3WFBH

Reduced cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
225
structure length
225
Chain Sequence
EVQLQQSGTVLARPGASVKMSCKASGYSFTSYWMHWVKQRPGQGLEWIGAVYPGNSDTSYNQKFKGKAKLTAVTSASTAYMELSSLTNEDSAVYYCSRSSLDGYYVKNWCFDVWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTRPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment light chain
publication title Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes
pubmed doi rcsb
molecule tags Immune system/oxidoreductase
total genus 42
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2013-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfbH02
4M61A 4G9DA 3VGAC 4NHUA 4I1NB 3SJVA 5B3JE 3EFDH 3FFCE 1IM3B 3VFNA 4XP5H 5L8LB 4YBHA 1CDGA 2GSIB 1ND0B 3MXVH 5DF0A 3S6CA 2W9DH 4JJ5A 2D9QB 1IC4L 4NDMB 1M7IA 5EU3B 1GHFH 4DFIA 1FBIH 1EMTL 3VRIB 4N8PA 5JXEC 3U2SB 5DFTA 1GGUA 4HC1A 5HGDA 3V6FA 3W82A 1CU4H 4AEIH 4OLEA 4ZTOL 1TVBA 4FABL 3JTTB 1U8JB 2OZ4L 3I85A 4OZIF 3OKMB 3PGCA 4J8RA 1GRWA 3H6JA 4I18A 1N5AB 7FABL 4JHWL 3RQ3A 1Q72H 1G7QB 4YDLC 1QFWI 3QCVH 3IDUA 1JNJA 4WFED 1LEKB 1NCBH 4FOMA 4ZS7L 3QRFM 1OTUC 5K9JH 3KNBB 1FVEA 4QNPE 2ZUYA 1I1CA 2VAAB 4JN2B 1KIPA 5A43C 5C0EA 4KC3B 3SCMA 3U46A 3U7AA 2CR3A 4C58B 4DW2L 1TZIA 2SEBA 2NY6D 3NPZB 5HYFA 3RNKB 4U6VH 4HBCL 3I9GH 1QRNE 4JHAH 3BKYL 4XMKH 3A6CL 1TJIH 4IOIB 5J1SC 4Y4KB 4JO4H 3QPQC 4LGPB 4XP9H 1TIUA 4YPGB 3MRBB 1FZMB 1U8IB 3LVEA 3G6JA 1YC7A 5F7YC 5SX5H 4HIEA 2QV2A 4MNHB 5C0AE 2VN7A 3CMOL 3QIBB 4P2QA 3SDCC 5JMRA 3QNYB 1RJZA 1FL6A 5I30L 4Q9RL 1FFRA 3NIDE 3VFPA 5CKAA 1MWAB 1EHNA 5TQ2H 1PBYA 4Y2DC 4AG4L 1G7JB 3RY6C 1MH5B 3GO1H 1CE1L 4GBXD 1U0QA 4TRPL 2D03L 3OB8A 3JTSB 6FABL 4M4PA 1LEIA 4H26A 1R3HA 5DDHB 4R8WH 4DAGH 5IB3A 5IB4A 3NIGE 2XXMB 4QGTA 4XMLH 3D0VB 3X13B 3I6KA 2VQ1A 3QDHA 3A67L 3MV01 4QLRA 5EZJB 2OJEB 4IS6A 5I2IA 5GGUB 2EH8L 4NC1E 5E03A 2IBZY 1GZPA 3EO0A 3K7UA 1MREL 2ZUTA 1IC7H 3O3EA 3IXTA 2FWOA 3TJHD 1S7XA 4YXHL 2Q76B 4EOWH 3ZKSD 3VJ6B 4PJEE 4UU9B 2AEWA 4GXVH 2AJXL 5KSBB 3QDJB 2VISA 2FDBP 3VWKB 3TV3L 1J1OL 3CK0L 2B4CH 3ROLA 5KTEH 2YK1L 5GGSA 3WFBH 3WS3A 1YUHA 1ZWIA 1MJ7H 2VZ3A 1NCDL 4DEPC 1ZE3C 1J11A 2ITDB 4PUBL 1WICA 4P5TD 4Y88A 4FQXC 2MQ0A 4P48A 2J88H 4PJHE 3RVVC 2O5ZL 4PJAE 1QSFE 3E8UL 4YFLF 3MV8E 5AD0B 4OFPA 1A6WL 3ELAT 5CZVL 4QHUB 2HTLD 2IFFL 3TVMC 1XIWC 2X09A 4XWGH 3TJEL 3G5VA 3ZL4L 2W65B 3Q3GA 2F19L 1PY4A 1QLRA 1F4XH 5D5ME 5I1EH 1RU9H 3ARBC 4WFHD 1JGUL 3OG6B 5IBLD 1JPGB 3AU1A 5T33H 3MLSL 1CFNA 3BW9B 3BPLC 1RAMA 1D9KC 1HZHH 1BQHG 4DFHA 1DEEB 1HWHB 3C6SB 1FSKC 2VITA 5ITBL 1S3KH 3LS4L 5JPNA 1FPTH 1NJ9B 5DEGB 3PV7A 1CICD 5JOFA 2BCKA 3IDGB 2R4RH 1ZANH 4L29A 3B9KA 2DYPD 1N7ML 3G6DH 4UDTA 4ZFFB 2N7BA 4JFXB 1W0WA 1V3KA 3IDJB 5SWZA 4PJ5B 5EBMB 5D70H 3T0EA 4ODSH 5D93B 3ULUH 5E8DH 5IMMB 3DI2B 1KJ2A 3RAJL 1UXSA 1YEKH 5KBNC 2ZG1A 3TO4B 1YDPA 1MFAH 3FQXB 3EJZD 4LARH 2X4SB 5IMLA 1C12B 1RVFL 3VXRB 5I8EA 1FVCA 1IILE 3NCMA 2A9ML 4G6FB 4EDWH 3HE6B 3SGDI 2NY4D 3UTTB 5CUSL 5FHAH 5GS3A 3UO1H 3O6FA 4JO2H 1ZLWH 5HPOA 3QUXC 3BEVA 3QB7C 4L4VD 4WV1C 3QUZA 3JV4A 3TZVB 4I13B 3LPGA 4U0RB 3HFMH 2P45B 3KGRA 4A6YA 3GHEH 4A2LA 3MLWH 1GIGL 2B20A 3TT3L 3FFDB 3HZKB 3MA9L 2Q86A 1P4IL 2P24A 1EHLH 1TJHH 3U7WH 4DQOH 4EI5C 3MRLB 4ZTPH 1T0NB 2Y72A 4GW4A 5F1SA 1U8HB 3BO8A 5DUPH 2X4OB 3FO0H 2HMID 5T1KD 4L8SB 3VRLE 1IKNC 3VFSB 1WBYB 3C8HA 1AO7E 4XNZC 5IOPB 5MENE 3GSUB 2GITB 3CDGB 5HHXH 3BKJH 3C9NA 2IBZX 1T1XA 4HUWA 5CJ5A 1E4KA 3RL1B 3OAYH 3P4LA 3SQOL 2QLVB 1DJSA 4JQIL 5AYUL 4D9RE 1JF1B 1U8OB 4CMMB 5CCKL 1N6QL 2J8UE 4XWOD 3VXNA 3D18A 4QO1A 3WFCH 4JPKL 3WFHA 1XCQB 2P1YA 4PBWD 1CZ8H 1C16B 3FTGA 3G5XA 3AAZB 3VWJD 3L3JA 4KRPB 2Q20A 2Y36L 4LPYA 1FJ1A 2PO6D 3FB7A 3GB7B 3O2DH 5LAXB 4UT6L 4JKLA 1SQ2N 2HP4A 3V52H 1WAAE 3DVGA 1N64H 3N06B 2A6IA 4ZUTA 3MO1B 1S8DB 5AYQA 3ORJA 2OK0L 1BD2A 1S7RA 2EIBA 1LK2A 2PCPA 2VDLH 1CFQB 4JFPB 1BBJB 5EULV 5CBAA 4QRPD 4M02A 4KJPD 4IRZH 2XZAL 2ZSWA 3IFPB 3OKYA 2BRRH 4Z77B 4XX1G 3UJIH 4U31A 3AS1A 2VL4A 5JUEH 4GAGL 2NW3A 1G7HB 2EDWA 1R24B 3QFJD 2YUVA 3D3VA 1HH9B 1G7PA 3HHRB 4P46A 4XNXL 5DC0A 2Y23A 3D69A 5EZIH 4NZTL 1N59A 4ZFGH 2CLVB 2PYFA 1A1OB 3DMMD 5DFVC 2HFEB 4LASH 2DBLL 4X4YA 4KTDL 3OJDB 3AUVA 1LDPH 4R3SB 4LSTH 3ZKMD 5JZ7D 5LQBH 2HLFD 1ZGLP 5CIPB 1PLGL 3MA7B 1Y0LA 4NNPL 5GRWA 4LLAA 4KVCL 3LEXA 4AJ0A 3LAFA 4TTDC 5J56B 4JKKA 3V0AC 1AHWB 4G7YL 3HG1A 2X9XA 5FGCE 5HI5C 1XF2B 2CGRL 1SEBB 1MCOL 1IAMA 3HE7A 3KPMA 4OIIL 4Y4KC 1Z6JT 4PG9A 3EYUL 1HNFA 2A83B 1OVZA 3MMEB 4KJYB 5BVPH 3RWFA 4BKLB 5LGHH 1RHFA 4OGYH 2K7QA 3V5KA 4UV7L 1WTGT 4L8DA 4LRNL 3JV6A 4M6OL 2YPVL 3PWJA 1FZOB 4R0LB 4PRPB 4W4OA 4Y4HD 4QNPF 4IMLA 3EO1B 4PJIF 3QQ9D 1R3KB 5FDYA 3SKJH 4QXUL 3HUJB 4GG6A 4FFYL 3RZCD 4YGVA 1IT9L 5F1IA 4XCCH 1PEZA 3RWHB 4PRID 3QDJE 5EUKA 3JZ7A 4XCYB 4XC3H 1DN2A 2OL3B 1S7WB 2ATKB 4NJAL 3VXOA 3I3BA 3EOTH 4WUUA 3PHSA 1YYLL 4X0KB 2C7UA 1SJXA 2W60A 5M7QA 2YD7A 4PP2A 1MFBH 5IQ9B 2CXGA 4MAUH 5HDOA 2AERT 1N4XH 5DMGC 3O3AB 5KN5B 2EH7L 2FJFB 4Y1AD 3GSXA 2GCYB 1B2WL 3NIDF 1HILB 1OTTD 2CDFA 1SBSH 3PE9A 2L7UA 1IFHL 3DTXB 3W9EB 1I9EA 1RZJH 1T83A 4HS3A 1JRHL 1CDIA 5KSVA 4WGWB 2CK2A 2DQJL 