4OZIE

S2 protein complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
202
structure length
199
Chain Sequence
KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGDGGSFSGGYNKLIFGAGTRLAVHPYIQNPDPAVYQLRDSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title T-cell receptor recognition of HLA-DQ2-gliadin complexes associated with celiac disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 199
sequence length 202
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07686 V-set Immunoglobulin V-set domain
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4oziE02
2WINA 5M95B 5TDOB 5SX5K 1TTGA 3OKLA 3GSXB 3MLTB 4S11A 1OGAD 1YJDH 1FLRL 4WUUA 1J8KA 4OZFH 1PSKL 2CIIB 3PGDB 2VZSA 3FQWB 2VDQL 1EBAA 2YUXA 3S5LG 5I16B 3OJDB 4UQ2B 3RIAF 1L6ZA 3HZYB 1B6DA 5FGRA 3H3BC 3HCVB 5JHDA 5EBWB 3U9PL 1J8HA 2HH0L 2NY5H 3T1WA 5I18L 1FPTL 5GS0C 3VFPB 3BP5A 5E2UH 2PUQT 3DPBA 4NNYB 4UOW1 1WWCA 2Q8BH 1QOKA 3CDGB 3OTTA 2J88H 1DBBL 4ODUB 3QWQB 4MAYB 3LQZB 3RGVC 4NJAH 2DIJA 3C8KA 3N85H 2BVPB 3HZMA 4NZRH 5H35B 5LXGL 5I74B 2BVQA 5FHBL 2WNGA 4OZ4A 4AENA 5EOTB 5IBTH 4RQQB 3RI5F 4FQCH 2P5EB 3BEVA 3HNTL 4OI9A 5GRVL 3UTTE 1R3JA 3BRDA 3H9ZA 1DLFL 4QRRB 4QRTA 5EU7E 5AUMB 1JZ3A 3QXWA 4HIXH 1Q8MA 4HX1B 1MVFA 5CZVH 4F57H 4H20L 4KI5C 2PXYB 4PJDE 3QI9C 3QULA 2X4QB 4UDTA 15C8H 4L8DB 4M8QB 4NZTL 4PTTA 4ZYKB 2LVEA 4X0KA 3U4EA 1I8KB 5IVZB 3KPSD 3QEUA 2ENSA 3LDBB 3UJTL 4FQ2H 3FQTB 3CFJB 4ETQA 4F7TB 4OTXL 2DLGA 3O2VL 2GY7B 4U31A 1AHWB 2GAZB 5FYLE 4XWOC 4IRSA 4XP5L 3VDBA 3EO1A 3NFPA 1EEYA 1H8OA 2VLRA 1K8DA 2R4RH 2VZVA 5DJCB 2PCPA 4LLVB 1T0MB 3G6JA 7FABL 3X11A 1JUFB 1MOEA 1ZHBA 1VESA 4Z7OE 4JJ5A 2YPKB 3SQOL 5BS0D 1IM9A 3LRSA 3HI5H 1RZJH 3QIBB 2EICA 2ZKHH 3GJFA 3QWOA 5DHVB 3EBAA 3M1BB 2YPLA 5FIEA 5GSVB 3HTLX 4P2QD 1JN6A 3IF1A 3CVIH 5FOBB 4MD5B 2WWMC 4P4RB 4MS8D 3SKNB 4JZJC 1NANH 4YXKL 3OKKA 5J06A 1MFCH 4HD9A 3DI3B 1UB5A 3MUGB 3WO3B 4R97C 4L3EB 5BV7L 1GZPA 3QIWD 5LGHH 4R0LB 1BPVA 1T3FB 5J56B 1X44A 3SCMC 1NSNL 1MY7A 1I9RL 1FCCA 3L3GB 2VLJA 3AY4C 4PRNB 5B38B 3E1F1 3QUZC 5BCAA 4HPOL 5IB1A 4BFEA 4PJAF 4YWGH 3HC0A 1OGTB 1JWSB 5F9JA 4EUPG 5K59F 3RL1B 1FZKB 4ZAKC 4MMXC 1FVCA 3UZVB 1NEUA 1D6EB 3FB7A 3G6AB 5EOCH 1INEL 1MIEL 1QHPA 1QLEL 1NL0H 4JVWA 3SE9H 3OAYH 4MA3B 1OLLA 3MRCA 4W6WB 4C56B 4LSRL 5F6HI 1PQZB 1RZIA 2WIIB 3QA3A 3LH2L 1CTNA 1U8NB 4KXZH 4PGCB 3BI9X 1GC1L 4M1GL 1C1EL 3MNZA 4MCZB 3UEZA 4JM4H 4P4KA 4PRPD 2AP2A 1NBVL 1SEBA 3C5SB 3VW3H 5DUPH 1LWRA 1I7ZB 2VQUA 3QG6B 2QEJA 4GAYA 1MQ8A 1H3UA 3L3HA 4NUJA 3WFBL 3MRJB 2ZUVA 3BDYH 2CRYA 1BVZA 4FMFA 1KENH 2A38A 4F3FA 4HG4J 3CCHB 3I9GL 4X4YB 3ECBB 3FO9A 4QTHA 5F7DA 1Y0LA 3ILQC 3TO4A 3U6RB 3MXWH 2CR3A 3BQUB 1E0OB 1CF8H 4UOW0 3WEXB 3RWIA 2IADA 3EAKA 2P5WB 4HMDA 4ODHH 4OI7A 2IH1B 2E5EA 3MV7B 1AD0A 1N64L 1T80A 1KIRA 5D1ZA 1JNNL 2H8PB 4E9LA 3LKRA 4XRCA 1J0ZA 1FYTE 1HIMH 2LU3A 3LY6A 5JORA 1ED3B 4R90H 4U7MA 1HILB 4YHML 3BO8B 4DFHA 4PJ9A 5T3XL 2PKDA 5TQ0H 4PD4J 5HYSB 2ARJQ 1T66D 1DQMH 2OR9H 1HCFX 3EOYG 4JRYA 3F7YA 4X7FC 1B90A 2GJ6D 1G7LB 4KUZL 1EZVX 3BGMB 3BIAX 2YEZB 2LQRA 2QADB 2A74B 4HV8B 4ZUUA 4Q9QL 3LOWA 3MNVB 4NZDA 1I8MB 5KZCD 3NFSH 4QHLA 3ARUA 1E4KA 2F19L 4N8CL 3C09C 1U6AL 4ERSL 1Q38A 1OP5H 3VFUB 3HE6C 3QRGH 1FFNA 4JGUA 3TIEA 3BPCB 2O5XH 4OLXH 2DN7A 5FV2A 4IS6A 1M1SA 4CVZA 3EO0A 3REVB 3ARZA 4L5FL 1K8IA 3VU2A 1MUJA 1EUUA 3HC3L 1YN6B 3UTTB 3ZDYE 1AKJB 1LK2A 4IRJD 1AP2B 5F9WC 3H42H 3RY6C 4CNIB 5IOPB 4JREC 2AEPL 4PGDB 3N1MC 2CKBL 4TPRL 4X7SH 3RWGB 4XPTL 1YYLL 3I85A 4LHQB 3UC0L 1IILE 2YC1B 4PJDB 2EH8H 4L3CB 2H3NB 2XWJB 5HHXH 1VFOA 2GTWA 2P44B 1G7HB 4P2RA 5IGXH 2Q87A 4Z7UF 3RWCA 3SKUD 5JW5A 4KDTC 2FZ3A 2IAMC 4B50A 3PNWA 4OT1L 3T8XA 1KIUA 2GSIA 1K9TA 2Z31C 5IQ7H 1S7WA 1X6LA 4AG4H 4JE4B 3S34L 5HDBF 4BZ1H 5TH2A 1BHGA 2F58L 2GSGB 4BFIB 3RZCC 1TVBB 4L8CB 4IHOB 1MH5A 4RAVA 5IJKA 4OV5B 2W9DL 4Y4FD 5KG9A 1KIPA 4DVRL 1I8IA 3MGTA 2CUIA 3D2UB 5K9OA 2YS4A 2F54A 4LSTL 4PGBA 1OPGL 5GZND 4G8IA 1YMMD 4H25B 3SJVA 1YEKH 1KB9J 3KYOA 4MA8L 5CCKL 2NW2A 2DTMH 3BN3B 4HAFA 4XHQA 2Y07H 4UQ3A 5DI8B 3IETB 5FYJU 2DM7A 4WFGD 4WFHD 5D2LE 1I75A 2JB6B 4HQQL 4BZ2L 1I3GH 5IKCB 2HT2D 4D94A 1CDIA 2N7AA 1UXSA 3JV5A 4NQSB 5TFSL 4O00A 1XF5A 2ZOKA 2X89D 3BJLA 5D70H 5C0RL 1EAPB 3LMJH 4DN4H 2V5RA 1MRDH 3F58H 1X4ZA 1IAII 5FUZH 4XBGB 1WT5C 1AXTH 3V8OA 5KS9F 5INDA 2R0WL 4K94H 3NA4A 4Y1AE 1YJDC 2C9AA 3DI2B 5C07D 3WJLC 3DMMB 1X5XA 3F7VB 1FIGL 5T3XD 1QBMH 3JBG7 3NCJH 4L4VD 2BDNH 2MQ0A 4NUGL 5GRUH 2Y23A 4OF3A 5EORH 5L0QC 1N5YL 3I02B 3RAJH 2Q86A 1BFOB 3V7AG 2XQYG 4GG6B 2R56L 4X6EA 1V7MH 4I5BA 5DMKB 1NLBH 5SV3A 3LEXB 1KUMA 1TCRA 4U1SA 2MQ3A 4Y7MA 3FT3B 4K2UH 3BIKA 3RVXC 5CGTA 4LAJH 1R3KB 3O8XD 3EYFB 1YNTB 4PRAA 5SWZE 5TE7H 1PY4A 3MRLA 1D5MB 4TNWK 5B38G 3MRRB 5I1EL 1KT2A 5E6YA 3L5WB 1IC1A 1FRGH 5I1HL 5JNYA 1U9KA 4RIRB 1HYRC 4UT9H 5DD5H 3ZDXE 3V4PH 1VKXA 3S35X 2X7LB 1LDSA 4N1HB 3VFMA 4OLYH 3WUWB 2ZOLA 1A0QH 4XCEA 2CUMA 3T0DA 1O7VA 4APQB 1ZA6A 1A7PL 3ULVF 5SV4A 1D6VH 1NFIA 4JKWA 3RA7H 4LLYA 5IEHB 2BFVH 1HI6B 2VR9A 5CBEB 3QO0B 5FUOL 1HHIB 4LAQL 1K6QL 3T0BA 3ZZ1A 1JGVL 1JBJA 2OTPA 4NM8H 