1R9FA

Crystal structure of p19 complexed with 19-bp small interfering rna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
121
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/rna
molecule keywords 5'-R(*CP*GP*UP*AP*CP*GP*CP*GP*GP*AP*AP*UP*AP*CP*UP*UP*CP*GP*
publication title Recognition of small interfering RNA by a viral suppressor of RNA
pubmed doi rcsb
source organism Tomato bushy stunt virus
total genus 34
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2003-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r9fA01
4KTGA 4JGNA 4JK0D 1R9FA 1RPUA 4J39A 4KQ0A 4J5VA 4JNXA 4KNQA
chains in the Genus database with same CATH superfamily
3RY6C 3NCMA 4AIEA 4UNUA 4K07A 2XN9A 4Y16C 4ZMXA 4JM2A 3CSYA 1BYNA 4M8QA 4ZO6A 3SDCC 1MH5A 3P0YL 5CBEA 3M1CA 4BZYA 4GRMB 1PLBA 2DQFA 3JWOC 4HF5H 4NQUA 2ITCA 3NP3A 1J9CT 3CDZA 4X4ZA 1NUNB 3VXUE 3W0WB 5D2LA 3P9LB 4M5YH 5IHHA 5HD8C 4XWOD 1JTPA 1U8CA 1ZVNA 4WFFE 3HC4L 1E42A 4UTAA 5INCA 2VERA 4NYLA 3TJEH 4UTAL 4DQAA 2ILLA 3SOBL 2JQAA 2X09A 3QDJE 5AL8A 4JN1H 1BVLA 1S78D 2LU5A 3SBWA 2ZOOA 1QRNB 1N5YH 4NPKA 4UQ2A 3DX9A 4KHXH 4OCXH 3LNIA 2IH3B 5C0ND 4EOWL 2SEBB 4KROC 5E6SB 4Z23A 2X4OB 4FXKC 1MW3A 4BK5C 1LGVA 1BOGA 3GSUA 3DV6B 2V7NA 3AQYA 1IM3B 1KIPB 5DD3L 3QUZB 4CDHA 3TWYA 3CUPB 1EFQA 1WLHA 4E9XA 4TUKL 4YFLF 4CU6A 4J3OH 2X6MA 3GI9H 2BPBA 4LCCA 4PJ8A 4ZUSA 2GB2A 3NOIA 3ZW3A 1FPTH 4IOSA 5B1CA 4KKRA 4U6XB 5T1KB 4TF4A 2VM4A 5HYSB 4BH8B 4U3SA 5E4AA 5HDOA 4FCAA 2MNWA 5C0CD 3HLKA 1MJ8H 4KNTA 3ESVF 1KJ3L 2VLKA 4JZNB 5IK3A 1BZ7B 1S9VB 1S7QA 5EPMA 5K33A 5ICYB 1IAOA 4QXGL 1MAKA 2L7EA 4KX9A 3ABZA 2VDRH 4N2CA 5GGTH 4DFIA 5J57B 3UJIL 1HKFA 1RUPL 5F0LB 3ZTCC 3GZPA 3E2HB 3DO4A 2NLJA 4XC1L 2YK1L 4R7LA 1AGFB 5FO9B 3KLAA 3NJVA 3QO1B 4LLUA 4ZOAA 4JDZB 1E30A 4PJ5D 3EFDL 3TV3L 4G6KL 4WY7H 1PFOA 4M5SA 3I9AA 4GMSL 3RJDA 3INOA 3MJ8A 3SQOL 3B3IA 4PJEE 1MHEA 4EBQL 4TSBH 4L1SA 2PYED 5A7BA 2HKHL 2OMUA 4NM8L 2EH7H 3RWJA 3NPSB 1VFMA 4S1DD 2JCCA 1IC0A 1NMCB 2X9WA 2ZKXA 3QDMB 4I13B 4JX0A 4M1CD 3WTXA 5TH2B 3B7SA 3MYJA 4CW1B 3DIDA 2X1XR 3L4WA 4IGBD 4Y1AE 2VLJB 5I1JH 2G4EA 3FAWA 4P9HH 4KK9C 3VXME 4MXWH 1KCVL 1YJDL 1PLGH 2HFFA 1W0WA 4KGJA 4AK1A 2K3HA 5TDPB 5KVFE 2WK2A 2Z31D 2IFFL 3AT8A 1FL6A 4HS6A 3BCDA 2HX8A 3BSZH 4KNQA 2BW5A 4FFVC 3CZSA 1IEHA 3FO0H 3RZCA 2OMXA 3QG7L 4AI7A 3UTSA 4XPTH 1IQWH 2CIKB 4PV8B 2DQEL 3O8XD 1Y6NR 4MA3A 1OSZA 5IUCA 4TOYH 4FG0A 5F71A 5KVDH 4QXWA 3KXFD 3MHZA 3LOWA 2VAAB 4U0RB 3CLEH 4XOEA 4U3HA 4MJ5B 1IJ9A 1IGCH 3NJKA 4PJAB 1UACL 4XPFH 3BPCA 4G8GA 5H37A 4RRPA 5AVVB 5JOPD 3ARED 2EDXA 4QLRA 3PAUA 4C58B 1AMYA 2C34A 2CHZA 4WFGE 3L5IA 4GG8A 5F7MC 2IOIA 5EOQL 3UTPE 3X13A 4YHYC 3MRHB 4ONOA 4JDEA 4FD0A 4WK4B 4L48A 2P8PB 2ATPA 4L1BA 5ESVA 4LB8A 5A1AA 5TF0A 1J1PH 4LLDA 3DXAE 3N1GC 4WSGA 2XPZA 4L4VE 2PCXA 3T4AC 4NQCE 5T3XD 4BFGA 1SVCP 5FOBB 3I3EA 1RURH 4G80A 4YSTA 1RJCA 3ECBB 2H6PA 4YIQA 4GKNB 5D7IB 1DP0A 4FC3E 2JK5A 5L6YH 3L13A 4DETA 3KWWB 3WTYA 2MOVA 4KI5D 2BSEA 3QJSB 2DJSA 4TVPH 1E5CA 1ZDSA 3NIDF 3KHOA 1MXGA 1YNTF 1IZJA 4EUPG 1N10A 3PQYE 4NO0A 3NQKA 1KYAA 2FJHB 3NTCL 1NGWA 5FF6B 1NGXB 3BVDB 3CDGA 3WU1A 1Q9WB 1SBBA 1JF1B 1AYOA 1TZAA 1C7SA 4OZIF 3TO4C 2MRYA 3F05A 2XXGA 1G7LA 2X4RB 3BWUF 5CM1A 5EOCL 1CYXA 5G2NA 4PTUA 3C6LB 4U6HB 3U1SL 2B59B 2NTFA 2EE2A 3ESMA 4UQ3A 1XX9C 4OBSA 5KBDA 4ODXA 3MA7A 3GIZL 4XAWL 1TETH 1TFPA 2UXVA 2ZQKA 4FQCL 2F53B 1FORH 5DLMH 3IJ8A 2IAAC 4JANB 3DHUA 1BM3L 3FT4B 5BVJA 3QQ4B 2WNGA 5IJCC 2NY3D 4BCYA 3CXFA 4ZDHA 3AACA 5AUMA 2Z7ZA 4PJ6A 1KPRB 4PW4A 3QIBA 3RGVA 3QZPA 1F4YL 5KVGH 2FQEA 3B2XA 1U93B 1M7UA 3VCLA 5HGAA 1HSBA 4KK6C 5I17B 3LB6C 3IE4A 4C55A 1Z9SB 3PABA 4LLVA 4AZ8A 1FI8C 4N2IA 2PXYA 3Q5OA 4G7VH 3U7AA 2CZNA 4G6AD 4S0SD 5E00B 5HYJB 2JJSC 1AQDB 2MQ0A 4KKBD 4J2QA 2HXAA 5FHAH 1GCYA 1EO5A 2JELL 3JV4A 4CMMA 2OJEB 5JIMA 4WW1A 4GUPA 1UM6H 3FFCA 4K5NA 2WJ5A 1L4IA 3DPBA 1IVLA 3SKOA 5MEQB 2O5ZH 1O6SA 4CJ1A 2X2YA 3DUHA 5KVEH 4WCYL 2MOQA 2J7LA 1A64A 2Z91B 1YECL 1CL7I 4QXUH 2HRPL 2VUYA 4AE0A 2YBGA 2OMTB 2NY6B 2RACA 2C9AA 2LU4A 3MCLL 5I16B 3TBWA 1E4WH 1GZPB 2R23A 2V2WA 1HE8A 4JDTH 1ND0B 1AYRA 2Y2WA 3TVMC 5E9DB 3K6SA 5DVOA 2UVFA 1U95B 2EIZA 1M6OB 1HWGB 1F58H 3MO1A 2DQTL 3CXHJ 1N59B 4YXHL 4AEEA 3L4TA 2CGZA 3OXSA 3A6BL 3AXIA 4MZRA 2ENJA 4NT6B 4X6DA 1I1FB 1KENH 5HYSG 1JZ4A 2AKRA 1W72A 2Y2TA 5TPWH 2MQCA 3OAZH 1W72L 1SOQA 3F7PC 2HT4C 2BSRA 4QJ5B 4XN7A 1S7UB 1NFIA 3OGCA 3QEQA 4FHKA 1VFAA 4OIIH 5KZCB 5D7SH 3RBGA 3OV6A 3QJHA 4AT6B 5KSAD 1BZEA 5AG8A 1YPZA 3AVEA 5MEPA 2BFVH 3WNJA 2RMNA 4M7JL 1SM3L 2OPCA 4X42A 1QPPA 5C2BL 1QKZH 4IOIA 3C5JA 1JUFB 4KU1A 4BQ9A 2DQDH 7PAZA 4DK3A 4XNBA 1DL7L 1ZT7A 2FIRT 2WWMD 4A2HA 1ADWA 1GMEA 1PY4A 3ILQC 4AITA 2DAVA 3K71B 1YLBB 4GIOA 5GZOA 3WSQH 3H54A 3SJVA 5TQ0H 1MCKA 1DQTA 2V4LA 5DC2A 2B8OT 3ECWA 1NFAA 3I2CL 1OLLA 2KDGA 1C9SA 4TSAL 3U46A 4WFFD 1PCXA 5GJTL 1EAJA 1RP9A 3SDDD 1XB6A 3PNRB 4N9GB 4S1RL 3B6SB 4CGUB 3WO4C 1CQYA 5C09B 2IAMC 5IB2B 2YLKA 3ZYJA 5JA9A 4PJXE 3OHXB 4UZGA 3KWVA 4WU5A 4WO0A 2N7SA 3F64A 5D7JB 4H88H 5HDBF 3L45A 4IU3B 2YMOA 2FQDA 5H4ZA 3EYSL 3SGJA 1EH9A 2WBXA 4ZZFA 3LH2H 4X6EB 