4HV8B 3N85L 2CUHA 3H0TB 4TNVK 3KPTA 5CLWA 3THML 2HKFL 4N90E 4NQDB 2A1WL 4Z76A 3VWKC 2A6JA 4LSVH 1W72B 3AREB 4PGBA 4AENB 1NDMB 4L3AA 3KPRE 4H5SA 4BQBA 1ERNA 4L9LA 4KKLC 3OHXA 4PJ5E 5DQJA 2AKRA 4PYGA 5E6YA 3DVFA 2R1WA 4ODWA 3H9SA 2DIJA 4QRQA 5CSZB 5ALCL 4Y19D 4NM8H 4JFED 4NQVB 1A6VH 1A6UL 3R8BB 1ZT1B 2P5WD 2V9RA 3VXRE 2OTWA 2C1PB 2R2BB 4G6AD 3MRGB 1CL7H 1I8LA 4PJEF 5T33L 1F3DJ 3UTTE 4WI2A 4TNWK 2ZPKL 3B3IB 4LCUB 3EHBD 2BY0A 2X4UB 4DOHB 2Z8VC 1CBVL 3EYQD 1OW0C 1FLRH 3WDHA 2YPLD 1SVZA 3B2VH 1R5WB 5SX4I 3RBSA 4X6CE 5T3XE 4R4ND 4AT6A 3UTQB 5C0DA 1YEFH 3BAEL 4P23D 4UNUA 1TCMA 2YA0A 2JJUA 5HI3C 5T5NG 4NSKA 1W8NA 5F3BB 3QDMA 1OAYH 4JGUA 3VFVA 5DHVA 2I9LB 4GKOA 5CBEA 1QYGL 3X17A 2E8ZA 2P5EB 4ZO8A 2Q8BL 1RJLA 4HKXA 5D93C 2VXVH 1FNEA 3W5MA 1WZKA 2C3VA 3OX8B 2QSCL 1UQSA 1TVDA 4TPRH 1TQCB 5I1JL 3TO4C 3K2UL 1BFVH 4HGWA 1T03H 1K4CB 3CD4A 4WEUD 2E7LA 2X4PB 3IU4L 4HWEL 5DZOA 2H2SC 5DYOA 1VKXA 5E2WH 4Q6IA 3F58H 3RDTB 4I4WA 3SDDB 3HE6C 4LKCA 4UDUA 2W92A 4OLVH 4JG0L 3ZE0E 5KZCD 3QJFB 3BSZH 3HNSH 3MJ7B 2BVOB 3T1FA 3V2AR 4BM7A 4KK5D 3EZ8A 4PLKC 3RL2B 3DO7B 1QFPA 2LU7A 1S7SA 1V7MH 3QJHB 3BKCL 4K7PL 4M7JL 3TZVC 5C08D 1J10A 4U0RC 1UH3A 5FYKU 1EEZB 1BQLL 5T1LA 1DLFL 3DROB 5KVFL 2OSLA 4HWBH 1BEYL 1H15B 5JQ6L 2PN5A 5JPMB 3UBXB 4KPHL 4YDVB 1X5JA 4M1DH 4Z5RA 3S3PA 5I71B 3LN9A 4F2MA 1KFAH 2HJKB 2XQYG 5GSRA 4WFFE 4ZFZB 5D7KE 2IPUG 3L3IA 3QUKA 4L8SC 4QRUA 1ZTXL 4O02L 2YMXL 3D1MC 4KVNL 2EYTB 4PJFB 1QEWA 4DZBA 4LSPL 3NCYP 3OJMB 3GSQB 1DUZB 1DSFL 4YQXL 2BOBA 4RGOH 1YEJL 1FNGA 4C4KO 1S9XA 5LGJA 4GRLC 5FUZL 3SPVA 1JFQL 1MHEB 3LS5L 3DI3B 4WFGD 1QA9B 3SKOA 3NBNA 4YHIA 5I1KH 2AJSH 1JF5A 2L7JA 43CAA 3NCFB 4MX7A 3RIFF 4C55A 2P44B 3AB0B 4KV5F 4F33A 1H8SA 5EOCH 3B5GA 5B39A 2FX8H 1WITA 3VRLF 1DEDA 5GPRA 4RNRB 1FO0A 2V2TB 2H9GA 3L6FB 4KRPC 3HZYB 3ZTJH 3LB6D 4J6RL 4X8JB 3PHQA 5GS0L 2F9BT 1G7IB 1P4LB 1V5JA 1AIFB 3DHJA 3CFKA 4MJIB 4HFWA 3TBWA 4PB0H 1R5IA 4Z6AT 3S5LA 2G5RA 3LPFA 4K7PX 3M8OL 3NCJL 3UJIL 2V2WB 1IZJA 3FB8A 4FFVC 3P0YH 5IWLC 1NGYA 5HHOD 1DBML 2OR7A 4P57A 1IJ9A 5KSUA 5C2BL 1KBGH 4DTGH 2VC2H 3RKDC 4MNQD 3WFDL 3GMPB 3DXAB 5CD3A 5L7XL 1R0AH 1XFPA 4HWZA 5D72H 1DQDL 3IDXH 1NFDA 4NHCH 4RISL 2EXWD 3KPOA 1C7TA 3PWPB 4PRPE 5DA4A 4Q6YA 3BPOB 4U4BA 2Y7QA 2DM7A 4UILL 5I1IH 25C8L 4OFYA 3HUJE 8FABA 4JM2A 3L5HA 3MLZH 5EO9A 2Q6WB 1I1AB 2YD8A 3ARSA 2AJ3B 2NY0B 5DJ6A 3U48A 1TETL 3PWLB 4QTIL 4P2YA 1KLGB 3KPLB 1AHWC 1K5NA 4LGSB 1GYAA 1EGJA 4BQ9A 3FQRB 3ROOA 3VXSD 5CJXA 5IP4A 3CZJA 1FE8L 4XCFH 3PWNA 1FHGA 2BVPB 3U30B 2WMPA 5IF0B 1CD8A 1SJVA 4HPOH 4CDHA 1L7IH 3WNNA 4JRXE 3EDDA 1ZSDA 1A02N 1ACZA 2AXJA 4PJCE 5FOBB 2ATPB 3QEUA 1MY7A 2F5BH 4HCRH 4MZ2A 4MXWH 3HN3A 4HUKB 1UCTA 5IEKB 5L8JB 3RVXC 4NQDE 4DKFH 2FL5A 1G6RA 4KQ4H 4HUVB 2YRZA 3TBSA 1YPZB 3U0TB 2ESVB 3CIQA 4X4ZA 4XZUA 3KLAA 4DUWA 3ARUA 4XHQA 2DJ4A 2MTPA 4M4RA 1Z9OA 5TF0A 4MNGE 3X12A 4EI6B 1KTRL 4TQEL 5D2NA 3F62A 3MUHL 2EDHA 5C0RH 4JKPH 4I8DA 4WNQB 4Y16A 5FYLH 3FN0H 1B9ZA 5JW4R 4B41A 2BJML 3U9UA 4OSUH 4K3EL 2VDRL 4L4TB 1X5GA 3IDNB 4Q2ZA 3WUZA 4CUCA 4M7LH 3RA7H 12E8H 3KXFA 5ICXB 3MJGX 3REVB 5F7LB 3RVTD 3MREB 5IEHA 5KSBF 1OPGL 3HR5A 4XI5D 3IJYB 1J0KA 1T66C 4NQXB 4R7NB 3NACL 3OF6A 1RUAL 4NKQB 3AC0A 4U1JB 1UM5H 4YHLL 1PKQA 3AS2A 3HPJB 2BY1A 1H3TA 5CJQH 5JOEA 3U0WH 3AMKA 4Z7WA 1A7RL 4WTZA 1CLZL 4X7SH 3AREC 3EYFA 4PTUB 1LP9A 5EC2B 3LKOB 1IGTA 4WUKL 4HGMA 5DJ0B 3V6ZA 2P8LA 2DQCH 5GJTH 2P5EE 2DQHH 1YEEL 1JPFB 1D6VH 1GGIL 2BVUA 5CAYB 3I75A 5ENWA 4RCAA 3U7YL 1MAML 1JF6A 4F9PA 4H88L 5L0QB 4LCIH 1HHHB 4P9HC 3QWRA 4DGVL 4QRSA 4G42A 1ZHKB 1YC8A 2FZ3B 4YNYB 3T2PA 4U1LB 1MFEL 2VL5A 4WY7H 3X14A 4KGLA 1P7KB 4S1RH 2X4RA 2DIBA 3JUZA 3I2CL 5JA8B 1S9WA 1VPOL 3GM0A 3KWWA 4XMPH 4BSVB 1UH4A 5D9SB 1FYTD 2GJ6E 2R2HA 4I2XE 1NC2B 5IHUH 3MR9B 1HXMB 3MZTA 2AXGA 3QA3A 2HFGH 2I26N 1RZFL 3QUMB 2LV4A 3MRPB 3C6LA 5KVDL 5C09A 1T5XA 4OLXH 1MWAL 2YPKA 4MCZB 1WLHA 3JWOH 4TUOB 3KLDA 1BBDL 3LQZB 1TQCC 4KJQD 3X11B 2L4OA 1G7LA 2LAAA 1XR9B 5FA4A 4PJFE 3KDMA 4HS6B 3TPKA 2R0WH 3C5JB 3RY4A 1F4WH 4ZUWA 4E41B 4PJGB 3SDDC 2NX5B 3ARYA 5MEOA 2PW1B 1CGSH 4HIXH 1Z9SA 5JW4N 2EDYA 4PJ9D 2ICWA 3LQAH 3L9RB 5DUML 5B38A 2VLLA 4MHHG 3VXUB 3UZEA 3SKMB 1X6LA 1S7UB 5TDOB 3NFSL 2NNAA 3MOAL 5HGBA 4MB4A 4KI5E 5DJXB 1S78D 3CXHJ 5IGXH 3FFCD 3TH4T 1T7ZA 5I71C 1FL5A 4C83A 4FQ2H 1JV5A 3BRDA 3P0VL 3HZMB 5KANG 3ZE0F 1LO2L 2KUTA 3MX0A 3BYYA 4MJIE 2WW8A 1AKJA 5IJVB 1BOGB 4HJ0D 3FOLB 3S35H 2A77H 1SYVA 3P73B 1NC4B 3W39A 4WI8A 2JIXA 3MBXH 3SDXB 2E27H 2DMCA 3PJSA 1BX2B 4M43L 1LD9B 4JANA 4TSBH 4G3YH 4MVBD 3LKRA 5IFAL 5FOJA 1F13A 3VE0A 3FO9B 3SKNA 1JN6B 3AB0C 1U93B 3TFKC 3PWPE 3CSYB 4HH9A 4R4FH 3WIFB 4LIQE 4JPIA 4DZ8A 3OKLB 4WHDA 5J12B 2X4NB 3FZUC 3G5ZB 3U0PB 4KI5C 4R90H 2VKWA 3UEZA 5L2KE 2PXYB 1FNFA 4P5KA 1KC5H 3D85A 5TE4L 4PG2C 3NH7H 1MVUA 3O9WD 2AJVH 2RGSA 1INQB 2ZCKL 1ZS8B 3QG6B 5B39G 3OB0K 4AMKH 2R4SL 1RSFA 4G8GB 1I9RH 1QRND 1MI5B 1JPTH 4FQLL 1QSED 4KK6C 4KGJA 1KF9B 5IR1A 1S5HA 4HK3N 3PL6B 1D5BA 1HHJB 2Z35A 4FMFA 2CLRA 2MNUA 3TYFB 4JO3H 2JLLA 3MACL 2EEAA 3D39B 2R0LL 3RWJA 1QSVA 5GGQH 2XY2A 5C0AD 1FFQA 3UTZA 3P11L 1RIHL 