3NJHA

D37a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
PQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGAITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDPQIINRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
molecule keywords Peptidase
total genus 20
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njhA00
5A7EA 4GXFA 3FYEB 2AVFA 4A68A 2XLLA 2BP8A 1NWPA 3CZUB 4YSCA 2YAHA 2ZONA 1CYXA 5AFAA 3IN2A 2BWIA 5E9NA 1F56A 3AY2A 3FQ2A 3FSWA 1J9TA 3UABA 3L45A 2NRDA 2GC4C 1HFUA 3NJJA 1GR7A 2B08A 1GS7A 1IKOP 1AR1B 2OV0A 4KO9A 3OD3A 2IDSA 1RKRA 1IUZA 1NIAA 4YVUA 3CVCA 3NJMA 2VM3A 1PCSA 4YSPA 1FWXA 4BK5C 4DP9X 2PPFA 5IY5B 2HZHA 1HAWA 3UACA 1L9PA 2PCFA 3V9CA 5I6OA 2YAQA 4KNTA 5PAZA 3NP4A 1SF3A 4EF3A 3IBOA 3CVBA 1J5DA 4AZUA 1JZIA 3BVDB 3NJLA 1PZAA 3OMNB 3NJGA 2J55A 4KO6A 1GY2A 3EH5B 3NSDA 2VMJA 3FPXA 1KV7A 4M3HA 1AIZA 2DWSA 3NJKA 4E9RA 3U25A 1ZIBA 2OJ1A 2WO3B 1TEGA 3C75A 1ILUA 1OV8A 4A66A 3ABGA 1E30A 3T6ZA 5I6MA 2BP0A 4KO7A 1L9OA 4F2EA 5B1JC 4BXSV 1AOZA 3H4FA 4Q8BA 3CG8A 1FFTB 1A8ZA 1PF3A 3FSAA 3NYKA 2XX0A 3X1EA 1AAJA 1KCWA 1KDJA 2XX1A 1M9WA 4A2HA 1ET5A 4CSPA 3T9WA 2PPAA 2P80A 3ABMB 1AZNA 1JZEA 2FT6A 3IE9A 2FQDA 2FQGA 4KO5A 1BXAA 1PLAA 3QJUB 1A3ZA 2ZOOA 1BYOA 1CC3A 1ASOA 1B3IA 4N8UA 4NB7A 1MZZA 4HIPA 1JXDA 2E86A 3FS9A 1ZPUA 1W6WA 2LLNA 2DYSB 1JXFA 3WI9A 2XVBA 2HRHA 4X4KA 3QJTB 1NPJA 2H5UA 3AG1B 2IH9A 4BDVA 3QJSB 1ID2A 5B1AB 3AG4B 4E9VA 2Q5BA 2CUAA 2W8CA 4G71B 4YSQA 3NJFA 4HAKA 1PNCA 3X1NA 1NPNA 2XV3A 1V55B 2BW4A 1WA2X 5F7BA 2EILB 2IAAC 3IEAA 3HB3B 4DP0X 1OE3A 4KNUA 2GHZA 3OMAB 3H56A 1NTDA 2YARA 1NDTA 5TK4A 2TSBA 2VW6A 2XUWA 2CBPA 3WNJA 1QNIA 5AKRA 1JZJA 3ASOB 5I26A 4AKQA 1JERA 3T6WA 5D4IA 2HX7A 4E9TA 1OCZB 4E9QA 3WG7B 3D12B 3SQRA 3PLYA 5PCYA 3OM3B 3UAEA 4G7SB 1AZUA 4F7KA 2GC7C 1ETJA 1JVOA 3AZUA 3H4HA 1N68A 1ET8A 1E5YA 1XB8A 3QJQB 2JFCA 4NAJA 1AS8A 4HCIA 5I5IA 2H3XC 1L9QA 1AACA 3PPSA 4YVNA 1SHWA 4UAHA 4JHUA 3S8FB 1KYAA 4M4RB 1J5CA 4RH4A 2VSKB 2BHFA 1GY1A 3X1GA 3JT2A 3CVDA 1ASQA 3PAZA 2BO0A 1IC0A 3SBRA 2QPDB 3UGEA 3TA4D 4E9YA 6PCYA 3FPYA 2BW5A 1SJMA 1X9RA 2YAFA 3ERXA 4G7QB 1PZBA 1E67A 2QPEB 3TU6A 2BZ7A 4W1TA 1J9RA 1GW0A 2IDQA 4DPCX 4YSRA 4DP4X 1UATA 4P5RA 2GSMB 2IWEA 1WS8A 3CDZB 3FT0A 2EIJB 3FU9A 3GXUB 4GYBA 2CALA 2I7SA 4HCFA 4HZ1A 3S3BB 2CAKA 1T5KA 4YSTA 1L9RA 1NIBA 2TSAA 1W6LA 2GB2A 2FQEA 2R7EB 2BZCA 4JKNA 3NSFA 1AZBA 2PPCA 4TXVB 1WA0X 3FU7A 1BQRA 3KW8A 3TBCA 4AI7A 1JZFA 1KDIA 4KNSA 2PP8A 4YSDA 1EHKB 4DP2X 1BAWA 3S3CB 2PP7A 1A4BA 2UXTA 4YSUA 1BXUA 1X9UA 1MDAA 2DWTA 2WO2B 2J56A 2X88A 2DV6A 1ADWA 4AKPA 2IDTA 1CUOA 3X2QB 1WS7A 3X1BA 4E9XA 3NP3A 2UX6A 2YAEA 1OCOB 5D4HA 3EHBB 5I5JA 3OMIB 1IBZA 4MFHA 1BXVA 3S8GB 3WKPA 3ZBMA 5I5MA 1BEXA 3ABKB 4A2EA 3NT0A 2P80D 3AW5A 5I6PA 4QLWA 1FA4A 1J9QA 1OCCB 1GS8A 1ZDSA 2HXAA 2XXGA 3DIVA 1OCRB 3QPKA 2HLEB 4BXVA 5I6KA 4UF7C 3QJVB 4HALA 4AX3A 1XB3A 1GYCA 1SDDA 3RYMA 2AZUA 1JZHA 2AANA 2H47C 1L9SA 1AG0A 1PMYA 1RZPA 5I6LA 1J9SA 4QKTA 1KBWA 2DY2A 1JXGA 4DP5X 1OF0A 3AG3B 3MBWB 2YAMA 1A65A 4L0PB 2N0MA 4A67A 1R1CA 1AS6A 2CCWA 5AZUA 5B1KA 3X1FA 2YXWA 2ZXWB 2JKWA 3ZIYA 2XWZA 2YXVA 3FSVA 1NICA 4UANA 1NINA 4A2GA 4G72B 1XB6A 4YSSA 2PPDA 2UXGA 2I85A 4YL4A 2PPEA 3N55A 4P5SA 5LDUA 4N4YB 2XU9A 2JXMA 1TU2A 2FTAA 1ASPA 4HCGA 3V9EA 2VN3A 3MX0B 5B7EA 3FQ1A 2A3TA 3QQXA 2PLTA 4GP4B 2R7EA 4YSEA 4DP7X 2AZAA 1NIDA 3QJRB 4K9JA 2Q9OA 1PLCA 2MTAA 4E9WA 1GSKA 3PAVA 4A2DA 1ZIAA 2UX7A 5I6NA 1SHXA 2HX9A 2ZWNA 2XXFA 1ZDQA 2GI0A 4DPAX 1TEFA 1ILSA 1QLEB 2Y69B 3BQVA 4ZK8A 3T6VA 1RZQA 1MZYA 2I7OA 2IH8A 3ZX1A 3OQRA 3NSCA 1SFHA 1YLBB 5B1JA 1GS6X 2QDVA 3ABLB 2Y1AA 2VW7A 2VSMB 4YSOA 8PAZA 1KCBA 1JZGA 2GIMA 6PAZA 1PY0A 3PCYA 3TASA 3EF4A 1JOIA 2AFNA 2W88A 3WIAA 3UAAA 3DTUB 1URIA 2UXVA 2IDFA 3CDZA 2IDUA 4GY4A 2J57A 4PCYA 1MG2C 3PXLA 1WA1X 2XYBA 3FU8A 3NJIA 2OCCB 1BYPA 1AANA 1KGYE 1W8EA 1NWOA 3IN0A 2EIMB 2FNWA 4DP1X 5FC9A 5TK2A 3NSYA 5B7MA 3WKQA 1OE2A 3EH4B 3FQYA 1RCYA 3FYIB 7PAZA 3KW7A 2FQFA 2YAPA 4GP8B 3G5WA 2QDWA 1XMEB 4NERA 3WNIA 3GYRA 4DP6X 5F7AA 1AZRA 2HX8A 4BWUA 1L9TA 1E65A 5B3SB 2EINB 4BWWA 2MRYA 1JVLA 2XV2A 4GP5B 2BP8B 2EIKB 2FT8A 5B1BB 3DKHA 2XV0A 3GDCA 4HHGA 3NJNA 3T71A 4HHWA 4BDVB 1OE1A 2FT7A 2YQBA 9PCYA 1A4AA 1CYWA 1PAZA 1PZCA 2VM4A 1NIEA 4G7RB 4JHVA 4A2FA 1ZV2A 2X87A 4ENZA 4W9ZA 1V10A 1SFDA 1BQKA 2BP0B 2YAOA 3NJHA 2J5WA 1CURA 1DZ0A 4CSZA 1HAUA 2CJ3A 1N70A 5ANHA 1PLBA 1TKWA 2DYRB 4BWTA 2BWDA 1DYZA 3JTBA 4E9SA 4FAAB 2IWFA 1ET7A 4G70B 1AG6A 1I53A 1KBVA 3PAUA 2VW4A 3TBBA 1AS7A 4AKOA 5I28A 1BQ5A 4PAZA 1VLXA 2FWLB 1SDDB 4FA7B 3AG2B 5D4JA 1E5ZA 1QHQA 1M57B 4WKXA 5B7FA 4KOBA 1SF5A 1IBYA 1M56B 3EH3B 3ZDWA 3SBPA 3N2JA 4YSAA 2GBAA 2PCYA 4F2FA 3SBQA 1SNRA 4WTQA 5EHFA 2B3IA 1OOWA 2FJSA 3T6XA 2UXFA 7PCYA 3HEIB 4KOCA 4DP8X 2QT6A 4Q89A 3FU7B 2HRGA 1AQ8A 1NIFA 1PNDA 4DPBX 3ASNB 1A4CA 2WSDA 1AZCA 2PP9A 1NZRA 2IWKA 2RACA 3S3DB 1WAEA 1EZLA 1V54B 1MG3C 3FSZA 3UADA
chains in the Genus database with same CATH superfamily
