4OZIE

S2 protein complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
202
structure length
199
Chain Sequence
KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGDGGSFSGGYNKLIFGAGTRLAVHPYIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 199
sequence length 202
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziE02
3MJ8B 4PV9A 4XX1G 5HYQB 5DF0A 2DBLL 4HS8H 5IM7A 5JPNB 1A6UL 1F8TL 1AKJB 5GRZA 4NZUH 4D9LH 1C5DB 1KXVC 4XNXL 5IR1B 3DYPA 4P2OD 5EH1A 3V4PH 5KSVB 4YFLI 4M9OA 3H2WA 3VXRB 4K7PY 4EDWH 1FFPA 1A1OB 3TA3B 5C0GB 1LP9F 1KLGB 5TGBB 1WC7A 5DFVD 4JY5L 1UZ6F 2NXYB 3C08H 4NQEA 4ERSL 3BSZL 1NGPL 4GSDL 1GGCL 4UT6H 1N3NB 1JHTA 2PXYC 4WU7A 2WLYA 3ZHKA 3RZCD 1OCWL 2IGFH 5EZOL 3PABB 5D9SA 3QUYC 1YDPB 1X9QA 4P4KA 5MI0B 5EZIL 1UA6L 1F4AA 3ARFB 4XAKE 1EO8H 1KGCE 3O8XC 3S3PA 2H2SC 5E94A 1TVDA 4NQDD 4W6WB 1QRND 4KI5C 1IGTB 1CLYL 1R24B 5EORH 1MFAH 5H94B 1IGJA 4WEBL 4XNMB 3BFOA 1NC2B 3CX5J 2BVTA 2EDFA 5JUEL 1DN2A 3GMNA 3MNVA 1GZQA 4OCSH 4YFDB 2KBGA 4ENEC 3L5XH 5FGSA 5K9QI 1B4RA 1HHGA 2W9EH 5C0CD 4Y2DC 2J5LB 1INDH 4YXLL 5JNYB 1XF2B 1MCHA 4FTVD 3SCMB 4RZCA 2HKFL 2QL1A 2Y06L 4NDMB 3FRPA 3HKFA 2WWKO 1T3FA 4KQ3L 4LHQB 3FONA 3HG1A 4EN3D 3CFDB 1NC4B 2COQA 5MP6H 3DRQA 4FFVC 3VFMB 4YHPA 1QFOA 2VLRA 4I3RH 2MTPA 1IZKA 2LVCA 4FFZL 4LQFL 5C2BL 5FCUH 4OFDA 2WIIA 3RNKA 2OI9C 1MJJA 4Z6AT 1S9YA 3EO0A 3K0WA 4L5FL 2AJXL 3E2HC 4JHZA 5J06A 2E5EA 4M8QA 3DRTB 4PG9B 1HWGB 3PIQA 4ZS7H 1M7DA 4JN1L 4QHMB 2WAHA 4JRXD 4X83A 3V5HA 2FEDD 4NNPL 4QHKJ 2ZSWA 3D0VB 1KXTB 4M3JA 4XNZB 4Z7OF 1ZT1B 2VDNL 3FQNA 3BPOC 4J3XA 1HN1A 4LPCA 5K9OA 4OCYL 1PZUB 4KROD 5D1ZD 5E8DH 1P7KA 1ZA6B 4HW6A 5D2NC 4Z78A 4XC1H 3RRQA 4N0UE 3GGWA 4NO2A 5FGCE 2G75A 5KS9E 3PGFH 1FJ1B 4X98A 4JFEA 5EWIL 1VENA 1QFPA 1UWGL 5MEQA 2R1YB 3VRJA 4KKLC 4UTBH 1V3KA 1KIQA 5I66B 2JJVA 5FB8B 1IM3B 3I6LD 1I8IB 3RY5A 4GG6F 3EO9L 3CFBB 3BZFB 2VDML 4OLEA 1HQRB 1HH6B 2BSRA 3VXQA 3I6GA 3HLAB 4MAUL 5IESH 3HI6L 1DBMH 1UB5B 2EC8A 3MUGB 3ROOA 1BIHA 2FX7H 2IC2A 4AH2B 3E3QE 1XF5B 1RMFL 3T3PE 3UTSB 3NA4A 2R15A 4S1DC 4U33A 3S96B 3DETD 1CE6A 4GS7B 1AO7E 3KPRD 4ZO7A 2RB8A 5E2VH 3GM8A 3VE0A 4X5WA 1QNZH 5EBWA 4G43A 3CFIC 3G5YA 2BCKA 1RZ7H 5BO1L 2X40A 5E03A 5ESQA 5TQ0H 3AMLA 4I4WA 3EZ8A 3BYTA 1ZA3A 2YZ1A 2DTML 1F6AB 4NWTH 3GO1H 3FTGA 2GTWB 3MLSL 5DJ2A 4FFYH 3H9SE 1CD9B 2MKWA 4YHKH 5LAXB 3BKJH 1OAQH 4H1LA 2JJTC 4HBCL 3QULB 4XPHH 5ENWB 3SDDA 2FX8L 3ZT6A 5D1XB 4Q6IB 4NN5C 2CRZA 3RX8A 3P11H 4F37K 35C8H 3GMOB 4Q9RL 3U83A 1U8KB 4PTUB 4TNWK 2A6IA 1RVFH 2ATPB 1IKFL 4P2QA 1QVOB 4DCQB 4WO4C 2VXQH 1MCSA 3TYFA 1NANI 1II4E 2VDPL 4HUWA 4S0SD 3JV0A 3RGVC 1DUYB 4OUOA 1YNKH 1BFOB 5I17B 1YEGH 2D7TH 2FECL 5FUOH 4ELKA 3REWB 5EPMB 1FL3A 4LVOC 3RVUC 2R56H 4OCXL 5GRVL 2DMKA 1Y0LB 3ARUA 4MCZA 2E3VA 3O45B 4RQQB 3NACL 3PWPB 4JAMA 1A2YA 1ZLVH 4LCIL 1NUFA 2FR4B 2W60A 4YH6A 1WFOA 4PJBB 3CDGB 2JF1A 1E28A 4J12A 3VGGA 3G9VA 3QAZC 1E4XI 5L2KA 3H0TB 4KAQH 5ABDE 2XPGB 3C8DA 1T03H 2P42B 1I1AB 1QFWI 5D4QA 3SE3A 3SDYH 5HDOA 5GGUB 3V6ZB 1KIPA 3P0VL 1KNOB 1ACZA 1EMTL 5D5MA 3MV11 4X8XA 1MCNA 2BHUA 1A3LL 4XVUD 3VG0H 2C3HA 2P1YA 2DWEB 2X4TB 2AGJH 5I30H 1FNLA 2AJSL 5I1KH 3LS4L 2CPCA 2BNRA 4LLYA 3BD5A 3MLUH 4HFUH 2FEEI 4J1UB 3IF1A 5DHVB 2HFEA 1CTOA 1MCBA 5DMIL 4KZEH 1IBGL 1ONQA 1BJ1J 4M62L 4O4YL 4PB0L 1FFNA 1T1WA 5FOBB 4QGYA 2BHZA 5IF0B 4R97C 5E8NB 1M05A 1SBSL 3B43A 4LSTL 2XTJC 4WHYH 5H35B 4YHOH 1NKRA 5CGYD 2R1WA 4YWGH 1LEIA 4E5XA 3OSKA 4G8IB 1A1MB 2W65A 4HIXH 3VXSB 1IAOB 5FUZL 5E9DE 3MGTA 1OT1A 1S9VA 2IAMC 5IMKA 2HWZL 4APQB 4BSWA 4ZFFA 2APWA 5EIVA 3SGKC 4U6HB 2NY7H 2J88L 4OIBA 4PV8B 1HKLL 2BC4A 4PLKD 1DP0A 4UV4H 4XVSL 4ZUTA 4DKEH 1Z2KA 2J1KA 4OF8A 5DR5L 5E2WL 5FM8A 4QRRA 4X9GA 3O9WD 3BN9C 2HAZA 3H3PH 4XPFH 2C7UA 1DN0A 5I1HH 4UZGA 4WHTB 4QHUB 1WTLA 5I71B 1AFVH 1ETZB 5GJSH 1JCKA 3WS3A 5I8CA 3HAEA 3IU3A 4PLJC 4R4BB 1P69B 1J88A 4HG4J 5IB3B 3HMXH 4IRSA 3WXVH 3C5ZD 3DVNA 1EK3A 4NHUB 1JMZA 4X6CB 1FNSL 1KLUB 2EYRB 3HUJB 5HDLA 5D93B 2KH2B 4WI8A 2AS5M 1LGVA 4Z9KB 5D71L 4D0BA 3MV9E 5DZNA 3KAAA 2RCSL 1MREL 3BAEH 4N0FA 1QFWL 1S5IH 3EYOB 3TCLA 3MRLA 3Q5OA 3B9KC 2RJMA 3QIUB 2EIZB 4K3GA 4TOYL 1A7NH 2GITA 1VADB 3M1BB 4ZFGH 5I1GH 3AU1A 3VXOA 3KPPB 1UM4H 4OLWL 1S7VA 1A9BA 4NM4H 5ISZD 3VD4A 2Y1VA 5B4MC 4F7EB 2E7LA 3RWHA 5DDHA 3UJJH 3GMMB 2FEEL 4O9HH 2BXZA 3KPQA 4JHBA 3DO3A 5DTFA 2ADIA 3KPOB 1UJTA 4Y88A 1BWMA 3Q3GA 3WFCH 4XH2A 4C56B 1FZMB 5C2UB 1L0XA 1I9JL 2C9AA 1RU9L 5C0DA 1OP5K 4NN6B 4OZGB 1Z3GH 2DL9A 5DMKB 3RDTB 2YD9A 3MXWL 2VN7A 4P9HH 2UZIH 3FL7A 3IAQA 3WKMH 4OQTL 4TULL 1VKXA 3EYUL 3P4LA 1NDGB 1HDMB 3KXFA 4M7JH 4LF3A 2MKLC 4DGVH 4OGAC 2JCCB 3HE7C 3VFRA 1QOKA 2DQCH 5KTEL 4YHLH 4YO0B 1JPFA 5FYJE 4LHUA 3HFMH 2N7BA 3CFKB 5LG1A 1DUZB 1NCCH 4AMKL 2IH3B 3MC0A 4C4KO 1LEKA 2P45B 1X44A 5C09A 1RFDH 4HZLA 2QTEA 2KQNA 5SWSD 3BKYL 4JGMA 3VFVA 5CMAA 1T20A 3K2UL 5F89B 1HIML 4PD4K 2BFVL 3KPLB 3WFDL 1T5XA 3T1WA 4OV5A 4JFPB 5I74B 3QO0A 3PGDB 1HNFA 1LE5B 3BT2H 5BVPL 3SQBA 4QHNB 2F54A 1HXYA 5F1KC 3PWLB 4QRPE 1WJ3A 4BFIB 4MZ2A 4JGUA 3QUXD 1DR9A 4UT9H 5EC2A 1GOGA 5JR1H 