1XMEB 2X1QA 4XI5D 5E4EC 5I6OA 4KJWC 5D71H 5EZPA 1BFTA 1SPDA 3HPLA 4DO6A 3B9VA 4NOBA 4MMYA 4OGXL 2NNXA 3N5AA 2IG2L 1XGTB 4J1UA 2XWTB 4NN7C 4DZ8A 4EUPA 3JYBA 3BD3A 3GM8A 3F58L 1IGYA 4OQTA 4QRAA 3RWCB 1U92A 3F12A 4HIHB 4XP1L 2AEOA 1ZXQA 1OO2A 4OQTL 5JORA 3P54A 4BINA 2ID5A 1WV7T 4M61B 2X6AA 4R7VA 3VXRB 5IJBC 2XQBH 2F54E 3N0AA 2VDKL 4P4RA 1U8MA 2VDQH 4OF6A 4MJ4A 2BVOA 3N43F 2KYIA 1I9IL 3RVUD 4HULB 1XSIA 1E4XI 5CJ8A 4O5LH 2RH0A 4WW2B 2VN5A 1JK8B 2D73A 2Z7UA 1WWAX 1GGIH 2EDTA 3O9WA 4NKDA 2L04A 3R4DA 5BPPA 5E2UH 4QTHB 1FFOB 3PGCA 3ZL2A 3P9WB 4AMKL 4MZ3A 4XNXH 5IQMA 3V52H 3ZSTA 5IB5B 5J56B 2DQUH 4M1GH 3CDFA 4PPTA 5BV7B 1NTDA 2WWNA 5FYLD 4FTVD 4U1IB 4QAWA 2P5PA 4RETB 1IC5H 4GRMA 2K3TA 3UPAA 1FUNA 2KT6A 2BINA 2WXLA 2IBZX 3Q48A 2AQRA 5E70A 1Q72H 5LAXB 2EADA 1ZA3B 3FYIB 4S1QL 4YXLL 3W0WA 1ILUA 3P9LA 4POYA 1WFOA 2IANB 3C2AH 3OGOE 3U36B 5IJKA 2CO6B 4GAGL 1A9EB 4PGCB 4BRJA 2EXSA 4K71C 1G5GA 2IMNA 3VYOA 4ABQA 4DUWA 1KDIA 4G1EB 1TLKA 3UJTH 1L6ZA 3ZKND 1QRNA 1IC7H 3QJTB 3RHWF 4FG4A 4QHKI 1AZVA 2IH3A 2SEBA 1F90H 4AGPA 2X4OA 4L3EE 4J3VA 1YQ2A 2B16A 4RMBA 5DF0A 2DH2A 3DV6A 3Q05A 3ESUF 1EZSA 1IM3A 1P4BH 1LO2H 1KIPA 2QSTA 4G5AA 3KE0A 4QRPE 4L2LA 3QUZA 3IJ7A 4DKTA 4JKLA 5KJRL 3WEXB 3CUPA 4ZOCA 5DDHB 1WFNA 1YRKA 3ULUH 5HDRA 3EJQA 4JQIA 4JB9H 5GGRB 4FA6A 5I19H 4XVJL 4B9ZA 3WEBA 2V5MA 4UTCA 2OQJB 1J9RA 4OD2B 4RGNE 2J8UF 5T1KA 3D85B 4U6XA 1OE1A 1RU9H 5HYSA 4BH8A 2C9SA 2F61A 2XSKA 4UNVA 2XYCA 4U7KA 4WFGD 5DA4A 5I73C 3CVIH 4IIZA 1NFKA 1JJUA 2EIKB 4PB9L 3P4MB 5J12B 4JZNA 2YAQA 3HR6A 2X0UA 5ICYA 2OP4H 1P7BA 3UTPD 4GO9A 1QASA 1JL8A 2CQVA 3EDJA 5C6TL 4RFOL 1U6AH 1LWRA 3KBFA 1I53A 3V0AC 4JFFE 1JS4A 4HSCX 3RVWC 5D5MB 1BV8A 1VZIA 4N2MA 4NQDD 3JWNC 3DXAD 1L5GB 1FLRL 1AGFA 5FO9A 4PJ9D 2K45A 3QO1A 4WUKL 3FB7B 1SJMA 4OJDH 3WD5H 3F00A 4FMFA 2XG5B 4JDZA 3QFDB 4LPYA 3D25B 5T33L 2Y72A 3BAIA 1BXAA 3MXWL 3NQIA 1JDAA 5DR5H 4FA7B 4G8AC 4ZMZA 4HUWB 2D3LA 3QUMB 2CWRA 3BUBA 4NHCL 2VXUH 3QDMA 5F8QC 3HG5A 5TH2A 3ZL1A 3PQYD 3QQXA 4CW1A 5CD5C 4GSDH 2CR6A 2GG1A 2VDPB 1XCXA 5F7BA 1EJ8A 2VLJA 4WEEA 2NNFA 3HNVH 3VD3A 3GRWA 3O81A 4UM9A 3GRWL 1PG7W 4NRXB 5CGMA 2EZ0C 4Z7VE 2ERJB 2DJMA 5TDPA 4JG0H 1PDKA 4DGIL 2LVEA 2PPDA 2XA8L 3ZDZB 2KMWA 3QJQB 4HSAC 5BVPL 1A1NB 2Q7NA 2DI7A 2J4WH 3T09A 3X17A 4AQ1B 1TF4A 3SIKA 2FLBT 2ED9A 3BZ5A 3MZTA 3EZJB 3LCYA 4NKQB 2WZPD 4PJHB 1G7QB 1EMTL 1B0GA 1CI3M 2CIKA 2XQ0A 4FQXC 4PV8A 2E8YA 5HJGA 4YK4B 5KSBF 3IRCA 2CCWA 2Z31B 5JW4R 3CQQA 3ZE0E 4G7YH 2MOGA 4YWGH 3NEEA 2AK1L 2VAAA 3MBWB 4LQFL 4MXVF 4EQ2A 5FYJH 3T0DA 4MJ5A 4PJAA 5HHOB 3W38A 3LNHA 5GS1B 1P84J 2DLTA 1HZHH 1U3HC 1T22B 5E99L 3VA2C 3TV8A 4AJWA 4HZ1A 3KR3H 3O8XB 4XXWA 4HJEA 3TN0D 3SDAB 4Z7QB 3KPSE 4PWEA 4AG4H 2BY3A 4FNRA 2WQXA 1VFUA 1DVZA 2NY1B 3PP4H 4KO5A 2WO3B 3K74B 4L9LB 4LHJB 3QPXH 2XWDA 3FAXA 3L4XA 4HUUB 3F8UB 3H2PA 1JOIA 4X9YA 2PN5A 3MRHA 4N0UE 1EZVX 3AREB 2P49B 1GSMA 3GS4A 1WD9A 4HQQL 2P8PA 2J1WA 3PHAA 1YEFH 5KVDE 4J5VA 5DHDA 2W9DH 3KS0H 3QCUL 3OWEA 1BBDH 1QOKA 1JGIA 25C8L 4GP5B 5F9WB 2F58H 2UZIH 4N8CH 5FOBA 4WGKA 5ANME 3CC5B 1RZ7L 4HIJA 3VD4A 3ECBA 4Y5YB 4HMEA 4GKNA 5D7IA 4GXUN 3LNGA 4EZLA 3VXTA 3KWWA 2FRGP 1P5VB 1DJYA 1EWHA 3VGAB 4YFDB 5DK3A 3TURA 1NUFA 1O5PA 1EK3A 5FF6A 1NGXA 3KLSA 3GUFA 2A74B 5I6XB 1Q9WA 3NA9H 2FEJA 4IJ3B 1JF1A 3VRIB 2JJTC 3QZBA 3WFBL 4P23D 1FBIL 2GPZA 4G70B 5IBTL 2X4RA 1Z5HA 4PRPE 3W2DL 1EDYA 3BAXA 4JPVH 5CSGA 3SDYL 4X7TA 3C6LA 4U6HA 3LKRB 2B59A 2N7AA 5AOJA 4CSTA 2WC7A 2CGRL 4XMKL 4M6NL 2QKSA 4YDVA 4X5RA 5E8DL 2DQCL 4YX2L 1R1CA 3BN9C 1BZOA 2F53A 3NCYS 2BNQA 4FEIA 4TVPE 1WJ3A 3C6EA 4NAQA 3T6ZA 3TIEB 4JANA 1G9ML 4O2EB 3CFMA 5E1GA 3FT4A 1SVBA 3L4UA 3QQ4A 3CN2A 4H8WC 4LEEA 1HU8A 1CLOH 4DJMA 1KPRA 1SOSA 1OF2B 5I82A 4ETQB 1YEJH 3BWUC 5FUCE 1NCJA 1U93A 5EO0A 4OI7A 4MDIB 3WEMA 5I17A 5DZVA 1B4TA 2R0LL 1Z9SA 1KTDA 5HYJA 5DEZA 5E00A 3VDCA 1RZJC 1AQDA 2WLLB 2R51A 4OFQA 3X1EA 1A3RL 2FATH 2OJEA 4PTTB 1PS3A 1TU2B 4GI6A 1AQKH 5AW0B 1S9XB 4GFXA 3HVNA 3VFWB 3CDYA 4PSPA 5DTFB 2Y23A 5FM5M 5MEQA 4NNPL 2OCCB 3I9IA 3EYQD 3IDGB 5FK9B 1YY9D 1CFTA 4NCC1 3OQRA 1MCEA 1IZKA 4LHUD 4Y4FC 4Z0BL 5KVGE 2Z91A 3UYOD 2EC8A 2UXGA 2QKIC 5KANI 2JKJA 3CU7A 1AJ7L 4QTIL 5FW7A 3DX8B 3DX1A 1XV8A 2E8ZA 5F0PB 5I16A 1ND0A 4IJTA 1PMYA 2Y1YA 3D7PA 4TQIA 4MBRA 1U95A 1KCLA 2CDGB 1M6OA 3ZMNA 3WNNA 4BSWB 1N59A 2QSCL 3A47A 3RWGA 2LFGA 2DYPD 2ENYA 4NT6A 5FYKU 3KYNB 1I1FA 1G7PB 2F54D 2J8OA 3HUJB 3V5DB 4NEHB 3RTQC 3WBDA 4HHAB 1JF6A 3BH8B 2NT0A 1DBKH 2ALWA 4V2BA 1S7UA 1K5WA 3BAJA 2VJ8A 3VSQA 3V7AE 3EUUA 4AT6A 1HEHC 2B1HL 4MA8H 2YC1B 5E5LA 2BRRL 3FQ1A 3E0GA 3D8MA 3V4PB 5FHBH 5DD5H 4N1HB 2G5BB 3LQMA 3S35X 4U2YA 4ZD3H 5TF1H 4JS7A 4BZ1A 1JUFA 4GSQA 5M94B 1OT1A 4FFZH 4BZ1L 2EC9U 3IU3B 3B5TA 4N90D 4WHYH 1HXYB 1G9NL 1XGPB 3K71A 3EUDA 3ZDYF 3MLZL 2WQRA 1ZVHA 1XR9B 2W9EH 2ZE0A 4NKMB 5EU5B 3GS0A 4DK5A 2ZWZA 4MLSA 3H0TB 2P4AB 3ZGHA 1TYJA 1IAIH 1QFWH 3C09B 1NMAH 4LOUD 4XBEH 3PAYA 4WHCA 4ODVL 4LKXB 3MAWA 2FJFB 4N9GA 3HS8A 5F9OL 4YPJA 4ZFFB 4P99A 1VDGA 5C09A 5IB2A 3VFUB 5EZOL 2DICA 3OHXA 3VXUB 2F5BH 5D7JA 3UZEA 1FO0H 2VXVL 2VLRE 4IU3A 1N0XL 1N3NB 3U7WH 4NIYE 