4QTIL 3FN9A 4GXFA 3GSNL 4D0CB 4H8VA 3QJHB 2R83A 4HLZG 1G7IB 3BPNC 4UOW1 3KYAA 2PO6D 4G7YH 4X9GA 4YHPA 4NQEA 2AEPH 3BWUC 3V4VA 3PGDB 5JR1L 4NWTH 3M07A 4UM9B 4LIQE 3K72B 4HPYH 5FKAB 5CLTA 1YYMH 2CRYA 1IGYA 1VGEL 3KS0H 3GHEL 3GXPA 3H85A 3KVQA 1UM6H 3DUSB 1IAKB 1OAYH 5DYOA 4LEOA 3VM5A 4OLVH 3NJJA 3Q5TA 1U42A 2B08A 5IVXE 4OCWH 2DQDH 3EG9A 2WYTA 3W11C 1JWMB 1WT5A 1BSIA 4M61A 4XMTA 4L2YA 3MUJA 1NKGA 3GB7A 4FMFA 2C1OA 2CO7B 2ICEB 4L3ED 2EDQA 1CD0A 2IH1B 4L37B 5C7ZA 3EFOB 1O6SB 2O6FA 4ODUA 4YO0A 4Z7UB 2J55A 2O30A 4KO6A 4XPFH 4IW4C 3UTSB 2I07A 4PN6A 4W9DC 4Z3EA 1N5YH 1N3NA 4WJG3 4MA7H 1AQKL 1L4IA 1HHIA 3Q5OA 3G5YB 1KG0B 1CL7H 1D5XA 5GRZA 1OV8A 3HZKB 1MW0A 3WO3B 1RK0A 2XJLA 1PZSA 3KJ6L 4M7ZC 1MY5A 3F3HA 3S2AA 5KVFH 4P05A 4X9BA 4P2RE 2PCXA 3SE3A 1PIFA 3FSAA 1DQQB 2KBGA 1RHFA 2PO6C 4WENB 5I30H 3RHWF 4QWWD 5KVDL 4OIBA 3D3VA 3VD5A 3GJFK 2ZPKH 3JWDC 3EJQA 4TUJA 1ZA6B 1OT1A 1CXLA 4K71B 4KTDH 4XN2A 2FIKB 2P5EE 4S2SB 5FHBL 3VFRB 3FONB 4WNQA 2VUYA 1YECL 1BYOA 1E6OL 1G7HB 1N4XH 2X28A 4QIRA 5IQLA 3S34H 3VRJB 3DC0A 1B3IA 1I9JL 1E2WA 1MZZA 2GJ6A 4E41E 3BKYH 5HYFA 4CW1A 3K80A 3O41A 4K15A 1A7NH 4XHJC 4S1RL 5JZ7C 2F5AL 2WWMD 1S9VB 3FB5B 1MCPL 2OCJA 4RBPK 1FV1B 3FQXA 2V2TA 2BSRA 3P4OA 3PL6C 1KBBA 2DQCH 4RAVA 4LLUB 3V4PB 4Z7OB 3BZFB 4XPGL 4TUOB 1P7QA 3CDGB 2VRQA 3D0LB 3FL7A 5JOPD 3DA0A 4UTBH 3LNGA 4GKNA 1NDGA 4OCSH 4IBZA 1NLBL 3BHBA 4WGWB 3A6OA 4W9JC 4MCYA 5MEPB 5EA0H 1UURA 4EDWH 3IFOA 1WCQA 2J71A 3DTXA 4LCWD 3L4CA 2X0WA 4IIZA 2D0FA 3OLGA 1J0ZA 5FM4A 1MFVA 1NDTA 3STZA 1JCKA 3C6EA 5DHYB 1MCWW 5SV4A 3QAQA 4LAQL 2R1WA 4KQ3L 3SSGA 3L54A 5E6IC 2VDLL 2WO4A 4KX7A 2G0KA 2VDKB 4E9QA 3U2IA 4ZMZA 3GSWB 5PCYA 5E99H 12E8L 2J8HA 4NPYA 5EFIA 5EZJB 4J5VA 4JZNB 5AVUB 4U33A 3X3GL 1XB8A 4OFKA 4KV5F 3IDJA 2JFCA 1RVFH 3U1QA 2Q3AA 2YSSB 2K6ZA 1QYGL 1GC1C 1YYCA 2HFEA 1QLEL 5AKVA 4KKZA 4UQ9A 3PPSA 3P0YH 5CJOH 4Y4KB 4IU3B 2Y24A 5CP3H 3S8FB 1XGPB 5IM7B 3HUJE 1FYTB 5ISZA 4MNQE 3KCPB 4IKJA 1KTCA 3JT2A 4LCIH 3D39A 3WEMA 3BQUC 5GZNA 4GAJH 3F7PC 4ONGL 2BO0A 4JPSA 5T3XL 3UYPB 3HZYA 3TA4D 4YDKL 1OSYA 2F2HA 4PJ5D 3EYOB 3QI9D 3ZDYB 2FSEB 1IC4L 4NWUH 4H13C 4R8WL 3R4RA 1E2VA 3O4LB 5EUKB 4JN1L 3UAJC 3MV01 2FB4L 3BDXA 4G43B 4HGKC 4JFED 4YSRA 1GPOL 3OZ9L 1KGWA 2NY3C 2QKSA 2C9UA 4PRPA 3FU9A 1TO5A 3QCUH 4RMRA 3QPQD 1DTUA 4X8XA 1YUHB 2X2HA 2V2XB 5ADPL 4KKBD 2X1QA 3TIEA 3OJ2C 4PLNC 1UHVA 4JKNA 1A3RL 2W0LA 2XWTA 1SXCA 3MGTB 4YE4L 3RVVC 1AZBA 3X3FH 2DF3A 2BIHA 3RWJB 5FK9B 4WWNA 2L3BA 2IGTA 1EHKB 3ABZA 3UJIH 1IBGL 3MLSL 5DJDA 4UWQB 2E6JA 3S3CB 1VFBB 4LAJH 5FOJA 4C4KT 4PYGA 2UXTA 2VN6A 4F15C 1QRKA 1H3PH 5D7SL 1LDPL 2WTRB 4NQEE 1JCVA 3VE0B 2KC0A 4GEJA 1RZ8A 3IJ8A 2QPSA 1AOHA 5KSBB 4ZYKB 5IB3A 1HXYB 1CTNA 3GWJA 3Q8AA 3EH2A 4UB0H 4XCNB 4MX7A 1DQTA 1J12A 1W8OA 3Q3GA 3RI5F 2CIIA 2DLEA 1B88A 1JTTA 1RUAH 4IRZL 4Z8FL 1BFVH 4ODSL 1SYSA 3SCMA 2KS0A 3EHBB 1S2EA 2BWQA 2YJQA 4HCRL 3TURA 4Z9KB 1G9HA 4MRBA 3Q9QA 2IBZX 3CVHB 1GL4B 1YJDL 5CJQH 4G8GB 4XE0A 2V8LA 1JZ3A 3CHXA 4QXUL 5I2IB 1A5FH 3HG0A 4K7PX 5EU3B 3RPKA 1DFBL 4JFYB 2P47B 3FTGB 3HNVH 5DK0B 4NO2B 4JANB 3VFMA 3BI9X 2Z92B 5F1IB 4PJEA 3R8QA 3H3KA 3G6AB 43C9A 2AJYH 4JPWL 4MYPA 5D1QA 3RJDA 1JNHA 1ZLUK 1AY1H 3BWUF 2AK4A 3MXWH 4PWGA 4M7LT 4TQEH 4Y2DA 1A1NA 1NGYA 2A38A 4XNAA 3DYOA 2R29L 3GDBA 3FUEA 1KB5H 1DJYA 2XPGB 2AZUA 4JPIB 4QYAA 4PVBA 2Q7YB 3PGDA 5F97E 3S4SA 1X5IA 4BSJA 1L9SA 1PMYA 5K39A 2EP6A 1J9SA 5ICYB 3L3JA 2XIIA 4APXB 3MBWB 2YAMA 1OGAE 2F5BL 5HDLA 1IAKA 2N0MA 4I85A 3NMEA 4APXA 4NLHA 1OSPH 2CU9A 3BGFC 3LIZL 5ID0A 6TAAA 1XBRA 2EYRB 4X5PA 4G8AC 1LP9F 4IHOA 4OCWL 3RWDA 3RVUD 3TBSB 2W91A 1NOLA 2EYRA 4EUPG 1XZ0A 4MXWL 2FZ3A 4WSJA 4BFBD 3VXOA 5AB0A 4HD9A 1I1YA 2WYZA 3FSVA 5F88A 4PRIB 2D4FA 1OGTA 4LLWA 4RGMB 1XB6A 5TE4H 4AVJA 4P2OD 2CKBH 1SLXA 1ZY9A 2BHYA 2W0KA 2Z8VC 2ISDA 1DJSA 2ZX6A 5KBNC 1D2PA 5DLMH 3AXHA 1MREH 2ZG3A 3P30L 1F86A 4UIMA 2XU9A 1ASPA 4PU2A 1TNMA 3QO1A 5JMOC 2JWYA 5BQDA 1T0MA 5ISZE 3QO1B 3RGVB 4LF3A 1QSFE 4OZGE 3US0A 3MFFA 5L6YH 3VD2A 3QJRB 3HS0A 2Q9OA 5ICXA 1QA9A 3B1TA 1HSBA 2IPUK 3T09A 4B96A 3H9HB 3KHOA 1GSKA 3S0PA 1XF2A 3C9NA 4J8RB 4A39A 3ULSB 3MRMA 5EO1B 4MJ6A 4WF7A 4WI5A 2DLGA 4FYSA 5CD5C 4PJEE 4Q0XH 3Q1EA 2B3RA 3QXDA 1BWMA 4QI3A 4ZK8A 1BF8A 1IM9A 3QIUA 4HIXL 2BH0A 2QSCH 4X0NA 1M05A 1DQDH 2IH8A 3HG1D 4G8GE 3KPRD 1NFDA 3LCYA 1E8ZA 5K9KB 1OARH 3KYNA 3VA6A 1WWBX 4JO3L 2YPVL 1P9MA 3DJZA 1NFIA 3HS8A 3ABLB 5D7LE 1UCBL 3E8UL 1L6PA 1T1WA 3JWDH 2DQJL 3U2JA 2NXZC 3PCYA 4Q6KA 2BY1A 3EF4A 3TH3T 4QXGL 2YFOA 2W88A 1U8OA 4RIRB 3TNMA 1WAAA 3II1A 5K1VA 1CGTA 2OS7A 3M17B 3PL6A 1SYVB 4PRHE 1U58A 3RUGA 1EK3A 1A7BA 5HGHB 2YRPA 3VCLB 3D3VB 4OQ1A 4IOFC 4FLOA 5DK2B 5C0AB 2EIMB 1J87A 3ORJA 3D3VD 1X5FA 4Q2ZA 2UYLB 4TLKA 3L6FB 1U6AH 5C09D 4XNXH 1C5DB 3L9RB 2NY1D 4OT1H 3HN5A 2LVEA 1TQSA 2NYYC 1CLCA 3QDJB 3RDJA 4C83A 5KJ7E 4XCYA 5I8CB 2IG2H 1S6NA 3QS2A 4HWBH 4L48A 4UQCA 4MB1A 1G9MC 1GTFA 3K2UL 4GRWB 1JZ2A 1MHPH 5DMKB 5KAQF 1N7MH 2KERA 4Z3TA 3T77B 2D2CC 5IB2A 4L1HA 2WGNB 1ZVHA 3D69B 1O0VA 4QOKA 3P69A 3TA3A 3IF1A 4LLQA 1FAIL 4U6YA 2XV2A 4WY7H 2RBLA 3PWPE 3FXIC 3MR9A 4NO0A 1XVSA 4WSKA 1KN2H 3N1MC 5KVFL 2ITDB 2NYKA 2ZOKB 4UTCA 3B7YA 1AP2B 2A1WH 1T0NA 