5CILH 5I1DA 4X6DE 5CKGA 1VPOL 5AG8A 3KYOB 2B1AL 5BQ7A 3CFCL 1T6WA 3Q6GL 1P84K 4RGOL 3GMPA 1K4CB 1HK6A 3T09A 4GXUN 3ZKXB 2ZP0T 1Z5LA 2ICWA 5HYSA 3ARXA 4LU5H 4HJJH 4XGZB 2VRAA 3F7PC 1JGEB 5CP3A 2W9DH 4QRTA 3RVTC 2R0WH 2R0KL 1ZHKA 1TJIH 2H45A 3W39A 4LCYA 3AFLA 1AGCA 2C1OB 4N0RA 4FZ8H 1XGQA 4IRZH 4RCAA 2V5MA 1EZVY 3UJIL 2M1KA 3G5XA 4RDQG 1MI5B 4AENB 1GJIA 4FOMA 4N0CC 4I0PA 3PWJB 2P5EA 1LDPL 3EJYC 3DX8A 4GW4A 2XWBB 5TDNA 3SE9L 2NY6C 4CMHC 1U8IA 5J6HA 4MA3B 4OCWH 4PGEA 1PG7H 4GUPA 4L3EB 5T1KB 4UQ2B 3CZJA 2WWKT 3LKPA 4QTHA 1DSFH 3GUTB 3LQAH 2CK2A 2VR4A 1MWAH 1SVCP 1B9ZA 2QKIA 5E6IB 5J89A 4PRIE 4PJCE 25C8H 5IFAL 3WNMA 2XQBL 1AI1L 3AY4C 1A9EB 4NOBA 3ABZA 4ZUVB 4HIIB 5CINH 1CIDA 1XGTA 2F53A 4I18C 4LDEB 5DD1L 3RI5K 2B1HL 4YDLC 2NTFB 5F7KC 4N90D 2AQ2A 3TVMB 2J8UB 3TJEL 4DQOH 3MZGB 3N9GL 5TF0A 2R2CA 3C5SA 4LMQI 1KT2B 4AY0A 1CFBA 3K7UA 1J8HD 1I7RA 2AK4B 1CS6A 1JRHI 4IRJC 2VDQH 2VSCA 4S11A 3MV8E 1FRGH 2G5BB 1CDGA 4TSCH 3JV4B 3VFOA 1P4IH 3E8UH 2FGZA 5F6HI 3TIDB 4DKDC 2AI0H 5CP7A 3IXTB 1X5YA 3CPLA 5CIPA 3C8HA 2DI9A 4PG2A 3GSWA 1CGUA 2XZAH 3KGRA 1ZGLB 1AHWA 4HH8A 1NBZB 3WIFA 1A22B 4S1QH 3QXUA 4NKMB 1WITA 3MJ9H 1QSED 1A21A 5T1MB 4G80B 1X5KA 5M7QA 4XMLL 1Q38A 1A3RL 2GTZA 3RL2A 4M7ZC 2NZIA 3RPIA 4PJ5B 1GC1L 1RUML 1SJEB 3T3MF 3QXWA 3P4NB 1VFAB 1V5JA 4U05A 3C09C 5D96C 3CVHA 1JNNL 2D0FA 4PJXA 4JGJA 3MTRA 3U1SH 1DFBL 4OLUL 3ZDXE 4YHZL 2DMBA 5J3HD 5D7SH 1MHPH 3BXNA 3LKQA 3EYSL 5E5RB 1H3XA 3JVGC 4G9DB 4QXTB 3Q1SH 4EI5A 3CH1B 2XFXB 3P30L 4K7FA 4XXDB 3DMMB 1S7QA 2ORBL 4Z5RA 1G9EA 4LAQH 2SEBA 3HZYA 2QQNL 3U82B 1G7PB 3VJ6B 3F5WB 2I5YH 3FO0H 3ARYA 4S2SA 4GRWF 1DQMH 1G7MB 3WIHH 1NMBL 2W0FB 4OFKA 5HPMB 3U2SB 4V2CB 4PV9B 2DQJH 5IM7B 4X9IA 2VITA 2HTLC 3AVEA 4Y4KA 1Y6MR 3WO3B 1JL8A 4WUUE 4OD1L 2ESVE 2NYYD 4M1CC 4JKLA 3V95A 3BUYB 1OLLA 2NW2A 1OP3H 3B4NA 3C2AH 2YEZA 4QWWD 1WLHA 3D2UD 1IC7H 4XZUA 1CL7I 3TBVA 4NQEB 4H8WC 2AQ1A 1JHTB 2ZNWA 2CQVA 4OKVA 4WU7B 3KJ6H 4KK5D 5E5UB 1BFTA 1P9MA 3DUUA 4DKFL 2YUVA 6FABH 4NNXA 1MY7A 1BX2A 2K3TA 5D9SB 1IRAY 3TJHC 1MFCL 4P4KB 4OT1H 3W0WD 4NC0B 2EKSA 3SDDC 2XV6B 4Y19D 3GSXA 1IEAA 4HX1B 2JIXA 5FYKL 1S8DA 1K2DA 5E94B 3QNYA 3I3EA 3O2VH 4KQ4L 5TDOA 4EKXA 1FV1A 4GMSH 3FN9A 3V5DB 4BUHA 3CC5A 1IGJB 3T0EE 2ICWJ 5I1EL 3MRRA 3V8CA 3R8BB 1GZQB 3SBWA 1CE1H 5HHME 1XR8A 3TN0A 1HHGB 1F97A 3A6BH 5CD3A 1UENA 1JE6A 4QRSB 4FQJL 1K3ZA 5EG6C 4RZCB 2PKDA 3BGFB 1Y18A 4LAJH 2VLJE 4AEEA 1T3FB 2PCPA 3W9EA 3FONB 1CFSA 3TBTA 3HG1B 4JHWL 3VG9B 5IMOA 3DRQB 3HC4H 3MA7A 4YHPB 5C0EA 4P5MA 3ZTJH 1F2QA 2VLRB 2APFA 3D9AL 4ELMF 1T2QH 1AXTL 1G0YR 3CVIL 1UM5L 3N85L 3G6DH 2C5DC 2Y6SD 3SO3B 3RNKB 4ORZC 5F70A 1MJJB 1CI5A 1S9YB 5T3ZL 3RTQD 1CLOL 3EO0B 3VMOA 4LLUA 1BECA 1C8PA 5I6XC 2OK0L 3QA3A 4M8QB 2ID5A 3QDJD 2YS4A 1M7XA 1M7DB 5E2UH 2PXYD 2NMSA 4BKLA 2OMBA 1KG0A 3V5HB 5F9WB 4N0UA 4LLWA 3GZKA 2EYTA 2Y07H 2ZSWB 5KS9A 3S8WA 3HMWL 3MV7E 5L9DH 4LVNB 1HHKA 1FG2A 5K9OB 1P1ZA 2NX5E 3OAUH 3O8XD 4H5SA 2H2SD 1P7KB 1JZ4A 3HI5L 4Z78B 4KI5D 2BY1A 3GGWB 4NO2B 2R0LH 5K9QG 2G75B 4WW1A 1WWBX 2ZKHL 4X98B 4HEPG 4JFEB 3PHSA 5MEQB 4HS6A 3RWGA 2V7NA 1KIQB 4ENED 3I2CH 4GW1A 2Z31A 3FN0L 5JTWA 4OB5H 4Y2DD 2O5ZL 4HWEL 1U92B 1C08A 5DEGA 1MRCH 1J0KA 2BSRB 3VXQB 2X05A 3I6GB 4ZAKC 1E27A 1A5FH 3ROOB 5EOQH 1NMAH 7FABH 4POYA 1N5YH 2FH6A 3H7LA 3ZLQC 2ENSA 2WWMC 1EGJH 4DFIA 3WFEL 1CE6B 4X7CC 3T0DA 2A2QT 5GRYA 4LP4A 4M4PA 4LPXA 3I9GL 1G7HA 1REIA 4NQDE 2FIKA 3VE0B 1LDSA 5EBWB 4HFWA 1DZBA 3LS5L 4G43B 3MCKA 3G5YB 3GK8L 2BCKB 5ESQB 3MLVL 1E6OH 3OJVC 5TQ2L 2BVYA 5JW3H 3BN3B 1RI8A 1JN6A 4I4WB 1X4XA 3QJFB 1ZA3B 5C0CE 1F90H 1OAXH 3FTGB 4FTVE 2FWOA 1U8PA 4NWUH 3O6KH 5EO1A 1Q0YH 2VXVH 4EDWL 3QFDB 1ACYL 5FECB 3DO7A 4H1LB 5F7HA 1NL0L 1AGBA 1LILA 2Z93A 4ONGH 4F9PA 2XKNA 1INEH 4HULB 4Y4HD 4YUEH 1KEGL 1RZJC 3QNZA 4WI3A 2XN9A 4X9FA 1YNLL 1NDMA 3FCTB 2R2HA 1RZGA 5E8PA 3FO9A 2A6IB 5LCVH 4P2QB 3TYFB 2WZPD 4HUWB 1PKQA 4JG1H 3W11C 5FEBA 4ELKB 1FL3B 4W81A 5HHOD 1TETH 1TTFA 4N5ED 3GKWH 4C4KT 4YHNA 4JAMB 1A2YB 2H9GA 3GDBA 2VUYA 5TPWL 2W60B 5I1AA 5C6PB 4BZ1L 2YBRA 1BJ8A 5L2KB 3U46B 1FE8L 3DURA 4U1JA 3I3BA 2UVEA 4RWYL 3NAAH 2YHGA 3VH8A 1MVUA 3GI8H 1KIPB 3MX0A 4UUJA 1FVCB 5D5MB 4M03A 3LD8C 3VGAC 1YEHH 2HA1A 4YR6A 1FYTD 4AJ0A 1ROWA 3I6LE 3ARBC 2W1NA 2BNRB 1MHCA 3CU7A 1RJCA 2ZUSA 4OJFH 4ZD3L 2Q8AL 1KBGL 3QJHB 4NKIL 2HFEB 1OAUL 1MLBA 4HK3J 5DK3A 2AXGA 3CU1A 1ONQB 5IVZA 5BRZD 1FFNB 3OR6A 5ICXA 3EGSA 1M05B 4JO2L 4AIZA 5E9DA 4ZUWA 5I1LA 1G0XA 3KPRE 3NZHH 4MNQD 2QADB 4QYOA 2R1WB 1LEIB 1NPUA 5EO0B 3WE6A 1A4KA 5FKAA 4E5XB 3IJSA 3KPSD 2W65B 7CGTA 5A2KH 3BHBB 1PJ9A 3EBAA 3MGTB 1S9VB 5HDQH 5EFIA 4R7NB 4Y2OA 4NZRL 1NEUA 4BSWB 4ZFFB 1UH3A 4PTTA 3C6LD 1NFDE 2NR6C 4LOUC 4UTBL 1SM3L 3VW3H 1ZANL 4EUPG 5A2LH 1PYWA 1U6AH 5F97E 4ZUTB 5GGSY 3PQYA 1NGWA 4PJ7E 2I9LA 3HZKB 1TFHA 2VNCA 3D39D 4QRRB 3HNVH 5HD8C 4NN7B 1T2XA 4RBPK 1DN0B 2P5WD 4K71B 1KJ3L 3ULVC 4Z8FH 4OBSA 1XH3A 4KRNA 1U93A 3QIWC 4JVUA 4I0PC 2R4RH 2E27H 3WS3B 4X4XA 5I8CB 3HAEB 4ALAL 4NQCD 3IU3B 3ALPA 1OT2A 1A14L 4KTDH 3S35X 3ARWA 4IRSB 4KFZC 1WT5C 4RGNC 5K93A 5HSFA 