4UU9B 1G87A 4N0RA 3RPIB 2FO1A 4XCEB 3EHBC 3KPNB 2APSA 4X6EA 4N87A 2OI9C 5JTWA 3QDJB 3GLZA 3AM8A 1A7BA 1CDJA 2J8HA 5DEJA 4DKFL 1RXLA 2YD3A 2GIXA 1YC7A 3FH8A 5IFHL 3HBQA 5DS1A 4P5TC 5BZZA 1XGTA 5F93C 2J88L 5D1QC 5D72L 3RWCA 4RAHA 1INEH 3DGDA 4HIHA 5DFTA 2C9VA 1TTRA 2QPFA 4BFRA 1F42A 1KLUB 2N3JA 3HS9A 4NJAH 3ZBMA 3VXRA 1A3LL 3BZEB 3WLWD 4F7TB 1TTUA 4HPOL 4MD0B 3FQYA 1QFPA 1TOXA 2JKXA 1IC4H 3L3OC 1UXSA 3UAJC 2XKNB 2QPDB 2FT6A 1I3GH 5CWSB 4R26H 3JSSA 4EPSA 3OZLA 4WW2A 1JFQH 2E46A 4N5ED 5FUOH 4QTHA 2VISB 1FFOA 5GZNA 1NBCA 4DP7X 2EE9A 4KTYA 4WFEE 1F4XH 3H9HB 5IB5A 2B2XH 3TEUA 1R6VA 4OZGE 3QPKA 3TZVB 4Q6KA 5ESAB 4U1IA 1HAWA 2EKSB 1T03H 1L0QA 2A83B 2WKLA 2IH8A 1A7NH 2PPCA 5I71B 4GW1A 2AQTA 5LAXA 2CLRB 2DTML 1ZA3A 5CLXA 3V5KB 1JPFB 1MFAL 2FX8H 4H13C 4HWEL 2IANA 3U36A 4LRNH 2CO6A 3JV6B 4PJEB 1QFHA 3QORD 1EUTA 5FW8A 1TIUA 5IVOA 1A9EA 4FJYA 4PGCA 4PEEA 1GYUA 2B20A 3ILDA 4G1EA 4DGVL 2APVA 3T2PA 5AAWA 2XVLA 4W4OC 1U33A 1P7HL 4ZUVB 1WZ1L 1M9WA 2VNCA 4Y1AB 3CH8A 2GI0A 4XPAL 2XTJC 1A6VH 4OAWB 3WHXB 4OGAC 4YHMH 4L0PB 4YHKH 3CN3A 1EV2E 2OZ4A 3VXMB 4JFZL 5C70A 1J8RA 5EDSA 2Y06H 4FKHA 5DZOA 3REVB 1U8PA 4JGNA 4HBQA 1S3KL 1Q1JL 1WUZA 4KX7A 5K9QI 3WEXA 3BAKA 4WI0B 5I6MA 4YSUA 2AVGA 1X6NA 5T1DL 4GG6F 3C5ZD 3PL6D 1WZKA 1XBDA 4K94H 2JJUA 2WQVA 2XA3A 1NICA 3UCRA 2WUCH 3NCJL 4OD2A 3CPLB 3D85A 4IEFB 1M6UA 3MVSA 2K4WA 3X2QB 3EOTH 3HAEB 3RA7H 2HTLC 3UG3A 1X5AA 7FABH 3DHMA 3UTTD 4IRZH 1C1EH 4R3SB 2K7QA 4JFEE 5I30L 3P4MA 1FYTE 2JI1A 2D3VA 3A6CH 2ADFL 1XAUA 4EZMA 4A6YH 1EEZB 3SPGA 2HTKD 5D5MA 3IKKA 5IHWA 3ULUE 2NR6C 2YXFA 5BW7A 1L5GA 4P9MH 1BOYA 3FB7A 2X4SB 1M2VB 2XG5A 3FT3B 2E74C 3QFDA 3D25A 2EXYD 3B9KD 4NCDA 3VXPB 4YAQB 1IKOP 3KBHE 2R8SL 2QFPA 4HUWA 1UM4L 3QUMA 4HD9A 4NQDB 3QUML 3DXAB 4ZFGL 5LBSH 4PJ9B 2CK0H 1RK7A 2MSPA 5A2FA 2OMVB 5AB2A 4NQCB 5HJ3B 1TQWA 3DMMC 5TE4H 4JHAH 2W81C 2P46B 1RZFL 2R83A 4KUCD 2VDPL 4XE0A 1BDYA 1UD6A 2WANA 3D9AH 1PJWA 2CK2A 2VR7A 3HC2A 4NRXA 2BO0A 1RJLB 5CJXA 4GOSA 4K7PX 1KWGA 1AGBB 4N8VB 1KZQA 1A1NA 1HKLL 2VZOA 3PQYB 1LWJA 2DTSA 4AQ1A 5HXMA 4JG9A 5D70L 5HHNB 2JF1A 4ZFOB 2CRIA 2K1MA 2X6VA 3AWEA 3AQZA 3BD4A 4UBDC 2VTFA 3H7LA 4PJHA 1J05B 1G7QA 4TVPD 5KUMA 2C9QA 2QDWA 3CVHB 2ADIB 2W9LA 3LIUA 2Z31A 3H56A 4BGLA 2DIBA 1FG2B 1HH6B 5DJ2B 3REWB 5CHNB 5F3FA 2Y6TE 3NZHH 4QHLB 4C54A 4E9SA 3MBWA 4PW3A 1ASOA 4MQXC 4M9OA 1MJ7H 2FT8A 4PBVC 2NY2C 5GS1A 5E4IA 3GBDA 3FQRB 4ZXBC 3HE6C 1T22A 1JXJA 2JB6B 2R2CA 3MJ6A 4QR7A 3O8XA 3JT2A 4PRAA 4JM2F 3PNWB 1UZ6F 2BNRE 3NFSH 1DJZA 4A67A 2NSQA 3IETB 5DVPA 4FZ8H 4L9LA 5E6RB 5GGQH 1FNFA 4LCYB 1WIUA 4ELDA 5GRYA 4IHOB 4HUUA 5EORH 4IRJD 3EADA 4M3KB 4AL8H 4LF3A 1L0PA 4ZMOA 1OAXL 3BKMH 3GMNB 1B6UA 3IMVA 3AREA 2K9UA 4F8OA 4IS6A 2QLYA 5D2LF 4HJJL 5JYMA 4A7UA 5FS5A 2A77H 2UZPA 4HU2A 1IT9L 3L1EA 4ZUTB 5E5MB 4POZC 5EFIB 5CEXB 5FYJE 2HVJB 2XG4B 1T2QH 2WZ0A 4KJPD 3FQ2A 3CC5A 1H3GA 4Y5YA 1HVXA 4L5FL 1X5XA 1VA9A 5K5YA 1JZ2A 4IBVA 2JNZA 2KS0A 3NJXA 3TWCH 1NBQA 1P5VA 3O2VL 3EO9H 4LLWB 5IK3B 3GMMB 1LMIA 3G6JB 3VB8A 4EN3D 1BYOA 3R0NA 2A74A 3CG8A 3PWPE 4GUOA 1EO8H 1NCAH 4E9WA 3NK4A 1Q9KB 1DQMH 3VRIA 1H6EA 5F7YC 5LNGA 1ECYA 1MFVA 1XCWA 4DKAA 2CE6A 3ZHNA 4NDMB 5LWYH 3ABLB 2NPLX 3IJSB 7TAAA 1K4DB 5IHBA 4DN3L 3UYRL 2P5EE 3LKRA 1N9PA 4XODA 2KH2B 4HC1A 3TT1H 4HC1L 4XHJD 3B9AA 1BQSA 2JQMA 1CJYA 1D9KC 3TIEA 2FX7L 1NAMB 4O2EA 1OAUL 3O2DL 3W9EB 3QP3A 5GRVL 4FFYH 1BXVA 1H8LA 4ZNEE 1L9SA 3LS4L 5HI5D 1QFOA 1OF2A 4WWNA 5C0IA 3HG0A 4ETQA 4HWZB 5I0YA 3GIVB 3M07A 1PQZB 5TFSH 5HHQB 3UBGA 4MDIA 5ADOL 4P2QE 2XV6B 3HI1B 1CFNB 1RUAL 2XZQL 1DBAL 1EA9C 2YWYA 4TRPH 4FP8L 3O6LH 1PZDA 3DROB 2WLLA 3ABGA 3IS1X 1JD7A 4HAGA 4HUCA 4YDIL 3SKMB 2JCCF 3RP1A 1EERB 3ZR5A 2N4IA 5G4NA 2E7MA 4FNQA 2E7HA 2LU3A 3FO2B 2KUTA 4PTTA 1RULH 2AJYH 1TU2A 2OW7A 4U6VL 1R5IB 1B2WH 5LXGH 1BWWA 4Q9QL 5DTFA 1YN6B 4K5LA 1E6JL 2YO3A 4KTDH 3FT1A 3AS1A 3IDGA 1JTOA 5FK9A 3LZNA 5LN4A 2ZXWB 1MFMA 1CGSH 3F85A 4TNVK 12E8L 1G0DA 4N0YL 4MWFB 4PJXB 4OGZA 3TIDA 1OT2A 2QR0B 3CHXA 3GTTA 5B7EA 5AB0A 2CRYA 4KQ4H 2Y22A 2ZUYA 3MYZA 3DX8A 1HX0A 3OAWA 1OAKL 1RFDL 2NY4C 2Y07L 1KJ2H 2WUBL 2RJMA 3MRQB 5JHBA 5BUAA 3SEPA 2W0PA 1RUQH 4N8PA 4BSWA 5FCSH 4N2OA 1UD8A 2WXIA 4OZFB 1N64L 1CIUA 5CS7A 3KYNA 2A3TA 1G7PA 4YEEA 1FV1B 3HUJA 2AV7B 3V5DA 3HAEG 4HHAA 3FUJA 5EA0L 5IESL 3BH8A 2JKWA 2FUQA 2QFRA 1DQLL 1KY6A 3MLYH 3OMIB 2E5EA 4MMZB 4D8OA 4W6YB 4OIBA 3SE4C 3NZ8B 2YC1A 1TTBA 2ED6A 1KBPA 3C5SB 4M9PA 3DX2A 5JO5B 1FSKB 4H2CA 5GGUB 3ZE2E 2F54B 3PGDB 4R4FH 3Q43A 5FGBA 2G5BA 2O5YL 5DURD 1FHNA 3F6JA 2E59A 4GKZB 3IU3A 5D6CB 1NFDE 4NQEE 4Y88A 2CDEB 3MUY1 4RRPM 1XGPA 4RGOL 1RUKL 4OV5B 4D9LL 5F88B 3Q6GL 2AJSL 4AEIL 1XR9A 3N40F 4XNUL 3MU3A 4IBTA 2VZUA 4NKMA 2J12B 5CGBA 4AVIA 1NIEA 5EU5A 3QXDA 4ZMYA 5KW9L 3D33A 3H0TA 1PZSA 3D18B 5E2TH 3FQUB 3BESR 2VOTA 4N2FA 4ZSOE 1DVFD 4M7LL 5DJCB 4LKXA 2FJFA 1M3IA 4KFMA 4ZFFA 1T3FB 1RZKC 3LQAH 4PB0H 3VFUA 2ZIDA 5CILL 3APFA 4KXBA 3VXUA 4BXSV 5MI0C 1HL8A 5AYQA 4WO4B 1FNLA 2AVFA 4N8VG 4WGWB 3ZKQD 4U49A 4PP2A 4UU9A 4EDWH 4XCEA 1JERA 2B0SL 3K8MA 3KPNA 3QS3A 5HHME 1PAMA 1J5OL 4HCRA 3LMJH 4OGYL 1OP4A 1WTLA 3L2NA 