3T2QA 4PLKD 4I48A 4HKBB 2ATKB 4YFDB 3VWKC 3UPAA 4URTB 4G80B 2IF7A 3T3PF 4OQTH 4UDUB 4HXBL 4OZFG 1QYGH 4ZOAA 4P46D 1QBLH 3C8HA 1FYTB 3HC4L 1A6UL 5DSCB 2XXMB 3T2OA 2EDLA 1MAJA 4M62L 5F1OB 3LQAC 3F12A 3EOAA 2NY3C 1IT9L 3GB7A 5CZXD 1JZ2A 3L6FA 2QR0B 4YNYB 2G9HB 1AJ7H 1EO8H 4MB3A 4S2SB 3HZKA 4QXGL 3LSOA 1QQDA 4G7VH 1T5XA 2PTUA 4XC3H 4K55A 1ZVSA 3SOBL 3VRLF 5C6PB 3O45B 4RGMC 5FHAH 1F02I 5I8OL 3PF2A 5E08H 3MGOA 5ADPH 4GLRH 35C8H 4U05A 1BBDH 2JJUA 4LCYA 4PJBE 4PP2A 3OHXB 4WW1A 4AYFA 2AJYH 2W60B 4JKPH 2EYRA 5D7JC 3L7FA 4IBLT 3OZ9H 3FN9A 3IJHB 5HHVH 4JVPA 4WVRA 4UNUA 4PJCE 5GGRB 3MV11 3I6GB 4QNPE 2WIMA 2AEQH 1ZLUK 1XF4A 4M5YH 1YEIH 3SDAA 3BH8B 3MLYL 4I0KA 3PWUA 3TCLB 2ZZUT 4HIHB 3T0EC 3NFNB 2VO5A 3F6IA 3IS0X 5T5FH 1T4KA 1AR1D 2BSSA 3C87A 2NTSP 4X6DA 5IROC 4XVJL 4FQXB 3QFDB 4QHMB 3B43A 1NBYB 5LBSL 3FN0H 3K1KC 3OGOE 4JM2A 3WFDL 1P9MC 5HI5C 2D0FA 4P3CH 4RFEA 5CJ5A 1H3VA 4KI5F 2Q3AA 1WZ1L 2DI7A 3HG1E 3HZVA 3C6LA 5FYJL 1EXUA 1DLHA 3L5HA 3TN0A 1ONQB 1YQ2A 1BF8A 5TDOA 1NQBA 2G75B 3GSXA 3MLTA 2X9WA 3ZYJA 4P5TC 1I85C 2CIIA 2GHWB 1IKFH 1OAXH 5C0AD 3PGDA 4CN6A 3TVMB 5I19L 5EZOL 2O93L 5C08E 3FQWA 5DURB 5GJTH 4D0BA 2ICWJ 3STLB 5I16A 3OJDA 4UQ2A 1XF2B 1MRCH 3VD4A 5AG9A 3HZYA 1JI2A 3HCVA 5EBWA 5JMRA 2B2XH 4X9FA 5ETUB 5DJ8B 1P4IL 3VFPA 5EPMB 3WE6B 3NCMA 1KNOB 4NNYA 2YK1H 1EGJL 4XCFH 3DYOA 3CDGA 1LDPL 3N06B 1FNSL 4ODUA 4MAYA 5F9OL 3LQZA 5B3NA 1QR1B 2L7UA 2BVPA 4JCLA 4Z8FH 1UWEH 5H35A 4S1DD 5EOTA 4RQQA 4ZNEE 3B2UC 3LN4B 2P5EA 4Y1AB 5I2IB 4QRRA 1DUYB 5AUMA 4UILL 4DGVH 5LCVH 4HX1A 1JRHL 2FJGB 2PXYA 5JUEH 2ZNWA 2A0LC 1U3YA 2X4QA 3TYGL 4HJJH 5MI0C 1D9KD 3QQ9D 4L8DA 3HE7B 4M8QA 4ZYKA 4H5SB 4IMKA 3ULUL 4BUGA 1I8KA 5GGTL 2J8HA 4S1QH 3GK8L 1ETZB 2P8PB 2DB8A 3LKQB 4QOKE 3QXDB 5EDXA 1BX2B 3OBAA 5I17B 4OGYL 3FQTA 3DGGB 1M05B 2NX5E 3CFJA 4NYLB 4F7TA 4WI2A 5HJ3B 3UTSE 4TUOB 5CWSB 5SWZB 2A1WL 1AHWA 1L7IL 2GAZA 2WBJD 3THML 1F4HA 1WWWX 3LPWA 1LNUB 4F2MB 4UV4L 4JKMA 3KPTA 4P99A 4YDKL 5DJCA 4Y4KD 5KVMC 4K9EL 4LLVA 1T0MA 1JUFA 2E9WA 3BEWB 3HAEG 2FWOB 5ECJE 3BKCL 2YPKA 4YBQC 3REWB 1G7MB 5E2VL 1K3IA 4DAGH 1T22B 5DHVA 3QIBA 1OD7A 3M1BA 5GSVA 5F1KC 1Z0NA 2GKIA 3O9WB 1OM3H 4KAQH 5FOBA 4MD5A 1NBQA 4EBQL 4P4RA 3JZ7A 4OZIF 2HT3C 1KN4H 4YHLL 5FYJD 2X1WL 1UWXK 3LV3B 3WHXB 4Y4HD 3MUGA 4P23D 4DGYH 4L3EA 4PJXF 2QJDA 1PLGL 3FQNB 4R0LA 5CINL 1ZGLP 1BM3L 1EBPA 2B20A 3L3GA 3HMWL 5E6ZA 1GGCH 5D7SH 4PRNA 1J87A 1QHOA 5E5MB 5D9SB 4HUXB 4HC1L 3MJ9L 4HBQA 1OGTA 2P7TB 1JWSA 1IARB 3I50L 1IQWL 1CFSB 2F53E 3RL1A 3MV9D 4JFEE 1FZKA 4OKVB 4O02L 1AFVH 1D6EA 3LIZH 4M03A 3G6AA 3WLWD 3RIFK 1S5IL 4QWWD 2GCYB 4LSSL 4IOFD 3G9VA 3BVNB 4MA3A 4WI5A 4O58L 4C56A 3WSQH 3ZTNH 4PUBL 3TZVC 1PQZA 2FGWH 1N4XL 2WIIA 5E1HB 3VE0B 3FT4B 3IU4H 3LN9A 3DYPA 3ARRA 2FRGP 1U8NA 4PGCA 4EJ1C 2HVJB 4JDTL 4W81A 4OCXH 5JW3H 4MCZA 3QP3A 2R23B 3EHBD 1ZT7B 4PJBB 3B2VL 4XMLL 2FO1A 3C5SA 2X4TB 4JG1L 1I7ZA 3QG6A 1UA6L 3VXME 4PJCB 4Z7WF 3PIQB 4MQXD 1G9NL 5EIIB 4F15B 1QUNA 3MRJA 3JTSB 3P0YH 3ESUF 1RVFL 3RJDA 4LVHB 4NFDA 2FJFB 4HJGB 2E7LA 2MMXA 4KY1L 2JJSC 4LVNB 1K85A 2OR7A 5EZJB 3KXFB 3CCHA 4X4YA 3ECBA 4QRPE 5D1XC 3ULUD 4W4OC 1NMBH 3RL2B 4OCWH 4PJ5E 3U6RA 2UUDH 5D1QC 5DJ0B 3VXUD 1JZ5A 1OTUC 3HUJE 3BQUA 4HS8H 1JYVA 5D93B 3HG1B 3WEXA 4NN7B 5E0QA 5HI4C 3H9HB 5F93C 2P5WA 2DI9A 2IH1A 5DQJB 4ZXBC 3MACL 4YC2C 3B6SB 5AAMA 1VEOA 3MR9B 5DD0L 2DJSA 2H8PA 2YD6A 3TT1H 5C08B 1FZOB 1ED3A 1FG2B 3OPZL 5D5MF 1TNNA 4OFIA 1HILA 1LK3L 3BO8A 1NC4B 5E2TL 1CD8A 5IFAL 4PJEF 5HYSA 1FV1B 4D9QE 3SE3C 3FO0L 4ODTL 1QFUH 1JGLL 3ZT7A 3KLDA 3U79A 1G7LA 4GMTL 5E8PB 3BGMA 3UZEA 2YEZA 4KK9D 2A74A 4HV8A 5ALBH 3MNVA 5MEPB 5GRXG 1YEFL 1I8MA 1L0YA 3O3UN 3O6FC 1AE6L 4Q9RH 4JO2H 3S96A 1WFTA 2NY6C 4TUKH 4YHKL 3VFUA 2COQA 5MP6L 2AK1L 5CEXB 1TNMA 1A5FH 5CZKA 4PJ8B 1MREL 4LCIL 2XTJD 3TO4C 3K3QA 2O5ZH 5I1CL 4UOJA 5E56A 1R5VB 3REVA 4Z5RB 3BYTA 3U7WL 3X12B 4XVUD 3QDJE 4LPVA 3D87B 5CGYD 1YN6A 3UTTA 3MBED 2M26A 1AKJA 2H9GB 4P2OC 1GXEA 1AP2A 4UNVA 1RQ5A 1TJHL 5GRZA 4CNIA 2D7OA 5IOPA 1OAQH 4DFIA 3B3IB 4PGDA 4OCSH 3RWGA 2HJLB 3NA9H 2YC1A 5L8KB 3X17A 4YXHL 4PJDA 4L3CA 2H3NA 2XWJA 3QFJB 4PJIE 1G7HA 3HRPA 3L7EB 4LHUD 2FCBA 4PJHE 5HI3C 5AYUL 4MXQD 1KEGH 1JGEB 3D69B 4X7EC 4ZFGH 5CLTA 1DVFC 3RNKB 1CN4A 1ZS8B 4QOKB 5DC0A 1IAIH 4MNGE 1BQHB 4BFIA 2NX5B 3UJIL 1TVBA 3LKPB 3QUYB 5FDWB 3A6CH 5GGVL 3UTSB 4K7PH 3K1DA 4L8CA 4IHOA 2Q8AL 5EU6D 4OV5A 1A02N 4ZO7A 4YFEA 4JRXD 3K2UH 3D2UA 2JIXB 4Y89A 1Q9LB 1U8PB 4OB5H 4KJPD 1PVHA 5FAAA 1S7XB 4H25A 3GM8A 4UAOB 2R0KH 1OWWA 4N0YH 5DI8A 3KPMB 3IETA 2VLME 2Z8VC 2JB6A 3PABB 4V1DD 4RGOH 3VXQB 3VFWB 3SKJH 3U2SB 1GPOL 1XGQB 4OD3H 5IKCA 1LVEA 3CK0L 4OCYL 4LU5L 1RIVH 2XZQL 4NQSA 5ISZD 5CKGA 3IFLL 4X83A 2VXVH 4HK0B 4O51B 3C9NB 4P59L 1PFCA 1CLZL 1EAPA 5BZDB 2X70B 5HVHB 3NCFB 3M8OL 3ZL4H 3VXSE 2P24B 4RNRB 5DEGB 4XBGA 1JGDA 1XIWC 1G1CA 4F7MB 3T04D 3FQRB 5ICZB 3DMMA 3F7VA 4YIQB 4PY7B 5I1JL 2F53B 1MFBL 4XNZC 4JFEB 3QCVL 2EDXA 3W9DB 1IMHC 3RDTB 4DN3L 3LS4H 3GMLB 3I02A 4GBXB 1BFOA 3QZWB 1QSVA 4NN6C 4PB9L 1KPVB 2ZUUA 3LCYA 3QEQD 3QXUA 5DMKA 2XZAL 3V4VL 3KNBB 4LOUC 1MJJA 3LEXA 1MEXL 