1R9FA

Crystal structure of p19 complexed with 19-bp small interfering rna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
121
Chain Sequence
HMTSPFKLPDESPSWTEWRLHNDETQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQEMLQMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*CP*GP*UP*AP*CP*GP*CP*GP*GP*AP*AP*UP*AP*CP*UP*UP*CP*GP*
publication title Recognition of small interfering RNA by a viral suppressor of RNA
pubmed doi rcsb
source organism Tomato bushy stunt virus
molecule tags Viral protein/rna
total genus 34
structure length 121
sequence length 124
ec nomenclature
pdb deposition date 2003-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1810 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1r9fA01
4KNQA 4KTGA 4JNXA 1RPUA 4JGNA 4JK0D 4J39A 4KQ0A 1R9FA 4J5VA
chains in the Genus database with same CATH superfamily
1DANU 4Y8AA 1EK3A 3SOTA 5ACLA 1VFUA 1S8DB 3FOMB 1LD9B 1AXSB 2Y4SA 3OMIB 1PQZA 3JVFC 2IPUG 4F57H 4JG1L 3ARBD 5PAZA 4R0LA 4FHBD 1IKOP 3LJ3A 3OKOA 5CS7A 1MKFA 3OVUB 5CJQL 3KL3A 2Q2EB 4I0PC 1SJXA 1NMBH 2GEEA 4K94L 3UJIL 4PLKC 4AMXA 5I19H 5EN2A 4Q7DA 1YEIL 2VR5A 4XTRC 3MLZH 4C83A 5GGQH 1JGIA 2C9XA 3NRFA 2FE0A 2VDMB 4UQEA 1A21A 2ZTBA 3O8XB 3B9KC 3MFGB 2CK0H 3VD0A 1BDYA 4D8PA 4NIKB 1H3TA 1X5AA 3OKMB 5FGBA 1RUMH 4LCYA 3QPQD 1M7DA 2BP8B 4NAQA 4A67A 2H6PA 4P5KB 2P4AB 3MLVH 3I84A 1YUHA 2H4EA 3F58L 3B2VL 3L2LA 3FZUC 4XR8C 5K1NA 2JJUA 3B7RL 2FLBT 3ZE2F 4AENA 1R19A 5DQ9A 4WU5A 5KSAD 1BQLL 2ZYHA 5L0QB 1A9VA 4L3CB 4PWHA 5GIRA 3F7VA 4GSRA 4ODVL 3MCG1 4IBVA 4OM1L 2R1WB 5SX4H 1IE5A 5GS2D 2F7RA 3T2NL 1I4FB 2FJGB 2TSAA 3A21A 3TOPA 1JZ5A 3GZPA 3DVFA 3N9GL 5KS9E 3QDJD 4NO0A 3LPOA 1YNTA 4QUOA 1SXAA 1FGNL 2BNRA 3WLWC 4OVVA 1IGJB 3SPGA 3KMDA 1RJZA 2NY0D 2R51A 1FAIL 4NWUH 5E2JA 5GGVL 2DM3A 1SY6L 2HFTA 1AIFB 3INUL 3N43B 1WCQA 4AEEA 3HS0C 2XPGA 3L2NA 2V2TB 3CVHA 2JJSA 2UZIH 3DHPA 3BAKA 4HK3N 2J6EA 3PDOB 4MJ6A 3BWUF 5I5IA 3JZYA 5KSBF 3JV6A 4GRLC 4ZFZB 1LYQA 3U4AA 1A4KA 5B38B 1G9MC 4N0YL 1ZSDB 3D3VB 3EYVA 3QUZC 2EIEA 4I87A 1G0XA 3RX9A 4B0MM 4TVUA 4NHUA 1JCKA 5FA3A 4F58H 4GB9A 1KGCD 2RCSL 1BYPA 2IBGA 4WO4D 1AQKL 5DHVA 5LXVA 3W2DH 4HXAL 4BHUI 2BOBA 2IG2H 1N12A 3IDNB 3IDJB 4U1IB 1ZLDA 4M1DL 3DV6A 1OOWA 5HGAA 3FU0A 3QDJE 4QGTA 1UA6L 2MPAL 2JLPA 2WGNB 3MA7B 1EJOL 3OHMB 4RAVB 1SEQH 3C5XA 4P04A 3V9FA 4X7SH 1TCRB 4Y2LA 1WWCA 4KQ3L 3FB5B 2GSIB 3FQRA 4JY4B 1HIML 3DROA 4XBEH 4LSPL 2WXKA 5GXBB 5EF2A 1U33A 3X1EA 1J1PL 1BZ7B 4U4IA 1NCJA 4GRMB 4M5ZL 4HJTA 3UBHA 4XRCA 1TTRA 3QZMA 3VO0A 4QXTB 3CVCA 2BNQB 4OUUB 1OSYA 5LKNA 3HB3B 4EEEA 1ONQA 3VXQB 2WSDA 5E00A 3CG8A 2X3BA 43C9B 4Y1AA 1KV3A 4PJGB 1SPDA 1MCOH 1PPIA 1SN5A 5I1CL 3WJJA 3CFUA 5I17A 2AJZA 2HUHA 3PQYD 3RDJA 2BRRL 1HILA 1BAGA 1A6AA 4XCCL 1KGCE 5D2NE 3ROLA 3WJLC 1NAMB 3ZHLA 2EEXA 2Z1PA 2F19L 1O0VA 3U0PB 1HOCB 4LPWA 5TDOB 4OFKA 4BFJA 2KKQA 3VFMA 3QRLA 4J1UA 2J1XA 4JS7A 3WDJA 4G1EB 4N3TA 1IL1B 3HC3L 4XWGL 2GQHA 2WLJA 1ULVA 2BH0A 2H0EA 3ESMA 4LP4A 4DGUA 3D9AH 3HZVB 2Z35B 3L1OH 1CGSH 5DZLA 4HHGA 1KYOJ 4XO4A 5INCA 4IMLA 1MJ8H 2ZOTA 3LQAH 2WUBH 3D39B 4NAJA 3WKNA 1HC1A 2BS8A 2OSLA 5GJTH 1LO0H 3IMTA 4AZUA 1HHJA 1KJMA 2CALA 2ARJB 1TQBB 4Z3EA 3DURB 5D71L 1JVLA 1QBML 2A6DA 4YK4C 5JOFA 4X4XA 5MP6L 3PV7A 1RZPA 1XB3A 3AREB 4N2FA 1UCBH 