2W9EH

Structure of icsm 18 (anti-prp therapeutic antibody) fab fragment complexed with human prp fragment 119-231
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
215
Chain Sequence
EVQLQQSGPELVKPGSSVKISCKASRNTFTDYNLDWVKQSHGKTLEWIGNVYPNNGVTGYNQKFRGKATLTVDKSSSTAYMELHSLTSEDSAVYYCALYYYDVSYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQSVTCNVAHPASSTAVDKKIAPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Prion Protein Bound to a Therapeutic Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MAJOR PRION PROTEIN
total genus 43
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9eH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9eH02
4AQOA 3LKSB 4PJHE 4QXUH 4JKKA 3OXRA 1WBYB 4M3KB 5D1QC 4PREA 1F4HA 5GSVB 3U0WL 2XQBH 3ECBB 4FFYL 4RIRA 1CE6B 5DHVA 3T0XA 5IV2B 4JREC 3ARSA 2NXYD 4AENA 3S5LA 1DBAL 4MXWH 4ZUVA 4XAWH 4JFHD 4YFLI 5T1KB 4QEGA 1QBMH 5HVGB 3QEQE 5GJSL 1H3GA 1AD9B 1WSST 1RK0A 4XMKH 4ZUWA 2XXMB 3MQIA 4R7NB 5FKPA 4GRLA 3K4ZA 4FFWD 1X7QA 2Z31C 2Q1EA 4PGEA 2P5WA 2DWDA 1KJ3L 3SPVB 4HH8A 1A1NA 4J6RL 2HJKA 2FBJL 2R1YB 3ESVF 3EYUH 3BO8B 2NY6B 3QNYB 5E8DL 4WY7H 4XB8A 4OZGF 4LCIH 3MA7A 3KR3H 4OZHA 3H9SD 1S7QB 3FB8A 2H26B 3P77A 2B1AL 2ESVA 1UM5L 4JPWH 4XPFH 5ACZB 2AV1B 5M94B 3FN3A 4BH8A 2C1PA 2YN3A 5K9QG 1NC2A 3S98A 4JGMA 4JFQB 3U0PB 5IB2A 3CLFH 3GRWL 3VFWA 3L3GB 4LMQE 4ALAL 2FH8A 4KDVA 1NDGB 4HWZA 2X1XR 4F7MA 2D7PA 2BNUA 3WNOA 1KB5H 2X1QA 2ZP0T 2W38A 5GRVL 5DEFA 4UT6L 3IDNB 2CK0H 5J56B 3KS0J 3VJ6A 3QDGE 4WDIB 3V4UH 4AYFA 1VGEL 3IAQA 3MV11 3OG6B 2OK0H 2VLLB 4JQIH 3WKMH 2DLTA 2V17H 1X5GA 1T5WB 4PJFA 2X5PA 2EH7H 3QFJE 4NKDB 2Y07H 3GMRA 4QRSB 4PJ9B 4FTVB 1A7NL 3WD5H 3KYKH 4WI2A 4ZPTA 1LE9B 5L6YH 4YO0B 1FG2B 1U92B 4LAJH 4Y0GA 4Z76B 1EHAA 4XI5D 2QBWA 5HYQB 4Y1AD 5FB8B 2XZCH 4CN4A 3LB6D 2ARJB 1R3HB 1RJYB 1JCKA 4X6CB 4MNHB 4XAWL 1LNUA 1PG7H 4HK3N 2CK2A 4TUKL 3C6SB 1FLRL 4HK3J 3CVIL 3ZE2E 4MGXA 1KXQE 4Z7UF 4RSVA 3VFOB 2B2XL 3K1DA 1NAKH 4JO4L 3OKMA 3QUZB 2VZUA 3O3DB 4FTVD 5IVZA 1ZHKA 2F53E 3MBXH 5FHBH 1S5HA 1M05A 4WW2A 3VE0B 5J1SC 2J8OA 1X5HA 1YNTB 3R8QA 1FYTA 4NZUH 1YEHH 5DJYB 3RVXD 3HA0A 4QY8B 5ERWA 4GG6E 2HJFA 5BS0B 3N9GL 1CXLA 1KB9J 4EOWL 3PUCA 2VC2H 2VXSL 4GUPA 1X3DA 3NCYP 1G6RB 4DVBA 3GSVB 4OIAA 1YN6B 1I4FA 4P9HH 4WHTB 4ZUUA 4X80H 1VKXA 4UB0H 5SV4A 1JN6B 5CINH 5F9DC 4D9LL 4HWNA 1CT8B 5AUMA 1A7OH 5EOTA 1CFSA 4YQXL 4OM1L 4JM2A 3BKML 5IG7A 1BBJA 2PCPA 4UTAH 4G3YH 2O5XH 4DUXA 4P49A 2AK4E 1WWAX 4HMDA 3V4UL 3RDTD 3GMOA 4PV9B 5IUSA 3DGCR 1EAPB 1DEDA 3Q1SH 3QPQC 1L4IA 2Y07L 3ARGC 4TSAH 1OM3H 4OLZL 3RPIA 4Q58C 1QO3B 4G8FA 2PKDA 1GGBL 1D5MB 3GHBL 5IW1A 3RJDA 1YYMH 4FZEH 3D69A 3BAEL 2R0ZH 5F6IC 3GSUA 1S5IL 1NCBH 4V1DB 4Y4KA 4X6CF 5ESQA 5EWIH 2XN9B 1DVFB 3IJYB 4YPGB 2B0SL 1NBYA 4XTRD 3DYOA 5HHOA 5CD5C 1L7IL 4JY5L 5ID1A 3LHPH 4MXWL 2ATKA 2BERA 1EUUA 2C7UB 4Q74A 1IEHA 2WINB 4Y2OA 1LDPL 3T4YA 3F6LA 1DLHB 5CJOH 4WTXA 5BRZD 3U6RB 2JCCF 2PNDA 3TO4C 3NGBC 5SWQA 2V5YA 1JMZA 3DX7B 3DECA 4P2OD 3FMGL 1K2DB 1MY5A 2DYPA 5IMKB 4NCDA 1HHGB 1OP3H 1VFBB 2XZAH 3BHBB 3TYFB 3WDHA 1YEHL 4GOSA 5MI0B 4LRIA 1CLZL 2BOBB 4EUPA 4JPIB 3LCYA 5E8DH 5A16A 2R1XB 4U6TA 4LHUG 4GKZB 5E8OB 1ZGLA 3RVWD 3FN9A 4JR9L 3SKMA 4MB4A 1MLCA 5ALBL 1FFQA 2JCCA 4MLSA 4XWOC 1KENH 4GRWE 1FC2D 3LN9A 3ULUD 2IBZX 4FFZH 5JHDE 1WFUA 5GJTL 3QCTL 2UYLA 1KJ2L 2Z91B 4KKAC 3BN9D 5EC1B 4Q9RH 1UWEH 4M3JA 5D1XA 1TDQA 2C9AA 4U2YA 1A9EA 1LE5A 1AXTH 1GGIL 2BZDA 4RISH 4ETYA 2DQFA 4XP1H 5DRNA 5FCUH 3BKJL 5I1GH 1N5AA 1MCWM 1WICA 1T20B 3HMXH 3SDAC 3RUGE 2XICA 5I15L 4ZSOA 3O9WC 2NW3B 3WFBL 1AGCA 5DJ0A 3NIGE 2BNRA 5IVXB 3MGAA 4GAGL 1G0DA 3QUMA 3VFTA 3KPSA 4UOJA 4W68A 5F3HB 1NBZA 5A2IH 1DQJB 4B7IA 2OLDA 5D7LB 5IFHL 1KCLA 4G7YL 3IFNH 5GISH 3TCLB 1JRHI 5CP3H 3L3OA 3GBNL 1B3JA 2VLRD 4PRHD 4HKBA 4G6MH 4JJ5B 3R06B 1U3ZA 4M48L 4UZGA 3VXOB 1FGVL 3L5IA 1RZGB 4OD3H 2MHAA 5D1XD 4ETQA 1IGJA 3C9NB 3O6FC 2NR6C 1YECH 3OV6A 2ADFH 4LPWA 3JV6A 5IROC 2D31A 3NIFF 1CFTB 3M8OH 3BFOA 2XZQH 4H20H 3KLAA 3E0GA 4G5ZH 4P4RA 4XVUC 5FA4B 4N9GB 4I0PB 1BFVL 2VDNH 2R2EA 1HQ4B 4PGDA 1ZWIB 3RRQA 5GS0L 2ZUVA 3SE3C 4NZUL 3NFPA 1AFVH 2J7LA 3RGVB 1JWSA 1IGMH 4XCFL 2JK5A 2OTPA 4MJ6B 4NUGH 1Q9WB 1LDSA 2AXFB 5JNYA 1P4BH 4NQCE 1FGNH 5CKAA 2HWZH 3P9MA 4Y2DD 4IIQC 5DD1H 2AK1L 4MA7L 5JMRA 4G6FB 4RRPG 1H0DA 5FOBB 1RIUL 3HC0B 4LDOB 5LAXB 3WJJC 2JJVA 4HIEB 4PRPD 4K9EH 4R4FH 4Q9RL 3SDYL 4MQXC 4P2RD 2VXTH 3LKRB 4RBPK 4WJ5A 2UWEB 4LCWB 3EOTH 4PJIF 4C59B 4DUVA 5E08H 4C83A 3ILQD 2NY4B 3GM8A 4Y1AE 1NCUA 4I8DA 2YD7A 4WHYG 4IRSB 3VWKA 1Z0NA 1BQHA 4MZ3A 4JFDE 5EBWA 1IFHH 4XC3L 3TVMB 5CCKL 1UWGL 5TFSH 5DJZB 3ZL4H 4DQOL 3G5XA 2NXYC 3STBA 4PGCA 2E9JA 5F7WC 1CU4L 4BUGA 3D85D 3EW3B 4BQ8A 1QEWA 3QDJB 4YFEA 4LP5A 2GHWB 1N4XH 1Z5LB 5DF0A 3O6LL 4LOUC 4BJLA 2ZCHH 4M6MH 5EU6A 1B4JH 4UT6H 1MAMH 3KPQA 4WEMB 1CDYA 4Y8DC 2NY3D 1BLNB 3EYSH 4HUUA 4JFEB 1RZ7L 1WAAA 1ZA3B 2AERT 4PJBA 1T1ZA 5LQBL 1LO5A 3S5LG 2HP4A 2BY2A 3QIUD 3K2UL 3VW3L 5ANME 1XGPB 1A3LL 2DD8H 5HDQH 3MNZB 4U1MA 4BKLB 3ZTJG 2GITA 3FO0H 3U82B 1JIBA 2IPUK 1ZK9A 3KWWA 1JPTH 2I5YH 3FT3B 1EIBA 3GBLA 1NGPH 4M62H 5BS0E 3T0EE 5ITFB 