2QVKA 3GLDA 3O2VH 5IEKA 4YE0A 1K6QH 1U8QB 3B43A 3F83A 2G75B 4P57A 4AJYV 3TT3H 1JFQH 5L4IA 1FC1A 1KJ3H 4PWHA 1UC6A 2DYRB 4WHYH 3W0WB 2R56H 4E9SA 1F4AA 2VDMB 5E6IA 2YPKA 2WXFA 4PWJA 1A6UL 3CSTA 5LXVA 4UIKL 1P0SE 1HSAA 3F64A 1XIWC 5F0LB 3QDMD 2AXHA 4LB8A 2D9CA 4H0HB 4IJTA 5FGRA 3DVNA 1J5IA 1OANA 3U7YH 1ZEAL 3CCHA 3U9PH 1F58L 2HTKC 4TQIA 1NCIA 1M57B 1SDAB 4LSSL 5I1CH 4KOBA 3IGKA 3LRGA 4GUOA 2CKBA 2AJSH 3K8LA 4Q58C 2NT0A 3MCLH 2CM5A 3D7PA 3DIFA 3L9BA 4HUUB 2ZTBA 5AZEL 4XE5B 5ERWA 3ZW3A 4DP8X 2J6EH 4OU3A 4OFYA 3DI3B 4LLUA 1MQKH 3QFDA 4KMQA 3V4PA 2OMYB 2X1PA 32C2B 4HJTA 3TIDB 1RJLB 1N0XH 4OZIB 4TVPE 1AZCA 1BVKB 5EO0A 1E9OB 4O2FA 5C07D 4I1PA 2VDOL 4Y5VB 4G8FB 4LE8A 1HINH 5EMYA 1PYWB 2VKXA 2GSGA 2AV1A 4Y5XC 5L8JB 2EDOA 4F33A 2HAZA 3ARGD 2BNRA 3IJ7A 5DJXB 5A7EA 3F7KA 2XQYA 1CQKA 4ZS7H 1UM5H 2B9AA 2QFRA 2WVVA 3CFNA 2OMZB 1EVUA 1TJIH 1J0HA 2F0CA 4P4KC 5FCUH 2MHAA 1KENH 2A6DB 4UNTA 1I4FA 1UFUA 2GFBB 3BZEB 5AD0A 1NLBH 4JPKL 2WAHA 4XBEL 4JLRA 5F7NC 2QGEA 1NBVH 5IFHL 3QPQC 4G8GA 3TT1L 3U6XA 2VDMH 3VWKD 3FN0H 3QXUA 5SX5K 1U92B 2XN9B 2DQEL 5E2JA 1GS7A 2E4TA 1LO3H 1P7QD 2W65B 1RKRA 3L3KA 4FLRA 5FO9B 3IJ9A 3KPQA 3LDBB 2VM3A 1SBSH 2PPFA 3MUHL 5H4YA 3BWZA 4XI5C 5AALA 3WEBA 3GLZA 2FEEI 2YAQA 2BVYA 4ONGH 5T3XH 3GHEH 4AZ8B 3PNRB 3CSFA 4ZFGH 1WBYA 5KUKA 1KTJA 3MU3A 4YBLB 3Q8EA 4LNVA 4FG6C 1S3RA 4KJWD 4GAYB 1KXQE 1YEJH 3S4SB 4NPJA 1HILB 2DWSA 4M93C 4PJ7A 1EO7A 3SE4C 4X8CA 3TOPA 5I0YA 4ZX3A 3T6QC 1GC1H 3MUGB 1RZKH 3GRBA 4G5ZH 5D7JB 2EEAA 1HHHB 3BC9A 3JQOB 4M7KH 3KWUA 1AJ7L 1MRFH 4ZMWA 4FQ2L 5D6DC 3QNYB 4TRPH 3UZQA 2NXZB 4RQQA 4CJ1A 3KXFB 4Z0XB 1DBBH 4F2MB 4P9HC 4QRTB 4M5ZH 2H2SD 2FBJL 2EVJA 5I0XA 3GRGA 1T2QL 2OR7A 3WEXB 1ZE3C 5DVLA 4K5NA 2CBMA 3KPMA 1A4KB 4HS6B 3ELQA 3G6JB 5AW1B 4DSYA 1RHHA 2QFPA 2X4PB 3O6MH 4S0HA 25C8H 1QSEB 2Q8BH 3LNIA 3M8OL 1IC5H 3WFBH 5C0ND 1MI5D 5AZ2L 2FQDA 5EEXA 2CCLA 1HHKA 4KKNA 1F02I 1TJGL 3C09C 3MBEB 3KPSA 5CJOL 3PFQA 4PJCE 3ZE1F 5HHPB 1DE4B 2ZUUA 4FNSA 3X13A 1ZCRA 3ZR6A 3O4LD 4UB0L 1UYWL 3RWIA 3V55A 1RK7A 1WGOA 3ZHKA 5KG9B 3HC4H 1LO0L 1F6AA 3WI9A 4LHUB 3UFIA 2QVFB 2WXHA 5C0CB 2QVMA 3MV7B 1KY6A 3G9AB 3NEEA 2Z31B 3KGUA 3AG4B 4G71B 1VRSA 4Y4KD 4J3OG 3TESA 1UT9A 3KLKA 4Q0XL 4X50A 3FUJA 4N0CD 3MGAA 2A6KB 4XAWL 4KTGA 4XP9H 3K71A 2H1LM 1P2CB 4FX5A 4JFYA 1R0AL 1J48A 4QRPB 2VYRE 5C3IA 1U8IB 3CX5J 3F8UB 1D5ZB 3DWTA 1AD9A 5EU6A 2EYTB 5FS5A 3CFJB 3OXRA 4JBSA 2WXIA 2EKSA 2TSBA 2VW6A 1OM3L 5GRUL 2PTTA 1YEHL 4LVEA 2VIRA 1FBIL 2Z31D 3CUPB 3QR0A 2HX7A 3KPOA 4UBDC 5HVGB 4ZX4A 5ACMA 2XFGB 2WXRA 2WQUA 4LCWB 2RHEA 5D1XB 1M2VA 4PJBF 4AEIL 2GBUA 3I9AA 4WI0A 5A2KH 1K4CB 1N68A 2IAND 4X0KB 1IC7H 3QJQB 4U0QB 4WNJA 1S4IA 2ZWZA 3UGXA 4OLYL 3ZJAA 3H53A 1BG1A 4NQCA 2RALA 3DSFL 4PJBA 4BFFA 4FTDA 5IR1B 1J18A 3VD7A 2DQGL 5L88L 4PIRF 5J3HD 1ZLVK 2YRZA 3HBZA 4U1NB 4S0TD 2C4XA 1BQHB 3UTQA 5F6HI 4WJKB 3SBRA 2QPDB 3UTQB 4G7VH 4H8HA 4Y8AA 4ZMVA 2R23B 4UAOC 1OB1B 3HW7A 3O6FB 2YAFA 4BSVA 3U0PB 1T1ZA 1A2YA 2JQMA 4MHHI 3L3HB 4L4VA 4GRWH 1YY9C 2JKJA 2OR9L 3VD0A 3FTZA 2BSEA 3QDHA 4JDEA 1PX4A 3EYSL 2I5YH 3ZZSA 3NJVA 3H3PL 4FQCH 3K6OA 4ZQKA 2P5ED 2NY4C 2WC7A 1ZHNB 4ZO7A 3DJTA 3KNBA 1JHKL 5D71L 1IZKA 4YUEH 5D7JD 3GI8H 1PGRB 4W6YB 3NSFA 5E5MB 3BVUA 3I9GL 4MZRA 3TO4A 2F7IA 3WY2A 3QZWG 2G4GA 4FQ1L 3TJHD 3TBCA 3WE6B 2YPLE 4J8RA 4PVNA 2B59A 1P7BA 1A9BB 4DUWA 3HMWL 5F6IC 2Q8AL 4AG4H 4NT6A 3CVHH 2VC2B 2AJUL 3FUKA 1YN6A 2ZXDA 3BKJL 3BAXA 4JFVA 3WFEH 4Q9CA 4GSDL 1NCNA 1IJ9A 1A9EB 2FO4A 2Z31C 1A6ZB 2XQBH 2BNUB 4N6QA 4H0LC 4L37A 1IFHH 2BMKA 3PABB 4NQXA 3Q0HA 1HEHC 4NPYB 1G7HA 1J8RA 2DEWX 2IIJA 5FYJH 3VWKB 1IGTB 3VFNB 4BFKA 2ZP9A 3HUJF 2RH0A 4MJ5B 5IMLB 1KFAH 2ITDA 2ZOKA 1ZV9A 4L3EB 1THCA 2FEJA 2VDPL 5G5DA 4U1IB 5HDWA 3U7WL 2K7QA 1QHOA 4JO1H 4PLOB 5IK3A 3BISA 1L0QA 3JTTB 4OZFG 4YBHA 4CADA 4DERA 4WV1C 4J39A 2J88H 4J3OF 3ZHDA 3QAZC 5C0BD 3L3OA 1MPAH 2WGXA 3TN0A 4Y5VA 3JWDL 1CI3M 1V7MH 4IMKC 1I82A 3E3QC 3ZPDA 3FZUC 4GKNB 5GS1C 2KL6A 5C1MB 5CILH 1SUJA 4DKFH 2KPNA 2HT4D 3K81A 3L1OL 4ORGA 5LKNA 5TQ0L 5ADOH 3ATDA 3OX8A 5EBWB 1GYCA 1NCWH 3LIZH 1A6WH 5BVPL 2HJKA 4DEPB 2NY3D 3B5GA 1YUHA 3QEUA 5I6LA 2CKBB 3VYPA 3HJEA 4C56A 2WINA 3MV11 3TO2B 1JK9A 3KWWB 4F57H 1R1CA 1RXLA 4MJIE 4HYTB 4AGLA 4AV4A 2R29H 1M42A 4DGVL 3KLHC 3KJ4B 5GS1B 2I24N 2AK1L 3IXAA 2F54A 2YXWA 3KPQB 4GMTH 4M1CC 5I9QC 4X5QA 2X89D 32C2A 3UG4A 3L95B 3PG2A 2B1AH 3PQYD 4XHQA 1NINA 3REWB 4J3WA 1HQRB 3T0ED 1E5UI 1ZKAA 2V9QA 3LZFL 1MCHA 3U6RB 5C6TL 1FRGH 1HX0A 5EZOH 4FFVD 3RX8A 1B3JA 3QUXC 3BGMA 3FOMB 1EFXD 1RL1A 4MCYB 1TTAA 1U3YA 3JV4A 2RD0A 4P5SA 4H25A 3SKJL 3BSZL 4NPKA 2DQFB 4KFZC 3WL9B 3BN9D 1KYDA 1TETL 1FI8C 3FRPG 3SOBH 1JK8A 5F9AC 3QQXA 1OAXL 1EGJL 2L0DA 2R7EA 4QGYA 5GJSH 4MAYB 5HGDA 5GRYA 3NTCL 2R1XB 2VSCA 5FGCB 4EO5A 4Y19B 1WPCA 4P23A 3U46A 2F8OA 1DVZA 2VQTA 1VFMA 4GBXA 2VLRE 4BELD 4A2MA 3JWNE 1F1AA 1PIGA 3HNSL 2VN7A 1LD9B 3ECQA 2ORBL 3MRIA 1LWRA 1T4KB 2XWTB 2X70B 5ALCH 5C9KA 2KLRA 1WIUA 3FFCA 4JGJA 5JW3L 4ABVA 1XH0A 1RJLA 1NCTA 2L7QA 3C6SB 2BSDA 2HG0A 3FUMA 3GXFA 3NABH 5GGQH 1QABA 4OBRA 3RIKA 3GRWL 2NCMA 