4ONGL 2Q2LA 4HCRL 3RX9A 4X9BA 3JWOH 4KNUA 5JPNB 2PR4H 4TN9A 2YLHA 1LDPH 1SF3A 2HJKA 1TVDA 4L3EB 3N50A 4QHNB 4WFHE 2DDQH 5F7UA 1PU0A 1UQSB 1ACYH 2OYPA 4XO9A 5DWUL 4HD5A 1E5UI 4P2AA 4QRPB 1T0MB 1KLUA 4RWHA 3PWLB 4PWGA 4UNTA 5ALBH 3W57A 4QNPE 1OB0A 5A2IH 5L4MA 3D87B 3BZEA 3GLAA 4F7TA 5EU7E 3ZDXF 4CVZB 2NSMA 1D2OA 4FABH 4MD0A 2MNJB 2ZG1A 1WO2A 4K3HA 2MCG1 4AENB 5AEAA 1FYTD 5M95B 4FCHA 4RGNB 4LDEB 2XKNA 1NM9A 1PLAA 1V27A 1T7YA 4UANA 1XIWD 5CWSA 2EDFA 4OSUL 2Y6SD 3KWXA 5MHSE 1PFCA 2YXMA 3ULUD 4KOCA 4DF9A 3DVNB 2VISA 4HUNB 1CDIA 1N6QH 3KLDA 2XQYG 2O5NA 3G9AB 1IBYA 4I9XA 5CZXC 3UYPB 3H9HA 1DR9A 1ZRUA 2V9QA 2CBTA 5TDOB 3TZVA 1E2ZA 2ZKHH 4QRTB 4JFFB 4KUZL 5ESAA 3IF1B 2EKSA 4GSRA 4AYDC 4KITB 1MFCL 3EXLA 1WK0A 4PN6A 3VQ1C 4Y4HD 4TNWK 3Q2WA 3QXAB 2CLRA 1SMOA 2CMRL 2JIXD 3KGRA 1JPFA 4LARH 2I07B 3MOBL 3P1VA 1M56B 3U48A 5H2BB 1H5BB 5DGRA 3JV6A 4PJEA 5FLUA 1V54B 5K93A 1KZYA 4LDOB 3FF8A 3AMKA 1G7HB 4ZZKA 4G6ML 5FYLL 4MJHA 3IDXL 3IJEB 4ZUVA 4NO2B 4M7ZB 4PM1A 3SY0B 1X4ZA 2VDRB 4Y1AA 4Y5XB 4E36A 1EZUA 4OAWA 3QORB 4XNYL 3WHXA 4X6DF 3NN8B 4OI9A 1OT4A 1EBAA 1FZJB 3OKNB 3KDMB 4MGXA 2QV4A 4NOFA 4W9KC 4XBGB 3ZTEA 3REVA 2CGYA 4N86A 4C56D 3G7TA 5JHAA 4WI0A 5KVFL 4MAYD 3PWUB 3TFKD 2AZAA 3BQUC 1YPZF 4G7RB 5AWNH 3L81A 1T89C 4MASA 1KCRH 5E6IB 3CPLA 3BPLB 4IEFA 2FGZA 2NXZD 3MPCA 3C60C 3HAEA 4G59C 3W1ZA 3F5WB 4BUGA 3ZJAA 4B0MM 3LEVL 4R3SA 3ZE0B 3VRLE 4AKPA 2PTVA 4A2LA 2CIIB 4NJ9L 2YD9A 3V6BR 4UTBA 4ZTOH 2I32A 1IM9D 2ZUWA 4FXTA 1U41A 4GB9A 4UTBL 5MENE 3NEXA 2GSMB 3CNKA 1EEZA 2Q8AL 1QI5A 1S46A 7CGTA 1TQBC 3KPSB 4WWOA 3RAJH 4KQ0A 1JGVH 3LN4B 1MF2H 2X4SA 4BEIA 4IDJH 3MLWH 5HHVH 3JBG7 5FYJD 3O6KL 1R46A 1OE3A 4AM0Q 5DJXB 3VXPA 4YAQA 1OTSD 3IDYC 4N0UB 3MCYA 4KRPB 2HPOA 2O6PA 1Z32X 4N20A 3WI9A 2XKSA 5JA8B 4NQDA 4MJ2A 4ABWA 2BWDA 3DXAA 4PJ9A 1ZPUA 4M6ML 3CZLA 2AQ1A 2OMVA 4NQCA 5HJ3A 2PO6C 5B3JE 4M48H 1UM5H 4PWFA 5ANMB 2DF3A 4GAFB 5KJ7E 3PWPD 1Z9MA 1IIIA 2VMEA 4WWKC 5D1ZC 2FX9L 3J2PA 4TL4A 2EDWA 2DWDB 4YGAB 4BWWA 4TUUA 1RJLA 1OGAE 4OZFG 1IV8A 1ET7A 3FCTB 5GGSY 3TCTA 3GK8L 4FKKA 5IFAH 5J3HC 4ZMAT 1VF5C 4N8VA 1VRSA 5ADPL 5B22A 6CGTA 1V8HA 3PQYA 3QEGL 3BIKB 4NZRL 1MCLA 1YEWA 1N5AB 2F7RA 4HBCL 5HHNA 4EIBA 1GGBL 4ZFOA 4K8RL 4J2XA 4ZFOL 3AGWA 5E9NA 3SE3C 1J05A 4O58L 3US9A 4EN2A 3IGAB 3CVHA 2ADIA 4PRPB 3B56A 3CVHL 4ADJA 1FG2A 1HH6A 2IF7A 3O3BB 4XTRD 5DJ2A 3REWA 3RIAK 4AWJC 4CKVX 4OM0L 5CHNA 2RALA 4QHLA 3QZLA 1G1CA 3LRMA 3MACL 2WVVB 4YL9A 3RDTC 3EYFB 2BZDA 4DERA 4ZW6A 3FQRA 3O6ML 2JB6A 3W9DB 3I9GH 1S7XB 4RMVA 2CNYA 4JMXA 3V0VB 4UZUA 2DIEA 2UY6B 3PNWA 2C8NA 3IETA 3ISWA 5CP3A 1IJNA 3VM5A 5DT1L 4H7VA 1ULVA 3ULVC 4WGVB 4LCYA 3BEVB 3WJLA 2BX5A 4URKA 3CH1A 4IHOA 5F70A 3CPUA 1RUMH 3A5VA 1H0DB 5EH1A 2E7LC 3GMNA 1DQQB 2A1WH 3OPZL 3QUYD 1MCFA 2XQYA 4FHBD 4FYTA 3KJ6H 1DBJH 4ZX3A 4LSSL 1B0RB 4I5BB 4KKNA 1LLAA 1NH6A 4NZDA 4ZUTA 5E5MA 2IO5A 3EFFB 3BZ4B 2I60L 4J7RA 5EFIA 2HVJA 5CEXA 1B90A 2XG4A 1W16A 1KTLB 3DHJA 2VJ0A 3IB4A 4IRJB 5C3TA 1VGEL 4FERA 4JM2C 5AW8B 3B2MA 4YQXH 2XV0A 4FN0A 4EI5B 3FN0L 5JIKA 2W88A 4XZ4A 1ITBB 5I1GH 3VFPB 2ZKWA 3X3GH 4YHLH 5FX3A 1TMCB 4UV4H 1PGRB 1CLVA 3QWRA 4JLRB 4LLWA 1BZ9B 5D55A 5A6LA 3GMMA 1TLMA 3G6JA 4FQ2H 4JMNA 3MTRA 3WIIH 5LDUA 1HNGA 4X99B 1Q9KA 4NAMA 2EEXA 2DLGA 1JNNL 3WKPA 1TDQA 1Q0EA 4Z7WE 3VVVA 3WJJA 4ELKB 4NDMA 3TEXA 3S88L 4NQQA 3IJSA 1K4DA 2BVYA 2DPKA 4OM1H 2FHBA 2FQGA 3RNKB 1MKFA 3H3BC 4YSRA 4BKLB 2VUOA 4GAAA 2HT2C 4FFTA 1G0XA 5FOJA 3AROA 2LVCA 5IG7B 2QSQA 4P8QA 1KB9K 3KBPA 5GRJH 2XJKA 4NO3B 1NAMA 1N70A 1QLRB 3W9EA 1MJUH 4YHOH 1NAML 5I1EH 3VI3E 2W94A 2Y9RT 1OTTC 1TSHA 3BYTA 3VFMA 3NYKA 2VR5A 1YNKL 1MRDL 2EH8H 3SYQA 4PJ8C 4HWZA 3CBKB 1S9WA 3GIVA 3WXWL 4R4NC 2RGSA 4JCMA 5HHQA 4GPVA 4K4KA 2BP5M 3HI1A 1CFNA 4J3OG 1BQKA 1AR2A 2C4XA 2QPUA 2ZCKL 4KKAD 3TS8A 1VACA 3DSNB 2CHNA 3DROA 4YDLB 3SKMA 4D9RD 1OOAA 2DJUA 3RIFF 2L8AA 4YLBA 3L1OL 3C8DA 4J23A 1KMGA 3FO2A 3NPZB 1YEEH 2X6CA 3VFRB 3E9UA 1HHKB 2XKUA 4HDIB 5L88L 3VXSD 1YN6A 1GA2A 2DBLL 2YEVB 2IALB 4TQEH 5HHMD 5C0DB 4GQRA 5GSRB 4NZTH 1DFBL 4MWFA 4PJXA 4Q74A 2QR0A 3DBSA 3T6XA 3MUUA 2BDNL 2VLRB 1PD1A 1NSNL 4NERA 3AWFA 4CVWA 1IILE 4NNXA 4NUJB 4WFHD 3MRQA 43CAB 2J20A 4QI3A 3U9PH 4XP9H 2WOBA 5D1XE 3U30C 2GW5A 4Z3JA 1A7RL 4F9LC 1Y1DA 5EDXA 1QYGL 4OV6F 3APCA 1ZS8B 1QA9B 4OZFA 1JDDA 3L8QA 3S37X 1NBVL 3GB7B 5ICXB 1FV1A 2AV7A 1PBYA 1CFVH 2P8LB 4YR6B 4EIGB 3WEOA 4AW7A 4MAZA 5EUOA 4MMZA 3P3TA 4XPHH 4PJAF 4G2AA 3NZ8A 5CU9A 1N19A 3T2NH 4H0GA 5DMIL 5MHSD 1OOWA 5JO5A 5GGUA 1AG6A 1DQJB 2UX6A 3INUL 1NEPA 1TEFA 2F54A 3PGDA 1OEZW 1CFMA 1UWEH 4HPYL 1G6RH 4TVSa 1JGEB 3RZCC 1TG8A 4GKZA 1XF3B 3QQ9C 5D6CA 1SLUA 1SBSH 4ZAKC 3DSFL 4X7EC 2CDEA 2DJ4A 2WKOA 3JUYA 4NZ8A 3T08A 4OV5A 2JKTM 2WSPA 4G1MB 5F88A 3AUVA 4K3DL 4MMXC 3TC9A 4JY4A 3N1FC 4C4KT 4GYBA 3ASNB 3AW5A 4XPBL 4GY4A 2GITB 4RFEB 1XXFC 2R29H 3FQUA 1AXTH 4OZGB 5DJDA 2IQAB 4AK2A 1T1WB 5DJCA 5D7IF 2NYKA 4U1KB 4BWTA 2AJUH 2WLIB 1OW0C 2EDQA 1T3FA 5JHLH 3RIKA 4CC4A 3U0WH 1MCOL 2VDQB 1X4YA 1J1OL 1SMDA 4M62L 5D7LE 1ID2A 3ZO9A 3C6SB 5D7KE 1WEJH 2ZOUA 3CFEB 4I87A 4PRNB 4WO4A 4QRFA 3IS0X 1DVFB 3VTTA 1I75A 