1ZD6A 4O9HL 5C0EA 5HYFA 1VPOL 4AM0B 1IJ9A 1LEKA 1F8TH 4NZUL 3WUWG 2ZCLH 3U9PL 1E5BA 1HL4A 1PS3A 3GLAA 3GXTA 2Z92B 3PQYE 1IIKA 2YPLB 4XZUB 3OHXB 3AGVA 2CHWA 3FQYA 3WFCH 2E47A 2HFFA 3EKCA 3BH9B 3MRJA 4A6YH 1I1AB 1INDL 3QCTH 4EUPH 5E6ZA 1G1CA 2C9PA 3TVMB 2WWNA 3UFIA 2ICEA 2V2WA 1L0YA 2G2RB 4HIJB 4MNQD 1ZT7A 1XIWC 4Q6KA 2WLNA 1USZA 4JFXB 4D9RD 1HT6A 3MROA 1IC4H 3WIIH 3KLLA 3FB7B 2EE3A 1DE4B 3NK4A 1M71B 4JN2A 2PR9A 3IRZA 4JFFD 4BFKA 3CZSA 1JK8A 4P4KB 3HR6A 1GXEA 2BVPB 2QQLH 3N85H 5GS0D 3R4DA 5I6OA 2WZPD 1PCSA 1AP2A 3AG2B 2VN4A 2FZ3A 4K9EL 4CDHA 4R2GC 1NGWB 3WN5A 1EEYA 3QG7H 4WSKA 5IB1A 1OTTD 4R7DB 1B0GA 3UAJD 1UA3A 4Y5YC 4PRDB 2WSKA 2WBJB 2YWZA 1ZHBB 3BWZA 3HG2A 4DKEH 3MTRA 4UIMA 4NQEB 5TGBB 1AZZC 4B95C 4F7MB 4LDLB 3PFQA 4OAWA 5IROD 3OKDB 5IEHA 1C12B 1P69B 4V1DD 4MQXC 4ORZC 2UX6A 3T77B 5GGSY 3GSRB 1R5WA 5F7DA 1PX4A 1E43A 1A5FL 2FWSA 4MNQE 4ZOCA 4EOWH 3D30A 3F05A 3N1QC 1SLXA 2HKHL 4D9RE 3ZHNA 1U8IA 4ZTOL 2O93L 1MJ7H 3S3CB 2CO4A 3KHOA 4GH7B 5CD5D 1IAIM 2VDOB 3DVIA 2XZZA 4GW4A 5JDSB 1W0YT 1ZIBA 4JFFE 3WFHA 4EZJA 4K3DH 3H0TA 3J7HA 3DBXB 2X3CA 1KJ2L 2GCYB 1U6AL 2Y5TA 2DEWX 3G6JB 1NL0L 4F9LC 1AE6H 2Q3AA 3QYCA 2OZ4L 3DPBA 1IGFL 3ZMRA 2BSTA 3P77B 3KAAA 2X4NB 3LOWA 5CNHA 3VCLA 2W94A 4CNIB 4LPUA 5GZOA 4PJ9C 2I27N 1WFOA 3T0VA 5HYQA 3E38A 4Z95L 5LAXB 4U3HA 2ITFA 4K4KA 3H6AA 1IFHH 3UYRL 5JORA 1RKRA 3DX6A 3TF7C 4FZEL 1PZ5A 3EIFA 3L6FA 3N1MC 1JHKL 2YAEA 2DWDB 5DYFA 4IIZA 3ZTDC 5B21A 5D1ZI 4V1DE 4W9EC 3O4LD 3PL6A 5F1NB 4RX4A 1FH5H 4XXDA 1GIGH 2CCLA 3SBPA 5JPMB 4J4PD 3UTTB 4F2FA 3LNHA 1FNHA 3SE3C 3MRIB 4MJIB 1RJYB 3UYPB 1W0VB 3TCLB 4A63A 1L5GB 3B3IA 4QT5A 2KYIA 4A7QA 4F8LA 4UILL 2O5YL 4M6OL 2G4EA 4AL8H 3VJ6A 1F6AA 1AANA 1TZ8A 3LRGA 4KHXL 4J7RA 4FYSA 2PTVA 2ID5A 2F54B 4C8XA 4ZUVB 3NH7H 4RMTA 5D1ZD 3BZFB 1BXAA 4HQQL 5FO7B 3A3YB 1M05A 3JXAA 3VU1A 3ZDZE 4D9QD 4PGEA 1MFEH 2MIZA 4X98A 4WIQA 5KBMA 5FF6A 4JRXD 3QFGA 2NY2B 5B4MC 3ZTNH 2EVGA 4JK0D 1KULA 4HXBH 3GXIA 2V7HA 4N5EC 1EO8H 3TU6A 4CVXB 3NFPA 3BXNB 4Z7NB 3O4LE 3OPZL 4GAYA 4WJ5B 1ZT1A 3BRDA 3HAEA 5DJZA 3O9WC 1F6LL 1FGVH 2MOGA 1NFDB 4L0PB 1GKEA 4ELDA 1NMBL 4M3KB 2NR6A 4PW9A 5DJ8B 1QPPA 3MLZL 5GGQL 3KE0A 4BFBD 3KPQA 3G5ZA 3EOTH 5T1LD 3IK2A 2Y36L 1OW0C 5C9JA 3JWDH 3JBG7 4Z76B 4TM9A 5EFIA 1JP5A 2XKNA 5D70H 2ADYA 2A9ML 1KPVA 2DIBA 1RUML 2QQNH 4LEXH 4LU5L 5BRQA 5K69A 1JYVA 3WO4C 5DJ2B 1KFGA 1OPGL 3GSVA 1EERB 3G9AB 2AITA 4D9QE 1LK3H 3MLVL 4TUJB 1Q0EA 2YARA 4B5ZA 1ZCRA 3UTZA 4APQD 2XVBA 4JMXA 4A55A 4E9XA 5H94A 5I30H 1JTTA 2ITDB 1ZJAA 4G8EB 4JRXE 3RA7H 5IHBA 1H6EA 5IFJA 2NY1B 2IH3B 2F8IA 2Y69B 1Z9SB 4XAKD 2ATPB 2B3IA 2WINB 3BSZA 3FOLB 1H3PH 3JTTB 4R84A 2XY1A 3OBAA 4Y9EA 4G6KH 2I07A 4OZFH 3BEVA 2D7QA 2XFXA 5J7CC 2WQAA 5I0WA 5HI4D 5T1KD 3HRZA 4WFFD 5EPMA 1FZMB 3WNLA 4AQOA 5AL0A 1N6QH 4UTBA 5CEYB 1EHAA 4W4OA 4X7EC 4NWUL 4QHUA 1Q94B 4QNPE 5EU6B 3RWJB 1RP8A 4HBCH 3QE5A 3QG6B 1PF3A 5D1XC 2DD8L 2WWKO 3T9WA 5C2UB 3CH1B 2OTUA 1P5VB 4BA8A 4NUGH 1ID2A 3ARPA 4HKBB 4LCWA 4Z3JA 4LB8A 4KUCD 3AW5A 5IQ9A 1LLAA 4WTZG 5HY9A 3OX8A 3EYUH 3QNXA 3UZQA 4CVZB 4F58L 1BFOB 4TMPA 2YD6A 3C5ZB 2IXQB 1F58L 3O3EA 3Q2WA 3W2DL 5F6HJ 3DRQB 4GIAA 5LBSA 3GUTB 4XAKE 4OV5A 2IG2L 3ZY7A 2JKLA 2UY6B 3EJPA 1VZHA 3HI6H 2KLTA 4XCYA 2EDDA 3Q0HA 3UXFA 2VDLH 5FUZH 4TNVF 3S97C 4BDVA 2OL3H 