4UOW1 4DN3L 3BPOC 1DE4B 3WXVL 2BVYA 2X44D 1ZEAL 4M5YL 3V95A 3ZKNC 1NCAH 1UACL 1I1AC 4CL7A 5T3XL 1KN2H 5DJDA 4JDVA 2NY0C 4N8VB 4MJ5A 4AZ8A 2GAZA 3TBVB 1YN7B 5JNYA 1OT2A 3BDYL 5H37G 5C0ND 3GRWA 2UZIL 2VDNL 5IMOA 4P5TA 1RJYB 2YD3A 3H3KA 1WIUA 1LEGA 1HI6A 1TITA 2GFBA 5FA3B 1YQVL 1GGCH 1L7IL 1YN6A 1JNNH 3MRRA 3U30C 1CFVH 5D1QD 4WW2A 5FKPA 3DX8A 1LO0H 3FQNA 3T77B 3UCRA 2BSTA 5E94A 4JZNA 4OLWH 3HUJF 3BESR 3UAJD 4KWUA 3MRKB 5F9JB 1FDLL 1BZQK 3VH8A 4S0SD 4CMHB 2Y4SA 1V7NL 2IALB 4CVWA 1VB9A 2YA2A 4YHPB 4NKMA 4XPFL 1JHTA 3BIKB 5J1AB 2FB4H 3L7FA 3BPCA 2FECL 5GS0D 2E6QA 3DJ9A 4DGYL 1QO3B 4G6KH 2DYPA 4LCWA 1TPXB 1AR1D 2FJHA 5ICZA 1EH9A 3CFBB 4ZAKA 3KYKL 4Q58C 1I3VA 5IB1A 1QSFD 2I07A 3MV8D 2HFFA 2DQDL 4IEFB 1WBXA 3ZKXB 5DI8A 4OCNC 4PJCF 4XXCC 1MCLA 1YECH 2AV1B 2YBRB 2DQEH 2YN5A 3KG5A 1J88A 1L0XA 2VYRE 5GHWH 1VFBA 1GL4B 3G04B 3K8MA 5CHNA 2VLRE 4LSUL 4HJGB 4N0UA 5J6HA 4NNXA 2YHGA 3WKMH 4X8XA 1UB5B 3RWEB 1MUJA 2C26A 4XNUL 4H1LG 5E95B 5E6ID 1OSZB 4HC1H 2Z31D 4MDJB 1QFWL 4PRAB 4M5ZL 4FQHB 3SGKA 3LN4A 5GJTL 2G2RB 4YX2H 2CXKA 4NP4H 4OQTL 5MEPA 2N4IA 3CLFL 3IJHA 1F6AB 2Z93B 1JVKA 2GQHA 4KQ3L 3HI5L 2PW2A 1QBML 4O9HL 3D2UB 3MOBL 2RHEA 1WC7A 1AR2A 5IVXB 3MLVH 4X6FA 5L0QC 4YH6A 2CRIA 1HNGA 1KT2B 4K2UH 3QIWA 5T1MA 3KPNA 1GH7A 4E41E 3GUTB 1CDBA 2AV7A 5DJCA 4FFZH 2VAJA 3WS6A 1K3IA 2H41A 3ULUC 5ESAA 2HRPL 1H8OA 4F37F 4U1IA 5CEYA 3GBNL 4N68A 3VXUE 5BO1H 1QKZH 5TF1H 3GFUA 1HQ4B 5ERWA 5D1XB 3AS3A 5DD6A 1AD9B 1SBBA 2VXTH 3PDOA 5CMAA 5SWSB 3JWNC 3P40A 3IFLL 3MGOB 4OGXH 1MCWW 1NCUA 5D2LA 1JI1A 5FYJH 2YKLL 4UT7H 1ZGLA 1R6VA 4EVNB 4AEHH 1EPFA 1U3YA 4UTAH 2D7NA 3AM8C 4O2FA 5HGAA 4N9GA 4P2CG 1F58H 2WSKA 3QCTH 2MCPH 4Z7VA 1AO7D 2FHBA 4WHYG 4RAUA 3SE3A 4ORGB 3KYNA 1N3NB 3WE6A 5MEND 1KOAA 3BP6B 4HIXL 5GRUL 4BQCA 3C60B 5JW5B 5GGRB 2ZUXA 3WD5L 3C8KA 4O51A 4MAYB 2F74B 4JPWL 2QSQA 3V4PH 3VD9A 5C0BB 4D9RD 1KCRL 2NR6D 1A21A 1D6EB 4TVPE 5DJZB 2HT3D 4CN1A 2DWEB 3QFJA 4NO2A 2PTTB 3BI9X 3W2DH 2FJGA 4QHLB 5DR5L 2FGZA 2XN9A 4D0CB 2EKSB 1PG7W 4X6BA 1KYOK 4P4RA 1H3UA 3L3DA 3MRJB 1ULVA 4ETYA 1OF2A 1DQLL 1EFXA 2HT2D 3LKSB 3CDFA 3PF2A 3DVNB 1QBLH 3DMMA 3MRHA 4OZ4A 1MFCH 4PJFF 4KROB 3VDAA 3O4LB 5SWQA 5ITFA 5FO8A 2FIKB 5IBUB 4TSCH 1VGKA 2PYEA 1W72L 2EDTA 1QNZH 3SE9L 2ARJB 4JFDE 3RWDB 2ADGB 4NQCE 1KENH 4ETQA 5EU6B 1P4BH 5IQ7H 2VZSA 3ETBF 3BEWA 4PGEA 5C8JA 5F3HA 2FYYB 1I1RA 3M07A 3T65A 5E2UH 5FHBH 4PTTA 4P9HL 3FT2B 4TULL 4WI3A 5DTFA 3D39E 3WSQL 4KI5F 1R3JA 4YHKH 3O2WL 4JE4B 3QIBD 1RFDL 1KCVL 3INUL 4M62L 4GXUM 1M7DA 3ECBB 5HD8D 5J12C 1DN0A 2ADIA 5GS1A 5IMKA 1SJHB 3T2QA 2D9CA 3MTRA 3RX8A 1FLTX 5GISH 2PXYC 3HC0B 1FH5H 2QADC 3A6BH 4UIKL 3N9GH 4MQXC 3RZCA 3LRHA 4Y2OA 4CADA 3BHBA 4G8EA 4JKWA 4RQQB 3ZMRA 4CJ1A 4PRIA 3E0GA 4OZHA 2JJTC 5J1TC 1I9IL 1JPSH 2EE3A 5CEXA 4MWFA 1OP5K 5I1CH 1NAMB 1T89C 4JFFE 4D0DB 1HE7A 5TE6L 3WJJA 1CXLA 3EYSH 1I7ZA 3KPQA 4PD4K 4XVTL 2AEPH 1MCJA 4LCCB 2WBKA 2G75B 5D7IB 4M9PA 3LKQA 4W81A 4YGAB 5KVMC 4Y5VB 4HT1H 3T4YB 4PRBB 3BN3B 4Y1AA 3O8XA 1QR1B 1AD0B 1T1YA 3BD4A 3MRMB 4JFHE 1ZVSA 3FMGH 2OR9H 2Y9RT 1KJ2H 5EA0H 1QR4A 1ADQL 1HXYB 5CSBA 1S7TA 4O5LH 3MRNA 2BC4A 1KN2L 4ONFH 3OKNB 1DQQA 4M7KL 5INDB 1B4JL 1Q0XH 1R3IH 1CQYA 3LIZL 3QDJD 3GZKA 1AC6A 4RAVB 3VFRB 3ZTNH 4KHXH 1A2YB 1SYSA 4K94H 3KJ6H 4R26H 3M1BB 4G6ML 4WU5A 4XB7A 1E27A 1SJEA 4KDWA 5BV7H 5L6YH 3U4EA 4YBQD 3U82B 3BIBX 1QLEH 4HIHB 4OLZL 2R8SH 3SBWA 4PY7A 3F7YB 2WUBL 1WT5C 5ILTH 1A6ZB 1BJ1J 4A6YH 3SOBL 2D0FA 5D71H 1LO0L 1KN4L 4NBXB 3V0VB 3RUGB 3L3HA 1KXVC 1Q9OB 5H94A 1SEQL 4YR6A 4LU5H 2EDFA 2H8PA 4CMHC 5E1AA 4POZD 1L4IA 3V6OE 1MIEL 1YPZF 1Y18A 1YEHH 3W0WA 5C9JA 3E3QC 4OF6A 2YPLA 4MA3A 4HUUA 4K3HA 4N90D 5BCAA 4QRTA 3RGVA 3BZ4B 5JHLL 3PHOB 4TVPH 4P23A 1CLYH 1JNHA 2X70A 1ACYH 2XKNA 3KPRD 5TH2B 4DN4L 3VMNA 1OTSD 1TPXC 2FGWL 3MV9B 3AGVA 3RPIB 2WBJD 4PJ5D 3HMWL 1XR8A 2DDQL 4MDIA 2DQGH 4ODVH 1XGRA 3FT3A 3MRCA 4MA8L 2AGJL 3ZKXC 3IAGC 3RY5A 4YHNA 4R6UA 5F96L 5IVXE 2BNRE 1BIIB 4QRRB 5C7XL 3F5WB 1QPXA 1MCWM 2NY1B 4BYHA 4Z7NE 4Z7UB 4HWNA 3AXLB 4J4PC 1IBGH 3BDBA 4QHNB 2EC9T 4F3FA 4XTRD 4S1DC 35C8H 1RZGA 3TH2T 1JHKH 3WCYA 3TA3A 2HVKB 3CFIC 1HEZB 1QP1A 2HJFB 4KZEL 1JUFB 1WBZA 1UENA 5C08A 3O41B 5D6CA 3ARDA 3ARZA 4G43B 5F7DA 4MD0A 5I8CA 4LIQL 4OZIA 2KL6A 5SWSE 4G7VH 3DV4B 4BH8A 2JE8A 1Q1JL 2H6PA 3ZE1E 1P7QA 2Q7YA 3QFDB 3BKMH 3RU8L 1INEH 1EFQA 1JK8A 1FZJA 4HF5L 1CFBA 1RZ7H 3QDME 4LAJH 5MP6L 1S5IH 1D5XA 4R4BB 5DRXA 4AM0A 2DLFH 5DMKB 3UYRL 2IAMD 4MQ7B 1D5IL 4PB9L 5CEZE 3PWUB 4LHUD 3PV6A 3VXMB 4YZFF 2QEJA 2XFXA 3CVHA 5EIVA 4ODHH 4JGJA 4G6JL 1WZMA 3NCCB 3ARGB 5GZOD 5ANMA 3MV7B 5L88H 1IKFL 4DVRL 3LZFL 3OAUH 4ZSOB 5DVNA 1HHGA 3EDFA 4LP4A 2JELL 1QQDB 1DFBL 3W9DB 4HMDA 1ZVHA 3VD4A 2ORBL 3EJYC 2WLZA 4PV9B 1EEYB 4P3DA 2LQRA 1JZ4A 5D1XC 2X4TB 5DJ2B 4GKZA 2XWJA 3C09B 5FYLD 4J3WA 2QSVA 3L1OH 5E00A 1NL0H 2VLJA 1ZT4A 1BVLB 5DJAB 2OTUB 3ZKQD 1WEJH 4YUEL 3VCLB 1HYSC 5F97E 5K93A 4WFFD 3STZA 3QBTB 1M6OB 4OI7A 5GGSY 1YEIL 1I3RB 2APTA 2VDOL 1OARH 3VG9B 3GHBL 3Q6GH 5KS9B 3IETA 4F7PA 1MCEA 3C60C 3QIUB 3P4OA 2OS7A 5KOMC 2D2OA 1B0GB 3MCKB 1A7QL 1CXKA 2IANB 4I5BA 4IM8A 4I77L 