1B4RA 5AOLA 3BT2L 4RZKA 3QC6X 2CM5A 1WHOA 5CEYB 1SHWA 4LDLB 2XUWA 2JH2A 4LP8A 5JPNA 4M3HA 5KSUB 4GRLD 4OR1A 4HLJA 5M7QA 3NCCB 4L3EA 4QHNA 1AO7E 1UUSA 1NC2D 1UQSA 1WFIA 3RI5F 1TSRA 4Q14A 1QUNB 3V4UH 4QRPA 4HF5L 3WFZA 1T0MA 4OFDA 3PWLA 4Y9CA 4MNGE 4RISH 1NIDA 3TM6A 1GIGH 1AQ8A 2IPUG 4PJFE 3LKOB 1JYNA 1JWSB 5KVMC 4I1RA 3WTSA 4AV4A 4PUBH 4AENA 1CE6B 3CCHB 3TJEL 3PP3K 1CBJA 3A3YB 2ZOTA 1N8ZB 4JN1L 5KBLA 1N5YL 1IUZA 3TBBA 4UV7H 3DVNA 2QVTA 4KHXL 4OCXL 3STLB 3EO0B 3QXTA 1YAIA 1FYTB 3UYPA 2P80A 5TDOA 1N6VA 5C9JB 1QNZH 1QHQA 2VZTA 4JFFA 4QRTA 2VSDA 3IF1A 1M9SA 5G4MA 3DTUB 2WLZA 1PZAA 3LXUX 2Z34A 1TZHA 5DS8B 5C08D 5FGSA 5HI4D 2VE6B 3QXAA 2EO7A 3GI9L 2I07A 1XWVA 4BUHA 3SGDH 1FPTL 5H2BA 1H5BA 2AXJA 3QB7C 5J11C 3L3KB 4Q58C 1CICD 5ILTL 3GUTB 1G9HA 1G7HA 4F8NA 4BCZA 1KB3A 1OGAD 1PKQA 3VUAA 4ONHB 2DH3A 3IJEA 3LXAA 4F33B 4Y4HB 1I7TA 1MJ8L 1QHOA 3FPXA 3JWNH 4NO2A 1Y1UA 2JIXB 3K1DA 5DJYB 3SY0A 3QIWB 4Y5XA 6TAAA 4B6ZA 2H6UA 5AAMA 4D0BB 2VDRL 3QORA 1MSPA 5GGTL 3NN8A 4GFTB 1FZJA 3OKNA 3KDMA 4XBGA 3FTVA 1E3XA 1M7IB 3D05A 1WT5A 2IVFC 5C0JB 4NC1C 3QUHA 2M1KA 5FEBA 1CE1H 3PWUA 4WY7L 5IROD 2CUAA 2KC0A 3V7AG 4TSBL 2QVKA 2ZKYA 2EH7L 5K9JH 4P2RE 4UM8B 3HFMH 2R9HC 4EKJA 1UT2A 5HHXH 3F5WA 3RWFB 5LN8A 1JP5A 3P0GB 5CGYC 4MDRA 2APBA 2CIIA 5I1JL 5JZ7D 4X5QA 1XO8A 4P9HL 2IQ9H 3QT2A 3N06B 4MXWL 3OKEB 4GEJA 4DGUA 1YA5A 2NXZB 3DX0A 3IFOB 5E0FA 4AX3A 2ENQA 3PIQB 3KPSA 2BNRB 4UOW0 2Y7QB 1CTOA 1KT2B 3QZNA 3P11H 3LN4A 4OGQC 2EIEA 2BIIA 3BX7C 3BSZA 3EJTA 4L4TD 3NACH 2P5WE 4LNVA 3BSZL 1H8NA 1D3CA 3ZKMD 1IM9B 3FO0L 2QEJA 4PJDE 1UWFA 4UAHA 1CDGA 2VDNH 1GGCH 2G75B 5DJXA 1ZIAA 4N0UA 1IQWL 2FEDD 3CLFH 4PLJC 4XPTL 1NCDH 3BKYH 3UGEA 3KLHD 2ZOKB 5J13C 4TOYL 4A7TA 5ID1B 5J06A 5KVDL 4M56A 3RY4A 3WN6A 4HOMA 3K4ZA 3D4YA 3UG5A 2HAZA 3QCVH 4H8HA 3CLEL 2OMZB 1IGCL 4Y5VB 4XPFL 3MNVB 1N7MH 1KCKA 4DEPB 3P2DA 3DGGB 1R5WB 2DWDA 3QHFH 4UIKH 4XT1C 2A38A 3FDWA 2W1NA 2XICA 1BXUA 3FCTA 3RFRA 2HMID 2B39A 3PCYA 3GRBA 5DC9B 3GSXB 4HS3B 3BFOA 2QQNH 4LAQH 5F1IB 1ZA6B 3BIKA 1N5AA 2V33A 4JREB 2AJXH 4HCFA 3PWPB 2ADGB 3V95A 3VFTB 5DO2C 2AANA 3ARGD 3UPCA 3H9ZA 4MA1C 2E6QA 3SGJC 2IDUA 3NIGE 3KLKA 3VDBA 1J1PL 1T04B 2R2EA 3IGAA 3VACA 1SJVA 4PRPA 1J0KA 1NM4A 4PSRA 3O3BA 4JQVA 2CJUH 2P5EB 2ZCLH 3V4VH 2D7QA 2F19H 1X5ZA 3TA3C 4WW2F 1RURL 3QJFB 2OMBA 2JVUA 3CSFA 5ECGA 1OKEA 2WVVA 3HB3D 4JO5A 2LV4A 3RWEB 1QZ1A 3EYFA 3ZKXB 2IWFA 5KANG 5L6YL 3L95B 1VERA 4LL9A 1BD2E 3W9DA 1S7XA 5GGVH 3MBEC 3QIUD 1VHPA 4TVPL 3V0VA 3B34A 2R7EA 2UY6A 1QEXA 2BFGA 4I89A 5DEFB 5DQDH 5BRQA 3UP1A 3BEVA 3NZUA 4ACTA 3GJFH 2G0KA 2EDLA 3T0WA 2Z35B 3WNIA 1H0DA 4N4YB 4KWUA 1YEDA 1TFHA 4XR8C 2UY7B 2GBAA 4P2QB 5GHWH 2X5PA 5B1JC 5LCVH 5H35B 2N1KA 1A0QH 1B0RA 4I5BA 1JVOA 1J12A 4ANWA 4L2YA 3EFFA 3BZ4A 4P3DB 3WXVH 2YGNA 1DQDH 1KTLA 1ROCA 4IRJA 4FYRA 1AMXA 3OXRB 1TETL 3EF4A 1WA2X 1FORL 4OJEH 1T1ZB 4EI5A 3QUYB 5MERB 3FT0A 3K80A 3TF7C 1PG7X 3T0BA 5B39B 5IQOA 3CZNA 3VFPA 5DMGD 1S2EA 2VMFA 4CAGA 3VXQB 5BZXA 4Y2OB 1P9MA 1TCRB 4H8VA 4JLRA 1BZ9A 4AGMA 3IFLH 1HILB 2YS4A 5KVGL 2DN7A 4X99A 3JWDC 3SODB 5IFJB 5DYOB 4ELKA 4CVXB 1MQKH 2HX9A 2Z7WA 4G7VL 1NEUA 4L29B 1H9VA 3O2WH 4XNDA 3RNKA 4BKLA 5FHAL 3WKNA 5B8CC 1ZLVK 1JNHB 6FABH 3HE7C 3L1FA 1UM6L 2FD6H 1MXDA 35C8H 4O00A 3PWJB 3ZYZA 3ZIYA 1XL4A 5IG7A 3O6FD 1ZV5A 2GAZB 5F3BB 1E7VA 4HUMB 2M26A 4NO3A 2O5ZL 2OCFD 1FNHA 4JQIH 1QLRA 2E75C 4Z78B 4KTEH 1BM7A 5KVEL 3KPPB 3QZMA 3EBIA 4ELME 3HC0B 1P6AB 1Q0YH 4QXUL 5D5MF 2PNDA 4MA7H 3FOMA 1WIOA 3THMH 3ZE2B 4B3VA 3S96B 1RHHB 4LAJH 1E4WL 4WLCA 3FUFA 4XRCB 4RWYH 4JDTL 4MAUH 1XH3B 1BSIA 5L4JA 3WCYA 4LESA 1NFDB 4NQEB 5IIEB 1F58L 2B77A 3VWKC 3DSNA 1ITCA 4LT7A 2W5PA 3ZZQA 4FXLA 2XVBA 4FG6D 1KENL 5TPWL 5IY5B 5D7LD 2EE3A 3GBLA 5E8PB 1KXVA 5F7EH 3B4NA 3BMWA 2GC7C 3D2UD 1AGCB 2JLLA 3VFRA 4EKXA 4E0RB 1HHKA 1T4KB 1W80A 1F4WH 3FC8A 3H42H 1IBDA 3LPOA 4HDIA 4OIIL 5D7SL 5EB9A 4ZSOB 2IALA 3MV7E 5F6HJ 5C0DA 1IE5A 4GINA 4TL5A 3ZUNC 5GSRA 2BFVL 3RE0A 1KJVB 2ROXA 1JXDA 1EXUA 4BK4A 5C3LD 1JCVA 2M2DA 4W9ZA 5F7WC 3ZDZF 8FABB 2VLRA 4U1JB 1QKZL 1F1DA 2DQDL 4TTGA 3VXSB 4NUJA 4EZJA 4CA4A 2AERT 4PJIE 43CAA 1AO7D 5A2BA 5HHMB 2P24A 2VL4A 3HJ0A 4GUCA 4L18A 1DVXA 1V55B 4PJHF 5DZLA 3WSQL 4JVWA 5TQ0L 1KXTB 1DO5A 1Y18A 1ZS8A 2UUDH 2WP3O 4D8PB 1GYVA 2AI0H 1FZOB 3GB7A 5ICXA 1UCBH 3U6RB 4YXKH 2Q1EA 3MR9B 4KDWA 4M7KL 5J5EA 2VIRB 1SZNA 2P8LA 4XNQB 4YR6A 2G3XA 2ZUVA 4I0PD 5GS3A 4U6TA 1KGWA 5DS2A 4IOFC 3H6JA 4J8RB 1W6LA 3FS9A 3Q44A 3IGKA 3MTXA 1FO0B 1DQJA 2CUIA 4Z7QF 1CGUA 4H88L 4QD2E 1TJHH 1HCFX 2FNWA 3PUCA 2ZX5A 1ACCA 1JGEA 3UC0H 1Q38A 3LH2L 3D30A 3L4YA 1XF3A 3VI4B 3PPSA 9PCYA 2ZTBA 2EDRA 2VM9A 1JN6B 3LRKA 5D71L 2IWGA 4GIAA 5FIEA 4PVLA 4PWKA 1P84K 4G1MA 1VCAA 2H5UA 3JQOB 3NCYP 3RJOA 2MIZA 15C8H 4Y4KB 4GRWH 5K9QG 3ARRA 3OKLB 4YHNB 4X98B 2YJQA 2GITA 3MGOB 4HKXB 4RFEA 3UX9B 2V7HB 1IKFH 1AKJB 1SGKA 1VESA 2IQAA 4GKLA 4R2GD 1T1WA 4U33A 5B4MC 4U1KA 4UQAA 2WLIA 1GTNA 3P2BA 3SE8H 2XQBL 1T66C 2G60H 3RTLA 2VDQL 1RD6A 4RX4A 4YZFF 3C6SA 1B4JH 1FZMB 2GUOB 3LY6A 3HC3H 3IN2A 4PRNA 1S7RB 3I75B 3UO1H 1DVFA 2YAHA 2FWSA 4O5LL 5AZUA 2ZUQB 1XTMA 1GGIL 