5D5MF 4QHNB 2ZAIA 4AYDC 4DOHE 4XGZA 1SLUA 3QUYD 2HLFC 1XV8A 2CO3A 4B9FA 3ARFD 4WFFE 2FUTA 4X7SL 5GJSL 1GSKA 3QJHA 4XBEL 2F7PA 1A8JH 2AK1H 1NCTA 4NRZB 5DHXB 4AIZA 3UADA 5EN3A 5AKVA 4Z7OB 3D69A 4AMWA 4U6XB 1KB5A 4PIBA 1YSOA 5AFAA 3NIGB 3PWNB 2LTQC 2E9GA 1E6JH 4FQIH 4QYOA 2YSTA 3HHSA 1U42A 1GY1A 2WAHA 5C92A 4JFDA 4ZYKA 1E9PB 1NAKL 4L9LC 3S3SA 3QORC 4Z7VE 2XWXA 3KPPB 2ZG1A 3CMOL 3AU1A 3RWCA 5HHPB 1T89C 2HJKB 3NIDF 4OZHB 1HQRB 4OF6A 3ZKXC 5ILTL 3N91A 3ARRA 2CLRA 3DVNB 1HK6A 1UYWH 2FGZA 5KOVC 4MFHA 3VGBA 5L2KA 5AVXB 5DD5H 1A7RH 4TVPH 4HUWB 3OXSB 3ULVC 1D5MB 1Z6JT 2WXLA 3FQWB 3L3DA 2VW7A 3Q3GA 1X7SA 4L8BA 4N2HA 3QZLA 3B1UA 1QOKA 2R83A 5JA8B 2JKJA 5B39G 2Z31A 1XGTB 4XPFH 3JTSB 3FUDA 1KTBA 3NUKA 1P7QB 3UDWC 1VKXA 1ANUA 1MJ8L 3O4OC 1Q9OB 3LQAL 2PCYA 1KDJA 1KTJA 2DLFH 3K0WA 4MWFB 1K5NB 5EO9B 5GJTL 4DP4X 3D25A 1GZHA 3HUJB 1Y6KR 3U30C 5FOBB 4Y4KB 1MW1A 3OF6A 4J6RL 1AIZA 3QDGB 5GHWH 1UCBL 1IM9A 2I26N 3KWUA 5HJBA 1JZ3A 1FNSH 4QHPA 1DBJL 1ZLVK 2HCZX 4KKBD 2B8OT 1F8TL 2PWGA 2ZCLL 5TQ2H 1KPUA 1YEDB 2WLZA 2YXMA 3RUGF 5JR1L 1AQDB 3M45A 4YS4A 1JF1A 1ETJA 4F15B 3WFCL 1URLA 3RVXC 2O26U 3VXRD 4F1ZA 2A2QT 4IRSB 4A6YL 5FHBH 2I9LA 3GM0A 2WQRA 1BHGA 3QCTL 2IH9A 3CH8A 4PCKA 4WI3A 3TO4B 4WF7A 5I6XC 3GUFA 3KYMA 2ZXAA 4FLRA 4PJDA 4QRUB 2D3JA 4PAZA 3TZVD 5E7FA 4ZDHA 5D5MA 1NC2B 3MRFB 4ICWA 3ZZQA 3KBEA 4WWNA 1Z5YD 3MO1A 1OO2A 5ICUA 3WU1A 4M4PA 1AY1H 1XHHA 3ATBA 7PCYA 1SHSA 1DJWA 2KQMA 5JHLL 4UUJB 4AGQA 4NYLA 1JWSB 4KAQL 5FO9A 2DYPD 3SGEI 2ROYA 1A9BA 4JFQA 5BV7H 4Y5VC 5KANI 3QG7L 3BUTA 4J3OC 2V37A 5IG7B 4PJHB 1NGYB 1JPTL 3LHPH 4JFEA 5F3HA 2PR4H 4EN3D 5HJGA 4HG4K 3HZMB 2OS7A 1C5DB 4N86A 1A6WH 2WMPB 4DKEL 2QKIC 4F8TA 3C2SA 1VCBC 2DLIA 2BVOA 4XHJC 3TA4D 4LHQB 4IDJH 3UTSA 3VXRE 4OCLC 1ES0A 2YC1A 1OGTA 3QWRD 3FQTB 5E2VH 1KTKE 5HHXH 1PX3A 5HHMD 5HGBA 2OYLA 4GQRA 3RGHA 4UDUA 3WG7B 1WA0X 2NY3D 2K3HA 3LEVH 2Y7NA 3D0VB 1YYLH 4AIXA 1CXFA 5A7EA 3GINA 4WTXA 1RMFH 4XWOC 3WHXA 4YVUA 1MJ7L 1CXIA 2XX1A 1GJIA 3VRLE 4JPSA 2YEZA 4YNYA 1J8HB 3L3GB 2G2NA 2ZX9A 4JZNB 5EZLB 5D7IF 3CX5K 4F8NA 4Z7UF 1XD0A 3VQ2C 4WRLA 3RVUD 5I75B 5DGQA 2N1TE 1AE6L 3W9EA 2EC9T 1QLRA 4UT6A 4JDEA 3M7OA 2FYYA 1X9QA 1OGAA 4CBZA 4HP5A 4LEOB 2VERA 1KPRB 4XP4L 2EUVA 3QBTB 1I3GH 4G3YL 5DD6A 5F7MC 4B6ZA 3HHRB 3T3MF 1IFHL 4TL5A 5CIPH 4HAKA 2YAQA 2ZJSH 4R7LA 4F1SA 3ZYIA 5PCYA 2DMKA 3MV8A 3FN9A 3D0AA 3D7PA 5HHME 4PREA 5CHNB 2FJHA 1KBGL 4NZFA 2HWZH 3L7FB 1QFPA 1YN6B 3D18A 1A1OB 1D5XB 4LSQH 4XOBA 4XNQA 2ZP9A 4NFCA 3KGUA 3RGVC 2G75B 3KLAB 4LEBA 5FUCE 2OTPA 2AVGA 1IV8A 1PNCA 4X8CA 4LCVA 2CJUH 3L9RB 4P4RB 4Q58C 5DHEA 3VGFA 2BIPA 1MH5A 5TK2A 1HN1A 1CDHA 2MMXA 4FQCH 4AL8L 5BRZA 2PP9A 2R1XB 3X3GL 3T0EB 2PABA 1A22B 3O6FB 5E4AA 1CICA 3MUGA 3V6OC 5B3SB 4E5XB 5TH2A 5E6RB 3X12B 3CLEL 3BPCA 5CEZD 2X4OA 1CE6A 1QTSA 4HUXA 4A2GA 2E9JA 4QRTA 4YHPA 2IJ0C 2ERJB 1JPST 4IHOA 2FATL 2Q3XA 4OGYL 4NENA 4CA4A 3MRNA 1XBDA 3RURA 2Q1EA 2BOCA 5JHDA 4W68A 3RL2A 3ZK0A 3VXUB 2W0LA 3K6SA 1VFBB 3HVNA 2DEYX 1PSKH 1EFXA 2DB8A 4HXBL 3S96A 4Q9BA 1D2OA 1EO8L 3SKOB 4PRBB 3WKPA 2AI0H 4AYBA 1PZ3A 4QO1B 1WBYA 3F04A 1I8IA 1M6OB 1EXUA 3I3BA 3V6BR 4XBPA 4H1LG 2DWEA 4EI6B 3QIBB 2NMSA 1ET5A 4R4FH 4L0YA 3FU7B 3ZKMC 3G08A 3TN0D 3K4ZA 4PJBB 4RISH 1OK8A 5AZEH 4HUMB 3EOTL 1IGTB 2WO4A 2K45A 2XQBH 4YDJA 