3NJHA

D37a mutant of so1698 protein, an aspartic peptidase from shewanella oneidensis.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
121
structure length
121
Chain Sequence
PQGLAQFIKVNVTLENGEPVFIYTDANGQVCQGAITVTQAGTITYLLNDQTLKGLKFVGVGFVTPFDGIIDAVTISSDGMLVQLVDLDKTPGTTKFQFVLSNTANTLLVLSPDPQIINRPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidase
publication title Characterization of member of DUF1888 protein family, self-cleaving and self-assembling endopeptidase.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 20
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08985 DP-EP DP-EP family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3njhA00
2HLEB 1L9SA 5B1JC 2XLLA 3IBOA 2VN3A 2P80D 4E9VA 2EIKB 3SBQA 1JZHA 2UX6A 1WA1X 5B3SB 1NIEA 2JFCA 1X9UA 1QLEB 1RZQA 4GP4B 2PP9A 1OCOB 4W1TA 2CJ3A 1CYWA 3NJHA 3AY2A 2QT6A 4BK5C 4CSPA 3QJUB 2MTAA 2XV0A 2IDSA 3X1GA 4HALA 3BQVA 1OCRB 4M4RB 5PCYA 2FNWA 1E67A 3H4FA 3ZDWA 5B7FA 2UXFA 4A68A 1I53A 1KV7A 1L9QA 3TU6A 2ZWNA 4A2DA 2YXWA 3T6ZA 1WS8A 2CALA 3MBWB 5F7BA 4UAHA 3FU7A 1ILSA 2QDVA 1JZJA 5I6MA 2PPEA 3NSDA 3FS9A 2PCFA 5I5IA 2BP8B 4E9TA 9PCYA 4GY4A 1AZBA 1NDTA 2I85A 2YAHA 2LLNA 3ERXA 4L0PB 1ADWA 2FT8A 3NJGA 3S3BB 4KNTA 3CVCA 2BWDA 5E9NA 1L9PA 1NPJA 3UACA 4A2GA 2AFNA 3FSVA 4MFHA 1ILUA 2E86A 5D4HA 4A67A 4NB7A 1BYPA 1AG0A 1PMYA 1KDJA 5EHFA 4KNSA 3UABA 8PAZA 4DP9X 3NP3A 2PP8A 4YL4A 4Q89A 1OV8A 4BDVA 1W8EA 4AZUA 4GP8B 4N8UA 3WIAA 2VW7A 1RZPA 4YSDA 4EF3A 2YAOA 3CVBA 1KBWA 1AQ8A 1OOWA 3PLYA 2GI0A 5AFAA 1BXVA 2CAKA 1PZAA 2NRDA 1FWXA 3FYEB 4YSSA 3QJQB 1AZCA 2QPEB 4F2FA 2UX7A 3V9EA 1ZDSA 3IEAA 1GYCA 1L9TA 1A8ZA 1JZEA 1VLXA 3AG3B 1ET7A 5I28A 3PCYA 1X9RA 2AZUA 3EH5B 3X1BA 1V55B 2HX8A 2DY2A 3OMIB 5I26A 5I6LA 3UADA 1SF3A 1HAUA 3ASNB 1PLBA 4BXVA 3FU7B 3S8FB 5PAZA 2HX9A 2BZ7A 3TA4D 2OV0A 1JVLA 1AZNA 2YQBA 3QPKA 1FFTB 2Q9OA 5B1BB 2XX1A 5D4IA 3ZBMA 1AS6A 2JXMA 2PPDA 4HZ1A 2IDTA 2VM4A 2J5WA 3IN2A 1N70A 5I5MA 4FAAB 4E9XA 2WO3B 1M56B 3RYMA 2YARA 3GDCA 2J56A 1SFHA 1B3IA 3NJFA 2UXTA 1J5DA 3T6VA 3X1NA 2YAPA 4NAJA 2BW4A 4YSPA 1ASOA 4QKTA 2XWZA 2IH8A 1IKOP 1ZPUA 1GY1A 5B1KA 1HAWA 4YSRA 4BDVB 2IDQA 3JTBA 1RCYA 5AZUA 4PCYA 2BZCA 1MZYA 4GYBA 4FA7B 3NJMA 3ASOB 3KW8A 4YSTA 1JOIA 5B1AB 3D12B 4DP1X 1ET5A 1JZFA 1XB3A 2R7EA 4DP2X 5I6NA 3NT0A 3OM3B 1J9TA 3FU9A 3G5WA 2DWTA 1EHKB 1WA2X 2BP0A 1PZCA 4QLWA 2YXVA 4WTQA 2DV6A 2X88A 1JXDA 1E5YA 1WS7A 2B3IA 1V10A 3NYKA 3S3DB 1NIAA 2VSKB 3N2JA 2PLTA 2FT7A 1BYOA 1IUZA 1SDDA 4A2EA 3H4HA 4HHGA 1PNDA 1PAZA 3NSYA 3CG8A 1AAJA 2MRYA 4KOBA 4M3HA 1TU2A 3PXLA 1PF3A 4G7RB 4DPBX 3HEIB 2FQDA 1XMEB 2GHZA 1TEFA 2UXVA 1WAEA 3OMNB 7PCYA 1AS8A 3FPYA 4A2FA 3CDZA 1AOZA 3FQ1A 2IAAC 5TK4A 1BQRA 1AACA 2FT6A 4HHWA 1J9RA 1ASPA 3GXUB 3X1EA 1NICA 1J9QA 2XV3A 3S8GB 3NJIA 1EZLA 5FC9A 1MDAA 1CUOA 2CBPA 2RACA 1KBVA 4ENZA 1GS8A 1IBYA 2J55A 2Y1AA 2YAMA 1ID2A 3KW7A 4E9QA 2DWSA 2HXAA 3OD3A 1AANA 3PAVA 5AKRA 1NWPA 2X87A 2ZXWB 3QJSB 4E9RA 1PZBA 1MG2C 3AG1B 2R7EB 2EILB 1GY2A 2XU9A 3FQYA 3UAAA 1URIA 3FSZA 3ABMB 4RH4A 4DPAX 1WA0X 2AANA 1A4AA 2BP0B 4G72B 1ZV2A 5B1JA 2EIMB 4W9ZA 1KYAA 1T5KA 4F2EA 2FQGA 3C75A 1BQ5A 3FPXA 3HB3B 3SBPA 1ET8A 1XB8A 2B08A 2FQFA 3FQ2A 2FTAA 2J57A 4G7QB 3AW5A 4KO9A 1SDDB 3IN0A 2PPFA 2DYSB 5TK2A 1A4BA 1SF5A 4JHVA 3TASA 2VMJA 3NP4A 1SHXA 3NJJA 1QNIA 2VSMB 5A7EA 2VW4A 1NZRA 2DYRB 2XVBA 2PPCA 5F7AA 4KNUA 5B7EA 4DP4X 3AZUA 2ZONA 4YSUA 2CCWA 1UATA 2GIMA 5I6KA 2XYBA 1PLCA 4JHUA 2PPAA 3ABKB 3ABLB 3SQRA 1OE3A 2YAEA 1ASQA 4KO6A 5LDUA 1OF0A 1BEXA 1J9SA 1SHWA 1NIFA 1BAWA 4BWWA 3BVDB 3PPSA 4YSQA 1AG6A 3S3CB 4PAZA 3EH3B 1JERA 1NIDA 3NJLA 2BHFA 1JVOA 4AX3A 1JZGA 3EHBB 3SBRA 4DP8X 2XUWA 2HRHA 3DKHA 2AZAA 2EINB 2UXGA 2A3TA 1QHQA 1KCBA 4G7SB 3TBCA 1CURA 1KDIA 2QDWA 4DP0X 4GXFA 4KO5A 5IY5B 1OCCB 3WNJA 1A3ZA 5I6PA 2IWFA 4YSEA 3FT0A 3QJTB 2BW5A 4BWTA 3FU8A 3FSWA 3T71A 2Q5BA 3WG7B 2VW6A 3DTUB 4HAKA 1BXAA 4DP5X 2GC4C 3OQRA 1AZUA 2VM3A 2CUAA 2OJ1A 2H47C 2XV2A 4JKNA 4KOCA 4YSCA 3T6XA 1GSKA 1DZ0A 6PCYA 1JXFA 3L45A 3QJRB 3NSCA 4Q8BA 3CVDA 3EH4B 5D4JA 3ZIYA 3AG4B 3QJVB 5I6OA 2GBAA 2IWEA 3WKPA 1GS7A 1N68A 2EIJB 3NJKA 2H3XC 4YVNA 1BQKA 1ZDQA 4YVUA 1L9RA 4P5RA 1OE2A 4DPCX 1ZIAA 3QQXA 1PY0A 4N4YB 1IC0A 1NIBA 4P5SA 3TBBA 3T6WA 1OE1A 1MG3C 3T9WA 1GS6X 1PCSA 4AKOA 2TSAA 1M57B 4HCIA 4F7KA 2PCYA 2JKWA 4YSAA 2GB2A 4E9WA 4A66A 1AS7A 1W6LA 3NSFA 4HCFA 3X2QB 1E5ZA 1FA4A 3MX0B 4NERA 2GC7C 4TXVB 6PAZA 2OCCB 1AR1B 1DYZA 3CZUB 3N55A 2GSMB 3U25A 2YAQA 2BWIA 3ABGA 3FSAA 3UGEA 2IDFA 2IH9A 1M9WA 1YLBB 1NWOA 1NINA 3JT2A 2YAFA 4DP7X 5I5JA 2N0MA 3WI9A 7PAZA 1SNRA 3GYRA 4UANA 4ZK8A 1MZZA 1AIZA 3WNIA 2BO0A 3DIVA 1L9OA 1GW0A 2P80A 3EF4A 1XB6A 2ZOOA 2FQEA 2WSDA 2IDUA 2TSBA 4HCGA 4HIPA 1V54B 5ANHA 1E30A 2W8CA 3CDZB 4BXSV 4UF7C 4DP6X 1TKWA 1KCWA 2AVFA 2FJSA 2HRGA 4WKXA 4GP5B 3NJNA 3UAEA 3X1FA 3PAZA 4BWUA 1CC3A 3H56A 4E9YA 1SJMA 1CYXA 1R1CA 4AI7A 4AKQA 2H5UA 2XXGA 5B7MA 3AG2B 4G71B 1J5CA 1NTDA 2HX7A 1JXGA 4AKPA 3IE9A 1JZIA 4KO7A 2WO2B 1HFUA 4G70B 2BP8A 1IBZA 1SFDA 1RKRA 1OCZB 1NPNA 1PLAA 4K9JA 2Y69B 1A4CA 1ZIBA 3ZX1A 1E65A 1ETJA 2XXFA 2QPDB 1A65A 1BXUA 1W6WA 1F56A 4CSZA 1GR7A 2FWLB 2XX0A 4A2HA 2I7SA 1TEGA 3PAUA 2IWKA 4E9SA 3V9CA 2HZHA 3WKQA 1AZRA 2PP7A 1PNCA 2I7OA 4YSOA 3OMAB 2W88A 4X4KA 1KGYE 3FYIB