4POUB 4HS6B 1XR8B 3U36B 3IF1B 4YWGL 5BJTB 1AO7B 4HJGB 3VXRB 1ZXQA 2BDNL 3V79C 1J1XL 1BVKB 4NQXB 1J18A 2UZIL 4CAGA 4U1GB 1SEBB 4ELMF 2UWEF 3GMPA 1BWMA 3H2WA 1IGYB 3MSPA 5HSFA 4ZG1A 3MFFB 4XVSL 4PJ5B 4GKSA 5HYEA 5E00B 4RISL 4IMLB 2C1OB 3REWA 4WFHD 5FK9A 5F88A 1FNGB 4B53A 1T1YA 3QIBA 4ZDHA 4JRXB 3KPRB 1A7PH 1NJ9B 4TUOA 3QXAA 3DBXB 4IRZL 4LSPH 4PJCF 2VE6B 3RNKA 2J6EL 4R4BB 3FQXA 5K9KA 3O3AA 1AKJD 5JOEA 1SBSL 2WSKA 1WIOA 2BMKB 4OZFB 1MH5A 4NRYA 2DJ4A 3CFDA 1YEJL 3QI9B 2OZ4H 1K6QL 2YUVA 5DXWA 5EPMA 3C8DA 2BRRH 2R39A 5IR1A 5IFJB 4NJAL 2IC2A 3MXWL 5DQJA 1TNNA 3O3BB 2BCKB 2K9UA 2FGZA 4ZTOH 4UINH 5C08D 4AH2A 4R8WH 4ODTH 4AL8L 5MHSD 2GT9A 1P7QD 1RZKL 4GS7B 4XC1L 4PJCA 2ZSWA 5E2TH 3SDXE 5KVGL 1V3JA 4OD3L 4L4VA 1LGVA 2QKIB 1OGAB 1RUQL 3MRCB 2H9GA 1G7PA 4C56B 3LEYL 3FRPA 5I8EA 1I9IH 5EU4A 3BPOC 1XGQA 4JFPA 5IIEB 2A6DA 4HZAA 2VDQL 4PRDB 3KXFB 4QYOB 1EDQA 1ZHBB 3WIHA 4M7JL 4H8WL 4G8IB 3BN3B 1JRHL 1R3LA 3U7WL 1AIFB 3D5OF 5L88H 1CL7L 4EDXB 4CVZA 5DJ8A 3WIIH 2APTA 1PGRB 3GSRB 4G8GA 1U8NB 4LCUB 3T4AA 2VLMD 3VD3A 2IPKB 4OGXL 1G7JB 5KG9A 1C16A 3AC0A 2AW2A 4J6RH 4ZYKA 4OQTL 2D7OA 1W72L 4NHUA 5D9SB 1F8TL 1QYGH 1T5XB 4PJEE 3KG5A 4YHZH 1J8HE 1HH6A 1MFEL 4K9EL 2PXYD 3RNQA 3MRGB 2FYYA 4LLUA 3RI5F 3GK8H 3TPUB 1OP9A 4UTAL 1MIEL 1UYWH 4JZJC 1FZJB 1F58H 3MRQA 4FNLH 4LGPB 1KENL 1LQSR 4ZXBB 3C5JA 1CL7I 3NFSH 5HI4D 2DM2A 1ZLUH 4X9BA 5JW4N 1IC4L 5DQ9B 1AQKL 3ZE0F 4O2FB 5IMMA 4YHPA 1B88A 2JB5H 3IAGC 5F44A 3HE7A 2ICES 3PHSA 2OR9L 1Q94A 2DQUL 1I75A 2R0ZL 2BVPB 2P7TB 2ZUXA 1BD2A 4OF3A 3V6ZB 4NZRH 3LN4B 1X4XA 4D0DB 1JZ4A 4EBQH 2ICWJ 4PLKD 1UCTA 4LNRB 4MD0B 4F7TA 1HNFA 3UTOA 2R15A 2MKLC 4PGZA 1DL7H 2F54E 3BMVA 4CNIB 2VLJB 5JHDA 4FQLH 3BEVB 2Z31B 3BIBX 4GAYA 4RGMB 2I07B 2ADGB 1NGYA 4KKLD 3QPXL 3C8KB 3RHWK 1FFNB 4PJ7F 4XAKE 4R0LC 5FECB 3VGFA 5JXAH 2QLVB 4Y4FC 2GSIA 2NY6C 2F54D 3HNVL 3SY0B 4PJDB 5F71A 1J0HA 5EA0H 2QV2A 1UXWB 4X6FB 3PGFH 4W4OA 1QRNE 4PPTA 3V7AE 4HUMB 1ACZA 4HV8A 4HK0B 3P11L 3FFCB 4JKLA 4LMQI 3EFFA 3B9VA 2Z4QA 5AZ2H 5AZEL 3H7LA 4IMKC 1MI5B 5EZLA 5C86A 3UPAA 3FHQA 1AQDA 4PS4L 4QHLA 5CIPB 1NUGA 2AABL 2AJVH 4XPHL 3L6FA 3OF6A 2ZSVA 1KPVA 1KTLA 3KLDA 3RA7L 3X3FL 2QSVA 4XI5C 1OSZB 1HCFX 2NY7L 4PRBA 2HWZL 1NLBL 4PJHB 4QRPB 2HT3D 4JN2A 3PIQA 3VDBA 3JVGA 1NMBH 1NFKA 3F62A 2EC8A 4YNYB 1U8LA 2V5TA 3ZDYF 2G5BA 3VD4A 2FBOJ 1GHFH 4OGAD 1VACA 3QDJE 3QDGA 5SWSA 5C0FA 3OGCB 1AD0A 2CKBA 1MAJA 3T1FB 5ALCH 1F3JA 1VFAA 5TGBA 5JOPD 3BH9B 3QFJA 4NQEB 1GGTA 3TZVC 2J8UF 4KROC 2R8SL 3TNNB 4YHNB 4MVBC 1AH1A 3QUXD 3QA3A 6CGTA 1KTDB 3MREA 3MRRA 4XVUD 1KACB 1JZ3A 1WT5C 2E7MA 4FFWC 3QUMH 1PVHA 4PJ8D 1S7TA 1RJCA 5K93A 3HAEH 3WS6C 3GUTA 3AROA 1K5NB 4HX1B 1CFQA 3QUZC 5JOPE 3LRSB 5I1DB 1V7NH 1RZFH 4KHTL 4ELKA 5EWIL 1FH5H 2VIRB 3LKNA 1TTGA 1JYXA 3A6OA 4S0SD 1Q8MA 3HKFA 4Y5YA 2Z9TA 3UPRB 3N1QC 1BZ7A 5IFAL 2WANA 4OZGB 4U49A 4NRZA 4FRWA 4HWEH 5L9DL 2WP3T 1OW0A 3H9SA 4R4NC 5HI5C 4JFDA 2NX5D 3BZEB 4HJJH 3MBEA 3WS3A 1J87A 4WI3A 3KXFD 4U4BA 1NC4B 1LK2A 3I6KA 4HBQA 5F1SA 1B9ZA 1SM3L 5TDNA 3ARGD 5KJRH 1KJMA 5KS9A 1FNEB 4FFZL 5CBAA 3D3VE 1PZ5B 4NQED 4JDZB 4NT6B 3RFZC 3DX8A 4U33A 1NGPL 4M62L 4KZDH 2V7HB 5EIIB 1PKQA 3K80A 2HFEA 5ESVB 1JNLH 3QXUA 4KTDH 2PYED 4W6YB 4MNQD 3D39D 3FCTA 1MRDH 1U8MB 1I8KA 4MNQA 1KCSH 4X7TA 4HS8L 3N1FC 4RFEA 3ARGB 3WDJA 4L3ED 4PLNC 3CFJA 4E41E 2FJFB 2R0KL 2AGJH 1MF2L 1YEDA 1OAYH 4WNQA 4X98A 2C3WA 2HTLD 3F65A 3P4MB 3B9KD 5D7KD 5HHQB 1IC5H 3MOQA 4FS0A 4M5ZL 3TT1L 3K8LA 5F6IB 3TN0C 4PUBH 3KHQA 3KPNB 3VXSD 5IVNA 3DV6B 5D70H 4AG4H 1T0PB 1K8DA 5JW5A 4LARL 5HI4C 5CZVL 1EMTL 2WV3A 1M6OA 3DSFH 3B5GA 4G7YH 1T83A 1LP9F 1URLA 2ICWA 1ULVA 1YYML 4FZEL 5FM8A 4NNXB 4V1DE 3MNVB 5FYKE 4ODWA 3PWPD 1C7TA 3MJ7A 3ULVH 4JCLA 5MI0C 2WK2A 1DUYB 2HG5A 1XIWD 5FEBA 4O4YL 5DGQA 4MAYD 4HCRA 5AD0A 4PP2A 1I9RL 5HVWA 4P5TB 2OTWB 4QHNB 4HPYH 3BD5A 4A6YA 5I19H 1U93A 2MMXA 5HGBB 1ZLWH 1AXIB 1Y0LB 2DAVA 3BP6B 3QHZL 4HXBH 5DR5L 1IM9A 4JE4B 1S3KH 5FV1L 3JTSB 1N6UA 5C0BB 1I85C 4B7LA 5TE6H 5IT2H 2B7DT 3OKNA 5IF0B 5HGHA 4ODHL 3EOTL 4X7CC 5E08L 1YPZA 5AAWA 3LPFA 5D7JC 2RQ8A 1KLGA 4YUEH 2BOCA 3GJFH 1A3QA 2JJSA 3IKCA 1BZ9B 4HIIA 2HMIC 1DQML 3MGTA 4PG2C 3SDDA 1F11B 4KUCF 3SDAB 3UBXG 5EUKB 4NN6B 4M1GH 2DM4A 1DUZA 4YXKL 3DMMA 1I9JL 1J05B 2WBKA 4MCZA 3GBMH 3LKQA 1JGUL 1I1AD 2ZOKB 4G9FB 2D7NA 4CDGC 4YFDB 3ILPA 1IC5L 3OKYA 4B5EA 4XNQB 2FEEI 4PJXF 2R4RL 5IMLB 2YN5A 4MQ7B 2H1PL 2X4RB 5E94B 5IVXF 4JQIL 4U1HA 1NMCB 4NN7B 4X4XB 3CVHL 4MA3B 2HT2D 2RAMA 4NFCA 4RNRA 5D70L 3IXAB 1F45A 4ZO8A 2VDML 1J5OH 5E1AB 1YYLH 4PJFE 1JHKL 1TVBB 3PWLB 4HS3A 4HUVA 3EO9L 1RUPL 2WWKT 2E7LA 2XWJB 4PJEA 4EI6B 2XQBL 4Y4HB 4J2XA 1G6RH 2YD8A 3BZ4B 5DGRA 1Q1JL 2EKSB 2VLKB 3CSYB 3EDJA 3GSNA 3RWIB 3OKEA 1CCZA 4R3SB 3NIDF 1CYGA 2VDRL 4D8PB 3VA6A 3MRKB 4E0RA 3QQNA 2ZOLA 3FJTA 3Q48A 3IETA 3PP4L 1KOAA 3I9GH 3QWQB 4N5UA 4XWOD 3KPMA 3IGAA 3DOSA 3PWJB 2J8UB 5D71L 4P46B 3T3MF 1A1MB 4L1DA 5LKNA 4N0UB 2DQJL 4J7RA 2X70A 4IIQB 1YEGH 3WIFB 5IQ9B 3X13B 5D96B 1T80A 3U48A 2DTML 5FCSH 1KJVA 4Y4HD 1TCMA 1I1CA 3NACL 2CMRH 2DQCH 4K3EL 4M4PA 3TJHC 3U79A 4LLYA 3GMNA 1WV7T 3MLYL 3GI8H 1S7WB 1E0OB 