4ZUSA 2N4IA 3BZEA 2R2EA 2VSMB 5D7IA 5D70L 5D7JC 5MHSD 4YLCA 1GR7A 1LP9E 3BMWA 2DICA 2QQNL 3GSWA 4N8CL 2XZQH 5CEZE 2BC4A 4DUVA 5FFOA 1LK3L 3CDZB 4PRAA 1I75A 4U1SB 1INEH 3BMVA 2DWTA 5I30L 1AACA 1KIRB 1AZNA 3RA7L 1HTYA 1KDIA 3EFDL 4I0PA 2Q86B 3HW7A 3BWAA 5DGRA 5CBEA 1Q9WB 4NC2B 4NN7B 2ENQA 3IDIA 1M1XB 4YX2H 2EQDA 4Y9CA 4D3CH 3GHPA 1XGRB 1OK0A 2VMEA 4AEFA 3UEZA 2FH8A 4D9LH 3B9KA 2CGYA 1CGVA 3ZE1E 5F7AA 4ADJA 2ZNWA 1KEMH 2XHNA 4YSTA 4ES8A 1BLNB 2YAMA 5A3ID 1GAFL 1OALA 4IRZA 1N6QL 4GKSA 2ALWA 3JWOC 3G5VB 5H8DA 3O45A 4Z7QB 4I4WB 2IV9A 2FBRA 2ZKMX 4RGND 3KGRA 1FNGB 4UV7H 1PMYA 5CGMA 5TF1L 1WAAF 5MHSE 1YEGH 4WWID 4HBCL 2W0FA 5E1AB 2QADD 4Z77B 3BLBA 3QIUB 1XR9B 4XMLL 4WK0B 2YD5A 1E6OH 5INDB 3GRWA 1FZOB 1B2YA 2VRQA 5CKGA 2ZUXA 4LCCC 4POZD 4I18C 3SDDB 4DAGH 1D9KC 2AZUA 4AUUA 1JI1A 3EYUL 5DTFB 4BKLA 5IB4A 5DC2A 1XGYH 3QDAA 4MAZA 1ZHNA 4KKCD 2Y7QA 4E68A 5D96C 4CJ0A 5IB3A 3MRHA 4MMYB 1YPZE 2AEWA 3IJEB 3GIVB 2ZE0A 4MNGA 3GJFA 1MLCA 3HI6L 4YR6A 1KV7A 4L5FE 1WH0A 2DQHH 2XY2A 3RVTC 1CDYA 4HH8A 3H6JA 2ZWLT 2HG0A 5EC1A 1EGJL 4PWKA 3HS0A 1S7XB 4YDZA 1R17A 1RZJC 2B4CH 1PZCA 1UT2A 3LZNA 1FVDB 2AK1L 1SQ2N 4GRLA 5AAMC 2R1YA 5EUOB 4UT7H 1AGEB 1ZY9A 4RGNE 3WMPA 2ZWZA 2GTWB 5FECB 3SPVA 1E6JL 3QUZA 4FQIL 2WBKA 1OSZB 3O3BB 4S1SH 4N2NA 5F7LB 3T6XA 4Q74A 1OWRM 3KWTA 7FABH 4HLZH 3LB6C 2Y6SD 1WBXA 2ZG3A 2R0KL 4MQSB 4U0QB 5TFSH 1ZLSH 4DEPB 5D1QB 1CE1L 3GXFA 4PGDA 3LN9A 1P7BA 2BNRD 2UY7A 4KRPD 4G8IA 2NQ3A 1RUPH 3EFOB 5EIIG 2QR0B 4KGJA 4A1RA 5E24E 5K1JA 5FK9B 4IOFD 4KKPA 4JPVL 1UYWL 5FLUA 1ASQA 3L4ZA 3AT9A 2R39A 3Q1SH 5DD5L 5F9WB 3RTQC 3EGDB 3W37A 4QY8B 1K8IA 4IHBA 1A7RL 2ESVD 4PJFF 4TVPL 2ZKWA 3RVVC 4EVNB 4MBOA 2YUVA 3CSGA 3U6RA 4JNXA 3R0NA 3WNJA 1CD1B 2MHAB 1CZ8H 2WYHA 1ZLUH 2WUCH 4XPFL 3QDMD 3RIKA 3EH1A 3QQ3B 5A7BA 1GW6A 2WXQA 2J1KA 1MRDH 3U6XA 5DLMH 4FQQB 5FB8A 2W9EL 5B1JC 2DLFL 3KJ4C 2YWYA 3LRKA 3PHAA 4OW6A 3FCBA 4IS6A 1WAAA 3EUUA 4HBQA 1MCCA 1CG9A 1CK0L 4ODUA 3WMQA 5LHDA 2DLGA 2Q20A 5GHWL 5IUSA 2DMHA 1U8PA 1PKQB 3I9AA 2RHEA 5CMAA 3WKQA 1U36A 4KBPA 1KIUB 4MD5A 5F7WC 1SXCA 4ZODA 2E9WA 1ADQA 2BNRE 5TQ2L 4PP2B 4ZMAT 3OAUL 4RQQA 5TE7L 2H2PD 4Z3IA 4OZIF 1Q72L 4A6YB 4NCC1 3QFJB 1FNEA 2ESVE 4EUPB 5JXED 4YDVA 3KL5A 1G7LA 3FCGA 3CSPA 3IFLH 2VLKD 3IGAA 2FGWL 4DKDC 4XXCC 1RU9H 4DPAX 4Y1AD 4LRIA 5CD3B 1GZPA 3RPIA 4XMXA 3EZJB 3V5DA 5GSVA 3I3DA 4QTIH 5GS1C 5IJKC 4HETA 3IDGB 4FQXB 3TIEB 3QWQB 1EVTC 3KGTA 3QK0A 4JZJB 1AY1L 4FTVB 1YEFH 2AXGB 1TITA 1UCTA 2EXWD 1AFVH 2VIRB 2BSEA 4XMPH 2X0VA 4FFZA 1RZKH 1VERA 2XG5A 4DZBB 5F44A 1UUNA 4HCIA 1VJSA 3QI9C 4NZRH 3ZTJH 1NCHA 3MMEB 4J3UA 4WKZB 4OCYL 2JK5A 5GS2H 3VA6A 4UU9B 2C34A 3FO2B 3K2MC 3RNQB 2PR4L 3K4DA 2MRYA 5IHLB 3WY4A 2F8VA 5E8OA 1U3HB 4DESA 5KVMC 3HJ0A 3FRPG 1ZMYA 3HJEA 4IDJL 2NY6D 4WV1B 5KSUA 3EYSL 4FQLH 4CN4A 2C1OB 5E2VL 5IJCC 4PJFA 4PP1D 5DD0H 2EXSA 5TQ0H 4Y1AE 4Q2ZA 1OM3H 3QIWC 4S0HA 3N40F 3AMKA 2SEBB 3K6DA 1YYLL 1Q0XH 2AEPH 4OI8A 1EX0A 2NY4D 4IKNA 1RMFL 4YHOL 2BY1A 2ADJA 3EBAA 3VFWA 2YLKA 2HTKD 3NJGA 1L7IH 4ELKB 3II1A 5C1MB 2WKLA 1NBCA 2IDUA 4Y5YA 1Y0LB 3MRMA 1J5DA 2DJ4A 4HPOL 4RFOH 1L9MA 2QEJA 5D6CA 3FKUS 3HG1A 4I3RH 3OZKA 4KDVA 3DSNB 1UH4A 3VXOB 1IGIH 4OF7A 1M7UA 1ZA6A 5H35B 1MWOA 1TPXB 2LV4A 3QEHA 1S7TB 1YECH 3V2AR 3UZVA 4HJGA 2APWA 4GXUM 4NQDA 3WFEH 