chains in the Genus database with same CATH superfamily
3BZ4A 3MV8A 1WBXA 4M7ZB 2WJ5A 1AI1H 4R5TA 4XVJL 1I8MB 4EIGB 4UUJA 4LSSL 5C8JB 4LB8A 1NIEA 4ZODA 1G7MA 2YKLH 4AYID 2Q20A 4Y1AE 4FFVC 3JWNE 4Y19E 4YPGB 1E40A 1R9FA 1A9BB 1VADB 3MV8E 2BOLA 4JN2B 5F1IA 3WXVH 5HYJA 4LVHC 4U4BA 2XV0A 4BSVA 4ABUA 3MBED 3QXAB 3O3BA 4HALA 4I18C 1MW3A 3BQVA 1T1YA 5FYLD 5MHSD 3ZXAC 1T5WA 2YPLB 4O4YH 1RZIB 2WPGA 2AV7B 1KV7A 4UYQA 2IQ9L 5I71C 5IHLB 4E9LA 1OAKH 1FNLA 5HYJE 4JKWA 4X9FA 2Z91B 1A3RH 3HAEG 5CN2A 3Q7JA 1Q9LB 4NENB 5GRXG 1YAIA 4FQQA 1BWMA 1EEZB 4FFYA 4BSWA 3MACH 1NCAL 1NSNH 1WFIA 3CUPA 5KSAD 2D31A 2N01B 1HHIB 1UB5B 2YAHA 3ERXA 1CCZA 2VCOA 1MY5A 2HT3D 1BD2D 1E6JH 4QRRB 3C9NA 1AXSB 5SWSB 4H8VA 3RAJL 1DVFA 4FQCH 2WZPD 3IRPX 2GFBB 4MLSA 2AFNA 4UTAA 2JJSC 4F7CA 4NJ9H 3RY5A 3CFDA 3UTTB 5HHPA 3H3PL 1EFQA 1JF6A 4X6DB 1F8TH 4ETQA 5EZLB 4N6RB 1HCYA 3VXUB 5L0QC 4CC4C 4F20A 3BD5A 4LLMB 3D3VA 5GS2H 1DO5A 3NP3A 3MCKB 5E03A 3S5LG 4QHLA 4G8FA 3O6FA 2BK8A 5HHXH 1A14L 3MJGX 2J2ZA 1BVNP 1FH2A 5M95B 5L4MA 1AIFB 3PLYA 2CDEA 2E8YA 1ZT1B 3D3VE 4J8QA 4PCKA 4ZW7A 3FYEB 1H19A 5JHBA 2QPEB 4JQIH 4BZ1H 4F58H 3LKPB 2I60H 5J1AB 2KL6A 4HJTA 2P7TB 4LASH 4LSUL 1RV6X 1Y0LB 1Z5LA 3KXFD 3B1UA 3T2NL 3TOPA 4M43L 2NY0C 2CQVA 1IKFH 4UILL 1U8IA 1XHHA 1XO8A 1JGUH 1M7XA 1MFEL 5HI5D 1LE5A 1NA8A 5DJAB 1WC7B 2WN2A 3S4SG 2JELH 2XKSA 3DK0A 4PG2C 2HX9A 3BW9B 3NFNA 5DSCB 4X6DF 5J12C 1BVOA 3QNXB 2HT2D 4D8PB 3SQBA 2FDBP 2WVTA 4R90H 3BXNB 4C83A 5FCUH 1ZT4B 5T3XD 4POZD 3OV6A 5FLVA 4AK2A 3TJEL 3ARGB 4MXQD 1HS6A 1NFDB 1N6VA 5IT2L 1GRWA 5JW4Q 4IKNA 1MXDA 3IVKA 4HCRH 3Q8EA 4G8GD 2EUVA 1GPOH 4ANVA 3MZTA 2EQDA 3EHBD 4YX2L 1PLGL 4YSPA 3T8XA 2CIIA 2XWRA 3MOAL 3VB8A 4DNLA 1IFHH 1NMBL 1I1YA 3CZEA 4ZAKB 3BQUA 4X2UA 1TDQA 1UB6A 4Y5VB 4OUUA 3L13A 2WC7A 4HJ0D 3BGFC 4HKBB 5D71H 2XTJC 5KS9B 1U3HB 2IH1B 2YRBA 1C5CH 5CO1A 5H37A 1DLFH 3O41B 4K2UL 3ASOB 4RGND 2WD0A 4G80B 4LLVB 5I6NA 3ZK0A 4YAQA 4Y4KB 5ALBL 3FQUA 5JPMB 5GZOD 2E9WA 5E6IC 3QEGL 4AEHL 2NY5H 1QP1A 4NP9A 4HETA 4P07A 1HCVA 1KBBA 15C8H 4CUCA 5EOCL 4FL4B 2CJSA 2NLJB 1CLYH 2X5PA 4FFZL 3V0WH 2OMBA 3OC5A 3VGEA 2ZKHH 2BWQA 1NGWA 1ULVA 2G5BA 3FUFA 3W39B 3NG5A 5DLLA 5LN8A 2DLFL 4AENB 1QLRA 3IFPB 3ZDXE 3Q2CA 5IB3B 3ESNA 4WFFE 3F6JA 3V6BR 1YPZB 2N1KA 3CG8A 4ZPTB 3SGEH 5C0NC 2CIKB 1TU2A 4WHTA 4Q9RH 1NC4D 5FA4B 1I7TB 3ULUH 4AH2A 4H26A 4HS3B 4C8XA 2YBRA 3OMZA 1PQZA 4V2CB 5E5MB 5DHVB 4HIXL 1H6TA 4XHQA 4GUCA 2Z7WA 4D9LL 2DS4A 2X42A 3NGBC 2KS0A 3DNKA 4WO4A 2CR3A 3VD5A 2E7LA 1EZLA 4LL9A 3QFJB 4ACPA 1UOVA 5MI0C 4FZ8L 4P2RB 5F0JB 1TTRA 2J25A 4JFQA 4OZFG 1A6WL 3E6FB 3ALXA 4K3DH 4XB8A 1KCUH 5I0XA 1CBJA 1XT5A 3OKDB 2X9XA 3PAVA 2WXRA 4IOFC 3ZHDA 4D2NA 5IB4B 2C9VA 2Q3ZA 3EW3B 4KZCA 4NFCA 5GRUL 3VX0A 1FL6A 3VFGH 1K6QL 4Y2DB 3QXWA 3ZSTA 2ORBL 2VZUA 1CFSA 4P3DA 4R7NB 4BKLA 3R4RA 3JV4B 3SPHA 4MD4B 3KJ6L 1JZ3A 4C4KO 1LDPL 5G5DA 1A4JA 3SCMD 4A39A 4ERSH 1DQLL 1JWSB 2WWNA 3WKNA 3TO2B 1CG9B 4JE0A 4JJ5A 1GMIA 1JP5A 2ZKYA 2LTQC 2PPFA 5DUJA 1LO3H 3KPLA 1UH2A 3JQOB 3EDJA 5TK2A 2EEXA 4EI5D 2DQHH 4LOEA 5HGBA 3BWAA 4LAQH 5KSUB 2BMKA 5G4OA 1DBBL 5A7EA 2VXUH 2GCYA 1KBGL 2G75B 1X7QA 4F7PB 3DURA 5ECJE 4U6XA 3L5WB 1KELL 2QHRL 4TSBH 5F6HI 5HJDA 4A7GF 4WW2A 4ISVA 3FC8A 5LAPA 3P9LA 4XODA 4GFXA 2QQKL 5I1HH 1QRND 4Z7QF 3VQ2C 1IL1B 4YHKH 2A1WH 2BVEA 4L48A 4P46C 5DQJA 3KLHD 1J9SA 4NUMA 5JDSA 2ZP0T 4XBMA 4N9GB 4IMKC 3S9DB 3O45A 3EZJB 3RX5A 5TD4A 4JREB 4Y5XA 3FBKA 4QR7A 4WW1A 1BX2B 5E99H 3V0VB 2WQRA 1Z3GL 4L0YA 1KEML 5ABAA 2EDMA 1SGKA 4OLZH 1CE6B 3HVDA 1UKTA 3M6DA 3O2WL 1KC5L 5I1AB 3I50L 1MN4A 5EZIL 4DF9A 2ERJB 3FZUD 4NKIL 3ARDA 5BMFH 1XCWA 1XIWA 4FA8A 2D73A 4UAOC 4GQQA 3L9BA 3O3EB 3KCWA 3QJTB 5LO7A 3HMWH 3QEUA 2VR3A 4HXBH 3L3HB 3WG7B 5I1IL 3H0TA 4Y5YC 2R4RH 3L2LA 5F44A 5IR1A 1G7LA 4GEJA 2H0FA 4EIUA 1UZGA 4TF4A 5GGSY 4P23C 32C2A 1GC1C 4LVHB 3VFNB 2OJ1A 3PNWA 2DJUA 4I18B 4N2BA 2V9TA 5I19L 2VL5B 1FYTB 5EBGA 1N9PA 3QP3A 1AGBB 2FO4B 4F9PA 5TQ0L 1RIUH 2IOOA 2YPLD 4G82A 5I71B 1HJCA 3L1OL 4NKDA 2DQUL 4YBQD 4XNBA 4E2OA 3CN2A 3EO0A 3B9KC 4JFZH 2NSMA 2GT9A 5DZPA 3RDTA 4PW3A 3WNNA 1JZ8A 1XD1A 4DW2L 2B5IC 4J3BA 3WFBL 1U3NA 4PRNA 4JM2C 2R2CA 1F90L 3JUZA 5TE6L 4R2GC 2OP4L 5IESH 4WENB 1A7QH 2F8VA 2DQJL 3ISYA 2AAVA 3HMXL 2P3YA 4MB1A 4Y2LA 1U8KA 2KC0A 2LFEA 5IWLA 5ES4B 4QRRD 5K39A 2YWZA 4OCLC 5GRYA 2RH0A 5SWSD 1BFOB 2YOAA 4F8QA 3EXJA 1MCKA 3FCTB 2Z93B 1T7XA 4QRQA 1SLXA 1WSST 1MRCH 3UTTD 1M57B 3BVWA 3LXCA 4MB5A 4OGZA 4QO1A 3U9UA 4IMLB 4WI0B 3KBHE 3B43A 4C4KT 3UJJH 4AYMC 3I2CH 5L0QB 3MFGB 5KVEE 3D0VA 1MCOH 3VXUD 1BF5A 1ED3A 1UXSB 3MNWA 3X2QB 2X4OA 1J1OL 1E5ZA 4FS0A 2OCCB 4AW4A 4JRXA 4YLQT 1UJ3A 3P3SA 3T0EC 1HSAB 3D09A 5LXVA 3CTTA 5IMLB 3WTYA 5KBMA 3TT1L 2ZCKH 3GO1H 3FB6B 4N5ED 4YHLH 1ECZA 3EFOB 2OZ4H 1IC5L 4QT5B 4XBPA 5I18L 1TZHA 4M8UA 2PCPA 4XR8C 5A2IH 1KLFA 1S7WB 3CSBA 4MA7L 3ATAA 1CICA 2AF2A 3MLWL 3AREC 4JRXE 4NP4H 5I8OL 3UL4A 1J9CT 2MEJB 1D5XB 3SKOB 2NY0B 5EOTA 2Q7YA 3T4YB 3RWGA 1W8NA 4H1LG 2W1NA 3VA2C 