2W9EH

Structure of icsm 18 (anti-prp therapeutic antibody) fab fragment complexed with human prp fragment 119-231
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
215
Chain Sequence
b'EVQLQQSGPELVKPGSSVKISCKASRNTFTDYNLDWVKQSHGKTLEWIGNVYPNNGVTGYNQKFRGKATLTVDKSSSTAYMELHSLTSEDSAVYYCALYYYDVSYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQSVTCNVAHPASSTAVDKKIAPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR PRION PROTEIN
publication title Crystal Structure of Human Prion Protein Bound to a Therapeutic Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2009-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9eH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w9eH02
3MRMB 1D5MA 1N5YH 3EZJB 5IJKA 3TO4C 4Y4HB 4KMQA 2G5BB 2GY7B 3EDEA 2H9GA 3CDCA 5KTEL 1JMZA 5J3HC 4M1DL 5HHME 3AS2A 1MCOH 3GSWA 3B9KA 5DMIH 1JNJA 3QEQE 3SPVA 3TNNA 5I15H 2PR4L 3MRHA 1CLYL 3B5GA 4KTEH 2XXMB 3S8WA 1YJDH 3OKKB 1CGUA 5C9KA 3BQUC 4HKXA 2NXZD 5FM5O 3S4SB 2F15A 4PJIE 4PGDA 3KYNA 4OAWA 3WIHL 2VDLL 4YDIL 2P5WB 1ITCA 4DFIA 5K59F 2ZUWA 5F6IB 5GZNC 2DKSA 1KUMA 3L1OH 4ZO9A 1PZ5B 2F19H 2Q86B 1R5VA 1KIUA 4L8CB 4K9EH 3EDFA 4Y1AB 4KROB 4QRQA 3SO5A 4AG4L 2H32A 3GHBH 1FLTX 3IDYC 1F3DJ 3BESR 4JE4B 4N0UE 2EYTA 4PJHF 4ZD3L 4ACPA 1DBBH 1GAFL 2VR4A 5IMMB 3JBG7 2W07A 4JO3L 3TT1H 2H8PB 2MTPA 1LHZA 2F5AH 4PTUB 2VXTH 1EXUA 1I8LC 4EEEA 3O8XD 1F8TH 3F6LA 1RU9L 4HCRL 5EIQA 3DETD 5IB2B 3QUXA 4WHDA 2Q1EA 2V7HA 4QHNB 3CLEL 2FLRT 4K3HA 4N0YL 3DSNA 1GGIH 4IIQB 2EIDA 5GS1A 2D7NA 1UXSA 3MMEB 3MV8E 2YA1A 4PJ9C 4YDVB 4ZFFB 5HPMB 3WD5L 3WKNA 3TN0A 1MIEL 3QWRD 4MXWH 1PW3A 1P1ZA 1I7ZB 1T7ZA 5E9DA 2G60H 5B8CA 1A02N 1UCBL 3M8OH 4RMRA 5EC1B 3BPOC 3IDGA 1R0AH 3ARBD 1ZTXL 4FQ1H 3GSRB 2Y36L 3RI5K 2Z8RA 3D39A 5DMKA 1AH1A 5TF1L 3HMXL 3MBXH 3AMKA 3DROA 2B1AH 2JTDA 4XVJL 2E8YA 8CGTA 3OGOE 3O4OB 5IVXE 3V7AE 1DSFL 2CRMA 3GBNH 1KFAH 1A5FL 4JPKH 1MRCL 1VACB 3UPCA 1KULA 5HYJE 4X6CB 1A7PH 5IFJB 1E27B 2VDRL 3CDFA 5C07E 3MRJB 3VFVB 3V5KB 1ZKAA 4RFOL 3LKRB 2R29L 4Z7OE 3H7BB 5KVDH 2B2XL 5I9QB 2BVQB 1MFDL 3L3KA 1RJLB 1XF1A 4MSWB 4Y4HC 2GJ6A 1UG9A 5T1DL 2J4WH 1EO5A 5MEPB 4MA8H 3RGHA 4R90L 4LFHG 3L3IB 1LDSA 3W0WA 2YPKA 5GS0L 1NUGA 4WHYG 5F9OL 1RZFL 2C3HA 1L0YA 3FOLB 3G5XA 4PJGF 5KG9A 1WISA 3BIAX 4OLVH 1JPFA 1CXIA 2NXZC 1SEQH 4JGJA 4ZOEA 4Z95H 5I66A 1WFNA 1G7LB 3DUUA 4NZDA 5ID1B 3FB5B 4OF8A 2NR6D 4UT9H 3OHXA 2FL5B 5JQHC 5KS9A 4FQXD 2WUBH 4XP1H 2V2XA 3RL1B 1W0YT 5CBEA 3V6OC 1WBXB 5F6IC 1TVHB 4EUPG 2HT2D 5GS3A 2AXGA 1ETZB 2VC2H 3HNVL 1IAIH 3AAZB 5DJ2A 1CE6A 3QIWD 4K3EL 2DL9A 5IEHA 1A8JH 4PJ8B 3F62A 3LAFA 1S9XA 2EC8A 4U7MA 5T5NF 2IJ0C 5INDA 1MREL 4I77L 5DFVD 5A2IH 3CFJB 4X6FA 3KS0J 2OSLB 4YXKL 1W0VA 2MOVA 4X7DC 2XNAA 3GZKA 1X5HA 3EYQD 1UEMA 5BZDB 4RQQB 4H8WH 1OB1B 3QEUB 2AEQH 5BVPH 3BWUC 1J8HE 3TBYB 3PIQB 1MRFL 3X11B 4X6DE 4O2CA 1DDHA 5CBAA 5C0ND 3DETC 1CFNB 4PJAA 5ADPH 1P9MA 5IHBA 4Y4KB 4NRZA 1L0QA 4XCFH 5DHVA 3DVFA 1KN4H 3MRBB 3RY4A 5DR5H 3BX7C 1MAMH 5C09A 4HUXA 4Z7WE 4HC1H 4L8DB 1S7RA 4V1DE 2P24A 3T4AA 4RGNE 2Q8AH 1GGUA 3ULUE 3ROOB 1W72H 4M93C 4PJCA 2ATPA 3U7WH 3D69B 3ARBC 4EBQH 2L7JA 5DYOB 5FIEA 2BERA 3SE8L 4QHLA 3KYOB 3KYAA 4PRPB 2G9HB 3MRKA 2ZPKH 2JJTA 1JHTA 2I60H 1RZ7L 3HZVB 1OPGH 1ZWIA 2VZ1A 3N1GC 4H1LA 3QFDB 5E2TH 1AD9B 1LNUB 2C1PB 1AGEB 4NT6B 1EUTA 2XFXB 3MOBL 1UWGL 1JUFA 4P2RE 3LIZH 5B3JE 3IXTB 3RVVD 3P4MB 2OXHA 1YC8A 1T7XA 4ZUVB 3G6AB 1NGWA 2BVPB 5HHMB 1FORL 2YS4A 4HIJA 3KPRA 1B0RA 1I1AA 1MJ8L 3QEQB 4IBLT 5I9QC 4EVNB 5F6HJ 1RUQH 1CFVH 1T04A 3VGHA 1N26A 3CFEA 2EEDA 3WLBA 4M5YL 2W0FB 2Z8VC 2P47B 2ZUQB 5KBNC 4OCNC 2W65A 5D96B 2ESVD 4PJIB 1UB5A 1I9IH 1OLZA 1K5NA 1KOAA 1AFVL 1DZBA 3C8DA 2FJGA 2NR6C 4KDTC 4JFDD 4O02L 1XR9B 3GGWB 1CFTA 2PW1A 1LD9A 1VCAA 2HKHH 4FQXC 5ICZA 3BAEH 5C8JB 1LE9A 1MHEB 2Y72A 4HWBH 4RISH 5J89A 1OP5H 1WAAE 4B7IA 2HT2C 4ZNEA 4UV4H 3L9RA 4P59L 2VXQH 1IKFL 1A6UL 1WLHA 1ZHNB 2NX5A 2XG4A 3CU1A 2P45B 1RUML 3U46A 4YPGA 3BKCL 5EU7E 3WSQH 5DFVC 3HZKA 2DM3A 3QUMH 3MNZA 4OQ1A 4WI5A 1INQB 4N0UB 4ZYKB 3W9EA 2FR4A 4KPHH 2X4TB 3TBSB 4WHTB 2Z92B 1DVFB 4GKZB 3RZWA 1EFXA 3EYQC 1ZT7B 2QKIA 1G9NL 2GT9A 3T3ME 5FAAA 2BHUA 5DJ0A 3SE3A 1INEH 2BNUB 5C0NC 2VQ1A 4YUEL 8FABA 5DC4B 1QYGL 3CX2A 4JRXE 4XH2A 3OJDA 3STLA 3QQ4B 1MCEA 4OM1H 5GGSA 2IANA 4XPAH 1PLGH 5L2KA 4QGYA 2HJLA 3OKLA 2X4PB 1LMKA 3RWFB 5DA4A 5TH2A 4WDIA 2ICWA 2YD1A 4YHKL 5JXAL 2ADFH 2OK0L 2HH0H 1A2YA 5FYKE 4WU7B 1CLZL 4G3YH 3RTQD 5DVLA 2RB8A 3ARGD 4LRNH 5J9PA 2VDQL 2VERN 3SY0A 4N0FA 4ODSL 3H3PL 3PQYD 4JM2F 4NQXA 3QNYA 1UM5H 2BNRE 2CRZA 12E8L 3LRSB 5L9DL 2X6MA 3AS0A 5L2JB 5AD0B 3X3GL 1GVIA 4XCEB 2VUOA 3MJ7B 5DJXA 3EHBD 5IVXB 1KN2L 2V9QA 3V9FA 2J6EH 3O41B 5IMKA 1V7NH 2GJZB 3RVVC 4JCLA 3I6KA 4ZFOA 4UOJA 5C07B 2PYEE 1KELH 3MRFA 4OLEA 3CSBA 4OQTA 3TCLB 4P5MA 4ZG1A 4Q6IA 3VRIB 4G6FD 1P6AB 3BKJH 4IRSA 2C7UB 3RGVB 3D0VA 4KTDH 3T09A 2GCYA 4B0MM 1P84J 1MIMH 1QP1A 3Q3GB 5A3ID 1JTOA 4LKXB 3B8SA 1A6VH 4F57H 3LQAL 4JFED 3PJSA 4S1RL 1CU4H 2DQUH 1KG0A 3O6FB 4L9LC 1HIML 3MRPB 4KZDH 1YYMH 2L4OA 3MRDB 5GSVB 3D48R 2AJVL 1AGBB 4JQVA 3NFNB 1FNSH 1BVKA 3B8YA 4KFZC 4PRBB 4MJ5B 