3FN0L 4ODVH 2ZUUA 4XBPA 5A43C 1PY4A 2P42B 1BD2E 1XF4A 2AI0H 4U1KA 5BS0D 1GZQB 3T0ED 4WUUB 3NPSC 4X4YB 5DA0B 4ORGA 3K7UA 3MRNA 4WHCA 4P46D 4KI5D 1KJ2A 2IADB 2F54A 3TVMC 3S37X 5CINL 3GMMB 5EORL 5F8RC 5FYJD 1BVLA 4ENEC 3BDYL 3V0WL 2A0LD 1MNUL 2NXYB 3VDCA 5M95B 3K4DA 2ZUYA 2VLKD 3IDXL 4OIIH 3OJDB 2C3GA 4HGWA 2BJMH 4AIXA 2FX8H 3L5WA 1YEJH 1VPOH 3MJ9L 5JXEA 1A14L 3BUYA 4MA8H 2R9HD 3ET9F 3WNKA 3RA7H 4P9MH 3U9UA 3X3FH 3EOAB 1CLOH 1TCRB 1F2XK 2FEDC 5EU5B 4QCIB 4M6AA 1A9BA 5F89B 4CADB 1IFHL 3KYNB 5CGMA 2AK4A 2V9TA 1J11A 1WBZA 2ENYA 4KKLC 2E9WA 2NCMA 4XP4L 3QUXA 4YC2B 4DGIH 4N1CA 1UA6L 2VDKL 3DTXB 3PDOB 2IAND 2PO6A 2NY3B 4UAOC 1H3WM 2LABA 3L9RB 4PRIB 2FJGA 4PJ8B 1QHPA 4BFIB 3RWHB 2XG4A 3QPXH 2A6KB 3ALPA 3HI5H 1HHJA 1V3MA 4GMSL 2Q3ZA 4WTZA 2J4WL 2H3NB 2F58H 1MCNA 3TBVB 1T1XA 1YNLL 4KK9C 1FZMB 4I13B 1YC7A 1GAFL 3ZZ1A 3UTSD 1R5IA 2DM3A 3VGBA 5IB4A 3CFIC 3MLZH 2W65B 2YUWA 4KQ3L 2OSLB 2PW1A 5DZNA 1DQTA 5HHNB 1ZEAH 4U1GC 5C0IA 2MFNA 1FIGH 5C6TL 1WWBX 4MS8C 4WIQA 3SE9H 1FHGA 5IEHA 1XMWA 2JELH 4NCC1 5EZOH 1PSKL 3QJFA 5D8JH 1P84K 1EEZB 3K4AA 5CD3B 3MA9H 1ACYH 1M7DB 3AXLA 2VN4A 5MEOA 4I5BB 4OI9A 5KN5B 3TYGH 1PKOA 3KYMA 5C7XH 5F72S 4X7EC 2OJZL 4KH2A 3WLWC 3VU2A 3QI9C 3MNWA 2W92A 1S7UB 3GIVB 2QADD 3MRFB 4F3FA 4UDUB 5C0JA 3U46B 4DGYL 3FQTA 4GS7C 4U7KA 5DQDH 4XP4H 3D39E 1NGQH 3VFVB 1AGDA 5D5MB 3ZKMD 1YMMD 4MQTB 3LDBB 3L3JA 2CR6A 4AY0A 5TE7H 3DV4A 2V2XB 1ND0B 5KS9E 1CIDA 2RFXA 4KGJA 3D3VA 2N4IA 3BPOB 2FO4A 2IH3B 4XWGL 4NDMB 2EYTB 3KPOA 4NC2B 1OPGH 5MERA 1BMGA 2XKUA 7CGTA 4CRPA 1RV6X 1RQ5A 4PGJA 4QRQA 2VZVA 4BK4A 3UYRH 4EVNA 1G7HB 1U91B 3N1PC 1OF2B 4JFZH 1MJ8L 2AJ3B 3O3UN 3MXVH 5C0AE 1DQDL 4H20L 3ULVE 4TUJA 4GRWB 4E41A 2D2OA 2C3XA 3QQ3B 3V4VL 3O11A 1K4CB 1P4IL 1FVCB 1N0LA 3HCVB 2VLRA 5C0DA 4L4TB 4EDWL 1EGJH 3ROLB 1E6OH 2P47B 4XP9L 4BYHA 4PY8I 5IJVA 3KR3L 3ULUC 3RY4A 1FO0A 4DTGH 2AKRA 1UVQA 3EYVA 1OAZH 1IKFH 1SMAA 1FL3A 3G6DH 2WIMA 4M7LT 3QCVL 3O8XB 4HC1L 3JWOH 4O00A 1YUHB 5BXFA 3HC4L 1D9KD 2ZG2A 2A77L 1OAQH 4ZXBC 2YRLA 4OCWL 4U1IB 1RULL 1TFHA 5AEAA 4YJZL 3S96B 2IBZY 3BRFA 1QSEB 4JFOB 1I1AA 2LU4A 3UJTL 3MV01 4F8TA 1RD6A 4N9OB 4CJ1A 4OZIA 3X3GH 2FX8L 1HH9B 4PRHB 4KFZC 4LSUL 1INQB 1QQDA 3GJFK 1AJ7L 3P3YA 1OB1B 4XMPL 3TA3B 1I3UA 3HMXL 2EYRA 3SDCA 5BZWB 3SGJC 4MSWA 1EVUA 4Z78A 3MLVH 3ZKSD 2P24A 3QNZA 3DVGA 3FO2A 3HR6A 1GGYA 5KAQG 4IDJH 4HGKC 4U6HA 4JO1L 3VH8B 5TDPA 2VR5A 4QXWA 4NNPL 3KNBB 2YMXH 3EFDH 4JFYA 3MJ8A 5MHSE 1A3RL 5BV7H 2ITCB 1IC7L 5HYSB 4ZO7A 4EEEA 3JWDL 3O6FD 4RGMC 3FKUS 5DVMA 4LLMA 2ED9A 5AYQA 1OAUH 5DK3A 1YEEL 4HKJA 4R0LB 2E6PA 1V5JA 4Y4FB 1HKLH 5L0QC 4AEIH 1WAAE 1U8HA 3BP5A 4XNYL 4BA8A 5L9DH 4NP4L 5CBEB 4Z5RA 4NBZB 2PW2A 1L0QA 1EVTC 3M8OL 1NC2D 4OCXH 4P2RE 2YPLB 3BAEH 4M8VA 3MYJA 3FONB 4LSVH 3TNMB 5F3BB 1FH5L 5A2JH 1RZIA 4JHZA 3KPLB 3U4AA 1QA9A 4TVPH 2Y1VA 1MHCB 5J11C 3VXTA 3Q5OA 1DANT 3T2PA 3ARBB 1QSFD 3THML 2FJHB 3TV3H 4LPUA 4RMQA 3P4NB 3S6CA 2YSSB 2VAAA 4TVSa 3UJJL 2OL3A 4OZHF 3FT2B 4NO3B 2Y6SD 5D2NC 4JPWL 4PJDF 1TZGH 4B50A 2NW2B 3UYOD 4KK5D 2ILLA 3VXNB 1UCBL 4DGVH 2SEBA 5LGJA 4QF1B 3GKWL 1NCNA 3T0VA 3N0PB 1IC1A 4YX2L 3A67L 5ISZD 1HCVA 4L3EA 3V5KB 5F7HA 5E0QA 3SOBL 3D0LB 3VI4F 2WMPA 1JWMA 5KSBB 4KTDL 4PJ5D 3C60A 5DRWB 1FVDB 5JOFA 2HVKA 1E6JH 4LSPL 4KROB 3TZVB 4APQB 2BHZA 2ED8A 3O4LB 2OQJA 3JSSA 1U8QB 1EO7A 4UQ3A 1T3FA 3QCTH 4LLAA 4PB0L 3BOVA 3ZL4L 4GBXD 2A6JA 4YHIA 2RHEA 4ODBD 3EDFA 4ISVA 2IANA 2PO6D 4PRPE 2BXZA 4QT5A 1SJEB 5IB1A 2JIXB 2WZPD 3NZ8A 2IG2H 4MA8L 4P48A 2G75B 3WXWH 3BKYL 1UWXH 5I2IB 3U30C 3DARA 1QKZH 3HHRB 4KV5F 5B3NA 4BSWA 3HB3C 4GKNB 4JFDD 2PN5A 1JWUB 1ADQL 3HRZA 3WL9A 3OWEA 4GXUN 3D1MC 5ADOH 2H6PA 5JXED 1ZVYA 2A74A 3EYOA 1TMCB 1G0YR 4LSTH 4R6UA 4KWUA 5L6YL 4L4VE 3ARFB 3ZYIA 1RZJH 2Q7YB 3H9SE 5B4MC 1HXMB 3MUGA 3FOMA 4K3EH 1JBJA 3KS0H 5FYKD 5BRZB 5FYLD 3TVMD 3QFDA 5EUOE 1N59B 3R0MA 2VAJA 1P7QA 5LG1A 1YNLH 1A6VL 4POZD 1F3DH 4BK5A 3RWFB 3H0TB 2NZIA 1DQMH 3L3IA 4M5YL 5C3TA 1Z9MA 1IGTB 4LKCA 2YD2A 2FWOB 4DKDC 1NMAL 3RDTA 5EDXA 5B38G 4Z0XB 3AU1A 3QDGD 1AXTL 1GGIH 1L9NA 2PTTB 1F42A 1NAMA 2X4NA 2ADJA 2GW5A 3BKJH 5I1GL 4G3YL 4G9DA 1XF5A 4XPFL 1FNLA 3FQNA 5HHXH 3QDMA 5BW7A 4MXQC 2APVA 1U6AH 1X4ZA 3TN0B 1RIUH 2GK0A 5I18H 4I1NB 1MRDL 3AAZB 1IBGH 2JE8A 3S36L 1S9VA 3TBSA 1HOCB 5I1EL 1J88A 2V2WB 2QR0B 4OF8A 4WFFE 3WLBA 2VDKH 4NZDA 3FO1A 1TETH 1DQLH 4W81A 1A2YA 2PXYA 2WM0A 4OI7A 3PGCA 1RIVH 3MMEA 3QSKB 3AMKA 5SWZD 4JO2H 1WTGT 3W5NA 2ICWI 1T0NB 2L0DA 5E5UB 5ICZA 3VRLE 5DC4B 4U1LB 3RHWF 4UU9A 3BEWA 3GGWA 5IQ7L 1BFOB 5EO9A 4GW5A 4I3RL 3CXDL 1S9XB 1BQSA 2ADFL 1U41A 1PLGL 4LLDA 1PY9A 3OR7B 1HHHB 1MRFH 1A7NH 3WD5L 2EC9U 2ZCLL 4P5TC 1IVLA 3O6MH 1U36A 2Z35B 3HI1B 3TBWA 3O41B 4OFYD 1D3CA 3QDMD 1JF6A 1BFVH 2R2HA 4UTBL 5CEZE 2G9HA 3CX5J 4XPTH 4WO4A 3QIWD 1YA5A 5F1IA 4HDIB 4L8CA 4F9PC 3U7WH 3TO2B 5D7JB 4HZLA 3UTPE 2L4OA 2X4PA 5DJ2A 1R3KB 5DUBB 2VKWA 2ZWLT 1S7XA 4K7PY 1DQDH 1ORQB 4NN6C 3S4SB 4KDTA 5EOCJ 2R23B 4KKCC 4RX4D 4WEBH 5CJQL 3T77A 1QRNA 1YPZE 4X8XA 4N0YL 3IFPB 1JNJA 2GIYA 2RB8A 1T1WB 2FR4A 2XPGB 1INDH 3KPSD 1U8OB 4MCYA 2CK0L 2X89A 4HULB 1J1PH 3L1OL 2WBJD 2VQUA 