4OZIE

S2 protein complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
202
structure length
199
Chain Sequence
b'KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGDGGSFSGGYNKLIFGAGTRLAVHPYIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 199
sequence length 202
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziE02
1MPAL 3BO8B 3WS6A 1FSKC 3M17A 4Q7DA 1QRKA 2JIXA 4YX2H 4OQTL 3ULSA 3QUMB 5ISZE 3UBXB 1DLHA 4CW1B 4OCRH 1P1ZB 4LGSB 1NBZA 2FIKB 1OSZB 2OR9L 4ODBD 5IFJB 4XP6L 2WM0A 5E6ZA 4OZHA 1Q9OA 4LKXB 4JO3L 1I8IB 3FOMB 4ISVA 4R97B 4CMMA 5E6IA 3HCVA 5CILH 5F21B 2P8LA 2A9MH 4U1SB 5ACZA 2Z0BA 3ARQA 5D93B 4OKVA 1IQDA 1Z9LA 1A6AB 4WO4A 4WW2C 4OI9A 5GSRB 4PJXF 1FNLA 5ICXA 4PS4H 1M7DA 4YDIL 3VCLA 3B83A 2H3NB 3OBAA 1EZVY 2FATH 4Z18A 2GQHA 3W2DH 5CGMA 4ONFL 1WLHA 2WLZA 1SY6A 3FQXB 3QRGH 2NZ9D 3CX5K 1SM3L 1ZGLB 3AMKA 3X3GL 5CP3A 1EVUA 4ELME 4RMTA 1D7FA 4K2UL 4XWGL 4PJCF 1U8HB 3ARYA 2QSQA 1BWWA 1NMCB 1CDJA 2DM2A 3TNMB 1S8DA 3GSQB 3WFEL 1QFUL 4PG2A 3EGSB 4YGVA 4JANA 4BFIB 4DVRL 3OAUL 1HWHB 1JNNL 3TPKA 3DVFA 4OZHE 4ZAKB 4FA8A 4U6YA 3U46B 1P4LA 3OPZH 4OIAA 1LEGB 4MJ5B 3BISA 5F6HI 3WEXA 3HLAB 3DV4A 1KJMB 1CGVA 5KJRH 1REIA 1UYWH 1X4YA 2Y36L 3EOTL 3W39A 3DYOA 1IC7H 3INUL 2Z35B 5ADOL 2B7DT 5HDQL 3RWIA 2VITA 5TGBB 4PD4K 2RFXA 3N1QC 3OHXB 4K3EH 4QHMA 5ELIA 3VFGL 4R3SA 4Z0XA 1D5BB 2QKIB 5EU3A 4M48H 2LQRA 3AREC 1H8OA 2HRLA 4UNVA 1SYSA 3FB6B 2VH5H 4HEME 5KSVA 1X5FA 3MLWL 1EJ6A 4HQQL 2YUZA 4W6XB 3UJIL 3MV7E 2BHUA 1ORQB 4WI5A 3KNBA 2VUYA 2EH7L 4PGDB 2W0KA 3EYVA 1I1RA 5IVXA 3ZHKA 2IAND 3OXSA 3WNKA 4MMXC 2NY2C 5JW3H 5D7JC 1K8IB 1CFQB 3PXJA 4EOWL 1FFNA 4P4KB 4C4KO 4CUCA 5C0RL 4PR5A 1ROWA 5D2NA 3QAZC 4M9PA 1SQ2N 3TBTA 3KLAB 5IEHA 5B39B 3F6LA 3ARED 1AJ7H 4FQLL 2I60L 3RRQA 1AE6H 2QQKH 4DKAA 1XR9B 4HWUA 4OLYL 1MRFL 2FJFB 3TYGH 2ZCLH 4ZXBD 3REWB 3VD4A 3SE4A 1BBDH 1YNLH 4NZDA 1LILA 3VFRA 3TWCH 4OGXL 4AY0A 4C57C 1N0XL 1ONQB 3HAEB 5I1EH 2LVEA 1U8QA 5FA3B 4NN5C 3T4AB 1MI5B 1JPSH 3D3VD 5D7JD 4YE4L 2XWTB 5DJ6A 3RWJB 3GMNB 5L88H 2YPVH 1B0RB 3MGTB 1FVEA 2HN7B 2R0LH 1Q9KA 4V2CB 3D39A 2P5ED 4MD5A 4Z7NF 4GG8B 1A2YA 5I8CB 5I15L 4P2QB 4D0CA 1JZ2A 1PLGL 1VADA 4DGVH 5EN2B 4M6NH 1WISA 4U0QB 3IKKA 1FVCA 2O5ZH 3MMEB 1IC5L 1A5FH 4WIQA 5EC2A 3TPUB 2X7LB 3KLDA 4L3EA 5I1JH 3KWWB 4ZNEE 4PTUB 4KUZL 2WP3T 4W6YB 1FZMB 3GKWH 4ETQB 2E9BA 4LAQH 2V17L 5ANME 1XZ0B 3U82B 2EDLA 3IU3B 4GBXB 2QADD 4XTRD 1UACL 3NTCH 3AAZB 4Y5VA 5L7XH 1QRNA 3QFDB 4KI5F 1H15A 1OSPH 3TO2B 5F6HJ 5H2BB 3ARZA 1FVDB 3BGMB 1U8LB 4FFYH 3U2SB 3RWFA 1KN4H 3HE6D 4MNQA 5I75B 3TJHC 3QXVA 1OP9A 4Z0BH 1UWEH 2XA3A 5EH1A 3NACH 2GK0B 2VLKB 3ABZA 5EU6B 3NCMA 1C16A 2VSDA 3KPQB 1BOYA 3VWKA 1E6OH 1HZHH 1BBJA 1G9EA 5HHQB 4L3EE 3CFBB 1IM9B 1TNNA 2IAMC 4GRWH 4MD4A 3SDDA 1A14H 1FO0B 2XRAH 4HFUL 2DF3A 4Y89A 4Y16A 3N9GH 4DW2L 3B9DA 4HH9A 3UTTB 5JR1H 3C5SB 4PJIB 4WGVB 4J1UA 5EFIB 1DZBA 1SMAA 2UY7A 3MCG1 4XNUH 2MTPA 1ND0A 1KBGH 1XCQB 3MX0A 1V3LA 2YD8A 2UWEF 5C0BA 4LVOB 3V7AG 2B39A 2FD6H 3EOYG 3P0GB 4LCUA 3ALXA 5DHVH 1AGEB 4MNQE 1TPXC 2BNRD 3AY4C 5HTSA 2BY1A 1T83A 3O2DA 2CDGA 4OFYD 4J6RL 5JO5B 1V7NL 2FYYB 2VDNL 2YPKB 3FQRB 3O2WL 4X6EB 1R5VB 2G5RA 4XNYL 3MODL 4RFNC 3O2VL 2YK1L 4L4TB 1TQBC 1DUYA 4GW4A 4JFPB 5K33A 4ODTH 4LEOB 2X4TA 4HIJB 1CGWA 2OQJB 5I19H 1F58L 4W4OA 4PP1C 1ULVA 2X4RA 5DA0B 2XQBH 1MH5B 1JRHL 2Y4SA 4C83A 3QUXA 1BFVL 1LO3L 2FLBT 4N68A 1BF8A 1ZHNA 1JUFA 2J2ZA 1FPTL 3PJSB 5DC4B 5L9DL 4BH7B 3RIFF 5F7LB 4ZMAT 2GSIB 3PV7A 3V5HA 4G8IB 1WWAX 2O26U 3GJEA 3IS1X 1AXSA 5ID0A 1HWGB 3KAAA 4K8RH 3LQZA 4OFDA 3QFJD 1QEWB 4U0RC 4ODSH 3I6LD 1RZFH 5F72S 1G1YA 5HYJB 5F9DC 1G9NH 3CDGB 1CLOH 4ODWB 4RX4A 2AEQH 3IFNL 4IRJD 1F3DH 5FGBA 4JJHA 1H3TA 3TT3L 2Z4QB 1HI6A 1R24B 4ZUUA 4XVJL 3QNYA 5C2UB 4GH7B 4WGWB 4DGIH 3BT2H 4FZ8L 1WCBA 3ARTA 4GXVH 4UTAH 2BVOB 1KXVC 3HZYA 4KV5E 3WD5L 4JM2A 4ZYKB 1CFTB 3QO1A 1K3ZA 2HLAB 4P3CL 4XPTL 3MLZL 1IGTA 4XH2B 5CSZA 1H0DB 2E7LC 4D9QD 5IQ9B 4DEPC 3H9SE 5FYLH 2PYFA 5GGSA 3HE7C 3QDMB 4WWKC 1GAFH 4DZ8A 1JGDA 1CQYA 1I9RL 1NCBL 5IWLA 3BEWA 3KPRA 4JG1H 1YEHL 2NY3C 1EV2E 1RZ8A 3CSYB 2D7OA 1NLDH 5C08A 3WE6A 1KJ2A 3H3PH 5GS3A 2JB5H 2PN5A 5GSVB 4LSTH 3ZKXC 5JW5A 1NAMH 1RUKL 3K80A 1A3QA 1XH3A 4RNRB 2JIXB 2P47B 3ULSB 1WTLA 4TVPH 1IC4H 4M1DL 2CR6A 1PKOA 5J9PB 4XZUA 3VG9C 4ODVL 1S7SA 2R2EA 3S96B 4RISH 2EDKA 3HE7D 3EW3B 4N90D 1KTDA 5IV2B 5ACZB 1CLZH 4DAGH 4FABL 3NZHH 4GMSL 4HV8A 1YA5A 1MFAL 4KI5C 4I48B 4QWWC 1VDGA 4NNPL 2NY3D 5B22A 2VL4A 3KPRE 5DQ9A 5IHBA 4RGMC 3F7YA 2D7MA 5L0QC 1C1EH 4F3FA 4KAQL 2C3VA 4NOBA 3KYAA 3GI9H 3MJ9H 5FUOH 2HJLA 4LSVL 2OI9C 1JNJA 3ULVE 1XR8A 5GHWL 4O2FA 1UC6A 1J7VR 2CKBH 1DFBH 3SKJL 1WSST 5JHDB 4XVTH 2A77L 2DMCA 2N7AA 4HT1H 3FN3A 5GRZA 1RUML 3OX8B 5GGTL 3RUGA 4A6YH 3PXHA 4F15C 1UJTA 4JANB 5I66A 3RWGA 5F1NA 2OSLB 2ZUQB 2APTA 5EZJA 4Z7VF 1JGLH 5D7LA 3S35X 2ESVE 3SQOH 1P6AB 3BKJH 4KI5D 1P84K 4QWWD 1D5IL 3VGFA 4XPAL 4ONGL 2D03H 4A2MA 4AG4L 3WIIL 1FFRA 4R90H 3AMLA 3AM8A 2LAGB 2AJZA 4TPRH 1PQZB 1CD9B 4YNYA 2VDLH 3DVGB 1JWMA 3RWIB 4JPVH 5CUSL 4GW5A 4JLRB 4PJDB 4R3SB 3S4SA 