4YC2B 3CHQA 4JGMA 3QB7C 4N20A 4BSWB 5K59E 5B1JA 5INCB 1THAA 2A9DA 2VW7A 4PI2A 1QI5A 2Q86A 1UKQA 1ECZA 2RQEA 2UVEA 1RFDH 5HHNA 1T1XB 3WTTA 2V9TA 2X4RB 2WW8A 3IMRA 4NQCE 4RQQB 4XODA 3VXQA 1DJWA 2G5BA 4AEEA 2HVJA 2IOIA 2KYIA 2Q76B 2IDFA 4DZ8B 1XTLA 1GZPB 2D2OA 5JXAH 4XNZC 3A3YB 2ATKB 4RFEA 1HHGA 1JGVL 3LKOB 1IAMA 2F68X 5F7EH 1A22B 1P2CA 1H15B 4H0IA 4FC3E 3BP6A 4RGOL 2VAAB 5CFHA 4Z7UA 3OKEA 1CFSB 1M2OA 2AQ3A 5ANME 2X2UA 2YOCA 2A77H 7PAZA 4XBGB 3C5SA 4QHKI 3ARSA 2BSBA 5HJBA 2A99A 2PYED 1N59A 3WNIA 1YEHH 4W6XB 2YGVA 2WQXA 2CMRL 2UWEB 5DZNA 3BE1H 3GKWH 2G3ZA 2Z34A 2HX8A 5CMAB 3MFFB 3HAEB 1JDCA 3QCTH 3T0BA 3AUWB 1U8NB 1URZA 2ARJA 4XNZB 3TNNA 2DYPD 1QD0A 2R56L 3MODL 4WU5A 2JH2A 3DX6B 5JW5A 2CA3A 3V4VL 5I8EB 1MCOL 1RD6A 1HXKA 5I8EA 3MJ8B 2OMXB 1CURA 3RVXC 1KJ2A 1DZ0A 2OJZL 3AREC 4ETYA 2WXKA 3NZ8A 1T0OA 1CB4A 4MSWB 1K3IA 1G87A 3N40F 3UXFA 3SDAB 3NA9H 1KN2L 1KPRB 1NC4D 3O3BB 4FE9A 4LU5L 1AVAA 2WQWA 4NUGH 4S1DC 4N1EA 3QRLA 1MH5B 5J56B 2FWLB 4NRZB 1IZJA 1FH2A 4QAMB 3RNKA 3F7YB 3HE7B 1UEYA 4C4BA 5AB9A 4HJEA 1NLDL 1FL3A 4PJ9A 1M56B 1DE4A 3VFGL 3HE6D 4XB8A 4ONOA 5DTFA 4UM9A 1KCRH 4RDQF 2EABA 3SBQA 1KYUA 2WLMA 4N3UA 2XBDA 4MQ7A 4DFHA 2YK1H 1A1OA 7FABL 5FYKU 4IIQB 3C09B 2WOBA 3FHQA 3MBEC 3SKMB 5KANG 1NGZA 2QT6A 4GIOA 2AXFA 3FDWA 4YC2C 3HBGA 4DGWC 3IRPX 1ZTXH 4UZUA 5AW3B 1PNDA 3VYNA 4I87A 5IJDC 3LKQB 3ZTDC 3ULUE 4GO9A 1XIWB 1CICD 3BQUA 4HWZB 4IJ3C 4ODVH 1C08B 4XVSH 1T7ZA 2IWKA 3DX8B 4M5ZL 2P7TB 5CJ5A 2KHAA 5FYJD 3RJQB 1X9QA 3DX2A 3OR6A 4QHLB 2W9EH 4JX0A 1X5GA 4HIIB 2DQTL 2BP8A 4UCFA 5EU6B 5HDBB 2YPVH 5EU6D 1FQ9C 4LGPB 2WBWB 3GNML 4OD1H 4UT6H 2ZUQC 4DK3A 3E6FA 1BM3L 2Z93A 5I73C 1RK0B 1EZSA 4BFEA 1FFPB 4FN0A 1X44A 2H7WA 2GC4C 3ARBA 4ZFQA 3APDA 3MHZA 3TO4B 1TOXA 2VB5A 4ISVB 1VJSA 4XH2B 4XMPL 1AGCB 1ACZA 2APVA 3W2DH 2VOTA 4HUVB 3NJMA 4J4PD 4YSPA 1KY7A 1XEUA 5AOMA 3TWCH 5BV7B 4F8OA 4ERSL 1NGXA 3PV7A 2B77A 2XTSA 4KNTA 3QJFB 1N8ZB 1VGKB 3F6JA 4G7VL 3CFTA 3RA7H 3L9RA 3HE6B 1R47A 3BVDB 3BVNA 1JHTA 1HL9A 3D08A 4KWUA 5F3HB 2ZUQB 4GG8B 2YEQA 1U3HA 1OAKL 3MJ7A 5C2UB 3IRCA 1MI5A 2B39A 3WSQH 4CW1B 3UIYA 1MY7A 3NPSB 4JDEB 2VDQH 1WHPA 3PWNA 2PCPA 5HD8D 5AZ2H 4NFBA 3BMWA 5CGTA 3F62A 1XGQB 1NM4A 1A47A 2VR7A 3KEDA 3ZRCC 1KYFA 1IBDA 1HCYA 1E4JA 1MFDL 4PI0A 1KCWA 3D30A 1RZIA 5C0IB 1J1PH 2R2CA 1YMMA 4IOIB 3M17A 3NN8A 3PL6B 2KZWA 1U58B 1SY6L 4AYMC 1MW1A 2YUXA 4M1GL 3TN0D 3P0YL 1S7UA 3CDFA 3TBWA 1FFRA 1GYUA 1PLAA 3QJUB 4XPAL 3L2NA 5C0FA 1TQTA 1IAOA 3WKML 3SKJH 3JV4B 2OQJB 5H94A 1A14L 3QQ9C 1CC3A 2R15A 4QGTA 5AVQB 4FNTA 4HXAL 4BQBA 2YHGA 3DDGA 2PMZA 3L3IA 1DBMH 4LCUA 3VXUA 2FO4B 2H32H 4Z7VA 1FNSH 1N6QL 2PYEB 1SJVA 2NY0C 2OMUB 4M8UA 5E94A 2XTJE 4BK5A 3FT4A 4N2LA 2Q8AH 4PGEA 2H5UA 3G5VB 4I5BA 4TPRL 3FT4B 5FFGA 2KH2B 2IJ0C 1KXHA 1W72H 1WFNA 3WENA 4LSRL 4EI6B 4HFUL 3PIQA 2QHLA 4XPHH 5D9SB 4DN3L 4CU7A 1SLVA 5EIIA 3ISRA 1XD0A 4IU3A 1PSKL 3ARVA 1TO4A 4KRPD 4LIQL 5B39G 4NUJA 1UJTA 4MBRA 3WNMA 2WXPA 2MIZA 3C60C 4ZDHB 1NCDH 4YWGH 4AQ8A 2GABA 3LH2L 4FOMA 4FA6A 4IDJH 1BQUA 1PZDA 4BZ1A 2FX8H 4FG0A 4JJHA 2F7OA 2L7JA 2ZAGA 1NKRA 3D33A 3I6KA 2B5IC 2D0GA 4MCMA 4X5LA 1NTDA 4ZQTA 4WCYL 4MXVE 2B15A 3SDYL 3WNJA 4HKXA 3B4NA 3MV8B 5EEYA 3U1PA 5HHNB 1CIUA 1S5HB 5KN5B 3DJ9A 1Q0XH 1HQ4A 4F9PA 4J3XA 4OZ4B 4X7EC 4OCXH 3VNZA 2NTSP 2D3NA 4MMXA 4ZAKC 4X6CF 5I1EH 4IBVA 4PMEA 1JAEA 1TITA 5F7UA 3HRZC 5F89B 4XTRC 5F7EL 5E8NA 1VFAB 3O2WH 1LEGA 4QF1A 3QARA 4OIIH 4UAHA 5KYUB 1LD9A 3MRIB 5E8NB 3AVEA 5HHMB 4Y19D 2BX5A 3HC0B 4PJXF 2Y7SA 2EH8L 2APTA 2QKIB 1YPZB 4ACTA 3MROB 4JRXB 5HHVH 1I7ZA 3BAEH 4G6JH 3LOWA 3KWXA 2VLJE 5DWPA 4KZDL 1RURL 4P2QE 2FR4A 3SGDI 2VH5L 1NAKL 1E9QA 5K5YA 4NXSA 3WFZA 4XHJD 2WZPD 4FZ8L 3UP1A 4WTWA 5KSVA 2NUPB 3O11A 3SOBL 1WS8A 1F3RB 1VGEH 4FQ1H 3US1A 3N9GH 3TEWA 5IVZA 4QJ5B 1NCAL 4F7PA 3PWUA 4B5EA 5LDSA 3PWLA 5I73B 3K71B 4Y19E 2R7EB 2V5RA 4I89A 3OAUL 5D4QA 3V7AG 4C57C 3QRFM 2NLJA 4HKZA 5BS0E 3PPEA 4AI7A 1MCIA 3LNHA 3N5AA 4MA8H 5ELIA 4DP2X 3VXRB 4ELDA 5AOIA 3TVMA 4TTDC 4W9LC 1CD1B 2PP7A 3LIZA 3ARFC 2DOCA 3ESOA 4XO9A 3S35H 2AK1H 2ZAIA 3BAKA 4NP4L 3MNWA 5EBLA 4X98A 5EF2A 2OMBA 5EIVA 1T6VN 4Q14A 4JO1L 3CFDB 5A2LH 1CL7L 2GVYA 5DD3L 5GGVL 4CJ0A 2UZYA 3WGVB 3POHA 2ENQA 4ODWA 1X5HA 4WIQA 1ZLSH 2DTML 2Y07H 5IP4A 1NMAH 4P0DA 5B21A 2ENSA 1J1OL 4F20A 4NO3A 1BBDL 2FD6L 5SWZE 4OR1A 4UM9D 1BXVA 1IGCL 3MO1A 3OB8A 4JO5A 4M7ZB 1SGKA 1X7TA 2WIIA 1JGVH 4WK0B 2ITEA 4XPBH 1UWGL 4F9PC 1LHZA 2HJFA 3DOSB 2ZUTA 2HT2C 3EG9B 5L2KA 1TZHA 2Y6SC 3QZNA 3NK3A 3VW3H 1K2DB 2EXSA 3RFRA 3ILPA 5FXCH 5BOPA 1EBPA 4HALA 1TVHB 4JCLA 3LS4L 5EBMB 3QORC 1MIML 1DQMH 3MBEA 4PJAE 5FO7B 3BW9A 4FQXA 1AG0A 3VD4A 3WNKA 1TZIA 3D50A 1KB9K 5BXFB 4UAOB 2GEQA 4PRAB 5FM5M 5D2LE 2VDOB 3MRFA 5HDBF 3FFDA 3MRLB 4YHKL 4BUGA 3CH1B 3RBGA 4XH2A 1HSBB 4X4MA 1LILA 4QR7A 4DT2A 1A21A 2EVGA 5FFLA 5AVTB 4E9LA 2ICEC 3ARFD 1X5YA 3GMPA 4I0PB 2PPDA 4MSWA 2UXGA 5CJ8A 1RZJL 3WNPA 3ZHNA 5IHUH 4YL4A 1OL0A 3JWOH 5HTSA 3TTYA 2PPEA 1USZA 2PYEE 2JCCF 4RMQA 5E6ID 2JXMA 3IWUA 2FTAA 3ECVA 4HP5A 4MJIA 2VN3A 3BP5A 1K72A 4OB5L 3WXWH 2TRYA 1PQZA 4YK4B 2XKNA 