3QEHB 3MACH 3MUHL 4P4KD 4RAUB 2CLVB 5I16A 1PYWB 1VFAB 4WO4B 3IAQA 2VKXA 5TFSL 2VZOA 3W82A 1EH9A 1CXEA 3QQNA 4JKWA 5D93B 1AJ7L 5MENE 1IM3B 4PP2B 3HC0A 4PV8A 5FYLH 2VSDA 4S1DD 3HNSH 4BH8B 3C60B 3ZTNL 2FCBA 5HSFA 3SCMD 4MJID 1KCKA 3GMOB 4N9GA 3QUZB 1U91A 3AVEA 4ZDHA 4PJFA 2WIIB 3H9SA 5TGBA 3PP4H 3BPCB 4G80A 1BD2E 1Q1JH 3MBEB 3SE4A 3VG0L 4NQDE 3BUTA 1X5YA 4X6DB 5I8KL 1U8LA 1SY6H 3CFCL 4JKPL 3EFDL 2V9RA 3OQ3B 5K9QG 4PGBA 1NAKL 1F4XL 5E5RB 4TNWK 5C08D 1JNHB 3OF6A 5C2UB 3TBWA 1CL7L 2I9TA 2P4AB 1UZ6F 3QG6A 1KTLB 1U8KB 2HT3D 4PP1D 5DQ9A 4Z7WB 2DYPA 2X7LA 4V1DB 1OLLA 1NC4B 4XNUL 4NSKB 3RTQC 3PL6B 1N8ZB 3MROB 3PWPA 5ESAB 4P23D 4XVSL 4HH9B 4GMTH 5D70H 1U3ZA 3SJVE 1RFDL 4ONHA 3U0TA 1ZA6B 1FNAA 3DMMA 5LGHL 1E6OL 3EHBC 5D2NC 3EOTL 2VLRE 4P2RB 1OP9A 5JW3L 5JIKA 1I1CA 4F7TA 2VDNL 3QHTC 5FO9A 3O0RH 1P4IH 4K94H 5C1MB 1FL5B 3KAAA 1O5DT 4QRRA 2EXWD 3WXVH 3EOYG 1MJJA 2VL5A 3N50A 3CU7A 3ZE2F 3GMRB 5H8DA 2LAAA 3NACL 2YEZA 3QIUA 5A3IC 1OOAA 5FB8B 5K59E 5I6XB 1ONQA 3PV6B 2Y07L 1DE4B 4BQ8A 5IK3A 1ZGLP 5IBUB 1NQBA 4LCWA 4M03A 3NCEB 4PRIE 1A4JB 1JVKA 3QPXH 3RL2A 4XNQA 5IJVB 3UZQA 3FO1B 4PGEA 3U1SH 5I18L 4MAYB 5DJ8A 2R4RL 3CC5B 1NFIA 4KKAD 1NLBH 3ORJA 1ZVHA 1DLFL 4YGAB 4JHZA 1YMMA 4R8WL 1SJHA 4K2UL 4P4KC 2BSED 3RWJA 4PJ9A 4LHUB 1IAOA 1JFQH 4PJHE 4NWUH 5CJ5A 2IH3A 2VLMD 5JTWA 2VLLA 4QRPE 1LO4H 5INCB 2XN9A 3OAYK 3NA9H 4LHUD 1TPXB 3LN9A 2WINB 2QBWA 4OD1L 3DUHA 4XP6L 5L6YL 2AJUL 4S1DC 3UPRA 3SCMC 2DTML 3RP1A 5E94B 4HV8A 4I48B 5EZJB 1DBML 3MNVA 1WEJH 1C5CH 4ODTH 1C16B 4WFFE 4MAUL 3PWVB 3BZFA 1G7PB 5H2BB 1A3LL 5BVJB 1ODAA 4JRXB 1NPUA 5DTFB 4X0KB 3QRGH 2FD6H 1U93B 4TRPH 4FQPA 2DRUA 1LO0L 3SE9L 4JO2H 3WDHA 3MRMA 2H41A 4HJGB 3WYRA 1T22B 4JPVH 4XWGH 4JR9L 1MFAH 3OXSB 2J88L 4Y4HA 4NCC1 2HT3C 3GMNB 4HSQA 4PP1C 2G5BA 1JYNA 1JTTA 3UBXI 1RJYB 1HN1A 3G04B 4G8GE 5CJXA 2DBLH 2HYMA 3W11D 1NMAL 1NGPH 3LEYH 5CD5C 1I8KB 1AO7E 4UT7H 3INUH 2XA3A 3FO0H 4P23C 3VG9B 4OKDA 3OKKA 3D5OF 1N6VA 4ELMF 3CJJA 3JSSA 3UTTD 2BNRB 5TDOB 1CBVH 1HXYB 3S4SA 1HXMB 3IXAB 3SBWA 1JE6A 2AKRB 1X5XA 2A74A 1IC5L 4AK1A 1K85A 2P5WA 1OD9A 2MKLC 4NC0B 5BMFH 5JXED 2DI9A 3P11H 5F8RC 1AC6A 3U6RB 4MQXD 2NCMA 3RJDA 1TTGA 2HLFC 1PZ5A 4RA0C 4PJGE 2Q86A 1JYVA 1FDLH 4NP4H 5F72S 4L8CA 4Y1AA 4GRLB 3QXVA 2BMKB 3BIBX 4LCUB 2C3GA 3EGSB 1KXQE 1TNNA 1KTRL 1S5IL 1NL0H 5DLML 4NO0D 1F2XK 2X1XR 1UADC 2AV7B 3WS3A 5IMMA 1LEGB 5I6XC 4GXVH 2H8PA 5IR1B 1EGJL 4NQEA 4PTUA 2NTFB 4KKAC 4DKFH 3AY4C 2B4CH 2RAMA 3SKMB 2P7TA 5IVNA 3UO1L 5IB2A 4WV1B 4GKSB 4IS6A 4QHNA 5CGYD 1IM9B 3QHFL 4IIQA 4WENB 3H0TA 5JMOC 3TV3H 4LCIL 5JHDD 2F53B 3MMEA 3NIDF 4YHML 2R2BA 4YDVA 3CXHJ 5E2WH 5HPMA 1FRGL 1U0QA 1TLKA 3UTSD 4C56E 5MENB 3BT2H 4YHLH 4WIQA 4P9ML 5IGXL 1I7ZA 1KENH 4XTRD 4LVNB 5F9JB 2VDPL 5EC1A 3FRUB 4K7PY 2V6HA 1HILB 1KCSH 4S0TD 3U4EA 1IAKB 3BISA 4OM0L 4WTXA 1QRNB 1TCMA 3GSRA 5GGTA 1Q8MA 3QP3A 5IVOA 2XZQL 5J56B 3BMVA 1VERA 4NUGL 2I26N 1QRND 1X5AA 1LK3L 3GIZH 2NY5C 4L29B 4TSBL 2HLAB 4JGUA 4EOWL 4MS8D 1VACA 4X6CA 4ERSL 1RZJH 5IFJA 1E27A 3MRJA 3VFVA 1QSZA 3V5KA 2EEAA 3LKRA 4DUVA 3H7BA 1ADQL 3VWJD 3MGAA 3LS5L 2BVQA 1RJLA 4KC3B 4N0RA 2ATKB 4PLOB 4MSWA 3W11C 2XRAL 1HHGB 3JV5A 5MEPA 4LLMB 3L3IA 1AC0A 1DUYB 1OQOA 2AQ1A 3D3VD 2H2PD 3OKDB 4O2FB 2MCG1 3FOLA 3DHJA 2CGRL 5FOJA 2YOCA 1EJOL 5F7MC 4C54A 5C0EB 1CD0A 5CGTA 3GSXB 1G7LA 4PV9B 4PJBB 3FCTB 5ID1A 4JJ5B 1EHLL 2XTJE 4GAFB 4WI8A 1DBKH 3TT3L 5JXEC 5ALBL 4OI7A 2FL5A 2GHWB 3WNNA 4YDKH 5LKNA 5BS0D 2EDLA 1I1YA 4MQXC 3RL1A 5BZWB 4X80H 1NCCL 1WBXA 5EA0L 1TVHA 5J4MA 1MFBL 2QV2A 1ETZA 4GRWF 3AAZA 3NCFB 4KUZL 1Q9WB 3ARZA 4PJ8A 2C5DC 1Q0XH 5DEGB 1XF3B 4N8VB 3F7YB 5SWZD 1OP3K 3V4UL 1FJ1A 3QDGE 2FO1A 4C55A 3A6BH 3CFJA 3J8F7 2OSLA 4WEBH 1JWSB 3S3PA 3SDAA 2MQ0A 3RWIB 4RQQA 2J12B 1OB1A 4ZSOB 1PVHA 3QEUA 5AUMB 3X17A 3T1WA 1XR8B 5T3XH 3RIFF 4LASH 3PIQA 2F8VA 3X11A 3NCJH 4KHXL 3P0VL 4M4PA 3QPQD 4N8CL 1U8JB 5E4IA 3VCLB 1CFNA 1F3RB 5D7JD 2GFBB 5E4EC 5DI8A 4P3CL 5EO0B 2XKNB 2ZKHH 4J3XA 2WANA 4PJHB 4MHHG 2OR9L 4Y4KA 3THMH 5A2FA 4QRPB 3MOAH 3H2WA 2CK2A 5F7EH 4WV1C 3REWA 2BVTA 5MP6H 35C8H 2H26B 5JHLL 2VXVH 3MRBA 3S37H 1WBZB 3MGTB 5IHUL 1MWAL 4L5FL 3CLFH 3E3QC 2Q8BL 4L8DA 2I27N 5AG9A 2CDGB 4XTRC 3ULVD 3UBXB 4NBZB 1RUKL 3M1BB 3ROOA 1LO3L 5KSBF 1HE7A 3D69A 1NMBH 5B39G 5DYOA 5FYLE 2DBJA 4LVNC 4ZS7H 1A9BB 4PRPA 3UDWA 4HQQL 1WBYB 3K74B 1KC5H 1T5XB 3HZVA 4FABH 1P5VA 4MD5B 5F3BB 3NFPB 3QFDA 5F1NB 4ALAL 1AD9A 1LNUA 2C1PA 4JQIH 4NT6A 1I9EA 2XFXA 5DD6B 3F7PC 2X89A 5J1SC 3DV4B 4MS8C 4NYLB 1JL8A 4FQCH 2OP4H 1JPGB 5CEZD 3IXTA 3O9WB 3O2VL 4I4WB 2QSCH 3P4MA 4CDHA 4ZUVA 3ARRA 3VFNB 3G6AA 4LPCA 2IFGA 2NQCA 3VXMB 3QHZH 4JY6B 3VWJC 1KB5H 1YC7A 4MWFB 3T65B 2BVPA 5FV1L 3SEPA 2EDDA 3KR3H 4P48A 4KRPD 4G8GB 2FJHB 4X4ZA 1BLNB 5DK0B 3PWLB 3I9GH 3QEQA 4EVNA 5ENWB 1RZ8A 1AO7B 1G1YA 5L88L 1R3JB 2H2PC 2HJKB 2W0FA 3MFFB 2ORBL 4XP5L 4TSAH 1IGFL 43CAB 3U7YH 3H8NA 4QXUL 1B6UA 3DUSB 2WSKA 1WJ3A 4PJIA 1ZLWK 4LOUD 3BHBB 4H0GA 2PCPB 4U0RC 2DLFL 5LAXB 1HQ4B 4YHOL 4PRAB 4XMPH 1XR9A 3GGWA 3ECBA 1JHKL 4L4JA 4HUUB 2ADGB 3VGBA 5C8JA 1JNNH 1MHEA 2ITDB 4PBXA 3BE1L 4NKIH 4C59B 3NFSL 2FIKB 1ZHNA 5EG6C 