3TESA 3LAFA 4LLAA 3OKNA 1TTFA 4ZUVA 1EGJL 1PW3A 4XMPH 3PWVB 1SYSB 5D1QB 1MAJA 4XXCA 1PD6A 1Q0XL 1JMZA 2OXHA 5KSVB 3FQUB 5F9JA 1IGMH 1KCVH 2B20A 4LNRB 3MRHA 3RNQB 3CUPA 3QHFH 1T1YB 3VXUD 5I71C 1QLRA 3UPRA 3L7EB 3IFPB 1FFQA 1SJVA 2CLRB 1URLA 4UTBL 5KG9B 3KNBB 5BRZE 1YECL 3GSOA 5ENWB 3EYVB 5IB1B 5DZNA 5IVXB 2CLZA 5I8KL 5BW7C 2W92A 2Y23A 1KC5H 2YUWA 4Y88A 3RWHA 3P73B 2N1KA 1OAZL 1R3JA 4PR5B 3P11H 1ZT7B 1BD2B 3TCLB 1L7TL 5C2BL 2JJUA 1F3JB 4A2LA 4MVBC 3QDJB 5JORA 5I16B 3OJDA 4Z5RA 1MCJA 1RU9L 2BC4A 3MOAH 5F7YC 4Q9RH 3EO0A 1FRGL 4D8PB 2R2CA 2YD2A 4P2CG 4M1CC 4UUJA 1GCFA 1FIGL 3VA6A 1MRDL 4G6ML 3VXOA 4HS8H 4XC1H 1EUUA 3S36X 5KVEH 1U8QB 4KKBC 2DTSA 3KLHC 3T1WA 1H5BC 2VZUA 3BZEB 4EIGB 5DJ6B 1MCLA 1QSFB 1LEKB 1U41A 5TQ0L 4RQQA 4GLRI 4M6OH 3MJ7A 3MNVB 1CYGA 3D39B 3B3IB 4MD5B 5E2TL 4YDLB 3CH1A 2WZPD 4CL7A 4F33B 5IB4A 4N8VB 1WAAA 4MVBD 1RULL 4LQFH 4XRCA 4OLVL 2J3SA 1WBYB 5DMJB 2Q7YB 1PEZA 4HG4J 1VADB 3KPNA 4OLUL 5C8JA 3ARRA 3MOBH 1S7VA 1LHZA 1CGSH 3KPPA 1QFOA 1HHHA 3MFFB 4G3YH 1A3RL 4NQSB 3MV9E 5D1ZC 1TTUA 4KKBD 1G0XA 5TE7L 3KLHD 3TT1L 4Q9CA 4FQXA 2RR3A 2ATKB 1BVLA 4M7JL 4YH6A 3ZYOA 3C60C 2WWKO 1NEZB 1MCRA 3QIWA 1P69B 3MRQB 4S1QH 3ILPB 2A83B 3H9YA 4NC1C 1MI5D 4K55A 4NKIL 2DWDA 1QHPA 3FN0H 1EHAA 4OF7A 1F4WL 2AS5M 4NIKB 2FSEA 2YD7A 1NC2A 3MGOA 3IDJB 4NZUH 1FZKA 4F37K 2QR0A 4XPFH 4LGPB 1VEPA 3RBSA 2B0SH 1AP2B 2OTWB 3RGVD 5J1SC 3P4MA 4P2QD 5FHAH 3TV3H 1ZAGA 2V5RA 3F5WA 3DX7A 7CGTA 5KOVC 5D1ZD 2AK1L 3SDDB 4MD4B 4NQTA 5F9AC 4YFEA 4O58L 4WFGD 2EC9T 3PGCB 5C0EB 4B7IA 5DD5H 4Y16B 3EYOA 4HH9B 4PJ9C 5BS0B 1N6QH 5F7EH 1OD7A 1OF2B 3TA3B 4LHUG 1CDGA 1U91A 3QDGD 2WWMD 2YR3A 4PJAA 2DQDL 3VGBA 1RZIB 5C0BB 4N8CL 5E8EB 2X1XR 4YQXL 1EHLL 4OQTA 1CL7L 3O6FC 3RTQC 5BJTB 4C4KT 4K9EC 3RKDD 1VGEL 4ZTOL 1FP5A 2Q8AH 5IOPA 4G8GB 3EDEA 4BFGA 4KC3B 2VLKD 4MZ2A 4R0LA 3RBGA 4XVSL 1S3KL 1L6ZA 4GW4B 3PQYA 2DWEA 3UMTA 4D0BB 1NSNL 1WEJH 2X4TB 5L2JA 1VGKA 1D9KA 2F19L 1LK3H 3TN0A 3VFPB 1KLGA 4GJTB 2FNBA 3Q0HA 4EXKA 3O6FD 3W9EA 3PWJB 3HC0A 3I9GH 4P0DA 3QULB 1ZT1A 2LABA 3Q2CA 1HINH 2V5SA 5D7IA 4BZ1H 2I27N 5E1AA 1BFOB 3FRPG 4I0PA 4NWUH 1U8OA 2F54B 4KTEL 3DSFH 2BSED 3MXVH 1K8DA 3VD3A 1RUAH 3CFIC 3LQZB 4V1DD 3DX9A 4CJ0A 3NIDF 3KR3L 4GAFB 5EU7C 3QXDA 3PQYE 4ZFGH 1G7HA 3MLYL 3O8XB 3SDCC 2XIDA 2VZ1A 1WZ1L 5JOFA 5TFSH 4LCWB 4H5SB 3WJLC 2X4PA 2VL5A 3C6LA 3HKFA 4G9DA 4YFLI 3P0YL 2NR6C 2A2QT 4F7EA 5DD3H 4L4VD 4MJIA 3OZ9H 3O6ML 4XC3L 2XKNA 5F3BA 5J7CC 3HAEH 3G6JB 3PP3K 3ZLQC 3CU1A 2P5WD 4JPKH 4F57H 3B2UD 1F90L 4M62H 2NY6B 3J8F7 4NN6C 5J6HB 5KSBF 5HHNA 1AIFB 1D5MA 1FNGA 1T0NB 2VXVL 3LKPA 2C3WA 2HJKB 3QO1B 4H1LA 1X4XA 1CD1B 4YC2C 1HKLL 3MO1A 4F7TB 5J11B 2H1PH 3S97C 2AV7A 3B9VA 4G7VL 2X5PA 4U1NB 3SDCD 4X98A 3IDYC 3AB0C 4PGBA 4LLQB 3BESR 5DD0H 1PY9A 2PYEE 1Z5LA 2P8PA 2ADFL 2NR6D 5C08B 3DGGB 3WE6B 1KJ2B 3UEZA 3IFLH 2DKSA 5DYOB 1A9BA 4R4BA 2W65A 3QNXB 1UKSA 4GRLC 3T0EE 5HYSB 1QLFA 3GSUA 3QZWG 4AEFA 4L4JA 2I26N 1S7QB 1RURL 3CXHJ 5T3XH 3WSQH 5SWZD 2VLRA 1LE5B 4HCRH 2ZCHL 1UA6H 4N0YH 2VDRL 3SDXB 5F6IC 5FKAA 2P44B 1ADQL 3VFNA 4HK3N 5IKCB 5GS0C 2Y7QA 3PGFH 2AJVH 1ZKAA 3RWEA 1KCRH 3PDGA 1S9YA 3MYJA 2IC2A 2DYPD 4PB0L 2HLFC 3BIAX 4GRLD 5LGHH 3V6ZA 3QWRA 1NC4A 1HH6A 4ZUWA 4LPUA 3V2AR 1QO3A 4CBPA 1XR8B 4BZYA 1E4KA 3GZKA 4O2FB 4KQ3H 3RAJL 4LSSL 3IRZA 2J1KA 4QTHA 4LVHB 2G75A 3ALWA 3WYRA 2V5MA 4JFHD 3RUGB 1NCWL 3V95A 1MCNA 5IEKB 3LV3A 5FA4A 5C0DB 1CG9A 2GCYB 3ZMRA 2VQ1B 5IB2B 2VLRE 3NH7L 3DRTA 4HUUA 4YHZH 2ZOKA 2NXZC 3M07A 3BPNC 2XY2A 5D7LB 4DZBB 4RGNB 1NGPL 2JCCA 2W38A 4EZMA 3I6GA 5I1KH 3DETD 2EO9A 1WFNA 5GS0D 3D85A 1A7RH 4JB9L 2B4CH 4Z76B 4MXWL 4GG6E 3OKDA 2HLFD 3IDGB 2XTJC 3UXFA 5TH2B 3T04D 1JWMB 2BFVH 2VABA 4LSQL 1RJLA 1N3NA 4KRPB 3QIUC 5C0CD 5EZIL 1CICC 1ERNA 1UM4L 4ZUVB 1P9MC 2EDDA 5C6TH 1UB6A 1R3HB 3Q5TA 5JNYA 1HN1A 1ZLVK 4X80H 1UEYA 2UVEA 1JFQL 2H6PA 3L5WA 5F9JB 5JHDD 2NXZD 4LVNC 5FM8A 4J3OC 4RRPG 5EWIL 2BNQB 5JXAL 4XXDA 3UPRB 4GS7B 3DTXA 5ESVB 2V9QA 2Z31A 3KYNA 4KJWC 3LOWA 2YA0A 4Y5YB 3F7RA 2XZCH 3X13B 5B38B 4GRWF 2CLZB 3ZDYF 4RFOH 5TDNB 1BVZA 5D2LB 3ARDB 2X9WA 4BK4A 2ZNXA 4AENA 2PUQT 3BHBB 3OF6A 3B6SA 3L95B 4U1GB 4YHKL 1EO8H 3VFOA 5FYJL 2DQGL 1S7XB 3OR6B 1Z9SA 3QIUD 2KBGA 4DK6A 3V52H 3MXWH 4S2SB 1F4XH 2WBWB 1X4ZA 3BSZL 4LF3B 1EMTH 4P9MH 4WFFE 5AZ2H 4QT5A 1JF5A 1HDMA 1L4IA 4U6TA 4X6CA 1FGNL 5EU5B 4XCFH 1YNKH 3ZE1F 2APVA 2X1PA 1ZV5A 3TO4B 3TZVC 5FCUH 5CBAB 1KFAL 1WGOA 3I2CH 4XMLH 4MQTB 1AD0B 1D6EA 1NBYA 3PV6B 4UUJB 3KYOB 1S9KC 1IAOB 3SEPA 1TVBA 2ZSWB 3QO0B 3C09C 4KJWD 1T4KB 3BGFC 5DRNB 1A6TB 2C1PB 2WIIA 4QHNA 4BFEA 4OLXL 3RIAK 3E3QE 3CMGA 3WL9A 3DUHA 1WT5A 4YHLL 3O4LB 4RQQB 4ACPA 3GHBL 4EI5C 1JHKH 5MHSE 3BW9A 1RHHA 4OLZL 4XBGA 3QI9B 4OZFA 2D9QB 3CH1B 1P53A 4OM0H 4M43L 1YQ2A 1BIIA 5IG7B 5IHLB 1L0XA 2AJXH 4Z7UA 4XRCB 4XHQA 1NGXB 5D96B 1WZKA 1QBMH 2IG2L 2QHLA 1Y18B 2BVTA 4X6CE 3TZVD 4JVPA 4ZD3L 1S7VB 5FYKD 3MQIA 1N0LA 1HH9A 3MROA 1HHHB 5T5FH 2R0KL 3QDJD 5C0NC 2L7UA 3HI6L 4LLVB 1R3KA 1UVQA 1YEKL 4MDJB 4JRYA 1U3HC 1DL7H 2FDBP 3MJ8B 2WBJA 4LSUH 3RVXC 2UYLA 2VDKH 5F96H 3MV8D 