2OR7A 1OAZH 4QT5B 5E2UL 5GXBB 5CEYA 5DUBB 3TU6A 4OH2A 4WHDA 5KN5B 1G5AA 2APTA 5KSUA 4XNXL 4QYOB 2LQRA 3V52L 4ODBD 2DQUL 4M1GL 4ES9A 3HNTH 3N44B 4HWNA 3U82B 1HEJC 2H0EA 1LP9E 1RVFH 4P2RD 1IC5L 1QUNA 1JE6A 3OKDB 3U0PB 1Q72L 2NYYC 2YA1A 3LKOA 3LTVA 1JWSA 1UOLA 3WFCH 4L9DA 4HZLB 3C2AL 1WUNT 3M8OH 1CE6A 5G4OA 2Q8BH 1NC2B 3CCHA 2O93L 4V2CB 3FUDA 4F3FB 1L9PA 4XNAA 3UJTL 1N8ZA 1O6TA 4X5WB 1EPFA 4U1MB 1IC7L 3S8WA 5J7CC 3TPKA 4IBUA 3SPVB 3STLA 3EO0A 4NFBA 1JGUH 2JMRA 1F90L 2W92A 3OB0K 4ZS6C 1FYTA 5FWQA 1RK0B 5GGSB 5JIHA 5C9JA 5MENB 4BRVA 1G94A 1WVZA 1P4BL 1LO2L 2CRZA 4D9QE 1HEZB 2CXKA 2X0WA 4WNJA 4HAKA 1T83A 1HI6B 3FT9A 4ENZA 4K15A 3ULUL 5DS8A 3WTVA 1FIGL 4JB9L 1KGIA 5I19L 2RR3A 2VE6A 5AW4B 4UQIM 4ZPTB 1J0IA 3UZVB 4JQXC 1GSKA 5B39G 1J88A 1JPTH 4AYGA 4CN4A 1RSYA 1RU9L 3L3KA 4KO9A 1M42A 3RQ3A 3WGVB 3GUTA 4F37F 4J6RH 4M93B 3JVGA 4ONHA 3V0HA 1ZS2A 4F33A 3CVIL 4J3TA 3GBMH 4Y4HA 3H9SD 2JIXA 3K6IA 5DJYA 1C5BH 1XH1A 2A4ZA 2NY0B 3B7UX 3BWAB 2OP4L 1TYRA 2VCOA 3DKHA 2H2PD 3QIWA 4IRSD 4YBQD 3C5XA 4PIBA 2VSMB 4AJYV 4B41A 4D0BA 2VWEC 5J9PB 3OVUB 2HRLA 1KXHA 2CCLA 5CEZH 2V5RA 3G9VA 1CICB 3HUJF 4MCZB 2IFGA 5KOMC 3GC3A 1OGAB 4W9EC 3S35H 3STZA 1M7IA 1YUKB 2IXQB 3PHQA 5DRZB 1SXSA 5CZVH 5C0JA 3WD5L 4R7NA 4YNYB 1H3VA 3ZL4H 1FE8H 3HMXA 1BJ8A 4PGEB 2VDOB 4ENED 5DR5L 1GS8A 1P7QD 3T6VA 3MJ7B 4UOZA 4UM8A 4JL2A 4P3CH 2F8OA 5JHMA 2VXUL 2KI6A 3JWNE 3RWFA 3MOAH 3T77B 5JOEA 4I1PA 2VN3A 4GSDL 4PS4H 4E41E 5KBKA 3UDWA 3HNVL 3TL5A 4B9JA 2R56H 2O6CA 1MCHA 4W81A 2QTEA 3IFOA 4JG0L 4QO1B 3PIQA 4XP4H 3UBXB 2BNRA 2Y7QA 1FFNB 1KT2A 4JRXE 1CF1A 1LDSA 2J4WL 4G8IA 4L8DB 1OHZA 5F1KC 1U42A 1UCTA 3MLSH 4KO7A 4IMLB 1IM9A 2D9CA 3HRZB 3RB7A 2G75A 3T0EC 2DD8H 4TSCH 1PVHA 1OY3B 1GC1H 1MDTA 1BG1A 2ZOKA 3POHA 1VFOA 3FMGH 5ID1A 5CO1A 4XN2A 1AQHA 3AS2A 4G7YL 2JSFA 4YWGL 1MRFH 2CJSA 5BO1H 1BCIA 4TQ8A 5FYJL 4CN1A 2OMZA 2EUVA 3SCMD 5BS0D 1A6AB 4Y5VA 2I9LB 3MNVA 4LEOB 1JPSH 1HZHL 4PLKC 3K6DA 4WTWA 5IW3A 4BGDA 3DGGA 1R5WA 2FO8A 3EJZC 3KR3L 5HVHB 3U83A 4AG4L 3ISRA 3GSXA 4HS3A 3PP4L 1BF5A 1CDUA 2ZONA 4X4ME 1CBVL 4MYPA 1XB3A 1ZA6A 2VR9A 3QPXL 5F1IA 4PRDB 4P05A 3UZEC 3DUSB 2FWUA 3PWNB 3NUKA 3WNPA 3PWPA 2ADGA 4LFHD 3VFTA 3OLIA 2LABA 4L3FA 1WWCA 3T65B 1ZVYA 4PGZA 1YEFL 5L2KE 4Z7WB 1T04A 2W9DL 1CC3A 3L1GA 4NENB 2RIKA 1BBDL 3K4DA 2OYMA 3RKDD 5MEOB 2X9YA 3ARDB 1GYAA 3ULAB 1C7TA 2F58L 2P5EA 2UZIL 4N8CL 5D96C 1AR1B 3QJFA 4UT7H 3KH4A 4AUUA 2OJ1A 3ARGB 4XN5A 3RWEA 3RVTC 3L95A 3WAKA 4I18B 2XBTA 1YMMD 5CKGA 2EQDA 5KS9E 4JZJB 1KLGB 2DMKA 1SRDA 5DEFA 3VI3B 4ZNEA 2BSCA 1D7DA 5E4OA 5BRZE 1YUHB 3MRCB 5I15H 2Z35A 1MW2A 4LSRH 5LGHH 4RESB 4LRIA 5C92A 4PQXA 4A2EA 2UY7A 4P2QA 1UOKA 5H35A 1GYWA 3W11D 4WW2C 4MQTB 2JFCA 1SDDB 3FQTB 4JPVL 4OUUB 4PJEF 5TQ2H 3AWGA 3DWTA 4IOSD 5GZNC 4P3DA 2VABB 1DZ0A 4G71B 1IGJB 5EMYA 2ETWA 4P5KB 4U1LB 1AVAA 3OXRA 4KXZH 1W8NA 3IMRA 1B9ZA 1Z0NA 1T1ZA 2PWDA 3QUYA 3KL0A 2EICA 4JKKA 2HT4D 3D4ZA 5MERA 5TJWK 4RDQG 2NT1A 4K5PA 2VLKD 3HPJA 5B39A 5GS0H 3PPEA 1I8MB 4LBAA 3VXQA 4Y2OA 1CLOL 1TCRA 4U7MA 4OT1H 2CO7B 1CDCA 1HILA 3KGSA 1YEJL 1Y6MR 1M3JA 3OZKA 5K1JA 2P1YA 3CXDH 3H85A 3T3PE 5DYOA 4ZNCD 4MNHB 3U2JA 4CVXA 3VW3H 2AJVH 1K5NB 2W60B 2J6EH 5D1XB 4L29A 4Y8AA 3SDXA 3ZMRA 4MB3A 3VFGH 4ZG1A 5I1CH 2DQGH 1JNHA 1OP5K 5L4FA 2FATL 2OZ4H 4XWOC 4K9EH 4OJYA 5CR8A 5I1KH 1ZGLM 4JFSA 1AQKL 3PWJA 2K0RA 3OLEA 1Q1PA 2QT6A 4LSTH 2GAZA 1AANA 4GQ9H 4H8PA 2OBGA 2IBZY 5F3BA 4Z78A 1S78C 1LE5A 5ISZE 4JR9H 3KPPA 1MI5E 3MRNB 4CMHC 5IQ9B 4AQ8C 4JNXA 3HC0A 5C0NC 1D7FA 1XGYH 2VUKA 3S96A 1RHHA 1U4EA 4PRIE 1KJ2B 5GRUH 4Z7UE 4I85A 4XRCA 3BQVA 5E03A 1XH3A 2FYYB 4X5XB 3KPQB 3T6QC 1NFDA 3LVTA 1X5YA 2VZVA 4NQEA 5IIEA 5IMMB 5ICUA 3GBNH 1OQXA 1SQ2N 2DWSA 2FAUA 1U3YA 4K7PH 5DXWA 2RHEA 1JZEA 3ARSA 5J12C 2EP6A 5E8PA 4XN1A 1BZDA 1LNUB 1DBKL 1AGCA 2ZCHH 4KKLD 3VDAA 4E0RA 1T4KA 1JNLH 1U58B 3SQBA 3CGTA 3IMUA 4ZSOA 2J55A 3JUZA 1R3IH 4MA8L 2Z1PA 2N0KA 5BW7C 3VWJB 3WKMH 1KJVA 4Y19E 1LILA 5FHBL 1S5IH 5DD5L 1BPLB 1CT8B 1FDLH 4OJFH 5D7LB 8FABA 4FFZA 4ZD3L 5TF1L 4U1JA 5EC2B 4FFZL 2LTQC 5FO7B 3VXSA 4HMDA 4U1GB 4LSUH 1QUPA 3CQFA 1MELA 2R1WB 3BGAA 3FONB 3IK2A 1NGPL 5EOCJ 1P6WA 2ARJB 2X2UA 4NQSB 3DLQR 3RX5A 1KXTA 4LGPB 2W9EL 4D8PA 1U2YA 1RZKH 1I82A 2G30A 5I26A 4DO4A 3ZTNH 1FZOA 1IFHH 1O6VA 1E8ZA 1DBMH 2HLEB 2EDKA 2XYBA 3Q2CA 3U6RA 1S8DB 3MR9A 1KTCA 4I8DA 2COVD 1NQBA 1IAIL 1QFWL 2V37A 1NMAL 3HCVB 4UDTB 4XBEL 1AO7B 1CVRA 2B5IC 2EO9A 4FE9A 4S1DC 4K73A 1J9TA 4P5RA 5CJXC 3W82A 2ERJC 3ZTDC 2DB8A 4BQCA 1SLVA 1JI1A 1W15A 2G5RA 2NYZA 4J8RA 4M1CC 4MNGB 3R0MA 3UC2A 1I3UA 4MMXB 3OAYK 1FO0A 2F5BL 4AQ1C 4HPHA 4PJFB 4IGBC 1FO0L 1B0WA 1XEDA 1JXGA 3GSQB 3UTQB 4Y16B 3U7WL 5SWQB 2GQHA 4A2FA 3UBXG 2XXCB 1JRHH 2ITFA 4LSQH 4I0PB 3SDCB 3KPLB 2DI9A 5C0RH 2CKBH 1B3JA 2HLAB 4KNSA 1JPEA 2XIDA 3VI4A 1JN6A 2Z31C 4X7CC 3TH2T 4D9QD 1D7BA 4F7CB 4P4KC 1SY6H 5FUZH 4BA8A 3CJJA 4YBLC 2R69H 4RVBA 4Y4KA 1A4CA 1GTFA 3B3BA 1QQDB 2PP9A 3JTSB 1HZLA 3OKLA 3EBGA 4YHNA 4X98A 5EIIB 5IT2H 2L0DA 3MGOA 1INEL 2V7HA 1AKJA 2M83A 3O8XC 3CN0A 5ACLA 1CQKA 4NJAL 2WQAA 1BGXH 3OMNB 3LQZB 4JBSA 3P4OB 1WGOA 5IW1B 2YHGA 2XN1A 