5I76B 3W2DH 3S97C 2AP2A 4WU5B 4WFGD 4OCXL 3DI3B 1OAXL 1GIGL 1OW0C 5KSAD 5E6ZA 4ZYKA 2QQNH 1INQA 4N0UA 3ZKQD 4Y8DC 2YSSB 1NBZB 1AXIB 1Q9LB 2X4TA 3TBSA 1I7RB 2Z92A 1DVFA 4GKZA 1N2RB 3BPLB 3U9UB 1GHFL 4P4RB 1E0OB 1XFPA 3JV4B 5FA3B 2EH7L 2MFNA 2F54E 4LAQL 4UMGA 5E8PB 5CJOL 3QPQC 1ZLVK 3AMLA 5ISZE 4K7FA 4HK3N 4BK5A 4NNPL 2WP3O 3QQ4A 3IFNL 1ES0B 4G6ML 4G6KH 2E9IA 2M1KA 4KWUA 4FQHB 3V0AC 2X4PA 4C56B 3RWFA 2DIAA 3MJGX 5DK3A 3CVHL 3V8OA 2YPLB 3ULVC 1BPVA 1GZQB 4WU7A 2FB4H 4HXAH 4P57B 1OAZH 1H8OA 1G7MB 4M1CD 3QQ3B 4KY1L 2ZOKB 5F8QC 3IAPA 3IS1X 4FNLH 4JHBA 1RIHL 4P9HH 3VXSB 4XBGB 1UZ6E 1VDGA 1VENA 3BSZH 3LRSA 2FBJH 2BJMH 2V17L 4MNQB 2VZUA 1W8OA 5L2JA 3HC3L 5AD0A 3MV11 1EZVY 1WVZA 4XCEA 3RWEB 4G9DB 1LEKB 3MJ7A 4KK8C 5IVXA 4MB4A 3I6LD 1OD7A 3S35L 4UTBL 4JKKA 1UENA 3O41A 4GBXB 5GGQH 3VGFA 1HINH 2GJZA 2BC4B 4PBWD 5HYJA 1G6RB 1QSEB 5C07A 3V0VB 5KTEH 4M1DH 4MZ2A 2BNQE 2YUZA 5JUEL 3VRIA 3OX8B 5I71C 5E03A 3RGVA 4S0SD 2C7UA 1FL3B 2XZCL 4HLZH 4IJ3B 1CDUA 5E6ID 3RHWK 1ZA3B 3CSYB 1CLYH 4U2ZA 4BZ2H 1G0DA 1WT5C 3Q3GA 3CCHB 1PBYA 3FMGH 4LKXA 3DLQR 1NCBL 1QR1B 3MUZ1 3WIHH 4N8PA 3LPFA 3RY5A 3VH8G 4DGIH 1G9MC 3O6FA 2IAMB 3S98A 4LOUC 2R39A 3MRPA 4MA1B 3MRDA 5GSVA 1AGBA 4HBCL 2CXKA 4DKAA 2XTJB 5L7XL 3NFNA 2DB8A 1E4XH 2IAMD 2PTVA 3ZE2E 5I1AB 4HS6B 4PRBA 4MJ5A 3QEHA 3HS0A 4F80A 4RAUA 2CLVA 5EDXA 1OWWA 1WITA 4WO4A 5GJTH 2COQA 1A7QH 2V5YA 5CZXC 2VWEE 4RX4D 5IHLB 5KJRH 3SDYL 1P84K 1TJHL 5IFAL 1IM3A 3SGDH 4AIXA 3RZCB 4PP2A 3MUY1 3QDGB 4G7VL 5KSAC 1BWMA 1JBJA 2ARWA 1XGYL 4BH8A 4JO3H 3C60A 4BSVB 2Z9TA 3GMOA 4X9BA 5LXGL 3QUZA 1ZOXA 1QACA 3NIFF 5TE4L 2WIIA 1H3PH 3SKNB 3QDME 5FCUH 1CR9L 3O2WH 3MBEA 4X6DA 5CMAB 4KGJA 4M1GL 3EYUL 1CE1H 1L9NA 1BIHA 3O2DA 4RZCB 3EO9L 1QBLL 3SO3C 2E6JA 4ODHH 1MFCL 4PY8I 3EDKA 4K71C 3OB0H 3Q5TA 2VIRB 4MA3B 1SEBB 2KDGA 1JYXA 1KTLA 5FUCE 3QCVL 1QBMH 2A1WL 1U8KA 5HJ3B 3MLVL 4Z7WA 3ARVA 3T2PA 4Z7VF 3I6GB 4V1DA 1NC4A 5HHXL 3FTGB 4RMWA 3JWOH 4NSKA 2FH8A 1ZTXH 3PL6A 5M7QA 4M1CC 5IB1B 4KZEL 5E2UH 2Y36H 2EIEA 1N8ZA 4NHUB 5DD1L 2YRLA 1J05B 3MROA 2IPUK 5ESAA 5HVHB 3C6SB 1B3JA 1EX0A 1JPTH 5CAYB 4HH9A 3T4YA 1BQHB 3TC9A 1SBSL 4XVJH 5JORB 3WNPA 3DXAD 5KZCD 1ZA6A 5F97E 2FH6A 3D9AL 1NUNB 3MJ9L 4JHWL 4O5LH 1R6VA 1A5FH 3BJLA 3VXUE 5D5MF 1TNMA 4KJPD 1CFSB 2VDRH 5E99L 4P2RA 4UUJA 4WGWB 4EDWL 2R29H 1KNOB 4LVOB 2DDQL 1AKJB 2KL6A 4U1SB 1T1XB 4F58H 2ERJC 2AK4E 4GAGH 2VZ3A 1FL5A 3RJQB 3A6OA 1BAFL 2AV1B 4ELME 5BV7H 3OB8A 1JGVL 4U05A 5E6IC 1I75A 5HY9B 3GMRA 5K9JL 4FFYH 2A6KB 4EI5B 4H26A 4L3EE 3WLWD 2OZ4L 5FB8A 4IJ3C 2QADB 1L0XA 3PV6A 1OM3L 4HEPG 1DE4A 2BOCA 4PJ7B 1BFVL 2B5IB 4Y19D 1JRHH 4O4YL 1BEYL 4NCC2 1A4JA 3B9EA 1B0GB 4QOKE 5IJVA 3FO1A 5C0FB 4MAYA 3FO2B 4N90E 3CC5A 4M6AA 1RUAL 5DSCB 3VI3E 2IAMC 4IOFD 4DZBB 4OD3L 3CXDL 4MA1C 3UTQB 4JFXB 5ACMA 3T0ED 2PXYA 1WAAA 2OXGA 4XAKD 2R69L 5INCA 5BXFB 2B0SH 3UYPA 3A6CH 2ZCHL 5DJ6B 2WINA 2A9NH 5DO2D 1RUPH 3KG5A 1QSFD 2CLRB 3WJLC 2ARJB 5E94A 4I48A 5EZJA 2L0DA 1NCDL 1MRFH 1OSZB 1EEYB 3ZSTA 1C16A 4HS8L 1CGSL 5EU4B 1H3VA 3VXPA 3PWVA 1HZHL 4JDZB 1G7PA 3HR5B 3M07A 3NIDE 5H2BA 3R1GH 2DI8A 1T0PB 2E27L 1GGBH 3ZKSD 3GK8H 1MCWW 5BVJA 5D2LF 4JRXA 4K3GA 5DTFA 4X0KA 5ISZB 1NLDH 3B4NA 5D72H 2E7HA 5T3XE 4FG6D 5FF6B 4Y5XC 1KPRB 4HJGA 3V4PL 1T22A 2N7BA 4Z6AT 3OXSA 4R9HA 5GISH 5C0CE 3TZVB 4MXQD 3GMNA 5E08H 1YNKL 2PTUA 4JO1H 4QRTA 1RJYA 3HRZB 4TNWF 3GFUA 3G04A 3SE8H 3TZVD 3S96B 4XXCC 4F8QA 1I8KA 3KXFE 7FABH 4DOHE 3FN3A 4WEMB 3IRPX 3VGAC 2BNRA 1T0NB 5TDOA 5EZOL 1EAPB 4DUWA 1U58B 1HXYA 5BRZE 1HXMA 3IXAA 4NZUL 2AKRA 5HVHC 5DDHB 5HYIA 1HHHB 2UWEF 4QYOB 5HVFB 2X4SA 4KJPC 2P42B 3ZTJG 4FTVD 2APVA 2BCKB 1BZ9B 1KJVB 1ZEAL 1Y6MR 3MA9L 3CX5K 3F7QA 5SWSE 3U6RA 5IQ7H 2PYEA 5ADOL 1NGZB 1FORH 1FVCB 2BNQB 1T2QH 5CKGA 3I2CL 4KH2A 4X5XA 1A7NH 3X14B 4I2XB 2RCSH 4PD4J 4GRLA 2BMKA 4F7PB 3EGSA 1SVZA 4R3SB 5DZOA 4V2CB 3WLWC 2XQBH 2ICCA 5B21A 3IF1B 3BOVA 4PS4L 4TQEL 2AV7A 1JGUH 1BHGA 1LEGA 3UJTH 2YA2A 2I5YH 3KDMB 4YHZL 4LSUL 4XCCL 2QSTA 1U3YA 4GRWE 2B5IC 3AC0A 2NTFA 5DRWB 4IOFC 5DJYB 4FXGB 3SKMA 4HAFA 1KGCE 4P59H 4JHAH 3T0EC 1DQQA 4N68A 3TBVB 3NTCH 1JWUB 3Q48A 5IP4A 4GKSA 1JNLH 1J10A 1UWEH 1IM9A 4JB9H 4NZRL 5GS2D 1BJ1J 2IPUG 1FVEB 1BM3L 2F53A 5TQ2L 5MENA 3MV8D 5DO2C 4LDLB 1P4BH 5TDPB 1V7ML 5F7HA 15C8L 1GGYA 2R56H 4PGZA 5F9JA 3D1MC 3B9AA 3FRUA 1HILA 1RSFA 1IT9L 3NZHL 1IAKA 3F7RA 3QDMB 4JRYE 4QNPF 4NQDA 1J11A 4RIRB 2VLKD 3ZT5A 2RGSA 1UB6B 3PHSA 4PG2C 4DTGL 2X4UB 5IB3B 5CSZB 5DWUH 3GSUB 4U1IB 3HAEB 4FG6C 3WBDA 4L29A 4M6NL 2HLAA 5ID0A 1XF4B 2V2TB 4XPGL 1P53A 1L7TL 3WJJC 3KPSB 4GFTB 4KJWD 5H94A 5KSBE 1FE8H 2D3VA 5JXAH 2HFEB 1U3JA 4PUBH 1S78D 1PY9A 4HUWB 3DYMA 3MXVL 4MXQC 1OAQH 1CLZH 1ZLSL 4G7YL 1IZKA 3EYSH 4WW1B 5FYJU 3V7MA 3U36B 2ATKA 4YR6B 3QJFB 3TZVC 1QFOA 3LHPL 1UJTA 1HHGA 4W6YB 2NY5L 4LLMA 4ODSH 1CWVA 1DUYA 3P73B 3ARTA 2E6PA 2VQTA 2GSGB 5L9DH 3OKDA 4O2FA 5IESL 5DHVH 5I73B 2VZVA 3O4LE 3OPZL 3IJHB 1EVTC 4OI8A 3ZDXF 4FQIH 5C0EA 2PO6D 3MLUL 3GSXA 1NC2D 4PV9A 5DXWA 1E4WH 3FCTA 4JAMB 3VMPA 4JJ5A 3C8HA 2GTZA 2ED8A 2FEEL 3LRHA 1GPOL 1MY7A 2YUXA 3O3UN 5GJSH 4KDVA 4LLUB 2ZP0T 5FGSA 3ZO0A 2DS4A 