4JZNB 3UDWA 5C0RH 1MJ7H 1XFPA 5E2JA 5GIRA 4KAQL 4QRPD 2FL5A 1NMCC 4NN7C 4GJTB 3LKSA 4NBXB 1G84A 1UACH 3I6LE 4KI5E 4HQQL 4JRYA 5D1QA 1F4WL 5H2BA 3H9ZA 1FCGA 1MFDH 3ECBA 4HSQA 3W0WB 4YZFF 3DRQA 4G6AC 1N4XL 1U2CA 4XAKD 3MOBL 4G6FD 4RMRA 3BJ91 3ULUF 1PEWA 2M8XA 2OR9H 4Y4HC 1EAJA 3S5LB 1A7PL 1FG9C 3PABA 4HUNB 4DFHA 5CUSH 4PJAB 1RJLB 1RK0B 4OFPA 1ETZA 2OP4H 2PYFB 5A40E 5GZOD 4CU6A 4DKFH 2IPTL 5C0GB 1CDUA 2DWDB 4Y4FD 3SPVA 5J1AA 4P46C 1NAKL 4LSTL 3JBG7 4B41A 2X4SA 2XRAH 3BO8A 3NCFB 5D1ZA 5K9OA 5D96C 4QHUA 1YY8B 5HHOD 3O2WL 3C60D 3DX6A 3CFEB 1Y18B 5ISZE 1SEQL 4OZIE 2CLRA 1MSPA 3BVNB 2F19L 3SE9L 1JHLH 2EE3A 1DEEA 1W0VA 3TFKD 1ES0B 5INDA 4MAUL 4P3CH 4S1RH 1XF3A 4OJFL 2R29L 4GQ9L 4KZEH 4JFQA 5IB2B 1JNNL 1MHEA 3HLAA 4KJQD 4X99A 3U0PA 3NPSB 3FRPG 4BH7B 1Z0MA 4LLQB 3L3DA 4FZ8L 1KF9B 3CPLA 5IBUB 1WQVT 2GY7B 3P30H 3N1MC 4F7MB 1EHLH 4K2UL 5DWUH 3J7HA 4FQQA 5I17A 3DI3B 9CGTA 1QR1B 4H5SA 1CFNB 1T4KA 4WDIA 3ZE1F 4CN6A 5JZ7C 3N50A 1EPFA 2VLLA 4HCRL 4ESKA 1G6VK 1PKQE 3Q1SL 2IJ0C 3GM0A 4O9HH 4UQ2B 1KB5A 4MHHI 4YC2C 3MCG1 5CEYB 1CGVA 2DLIA 2EDNA 3VXMB 3OJMB 4Y7MA 1BOGA 4UAOB 2NY3C 5DHVH 4LHUB 2A83A 3I50H 3JWNC 2D7QA 3GSQA 2AJSL 1JHTA 4D94A 3D25B 4PJ8C 4N5ED 3QAZB 5IOPA 4QRTB 1MCCA 4AM0A 4LIQH 4JVWA 4KTEH 4R90L 2W0FB 5J13B 3KDMB 5DQDL 2XWBB 1GOHA 1RPQA 4OZ4B 4P99A 4PV8A 4OFKA 4DGIL 5IQ7H 3OKMB 2IH1B 1H5BB 1OOAA 3AM8A 1TJHH 1A21A 1S5HB 3MRPB 5BZDA 4OZFH 4TRPL 3GHEL 4BUHA 1YNTA 4K94L 4M8QB 5ICYB 1WUNT 2XRAL 3B9KA 5C07B 1JGDB 4BQ9A 4EN3D 4DZ8B 1J0ZA 4GBXA 2QSTA 3P40A 2DS4A 3CSBA 4M48H 3V5DA 2ID5A 3FT4B 1MJJA 3T0EC 4BZ1L 4DVBB 3CVHB 3CVIH 2NQCA 4POYA 1RU9H 2PYEA 4YBQD 1I7UB 1A3LH 1F2QA 2NXZD 2NY1D 2CIIA 2G2RB 1C5DA 4F7PB 2X7LA 3IJHB 3RWCA 1UCBH 3V8OA 4I48A 2AJUH 4YXLH 3ARTA 3FQWB 1ZEAL 3ZYOA 4N0YH 4RMUA 4PG9B 3WNMA 1DP0A 1P1ZB 4ELMA 1IGML 2AJZA 3OBAA 2W91A 1UQSA 2OBGA 3U9PL 2XNAA 5LXGH 2FLBT 4MB3A 4P4KA 1I1FA 4A2LA 5IEKA 5I73B 3DO7A 1G9MH 1MFAH 5DS8A 2OL3H 4OM0L 4YEFA 1CQKA 1DQQA 3PV6A 2Q6WA 5E8NB 3MR9B 4IRZH 5AYUH 4FQJL 4BSVA 4EKXA 4HHAB 4FQXB 2W07A 4AEHL 5JPNB 5CWSA 4Y16D 3B2UC 4G42B 4MNGB 4YQXH 4M61A 1MFDL 1BIIB 4R2GD 4I18C 3LDBC 3WFHA 3TIDA 1GC1L 1DVFA 1R5WB 2XA8L 2NZ9C 1NLDH 3QEHB 1QKZL 3D39A 5I1KL 1N5YH 3S88H 1QR4A 3LH2H 4RZCB 3FB7B 3DIFB 4AEEA 2F53B 4TNVF 4LCYB 1DLHA 1KIPB 1Z9SA 3S34L 1S7RB 3OZ9H 3F7QA 3QG7L 4KY1H 5TQ2H 1FYTD 2HKHL 3MUY1 2VERN 1SHMA 4PRAA 1T66D 3TBYB 2DYPB 5TE7L 3VFPB 4POZC 4J3UA 1IEBA 1TVHA 2AK4D 1MCLA 1NEUA 3FZUD 3MV7D 1JF1B 1K8IB 1XR9B 3PL6D 1ZVHA 4KHXH 5JPMB 3E3QC 4HMEA 2V5MA 3ARUA 3G5ZA 4FXGA 5FGCB 1RHFA 3X11A 5T33L 2JCCB 4X83A 1HIMH 3C6LA 2OTUB 3O8XC 4TSCH 5DD6B 3MRIA 4RQQA 1OD7A 4XCNB 4Z0BL 2DQHH 1B2WL 2D0FA 2GJZA 3HFMH 3PHOA 1OGAD 1IILE 3MV7E 3SKOA 4WI8A 1D9KA 1A9EB 1QYGL 3L7EA 3MCLL 1BQLL 2H2PD 2KUTA 2P5EE 5DRNB 1JPGB 1KG0A 1ZSDB 2O26U 5CZVH 1XGRA 3Q2CA 4UOW0 5FDYA 1NFDA 3WBDA 1MCRA 5FYJL 4G43A 2XOTA 1IGIH 4UNTA 3TA3C 4G80A 3VFTB 4RGNE 1LILA 3H6JA 3HUJF 4P2QE 2ZNWA 3B2VH 5AYUL 4P57A 3T8XA 4JDTL 1CWVA 1MHPH 1MI5E 2WP3O 3D6GA 43CAB 1J7VR 5EBMB 3PWPB 4KRMB 4FQ2H 3OAYK 1IGFL 2MOVA 4PB9H 3SKNB 5I0ZA 4KTYA 1W2KT 2HRLA 1Q0YH 3O6LH 4JO3H 4TYUA 3CSGA 1BX2B 2FLRT 3JWDC 5DRXB 5IM7A 1MAML 3O45A 4JJ5A 2AJSH 5IESH 1IM3B 1J8HD 1FIEA 3HNTL 3G6AB 3FOLB 5T3ZL 3RL1A 4ETQB 3STLA 1T0MA 5D7SH 3C9NA 2EO9A 3HUJA 3O6FA 5T1LD 5EN2B 1FJ1A 3FQRA 4OGZA 4PJHF 5L0QB 4ZUSB 1JK8A 1AC0A 2H2SD 2ZCKL 3UZVB 5IK3A 4R97B 2E7HA 3OR6A 5I16B 4HW6A 1Q72L 2VABB 1HQ4A 3EO9H 5HPMA 2QQKL 3JWDH 3DXAD 1NFIA 3RZCD 2EKJA 2EDFA 5J11B 4MJ6A 3ARBC 1QVOA 5HVHC 4GRLC 5CZXC 1I9EA 1QFWM 4BM7A 3MCKB 2E7CA 5F1NB 5CZKA 1SMOA 1YNKL 1H0DB 2M1KA 3DX9B 5I66A 1FSKC 4M02A 5D2NB 4QHKI 4NCC2 3JTTB 2X4QB 1LO0L 3MGOB 4FG6D 4FP8H 3RUGB 1NUDA 4O58L 3V6FB 4HIXH 4EN3C 4OZGE 3ZMRA 2EE6A 1I8IA 2F19H 5I1CH 1PG7L 1OVZA 3INUH 3SKJH 4FHBD 5T1LB 1OARH 2P48B 3V2AR 2BXYA 3LS4H 3D48R 3K74B 4P3DB 3S97C 3T2QA 5JQHC 1FAIL 3WSQL 3OHXA 2F15A 4APQC 3OAUL 3UO1H 4NC1E 1Z5LA 3LQAH 5DHYB 1B0GA 3B4NA 4S0TD 5TJWK 4DCQA 5B38A 4K7FB 3AMLA 3KPQB 4E42A 5E2WL 3DURA 4QKXB 3GSWB 1S9WA 2CLVA 3WE6A 2DQGL 1G0XA 4F57L 3U30B 1WEJH 1FO0L 5E8EA 1FN4A 5B4MD 3UBXA 1VGEH 4GKOA 3QUXC 5T3ZD 4Z7UB 4I4WA 5CSZA 3RBSA 3VXQA 1RZKH 1CXHA 3WFBH 1XGPA 3BQUA 1UZ8A 5C9JA 3LB6C 3T04D 2RJMA 1U8KB 5JA8B 1JYNA 1LEGA 4KPHL 4LLWA 1PLGH 4BKLA 5TE4L 2O5XL 1NUFA 4NQCB 4XWGH 1JJUA 3ARFC 2Z93B 1F13A 5GS1C 4U1JB 4NZRL 1OPGL 5GPRA 1OTTD 4I0CC 4NQDA 1SEQH 3CVHH 3EGSA 4MDJA 4PLJC 4KHXL 1YY9C 1OWWA 4P5KB 2VITB 3FB5A 5E9DB 4F7EA 4WW2C 4OJFH 5EU7E 1R5VA 3WFEL 3ALWA 3LZFL 4K8RC 5MEPA 2DMBA 3KPPA 5ICXB 3CNKA 3NCYS 2UY7A 1AHWC 2VDNL 3F7VB 5EULV 3HNSH 5C0AA 4GKSB 3CFKB 4LF3A 3QXDA 2CDFA 5JR1H 4YK4C 4IMLA 2C1OA 3EOBA 3I3EA 3QIBB 2KQNA 3GK8L 4JRXA 5J9PA 2FSEB 3QEUB 1WCQA 5F6HJ 4K3DH 5CJOL 3QO1A 1CF8L 2IAMA 3D2UD 3MBED 5FHAH 5FOJA 4X5XB 3S35X 5FA3B 4K7PL 3MLTB 3C2AL 4FN0A 2NYYC 1Q38A 3IB4A 3HG1B 5MEQA 4K3GA 1ZMYA 2DWEB 1WFOA 4Y16A 3I84A 5EOCL 4GT7A 5DQJB 5F9OH 1ZVSA 1LO4H 1NDMB 1YN7B 4FQ1L 4EI5A 4KKCD 1WZKA 5JIIA 5E8PB 3VFMB 1SVZA 3QIBD 3TN0D 4RFNB 2GT9B 1JFQH 1KLUB 3QULA 4OD2B 2CSPA 