3AXLA 3MV9A 3DVNB 3FZUC 3HCVA 5KAQF 4B0MM 1NEZA 2EDWA 1G9MC 4M7LT 4MCYA 3RA7H 3QIBA 1QNZL 1OB1B 4UOW0 2MCG1 4D0BB 3UJTH 3B5HA 1GGIL 2OTPA 4PJDE 3U79A 1E4KA 4K94L 1BOGB 1ZKAA 3K46A 3TCLB 1T04A 3UZVB 1BQHB 4XBEH 2YPLA 4MA1B 2M2DA 2GW5A 2XTJD 4LGPB 2Y7QA 1GHFL 2GITB 2QHRL 4NWTL 3GO1L 3AU1B 1A9BB 4EOWL 2JELH 3ARED 4LGSB 2VDOH 1RIHL 3BKJL 1B2WH 1OAQL 1S9XA 5DDHB 3T04D 2OL3A 2VQUA 5C0JA 1D5MA 1L9NA 5C70A 2IAMD 3QHZH 4MVBC 5A2IH 1K8DA 1RIUL 1UWXK 3KPQB 4JY6A 4F57H 5JW4Q 2ADIB 1P5UA 2HFGH 3Q3GB 5B38A 3QRFM 2BNUA 4IS6A 3P11L 3QDAA 5IJKA 4Y5YC 2J6EA 5C0DB 1RVFL 1R6VA 3QCUH 2Q3ZA 2VXQL 3QWOA 4DZBA 1S7XA 4I0KA 3F7YA 2NPLX 1OW0C 1YEGL 4PG2C 5FUOL 3KXFB 5I0ZA 4LF3B 3GNML 1AQDA 1H3PL 3VFRB 1PD6A 2VABB 1I8MA 3B9DA 5D1QD 2FHBA 3UYOD 1JPFB 4RIRA 4LHUB 5F7MC 5TH2A 5C3LD 5J11B 4RMTA 2DJ4A 4EXKA 1LEKB 2FJHB 2EH7L 1ZWIA 5C09B 4X8JA 4HZLB 4LLAA 5E1HB 2CUIA 1KCUH 2E7MA 3VFVB 4P46A 1T20B 1MPAH 3CX5K 1IAIL 4J4PA 4K55A 2DYPD 1DBKL 1T5XB 3BOVA 5HGAA 5E08L 4OV5B 1X5IA 3QO0B 4QRPA 1S7TA 4P5TB 5JORB 4GRWB 1SEBB 2IQAA 4X6DA 5EA0H 5DQJA 3BZ4B 1J7VR 1RUKL 1EV2E 2F54B 3MLPA 5I30L 1HXYB 5JIHA 4EIZC 1U95A 1BVKA 2DWDB 3ZE2F 1IL1A 1FPTH 1UC6A 5EC2B 1P7QD 5I1DB 3V0VA 3A67H 3VXNA 3QUKA 1IILE 5ELIA 3OG6B 1F4XH 2Z8SA 3GMPB 1JTTA 4GAJL 4OM0H 4Q97A 1QZ1A 2GJ6D 2ICWB 2AK1H 2BK8A 4XTRC 4G9FD 4MJ5A 4YWGL 3NTCL 4RMRA 1KJMA 1A6WL 5C8JA 3EDJA 4D9RE 3W39B 2CGRL 2XKSA 1AGCB 4EZMA 4TNVK 1C5CH 5DUML 1CFTA 1ZHBA 1HKFA 3VA2C 3D48R 3G5XB 4HC1H 2XYCA 4OCLC 5FHBH 3FQUB 4KK8C 2NY7L 1S78C 3HNSL 3WL9A 1HCFX 3F7VA 1I7TA 2NY5C 5DO2D 1CN4A 5ISZE 2P5EB 1KN4H 3DX8B 4GW4B 3TPUA 1EJOL 2QBWA 4Z7UE 3NFSL 5SWZB 4KKNA 1JPSL 5TDNB 1E6JH 1YEJH 1U8IB 3OL2A 4ODHL 3EZJB 3H3PL 3DROA 5CWSA 4NO3A 1OQXA 4PGEB 1MIML 1MAML 1QLEH 2DM2A 4PY8J 2P7TA 1AFVL 4PRIA 4PJCA 1N0XL 3I02A 2H32A 3LKPB 4QTHB 3PHQA 4UDTA 4KV5F 5KSUA 1UKSA 1LD9A 4PJFF 4CL7A 5DJYA 5AZ2L 4K23H 1Q9LA 5BVJA 2L7UA 5HI4C 3LEXA 4JREC 4JFDA 4JRYA 1GGTA 1YEDA 1XGTB 2F53B 1SJXA 2A6DA 3TT3L 4PB9L 1MQKH 4YHIA 1BQUA 1YY9C 1JGVH 1PY9A 1I3VA 3MV8A 4U1KA 4JFOA 4KTYA 2DQHH 3MBXL 5I1GL 3C5SB 1PSKL 2D9QB 5SWSE 4PPTA 3IVKA 4NM4L 1I7RB 5EOTA 3RVTD 3LPGA 2BSTA 4XNUL 3L5IA 5HGBA 3T0BA 4Q2ZA 5KW9H 1IGIH 3O3AA 5DJ0B 1VB9A 3LRGA 1UWEH 3VFOB 5C0AE 4UOW1 3CPLB 2YUZA 3GSWB 3SE4A 4Z7VE 3WD5L 1AHWB 1DQDH 3WIFB 4D9QD 3MACH 5BW7C 4P9HL 2BNQE 4P4RA 4NQTA 4V1DE 1MRDH 4M6NH 3OPZL 1KENL 2GTZB 3RL2B 4GLRI 3RPIB 4G7VH 1RPQA 4DGVL 3VDCA 3TEUA 2YWYA 3KWWA 5IBLD 1KYOJ 3WFZA 1KTLA 2WIMA 4OLYL 4PJXB 3ULUE 1S7UB 3UTZA 2B0SL 3OTTA 2B4CH 3BXNB 5CSGA 2Z31C 4EI5B 1NFKA 3QH3B 5I18H 1KSRA 4M5ZL 1CDUA 4K7FB 3EJZD 1S7QB 4Z5RB 1P4BL 4GXVH 4E0RA 1ES0A 2G2RA 4DW2L 1R3IL 3HZYB 2RBLA 2QQKH 1I1RA 4JO3H 3BT2L 4XI5C 2CRMA 4S2SB 3VWKA 3KYNA 4DN4L 4GG8A 1JZ5A 5E99H 3DNKA 4LSUH 3G08A 3NCYP 3P2TA 2YUXA 4WUUA 2ESVA 3FAWA 3NA9L 3MUHL 5GS2D 3O11A 3SGJA 2VITB 5CILL 2EICA 4Y4KB 1FC2D 1RZKH 3O6LH 1RUQH 5F21B 2E7HA 4R26L 3EOTL 2PN5A 4OIIL 1JV5A 5SWQB 2IBBA 3OJMB 1QYGH 3Q5YA 4ZTPH 4MQSB 2NW2B 3UPCA 4NKOA 5HYIA 4H1LG 4HJJL 3IS0X 2YEZB 2YPKB 5ALBH 2WANA 4XZUB 3TBVB 5ID1A 2R0WL 1TJIL 4KK6C 4KUCD 3SO5A 1JPGA 4B7LA 3DUUB 4E42A 1RJLA 5L6YH 4FZ8L 3LOWA 4NNXB 2XY2A 3QWRA 4U1HA 2CUMA 2PR4H 5F7YC 4P23A 3T0EA 2EKSB 5LGHL 1KJ2A 1YMHA 3FT4A 2ZG2A 3GSXB 1IEAB 2JIXB 5T33H 2I9TA 1GGYA 1S8DB 1K2DB 1J8HE 3EYQC 3QNYB 5TDOB 1RHHB 1FV1B 3BQUA 3L9RA 1UXSA 5M95B 3CC5B 5JW4R 3OXRA 4IMLA 4GMTL 2BSSA 5EU5A 2VLJA 2AKRA 3MRRB 4YAQA 1ZS8A 3MUJA 4FRWA 1XR8B 1DVFC 3TN0B 4MA7L 1HWHB 2VWEC 1N26A 5CD3B 4KMLB 1A7OL 4BZ2H 5FA3A 2VZ3A 4R2GB 4M3KB 1Y18B 2YN3A 4WUKH 1G9NL 3W9EB 1K9TA 2PCPB 1QSEE 1UEMA 1CFSB 3TBTB 3OKNA 5EU4A 5IMOB 1X7QA 4G3YL 2V5RA 3MA7B 3BISA 1UM6H 2ENYA 4P5MB 3GJFK 2RAMA 3C60A 3GHEH 1T1YB 3PDOB 4HG4K 1JFQH 2O93L 1DTUA 4QF1A 4M1CD 1W0WA 4UAOB 3F12A 4DQOL 4WFHD 4YDIL 3D69A 1AD0A 2AJZA 3Q5TA 1QD0A 2EH8L 3QA3B 2DJSA 3MV7A 5L0QB 1G6RA 2VDQL 2NX5A 2IBZX 4OGYH 4HUVA 1QSVA 4BKLB 5JOFA 1KG0B 1SYVA 3V6OC 4YHYB 4N0UB 4TSCL 5FGCB 2WUCH 5KS9B 4RAVA 5GRJH 1HHKB 2XKUA 1I9RH 1FG2B 2OR7A 1MCRA 1P1ZB 4WWKC 2XZAL 4H5SB 4DAGL 3IFLH 5SX4I 5DLML 2XZQL 4LCWD 1F2XK 4WW1B 1IFHL 5MHSD 4JANA 4HPOH 4HS6B 2X6MA 3RWGB 2V7NB 3ZL4H 1T66C 1U3HD 4PJHF 3GI9L 3NCMA 5EU6B 4GW1B 2NY3D 4OF6A 4Z7WF 4HJ0D 1C08B 2MHAA 5DEGB 3B3IB 3PE9A 1AJ7H 1DLFH 3RWCA 1E27B 3ARSA 2IJ0C 3U1SL 1F4YH 1FSKC 4MZ3A 3QFJD 1EBPA 4UU9A 1H9VA 4KUZH 2JJSC 3QCTH 4NFDA 3W0WE 3AS0A 4Q0XH 4Y19E 1OTSC 2ICEB 2I5YL 3FO0L 2MOVA 2FIKB 5C0CA 1YEFH 3QZWA 1F3JB 2W9LA 1S3KH 4HFWB 2BDNH 4FTVA 2LABA 1P6FA 1SY6A 2HJKA 1L4IA 4WIQA 1JN6B 4M6MH 4KRMB 2BOCA 1XCTA 4EN3A 3U48A 4G8GD 4UIMA 3AAZA 4MXVE 5JMOC 1JHKL 3SDCC 5E95B 5EO1B 1R3KA 1CGVA 3CXHJ 1CLCA 4IDJH 3DO7B 2CLVA 5C07D 4AEIL 1AGBB 2Z93B 2XKNB 1ND0A 1D5ZA 4JO1L 2OTWA 3VU2A 5C08B 3QNZB 4Y5XA 4HLJA 1B90A 2XN9B 5GZOC 3WUWG 1NDMB 5FO7A 2R2HB 1RZGB 5SX5K 3I50L 5E8PB 3FO9B 4E9LA 1C5BH 4OT1L 1CU4L 5IBUG 2HH0L 1WEJH 3GBLA 1PKQB 1KCVH 4K9EH 1F6LL 4V2BA 1MSPA 4JFXA 4ZAKD 3QDJE 1YJDC 2G60L 4GMSL 1Q9OA 3MJ7A 5IJKC 1M1SA 1HHJB 4PRBA 1TIUA 2P4AB 