5BZWA 2AK4B 2ZSWB 1KLFA 4RFNC 2DMBA 1EIBA 3S3JA 4N5UA 2LVCA 4ELMB 3RNQB 3L3OA 5TDNB 1Q9WA 4H1LH 5DEGA 3RDTB 3LQAH 1XF3A 4N8VA 3F7YA 4S1RH 4NKMB 4XP9H 2YC1B 4CMHB 4P46B 3VFGL 4H5SA 1JWSA 1MCSA 2EDNA 5GRYA 3RWIA 3EOAB 4QOKB 4ZSOA 5AUMA 1ZSDA 1XR8A 2DIBA 2Z8SA 4M00A 1VGEL 3GJEB 4JZJB 1J8HD 5IROC 4HK0B 1U8JA 3LEVH 2MJWA 5A16B 2V2WB 1F2QA 3UJJL 3K2MC 1AJ7H 2XKNA 5EO0A 4PJHA 4MMZC 1RY7B 5ALCL 4QRPA 4IRJD 3UTZB 4JN1L 2BXYA 5CUSH 2VDOH 2W9DH 4ODXA 2H26A 3ZTNH 1WBZA 3MGTA 3JWDC 3L5JA 1N6UA 4O9HL 5HHOE 2CDGA 1JPSL 3QA3B 3UBXA 1K8IB 1OGAD 2QHRL 3QI9D 3GI9L 2HKFH 4X4MA 5HHVL 3WS6A 4OCWL 3VG0H 3B2UD 2GSIB 3I50L 1KJ3L 3QXAB 1A9BA 1D3CA 1WBYA 5F71A 1NAMB 1T5XA 4MD5A 1X9QA 5F3BA 2DJUA 3NFPA 2YWZA 5F1NA 2CMRL 4QCIB 1QKZH 2BSSB 5F88B 4HKBB 5DD6A 5E1AB 3DV4A 3ZYOA 2RJMA 3GI8L 3A67H 1YDPB 4KJWC 4OSUL 1JPGA 5FHBL 3O9WA 4LFHD 4I4WA 1D9KB 3QXWA 2ICEB 1S78C 5C0CB 1EEZA 3SOBH 1J1XL 3VXMA 3VFNA 4AT6B 1CLOL 4MWFA 4U2YA 3T65A 5A40E 2NY7L 3P30H 3RX5A 2CJUH 4G8GA 2A9ML 1IGTB 3CFKB 5ICXB 2FJHA 4JN2B 5DK0A 5D1XB 3PWLA 4EUPB 5ENWA 4NN5B 5E0QA 4DGVL 1RFDH 4HC1A 5IV2B 1B0WA 1AO7A 2AGJH 4TUKL 1R3JA 2ZUSA 4FQLH 2HJKA 5GSRB 4DOHB 3HZYB 3MFFA 1D5XB 2VAJA 43CAA 3C08L 4X4YB 4KVCL 5BRZB 2PO6C 4U49A 3DUSA 3BHBA 5AAWA 1OAYH 4Z76B 3HI6L 5LAXA 4LSVL 1HQ4A 1U9KA 4YJZL 4PRAA 2CDEB 3WFCH 1DJSA 4HUUA 4MJ4A 4Y4FB 5SWSB 2ADGA 2ITDA 4PREB 3WO4B 1UJ3B 2DKUA 3AB0B 1DEDA 4XNYL 2FIKA 3NACH 4PR5A 1LO2H 1J86A 3WV0A 5I76A 4AJ0A 1T83C 4WU5A 3JZ7A 4LCCB 2GI7A 4QHKI 1NBQA 1QOKA 2CKNA 3HUJF 1B88A 1AHWB 5FK9B 2N7AA 4WI3A 1SYVB 1JIBA 4AQOA 4Z77B 1JZ8A 5JPMB 1NEZB 3C5JB 1TZGH 1NBZA 1Q9LA 4NOBA 1JZ5A 1I7RA 1N2RA 3U9UA 4P4RA 1URLA 2EYRB 4OQTH 2DQIL 2C4XA 3IU4H 3L6FB 4KQ4L 1CDBA 4GRWB 4R8WH 1ITBB 5FA3A 1IC4L 1Z2KA 3RWHB 3ROLB 5DVNA 5E8PA 3S5LA 4MD4B 4WCYH 3B83A 1T6WA 2DQFB 1QPPA 2VN7A 3QUYB 1R3IH 3EBAA 2P5ED 2JIXD 3C8KA 5ICYB 1NKOA 1ZS8B 1ES0A 3VD5A 3QUYD 1IEBB 4XP6H 3NIFE 5K9QI 4FQHA 1KEML 3IDIB 4C56A 4WEUD 5CILL 5FO7B 4XPTL 5EUOF 3QRFM 3PP3H 4RDQG 2YPLA 1GZQA 3BJ91 4HPYH 5C0JB 1INDH 3QI9C 3CMOL 4A6YB 4XNZB 4P57A 4KRMB 3N1FC 4XC3H 3MTRA 2IGFL 3QQ3A 2ZOKA 3BD4A 3R0NA 3B2UC 1UACL 2Z93B 3DVNB 4OGYL 4Z0XB 3LKNB 3RWCB 1JRHI 3WXWL 2AK1H 4JRYB 3VXSA 4X8XA 2Y7QB 5C6TH 4D94A 4XBGA 1P7QB 4MNQA 4XX1E 2ILLA 2NZIA 4NQSA 3I3BA 3RWEA 2D4DA 3ULVL 4G9DA 4Z7VE 1D6VH 3WFEL 1U95B 4DN4L 25C8L 4JR9H 3EYFB 3LS4H 2OCFD 5T1MB 1I3GL 4Y16B 2VLJE 1B4JH 4GBXA 5KSBB 2BC4A 4OIIL 2EIBA 1G6RA 1N5AB 1QSEA 5GGSY 3V0VA 5H37G 4LARL 4LSRH 3OX8A 5D7LE 4E41B 1FL3A 1ZA3A 3CSYA 5DMGD 1EMTL 3DPBA 1OF2B 5D5ME 1KPVB 3CCHA 4E41D 4D9QD 3QEGL 5KSUB 1LP9F 4M7KH 5D4QA 5CEZL 1QR1A 4X9IA 5D1XC 5KOMC 3O4LB 1CK0H 1QNZH 1X4XA 4LBEA 4NN5C 2UZYB 4WUKH 4YE4H 2IAMA 1WTGT 3CGTA 1I9RL 2ZCKH 2CQVA 2AJSL 3JTTB 1NCNA 1QHOA 2BVEA 5EN2B 4XNXL 3T1FB 2D2OA 2FX7L 3I84A 5I1AA 5I1KH 4HS6A 3TCXA 4MA7L 3RUGB 5F3HB 1MJ7H 1RULL 3BP7B 3P0YL 5DRZB 3GSOB 2J6EA 1G9ML 5DLMH 5F1KC 4WFHD 5E5MB 3WO4C 1UJ3C 4BFEA 4PYGA 3RIAF 4CN1A 2DJSA 5EPMB 3RZCA 4CU8A 3QDGA 4FFWC 5B3NA 2R0LL 5TPWH 3DECA 4GQ9H 2V7NB 4LCCC 1NCWL 4BSVA 1RZGB 2EDTA 3ZDZF 4JPWH 1AHWC 2WUCH 4UV7H 5DGRA 1MNUL 2BDNL 3SKNA 3KJ4B 1FYTD 2EDYA 3V5DB 5F70A 4NKDB 5CMAA 3T0WA 2YA0A 1CIDA 5DQDL 2YK1H 5EOQH 1Y0LB 2HT4D 1FFNB 4LCIH 4OBRA 3MREB 4U1GB 1P6FA 4YHIB 3BO8B 1E28B 3KS0H 3QUYC 4LSPH 5F93C 2VIRA 4MA3A 2LU4A 4OJFH 3UYRL 1SEBA 3KYKL 1LK2B 3QFJE 1IGJB 5E95B 5HJ3A 5LGKA 4JG1H 3VFPB 3ARYA 5IT2H 5E6YA 3I6GA 1IBGL 5AEAA 3FTGA 3OKOB 4HPOH 5D2LE 4L4TD 5IB1A 4NHUA 1C5DB 2EDOA 3GUTB 4GG6B 1J05A 5BW7A 3QSKB 3WUWG 3MRLB 4NUGH 3C6SA 1EO8L 3DIFB 3KPOB 5JORA 1BQHA 5ERWB 1A1MB 3GSNH 2XY1A 4FFZH 4PLJD 2IBZX 2V5SA 2DQTH 3SJVD 1YEGH 3VFMB 4XCYB 5EU6D 4JCMA 3FT3B 4P2QE 1WIOA 3TVMD 3V5HB 4OLZH 1NMCC 1UQSB 1KNOA 2VLRD 1SY6A 1A21A 3EO1A 1AKJA 4U1SA 1T1XA 1KIQB 3Q0HA 5MI0C 1MHHB 1BMGA 4PRDB 3ILPA 4NZTL 4K3DL 1CI5A 2AV1A 1IZJA 2VR9A 1R3KB 3G6JF 3WNKA 3TGXA 3AROA 5HY9A 5DMGC 3RVXC 1A6PA 3B2VH 4L4VD 2UWEE 5E70A 2A6KA 4EI5A 5JDJA 1BIIB 3HC4H 1B2WL 3LKQB 4PJ7A 4ZFGL 3FB6B 5ANME 3NN8B 2APFA 4JFHD 1B0GA 1RD6A 4PRID 3U48A 4WWKD 5ALBH 5C0FA 1YEFL 5CZVL 5T33L 1J0HA 3FO2A 4JLRB 1PSKL 1YEEL 5EA0H 4X5LA 3MLRL 2DICA 4HMEA 4G9FE 4JFZL 4L8SB 3HZMB 3UTQA 4JFXA 1V8HA 2EDFA 3F58L 3DWTA 3UYOD 4KUZH 5EZLB 3WL9B 2AXJA 2GITB 1YNTB 5KVEH 3V4UH 5BXFA 3ARED 4XP4L 2QQLH 1MUJB 5DJ6A 4H0IA 5TE6H 2JCCF 3EJZD 4I5BB 3GJFK 3IT8D 1DL7H 3OZ9L 2CLRA 2ARJA 3ARFB 5HI3D 1CDGA 3BD3A 4WY7H 4DAGL 5J1AB 2ENSA 3HMWH 3QIBA 3RAJH 1OSZA 1EEYA 1ZLVH 5EU4A 1J0KA 4UB0H 5EUKB 4JDZA 3HR5A 2F54A 2OJEB 3MODH 1DFBL 4XMKL 2CK0L 3PG2A 4JREC 1J5OL 1FAIH 2D0FA 2PETA 2HT4C 4KAQH 3Q6GH 3T8XA 5ISZA 3KJ4C 4QWWD 2F5BL 3EO0B 4Z18A 5FF6A 4QRUB 3I02B 3KPRE 1F6LL 3O6LH 1KPRA 4R4ND 4ONFH 4HIXL 3QG7L 5E8EB 4Z8FH 2R0KH 3TZVA 1RZIB 2K7QA 4QNPE 4LPYA 1VSCA 4JVPA 4OCSL 3HRZA 3VWKD 1X5IA 1FYHB 1GC1C 4MNHB 4OV5A 3FOMB 3S96A 4WWID 4HQQH 3R06B 1D7FA 3SHSA 1Q9KB 2VH5H 3BN3B 3OG4B 4LLVB 4ALAH 3T04D 4Z7UF 1AXTH 1T0NA 3BDYL 4FZ8L 1EAPA 4PLJC 1U58A 1C08B 1F58L 4RMUA 1HYSD 5D71H 5DDHA 3D18B 2ZG3A 1HHHA 4KQ3H 4Z7VB 4QYOA 3TJEH 3U0WL 1W2KT 3O2VH 