5EZOL 4UINH 5KS9B 2W80C 3R06A 1UOLA 3MZGB 4DP7X 3CX2A 4KUCD 4IBSA 1NAML 5DTFB 3TIDA 1A25A 1ZHNA 4A2DA 5DQDL 2HPTA 3FN3A 4NUPA 4M6NL 4Y5XA 2R8SH 4OY9A 1QRNB 2ZKHH 4X7CC 2DWEB 3G6DH 3O2VL 4OQTL 3L6FA 4W9FC 1U8HA 2IGFL 2IANB 1ID5I 4PRPE 1B4JH 2J1KA 2AQNA 1WEJL 3BJ91 3INUL 1IIIA 1SLWA 4EOWL 1NMBH 3KL0A 4BCXA 3QEQB 5BZDB 3APNA 5JQ6H 1A9EA 3K0WA 8CGTA 2X0VA 4I9WE 1GAFL 4XN8A 2F58H 3TASA 6PAZA 2EUWA 2LE9A 3G5VA 4DN4L 3VMOA 4LVOC 2W60A 4D9RD 4HKBB 1ES0A 5GRVK 1C1EL 4L9LB 2XKUA 4PCYA 1PD1A 3SJVB 3VFSA 3L95A 5I75C 4F3FA 3B6SB 2K0RA 4N0YH 4DP1X 4U3XA 5I1AA 1CIDA 2VM9A 2RJMA 3O81A 1NH6A 3QZMA 3MV7D 1OE2A 1MFEL 2HUEA 3GPSA 2Q7NA 2EIBA 5I1LB 4AMKL 4OM1L 3NQIA 5H94B 1ZVSA 4NM4L 5LGHH 4NZUH 5TE6H 1NQBA 3OLIA 3TJHC 3DVNB 2VZUA 1YN6B 5C0RH 5INDA 1E65A 1UWEL 4OUUB 3M1BB 2DQDL 5I8OL 5E08L 5I9QB 3VUAA 2C1PB 1SQMA 1JVLA 5E5RB 3HCVA 1FIEA 1IMHC 3CLEH 5CCKL 4I7ZC 2IC2A 3TEXA 1MI5B 2ZKWA 4OLEA 4JHVA 1NSNH 4MD5B 4KGLA 3VXMA 1ZV2A 4H20L 1XCXA 4HUUA 5KW9L 2A73A 2N59A 1NUGA 1F90L 3LS5L 2XDHA 2C9AA 4Q6YA 4WWKD 2X12A 1G7JB 1N70A 4OFQA 4P2QB 1XSOA 2FNBA 1IVTA 3M7FB 4LLVA 4MB3A 4HCRA 3QW9A 3VAEA 3MXWL 5E2TH 1OTSD 2YRLA 2MCPH 4IJ3B 1CPUA 3QFJA 5B4MD 1M7DB 3CHPA 3MRPB 4YLBA 3DMMD 4ZOBA 4X6BB 1T1XA 2ENPA 4F9LA 5D5MB 4ERSH 3WTUA 5TPWL 5D2NC 1XGTB 4JPVH 4WSGA 1D9KC 1SF5A 2DB8A 3VFTB 3ZDWA 5FUOL 3IETB 4ZMPA 3SZKC 5E6YA 5GRJH 3S36H 2MCMA 4WW2C 4JO4L 4BRJA 2ATPB 2F53D 4PBDA 5DF0A 2WYHA 4OTXL 4JO2H 4HT1L 1QBLH 1YECH 4L8BA 4BH8B 1W0WA 3TFKD 1AQ8A 4R5TA 4DPBX 4R4FL 2XN9D 4YL9A 1UASA 4KQ4H 1A4CA 1CK0L 2MOVA 3KJ6H 4TLTA 4ELMB 4AQEA 5CZRA 4NKDB 1UCTA 2YA0A 3NCJH 4ELMA 1EZLA 5F71A 1QSFD 5HJGA 3IKKA 2MEJB 3FF8A 3H9SE 2WJ5A 2XVGA 1FNLA 3VFOB 3U6RA 35C8H 4IK7A 1OP5K 4R96B 5DVOA 1RV6X 3EDDA 2JQAA 2MJWA 1V5JA 5AW7B 4EI5A 3QJXA 2AXGB 1A3LH 3P40A 4XMUA 4CAGA 1HWWA 4CN6A 1Q8MA 5E9NA 3VU2A 1Z3GH 5JA9A 1YZZA 4OZHF 3PAYA 1ZSHA 4WI3A 1HIMH 3WJMA 4XXCC 3M1CA 3LKRA 3Q43A 3T4YB 1HFUA 5T1LD 2CO2A 3GBNH 3I02A 1OAZH 3CVIH 4KO9A 3UBXG 4U0RC 1P6WA 1AI1H 1D6VL 5HDQL 5J0BA 3CFIC 5CINH 3ME0A 1U93A 5I6OA 3KYOA 1O9WA 1T3FB 2F19L 2Y7NA 1KZQA 3GJFA 2YOAA 4FQIL 4W9CC 3HAEH 1JZIA 1F4YH 3GTVA 4U4IA 1KXVC 2VC2H 1OZUA 2BRRH 3FUIA 3NJGA 4ODHH 2E27H 5I8KH 2ETWA 1PSKH 2GIYA 2O61A 1Y6KR 3QUYD 3U25A 1ZIBA 1I8AA 4YZFE 1ZLUH 3BVVA 1YEGL 2YIHA 1CFTB 4KKLC 4HIHA 5AENA 4UV4H 4BSWA 1SOSA 5KOVC 2B1HL 2JKLA 1CZ8H 3DETD 4MDIA 4G82A 1MDTA 4GFTB 3W0WD 4Q8BA 4FJZA 3QZPA 3W5NA 2EVFA 4CU8A 1ODUA 4FHBD 4RNRA 2XX0A 1S8DB 1QI4A 1AAJA 3V5KA 3MTRA 2CKNA 2YA1A 3DX6A 4OCXL 3ZGHA 5LQBL 1XGUB 4ZUWB 3ULSA 5IHZB 3V4PH 3MRMB 4HSCX 4FP8L 3HI5H 4ZTPL 5IMMB 3MCKB 4LL1A 4XVUD 2ZOOA 5IMMA 3E3QE 2Y36L 1UADC 3CH8A 5GS0C 3HC2A 1W72L 1U3NA 2WCSA 2WVUA 4HFUH 4IMLB 1QR4A 2B7DT 5CNHA 3VDBA 4DVBA 3GS7A 5GJTH 4QCIA 1TZIB 2LLNA 1E9PB 4Y5VC 3SN6N 2APBA 5HHOD 2CJUL 3KPOB 5D70L 1RSYA 3D18B 3MA7A 4X4KA 1Y1DA 3S8WA 3QJTB 1IC4H 4NWUL 1NPJA 1TQWA 3AG1B 3FRPB 3QYNA 2ED8A 1NAKH 3CFKB 5KVEL 4N2BA 2X3BA 4JGNA 3I75A 4ALAL 4AITA 2EXWD 1YC8A 2Q5BA 4QRQA 1RIHL 5C0AD 3LMJL 4M4PA 5BQ7A 2BS9A 5D1ZI 1OQXA 2VXTH 3WLWD 1L7IL 2KZKA 4TUKL 3WUWA 1W91A 2AI0H 2OI9C 3TLRA 3US9A 3WFHB 4DP0X 5DJZA 4B0MM 1CTMA 1N5AB 2BSSB 1R3HB 3HUJA 3K4DA 1DUYB 3AWGA 4QHKJ 1UM4H 2Z35A 4U31A 5IMKA 1O6TA 4ABQA 3P4LA 5AUMA 4D3CL 4IMKA 4NKQB 1XBDA 4P49A 4TVUA 2Q6WA 2NCEA 3W9EA 3QHTC 1AQMA 2YD1A 1D5MA 3LH2H 2NR6C 4FRWA 1KSRA 2MTPA 3GO1H 5C07E 2HCZX 3VGEA 1Q9LA 2Q7AA 4MCZA 2VXQL 3E38A 1IL1A 1YNLL 3MKGA 3OC5A 2H9GA 1E5YA 3GGWA 1N0LA 3QR2A 4IOIA 2IV8A 1DSYA 2V5YA 4B27A 4MJ4A 3FO0H 3LSOB 5E7FA 3LS4H 3CZGA 1U8PB 2EJ1A 1AC6A 4HIQA 4Z3JA 5DJ0A 5KYWA 5JOFA 4QRRD 5DJ0B 3O3DB 5EU4A 2IADB 1IFRA 1SMAA 4NNYB 5FKPB 4KXZH 3RB5A 4JY4A 3RA7L 1I9IL 3LXUX 3DX8A 2QPEB 2UY6B 1C5BL 4XN5A 5BZZA 2I26N 4QRUA 5H37A 4WO0A 2GSMB 1J0KA 2ZF8A 1X5MA 3H54A 2NY7H 4Y7MA 3BAEL 2W60B 5GGRY 2NY0D 5KJ4A 4HZ1A 2VUKA 2AF2A 4AC4A 1QVOA 4YSTA 5F7YC 3IS0X 2G9HB 3TIEB 5LWYL 3RFZC 4JM2B 5IMOB 5J13B 1SN2A 1YJDC 1VKXB 3E2HC 1EHNA 3NAAL 4JG0L 5SV3A 4I0KA 1FCGA 5IVXA 2YD3A 3GF8A 3BEVB 5DD3H 5GGVH 5CBAA 4BCYA 3D8MA 4XXWA 4XMZA 4O58H 1SY6H 5FO8A 3VB8A 1TPXC 2BFVL 4OCRL 3QFJB 4PVLA 3B7TA 4JKLA 3TBTA 3WJLA 2OZNA 4OW6A 2R51A 4HLEA 5F3BB 2DWTA 4ZPVB 5ITBH 4ORGB 3WHXA 4DWHA 4WI2A 4CVXB 4MNHB 1N8ZA 3EOBA 5FGSA 2QQQA 1FHGA 1XGTA 5I16B 1M7IA 1LYQA 3KLHD 1BD2D 4HXAH 5I16A 3UBGA 5LGJA 1CLVA 1HNGA 2G5BB 1RUPH 1ZAGA 3DGCR 5CEZL 5ISZD 4ZNEE 5FW6A 1ZJBA 3P9MB 2YAEA 1OCOB 3QG7L 1IE4A 3BZEA 1QLFA 1PPIA 2MPAL 2OSLB 4FYRA 5DURD 4ELME 4IRSB 2ADIB 1WH0A 1TPXB 2C9PA 3F84A 4S1DD 5A16B 2C9VA 3WOVA 4XXDB 1I1AD 3DV6A 2HLFC 1K8DB 1TQVA 1REIA 4M3KB 4GRLB 1RZ7L 2OTWB 2H8PB 1RERA 1JGEA 1IARB 2R2EA 1BBDH 2FD6H 5DO2C 3DSNB 4PJGA 4OM1H 5AAPA 2ITCB 2ZWSA 1KIQB 3ZHLA 3EJUA 4UUJA 2BRQA 4NQDB 3QNFA 1QSFA 4OZGA 1SDDA 2OSWA 5CGMA 1VHPA 4ZTOL 4YAQA 4EIUA 1MLBB 4ANVA 4JQXC 5KBMA 2BJML 4XBEH 1FCCA 1KGCD 4DO6A 1KPUB 1QSZA 3HG5A 3NCXA 1DQDL 4FQXC 5FDWB 5GHWL 1IRAY 5E8DL 1QACA 4PJDA 4LCUB 1DLFH 1QKZL 1BW8A 1BZQK 1CU4L 2F54D 1AS6A 4K8RD 3DHUA 3MC0A 4IS6B 4I1NB 4L4TE 2APXA 