1S7VA 1JTTA 3FT3A 5F96H 4FFZH 5ITBH 3RTQC 3KYMB 4JDVB 2ZJSH 1R3KA 2BZDA 1QZ1A 3I2CH 1GCFA 3EYFA 1YNTA 4PLJC 2EDTA 2VDKL 4W6YB 2FECL 3KPSE 1D5MA 3UBXI 3DURB 3ALXA 1U36A 3MRRA 4G8GE 3GI9L 3VXMB 3L5WA 3AS3A 2HAZA 4O2EB 4RIRA 4J3OC 3HLAB 3BDBA 1RZKC 1TJIH 1JNHB 3RVUD 2X7LA 1XGYH 5ANMB 2JCCF 5C09D 5LG1A 3MLXH 4CVXB 3WUWA 4NDMB 3VWJB 5FA4B 2YZ1A 4W68A 1S9XB 1HQ4B 5DO2C 4APQA 5IW3A 4GFTB 3DHMA 1EX0A 2XN9D 4UT6L 3BKJH 4QRPB 2X6MA 4Q6IB 3TESA 2I9TB 1WEJL 4PJ5B 5IEHA 1HI6A 3BAEH 5CBEA 3HUJB 3QO0A 5B21A 2Y25A 2CLVB 5JXAL 3T0AA 1HHIA 4YH6A 2NY0B 5E2WH 5L6YL 2VXUH 4R26L 4HKBA 2ATKA 2X4UB 5FGBA 4G80A 5ENWB 4PRIE 3GSNL 1CVSC 5I30H 2OL3H 3C60C 3ULVL 4YHNB 4F33B 3X3GL 4UDUA 2CK0H 3RIAK 5DHXB 4A6YH 1S9VB 3J7HA 2O61A 2F8VA 3BN9C 1FYTA 4R4ND 4KGLA 1F8TH 2I07B 1YEHL 4HUKB 3VA2C 1ZGLB 4Z7QE 3F7RA 5DSCA 3TH2T 1U8LB 1P4BH 4OGAD 4TOYL 5ABDE 4ODBD 4G6JH 1BD2D 3O6KH 2QR0A 4YNYA 2OTUB 1Q72H 3QUXC 2G9HA 4TSBH 3ARFC 2DWDB 4KHTL 1MLBB 4S2SA 5KOMC 4BM7A 5JHLL 4GW4B 3O45A 2HTKC 4QRSB 5IBLC 3TBSB 2Y06L 5IFHL 2D31B 2CGRH 2VL5B 1A6WL 2HN7B 4ZOCA 2CXGA 2X5PA 4M6NH 4HW6A 4GG6F 3OHXA 2W60A 1B3JA 3ZDZF 3FB8B 4LRIC 5H8DA 1FLRH 3IJHA 4G7YL 2J3SA 4FFYL 4NKQB 2CPCA 5GGRA 4PRPE 4LDOB 3I6GA 4ODVL 4G6AD 4X80H 4MJ6B 4PRBB 3UJJL 2I5YL 2AQ1A 3BH8A 5C71A 1SM3H 2VDQH 4JY5L 4PB0H 3TCLA 4FMKA 3NBNA 3U7YL 4ELMF 3I75B 5T33L 3NFNA 4OCRH 3JSSA 2DQGL 5DF0A 5GS0L 4LDLB 4I1NB 4H0IA 3ALWA 3U9PH 5EUOE 1MCBA 2JF1A 4FQXA 3QFDA 4QHMA 5I18H 1XR8B 4XNMA 3W0WE 1S9WB 1NBYA 4PJHB 3UAJC 2E6JA 5C0CD 4S0SD 4L8SB 4GRLC 4MNGB 1ONQA 1U41A 3RY4A 5JOFB 2G75A 4MQ7B 1AGDB 1U3HC 1X4XA 4R7NB 5KVDH 4RFNB 5FHBH 1UC6A 5GXBB 1CICB 4J3UA 2DQDL 5HYJE 3TVMA 2JB5L 4Y2DB 3BKML 1MRFL 1E6OH 3VGGA 3STLA 4K3EH 3WV0A 1XF2A 3DHJA 5EU3B 3B5GA 2D7QA 3KPLB 4R2GD 2QV2A 4KKNA 3HMXA 3ZHLA 2BNQE 4OD1L 2DAVA 5ETUA 5DUBB 5DJ8A 1SQ2N 3SDDC 3SDAC 5EPMA 3WE6A 4FFWC 4NZTH 1KNOA 1VEMA 4AQ1B 1WFNA 1WIUA 5HVFB 5D7KD 3GZKA 3QQ3B 1FL3B 1B4JL 3WFEL 3EJZC 4I0PD 3SY0B 3FN3A 1GJIA 1QR1A 4B0MM 3UJTH 3VXSB 4OTXH 3O2VH 3ULVD 3D85D 4UT7H 4XP5H 3V6ZB 1PZ5B 3DBXB 3GSWB 3LN4A 4XMKL 1DP0A 4Y1AA 5GZOD 3C6LC 1BVKB 1MAKA 3BMVA 2VDPL 7FABH 5I2IA 5IM7B 1DUYA 3SQOH 1KCLA 3WNNA 2DS4A 2FJGA 1JRHI 3QCTL 1ZLVH 4NCC2 4HAGA 1ORSB 4JHWL 4WTWA 3HE7A 1JL8A 4H5SA 1PGRB 3NMEA 4FFVD 1P7HL 3T77B 3GDBA 4WWKD 1V8HA 1ETZA 4YXKH 4U0QB 2P8PA 3LKQA 4Z77B 2J2ZA 3QXDA 5B8CC 1BX2A 5I17A 3PWPE 1M05A 3DGGA 4NYLA 5TPWL 5IFJB 3FOMB 4ZFOB 5HJ3A 4TUOA 5CWSA 3GFUA 5SWZA 1D5XB 5C6TH 3KPSB 1LNUA 3CSGA 4F2MA 3VRIB 1OAYL 2LTQB 3W9EB 2ICWI 2OL3B 4HPOH 2NTFA 4KRMB 1J0KA 5KSAC 3BEWA 4OQTA 2FWOA 4A6YB 5IT2L 6CGTA 5CGMA 5I74C 4Y5XB 1RJYB 3REWA 3SKOB 1G7MA 4HWEH 1B0GB 1JNLL 3JWOC 5GS0D 2WLZA 1T22A 3WXWL 1QACA 1INEH 4MNHB 4TN9A 1QLEH 3KJ6L 3O9WA 3GJFK 2B1HL 3EJJX 5KSBB 4FA8A 1PG7X 4LSRH 3SDCD 4WFHE 3RGVD 5KAQF 2AEIT 3IDMB 3BUYB 4FOMA 3MO1A 4M6ML 2CLRB 4PRHD 4P2QB 4AEFA 1XCQB 3LV3A 5A3IC 1GC1H 3WHXA 2HFGL 4E41E 3ARDC 2Y5TA 1XF3A 1MCOL 4R4FH 4K3HA 4DZ8B 3FQNA 3VI4E 1M7XA 1P2CB 4I3RH 1NBVH 1JPTL 5ERWB 4PRIB 1JMZA 5FUCC 5IMMB 2BRRH 5E5MA 5D9SA 1DCLA 1A6VL 4HUXA 3QIWB 3E2HC 5GRWA 2P7TA 4RWYL 4KI5D 3WL9B 1R0AH 4XP1L 1CFSA 2W0FB 3WFBH 2ENYA 1C8PA 3QI9D 4OKVA 2IQ9L 4OLWL 3NPSC 3PP3K 3DNKA 4KDVA 2GCYA 2PW2B 5T3XE 1IRAY 3BVNA 2V2WB 3T1FB 4LLDB 3IKCB 1KCKA 1G6RL 3D6GA 3I9GH 3VE0A 3FT4A 4MXVF 2HVJA 4KKCC 2R23A 2ZUWA 2DWEB 4XWOD 3GUTB 1ZT7A 4HLJA 1LE5B 4PJBA 2W0PA 1T89A 5CD5C 3SKMB 2X4TA 2P47B 2CJUL 4DCQB 2X2YA 1N64H 1NGZB 2DICA 4PJCA 4PRPB 4POZC 2F9BT 3H2WA 3PIQA 4X9IA 4ZOBA 2BNRD 5EIIA 2ZSVB 3H0TB 3JTSA 3SGKA 4RISL 4YHMH 1NLDL 2OXHA 1UCBL 5T3XH 2FJFA 4HJGA 5J8OA 4WW2B 1YY9C 2WWMD 3Q5OA 2V5TA 5CJXC 3WD5H 5EUOB 5EZJA 3EOBB 3KXFA 5DGRA 2Q1EA 5I8EB 3X3FH 4L4TD 4UTAL 4HZLB 2RHEA 1OAZH 3W0WB 3RL2A 1BQLL 2LAGB 4WO4C 4N0RA 3CGTA 4Q9QH 1GAFH 5DWUL 1VPOH 1A6AB 1ZTXL 3HG1A 5IHUL 2Y72A 4KMQA 4Q58C 2CKNA 3H9HA 5JPMB 2F19H 3QUZD 4N8CH 1LP9E 1U6AH 5GGSB 1MNUL 4RGNC 2IAND 2WBWB 5DQJA 3RUGE 5BRZD 3B6SA 1LO4L 3MR9A 3WNKA 1BGXL 5HYJB 4ZAKD 1T7XA 1ZGLM 4YDJB 1DANU 5C08A 2YD9A 1FZOA 2IBZX 1FG2A 5D72L 3HC3H 3RBSA 4P9HL 3ZE2E 1NC4A 4IRZH 1J05B 3CFCL 4I2XE 5EBGA 3UTZA 4TTDC 3GMQB 2DM2A 1FV1A 3N1PC 4X6CF 1WBXB 3WIHL 4ZTOL 2BNQB 2CKBH 4XPTH 1YYLH 1MCPL 3UC0H 2NXZC 3BZFB 3CDCA 4DKDC 3ZSTA 1M4KA 3H9SD 2PO6B 4KZDL 3IFPB 5E8PA 4RA3A 2Y5EA 2AS5M 3J8F7 4DOHE 4W4NA 5MEPA 1MSPA 3MRKB 5BVJB 4X6BB 4BQ6A 4Z7VE 5FCSH 2GJ6B 5E9DD 1TVDA 3S34H 1IAIM 5CEXA 2F58H 4YHYB 1UADC 1FN4B 4PJ8A 1JWUB 2DQCH 4HCRL 5KZCB 2W9DH 1NCAH 1R5VA 3CZFB 4DVRH 3V0WL 3SE4A 5BO1L 3RKPA 4ZNEA 4Z5RA 3X12A 4LSTH 1KLUB 1OPGH 3AS1A 2FH8A 1LEIB 4GKZB 2H9GA 3SGJA 5E8OB 1IC4L 3BMWA 4MA8H 5CCKH 5M94B 5KVEL 3BP7B 3B3IA 3RNQB 3V6OE 2HJLA 1D5IL 4LQFH 3QFJA 4IRJB 4G9FD 1OTSC 1AGEB 1A9BB 4LL9A 4JFHD 1T03H 3L7EA 2Y6SC 1OOAA 2VMFA 4ZD3L 1FAKT 1IVLA 3D69A 2A6KB 5TFSH 3H3KA 3RNKA 4RWHA 1ZS8A 4QOKA 3SDXF 5C0RH 4FXLA 1NFDF 3ZYIA 4KTEL 3PWPB 4Y88A 1BQHA 2NX5A 4TRPL 1F2QA 3QUYA 3LKPA 5FDWA 3AM8C 3R4DA 4M1CC 3UTSA 5LGKA 4OCMC 1P7KB 3CLFL 1N6QL 4ZO9A 1OF2B 2JIXA 1Q9LA 3B9KD 1U8PA 1BFSA 4Z78A 