2E6JA 4XNYH 4TSCH 5DD1H 3MXWL 1IBHA 3CFIC 5J12B 4HAGA 2DQ6A 1FGVH 3KM1A 2PO6A 5EO0B 3VGHA 4KHTH 1CC3A 1FF5A 4M7KL 1IILE 2HT4C 3DVGA 3K0WA 4HIJA 3DX3A 4UV4L 5HYSB 2CJUL 2XIIA 3C8KA 4BK8A 4IOSA 5H4YA 5DZVA 4EVNB 4WI2A 4OCYH 2Z0UA 2KZKA 3FB8A 4Z78A 4LRNH 2GAZB 1LO0H 3ARGD 5FKAB 1EFXA 2VERA 5KYXA 1SHSA 3FRPG 3UDWA 2CGRL 1F4WH 3OB8A 4FNRA 1BFVH 4K9JA 5CGBA 3JWNG 4PGBA 1HHJB 1WGVA 3Q6FA 4KRPC 3MLYH 4PJDB 4R7DB 3IB4A 4U6YA 2AJXH 4M5ZL 1A65A 1DVXA 1U2HA 3GRWH 2BP3A 4PBVC 4HG4J 4ZAKD 5I1CH 3UCRA 3BGFB 3L5XL 2XTJB 4G7YL 5CN1A 1S9WA 1AZRA 3SJVB 1U3HD 3DBSA 3BISA 4OD3L 1ZHKA 1T6BX 4TL4A 3TT3L 2R4SL 1A6TA 1HN1A 3FU6A 2FEJA 3WFHB 1H6FA 2P80D 4Y4KD 4ODBD 5ERWB 5E6IB 3NCFB 3BAEH 4X6BB 3TIEB 4ATTA 3CLWA 3D51A 2AITA 4AJWA 4XPGH 1YYLH 3M8OH 2BZDA 4GO8A 1SBBA 4G3YL 1XSJA 3GXIA 4J3SA 1SYSA 5LG6A 5AVSB 2J1YA 1SZNA 3WD5L 3BZ5A 3TVMB 4LBAA 4FQXA 2QJDA 2YA1A 3T4AC 5DD3H 1A7RL 4J23A 4KKLD 4WWKC 5PCYA 5C7XH 4GRWB 3BWZA 4OF3A 5HJ3B 1I3VA 5T1DL 4GFTB 4CC0A 4EMZA 4UNTA 1C1EL 4IOIA 3L4XA 3BO8A 5EEZA 4PD4J 4PGDB 3TWCH 3LMJH 3B7YA 3BLPX 2M1KA 4Q6IA 5AD0B 4DESA 1ILSA 2VLME 3MUGB 4JY5H 2EDFA 5I5IA 4LP5A 2ZYSA 1XF4A 1I7UA 3RUGA 3X3GL 4JHBA 3NGBB 2BCKA 4X4XA 3CXDH 2ICES 3FW6A 4KJWC 3S3BB 2ZUYA 5T1KB 4TQPA 4B9JA 2XN0A 2IVFC 4XHJC 1S5HB 5HD8D 5MI0B 3QFJD 3ROLA 3Q9QA 1G6RH 2C9SA 4P2RD 4GRMA 2A77L 3D25B 2VITA 3GBNH 3T3PE 3CN4A 4N3TA 4UIMA 3RUGE 1A4KB 3FT9A 4PW4A 2J1WA 1HNGA 2BSCA 2X4SA 4L4TB 4BH8B 1AXTH 4JGUA 4YN3A 2BSED 4KNQA 4RX4D 5LGHL 3FF7A 3WELA 3V7MA 4Y2DD 1AHWB 2I69A 4OJAA 1OV8A 5C9JA 2A6JA 3L9RA 5KBNC 1DJIA 1RZPA 4Z7OE 3HBGA 3A6OA 5DRWA 4BFIA 3REVB 3ZRCC 4RMWA 3N1PC 2DZEA 1R0AL 2L04A 4IHOA 4YGAB 2ZXCA 3QSKB 2LTQB 3IEAA 1GYCA 3B6SA 3IBEA 2GG1A 3FOLA 2OMWA 4DO4A 3DUHA 3SKNB 4K23H 3M45A 1FVCA 1BZ7A 3EJPA 4DT2A 4GAGL 2LGNA 1DBKL 4HFWB 2MPAH 3WIHA 2XBTA 3DTDA 1KBPA 3SE8L 1ZHLA 1PFOA 3HNTH 2VLJB 4H20L 2AXHA 4DOHB 1PVHA 1TMQA 4PRBB 2EYRA 5E6ZA 4P46B 3SGJC 1F86A 2PPDA 4K7PL 1IT9H 4HDIB 2WWMD 3OSKA 4HIIB 3K81A 1PY9A 3JT0A 3ULAB 1EA9C 3BWUF 3UXFA 2EH7H 4K71C 2EYSA 5H37G 4AUYA 2YARA 3GDCA 1P4IH 4QLRA 3CK0H 2ZX8A 3KLKA 1NCJA 3D07A 3BEWA 1MHCA 4GIAA 5K9JL 4OGQC 2GTWB 1DANU 4HGMA 1JNJA 3N06B 1KCRL 1ZT7B 1BVKB 4G8EA 1OB0A 4L9LA 3WMQA 4BDVB 4R8WL 4WI8A 1LO5B 4UAOB 2EJ1A 1L3NA 5GRWA 4U1HA 5AZUA 4PN6A 3OGCB 4WF7A 4FMVA 3BP6A 1OSZB 1DFXA 1MZYA 3MRBB 3NJMA 4GYBA 4ZNEA 5KG9A 4LCVA 4WI9A 4Y5YB 4PJ9C 4L5FL 5F3HB 2E7DA 1T2QL 4NHUA 2CPUA 3ELQA 4FFVD 4JFYA 4Q9BA 1P5VB 2AJSL 3GT6A 4P23B 4AEEA 4BZ2L 5EIQA 3KDMA 5GIRA 2WCGA 4ZNEE 5I76B 2DV6A 5BZWA 3LTVA 1GOHA 4JM4H 2OAAA 1E5YA 2CUMA 5E9DB 3SPGA 1WS7A 1FYTD 2CA3A 4FJ6A 3EF7A 1TFHA 4U3SA 3KNBA 3V8OA 1ICTA 2OX5A 2NY6B 3G5ZB 3B9KB 3H4HA 4YNYA 5AOZA 5KWYC 1IBBA 2XWCA 1OWRM 2Q86A 3TBSB 1RURH 3GZKA 2XN2A 5A2AA 2H26A 4G6KL 3A6CL 4AYEC 4YZWA 4X4YB 2B5IB 3HEIB 3LPWA 4DIXA 5B3JE 1YEWA 4JM2B 3HE7A 5GGVH 5E08H 4R2GB 4ZW8A 1MCWM 1EAPB 4ICXA 4LGRB 4DUWA 5TK4A 3UGUA 4P5TC 5CGMA 3CXFA 1KCVL 2X4TA 4YDJA 5IV2B 1YG9A 5E56A 1AD9B 4JLRB 2OTUA 3RA7H 1UOKA 4P3CH 4Y16A 1YNKL 4S1RH 4ENZA 4EZMA 1IIIA 1AY1H 4MNGB 2R9HC 4LQFL 1TEYA 1FO0L 2BLFA 4OU3A 3VXNB 4OQTH 2MFNA 1XTLA 1BVZA 4N8PA 2FZ3B 2X4QB 1SM3H 4J3UA 4TUOA 4DO5A 2ICEA 2DQGL 1URIA 2UY7B 4PS4H 1CYGA 3DGDA 3T0EB 3G9AB 4DPAX 2DMKA 1LP9A 2VDPH 5JHLL 4JANB 2VZOA 4B96A 3WSQH 1A4AA 3FO1B 1G9NC 4W9ZA 4YPJA 4E42B 2YXFA 5GSRB 3EOAB 4H88L 2BS9A 4P2QA 2X2UA 3BAIA 1UFUA 3AREB 3HI1A 2Y1YA 4OFKA 4X6CA 1E9OA 3GUTA 4OIBA 4YDNA 1LP9E 5EBLA 1YNTA 5AW6B 4KO9A 3UTPE 4KZEH 2NY0D 3OB0H 1NOAA 2WXHA 4P2QE 4DZ8A 4RFEB 4FN0A 4MQ7B 5EZJA 3B1TA 2FECL 4X6CE 3P3YA 2O1AA 2WK2A 4CW1A 5I2IB 3L5IA 5AVTB 2WYZA 3H6JA 3POHA 4PJGA 3PY9A 1D9KA 2G30A 3CFTA 5ID0B 3ABKB 3TBYB 1XR9A 3IMWA 3LPPA 5C3TA 5KSBA 1F45A 4A2MA 4NHCH 1SOQA 3NCYP 2NXYC 3PL6C 1DVSA 3RWDB 1I8AA 2G0LA 4FQPA 3ULVH 1VB9A 3EDDA 4WCYH 5E8NA 3RU8L 4AIEA 4KRPB 4YSQA 2YSSA 4PJGE 5DRZB 3I9GH 4ZRGA 4ZUSB 3SHSA 4KKZA 1I75A 5FO7B 1NIDA 3JTTA 4XO8A 5KSBE 2D0GA 1BDYA 1PZUB 1FC2D 4XAKE 3SDYH 3AM8A 1UD8A 4HPYL 3ILPB 1B9KA 4XVOA 5FK9A 4GNKB 3S96B 4QXGH 2A3TA 3HCVB 4OM1L 2SEBB 1S9YB 2XTJD 3LIUA 4NKMA 4P05A 2E4FA 4DVRL 4GXFA 3DVFA 5C6TH 1U4EA 3S35L 3SJVD 2Y06L 1ESOA 4XVTL 4PJ5B 4PWHA 3U1QA 4UB0L 4JKPL 2BW5A 3V5KB 2K1MA 3QO0A 2DTMH 3L3OA 4GAYB 5E6ID 4GG6A 5F0PB 4ADGA 2H32A 4U3CA 4I1PA 1T20A 3EYSL 5CBEB 3ESPA 3F6LA 4RQQA 5EN2A 4PJAB 1AZUA 3HN8A 4FX5A 4KHXH 1DBMH 1QYGH 3E8UH 4FTVA 3ARQA 1XZ0A 2QQQA 4LEXH 4UM8B 3TVMD 3T4AB 2H47C 3HBQA 3VMPA 4WWKB 4GG6E 2LT9A 1OIOA 5TF0A 1U6AL 3IPBA 1FNEA 4PJXA 1P9MA 1QBML 1XCTB 4H5SB 5C0ND 1FDLL 1V7MH 4QF1B 1U8PA 4FTVE 4JN1L 1QSEB 3PGDA 3WL9B 1N68A 4LCCA 1R24A 1A7OL 2JJUA 3SY0A 5BZDA 4YVNA 4NC2B 4Z7WA 3WFCH 1A22B 4YHML 4HKZB 1TQCC 3C5ZC 4PJXE 3SYPA 2BY1A 3GK8H 4NYLA 5T1KD 5HGAA 4Y4FA 4Z7WE 5DHEA 2BHZA 3P11L 5E0QA 5IHUH 2NQDA 3OLEA 4GMSH 2EIEA 4DN3L 3S37H 4Q97A 1RULH 3QZWB 4KVNL 2YMOA 1MFBH 4DKEH 3TFBA 1F4HA 4E9WA 4IOFD 4PGZA 2F8OA 5IB5B 4L4TD 3A47A 1KIPB 4PP2B 2KH2B 5CEXA 1G9HA 2DWEA 2QR0A 4LCIL 4QMEA 4XWGL 2YK1H 3DUUB 3NSXA 4QHMA 4U1MA 1E8YA 1HL8A 5F7FA 2GC7C 5DZNA 3CIAA 4QXTA 3VXMB 2HH0H 