5B1KA 4NZUL 5TE6L 2CPUA 5ES4B 4I5BB 2R2HA 2F58L 5CSGA 1MCLA 1X6LA 5T3XD 4NXKA 5IBTL 4GRLC 5KVGE 3T65B 4P4RB 5B22A 4H26A 5FFOA 2DM4A 3B37A 5BVJA 4MNQD 1WD8A 3LRSA 5FYJU 1FVEB 3HRZA 1G7JA 4HHAB 2A74A 1ML0A 1QATA 4GW5B 1NJ9A 4JL1A 5FPIA 1IT9L 4UIMB 2VT0A 1JGLH 3UTTB 1TSRA 3OZKA 2GY7B 2MQ3A 4MJ2A 1A1MB 4JPIA 4MASA 3WBDA 1G7LB 2WV3A 2HN7A 2WBJA 5LAPA 3BD4A 1QFWM 3V9EA 3MX0B 3B2UC 4PSRA 1N6UA 5E4EC 1OQOA 2YD4A 3RWIB 5CCGE 3MX0A 5BO1H 4QXVA 4PGDB 4PIBA 1IM9D 3QIUD 4KVCL 1AGDA 1NIDA 1VCAA 5CCJA 5MENA 5HI5D 3OTTA 5BNXD 1XIWA 3D07A 4B9YA 2CDGA 2WN2A 3WXVL 2R0LL 3QG6B 2ZWNA 5EU5B 3U0WH 4MMXB 4MQTB 2QGCA 5H2BA 3WFCL 1SMOA 2FJHA 2GTZA 2ALWA 3A4DA 1AIFA 1ND0B 5D7KD 1T03H 1A7QL 1X7SA 4JRYD 3ARDC 4NN7B 5DGRA 3HLKA 3OWRA 1DEEA 2ATAA 2FJUB 4XRCA 5TF0A 5GQBA 2P8LA 4G6FB 2WNKA 3LN4B 4JJ5A 4AGMA 5KVDE 2Y1AA 2Z91A 4ODTL 1HOCA 1U8OB 4J3BA 3MRFB 4L3EE 1B4TA 1U8CB 1XL4A 4NCDA 4WU7A 5BRZD 1R75A 3U6XS 5FB8B 2DM7A 3C6LA 5HYQA 2GEEA 4HJIA 2NUPA 2YRBA 3MAWA 2AKRA 3N0PB 4FJ6A 4JG1H 2QPUA 4AQ1A 2IDUA 4PWFA 5KVMC 2K4WA 2J8UB 4U1MA 4PUBL 1F4XL 1MJJA 3QZWA 5IVNA 1BVLB 1DLHB 3LKPB 3L3DB 1EZVX 3D0VB 4MMYA 2XWEA 5IBUB 2N7BA 3H7BB 4X7FC 5FHAL 3ZY7A 3QWQB 2CGRL 4FQIH 1F4YL 2PNDA 1P4LB 2BNQD 3NRFA 1ZGLM 2VZVA 3T77A 3FN0L 5FUCC 4MDJB 4YNYB 5F7AA 1AZRA 5GGSB 4KUZL 4BWUA 2FLBT 4NC1C 3NCJL 3MQIA 1KXQA 2F18A 3IMVA 4DCQB 3ESPA 1G7IA 1P4BH 3CXHJ 2I32A 3D0LA 4G2AA 3U7WH 4ATWA 4A7VA 1OGSA 1HHIB 4RAVB 3WLWC 3WUWG 5MEOA 2X6CA 2XTJB 1JPTH 2ADFL 4A2FA 2JLPA 5KVGH 3HB3C 4IIQA 5AYTA 4WUUE 1A3LL 1U8HB 4O51B 4RZCA 1JIBA 2P48B 3P4NA 1G7MB 1KXTB 3FU0A 4Z7VE 1F97A 3UBXB 2CR3A 3ATAA 4FP8H 3CLEL 1AC0A 2IQAB 2X1XR 2YPLB 2ZYRA 5HY9A 5K9OA 2A9BA 2DWXA 3R4DA 3WFHA 4E41B 5J11C 2ZWYA 3Q6FB 3SDCA 1JF6A 1O7DC 1IGFH 2H26B 4FQHA 3CFBA 5AUMB 4XWGH 2FHCA 4S2SA 2R1WB 4FA7B 4Q9QH 4ZSOE 1NA8A 3WJLC 5B7FA 4N0FA 1X5LA 3BP7A 3SPHA 1FG2A 2GTQA 5C07A 4R4FH 2BNRE 2CK0L 2ZCLH 1P7KB 4YUEL 4DPRA 4L8DA 3HMXA 4IGBC 4UT7H 5E2WH 2B3IA 5E6ZA 1T0NB 3QE5A 4TNVF 1GGTA 1DJXA 3D18A 4KOCA 5CP3A 2YBRA 2A9MH 3FH8A 4I88A 4Q89A 2EKJA 3V8OA 3BUTA 1UB5B 5FUOH 3G08B 4ANUA 1FRGL 5I82A 1P4IH 4U6VL 4G9FB 1Y6NR 4I9WD 5GJTL 1H9DA 1C12B 2R29A 3BKJH 3VSUA 4ZW6A 5ILTH 4LPYA 1MI5E 3SDAC 5FA4A 3S37X 3OPZH 4Z7IA 1RZJC 2A7BA 3QNXB 4LCYB 4YZWA 4ZUSA 1DBJH 4RVBA 1Q0YL 4KNQA 3QIBA 2AVGA 3OAZK 4MAZA 3VH8B 5EF3A 1UT1A 1PLGL 2PW2A 4FQQA 2BSSA 4JFFB 1BPLB 4Z7UF 5GSRB 1O9ZA 2J6WA 4YSCA 2YAHA 5TTRA 3DVFA 3P9MA 4JHWH 1F8TL 1FNAA 4V11A 4EI5C 2BWIA 4GKZB 2AAVA 3VSQA 1KBGL 1F56A 5A2JH 3ZL1A 3B34A 3P0VL 4X9FA 3MOBL 2ADIA 2VN5A 1XFPA 35C8L 2ZYHA 2O5XH 3ARGA 2I5YL 4W68A 4AW7A 2J88L 1GGIH 5BVJB 1PEWA 5DJ2B 3II2A 5DRNB 3WNOA 1T0PB 3I2CH 1J05A 2R1YB 1AKJD 2HFEB 1KEGL 1XAUA 4OVUA 3QUZB 3CZFB 4PRHB 3JTSA 4JUSA 3V9CA 2D7QA 5HHXH 2DZEA 2ODIA 4ILDA 1SRDA 4AZUA 4GLRI 2PR9A 4HJ0C 5T1KA 5JW4R 3ULUC 1GY2A 3PV6A 4ZTOH 3EYOA 5DXWA 4XB3A 4U6TA 1ZVSB 3CMGA 1ORSB 3C5ZC 4HIJA 4ONFL 4P2RD 4XVTH 1YQVL 1FZJB 3KPPB 3VQ1C 3ZU8A 3G5ZA 4N3TA 1C8PA 4M5YL 1JYWA 3D0AA 3T6ZA 5I6MA 2X42A 1L9OA 3CVHA 4U0RB 2IANE 2AJXL 3H4FA 1MVFA 3CTTA 3CLFL 5ESQA 1R17A 1TZGL 2QLYA 1DQVA 3GKZA 3IDYC 4NX0A 1J8HD 2XX1A 2VO8A 5TH2A 3SPVA 2PPAA 2P80A 3FT3B 3EYFA 1DVFC 1FL6B 3U4EA 3VFSB 4RGND 4LP4A 3IRZA 4EN3A 5D72L 3EJYC 2GJJA 2ZXAA 4JFDD 1XHHA 4IYKA 5E2TL 3EUUA 2EE3A 2UWEE 4Y4FA 5KAQG 1HI6B 5AOZA 4UTBA 1T5XA 3NACL 5DO2D 3O3EB 2J1XA 5L4JA 3D34A 3AS2A 5C08D 2ZYSA 1JZDC 3DOHA 2K3HA 3IMBA 3OJDB 1ZPUA 5FUZH 4KVCH 1KB5L 2OYLA 4KITB 2VH5H 1HQ4B 4R4BA 3TBSA 2XWJB 4O2CB 3TT3L 3OHXA 4TSCH 3MRHA 4BDVA 5LNGA 4RETB 3QJSB 4X6DB 3KPSD 1ID2A 5BUPA 4JHAH 1RIVH 2CUAA 4ZX6A 5MEND 1I8IB 3NOIA 3KYOB 3OKOB 4P4RA 4HAKA 2ICEA 1NPNA 3NIGF 1LEGB 2E47A 3QIUC 4Q6IB 3H9SB 5A6MA 2HT3C 2IOMA 1T03L 3AMKA 4QHUB 5JTWA 3H9SA 1KTBA 2HTLD 2EE9A 5CSZB 3S9DB 4LCCB 3FTUA 3TZVB 3DX7A 4KNUA 5T8IA 2GHZA 3OMAB 5JYLA 2R9HC 4JFSA 2XZQL 3GIZL 4LLVB 4RFNB 5KBKA 2Z7UA 3VX0A 4GO8A 3FQTB 2QKIC 1FFOA 1NPUA 3N0AA 2ESVB 2W92A 3PUCA 3V6OA 3RBSA 1JYXA 5ECGA 5CMAA 4GXVH 4S10A 2XPGA 2YS4A 3N04A 1SJHA 2GHWB 4WJ5B 5I30L 3I9IA 4DQOH 1QKZH 1TVBA 3C9NB 3EOAA 3AZUA 3PP3H 1GH7A 5HGAA 3L3JB 5FDYA 5GGSY 3H9HA 1QPPA 1XR8A 4M61B 1I1FA 2G4EA 1NCWL 4N25A 3DROB 3SGJC 1PY9A 4KK8C 2IAMA 3PGCB 3RDTB 3QISA 2J2ZB 1YEFH 1YN7B 4LK4A 4MVBD 1WWCA 1CMOA 3UGEA 4RFNC 3VVVA 3B5HA 2MOGA 2J8OA 3U4BH 2IMMA 2Z92A 4WV1A 1TLMA 3MOAL 3OHXC 5CIPH 2EUVA 3C6LC 1E4WH 5F1SA 3NA4A 4W1TA 4XNBA 1GW0A 5DJYA 4AIEA 2IDQA 5D96B 3RX5A 3NABL 4D0CA 1WUZA 3CDCA 3FT0A 1DO6A 1H8LA 4TUOA 3MODH 3CDGA 5SWQA 1KTDA 2B0SH 1X3DA 5E8OA 1TMQA 1S7XB 2HRPH 2B4CH 4KHXL 4XO3A 5IG7B 1E0OB 4NQED 3FU3A 5FW8A 4LKXB 2GT9B 3L3OC 5CLWA 4HBCL 3UTTE 1NEZG 4A63A 2FATH 3F5WA 5I18L 4LAQH 2EDWA 2P5WB 3F5WB 1T1ZB 2ZG1A 1LE9A 3X14A 4HK0B 4YGAB 4G83A 4D9QE 2JB6A 5B38G 3UROR 3X11B 3RPBA 5LXGH 4HBQA 4DCQA 1W16A 2N3JA 3S3JA 1YC7A 2DBJA 3OGOE 2EXYD 3ASWA 2NY4B 4LFHD 5D4HA 3ALPA 1UXMA 4FZEL 3RY5A 2R4SH 4QRSB 4IIQC 4AEFA 3EYUH 3RVWC 4MFHA 1Y07A 4HH9A 3SDCD 3WFBL 4FXLA 4NRXA 4G1EA 4XPTL 2WNGA 4AK1A 1UGNA 3FTVA 1KC5L 4N2MA 2ICWI 