4AQ1A 1GGCH 1EDYA 1DR9A 4JM2D 3RX5A 1U92A 2D8KA 4U6YB 5ENWA 7PAZA 1GHFL 5B7FA 2XTJD 2ZJSL 2XXFA 4OZIA 4R96B 3JVGA 3FT2A 3QNZA 1G6RA 3IDYB 2CKBH 4R4BA 5DQJB 4Z18A 1VFOA 2ZXQA 3DRTA 1DQQA 2OXHA 3RIAK 2HWZL 1LM8V 3KLSA 4N0UB 4PJ8C 4AW7A 1DSYA 1HQ4B 1XF4A 4OM0H 1RCYA 5F7KC 4AT6A 2H9GA 3WTWA 4W1TA 1E4WH 4DP7X 1T5XB 3C6LA 3VFPA 1KWGA 1RXLA 5A43C 3AXLA 4P46D 1DL7H 1UWGH 3TBSB 1OT1A 2APFA 2DY2A 2PWDA 4FQCL 1BIHA 1RJLB 3MCKA 1F86A 3AM8C 5LGHH 4F7KA 4OZGA 4X50A 4QHKJ 5GGVY 5EIIB 1YEEH 4I2XB 2VXQH 3GJEA 5LUMA 1NANI 3P4NB 5F6HI 4A2HA 1UZ8A 2IH1A 4JHWH 5TDNA 2FJFB 1R3JB 1LO5A 1YJDH 3SDAB 2B7DT 3FT1A 3IVKB 5SWSD 3WN6A 1NQBA 3FH7A 3TBVA 3GSXA 3MBWB 1DBMH 3EF7A 2VQ1A 4JFUA 3TJEH 1AJ7H 2XTJE 4KVNL 4PU2A 3BQUA 4JPIB 2VR8A 4XVJH 1TJXA 2R69H 3N6YA 3VRIA 1MFBH 3S5LA 2J1YA 1FZKA 3SDCB 3O41A 3LZQA 1CDJA 3RDTC 4DNLA 2OMZA 4JQIH 4GP4B 5ISZB 2XKUA 4TSCH 3EYFB 3ZO0A 1JZHA 4NN5C 5GZOD 2AK4A 4R4FL 4M9OA 4RFEB 4PYGA 1EZVX 1LE9B 2NSQA 1ZLEA 4FFTA 3QSKB 4RISL 1HHKB 2LFEA 5AZEL 3J07A 4M3JA 1G7QB 3HZ3A 3MC0A 2C9RA 2VC2L 1O6VA 3A22A 5J3HD 1QKZH 3VXNA 4PGZA 1J5OL 5C3IA 3VFVB 5BS0D 2VISA 3L9YA 4ZPVB 1MFCH 2IDFA 4QPEA 2KUTA 3HZKB 3PL6D 4ATTA 5C0RH 4RX4D 5K9OB 4F3FA 2BERA 2WXJA 5L0QC 3CFIC 1O7DE 2XZQL 4FFVC 2GT9A 2J8UE 1OAQL 1N0XH 4WEUD 3MRLA 3NVQA 2H0FA 3VQMA 5SWSE 4OLYL 3RBGA 2NQDA 3O9WA 4OGXH 1RLBA 4X7DC 3ZX1A 1U91B 1ROCA 2GJ6B 4JJOA 4NT6A 3WE6A 1F2XK 2F7IA 2Y23A 4M56A 4LBAA 3FSAA 5KVDH 2F7OA 5FV1L 3ES6A 3SKNB 4D3CL 1BG9A 4BEIA 1OW0A 3F5WB 1CDUA 3AS2A 3LKRA 1S5HA 4OZFB 1T0MA 3P0VH 1PG7L 4JQXC 3SYPA 3ZUNC 5GS0H 5E6YA 3I02B 3X1BA 4H5SA 1Q9LB 3I9PA 5LNEA 5AVUB 5B8CC 1KEML 4FNUA 3UL4A 4F8PA 1JTOA 4U3CA 1ETA1 3L5XH 4WI0B 4JG9A 5B3NA 4GSUA 3MV01 3DTXB 4DW2H 2ED8A 4YSQA 1ZGLP 4KXAA 1EQWA 4RESB 4WJG3 3TFKC 5BS0E 2H3NA 2VM3A 5M95B 5KVFH 3VFSA 1CTOA 1YEGL 3NZ8A 4Y2OB 3P0YH 1MVFA 2J2ZB 5DWUL 4WHDA 4H44C 4CUCA 3SY6A 3ULVF 2ZOLA 1SJHB 1SEBB 2YFOA 4J8RB 1UXSB 3BYYA 4MSWA 2XJLA 4KV5F 2WXMA 5HYEA 1XGYL 3UPCA 3FT4B 4P23C 1OIOA 5K33A 4X6CF 3TEUA 3A67H 3B5HA 2V5RA 1XTLA 4N68A 2DAVA 4I0CC 1TVBA 4I5BB 5AUMB 3TJHC 4AK1A 1J9SA 4PRNB 4I9WD 4ZFFB 2VDLB 2WP3O 5DDHB 4ZUTA 3ZBMA 2OL3B 3V0WL 5GRJL 4NO5A 1MHCB 4W9IC 4ZPTA 3GMLA 3U82B 2R23A 1V54B 2PLTA 3GMMA 5D1XA 5I73B 5E0QA 3UG5A 2B4CL 4M48H 5CJXA 5M7QA 1H3WM 1CFQA 3CHXA 3T0XA 2ZCKH 4PSRA 5J57B 3CFBA 5DUPH 5HYSG 2PXYD 4JDVB 4UT7L 3DJRA 1G9NH 1JRHI 3CZFB 2IDTA 4HSQA 3PWPD 3S4SA 5IOPB 5E5MB 5B1BB 1HKFA 4PJXB 2RALA 3FU6A 3KLQA 5HHOB 4XN1A 3U2JA 7FABL 2WZ5A 3GMNB 4XCEA 1NPJA 1ZLSL 5T3ZL 2BSSB 4KK6C 4XMKH 3UX9B 2D4FA 3BO8A 3KXFB 4UOW1 1ZTXE 1DBAL 4HWBH 4JFOA 3SDXE 2NOYA 2OMWB 4Y19A 3UC0H 1T7ZA 4YWGL 3CXDH 2BWDA 3D2UA 2P47B 5KZCD 4JDTH 5DRNB 3H9HA 3M17A 2XV3A 1GA2A 3IFOA 4IGBB 3C75A 4LVNB 4KJQC 4WEEA 3WY2A 1S5IH 4D94A 2FSEA 4WY7H 1CDGA 1BVKB 4AGPA 4YZFF 1V5JA 2QTVA 2ZXEB 1I8KA 4UTAA 2XOTA 4LCWD 2MCMA 1BQHG 1UACH 1CZ8L 3QHFH 4K73A 3B6SB 1YY9D 3AREC 5C08A 3KPMB 4DP0X 1MRDL 1Q1JH 2M83A 3VWKB 5DLML 3IMRA 3K4AA 1ACCA 3SDYH 5J1AB 1T89A 3PWPE 1CR9H 4U0RC 3UTQB 1SN2A 1VAHA 4JHAH 3WAKA 1ZHKA 2BY3A 2HMIC 1RZGA 4RZKA 2ZOUA 4CU8A 2VMJA 1U8NB 1TQCC 3BIKB 3E6FA 1CGUA 4B9GA 1JI2A 2VO5A 3RZCB 1KCUH 2MQCA 4IKJA 3CFCH 1JD7A 2B59B 1CXLA 3BPOC 3E1ZA 4OQ1A 4X6CA 4LSSL 5D2LF 3K81A 3UDWA 3B2UD 3I9GH 