1RIUL 4FQXB 5GISH 3EO1A 1E6JH 5DJAB 4JHAL 2X1OA 7FABH 5IJKA 3DJ9A 2ZP0T 3G5XB 2A1WH 3RQ3A 2YWYA 3M8OH 3X3FH 2DWDB 1FC2D 1NMBH 3EOAB 3F6IA 3S8WA 3T0XA 4R8WH 4NCC2 4Z7UE 5KBNC 4LVEA 1FE8H 5E03A 2K1MA 2D7QA 3LH2H 4YDKL 4MA7H 5SV4A 5T1DH 43CAB 4F8QA 1YPZF 2AJUH 3GSWA 1SY6H 1SEQH 4WV1C 1TCRA 4HXBH 1IKFH 4FQJL 5CP3H 3F5WB 1U3HD 3REVA 3H9HB 4QXWA 4M1GL 2PTUA 4YZFE 1KCUL 4NRZA 3HG1A 4JRYE 3QCUH 4YX2L 4EN3C 1HHJA 4WUUA 3RVXD 5FEBA 1QBBA 3IVKA 4OCRL 3ZDZF 2M26A 4Z78A 4PFEA 4OCLC 1JV5A 1TFHA 4LLDB 3HPJA 5IJVA 3O81A 5CILL 4KJQD 4PJAB 3IDUA 3C08H 1DE4A 1GIGL 4P2RA 3OXRA 3SJVB 5L2KB 2AK4B 3LQMA 2GSGA 4ZOEA 2DAVA 2D7PA 1OY3B 3SDYL 4HUVA 3NAAH 2LFGA 4MXVE 5ERWA 2YKLH 3PL6A 4HDIB 2FBJL 5ITBL 4M6ML 4ZO6A 1WTGT 2DQTH 1FFOB 4H20L 4Q58C 1U92A 2DLHA 3PGDA 5KSAC 4EN3D 1G7MA 3ELAT 1KG0A 1X5ZA 4K7PY 5CZVH 3V5KA 2NLJB 4U1KA 3HG1E 3SGKA 3BXNB 3UYRH 4WUUE 3WLBB 4M7KH 1TQCC 2YEZB 5JA9A 4PJ5D 3WLWC 1DQLL 4L9LA 4QRRA 1X5LA 3QEQB 4BQ6A 1CFSB 1QD0A 1S7TB 3KPSD 3QJFA 4I0KA 3W0WD 4KRLB 3OPZL 3NGBC 4PJXE 2HVJB 4JPIA 4FNLH 4P2RE 2Z8WC 1HHGB 3GMOB 5BMFH 5KJRL 4M93C 1CN4A 4MA1C 1UYWL 5GGTA 4PB9L 1IC7L 1NBVH 2CDEA 5EUKA 5D7IB 3IGAB 4HAGA 4K7PH 3H7BA 4I0PB 5IW6A 3K2UH 1N8ZB 1S9VA 5D72L 3WDHA 1K8DB 1CD0A 1A4KB 4MAYC 3VXRA 3MLTB 4CKVX 2HG5B 4GO6B 5C09D 3HNTH 2DI9A 3DVIA 5LAXB 3QXDB 2EZ0C 4MA8H 1E4JA 3LZFH 1AH1A 4PV8A 3KXFA 4QRRE 5JLZB 5HGDB 4PRDA 1A0QH 1SYVB 3HMWL 3L5JA 4G9DB 1BFSA 5DMGC 4MJIB 3VW3L 4UV4H 4QHLA 4QHKI 2ZPKH 2WWKT 1UJ3C 4N9GA 1EGJA 1TETL 3M1BA 4P9HC 4PJ8C 5JW3L 2XY1A 2X1QA 3LIZH 3ULUC 3LKPB 5D70H 2EICA 4YO0B 2YA1A 2WNGA 3LKQA 3O9WA 4YEEA 4R2GD 3Q1SH 1GJIA 2ORBL 5DFWH 1HXYA 1AR2A 4IOSD 2CDFA 3BI9X 3KPOB 1FNEA 4YFDB 1CFNA 1FYTB 4WI9A 4NRYA 1FLRL 4IEFB 5CEYA 1BBDL 3KXFE 3WUWA 1NGQH 1YNLL 1A9BB 4ODXB 3TWCL 3TJEL 4R4BB 5LGJA 3KDMA 1MCDA 3AU1A 2X9YA 5I1EL 1VPOH 4YHIB 2BOBA 1INDH 3BPLC 2PCPB 1CLCA 3DI2B 3RDTA 3ULUD 4Z7WB 5L88L 2DKMA 2YPVL 4G9FA 3TBVB 3ARPA 2DKUA 4YHML 1T3FB 2H26B 3BQUA 2AJSH 4K8RC 3L3DB 5IM7A 2AQ2A 4N9OB 1G9NC 2BXYA 3QEHA 4DGVL 2ZG2A 2CGRL 3VFNB 4YPGA 3TFKC 4N0CC 2Y7QB 1XF1A 3QUYC 1A6WH 2X70B 3BP6A 4FFWC 4WEBH 5I1JL 5B39G 2ENSA 3L3IB 3DV6B 4ZUWB 3FB5A 4JRXD 5D1XA 4QRPE 3QDAA 5F3HA 3D69A 5D4QA 2AQ1A 2VAAA 3IDMA 5IVOA 3UTSE 3OKEB 5FF6A 3LV3B 3NTCL 4G9FE 5BXFA 3LQAH 4Z7NE 4RMWA 1JPFB 4K8RD 1GGBL 3TM6A 1HKFA 4PRHD 3DRTB 5EIIA 1WBZA 4Q2ZA 1CU4H 4FFYL 5K59E 4ERSL 3WIFB 5AYUH 1W8OA 2FEDD 5JIIA 4YHOH 1KN4L 4C56A 3I6GB 4Y2OA 1BZ7B 2JK5A 3TFKD 2ZCKL 1IGYA 5DEFB 1IEHA 2NX5D 3QUYD 4NWTL 4P5TC 3KYMA 3OKDB 4FFWD 3WJJC 1E6OL 5FM5M 5I8OH 4MQ7B 1S78C 2F53A 2VABB 4C58B 2PO6B 3MRKB 4JFEB 4MCZB 1RJLB 3QUZC 5HVGB 1U2CA 4PJGF 3ES6A 3U0TA 4K94H 1KULA 2Q86B 3FQNA 2UWEA 4KKLC 3PUCA 4YHNA 4OGYH 2KPNA 5FYLD 4N0FA 1MCFA 5EDXA 1IBGH 3QQ9C 3CFJB 1MCQA 1U8JB 5IFAH 3MRFA 3WXVH 1KPUB 4UDUA 4KJPC 5KN5A 1XGPA 2DLGA 3VXMB 4C56E 3KYNB 5E2JA 2NMSA 3O4OB 1BQHG 2EE9A 3PP3H 2D7NA 4RFEA 3X14B 3WFHA 5FECA 1CXIA 3SE3A 4X4YA 1S78D 1MY7A 3VFOB 4TVPD 3UROR 3T0DA 1I7TB 4MHHG 25C8L 3SE8L 4JG0H 5B8CA 1NUDA 3D2UA 4PBXA 3FFDB 1K2DB 2UWEE 1G0YR 3Q6GL 2BVYA 1UXWA 1C5BL 4ODTL 4IM8A 1T7XA 3RZCC 3LKOB 2J8UF 4I3RH 5I19L 3QBTB 4HZLA 4KQ4H 3RX8A 4OAWB 1D6EB 1NBYB 2XQBL 4KJPD 4H25A 1A21A 4OBRA 5FB8B 1TVBB 3WNLA 4NQCD 1LNUA 2CUHA 1JVKA 5E7BA 5GGRA 2R2BA 2BNQD 3WL9B 3DRQA 2D3VA 3O3UN 5EA0H 5EZOL 2OP4H 1RIVH 3SKUD 4WU5A 3MACL 3V0VA 2FRGP 3AS1A 4POZC 5HHPB 4I5BA 3UX9B 4PLJC 2XZAH 2BJML 2GJ6D 4GAGH 3BVNA 3HUJA 3HC3H 4ZOAA 1DQQA 5C0GA 5I6XB 1EHXA 4ALAH 5GS2H 4MGXA 2AEQL 4DWHA 5K9JH 3SCMC 4HK3J 1EH9A 4XCYA 1GH7A 4KZEH 1KJ2H 4KH2A 1XGQA 1A7OH 1ZOXA 3NA4A 4NKDA 3SE9L 5AAMA 5DJYB 4DGIL 4EI6B 4UTAL 5TQ2H 4EVNB 2ZSVB 4CVZA 1HSBA 1AGFA 4JY4A 2VDML 2Z8SA 3S5LB 3MRIA 1PX3A 3O6KH 1DJSA 4EDWH 4HMCA 3BE1L 4FQIH 3HTLX 1X7QA 1INEH 1VEOA 4G8FB 3OB8A 3VWJB 3B2VL 4I18A 4POZD 3LN4A 5EBLB 1INQB 4XGZB 3BFOA 1CGUA 1EPFA 3R4DA 4HUNB 4HWEL 1CE1L 3HUJE 4DKDC 4ZUTB 4G6AC 2W60B 2WUCH 2C26A 5I1DB 3SCMD 4QO1A 4P23A 2DDQL 4QY8A 2BX5A 2KDGA 5ETUB 2NY0D 4ZS7L 3UTPD 4QRQB 5JW4Q 1T89A 2XWJA 2FGWH 1TCRB 4LSTL 5BCAA 1NAML 1RAMA 3QCTH 4F58H 3REVB 3CFCH 1CE6B 4MB3A 3S7GA 3KS0H 4XBPB 4NRZB 5T33H 5GZNC 4JFYA 1IC4L 5DUBA 3U4EA 1HE7A 5I1HH 4LOUD 1T0MA 2GY7B 1MHPH 5CBEB 2VDOH 2BVEA 3C8DA 1YQVH 4LSPH 3E1F1 3B5TA 3NABH 3O3BA 4RISL 4F7CB 2FIRT 3T2QA 4LPYA 2W9EH 1CLZL 3NZHL 4M03A 1NGWA 5HDBE 2APBA 2GSGB 4G6AD 5F8QC 5FK9B 1AHWC 3B8SA 1FNSH 4L8SB 3VRLF 2QSTA 3ARGC 2VUOA 3JWDH 4HIIB 1UKTA 2Z93B 3MJ9L 1YMMA 4WI6A 5FUOL 2NTFA 4H88L 4N8PA 1OTTC 1U92B 1S7RB 4I4WB 3K8KA 1XT5A 4TSCH 4U1KB 5I1GL 4HT1L 5CEXB 4A6YL 3CFKA 3K8MA 4Y4HA 5GS1A 1EAPB 3QNZA 1FFPA 1RK0A 1NGYB 1WFOA 5IVZA 3QJFB 4L3CB 2IEPA 3SQOL 1ACYH 3BKJL 3V7AE 4KDTA 1KJVA 2DQIL 1GOHA 4N1EA 3HZMB 3R8BB 3ARGD 1XF2B 2VDQH 5EUKB 1F3DJ 4PJIF 2VDPH 2VDLL 3UTQA 4ZDHA 1YMME 1OTTD 4JPVL 5D6DC 2BSSA 4XNQA 1JYVA 2ED9A 3MV7B 5JXEA 3VFSB 3U36A 5IESH 4OV6F 5FDYA 2ICWA 4F2MB 2G2RA 4XMPL 5CD3A 4Z7VE 3FFCA 1IZKA 4P2OC 2Z92B 1TZIA 3QHFL 4YEFA 2AERT 5EU4B 4NQEE 4AMKL 1MHEB 4NO5B 5D9SA 3RA7H 