3STBA 2R0ZH 2V5TA 3TVMC 2BCKA 4M6ML 3UPAA 1BZ9A 1KLUB 1N0LA 3NABL 5C0AB 1KJVA 2VLJB 2WBKA 3H42L 4OFYD 1N64L 4M61B 5I1CL 4QRSB 2BNQA 2IFFL 5FM8A 1A0QH 4WUUE 5D7LB 3X14A 4I2XA 1TENA 4LQFL 4YGVB 3ZDXE 4F7PA 4I3SL 1KEGL 4R3SA 5DJAA 1ZXQA 5D5MB 4XP5H 3QDAA 2HN7B 3IF1A 4QXUH 5EFIA 5JLZB 4AQ1B 4MCYB 4BQ6A 1JF5A 2DLFH 4JDTH 3KDMA 3TM6A 1H5BC 4WWKC 5IROA 3ZKMC 3HE6D 2IANE 2MQ3A 4O00A 2P43B 5DRWA 5GGRY 3ZYJA 5DJYA 5A1AA 4FXGA 3BE1H 3NFSH 2YD3A 4UNTA 1CL7I 2ZCLH 1XGQA 2XICA 3TBVA 1C1EH 1JWUA 4ODVL 1A9EB 4Z78B 2HMIC 3U4BH 4OCXH 5FV2A 1FVEA 4M6OL 3FN0L 3AREC 5BO1H 2A6JB 2J8UF 5FUZL 1CQYA 5IBTL 4MHHI 2J7LA 2YXFA 5TDPA 4Q0XL 4NWTL 5JNYB 5HI3C 2NY2D 4U1LB 1HH6B 1MQ8A 4UQ3B 3PWJB 1K4CB 4HF5L 3QDMA 2DQEL 2V5MA 1Z9LA 5IQ9B 4RMVA 1OAKL 3HE7B 3PXHA 4ETQB 3ISWA 3DBXB 2X42A 3MGOB 5BCAA 2X4UA 5IB3A 4QWWC 5CSZA 1FVDB 3GSUA 4U1IA 3HAEA 4DQOH 1F4YH 1XF4A 3HE7D 5D7KE 2V2TA 4AYFA 1AGCB 3KYMB 4R4NC 3KPSA 4LEXL 3CVHH 2HFEA 2G75B 5M95B 3QFJB 3ARSA 1FO0L 5JR1L 1K2DB 4X4XB 4UOW0 1JMXA 1H9VA 3Q5OA 2BRRH 4WW1A 5IW3A 1T6VN 3VWKC 1BQSA 1MCRA 4KY1H 3U36A 3QCUH 4YR6A 3QJFA 5EC2B 4AM0B 5D2LB 4I9WE 3REVB 1RIHH 4LPUA 2ADJB 1U8IB 5D7IB 3T0XA 4M7LL 2MCPH 3QAZB 4M7ZC 3P73A 4GW1B 5AZ2H 4QTIH 2DTSA 1RK1A 1HHJB 3MV9E 2GKIA 4OZHB 3QDJE 3IJHA 4WFEE 5FXCH 1N7ML 1HYSC 4LLQB 3QNZB 5BOZG 3NCCB 4JAMA 1BWWA 4P2QB 3I85A 1OSPL 4QEGA 4WTZG 4TNVK 3B3IB 4LLUA 2E9WA 4JO4L 3H9HB 4Y5VA 2AK4A 4XPBL 2ZSWA 4OLXH 5CLWA 1EHNA 1PX3A 2XYCA 4ELMA 3RNQA 5E2VL 5TDNA 1KF9B 4EDXB 5D6DA 1XGPB 3RDTA 1NCBH 1P2CA 2UWEB 3KGRA 4KVNH 2QSVA 4NKMA 2YC1A 5HPOA 4P46A 1S7WB 4YXHL 2F74B 3VXNB 1U8MA 5CIPB 3ZKND 3UAJD 2QJDA 5CGMA 1U3HB 2DMKA 3EOAA 4QOKA 4LL9A 5L7XH 4HAGA 1WCQA 4HWZB 4G6AD 4RMQA 4P49A 3P9WB 4JZJA 3VFTB 2C3XA 2I9LB 3UC0L 3RY6C 4G9FB 3QXDA 4HK0A 4BA8A 3HUJE 3SKJL 3S37X 5A16A 2V2WA 3C6LB 3MJ6A 3VRLE 2IQ9H 5IFAH 2X9XA 1BF8A 3UTZA 1EVUA 5EO1B 2JB5L 1U8NB 3FQNA 3U30C 1L9MA 1U8OA 3VGEA 3C2AL 3JV6A 1IMHC 3K46A 2MWCA 3GB7B 3QA3A 4EZMA 3PWUB 1AE6H 1K8IA 4AEEA 2NY2C 1YECH 4NQCE 1T1WB 1LEIB 4LRIA 2AJYL 3MXWL 1PX4A 2GSIA 3PXJA 5SX5K 5JW4M 1JP5A 3QXAA 4O51A 4M62L 1QBLH 5HGAB 1A1OB 1MFCH 2FATL 4JQXA 1NAMA 3CH8A 3JWDL 4MQSB 1T89A 1YPZB 4CADB 5HGBB 1MLBB 3U0PB 4QCIA 5EUOE 1D5IL 2BSSA 5F88A 5C0RL 1FV1B 4HKBA 2L7UA 3HE7C 5E1AA 3S4SG 4I0PD 2A1WH 1YDPA 1J1PL 3D2UB 4Y5YB 2A73B 3WNMA 1D9KA 2ICEA 1RQ5A 4KTYA 1AI1H 5C0CA 4AT6A 4YO0B 2BFVL 2VUYA 4KZEH 3K0WA 2AS5M 2J3SA 5E56A 5ICXA 1IGTA 3CFKA 4JM2D 4JN2A 2CKBH 2GK0B 4RBPH 3VXRB 3ZYZA 5JOPD 3S88L 5D1XA 1CQKA 1XF5B 1KJMB 4EUPA 4Z7NF 5IV2A 3KXFA 1KPUB 2W9EH 4JZOB 5GSRA 3HZYA 2NYYD 1D5XA 5CCKL 4JHWH 2HWZL 4X4YA 5JZ7D 3QQ9D 4ETYA 4F7CB 3QAZC 5BRZA 5I1IL 5E99H 3HTLX 3TH4T 1AP2B 3NA4A 4Y2DD 4Z76A 2DDQH 2NY6D 1AQKH 1FNGB 4PJ5D 2CDEA 1F11B 1UXWB 4Y4FA 5SWSA 2VDKH 4HWEL 3JVGC 4RWYH 3ARDB 1JGVH 4PREA 1LP9E 4AL8L 3GMMB 2WQ8A 3JWNC 4WUUB 2OM5A 3FQRB 1KJ2L 3ALPA 1HCFX 4DKDC 4RGOH 1OM3H 3UMTA 4LCCA 2FLBT 1BFVH 3ZL4L 5C7XL 2X9YA 4TSCH 1BEYH 5FK9A 3BP6B 4GOSA 4Z7WF 2E7LA 3KNBA 1SYVA 1M6OB 4Z77A 2OL3L 3ZKNC 5JPMA 1NEZA 3C5JA 3UAJC 3LV3B 3MV7D 1UM6L 3V4VL 1TVBB 2EYRA 3L6FA 4G6AC 1I85C 2DQCH 3CPLB 5E8OB 3FB8B 4DN3L 2YWYA 2YBRB 5F9DC 3RWHA 4OLWL 1GGCL 4MD4A 4BFIB 2AABH 1YEIH 3KHQA 2DQFA 2IBBA 2UUDK 1L7IH 3MYZA 5FCSH 4CN6A 4I8DA 2Z31B 3PF2A 2IADB 4OLUH 5I1LB 5FYJH 2ZCHH 4F37F 5ICYA 4NKOB 5FA4B 1ZS8A 4L8BA 2OR7A 3ZDZE 1IEBA 5HDBF 1Q0YH 3C6LC 1FNHA 1WZLA 3IDIA 4XB7A 4P5TB 2WBJB 5FO7A 5I1GH 1A4KB 2KQMA 1QRKA 5C0JA 4OV6F 2OX5A 1V5JA 2ZJSL 1CGSH 3Q1SH 4HS8H 4A6YA 1FH5H 4JANB 4CGTA 4M8VA 4LU5L 2CSPA 2E27H 2P5WE 2Z93A 3DVNA 3V6OE 4EI6B 4Q58C 4Z0XA 4J4PA 3LKNA 1ZHBB 4JRYA 4APQD 1U8QB 4QXTB 2Y7QA 1HI6B 4U1KB 2R8SH 1P7QA 3BVNB 1NSNL 5JA8B 1U95A 1OQXA 3EYFA 1C5BL 5T1MA 5GQBA 3SDCD 4Y16A 4HEME 5KSBA 5KVMC 3ULUL 1WK0A 1N5AA 1JGEB 3IU3B 2FSEB 4NOFA 1II4E 2GAZB 5GHWL 5DD0L 4BQ9A 1NBVH 1S3KL 4Y88A 3H7LA 1CICD 4P3DB 2CIIB 3MLWL 3O2DH 3FB7B 4S1SH 4UTAL 1OF2A 5DUPL 3K4DA 1KPVA 3FO9B 4GUPB 5KSUA 3SDXF 2NYYC 4NZUH 1DBJH 4UQ2B 3O4LA 5JZ7C 3G5YB 3QDJB 2DM4A 4NN7C 1HEZA 4PRHB 3QB7C 4FP8H 3TYFB 4Y2DC 2CR6A 2CD0A 3JTTA 3G6JE 4GW5A 2NY6C 1AGDB 5DHYB 1NCTA 5ADOH 4PRHD 4CNIB 5EN2A 4OZFH 3WNOA 3T1FA 3QR2A 1TCRA 2X05A 1ZVYA 3JTSB 1CD1A 2IG2L 1J8KA 3RUGA 5F3HA 3BP7A 5HHNB 5DRZA 4LPTA 3GSOA 5IB4B 4KMTL 4BSJA 5E5MA 5EPMA 3HCVB 2FX8L 4TQEH 1J18A 3ARQA 4XPHL 2V7NA 4LSUH 3S36H 1RZGA 4JKLA 5GRVL 5GGVY 3UTPE 4G5ZL 4C58B 2DWEB 5I1HL 2UZIL 4NHCL 1MHCB 3KPQB 3TO4B 1EBPA 3X3FL 1ZAGA 5C3LD 5KN5B 2GW5A 3V5DA 3WIHA 2C26A 4NKDA 4DKEH 5AG8A 3RBGA 3LQZB 3MLXL 5ESQB 3FJTA 1FFRA 2RQ8A 5LCVH 1PG7H 1N0XL 2MPAH 1Y0LA 2H3NB 2IPKB 2JCCE 1FFNA 3EJYD 4DVBA 3MREA 3D6GA 4X7TB 4YHIA 3BO8A 1E28A 1H8SA 1HWGB 4R97B 3BQUB 1BQLH 1LK2A 3AM8C 4FXLA 4JFQB 4UU9B 3GO1H 1IGJA 4YNYB 1F02I 3TYGL 1PKOA 3VFPA 4OCYL 4MZ3A 5EBWB 4M3KB 1NFDF 3OKOA 4EIZC 1L4IA 4KJQD 1C5DA 3GUTA 3MRLA 4PG9B 5FGRA 4Z7QF 3ME0A 4BUGA 3KPOA 4JFYB 5ERWA 1A1MA 5ACZB 5IUSA 1FLRL 5KVGL 2R4SH 3DURB 3VFMA 2B7DT 3KJ6H 3GRWH 4XPGH 4C4KT 4XCYA 5D1ZB 3NPSB 3FT3A 1GXEA 4HCRA 3V0WL 3IDYB 3VXUD 3SDCC 3V5HA 5JO5B 5FYKL 1UQSA 3WIIH 