3QI9A 2GK2A 1D9KC 4MD0A 4LHUG 2DQEH 1ZVHA 3PXHA 2H9GB 1A64A 3V6FA 1OAKH 4NC1C 4JPWH 4MYWB 2YBRB 3A6BL 1BZ7A 4HCRH 4XPBH 1QEWA 4KDTC 4KY1H 4OZFG 2GAZB 3DURB 2ATKA 2C3GA 4U1JB 1N6UA 5D2LF 5BOZG 5KVFH 3Q0HA 3VXME 4KI5E 4MAYD 3HC3H 1MVUB 4TPRL 1T0NA 12E8L 2DQDL 4N9GA 5DK2A 2J6EL 3BGMA 4UUJB 3K4AA 4YR6B 3MRDA 3VGHA 3X17A 1JYXA 3JWDH 1KB9K 2MPAH 1MHCB 2VISB 1JF5A 4U31A 4MA8H 5GISH 2FH8A 4FHBD 3KPRA 1A0QH 3ZMRA 5IVXE 5CBEB 5F44A 1MLBB 2AXGB 1T2JA 5IVZB 4PRHD 2C3XA 3OR6B 4Y8DC 2UWEE 5E2UL 4TQEH 5ICXB 3EGSB 2R9HD 3MNWA 4AIZB 5E9DB 1WZ1L 4ZUWB 5HYSG 5I1LB 1AKJD 2D0HA 5AG9A 4GW5A 4QYOB 1DE4A 2P47B 3WE6B 1A4KB 4L8BA 3SPVA 2ADFH 5FKAB 5L9DL 3IJSB 4NGHL 1IGMH 1NFDA 3VXRD 3TA3D 4L4VE 3WHE0 5CEZE 4PJ7A 5DQ9A 4YPJA 1BP3B 4JKPH 5EFIB 2NZ9C 2R0LL 3GBML 2LTQC 1A6AA 4LVEA 3OAYH 3KLHD 2OS7A 3VI4E 5KSBF 4K8RC 1FC1A 5GS0D 5HYJB 4C83A 15C8H 2AEPL 3BE1H 1PYWB 5GGTH 3PQYB 1NGWB 4ZUSA 4OB5L 2I9LB 4ODVH 2IADA 3UP1A 3SKMA 1XZ0B 2AEQH 4OGZA 1YQVH 1KN2H 4QTIH 4OKDA 5D2NE 3GSNA 3ARFD 5I1CH 3FMGH 3OB8A 1B6DA 1TENA 4D3CH 4LVHC 1B4JH 3T4YA 4X4XB 4NYLB 1BZ9A 1NC2D 1EGJL 1RK1B 1YC7A 2NY1B 3MV9B 4XP6L 4PJDA 3HCVB 5FKPA 4K3HA 3FKUS 4R96A 1NEZB 5DXWA 5IFHL 4Y89A 5C1MB 3QIBB 3SCMD 4KKAC 5E7FA 5HHOE 3VGBA 2KKQA 3EOBA 5DURD 5ID0A 5JW3L 5IEKA 4NCC1 4ODSH 1RZ8A 5GS0H 1T04B 1NC4D 1WBXA 2VLMD 2YPLB 4O58H 5DRXA 4DUWA 3MOBL 3ZE0E 3BYYA 2Y7QB 3ILQD 3OGOE 5HHQA 3LPWA 1OAXL 3P77A 1ITBB 4NC2B 4S1RH 1FFRA 4OZHE 4NWUL 1Q0YL 3HE6C 4NJAH 5KSAA 1BVLA 3GHBH 5MERB 4QY8B 5LQBH 4POZD 3X3FH 3WFHB 1MLCA 1KCKA 1AIFA 1D5MB 5HTSA 1K8DB 5BV7C 4JY6B 1FYTE 4X80L 1X5AA 3TM6A 4FNLL 2IAND 5B38B 2BNUB 2NR6D 4IS6B 4I8DA 1AE6H 1CCZA 1C7TA 2V17L 4U6XA 1CF8L 3D6GA 2O5XH 2PO6C 2OX5A 2KQMA 2EDHA 4NIKB 4RA3A 3EDFA 3MFGB 4R7DA 3C87A 3QWOB 4DZBB 4JDTL 3F7YB 4E41E 4Y16A 1Q0XL 4K3EH 5BRZE 3UEZA 2DQIL 2ZJSL 2KPNA 3H8NA 1AQDB 4QEGA 3MBEC 5D7KD 1I8MB 4NFBA 4MNQE 4RRPA 4ZS6C 1DQJA 4J23A 4RIRB 5TH2B 1C12A 4HPYL 4XPAH 3ZE1F 2QSQA 1EHLL 1ZWIB 4X8JB 1TQBC 3B6SA 4FXLA 1WICA 5DC9B 1MCWM 3U30B 2CO6B 4P46B 1QFUH 5CJQL 2HYMA 4HHAA 1EAPA 1R3LA 3GI8L 3O9WA 5HGAB 4TSAH 2P46B 4WW2F 3TO4A 5J1SC 4F15B 3ZTNH 1S7TB 3DXAE 3CLEL 1VGEH 2IQAB 4X6DB 5DQJB 3V9FA 5JPMA 3CIQA 3ILPA 3UTSD 4PJ9C 5TE4H 1U95B 1BVKB 1IL1B 3VXTB 1C1EH 1OARH 1UYWH 3WNPA 2P5WE 4OJFL 3QHFL 4KXZH 4OI9A 1OGAE 4NQCE 5EUOE 2X4OA 1JHLL 3QUKB 1BQLL 5JHLL 2YK1L 3WO4C 2DKSA 2VN4A 3AC0A 2BVUA 1LO2H 1H3WM 4DUVA 4ZPVA 1PQZA 3NZHL 1FYHB 1TZGL 4DZ8A 4MJ5B 4GAGH 4N0YL 4JFZL 2DBLH 4LRIA 1KPVA 5C8JB 1F8TH 1CFNA 1KACB 4UQ3A 5C0RL 3NVQA 1CFTB 1H5BA 2QR0A 3D3VD 1D5IL 4Z7UA 4F33B 4OLZL 3B8YA 1JI1A 1XIWC 4YBLC 2XTJE 1JZ6A 1A8JH 5F96L 3WJJA 1DLHA 3W9DA 4OZIF 1HSAA 3VD7A 1N59B 1I7TB 2R0ZH 5FV2A 4JY5H 3OB0H 1U6AL 1Q72H 4KMTL 4ERSH 3BSZH 2X89D 2QADC 3HHRB 2ILLA 1NGPH 3TPUB 3IKCA 4K7PL 3QG6A 1OCWH 3JWNC 4MSWA 2Z8WC 3ZDZE 4O2EA 3DROB 4N9OB 4OD2B 5CWSB 4NO3B 3PUCA 2WM0A 2QSTA 4U49A 4GBXA 3KPMB 5L88H 4HJGA 4JPVL 4PRIB 4PJCB 3WHE1 3BQUC 5F93C 3I02B 2H32B 1ZLVK 3SKNB 1CIUA 4KTDL 3KLDA 5E4EB 1CLYH 1GIGL 4CN1A 3TO2B 5IBTL 4WEBH 3UZQA 4ZXBA 5JUEH 1U42A 1Q9LB 2BVOA 5BVJB 1JYWA 4C59B 2P8PA 2ZG3A 4NP4L 4XBGA 1I1AD 4JFDB 5SWSA 4JRYB 3OF6D 4YXLH 4L4TB 4YHIB 4JRWA 1NGZB 3MV8B 2Y06H 4JFOB 4U1KB 4BH7A 4DFHA 3M07A 5AWNL 4KQ3H 1EX0A 1G7QA 3IVKB 5C0AA 5EOTB 1A6TA 2JELL 2HT3D 2BSTB 2VDOL 5HGBB 1M6OA 4AEHL 4Z7VA 4Q2ZB 3O3AB 4M6OL 3QUXA 3QHZL 2XOTA 4F57L 2BNQA 4DUXA 4RFEA 4Q7DA 3GM0A 4KK8D 4V1DA 5TDPA 1S78D 2GJJA 1I1FA 1U91A 4L5FH 2AJXH 4Z76A 1LO3L 3TCXA 2R1XA 2X1PA 3DGGA 1J1OL 5ANME 3QCUL 3QO1A 5IEHA 1W8NA 2VDLL 1A6PA 2KDGA 1N5AA 3VXSD 4LNVA 4XXCA 4P2OC 4P0DA 1DQTA 3HI1A 2VDNH 5DD0L 1NAMA 1CDCA 3KWWB 2LU3A 5HGGS 2GJ6E 4OCYH 5GGVY 4GOSA 5B3JE 5K59E 2FB4H 4LARL 4G9FE 1G6RL 5DFVC 2R69H 5E2TL 3UTZB 4X6BA 4X6FA 1MIEL 1T89C 3HPLA 4M1DL 2GCYA 1O7SA 1UWGH 2IBZY 1TZHA 4ODUA 1A47A 1RHFA 3RZCC 1GZPA 1KCUL 4U1LB 1MPAL 5DHVH 4LLMB 1YYMH 2WINA 3EO9H 2G2RB 4YK4B 2VDMH 1YY9D 1X3DA 5DSCA 1L0QA 3VWKB 2IWGA 2NXZC 4GG8B 3HI6H 2N7AA 3FB6A 3QXDB 4WUUB 4Z7QE 3OKOA 5CLTA 2ESVB 4FQ2L 4JKWA 1RMFH 3CZFA 5LWYH 3NBNA 2C4FU 3O11B 4NPYA 4U0RC 4GT7A 3UO1L 1ZLUK 2WMPA 2HKHL 1CXFA 3S37L 3UAJD 3FO1A 4XHJD 2NNAA 3D25A 1ZHNA 4NKOB 5BO1H 1J5OL 1WFNA 1YZZA 3K80A 4EN3C 3BX7C 1MNUL 4P59L 4C58B 5EZLA 5ID1B 3BDYH 1MRFL 2FO4A 4XWGL 1T7YA 1I1YB 2F15A 1JPGB 1YC8A 4E42B 1RJLB 3CD4A 3MLSH 4U1HB 4X4ME 1B0RB 1RZFL 2IBGA 5ITFA 4P23B 3T0EB 1YMHB 2Y5TB 3FT4B 5FYLH 3ARDA 3P9LA 1GL4B 3V4VH 2I9TB 5F9JA 4LLQA 4JB9L 4Z18A 1UVQA 3B5GA 1HZHL 2FX8H 4LPWA 3L9RB 1UXSB 3KS0H 3NIGF 3OXRB 4IMLB 3RDTD 2BSSB 5EU5B 1MFEL 2VLJB 2AKRB 4YAQB 1YEJL 2FEDC 1LVEA 4Q9RH 1FZKA 1R3HA 3L3OB 3C2SA 3VI3F 2VXTL 1IKFH 4NT6A 4YDKL 4YZFE 5IJVA 2VDPH 1KB5A 3HPJA 1VFBA 5D1ZC 3LN4A 5FA3B 5IFJA 4KKBD 3PWVA 1G7LA 1XMWA 4FMFA 4D9QE 1QHPA 4I9WD 3VH8G 1DQLH 4OCXH 4LKXB 3OKNB 5EU4B 1TPXC 3IFPB 4BK5A 4GKOA 1X7QB 1BREA 1BM3H 3NACH 3WSQL 5A3ID 2DN7A 2BSED 4IMKA 4LCIH 3C60B 1YEIL 5FM4A 3DX7B 5EIIA 3HA0A 4L1DA 1NUDA 4YC2C 1HOCA 3LKOB 5IROC 3VMPA 2OZ4H 2BMKA 1OTTD 4L4JA 2CDGA 