1XGZA 1FZMA 2EE0A 1KYDA 3DK2A 2GUOA 4HKZB 4KROB 3FW6A 4FXKB 5D1QE 1IC4L 3H8NA 4WI5A 5DGQA 1S7RA 3G6JF 3AREC 1BJ1J 4OCRH 3TESA 2Z8RA 3I75A 4LVHB 4MD4B 4R2GB 1I3GL 4R26L 3QIBD 1E67A 3RGVD 4KK5C 4ZBJA 1YYMH 1JFQL 5FUOL 3MN8A 4GRWE 4K23H 2WQUA 2C9XA 3AY2A 5DUBA 3UFIA 2YEQA 2DYRB 4XNMB 3BJ91 1F4XL 2HFGH 4QYOA 4DGYH 2B2XL 3NESA 2CKNA 2A2QT 2AAAA 3VAEA 3TYFB 3QRBA 1ZY9A 1F2XK 1T03L 2BHZA 1A7NL 2HKFH 4Z7IA 2DM3A 3U0PA 4ZI8A 2DOCA 5TDNB 5CCJA 4BZ2H 3ETBF 2D9QB 2A9NH 2FX8L 3GSWA 2ATKA 1S9KC 4HZLA 4V11A 3TGXA 4LRNL 5FYKH 1NC2A 2VZ1A 5T5FH 2WLJA 4P2RB 4KI5C 3SYPA 4F3FA 2GCYB 5KYNA 3L7FB 4NCC2 4X5WA 4U1MA 4D94A 3WGUB 1PZ3A 1HOCB 4JRXD 1MCDA 3SPVA 3BN3B 4J4PD 3SBQA 2OTWB 1A6VL 1RK0A 5EO1B 5GGSA 3QRFM 4V1DE 5DLLA 4YHKL 4YHML 4NS0A 1TUPA 1I8IB 4F1SA 5MENA 4M8VA 1UJ3C 2FWLB 2Y06L 3KLQA 2AABH 1HEZA 1JG9A 1ZLSH 2PW2B 1CGVA 4HZAA 5CP7B 1HI6A 5CZRA 1M4KA 2L7JA 3QEQD 1E4HA 3R7QA 1Z9OA 2KQNA 2P5WB 3P0VH 1AFVH 4K94L 1G6VK 4ZPTA 3UZVA 2YQ3A 2XTJE 2WUCL 4PJXF 4DIXA 1PJ9A 3FSAA 3OAUH 3EOTL 1KEGH 3RA7L 4IRZA 3UH8A 2NY3C 7FABL 4KV5E 1UWYA 1ET5A 2I7OA 4IRZL 4J39A 2EE6A 1WCBB 3BPNC 5DD0H 5AVXB 1C1EL 4N3TA 3KDPB 1RPKA 3PAZA 5F1SA 3ROLA 3BWAA 4NKOA 4A6YA 3A6CL 2CR3A 2Z4TA 4A6YL 1NKOA 4NUMA 1FCCA 3QI9D 5GZOD 5J9PA 2A73B 4XMXA 1S3RA 3SJVD 2VO5A 1CICA 3D0VB 1HJCA 3OJVC 4MCZA 1ECZA 1OGAA 4G6AC 2I5YH 2IXQA 5DRZA 1EO7A 2R1YA 2X3AA 4KHTH 4KKBC 5EUOF 2F74B 4YNYA 3D69B 3AY4A 3DVFA 2FO4B 4PGEA 4Q9BA 2NRDA 1MCWM 2ICES 1E6OH 5SX4H 2WXJA 4F8LA 5HDLA 3NIGB 4HT1H 1CIDA 4NRYB 5LBSA 1NDGB 5J1SC 1PYWB 4MCMA 1X9LA 5LBSL 3T77A 4K55A 1UKQA 2OR9H 4WF7A 3IAQA 2GI7A 5TE4L 2OULB 4JHAL 1OCCB 5IROA 1ZXKA 2WKOF 4UOQA 4CBZA 4JPWH 5CEZE 3V8CA 3NFPB 3UCQA 2FHCA 3CFIC 3QJRB 2DEYX 5CUSH 3RPBA 1P7QB 4YHYB 2YN5A 3JV5A 1G1OA 4XWGH 4FTDA 4MKMA 1BD2B 2W80C 3V4PH 3WDIA 4QO1A 4WI4A 3UBXA 3U4EA 3EJPA 1FFNA 3CFBA 4L8DA 3T4AB 4B95C 5FGBC 1PIFA 1ERNA 3RB5A 4E9LA 4IMLA 3HA0A 3HRZA 1N2RA 2BSBA 2DQ6A 1XSKA 5E1IA 1UURA 3UEZA 2R0KH 5AZEH 1BIHA 4PS8A 5KSAC 1EAPB 3H2WA 1DVSA 1HHJB 4L4TA 5IQNA 3VSUA 2X1OA 3NZHL 1GAFH 1A6UH 1MJ7L 3ULVH 2KERA 3O9WD 1A6AA 4DCQB 2I9LA 1UKSA 3BIAX 2M8XA 4LEOA 2B14A 3U9WA 3C09C 2WWMC 2Y5TB 4JFUA 4XAKE 3O4LE 3KEDA 3Q8EA 3TPUB 3GEFA 3NFSL 1CTNA 5T3ZH 4DP2X 4FZ8L 4GP8B 5GGQL 3IWVA 5AW2B 5LGKA 5E95B 2X12A 3MROA 3D08A 4PRDA 5EORL 3DUSA 2JKLA 1UUNA 3FTGA 3PWNA 4AL8L 5AENA 1BF2A 3RGBA 3BKML 1R75A 4NN5C 1BLNB 4MB4A 1O7SA 3T65A 4E9VA 2WGNB 1SN2A 4NI3A 5IBLD 4Z7WA 4ZW8A 2A77L 3SDDC 3E6FB 1PSKH 4NENA 4Q8BA 3W0WD 3P0YH 1UG9A 5MEOA 3VNZA 3ARDA 3FYEB 1T2QL 3GXFA 2P8MB 5F3HB 3MRMB 3RX7A 3V0WH 3FSVA 1JPST 3ARGA 1U9KA 3G6AB 4LL4A 5MP6H 3NJNA 3KPRE 4XI5C 4EXKA 4MJJA 2RD0A 3TWCL 4PS3A 4JZJA 5EC1B 1ZOXA 4LOEA 2VKWA 3VU1A 1IX2A 4UT6H 5DC0A 4HFUH 1KLGA 3EO9L 1MWAH 4AIZB 5EIIG 5ITBH 3VI3A 3K2UH 4ELMB 1DE4B 3UGUA 4KDVA 1IM3D 4DW2H 3MRJA 4AUYA 1YUHA 4ZMTA 3MRCA 1EO8L 1FNSH 5F7HA 1NCAL 3QUZD 1BMZA 3B5GA 1DQML 1YYLH 4J3OF 3S36X 1OZTG 2ZUSA 1KIRB 2VMCA 1E8XA 1SXCA 4XCFH 5LWYL 1ADQH 3C9NA 1Z5YD 1E65A 3WELA 2EEFA 1SDDA 3FQTA 3U4AA 1ODAA 4DWHA 3JZ7A 5ALCH 3EIFA 3UADA 2VABA 3F3HA 4K7FB 5F7LB 1KFGA 3HZYB 1IE4A 4Y19D 1IGJA 1QD0A 3OF6A 4K3JH 4P5KA 4U1LA 3TT1L 5DUMH 2W91A 1QSEE 2X4QB 3RVUC 2V2TB 2DRUA 2X6BA 2WXKA 1MOEA 1HAUA 1EANA 4FFYA 4L3AA 5E1QA 1I8MA 3MV7B 5HPMB 4FFYL 2XETA 1AE6H 1U36A 4XCNB 2D03H 3P69A 9CGTA 3VVWA 1AXIB 2CO7A 5EU6E 3W81A 4A1RA 5TFSL 3OLDA 5SX5K 4HH8A 2ESVE 1QWNA 3LN9A 2W07B 1WAPA 2OKMA 4PJIB 5AVYB 1K5NA 2FR4B 1AGDB 3EFOB 2W60A 2Z4QB 3O6LL 4I88A 4TRPL 1ODUA 5D1XA 3TJHD 5SWSE 4CDGC 1Z3GH 3QQNA 4BFOA 4JO2H 3TFBA 4JHWH 3NG5A 4G82A 2PYFB 1DEDA 2FB4H 1RULL 2AJYL 3GHEH 4XB3A 5L0QC 3QDMD 4MNQE 3NH7H 2R15A 3QO0B 1B2WL 3MRPB 4JM0A 3ZE0F 5LXGL 3QYNA 1JRHI 3UJJH 4KTDL 3Q8AA 4AJVA 3FCSB 5EEYA 2VLJD 1CGSL 1URLA 1XCTB 3ZKNC 4NWTH 1LK3H 5IQ9A 1G0YR 2O6EA 3WIHA 1XDTT 5C07E 1N4XH 4EDXB 4FFWD 4F20A 3KGTA 2YD4A 1X5LA 4TULH 4KQ4L 2KLRA 5F1OB 1KJ2A 1MUJB 3V6FB 4CSSA 1KJ2L 2JB5H 1HYSD 2YUXA 1HC1A 2FYYA 2ZSWB 4I0CC 4FHJA 2WAHA 3KPQA 5IMMA 1RUQL 1X9QA 2OW6A 3WO4B 4I9WD 2IAMB 3ZK0A 3WTUA 3L4CA 4A68A 5L2JB 4AQEB 3SB3A 3JTTB 3BWSA 5TE6H 1JNJA 1I1YB 1JZ7A 4PMFA 4OKVB 1LNUA 1XD0A 3IXTB 1ZE3C 3LYRA 1U58A 3MLYL 4Q4EA 3V0JA 3MZGB 5CJ5A 1URZA 1CU4H 5E4EB 4NPYB 3AU0A 5IMOB 3VWJA 4DP1X 3TBSB 2ORBH 1VAHA 1G6RB 4FYQA 4R4FL 4A7VA 1CT8A 5D7LA 4GAYA 5DJ8B 4NN7B 4HKBB 2X1PA 2XRAH 2WXQA 1UACH 4IDLA 5FO7A 2RTTA 1AZBA 2WWKT 4KUCF 2XACC 4R84A 4NQXB 1I8AA 2XLLA 4PJ9C 3FONA 5HGHB 2X10A 4EAEA 3LH8A 4NQSA 3BUYB 1A1OB 3MFGB 3F7RA 4R83A 5BNXD 2AJ3B 2F8IA 5E51A 4LVOB 5CFHA 4F2FA 4S11A 5EF3A 5BMFH 1S8DA 5E2TL 4R5XA 5I6KA 2GBVA 4UDTA 1CZ8H 3HCVA 1JK9B 1AO7A 1IBGH 2NW2B 3FUHA 4FG2A 1LP9B 2JWYA 2X4UB 4AMXA 3LQAL 3QUGA 4PB0L 4MNGA 4HSQA 5IVZB 4MMXA 1FHGA 3RWIB 2AJZB 4PJFA 3CFDB 4UZSA 4XCYB 2ZSVB 3GSQA 3UTQA 4Y16A 4R4BB 4EDWL 4I0PA 3ARXA 1IGFH 3SDCA 3KPLA 1KPVB 2HLAA 3LMJL 4K9JA 3CFCH 3DJTA 3QRGH 4GXVH 3DDGA 4F7CA 2D3NA 3WY1A 3O0LA 5EWIH 2PR4L 1FFRA 2DEXX 2NZ1A 3Q6FB 2EXTA 2WBWB 1LDPL 1QQDA 2BP3A 3JTSA 4NB7A 4UILH 3OJDB 4F58H 4X2UA 4K7PY 2KPWA 4WZ9A 5ANHA 5EIIA 