1QTYT 1ZLSH 5D1ZD 5EWIL 1S7QB 4TULL 1KIQA 1MHHA 2EKJA 1YN7B 4PRDA 1I7UB 1R5IB 2V5RA 1EHAA 1KB9J 2D31B 1PQZB 1UKTA 4ODBD 1R3KA 2DQGL 2NY5H 1VGKB 4Z7UE 3V52L 1CICC 2JE8A 2OTPA 1CCZA 2QQKH 1A7BA 3IETB 3OPZH 3U9PL 1BIIA 3LKQA 3MLUH 1UYWL 3TPKA 3NN8A 1S9YB 1QG3A 3CD4A 4L1HA 1JZ4A 4J23A 1MCQA 1WQVT 1SM3L 3L7FB 4JLRA 1U6AH 4PJXF 4N90D 1MI5D 1N5YL 4L8SA 3HZMA 1JI1A 4LNRB 1KXVC 3BPOB 4M4RA 2NY4D 3O11B 1L6ZA 1LP9B 5IOPB 5EZLA 3WL9A 2GITA 2WLYA 2FECL 1YNTA 4XBPB 1HKLH 4P2OB 4X7EC 4YHYC 1WC7B 4I3RL 1MUJA 5DMIL 5I15L 2D4FA 3VFGH 1TETH 4KTEL 4I5BA 2DAVA 2K9UA 1LO5B 3ARFA 4OTXH 3IFPB 4B53A 1T1YB 5F7DB 5J1AA 2AVGA 4UILH 5GRVK 5J6HB 2VXUH 3OGCB 1UM4H 3BYTA 4YX2H 1ORQB 1CTNA 2EZ0C 2OJEA 2J8UE 4CKVX 4W6WB 5HYSA 3MLZH 1RIUH 3L1OL 3PGFH 5ALCH 4ZMAT 3EJYC 1F4AA 1AQDB 4JN1H 4PJBF 5CKAA 2F19L 3EO0A 2DQHL 2ZNXA 4M9PA 4QRUA 3I02A 5T3XD 1NGYB 1VEPA 1CGWA 3OJ2C 4O9HH 3FFCD 4NJAH 5E8EA 3V7AG 1JPSH 4N9OB 2NXZB 2ESVE 3GHBL 4CN4A 2W60B 3GI9H 1CT8B 4NCDA 5T1KB 2F8OA 1RVFH 1DBBL 5FUOH 4R97C 4YEFA 2E6QA 4MNHA 3I50H 4JFDE 4H0HB 3FOMA 4KJQC 4HIIB 1U92B 1CGVA 4XBEH 4MCZB 5T1KD 3TT1L 2F5AL 3R06A 4I13B 1Q9KA 3GKWH 1QBBA 5C0BD 5AYUH 4WVRA 1WZMA 4LLVA 2CMRH 4U6YB 1F8TL 4LHJB 2DLTA 1C08A 5HHPB 3TLRA 4E42B 3D18A 4UNVA 3U83A 5I1DB 4OSUH 4Z7VA 5KAQF 5T1LD 5JOFA 1GGIL 1GC1L 2AJZB 1F90H 1KLUA 5C0AA 4MYWB 2JELH 2VLJA 1J1XH 1EEQA 2EDRA 4GKNB 1DQLL 1HSBA 3R4DA 5D1ZC 4EN3D 3NPSC 4M61A 4OZGF 3ALXA 3B5HA 4QRSA 4MXWL 2B20A 2MHAB 4ZO8A 5D7LA 1MWAB 4QLRA 3M8OL 3CAFA 4IMKC 4N1CA 4YGVA 2RR3A 3O6ML 3O8XB 5TE7H 3OKNB 4OT1H 5D5MA 3C08H 1IILE 4KVCH 1GSMA 3MRGB 2EO1A 2HN7A 1L6XA 1J88A 2VRAA 5JLZA 5DEFB 3MBXL 1IKNA 4MCYA 2BOBB 4Q74A 1Q72H 2O61B 2O26U 3RWDB 3KHOA 3TNMB 1XF2B 4LP5A 4NZJA 3KLAB 3G6JB 2R0WH 2J5LC 3T2QA 4RSVA 5DURD 3GBNL 1KFAL 4JPKL 3VMOA 1A7PL 1XIWD 2NY4C 4M93B 1Z9MA 4Z78A 1A9EA 4J3SA 5IB5A 3ARBB 4GSDH 3LKOB 5FDWB 3T3PF 3IDUA 1AIFB 2UYLB 1M71B 1WWBX 1CVSC 3PQYE 2A6JA 2J4WL 3G08B 5I17B 5HHQB 1VFMA 2XOTA 4GLRI 2A6IB 3QYCA 4I3GA 4P2OC 1OL0A 2ZUYA 5D2NE 5JNYA 4HZLB 4DK3A 3QJHA 1HH9B 1SEQL 2JJSC 3QXTA 4U1LA 1HH6A 4W81A 5SV4A 4KHTH 3FHQA 4UQ3A 2XXCB 3PWJA 3T2OA 1K4CA 3C5ZD 3HHRB 4UT9L 5IQ9A 2DQDL 4OCLC 3DX8B 1NUDA 3HE7A 4ETQA 2HVKB 2WUBL 4XP1L 1T2XA 2JCCB 1FVDA 1ZK9A 4ZAKD 2VC2L 4ZQKB 1IAIL 4G42A 3WFBH 3KYMA 2UZXB 3K3QA 4JFEE 5CILH 2ZUUA 4XPTH 2NZ9D 5C6WH 4KKCD 4ZXBB 1Z3GH 1G7HB 3IFLH 3QFJA 1TZHB 5F1SA 3HRPA 5FYJE 1K2DA 3TA3D 4X4XA 1GZPB 4AEIH 4BQCA 2LTQC 2IGFH 4J6RL 4ZXBD 1UACH 5EC2A 4WRLA 4AM0A 5D2LA 3CDGB 1PEZA 3VU2A 4HT1H 1EUUA 3REVA 4UBDD 4ONGH 3HPJB 4H8WL 4FQXB 2ADJA 2XWBB 1U8IA 2AEQL 2DQJL 5D7IA 5GRZA 5BVPL 2IMNA 4UDUB 1HHJA 2VABB 1IC1A 1OCWL 3QIWB 1X3DA 5GRWA 4LLQA 5IBUG 5ADPL 3QNZA 5E8NB 1HYRC 5HDLA 4LSSH 4PLNC 4P2QA 5I30H 4XCFL 3K7UA 4MJIE 2LVEA 3B3IA 5DR5L 4EN3C 5I19H 1MAML 3H9HA 4Z7NE 3NCYS 4HC1L 4QTHB 1MPAH 4UZGA 5HYQB 2J1KA 2NY0D 4KK9D 4Z7UB 4D9RD 1ZVSB 3CVHB 1W72L 4EDXA 4AENB 3GBMH 3U7WL 1XGPA 3U2SB 2XY2A 1QFUH 1KIRB 4EBQL 2AJXH 5CEZH 4X7CC 2UWEA 5GRJH 2Z4QB 5CEYB 1WIUA 4X6EB 1S7WA 2F74A 5E2JA 3VXNA 5CIPA 2ZPKL 3O8XC 5C08E 4JFFB 5ANMA 1OPGL 1U3HA 4RMTA 5E2TL 4B50A 5IVZB 4XNMB 2LABA 3UROR 1S7TB 4HWZA 4JFFD 1BBJB 4MA7H 2EE9A 5DMJB 3VFTA 5IMLB 2I9LA 4WNQB 4G9FA 1RULH 1XIWC 3P0YH 4WI7A 3HI1A 5IMOB 1T2JA 1G9MH 3C6LA 1J1OH 4UIMB 3H6JA 4MLSA 2JJWA 4YXLH 1FCCA 5EO1A 1U8NA 3DVGB 5J7CC 2XT1B 4LLWB 1IQWL 4X98B 4TTGA 1RUQL 1E4KA 3GB7A 1N6QH 3PWUA 5I8CB 4LSQH 1YUHB 1X5LA 1MNUH 4UIKH 5HHOD 4U1MB 1LEIA 1MLCB 3PABB 4R0LB 1E6JH 3NZ8B 1I9IL 2X09A 2XPGB 3C5ZC 3EYVB 4E5XB 4LGSB 1MCBA 5HGAA 1WFTA 4QY8B 5HDBE 5D6CA 3DV6B 1A1OA 2J8UB 5EORH 2HKHL 4J3UA 1ZGLB 1YPZA 1YEDB 4CADA 4HWBL 4RISL 5HGBA 1MLBA 3U0PA 3C09C 4L3AA 1HOCA 2P8PA 5IEKB 4UV4L 4ZAKC 1FV1A 2VXQL 4NM4L 1MF2L 4JKMA 4BELD 3M17B 5FOBB 5DD3H 3D2UA 2NZ9C 4Y5YA 1U36A 4FS0A 2A73A 1G0YR 5EBLB 2AERT 1Z5LA 1S9WB 2ESVB 3WSQL 2A77H 4L9LB 5CLTA 3ET9F 3TA3C 3QUML 4FN0A 4YO0A 1U8PB 5MEOB 4ZXBC 4KPHL 3HG1D 4JFDB 2GK0A 4O58H 3VXRA 4UBDC 1XF5A 1EA9C 1KJMA 1MCDA 3PGCB 5IFHH 5DRNB 4JZOA 1INEL 1F6FB 2VLME 3SGJA 3BDBA 3LZFH 1CF8H 2D7OA 5FHAL 1WFUA 4F7CA 2WWMD 1NANH 4F9PC 1AP2A 4I1NB 4NIKB 3QIWC 2BVYA 1SMAA 3N9GL 4XPAL 1FNGA 1PLGL 3M45A 4OKVB 1F11A 1UXWA 4HXBH 4LIQL 5FO8B 2QTEA 3ARDA 5IG7B 3B6SB 4U0QB 3Q5YA 3SDXE 3GMMA 4WUUA 4KV5F 3GMQB 2NY0C 3FQRA 3BEWB 3GM0A 4KK9C 3WO3B 3E6FB 4G3YL 1GGTA 3NPZB 4WJ5B 4ZFGH 1MHPL 3OJMB 2WWKT 5LQBH 4RA3A 4LF3B 1UM5L 1V3LA 2CKBB 1G6RH 5TQ0H 1BJMA 4XMLH 3IJSB 3SGKC 4R6UA 1YZZA 3VD7A 1YEEH 1NJ9B 4IHOB 2W0PA 3CPLA 5E8OA 3FB8A 2YBRA 4TPRH 3F58H 4BFIA 3TWCH 1KCVH 2H9GB 3RTQB 4LSDA 2Z31A 2IADA 3GSWB 5I1LA 5E00B 3BRGC 1RZKC 4NKOA 5FA4A 3ARGB 2X1PA 3BKJL 3TNNB 4TUJB 4KTDL 4U1NB 3UTTE 2FZ3B 3PQYB 1F00I 1MIML 3L7EB 4P5TA 3OZ9H 3B9KD 3VGGA 2WBJA 3UX9B 1A4KA 1A6VL 4HFWA 4F57L 1B6DA 5DMYA 5D2NB 2YN3A 1CU4L 3RVUD 1A14H 2DQUL 2H45A 3JXAA 4JANA 1R5WB 4KZDL 4EI6A 2C1OB 3NAAH 1FSKC 1J5OH 2CK0H 1ZHBA 4PJ7F 1IC7H 4R0LC 4G6FB 1BJ1H 1BZQK 4KK6D 1HI6A 4U1KA 4OFIA 1NDMB 2FEEI 2EDKA 3BVNA 5JOEA 4JY4B 3FQUB 5TF0A 3AU1B 3BEVB 1OP5K 2KKQA 1NFDE 1MEXH 4HIXH 4HUKB 