4QF1B 2FGWL 5T1LD 3BP4A 3QUZA 2MCPL 4IOIA 1SEQH 1W0WB 3F12B 4ZSOE 4JZOA 2HRLA 3K81A 5GZND 3MRKA 3D69B 2DQHL 4H0GA 1AD0B 1MAJA 2AJZB 4LNRA 3P0VH 1RURH 4OGXL 4U1GC 2HN7A 3MV7B 1A3LH 1G6RB 4HUVB 3DETC 5JOFB 1SYVB 3E1F1 2V2TB 3O6FB 3LS4H 1BHGA 4RAVB 3GSRA 4GFTB 1ADQA 3RFZC 2WK2A 4CVWA 4JVPA 4U1MA 1IBGH 3EYQD 2ED7A 3WHXA 4CW1A 4M62H 4O4YH 2H3NA 4PB0H 5HVGB 4KWUA 2LQRA 2CJUH 4JANB 4P3DA 1SBSH 3D2UA 1CDYA 2CIIA 4G7VL 2VC2L 3KJ4B 5B39G 3IJHB 2X9YA 1WAAE 2MHAB 5FUZH 5TE7L 3UPRB 3AS1A 3W0WA 1MI5D 3RWCB 4UOJA 5CCKH 1WCBA 4OLVH 4Y19A 3U7YL 2HWZH 5C9KA 4NBXB 2H8PA 4UU9B 2J88H 2NTSP 3U0PA 4MDIB 1BF2A 3RUGF 4OFYD 4XVSH 4FFWC 2PW2A 4Y5VC 4EVNA 1GGBH 4GXVL 2OJEA 2Y9RT 5DK0A 5E2WH 3VWJC 1H8NA 3BJ91 3OKLA 1NEZG 4L3ED 4LFHG 2XXCB 4OFVA 5DA0B 5T1KD 4WRLA 1HCVA 5C0CB 1KC5L 5HVHC 3MRMA 3QZWB 2YMXL 1NANH 4LSUL 2CKBA 1CD8A 4CMMB 1XGUA 4FTVB 2E6QA 5F88A 4JLRA 4YE4L 3P73A 3UYRH 1MJ8L 2HJKB 1IAKB 3EDKA 3S7GA 2F8XC 3R06A 1WZKA 2NY2B 2JB6A 4G7YL 1BJMA 2BOCB 1XCTB 5C7XL 1JNLH 4UIMB 3AAZB 1CWVA 5HVWA 3O6LL 3EOYG 3GSNL 5HHXL 4O02L 4WJ5A 1R3KB 5F71A 1OHQA 4JM2F 3U36A 4XPGL 4ZTPL 1E4XH 4WWKD 2YZ8A 1G84A 5D71H 1U8HA 4EUPH 2RCSH 1MREH 1QFWH 1D5ZB 4XVUC 2OTWB 5I9QB 4Y5XB 4DEPB 4TOYH 5B38G 1T66D 2CD0A 3QDJA 5FO7B 4FQQA 4NCDA 4OLWH 1ORSB 2PXYA 1FGVL 4MD5A 4HWBA 5IMLB 3Q6FA 4HIEA 4WFHE 1KOAA 4JJ5A 2X4RA 5AD0A 3QUYA 1KELL 1AH1A 1XF4A 4JFXB 2DDQL 3ZYZA 4C54A 1Q9OB 3MPCA 4KROB 4U6YA 3MJ7B 3O8XA 5KVEH 4PRBB 1XGRB 1FLRH 4U1SA 3JV6A 5FGBA 3VXMA 3QI9B 1I9JH 4MD0B 3GMQA 1RU9H 2DJUA 5CGYC 3V6FB 3GSQA 1WFTA 5DJDA 3NPSB 2I26N 1BZ7B 1QEWB 1OTUD 4UNVA 4OQTH 4TULH 4RDQF 3EYUH 4LLDB 2ATKB 3I84A 1ZMYA 1URLA 5B8CB 2W59A 5I19H 4Y2DA 2NY0C 2R29H 1EEYA 5MHSE 1T0NB 1FIGH 4M43L 4N9GB 5DK2B 3VMNA 3BGMB 5D7LB 5KTEH 4PLKC 4XP9L 3MRDB 2WNGA 1IGYA 3GHEL 5IVXA 3FB8A 2BY3A 4PJIE 3SDCD 1ZXQA 1UCBL 1W72A 2PTTA 5GRUL 2EDLA 2MWCA 3BKYH 3O9WC 3QP3A 2UWEA 4X4YA 5EOCH 1BMGA 2DICA 2BFVH 3WFDH 2B5IB 4DWHA 1F5WA 2FLRT 2XWTB 2ZUVA 4L9DA 4BQ6A 5BVPH 1T4KA 3MNWB 3MSPA 4L4VA 3UBXG 4EDXA 3C5ZC 5GZOD 1FO0A 1X6NA 2EECA 3CSYA 4GW5B 1DE4B 4P9HC 1IE5A 2VMFA 4L8BB 2AW2A 3SPVB 1OP3K 1I75A 1NFDB 1CK0H 1VPOH 5IW6A 1JGLH 1EUTA 3CFCH 3IFLL 1OQOA 5F7UA 4PJ7B 5DQ9B 3Q6GH 4LPVA 5EU7C 4AQOA 4RGOH 1MCEA 3CNKA 1A6AB 4G8GE 4OZIB 1UZ8A 4LCCC 5D2NA 4NQED 4HPOL 4YX2L 5GGSA 4C83B 5D8JL 3RY6C 1QPXA 2Y25A 4MX7A 4YHML 4ZUSB 5I73C 4FQIL 2R0KH 2IADB 3SKMB 3UTQB 3UX9B 1XCQA 4P4KD 1J87A 1OY3B 5C07E 4OF0A 3NIFE 3GSNB 4BQCA 1AJ7L 1U8QA 4TVPE 3F8UB 3VRLE 3HRPA 3UJIH 4ODTH 1MCPL 3BP6A 3T4YB 2AXHA 4GKZA 5GSVA 3KDMA 1NMCB 4KUZL 2BZDA 1BZ9B 3QQ4A 3QCTL 1C16A 1LDPH 5FKPB 1NGYA 4R96B 3SE9H 4JFQA 2DIJA 1YEFL 4JQIH 4GRLC 3E6FA 5LGJA 5ESVA 4PBVC 2FCBA 3EOBB 4OZHA 1F4HA 5ID0B 4LEXL 1RZ8B 4M6ML 5EULV 1YN7A 1WBXB 3B9VA 5DRXB 2ITCA 3U6RA 5HHQB 2VLRD 2PW1A 4JFFB 5IVOA 1FYTA 2VIRB 3BIBX 4RGMB 4U7MA 4X9BA 3SJVD 5DQDH 1BVLB 4QRUA 2XQBH 1AI1H 4RMQA 5KSAB 1MLCB 1S9WA 1VFOA 3F7QA 1EVTC 5DD1H 1AIFB 3CXDL 2NY4B 2B1HH 1PDKA 2EEBA 3NN8B 1L0YA 1UG9A 3U9PL 4N1HB 1UJ3B 3TJEH 1RUAH 4E41A 2Z91A 3N9GH 2ADGB 3BPLB 4KRPC 4F8QA 3IFNL 5BRZA 1QRKA 2GIYA 1X6LA 3X3GH 1LWRA 3NGBC 4MNQA 1KCVL 4K9EL 4Y16B 4P5KA 1EJ6A 4PRHE 5I75B 4JHAL 3RGVA 4MJ2A 2YD3A 2VLKD 3DWTA 3IDYB 1NBVL 3NCYS 3DVGA 3CLFH 3TESA 1DQJB 1BLNA 3LQAC 1C12B 43CAA 1MFBH 2R4SL 3G5VA 4JPWL 1YUHA 3IETA 4PGBA 3C6LA 4XXCC 3VXRE 1TDQA 4KY1L 5HHVL 3DXAA 4LBEA 3M17B 4L8SA 3B6SB 4XMLH 4PP1C 4PRPD 4ZOEA 5KVFL 1A3RH 4M1GL 1OGTA 4HHAB 1EAPB 1GC1H 1R3LB 3EKCA 3PL6B 3TO4B 4BQBA 3IDMA 4TTDD 2P5WA 1W2KT 4J6RL 1JNNH 2EIEA 2YOCA 5JPMB 1VACB 2A0LC 2XICA 3AB0B 3T2PA 1DFBH 3ILPB 2F8OA 3BDBA 4YHZH 3ULUL 3SHSA 1OGAA 3GRWA 3ME0A 4NQCA 5EUOA 3EYSH 2XTLA 4PJBF 1D6VH 3LEVL 5IVXF 3CFJA 4HGWA 4WI2A 5LGKA 3GSVA 3R0MA 3HE6D 1WZMA 3P30H 4AL8L 3ARGB 2EYSA 2X4OB 1V3MA 4KHTL 2EE3A 2V6HA 4S1SL 4YFLF 2DLGA 4PJAA 4ZPVB 1PQZB 3D87B 3SDAB 4DZ8B 4HZAA 4GRMA 2PO6D 4NFCA 2ADFL 1KPVB 5CSZB 1CFNB 1M4KA 4UQ3B 2BRRL 1EA9C 3AREA 1H5BB 4KVCL 2QR0B 5ETUA 1FNHA 2PF6A 4Z7UB 4OD1H 3ZKQD 2VAAA 4ODWA 4RFNB 4OBRA 4R0LC 5ADPL 4IJ3C 5IVNA 2IAMA 1DLHB 3W9DB 1HSAB 3VD3A 4U3XA 2BHYA 3BE1L 5MEPA 5ALCL 3CUPB 4DGIL 4PP2A 2EDDA 3IAPA 4ODVL 3L3IA 1HE7A 3CMOL 2DQTL 4P2QD 4BZYA 3QG6B 4DKFH 5HGDA 4MSWB 1FGNL 4O2EB 4JDZA 5DUPL 4GBXB 1U8OB 4HJGB 1VERA 2IANE 1P6AB 5JDSA 5IWLC 3QQ3B 5FYKH 1KJVA 5J4MA 4KQ4H 2A9NL 2A9ML 4PJ9D 1IM9D 5I1EH 4ZXBB 5L2KD 4ONFL 2BVOB 3DYOA 5JHDB 2P8PB 2Z35A 5DMJB 3ZE0F 4LSDA 4H1LH 1FQ9C 2OTUA 5I1JH 3OAZH 5EUKA 1TTGA 1CT8A 5BXFA 1FH5L 4BH7B 2CLRA 3NABH 1CXEA 4NQVA 5J3HC 5D7JB 2H41A 1G7QB 4OTXL 3ZKMD 5B22A 2H1PL 1I3GL 3B9KA 4S1RL 1J8KA 4JHWH 5C0AB 4JPIA 4X6CF 1MCOH 1A6TB 4YNYA 4P9MH 2FJFA 4OLXL 3GIZL 1M6OB 2APXA 3GHBL 1BEYH 4Z7VB 5LQBL 1KB5L 3D9AH 3K1DA 1AXTH 4WTZA 2XG4A 3ESUF 3QUXB 5ANMA 3CVIH 1UM5H 3WLBA 3N85H 2HMID 4D0CA 2BNQB 2FX9L 4FQXC 4RFEB 3UTSE 1XIWD 4ESKA 4V1DB 2ED8A 1I1FB 3MRGA 5T3ZH 3RWIA 1CLOH 1U91B 4MXWH 4G8EB 2XZCH 1V3LA 1AE6L 4Z76B 4M93C 4R3SA 4HGMA 3MLXH 5D7IE 3U4BH 2R1XB 3DGGB 1U2HA 1CFVL 4PJ8C 4Z0XB 4XP4L 2QADD 