3H7BB 3MCG1 5TE4H 1S7XA 2CDEA 1ZV5A 1Z2KA 1OVZA 1I3RB 3G6DH 3DUUB 3WHE1 1FLTX 3KPMA 5C0AE 4FQLH 2VUOA 4IIQC 3PDGA 3WS6A 3JV6B 5AYQA 3PABA 1N5YH 3VXQA 4HEME 1CG9B 3E0GA 3VFWA 1KG0B 3PWVB 3U2SA 1XGQA 1CI5A 3TM6A 2R56H 1T5WA 3VG0L 3MRFB 5D7IE 4HK0A 4O51A 3HE6D 3C9NA 2YD3A 5BZDA 1JWMB 2X70A 1CZ8L 3K81A 4C54A 3BFOA 4EOWL 4NOBA 5I1DB 4RNRA 1P5UA 5DEGA 4EN3C 2AJSL 3ARBC 3I6LD 4F37K 4GKNB 4F7MA 4NNPL 3Q6GL 5A2JH 1S7RB 1RZFH 5D6CB 3FQRA 5ICZA 1RUKH 3WJJA 5I1EH 3MV8D 2WSKA 1JHLH 4PYHA 4YIQA 1RUPL 3R8BB 5GGRY 4NZJA 2D7NA 2F53A 4JFEA 4XAKE 5I1IL 3W9DA 3LD8B 3S8WA 3RDTA 4QHUB 4IDJL 2YD5A 3DETC 4HK3J 3GMLA 4TQEL 3BPLC 5C07B 4ZS7H 4GBXA 3CU1A 4YK4B 5I1KL 3QZWA 4U0RB 4WU5B 2IAMD 4ALAL 1KPVA 1UCTA 1G0XA 1A7PH 2Z31D 3KNBA 1MJUL 1JGUH 1ZVYA 2XWBB 2A9NL 4NQVB 1SHMA 3TBYA 3MSPA 2OI9B 5F7FA 4YDIL 1NEZB 4ETYA 2I60L 3S36X 4F8QA 3U7AA 3S9DB 3WFCH 3KYMA 1UKQA 4JDVA 4XTRC 4R3SB 1K6QH 1JGVH 1JYXA 4DZBB 3MOBL 1WFOA 3E6HB 2FDBP 4HZAA 2QHRL 3DURA 1ADQL 2FECI 1NDGB 3VXMA 3O8XB 5D2NC 3BT2H 1NCBL 3WXVL 4O2EA 5J12B 3HLAA 3HC4H 1JNHA 3NIGF 4EQ2A 1A6UH 4CU8A 4M7ZC 1IQDB 5ANMA 5IWLA 2QHLA 5FOJA 3ZSSA 4HUUB 4M62H 4L29B 4CVXA 2BHZA 4NDMA 1IT9H 3VWJA 5FA4A 1V3JA 3ZKMC 1S9XA 1HQ4A 3ZHDA 2Z8WC 1F90L 3W5NA 3OGCB 2CKBB 4QRPA 4Q6IA 5F8RC 4QXGH 2KBGA 2I9TA 1ITCA 4ORGB 5KVFL 4CRPA 4PJ5A 4NQEE 3SOBH 1HNGA 1WAAA 3HUJA 5L2KE 2CLVA 3EYSH 4ZQKB 5I8OH 3VD9A 1U3ZA 1UZ6F 2R1XB 3OX8B 4MA1B 4C57C 1LP9B 2EIEA 3RUGB 4RX4A 4HHAB 2X4UA 5EIQA 5ENWA 4P3DB 2F74B 1AGBB 4NP4H 4YHNA 1QFOA 4F33A 1PW3A 1S9VA 5BV7C 4DK3A 4I18B 3CVHH 1TQCB 4XNYL 4LPTA 4F58L 5DS8B 1ZGLA 2I07A 1U8LA 1MWAH 3MLYH 4MNQD 1DBJL 5HHQB 4P46B 1YNKL 4MJID 2AJVL 3B9EA 2R1YB 1N7ML 1EUTA 5I15L 2OTUA 3MV9E 2DWDA 1MLBA 3V9FA 3SEPA 4EIGB 1IGFH 4AMKL 2LU7A 4GW4A 3RVXD 5J1AB 3I84A 5HYEA 2B7DT 3K7UA 4DOHB 4QRSA 3TBSA 1NMAH 3WFDH 1G1YA 1MI5E 2D31A 2VL5A 3AB0B 2HN7A 4APQC 1WZ1H 4HMCA 5FYJH 3S3JA 5C0GB 5KW9L 4HFUH 4EKXA 3ES6B 3FB8A 1YEDB 4PP1C 3GGWB 3VG9B 1H0DB 5CEZD 4FN0A 5SX5H 1PBYA 2ZUQB 4POYA 3QDJA 1KEMH 5I19H 5EZOH 4PRBA 1KF9B 1G7PB 2XZCL 1KTLA 3HRZB 5GZNC 3I75A 4B7LA 4NC2B 4H88L 3WHE0 3NTCL 3MRPB 1JI1A 3L5XL 4BQ8A 4G6FB 1XR8A 1N0XL 1S9WA 3GJEA 4PJHA 1UT9A 1N6VA 1EGJH 4HEPG 1LDPH 4L8SA 3VWKD 1FNSH 3DROB 4MNGA 2HT2C 4OF8A 1QO3B 5JOFA 1Z5LB 4MQ7A 1AGDA 4M61A 2QKIB 4R7NA 2DKSA 2FATL 1NAML 3SO3C 3S4SB 3OKEA 1QBAA 1CICA 3KPPB 3UBXB 4JPVH 1U8KB 4Y2DA 4JQIH 2NY3D 1MJ7L 5C0IB 1RY7B 1B9ZA 1LMKA 1Q9KB 5EU3A 5C0AB 3KPLA 5FGCE 1GGYA 1A2YB 3Q5YA 3A6BL 1HKLH 2AJZB 2KPNA 1MHEB 1CLYL 4ODSL 5GGQL 2EDNA 5DUBA 2C3HA 2CDFB 3TYGH 4MA7L 1DBAH 4JN2B 2FHCA 3H3PH 3VDCA 1ITBB 3ULUH 1VSCA 5D7IB 3OG6B 2XYCA 4NO2B 1U8OB 2I27N 3QQ3A 1FL3A 5GGTH 4KV5F 2HFTA 4WCYL 3GK8H 3SY0A 1DR9A 3NIFF 2H32B 3VXSA 1R5WB 4M7JL 5K33A 2F5BH 2A1WH 1L7IH 3D48R 4Q0XL 5JOPE 3MLVL 3O6ML 3THMH 3M07A 5JQ6H 3V6ZA 1CQKA 1PZ5A 3DBXA 3GSWA 4UV4H 1P6FA 1BVKA 2WQ8A 2JJVA 5I8KL 2ERJC 2E9JA 3L3DB 4K9EH 3T0ED 4OCNC 1EHAA 5IM7A 2L7JA 5ESAB 2A9ML 3BKCH 2ZPKL 4JFYB 5DK2B 5E2VH 5JMOC 4K3DL 3MFGB 1JV5B 3DYMA 1W0YT 5JHDE 1XGPB 3TA3C 4OJFL 5HI5D 5J57B 1ORSA 2ITCB 3ROLB 3IFOB 4EDXB 4E5XB 3UO1L 1UG9A 3T77A 4NCDA 4FABL 4OFDA 4HF5H 2DF3A 1B88A 4Z77A 1D9KB 4PJAE 5IFJA 3WYRA 1MFEL 3FOMA 4ZFOA 4R96B 1D5XA 5K59E 4CW1B 2ILLA 1PLGH 3KPSA 1JFQH 5CINH 4M93C 1BM3H 2DQEL 3P2TA 3VRIA 4JO3L 1BP3B 2K3TA 1YNLL 1FG9C 4U49A 2OL3A 1X5IA 3EIFA 2VDNL 2C4FU 2VC2L 2EYTB 4HC1H 5EU6E 3MJ9H 4A6YA 4F9PC 2WBJB 4DKEL 3P77B 3I50H 4Y5XA 1RJYA 3DSFL 3WO4C 1IQWH 3SKOA 3CVHB 1B0GA 4Y4KB 2RFXB 2R0LL 2G60H 3TGXA 3F62A 2DOCA 2J8UB 1MWAB 4MNHA 1S5IH 3U1SL 4LSSH 1F3JB 1HKFA 1OHQA 4O58H 5IIEB 1CDYA 5KSBA 3TH3T 1VFBB 4PUBH 2XQYK 3MLUL 4V1DE 3IDMA 3BUYA 1AY1H 4ONGL 2CLRA 5L2KB 4P2QA 2J5LB 1XCQA 3NN8B 4JDTH 5CJQH 2APBA 4KU1A 5IQ9B 4N9GB 3B2UD 1QFWL 5C6WH 3U0WL 2LV4A 2C26A 4DZ8A 1C12B 1K5NB 2XACC 4XMLH 1P2CA 3CZJA 4LQ1A 5ERWA 4PRDB 4PRIA 1FH5L 4JG1H 1UYWH 5GRJH 5IMMA 2WAHA 4JZNB 5CILL 4EXKA 1UA6H 3QIWA 4NPYB 3Q3GB 3MX0A 3IYLW 1KN2L 3WL9A 6FABL 5IP4A 2W0FA 4OLZL 5FA3B 2A0LD 3HNSH 1BJMA 4NO0D 3B83A 1FYHB 3LEVL 2OBGA 2IGFL 2PW2A 3C6SB 5CKAA 5E8EB 1WZKA 2V2WA 4KY1H 3T1FA 4LLDA 3IKCA 3MV9B 2CK2A 3SBWC 5IVXF 2C1OA 1MI5B 3SGDI 3TPUB 5BZWB 1EK3A 1FFRA 2DWEA 3GUTA 4NM4H 1LE5A 5JW4N 3ETBF 3SKMA 4JR9L 3SPVB 3MACH 3O0RH 4DCQA 1FZMB 5DD0H 1NGZA 4PRPA 1ZK9A 5HDQL 2XQBL 2QSQA 2ZSVA 3F8UB 2R39A 4AL8H 1AIFB 3QWRD 5GHWH 1F4YH 4YBHA 1DSFL 4GXUM 1TQBC 1TZIB 4O2FA 5E2TH 5F72S 5IFAH 4WW2A 2W92A 3FO0H 4ZODA 1VFMA 2IALB 4ODTH 5EUOA 1QTYT 3EOBA 2HT3D 5I8EA 2VSCA 1C08A 2C4XA 2XKUA 5C09E 4HZLA 3W0WA 2Z8SA 2HLFC 2OJZL 3PP4L 2GFBB 4JFXB 1YEFH 1A6AA 2XN9E 2EXWC 1FE8L 1ZT4B 3KHQA 2VQ1B 1BAFL 1F97A 1E4JA 5GGSA 4Y8DC 4YHKH 5MP6H 3VXUB 4AEHH 3NCCB 5DEFB 5LJYH 1NKOA 3ZTJH 5HYJA 2LVCA 2RJMA 4G3YH 4YDJA 3ARTA 5GS2D 2EIBA 4IRSD 2YRLA 2VLRD 3RJQB 3G5YB 1T89C 1J05A 4GSDL 4Z7UE 3VCLA 3KR3L 3GMQA 1TJHH 4G8EB 5FGCB 1WBXA 3ARXA 1T2QL 3LEYH 2BNQA 3C2SA 1CGXA 2ED9A 3BZFA 1A22B 4YXHH 3RX8A 2NR6C 5HDBE 3BPNC 4XPBL 3P9MB 2PO6A 5EO9B 3IFPA 5ITFB 4H1LG 12E8H 1BD2E 5EZLB 4QYOB 5EFIB 5E00B 5AYUH 