5DS2A 4MNQA 3BN9C 1M9WA 5BZXA 1OZTG 3TNNB 4WSGA 5DHDA 4B97A 1VKXA 2AQ1A 3CPLB 5ETUB 3L5HA 3BFOA 5M7QA 3VSQA 4M02A 1AIZA 4ANKA 5HY9B 1G5AA 4MNQE 1IQWL 4NN6C 4WGKA 2YPVA 3F84A 1A2YA 3QQDB 1XB6A 2Y5TA 4G43B 5IG7A 2FQEA 1ZSHA 3QJZA 3GHBH 1QWUA 2C1PA 1V54B 3PE9A 1FZKB 4PBDA 4F57L 2BNUA 2Z64C 2BNRB 5HYIA 3D52A 5C0RL 4HUXA 2VLJD 3RVUC 3V4PA 2FIKB 1DEEB 3LS5H 1G87A 5F7YC 4P46D 5FYKL 5EO1B 1NTDA 2EDEA 3MJ8A 3JUYA 1OARL 1QR4A 1JF1B 4D0DB 1F00I 5DJDA 4K71B 4LDCA 1YEJH 1OAXH 3RX8A 2OR9H 1CFVL 2Y69B 3BT0A 5FUOH 2LU5A 1CLOL 3OAUH 3U7AA 2B9AA 3HI6L 4YZFE 5CEZL 3KPQA 1CTOA 1GW6A 3NPSC 2EE9A 3WEXB 2CD0A 2YUWA 2NZ1A 1HI6A 3FRUA 3VVVA 3GTNA 2CBTA 2HG5A 3G7TA 4QTIL 4E9SA 1XL4A 3CFNA 3DX9B 2X3CA 4ODWB 3ZN6A 4F7TA 3RWIA 4DAGH 1XH3B 3T2LA 3RPIA 3O2VH 2CNZA 3V8CA 2D9QB 2XJKA 3FTXA 3VTMA 3OX8A 4ONGL 3RY4A 1L9SA 2YPKA 2GJJA 1M53A 4JAMB 4AQAA 3IJEB 1CFQB 2UX6A 1SBSL 4UT9H 1H5BC 1FFOB 1NGQL 1RHHA 2ATAA 5FOBB 4P23D 3QUML 3AAZA 4HV8B 1XH1A 1DBAH 3FFDA 3MC0A 4W1TA 2X6UA 1T1ZA 1S7UB 3WEBA 1EHLH 1KLGA 4WTZA 1T83A 4OZGB 1AD0A 5I1JH 2DQIH 1Z0NA 5E9DD 3AADB 1EO5A 3QQ4A 5IQNA 1UA7A 4IRZL 4EIZC 1G1YA 4XC3L 2DQCL 2ZKXA 2Q8AH 1JUFA 2NY6D 3B9KD 3MA7B 4WVRA 5IBUB 4XCYA 1I3RA 5MEQA 2R2EA 4JQXA 1Z9MA 2X4PA 3QUYC 5D7IA 5L8LB 3U6RB 4JM2D 5ICXA 4HWBH 3FU7A 2VKWA 4FQIH 4R2GD 1SXNA 5AZ2H 5AW8B 4P5TB 4GY4A 4EN3A 5KW9L 1H0DA 1YEFH 1TTGA 4NQXA 3QBTB 4L0PB 1CFNA 2IANB 1U2YA 2JKXA 2VH5L 3NJGA 5D7IE 3IK2A 1JPSL 5E9NA 1NBVL 2X09A 1UXLA 3QPXH 4GKNA 4IGBA 4NZTL 3CQQA 3OPUA 5FECA 3TCLB 2APWA 1WJ3A 2WXOA 3K0YA 5INCB 2HN7B 3RVXC 4P9HH 3VI3B 2FJUB 3KYOB 3JWDC 5BUPA 4XVJH 1KDJA 1O5DT 1OTSC 2H0EA 4P4KC 5C0IA 4LSSH 4PLOB 4Z7NB 5LKNA 2BSRA 1PCXA 2VR5A 1SLVA 1P7BA 2ZXDA 4HC1H 2AEPL 2QFPA 4Y7MA 3T0ED 4AZUA 25C8L 4MA8L 3QUGA 2OMZA 3VRIA 3SGDI 4HS6A 2CLZA 1KJ2A 3ML9A 3VFMB 6CGTA 3ILDA 3CVBA 3QIWC 1MREL 4X6FA 2CAKA 1XVSA 1UZ6E 2F2HA 3ARED 4M6OL 1T22B 2IQ9H 3C6LB 4F2FA 1DQIA 5KUKA 3E6HB 3L3DB 4ODVL 3DJZA 4NLAA 2Y7LA 2R2BA 3FK3A 3RVWC 4YS4A 3MUHL 3E2HC 1B0RB 1D5ZB 1JMXA 4U2YA 5D7LA 5HI4C 3I9IA 4ORZC 4XMUA 4NQEB 4HS8L 3C12A 4WAFA 2AJVL 2IPKA 1TVBA 3ASNB 3M88A 1NCAH 5BUGA 3IKCB 3Q1EA 3VI3F 5LCVA 2X0VA 1BJMA 4NO2A 2HT4D 4MA3A 3U0TB 3RAJH 3TA4D 2QKIA 1CXFA 5D7LE 5HDBE 4ZUWB 4TVUA 2VDOL 2NW3B 2XX1A 2NXYB 3H3PH 3PL6B 2Y2TA 2VXSL 5EN3A 2XFXB 1LL1A 3MREB 5T33L 4KRPD 2DDQL 2JH2A 3H8NA 3QH3A 4N2HA 1SDYA 2N59A 3RWCA 4D0CB 1QVOA 4N0UA 4D94A 4MCNA 3ZYOA 3P77B 1I8UA 1TLKA 1AE6L 5E2JA 4ZX5A 2ZF8A 4H2AA 5EPMA 3PQYB 4U7MA 1A14H 1X7TA 3A6BL 3AQXA 4RSYA 5IQ9A 4NRYB 3MV11 3UTSA 4N8VA 1A9VA 43C9B 1MWOA 4B9YA 5J0BA 4XOBA 4N0UE 5BW7C 5JQIB 3L7FA 1DE4B 3DSNA 1A3LL 4PJ5D 4L3EA 1A25A 5B39B 1RPUA 3WS6A 1NCNA 3LOWA 1FLTX 1JOIA 1YVLA 4LSVL 4UNIA 4LSUH 5FUCE 3IJ8A 3O81A 3LQAC 1E5UI 1OPGL 1A1NA 4OJYA 3UTSE 2WXIA 4IRJC 4OLUL 1MXGA 4M43H 2CO6B 3GIVB 4JQIA 4B6ZA 2C9AA 3TESA 2G9HA 3K8LA 1MFEH 3BMVA 4L3EE 1DL7L 1IJNA 2EIBA 3NIGE 1PEZA 2O61B 1IBDA 2X0UA 3UTZB 3VVWA 3FQXB 4WWKD 4KTEL 5E6RB 4ZUUB 1M3IA 4X5WB 1MCQA 1BZ9B 4I5BB 4MSWA 1IAOA 2R0WL 3B3BA 4B9KC 5IFHL 3TJEH 1QSED 3LQZB 4KOBA 1T0MB 4KRLB 4QRUB 4UV7L 2A99A 3HR5A 2CRMA 3ARFB 3I3EA 1BJ8A 3P1VA 4ZMOA 2J7LA 4TYUA 1TQCB 3C5ZB 3V55A 2EIDA 4H4NA 1MIEL 4CJ1A 1UCBL 4YX2H 3WO3B 4NDMB 1PLGH 5L88H 3MOAH 4KJWD 1C5DB 2ATPA 3P4OA 2J12B 1NMBH 2VLKA 4XHJD 2QMKA 1UEMA 4NLHA 3ZE1E 1FG9C 4D3CL 2CHDA 4ZMAT 4X9GA 3ZR6A 4E5XB 3I6KA 1CUOA 1G7PB 2OL3B 4RMVA 1A9EB 2MCMA 3LJ3A 1BQLL 1G9MC 4PSRA 1CGYA 1GS8A 4K2UH 2CHZA 1JGEB 3L4WA 3KW7A 2HJKA 2VLKE 4C57C 3AWEA 3PJSB 3DOSA 5ALBH 3VG9C 3MJ9L 2JJWA 5D72L 2F7QA 3QEGH 4ALAC 3ARVA 1QD0A 3NJXA 1EZVY 2WLNA 3JV5A 3GC3A 1KG0A 3IRZA 1YJDC 2Z1PA 3FSZA 3OAZK 5EOCH 3VXMD 4D9QD 4ELKB 3LRHA 4FFZH 2QEJA 5C0GA 5JQ6L 4Z76A 1SUHA 3HZKA 2DLFH 5B8CA 3Q8FA 1QZ1A 5DJ0A 3GXFA 2WXNA 4E41A 3SBPA 3CFBB 4MWFB 3OG4B 4LLDA 4NN6B 1Q8MA 1OP5H 1FLRL 4S1SL 1BAFL 3UG3A 3ZE0E 2AMUA 2I5YL 3P4NB 2J73A 3DHPA 2BY3A 2H3NB 1P0SE 4HIXH 2XFGB 4EQ3A 5IOPA 2VMJA 4E41E 2BNRD 4M00A 1A21A 1PD0A 2OI9C 1CGSL 4XN2A 2VWEE 4D9LH 2XVBA 5ENWA 2ENJA 4J1UA 3WAKA 3DX1A 3Q48A 3GLDA 3SZKC 3BVXA 1L9MA 1MJUL 3UCQA 3BEVA 3OLIA 4FZ8H 4XX1E 3WDJA 3NFPB 1GOGA 4JG0H 5F7KC 3EJUA 1A6WH 2WNKA 5GISH 3ULUE 2FJGA 3B5GA 1LILA 1CL7I 5JLZA 3WHE0 1T89C 2FJHA 1U3ZA 1UQSB 4W9IC 4XGZB 2VERN 4EE2A 2Z4TA 4FYQA 2ZUWA 5GRUH 5DQ9B 3NPSB 3LRSB 1K6QH 1OF2A 1OGTB 1LJMA 2JKTM 2WTOA 2ZXQA 5T8IA 5JMRA 2YD4A 5D7KE 3GB7A 1HOEA 2ORBH 4TL5A 1K5NA 2W81C 2EYTA 4GKLA 1PIFA 3MRJA 2UXGA 4XOEA 3IMSA 5CJOL 5SWZA 1E2WA 3F62A 5TH2A 2ZUSA 5J4MA 3KJ6H 1CURA 1T1WB 3DYOA 3II2A 1LDPH 1GZHA 5LAXB 1PKQA 1CDGA 2PTVA 5J6GA 1DQLH 4A6YH 3FU8A 4ODXB 5SWZE 1ETZB 1GL4B 4W9DC 4ADIA 1Q9KB 1H5BB 1R47A 5D6DC 1ONQB 4AGMA 4ZOEA 1DBBH 1PKQE 3NA4A 5AVRB 2CXGA 2XWBA 1YEDA 1KELH 3ABZA 2CUAA 1OTTC 5BNXD 3ZUNC 3QDJA 1AZZC 3OJMB 4KOCA 1Q9WB 2QQKH 4ZFOL 1CQYA 4Z7UB 3CVDA 2GABA 2D0FA 1EVUA 1C7TA 2G5UA 4HUWB 5D8JL 3BLKA 4TNFA 1OCWL 3QXUA 5F89A 2WWKO 2BVOB 1S7QA 3QUYB 4OJEH 2R29L 3DOHA 3MGOB 3QDJE 1J5IA 3U46B 2HVBA 12E8L 2CBQA 5BV7C 1FHGA 3I6GB 5DEFB 3SOBL 3H9HB 1FNGB 4RRPM 2VJXA 1ZVSA 5DMKB 1Z3GH 4JFHE 