2OL3L 1LP9B 3E6HA 2EZ0D 3HZYB 2UZYB 1JGEB 3NMEA 1DL7L 2BP3A 3S3JA 3I2CH 3MRHB 1L7TH 1MPAH 4N90E 2EYSA 4XNZC 2ZPKL 4PRDA 1S9YB 4X0KB 4QYOA 4HH9B 4J4PD 4D0CA 5GGSB 3DVNB 1T2XA 4EDXA 5CFHA 3BP7B 2VLME 1ZT4B 3SBWA 1G7IB 1F02I 2IPKA 2JCCE 2HN7B 3CIQA 5E6YA 1D7FA 2XV6B 4PRNB 4X6BA 5HI3D 1L0XA 1M71B 1U8IB 3DGGA 3E8UH 3QNXB 4HXAH 1U3YA 1HHIA 1Q9KB 4HF5L 1SYSB 4P2YA 1BJ1J 4KMTL 1KPUB 3MACH 3KJ4B 1SYVB 4HKZB 1UM6H 5DDHA 3TP4A 2YA1A 3FN0H 1QFWH 1FZJA 1K3ZA 2JB6A 3W11C 3Q5YA 4TVPD 3P9LB 3P0VH 4ZSOE 2NY7H 4GRWF 5E99L 4HC1H 3GDBA 2DQHL 1FDLL 2E8ZA 5DR5H 3TIEB 1WBYA 1DE4A 5IKCB 1I1YB 2JKXA 1MOEA 4G9FE 5GSVA 4ZS6D 1P4LB 5DHVB 3C5ZD 3H3PL 1A14H 3BN9C 5DVLA 1JL8A 4YDLC 2OI9B 4WUUE 4KJPD 4JFHE 1IAKB 3LRGA 3SDDD 4MD0A 5C0EB 3NIGF 1FVEB 1XT5A 2C3VB 2QEJA 2QHLA 2OJEA 4JFFB 7FABH 4P2QD 2ARWA 2OXHA 5BVJB 1AGFB 2WIIB 2FHBA 5HYSG 3IS0X 4KJQC 5C0BE 4FQHA 5J57B 1RURH 4LSSH 5DI8A 2P5WB 3TT3H 1HSBB 4JHWH 4JN1L 4MD5A 2Y5EA 5L8JB 1N3NA 1G6RL 4OFIA 1HINL 3K0WA 3OGOE 3RKPA 4YIQA 3GO1H 1H3XA 4OBRA 5IROA 3FB8B 3MUHL 5BO1H 2C26A 4JB9H 3SCMC 4I2XB 1KFAH 3NIFE 1B90A 3ARRA 5DVKA 3HZVB 4DN3H 5ESAA 4RMSA 1HILB 5F6HI 1DJSA 4Y19B 4F8QA 5LGHL 3L3GA 1MI5A 5EZLB 1O5DT 5B8CB 5GGQL 4Y5XA 4HWZB 5CIPA 1KYOJ 2YPKA 4O5LL 4QRRA 1I3RA 3G08A 3H3KA 3L6FB 1MREL 5DTFA 4C55A 1KPVB 3CFCL 1WISA 5DMJB 1OGTB 3IDNA 1QFWI 1LDPH 4NO5B 1JNHA 5F7NC 4Q9CA 2QTEA 3ZSTA 2Z31D 1EFXA 1QP1A 4Y1AB 5D4QA 4KROD 1T89C 1AGBB 5GGRA 4YNYA 3TBTB 1U8LB 3O4LD 2J5LC 2O61A 2OR7A 3RX7A 5HYIA 4NQEE 1HEZB 4WFED 1V05A 1IKNA 3ZKND 1KCRL 3GFUA 2FIKA 4K8RD 5DJCA 4FQJH 4MHHG 4G6AD 4MDIA 5JLZA 4HIXL 1WFTA 4ONHA 2R4SH 3IDXH 1WTLA 3TH2T 1C5BL 3HPJB 1E28A 1MCIA 2MSPA 3R1GH 3VGGA 5C8JA 2MQ3A 3L95B 4FQCH 5M7QA 4Q6YA 5GGTL 2CRIA 5KAQF 2ARJA 1ZTXH 1RJYA 2GFBB 3TJEL 3PQYE 2EIEA 3QAZC 1NGWB 3ILQC 4OAWA 1Y6NR 2O5YH 3CDFA 1MUJA 4OUUA 3WKML 5J13C 3V6OE 3AY4A 3IXTB 4AEHH 4OF7A 4ZS7H 4OLWH 4Z95H 4LPVA 3VFOA 2AQ1A 1JI1A 3OZ9L 3HZKA 1CFQB 5KBNC 3O3DA 1H5BC 1W0WA 1ONQB 1ZHKB 1CI5A 4F33B 1RHHB 4WEUD 1M05B 5EB9A 5HY9B 1AJ7H 1P7HL 4OZGA 3VXSE 2DQIL 5I15H 2ESVD 5EC2B 1NEZG 1U9KA 2FGWL 2MCG1 2HJFB 5EZIH 5I1IH 1YMMB 2YZ8A 3Q3GA 1KBGL 2PTVA 5JIHA 5TF1H 3T0EB 4HUKB 4X7SL 4YDIL 5D7IF 4QHMB 1BGXL 1J86A 3AFLA 1KGCD 3BIKA 5KS9B 4YR6B 1GZPA 3V0VB 5E7BA 3QUKB 3PP3K 1LO3H 1PZ5A 4EI5D 1VA9A 5EG6C 2DIJA 3WUWA 4FP8L 3DI2B 4M43H 4M1DL 2DOCA 1YEEH 5I76B 5T3XL 5AWNH 5IG7B 4J1UA 1EEUA 2PYEE 4K94C 4KKBC 1OARL 4JQXA 4IRJD 5HHMD 1RFDL 4PV9A 4TSCL 4NQSB 1FNHA 3GMQA 5I73C 1FZOB 2EXYD 3BJLA 4F7CB 1BQUA 3D2UA 3BPCA 3VCLB 4M1GL 4L4TD 3E6FB 1JMXA 3ARGA 4NQDD 5CP7A 4ELME 1XGYH 1T04B 3EHBD 3AS0A 4FQXC 5DYOB 4MXQD 5I8OL 3DWTA 1RZKC 1FL5A 4TTDC 1WCBA 3EJZD 1UM4L 2Z92A 3QIWA 4I18B 5ADPL 4LSUH 4KUZH 1X5JA 4AT6B 5DD1L 4PJCE 3C08H 8CGTA 2Z8RA 2XWTB 5CGTA 5GRWA 2HRPH 4QRUA 2WINA 4X8JB 3PJSB 2VR4A 3V52H 2KL6A 3W2DH 1E4KC 7FABL 3U6RA 2RBLA 3UTSB 3DVFA 1RJZB 2XTJE 4NWUL 1A8JH 3LAFA 1T22B 4FXKA 2CPCA 2F8XC 3IU3A 4HIJA 2IEPA 3T2NH 4JRYE 2MWCA 3TT3L 3VFSB 3MJ7B 5LWYH 5ALCL 2VISA 2EDYA 1QLRA 1DUYA 1MFCL 1XGTA 3EUUA 3NA9L 4IOSD 4WWKB 4ZTOL 2AV7A 4JRXE 2YA0A 4XC1H 3CH1B 1DR9A 3R8BB 1ZGLB 1U95B 3CZFA 1LMKA 3DUSB 3RY5A 2P49B 2NNAA 1HI6B 4R7DB 4BQBA 2CJUL 3BH8A 4KK6C 4P2OA 1XGUA 1MCPL 4IS6B 1J8HA 4WO4C 1D5BB 2DIBA 2CKBL 4XMLL 5DJXB 4U7MA 4GW4B 2B4CC 1E27A 3OKNB 2XXCB 5DMKA 1H3VA 1YPZB 3DMMD 1NEZB 6FABH 3U2SA 4L8BA 2BOCB 2WQ8A 4HUWA 2E9BA 1V8HA 2YPLD 4YHMH 4LARH 5DK2A 5KVEL 4S2SA 5ISZA 3MLXL 5FDWB 3WJLA 5ETUB 1W72B 1GL4B 5I1AA 3QUMB 1U8JB 1MIML 4LSDA 2OXGA 4PJEF 3VWJB 1F8TH 2YRPA 4K7PX 5F9JB 3A6BL 3L3HA 2P5EB 4JZJA 3TGXA 1UB6A 3O2DA 1D5XA 2EZ0C 1UH4A 1MY7A 3HNVH 1JV5A 3EO0A 4DJMA 3G5YA 3MOAL 1LD9A 4NOBA 4WTZG 4OLXL 4ZD3L 1LO2L 4U6VL 2IF7A 1CGUA 4HKBB 5D2LF 2BDNH 2RIKA 1FGNL 2F5AH 2Y9RT 1S7SB 4MA3A 1X9QA 1ZT7B 3VXOA 4R96A 3OKDB 3OXRB 5E1AA 4PJ9D 3ZE0E 5GGUB 2FCBA 2IFFL 4NO0B 5I8KH 3H9HB 4JY6A 5IV2A 5KTEH 2OYPA 4HKXA 3MRMB 5DUPL 4LPYA 4AENB 4R97C 1RZ8B 2DQGH 3HAEB 3MRBB 2WLYA 2E8YA 1ZWIA 2OZ4A 1NL0L 4D8PA 3NFPB 3MLWL 2EH8L 4OCSL 3ZYJA 1AD9A 5JW4Q 4NKOB 1FE8L 2A38A 5HVHB 3KPMB 1A6TA 4QOKA 5HYJA 2UUDH 4GRLB 2AXFA 5JNYB 3CDGA 3PV7A 3IKKA 5B39B 2A1WL 3I75A 4P2CG 1JHKH 1RURL 1ITBB 2QL1A 4K55A 4Y19E 1FSKB 3VXUA 2Y06H 3LOWA 4NZJA 4W6XB 2AQ2A 1FV1B 4UINL 4R8WL 4AL8H 1S7QA 4HIHA 4XBPB 1YDPA 2DI8A 3IU4L 3M17A 4EN3B 4WVRA 3QO0A 4F2MB 1HKLL 3ULVL 4I77L 2ZG3A 1GZQA 4WUUA 2I9LB 4BH8B 3HS0B 4M9PA 3ARFD 4QTIL 5F7LB 3EO1B 1FFOB 1UWXK 2R29H 3G04A 2Y5TA 4NFDA 3V5HB 4YHOL 3EJYC 4LSQL 1WC7B 1KIRA 2XTLA 1R6VA 4PGCB 3UC0H 1LVEA 1C5CH 3QDJA 1JZ5A 3OJDA 4HGWB 3BUYB 1JRHH 3G9VA 5EU6B 2J8HA 3IDYC 1T03H 4N0RA 1BLNA 4K07A 4J3TA 4XHJD 2BSRB 2GQHA 3KYNA 4J12A 4XVJH 1T5WA 2W0PA 4PJFB 2GY5A 4KMQA 5C0CD 4NKDA 4MX7A 3QUXB 4NO0D 4XCEA 2AJYH 5LJYH 3TF7C 5HTSA 1KEGH 4PJ9A 5EORH 3SE4C 3BDYH 1P2CB 3S36H 4DWHA 5DVOA 1JTOA 4GFTB 5DUML 4ZOBA 5BOZG 2A9MH 2B4CL 1PAMA 4PRPB 4GXVH 4PRIA 5IBLC 4FQ1H 1RY7B 4U1MB 4UV7L 4LEOA 3RZCC 3BKMH 3WN5C 3OKLB 4QRRE 1JNLL 4YGVB 5DO2D 1HHJB 2J8UE 4MNHA 1LNUB 1QFPA 1N5YL 5FFLA 5I75B 3MJ9A 1AXSB 4X6EB 3BIAX 3VFRB 5GS1B 