3HS0B 3CFQA 1MCKA 3EOYG 3RI5K 1OCCB 5F21B 4NT6B 5SWSD 4PJAF 1MJJB 4LFHG 3LB6C 1DN0A 1BVLA 3ARTA 1OCRB 2KI6A 2XICA 5CIPA 2EIZB 2K78A 2RCSH 4X4YB 3KLQA 2K4AA 4K7PY 4C83B 3HNSH 2DQUH 3BPLC 3RYMA 4HIXH 4YIQA 5BZWB 2IBGA 4A38A 1K8IB 4HPHA 1GTNA 1YNTF 5D7LA 1KLUB 1P7KA 1JK9B 1M1XA 3C2SA 3KG5A 1BJ1H 4B9KC 2XRAH 5EPMA 4IMLA 3RNQA 4U6YB 1JPTL 1WZKA 4X5WB 3ZYJA 1V3MA 3TPUB 3K6DA 2AQRA 4RIRA 2CXKA 4BHUI 4FHJA 4LGSB 3AITA 2BVOB 1KJVA 4OZIA 1I9RH 5AAWC 5LAXB 4EUPA 4OJEH 1AFVL 3RGBA 3FQUB 4XO8A 4GRMA 5DUMH 4BZ2L 5KWYC 3ULUF 2H6UA 2NW2B 4MNHA 1FNFA 2ZCKL 1CVRA 1B0WA 2W5PA 4EN3C 4AIXA 4FQQB 1OLLA 2LU3A 2VQ1B 2WSKA 3IKCB 1TU2A 4F5CA 1YNTB 1B4LA 3GSOA 3L7FA 2XXMB 2HFGH 4AGQA 4E0RB 3BZ4A 3VMPA 3VI3A 3I6SA 3BE1L 5ESQB 1GKOA 3UL4A 2Z8WC 3ARED 3A4EA 4PJAB 4F7EA 1DBAL 4CVWA 4JG0H 4DPAX 3EKCA 4M9PA 3QWOB 5KW9H 5AL0A 1E5CA 5FGBC 2G75A 1ZLWH 2H3NB 1LNUA 3SEPA 2EAEA 4GMSL 4XVOA 3QA3A 4NNXB 2V0AA 1DBJL 1J0YA 3CE1A 3UBFA 1GPOH 2C7UA 3O3DA 1UFGA 3OZ9H 4W9HC 2X7LA 4KU1A 5EU4B 5D71H 3EJZC 3ES6A 4PJDB 5C0BE 4HIJB 5JDJA 4CBPA 2P5PA 1ZEAH 2NQDA 1Z5HA 1SXBA 4N85A 3LY6A 1I3VA 5T5NG 4IHOB 3L2MA 4MQXC 1GC1L 2ZSVB 3PHQB 1ZWIB 2H32B 5DS8A 5F7WC 5C09E 3SCMD 1PBYA 3DUUA 1FYHB 3ZT7A 4YFLI 4GW4B 3J2PA 3FU8A 4B9GA 1CI5A 2NNRA 1CICC 2V5SA 1SOKA 3IN0A 1MCFA 2V4LA 3IJSA 3NSYA 4RDBA 2YK1L 3BUYA 4PGJA 1Z5LA 3FUFA 5J89A 1HH9B 1QQDB 1S5IL 3M1OA 3FYIB 4LSQL 3E1F1 3KW7A 3VXRE 1E7VA 2NY4D 3Q2VA 2ZPKL 4WK4B 4Y2OB 1UXSB 2E9BA 1GGIL 2BC4B 2YD7A 5D1XC 5B1CA 3P9WB 3BWSA 5EU6E 1GZQB 1YNKL 3ZMNA 4Q7DA 5F93C 5JHAA 5CJQL 5B1BB 3RIAK 1VADB 1W15A 2VR5A 2YQBA 3F04A 4YHMH 4B6ZA 1PAZA 4ZMLA 1FNSL 1KJ2B 3FCSA 4KPHL 1Z3GL 5BW7A 1SLUA 4UT6L 1JE6A 3QXDB 3QWRA 2XJKA 4UI2A 4N90D 2PWFA 1HAUA 5HP5A 1KBGH 2H2PC 5K69A 3LB6D 1D5ZA 3FB8A 4XN4A 2HVKA 4JGUA 2H6PB 5EZIL 3ZYIA 3SPVB 4RBPH 4JZJC 3G6AA 4DK6A 3PDDA 2ADFH 4M5YH 4N24A 3QUYA 4X6CB 4Y5YB 3NZHL 1BQ5A 2H8PA 2Z91B 4H1LH 2AJXH 5K1JA 1T1WB 1IKNC 1WZAA 4R4NC 1LK3H 5CJBA 4FZ8H 4UBDD 3OKYA 3FQRA 1QHQA 3KGTA 3GMQB 3UJJH 2ITCA 4M1DH 5IW1B 5KYNA 1LK2B 3C60B 4QT5A 3F58L 2ESVE 1MF2H 1DVQA 1MW3A 2B0SL 4QHMB 5E8OB 1P1ZB 4NNPH 4DIXA 3B9KA 3MUUA 4K7FB 1ZT7A 3RDTD 3UBHA 1FGVH 3DUSA 3JWNH 1TG8A 4LEOB 3N40P 1KTRL 5EWIL 1NC2B 1Z6JT 1JUFA 3MLVL 1TSHA 1ZHKA 1I1YB 2BERA 3ZKXB 1HEZA 1XTMA 2YMXH 1PJWA 4F8PA 3I3BA 4OZFH 4ZXBD 2N1TE 1P5UA 4AL8C 5H2BB 3CIAA 4UQ2B 5E23A 4TPRH 1BMWA 3GJFB 5LBGA 2IPTL 4EIGB 4LQ1A 1TVHA 1RP9A 3F7YA 3HE7A 3GI9L 5DC0A 1NWPA 5HYSG 3NBNA 3TF4A 2GTWA 2X2YA 3TEYA 3S96A 2AQPA 1CO1A 1H6EA 2GTWB 4NHCH 1U8KA 2NDGA 4EQ2A 4WO4C 2JNZA 4UNVA 3SIKA 2QZQA 3UABA 1LE5A 3LYRA 5D1XA 1NANH 3FUNA 5JMRA 4WJ5A 3UBXA 2VN4A 4U1HA 5KJRH 2QADD 4HVBA 1DQLH 4FNLL 3VG9C 2AHIA 1IUZA 3OSKA 3CVCA 3HR5A 2XY2A 1F11A 2D0HA 4DGIH 4JY4B 4WZ9A 2V3EA 2DJ4A 3LH9A 4H88H 1VA9A 3SGEI 2QQNH 3VXSD 1W9XA 2WVSA 3HMXH 3GZKA 5C09A 2X5PA 1O7SA 3BUIA 2NNAB 3NESA 3DOIA 3T8MA 1MJ7L 2Q3ZA 3ZUCA 3D85D 4HF5L 1KV7A 2OW6A 3JVFC 3S5LG 4JFEE 4P8QA 4QRBA 2E7HA 1LDPH 4WHTB 4HJSA 5EOCJ 3SGEH 1JN6B 1SJEB 1JV2B 4FFYH 4L1LA 2XN0A 3G5YA 1D5XB 3MJWA 1FFPA 4K94H 5JPMA 3BO8A 2XA8H 4F2EA 1NGPL 1SN0A 3IDMB 1P9MC 1FV1A 3MLYL 4BXSV 5KZCB 2WLLB 1FFTB 2J44A 5DJAB 4F7MB 1TUPA 4PGBB 1AGFB 1OPGL 1Z9PA 4PP1C 2EO1A 4AQ1C 1E9OA 2C26A 3L16A 1QX1A 2HWZH 3LZPA 4RSYA 4KROD 4BFRA 2DTSA 1XAKA 2DI7A 4M8QA 4Y2NA 5DHEA 4YLCA 1HEJC 4F92B 2QVIA 2FRGP 5IJCC 3K2MC 3Q7JA 4HPOH 4Q2ZB 3DO7A 3E80A 3V7AE 3BIBX 5T3XE 3THML 3RWEB 4MA3B 5J1SC 4ADJA 2CBTA 4FXGB 3UPRB 1INEH 4R7LA 1R5IA 2Z35B 2ADYA 4Q6IC 3L7FB 5DHYA 3QDJE 4Z1PA 1PKQE 1R5IB 2NSXA 3W39B 2MPVA 4HK0A 4UINL 4NBYB 1A7OL 1H3UA 3DIFB 4JQIL 1DCLA 3L3HA 4PHZA 3W0WE 1I7UB 4ANWA 1D5MB 4QHNB 4JFFE 1H6TA 3RWCB 3U4AA 4A1RA 2YD5A 2UZXB 4DKEL 5JHDA 5E5LA 3IS1X 4E9VA 4Y9EA 4F57L 3GBML 1Y18A 3P3YA 4IHBA 4MD4B 4CMMB 1L0XA 5D6CA 4ZDHA 2NX5D 3F7LA 4G9FE 5J12C 5DCCA 1JYNA 2K1MA 3TYFA 5F7BA 1KJMA 3QC5X 5CAYB 5AYUH 4ZFFA 5KUMA 2YPKB 5FWQA 1QW8A 4JHAL 1AO7A 3WYRA 5HBBA 2O1AA 5C6TH 2C7UB 1DDTA 4YPGA 5JW4Q 4JDZB 4R3SB 4AYBA 2E6QA 3QNXA 4JFFD 2XCMC 4GSDH 4U7SA 1PAMA 4J2QA 4EZMA 5INDB 2R1XA 2ZWKA 3DBXA 4P9MH 2BFGA 2EH7L 2QTVA 4YIQB 3P73A 3OM3B 3SQRA 4PJFF 3GUTB 3ZRSA 1DUZA 2Q87A 1HYSC 5TH2B 3H8NA 2PYFA 3VFVB 3BN3B 2MPAH 3V4UH 4QF1B 3BIKA 1BZEA 4IRJA 3BFQG 2O4EA 1FZOA 3SHSA 1ECYA 2BP3A 3WS6C 1DQML 3SDDC 1IM3D 1CF8H 4JHUA 4L5FE 3UO1H 2BOBB 1KCKA 2DQMA 4W81A 2CHXA 2QLVB 3MRJA 3PAZA 4HOXA 4JVPA 3KYKL 3CPLA 3WN5C 2MCAA 2CSPA 1QLRB 1E67A 2D31B 5CEXB 5L2JB 3MV8A 1QRNE 4MXQC 1U0QA 1MW2A 5EO9B 1IV8A 4OCNC 2EVHA 5AVSB 3UTZB 3LRMA 5EBWA 3C12A 3EBIA 1MRCH 4XVTL 5CKAA 4HZLB 3ECBA 3IDNA 2Z31A 1ZE3H 2WWOA 2VL5A 3GSQA 3ULVF 1SPDA 2NYYD 4AY0A 1E6OH 1N4XL 2UZPA 4FFZA 4S1SL 2FQEA 2V2XA 4LPUA 3BIAX 4R7XA 2D03H 3HZ3A 2G30A 5C9JB 2DIJA 4TXVB 3WIHL 3ISWA 3T1FA 4ZMXA 3BT2L 6FABH 3C87A 4IOFD 1MFNA 5DMYA 1KDIA 1CGYA 3LPOA 1BAWA 1QWNA 1QI3A 5EIQA 2JJTC 2WAQA 1UACL 3GS4A 1CGWA 4MA7L 4BE5A 1X9UA 3VFPA 3AWEA 3SDXB 2FL5B 1U6AL 2WQRA 5DVPA 1RULL 2O6DA 5DC9B 1I7TB 1IM3B 4TSBH 3F7RA 1QR1A 2M1KA 4G5ZL 4H1LB 2H4EA 4J4PA 1IILE 1X4YA 