4ZUUA 2GJ6A 3QO1B 5IEHB 1LO0H 1JWMA 1F13A 1B0WA 2HJFB 3QDGE 4G9FA 4WDIA 4HH9A 3KS0J 1A02N 2VZVA 1CXHA 1N5AB 2ZUUA 4K3EL 2VOTA 3HMWH 3HI1B 3G6AA 2P43B 4LSQL 5FFLA 1AC0A 5DEFA 5C0FA 2G5RA 2B7DT 3HI5H 4QWWC 1OF2A 1IC4H 4X6BB 4HGKC 3JXAA 4X6FB 2ZKHH 4OZGF 1JTOA 3HPLB 2GCYB 2HG5A 2UUDK 3BIAX 1TZHB 1YMMA 4KK5C 3O3DA 4ODUB 1GZPB 1CL7H 3D3VE 1OM3L 4XCFL 1ADQL 3FT3A 1ZLSL 4KVNL 4HLZH 3FN0H 3LCYA 1CFQA 1TVBA 2O5ZH 2WINB 3MGOA 3ZTNL 4HWEH 5DSCB 3X11A 3VGEA 4GQPH 3I85A 1MUJA 1IJ9A 5E70A 5JOPD 4CU7A 2IEPA 3FB6B 3BGAA 4CBPA 5F72S 3OKOB 3CZFB 4M00A 3GSUA 1C1EL 4JFHD 1Z9OA 3TP4A 5C0BA 4M48L 2MSPA 2NQCA 2JJWA 3FO1B 4FABL 2NNAB 3D25B 2QQLL 1ZHNB 5JXED 3LS5H 3GK8H 4X4MA 5IW3A 4U6VL 1SYSA 3MLVH 4PJAF 5CJXC 5TQ2H 5H37G 1LEGA 2FO4B 5DVNA 5HDBE 3H7BB 4XNQB 2EIDA 2GSIA 3HRZA 2CKBL 3KR3H 2Y6SC 4WCYL 4L29A 5CHNB 5ITFB 4BFGA 2EXYD 1ACYH 4QNPF 3ARDB 3HAEH 3P9LB 3RTQC 2R0ZL 5F9JB 4LLQB 1NL0H 1Q72L 5DHYA 5IIEA 1VDGA 4CDGC 1KEGH 4J3OC 3FFCE 3X12A 1YEKL 2W92A 2X4PA 3QYCA 1IEBB 1YNLH 3ZYIA 5IV2A 3BPNC 3IRZA 3OJ2C 1U3ZA 1FZKB 4A2MA 1R3HB 2YA2A 5A16B 2Q7YB 1QPPA 5L88L 2IF7A 1J86A 4NO0A 5IJVB 4EI6A 5DJAA 4AZ8A 5JZ7C 1KB5B 3HPJB 1VFBB 5IFJB 3LN4B 3PWVB 2NXZD 4I48A 4HIHA 5FGBC 2B2XL 4WTXA 3O3EA 3MOAL 3C9NA 3UZEA 2FYYA 3A6OA 1P2CA 3C5JA 5T3XH 4ZSOA 5C09D 3T0XA 4U3HA 2FSEA 5TPWH 5EIIB 5INCB 1IC1A 4BZ1H 3REVA 3STZA 2APVA 3LKNA 1HOCB 2BMKB 5T5FH 1FE8H 2CDGB 3AY4A 3BP4B 3QUZB 1L6ZA 1RIVL 4AYFA 4RWYH 4P5TD 4YEEA 3ZDYE 4IOIB 5F6IB 4I18A 4JZOB 3MRKB 1F11A 5ACZA 1RV6X 4LNRB 1PG7X 1NGQH 1LQSR 4TUOA 2HN7B 2Z4QA 4Z95H 5F3HA 4Z0BH 1BAFL 1GAFL 4Y1AD 3QEQD 4X7DC 5DT1L 3WN5C 4A2LA 1U8JA 1PEWA 2J2ZA 4IRJA 5ILTL 3DV4A 3GSRB 3LKRA 4ZD3H 2Q8AH 1KBGH 2J8UF 4NKIH 4CN6A 1OAUH 1A6ZA 4U1MB 1H0DA 3MYJA 4UINL 3MRJA 4CW1B 1MCFA 2PYEB 2H3NB 1EH9A 3ROLB 1WAAA 1W72L 3ESVF 2Z8RA 4P3DB 1F42A 4JO2H 1YPZA 3BEWA 1MCIA 2XNAB 4JR9L 1JF1A 1AGFA 1OAYL 2ZCKL 1HSBA 2CIIB 2BXYA 4JCMA 2FNBA 5E0QA 4GRWH 2FB4L 3WS6C 2WBJB 2R69L 1X5XA 1WCBB 3LIZL 4Y19B 4Y4HC 4HUXA 4NZRH 1FO0L 4HXBH 5CEZL 3G6JE 1CR9L 2H8PB 2P5ED 5H2BA 3MUZ1 5C6TL 3RAJL 5SWZD 1SM3H 1ZANH 4QXGL 1OVZA 1TQCB 3JVGA 2PW2B 3MRCA 4EVNB 1YYML 5A43C 1MHHA 2F5BL 2OJEB 5AYQA 5DK0B 4LSRL 4WHYG 3OKLB 1QR1B 1UB6A 5FHAL 3IXAA 3MRMB 2X4UA 1KJ3H 1XFPA 5F1IA 2CKBB 4LCUA 1TCRB 5EOCJ 5F88B 2W07A 4JLRB 4WI6A 4MNGE 4N5EC 5CBAA 2AXJA 5CP3H 2Q6WA 4ALAH 2BVPA 5LWYL 5CFHA 2ARJA 3R06B 1A14H 4MS8D 1XGPA 4X7TA 2JB6B 4XP1H 3FO2B 3TH4T 3MFFA 1CZ8H 3N1PC 1D5BA 4RFOL 4I3SH 4DN3L 1QFWM 4WJ5B 1M71A 2X4NA 5T5NG 3U36B 2A77L 3BH9B 4F37F 4QOKE 2YC1B 1JK8A 2CH8A 3ULVH 2A6JA 4TNWF 1LO5B 1GGIH 5BS0D 1CDHA 1PW3A 4QXUH 1HEZA 4K94H 3BDYL 5J13C 4JM4L 4UBDD 3EO1B 3LQZA 3T0AA 1GHFH 2QHRH 4FQ1H 4FQQB 3TZVC 1BGXL 2PXYB 1A6VL 4EOWH 4MD5B 2QEJA 4HUUA 4HIEB 4MB4A 2IPTL 5FYLL 1RIHH 2QSCL 5AD0B 3QUYB 5C71A 2VQTA 3V4VL 1XF4B 4YQXH 2IMNA 1RIUH 1CICC 2VQ1A 4U6YB 4PYHA 3O8XB 1M7IA 3JTTA 4YZFF 1BQSA 4U1SB 3JV6B 1QSFD 3VXMB 4RRPG 4NQSA 2XT1B 3GMQB 4DVBA 2H2PC 4FFWD 5TFSL 3GSQB 3WLWC 4XAWL 1AY1L 1L7IL 3MO1B 5C9JA 1LP9E 3QG7L 4L9LC 3VWJD 2Y23A 4PLOB 1FBIL 2O61A 1V3JA 4Y2DB 1UZ6E 2EDXA 4PJIA 3WYRA 1DQLL 1EEYB 3GNMH 1H3PH 3UTTA 5I0DA 3RIFK 3MNZA 1ZK9A 3DX9A 1BM3L 3C6LC 4TUKL 1IGYB 2VWEE 4L8SC 1CDBA 5IVXB 1K5NA 2EH7H 1W72B 2OZ4L 2PTTB 3V7AE 1ZGLM 1DL7L 3O3BA 2UWEB 3RHWK 1MI5E 4X4YB 1SEQL 5CIPH 1IAIH 4JZNA 1DBKH 5E08H 4BM7A 2GYSA 2OI9B 1RURL 3DECA 3PHOA 3MRFB 3DBXA 3L6FA 4FQLL 2GK0B 3SGEI 3E2HB 3NIDF 1T4KB 3RJDA 1RUKH 4L4VB 3ZKND 1FO0B 3IKKA 1N7ML 1YN6B 1VCAA 3N1MC 4O51A 4Y4KD 5AUMA 1GCFA 4L3EE 3V5KA 3O0RL 1WUNT 4G8GA 4XMPL 1GRWA 2CDEA 5GXBB 5IW6B 3AGVA 4CUCA 3CVHH 3BPCA 4H25A 3NZ8A 3ZT7A 3BPOB 3LPFA 3NCEB 2DI7A 3O2WH 4N68A 3GRWL 4GAJH 3OHXA 2EZ0C 3PGCA 3S4SA 1UZ8B 2CJUL 3V6OE 5D2NB 4MJ4A 4OUUB 3TH3T 3G9AB 5GGSB 4MWFA 3BKML 1YPZF 4DK3A 4MX7B 3NTCH 3AREC 1A6WH 4EQ2A 1XCQB 2CGRH 4N8VG 4OQ1A 1MFNA 4NSKA 1U8QB 5DUMH 4JKMA 5CCKL 2NY0D 2XXMB 2JIXD 3JUZA 4OLVL 1MJUL 2W0PA 4ZAKA 3BP6B 1L9MA 4GKZB 3HNSH 3KDMB 4BSVA 3QQ4B 3DVIA 1C16B 3RVWD 4Z7OE 1GGBL 5IB1A 3AM8A 1PZ5A 1EJOH 3NFSH 3IS1X 4HEME 1JPSH 1NGYB 5KG9B 1AGEA 4PRNA 4ODHH 5DFWH 4JFQB 1NLBL 4R2GD 2DMCA 1MIMH 3E6FB 1MAMH 3WMSA 5LGJB 5ESVB 2UZYB 2VZTA 4OZHB 4MAYA 1N0XH 3UYRL 3QCVL 5D1QC 1TTUA 1MCCA 3K4DA 3KPNA 1YN7B 3CDCA 4XPTL 1OAZL 1JNLL 2ITCB 3U6RB 4GG6E 2PW1B 3DIFA 4W4OC 4LSPL 2CMRL 3O2DA 1WWCA 5AZ2H 2GT9A 2YRPA 2EDYA 3GIVA 5IHBA 2Y36L 4QRUB 1E4XL 3A6CL 1Q9KA 1S9WB 3L7FA 4YBQC 3HR5A 3TT3H 4PB9H 3NFNA 5F7WC 2YKLL 3S88L 4E41B 3T65B 2Z91B 2Y5EA 3MBXH 4PRHA 1PSKH 5MEND 1AD9A 4NN5B 2ZOKA 3U0TB 3SQOH 5JPNA 4XNUH 3RKDC 5KBNC 3TLRA 1AKJA 1T7WA 2UYLA 3S36H 1C5DA 1VFUA 5IR1A 3LN5A 4WO4B 3RVVD 5KSVA 2HVKA 4WI7A 3VXRA 2V9RA 4RX4A 3RGVB 1P53A 5CEXB 5KVEL 1FLRL 2DIBA 3WUWA 4LVOB 3DVGB 3BRDA 5TGBA 3SOBH 1BLNB 3WD5H 1KFAL 43CAB 3G5VB 3U4EA 5F6HJ 2C3VA 1EXUB 1YUHB 3CH8A 5EU6D 4PGBB 3ULSA 4M61A 3ES6A 3DXAB 4LBEB 2DLIA 3OPZH 5DHXB 1KENH 5I19L 1BD2B 1YDPA 4GRLD 1UCTA 3V52L 2R29L 3QAZB 4M9PA 1FIGL 4NQEE 1DJSA 3IDMB 4G6FB 5IHZB 1NCDH 5GS1C 4YGVA 5KJRH 