2NY7H 4OTXL 4TVSa 2WP3T 3RNQA 1CD1A 4LLDA 4Y4FD 3S37H 5BW7A 3ME0A 4FG6C 4MNQA 3WUWA 1YJDH 1IGMH 1ZGLM 4Q9BA 3L5XH 4DK3A 3PP4H 4P9MH 1CT8A 4UNVA 2FATH 4OF3A 4ALAH 5EBGA 2RAMA 1T04B 3OJ2C 3PQYB 2CIIB 3BP7A 4BZ2H 5DK2B 3T0XA 4GJTB 5DVLA 3HAEA 3U9PH 1U8KA 5ACZA 2I9TB 1Q9KB 2A38A 3ES6A 1X5IA 2CDGA 1NEZA 4KROC 5F7FA 1XGYL 4U1KB 4LPWA 4NRYA 1I7TB 1H0DA 4ZO7A 3SDXF 4OAWA 1HWGB 2WWMC 4GOSA 2P8MB 5H35B 4U1MA 4QT5A 1BQHB 3NCYS 2ITCA 2FBOJ 5I8KH 5D7IE 5K9QG 4X7TB 3VXSA 1U6AL 3IF1B 5CSGA 2DI8A 4PJ8B 4Q9QH 4U1SB 4LRIA 4XCNA 5DUBB 4QHMB 2B1AL 1JZ6A 4N8CL 1IL1A 2DI9A 4DKEH 4ZFOB 4XGZA 2R0ZL 4LDEB 4ZPVA 4MJ4A 5HDBE 1J0JA 2HVJB 1M05A 3MBEA 5C6WH 3QWOB 4QY8B 2VR9A 5GISL 4ZUVB 4PRHD 2WBWB 5FB8A 4P0DA 1NSNL 5ADOL 1OY3B 5T1DL 5FGRA 1YNKL 5J3HC 5I76A 4UV4H 3T3MF 3TF7C 4BK4A 4APQD 4RMSA 3OQ3B 5DMIL 4P2OD 3QO1B 5C0GA 1EX0A 2B1HL 4IRSA 4P2RA 1WZLA 3C2AL 3EYSL 1CYGA 1KIUA 3BN9D 5GRJH 4YFEA 1TCRB 4E5XB 1LNUA 3PGDB 2WZPD 5F8RC 2BMKA 3QUML 2OLDA 2P43B 3QCUH 2DM2A 2HT4C 1RUPL 2E6PA 1ZV5A 4DKDC 5C71A 4OM1H 5FGBA 4LCCC 4QTHA 1NLBH 5A2LH 5C0IB 4Y5VC 1HSAB 3NMEA 4N1CA 1DQTA 5DHVH 5DC9B 1H5BB 3KPSB 3TYGL 4ENED 2KZ1B 4U7SA 1SHMA 1M71A 4JRXD 3SGEI 3VD5A 4M1CD 3RWIB 1YMHB 4K3DL 2LAGB 5F9WB 3FRPA 5FO7B 3NZHL 2V17L 3SDAB 1NCWL 1P9MC 4FXKB 4ZXBC 5KSAB 4LVEA 4CNIA 1J5OL 3TN0B 3JV0A 1K4DA 2QQKL 5AUMB 2H32B 3J8F7 4LHQB 1D5ZA 1KEMH 1T3FB 2GI7A 2FR4B 5HYJE 4JQVA 4JM4H 2VKXA 4YK4B 4JVWA 1F3DH 1NPUA 2EZ0C 3SQBA 1IVLA 4X7EC 5EO0A 4PRDB 4NZJA 5BRZA 4RFEA 3GI8H 4IMKA 5D2NE 1FFPA 1KIRA 3HNTL 4LNRA 2ZNXA 4NPYB 5CWSB 5D7LB 3LKNB 4U6YB 3BVNA 1HOCA 3C08L 5DJ8B 1D5MA 3BP4B 4H20L 1RMFL 4P5MA 4NNYB 4PBXA 3RTQB 3EUUA 3S88H 1L6XA 4OZFB 1Z9MA 3BQUB 4DUXA 4HQQH 2AI0H 3QDGA 3ZYIA 1B4RA 4L5FH 5F1OB 2AK4D 5AZEL 3QUYA 4G9DB 4FQIH 5EU4B 3SJVB 2GUOB 3CZFA 3V7AG 1PKQE 5HYIA 4AL8H 3DX9A 4Z95L 1DUYB 3E2HB 1BAFL 1EO8L 2EDKA 1CDHA 4JJ5B 1X3DA 2C1OA 1F90H 4NUGH 5DXWA 3B9AA 4OFDA 4GG8A 4FP8H 1JMZA 1IBGL 4WW1B 4KTYA 2FEDD 4OCWL 2NY5L 1R3LA 1FO0H 2NY1C 4ZNCD 4OI8A 1TVBB 1XGQB 2VDQH 1DVFD 1T22A 4U1NB 3RDTD 4X4MA 1Q94A 1A6TA 5EPMB 1OP3K 3TCXA 5L2JB 4EN3D 1NMAL 4OCRL 1CGTA 4PLJD 3MV7E 1HINH 4LLVB 4PJ9A 4WWKD 5TPWH 4ZSOE 4WI9A 1L0YA 1NBZB 4XP4L 2XI9A 2GJ6D 2AQ2A 3HI1A 2GY5A 5DMJB 5EOQH 2VH5H 2NY3B 1FZKB 5DRNA 2BDNH 3QEQA 5E9DA 2MQ3A 3FQWB 2XKSA 3FRUB 1KIPB 5IVXF 5C0CA 4BZ1H 3FB6A 4Z7NF 2HJLA 1XH3A 3OPZH 3FFCA 2SEBB 3MUGA 2QBWA 2RIKA 3EGSA 3I6GA 1CDJA 5DQ9A 2ZCHL 3VFMA 1IC5H 2V9QA 3OKOA 3FCTA 4W6WB 1N2RB 5KS9E 1YMMD 5DGQA 3SO3B 1I8IB 1TNMA 1U58B 4YDIL 3S3JA 4M7LT 1U9KA 1OWRM 1EXUA 3ARGC 1MPAH 2IANE 3JWOC 5JHDE 4NQEB 1RZKH 4NO3B 5HHMB 5FM8A 3IFOB 2QR0A 3ZE1F 1EGJH 2APFA 1K9TA 3FT4A 1NGXB 5LCVL 3SDCA 5TDPA 4BJLA 1T20B 2VXQL 4HPYL 3C09C 4I3RH 1UZ6E 3QEGL 2P7TA 5GGVH 1X4YA 2HKHL 2CUMA 3WIIH 1LEIB 5I1GH 3O9WA 4NWTL 3RY6A 3MV11 4MJID 3VG9C 1A7NL 1LO4H 4S1QL 2GSGB 5IB4B 5MHSE 3LEYH 2NY7L 1OB1A 3QIUC 4S2SA 1HHKB 2ZUWA 5E2VH 2VQ1B 3ARFB 2H1PL 1G6RH 4JG1H 5JA9A 5I2IB 1BVKB 4JZOA 3C5ZC 3L5JA 1QBBA 4PLNC 1VACA 3PDDA 3CC5A 2C3XA 3GJFB 5I0DA 5IHZB 2EDNA 5C0AA 4HH8A 5FYKE 3LRSA 4X7CC 1AGDA 5HVHB 1XZ0B 5TQ0H 4NKDB 4P59L 4HLJA 3RI5F 5L2KD 4PGCA 3ROLB 3MLYL 5DJYA 1UXWA 3VFWA 1YUHB 1EO5A 2JCCB 2V7NB 1YY8B 2R0KH 2F58L 1QFUH 1IM9B 3ZYJA 3LV3A 1YEDB 3WFEL 4X6DB 3HAEG 1NDGA 2DM3A 5CLTA 3SCMD 4ZYKB 3O3BA 4PGZA 3PNWB 1VFAA 4KHTH 4R2GB 3FO1A 4PJ8C 1AE6H 4HS8H 3Q3GB 1X7QA 4TN9A 3GSRA 3DGGA 4AIZB 5K9KB 5JW3H 1MHHA 1ZLSH 2IQ9L 3TIEA 1J05A 5I17A 2ZUVA 4HK0B 2VITB 5JPNB 2CRYA 3HB3D 1BGXL 2IADA 5GSVA 4P2QD 4L29B 4PJEA 4RWYL 1WJ3A 3V5HA 2YD9A 1JI2A 1W0WB 4XHJC 5SWZB 4L3EB 3WNOA 5D7IF 3T0EB 4QF1A 4KKCC 1ZHNB 4V1DE 5DO2D 1KJ2B 4UIMB 4PJDE 2NY2D 2BY2A 4HIIA 4X9FA 1Q38A 1YDPB 1KULA 3H3BC 4JY4A 4XP6L 4TSAL 4PJAA 1QSFA 1I3GH 5I8EB 1TZGL 3MV8A 5D1ZC 4F7MA 4DGIH 5HJ3B 2BFVH 1CGWA 5CEZL 1EAPA 4J3TA 1H5BC 1U8NA 3O6FB 3STLA 5D7LE 4XC1L 2VWEE 4OCYH 5D5MA 3S4SA 2HFTA 3MLXH 3JV4B 5F9WC 3H7LA 5EU7C 4ZS6D 3SDAC 5GS2H 3UZVB 4OV6F 3QUXA 4LEXH 5KSAC 2WINA 5CINH 3I50H 5KANI 4H0IA 4WV1A 2Q86B 3JWDH 2J8HA 5E6IA 4F7EA 1CTOA 4NIKB 5EZOL 2R69L 2Z31A 5HGHA 4OF5A 3BO8B 1KB9K 4AQOA 1UEYA 2VJXA 1R5VA 3CVIH 1XMWA 3RUGF 2BP3A 1LE9A 4N5ED 4YK4C 3MNZA 5F9DC 5KG9A 4NCDA 1IKNA 1AXTL 3C9NB 2E5EA 1T1XB 5I18L 2OXGA 1CIDA 4Z18A 4XP1H 2UY6A 2VDMH 2VUYA 1H9VA 3FAWA 2G9HA 4XPHH 5I1HL 3ZT5A 4M6NH 1AJ7H 1VADB 2VLRD 2O93L 4HXBL 3NCBB 2NZ9D 3D18B 4FZ8H 2R2EA 2V5RA 4NJ9H 2WWKT 2IH3A 3RTQC 1A1MA 2ZCLH 5CP7A 3GBMH 3IDMB 2AXFB 1CK0L 1BZ7A 1QTYT 3TNNB 5JXAL 1FORL 3G5XB 2RFXA 2IFGA 4JGMA 4LVOB 2ZG3A 3QPXH 4NZDA 3MLUH 2IPKA 1QD0A 3WLBA 5T5FL 1Y6NR 2CK0L 2A6IB 3VFTB 4ZUTB 3E2HC 2YA1A 3QSKB 2XZQL 2D7PA 3B9KD 1BD2B 4X5WB 1S7RB 4Z7UF 1RIUH 1EEUA 1IM3A 2BVQB 4LCYB 4FMKA 4LHJB 4U05A 2DF3A 3KVQA 1Z3GH 2GSIA 1DL7H 1KGCD 2IPTL 2CMRL 1J1XL 3KLHC 1NAML 1GC1H 1A7OL 2IC2A 1HHIA 2QQNL 3U79A 3VRIA 1OSPL 1XGTA 3U2SA 3MOQA 5H8DA 2HRLA 2DQIH 1J8HB 4I18C 3D3VB 2CQVA 1KPRB 2XNAB 1MEXH 5GGVY 3D69B 3OKMA 4YHYB 1N5AA 2J8UA 4MS8C 4OB5H 1MNUL 1I3UA 3MRDB 3V79C 4X4YB 5DA0B 1G7QA 3UC0H 3QUZD 4BFEA 2DS4A 5GJSH 1AGFB 5EORL 3DGCR 2GJJA 