2H32B 2Y06H 3ZT7A 2ENYA 4JFEB 1JGEA 1UH2A 3IU3A 4OCSH 1ACYH 2FSEA 5FYLL 1I3RB 3HNSL 4Z7QE 3E0GA 2GAZA 3E8UH 3IDMB 3S9DB 1JGLH 1A6WH 3DO7B 4P3DA 2CIIA 4ZOAA 3FB7A 3PP4L 2HFGL 4P4KB 4GUPA 3QCTL 1Q1JL 3ABZA 1F13A 3MV9A 1IGYB 3LKSB 1CD9B 4N8VG 4UQ2A 3G5YA 3QDJA 3U0WH 5JHDE 3JWOC 2WWMC 1SY6L 4QHMA 4YFLI 4M6MH 3T2NH 3UTSE 5ILTL 3QUXD 2LE9A 1N64H 3E3QE 1AGDA 2F53E 3GNMH 5D8JH 5DHYA 3WEXB 4CNIA 3SCMB 2GIYA 4MJIB 3TBTB 5C92A 4LLYB 3JTSA 1S8DB 3TN0D 4F7MA 5HHNA 3IDGB 1HSAB 1NCAH 2FGZA 2XQYK 5E9DD 2NY3D 5IB4A 2HP4A 1QBAA 1TQBB 5HDQH 3HCVA 1X5ZA 1OGTB 1FPTH 1QRNE 1QLFB 4PJXE 1O7VA 1FC1A 4GMTL 5D70L 2YPVL 5C08B 3N85L 2Q6WB 3D39D 2Q7YB 5I8OH 2DWEA 3BGFC 1MHCA 3KPQA 5KSVB 3TO4A 1S5HB 3EW3B 5KN5A 1JI2A 1YEJH 3LQZA 5JA9A 4ODVH 5ESQA 1SYSB 3OMZA 4JY5H 3O0RL 3RX8A 1P4IL 5IJKC 3HUJA 2H3NA 2IPKA 2X41A 3E1F1 4K94L 2Q3AA 4MNGB 3C5SB 1X4YA 1DUZB 3WXVL 4X7TA 3ZZ1A 3R0MA 4UI2A 1A3QA 4P23B 3D3VE 4OZFB 3CNKA 3W0WB 2YPKB 4UINH 4KJYA 1FFOB 2GJ6D 3BQUA 3G5XB 4JFQA 3B9KC 4UU9A 1FNFA 3ARGC 3CIQA 1JPFB 1ZV5A 4XXDB 3W0WD 1UKSA 3NCBB 4G43B 5EBWA 4LKCB 5B38G 3RVUC 4NQCA 5J57B 3HN3A 3L3HB 1D5BB 2DQEH 3KPLB 4V2BA 4X7SH 4PJBE 2Z91B 3GMLB 4FZEH 4QT5B 3U1SL 2X40A 4PG9A 1NLBL 2E7CA 5ELIA 3IJYA 3IDNB 4JFYA 4KK6C 1EGJA 5L0QB 4M48H 1YY8B 4XVTH 4NRXB 5MERB 1K8DB 4ZUUA 1CE6B 4ELKB 3DURA 5EUOA 5IEHB 5SWZE 1JFQL 2X10A 4NWUL 4TTDD 3JUYA 5GRUH 2XZAL 5CD3B 3BKML 1KCRL 1A22B 2NY1D 1S7QA 4IMKA 4URTB 3VI4F 1C8PA 1I7UA 1AXSB 1CZ8L 2D31A 5LVEA 3MRIB 1PQZA 1CXKA 1VGKA 3MZTA 3LD8B 2NLJB 1S9KC 1ZANH 3P9MB 1I8LA 3SQOH 2B1HL 1WEJL 3IS0X 4ZSOE 3WFZA 1C5CL 2HRPH 1FG2A 4OFDA 2ZG2A 3IETA 4FFVD 3LH2H 2ZOLB 3WN5B 1N7MH 4FQ2L 3N0PB 4HG4K 4JVWA 4ODWB 3MLPA 4H20H 1S9YA 2Y5EA 4OZGE 5F89B 3ZHDA 3EUUA 5DD5H 4C83B 4K7PL 5GIRB 4FQJH 3L7FA 1M7DB 4D2NA 1MAJA 4XAWL 1GYAA 4MJ6B 1XZ0B 3ULVE 3TH2T 3GSNA 4JPVL 4XWGL 1QSVA 3HNTH 4MLIA 2VN4A 4LNRA 4CVXB 5HYFA 3TN0C 3S5LG 4MX7B 3O11A 1LP9A 1KB9K 4PJCB 1T3FB 2ATPB 3SDXB 1ND0B 3TPUB 5IOPA 5C09D 2P8MA 3O81A 4GS7B 1BBDH 4XBPA 5T5NG 2H1PH 4P2OA 4X4ME 1H3TA 2DBLL 2NY3C 1WC7A 2XWTA 3P0GB 4IM8A 4P99A 5B8CC 1NGPL 1HQRB 3QZWB 5C0GA 3DRQB 2JJSA 1BGXH 5DUBB 4ZTOL 3INUL 3FO0L 1LO5A 2AEIT 1TQBC 3IFPA 1T1YA 1WUNT 1CBVL 5CEZE 4DEPB 3QNXB 5DUMH 5J6HA 3OGCA 3UC0H 4DJMA 3T3PE 1UFUA 3MC0A 4CVZB 1ORQA 4GAJL 5BMFL 4W70A 1TJGH 1FBIH 3CX5J 3P11L 2NMSA 1RIVH 2JJUA 1I4FB 3VXME 3WUWB 2DD8L 2JB5H 1WCBB 4MB3A 1FDLL 4KXZI 4NJ9H 2FO4B 5CINH 3UTTB 3KPRD 4L3CB 4XCNB 2DIJA 1I1AD 1NL0L 5I75C 4M9OA 2W60A 2IBZY 1CT8A 3SN6N 5GS2H 2EECA 5IF0B 3CK0H 4HIIA 4MCZA 4DCQB 2PW1B 2FATH 5C71A 3V6OA 4J2XA 5DHXB 1FIGH 4AEHL 5IWLC 4U6YA 3UZVB 2XQYG 5EIVA 5HHPA 1EBAA 2NX5B 3RBSA 5HGDB 3O3EB 3ESVF 3C2SA 5I1DA 2EXWC 2UV3A 5L0QC 2AJZA 1NFDB 3TV3L 2W1NA 4NO0B 4R4FH 4Q6YA 4RGMC 5LBSH 5J12C 3VI3F 2NX5D 5E2WL 3L3GB 4HJ0D 4GKNA 1YY9D 2NY1C 2E3VA 4HGMA 1ZLUH 2CO6B 4YHLL 1MCWM 1KENL 3BKYH 4N5ED 2MHAA 3S88H 1JV5B 1MWAA 1F3JB 2QKIB 4ZTPH 1YNLL 1MVUB 4GH7B 3O8XA 4GMSH 1SQ2N 1KCSL 1EFXD 4FA8A 3OKNA 4HFUL 8FABB 5CCKH 3HAEH 1B90A 4YC2C 2EDJA 3LD8C 3T0BA 1VPOH 2DI7A 3MRGA 5E4EB 4X9HA 3OAZH 4Z0BH 2BOBA 4UT6H 5JHDB 5GGSB 2O61A 3SKUD 3RWDA 3WN5C 1EO7A 3UTSB 4OI9A 3QWRA 1N4XH 1P9MC 1XF2A 2EH8H 3KLAA 3G6JA 5J8OA 4HWEH 2VNCA 4JDVB 1FNEB 5TH2B 3B5TA 1T0MB 4ZFFA 2ICWB 1UA6H 2E5EA 2X44D 1RZJL 5L2KD 4TVPH 1KJ2H 3KLSA 1FGNH 2YPLE 3ARBA 4NQUA 3K81A 1EFQA 3DYOA 1FAKT 3LKOA 2VXSL 4YK4C 1AIFA 5C7XH 2EO9A 2UYLA 5CHNB 1M71A 5J9PB 4XT1C 3MR9B 3G08A 5I17A 5HHQA 2YKLL 5DS8B 2D7TL 4NQXB 4GS7C 1VHPA 5ESVB 2A6IA 2IF7A 1QPXA 3VXSE 1UM6H 5CFHA 4PJXB 3I6LE 1RHFA 4HZLA 4AMKL 1HH9A 2JJTC 4MNQE 1AGFB 1MCKA 1U42A 3CH1B 4OLWH 1GGCH 3EKCA 1Y6NR 1DBKL 5T5FH 3VWJB 1BF2A 3BD5A 3UEZA 4DEPC 3DX8A 1NANI 1QSEE 1H3UA 2HVKA 3FRPG 2HG5B 4Q6IB 4IRSB 4X80L 1FNLA 1IGMH 2JCCA 4OB5L 1Q9OB 4EIGB 4ZQKA 1QZ1A 5DT1H 3D3VB 4IRSD 2HFFB 4HJJH 5D7KD 1C7SA 2IPTH 1G7HA 2D03L 3A6BL 4K07A 2CLZB 5I1JH 3BRFA 1NKRA 5JPNB 2FGWH 3DTXB 4U0RB 4WEBL 5I2IB 4KDTA 4LU5H 3CDGA 1FQ9C 1U2CA 2GTWB 3HPJA 4FQXA 2XWBA 5BS0B 4PJEB 5IHZB 4DGYH 3FB5A 5T3XL 4LASL 3GSQB 4LGRB 2JK5B 3MRRB 2VABA 1MQKH 3QIWA 2Q3ZA 1J0JA 4PBVC 2X2YA 1A7RL 5SWZB 2ZKHL 4PJDF 2VDML 3THML 4XPFL 3DSFH 1WF5A 2EXYD 2OJZH 1QFHA 3KWWB 4HJ0C 5MP6L 4JZNB 1YY9C 3STZB 3RPKA 3B9DA 3S37L 2HRLA 5GHWH 5DD0H 4U6VH 1U91B 3FONB 3NH7L 2Y6SD 4N5EC 4QTHA 4H88H 2MSPA 1PFCA 2VYRE 2YN5A 3QH3B 4TOYH 5HYQA 4Z7UA 5DUPH 1NAMH 1ZVSA 3CVHA 4G80B 4AENA 5BZDA 3U2SA 1NMBL 5DFTA 1KIRA 4IRZH 1DLHB 3BZ4B 2GK2A 1QO3B 2Z4QA 4WHYH 4XB8A 4ZS7L 3TBYA 3VW3H 5CEYA 5D7JB 3H9SD 1QVOB 4X6EA 3LMJH 2R9HD 1KC5L 4JFFA 1HWHB 3P40A 2FDBP 4FABL 1QQDB 5AWNL 1A6TB 4OZGB 4XNMA 5IVZA 4JQIL 1VB9A 1S7TA 5CGYC 1TITA 4KV5E 4K23L 4K8RD 5E8DL 1BBJA 3OF6D 5EOCJ 5IMLA 5E7BA 4WNQA 1A6AB 2X7LB 4EUPH 5IMOA 5HGHB 3QHZL 4KMTH 4UIMA 1KB5L 4F15C 3KR3L 2DYPD 3QO1B 4YWGH 3DVGA 3DXAE 4CMMB 3I9GL 4LLWA 4X98A 3KYOA 3U82B 2G9HA 4OGXL 3PWPD 5I1HH 2UZIH 2WNGA 5I8CA 3UXFA 1YUHA 1P5UA 1ZHKB 3CSPA 4U1MA 1MLCA 3PABA 3U7YL 3AS1A 4NM8H 1X44A 3UJIH 2BSTB 1PKQE 3DMMD 1AGEA 3NZ8A 5EBMB 3IAGC 2V9TA 2XPGA 3EYVA 4D9LL 4E5XA 1RMFH 2XV6B 4QY8A 