1OW0A 4IMLA 4JFFA 3VXQA 1IEBA 3GMRA 3VRJA 3SDAB 4OCWL 2IADB 4Q6IC 3VXSD 4Y4KA 5D6CA 1IGCL 4NQUA 4IRSD 3ROOB 2YMXL 3QQ3A 1VACA 4TUOB 4OF3A 5E70A 1V3JA 2NTSP 4Y1AA 5IBUB 5SWQB 4QOKA 4P2YA 3PWUB 1CFNB 1A4JA 5E94B 1PG7H 4DVBA 4P2OD 2HYMA 3O3AA 4NRYB 3FFCE 1P5UA 3MOAL 1N2RB 1G9MH 2PXYC 1IM3B 2GITA 5JDSA 3T1FA 3WUWB 5C0JB 3DIFA 3MBEC 4J7RA 4HIHA 4JFFE 2DMKA 2YD5A 3D9AH 2HJFA 2R8SH 4JHWL 2HWZL 3R0NA 3DUSA 1JWSB 1J0IA 1DDHB 4M3KB 1H9VA 2OL3B 1J86A 1CFVH 3P9WB 1A6UH 1EEZB 3NN8B 5EU7E 4M6OL 3BQUB 4JVWA 1YEJH 5EO1A 4OCYH 4Y1AE 5DSCB 1CDUA 3BUYA 1TCMA 5FYJU 5CKGA 1YYLL 4KUCD 1EERB 3KLSA 1L9MA 2IMNA 5ANMB 4LKCB 4YPGB 1HOCB 3MOBL 5CIPB 1CGSL 4PLKC 2R0ZH 3W5NA 3MBED 1K5NB 3TIDA 3MV01 1FL5B 3L9RB 4XP5H 5FYJE 4UIKL 3BP4A 2IH3A 1IGIL 4NFCA 5FAAA 2IALB 2J8OA 3SY0B 3QUML 4U6XA 4Q9QL 3D69B 2AI0H 4UU9A 3SO5A 2XICA 4HFWA 5E7FA 4XNZB 5FF6B 2R9HC 2DQUL 5J13C 1K9TA 4QRUA 3H3BC 2BOCB 4Q2ZB 3T77A 3BWAA 2DL9A 4NQDA 2IPKB 3G5VA 2N4IA 1MPAH 5IHUH 4ELMF 4OQTH 2F8VA 4NZUL 1CZ8L 3AVEA 2XYCA 4XPFL 5I76A 4LPVA 4YPJA 2B0SL 3G6AB 1IGYB 2OR9H 1A1OB 4XP6H 2E6JA 4JO3H 4UAOC 2ZNWA 3KYMB 5FHAL 5T3ZH 3TV3L 3LKNB 1GGTA 5IMOA 4OZHF 2F53B 1OGAA 4P3DA 5EOCH 1F97A 1U2HA 4XI5C 4LU5H 5GJSL 2C4FU 1F11B 3U6RA 5DD5L 3S34L 1TIUA 1JP5A 5DJ8A 5F7EL 4BSVB 1N6QL 5B3JF 1H3VA 3PNWB 2R9HD 5F9WC 2BZDA 1JN6B 4ONFH 5KW9H 1LP9B 1WBXB 3MLUL 1LO2H 3U7WL 3X3GH 2DQCH 2DM3A 1C7TA 4FQHB 2LAAA 3GMPB 5C07A 2VZTA 3MRFB 4K2UH 5C71A 4RGOH 4PRIB 4NQDE 3L5IA 1Q9WA 3WFEH 1QFUH 1OAXH 2GTWB 3TGXA 1JNNH 3JV6A 4YK4C 2NY5L 3WFHB 4NC0B 1C8PA 3RI5K 4LLWA 5J1TC 2OTUB 2ICCA 1HSAB 1HHKA 4XI5D 5HGHA 1OGAE 3TYFB 2E8YA 4HGMA 5T3XD 4P46B 5B8CB 1RJZA 1HQRB 3TF7C 1F4YL 2X4OB 2L4OA 4O2CB 3EOTH 1WEJL 3INUH 5SWSB 2ZUYA 3SKOA 5ADOH 5HDQH 3SHSA 2EDXA 2FX8H 3CVIL 5HHOE 5C07E 4G8EA 2XTJE 4WFHD 4H25B 5T1MB 1ETZA 3NIFF 1UM6L 2Z91A 4UNUA 5MENE 1VESA 2B4CC 2BVPB 3D0LA 4KVCH 3BAEH 1F6AA 1PVHA 3N0PB 4PJDF 1DVFB 5FHBL 5BVPL 1HINL 4F9LC 2B2XL 2F8OA 3LD8C 3EDDA 3S9DB 3E2HB 3DRQB 1XEDA 4APQA 3EJYC 1QR1A 1KYOK 3MNZA 4NWUL 4H1LH 4EDXA 3CX5J 1S7UA 1RJCA 1RK1A 3KPLB 3JVGA 1RUAL 2Y5EA 5T1KB 3VXPB 3GRWA 1BEYH 4OCMC 1AGBA 4MNHB 2EH7H 4NYLA 5FFLA 2YPLD 1PZ5A 4GAYB 5C3TA 3F7PC 1I85C 1XGTB 3BPCA 2ADJB 5IVXF 5TFSL 4YHYB 5L8KB 3TVMB 5IR1B 3WN5C 5C0RH 5DD3L 1XGQB 3H9SB 4BQBA 3S6CA 4H26A 5I1LA 1FZJB 3RIFK 5E8PA 1OARL 4JY4B 4LLMA 4GW1B 4JPKL 5HYQB 4F57L 1K3IA 2HTLD 2I60H 4FQLH 3UTZA 4JO1L 4QF1A 3KPMA 2ARJQ 1ES0B 2Q76B 4Q9BA 4OLYH 5HYEA 3EJYD 4P5MA 3JTSB 3ROLA 1NEUA 2IPUG 3D25B 3H0TB 5JHLH 2LE9A 2H1PL 3DECA 1QSEE 4LEXH 1PSKL 4F7PA 4OGXH 4PD4J 3UO1L 4HH8A 4PJBA 4PY7B 1DN0B 1N0XH 4WHDA 3WS3B 2B1HL 4HS6A 3X11B 4JZOA 3W11C 1WC7A 4X6BA 1JZ8A 5DRWA 4YE4H 2ICEA 3WDJA 4P23B 4PV9A 2PTTA 1MFCL 3Q6FA 2XWJB 4YDJA 3T65A 2GAZA 1T80A 2VYRE 3W9DA 4ZFFA 5KSBE 2P48B 1T21B 1PLGH 1T5XA 4MHHI 5I1CH 5DUBB 1P7HL 5I0DA 2H8PA 3BIKB 1GVIA 1E4WL 4FMFA 5IF0B 4ZQKA 1XGRB 2VSCA 3WSQL 2YA2A 4HCRL 1L0YA 2JKXA 3FOLB 4HKXB 1UA6L 4AEIL 1IC5H 5ADPL 2FO1A 1FBIL 1S5HA 1XF4B 4Y4FA 4LHQB 3DURB 4V2BA 4F37F 5LCVL 4KUZH 4NBYB 4NJ9L 5DS8B 3OMZA 1BAFL 3QPQD 1NGWB 3VGGA 4QYOB 1UWGH 3W11D 2V17H 4FQCH 2D0HA 3EDFA 4X9GA 2AJVL 2CLVB 1RIHH 3TBSA 1UACH 1EXUA 3UP1A 2FHFA 5FUCE 3IJSA 2NTFB 5LGHL 5ISZD 1DQJB 3WS6C 3FB8B 3IDIB 4AZ8A 2EEAA 5DVOA 3TH3T 1XIWA 1FO0L 3CSGA 5IBLC 3FQWA 1NUGA 1CDYA 2AVGA 4NCC1 2R23A 3CFKB 3N85L 2ARJA 3STLB 1MSPA 2R69H 2XN9B 5GS1B 1XF3B 4HEPG 5I74C 4KK9C 5E6IC 1UZ6E 5DEGA 1QQDA 3CC5B 1I3GL 1CT8A 4LLYB 4WO4C 4M7ZC 1HQ4A 2BRRL 1GHFL 1RZKL 3GO1H 3ILQC 5CWSA 3WO4B 3EZJB 5AAWA 5MEPA 1L7IH 2HH0H 4IDJL 4ZFZA 1ZHKB 1QOKA 1QFHA 1MEXH 3QIBD 5HHME 2BFVL 4JR9H 2BSSB 1HIMH 5IBLD 3HRZA 1ED3B 2GTZA 4U1LB 3U36B 1J0ZA 4PG2C 3QWQB 5C6TL 2ICWB 3PP4H 2KUTA 4RZCB 2ZUQC 5EB9A 1O7SA 4KK9D 4X9FA 5DURB 5E6ID 5CD3B 5CGYC 3H42H 5FGCB 3C5JB 3LSOA 2V2TB 5JIPA 2FR4B 4UQ2B 5D9SB 2VDNH 3O2WH 3ILQD 2YN3A 1IEBB 5I2IB 3T4YA 4PRPB 4X6DA 2XZCL 1EBAA 1JTPA 2CRMA 2Y6SC 1UENA 3HS0A 2MCG1 2VLJA 2V5TA 1TJIL 1FNFA 3B9KB 4ZO9A 5JPMA 5KS9A 1VACB 1EO8L 1T1XA 1F58H 1OAQH 3JV5A 4OZFH 1J5OL 3GIZH 1JRHH 4QOKB 4YXLH 4NM4L 5C0AE 1BQSA 1EMTL 1DEEB 4NO2A 5IMMA 2W9LA 1A4JB 1BFVH 2P45B 1I1AA 5E9DE 2BVUA 1J1XL 1YNKL 3MV7D 4XCFL 2JLLA 1FPTH 4GMTH 3CZFA 5L9DH 5FCUL 3VMOA 4HWZA 4JDVA 3WNOA 4ZXBA 4N5UA 5INCA 3S4SG 3ZDYE 1CFBA 4TOYH 4QCIA 5JOEA 4X6DE 2E7HA 2CPCA 1YNTB 3ZTNL 3F12B 3CU7A 2VLJE 1A1MB 4TNVF 4ZPVB 3IFNH 4U2YA 5D2NC 3D3VA 5F70A 1JHKL 2F15A 4AM0B 4M61B 1J8HB 1I8KA 2EEDA 2GK2A 5EO1B 5HD8C 1I9IL 4NNYA 2R1XA 1CDCA 5E6YA 1MCIA 1JZ3A 4OM0L 4WFEE 1W0VA 3P30H 4BM7A 3QDHA 2AJXL 2P5EA 1TVHB 3ESUF 3DMMB 3ZE1E 5DFTA 2J5LC 3SE4C 1TXKA 4Y2DB 2W9DH 2O61B 4JM2F 5FO8B 5T5FL 3DWTA 5HDOA 3PDDA 1NCNA 4JFQA 2V2XA 4LSUL 4HJJH 5E8DL 1QFWL 4U6XB 5T1LA 5F96L 5GISL 1E27A 5K9OA 1OGTB 1YEHH 1AO7A 1T7YA 4K07A 4O9HH 2DQJH 4F9PA 3EYFA 2Y06L 3VH8A 3LDBB 1RUKH 3X3FL 1JHLH 3DHMA 3R06A 1NMBL 4YWGH 5JW4R 2SEBA 1GXEA 1I8MB 4R8WL 1YPZA 5EPMA 3TBWB 3BPOB 1B4JL 1FE8L 4JFZL 5I76B 3LH2L 1F8TL 4X6FA 3HE6A 5T1DL 4TUKH 3NCYS 2AJUL 1CTNA 1LVEA 