5LJYH 2ZKHL 1Y0LB 1LEKA 3LEXB 5HHQA 1CLOH 3ISWA 4JAMA 2HAZA 2Y5TA 4F15B 3CX5J 1X5XA 2XZZA 4H0HB 2VAAA 4JRYB 2O5XL 5SV4A 5F6HJ 4UT9H 4C54A 4FQCH 2A0LC 3UMTA 5TFSL 3HE7B 3KPMB 3O6LL 3SO3C 4Y5YB 3RNKA 3X3GL 5KVGL 3RWFB 4FRWA 4ZMAT 3GMLA 4XPBH 4EUPB 3AMLA 5E24E 1RULL 3JXAA 1HSBB 2NYYD 4YWGL 4TVPD 3HMXH 3M17B 3P0GB 4YPGA 4GMTH 1EAJA 4NWUL 1FZMA 4IMLB 1U8IA 3LSOB 3E6FB 1UYWH 3QIBA 3GDBA 4YGVB 3X3FL 5F1IB 4YXLH 3U83A 1RUML 1L7TH 2CJUL 4GRWE 1BLNB 4UB0H 3VXOB 2XN9E 1MWAA 2XICA 3P9LB 2YS4A 3V4VH 5KS9F 4NQUA 1P84K 1A7PH 2GK2A 1ETZB 2JCCE 1NH6A 1HN1A 1G7JA 3UP1A 2MCG1 5IFHL 3NTCL 3JSSA 1CG9B 2EO1A 1MCIA 2ZP0T 4JFDD 4NQCD 4NRXA 4X6DE 3JTSA 3GSNB 5CD5D 5T3ZE 5EOCJ 2VIRB 4Y8DC 4P4KB 5DDHA 3LMJL 3PL6D 4L8BB 1KELL 3DETD 2EDXA 2JB5L 2CDFB 4UUJA 3RVWC 1FL3A 4OIBA 5CJ8A 1T5WA 1MRFL 5EZJA 5ALBH 5KSVB 2FRGP 2VZTA 4JO1H 2OJEA 1UZ6F 2LFGA 4Y0GA 3SE8L 2I60L 4ZO9A 5JIIA 4NGHL 1MJJB 4FTVE 5HVHC 1DQJB 3L5WB 1PKOA 4PS4H 4KXZI 3VFGL 4Z76B 2NXYB 2B2XH 2YC1B 4P46D 1J0ZA 2JK5B 2Q76A 5IJKC 3VI4F 3VJ6A 4QWWC 4PGBB 5HPMB 4H5SB 5KSBA 3QDJA 5FUOL 3ZDXE 2DI7A 1F4YH 4L9LB 3VWKA 1RUQH 4L3EE 4MA7L 4YXKH 3OHXB 5DQJB 4NFCA 5E08H 1U2CA 3U4BH 1HKLH 3B6SB 4JFFD 3UZQA 4UINH 2P46B 2DQFA 1BFOB 4OZHE 2DMKA 3EFFB 2ITDA 5EUOE 5LBSH 3VG0L 3EYVA 1OLZA 3O4OB 2ADFL 2OTWB 3WJLA 2M26A 5AD0A 5HYSG 2ICCA 4S10A 3WDJA 3BGMB 3HG1D 1G0YR 1CE6B 5DZNA 1JWMA 2GT9B 3OKDB 4C56E 1WK0A 4QKXB 2W65A 5F7EL 5IVZB 4MMZC 2IWGA 1JPGA 2IJ0C 3CCHB 4U0QB 1KTLA 5C0DB 3BW9A 1B6UA 1LO3L 4OLYL 4NSKB 3C6SA 5IT2H 4JDTL 4R9HA 1NJ9A 5DEGA 5DHVB 3V6BR 5E8OA 1UM4L 4OUUB 4HSQA 3ZT7A 2O61B 1I8KB 5C92A 3MRIB 3T0EC 2OP4H 4I3SH 1FNEB 4KMLB 2NQCA 3KPRA 3RVUC 2XTJE 1NKOA 3S36H 4ZFFA 3B5TA 2HWZL 3RGHA 4DJMA 3O3DB 5BS0E 4HWUA 2WBJA 4KY1L 4PJ5A 1GGBL 5DZLA 4WUUD 5EBMA 1KTKE 3P2TA 1OGAB 5IMMA 1UB6B 1B0RA 1YY9C 2KH2B 2JB6B 2NXZB 4X9GA 4GLRH 2VTFA 3TT1H 3TO4A 4LKCB 4K94C 3FQXA 1MCPL 2X7LB 3MYJB 3VXRA 3O6FC 3V4UL 3W5NA 4JFOB 1A7BA 3UTTA 5FIEA 3SGJC 1FCCA 4OM0H 4IHOB 5KW9H 3ULVE 1YYML 1H3WM 2XXCB 2VLKE 4H25A 3QI9B 3F7VB 4X6CA 3B8YA 4Z9KB 3GSWB 3O45A 3W0WE 3FFDA 1JPST 3HZKA 1AI1H 1UEMA 4Z0XB 1MJ8L 4OCXL 5ID0A 3D9AL 2GK0B 2MOVA 4W6YB 4MSWA 1T0NA 4GAFB 4F37K 3T08A 4N0CD 4GRWH 4OD2A 2X4OA 3PIQB 4I48A 2AK1H 2GY7B 1JHLL 5EWIL 3BH8A 1RD6A 4DZBB 3VFSA 2IAMA 1E4KC 3BWAA 3TH3T 2BNRD 5J9PA 4M48H 2BOBB 5F6IB 2W91A 4HMCA 1X4XA 3LH2H 5IOPA 4HX1B 3FQUB 2GITA 3UJJL 4UTBL 3CDGA 4ODTL 5ISZE 1FG9C 4PJBB 5SV3A 4M6ML 1MJUL 3OB0H 1J8HE 3RL1A 1PAMA 43CAB 3I3EA 5JDJA 5HHNB 3VGEA 3GMNB 4MZ3A 1WCQA 1JF1A 1U8OA 3BJLA 4KAQH 4CMMA 5B39B 4O00A 4ZFOL 1EJOL 4Y89A 3D0LB 4LVOC 3TIDB 1QOKA 4JREB 1OM3H 3NABH 1CVRA 5FYKL 4N0RA 4EIGB 1JYWA 1XCQA 1C16A 2VSDA 1OAQH 3PHQB 4BSJA 4K9EH 3AAZA 3GMRA 4MD4A 4E0RB 3GB7A 3CFKB 4I0PB 3TBWB 5LAXA 2XY1A 1NBVH 3QDMD 1VESA 2YD5A 4JY5L 2XRAH 1TZHB 1R5IB 4NN6B 4JRYE 1PQZB 1S8DA 3MO1A 3CFCH 1T6VN 4OQ1A 4PY8J 4F58L 4FQJL 2H2PD 5CEZD 1NGYB 4EXPX 3IFNL 5DS8B 2PETA 4NKIL 1CFQA 2IBGA 4JFPA 3C87A 1BBJA 3B9DA 4AIOA 5CD3B 4ZOBA 5IWLA 1J0HA 3W11C 4MAYD 3IFPA 1NFDB 2OXHA 1KCSL 4X80L 4NO5A 1IC4H 2H26A 3IJSA 4OB5L 3TGXA 4JEGB 1CS6A 1J9CT 1FFNB 2X89D 1R24A 3CNKA 4XBGA 1MVFA 4DUVA 4Y8AA 4YHYC 1EMTH 1JL8A 8FABB 4JM2B 1KLUA 3SGEH 1ZHBB 1AQDB 2J5LB 4JHBA 4ZTOH 3ILQD 1EUUA 4FABH 4Q97A 4ODXB 2OZ4H 3LHPL 3EO9L 5T1LD 5FM5O 3N0PB 1UGNA 4NUJB 1BECA 3P3YA 1KLFA 4OBRA 7FABH 4JHWH 1K6QL 3OJDA 4F15C 4U3HA 4FZEL 4R3SA 1I9JH 5CIPA 3UXFA 1X5LA 3HZVB 1SM3L 2VLJE 5FK9B 2ZUQB 3HE7C 3IS0X 1ZHLA 4Y5YC 4X9IA 4S1SL 4ZS7H 4HKJB 1SEBA 5IV2A 2A83A 1HK6A 4LQ1A 4J3UA 4DW2H 4BKLA 4W4OC 1IQWL 1F97A 4BH7B 4HBCH 3QEUB 3BKYH 2PR4L 3A6CH 1FZOA 4R0LA 4XCEB 4PGDB 4NZUL 4PRPA 4KJWD 4U7KA 2R29L 5I66B 1CR9L 4OGAC 2W0FA 5TE7L 1XF3B 7CGTA 3Q1SL 1K8DA 3HUJA 2FEEL 4X7FC 4JB9L 3A6OA 4YO0B 4APQA 3KLAB 4P2OA 4XCYA 3CMOH 2ATKA 3X12B 2MMXA 2MPAL 3ESUF 5I30H 4Q9RH 1UG9A 2XQBL 3JUYA 3EOYG 2KQNA 2DLIA 2DKMA 3U9UB 3GSOB 5D4QA 5EFIA 5IQ9A 1TJGL 4P4KC 4H1LB 4AG4H 1AP2A 3IU3B 1P1ZB 4LL9A 4IOFC 2WANA 3B4NA 3K4ZA 1CE1H 5ALBL 3KXFB 2F54B 4TRPH 3HPLA 5LXGL 2LVEA 2DD8H 5IEHB 6FABH 3QXAB 5C0FA 4JRXA 1TLKA 2CH8A 4H8WC 4NO0D 3DTXA 3QDAA 3W9EA 3T3PE 4G9FB 1CD0A 1MF2L 4PJCA 4BA8A 2JCCF 4Z7WB 2NZIA 2NXYC 2DTML 3MC0A 4NFBA 3T2OA 3A67H 3EYFB 3OTTA 4X6DF 2QQLL 5C07B 2EH8H 4NQDA 4L9LC 3LY6A 2HN7B 4OFYD 2P8LB 2P49B 1MREH 1W72A 3AREA 1HH6A 4YXHH 1EIBA 3I75B 3R1GL 3GSVA 3GK8L 4MNGA 1PJ9A 3OZ9L 3O4OC 2AJXH 2EDOA 4LBEB 4UQ3B 4WJ5A 1OGAE 3TV3H 1J1OH 3CK0H 5DVOA 4C57C 1Q8MA 4NQVA 2YK1H 1ZT1A 2VN4A 3DUUA 5L9DH 1NCDH 4HGKC 3QQ4B 4O2CA 2IH1A 2R2BA 4PUBH 5AWNL 3MUY1 2X4RB 3K8LA 3UTSB 3T4AB 2O5ZH 3CFEB 1SMAA 4PPTA 2E9WA 3E8UH 4GW5A 2BK8A 3ZE2F 5CZVH 1A6WH 3B3IA 4LCUA 2IFFH 4BK5A 1NFKA 4P3CL 3TJEH 2AXGB 4FQQA 1EZVX 5J06A 3MCLL 3ZL4H 2KPNA 3WN5B 4WI6A 5ETUB 5C09B 2F19H 1S9YA 4IRJD 3BPLB 4HULB 1D9KB 2YPKB 1JGUH 4QHKJ 3ZTJG 3RRQA 2QHRL 3MLSH 4BSWA 5HYJD 4KUCD 4KKBD 4QYOA 3G5YB 5D96B 5ITBH 4OKVB 3LS4H 5FA4B 2P5EA 2E7LC 4PJ7B 2HH0L 3CSGA 3MROA 2X40A 1AFVL 5CGTA 1ZLVK 3OX8A 2NXZC 3REWB 4ZUWB 3VFOB 3E6HA 1N7MH 4YIQA 1SVCP 4Y16D 1EDQA 5J13B 3SDYL 