4XMPL 1HNGA 5DRXB 5I71B 4KRNA 3RI5F 3DV6A 2J8UA 4Q9RL 4KU1A 3S7GA 1FP5A 4KRPB 1ZGLA 1JNNL 1T4KB 1YEDA 5F7YC 1JPST 5IEKA 5D7SH 2LQRA 1BOGB 4Q6IC 3QDHA 4QRRD 1MFEH 2IALB 4JPIB 4IRSC 3M17A 3W2DL 3TYGH 1I9JL 3NBNA 5EBLA 4HH8A 3AUVA 3QO0B 1S9WA 1MCPL 4OCYH 4YZFF 2ESVA 4LCWB 3RUGF 4GRWH 3RPIB 1IQDB 4L9LA 3RU8H 3WKMH 4PJ7E 3QIUD 2QEJA 2QQNL 1U8PA 2KPNA 5MEOA 3GJFB 5ABDE 5SWQB 4PY7B 4JFDA 3C87A 5LGJB 4LCWD 4OD2B 1YQVH 1QFWL 1YMMB 2Z35B 3T0EE 3PGCA 5DRNA 4X7FC 4XAKE 4QKXB 3P4LA 4JQVC 1YMMD 3TIEB 4BH7B 2YRPA 4PJ9D 4JVUA 5KSAB 5L8KB 3ZMRA 2EXYC 4G6KL 1QSFE 4XC1L 4A6YH 1EEUA 3MLSH 2XN9D 1DQMH 3BWAB 1FFPB 1HK6A 5FO8A 2DQGH 4OGAD 5IG7A 2BY3A 1PG7W 2Y6SC 1YEHH 3IYLW 4MQTB 3D0LB 3GMQA 2FB4L 4HXAL 3E6FA 4WHTA 1OAZL 2R2CA 4U6TA 4WJ5A 1ZT7A 3PDGA 4BM7A 4FNLL 1IGIH 4NNYB 4YBLC 3SO3B 5DJZB 2BNUA 3TFKD 1CDCA 2R9HC 3RA7L 4EQ3A 3SE4C 4TYUA 4LF3A 4Y2OA 3HI5H 4M43H 4K71B 2CKBA 2D0HA 3S3SA 1SM3H 3VDCA 5D7JC 4GG6F 1NJ9A 3CZFB 3TESA 4IHOA 3BZDA 4K8RC 3MJ9A 1R3HB 2ICWJ 5GGQL 1HINL 4JRWA 5F1OB 1QLRB 4B41A 1YQ2A 1OAUH 3RTQA 1WZ1H 3MNWB 1EERB 4I3RH 4Y4HD 1JHLH 5E00A 5ITBL 4O2EB 3ARGA 2OYPA 2UY7A 2ID5A 4TUJA 4G6JH 4U1NA 2FZ3A 3HAEG 3PQYA 3L7EA 4BZ2L 4I0CC 5I1EH 5A2JH 3FMGL 4Q9BA 2APTA 5T3ZD 5GGRB 1BQUA 2A74B 5D2NA 4FTVE 4GXUM 2OZ4A 3L5XH 4DGIL 4J8RB 3DMMC 1R5WA 4J3VA 1RZKL 2C1OA 2ERJB 4F33B 1DANU 2XA8L 4LP4A 2P5WD 4ZO6A 1E4XL 3FQWB 1VADB 4BK4A 2DQHH 1NDMA 5E6IB 5TJWK 2CUMA 1T20B 4CU6A 2W0KA 4JFOB 3TCLA 1IFHL 1TXKA 5GJTL 4JY4A 3FQUA 4U3HA 1A7QL 3LDBC 4I2XE 3AU1A 3BEVA 2N1KA 5GZOD 1ZE3C 4KRPC 3RIFK 5KJRL 2PR4H 4JFEA 4Y1AD 4Q9QL 4KROD 2R1WB 3QIUC 1I3RA 3WS3B 2AQ3A 2VDLH 4YDIH 3IDMA 4L1DA 3DO7A 4NQEB 4NO2B 1H3PL 4P4KA 3WUZA 4PB0L 2P7TB 5FCUL 3O2WL 3G5VB 4NQED 4MVBD 4J3OC 1IGYA 3LKSA 2OI9C 4PTTB 4IS6B 1CE1L 1GC1H 3VI4E 1PYWA 3H0TB 1VFAA 4ODHL 2R2BB 3MRQB 2DOCA 1DQLH 4AG4H 1OHQA 4HK3J 3WEXA 3SCMA 4MJIA 3TBTA 4LLYA 4ZD3H 1REIA 4QF1B 2P8LB 2MNUA 1S8DA 1LVEA 3L5WB 4OGAC 3K4AA 1CG9B 1QBML 4LVEA 1GAFH 1KCUL 2W38A 2BZDA 1HSAA 3O6MH 1K9TA 3JWOL 3PWNB 3S36X 3U4EB 2VLKE 4OFPA 1CN4A 5E2UL 3OAUL 4NC1C 3BPCA 1WWAX 5GGUB 1OGTA 1RU9H 4GRMB 1QLFA 3CFBB 4HCRH 3TFKC 1JPTL 4Y5XB 1HDMB 5C08A 3CLEH 2Q6WA 4N0YH 2Q7YA 1PG7X 4O5LL 3UTPD 2FX9L 2XZZA 5KSVA 3WD5H 1MSPA 1S5HA 2X1QA 1JNHA 1MIEH 4R4BB 2QQQA 3KPSE 2DM7A 1ERNA 1SYSA 2ZZUT 1Z0MA 4OUOA 2R23B 4F58L 3QWOB 1UCBH 4GAGL 4MNGA 3C5SA 1DUZA 5BV7L 4P23A 4OZFA 2BSRB 3BUYB 3VGAB 5CJXC 1FFOA 3DXAB 4TVPE 5KZCB 1WZKA 4FFYL 5TF1H 3HMXH 2BY0A 4XXDA 3BRDA 4G43A 1JRHL 5CEXB 3L5HA 4LKCA 3H3KA 4OLYL 3IB4A 1DSFH 3L3HA 1D5BA 5IWLA 5EZIL 3KPLA 3VXOB 1PKQB 2FWOB 3QISA 3SBWC 2Z91A 1MRCH 2DQDH 3HA0A 3GMLA 4QT5A 4OF7A 1I1YB 3B43A 1H3WM 2PF6A 4RFOH 3IDNA 1BVLB 3KPMB 2B2XH 1MFDH 1YY8A 1KSRA 4NRXA 5MERA 1K8DA 4ELKA 2UY6A 5T1DH 3NCYP 3RVTD 5GZOC 5ETUB 4HIHB 3CMGA 4KI5D 1FJ1B 2B0SL 2Z0BA 4R90H 5GS0H 5CD3A 3A6CL 2QL1A 2Y5TB 4Y19B 4DW2L 5F9OH 3ZSSA 5EIIB 1RZFH 1PY4A 4RFEB 4PJ8D 2A9NL 4KROC 3L3DB 4J6RH 2EDEA 3SDAB 2HTLD 1AXSA 1RUPL 3MLYL 1S7SB 3MRIA 2NLJA 2DQJH 3AY4A 4EXPX 3P9MA 4BZYA 3SDAD 1NDGB 1P7KB 5C9JB 1QEWB 2AI0L 3T0EB 1OCWH 2ZOLA 3WN5A 4MVBC 3R1GL 3BW9B 3LVEA 1GGBL 5DI8B 4ODWA 2R2EB 3GK8L 4NFDA 3HNVH 1TTUA 4K3EH 5F89A 4LHUA 1NLDL 1QFPA 1X4ZA 5D72L 1NEZG 4LLDB 3REWB 4C83A 3O3BB 5GIRA 1M7DA 2AW2A 4IIQC 1MREH 4I77H 1QSFB 1XZ0A 4MJ6A 4GW4B 4Y4KD 1OGAE 3LN4B 3OB0K 4CVXA 3ILQD 4KKNA 5GISL 3NGBB 1SJXA 4YXKH 3GRWA 5E08L 3LOWA 4MX7A 4JO1L 3SDXA 1T3FA 3TPUA 1ND0A 3B9VA 4X8JB 1KXTB 1FO0B 5HI5D 2LAGB 1HQRA 3QZWA 1BP3B 3DRQA 3OBAA 5DUBA 1I8IB 7FABL 3MX0A 4PRPD 3N1QC 4BZ1L 2EEBA 2AXFB 2PTTB 1TDQA 1YA5A 1U93A 4MD0B 5D7IF 3QNXA 1S7XB 3O4OC 4CVZA 2GY5A 1GRWA 4OF3A 1CTOA 2X89D 4JFPB 4OZHF 5I74B 5IQ7L 1I4FA 3WUWA 2IC2A 1T2QL 2YD8A 3IDJB 1A7NL 1WCBA 2FEDD 1IQWH 3FAWA 2RCSL 4LDEB 3V6FB 4YQXL 4X99B 1RZ8B 2FO4A 5HHMD 4PGCB 3UTTA 1OTUD 2WW8A 4L3CA 4XCNA 2XQBL 4NQVB 1RZ7H 1UKQA 3FKUS 3QEQD 1RI8A 1N59B 2HTKD 3DO3A 3V6ZB 4CBPA 4FTVB 2JKXA 1JGUL 3MOBH 1UWGH 3SDDB 3UJTL 5JXEA 4X83A 5IF0A 1CDHA 2ZSVB 3LB6D 2I5YL 3OJVC 5A2LH 4DCQA 4Q7DA 3ECBB 3SKOB 1XGRB 2X70B 3SDDD 4RFNB 4HMCA 1WTLA 2JLLA 4NM4H 4JHAL 1MF2H 3NTCL 4HUVB 5HGDA 3O3EA 4L9DA 1JNLL 5AYQA 3RVTC 1UWEL 4YAQB 4JB9L 4P0DA 1MJ8H 3PNWB 1NFDA 2BY2A 4NO0A 4KI5C 2CDFB 4LCUA 4OCMC 3L3GA 4M5YH 4PJ8C 4WI9A 1PGRB 3WE6B 1P4BL 2HTLC 1A3RL 1JV5A 2R56L 1F3JA 3U7AA 1MVUA 1T5WB 3O6KL 1UCTA 1AFVH 3SDAC 2P49B 4EJ1C 2ZNWA 1DVFD 2PKDA 4O02H 5IR1A 1G9EA 4PJDE 5FHAH 2P5EE 4U3CA 4K7FB 1FCGA 5FEBA 1IKFH 5JHDA 1A6UH 2FNBA 4WV1A 3N9GH 4GG8B 5EOTB 4HLZG 5DWUL 3UTSA 1BREA 1DBAL 3MV8B 3BZEB 5CS7A 3CSGA 1DEEB 4LIQH 1RUMH 4JDVA 3BKCH 4M3JA 1FNEA 4Y4KC 1NH6A 1CXLA 1T0MA 4I0KA 4J3TA 5FKAB 1FE8L 3NMEA 3ILQC 1YPZF 3FL7A 4PUBL 2A0LD 1LWRA 1OAQL 1MFNA 2CR3A 3V8CA 4IEFB 3EYSL 5KOVC 4Y8AA 1G9NH 3FQXB 4HHAB 5CHNA 3NGBC 1MHPH 5HI5C 3MR9A 2VLKB 3UCRA 3ELAT 3IRZA 5DS8A 3SGEI 3ZE1F 4YUEH 5DZNA 1QRNA 1QYGH 5ESVA 4LMQE 4RRPG 1J9CT 4PJXA 1WSST 3UDWC 5HBBA 3MA7B 4LDOB 3FHAA 4HUNB 3EJJX 1AGFA 4FQIL 3CH1A 3D85B 1E4WL 5EOCL 5FGCE 5HYJB 3DHMA 1G7IB 3VWJA 1CLCA 1CS6A 1JZ6A 2X4OB 3DYPA 4YHKH 3D85D 5GJSL