4XMPL 3MRKA 5BVJA 4J7RA 4X6BA 3T2NL 5AWNH 4S10A 1N8ZB 2VNCA 3KPRE 1FN4A 2XFXB 3VMOA 3UJIH 3U0PB 5GGVH 1JWUA 2MCPL 5ESQB 3S4SG 1ODAA 2Q8AH 1U42A 3CZFA 4HH8A 3UBXG 2J12B 2Q7YB 3V2AR 1KLUA 1LEIA 2V9TA 2OMBA 2EE9A 2XTJB 4GKZA 4QHKJ 1NGXB 5E8OA 1G9MC 2ZP0T 5HSFA 1DQDL 4U3HA 3B4NA 4WFFD 3BP7A 2A6JB 1F5WA 4TSCL 3RNQA 3OKOB 2BJMH 3P3YA 4IRJA 4HLZH 5D1QD 1N5AB 1AGEA 3AAZB 3QO1B 1R3HB 1A9BA 1GPOH 4WJ5B 3CK0H 5HI4D 1S7QB 4LU5H 1H3TA 1MCRA 2A6KA 2XZQH 4XXCA 4BQ9A 4YFLI 5KS9E 3LKNA 2IC2A 4ZXBD 4P59H 1CLZH 2P8MB 5LQBL 2NXYB 4PJAB 3W2DL 3PWPA 4M1DH 4PV9B 3INUL 1H3XA 3M8OH 3Q0HA 1P7KA 5C0CE 1J1PL 4HXAL 3JV4A 1OF2A 3ET9F 4PJ7F 3L1OL 4YXLL 3H7BA 5HHOD 1GSMA 4CMHC 5EU6B 1I3RA 3IVKB 3DUUA 3PWNB 1NCDL 5I1JH 1MFBH 5EULV 3MYZA 3QCVH 5TF1L 3W81A 3TWCL 4DN3H 1QFHA 3JV6A 4P9ML 1CG9A 1JPSH 4LSQL 1KG0A 4LVEA 3PWVA 1Z3GH 4NKMB 1H15B 3BGFB 1UACL 3SGJC 3OV6A 3O6FD 4ACPA 2XZAH 3WLWC 4V1DB 1KJVB 1WZMA 2NY6D 3MRFA 5CSBA 5D71L 1U8JB 1RJZB 1BJ8A 4OD2B 2GI7A 2X41A 3OAYK 4LPWA 1JWMA 3TJEL 3TO4D 4E41A 2FIRT 4D8PB 4DJMA 3BUTA 1CE1L 2HKHH 5ISZB 3ARGB 1C7TA 5I1DA 5HHME 5DZNA 1INQB 2X89A 3PDDA 3WIIH 4LIQL 2VDKH 2YD8A 1S7RA 4GRWF 3CFDB 1RZKL 3MLZH 4PBVC 1R24B 2VERN 5D1ZD 2Y4SA 1PJ9A 4K7PY 4QCIB 5A1AA 3LQMA 4JY6B 5EA0H 4QHUA 1J1XL 1KFAL 5CLWA 5C07A 4LSPL 5HI3D 2DMKA 2WV3A 4WU5A 4YHPB 3HR5B 4UAOC 3C5JB 1DVFD 4JRYD 4XNXL 4YX2L 4UT6H 2XWBA 4OQ1A 4M3JA 2X44D 1NEZA 3T3PE 3OWEA 1CGUA 5GS1B 2IWGA 4R3SA 2BVUA 4LASL 4DZBA 4XBPB 4X8JB 5GRYA 3E6HA 5L6YH 4R26H 3TIDB 2DQTH 3MLRL 4WUKL 3GSNH 1NDGA 3ULVH 4GMSL 5CMAB 3O8XA 3X3GH 4G42B 1A8JH 1EMTL 1FDLH 1A3LH 4MXWL 3AGVA 3TH4T 4G43B 5I71B 5IUSA 1HHJB 1IQDA 3VRLE 4HUUA 4L29A 1TPXC 4TOYH 2BSRB 3VXRD 2EC9U 4NKIH 5BMFL 3Q1SL 1P7QB 2XG4A 3OGCA 1KCUL 2CKBA 3G04B 5C09B 4KHTH 4PYGA 5HGGS 5JHLH 1Q0YL 2ADIB 4ORGA 3U9UB 4KVNL 4WEBL 4P2RD 4KUCD 1RUML 2QSCL 1E6JL 2XN9B 3ZO0A 4ZQKA 2NNAB 1A6WH 3OX8A 1LP9A 2BC4B 3PGCB 4PBXA 1IGML 3RUGA 4HHAA 4PRHE 4U2ZA 4P3DA 2F74A 1AGBA 1BOYA 4AJ0A 4KRPC 2NPLX 5HHNB 4FFYH 4I18A 1OP5K 4F7PB 3MOAL 4OGZA 1CD9B 2F54D 5DS8A 4YEEA 3HA0A 3QIUB 5BOPA 3UJJH 3BZ4B 1OW0A 3IDNB 4Z7UB 4LCWD 1RUAL 4YR6B 4NHUB 4JY5H 3SJVD 3VH8G 2WQRA 5HHQA 4P46A 3HKFA 3U7YH 4LOUD 4NWTL 1HE7A 1D3CA 2R1YA 3MBEC 5GS0H 3K8LA 5JIPA 3RTQD 1YPZF 4CL7A 5J1AA 4NRZB 1BD2B 1AQKL 1DQLH 4QF1B 2BK8A 4PLJD 2PR4L 4H8WC 4K3JH 5CEYB 4NQUA 5C0GA 4XZUB 3ES6A 4L9LC 1YEDA 3GGWA 1H0DA 5CSZB 1D7FA 5IG7B 1CD0A 3QUKB 2DQDH 2NY0C 3QEHB 2JB5H 1NGQH 2PN5A 3BKMH 1G7PA 4EUPH 5AD0B 3GMMB 4TVPL 2NZIA 3H8NA 5DO2D 3HRZA 1CBVL 5DVMA 2G5BA 5HDOA 1G9NC 4FXKB 4QLRA 3V6OA 2BNRE 4JHZA 3VFGL 5EOQL 2FYYB 3MRPA 4B53A 1Q94B 4PJFF 2VN4A 2AXJA 4OD1H 2D7TL 2DL2A 3QQNA 2DLTA 1RZ7H 4X9BA 5IB2B 5TE6L 4ZDHB 4WTZG 4CAGA 2IFGA 1B4JH 3DROA 4L4TE 3C60D 1M7DB 3ZE1F 5JIIA 1U8IB 1QO3A 3BN9D 2KL6A 1NCUA 4BFGA 1Z5LA 2CO6B 2F8OA 2B4CC 5C0CB 2QKIA 5TQ2L 3S4SA 1I1CA 3BP6B 3KPPA 2B5IB 3UBXA 1RIHH 1SBBA 1U8KA 4XMKH 1CXKA 5BRZE 1FNLA 4I3SL 5E95B 5C0IA 3ISWA 1Q9KA 3GBNL 5C0AA 2MOVA 3QUXD 3ARFD 1A2YA 3S5LB 2AJZA 2B0SL 4KRNA 1MHEA 3K4DA 2HTKD 5M7QA 3QCTH 5IBLD 5FB8A 2ADFL 4HUWB 4X6DE 4B5EA 3IAQA 4JHWH 1LO0H 2GYSA 4JN2A 2VXSL 3V6FB 5D7IA 4FHBD 2A6IB 2DTSA 4NO2A 1U8OA 2VJXA 2XKSA 4JQXC 1KCSL 4RFOL 4LHUG 3RRQA 2NY4B 1ACYH 2H32A 1W0WB 1R5WA 3CMOH 4HS6B 5HHMB 5TPWH 2IBZY 1YZZA 4NN5B 1SJEA 1RULL 3CFKB 2E8ZA 4HH9B 4M48H 1TIUA 1AI1L 5F7EL 1OAYH 3GI8L 4GW5B 1U8MB 3L3DA 4S1RL 3BE1L 5ESAA 4GAJL 2OTWB 4UBDD 5DQDL 3PGFL 3SE8L 4RFNC 3V7MA 4OZIE 1W2KT 2CMRL 3WNMA 4JFYA 1XFPA 3DJ9A 1JV5A 1O5DT 1XGPA 3UAJD 2ITCA 1B0WA 2UYLB 2VR4A 1BFVL 3ROLA 3RVUC 4X9GA 4YDLB 2NMSA 3T0XA 3IFOA 3KJ6H 4PJXE 4FZEL 4EDXA 3I3BA 4E5XA 2B1HH 1CFBA 1LO3L 2EEAA 5IMLB 5EIVA 1URLA 8FABB 4M43H 2UV3A 1WQVT 1U3HD 1D9KA 4M6MH 3ILPB 5E8DL 5ID1B 4QEGA 2HFGH 1RURL 4R96A 1MCOH 1F11B 4N0UE 4WWKB 4CW1A 2AV7B 1D5ZB 1JPTH 4YZFF 1DQJB 2BXZA 2V5SA 1ULVA 3ZMRA 4K71C 4HKZB 3ESVF 5KJRL 1A6VH 2EYTA 4TVPD 2VLKD 2WBJA 3P77A 4RWYH 1E4WL 4XP1H 3CVHA 4M7LL 4NQTA 2FX7L 2YPVH 2RFXA 4Y4KA 5HY9A 3SDAD 4JQVA 4AY0A 1NPUA 3MXVL 4FFWD 2J8UA 1MWAA 2XIDA 2EDKA 4R4NC 3TV3L 4HPYH 3UXFA 1FORL 2VOTA 1F3JA 2ZCKL 4NKDA 1SJHB 3N0PB 2XTLA 5IIEA 1BFTA 1FFOB 1VFBA 3EJZD 3AMLA 2YD2A 5EN2B 3KJ4C 3SGDH 4GS7C 5L2KA 1UH2A 4XCCL 3NN8A 5DT1H 4JM2D 4LPXA 5DD3H 4Z7WE 3OJMB 1KCRL 4HKJB 5IQ9A 4N9GA 1C12A 1K5NA 3C6LD 2J6EH 1QFWI 2H2SC 4PRDA 4PRHB 3P73B 1I1YB 4GG8B 2CJUH 5IW6B 4QGTA 4JZNA 4OZGB 4NPYA 3Q3GA 4XH2B 3ZTJG 2FX8L 2EE6A 3B8YA 4HT1L 3BPOC 1IL1B 3I6LE 3MODL 5FA3A 1YY8B 4EUPB 4RISH 3QEGL 1UCBH 4NHCL 5EB9A 2OSLB 2LTQC 4LKCB 3C6SA 4ZFZB 5E8EA 4KKBC 1A7BA 4CVWA 1CGSL 1W0VB 3MV9A 3QI9B 3C08H 4OM1L 3V52H 1CXHA 1PY9A 4MHHI 4UTAH 5JPNB 3TYFB 4HDIB 3TCXA 2HFEB 1BQLH 1GHFH 4LKXB 1MI5A 4I77L 4UB0H 1OAKL 3BWUC 3B9VA 3TPUA 5BZWA 1ZTXH 1EGJA 5HHPB 5IHUH 4JKLA 5D5ME 3PXHA 5AG8A 1DBML 4PV8B 3SPVA 2Z9TA 3O3BB 4PJEE 1CDJA 1FZMA 2IMNA 3D9AL 3RPIB 5DJXB 2P5ED 4WFEE 3CFEB 3FMGL 2V5YA 1BJ1H 3GIVB 1TZIA 1CGTA 1UFUA 3CFCH 3IFNL 5JQHC 5DJDB 3PL6B 4EI6B 2BNRB 4ZTOH 1ZLSL 4NQCE 2R9HC 2IALA 3MRQB 1HSAB 3B9DA 5E24E 3DX6B 2PXYD 1O7SA 