3C5SA 1KEMH 4P5TD 2XKUA 4LPXA 5ABDE 4I0PA 3ZSSA 4L8BB 2OMUB 2VAJA 1F11A 2IAND 3O2WH 1KC5H 5C3IA 3FT4B 3LNEA 2NW2A 3I50H 4K8RC 4DETA 5JXEA 5EZIH 4ZT1A 4K5MA 2C34A 4NKIH 5B21A 1BJ1J 3CVHL 1RAMA 1YUHB 4UZSA 2R9HD 2X7LA 2Y7QB 4QGTA 5EMYA 3QB7C 5TJWK 2GJZA 2JKWA 3EBGA 1S5IL 4P4KB 4PD4K 5HDRA 1CU4L 4JPQA 3MPCA 1BQHB 4PH8A 4BCXA 5I1IH 4JO3L 1QTSA 5FA3A 4OF0A 1A5FL 3N44B 4G8IA 1LLAA 3U9PL 4F7MA 5DUBB 2JI2A 2PWHA 3DJ9A 4JDTL 1R3HB 4JEGB 3STZB 3I75B 1Q9OB 3BN3B 3M7OA 1TT6A 1DYZA 2VR7A 2DWDA 2Y7OA 3QIWB 2I9LB 3VD1A 3CBRA 5I19H 2AKRA 1YYCA 4AQ8A 3FUEA 3S5ZA 3BDYL 4IBVA 1TJIH 5TQ0H 1OL0A 3NZSA 5EU6B 3L1OH 2DQUH 2D7PA 2QLYA 3C6LD 1SDAB 4KUCF 4X99B 4H8WC 1L9OA 1X5IA 3EF4A 3E2HB 3NCYS 2PR4L 4LRIC 3ROOA 2VQ4A 3WFBH 4PRHB 4KXAA 1F90H 4NQED 5TE6H 2OP4H 4BQ6A 4RGOL 2OMYA 4HEPA 3BAJA 3QEHA 5F1NA 1KBKA 1B0IA 2DQJH 3V0HA 5I8CA 3HMXH 3QJFB 3F7RA 3SO5A 3L3KA 3H3BC 3NJNA 4MJ2A 1X4YA 1VDGA 4HJJL 4W70A 3H56A 5C0JA 4PTUA 1W72A 5BCAA 4AI7A 2H5UA 1AFVH 2VXQA 3PL6D 4G5AA 2NXYD 2HX7A 1TO4A 2Q0ZX 4JFUA 1AKJA 4YIQA 3T0AA 5BQ7B 1PEWA 5KUMA 4JK0D 4EJ1C 5J5EA 1YAZA 3LB6C 4HULB 1H15B 3UPRB 1Y1UA 5CIPB 1U92A 1WDAA 3O6KL 1NJ9A 2K78A 3CC5B 4DGIL 3UTOA 2D3LA 2AXGA 1TQVA 3PQYD 5DJ2B 3TT1H 4PTTB 4KJPC 4RAUB 4ZO8A 3VH8B 3VNYA 1K4DA 3HJ0A 1IC5H 5I18H 4WTZG 1HH6B 3CHRA 1FNFA 1A1MB 1OD9A 1O75A 3N6YA 4WNQA 2H9GB 3RNQA 4MA7H 3MLWH 5I8OH 1ZLEA 4HPHA 3IU3B 5D93C 3WKML 3B83A 3BUTA 4KDTA 4IRJB 5EA0L 2OL3L 5M94B 5IHZB 4MDIB 3MRFA 2JFCA 2WWKT 4L0ZA 1RLWA 1RLBA 4L4VB 1NKOA 1L5GB 2P5WA 5I16A 3MXWH 4MKTA 3HVNA 1CYWA 5IB2B 1R5WA 4IKLA 2EAEA 3NQKA 4BD4A 3TEWA 5ITFA 4M7KH 1CT8B 3LPGA 3BUDA 1CFBA 5E0FA 4PB0H 2CJUH 1U93B 2RALA 2V2XB 1TZIB 2P5WE 2MNWA 4HX1B 3TM6A 2UXFA 5I15L 4AEFA 2MMXA 1HXMA 1OP4A 4A2DA 1CMOA 2CGRH 3ARFD 5J9PB 1WS8A 5EU5B 5F7BA 5CD3B 5MENA 3C5ZD 3NCJL 2FWOB 5GRVK 2AJUL 4GG8B 3A23A 4M5ZH 3VD7A 5D1QA 1VCAA 5JYLA 1E4KA 3TBWA 3GHPA 4K94C 2GSGB 2X2JA 2CPCA 3BZFB 4KUZL 5DC4B 1N64H 3ZDZB 4PS7A 5MENE 3ZIMA 5JR1L 1NM4A 2Y7SA 3B34A 2DTSA 3L5XH 5IVOA 3MV7A 5DHVH 4A2GA 2IADB 2QBWA 4NO3A 3W2DH 4J6RH 4OD3H 4GUPA 3QXDB 5D1QE 9CGTA 4R7VA 2H7WA 2NNXA 3TT3H 2R4SH 5IVXA 1G7IB 3QWOB 3RVTC 1PMYA 4NT6B 4R5XA 5J6HA 3ZL1A 1BZ8A 3MV7E 4U6TA 1FFPA 2DLHA 2MCPH 5C0BB 5JIPA 4QOKB 4WJG3 4G3YH 1BOGB 3G5VB 1W8EA 4WO0A 5HVWA 1QHPA 5IVXE 3WD5H 3BN9D 1AO7B 1BLNB 3DGGB 1RY7B 1A7RH 1ZLUK 1K2DB 5F3BB 4OZIB 3CFKB 1IARB 1AHKA 1N26A 2Z34A 4JCLA 1RUML 4KU1A 5T1DH 5CBAB 3EUDA 1C1EH 4M5TA 2UX7A 2YLHA 5E00A 5F70A 1CI5A 1A8ZA 2DI8A 1U9KA 3IMBA 4F7EA 2AHIA 5JZ7C 1NGPL 2EDQA 3RZCA 3ZDZF 5LQBL 2DOCA 2J1KA 5CILL 4ES9A 1X9RA 4ZW5A 5F21B 4AUJA 3OR6B 4KK9C 2WOBA 2BINA 2OI9B 1SF3A 3X3GH 3EOBB 3US9A 1DDHB 2W38A 1IAIL 1M6OB 3RVUD 4XCNA 4R3SA 4GAFB 2N3JA 3D87B 1JVLA 1LQBC 1TZAA 3MZGB 1HESA 1AR2A 2CO7A 4JFEB 2A77H 4X80L 2WTRA 1AS6A 3SPVB 1S7SB 2X1OA 4BQBA 1DBJL 4ENEC 2PN5A 2KZWA 5IZ7A 3CX2A 4ZO9A 4Z5RB 1JXJA 1JWUA 1F1AA 4OV5B 3L3IA 4HD9A 4ELDA 3NJFA 4RA0C 2ZJSL 4OF8A 4OZIF 2I07A 4HP5A 3OHXA 1QFWL 4CMHC 1BZDA 3FQNB 1XXDC 3Q5TA 5EUKA 3TA3C 3QNYA 1ZPUA 2O5YL 3DMMC 3QQ3A 4PYGA 4X9IA 3QR1A 2GY5A 1S3RA 2P28B 3OQ3B 4R4BB 1X5MA 4Y89A 3APNA 3ZE2B 4FE9A 3FB5B 1VGEL 1AGFA 1TITA 1G0DA 3GSQA 1GJIA 3L3GB 5A6LA 4LEEA 3UJIL 1SY6L 3X13B 4TVPD 3FTZA 4RLDA 1VRSA 3QFDB 1E5CA 4I9WE 1RK0B 4GAGH 2DM4A 3B2PA 3MGTB 1DBKH 4QLWA 4WKZB 4WTQA 1AC0A 3UERA 5BXFA 4LKXA 5CCJA 5HGHB 5KVGL 2Z8SA 3GSVA 4H20H 4FKEA 1OW0A 3STLA 1ZXQA 4K7FB 4AZ8A 4N8CL 7CGTA 1ORQA 3CZGA 3DPBA 2IALA 2EKSB 3RWFB 4HOMA 2WCPA 3IYLW 4KX8A 4DGWC 4Z9KB 4TTDC 3QUYD 5IROC 5BV7B 5FGCB 4RGMB 3UZQA 1RERA 3VACA 1DUYB 5IF0B 5IMKB 3BPLC 2YEVB 2V7NA 1CDBA 4U2ZA 1TEFA 1WAEA 3IS1X 3PDGA 1J0YA 3FPYA 1ZHNB 2ZYRA 5K9JH 1X5XA 1JNLL 4KUCD 1HEZA 3IFNL 4LLAA 1BQRA 5KJ4A 3ZE2F 4FYTA 1SEBA 5FYJL 3H9ZA 1R3IH 2ZUXA 3CZSA 4KK8C 4OGAD 3GXDA 5FC9A 4R8WH 5D5MB 3RJOA 3DWTA 1M7IA 1A6PA 3RVXD 1RJCA 3LKNB 1MUJB 3HC3L 2F61A 5DS1A 3UIZA 4GW5B 4ANUA 4BFBD 2XG5B 5EEUA 3HS8A 1OTSD 2AV1B 4P4KD 4PLJC 1XR8B 4L5FH 3ZDYF 3OD3A 4ZQTA 1TETH 4BQCA 3L3JA 3R1GL 1T2QH 3GJEA 2ZP8A 2XWJA 2AJSH 2QTEA 1NFIA 2FHFA 4BZ2H 3T0WA 4J28A 3VFVA 3MYJA 4M62L 5JNYB 3DTXB 3QQNA 4AVKA 3GMQA 1WA0X 5I0WA 5F9JA 3MV9B 3QIWD 5DEGA 1QSFB 4XX1G 2A4EA 3EDFA 3TJPA 1ZV2A 1I9IL 4R84A 2A74C 4Z0XA 5J57B 3WHXB 4R97C 2H45A 4MCYB 4ZJ9A 1OSYA 3TGXA 2HA1A 4QCIB 2C8NA 2Q7AA 3K5RA 3C75A 5EU6D 3RTQC 4QRSA 1WIOA 2GUOA 2NQCA 2WINB 4IEFB 4XNUL 1KTJA 1O7DC 3FQ2A 4G6KH 3A6CH 2J57A 3RVWD 2AABL 3KWVA 5HI4D 1TZGL 4FLHA 4JCMA 5HBBA 4UQ2B 4KJQC 5FYJD 5HHNB 4PRHD 1J8HA 1EX0A 5D5MF 2X1PA 5LB1A 3KWWB 1KB3A 4RMTA 5ANMB 5ESVA 1NZRA 5LVEA 5KJRL 2OTWB 1KCVH 3GQFA 4NPJA 1XGYL 2PPCA 4DP4X 5CR1A 1CXHA 2F54A 2ZONA 4RAHA 3TN0A 1G0YR 3IM1A 5INDA 4EI0A 3GMRA 5DHYA 3VCLB 3ATEA 2E27L 3K46A 1J8HE 2GITA 4P2YA 3S34L 4S2SB 1WAPA 5BO1L 4OVVA 2MOQA 3FL7A 5FDYA 3HAEB 2PYFB 4LQFH 2ZX7A 2BC4A 2NNAA 3V4VB 5D1XA 4PV8B 1N8OE 2F54E 1WG3A 1U8LA 3T0DA 3ZHNA 5CSGA 1YUKB 1FNHA 4GO6B 1I8IA 3EH3B 4Q7DA 4ZQKA 5DRXA 1FV1B 3CLFL 3QJXA 3NJLA 4PI0A 4IBYA 1FYHB 4OQTA 1F6FB 2FSEB 3B7TA 2XN9A 5D1XE 4TVSa 5JHLH 4XO5A 2VN7A 5EZOH 2OM5A 1KCBA 3TBCA 