3MREA 4L8CB 1G7HB 4D0DB 3U36A 2GTQA 4FQ2H 3EO0B 1RU9L 4TNFA 1E4XI 4Y2DB 3FT3A 3ETTA 4Q9QH 4P5TB 3U83A 1MJJB 4LCWE 5FGCB 3Q9QA 2J12B 3BH4A 5HGDA 4LL9A 5HPMA 3ASOB 3RTLA 1ZWIB 3BIBX 1IIIA 2CDEA 4K3JH 4YE4H 3O6LH 4WU7B 4FXKA 4G7YH 5E0FA 3DTDA 1ZGLA 4JKMA 3ZZSA 5K9QG 4N0RA 3PGDA 1DDHA 1IE4A 3GRWH 1I8MB 4WW2B 3WEXA 2Q8BH 1Z9OA 4PSPA 4ZOAA 4GG8A 5BV7B 5T5FH 2JKTM 1JF6A 2HVKA 4YHYB 5BQ7A 4CJ1A 5E8DH 3GK8L 1BQUA 2UZPA 1MRCH 2IALA 4MS6A 2Z31D 1EAJA 4UQCA 1BMGA 1W80A 2R0LL 1KCSH 2ICWJ 4HJIA 4M8QA 4EKJA 1VCAA 1Y18B 4P8QA 4H88H 2H47C 3B2PA 3N42F 5C86A 3LRHA 1SJEA 2AVFA 3DUUB 1OVZA 1E3FA 2HYMA 4L0ZA 5IVXB 3PAYA 4JRLA 5I5JA 3HPLA 3EO9H 1IAOA 4JFDE 1TF4A 4XP9L 4HS6B 5AYUH 5E8EA 3ARVA 4ZFQA 3FAWA 2OW6A 3VFTB 3IF1A 4AKOA 4P9ML 1J05B 3U7AA 1KB5L 4ZMVA 4ZUUB 2E7DA 2HVJB 4Y89A 4Z78A 1YDPB 1TQSA 2V9TA 1L7IL 2P8PB 1T66D 1BIIA 1DQDL 5B7MA 2YKKA 4QD2E 4RFOL 4TSAH 3MOAL 2X2YA 4KTDH 2NZIA 3GMOB 4M6MH 5FPIA 1OQXA 4YIQB 4GAAA 4I3RL 2QKIA 2WLLB 4OZ4B 2E7BA 1FIGH 5IMOB 1G7MB 1IGIL 4M29A 1KGJA 4YSAA 1NC4B 3M6DA 1K6QH 3QO0B 4WUUB 1FWXA 3DX8B 4BCZA 1YECL 1IBYA 4CL7A 2WYZA 5AW9B 5H2BB 3VYOA 3HE7D 3HC0A 4Y5XC 5JPMC 2QMKA 1P7KB 1MRFH 5ID0A 3LKPA 1T5WB 5DRZA 4PRIB 5A2LH 2IPKA 3IM1A 3PP3K 3PF2A 3HS9A 2CKBL 3Q01A 3Q7JA 4M7LH 3SGDI 3SKMB 4FP8H 3O81A 5L4FA 4KX9A 3W9DA 4YSEA 1F02I 2XBDA 2MQGA 2QPUA 5EBMA 2IANA 1WICA 1KTCA 5C0JB 1NGZB 3A4AA 4PCYA 3QCUH 4OM0L 1HXKA 1AS8A 3QULB 1A7PL 2MH4A 4X8JB 1QR1A 4P2OD 3VD5A 5AVRB 2VXVH 4A7UA 1YAIA 4BFOA 3ARDB 1DL7L 4X42A 2P5EA 5E6IB 4IQHA 4NUJA 2X0UA 3AG3B 1TEGA 1KXQA 2LLLA 2WD0A 1HH9A 2X7LB 5CN1A 5E56A 4DTGH 3V52H 1YEEL 4PJDE 2VXQL 3N50A 2KPNA 3P4OB 3X14A 2X09A 3DIFA 4JHWL 3V4PH 2NNRA 2C9AA 2WXOA 4HF5H 3VXSA 1V7NH 3RVWC 1QR4A 1YJDL 2H6UA 3VFNB 4IKIA 3A0OA 4K94C 2BDNH 1SXZA 1DBML 4FABH 4HIEB 4OH2A 1N8ZB 2F74B 3GDCA 1AJ7L 1JZDC 1RK1A 3DETD 5I8KH 2Z91B 1KJVA 4MJ2A 1BQHB 3RGVA 2EIMB 2ADIB 4HS3A 5ANME 4XVJL 5F1IA 1N9PA 4C57C 2R69L 3BPNB 2A5UA 1MFBL 2OTWA 3VW3H 3C5JA 4JQIL 5J8OA 3EHBC 4TSCL 3V6ZA 4FOMA 1GVIA 4GKNB 3KG5A 4MJ5A 1CFMA 1YMHB 3OG4B 4JFEE 3DI2B 4O02H 1CDIA 2LVEA 3PNWB 1MCIA 2F08A 2YMXH 5DZJA 2FWOB 5GGSA 3U2SB 4J5VA 1VACA 1FORL 5F1SA 5DHYB 5IB5B 4FJ6A 3BESR 1TMCB 3E8VA 4CN1A 1FYTA 1QKZL 3DTUB 3MV8D 5AYQA 5IQNA 3SCMA 2EZ0C 3MQIA 3QZBA 4QGYA 1JJUA 1MFCL 1QASA 5C0RL 2P80A 4PGCB 1N5AB 1I7TB 2NY1C 1DEEA 4GW1A 4GG6F 1DJIA 5D8JL 1R5IB 1TEYA 3VM7A 4L2LA 4MBRA 1N0XL 1VGKA 1HU8A 1LE5A 3JV4A 2YD0A 5HDBB 4X4YA 2AXWA 4ELMF 2OJEB 1KXVC 1IAII 1R46A 4OGXL 4YXKH 1SXBA 1I9EA 4AMKH 2BNUB 4FQJL 3T8VA 1NJ9B 4NKOB 5BJTB 3PWVB 5KVDL 1OB1A 2JCWA 4EDWL 2ZXDA 1VFAA 3QW9A 4PBXA 3LVEA 2Y2WA 5F71A 5C0BB 3RWFA 3P30H 2W07B 4HX1A 4I1NB 3UJTH 4AQ8C 3P0VL 2Z0UA 3ARYA 4LESA 5BNXD 4HUNB 1E65A 2DW5A 3NN8A 1JPFB 4YC2C 5DFVC 4F7EB 5IF0A 3GI9L 5KYXB 1ETZA 2PYEA 4HIXH 3L5XL 4K8RD 1JNHB 1HCVA 4DW2L 4HWUA 4U6HB 5DJDB 3BUYB 4MYPA 3G5XA 3VI3F 3ZJAA 5J13C 3MV8E 3TWCH 3GS4A 2NXYB 2QJDA 1QW8A 2R29A 3CVBA 2D9CA 3TA3A 1WCBB 2VE6B 3SGJA 4PW3A 5KVFL 3VACA 5I1EL 4M61A 3P0YL 3KPSB 2OMVA 4KK8D 1CLOL 4KZCA 4QLWA 3LZOA 1UT1A 4QCIB 4B27A 2VSCA 3PWUA 2NRDA 3QNYA 3II2A 1RK0B 1M57B 2NUPB 4RNRA 3L81A 3SGEH 4LSRH 1U8KB 3DYOA 4HJ0C 3FTVA 2AQ1A 4GKZB 4KY1H 1F4AA 2HRPH 3CCHB 4B9JA 1FVEB 5SWZB 2QPFA 5I18H 4K7PX 2WBXA 2C4XA 