4HLZG 4R2GC 4ZPTB 4KZDH 5A3ID 1SMAA 2GFBA 1E27B 25C8L 4JFXA 4JZJB 5FV1L 1ZT4A 1JHTB 2J8UF 2VQ1A 4L4TB 1OAUL 4N68A 4Q97A 5GGTA 1IEBA 2VSDA 4R97B 3VXUA 3GMRB 1GIGL 5DEFA 4M6OH 2VXTL 3SCMB 1KSRA 2HRPL 5DZLA 4PR5B 4I0PC 3VA6A 1VFAB 3T0WA 1FO0H 5BO1H 2X9XA 3NPZB 3QUZB 3N85L 5BRZB 3G5YA 4JN1L 4PLOB 5I73C 4ELKB 4G8EA 4FQJL 4U6TA 4FQCL 4YQXL 1FGVL 3MRMB 3UX9B 4HIIB 2WUBL 4KMTL 5EO0B 3P9MA 4U7KA 1UJ3B 5EO9A 4MNQE 1R3LB 2E8YA 5ITFA 4MMZC 3HNVH 4KKCD 5EZLA 4QYOA 5EFIA 1QSFE 2WM0A 4F57L 3GIZL 2W9LA 5E00A 1WWBX 4WW2C 4M7KL 5CD5D 4WTZA 5SX4I 2M2DA 3P40A 1N8ZA 3A6OA 4M5ZL 5EOCJ 2FBJH 2XFXA 4TRPH 4POZD 3U0PA 5ESQA 1IC7L 3VGEA 2XA8L 1G7JB 4L3ED 3CLFH 1N6QH 1MPAH 3MV7E 2Q7YA 3BHBB 4P48A 1YY9D 5CEZE 1T6WA 1CR9H 4HC1A 3MJ9A 4OZIB 2A6JA 2H6PB 2EEBA 5J13C 3OKOA 2R4RL 2Z0BA 4LSUH 3SN6N 4EI5C 4WO4D 3DIFB 1N5AA 1YYMH 1KXTB 3AAZA 3QO1A 1R3HA 2R8SH 5GISH 2O26U 4JB9L 4PJXB 1N2RB 2DQUL 4WJ5A 5HPMB 1S7QA 3VG0H 2Q6WB 1WIPA 4G9FB 3QDGE 4RGND 1RZJL 1XGUB 1ZT1B 5JXEC 2P8MA 3LS5L 5F6IC 5F3HA 5IMOB 4PJAA 5F7UA 4PV9A 3SDCC 4J6RH 1CZ8H 3CVIL 5L88H 4EOWH 1SY6L 4N0UB 1FAIL 4JO4L 5IF0B 4A2LA 4HIEB 1MFCL 4NNPH 2DM4A 3Q6GH 3FONB 5CEZH 1MF2H 4HJ0C 4TTDD 2NW3B 3UDWC 4HBCL 3ULUF 5EU6A 1QP1A 2XA3A 5FYLL 1S78C 3IVKA 2VZOA 1RUPH 5LGHL 3PWNA 1JYWA 2NXZD 2EO1A 5K9KB 3OAUL 5I1IH 4D9LH 2X4SB 5K9JL 4IDJH 5EBLA 3P0GB 4PBWD 2EECA 4TQEH 1UZ8B 5BW7C 2DQIL 5I1KH 4NKMA 5EU4A 1H15A 4ALAH 4MDIB 1MJUH 4V1DA 2A9NH 4LEXL 1KJVA 4MLSA 1U8JA 2YA0A 1RJZA 5DUML 4OD2A 4JFFE 3T3MF 3V5HB 4YDIH 4WI4A 4FNLL 2I60H 1I8LC 3SE9L 4J4PC 4JEGB 2EC8A 4D8PA 4Z7WB 3C09B 3ARGA 1INQA 1PKOA 3HE6B 3MOBH 2WUCL 2EH7H 4OI8A 2JJWA 2V9QA 2JCCE 2QHRH 3S35L 3CFDA 1ADQH 1R24A 1I7RB 3DX8B 4X5LA 4LLUB 1IKNA 1JHKL 1NCBH 4QCIA 4QXUL 4OUUB 1JMXA 4JY6A 3LQAH 3UMTA 1OTSD 1PEWA 5F9WB 2XOTA 5ID0B 2Y6SD 1G9EA 2EKSB 3T0EE 5IHBA 1KXQE 4YHPA 1CFQB 5JW4R 3HR5A 3C5JA 5KTEL 1F90H 4AH2B 4CN1A 2EE3A 2OJEB 4N8VG 1RUQL 3RHWK 2XG5A 3EDFA 4M1CD 2IAMB 5GS1A 2ATPB 2Z31B 1U8HB 1TJGH 3B5HA 1JTOA 1HINH 4XBPA 5E4EC 4U2YA 1LD9B 5D5MB 4X8JA 5E5RB 5F3BB 2UUDK 3RZCB 3VGHA 1F3DH 2FIKB 3TIDA 2CIKB 1VHPA 4U1KB 4PJEB 1A7RL 4XVTH 1CDBA 4YPGB 3NGBC 4G6ML 5CMAA 4G42A 5F70A 1FO0B 4XNYH 4G43A 2YKLL 1HHJA 5F7MC 3MA7B 1T20B 3UTTD 3WLBB 1S9YB 2BSRA 2GITB 5CP7B 5BQ7B 1GVIA 1YNKH 1P7QA 2AJVH 2APWA 4NQCB 1S7UB 3PG2A 1BZQK 4LLQB 1HIML 2ZCLH 5CFHA 1OWRM 5I15H 3G04A 5C09A 4LCCC 4GG6E 2ADIA 1DBKH 5DD6B 2AGJL 3BESR 4EN3D 2XN9A 3ARBD 2NNAA 1CXFA 1MHPH 1AGFB 4OFVA 2BC4A 2ZUYA 3PGCA 1P84K 3FZUC 4BSVB 3MCLH 2NY1B 4KROC 4J1UB 4ELME 3N50A 1UGNA 3NFSL 5HHNA 3F5WA 3RGHA 3FRPG 4MX7B 5FYLD 4F7PA 3DETD 4NIKB 3HAEH 4OZFB 4KJWC 4Y5YC 3QRGL 3QIUA 2AVGA 2O5XL 3BZ4A 4OF0A 4OLXL 3IDNA 4Z7UA 3VD5A 4BJLA 4YR6A 4NHUA 1WBZB 5E6IC 2C4FT 5H37H 2K9UA 4RA0C 4H88H 1NAKL 3WIFB 3NTCH 3D25B 5ALCH 1JF1B 4UV7H 4MNQB 3TLRA 3L5XH 4U6XB 4FQIL 4O9HL 1BD2A 2BHUA 4XTRD 2FEDC 1QSFB 4QF1A 5EZIH 1SJVA 4K7FB 3HHRB 2EH8L 2P43B 3MREB 5CEYA 5C2UB 2EDRA 3KPRA 3T4YB 1A1MB 4XZUA 4MD4B 5CSZA 1EJOH 4HK3N 1H3PL 2FATH 5DFVC 3TNMB 2OS7A 5IG7A 1WSST 5DYOB 4AG4L 2RGSA 3QUKA 1T6VN 4D9RE 3QEHA 3MBXH 5AD0A 3VDAA 1MJ7H 3QQ4B 3BD3A 2ZUTA 3GMMA 3ZKMD 3CFBB 3GSUB 3DMMD 5CSGA 3B9KC 5DD1H 4FXKA 4QO1A 1UQSB 5L8JB 2FYYA 3V0VA 2WZPD 3A6BH 1Q94A 2JJTC 1IGYB 1CLYH 3C5ZC 3GNML 2DTML 5GGQH 1Z6JT 1QVOA 5DC4B 5C0BE 4MA7H 4S1SL 5T1KD 5IB2A 5KS9A 3QDGB 4ZDHA 3A67L 4GUPA 2I24N 1QPPA 4WCYH 1M7DA 3FOLB 1I3GL 3O2WL 1U8IA 4NNXB 3JUYA 2CDGB 1T83C 5C0CA 3MLSL 2DIAA 4ONOA 2UWEF 3VWKB 1EAJA 2N56A 4LF3B 5SWSD 4Q0XH 3BP6A 3O6MH 1X5HA 2C5DC 5CIPH 4DN4L 5GPRA 3KS0H 5I8KH 5A43C 3V5DB 4OIIL 3DX7B 1I1AC 3RWEB 3S88H 2X1PA 5T1LB 4WI7A 4KFZC 2ZPKH 2P49B 3S5LA 1M7IB 2NY3B 3OAZH 4P9HC 4K3DH 2E9BA 3QJHB 4WI8A 4OJFH 4HUWA 3PJSB 2FR4B 3HMXL 3V6FA 4APQD 2ITDB 3DVGB 4YE4L 3MQIA 3UO1H 2A6IA 5GRUL 4JFFB 1X5ZA 1Q1JL 4RGMB 1DJSA 4FABH 4F7CB 5DEZA 2EXYC 4PP1D 5GQBA 4MCYB 1KBGL 3RX7A 4MQTB 2VDML 1F00I 1L0QA 1W0WA 2WP3T 3GSOB 2XT1B 4HS6A 1MFEH 2VB5A 4LLMB 5D7JB 2JCCB 4HH9A 3CFKA 3IDGB 2QLVB 4PLNC 2DQEH 4JO3H 4UINL 1XH3B 4GW5A 1U8MA 4DKFL 1YNLH 4EZMA 5C1MB 1C5CL 3MV01 2VC2H 5GS2H 4LNRA 2OTWA 1TZHB 4DKEH 1RHHB 3QDMD 2VIRB 3DXAD 3DSFH 5L7XH 2AABL 1YEEL 2R0LH 3EFFB 3T0EB 1YMHB 4R8WL 1FHGA 5DJ6B 2UYLA 5DD5L 3LZFL 2UVFA 4WFFE 1MQKL 4NQDD 2DBLL 4LLWB 3RVWC 5IMLA 3AREB 3MLUH 8FABA 1A0QL 4ONGH 3WS3B 3ILPA 5LWYL 3R1GL 5ID1A 3DWTA 5TDPB 1D6VL 1F11A 4WWKA 3U0WH 2W0LA 2OR8A 2AV7A 1D5ZA 2ZUXA 3U82B 3K74B 4UIKH 1DQJA 1FH5H 4P5TB 3RPKA 5C2BL 4RMQA 1FGNL 3OKMA 4HKZA 5CILH 4JFZL 4U1IB 1X7QB 1KN2H 4OLZH 2CLZB 3HAEB 3IDUA 4HFWB 4MXVE 5HHOE 2DJ4A 3LEVH 4RCAA 1WC7B 2VQTA 3EYVB 1G7QB 1QBLL 3EYOB 4DGIL 1CIUA 4LMQE 3WFHB 2FD6H 3VGAC 3Q2CA 4Y5VC 1SJHA 2GT9B 1FFOA 3LKSA 4JLRB 1KB5L 2EZ0C 3U30C 4LP5A 4TNWF 1A7NL 2EIZB 4FQXD 5HYFA 5EN2A 1QRND 3CC5B 1IGTA 1IM3B 5F7HA 1AJ7L 4LPUA 3DO7B 2FB4L 4WHTB 1EHLL 4PRHA 3P73A 1I1YA 4GG8A 3KHOA 4ELMB 2RBLA 5IW6A 3P4MB 5HGDB 1FCGA 5KVGH 2QSVA 4XH2A 5CAYB 5HDQH 1BBDL 2CRZA 1IL1A 3QUMH 2RAMA 3FFCD 4OM0H 5F1NB 3TA3D 4EVNB 3OZ9L 1DSFH 1YY8A 4EUPA 1I3VA 3U4BL 2P42B 3NZHL 