1CFTA 3RDTA 4PJBE 3SDDA 1QFHA 1ODAA 1A4JB 5D7JD 5FUCE 3RAJH 4EN3A 3MODL 2XWTB 1ADQA 3MJ7A 3MLRL 3J7HA 3VU2A 5I1LB 3CFJB 3DO7A 4WWKA 3QJHA 1KTDA 2VXSL 1UWGL 4BFIA 5HGBB 2A9MH 3MNVA 1AI1L 1EEZA 5CUSH 4CKVX 3QDGE 4G8IB 4ZUUB 1I85C 1FL5B 4C83B 1G1CA 1I1FA 1TDQA 3WLWC 5FV1L 1JV5B 4ERSL 1H15A 2ILLA 4NM4L 4HG4J 3DBXB 2ZG2A 1EA9C 3P4MA 4MD5B 2HJKA 2NY6B 4ZFZA 3NVQA 1J86A 2QHLA 1N0XL 1GIGH 3TT3H 5IESL 2KQMA 3MA9H 1NGWA 4M03A 1P4IH 2EYTA 4K7FB 3HAEH 4PJFA 1MY5A 5F6IC 5HI4C 4D2NA 5LVEA 3PJSB 3ULVF 5T3ZL 1OP5H 5CGYC 1I7RB 2ZSVA 3EW3B 2Z92A 3GSQA 1DUZA 1IQDA 4X9BA 3S36X 1AGBB 2BZDA 5ESVA 3NIFE 1MLBB 1MHEA 4WRLA 3T0AA 1QA9A 2RCSL 4GS7B 5E99L 2CKBB 2O26U 5ICYB 4LHUG 1IGCL 1HQRB 3B2UD 4WI4A 3V5DB 5GZNC 3H3PL 4JREC 1S9VA 2CRMA 4KZDL 3SQOH 4GSDL 1MCCA 3T0BA 3WEXB 3HLAA 4JQIH 2V2TA 5AYUH 2V7HB 3L6FA 1MAJA 5CCKH 1N6QH 4GBXB 2FECI 1JWUA 4X8JA 4PG2A 2WP3O 5JORA 3DSFL 4NN6C 2DQTL 3C6LD 1G7IA 4JPKH 5C0CE 1P4LA 2XKUA 5CILL 4KKAD 4MJIA 2EC9U 4MXQC 5IR1B 3TPUB 3IKCB 2VNCA 5FCUL 2Y36H 4UBDC 2CLRB 3GI9L 5F70A 4OD1L 5GS2D 4GQ9L 4UT6H 4BQ8A 5F1KC 1FNSL 1DZBA 2IAND 3RWJB 4ZNEE 4F80A 5JHDD 2OK0H 4XPTL 3GMPA 3DXAA 3DPBA 3CDYA 3ALXA 3CDCA 3K74B 3O6ML 4LPUA 1FGNL 1K3ZA 4JM2C 3QG7L 3NA4A 3PWPA 2XZAH 2J5LC 1F42A 1MFDL 4R97B 5DJDB 4GAGH 5I15H 2DICA 1U91A 1I9JL 1RZKC 2GAZB 5L2KA 2EECA 4JFZL 5JNYB 4XNXH 4U2ZA 4FFWD 1E4JA 4NZTH 4P5TB 5FECB 1I7UB 5FM4A 4EZMA 1IAKB 3PWLA 2ZUQC 2BNQB 3P77B 5CJXC 2GFBB 1KLGA 3KPLA 5MHSD 5E5UB 4XBPB 4PJIE 5GGTL 5BMFL 2DBLH 1QFWM 4KTDH 1Z5LB 3OMZA 4GKSA 5FKPB 3UTPE 1AKJD 5FCSH 3FQNB 2JF1A 1OAZL 4Z78B 2BSTB 1PLGH 4NNPH 5ID1A 3EBAA 4KVCH 4NBYB 5I19L 1NCCL 2F54E 2VZUA 4XVUD 3Q6FA 2X1WL 3WHE1 5IF0A 4JZJB 2JIXD 2VXUL 4G7YH 3CH8A 2P48B 2W38A 3RIAF 1G9MC 2CGRH 1FIGL 4I3GA 1MCOH 5FYKD 2R9HD 4G9FE 4OIIH 2Z91A 3EYUH 3L7FB 4KK9C 5FOBA 1CICB 3DUHA 3SHSA 1J1PL 3I6LE 4OF8A 3ULVL 4PIRF 1J12A 5IEKA 5I1AA 2DYPB 5FXCH 4UV7H 3FJTA 2FJHB 2XOTA 4LRNH 4M6OH 5C07E 2YPVH 4HUVA 1YPZA 3U0TA 4ODUB 2WK2A 5EOTB 1YEGL 2NCMA 4PP1D 3D85D 3WMSA 1G9NC 2Z8SA 3QHFL 4QXUH 1WBXB 5DI8B 4XAWL 2J3SA 4FFYH 5CJOL 4IDJL 1IT9H 1NGQH 43C9B 4GKNB 4TOYL 2DD8L 1F6LL 4NJAH 4XXCA 5CHNB 5CZXC 5MI0B 3TBYA 2NY4B 1YYLH 3MLTB 1NGPL 4NNXB 2D7MA 3UTSE 1FFOB 5ICXA 3REVA 1ONQB 1DBJL 1F3RB 4NQSB 4L4VB 1MUJB 3QQ3B 4L1HA 1LK3L 3IJYA 4GAYB 3NA9L 2HTKD 4R7NA 2EH7H 4XH2B 4U1JA 4JVUA 1B2WH 3TN0D 2GJZB 4FQ1L 1KB5B 3HPJA 3R0NA 1IFHH 1JRHH 5F9OL 4OT1L 4XPGL 1KJMA 1T7WA 4V1DD 2DQJH 2FSEA 5EC2A 3LKOA 5T1KB 4HFUL 1T21B 5DJ0A 3N85H 5I8OL 1G7MA 3OR7B 3FONB 4X6FB 3THMH 2HKFH 2A1WH 2AABL 1JPFA 3ESVF 5L9DL 3WNLA 2XA3A 3KPNB 3T3PF 4CU7A 1V3LA 2FLBT 3QZWG 1NUDA 3KYAA 4O58L 5ESAB 2XG4A 1ZHKA 4U1IB 1TTUA 4YNYA 2EDRA 2VLRA 4K8RL 4U1LA 2NMSA 1C5CL 5ALCH 5CEYB 2CLZB 2IBBA 2BERA 4WO4D 1P7KA 1A6UH 5C6TL 3BQUD 3RWGB 3UDWA 2EO9A 4BSVA 5CMAB 3VW3L 3LEVL 3VWJB 3OR6B 3WN5C 2PO6B 2ZPKH 5D2LB 1HXMA 2EDQA 5EG6C 1Q9LB 1N6VA 3HR6A 1CBVH 5HGAB 1CGXA 3QUMA 4PGJA 5D96C 2NW2B 5MERB 4MCZA 1RV6X 4EIZC 4RAUB 3BP5B 2EE9A 4TUOA 15C8L 3LQZA 4LCWD 3BAEH 3X11A 4ZAKD 2DJUA 4U6XA 4QRPB 1JGEB 1XR9A 4JCMA 1VFOA 4M8QB 4HS6A 2DL9A 3CH1B 1IRAY 5J13C 1QYGH 3C5JA 3GSNL 4E41A 2Q8BH 5FDWA 1KXQE 2PW1A 4NZRL 3OV6A 3QFJB 2QSCH 1NMBL 1Z0MA 2BOCB 5C3LD 5I1JH 3K2UH 1NANI 3L9RA 2Y25A 3IU4H 4HWEH 1A14L 3IGAB 1OF2B 2K1MA 3VXUA 1S7UA 4H8WL 3WIHL 4JG0H 4D3CL 2AEQL 3RHWF 1MRDL 2NY3D 1UT9A 5SWQB 2OBGA 5F89A 5FO8B 3WKNA 1LVEA 4GRMA 5DJXA 3BKCH 4K7PH 4M7JH 1TVHB 2ZOLB 1WQVT 2NY6C 3UPAA 1BQLH 3T04D 1DLFH 1DR9A 4N0YL 4PJBF 5DRZB 1E0OB 3AS0A 1FN4B 4ETQB 4ZG1A 5KVFH 3HCVA 1BEYH 4KV5E 3UBXI 5JQ6H 1RIVL 3BEWB 5IJVA 4KPHH 1BOGA 5F9AC 3FOLA 5FV2A 4M8VA 3P73A 1NC4A 3K81A 3CUPB 1JGLL 3WV0A 2RR3A 3QIWD 5ADPL 1W0VB 2EE2A 4WTWA 4URTB 1ZTXH 4O02H 2Z0BA 2YMXH 2H3NB 3BD5A 4KVNH 1BX2A 5J57B 1LD9A 5HVFB 2X1QA 4X99A 4GS7C 3TM6A 3VA6A 3S3SA 4Y4HB 2GTWA 4EDXB 1DN0B 2ADIB 4AH2B 4GRLB 3KPPB 1FVDA 1GC1C 3HC4L 4LSPH 1JN6A 4YQXH 3GNML 1DSFH 1U93A 1BVZA 1YEJH 3RZCB 4GAJL 3V7MA 3WIFA 5FUZH 1EK3A 4HZAA 4ELMB 3OKLA 4PRIB 1JFQH 1QSZA 3LS5H 4OBSA 3TNMB 3U0PA 5CEXB 4MWFB 5DRWA 4GBXC 1BJMA 2PXYA 3SY0A 2XA8L 1XF1A 2OX5A 4YHML 4JY6B 5GXBB 1WISA 1UWEL 2JJTA 2Y6SD 1I7ZB 2A74B 2VOTA 2UWEB 1MHPL 2VABB 2BNQE 2DB8A 3EOBB 1MQ8A 3NIFF 4LLMA 1T89A 4JFDA 4NQCA 3LKQB 1BMGA 4J6RH 4MMXC 1UCBL 2ZOKB 3RI5K 4Y1AB 1IARB 3ARFD 3PL6A 5K33A 5GS0H 1HHJA 2YUZA 4JM2F 3TYFA 3BH9B 2OQJB 4LP5A 3D39A 3M8OH 3NCJH 3MRNB 2BC4B 4GFTB 3TJHC 5I15L 3NN8B 1DBMH 1IAOB 4OFIA 5C2BH 4D9LL 4R97C 1SYSB 3WFDH 3GKZA 5L7XH 2XN9D 2IF7A 3N1MC 3VD7A 3QXWA 1DQDH 3PG2A 4U33A 4RISH 1EFXD 2FD6H 2NPLX 5H2BB 5B4MD 5JDSB 2BSRB 4N8VA 1T2QL 4P5TC 3ZHLA 5LKNA 1WWWX 1IM9D 1YN7A 3UTOA 4WEBL 4UILH 5F7MC 4JFFA 25C8H 1UA6L 5D7SL 4Y19B 3VXQA 2HTLC 4TNVF 4JFEB 2XV6B 2PYED 1C08B 1RJYA 3HRPA 2P5WB 1WT5A 3L3HB 5EIIB 5IROA 4R2GD 5F88B 2FO1A 3FO2A 2N1KA 1TETH 5HHVL 5H94B 4RA0C 2UUDK 5DD5L 4QTIH 4JZJC 2ZJSL 1WIPA 4ZQKB 3HC3L 5IBLC 3T77A 1ES0A 3KR3L 4YDJB 5C9JB 4OD3L 2YPLB 4FTVD 4MA3B 4HUUB 2F53B 1FE8H 3EYOA 4LFHD 4YDKL 1MSPA 1CICC 4LOUD 1OP3H 5AAMA 2D7TL 4GUPB 2X70B 5IM7B 2XKNB 3SEPA 