1MFBL 2YHGA 3QBTB 4LIQL 4CKVX 1FE8H 3CX2A 5C0CB 1X4YA 3U36A 3MO1B 3ULUL 5BJTA 3GSNH 1KCUL 5ANMB 2ADIB 4ZTPL 1UA6H 4PBWD 2X2YA 4P0DA 3TWCH 4WW2B 3VE0A 3D9AL 1C08B 1FYTB 2JJTA 2OSLA 4NQDE 4KRLB 2IQAB 1Z9LA 3GMPB 2YC1A 2CUIA 1RUKH 3UCRA 1AHWB 3VFGL 1LEKB 2LVEA 3WLWD 3ARYA 3OXSA 4YK4B 1OLZA 3HI6H 5FKAB 2OM5A 4F9LA 3DRTB 2PUQT 1FNGA 4XH2A 1EEZA 3QIBC 4PGBB 1HWHB 4P5MB 5B39G 1CT8A 4MNQE 3BZFA 5EOTB 5K9KB 5KVMC 1XCTB 4UBDC 4KMTH 5JIPA 4PIRF 3IYLW 2BMKA 3FMGH 4LLVA 5EU6D 2BNQB 4NHCH 1PYWA 4NRYB 3LPGA 4FA8A 1U3HB 5EOQH 2CUHA 3UJIH 1MWAA 3RKDD 1C5BH 2P8PA 4N1EA 1RUMH 5D6DC 3VXSA 2FZ3A 3NN8A 3O3BA 3BGMA 3U9PH 4HAGA 4H88H 1CS6A 4NWTL 1Y6MR 2D9CA 3MLSL 4RFNC 5JA9A 4KJWC 1NFDE 2XN9E 2P5ED 3VXRD 4DFIA 1U6AL 1QO3A 1A6ZB 4E9LA 2J6EH 3WFDH 3HG1E 1RIHL 4OLYL 4MAYA 1JE6A 4XZUB 3D69B 3MRCA 4P2QA 3LSOB 3QZWA 2RFXB 4O51A 2EDDA 3CXHJ 4OIIL 5I8EB 4V1DA 2IH3A 4YXHL 2EYTA 4IOFC 1F00I 4IHOB 4XNZB 3KPOB 4RMTA 1ZHBA 1MCOH 3CMOL 1AO7E 2HH0L 3U7AA 1DN0A 2GJ6E 4X6DA 1Q9OA 3ISWA 4OBSA 5ENWA 1T66C 3T4YB 2L7JA 2WNGA 1WJ3A 3SDXB 4JG0L 5KSAB 4M7LL 5SWQB 5DJAB 3T4AB 3ZLQC 2Q8BH 1E4XI 1G7JA 4HFWA 3GEWB 4I0PD 3T65B 4NHUB 5D9SA 2XA3A 4KMLB 5FGRA 2QSCL 3HCVA 3RL2A 4C4KT 5FO9B 3KJ4C 4PJGB 2H32H 4Z8FH 3C6LC 3SKMB 3DUHA 2J4WH 4Y8AA 3EHBC 2BVQB 5HVFB 3LY6A 2A6IA 4YDJB 3MRQB 3PWVA 4HC1A 3W9EA 1OT2A 3IRZA 3QUYB 4IEFB 5I71B 3OB0H 2P44B 4TSBL 5EO0B 1RZJL 3EYFB 3MRLA 4O58H 4YHPB 2APBA 4YE4L 5KVDH 3WYRA 5DSCA 4PRHA 4PG2A 4OTXH 5HHVL 5A1AA 3NH7H 2NW3A 5KSAD 1AGCB 4D0DA 2C4FU 3TZVD 4YDLB 2OI9C 3OTTA 3KPSB 4F37K 2X4TA 1LWRA 2DYPD 2Y4SA 5IJKA 2MQCA 3WFDL 1F4XL 4Z7NE 5FYJU 4RDQF 1EO8L 5H94B 1L6XA 1ZHNB 1TJGH 3VD5A 4WY7L 2YD5A 4U7SA 3S7GA 1F4WH 1JGUH 1UXSA 1PFCA 1TQBC 2GUOA 2I60H 4K3JH 3V0AC 2VH5L 3W5MA 4NC0B 1CD0A 2ADGA 5J06A 4LLMB 3BKYH 3WNNA 4I3SL 1M7IA 4JJHA 2B5IC 3GMLA 4XNXL 4HKJB 5ELIA 4R0LA 5CSGA 4KRNA 4Y4FA 1FP5A 3BDXA 2MHAB 3OPZH 1P9MA 4PJDA 1HK6A 4NM4L 2GTZB 4ZQKA 5I1IL 1E4XH 1EEYB 3RTQA 1A6PA 3IDUA 1FBIH 4KVCH 3SCMB 3HPLB 4PJFF 1UT9A 3KLAB 4HK0A 5D2LB 1X5FA 3FONA 3TNMA 5F3BA 1QSFB 5FA4A 1CLYH 4I0PA 1A47A 1FFPA 5T3ZE 3NFNB 5EU3B 2ZCHL 1GC1H 2P46B 5B8CC 1BPVA 3NABL 1QRND 3NIDE 3LV3B 2Y36H 3P4NA 5CUSL 3GI9L 2AJXL 2VAAB 3S9DB 3VXMD 5E2TL 2ITDA 1IAOB 1CICD 3P9MB 1SVCP 1PQZB 1Q9LA 2FX7H 1EMTH 4OF5A 5C07D 3T3ME 4F37F 1C12B 3RY6A 4LCWD 2SEBB 5LGJB 2J5LB 4JVUA 3KGRA 3O81A 4WJ5B 4FZ8H 5F9WC 2DTMH 5KVFL 1YC8A 2YBRB 5F7DA 3SJVE 1MHHA 3THMH 2CLZB 2R1WB 4U3XA 4L1HA 3OGCA 3O6KH 2AEPH 5C09A 4EDWH 1BQHB 2EDEA 4DVRH 5IB3A 2UZXB 2NY0D 1N7ML 5GGVY 3BH9A 3QFJB 3O3EA 4NQEA 1HIML 3TZVA 5DJZA 4YHNA 1EJ6A 5EO1B 3BT2L 1T3FB 4XNMA 2PTUA 1GXEA 3GB7A 1T7WA 5JXEC 3OAUH 3UAJD 1S7TB 3QH3A 3VA2C 3GJFA 3VXUE 1GGCL 4L8DA 4NPYA 4XP1L 1ZA3A 3CDCA 4JM2F 1XAUA 3V6OA 4BSJA 3F8UB 4U1SA 4K8RH 1YEFL 2W9EL 1FRGL 4NQVA 3RWEA 3WL9B 1ZT1B 1KELH 3EYOB 4HUXA 4IM8A 2YS4A 5DRZA 3UTTD 5HHPA 1AGEA 3LKPB 3QIUA 4MJID 4XP6L 2VUYA 1I8MB 2NMSA 3I6KB 2BSTA 2ORBH 5IHUL 2GITB 3I50L 5TDNB 4OCYL 3U0WH 2XACC 1KJMB 3FOMB 3GHEH 3DYPA 1CK0H 5CBAB 4LVNB 3VGHA 2DLFL 1XR8A 3KJ6L 4ORZC 2VMFA 3EJZC 1A0QL 3WEXA 4EUPG 5D7JD 3H0TA 1OM3L 3GSNL 3F5WB 4YBQC 2LV4A 3AREB 2HMID 4QTIH 1T6VN 3PWUB 4W70A 2VSCA 3RU8H 4KK9D 4KRPD 3UTZA 1F4YH 2DDQL 5HGAB 2CDEA 4PJ5A 5CEXA 2FJFA 3ESUF 3HMWL 4TVPL 2C5DC 4PRIE 2PTTA 3CC5B 1FNAA 4OD1L 4L4VD 3GSOA 4E5XB 1TZHB 4N0CC 3O4LE 1INEL 4XCYA 2YK1H 1IL1B 3UBXI 2H41A 3L5XH 4O2EA 5INCB 1D6VH 1C1EL 4R9HA 1G9ML 3HTLX 3QI9D 2Q76B 5E24E 3BW9A 3DETC 5E2VL 4OZFA 1QNZL 1BFTA 4G7VH 3CLFL 3CFDB 4HT1H 4Y16C 3PHQB 1DBKL 1OTUC 4R4FL 1ZE3C 1OAKL 3SDYH 2BX5A 1AO7D 2B4CH 3PQYD 4L9LB 5IFJA 4HWBA 4QTHB 4PTTB 4F15B 3MOAH 3U1SL 3NZHL 4OLXH 3UX9B 4EOWH 3KPRE 3MNVA 1MIEH 1UYWL 2MKWA 3I6GB 3LS4L 4FABH 4N8VB 4K23L 5I30H 5ICZB 1NSNH 2FB4L 2ZSWB 4O2CB 5I1KH 1NMBL 4WWKC 2HFFA 1BBDH 4GW5B 1KTKE 1DBBL 4K3HA 4X80L 5I1EH 2YUXA 1OCWL 4ZFOB 3W2DL 5CHNA 2HTLC 4M1CC 4RA0C 4AK1A 3REVB 1I7ZA 5KZCD 1XGQB 2F5BL 3HI1A 4OFVA 1MJUL 3O41A 1Y0LA 4KK8C 1CVRA 3BPNC 2R69H 3QQ9C 1QFUH 4J3OC 2MJWA 4WO4B 2Y06L 1WBXA 2DL9A 5C0BA 1TQCB 1QBAA 1AIFA 5MENB 5IF0A 4JFXA 3GO1L 5HGHB 4HLZG 3OX8A 3H3BC 1BZ9A 4HIIB 1KNOA 4I3RH 5K33A 4BQ6A 5I9QB 5KG9B 4MAUH 4P3CL 4S1RL 2HVJB 1YJDL 2R23A 2IBBA 3G6JF 3IFNL 3W39B 1HH6B 4HPYL 1A1OB 5GGQH 4M6OH 1TIUA 3EDDA 3VWJC 1MLBA 4OFDA 2EDXA 4GMSH 3C5ZB 2ICEB 1HWGB 4DKEH 3PL6A 3D18B 2D3VA 1KIQA 2GJ6A 4X6DE 4ZXBA 1CICC 1CZ8L 4HWBH 4MQ7A 3TC9A 4N0UE 4NM8L 4U1HB 5BV7B 1NAMH 4EIGB 1VEPA 3F58H 5DJDA 4LBEB 4PY7A 4M93C 4TQEH 3L3KA 1F90L 2AJUL 3HE7C 2BC4A 4OKVB 5JR1L 1KN2H 4M6NL 1FZKA 1CE6A 1EX0A 2E7LC 3NVQA 1RK1A 5E2WH 1HQRB 3O9WA 4FQCL 5F7FA 5FYJH 5EBLB 1ZTXL 1HYSC 4LNRA 1CIUA 1ETZB 2XTJD 4L8SC 3IETB 1MWAL 4XNUL 4PJ7B 3GRWH 3UTQA 3LQZA 1F4XH 4AIOA 5H35A 5I1HH 4XHJC 5J1AB 3L5JA 4P2RA 2DQDH 3WIFA 3X13A 4WRLA 3U7YH 4QHUB 2ORBL 1AY1L 1MCDA 2R1YA 3F7YB 4PR5A 1EXUA 2GSIB 1KCVL 3QB7C 2CIKA 3QNYA 4EQ2A 1ERNA 1U8PA 1NCWL 1RUKL 1JPST 3UTTB 1DEEB 3MYZA 1WAAF 2ESVB 1XF3B 1L7IH 4JY5H 1CD8A 4DOHB 1MHEB 2AV1A 4X99B 3IDMB 1G7MA 3D85A 2EEDA 3G6JB 1CDHA 5DA4A 4X4YA 2HKHH 4LLQA 4UIMA 1NC4D 