3A67L 4CSZA 5BUPA 2OR9L 2Y2TA 4WI8A 1G5AA 1S6NA 4GUQA 1E9QB 1IZKA 1H0DA 4NQVB 4S1DC 1XO8A 3ETBF 3HN5A 3FQUB 3HIZA 4UT9H 5FLVA 4PWFA 1GJUA 4MXQC 1QMUA 2P8LA 2QV2A 4IYKA 1KF9B 4JFYB 2OP4L 4M48L 4FC3E 4HEPA 4NZTH 3ECWA 5BZDA 4FFWC 5J9PB 3CIAA 1G1OA 4D0BA 3PRZA 1TVHA 4PLKD 3FMGL 4FCAA 5L4IA 4RBPH 3CFJB 1G9NL 2IAMA 5E4IA 4LCCA 4PRHA 4I18A 2VAAA 4DP5X 1U8JA 2X40A 1ZEAL 2QPEB 3KPRD 3P3SA 4XTRD 5KOMC 1ZVSA 1D9KA 4LLVB 5JTWA 4H8UA 1N59A 2HAZA 4QOKA 1J9RA 3B9KD 1DLHB 5EEZA 4GG6A 3BH8B 1N0LA 3GNML 5IWLA 2X4PB 3DV4B 2C1PB 2KDGA 4H7VA 3O6MH 2FO4A 1IGMH 2MNJB 4Z3HA 5IY5B 1IC7H 3DK2A 3L17A 3UC0L 3CXDL 1QRNA 4XVSH 3FYEB 4QHLB 3LAFA 4JDTL 1S7UA 1YMMD 3OLDA 5CZRA 4JO3H 32C2A 4Z5RA 1HCZA 3FZUD 3N1PC 4K15A 1A65A 4NLHA 3LEYH 4BFIB 1S5IL 4NS0A 3NA4A 3VXTA 2Z6FA 3WIHA 3KPNB 3S37H 4AITA 4M1GH 4Y4KC 1JF5A 5MEQA 4L4TA 5EBWB 3QHFL 4ZMQA 3L5WA 1J12A 1Q1JL 2YMTA 2BZCA 2Z7YA 4LCIH 4W6YB 3T08A 4MZIA 1XZWA 4MX7A 3H9SD 1S7WA 1LTXA 3N5AA 1LVEA 3SDYL 3VI3A 3KPRE 4X4MA 4UOJA 3WLWD 2YGOA 4HV8A 4D0CB 2QHLA 3GSNB 4F15C 3ARBB 5B3JE 4G6MH 2NW3A 3NSYA 5T33H 3ABGA 3RY5A 1JERA 1T6VN 1HXMB 5I0XA 2O1AA 1YAZA 2QGCA 1T1ZB 2QSCL 5HSFA 3PXLA 5KS9B 4FXLA 5DS2A 2DJUA 3FT9A 4GRLD 5DFTA 3RAJH 4M62H 3B34A 4QR7A 4TLKA 1ETB1 1KCUL 1P4IL 2OR7A 3NFSH 3NMEA 2P24A 1YMME 5HVGB 3Q8EA 4JREC 3VUAA 4PWIA 1AG6A 3CFCL 3QUZD 5HYJA 3MXWH 3T0DA 2WWMC 4W70A 2AKRA 4FXGA 3I9GL 4ZW7A 1LO4L 3T0AA 4FA7B 2EVJA 1THCA 1BREA 4HCGA 4WK2B 4FNPA 1KY6A 1P84J 4YSPA 1TJIH 1M9WA 4QHKI 4OI9A 5IR1A 3R18A 4K9EC 5FKAA 4YE4L 1UKTA 4DCQA 4S11A 1AD9B 1RUQH 3TBYB 1UA7A 4M00A 3TNNB 3P9WB 4JRFA 3ULUF 1XGPA 1I7RB 1DCEA 1RY7B 3H9SE 3LD8C 3GRWL 5FR3A 5ECGA 2Q8BL 5KSAB 2OMTB 1WZ1H 4MNGE 3L1GA 5T5FL 2A6KB 4OCWL 5AZ2H 2BINA 4NP4H 3CSFA 1G9EA 2IBZY 4AC4A 8FABB 3PY9A 3CMGA 4HJSA 4UYQA 3OKYA 1MRCL 4L5FH 4PY8J 4F27A 3FQNB 2IIJA 3QDJB 3GM8A 2PN5A 1BV8A 4G6JH 1KCSL 4GI6A 2KBGA 3Q48A 4H88L 4YMPA 2AEQH 5J6HA 3HI1A 5CP3H 2PTUA 3DMMA 2Z7WA 3KWWB 5GS1A 1AYOA 2G4GA 2NY0B 4TUUA 3DVGB 3NA9H 5ESAB 1YUKB 3JQOB 3ZL4H 3B9AA 4WSGA 3EO9L 2JCCF 1PFCA 5AYUL 1NFIB 3BP5B 2FEDC 2BHFA 3ARGC 4HKJA 2JIXD 4O2FA 3T1FA 4Z6AT 4RDQF 1DDTA 1X5IA 3ROOB 4CC0A 4P2QA 1GGTA 4F5CE 1IQWL 1XB6A 3KR3H 4FLOA 3WGVB 1EAPB 4PI2A 3QI9A 4KO7A 4P59L 4OFIA 2Y3AA 5DRXA 2NZ9C 3UZEA 1NEUA 4ZSOE 4TS6A 4EI0A 3TO2A 1IEBB 5D2NB 1H15B 2EH8H 1D5RA 4KTDL 4WO4B 4M6ML 5FS5A 5CU9A 4U1HA 1CFVH 4YO0A 1CFBA 3E2HB 4E0RB 3PHOB 4WI2A 1K6QL 3GSQB 1K4CA 1P4LA 3ML9A 5F3BB 4MAYA 2EACA 4KU1A 4NBYB 3N06B 4PGBB 5CSZA 1SBSH 1JUFB 2KERA 1U8QA 2BSRA 3F7YB 1MRFL 1ICTA 2BSED 2PW2A 5E4EC 1G7PB 3I2CH 1WEJL 3WS6C 1IVLA 2W1NA 1QHQA 2YUWA 1IC1A 2CKBB 2CIIB 4M7LL 1HDMB 3REWB 1FRGH 1FG2A 4H8WH 2ZX6A 5AAPA 5K5YA 1WG3A 3O6FC 1QLEH 5I6PA 1D5ZA 2XC8A 1WPCA 5EBLA 4RGOL 4HIHB 1MCJA 3GBNH 2VXVL 3NJHA 4ZMXA 5DZ9A 1XIWD 3PQYB 1WFIA 5E8PA 1KCVH 3MRQA 1IT9L 2PPDA 3U7YH 1HI6B 5KYWA 2KC0A 2JKRM 3IU4H 2XIDA 4XN2A 2UVEA 4DTGL 5C0GB 2EICA 3FU5A 3V52L 1UQSB 5F9JA 3FUJA 1TJHL 2YAPA 5IMLA 1QBAA 2OX5A 4G43A 5FYJD 3MRCA 4PQXA 2P44B 5LN4A 5DD3H 3QO1B 3V4PL 4CRPA 4HF5L 3FCTB 3U46A 1GGBH 3ME0A 2XWRA 1MFNA 3MZTA 3N43F 1ID5I 2BDNL 2VM9A 2X4UA 3GO1L 3MLRH 3O0RH 4IW4C 4PJ8A 5C07A 4FABL 3BVVA 2LFGA 5I8KL 1RZIA 1XZ0A 3QUMB 3ZE0E 1MCFA 5J56B 3ZO9A 1MSPA 4LCUA 35C8L 3L1EA 4P5RA 