3BIKA 1AXIB 2YUWA 1OGTA 4X98A 3K46A 1XAUA 2HG5B 2WQ8A 4L3ED 3Q5OA 1XR8B 1E6OL 5EU5B 2VQUA 1NGQL 5KSBE 2ZUUA 1W2KT 4MLIA 4YHNB 3CFBA 3B9VA 2K9UA 5C86A 3EJZC 5F8QC 4OKDA 2DKSA 2QTEA 5DD3L 3R0MA 3WHXB 2KBGA 4F3FB 5MI0C 2NY4C 4HBQA 2AV1A 3S96B 4Z7WF 1EHXA 1KCUL 4C56D 4K3JL 2OYPA 4J4PA 4JLRA 2BNUB 2ICES 4TQEH 3ZYZA 5A2KH 4LLWB 3O0RL 4HJGA 1U41A 3DX6A 3O8XD 5C08B 1DLHB 3V6OA 2UZYB 2BJMH 1XGUA 3KYOB 4K3EH 1UB5A 2VDRH 1MOEA 3BUYB 5F7DB 3RWEA 3T0VA 2C3HA 4GO6B 1OSZA 2V5TA 4XVSL 2H6PB 4L8CB 4MDJA 1DBKL 4FQHA 1OPGH 4J2XA 3OGCA 3P4NB 2XTJD 2HMIC 1J0YA 3NACH 2BHYA 1RUAH 5BS0D 4YHLH 3MUZ1 1F6AA 2Z93A 4M7ZB 4U1HB 4YE4L 2WWKO 1A7RH 3CVHB 1CLZH 5IVXA 4QRPE 2BNRA 1XF5A 4WUKH 1PSKL 3WS6C 1X5ZA 3MNWA 1A6AA 5ANMB 3K80A 4YBLB 4B50A 1YEEH 1IEBB 4OV5A 1GGIH 4XWOC 2OJZL 5AG8A 1IAIL 3UJTL 3U7YH 4HUXA 1MAMH 4K7PY 3BPNB 4H88H 2W59A 3ULVD 1MCSA 2YR3A 1F11B 4P3DB 2ARWA 4LMQI 1OD7A 2VLKD 4DGVH 5JTWA 3TWCL 4GKZB 3H7BA 3VWJC 4LSRL 1G9ML 4KDTA 4L3CA 1JGVL 1Z9LA 2PO6C 1MFEH 4PJ7F 3W0WD 1HQ4A 5D1XA 1AD9A 1DBAL 5SWSA 3RGVD 5E70A 3MGOA 3I2CH 1G0DA 1VPOH 1A1NA 2DN7A 1GSMA 1UH2A 4EVNA 2UVFA 4HEPG 3MJ9L 3WNMA 1Z0NA 1GZQB 3P30L 1OAKL 4JQXC 1RZFH 4KJPC 4K71B 1G9NL 4ORGA 3MXWL 4I5BB 1N3NA 5HHOB 4U6HB 5KVDH 3BP6A 1MWAH 5ISZD 4MNQB 2GYSA 4Q9CA 1RI8A 1BBDH 3VXTA 4MAYA 2F74A 5IB2A 1UVQB 3FQTB 1D6EA 2X89A 3BP7B 1U3HD 2X05A 4BFGA 2DWEA 3HAEB 3TA3D 2PUQT 5DD1L 5ACZB 3DMMC 4FXGB 2IG2L 4QHLA 3BZEB 3C2SA 3ES6B 4D0CA 2EKSA 1C7SA 3MRQA 2G60L 3MLPA 3MRJA 4ELME 4ISVA 1JGDB 5HY9B 2FCBA 3ZKMC 5DUMH 5JZ7C 5FKAA 2HLFC 3ARDD 3QH3B 5KAQG 4OAWB 3T8XB 4U1MB 2EYRB 2FIKA 4JDZA 3NFSH 4OGZA 5DSCA 1P7QD 2X9WA 2EYSB 3MOAH 2UWEE 4WU7B 1E28B 2ARJA 3VXSB 2ADGA 4AEEA 4XCNB 5EU6A 3C8DA 5BZDB 4K8RD 1IL1B 1GGYA 2Y06L 3P0VH 2JKXA 1LO2H 4PRNA 2FYYA 3CAFA 4CVXB 4YHZL 4Y4HC 5IHLB 3EOAA 3QQ9C 5F7NC 3O11A 4F57L 2W9EL 1C5DB 3LD8C 2DQUL 1JZ8A 1ZXQA 3RZCC 2GW5A 1T2XA 4OLUL 1HIML 4JFYB 5C0JB 3VD3A 4DKAA 5C0GB 1F3JA 5IKCB 4M43H 1MFNA 4LLQB 5IFAH 1U8QB 5EIQA 2IMMA 2BMKB 5I74B 4RQQA 4ESKA 3BT2L 3TP4A 3WJJC 3RX5A 3BDXA 1KNOA 2VLJD 3ABZA 1ED3B 1NAMA 5HVWA 4D0DA 3GGWB 4Y19E 4JFEE 1UFUA 2KZWA 5TE4H 4LCCA 4LAQL 2YRPA 2EXYD 5D7IA 4HKZB 1YNTB 1M71B 1OTTC 4XPAL 3V7AE 2ZCKH 4W6XB 4YPJA 2R4SH 4FQLH 4NO0A 4AQ1B 4UQ2B 3MJ8A 2F53E 4UOW0 5IFJA 4JR9L 1HXYA 2VR4A 3DX7A 1P9MA 2DOCA 2OR8A 1D5ZB 2FD6L 3GBLA 3P9MB 4LSQL 4G8FB 3MACH 2R0LH 3VGHA 1LWRA 4RAVA 3VFRA 3P11H 1RIHH 2WUCL 4DN3H 1A2YA 3SBWC 1UZ8B 3WXVH 4M5YH 1ZEAH 2R39A 4HIHA 1UACH 3ZDZF 4RFEB 4UI2A 1KSRA 1KIRB 3S7GA 3BZDA 2VDPL 1A6ZA 5T3XH 4LLUB 3F12B 4JN1L 2F8OA 4G6AC 5A1AA 3BE1L 1F8TL 3ARRA 5DEFB 4D9QE 3V0VA 4N8VG 4KTEL 1UJ3B 3BDYH 4EXKA 2WLYA 3PGFL 2UZIH 2VDNH 3EHBC 1OAXL 1Q9WB 3I02B 3RJDA 1Q9OA 3BGFB 1J18A 3EYQC 4RFOL 1YQVH 4IIQA 4R4NC 1FYTB 4TUKL 4P23C 3MBED 4OZGB 5I0ZA 3KS0H 4M93B 3HNVL 2CKBL 1A3LL 3BUTA 3DX9B 4PBVC 3BZ4A 3PHOA 2VUOA 1FDLH 4IRJA 5CP3A 1V7NH 2W0PA 1GPOL 2L0DA 3DO3A 3GIZL 5HYJA 4IRSD 3SE4C 4P2RD 4XPFH 3WXWL 4X4XB 5GIRA 6CGTA 2FX7L 3S8WA 4DGYH 1NAKL 4RZCA 1BIIA 1GOHA 3F5WA 1OP9A 1QLFB 1E4WL 1KPVA 4TYUA 4Z7UA 3AXLA 4OFVA 1K8IA 2YSSB 1I8MB 3KYKH 4KK5C 4PJ9B 4WFGE 4KMTL 3QHTC 5DURD 5BQ7B 3FB5B 2DQDH 5D7JA 1Q0YL 1GAFL 4LGRB 3HI1B 1HEZA 5A3ID 1FGVL 3MQIA 5FYJU 2X1OA 1AQKL 3QNZA 3P9WB 5FEBA 3QI9D 3BRGC 2X4QB 1MQKL 4DOHE 1EHAA 2EIDA 4KK8D 3O41A 4ODBD 4LSUH 2FX9L 5DWUL 2HJLB 3WL9B 3MUGB 3EGSB 4HJJL 1FV1B 1I4FB 4Y5XA 4RGND 1KEGL 4I0KA 4NT6B 2APBA 3QFDA 4M7ZC 1CGVA 3VFMB 1QFOA 2DLHA 4XNUH 4LSDA 4IJ3B 2Q87A 4R4BA 1CL7I 1QFWH 3GRWL 3L3OB 4RGMB 5DD0L 3M45A 4M5ZH 5DMKA 3PWUA 3VXMA 4OQTH 3CLFH 4FXLA 5HHOE 1UKTA 4LK4A 5BRZD 4WDIA 4YBLC 4KQ3H 3HI5H 1CGYA 2DAVA 2ICWJ 1VHPA 1QBMH 2OCFD 4O9HH 1T4KB 3MOBH 3QULA 5CIPH 2V2XA 3V8CA 2NTFB 3BFOA 5D2LF 3MV7A 3BPNC 3FT4B 4ZSOA 1URLA 5TDPB 1U8MB 1CDCA 1OQXA 1OAUL 5DHXB 1QQDA 2PTVA 3W9DA 3G9AB 2W0KA 3VGFA 2P7TB 1EEYA 4Q0XL 3IS1X 3LB6C 3QDGD 1JCKA 4V2BA 2Q8AL 2X4TA 1N8ZA 2HRPH 1BOYA 3QUYD 4ONGL 3BOVA 4JFQA 4I0PD 5DJAA 2OTUA 3GBNH 1MCHA 4DWHA 1RZIB 1Y6MR 3T0WA 1M6OA 3QRGL 1QRNB 1I3RA 5IK3B 4UOJA 1P7HL 1A3RH 1QSEB 2Y5EA 4K71C 3IFLH 5KS9A 3L5IA 5DLML 4JZOB 1VA9A 3L7EB 4WWID 5BW7C 2YKLH 5F6HI 1C5BL 4ZUSB 1KJ3L 1B0GA 4FS0A 3MCKA 2IANA 4LEOB 5JHDA 5JXED 2EXWC 2R1XB 3F8UB 3LRSB 2W9LA 3ULSB 1AGDB 5E2TL 1SY6L 1PG7L 5GRUH 4RMQA 3VDCA 3FKUS 2GHWB 3UPRA 1CF8L 3PQYA 3WD5H 1MRCL 4F9LC 2CIIA 5HYSB 4F7TB 4JPWH 4X6EB 1XCTA 1KCRH 2I9TA 1Q9KA 2A2QT 4OCMC 4U49A 2X10A 4IOSD 2R15A 3QEQD 5E9DD 5EN2A 5LWYL 3OBAA 2EE6A 1KB5L 1UKQA 1PZ5B 3HRZB 5DR5H 3OJVC 5C0CD 3NAAL 5I6XB 1OTUD 1VFAB 1PVHA 1DQLH 4CVZB 1OCWL 2P8MA 3FO1B 5H35A 1BQHA 3OKKB 2R56L 4OJFL 4ACPA 3E1F1 2H45A 1MHHB 3RWCB 5D1QB 4X7TA 3L3GA 4FNLL 4PJ8A 4WCYH 3TIEB 1J05B 1T1ZB 1W72H 4U1SA 3SE9H 5DUBA 4QHMA 3SKUD 4ELMF 1U8LB 3QPQD 2F5AL 4ZFOA 2HVJA 5D6DC 3GMQB 3DXAE 3QWOA 3VDBA 4QY8A 3GJFK 4ZUVA 2ICEB 1CN4A 4EBQL 2UWEF 2K7PA 4Z8FL 3SDCD 4P9HH 4J3SA 4WEMB 4JPVL 4TULH 5JW4M 1AXSB 1DCLA 5D8JL 3WSQH 1MIML 3O2WH 5I74C 3QO1A 4M3KB 5IG7A 1RFDH 1KCVH 3INUH 4M62H 1S7QA 3V0WL 4PJHB 1A9BA 2QADB 4ORZC 5INCB 4PJAB 1QSFB 4E5XA 4Y2DD 3MV8B 