3KPSB 1KXHA 1XTMA 4OLWL 4H88H 5E8OB 2B1OA 4FJYA 2BH0A 3P3UA 3FCUB 1NGZB 4N90E 3VM7A 1F6AA 1HZKA 5D93B 2IWFA 1TSHA 2XN9E 4X5QA 4N0FB 3LRLA 1KJMA 3LEXB 3T71A 4IRJD 2CHNA 1G9ML 4X5PA 4PSPA 3SYCA 4EUPH 4L4VD 1RK1A 2VB5A 2YUXA 3FUDA 2VISB 3CZJA 1AKPA 2ADFL 3GJFK 1YEKH 1N5AB 3C87A 4GSXA 4X8JB 1UWXH 1KIUB 1HOCB 3BGMA 2MQ3A 4FG4A 2Z8RA 4FZEL 1ADQL 5CXPA 1DQVA 5E95B 3UH8A 1LWHA 3FAXA 3AVEA 2O30A 4YHOL 1N0LB 3P69A 2MWCA 3AG4B 4UM9A 1O6SB 2DEYX 3RU8H 5C9KA 1PGRB 4C47A 4NO0A 1RP8A 3PNRB 4BA8A 3SE6A 3S4SB 4ZPVA 5GGSA 3NIDE 3CD4A 3L4CA 4YVUA 4WI4A 3VE0A 3MCLL 3EJRA 3GMOB 1I4FB 1T7YA 2E5EA 4DKFL 4DEUA 4OM1H 4QNPF 4BFKA 5AAMC 2J20A 3ZKXC 2ENPA 2DYPA 3RGHA 4ZDHA 3V4LA 5DHMC 4DVRH 1N4XL 2VDMB 4XPAL 2V5SA 3S35H 1YYML 1S7RB 3S3SA 1MWAB 4AKOA 2Y06H 4HHAA 5T1MA 3ULVE 1DQQA 5GRVL 4UB0H 3F58L 4LF3B 1KJVA 3QEQA 4JKPH 4J3XA 3FDWA 3JWNC 1C5BL 2DICA 3FQWB 3K6IA 4HPOL 3WTXA 2ENYA 4G5ZL 2IPTL 3PWPA 4Q0XL 2EVFA 3DPDA 3EYSH 4KKRA 3FHQA 3I6SA 5C0BD 2CRIA 3L6FB 4QOKD 5C0EA 5IFJB 3CN3A 5CZVH 4NERA 2ALWA 2E9BA 5I1DA 1JK8B 5F1OB 2JIXB 3N55A 3QEQE 5FHAL 1AO7D 4NUGL 2IIJA 3VRLF 3ABGA 1HHKA 4B7IA 4HEPG 4U6HB 5C70A 1NINA 1NKRA 1U6AH 3PWPE 4F33A 2VR4A 3N43B 1QBMH 2X6MA 1QEWA 3DX2A 4N0YL 5H2BB 3UO1L 4JN1H 4AYBA 3DIVA 3LKQA 1J7VR 1A7OH 4JDVB 2WLMA 4N1CA 4QRTB 4YDVB 4YHMH 1E3FA 2ESVA 5AYQA 3DO3A 1XGTA 3FQRB 2RHEA 1ZSDA 3QISA 4B53A 2EKJA 4QHUB 3GSNL 3T65B 1E28A 3BGAA 4MJIA 1C12B 1F3RB 2ZCLH 1CZ8L 1GIGL 1M6UA 3QWRD 3KPMB 4NFBA 4E9YA 4XZUA 2ESVE 3P11H 2QVIA 3N85H 1CYXA 4JFED 4DN3H 4ZW6A 1WCBB 3VG0L 4KVNH 3DX0A 3ZT6A 1ZGLB 4G1MB 4PJFA 3O11B 4HKJB 4MJIE 5EU4B 4XMVA 3VNZA 1IBZA 3GSRA 5CUSL 3RY6A 4LCIH 4IU3B 2K9UA 3HC4L 4PJ7B 2WSPA 4XWGH 3AGVA 1ZCRA 5FM8A 3N41F 4CMHB 4WEUD 2O72A 1OANA 3BFWA 4PJFE 3TA3B 3HG1B 3DMMB 3PDOA 2YZ8A 3O6FC 2V2TB 1GR7A 5EC2B 1RZGB 5BVJA 5FGSA 4OZFB 2ZOLA 3ZUCA 4JFXA 3E7JA 4ZTOL 5ALCL 3MNVB 1MW2A 1FZJB 1PZ3A 1RVFH 3CFMA 3BP4A 2W88A 5IGXL 1Y6NR 1IQWH 3BESR 5B1JC 6TAAA 1CFTB 4LL4A 2EIKB 1II4E 3FU0A 1CK0L 2J1ZA 4NWTL 3CHQA 5E2VL 4F57H 1HYRC 2G3ZA 3A0OA 4GP4B 5DLML 2XZQL 1ES0A 1OTTD 4J4PC 2GYSA 5C0RH 1IGYB 2QT6A 1FL5A 2XKNA 1E6OL 4XVUC 3KPRA 4CSPA 4L2LA 3BHBB 1UT1A 5DVOA 1JPGA 3ISWA 2E6QA 5FYKH 3GLAA 4YC2C 1IBFA 3ZTDC 3GMMA 4PR5B 1AP2A 4U3XA 2P46B 1OARH 1D5BA 1G4RA 2AC0A 1EUTA 5DZ9A 1S7VA 1SQ2N 3LPFA 3BPLB 3EADA 1CS6A 3KPRE 5EBWA 4NIKB 2FO1A 4R5VA 3FT3B 1CFVH 4GOSA 4R4NC 4GW1A 1CLOH 3HI6H 5CEZH 3NSDA 2AJZB 4E9TA 1S9VB 5KYYB 2PYEA 4K8RD 2Y3NA 1X5LA 1HCFX 1Y1DA 3CDGA 3GI8L 4K5LA 2O93L 4QTIH 5L7XL 1CF1A 1YECL 3UACA 3QI9C 1KNOA 1WBZB 1HZLA 2R27A 1JGVL 4LXFA 2GSIB 1NAMA 2PYEE 4U7SA 4WDIB 4N1EA 3O3AB 1M9SA 1W0VA 2XQBL 5EORL 1ZWIB 2YGNA 4IBUA 1CXLA 1I7RB 4KI5F 1SBSH 2D3NA 3QG6A 3MLZL 4O2CA 4ODUB 4ABWA 3QG7H 1NGQH 3QCUL 2J8UB 3QUMH 3T0BA 3C8DA 4U1NA 4N22A 2A6IA 3V4VL 4X0NA 1PW3A 1PG7W 4Y0GA 1NDGB 1U8CA 3W38A 3MV9D 1QSFD 1U4FA 2A74B 1F4YL 1YSOA 4P4RB 4R97B 4FQ1H 4UQEA 5D9SB 1AQ8A 1N59B 4IRZH 2N1TE 4NO5B 1K8DB 2LFGA 4XC3H 1QR1B 3RTQB 2BFVL 2DQCH 2NRDA 2W80C 3NDYE 4XMWA 5HHOB 4W9FC 1TPXC 4V33A 3ALWA 3DA0A 3I74A 1ZDSA 1UH4A 5IOKA 1JCVA 4XPBL 3P9MA 2K4WA 3EO9L 3PCYA 2R51A 4K15A 2X53A 1FVDA 5I26A 4Q9QL 1QFUL 1UM4L 5F9AC 2B4CC 4U05A 1OD7A 1TOXA 5KW9H 1AGCA 2ZOTA 3MBEA 3QZMA 1BZOA 4MX7A 3ARYA 2HJLA 2VH5H 2CLVB 3RPBA 4ZX3A 1JPSH 1BM7A 3UC2A 1NBVH 3I3DA 1MHHA 3W9DA 3KLAB 4WO4C 2OXHB 1JV2B 3CSYB 2XNAB 4X7EC 3F12B 2DQFA 2J8UF 1T03L 3SN6N 4QXVA 4YR6B 2VM4A 1FORL 5F7DA 1E0OB 5FYLE 4Y2OA 5MHSE 3GI9L 3O3UN 1QSVA 2FD6L 5H35B 3LB6D 3VMNA 4E9XA 3UPCA 1XCQB 2AQRA 1BD2A 5F0LB 2AEPH 4CVXA 4M8QA 2YAPA 25C8H 2WZPA 4MA8H 1KPUB 2XICA 5LG1A 4TTGA 1ASOA 2Y07L 4KJPD 1UWYA 4HC1A 1MREH 3KPSD 5I1EL 3P3RA 5CSZA 5KOMC 2HVJA 4L8CB 2OCJA 1BD2E 2RCSH 4LPTA 4BHUA 1CVRA 5DU7A 4M6OH 5C08B 4AXWB 4LLQA 4H2CA 5BUAA 3B37A 4HOWA 3C6SA 4IKKA 5FFOA 2QZQA 1JZFA 2LV4A 3IMVA 2IC2A 5HGDA 1I8LA 3CCHB 2W0FA 3VFUA 3VRJB 3GMPA 4HS8H 1N6QL 2AJVH 1WYJA 1ZS2A 2IOIA 5DK2B 5JW4M 1PZCA 1Q4NX 5I73C 1TCRB 1UD2A 3OKMB 4L1HA 1N6UA 4MLIA 1S2EA 4K4KA 1VFAA 4X0KB 4POYA 4WJ5A 4P2AA 3RL2A 1FAIL 4BCZA 5CD5C 1C16A 1KOAA 4RZCA 1PZ5B 3S3DB 1IC4L 4QGYA 1SN0A 3VFTB 2V7HA 4PREA 2VDOH 3KXFA 1Y6MR 1DSWA 2VXSH 3ETSA 1D5IL 1PNDA 3O8XA 5T3ZD 4U1SB 4H1LB 3U30C 1AAJA 3FT2B 3KBPA 5GJTH 4ELMB 4XXWA 4PGEA 5I1KL 3WIFB 1QO3B 2DDQH 2RR3A 2ZOWA 5ILTL 1VIWA 1X5GA 1ZVNA 3L95A 1XMEB 3VFPA 3BSZA 4ORGA 1INEL 3KXFE 7PCYA 1XEUA 1SHMA 2G3NA 3CWGA 1UJTA 1AE6H 2YEZA 3IJSB 5JW5A 3KYKL 1Y7VA 3RFRA 4AK1A 3ZKXB 2A6DB 2H6UA 2OMTB 5GPRA 1P2CA 3KPPB 4KKBC 1M2VB 3KYAA 3T0XA 2V17H 2HPTA 4BH7B 3CHPA 3FRPB 3MRCB 4Y1AB 3ARDC 4PJHF 1A3LH 2Z1KA 1IBYA 4G8GA 3RVTD 5C09A 4M3JA 4LSVH 5T3XE 3F85A 5K5YA 1WBXB 1UUNA 2I9TB 3N04A 1E7VA 3QUZB 3GTTA 3BDXA 3MDJA 4N85A 1BZQK 2EEAA 1ZJAA 3NZHL 2WZ5A 1T4KA 1H3GA 3ESUF 2OMVB 5KVDE 1GZPA 2YGPA 1DL7H 4G8GE 5HHME 5C09E 3SE3C 4DZBA 2JIXD 4LQ1A 2E6PA 4GSDL 5F1IB 5E1AA 1NANI 3EJYC 2W65A 4KTEH 4G72B 2ZYHA 5LNEA 5AAPA 1KY6A 3N50A 4JRWA 3K72A 3SKJL 3MRDA 4L8SB 1JRHH 1T1YB 5IFHH 3F7KA 2R0WH 1BQ5A 4GKSB 3FPXA 4PS3A 3V6FA 5GZOA 5DJ8A 4NNYA 5FAAA 4FXKA 4UV7H 2FQFA 5JZ7D 2FWSA 