5HHVL 5DJAB 43C9B 1AC0A 2OSLA 4XBEH 4CADB 4ZFZA 1J0IA 4FP8H 1RIUH 1W0VA 3QI9A 4NO0B 4U1MB 3RX5A 5J6HB 4XP4L 5MI0B 4AM0B 4LSVL 3TYFA 4HDIA 2HFEA 4BUHA 4LKXA 5IJVB 1AH1A 1OT1A 3IDXL 4LRNH 5D6DA 4OAWB 5HHPA 4RRPG 2X42A 4CU6A 1FFPA 2J7LA 1OSPH 1BAFH 1NC2D 4WY7H 4PV8A 4G6KL 3O3BA 2E7HA 1F6LL 2D4DA 3MNWB 4X6CE 2J5LC 4M02A 4JKKA 3RP1A 1CLOL 3FRPA 4TNVK 3RPIA 1CL7L 5DJXA 5CIPB 3CFEA 2MFNA 4GSDH 3GIVA 2Y36L 1PD6A 2V17L 4XP9L 5DJDA 3PL6A 3KR3H 4EI6A 1GH7A 2BNRA 4ZOEA 3K4ZA 1WISA 1T2QH 3MRQA 1HSAA 2V7NB 1QNZH 5DVLA 5F8QC 5GRVK 1JVKA 1VGEH 3DX6A 3DVIA 5IVNA 1I7UB 4ZUSB 3L3JB 2R0ZH 4ZPTA 5C0BB 1MRCL 4Z18A 5JLZA 1E27A 3HE7D 4IOSD 4QRQB 4JZJA 4LARL 2B2XL 5SX4H 2YRZA 1JHTA 4L4TA 2GEEA 1SVCP 4OLUL 3T2NH 2IFFL 1T1WB 3KLAB 3MJ8B 3GMRA 5F97E 2MCPH 4XCFL 5F6HJ 3SCMA 5C3LD 4PR5A 1VFAA 4GRMB 1NMCC 3AY4A 3L95B 43CAB 1CU4L 1SBSL 9CGTA 3QUZA 5T3ZL 5MENE 1G9ML 5BRZA 3L3OB 3HFML 1KTRL 1SYVB 2DQJL 1JYNA 4ELKA 4WWID 1DQDH 2HRLA 3MRMA 4OZGF 4HIIA 3S37H 1TETL 5EO0A 1NFDE 4Y16A 4LCWE 1UJ3A 1KLGB 3B9AA 4B41A 3VI3E 3KXFE 2EC9T 2BVYA 3TZVB 2IG2L 5GSRB 5LCVL 2RR3A 1HOCB 5EWIL 1ZLVK 5JUEL 4NO5B 3BYYA 5LQBH 2XPGB 4R6UA 2H1PL 2Y7QB 2E27H 3IF1B 3MA9H 5J7CC 2DMBA 3INUH 3GMNB 1G7JA 1JTPA 3BSZL 2ZUSA 1LILA 4UTBL 3BHBA 4J3VA 3L1OH 4YXLH 5FO8B 1CDCA 5DR5L 2ZG3A 2C1PB 1K4CB 3NACH 4OZIA 2H6PA 4ODWB 4QRUB 2HLFD 3PQYE 3DIFA 4P9MH 3QHZH 4JGJA 4LSQH 5C7XL 3BZDA 3ARVA 1AD9B 3F7QA 4PJXA 1N2RA 2HG5B 3BZEB 2EXWD 5HPMA 5D1XB 2L0DA 4PFEA 4TSAL 4IJ3C 2Q6WA 4G9FA 5D1QB 1XGUA 1ZT1A 2XRAL 4OFPA 3MRIB 5IMOA 1FVEB 2C7UB 3MRCB 5ICYB 1CE1H 2EYSB 4N0UA 4U6HB 3Q5TA 4ZXBB 4YC2B 5IF0A 2AXGB 2FBOJ 4HIEA 2NCMA 4LIQH 4WIQA 2J6EA 3LN5B 3FONA 2NW3A 1RZKH 3ZYZA 4DGYL 1IGJB 2Z93B 5GGVY 1OP3H 2DLFH 1B2WL 5K9KA 4U1NB 2NR6D 1GGCL 2X4SA 4JPWL 3QUMB 5D7SL 1J1XH 1KFAH 4OLEA 5ILTL 5C86A 5HHOB 1UZ8A 1NFKA 4JHAL 4LSPH 4X4ME 3WDIA 3QFJE 4GOSA 4MDIA 4ONHB 2BRQA 2IQAB 3SHSA 5FGSA 4OSUL 5I66B 1J0HA 4U1GC 5IVZA 3V5HA 4HUVB 5F7LB 3LPGA 4X7TB 3QT2A 4FQHB 3O6FB 4Z7WA 3NH7L 5E2JA 3WSQL 3MCKB 1QBBA 2N1KA 2NY6B 3HG1D 3NIGE 4LASH 2FGWL 3HE6A 2B39A 1B0RB 1HCVA 3W39B 3MLRH 2NZ9D 2P8LB 5T3ZD 2VZ3A 4KXZI 1I7RA 3DX8A 5EO1B 4GMSH 2YRPA 5BOZG 1P84J 4LLUA 1EMTH 4L4JA 4OUUA 5ACZB 4MXWH 5AZEH 3HI6H 1HXYB 4P2OB 3RWJB 5ID0A 3QG7L 2EKSA 4XPHL 5BMFH 5H37G 1CFQA 5IB5B 3N9GH 3P0YL 1UZ6E 5CBAB 4AH2A 1KCUH 2OJEA 2X09A 3K8MA 2VLLB 4YAQB 1X5KA 1Q0YH 1JPGB 3O3EB 4KDTA 4WEBH 3SKNA 2IAMA 3KYKH 3NCEB 4WNQB 1AR2A 1MCCA 1DVFB 1I4FB 2ATPA 2KZ1B 2QSCH 2Z31A 1U8HA 5F3BA 3Q6FB 1LD9A 5D5MA 3RZCA 1UM4H 1NMBL 4BH7B 2FIKA 5I75C 2CIKA 1IGMH 3GKWH 4AK1A 4U1KA 4PJEA 3RIFF 1T3FA 4X6CB 4YPGA 1X4YA 3FAXA 5CS7A 3IXTB 4DTGH 1F3RB 4U1LB 5B38A 5I8CB 1NCWL 3MOAH 3DVFA 2PYEE 1FO0A 3ARGC 4JG0H 4OFKA 1MCSA 3MA7A 4HGKC 4D3CL 1F4AA 1T20A 3WLBA 1F58L 2AQ2A 1S9YA 2GITA 5CP7A 5BQ7A 5E5UB 4IRSC 1UM6H 4TVPE 1SEQH 4NQCA 2VLKE 1S7UA 4NWTH 2AJ3B 4LLQA 3O2DL 1IKNC 2VABB 4NBXB 2JE8A 3QCUL 2ZSWB 3TBTB 3VXRB 4H8WL 2XICA 5DD6A 1AQKH 5EC1B 1RFDL 1VCAA 1QSEE 2PR4H 1IAKB 4S0TD 1QFUL 4GH7B 2D2OA 4OZHF 2YOCA 5J1TC 1AGFA 4RRPA 3E8UL 4QOKD 4PREB 3ZE2F 4DQOL 2AI0H 3ZKXC 1RD6A 4BSVA 3LAFA 5ALBL 1WT5A 1YDPB 1XIWB 4J1UA 3UTSD 1ND0B 2EDHA 1MCWW 3BIBX 1WTGT 4OLVL 3GHBL 4JO2L 5MERB 4CBPA 5MENB 5DVNA 5AAWA 4OZFA 1A7QL 5FM8A 5H94B 3WJLA 3U36B 1UVQB 3RU8L 1A5FL 4TVPH 2O5ZL 4XNZB 3U48A 4OFYD 1WBZA 5JZ7C 5ANME 3I6KB 1BEYL 1K4DB 2RQ8A 2EKJA 2MPAL 4Z7VF 3GM0A 5EOQH 4ONFH 3SDXB 3WIFA 1NFDB 3D25A 1JF1A 2H2PC 4LCWB 1ZE3C 4MNQA 5I71C 2FLBT 4U6XA 3ELAT 5D96C 1OAQL 5DLML 1QSFA 2PTTB 1KJ2L 2QQKL 3EDKA 4K7FA 5TE6H 1WAAE 2MKLC 3MREA 4NFCA 5D8JL 3RTQB 2B4CL 3UYRH 3T4YA 1A1MA 4JY4B 4X6FB 5DJ2B 1KEGL 4XC1L 4MD4A 3S37X 1RK0B 5TQ2H 3TNMA 3MV7A 5DYOA 4NBZB 1RSFA 2APTA 2Y9RT 4L1HA 1H5BB 1IGIH 3A6CL 3QQ4A 4P4KC 4I3SH 3CFBA 3GSUA 3MGAA 1CFVL 3GBNH 3U0TB 4P49A 3K2UL 1UQSA 7CGTA 4JFED 2C3XA 1YC8A 4EDWL 4KV5E 3PQYB 2B0SH 1F6FB 1IGYA 3BOVA 4ZSOB 3QIUC 1QPXA 3NIFE 2ADFH 4N0YL 1ZMYA 4OCLC 2VXSH 5LVEA 1BWMA 3QDGA 3U4AA 1EHNA 5E70A 4MJ5B 4MQSB 4QKXB 4I8DA 1KCSH 4RFOH 4DEPC 3FOLA 4KRPD 4ZUWB 3D39E 4NNXA 5D7LE 3FHQA 3SQBA 3CDFA 1DTUA 1UEMA 2CDGA 1RIVL 2VXVL 3BPCA 4KMLB 3VWKA 2W59A 4LF3A 5IB4B 4E42B 3C60B 2VH5L 3MJGX 4CJ0A 1AI1H 3QXTA 5F7EH 4YFLF 3GI8H 1QKZL 2X4RB 3V5DA 1ADQA 2QQNH 4XNUH 2QQLH 3DX7A 3RWEA 4S1RH 3VXMD 5T1LA 3BE1H 3JWOH 3D1MC 5KAQG 4GAJH 3NVQA 3MLPA 3MROB 3PGFH 1M7IA 1P1ZB 5D1ZC 3QJHA 5L2JB 2PNDA 3PJSA 1N59B 1HZHL 2VWEC 2NY7L 3QUXB 3ARFB 1BFVH 2IPTL 4G5ZL 4Y19D 2FR4A 4XX1G 4FZEH 2OP4L 2ITDA 3DVGA 4PJ9C 3LS4L 4QRPD 4MHHG 1HHGB 4JFFA 1IE5A 4F7CA 4XPAL 1F4XL 1KC5H 4PJ5D 4TYUA 2YXMA 4MCYA 3F65A 3GSOA 1U95B 4K23L 2GSGA 5CJOL 1RURH 1C5BH 4LLMA 4YPJA 2NY0D 4CN4A 4ZFFB 2DIBA 5D7JA 2JCCA 4RBPH 3S98A 3IDGA 4FFZL 1W72L 3GSRB 4RX4D 2OLDA 5DVKA 4KJQC 3I2CL 4NC0B 2YHGA 4FZ8L 4GXVL 5J89A 1E4KC 5J3HC 3QAZC 1TZHA 1OGAE 1RHHA 2VIRA 2V7HB 4I48B 4XPGL 1E4WH 3CLEL 1DN0B 3X14B 2FX7H 1A7OL 2B5IC 1PG7L 3EFFA 5JR1L 3T0EA 1YMHA 3MXVH 5DJ6A 4D9QD 5KN5B 1Y6KR 4ZO8A 5IROA 2H41A 2ZCKH 3ARSA 3DV6B 2CQVA 2DRUA 4QTIL 4LLWA 4JGMA 3PXJA 5DHVH 3MLXL 3PWJB 