2YXMA 1BJ1J 4HXBL 2CMRH 1SEBA 2HT2C 4NSKA 3F7VB 2HKHH 4O2EB 5IMOB 3B9EA 3T0AA 3MPCA 4J2XA 3QCUL 4GMSH 4HIEA 4KDWA 2EE2A 1OAUH 3HHRB 4CADA 4CNIB 5CJ8A 2F74A 1NPUA 3M45A 4Y5VC 4HMDA 4K7FB 2JB6A 5IHZB 3IJYB 3GJFA 3RGHA 3QYCA 1S7WA 1AO7E 1I75A 1IC1A 4AQOA 4LSVH 1MLCB 5GHWH 1KIQB 3D0VB 3VFVB 3RWCB 5F71A 4L8BB 1ZGLM 4FQQB 2MSPA 2A77H 2GFBA 2VRAA 1YPZE 2YBRB 3NAAL 4PJFB 2NW2A 1RUMH 4L3ED 3VWKC 1F13A 1T1ZA 2VB5A 2HT2D 3ARWA 3RUGF 3LEYH 3U7YH 3SDDC 2DQTL 1PGRB 3UC0L 3CDYA 4OUUA 3ZDZE 3U79A 35C8L 4OFYA 3RWDA 1UQSA 5CZVL 5HGHB 3G5ZB 3R0MA 1MCHA 4DFHA 2ERJC 4ONGH 4XPAH 3LEVH 3LQAC 4JFDA 3T3MF 2VXSL 4H0HB 1AGCA 1CIUA 3NPSC 3GNML 2AGJH 3U9UB 1MLBB 3PWPB 4MNQD 4GUPB 4FNLL 1T2QL 4IOIB 4QXTA 4G8EB 2EIZB 4NZTL 4G6FD 1YUHA 3L3JB 5BMFL 1DUZB 1ETZB 1SJEB 5AZEL 3EHBC 2R56H 4A6YA 1EVTC 1EGJH 1KEMH 3P4LA 3VWKD 1T83C 4APQB 4FXGB 1QR1B 1HILA 3MNZB 4NRXA 5AEAA 4EDXB 3K2UL 1JGVL 3LEXA 1D5ZA 1A1NB 2X2YA 4NT6A 4G7YL 5D5MA 2OJEB 2I9LA 5BV7B 1YECH 1AGBB 1MHCA 2XWBA 4X8JA 4IHOB 4E41E 5I8KH 1PZ5B 4MA8L 3DBXB 5HSFA 4JFDE 4OZGB 4W4OC 3QFJA 3O3EA 5BZWB 4NO0D 3VMNA 1HHIB 1A0QL 3FB7B 4AIZA 5BOZG 3FN9A 3FMGL 4P46D 1MCPH 5E4EB 3MV11 1OAZH 1BVKA 3IXAA 4GAJL 1WFUA 3RIAF 5H35B 4IRJA 3ME0A 2RB8A 3QUXC 4UV4L 2K9UA 5MEQA 1NAKL 1L7TH 3EHBD 4CMHB 2D0GA 4LLMB 1P84J 1J87A 1OWWA 2P8MA 3LIZL 2L7JA 2OL3H 3C5ZD 4BYHA 3G6DH 3Q1SL 3GMMA 4FTVB 4G42A 1OTUD 1FRGH 1KJ3L 3FONA 1NKOA 1DVFD 3JSSA 3CPLA 4JZJA 1LDPH 5ILTH 4F7PB 3T0EB 3V6BR 5D5ME 4PJBB 4RMSA 2IH1B 5BO1L 2DI8A 2DICA 5FGBC 4JJ5B 4PGCA 5CIPH 4LHJB 1ZK9A 2YXFA 4GSDH 5TQ0H 5CD5D 5T1KD 3MRRB 1OAYH 3OR7A 2BNUA 2XKUA 3CDCA 4JQXA 3QUXD 1S5IL 1QVOA 4YDJB 5E2TH 2NNAA 4K71B 4LP5A 4NUJB 5FDWA 1VPOL 1J88A 4JM2C 1RULH 3C9NB 4KK6C 4OLUH 1WAAF 3H9SD 1YDPA 2R1YB 5KVFL 1S9XB 5HJ3A 3SPVB 3VJ6A 1FHGA 3L3HB 5ESQB 2AJSL 4UT9H 5IWLC 2C3XA 4RX4D 2DJUA 3GIVA 3WFBL 3TT1H 4HKZA 1FJ1A 1WUNT 2I07A 4EKXA 4M7JH 4H1LG 4YHPB 2X09A 1A6WL 1M71A 4WEBL 2XG4A 5EUOA 1OHQA 4NHUA 4WY7H 3ZTJH 3HR5A 4JM2D 1I7RA 5FO7A 5L8LB 1MJJB 4YAQA 5DFVC 4KK6D 3VDBA 1UB5A 2AV1A 43C9B 2XXCB 1TTGA 1KCLA 3TP4A 4GG6B 5I17B 1XGUB 3EO9H 1MCBA 1B0GA 1CU4L 1GC1L 1CF8H 5AYUL 3BO8A 5GS2D 2AK1H 3KPRD 5A2LH 5DVMA 5KVDH 3QUMA 3UBXA 4O58H 4CW1A 1P1ZA 4LIQH 2FIKA 4WEMB 4P49A 1OSZA 5IFJA 4WW2B 1JWUA 4MNGE 4XPGH 1OPGH 3ULVD 2XQYK 1I8IA 5MEPB 1OLLA 1MUJB 1QA9B 3FOMA 2NY4C 2NYYC 2DQDH 4U1SA 1MNUL 1FORL 1A6AA 1I7UA 3MA7A 4PJAF 4YQXH 5GSRA 4K94L 4TSAL 1CL7H 5DFVD 3S35H 4CU7A 3ARFD 1KIPB 4NBZB 3MJ6A 2VE6B 3DXAE 2VLMD 1VGEH 4ZTOH 2ESVD 3JWOH 4BH8A 3WXVL 1LQSR 1T0PB 1U8HA 3NCFB 3PABB 1HXMB 5E99H 4XVSH 4I13B 3TNMA 2WMPA 2DLFL 4BFIA 3EGSA 5FXCH 3JWDC 3AM8C 2WP3O 2XV6B 1BHGA 2GEEA 3MRGA 3GSNA 2NY4D 3ZSTA 1K4DB 2IANB 3WXWL 3QSKB 5JPMB 3GUTB 3W82A 1LEGA 4MJ5A 4HW6A 1RV6X 3HLAA 2FJGA 1KJMA 3UJJH 4XXCC 3ZO0A 1KCSH 3BD4A 4NO2B 3BGAA 5ESAB 2E7CA 3AREB 1P2CB 4XAWL 3DHJA 3GM8A 5BRZD 5TGBA 2YUVA 4KQ4L 4KTEH 4OB5H 5D7IF 3OHXA 3I02B 2IBZX 1D5BA 3QISA 1UM5L 4NUGH 5J3HC 3P4OA 1C7SA 1N5YH 3I84A 5IMKB 3FB6A 3HN3A 1ZLWH 1U8PA 2NPLX 3MLYH 4NFBA 2OP4L 1RIVL 4C54A 1WZ1H 4Q97A 3D3VB 5D7JB 1T22B 3WHXA 3P0YH 3GFUA 3D48R 1ORQA 3HB3C 3THMH 1HNGA 4XC3H 4PGDA 1T7VA 3GB7B 3QAZB 2A73B 2M8XA 4TRPH 1BX2B 4HD9A 4PBWD 2EKSA 2UZIL 5DVNA 5C1MB 4M6AA 3K4AA 3S36H 2VXVH 2MWCA 4KHXH 4P4KA 4IDLA 4KZEL 1KJ2L 2P1YA 1HKLH 5FV2A 3MUGB 3KLAA 2X4SA 1RZGB 1ITBB 1UKQA 5AD0A 3RVUC 1CVSC 1XR9A 2FJFA 1E27B 4FQIL 3IETB 3A6BL 2AABL 1KNOB 4UV7H 4NN5B 3REWA 2ZOLA 4OF5A 4IJ3C 3HB3D 5CP7B 1PDKA 2QADB 1ONQA 4HS3B 5HGAB 3HAEA 4OQ1A 1NL0H 3ARVA 1V7MH 3I50L 2K7QA 5FA3A 1MI5A 1G9MC 3FCTA 2WUCL 3FHAA 2XWTA 3GMNA 1B0RA 3MV9D 1Q0YL 4PREA 3F7QA 1T5WA 2AXFA 3MGTA 4PG9B 4WWID 2HN7A 5IQ7L 2ZCHH 3OAYH 4PLNC 2FX9L 4KGLA 2FGWL 3VXNB 3QCTL 3RGVA 3TEUA 4GG8A 4OZFG 2E3VA 4F58L 4O02H 2BSTA 2VDRH 4P2QA 2CJUH 3H7LA 1KLFA 4FQXC 4HIEB 3UPAA 4LLUB 4R96B 5EN2A 5D1ZA 5I1HL 1EEUA 2F74B 5CEZD 1MHPL 1YQVL 5IFHL 2AW2A 2R39A 2VWEE 3MMEA 3QIWC 4XNMB 5M7QA 4ODHL 1TDQA 4R7NB 3TPUA 2X7LA 2EDNA 3KWWA 3KJ6L 4PTUA 2W9EL 4PB0H 3QHZH 1K4CB 1B88A 1FZMA 4Z6AT 4ETQA 1JHTB 2D9CA 4LSSH 1T66C 2NXYC 2GFBB 1MI5E 1XZ0A 4PRAB 1KGCE 3IU3A 4GBXA 2VTFA 1ZWIB 2XPGA 4KMTH 3JWDL 3AAZA 4QRSB 3V4VL 3QFDA 2CIKA 2CO6B 5E8NB 2AKRA 4YR6A 3NH7H 2EXYC 2BNRB 3FAWA 5H2BA 3U2SA 1FVDA 3BGMA 1U8LA 4KZDH 2IAMB 3GJFK 2VLKA 5EZLB 1ZSDB 2JCCF 3QIWD 3R1GL 4J3UA 5EU6A 4JB9H 1I3UA 5C3LD 2YN5A 3KPQA 4PJCB 3CFBA 1IM9A 1Z0MA 4YBQD 1NC2D 1FO0A 4LSQH 2NXYD 3VRLE 2WINB 5EZIH 3UTTA 1UM4H 2DQEL 4PJIA 3BN3B 5EFIA 2VDQL 3DX8A 4I8DA 1EUTA 3U1SL 1TPXB 4KTDL 2G9HB 3CK0H 2RGSA 2VDPL 3L1OH 2EXYD 1MFNA 4M7LT 4FFZH 5EWIH 4R0LC 1ITCA 1D5ZB 3LY6A 4JDTL 5HPMA 2Q3AA 3QXUA 2R2HB 4NT6B 3ZZ1A 3DX6A 3FAXA 4NN7C 3BKCL 5FO9A 2E6PA 4HULB 4RFNB 5MEOA 1D9KC 1TQBB 1PEWA 1X6NA 5EU6E 3LKRB 3QFJB 2Z8VC 3O3EB 3TN0C 4DKFL 3NCCB 2G5BB 4YHKH 4F7MB 5JO5A 2FYYA 2DQGH 2YPKA 3FQRA 5FYJH 4X6EA 3RA7L 3RU8L 1KEGL 1R5VA 4Y5XC 4QNPF 4L4TA 4JFPA 3UTTE 4PJIE 1FGNH 4LEOA 3DROA 4HIJA 2OQJA 2XACC 4EUPB 1T7WA 4X6CF 4HK0B 4NNXA 1BPVA 3UZQA 4G42B 4DQOL 1MH5A 