2CCVA 5AOLA 1JJUA 2EDYA 1KFGA 3OKKB 4KK9D 2A5UA 3GMNA 4MCZB 1MIEH 4RGNE 3WEOA 1UCBH 4FQQB 1M7DB 3ARZA 4BSWB 3B5TA 5K33A 2VW4A 2YC1A 4X6EA 3CUPB 1WD8A 8FABA 1SXZA 4G9FA 2DWYA 4OV6F 3R7RA 4D3CH 1JN6A 1UGNA 4H0IA 4HJIA 4BFGA 5IWLC 1JPFB 5LBGA 2NX5B 1BG9A 4RAVA 3WNLA 1SMAA 4F7CB 2J88L 4ENED 1NC4A 1TVHA 1R34A 2C7UB 2TAAA 2VR6A 4HGWB 1OM3L 2NUPB 1RI8A 2H6OA 4G9FE 3MJ9H 5IW1A 5D72H 1AQDA 1CIDA 1OO2A 4L3FA 2HFEB 1YHPA 4QHLB 4XTRC 2XT1B 3O6FB 3TA3D 1MHPL 3HG1D 3QRGL 3MSPA 1QW9A 2EINB 3JWOL 1TZ8A 3DMMD 5JQ6H 3ZYJA 3AY4A 2X70B 1AYRA 3H54A 3MROA 1UOLA 2GK2A 3MCYA 4OI7A 2B59B 3BD3A 3C2AH 1SYVB 1H6UA 3N3EA 3Q8AA 4ZUVA 2FYYB 1FLRH 1MPAL 2IAMA 4HUUB 4S1SH 4YHZL 4KZ0A 1BAFH 3VB9A 2HKFL 4I48A 1Z5LB 2I5YH 4NN5C 4N2DA 4DGYL 3HPLB 1OSPL 4TLTA 2QGDA 3HS0A 4R7LA 1NCIA 4XMLL 3AXLA 2ED7A 1FFNA 2VN6A 4FKKA 3SCMA 1V5JA 2ZXAA 1BIIB 4S1QL 1GSKA 4YUEL 1MJUH 2FX7L 2PO6C 1HXYB 3Q9PA 4YC2B 3SQBB 3FO0L 3D4GA 4GUOA 4TTDD 2IXQB 1EGJA 3ILQC 4M1CC 4KJYB 4EI5A 5IROD 1BPVA 1I1FA 2IWEA 4NCDA 4CGUB 2OJEA 2K7QA 1NEZA 4FG0A 4FI7A 3PHSA 3IVKB 3UDWC 1GZQA 1Q72L 2BOCA 1SMOA 3COOA 1P1ZB 1S78C 3BYTA 3UEZA 4S10A 3MQIA 3T8XB 4F37K 1QRNA 1L7IL 3GIZL 3OKOA 3PF2A 4KK8D 2IMMA 5CJOH 4QTHA 2WZAA 2WLKA 6FABH 1UB6B 5AYTA 3QI9B 2B77A 4FYSA 5IW6B 5KSVB 2YD1A 4XNAA 5D2LA 2DMCA 1THCA 4BFOA 3RWHB 3T2OA 1YY8A 4Q52A 2K8MA 4JY4A 5EO9B 5CLTA 1GAFL 4PLJD 3KHQA 1QRNE 4N2IA 5EU7C 2FVNA 5IIEA 3ZTJH 4YAQB 2VLLA 4EBQL 3R0MA 2BNQB 2HWZL 4IIQA 4A7SA 2ZWLT 5A16B 3MKKA 4HCFA 5D2LE 4A6YA 2Z92B 1NFKA 3F5WB 4TXVB 5ADPL 3M1CA 5EUOA 1Z9SB 3PDDA 4YL9A 5I1LA 4UIKL 2BWIA 3DJRA 2BVUA 1NGWB 3TONA 3UMTA 4CBPA 3RTQD 1TPXB 1HWGB 5HHOD 1FE8L 1UACL 3LHAA 5D8JH 1I8MA 1SNRA 4ZK8A 1OCWH 1WV7T 4KQ0A 3MLRL 4ONFL 1V3LA 2R29H 4LBEB 1R3LB 2EDXA 2ZG2A 1ACXA 3QIUC 4KJQD 4U1LB 4WHTB 5EUOE 12E8H 4LSRL 2H4EA 3SOBH 2IDUA 1A9BA 4Q6IC 4FLSA 1VADA 1MVFA 3PG2A 3QC6X 4MBRA 4RBPK 2O6CA 3QXAA 4PYHA 4UF7C 1K4CB 4DP6X 3TO4C 4GIPD 1Q0XL 2YPLA 4WO4B 1YEHL 4AM0B 1S9XB 4AQZA 3NQIA 3WTUA 1SJMA 1GVIA 1WIUA 3CVHH 5F93C 4QEGA 1LE9A 3L4ZA 2FECI 5B7MA 2ICWI 3EYVA 3ZO9A 3ZDXF 2XWTB 4HJUA 4TNEA 1GGCH 1Q9LA 3X12B 1S5IH 1EEZA 4Y88A 3SIKA 1CU4H 2YPLE 2L3BA 1S3KL 5DVKA 2A83A 4JO3H 3P30L 1NPNA 5E6YA 3SDDA 1NCHA 1HHIA 1UB5A 4LCWB 1A5FH 3U9PH 2ZKWA 1AXSA 4HMCA 2D7QA 4JDTH 5SWSA 2CCLA 3HIZA 4ZO7A 3WFDH 4P3DB 4PB9H 3UTTA 4ETYA 3PAUA 3BH9B 3BDYH 4LT7A 4X6DA 4Z3TA 2WKLA 4OFYD 3WKQA 2G3MA 5SWSE 1WO2A 5EZLA 4N6RA 4OSUL 1NUNB 5C08D 3MRQA 4X4KA 3TCXA 3VXUA 1NEPA 1Z6JT 3CU1A 4GBXA 4LLMA 3K91A 3IBOA 3UTTE 3MCKA 2PR4H 4KAQL 1B6DA 3SBQA 4LNVA 3KPLB 4X6DE 1TJXA 2VZVA 4F37F 1MF2L 5ID1B 5I73B 2ZXGA 1EXUA 1AIFA 1N67A 2QLVB 3VXUE 4E0RB 3DURB 5C0AA 3MJWA 1ZT1A 3ARRA 1KACB 4HJJH 5JIIA 2BSDA 4Y9EA 3TEZA 4DHLA 2WHVA 4FNTA 5J1AA 2IBBA 3KYNB 3TXAA 2P7TA 3AQYA 1Y0LA 3U30B 2DQEL 2ED9A 3HUJB 1L9QA 5C0AE 5AAWC 2ZWNA 3WNPA 5JDSB 1BYNA 3O45B 4MMYA 3T6ZA 3VWJC 1TSRA 2XV6B 1WC7A 1Z5HA 3MN8A 3P4LA 5DJAA 5DFVC 5DSCA 3BW9A 1S7TA 2UVEA 2VTFA 3KE0A 4J3OG 5CZKA 3O6KH 3QNXA 4S0SD 4D8PA 3MODL 1DSFL 1CO1A 1FZOB 1D7CA 3M17B 2XG4A 4H8UA 1AZBA 1EEUA 2GK0B 1IEAA 3U4EA 3BXNA 3V0DA 1WE5A 5CJ5A 3N42F 1R19A 2R59A 1G6RB 1A0QH 4G7VL 3LKRB 1NPJA 3ARGA 4FFYL 3ARDB 1NFDA 4L3CA 5BJTB 4OKDA 4UOZA 4L9LC 5A2KH 4Y1AD 4BKSC 1BBDL 4A67A 4OQ1A 1EHNA 2ALAA 4QD2E 4UTBH 2J3SA 2R69A 3VYPA 3WKMH 3QIBC 2IF7A 5EA0H 3QEUB 3OG6B 2OL3H 3QUZD 4UTAL 3H0TB 1KEGH 1A66A 2WUCL 1NUFA 1NFDE 1PX4A 3LRKA 4GRLC 4ZAKA 2VR9A 4Y5VA 4G1EB 5DJCB 3HUJF 1HZHL 1N5YL 3IMTA 1RPKA 4WFED 4HKBA 1L0XA 1EIBA 1F2QA 3ZYZA 2IH1A 5KS9A 4N2NA 4U1IB 3LAFA 3SEPA 3O41A 3FULA 1A7PL 4LDEB 3DROA 3X3FL 3BKML 4LLVA 5MEPB 4Y4KA 2R1XB 3ZKMC 4NKDB 5JPMA 1KPRB 2O6DA 5IQMA 5KS9E 2SODB 1JZEA 5FGBC 4AC4A 1KYDA 2BHYA 5K1VA 4AYDC 5AOKA 3LXAA 2NLJA 3QARA 2ATKB 2AJUH 4RRPA 5FGRA 2E3VA 3MUJA 1CDJA 2G2PA 3UADA 1YEIL 2K4AA 3W39A 4MNHB 3WN6A 2NY7L 3V6ZB 1BXXA 4AENA 1OPOA 3GBLA 4KUZH 4FXGC 3MRGA 4IK6A 4O9HL 1XSIA 5K39B 1JNNL 5IB3A 3EYQC 5JR1H 2ADGA 1D6VL 3L1GA 1FFTB 1YPZA 4ZPTA 2NX5D 5D7JA 1QUNA 2CIKA 5L2KA 1R5VA 1FRGL 5FA4A 4L29B 1I7TA 4I4WB 2VJ8A 3ZYIA 2APTA 2LE9A 3KAAA 1YC8A 1IFRA 3WFEL 4QO1B 1I1AA 4NQDB 2R83A 5DHVA 3IN2A 3SDCA 3WJJA 4JHAL 4APQC 2ADJB 1LEIB 4OZHA 3O9WC 3ZTJG 1YPZE 3ARSA 1BQUA 5L2KE 1PL3A 4XBGB 2GBUA 1G7QB 2X4OB 2H6PB 3V4UH 4MDRA 2AK4B 3O6FD 4PBWD 5AW4B 1RMFH 1W16A 4V1DA 1BLIA 3AACA 4OZHE 4JHWL 3IDYC 1SJXA 3E6FA 4JPKL 1CBVL 3P4MB 4XNMB 4EZLA 4XBPB 1KTLB 1J5OL 1RUMH 1TZHB 3OKDA 3ZLQC 3IDUA 2XACC 3TP4A 4DVBB 5IB4A 2BSEA 3EYFA 3MAWA 4RX4A 4G83A 5E1HB 4V1DE 3MLSL 4NN5B 1NGPH 1UWGL 3BUIA 3OAZH 4Y2DA 4AYFB 5LQBH 5CILH 3OM3B 4R7NA 4J4PD 5HYQB 3JV4A 4MD4A 4FFTA 4HUMB 1IAIH 2YRZA 1K8IB 4XVUD 2FX8L 1OAUL 1TF4A 1DZBA 5ESQB 2PO6B 4HK3N 4M7JH 4UCFA 4X98A 1T0NB 4ESKA 4HIJB 4JJOA 3TO2A 1CG9A 4X80H 1P7QB 4H0GA 1H3XA 1G84A 1GYWA 4Y9FA 3IF1B 1MFCH 4HZLA 4R4ND 2G75A 4L3AA 5KOVC 4F7PA 1DN2A 3L5WA 3Q6FB 3EOTL 2ZJSH 4BELD 4EKJA 4A38A 2W95A 1DTUA 1QFWH 2IAAC 5LNDA 1KYOJ 3OXRA 4PG9A 3EGXA 5TF1L 3X1EA 3X17A 2D7TL 3Q3GA 2B4CL 3QI9D 2V33A 1B0GA 1JYWA 2F7RA 2CMRH 4TPRL 5F8RC 4ZTPL 4P9HC 2VXVL 4LSQL 4K5NA 1VGEH 