3AREA 1TDQA 3EJYD 1MIML 1P9MA 1N26A 4RAUB 3WS3A 4XCCH 4JPKL 4GRLB 2APVA 5KSVB 4KK6C 3DECA 1U3HB 3BAEL 4P5TA 4CVUA 1I85A 4GKOA 1WVZA 1NUNB 2NY4C 4U1IA 2FX8H 2PYEB 1U8QB 1X7QA 3KAAA 4HT1H 4PGEB 3QDJD 1HH9B 3MODH 2CLZA 3HAEA 5DA4A 5I30L 2OL3L 5IVXE 5IJKC 2FL5B 2W1NA 3QEGH 4HFWA 1MELA 4FTVD 1WC7A 2VLKB 4I4WB 1G7QA 1KTDB 3EYOA 4H0GA 2DQHL 2GY5A 1GGBH 3WMSA 2YMXL 32C2B 2APFA 1CGSH 4JLRA 4GG6A 1G6VK 3IGAB 3SDDB 5GJSL 4OM1H 3K80A 2EIZA 3ZHKA 4G6JL 4WDIB 1QSEB 3CC5A 3O6KL 2P48B 1IM3A 4I77H 1MAMH 1OAKH 1Q72L 3O81A 3DO7A 1WZLA 1HQRB 4WHTA 5J4MA 1AO7D 5K9QI 1DBMH 4ELMA 4ZUTB 4PS4L 3P4MA 5HGDA 2CGRL 2ZCHL 2BHYA 1L6XA 4M6NL 4FQPA 3WKML 4GLRI 5F1NA 4Y2DD 4MVBC 4EVNA 1RPQA 4PIRF 3FMGH 3FQUB 3IFNH 1A4KB 5DJAA 43C9A 1SVZA 2P46B 4CADA 4X80L 4YHOL 2VLMD 2YWYA 1ZLSH 4U1MA 4NO0A 3VXTB 5J6HA 3DUHA 1FNGB 4AM0A 1SM3L 4D0BB 4PB0L 1JF6A 5BS0E 2NY2C 3STZB 5KSBE 3PV6B 1CGVA 4OCRL 4NOFA 5IJVA 3STBA 25C8H 3QBTB 1GOHA 4OAWA 4P2QE 5B8CB 3EKCA 1OAUH 3EZJB 3O4LD 1J10A 4U6VH 4IDLA 1GIGH 5FEBA 1EJ6A 3MNWA 3VXSD 4MJ2A 5DRNB 2VXTH 4JPIB 3TPKA 2HRPH 4HWUA 5ACMA 4FG6C 1AQDB 1TZGH 1EEZB 5CIPA 5KSAB 1CL7I 1S7TB 1Z9LA 4JN1H 1ZEAL 3LHPH 5KVDL 3TFKC 4K8RC 1Q9OB 4FQJH 3O4OC 4WEUD 2EDJA 3QWRA 1FGVH 1LO5B 2V7NA 4YQXH 3GO1H 1E6OL 2WUBH 3VFOB 1NCCH 4KMTH 1I7UA 4ZUSA 3L3JA 4K07A 4K3EL 3BKYL 5C0BA 2E7BA 1FSKC 4QRQA 3VFVB 5CJBA 3GIZH 2R2EB 3W11D 3ZE0F 4LCUB 2GQHA 4M7KH 2H2SD 3LPFA 1IC5H 2HYMA 3RI5K 3ARDB 3D39B 5D7LB 4M5ZH 5DTFB 1MJ8H 3KLAA 1T1WA 3MJ8A 2ARJB 2ICES 1IC7H 1IBGL 4PY8J 2XA8H 4GRMA 1IGCL 3L95A 5D6DC 43CAA 1PSKH 4G8GD 4OBRA 3E2HB 1NJ9B 3L3OA 3OR7B 4U3XA 1VACB 4KKBD 1SYVA 1H8SA 4UT7L 1T0NB 2IMMA 3H6JA 5JOEA 2EEDA 4HIHA 2FEEL 3V79C 5LAXB 3NPSB 4HWNA 3VXPB 2LAAA 1KLGA 3OMZA 1WTLA 4GQ9L 4UBDC 1JZ4A 2HH0H 3TZVA 4JB9H 5GSRA 1NGWB 2DQUH 4YBLC 4ENEC 1FPTH 1PDKA 5DDHB 1ZWIB 3PL6C 4FRWA 5IK3B 1HOCA 3D0LB 1JE6A 4PJ7E 4NO5A 3LS5H 3BP4B 1DBBH 2XPGA 4JDZB 4KWUA 2Y7QA 3UYPA 3GMNA 1SY6H 4NSKB 1FAIH 4BA8A 2R2BB 4JO4H 5J11C 5LXGH 1HHHB 3UZQA 5I0ZA 5DGQA 4D2NA 1J12A 3NABL 4PRID 1MHCB 4X5WB 1S8DB 3IDYC 5D2NE 4H26B 5FO8A 1NGPL 4Z7NE 4HBCH 5FYLH 3HNTH 2X4OB 2R9HD 4XB8A 1OGAB 4XAWL 5C6TL 3E3QE 2C1PA 1K4CA 2AV1B 4LVOC 3OAUH 1DLFH 4ODWA 4QRUA 4H0HB 5K9JH 3FB6B 2JJSA 1INDL 4H20H 4K7PX 2XNAB 2DQIH 1QLFB 1AD9A 3BH9B 2HG5A 3BZEA 2CRIA 1G7IB 1Q0XL 5D1XA 4HWEL 4W4OA 4J2XA 4WO4B 5I6XC 4LEXH 5AZ2L 5D1QA 4GRWE 5JW4Q 5DUMH 3DV4B 3MRIA 1J5OL 1XR9B 4FNLH 4Y16C 4ZMAT 4QHNB 1FVEA 2C7UA 2GJ6E 1UJ3C 3QR2A 2I26N 5ICYA 2EYSA 4U6HA 2KZWA 4RGNB 4ZXBA 2AXGA 2WUCH 1ZSDB 4JM2C 3LN5A 5BJTB 4EIZC 3S35H 3B5TA 4R4FL 5C0FB 1IGJA 4XT1C 2Z93A 3MJ7B 1JHKH 4QXUH 3TN0C 1AGCB 5CJ8A 5SWSE 3TT3L 2P1YA 4I3RL 1L7TL 4U1NA 1EIBA 5IVXB 5E1AB 3QUMA 2BRRL 5HHOA 1CE6B 4JFQB 3SE3A 1R3IL 1LGVA 5B39B 2NXZB 2VISB 1MFDL 2X40A 4KGJA 3S36L 1R0AL 4TVSa 4AIXA 2DL9A 5KTEH 5H2BB 4GRWH 4ONHA 1CD1B 2APXA 4PJGB 2IQAA 4WHCA 1RUQH 5I66A 2OX5A 3W0WD 4HUVA 4X7TA 4J8RB 4JFDD 1RI8A 1BBJB 3GRWL 3O6FA 4FQHA 4V2BA 3NAAL 3MCKA 3G6JF 3F6LA 4UUJB 2HJKB 1B0RA 5BV7H 1EFQA 1L4IA 2AERT 3W39A 4RMSA 1A7RH 2P8LA 5B4MD 1NSNH 3B8SA 4NCC1 5EO1A 1I9RH 4G6MH 4M9PA 5DJZB 4MAYC 1T7WA 4WEMB 5ACZA 5HYJD 4EI5D 1CIDA 1HXYA 4P2OA 5IBUG 4MWFB 3KWWB 2YKLH 1FVDB 3RWJA 4BKLB 1I1RA 5E99L 3WN5B 2YD1A 3LB6D 1H3WM 1S3KL 3AROA 2XZZA 3FHAA 1YMME 5IB5A 1MIEH 3QDME 2BNQD 3DXAE 2A6DB 5CBAA 5JXED 2VLLA 4YAQA 5BS0B 3QPXL 2PO6D 4YGAB 2VAJA 1JPGA 2NYYC 3O3EA 4WFGE 5A2LH 1VERA 3V5KB 5DZOA 4WNQA 3UTPD 3WD5L 1DVFA 1I4FA 2AGJH 2F5AL 2PXYC 3LH2H 4NQDE 1T7ZA 3X3FL 3Q6FA 3G5VB 1C1EH 4M1GH 1U93B 1OAZL 4HJ0D 4BH7A 1A3QA 1VGKB 1TTUA 1EFXD 4IMKC 1S78D 5CUSL 1EV2E 3CNKA 3OR6B 4X6CA 1GAFL 1VPOL 3IXTA 4ODXB 3QDAA 1LEKB 3PHSA 1MY5A 4UZGA 5B3JF 4U1LA 1J1OL 5I8CA 3LDBC 5DFWH 3S96B 3VGFA 1YPZE 1U91B 3UTQB 1AHWC 4IIQB 5C07E 2AJ3A 2GTZB 3EDEA 3QPQC 1A47A 2VABA 1NAKH 5JA9A 5F9DC 5LGJB 4AQOA 3CAFA 4IRZL 1HYSC 2ZSWA 4L4VE 3TBTA 3VXRA 4J4PD 4NJ9L 3IB4A 2YA2A 4FQIH 4O9HH 4RDQG 3FTGB 4NKOB 2YD4A 5EC1A 1IAKA 1A4JB 2G2RB 3QIBC 3EO9L 3C2AL 4Z0BL 1JJUA 3UPRB 4PREA 2A77L 2YA1A 1QRNE 4ZTPL 3PWPD 4EN3B 2CO7B 3ARBB 1YDPA 1XIWA 1ND0A 1KYOK 3EYQC 1H3PH 5MERA 5MENA 1KV3A 4PJFE 5MEQB 5H94A 1JNNH 3U36A 1UVQA 2ICEB 1CXEA 2DQCL 3OQ3B 4N90D 1WWAX 4R0LC 1NCAL 3I6KA 1K4DA 1PG7W 5CP3H 3BPLB 3IS1X 3SDXA 2FSEB 3QXVA 1NFDA 3FFCE 4RAHA 1H9VA 4LCWA 3ZE1E 4F7EB 3GNMH 1V3MA 3OKNB 2PTTA 4S1SH 3FAWA 4KUZH 4AIOA 3O3DB 4P2YA 4LQFL 5DJ0A 4PJ7B 3RTQA 3A67H 1T03L 2FO4B 4JY4A 3O2WH 4X6FA 5DJ2A 3EDJA 4E41D 4DK6A 4Y2OA 4ERSH 3MLSH 1FBIL 1RK0A 3CUPB 1JIBA 2HP4A 1LO2L 5D2NB 1KJ3L 4Y8AA 1H5BA 4L5FH 1XCTB 2EDFA 4Q74A 4UNTA 5KBNC 2HWZL 4OIIH 2V2XB 1E28B 1OCWL 3U0TA 1JGDB 2NY1C 4M7ZB 4OF5A 4M9OA 2KQMA 3PQYA 5TE4L 2AEPH 3WDJA 4TPRH 4ZSOA 4U6YB 3G6DL 4HWZB 2OZ4L 3QXAB 3HMXH 4FQLL 2DQFB 5HD8C 4YE4H 4GRWB 3FZUD 2E7LC 1Q1JH 4MJ5A 1FL6B 4OT1H 4KROD 1KBGH 4ZUWA 2VDMH 2CXKA 5C0NC 5T1KB 4YGVB 5ACLA 8CGTA 1MJJB 2K7QA 2NY5C 4JZOB 1S7VB 4KJWD 5IB4A 2X1OA 4E42A 3OKDB 1MCEA 3C60A 4TTGA 2VZ1A 5B22A 5BV7B 3BQUC 3N1FC 3L3IB 4UINH 5E6ID 2X4RA 3MC0A 3TBWB 4DKFH 1UB6B 1C5CH 5KSUB