1P6AB 3MRNB 4QXUL 5E1HB 4K71B 3EAKA 3VFWB 3TJHD 1YEIH 2FH6A 4XPAL 1PBYA 3SKUD 3MC0A 2EDBA 2YEZB 4PJIA 1A4KA 4KXZH 3KVQA 1MREH 3RWJB 1T89A 3MLUH 4PRBB 3BP4A 3UYRL 1JHLL 2D9QB 4HWEL 5JDSB 3IDYB 2H32A 3LEVL 1GYAA 2DI7A 1A9BB 4PJDE 5F89A 4CADA 2QADC 3CAFA 4UQ2A 2I9TA 1H8NA 4OM0H 1VACB 3MV8D 3EDKA 4JANA 5CEYA 3V4VH 4K2UH 2IANE 4OCWH 1KV3A 4Z7WB 1MCSA 3LQAL 3M1BA 3VI4E 1F3JB 5E5MA 1OAZL 1O7SA 3RWHA 4PJBF 3HR5A 3QP3A 4WU5B 3RZCB 3WN5B 1F58L 4S1QL 1EZVY 2I26N 4NN5C 5I75C 1WT5A 2A0LC 4UV4L 2IH1A 4H25A 3MV9E 5DT1H 1QTYT 3WS6A 1A7OL 2XQYK 4HX1A 1IMHC 3QUZA 4OSUL 1ROWA 3LRSA 4ELKB 4UDTA 5E56A 5HXMA 1JGDA 3UPRA 3B6SB 2XFXB 4XT1C 4GBXC 5I8CB 1Q0XH 1GOGA 4J23A 3RIAF 3F12B 3VXUD 3SJVA 4KV5E 5C3LD 5DJYA 1NGZA 4LSRH 5E6ZA 2X9YA 3OL2A 4K8RL 1OW0C 5KSBF 1MJJB 5EUOA 3S37L 1I3VA 5C09E 5C6WH 4CMMA 2D03L 2YXFA 4QO1A 2Y7QB 3BZEA 3U0TB 1KELL 4Z77A 5FUZL 2EXWD 1I7TB 4JZOB 4MA1C 1I4FB 2BVOA 4F7PA 5CP3A 5F7YC 1DQLL 2X7LB 3IJHA 2NX5A 3E8UL 1MCPH 3RGVD 1T21A 3QWRD 5D5MF 1CFSB 5KVFH 1UB5A 3KYMB 1BECA 2B0SH 3KLHC 4KVNH 4Y2DB 3LVEA 2HFEB 1U3HC 2XG5A 5AG9A 2HA1A 4IOFD 5IW3A 3DO7B 4KJYA 1QBLL 4NSKB 3GMOB 1VHPA 5DS8B 2Q3AA 3FCTB 4X9GA 4OGYH 2PR4H 4RWYH 4OCXL 1HDMB 1MJ8H 3JV4B 4LKXA 3T08A 3U46A 3P0YL 3GJEA 2CO6B 4M7KL 5EIVA 2EDHA 4G42A 1KXTB 1AGDB 5D5MA 2HFGL 5FF6B 3P4MA 4OT1L 5HHQA 2VUOA 3HZMB 3TV3L 5IW1B 3TIDB 4LCCA 1ND0A 1I7RA 4QXGL 3RVTC 1MCQA 2RCSL 3H3PH 3OMZA 4XRCB 1ZHLA 2XN9A 4JRXD 5DZLA 1CF8H 5E6IA 2F74B 3IJYA 3O2VL 4XVTH 4YPGA 2F5AL 3KPNA 2E9IA 1XCQA 3QDJD 5DEGA 5J3HD 5ID1B 1E4KA 2A77H 1FL6A 2GTWB 1M6OB 1OLLA 1QACA 1U3JA 2DKUA 1NBQA 2XZZA 4YPJA 2YKLL 5KSAC 2IFGA 2V2TB 2R4SL 2I60L 4K3JL 1AE6H 4XHQA 2N56A 4ERSL 2IQ9H 4LU5H 1K2DA 1DCLA 1Q0XL 4JVPA 4F80A 4N0FB 2DTSA 1K4CA 4NKIL 4K23H 4I0KA 1NSNL 4EUPB 1K8IA 1XR9A 4JPIA 3RP1A 5JPMA 3VRLF 2UY6A 3B9AA 5KANG 5E8OA 3ZKMC 3C6LB 2V7NA 3S34H 2CXGA 3P0GB 4Z7VE 3MRIB 3K2MC 1N6VA 4OV5A 4J8RB 4QOKE 3BP6A 5HYJE 5HPOA 5IGXH 4C58B 3QUYC 1IM9B 1CD1B 1J1OL 2HKFL 2DD8L 4HWUA 5EC1A 5I71C 1GJIA 1G7QA 1QFUL 1BAFL 1VGKA 1TVDA 4JRYD 5D1QD 1P7KA 1XGRB 4OZIB 1HXYB 5IHZB 1D6EB 3IDJB 3MGTB 3GIZH 4P23A 2Y72A 3ES6A 3TA3A 2EYRB 2X4UA 4Z78B 3WUWG 4ZAKA 1P5VA 4P57B 3MV7B 1YEGL 1P6FA 1YPZF 3ROOA 3U4EB 1DQJA 4TOYL 3VMNA 4LQFH 1VERA 4W6WB 5D7LA 3UO1L 3JV0A 5JXAL 3ILPB 2X40A 35C8L 1QFWL 4XNQA 4L3CB 5IM7B 2EEAA 5HYSA 1EH9A 1NBVH 2YZ1A 4CDHA 1N64H 5C0ND 1TQBB 1EFXD 3QG6A 4LAQH 5E94A 3RL1B 1QLFB 4DW2H 4E41D 1T0MB 2B5IB 3IXAA 2Z0BA 4S1SH 3FQRB 1GRWA 4JPVL 2XT1B 1U8HB 4PREB 2D31B 2WBWB 1SBSH 1DZBA 1IAMA 4RIRB 5HGGS 5IWLC 3S36X 3BZ4A 5LVEA 4P4RB 1MI5D 5F9OL 3ULUE 4PGDB 3MRDA 3QEQD 5T1KA 1AP2B 5CAYB 3I85A 3MRJB 3B5HA 4JO2L 3MCKA 1EGJA 3R4DA 2ZUWA 2J8UA 3B83A 4NUJA 3DX9A 1X7QB 3FAWA 3VRIA 5I66B 4NO2A 4N0UA 4IIQA 4PGEB 4OCRL 4X9HA 5D2NA 1QSFE 1X5XA 2NW2A 5FOBA 1P53A 3EIFA 4U6XB 4APQD 3VXNA 4HIEA 4AMKH 1DBJH 5GISL 3CXHK 4JFEE 4ODSL 4Y5VA 3LKRA 4D9QD 5F9WB 2QQNH 4LFHG 4OZIF 4LCWA 5FYJE 2H26A 3P77B 4X5WB 1XF4B 2NR6D 5T3XH 1N6QL 1JWMB 5ACZA 1OP5H 3QJHA 4HBCH 4ORGB 1IQWH 5DRWA 5IVOA 1VENA 2NY2B 2HVKB 4IMKA 1MCHA 2GI7A 1U58B 1BVLB 4Q9BA 2W60A 5ACMA 2UVFA 3SGEI 3DVIA 3P0YH 2BNUB 3QXVA 5DHYA 5H8DA 1F90H 5CILH 4G5ZL 4Y19D 1P4IH 2P45B 4KXZI 4E42B 4OD1H 4NBYB 5IB1B 3E2HC 1DBML 1FIGL 2EE9A 5DMIL 2G75A 1NBVL 5CLTA 5HJ3A 2V9RA 5ADPH 3ABZA 4MJIE 3RVXC 4U31A 4D2NA 1VFOA 1LO5B 3BZDA 1YQ2A 1B0RB 4D9RE 4G8EB 5HD8D 1JWUA 1S8DB 1YY9D 2DJUA 3DTXA 2H6PB 4S1DC 2PO6C 2ZG1A 4ZS7L 2P8MA 4M7ZC 3BSZL 1YQVL 2WW8A 5HYQA 3QEQB 5KSVA 4RCAA 3FB6B 5CJBA 4U1JA 2Q8AL 5L2JA 2Q7YA 1ORSA 1OTUD 4J3VA 3FT3A 4MXVE 1MFAL 1R3JA 1E4JA 5IBTL 3ZTNH 1NCWH 4LVNC 1FZMA 2A73B 4NGHL 1CQYA 3A6CL 3FB5B 4WU7B 4ZPVB 3GKZA 2B20A 2EDQA 1ED3B 1AO7A 4F7EB 1Y6KR 4LOUD 1JZ2A 2R0KH 4P4KD 5ADOL 1BVKA 2Q8BL 3AREC 3L3IB 4NQXA 4P3WA 5DK0B 1IGTA 5DUPH 4AMKL 4NKQB 5DD3H 5ERWB 1SEBA 1RIVL 3CFKA 2AQ3A 3QXDB 1EBAA 4Z0XA 4GLRI 3P4OA 4GUPB 1NCAH 5BRZE 5J9PB 2FSEA 1DSFL 2QHRL 4NNYA 3QO1B 3V7MA 4DKEL 5HGDB 5JW4R 1NANH 2IAMC 2N7BA 4CGTA 5J0BA 5KSUB 3QQ9D 3QEGH 4ZUUB 1M7DA 2KKQA 3FQNB 1XF2B 3TN0A 4FFVC 5D93B 5SX5H 3FQXB 3MV9A 1Z6JT 5F7EH 1UH3A 3EBAA 5GXBB 5I19L 4JM2B 2QR0A 2VDQH 5AZ2L 2DWEA 1ZGLM 2AXGA 4Y16B 4L29A 3QI9A 1VEMA 2NY1C 1CG9A 2Y25A 5DJ6B 5E8PA 3VFMA 4L9LC 2GK2A 4F15C 1CN4A 1BJMA 3B2UD 4GQ9H 4PYGA 1IKFL 4PRHE 5K9JL 3MLPA 4BZ2L 4D3CH 3C08L 2FD6H 3RWGA 5EO9B 5DWUL 5JO5B 3IFLH 4JM2D 4ZFZA 1HHHA 2BY1A 2P8LA 5K59F 5EZJA 3L7FB 4PLOB 1HZHL 1S78C 4LCIL 3TCXA 1BP3B 5IIEA 1R0AH 3LQMA 3OKKB 5J7CC 1G1YA 2X4OB 3BPNB 4M03A 4PJXB 1MCOL 3CMOH 3DUUA 3FO9B 1TQCC 3NFSL 2BVTA 4P9HC 5DJ8B 4BQCA 5EFIB 1OF2A 4XXCC 3GBML 2R2BB 5DUMH 43C9A 2YWZA 1CVSC 1J0IA 1HHIB 3BKCL 1U3HD 4NYLA 5T5FH 5TH2A 5I9QC 1HHGA 5FV2A 4J4PA 2R0LL 3W9DA 3M45A 3MOBH 1T7VA 4BFGA 1SYVA 5B3JE 1CFVH 4L4TA 2YD3A 3CX5K 3ROLA 3O8XD 2CKBH 3KPTA 4KTEL 4XMLH 1OTSC 2E3VA 4ZS6C 3KAAA 5E70A 4A6YL 4AJ0A 3C5ZC 1FNSH 3F7PC 1M7XA 2EDRA 3P9LA 2GJ6D 3STZA 4I77H 1MLCB 2VXVH 4P23D 2VLJE 1PX3A 1PX4A 3KLSA 4YHML 4NFBA 3DETD 1CICB 4HXAL 2FL5B 3T0DA 5BV7C 5D1XC 2AP2A 4RGND 1LEIB 1K4DA 2EIZB 2K3TA 5FGBC 5DQ9A 