2OMBA 2RQ8A 1YNLL 1RPQA 2BXYA 3IXAB 4OCSL 5BJTA 4UIKH 4R96A 3CXDL 4CRPA 1RUKL 2Z4QB 4ZOAA 1I9IH 5C0IA 1RQ5A 4JVPA 3STLB 3GJEA 5HHPA 2F54D 5B8CB 1HSAA 4ZD3L 4LQFL 5D5MB 5IW1A 3RVTC 2P8PB 1H5BA 5TE6H 3WBDA 4XI5C 4XVTH 2MWCA 4HUNB 1CQKA 4G9FD 1YMHA 1VFUA 1LE5A 4GMSL 1FAIL 5FO7A 1RHHB 3DECA 5E6IB 1MCFA 2AJUL 3I6LD 3S5LG 5ACLA 1EEQA 4HHAA 4FXKA 4OZGE 1NANH 5B22A 3VFUA 2V5MA 5KSAA 3SGDH 3TN0A 3U1SL 5GRVL 1PDKA 5F44A 4GQPH 4RIRB 1C1EL 1LE9B 1ADQH 1BIHA 1T3FA 4UZGA 1V3JA 1S7VB 5KG9B 4V1DA 1INDL 4PJDA 5HDLA 4M7KH 1CD9B 1B4JH 1YPZE 4BUHA 2ESVE 2VE6B 3LIZH 2LU4A 3HMXA 1RK1B 1MCKA 3QHZL 3OXSB 3CFDA 2XWBB 4RMVA 4PRDA 4FQXD 4G6MH 1OQOA 3DVIA 4NN5B 5DVKA 4YC2B 1UJ3C 1T7XA 3RVVD 1DQML 4Z7QE 5CGMA 4OLZH 4NPYA 2IH3B 3TVMD 1XIWD 5D7LA 2WUBH 2BSED 3BGFC 3LKNA 4U6YA 5JQHC 3N1PC 4XVJL 1BZ7B 3SOBH 3QXDA 4L4TE 5DJ8A 3BP4A 1KN4H 4NNYA 4WO4A 3RTQA 4OZFA 1IEAB 1IGIL 1T0MA 2C4FT 2E7HA 3BQUA 3DIFB 2AJYL 1P5UA 3ARBD 4M93C 3WLBB 5KJRH 2XQYK 2IPUK 2JJVA 3VGGA 2BVTA 1SEQH 3K1KC 3KAAA 1D9KD 1S9KC 3B8SA 5EU4A 2GUOA 5E0QA 1MIEH 4B5EA 3UYOD 3DYMA 1DUYA 4KJQC 1QBAA 4JCLA 1AO7B 4HIJB 5JHLH 1HHIB 2B0SL 3DV6B 5MENB 3FHAA 1XGTB 4WW1A 4KRMB 1NFIB 1FC1A 4DN4H 2FGWH 5F7HA 5E8EA 3OXRA 3T2NL 1FRGL 2DWDB 1XGQA 3HMWH 4U1NA 4PJ9C 2DDQH 4I9WE 2Q3ZA 5EPMA 4MA8H 5L2JA 1X5YA 2AGJH 2B4CC 2J8UB 1W0YT 4HZLB 4LSSL 4LMQE 1LO5B 3MCG1 5F96H 4LLVA 5C7XH 5I1DB 1NBZA 4NKOB 3QEHB 1BJ8A 3ULUE 3DRQA 4YZFE 3D25B 5HHQB 1S78C 3QUXD 4JAMB 2Y5TB 4D8PB 1XF4B 4MJ6B 1FZKA 2A6DA 1U8PA 3H9HA 8CGTA 5F93C 3FQWA 3FRUA 5AG9A 5KVEL 4KZEH 2APXA 1HDMB 4J23A 4B53A 4G5ZL 4IJ3C 1P2CB 2IGFH 2DMBA 4HJ0C 4J12A 4EI5D 3NZ8A 4RGMC 3VMPA 1GOFA 3VRJA 4LIQH 1QSEE 3GMLB 3L3KB 1FG2B 4ZODA 1A4KB 1N2RA 1OLLA 1Q1JH 4ELKA 1I8IA 3RU8H 1OWWA 1U58A 4HF5H 1T1WB 2OTPA 5LGKA 4WTZG 4PY8I 4MVBC 5MP6H 1JNLL 2W07A 3UYRH 3ZSTA 1CVSC 4NQEA 4NO3A 1PX3A 1D5IH 3IFOA 1NLDL 4PB9H 1NUNB 4PJGE 2NX5E 4PR5B 5DK0B 1IEHA 1EVTC 4NRZB 4K23L 3L95B 2GTZB 4G6JH 1NGXA 1BF2A 4L1DA 4WENB 1T20A 3SN6N 1IKFH 4DVRH 1JTOA 3LZFH 3O9WC 2JELH 4WVRA 3MGTA 1DFBH 5GQBA 1A3RL 2ORBH 4NRXB 1BM3L 1WGOA 2BHUA 2EICA 5ESQA 5FGCB 2QQQA 3EAKA 4KRLB 4U6TA 4NBZB 4TUJB 4Q7DA 3U6RB 4UUJB 3F7RA 1BWWA 2GSGA 3O81A 1UM6L 2OL3L 3LDBB 1FL3B 2RB8A 1HCFX 1T5WB 1HHKA 4YUEH 3ARFA 2E7CA 1E6JL 1YEIH 1BVKA 4R7DB 2VDKL 2VDOH 2J4WL 3GHBH 1WZ1H 1ZT7B 3GJFA 3SDXE 5IHZA 3DRTB 5FF6B 3O6KL 1F00I 5TGBA 1II4E 5EBLB 5A16A 3HS0A 5IBTL 4DK6A 1A7QH 2FHFA 5DHYB 4I77H 4OTXH 1M4KA 1XZ0A 4QCIA 4YHOL 5E8NA 4NKDA 5IJKA 1IGFL 2YD4A 2Y07L 5IW3A 2JCCA 2DQFB 1YY8A 2V7NA 5C0NC 3MPCA 4Y7MA 5DFVD 3FN3A 3RIAK 5I6XC 1NBYB 3EYVB 1IM9A 3MRFB 2BNQD 4ONHB 1B0WA 1YEDA 5B38G 3TEUA 4X6DA 4QOKB 4WCYL 4ZYKA 1XGYH 3PNWA 4TTDD 5D1QC 1JWMB 2AJZB 3B5HA 4WI5A 5JR1H 3CVHL 3T3ME 1U3ZA 2O5YL 4G8GE 5EO1B 2AQ3A 1X5AA 3KYMB 3R06B 1ZVYA 1VGEL 3OSKA 3UAJC 1MI5E 4NC1C 5HI5D 2FBJL 4HXAL 5I75B 4AIZA 5K9KA 3IVKA 1KJVA 1ZLVH 4Y4KD 5DQDL 2J7LA 1KTLB 3TBTB 4KUZL 2G5BB 1M1SA 3O2VL 3PDGA 3OL2A 4HK0A 1TFHA 1U6AH 3NGBB 4FTVA 4CVUA 1PEWA 5GS0C 5E8OB 4WGVB 3VXPB 2B1AH 4N8CH 1N5YL 5AZ2L 2R0ZH 3KPRB 1DBBL 1P69B 4HLZG 2EDLA 1AR1C 4L3EA 4Z0BL 2WBJB 1NCTA 1XGPB 1NSNH 4DVBB 1ORQA 5ADOH 1ZHNA 3CLEL 1B0RB 5SX4H 4UIMA 5T1DH 2YUXA 1YNKH 3G6AA 5EUOA 3LPWA 5DMIH 2P47B 1E4XL 2ZUSA 1MCQA 3G08B 4N0FA 2B1HH 4YJZL 5HJ3A 1OHQA 3C2AH 2B39A 5B8CC 1A5FL 1NMCB 4POUB 3QUMH 1IGYB 4B7LA 4C56A 1RUPH 5DMGD 4QXGL 2OZ4A 3TO2A 4XRCB 4CN4A 4H25B 4X6CB 1A0QL 2D4FA 3SGJA 4I0CC 5E6IC 2A73A 2Z31C 5K59F 3O45B 3TYGH 5C3TA 2FNBA 5J7CC 2UYLB 1WCBB 3IDIB 5ID0B 3AVEA 4MSWB 4RFNB 3GKWL 4K3DH 4ZXBB 5FO9B 4M1GL 3NZHH 2V17H 3E3QE 4OD2B 4I48B 1NCWH 1BWMA 4XBEL 2YWZA 3VWKD 2VR5A 3BH8B 5GGTA 3MFFA 5BS0A 2IAMB 1J5OH 3BWAB 5HDQL 5J9PB 4CU8A 2QQKH 1RURL 4LHUB 2I5YL 4QHKI 4E42B 3H2WA 5AEAA 1H3PL 3N50A 4KKLD 4NN5C 5JOPE 4YAQB 4YC2C 2X2YA 1TMCB 4OZGF 3BXNB 1VADA 3H42L 2XZCL 4JHZA 3CU1A 5KJRL 3ZDYE 3HI6L 5B3NA 5JO5B 3HNTH 3IDMA 2AXFA 2D31B 2VLKA 3F7QA 3TNNA 3EFDL 3GMOB 5EZLB 3GMRB 4XP5L 4MD4B 5K9OB 1ZAGA 3C08H 3MXVL 1QRKA 2W9DL 2XPGB 4H20H 1RMFH 1MHCA 2FEEI 3VFTA 1GHFL 5E8PB 1FBIL 3PABB 5HI3D 4OZFG 1EJ6A 4Z7QF 4X5WA 3VH8G 5AZEH 1RZJC 2BVQA 4LCYA 1CU4L 4AEIL 2ENYA 4Z95H 4MXVE 3DYOA 3RHWK 1BAFH 1EO8H 32C2B 4NO5B 1Q72L 3TO4D 1JTPA 2H26B 3IJSB 4Y4FB 5ISZA 2NR6C 2NLJB 1J8HA 4XBGB 2HT3C 3VXRD 3TC9A 1KYOJ 2H2SD 1KPRA 3QCVL 1Y6KR 2XNAA 2EIZB 4G6FD 4YEFA 5B3JF 1KLUB 3HE6D 4OCWH 2NY5H 2R23A 3UTTD 3GIVA 1NCBL 5K9JL 1U3HA 4PJXB 2HT2C 4PLKD 1A9EB 3MRDA 5BZWA 5E5MB 3IRPX 5TDNB 1NMAH 4OCRH 3TZVD 5T3XD 1AGFA 4RMRA 1MLCB 2IGFL 4U6VL 2X42A 2YZ8A 3I9GL 4JHAL 3JVGA 4XMKL 4XP4H 2LTQB 1ZHLB 1TJIL 1ORSA 1CI5A 4JO4L 3AFLA 4JRYA 3GM8A 4J1UB 4XP9L 1FQ9C 5IV2B 4Y5YA 3F65A 1G1YA 1QHOA 4LKXB 3ULUF 4EUPA 1HSBA 4D0BB 1PZUB 2ZCHH 4RMWA 2HLAB 3QIBC 4MCYB 3M17A 4PRHB 5HD8C 2W0FB 3LSOA 4GRLD 3WFZA 5TQ2L 3E6FA 4YDIH 5C0BE 1K8DB 3GO1L 3NFPB 3OKEA 2DKUA 2BSSA 4APQB 4P2OB 1BLNA 2CIKB 4IBLT 4MLSA 3P9LA 4LF3B 3K3QA 1JWSA 4PD4J 1CXEA 2JJSA 1ETZA 4W70A 3I84A 4R8WL 4DAGL 1U92B 4KRPD 3N1QC 5LCVH 5EFIB 1CG9A 3EIFA 3ILPB 1TTGA 2VXQH 1F02I 4HPYH 4XMLL 4BFBD 1AP2B