3KNBA 4OLYH 1DBJH 5DO2C 4LRNL 4NC1E 5FYKU 4JPKH 4Y4FC 3FQXA 1IGTA 2B0SH 1R24A 1OGAB 5EUOB 4XNMA 2L7JA 3P9WB 3VFPA 3CFJB 1F6FB 4OZFA 4WFFD 1GYAA 3GSVB 1G1YA 3ARBA 4U1IB 3DUSA 1N64L 5EOCL 4M5ZH 1EFXA 2WBKA 1P4BH 2EYSB 4WENB 4DW2H 4WW2C 1R3IH 3OQ3B 5JW4M 1ZE3C 5GIRA 4LKCA 5D5MF 3WNLA 2X5PA 4DN4H 2AJYL 4L3AA 4PJAB 4KRPD 2EC9T 3NCJH 2YXMA 4RAHA 3LZFH 1NKOA 4LIQE 4JZJC 3NA9H 4GRMB 4OD3L 4QXWA 4R97B 2XTJB 4UIKL 3EFDL 4ZOAA 3V4UL 4XHQA 3BZEA 1CK0L 1JGLL 3EHBD 1P84J 2K9UA 1NAKL 3T2QA 5ETUB 3EDEA 4R26H 2HLFD 2KZWA 3EOTH 4ODWB 4OIIH 1BBDL 3PP4L 2BERA 2VLRE 2IAMB 4J7RA 5F9OL 5C08D 2YA1A 3KYKH 4J2XA 5MEPB 2IFFL 2XN9D 1NCTA 4HIJA 1PY4A 2B4CC 3DHJA 3KHOA 3VRLF 1UWXH 2IANA 5BZWA 4QHMA 3SJVE 1W0VA 3L3IB 3QPXH 5J57B 4KMQA 4PP1D 4X5XA 5HGDB 2DTSA 3E6HA 2P8LB 2PTVA 4JDZB 1ZT1A 4ODTL 4PS4L 5LGHH 4NRXA 4G42A 1I3RA 2WW8A 1KJVB 4EUPB 2A0LD 4HAGA 2VAJA 3QIWA 2EEAA 4ZTOH 2OP4H 1FIEA 3RI5F 5FK9B 4GMTH 5IB5A 3C6SA 2D03L 4IIQC 1WT5A 1TNNA 4UB0H 1WF5A 5C3TA 4JQIL 1I9EA 1PEZA 1RZKC 4O5LH 2Z35B 5D70L 4MA7H 2VLKE 4HKBB 1A7OH 5IBLC 2ZUQC 2OTUB 1XEDA 4R90L 3CAFA 1OPGL 4URTB 1CT8B 5EUKB 5BXFB 1G0DA 4WFGD 1G9NH 2CLRB 4NQVB 1YNTA 3LDBC 3B9KB 1XF5A 4PRPE 2V5SA 2Z8VC 4JPIB 4G3YH 4YNYB 3T1FA 3UTSA 1ZEAL 2DIAA 2IALA 2FJFB 4XB8A 5DQDL 3EJZC 5HGHB 2WQRA 5D7IA 2EDTA 1VEMA 2KZ1B 3BWUC 3WLBB 2OYPA 3RWJA 2BJMH 4D0CB 3QDGA 2V2WA 1RUAL 1I9IH 4YDIH 3RQ3A 1H15A 3MRGB 3RWIB 4FP8L 2EH8H 4R3SB 3X3GL 4XB7A 5EC1A 4ZUUB 2GJ6B 3CJJA 1Q94A 4XVJH 1JWMB 3DHMA 3DUHA 5DD5L 3LKSB 3RJQB 3TNNA 4Y5YA 4G9FB 4HH9B 4R4FH 4FQHA 2GTWA 1KIRA 5FO8B 4QCIB 1CGSL 3GMLA 3G6AB 4P3CL 5JA9A 1OW0A 4IEFB 4MJ6B 5DEFB 3D3VA 1IQWH 4RAUA 5IK3A 5C0FB 3CLFL 1FNEA 4DAGH 3QULA 3HE7B 5DLMH 1OF2B 2O5YH 5HYJD 1MFBL 2XZQH 4ODXA 5HPOA 3MYZA 3VXPB 2D9CA 1IFHH 2GKIA 2HG5B 3PQYD 1YMMB 3O3DB 2X89A 3GI9H 3FT3B 4PTUA 2X2YA 1AQKL 3QDMB 3O4OC 4P57A 1CFQB 1TVHA 1TVBB 2I07B 4PJGA 3MGOB 2HRPL 4MB3A 1FL6A 1DUYA 4CADA 5DC0A 3REWA 4JDVA 2AJUL 5KVDH 1MUJB 4DVRL 4UDUA 5LXGL 1TMCB 4H26A 1F00I 3INUL 1D6VL 5C0ND 3MV9D 4ONOA 5IT2L 4CU6A 1I4FA 5C0BB 1KV3A 2K7PA 4KHXH 3QIBD 3RIAF 1MEXL 3O4LE 4FQXD 4NBZB 1ZLWK 3JWOH 4FMKA 3V6ZA 2YPLD 1KNOA 2JJUA 4PJ8D 2Q20A 5L2KE 1LEGB 1MJ7L 4JFYA 3LB6D 4LSSH 4P2YA 1U3JA 4PREA 1SMOA 3MLYL 2KUTA 4X7FC 1NCBL 1JHKH 1CGWA 5GRWA 2GSIB 3HRZB 3T2OA 3FFCA 4L29B 4J1UA 1FFPB 2E7CA 1WC7B 4AEIH 5E2JA 5ECJE 1U41A 5DHYB 3WIIL 5IIEB 4JO1H 4M4RA 5IF0A 2F74A 3X12B 2X4PB 5JLZA 4I13B 1JRHL 5IV2B 4EIGB 3I50H 5KOMC 4K3DL 1CU4H 5HI3C 3TPKA 2NY6B 3L95A 4CMHB 1A1MA 3LRSA 2HH0H 4NO0B 4EI6B 3HB3C 1IAOA 5DJAB 2J8OA 1AXSA 3VGDA 4F7MA 3N1FC 3S35L 4UILL 4I48B 2G60H 2VXSL 4HIHB 3ULVF 1T80A 3O3EB 5KVMC 3C9NB 3TFKD 2FYYB 4H8WL 4X9HA 1KUMA 1P2CB 4ZSOB 3GMNB 3UXFA 2ERJC 1U3HC 3MNVB 2FSEB 2UY7A 5FM5M 2ZUTA 4BUGA 1NSNH 4P46D 4ORGA 1IEHA 2NY3C 2OL3H 3REVB 3STZB 3CSBA 3LKNB 4J4PD 5I1JL 4HJ0C 4WV1C 4I18B 4MQXC 3NABL 5JO5A 4YDLB 4TPRH 1F11B 1ETZA 5ACZB 12E8H 2D3VA 2DF3A 2DQDH 2J6EH 3B9EA 3Q48A 4JQXA 4P2RE 4TUOB 3SY0A 3PWUA 3IDUA 1MCOL 2Z4QB 3VFUA 4P9ML 1YY8A 2GI7A 3ECBA 5F3HB 5KN5A 2CO7B 4XNYL 5FYJH 1BEYL 4HF5H 3V0WL 1JNJA 2ZCLH 1U8JB 1V05A 2UV3A 4IRJB 4NCC2 3DV4B 2WIIB 3LKRB 1F3DH 5JOPE 3BP7A 4MGXA 5L8JB 4MXWL 2XZCL 4OV6F 1LK3L 3RL1A 1S5HA 1H0DB 3MYJB 3NFPA 3MLXL 3MRJB 3U4BL 1JZ8A 3PIQB 4JFHE 1G7IA 1LO0L 1PGRB 4CVXA 2BY2A 1YPZB 1OL0A 1WZ1H 3BEWB 5JXAL 3DGCR 5BW7A 2AV1A 1JF1B 2WLZA 1AGFB 3NOIA 4KH2A 1HSBB 3EOAA 1LO4L 3G6JA 3PV7A 4CRPA 3FQNB 4NGHH 5JZ7D 4M7ZB 1Q1JL 4M02A 1HQ4A 3F6IA 1IC4L 3GBMH 3C09B 4N8CH 4X5LA 4HUXB 4XCEA 5D96B 2BX5A 5JIKA 5F3BA 3QR2A 2X1WL 1WGOA 4PRDA 5H2BB 3VRJB 4Z7NF 5FF6A 1CL7L 1T7ZA 2AEPH 3JWDC 1QKZL 5DMKA 3MRCB 2HLAA 4MNGA 3MJ6A 1FNAA 4ONHA 1ODAA 4PJGF 5JIIA 5JA8B 2V9QA 4PRID 2XRAL 3KLAA 1KCRL 1UB6B 3IXAB 1FVEA 4PJXF 1AO7A 2X4UB 5F1IB 1QTYT 4LCUB 3OKMA 4TVPL 3MLRH 5CBAB 3VFWA 3BP5A 3RWFA 2Q6WB 2BVPB 2X4SA 3AM8C 2HTKD 1T22A 2ARJB 1XGPB 4IHOA 4QOKA 4X7TB 1KPUA 3MODL 4XP6H 3T3ME 1FAIL 3MFFB 1D5BB 4JFDD 4JRYD 3PNWA 5IFHH 3P0YL 1M71B 2F58L 1QRNE 2X4NB 4L4TD 4MAYC 4X5WB 5IQ7L 5T1LA 1JK8B 2QV2A 2A6JB 4KKCD 1U2CA 1XR9A 3H9SA 1CBVL 1WWWX 1HEZB 2VZSA 1R5IA 3LQZB 5J12C 3MOBH 3R0NA 1LHZA 3WDHA 4QHLA 3WNOA 5DJ2B 3KR3L 2K7QA 4GRWE 4HUUB 4JM2C 1U8MA 2H32H 4FA8A 1J10A 3B5TA 1QO3A 3SDDB 2DQUL 1QHOA 4X80H 2VQ1B 3G04A 1LP9A 1MCQA 2D2OA 3DV6A 1M7IB 5E7BA 3JTTB 4Y1AE 1GPOL 3QEQE 2R9HC 4FNLH 3O2DL 2D7OA 2V17H 4DVBB 1CF8H 5C9JB 4B41A 1Z0MA 4JDTH 3X13A 2X7LA 4RA0C 1DVFA 3TA3C 1Q0XH 2O61B 4FZEL 2VXUL 1R3JA 4PJIB 2DQIH 2ZJSH 3L1OH 4JRXE 2NXYC 3UTTB 3KLHC 1RZJL 4UV7L 4MCZB 5I8EA 5GS0C 4AENA 5T3XL 3DX9B 1PG7W 2IH1A 5L8LB 4HPYH 3PWJA 1IAIM 1KIUA 1VEPA 1K5NB 3FT2A 1E28B 1EHLH 4FG6D 2X1QA 5T5FL 5MI0C 3QEGL 4NKQB 1RY7B 2CUHA 4OZ4A 3ARFC 1OSPL 2P44B 5CJQH 3QXAA 4JZNB 3VWKD 5BJTA 2B39A 5T1KA 1NGQL 2VL5A 4W4NA 1XGYH 5SWZE 4PFEA 4ZG1A 1N4XL 3DBXB 2ZUYA 3CLEH 5K9KA 4Z95L 2BVQA 4Z0BL 3GUTA 5I6XB 3FQTA 3EAKA 2CLZA 1MFDL 3TZVD 5AUMB 3BJLA 4LLYB 2J5LC 4G8GB 5DVMA 3V6OA 1CLZH 3MRNA 3IF1B 3SCMC 3QHFH 1NCUA 1A9EA 4NZJA 2OQJA 3BPCB 4ZUVA 