2QQKH 4O2FA 4M93B 2HFGH 3OB0K 4P59H 1P4LA 3PWNB 4GMTH 1A6AB 1X5AA 3DRQB 4YE4H 3HE7B 5GRVK 4QXTB 1HSAA 1QQDB 3I3BA 5J6HB 2IMMA 3NCJH 1T03L 4MSWB 4DZBA 1CL7H 3GSXB 5C0EA 5IVXA 2AI0L 1RFDH 5GSRB 3WHE1 1OGAE 1WF5A 3FO2B 3HE6C 3HUJE 1RJLA 4KC3B 4M5YH 5F3HA 2PYFA 2QQLL 4L8SB 5IB5A 4DEPC 1SJHA 4LPCA 4FQHB 4NC1C 3TCLA 4FQ2L 5JHDB 1HSBA 1NGXB 4OCNC 1KN4L 4AEFA 3VGAB 3PXJA 2Z8WC 3C8KA 4RAUA 2VLKE 1RZGA 1IQDA 2H2SC 4YH6A 2MPAH 3HMXA 1D5IL 4MYWB 4DQOH 1ES0A 1WZLA 5JTWA 4D9QE 2EC9T 1AQKH 2HT2C 4BH7A 5KTEL 4G8GD 4N9GA 4XP6H 4LQ1A 5B8CA 5IGXL 1MHCA 2RR3A 4K71C 3IFOA 3UZQA 1D5ZB 3OB8A 1XEDA 1AQDB 4QHLB 2JK5B 4NRXB 1UEYA 4OCSH 2DLFH 2YSSA 3OKOB 4H5SB 2N7AA 1T4KB 3ZYZA 4QNPF 1OSZA 4CVXB 3JV5A 2GSGB 2HJLA 1KFAL 4GQPH 2O61B 4G6KH 1YMHB 4ZO6A 5LAXA 1ZS8A 1HEZA 1IKNC 2V9QA 1JTPA 2VN7A 2QADB 5DJCB 1ZLVH 4YHOH 1KPRB 4OKDA 4WENB 1ODAA 4KU1A 2IALA 3QDGB 4XPGL 2EXWC 1NKOA 3D0LA 1S7VB 3TFKC 1YEKH 2KH2B 4IRSA 1UM6L 2YK1L 3C60B 4RAVB 3PE9A 3U4BL 3O9WD 2FEEL 4PJ5E 5DD0H 5CJXA 3ORJA 1HYSD 5TGBB 5F21B 3ARZA 4YHYC 4QRTA 1UJ3A 4APQA 1CDGA 3RWDA 1A4JA 3AB0B 4OAWB 1F6AA 1L9MA 5D7IA 3O4LA 3PXHA 4FMKA 4KKNA 3KLHD 1KTDA 3MREB 2HT4D 2A6JB 4NN5B 3MLZL 1NUNB 4ISVB 3MROA 4D9LH 3MCLH 2VDPH 3NZ8B 5I0DA 1NMAH 5KVDL 1RHHA 3GUTB 3X12B 1IGFH 2AJVL 4JFEA 5EZOL 5ICYA 2VIRA 3LKNB 4ZFFA 3DROA 4NQCD 4H1LA 4GBXB 1G9NC 4CW1A 1FORL 1WEJL 1MFCH 3NA9H 5GGTA 4HPOL 4PBXA 2D0GA 3CCHA 4XC3H 2VQ1A 1CLCA 3QR2A 1UACL 3C09C 1BVZA 3RAJL 3WS3B 2IFFH 4QHMA 4TSAL 5I8KL 4ACPA 1NC4A 1IRAY 4UNUA 4MA1B 1C5DB 1X5KA 5FUOL 5C08E 3ULSB 4LSSL 1HXMA 3MUGB 3KWWB 4I48B 3IS1X 1UKTA 3QFJD 2QQNL 4JAMA 4PG9A 1N59A 1QPPA 2FHFA 1P1ZA 5F96H 1MCBA 4ODTL 1QSED 4AIZA 4PUBL 2IGFL 4HJGA 4WUKL 4Y2DC 1UQSB 5GGVL 5JW3L 1KTRL 4JY4A 3RWFA 5GRZA 2VWEE 4YDKH 2VXVL 3JXAA 4X4ME 2VDOL 3QUZD 2VB5A 1UZ6E 2CRZA 3BPCB 3VCLA 1RU9L 3CXDH 1DQQB 3CFBA 1I8KB 3PV6B 2Q6WB 2B8OT 5CP7B 5C2BH 3CUPB 5DYOA 3AU1B 1IAIH 3MFFA 5I1LA 5CWSB 2VL5B 3CFJB 4N68A 1FL5B 2BSSA 4Q2ZB 4WNQB 2APWA 2R2CA 3VG9C 5IP4A 1WZ1H 2ADJB 4DUWA 1NJ9A 4TUOB 4X9IA 2YD1A 4G6JH 4DN4H 4PTUB 2B2XH 2DI9A 3BGAA 4H88L 4QRUB 3TM6A 1TZIB 1HOCA 4OZFG 4U0RB 5ABDE 4LCYA 3Q6FA 3WLBB 3WIHH 5JW5B 1S7RA 5DURB 1WWCA 5FYKL 3V0WH 2WAHA 5KJRL 4FXKB 1HHKA 1XIWB 5FO7B 5TQ0H 1EGJL 3QQ4B 3BGFB 5E03A 1N64L 2BCKA 2AEPL 1UGNA 3IVKB 1A5FH 4OM1H 4XB7A 4ODWB 1N7MH 4RWHA 4YUEL 1FCCA 1QPXA 1AR1D 1T0NA 4S11A 1H9VA 2APFA 3S88L 3T3PF 3BXNB 1ZA6B 2OMNA 2QKIA 5CEZD 3V52L 2NNAB 3ULVC 1TJIL 3QRGL 5ILTH 1NQBA 4R2GC 4I9WD 4NWUH 1KUMA 4Y4KC 1XGUB 5ID0A 3VFUB 3WXVH 2DLHA 2JTDA 4XPBH 5DJXA 2XN9D 4RMWA 1E27B 2BNQD 4HMCA 1R24A 3SKOB 1FO0H 3CH8A 4YDVB 15C8L 2D7TH 4L8CB 1RZJC 4Z7VA 1X5ZA 3GI9H 5FO8A 2YA2A 3TO4A 4HZLB 3E3QE 3GSRA 4EZMA 5ISZB 4G8GB 4MWFB 2E5EA 3IKCB 4YDKL 5ETUA 4ONFL 5KW9H 5GS2H 1IEAB 2VDMH 5I1AB 1IM9D 3IDGA 3OSKA 5D6CB 4UUJB 4G6KL 1IT9L 1NCCH 4I3GA 3DSFL 1QRNB 5CMAB 1J05A 4MCZB 5F9JA 1IAIM 5IHBA 3FZUC 3BESR 4RA3A 1MELA 4EIZC 3TPUA 1T7XA 4G9FA 2ZOKA 5GS2D 3EO0B 1WIUA 3SKNA 3FFDB 3CK0H 5AWNL 2XYCA 1J9CT 4XCFH 4Y88A 1MCJA 5IMLA 3LD8B 4G6JL 1ZT7A 4M00A 5GIRB 1IM3A 2NY6D 5T1DL 1S78D 5D7LE 3OKDA 5I1JL 5GGRY 5GGUA 1IE5A 5H2BB 1NCDH 4CUCA 4ZUSA 3N06B 3PWLA 4HS3B 3MV8B 3BD4A 3WFCL 4ZXBD 4HUVB 2CKNA 2IPUG 2Q86B 3ZDZE 3OR6B 2XWJA 2VABA 5I8OH 4Y4HA 4JLRA 2V5SA 4LGRB 3O2DL 4FXLA 4Z7QF 3RWIA 3FAXA 4KDWA 1QVOB 3MRKA 1A6TB 4QOKB 5HYJB 4E0RB 5DD5H 1JFQL 5CSBA 2VLJA 2QQLH 4HPOH 5T1MA 4MQXD 5B39A 3MJ6A 3IGAB 4KJPC 3GKWH 4Z7OE 4YGAB 4V1DD 4P46A 3EZJB 3BSZH 1VB9A 5J8OA 3VFNA 2I07A 5EOCH 2X4SB 4WUUD 2HJKB 4NKMB 3SCMD 3DX6B 4OCYH 3MGOA 3CFEA 1OP3K 3SY0A 3VGDA 2HH0H 3MA7B 1KCVH 3QCUL 4OZHB 5GHWL 2VRAA 4X6FA 5D2NE 4QOKD 5HYJD 4U1KB 1EUTA 3EO1A 3HLAB 1QSZA 3G04B 3V5HA 4QGTA 1NC2B 1KIRB 3ME0A 4WI6A 1YNKH 3LN5A 2F54B 1DDHA 2NY2C 2HAZA 3GMMA 4FG6C 5FYLL 3RU8L 4TRPH 4S1DD 3UTPD 2NY4D 2NX5E 2ZSVB 4K7FA 5DEFB 4YHLH 1GIGL 3E2HB 3CFCH 3U9UB 2YD9A 5JORB 3PDGA 1VADA 3LHPL 3PQYA 2W0LA 3DNKA 3TEUA 3D0VB 2YWYA 4MX7B 4WI4A 1FNFA 3C5SA 4OCMC 4XCEB 5IHLB 5J6GB 2J12B 3GMRB 2AK1H 5C9JB 3MACL 5SWSB 1C5CL 4G7VL 4HT1L 4V2CB 4Q6IA 2X09A 4XPGH 1DBKH 2BY3A 4JKPL 4UOW1 4GG6B 1RULH 2PO6B 1AD0B 3PDOA 4ZPTB 1LE9A 4MJIA 1MEXH 2NY5H 4YO0A 4M7ZB 3OKLA 4RGOL 1CXFA 2FJGB 1FLTX 5FB8A 3QYCA 2X42A 4AM0B 1R3HA 3HC3H 2Z93A 3KDMA 3QA3B 1J1PL 3QHTC 4L5FL 5T5NF 4OZ4A 3EGSB 1MJ7L 5HHXL 3C6SA 3FRUB 1H5BA 5HYFA 1A64A 2J1KA 4TULL 5ILTL 3V4PL 5J1TC 2R9HC 2A9ML 4M8QA 4WGWB 5I1DA 5C07A 1KB5L 5MEPB 4Z7WF 4XBGB 2OZ4L 4JO3L 1Z3GL 5HHNA 5C0IB 4NRZB 1B4JL 1NLDL 4UMGA 3RBGA 3FT4A 2CDFB 3H9SB 5C0CE 1AR1C 1QLEL 5FKAA 2FNBA 1H15A 2G60L 3DRTA 1II4E 3Q6GH 4MQSB 4GW1B 2K1MA 5CS7A 1JGVH 1G7LA 3WHXA 2ZKHL 2CDGB 2W1NA 3GSVA 5D7IE 4ZTPH 2IAMB 4JB9L 1JZ7A 4WHTA 3I2CL 3D9AH 3D3VD 3MLTA 5D93C 3V95A 3PDDA 5KN5A 1MRFL 1PYWB 2HLAA 4JDZA 1JPFB 4CL7A 1G9MC 4JM2C 4ZOCA 2P8PB 3ZHKA 3KYOB 2NY1B 2FZ3B 3I02A 3NN8B 4WUKH 5GGVH 1I1FB 4A2MA 5IEKB 3CK0L 1FPTL 3FTGA 3ZDXE 2PF6A 2BVUA 4WFHE 3GIVA 1KGCE 1OT1A 3G5VA 3JWOC 4TTDD 4BSVB 4HHAA 4RFEB 5C2BL 2UVEA 3IDIA 1KLFA 4MAYC 1YEDB 5FHBL 3RPIB 4XZUA 3FQUA 4X98B 5FUCE 3SE8L 4LP4A