4GLRI 3C6LD 3ATBA 1ACYL 5CP3H 4H5SB 1G4RA 4RCAA 4U3CA 4K71B 4JRYE 5ALBL 5IEHA 2F8XC 1Q9OB 3LZLA 4L1LA 3LQZA 4IIQC 1II4E 2GTZB 3D3VE 2Z0BA 3LPWA 3M7OA 3P4OA 3QR2A 5ABZA 5IW1A 4FABL 2JTYA 1QSFE 2ADJB 4FXKA 3GI8H 5D6DA 1M7DB 2EXWD 1Q8MA 1A6PA 3A0OA 4MD4A 5HI3D 3TN0C 2Z0UA 4HJGB 3IXAB 4LNRB 2VKXA 1EUUA 1M71B 1L6XA 4OD1H 2WQWA 3H4HA 5B38B 2R2BB 4UINH 3EDFA 4XBMA 4GW5B 4XNMA 3ZE1E 1B4LA 2UV3A 5EV7A 5DZNA 5HDQH 1NMBH 3CFTA 1U2CA 2ZKHL 1BFSA 3TYFA 3JXAA 3HS0C 1WHPA 4M02A 1UHVA 3A21A 5D1ZI 4H25B 2DEWX 5TDNA 3T04D 5I73B 4WEBH 1NBZB 4TM9A 4LARL 3FBKA 1GJUA 4WJ5B 5KYYB 1ANUA 3BD5A 3DBXA 5HGGS 1OV8A 3MLRH 3RL2B 3ZIMA 3T3ME 4N1EA 1AD9B 4O9HH 2H0PA 3UIZA 2FVNA 2F18A 2VMDA 4P2RA 2GCYA 5FPIA 2NY6D 3L7FA 4WTZG 5FCUH 3MLUH 1HOCA 3KPOB 5E9DD 1LM8V 1JXKA 1GCFA 4E41B 2OTWA 4KH9A 4P23C 5EO1A 2YAOA 2O6DA 4Q56A 3FTZA 1I8IA 3FZUD 3VFSA 2X7LB 4FXGC 4AGNA 3DJZA 3QYCA 5CP7A 3QAQA 3SD2A 3ZSSA 1ZV2A 4JRXB 2ZWLT 1G7MB 3SN6N 3T2OA 3TNNB 2CHXA 2P5WA 5AWNL 4HJTA 4YOKA 4QUOA 3OJMB 4IKLA 1KCRL 1GGTA 4F8QA 2OSWA 3TEWA 4WU7B 3S37H 4I3SH 5HYQB 1A4AA 4LXFA 2ZP9A 3IMTA 4XAKD 5FFGA 1M53A 2OMYB 1WCBA 3R19A 5FM4A 3QFJE 4KQ3H 3UBFA 4R0LC 3Q1EA 5A40E 1AS6A 1UT9A 1RKRA 2EEBA 4ZTOL 1JI2A 1EEQA 3MJGX 1I1AD 3NCWA 2A73A 5LKNA 1FGVH 3LKQB 1WIPA 2ZG3A 3D0VA 4M8RA 2OL3B 3HE6D 4FQXB 1DL7H 1UWXK 5D93B 3R18A 1WWWX 2EC9T 1UA7A 5EEXA 1JGVL 1FL5B 5E1AB 2A0LD 1MF2L 2F74A 2WB7A 3H9SA 4IDJL 3D69A 3MLWL 5HHVL 2L7UA 3I2CH 2FO4A 4Z8FH 2VDNB 4H0HB 3QI9B 5LJYH 2P42B 5C09D 1WBYA 2FK9A 1U3HB 4NRYA 3KPRD 5L2KB 3EYQC 1NDGA 4GG6E 1YY9C 2CR0A 2FH8A 2FLMA 4F15C 1FGNH 2PWHA 4Q0XH 3RUGE 1JWUB 3BH9B 4K3EH 4M48L 4O4YH 5I6NA 1UM5L 2IOMA 4ZW7A 3B2PA 3M46A 3VFOB 3NFPA 1CXIA 3F84A 4XZUB 1P7QA 2ZXGA 4KXAA 3QDHA 4F2ME 3SKNB 2YAEA 5A2AA 4MMZC 1BD2A 1O7DC 5IFAL 5KS9B 4GMTL 5FDYA 5I74C 3BE1H 1Q4NX 1ZT1B 3D34A 3T4AA 2ZUUA 3NSCA 3WS6A 4MS6A 4XC3H 5BRZB 1CL7H 2Q3XA 3VXRD 4CSPA 2G2RB 2I26N 4PG9B 3RX8A 3K0YA 4JFXB 2ZYSA 1BYPA 2H1PH 1GY2A 3V4VB 1EAPA 3ZQWA 5BUPA 1H3PH 2NX5E 4A2MA 1NANH 1HHJA 2X3BA 2OJZH 1TYEB 5ID0B 3BI9X 2PCPB 1G7IA 4DCQA 2JJVA 2F2HA 4XVSH 2IPTH 3I9GL 2XPGB 3ECQA 1BZ8A 2Y5TA 4XXDB 2ESVD 3TPUA 4E9YA 1XGUB 2XDHA 2Q10A 3GJFB 1ILSA 4YDKH 1HINH 1IGMH 1L9RA 1RUML 5HJBA 5EG6C 3V6OC 1IQDA 3UL4A 1Q0XH 2FQFA 4PRHE 3RHWK 1BLNA 2GVYA 3SKUD 2A1WL 4LOUC 1NCIA 1J18A 2H3KA 3T3PB 1E0OB 5GS0D 3S3DB 3KJ6L 1DBJL 3E6FA 1MZZA 1ZEAL 4K0OA 2EACA 4DVRH 2IAND 4ZT1A 2IGTA 3IRPX 2OSLB 2NY5H 3QK0A 1EIBA 5DUJA 3ZQ9A 4C47A 3ULVE 4M5TA 5JPNC 3VNYA 3L3GB 2P8MA 5F3HA 3MRMA 2BVQB 3TTSA 1AOZA 2UWEA 1FFTB 2PUQT 4XP6H 3BFQG 3G6AA 4YQXL 5HDWA 3WAJA 2ZOLB 4BE6A 1FJ1B 5T3ZE 4JUSA 3GXMA 3L3HB 3JWDH 5I1GL 5LGYA 5EC1A 3X3GL 4DPBX 4YHLL 4M03A 4UV4L 4Z1PA 2JJSA 4AIZA 3B7YA 2Z65C 4ELMA 1DE4A 3MRBB 1XMWA 3QEUB 4FQ2L 3ULUF 3WIIL 4WTZA 5IV2B 2DLIA 3MKKA 4PRIB 3KVQA 2XFXB 4Z7UB 1KIRA 4N22A 4KGLA 1YMMA 1UEMA 1WITA 2MCAA 3T8MA 1HNFA 5EOTB 4UDUB 4OM1L 1S5HB 4NZFA 4Y4FB 2L4OA 3D85D 3LHPH 1K4CB 4K7FA 2QKIB 2QGCA 1XGRB 2Q86B 1ZSDB 3DA0A 1RZIB 2X4QA 4BFEA 2V2TA 1KB9J 1PX8A 4PI2A 5GRJL 5B38G 1DQVA 4N5EC 1MJUL 2MH4A 4QPEA 2V5YA 3MV7A 4YHOL 4DNLA 5HPMA 5I1EL 1LE9A 1M05B 1HL5A 4XCNA 2EDBA 4Y19B 5B21A 5G5DB 2EH8L 1KACB 3BEWB 3RTQB 5JW4N 2VXQH 3UAAA 4NKOB 2W07A 3FF7A 4PJIA 2H7WA 4RNRB 2FR4A 4DK6A 1FVCA 2Z4QA 3EFOA 3S6CA 3TYGH 3RY5A 1E4XH 3U0TB 1DN2A 4ZUUB 3I6LD 1RZ8B 5TK2A 4HV8B 4TKWA 2LFEA 1YEEL 2ZYIA 2G3MA 3QO0A 3JWNG 1HSAB 3QORC 3MRPA 4X4YA 4OFVA 2GHWB 4TQEL 3PS6A 3X3FH 1MHCB 3FCSA 1IB5A 1OWWA 1XCTA 4NZTL 1QR4A 3P2TA 4X4KA 4WUUE 1E7UA 5CBAB 4PJCE 4EDXA 3AQDA 3CSTA 5DZPA 5I6PA 1MUJA 3V6FA 3QYMA 1LEIB 1MW0A 2YSTA 5IREA 3TT3H 2ZSWA 2EILB 3ULSB 3U9PL 4GW4B 1QLFB 4XP9L 3F7QA 3EH2A 1MCRA 4X6CE 3L08A 2F68X 1AOHA 4LLMB 2IAMA 4JRYD 4YHIB 4B9GA 3C5ZC 1DLHB 3PL6C 2ZNXA 3T2QA 4AQEA 4B7LA 5L2JA 3JTTA 4P9HC 1I1YA 5IHZB 2R27A 3AS0A 1KYOJ 1AGEB 2JI2A 3OBAA 4OKVA 4WJKB 1ASQA 1CFVL 3IXTA 4FNLH 2YZ8A 4F7PA 1I7UB 1R34A 2GK2A 3E38A 1LTXA 2PTTB 3EHBB 4XPHL 2PPAA 3RU8H 4NPYA 2OI9B 3T2NL 5IMOA 2X41A 1OM3H 1HL4A 5HHOD 3TBSA 3FCBA 2WKGA 4XMUA 1G6RA 2AFNA 2E3VA 5L7XH 3GHBH 1T7ZA 4P5TB 1G6RL 1MCNA 5DJ8A 3SDAD 4G9FE 4HKBA 5D1QB 3N1MC 2NY1D 2YR3A 3HZKB 4FQPA 2HTKC 1SBSL 3K72B 4AYBA 4NQXA 3WUWB 3F01A 1RCYA 2WXPA 3TONA 4QRRE 5HGHA 2OM5A 4GRWB 3BUYA 1A1OA 1MREH 3VD2A 3S48A 4AYFA 1C8QA 2AJ3A 3W5MA 2EXYC 3SO3C 4ICXA 3B9KC 2R29A 2Y5QA 2DM4A 3BRFA 2R29L 1AXTL 3L3OB 3UTSE 5C3IA 3DYOA 1JK9A 2NW2A 5JHLA 3UOAB 2AJUL 2X4UA 5AB9A 1BG9A 5JHLL 2IWKA 5DRWB 3U0WL 3KL3A 3DRTB 4OCSH 4XN4A 5IVZA 3QR0A 5I1LB 5IQ7H 2AJZA 3CFDA 1WEJL 4HIXH 1A47A 4C59B 2AK4E 4XCYA 1NCHA 1AKPA 2XZZA 4G8GE 4R4BA 4NM4H 2YFOA 1KPVA 4Y0GA 3I6SA 2QGDA 3VG9C 1FNAA 5E2WH 1J0HA 3ARVA 2XCMC 1S9YB 3FT2B 2WHVA 1I1CA 3N43B 1PG7H 4MHHG 5F9DC 1KCSH 5AKSA 3Q6FA 5JQHC 4I1NB 4LPCA 3OJDA 4TQPA 2HRGA 5FYKD 1E9QB 2BVUA 3AXLB 4I77H 4AIXA 4V1DB 1A7PL 3K8KA 4H5SA 2OFQA 3V4UL 5B1BB 4M00A 1TQCC 2DKSA 4RISL 4PS7A 5FV1L 1GIGL 5T8IA 1Q9OA 2H32H 3ZYOA 2GTZA 3GEWB 5F7NC 1KN4H 3QFJD 4H8QA 1NC4B 4PUBL 4XMKH 2ADJA 4QJ4B 2JE8A 2X38A 3KMDA 2XTJB 4LVNB 2CBPA 4XP5H 5FUCC 1M7DA