3ESVF 4JZJB 3PQYD 3KS0J 2HFEB 1JNLL 2BY2A 2OR7A 1DBKL 1QPXA 1D9KD 1OB1B 2KL6A 4OLXH 4S0SD 5HYIA 5J4MA 3JTTB 2BHZA 1TZHA 4R4NC 3TN0D 3C6LC 4PGCB 5KANG 4YHLH 4U0RB 4NDMB 4G8IA 3GHBH 3WJLA 5K9KB 2NNAB 5DMKA 4JKPL 4XCCH 2XG5A 3ZT5A 2R8SL 4M43H 4L4TE 5DJZB 5HYJA 3A67L 3CDGA 2R4RH 3S37X 1BREA 5F1IB 1A6UL 1YDPB 3V4UH 4Z7UF 3BIBX 4ZPTB 2JJTA 2Z4QA 1Q38A 4OCYL 1ZHLB 4X7TB 3RVWD 2R0KH 1YEKH 3P0VH 4TTGA 2GHWB 5HHVH 2PYED 4DEPB 3HE7B 4WWKB 5F44A 3CLEH 1FJ1B 4ESKA 3MRLA 1CFTA 1RIUH 2X1WL 4R4ND 2BY0A 5DDHA 4XVUD 2X10A 5E8OB 2VIRB 3EAKA 3T0ED 3A0OA 2EDJA 2VQUA 2NY3B 4JHAH 5IQ9A 5DGQA 1P4IL 4JQIL 3QDMA 1DBML 4HLZH 5FO7B 4HKBB 3ZKXB 4GRLA 3PHSA 5HYJE 2A6IA 1UB5B 3CSYA 3LPWA 2E7BA 5H94B 1FG9C 4YDKH 2FHBA 3WUWG 4R7DB 4OBSA 3VDCA 4MXVF 3I3DA 5GSVA 3VG9B 2GW5A 4FQJH 4AH2B 4RNRA 5GZOD 5IHUL 2AJYH 4M1GH 5E08L 1KCUH 1LE9B 4J3WA 4GXUN 3RVTD 3MRMB 3QPXL 2YC1B 1JWUB 5J9PA 1T2XA 1CLYH 3C2AL 3S96A 2X6MA 5T3ZL 1MCKA 4RGMB 1E4KC 5L0QB 5IV2A 3VFUB 4MA3B 5EOCL 3QDME 1GIGH 2VKWA 3PWNB 1I7UB 3MA7B 4LU5L 4MJ6B 4I48A 1NLBL 4KRNA 5DRXB 4UILH 2VLRD 2YS4A 3SDYH 1JGEA 4ELKB 5KW9L 1BZQK 3L3KA 1ZTXL 4XCNB 1LO2L 2FBJH 3MRNB 4F15B 1X5GA 4LPWA 1KPVA 2DQCL 4M6MH 3RNKB 2VXQH 4BH8B 5ITBH 2GUOB 4H20H 4U1HB 4FQ1L 4RGOL 3O45B 5JHDA 1MIEL 5I1IL 4JQVA 3VXUB 3OX8A 1Z2KA 4BZ2L 1NFDB 1OAXL 1G7IB 1DQLH 2OSLA 3MRGB 1NC4D 3QWRD 3GSNB 1YN6B 5ICZB 1MQKL 5KTEH 5TF1H 1YEIL 4MXQC 4ZSOB 3VXTB 2JJVA 2FJGB 3TH2T 5B3JE 3GRWH 3HR6A 4PB9H 3UYOD 1SHMA 2QSCH 4IMKA 1Y6KR 2A6DB 1PQZA 5TDOA 2EC9U 3DVGA 2FX8L 3ZTJG 2NY1C 4GFTB 3QXTA 2GJZB 2Z31C 2DTMH 4JLRA 4XCEA 4PJDA 2AXJA 1KLUB 5D72H 3D85D 3E3QC 5JHDE 5I71B 4KVCL 1H3GA 3H2WA 3BAEL 3P4OB 3PWVA 1U8MB 4X7CC 5D1QA 1BLNB 1MHHB 3VI4E 1NJ9B 3FQUA 1U8PB 2NY7H 4P4RB 2WUBH 4LNRA 3RNQA 1T1YA 1P4BH 4E0RA 5B21A 3L7EA 3HMWH 3DOSA 3IFPA 1G7JA 3GSRB 3WHXB 5DD1L 4WFFD 1YMHB 2CLRA 5KG9A 1MFBL 1FQ9C 3VW3H 2DIAA 1UH3A 1BEYL 1CBVH 3VD9A 5ENWA 5IB1A 1YY8B 5AG9A 1TETH 2VMFA 4URTB 2EKSB 2EIDA 3P73A 2Y07H 4KI1A 5HI4C 4UOJA 1IAIL 5F7FA 3RL1A 2NY1D 5AUMB 2Z31D 2ORBH 3NIFE 4NKOB 1ZT7A 4R9HA 1BD2A 3QXWA 3TCLA 2X4SB 4PJDE 4TUJB 3KGRA 3B5GA 1F3JA 3E8UH 3QDJA 1WT5C 5AD0B 5I16A 1KXQE 3OF6D 5MHSD 1A3LH 4YBLC 3U4BL 1FLRH 2W0FA 2ZOLB 3RP1A 1NDGB 3O41B 4D8PA 5JHLL 1I9JH 3HZKA 3EOBB 4LEXL 5E4IA 3TJEH 1YJDH 3EBAA 1MWAB 3EDJA 1MCEA 2NY2D 2NW3A 5BZDB 3S3PA 5A3IC 3L5XL 5IVXE 3BEVA 1LEIB 1EJOL 3FCTB 5J12C 3BZEA 4S10A 1KIRB 1QSFA 1LEKA 4UNTA 5I8EA 3DNKA 4PREB 1T5WB 2AXFB 3MNVA 4YHMH 3B3IA 1AD9B 5D2NE 1J1PL 3RGVB 4F33A 4J12A 2WBJC 1BD2E 1YY9C 3IF1B 4N8VA 2BSTB 3NVQA 2DLIA 4RMRA 1A64A 1WBYA 2Q7YA 5K59F 5EOQL 1AI1H 5I1CL 3V7MA 2CGRH 5D1ZB 3QCVH 5DUPL 5IJKC 3S3JA 4I2XB 3MFFA 2DBLH 4NQSA 1AXTL 3C60B 4M9OA 4HBQA 4OD3H 1D5XA 3FT3A 3MRJB 2YD4A 2VC2L 3EDKA 3QDGB 1UWGL 3MFGB 4LFHD 5J1AA 5SX4H 3U30C 1U8NB 4FQCL 2ATKA 1WK0A 1IT9L 1RIHL 2XT1B 3KHOA 1KV3A 2XPGB 3QUKB 5KZCD 1NEZA 1QSFE 5I73C 2QLVB 4E5XB 1WJ3A 4WCYL 3MRQA 4JRYD 2CIKB 1GGBH 3ILPA 2A83A 4YR6B 2AKRB 4QTIL 3K3QA 3D39E 1NBQA 2WBJD 1YY9D 4ERSH 3L3OB 2M1KA 1U93B 2V7HB 1KPRA 4M5ZL 2DM7A 3IDJA 3LB6C 2ZCKH 1AP2A 1RUPL 2OTWA 5BOPA 2R69L 2X4UB 4ZG1A 1KTLA 4G80A 1AFVL 4NWTH 3CLFH 4PJ5A 4LARL 4Z95L 3GO1L 4U6VH 3KPSA 5E2VH 3RI5F 3PGCA 5C0EA 4JY6A 5BS0A 3PL6C 4ONOA 5FIEA 4ENEC 1OF2A 3TA3A 3DX8B 3O6FB 1L7IL 2HH0L 1OP5H 2Q7NA 4I3GA 4X4MA 1N4XH 3RPIA 3C8HA 1MEXL 1RZIA 3HG1D 4NQEB 1QRNE 3SBWC 5E8EA 1W72B 2PW2B 4JR9L 4WUUD 3C6SB 3TH4T 1HIML 1JYXA 1LP9F 3SGKC 5DJ2B 5DXWA 5HPMB 3TJHD 3MUHL 1N64H 1PZUB 2VZVA 5BJTA 4UDTB 3DX6B 1R5WB 1QUNA 4NOFA 3PP4L 4L9LC 5FO9B 1XCTB 1I3RA 3H42L 5MEOB 1A7PL 4V1DB 1YC7A 2FO4B 4P2RD 5IBTL 1AKJB 3VD7A 4K3JH 2IAMD 1ACZA 3O11B 4G8GA 3WNNA 1EAJA 25C8H 3JBG7 3SE8H 3PL6D 1JRHI 2YD6A 3SGDH 4L4VB 5BS0E 4D0BA 5GQBA 3Q6GH 1C5BH 1WCQA 3DROB 2BSRA 4AT6B 1Q9LB 2P5WB 4X4ME 4NZJA 5MERB 1OAQL 3VFPA 4NNXB 5C0BE 1EBPA 1I7ZA 3GIZL 4YXLL 1EO5A 1KENL 3PWJA 1DR9A 3QULA 3SO3C 4QRRD 1ZHBB 4GKSB 4OIIH 4GMTL 1M7IA 1BFOA 1TZHB 1J0JA 5EZOH 1I1CA 4OIBA 3T8XB 3MACH 2F54A 3SDCB 1T6WA 4UQ3B 2VOTA 5EC1B 2W0PA 2XKSA 4G8GE 2I5YH 3A6CH 4TOYL 3ZYIA 3ZHLA 2K7PA 4X7DC 5DMKB 4HUXB 4IS6B 2BJMH 4FG6C 1CR9H 3O8XA 1B9ZA 2WBKA 3O9WC 4FMKA 3BDYH 3OG4B 2JELL 3ALPA 3HUJF 1IILE 4H5SA 4LCWA 3WNMA 3QG7H 4PP1D 5MI0C 1OCWL 3SE9H 3QQNA 5SWZB 4Z7QE 4YC2B 3FO0H 3P30L 3G6JA 1X5HA 2VDMH 2LTQC 5DJ0B 3KXFD 5J6HA 3LMJL 1AIFA 3KJ4C 1T0NA 3JZ7A 4LMQI 3MRLB 2HJKA 3CX2A 3BE1H 4PRBB 1E28B 5DDHB 2EE6A 2W9DL 1OM3H 1CD1A 3QJHB 3IDYB 3AB0B 3GMQB 4F7TA 2F54E 3B2VH 2EDOA 4O00A 3H6JA 4NQXB 5FV1L 4HJJL 2DYPB 3RDTC 4HWEH 4GRLB 4U1NA 1CE1H 3ARBC 5HDBF 4LLQA 2RQ8A 2A6IB 5C0FB 2DDQH 3BQUC 4JPWL 1P6FA 3GJFH 3DGGA 2N56A 4LCWE 2ZG3A 4O9HL 2DQJL 1CDHA 4ZS7H 5DYOA 5I1AB 4AEHL 3QNXA 1JHLL 4YFLF 2I25N 5HYSA 4YWGL 4EIZC 3WFZA 3DO7A 3G9AB 1S7QA 4EQ2A 5FKPB 3OKKB 5F6IB 4TUKL 1LE5A 4N0UA 2CMRL 4QRPD 4BSWB 2NX5A 2HKHL 4WWKD 4HUWB 3VGHA 5D1XC 3UTSD 3SDXA 3QHTC 1EIBA 1MRCH 5C6PB 3RDTD 5CJOH 1OAUL 4G9FD 4FXLA 3ARBD 4RAUB 1IGJB 3JUYA 5IKCA 2CRYA 1JGEB 3MOQA 5C0CB 1CS6A 5GIRB 3L3KB 3QEUB 5C08E 