2IDTA 3MNDA 1JGUH 2FK9A 3QP3A 3WS6A 1ZTXE 2BNQB 2JK5A 4EZLA 2X05A 4FFYA 1B4JL 1G6RB 3PWUB 4G80B 1L6ZA 4NQCB 5JW4M 2VZ1A 1XGZA 4B9PA 2BM3A 4LVNC 4XXCA 5IEHB 4B95C 4HKJB 1BEXA 2H2PD 2CIKA 1XH2A 3WLBA 2ICWA 1OGAB 4HSQA 5EN2A 4QLWA 2YMXL 2ZNXA 2XWDA 4PRNB 4OF0A 3EGSB 2XXGA 5C0GB 1MJ8L 3MNZA 3LRKA 5HHOE 4EDXA 4L9DA 2QR0A 1PZ2A 2LLGA 4JCMA 4PJ8A 5T1DL 3ARQA 2X4QA 4PJGE 3V6OE 3RVTD 2YGQA 3HBPA 1WAPA 3DX7B 1XV8A 5K9JH 4ES8A 4N0YL 1G7PB 4ZAKB 1H8SA 1VPOH 2Q7YA 2XBTA 3FQTA 4QT5B 3DARA 1ZK5A 1KBWA 3UEZA 3ULUL 5INCA 4PGDA 4U6HA 2AXFB 3Q9PA 5DUML 4D9RE 1LE5B 2KDYA 2OP4L 3P4NB 3K6SA 3B8YA 2LW3A 2Y72A 1CXEA 4LLMA 3O45B 3IJEA 3VXQB 1DQLL 1QNZL 1AZZC 2LFEA 3ZL4L 1OO2A 3ZOAA 5BRPA 1SOQA 1QUNA 2JKWA 5L2KB 1MCEA 1FN4B 2X9ZA 4YDZA 2WXNA 3QBTB 5JIMA 1ZVNA 5M95B 5I8OH 5MERA 5E08H 5KSBE 5AZEH 5JHMA 1MFBL 1Q9KB 1Z9SA 4P23C 2B2XH 5E8PA 4I3SL 4KH2A 4UQ2A 4UDUA 2I85A 3PGCA 1IM9B 3HFFA 3QIUB 4ZS6C 3QIBC 5I24A 4OGZA 2JJVA 1Z66A 4WLCA 4H8WL 5I1JH 4OKVB 4QY8B 4UYPA 4BRVA 1MFAH 2XKNB 4BCZA 3HZKA 3UTTD 4HQQL 4RFOH 3JWNC 2XZCL 1JDAA 4X6EB 3OZLA 4TL5A 1AGCA 2WLLA 4ZD3L 5I74C 2AEIT 3DVGA 4KXBA 3O2DH 4PLJC 2MTAA 4P07A 5J6GA 2IBZY 1FO0A 4PJHF 1KT2A 5EWIH 4JL2A 1SHXA 2HX9A 1RJCA 2J8UA 5HHVL 4ZFZA 5IFAL 3OL2A 3P1VA 1ZT7B 4HA1A 4Y9FA 5IFHH 3MCYA 3GS0A 3S48A 5BS0D 2H0EA 1AXTH 5DK3A 2JB5H 3DROA 2Y69B 4L29B 3F58H 4JRXE 5BZWA 1RZQA 4DW2L 2K8QA 3N41B 2NNAA 1D5IL 4I2XB 1Q1PA 2VDKL 3OQRA 4OGAD 5B8CB 4WFED 4PJ7E 5DSCA 4IRJD 2DICA 1DFBH 2E7BA 3C8HA 3OR6B 4GG8A 4JN2B 4NYLA 3ZO0A 5I76B 4FXKA 3EDFA 5A2BA 3H2QA 3R0NA 1INDL 1PY0A 1I3UA 1S9VA 1GGBL 3FB5A 1JSYA 1XGQA 3RWCA 3WIAA 5LBSH 2NY6B 3GIVA 3HPJB 3RZCB 5DRNA 1URIA 3OV6A 2XNAA 1BVZA 4GY4A 5IKCB 4EUPB 1MG2C 1UA6L 2W9LA 3F6LA 5TDPA 4JM2C 4AENA 4M7KL 5DLML 4TULL 1O7DE 4L5FL 5GRJL 1NWOA 3P30H 7TAAA 4P2OA 1ROCA 1NMCC 5DK2A 1W80A 3FO1B 2P43B 3AM8C 4J3SA 3OX8B 1F0LA 4HT1H 3BXNB 3LKQA 4ZXBB 3LNDA 3KVPA 2DBLH 1F3JA 1F4HA 1WAAF 3T0EA 4L8CA 3CDYA 4TKWA 2OK0L 5BRZE 3AXLB 3PUUA 1WZLA 3RY6A 3ULVH 4OI7A 2Y22A 4EBQL 4HS3B 1I3GL 1LP9A 1TTBA 2VUOA 2Y5TB 4J23A 4JFUA 4EI6A 1DBML 2XKSA 1JD9A 5DMGD 3QFJD 3VQ2C 3MJ7B 1EMTH 3H0TA 2FWOB 2FX9L 4PJDF 2ORBH 4EXKA 4XOBA 4Z95L 1V7NH 3IDMA 4XPGH 4JK0D 4U7KA 1TTGA 5ANHA 1UB5A 2VXUL 3DBSA 5DFAA 5CILL 5D2LB 2ICCA 3MRJB 3TO4C 4XC1H 3ZKMD 2CO6A 1EXGA 1Q1JL 1ET7A 2CO4A 3LH8A 4PB9L 4PG9A 5TQ0H 1KJVB 1HC1A 3CXDH 4O5LL 2VW4A 2DQFA 4M8VA 3ZKXC 5SX4I 2V2WA 5AW9B 4TOYL 5A2IH 1H3PL 3LEXB 2XG4A 4JM0A 1HSAB 2VDNH 2Q86B 3TBWB 1SDYA 3K6NA 1MHEA 3BVWA 1T20B 3D09A 4M03A 3WJJC 3QIWA 2N7SA 1GCYA 3L5IA 3O3AA 5DGQA 3WMSA 1T6WA 3BCFA 4XTRD 2OMTA 2PCYA 1HYRC 3MYJA 3EBGA 4KV5E 5JXAL 1K8IA 1Y1UA 5EHFA 5G2NA 1OTTC 1HHGB 4OT1L 3VXMB 5E99L 1EXHA 4V1DD 2NXYC 5A2FA 5EZPA 4YS4A 4M1DL 3FB7A 2WXLA 5IHUL 5A16A 2XXCB 3Q2LA 5ITFA 4I18B 1IGJA 2FJFA 1OVZA 2WSDA 4Z7UE 3EADA 1C7TA 3ESVF 1C5CL 1T7VA 2A6JA 2ZUWA 2OZ4H 4NQVB 3QVAA 1MG3C 2L7UA 5E1AA 4IU2A 1N6VA 5IB4B 4PTUA 4LOUD 3UYRH 4EUPH 3RWGA 3VFOA 2TRHA 1KUMA 3SQBB 4GRMB 4HUWA 1EJFA 4TUUA 4U7MA 3IJHA 2Y1YA 3SQBA 3IDIA 4RGMC 1KNOA 3EYVB 3C6LD 3QDGB 1SYSB 3SCMB 1N19A 2VCOA 1YQ2A 1F3DJ 2R39A 1RPUA 2BCMA 2V7NB 3U0WL 1OALA 4X5XA 3HIZA 2IAMB 1PY4A 3W38A 4FQCL 1H15A 1ITBB 3QQ4A 4KJQD 3RDTA 3EDEA 3EUDA 3KAAA 1E5BA 2WKOA 1EEYA 2DYPA 4JANA 5D70H 1QBBA 1NIAA 4YVUA 5CUSH 1EEYB 1NCBL 3TVMB 1GHFL 1HXMB 1T4KA 3I74A 3ZL2A 3IMWA 4EF3A 3GPEA 3FQRB 1E6JH 2NW3A 3BUBA 1O7VA 3SDXA 4WVRA 4K94L 5C8JB 3O3EA 4KKAC 5B38B 4JREB 4PQXA 1CDBA 3ARDA 1JNNL 3INOA 2BJMH 3L13A 4JFHE 4EI5B 5IHHA 4ETQA 1N67A 3ZKND 2PR4H 3LZNA 2OJ1A 1MRCL 1NEPA 5BS0A 1TEGA 1G6VK 1U95B 1YRKA 4NP9A 2YLKA 2X4NB 5IUCA 1NCCH 5T3ZE 1HL4A 2RA1A 1QTSA 3VG9B 3HZMB 1NEZB 4PUBH 4PJ9D 4OZ4A 3V5KB 3OKMA 3U9UA 4UQBA 5KSAC 4ALAC 3QHFH 3EDJA 3WLBB 3KBHE 1WK0A 1SEBB 1I8IA 4A2HA 4KHTH 1CFMA 2VNCA 1OOAA 3P77A 4KK6D 1CR9H 3ILPB 4MB5A 1GXEA 1RHHB 1JDDA 2W94A 2ZX9A 3B7SA 3QHZH 1TJIL 3TS8A 2XN2A 3GJEB 3L1FA 4CC1A 4DEUA 3GMLA 4KO5A 3UMNA 2D4DA 2NZ9D 5KTEL 2APFA 2CHNA 3UAJD 4NRYB 3QO0B 4KAQL 2PABA 3CK0L 5DI8B 2WXOA 2DWYA 4JG5A 5GGVY 2JELH 5B39B 4K23L 2ZX7A 1BOGA 1N0XL 1TZAA 3MOAH 3F12A 1UH4A 2XQ0A 4MAYC 3MVSA 2PWDA 3GRWA 1NGWB 5DUJA 3IDUA 2F7PA 1D7DA 3BDBA 1CLYH 2IF7A 2OXGB 2VMEA 3CBKB 2P49B 2Q1EA 4CBZA 5JHBA 1KMGA 5BQ7B 2W8CA 4AQ1B 4UQIM 4I0PA 4MJ6B 4NM8L 5JHLH 4MA1C 4JFWA 3MLVH 1V55B 3LKPA 3HRPA 2B1OA 2VISB 3QIBD 2OMXA 5KOMC 3R7QA 4FXGC 4KHXH 3ZR5A 1OGAA 5TFSH 1ZHKB 2O5NA 1CE1H 3FT2A 1EGJA 3LHPH 4H7VA 2BY2A 1CT8B 2AJSL 1AD9B 4HWNA 1IEHA 3MN8A 3IU3A 1INQA 3Q48A 1V3LA 3E6FB 1JZJA 5IOPA 4NUMA 2NNXA 5DVNA 5JIHA 5J6HA 5D4IA 1TCRA 4OZGF 3T3PE 2IXQA 4BFIB 2VLRB 4NHCL 3W81A 3OXSB 5CGYC 4APQD 1KIPA 5FECA 4X7DC 3C2AH 4TSAH 2Y0SA 3OG6B 4CMHB 5IW1A 5EH1A 2PTVA 1FO0B 5F7MC 5FIEA 4J3UA 4FABH 1AACA 1YMME 2NUTB 3B83A 3FT1A 5KANI 1UUSA 3AWFA 3CH1A 2JKTM 3QXAB 2Z4QA 3KPLB 4DZBA 3BQUB 1K5NA 2WIIB 3BXNA 2ZKHL 4FFZH 4I3SH 1Q0YH 1IC0A 2P5WD 4RGNC 3UPRA 5MERB 4DKTA 1FGNH 4M7LL 4QYOB 1HJBC 1F11B 4AL8L 1U91B 4UV7L 3C5JB 3WFCH 4AW4A 4KUZH 1NUFA 1OB1A 1A7NL 3U36A 2HKFH 4LBEB 3EO9H