4F93B 2Y1AA 3CXHJ 3HKZA 3KH3A 2N56A 3LSOA 5A6IA 4XN9A 3UJIH 2EZ0C 1SY6H 2CDFB 1CE6A 2BNQD 4XT1C 5F9WC 1NWPA 2Y25A 2ZXWB 3S88L 5I1AA 2R7EB 2N4IA 2R2HB 1E90A 3VI4B 4WFFD 1PKOA 4P57A 3BVVA 1PX8A 4NQVA 5KVGH 3IPFA 4ZTEA 1QATA 2Y23A 1X5KA 3MLUL 4Q74A 2BP0B 2YGQA 2VDKB 4N8CH 3O3EA 3KCPA 4WWID 3FQ4A 3L3HA 3PHOB 4O58H 3QIUB 5GZNA 1XB8A 1KULA 4IOIB 4MQTB 4WY7L 3TV3H 2YJQA 4R0LC 1ID5I 1NCOA 1PDKB 3DBXA 1DVZA 4FTDA 4Q6IB 1SDDB 3IN0A 3MR9B 4KKAC 4Z18A 1DJZA 3F65A 3M86A 3VFNA 3O6ML 1GTNA 1QACA 3TO4B 3NP4A 3NJJA 1JNLH 1QNIA 2VL5A 1FYTA 3IFNH 3L9EA 1I7UB 3RUGB 4D0BB 3N1QC 1AGBA 2FO4A 4X4XB 5FYJH 4WO4D 2H8PA 4F91B 1SJHB 4FJZA 3ROLB 5E6SB 1EDQA 4PJCB 2PPAA 4DCQB 3U7WL 4OLXL 3HC3H 3UPAA 1FYTE 4UIMB 3VI4F 2RMNA 2V3FA 1ODAA 3BIAX 4W4OA 4JO2L 1F3JB 5E23A 3UBXB 3R1GH 3ARBA 4LCWD 4IIZA 43CAA 3ZO0A 3SDAA 2BVPB 2JB6B 4FA6A 3TEYA 4DP8X 1BFOA 1P4UA 2JJSA 1GKEA 4KKPA 2FAUA 2Z93A 4JFWA 4DFIA 5C9JB 3WMSA 2BVQB 1GJUA 3L9RB 5CLYA 5K1NA 5AB0A 2P43B 2N7AA 4BZ2A 1R6VA 4BFIB 1QWHA 3T09A 4WI0A 2FO8A 4YDLC 3BH8A 4DP0X 5DJZB 1DJYA 2CZNA 4CC4A 4CU8A 4IHOB 1G43A 3T3PF 2D03L 2BJML 3RUGF 2LLLA 1UXSA 1X5YA 1BA9A 3B6SB 3OJVC 2KBGA 1TZGH 2R15A 3FOLB 4JNXA 2UZIL 3F7YA 1HSAA 2R0LL 5IMLA 1BZ7B 4PJCF 1JPTL 1NEZG 4ZMZA 5C2UB 5C92A 5KEZA 3FB6A 1GGYA 4ZSOB 5KJRH 3LQAH 3PWLB 3EFOA 1XGYH 3ECVA 1EXHA 3G5XA 5I8KL 4NUPA 5CD5D 4QYOB 1S7WA 1TTCA 4Z7OF 1SVBA 4AG4L 4GB9A 2GEEA 3RLSA 1I9JL 3S34H 5BO1H 2ZICA 4MDJB 1D5XA 3BRFA 1P6WA 4CU7A 3T4YA 5ADOL 5DJ6A 5JPNC 3VWJB 4F1ZA 4JDZA 4MA1C 4PY8I 3UEQA 4LHJB 4PG2A 5TE7L 5GGQL 3LNGA 3ATBA 5D1ZA 3IJ9A 2GVYA 3CLFH 4QRAA 4OH2A 5EO0A 2DH3A 1SEQL 3QNZB 1CPUA 3BEWB 5BVPL 1P6AB 3GZOA 3QT2A 1INQB 1TQTA 5AW7B 1WHPA 5SWQB 1U36A 4KKBD 4EVNA 2YD7A 4QRFA 2KQMA 4OLWH 4L9LB 2DMGA 5FKAA 3ARDD 3ORJA 1D2PA 4PWGA 2A4ZA 4U1HB 3MRLA 5IFAL 2BDNL 2HPOA 2ZUQC 4PJDA 4LLUB 3QIBB 4AGNA 3NH7L 3VU1A 5DT1L 1G9MH 1AS7A 4HIHA 1MIML 4NZRL 4CBZA 5KVEL 4GRLB 1N19A 4KK5C 1TYJA 1MFVA 4NHUB 5J56B 3QCTL 4YOKA 2ADFH 2F5AL 3MX0B 3Q05A 4MGXA 1RU9L 4PJDE 4NX0A 3V95A 1NLDL 1GOFA 1Q94B 3EJYD 1TQSA 4ALAH 3CHXA 3QNFA 3RKDC 1BGXL 5EG6C 1T83C 4HISA 3KEHA 1ADQH 2ZNWA 1T3FB 3AUVA 3BSHA 3KEDA 2WVSA 3LNDA 4FZEH 4LEOB 3WFHA 3OWEA 2N0MA 5FOJA 5ERWA 4H8HA 4YHOH 1EO8L 5E6IA 2OX5B 3GYRA 4X6BA 3TIEA 2AK1L 1G94A 2YJLA 4DGUA 2XZCL 2HRLA 2VQ1B 3JXAA 1QWNA 2J8OA 3WJMB 5ANHA 4W9JC 3TVMA 4O2FB 3MCLH 5IMOA 1GGBL 2PW2A 4FXGB 4DKFH 4EN3C 3QZNA 4YDJB 4KC3B 1FNSL 5HJ3A 3WDIA 2MTPA 4OCSL 2QTVA 3WOVA 4CMMB 2OMXB 1N4XH 4XPAH 2OR8A 2G2NA 1G7JB 1YYMH 3II3A 4PGDA 3RWEA 2XXGA 1I9EA 3IDJB 2ZSVA 3AG2B 5AD0A 4WHYH 2H2PC 5GS3A 3F58H 4APQB 4GRWE 4XCEA 4NQDD 1C5BH 3MUGA 4HPOH 5JORB 3O9WB 4N2LA 1SOXA 4G5ZH 2IPTH 5AKVA 3IFOB 3Q1SL 4Q0XH 4W93A 5HVGB 4GUQA 1UASA 1Z9LA 3MLVL 1QG3A 3O2DA 4XTRD 1VZIA 4EEEA 4PMEA 4L1SA 4XMZA 5T1KA 4P59L 1DJHA 2OXGB 2APBA 2ED6A 3UOAB 1S5HA 2AK4D 2DEWX 5AKSA 2CBMA 3Q06A 5EF0A 1LP9B 4NUGH 2X3BA 2XJLA 2Y0SA 3FSOA 4L1BA 2WXJA 1CQKA 1A4KA 3V9CA 4NXSA 3QYNA 1F4XL 1GHFL 1A7BA 5E4AA 1NCDH 2KZBA 4L4TA 4N0YH 1J0JA 3F6IA 4I3GA 2AXFB 3UO1H 3NMEA 2HLFC 4YGVB 4OJDH 3TYGL 4CADB 3GRGA 3UYOD 1AHWA 2Z6FA 2OSLB 3GLZA 5E1IA 4XXCA 4AYGA 3X11B 4OLYL 4L4TE 1ZLUH 4DZ8B 2OYLA 3GSNH 4LSTL 1FVEB 2IH3A 5F8QC 4CW1B 1JV5A 4UOJA 2PO6D 1CZ8H 1GIGH 1MCDA 4KQ4H 2MTAA 3Q6GL 4TOYL 4BFNA 2VAAB 4I7ZC 3ZZLA 4MB4A 3VG0H 1KPVB 3ILQD 4M1CD 4NFDA 1P7QD 2Y36L 5GGTA 5HDWA 2APXA 5B7FA 3SKNA 4KRMB 4ONHB 2YR3A 4UT7H 1YA5A 1LP9F 4Z95L 5E8NB 4HFWA 1T7WA 2YSSB 5GS0C 1MCEA 1RUAL 1VA9A 3HC4H 4OCWL 1KUMA 2CR6A 1FGNL 1S78D 5IKCB 3WIIL 2VLJA 3NABL 1DUZA 1Q1PA 4XP4L 1LWJA 5SX5H 3J2PA 5BV7H 1VSCA 4PRBA 1NDTA 2CBOA 2CKBB 5KYUB 4FP8L 3OKYA 3O0RL 4P46A 1YNTF 4C4UA 3DX7B 3LRGA 4HDIA 4IMKA 3EJJX 3MRMB 4XE5B 1L9PA 4ZTOH 3RIAF 3BLBA 3ECBB 4IU2B 5ALCH 5FUCC 3AXIA 3QZOA 2VLJE 2HRPL 2GW5A 2BVTA 5IGXH 1MI5B 1OLZA 4NB7A 3BE1L 1GYVA 2W07B 4GXUM 4OF7A 1FH5L 3QUXC 2CKNA 5FM5O 5F9WB 3QO0B 2FSDA 4P3WA 4ZS6C 3WS6C 1CK0H 4NWTH 3QRFM 5FV2A 1TR7A 3ZRSA 2H32B 4PJGF 5E2VH 1R46A 3FONA 3THML 4LE8A 3V9FA 2PP8A 1ZT7A 1BVKA 5DLMH 3RVVC 3U36B 1QTPA 2CHWA 5F71A 1ZLWK 2YRPA 3D39B 4RQQB 4BDVA 3BIKB 1IGML 2NYYC 4UU9B 1E6OH 4RRPG 3A4DA 1G1CA 3OGCA 5I0DA 2FEEI 3KR3L 1OSZA 4XPTL 1KBWA 4TMPA 3MRBA 2DF3A 3TEUA 1PTZA 3V10A 4X9YA 4NGHL 5AFAA 1I3GL 4CN1A 2VLMD 2XSKA 1FNEB 1IGTB 4Y5YA 5F3HA 3JBG7 2DLGA 4OJFL 3QIUD 4R0LB 3ZZSA 3F83A 2AQSA 1L9TA 1NPUA 4UQDA 4K0OA 1P5VA 3I6LD 4P23A 1DQJB 1R24B 4LHUB 2UY6A 5DFAA 4FKHA 3SY0B 3ZMRA 5I76A 3EH5B 4AUUA 3NTCL 3RG1C 4G8AC 1UZ8B 3TO4D 3CC1A 3CH1B 5CEYA 1J05A 5EULV 1U58A 2E0PA 1H6EA 1HH9B 2OZNA 5IW3A 3GI8H 2ZQKA 3CFEB 2G60H 4POUB 5CGYC 5AVYB 3G5ZA 4ZG1A 5L7XH 3B9KA 3AMLA 2CK0L 4JW3A 4TRPL 3TBSA 1EAQA 1I9RL 5TE4L 4X4YA 2JKRM 1JWMB 2JCWA 3R06B 3GFUA 4JM2A 4GI8A 3WIHL 2MJWA 4HZ1A 1E8WA 4NC1E 2XQBH 5DTFA 1AQKL 4XNQA 5EORH 4HH9A 1FAKT 1BECA 2A9DA 2BM3A 1EAPA 5CMAB 4UOQA 2VKXA 2A73B 5CEXB 5AVXB 1FN4B 1MCBA 2DWEB 3DJSA 3QCUH 5IV2A 3HAEH 4UQBA 1EDHA 1J5DA 4LDLB 5T5FA 3V4VH 1HL4A 3WDHA 1AD9A 4JLRA 4OTXL 1AGEB 3N40P 4P0DA 2YBGA 1ZGLM 2DJ4A 2IH8A 1IKOP 4QUOA 4YDLB 2X2IA 2XIDA 2YOCA 2BFVH 1WT5A