1U3YA 5JW4N 2DIBA 1KPVB 4H88H 2MQCA 5I8CA 5KANI 3NCEB 2Y72A 4HUKB 4KKAC 2NXZB 1P5VA 3BPNB 5I1GH 3Q3GB 15C8L 5CAYB 5IEKA 4HUMB 1OTSC 1QBLH 4FZEL 5C0DA 2GCYA 2EXWC 2VQ1A 5IB2A 2HT4C 2PW1B 3LEYL 3U7YL 5T5NG 1MELA 5D1XD 5DQDL 3HZVB 2VO5A 4DZBA 3SDXE 2XTJB 1VB9A 2DQIH 1G7LB 6FABH 5MENB 1UXSB 4X0KB 4O4YL 3LEVL 5LXGH 3FO2A 3QIUB 4X99B 3UDWA 4Z76A 1CICB 5HI3C 1MVFA 1SMOA 4U7SA 2AGJL 3IDGA 1U8IB 3MREB 4L5FL 5TH2A 5TDOB 4HLZG 4C56D 1RUQL 5DK3A 3N1MC 4XCEB 4LVNB 4MDIA 4OCXL 4LPCA 4XB8A 5IW1B 1R6VA 1R3HA 2R56L 1KEML 1OTSD 3RUGE 3SE3C 1ZVSA 3ZDXE 1M6OB 4NQCA 2HT4D 5BQ7B 5D8JH 3MR9A 2DQHL 4ZFOB 4MCYB 2QV2A 4OZIA 2BNQA 1A6PA 5FOJA 4E0RB 4AMKH 5D7LE 1G7JB 5ESVA 5B8CC 4RGNE 2GKIA 2JJSA 4Y5YA 3T3ME 3X13A 5B38A 4OCWH 5TDNA 1QACA 1IGCH 5D2LA 5HI3D 3JWOC 1J1OL 1WZMA 3ARDA 2YMXH 3I3EA 2GJ6A 3ARSA 1RSFA 3BHBA 3WHE1 3FT2B 3L95A 3SOBL 4DJMA 3RL1B 3MCKB 1MCPL 2AXGB 4GT7A 5DC9B 5BVJB 1S7XA 3OR6A 3TZVB 4ODUB 5JOPE 4WTZA 4S2SA 4XHJC 4LF3A 3E2HC 3C09B 1U6AL 5EU5A 3BGFB 4XT1C 2OL3L 1CK0L 1TJHL 3TO4A 5CBAA 2OLDA 2W0FB 3G6DL 4Z77B 1VFBB 2ENYA 1AD0A 1F6LL 1PYWA 3MV8B 5F7MC 5IMLB 3PV6A 5CMAB 3KYOA 1IAOA 3HZKB 1LDPL 2ZSWA 3QO0A 5ILTL 2C1OB 4EI5B 3CFDA 2MPAH 1T4KA 5DRNA 1A6TA 4J3SA 2C1PA 4EEEA 4JHWH 2HWZH 2CIIB 2DQFB 2NW3B 3BEVB 1LDSA 2YHGA 3O4LA 4UT6H 4GSDL 2V2WB 5I8EB 4JY5L 1OAYL 2KKQA 4BELD 4L3AA 1S9WB 4HJGB 3QI9A 3FO1A 4IIQA 3VI3F 5EO9B 1GOFA 5IG7A 1JJUA 1NGXA 1YYLH 4QGYA 3VGAC 1U3HB 1Y18A 2J4WH 4N1CA 4Z8FL 4D9RE 3EFDL 4KKCC 2APWA 2EYRA 4I18C 1A6ZB 3WFDL 4M1CD 5DC0A 2ILLA 3U7AA 4UT9L 5FOBB 4LLVA 3RY6A 4MDJA 4UIKH 1D5XB 3FT3B 1IGIH 1X5XA 3MJ8A 2X89A 4Z7OE 2BMKB 3QUMH 5J1AB 4Q9QH 4P23C 1T03H 2GYSA 5J06A 3MA9L 1IQWL 4M8QB 5IP4A 5CZXC 3O4LE 1T89C 5DJAA 2OCFD 1EEYA 5JPNB 5DWUL 2DQUH 2ZJSH 3GHEH 3G5XA 1G6RA 4PJEA 4WY7L 3EOAA 4WV1B 3BZFB 1KPRB 1WAAE 5T5NF 4TVSa 1CZ8H 4EN3B 5HVHC 2BP3A 43CAA 4HPYH 1KTLB 4LCCC 4G80B 3TIEB 3EO9L 5HHMB 5EOTB 4PJ5B 1CF8L 3H9HA 1C5DB 3WIHL 5ALCL 5KVDL 3CSPA 3KPSB 1A7QH 5GJSH 3W0WB 3X12A 4LIQL 1CL7I 2IF7A 3S34H 4JY6B 4XPGL 1OPGL 4R4FL 3C60D 4LLDA 4G43B 4JO2L 3BZ4B 4OKDA 3K7UA 3GSNH 3MLUH 3U7WH 4O5LL 3RPIB 3I75A 5DQJA 2WK2A 5L2KA 3SJVA 1RPQA 2AK4A 1FZOB 4OTXH 5D7KE 1R3LA 4ZO7A 1OWRM 3F65A 4Y4HC 3S35L 5KSAB 1M4KA 3QG6B 4MWFB 3CXDH 2P24A 1WFTA 1RI8A 2CH8A 1I3RB 4HDIA 2XQYG 1TQCB 3JWOL 1NDMB 2NY5H 4MAUL 5C09B 1FFOA 4KDTC 1QBAA 1N5AA 1LD9B 2NLJA 5E99L 1U58A 3BXNA 1A02N 3NGBB 3WLBA 3OGCB 4PJ9D 5C0AB 4JN2B 2YEZA 5CLWA 5FGSA 1ZLUH 1YMMD 1F4YH 1JPTL 4M93B 2BERA 3QEQA 1JBJA 1MJ8L 32C2B 4HPOL 1CFSA 2BSRB 1S7TA 4IRSA 5J8OA 4PJAE 4JKLA 5JXEC 1FN4A 4U6HB 2HVJA 3CVIH 4WHTB 5L2KE 4GRWB 1HHGA 3SJVE 2AK4E 4TTDC 3GMOA 1I7ZB 3RTQD 3WO3B 3UJJL 4R2GB 1UM6H 2VNCA 1KCSL 5F97E 4NQED 1WWWX 5FHBH 4MAYB 5BVPH 3HI5H 2B2XH 4UIMA 4KXZH 4RA0C 3IGAA 1M7IB 3K46A 4JN1L 1B6UA 4P2OA 5TDPA 5T3ZE 1N8ZA 2Q6WB 4OB5L 4HXAL 4K3HA 1A4KA 4Y4KC 3MLTA 4NUGL 5DHVB 2HG5A 1N5YL 1AKJD 2B8OT 5LAXA 5HYFA 1T7ZA 1UJ3B 3CAFA 3F58L 5JLZA 3QEQE 5HGDA 1JNHB 5JXED 2IPUK 1SYVA 2RBLA 3B43A 3ZL4H 3P9MB 3LN5B 1WIPA 4TTDD 3THML 3OKMB 2C7UB 3FFCD 4TRPL 2L0DA 1OARH 5EBWB 4OUOA 4JO1H 1C12B 3QZWB 3S36L 4PYHA 4KHXL 4YO0A 5D7IE 3GK8L 2ITCB 4JFFD 4K3DL 4PY8I 3KPOA 4Y4KD 1PSKH 3P77B 4TNVK 1PG7X 3UO1H 1G0DA 3FT4A 3NBNA 1FYTA 2B1HH 2MQ3A 1M7XA 2MKWA 2PF6A 4PJBF 4UV7L 4JRXB 3BPLB 5DTFB 4Y1AD 4N0RA 5AG8A 1F45A 1MFCH 4ODXA 2PR4L 1KYOJ 3ULVL 2X40A 2VISB 3BKMH 4MJIE 5DK0A 1NL0L 4YHIA 1L9NA 1PBYA 1V7ML 3FRUB 4PRHB 1ZE3C 4BK5A 3DO7B 2PCPA 1ZVYA 2HFFB 2HVKA 3GBML 4Z7WA 5FYJD 4G6JH 1E4WH 3TBVA 4DKEH 4HF5H 1RY7B 4BUHA 1T3FA 2H26A 4AEIH 3W5MA 4N0UB 5ADPH 1FBIH 2NX5B 3QUYB 4O02L 1UZ6F 3L3DA 5LCVH 3V6OA 3GBNL 4NJ9H 4PYGA 2CJUL 1JPST 1BAFH 4X7FC 5DD6B 1FYTE 3GGWA 4D3CL 2B5IC 3FO9B 2UZYB 2X70A 4XX1E 5EBMB 3QWOB 1SJXA 3RX5A 3L3IA 3QHZL 1AR1C 3DV6A 4FFVC 2R4SL 3BPOC 2EIBA 2Y5TB 1FO0H 1FV1A 4E42B 1FYHB 3I6KB 4YIQB 2ICWI 1M1SA 3OKEA 4KMTL 4Z7WE 3N85H 3NA9L 3IYLW 4OZ4B 1JPFA 4DN3L 3OKOB 4GXUM 1I3GH 2YRLA 1K6QL 3VH8G 4P5TB 3WIFA 4KZDL 4LASH 3EYQC 2EDWA 4B41A 2BRRH 1GHFH 1RZKH 1CXLA 1BZ7A 5LG1A 5DEFA 1OT1A 3FO2B 2LV4A 1DBJH 3HNSH 4IDJH 2JTDA 1JGUL 1J05A 4XPHH 4NQDD 4Y19B 1AR1D 4MQ7A 4OM1L 1YEEH 4MD0B 1BM3L 2HMIC 3MLSL 2PO6A 3MRKA 4JFEA 2BY3A 4MCZA 2HT3C 4MDIB 4KVNH 2BVQB 3IJHB 2ZKHH 2Q86A 2DL2A 1X9QA 1RFDL 4OSUL 2HTKC 4H8WL 1ZVSB 5EIVA 4NQCB 3CK0L 2XI9A 3L1OL 3QA3B 3CFJA 1U8JA 1GZPB 3MR9B 4FFZL 4OF8A 4OZIB 1FL3B 2O93L 1KPUA 4LNVA 5HGBA 1NCTA 2CKBB 4ZNCD 2JCCE 3VXMA 1G84A 3P4NA 1FH5L 5HHOD 4NHCH 5CJBA 3X14A 4U1IB 4X6DF 2UV3A 1IEAB 3BD3A 4RMVA 1TJIH 5C07D 2GJ6B 2XTJD 4JFXB 4XBEL 4JREC 5MEND 3RZCB 4OFPA 3PWLB 4LRNH 1I7TA 2HT3D 2CXGA 5KS9F 4JFEE 1CICD 4P57B 5J0BA 5JTWA 1J5OH 4NM4H 3FFDA 2HTKD 4UZGA 1K2DA 5E00A 2MCPL 4APQC 3CMOL 1HYRC 1J1XH 3LKOA 4KK8C 1LO5B 3K4DA 1PYWB 3JVGC 4OAWA 4HSQA 5FB8A 3CFDB 4LRIA 4GRMB 3VXME 4MQXC 1UT9A 3ZTNH 5HI5C 1DQTA 4QNPE 5CEZL 1AGDB 1MCSA 1MCWM 3SCMB 4PP2A 1AQDB 5HHPA 4M5YL 1I9IH 2NY0B 3FO1B 4XCCL 4IIQB 1ZXQA 4JVUA 2AXHA 4GKNA 5GGUB 3U9PL 4KK8D 2N7BA 3RJDA 2R4RL 4RWYH 3BP7B 