4H25B 4NBYB 3NZ8B 1J12A 1VGKA 1JHLH 1CICD 4NUGL 5IGXH 4WWKA 1BQLH 3L3JA 1T1WB 5JHLH 2A1WH 2YK1H 3OHXB 3PGCB 2X9WA 3ZKSD 4HKXA 3ILQC 4ELME 3DTXA 2VLLA 4KGLA 3CFEA 1TZGH 2H2PD 3P0GB 4FXGA 4G6AD 4N0YH 1PKOA 4JFZH 3MZTA 4KJWC 4NO5A 3WLWD 2EDRA 4B7IA 5KS9F 2DQFA 1JTPA 5LVEA 4X99A 4PY7A 4P23D 4POZC 4YIQA 4XC3H 5C0RH 4NSKB 5BS0E 2WSKA 1D5IH 5IMKB 4OLZH 1CG9A 2AJVL 4HXBL 4NUJA 4ZAKB 2BC4B 5F96H 4BSVB 4KMTH 1NBZA 4NKMA 5IB1B 3CK0H 2V5YA 5B39A 1PZ5B 2JJSA 2E9BA 2VR9A 5I8OL 4XNZC 4K7PH 1K4DA 1AGEB 3T3PF 4PRNB 1U58A 2C7UB 3B2VL 5K9JL 2J12B 3GB7A 4GG6A 5GRVK 3PP3H 4JPVH 2KL6A 4PRAA 2F19H 1QSFE 3KVQA 2EDKA 4O2FA 2GEEA 3KPNB 4XP1L 2D4FA 4Q58C 1GIGH 2F9BT 3DIFB 3C60D 5IBTH 1CZ8L 4QXTA 4I3SL 1R0AL 1NLDH 4IOSD 3ELAT 4JO4H 2GT9B 3PJSA 1CVSC 3I3DA 3GIVB 4XXDA 2L0DA 1KJ2H 4KK9D 3SDCA 3ZSTA 4NP4H 3ALXA 1F4WL 1Q9KB 3ZYOA 3ULVL 5D6CA 3L7FB 4WTZG 2H26A 5CZXD 1U0QA 4DTGL 3HR5B 4S10A 4QXUL 3NFNB 4N0FB 3MRLB 1ZHLA 2EZ0D 3MV7D 1JMXA 1G7MA 5AWNH 1MF2H 2WP3O 1Z9MA 1F58L 3MCLH 4FQ1L 4PRHB 5HHNA 1AD9B 3VFGL 3VXOB 1S7VB 4GS7C 1RAMA 2ZOKB 3O6FD 3LHPL 1NH6A 1G9ML 4AQ1B 4AEHH 1WK0A 2UYLB 3RWHB 4M6OH 4X7SL 4YQXL 1PLGH 2MMXA 3LN5B 2HVKB 1R5WA 3QRGL 5FM5O 5DTFB 3BUYA 3IAGC 4XH2B 5F7EL 5AZEL 4KU1A 3WUWB 5C6WH 1LO3H 1WZLA 3RVXC 2ZWLT 3T0WA 1KF9B 3L3DA 1J1OH 3U4EB 5IBUB 2C3VB 8CGTA 1D9KA 3ULSB 2VDLH 4M61B 3ES6B 1T83C 1FAKT 3QISA 4RWHA 2BVEA 1VKXB 1INQA 1RQ5A 4CDHA 4I3GA 3BZDA 4N8PA 2ARJQ 4KDTA 5J7CC 4OSUH 5DD0H 5D1XC 4HX1A 4YGVB 4Q6IC 3RBSA 4LARH 1G6RH 4M5YL 3KNBB 5GGRY 5E2TH 2JLLA 5EU3A 3FQXB 1QBML 3V5DA 1MIEH 3LD8B 4M1DH 5AAWA 3VGAB 5D72L 3QEHA 3VFPB 4OZFB 1CD1A 2A38A 3ARBB 5GGVL 3DUSB 5CMAB 1W8OA 3S98A 1T21A 2AABH 1EFXB 4QRSA 4YBQD 3LY6A 1DBAH 3WNNA 5GIRB 1T5WA 5B3NA 4LKCB 3FOLA 3TYGH 2VUOA 3L5JA 5DURB 5ADOL 2NY2D 4TNVF 4UNUA 1YQ2A 4L3CA 4FQ2H 3TV3H 3ALWA 1PVHA 2ZPKL 3RKDD 1TJHL 1EFQA 3LMJL 3BZEB 1PFCA 1I1AC 3CVHL 4AG4L 2Q86A 5BQ7B 3UO1H 1A4JA 4KDWA 2HKHH 2IQ9H 3S37H 3SJVA 3O2WL 2OXGA 3B2UD 4BFBD 4GKNA 4TSBH 2RHEA 3UBXA 1Z5LB 5HYSB 3H42H 3KYAA 1OD9A 1J5OH 4HIJB 1MNUH 4P59H 4QRTB 5F8QC 5BZWB 2IANB 2HT3C 1MRFH 1ZHKB 1W0VB 4XWGH 5CZVL 2AERT 3HZVA 3B9AA 2E9IA 3MREA 4LCYB 2W0KA 3QHTC 2PNDA 4X5XB 5EU7E 3E6HB 5FUCE 1XGQB 4JE4B 2C4XA 1RZFH 2FECI 1DEDA 4NRXB 3GJFA 3OJDA 1SY6H 1LK2A 4G42B 5MENE 1I3RB 5DD3L 3JSSA 4JB9H 2VLKA 3QIWB 3QI9D 1HZHH 4I0PB 4Y4FD 4F9LC 1IGCL 4W6YB 3OWEA 5IB5B 3C6SB 1MFEH 4WI4A 4RGNB 4NM8H 4J8RA 1K85A 1HINH 3SGDI 5J6HB 3IU4L 5JQHC 2VXTH 5E8EA 4YDKH 4GUPB 4PRPA 1U92A 5H37H 4APQC 5D7LD 2NY5L 3TGXA 2AV7A 4RISL 1ED3A 4RMWA 5EU6E 4D94A 5T1DL 3IDIA 1YNTB 2Q8BL 3P4MA 2QKIB 3RGHA 1T1XA 4F58L 2FATH 3T1FB 4PGZA 3WSQH 2IALB 1YEIH 3SDXE 3RKPA 2H6PA 3W82A 2EE2A 4KPHL 5D7IB 3HE6A 2BY0A 2FGWH 5I71C 3U0WL 3RWJB 1IT9L 2MCPH 3QDGB 2V2WB 4JQXC 4FXKA 2JB5H 1H15B 2LAGB 3MRBA 1RZIA 4WFFE 4OGXH 5DRNA 4XRCA 2AVGA 3SQOL 5EC1B 1U9KA 3QJFA 1Q94B 1E4WH 3TNNB 4Y5YB 3D18A 4PGDA 2DKMA 2PO6A 5GJTL 5D93C 3S36L 4FQHB 1KIRB 3UAJC 3OKKA 1NCWH 3OG4B 4OM1L 5J6GA 3GMLB 3QQ9D 2IPUK 3QFDA 4XHJC 5CP7B 5F9AC 5CIPB 4G6MH 5FECA 3MMEA 3D3VB 4RAUB 5IK3B 4XCCL 3K4ZA 3QIUC 1FNEB 3SOBL 3MBEA 4ODXB 4ZNEE 1KCLA 2BP3A 2CR6A 2J3SA 3K3QA 3FCTA 5DZLA 4ZFZA 1WSST 1ZTXL 2VC2H 4P57B 1TVHB 4PJGB 3DSNA 5SV4A 1NCDL 1FL6B 5C08E 3CVHB 5TE7H 5IOPA 5KJRL 1S7WA 2XN9E 3U7AA 3AS2A 5AAMA 4A6YA 1DBJL 4CADB 5E8OA 2MQ3A 4JPKL 4JDVB 3U7YH 4UDUB 2QLVB 4NKDA 3FHAA 3LKQB 4H26B 4NN6C 1UACL 1XT5A 3RDTC 3VFNA 3O4LA 4WGWB 1PKQE 4DOHE 4PJ9A 1I4FB 1IM9A 1RULL 2SEBB 3U46A 1XF3A 4WHCA 4KKBC 2VO5A 5F7NC 1KC5H 5DJ6A 4LPTA 4X6DF 1YECH 2YMXH 3K8LA 5IMMA 5IG7A 1L6XA 3SE8L 3NCJL 1F3DJ 4YE4H 1FVCA 3LZFL 1MJ8H 4I5BA 3FRUA 4JFFD 4JFYB 2ZNXA 4G7YH 2APTA 5A3IC 4PREB 5C7XH 3RU8L 1QFHA 5FYJU 3GSNH 3MRPA 5KSAD 5HHXH 3QWQB 1OTTC 2EDEA 3ARQA 4O02H 4QT5A 5I74C 4WFGE 3FFCB 2NY4D 2HT2D 3SKOA 4XPGH 5GZNC 3QJHA 5DJCA 2X09A 4QHKI 3KYKL 3S5LA 5L2JA 3F58L 3ZE2E 1HHIA 1XIWA 3QPXL 3MROA 4OKVB 2F74B 2IMMA 5EBGA 5JLZB 1NGXA 4Z77A 2FHCA 5MEOA 4WNQA 3TBWA 1BX2B 4H88L 1FGVH 5EO0A 4N90E 4Y16D 2ITDA 4POUB 4TRPH 3L95B 1JNHA 3LN9A 3LRSB 4XVTH 3SEPA 1AXSB 4HWUA 1KELH 4F7MB 4FN0A 2JK5A 3BHBA 3ZKXC 2DDQH 3QUMA 1BFSA 2OP4L 4R7NA 4ZTOL 5FO9A 1G7JA 3A0OA 4U2ZA 2VDKL 1BBJA 1IC5H 4WEUD 3W81A 4UB0L 4YJZL 4EJ1C 2P24A 4O5LL 3HZKA 4ORGB 4P2RA 5LBSL 1RD6A 3PL6D 5EB9A 3TO4D 4PJCF 4JREB 5HYJE 5EBMA 4OFPA 4J3VA 5FDWA 3ARTA 1FLTX 5JO5B 3PQYE 1FFQA 1F45A 4M43H 1FZOA 4N1EA 3SY0B 3PWUB 4R6UA 2VKWA 4XP9H 5C0EB 3VFUB 5BCAA 2DB8A 3LH2L 1YY8B 3ECBB 5KN5B 2G9HA 3LEYH 3GBNL 1X5FA 1UCBH 5GRUH 3ARGD 4I1NB 2BJML 1W0YT 4KV5E 1I9IL 4D9RD 4NJ9L 3HNTL 1OB1A 3BP7B 2CR3A 4LLUB 3PDGA 4DGYL 3RL1B 5JOEA 1S5HB 4PJFE 1ZLUH 3NFPB 1J0ZA 1T6VN 5JXEA 1BOGA 3SDAD 1G7IB 1MCLA 1BQHA 5E6IC 2FBJL 4XVJL 5SV3A 3S4SG 3BRFA 4CVXB 3R8QA 2I60L 4MJID 4R4FL 1I8LA 2AV1B 4LLWB 2EYTB 5I15L 3EOAB 1I3UA 5HI3D 3G6JB 3FQRA 2YD5A 1RSFA 3BD3A 1IQWL 3HB3D 4MD4A 4P2OA 2YPLE 3TVMC 2RR3A 3WJLA 1HQ4B 4Y0GA 2O5YL 3MXVL 1E0OB 1QUNA 1J05A 4XCEB 1IKNC 2J8HA 5F3BB 5ITBL 5C86A 4YX2H 4PRDB 5FF6B 1BFVL 5AYUL 1T89A