA 2PWFA 4JMNA 2NXZB 4P4RA 4JFQA 4AY0A 3RDJA 1NFDE 1Z9PA 4MYWB 2XQYA 4NO2A 5I0XA 1BPVA 4DFIA 5D9SB 4YBLB 5SX5H 4OLVH 4F8NA 2AVFA 2F54A 1EEQA 3SDDA 4H8QA 2RJMA 1G1OA 4H13C 4UMSA 2EILB 2Q76A 2UY7B 1GIGL 4ZFOB 2UXVA 5I1JL 4E9TA 1BFTA 1W6WA 4BUHA 3IYLW 5CILL 1E43A 4BSJA 3N1PC 4BFOA 3C6LB 2OJZH 3RU8H 4BHUA 1H0DA 1XGQB 1JTOA