3V4UL 1JPGB 1QSED 4HHAB 1AQKH 3HMXL 2EYRB 4LPXA 5CJ5A 3OKLB 3RFZC 5DJYA 4Y7MA 2HKFL 4EI6A 5H8DA 3V6FB 3P0VL 2ZSVA 5F7DB 4EVNA 2Z9TA 4WI3A 5HHVL 1XFPA 1YEFL 3S5LA 1F42A 1CD8A 3BUTA 3CCHB 5E8DH 1QFWH 4CU8A 3CLEL 1XF5B 2IGFL 5CSGA 1I4FB 5FUCC 4G8FA 5HI5D 4EI5D 2QHRL 3VWJA 2VLLA 1EEYB 1MFDH 5EBLA 3U83A 1INQA 4XGZA 4Q0XL 4M4PA 2Y06H 1G6RB 4PJEB 4JGJA 2EYTB 5GRJH 5F7UA 8CGTA 5ISZA 4YLQT 4ZUTA 1ODAA 2W60A 3OJVC 1B4JH 5I1DA 1FAKT 4JFZH 1Z9OA 1F8TH 5ETUA 1GGCL 1H3PL 4BQ9A 4QRQA 2P46B 4Y4FC 3EUUA 1YJDC 2OK0L 5C0ND 1B6DA 4FN0A 1CE6A 2AJYL 4DOHB 3V79C 4RAVB 4XBPA 3LHPL 1ZGLP 5KVMC 1JMXA 4ONHA 3N1PC 3X12B 3GSVB 4CDHA 5CBEA 1CLYL 3DXAB 1AHWB 1I8LA 4F7CA 2A38A 2MFNA 4S1RL 3ARGB 1XIWC 4KHTH 3I75B 5DQJB 3MYZA 5F1KC 5IB5A 1R3LB 3QIBA 5FK9A 4UILL 3FQTB 4L8SA 4LHUD 3DO3A 3J7HA 4OFIA 4Z9KB 1ZS8B 2P24B 4MLSA 3ECBB 4QHUB 4Y4FD 4HIIA 2Z93A 3GSXA 2I9TB 4TULL 5DMIH 2VXQL 3UC0H 5HY9B 4PJGB 1S7RA 2HA1A 5GRWA 4I4WA 4QXGL 1N5AB 2ICES 35C8H 5EO0B 3BRDA 1OOAA 1U58B 1ORSB 5CEXA 2EH8L 2CK0H 4LMQE 3WCYA 5HHMD 1EAPA 1FL6A 2VXSH 1NGYA 1QYGL 4ETYA 3VXSB 1XIWD 3GNMH 4IRSB 5E1HB 4L3CA 5KTEL 5TF1L 5ICYB 1PKQB 1FN4B 1G7QB 1T2QH 4NZTH 3UBXG 4I9WE 5C7XL 2XZQL 3HZMA 3GRWL 5BV7L 5AZEH 3L6FB 3QB7C 5JQ6H 3DVNA 1VFOA 1XF2A 2QSCL 1TLKA 2G60H 3EFFA 4UIMB 4PBVC 2BXZA 3BH9A 4GKZB 4P2OB 5TDPB 5KSAD 3MV7A 1JGVH 2DTML 1VFAA 3VFSA 5DT1H 5FYKH 4G7YH 4L29A 4F2MA 3F62A 2J8UB 4JKKA 4NM8H 3WLWD 5D5MF 3S98A 2Z92A 4NJAH 2NY7L 2JJWA 2WUBL 1U95A 4Q6IB 2E5EA 3SGJC 5EU4A 4MB4A 1P4BL 4QXUL 5ALBL 1MHEA 4NO5A 3FMGH 5C0AD 4DFIA 4RDQG 5CGTA 4GAJH 2D31A 2Q20A 5E9DD 2OZ4L 1U8KA 1CBVL 1NAKH 1B0WA 3SDAA 1I1AC 2IADA 1XGYL 3ROOA 5JUEH 2FX7H 2J6EL 4JFOB 4GQ9H 5HVWA 2Y07L 4TUOA 4ZXBC 4PJ7B 12E8L 2PXYB 1T04B 1KJ3H 3BP5B 5SWQA 1OQOA 4MAYD 4OF0A 3PWUA 4P99A 2VLJD 3MBEB 2DRUA 3FT4B 5E94A 3VXRE 3U0PA 3E8UL 3STZB 3VRIB 5BO1H 2QBWA 2EZ0D 1A3LL 1JE6A 1N2RA 2COQA 1IM3A 1Y6MR 3D6GA 1KB5B 4KU1A 2HRPL 4WFED 5C0JA 1I9JL 5DMGD 2VN4A 2A6KB 4PTTA 5I30L 1D6VH 1S5IH 3QH3A 1YJDL 5F89B 1I1AD 5DK0B 2OM5A 3K0WA 1JF6A 1WV7T 1JWSA 5DVKA 3T2PA 4PJ8D 1DDHA 2OL3A 2HVKB 4AL8H 5EIQA 5KVFH 2XNAB 1EEZA 3NN8A 2HP4A 3O3DB 2VKXA 4JDZB 1DQDL 3K4ZA 2FJHA 4ZNEA 5DSCA 5GRYA 1RMFL 3DARA 1JZ7A 3LS4H 4PJHB 4RBPH 1AI1L 1VKXB 5KVGH 5SX4I 3WFBH 3GGWB 5ANMA 4LKCA 3B4NA 1HOCA 3QCVL 5CIPA 4JKMA 3TBYB 4F9PC 2MNUA 2QADC 4XTRC 1EFXB 5CZKA 1K5NA 1FL5A 2DBLL 3L9RA 4ZUSB 2D0FA 4OD3L 1P7QD 3PHOA 1Z6JT 2E8ZA 2IALA 5J13B 3SY0A 2D4FA 1FV1B 5EUOF 5J56B 1DSFL 3HE6C 3GMLB 1IGFL 4CGTA 3HFML 4OJFL 2P42B 2XA8H 2HAZA 2XFXA 4NBXB 4BKLB 2BOCA 1ZLSL 4G5ZH 5T1LD 3HAEG 1IL1B 1GC1H 2IPKA 2EDTA 4UAOB 4FQ2L 4OI8A 4WNQB 3CZJA 1AO7D 2UUDK 3G6AA 4N0CD 2APFA 1A1OA 1BQHB 5KSUB 3EIFA 4TNWF 5FUZH 4QLRA 3T0BA 1J05B 3CLFL 3KYKH 3LKNA 5F9WB 4JO4L 5HVFB 4X4XB 1MNUH 1FORH 4D0DB 4U6VL 3NFPB 5E2VL 1F11A 1O7VA 4TSAH 4BSVA 5JW4M 3ET9F 2P49B 3CVHB 3PNWA 4Y8AA 5TE4H 1JN6A 3NFNB 5JA8B 1T1WA 1LP9A 1WBXA 4L8DB 5LBSH 1N4XL 2X9XA 3V8CA 4FQHA 4HGWB 3GMPA 4YK4B 3IS0X 4M7LL 3WIHA 4PRIA 4QHKJ 5HGBB 4OT1L 1N64L 2UY6A 4YXHL 4PUBH 3P4NB 2DLFH 3QR2A 4RDQF 4XP1L 4EJ1C 3SGDI 3MRPA 2GTWA 1HEZA 4P5TD 5GRUH 1NFDF 2OTUA 3CJJA 3WXWH 1HSAA 2YPLB 2FL5B 1F5WA 4K3JL 1UCBH 1FG2B 2F53E 3QUZD 3TYFA 1H3UA 4NO0A 5DEZA 4P46A 5JZ7C 1FGVL 4KKLD 1J12A 1MVUB 1HQRA 3MJGX 4EQ3A 4Y19D 2X4OA 4O2CA 5E00B 5ID1B 1CCZA 3OB0H 3QQ9D 5SWSA 1WWCA 4B7LA 2MHAA 4M3JA 1SJHA 3TLRA 1LP9E 1UG9A 4P9HH 4XAWH 1C08A 3LD8B 1W0YT 1AXIB 3ULUH 1X3DA 4E41D 3C5ZA 5T1MA 4OV5B 4PRIE 4JFDD 1UM5H 2BVPA 3PDOB 1DVFA 1BZ9A 1JZ5A 4LIQE 2LVCA 5C0IB 4OIIL 1ZT4B 4OD2A 1R5IB 3AXLA 4JHBA 4HIXL 1OQXA 3AFLA 4IRJC 1IAMA 1I1FB 3MLVL 3NZ8A 4PP2B 3KPLA 2I5YL 3A6CL 3RJQB 5JZ7D 5T1KA 3VXPA 5K93A 3WN5B 4U31A 4MNHA 3VMPA 5IIEA 1QG3A 4GAYA 1CR9L 4GKNB 3QT2A 3RZCD 2UZIH 1XGTA 1UH4A 1U0QA 2ADJA 3BDYL 1N7ML 3OJMB 2IQAB 5SWSE 3QG7L 1YZZA 3TVMA 5IR1A 5F88B 4U1JB 5F1SA 4KPHH 2AEPH 4JZJC 3H9SA 1VFUA 1FZJA 2EDQA 1QLEH 4P3WA 3SKNB 3FO0L 5MP6L 4XP9L 4J8RB 4GW1A 5HYQA 1FCGA 2RJMA 5E5UB 1ZA3B 1ES0A 2Q76A 1T20A 3A6BH 2AABH 3JTSA 2GJJA 1OM3L 1VCAA 4KDVA 2BCKB 4JQXC 3D25A 3H0TA 2VLLB 1I1YB 2DLEA 2ZG1A 4PLJD 1KOAA 4PY7A 1DN0A 3WS3A 2Q87A 3X11A 3HRPA 3I50H 4LBEB 1BP3B 5ISZB 3KVQA 3HNVH 4X5XB 5IVNA 1IAKA 2W0LA 5E56A 1NMAH 3IU4H 1Q0YH 4U4BA 1QZ1A 4I3SL 5IQ7H 3LPFA 2FX9H 1G7PB 4HWBA 1NANH 1T21A 2HFTA 3V5DA 3EKCA 4ONHB 2EDEA 3BIKA 4U05A 5IF0A 4WDIB 1XGRA 1WF5A 3BH8A 3FOLA 5IFHH 4HKXA 1Z9MA 1GYAA 4ODHH 2AJ3B 5E2WL 2R1WB 1XF4A 1VA9A 1WVZA 3DURA 4ELMB 3KJ6H 5I18L 4U7MA 3CDFA 1MRCL 5DS8A 1E4XH 3EJJX 5CJOL 5IB5B 3EZ8A 4QYOA 1TITA 3M17B 3QIBB 1SBSH 2OMBA 1YYML 5GRVL 1DLHB 2CLVA 1UWXH 1UCTA 1NBZB 2V5YA 1MY5A 4CU6A 4KROC 3ARFA 4OZHB 1Q9OB 3GSXB 3V4VH 1DQJA 4ISVB 4CMMB 1FDLL 3FB8A 3IDIA 3ORJA 4M02A 3HCVB 4J3VA 5E6IB 5I74B 2ESVA 1CDBA 2VZ3A 2P8LB 2Y25A 4W4NA 5TE6L 4OKVB 1IQDB 5GZND 4WO4B 4M7ZB 4NKMA 5ICXB 3JV0A 1A6VL 4ORZC 1M7DB 1QBLL 4XPBL 3STLA 2XN9A 3VCLB 2CK2A 1XF3A 1FL6B 3R1GH 4JGUA 4R97C 1O5DT 5CKAA 3CC5A 3CD4A 4K23L 5CINL 5D93C 4LLYA 1LO0L 1KELL 2X4NA 3AS0A 1I3VA 3DXAD