1OTSC 4MXVE 4BZ2H 2WQVA 2QPSA 3GXNA 5DI8A 1T83C 5E23A 4AGNA 4QXGH 2J44A 1T80A 5E5UB 2O30A 1BJ8A 2XA8H 1OP3H 1TENA 3AM8A 4MQXD 1ZLUK 4O02L 5F96H 1S8DA 2EEFA 3FOMA 1A6VH 1LD9A 1AXSA 4DFHA 2YMXL 1OP5K 2YD3A 2Z34A 3HMXA 8PAZA 2DIAA 1SVBA 3QZWG 1WIPA 1KUMA 1ACXA 1WTLA 3ML8A 3WXWH 4LSVL 5DJ0B 3AT0A 1MCEA 2YJQA 4PPTA 3KLKA 1HE7A 4HGMA 1R75A 3DHUA 3S36H 3ZZLA 1NBVH 2UZXB 2AQTA 5IV2B 1H5BB 1K2DB 4DGWC 1C1EL 3DUSB 3PHSA 4BWTA 2JMRA 5FYJE 1GYCA 1DVZA 4IBZA 3BKJH 1NICA 1KGWA 3T3PE 1IX2A 1FLRL 3P11H 5EDXA 3RE0A 3RDTA 3WTSA 1A4JA 3WO3B 3QJTB 4YXKL 1WWBX 4LNRA 4AMKL 2X4RB 4PJ9D 3OKMA 3IMBA 2R59A 1SDYA 4H2CA 1ITBB 4CADB 4PJGF 4AIOA 4F80A 5J0BA 4F24A 3DGCR 3NDZE 2I25N 4KTGA 1VADB 5KVGE 3NABL 3NSDA 4TYUA 4U7MA 4NUPA 2EKJA 5E1HB 2VZTA 5D7KD 4L3CA 3MCYA 4JRYA 4PB9H 4XPHH 2FK9A 1FBIH 5CLWA 3SDDC 2R1WA 1YHPA 2FJSA 3TWCL 1I4FA 2FJGA 1OF0A 1E42A 3REVB 3GMQB 4V1DB 2HLAB 4IJ3C 1IC5L 2A1WH 1EZVY 5C09A 3BUIA 3FTWA 1IGJA 3HA0A 1PDKA 1YEHH 1FL3B 2GITB 3RI5F 3FO0L 4J39A 1AIFA 3LDBB 2XIBA 4JQXA 4QRPA 3HBGA 3SGKC 2YJLA 2HRPL 4PEEA 2OI9B 3FUEA 1RK7A 4IOSA 4HK0B 4GAGL 3PDOA 2GTZA 5I18L 3V4VH 2XYCA 1W72B 2B20A 4ONOA 3EYQC 4GI8A 1CI5A 4OZGE 4AVIA 4PUBH 4ZFZA 5K9JL 1X5ZA 3LYRA 4LPXA 5JYMA 2VKXA 5B4MD 5IMMB 5B38A 2FB4L 4JFPA 2HKFH 2CGRL 3NCFB 1ZSDA 3S48A 3UMNA 4LHUA 4W9JC 4N5ED 3D3VA 1WFMA 4U6VH 3Q6FB 3DI3B 4Q6IB 4UB0H 5DJAB 4BK5C 2W95A 3O9WD 2F7QA 5D7KE 3ISRA 1DYZA 3T09A 5ALBH 2EKSA 3K3QA 2G5BB 3ETSA 4PRPD 2ICWI 2Y5EA 3DX0A 3IDNA 1TDQA 3DC0A 3IDJA 1BZOA 3R06B 4U1IA 5EO0A 3SBWC 2A99A 5FGRA 4JN1H 1ET8A 1UGNA 5EOQH 5GRXG 3S6CA 5JMRA 3MA7A 2XWTB 4FFYH 3MI6A 4XCNB 1P1ZB 5F9WC 4RAVA 4CC4A 4WO0A 4P23A 5CEXA 4LVEA 3G5WA 4Z7WA 3VQ1C 2W9DL 4LLWA 2GSIA 4JY4A 3O6ML 5ITFB 1BZ7A 1IGML 2X42A 4GRMA 3VXMD 4YHIB 1IC7L 1FQ9C 4X7TA 3U7WH 4LZKA 5CR1A 3IGFA 3CIQA 4QXTA 4XVSL 5GSRA 2BNQA 1BF8A 3HG4A 4OUUA 4WUKL 1M3JA 1E4JA 4JO3L 1BWMA 3VXQA 1IQDB 3NJKA 4LKCB 3LQAC 1NIAA 5CILH 2O5XH 4AYFB 2UUDK 4G11A 3T4YB 1N6UA 1HHHB 2C3XA 1J0JA 4M1GL 4YSSA 5D1ZB 3LZRA 3D52A 2AQ2A 3QJFB 3DECA 4JEGB 1JFHA 4FAAB 3CX2A 1NAMA 2X2JA 4AQAB 3QA3A 4LCIL 3U0PA 2OA9A 2BHYA 5TDOA 3DX9B 4N85A 1CPUA 2VJXA 4JRXB 4LXFA 4PWEA 4PRPE 2FX9L 2C9SA 4IOIB 4G1EA 2VITB 1IL1A 4NBZB 4U7KA 1P5UC 1UEMA 4KVCH 4G6ML 4X5XB 5T33L 3HZVA 4WFED 2Z35A 3IB4A 3UBGA 1AGBB 5KJ7E 2WTRB 3K6OA 5D1XD 3P9MB 2B77A 4LLDA 4X0NA 3RKPA 1HZKA 3POHA 4CSTA 4ZD3H 3S88H 1PZSA 3D39A 3VXME 5HVHC 1NANH 3RAJL 3M8OH 4M62L 3CTTA 4UM8B 1XSJA 3NFSL 2J5LB 2ARJA 2BXZA 1WD9A 3DURA 2BO0A 2KMWA 3D5OF 4FQXC 4LARH 4TNVK 1WZLA 2ARWA 3LEXB 3AREA 1Z3RA 4G9FA 4QRRB 3MXWL 1F97A 1LXMA 3QZWB 4WCYL 1JDCA 2VXSH 4N8VB 4HVBA 5CGYC 3T4AC 4OKDA 2BP0B 4XZUA 2Z92A 2PP8A 2YPLA 1WFNA 3OHXA 4HH9B 4BCYA 1BXVA 4GUCA 2R29H 4Y19D 4APQB 4F8OA 5EO1B 3BH9A 2VMCA 3AWEA 1I1AA 4KDTC 4ORGB 4JFTA 2XWZA 3IDXL 2HLFD 4TNEA 1A02N 2UV3A 3CN1A 2JKXA 4J27A 5I1LB 2ODIA 3U1QA 1U3HC 1G5GA 1WZ1L 5GZNC 2G2RA 3ESOA 2XWBA 3OXRA 4KOBA 4NP4L 4WV1C 4JFXA 1XB8A 4WFEE 4I89A 2VDRH 3GRBA 2CIKB 4WW1B 3FB7A 3RZWA 3C2AH 1DE4A 5D1XE 4DOHB 2XV6B 3CVIH 1ED3B 4NM8H 3RILA 4G6JL 1M71A 3QORD 4F20A 5T1KB 1TO5A 4UTCA 4N2KA 4P4KA 2BVPA 3VH8B 2AEQL 4PJEE 1J1OH 5F1KC 1W8OA 3BC9A 1KEGH 1J9TA 2XU9A 1U8OB 4KUZH 4OD2B 1ET7A 2DPKA 1NINA 3NA9L 1RVFL 4LO9A 3WNNA 1E2WA 3EGXA 3LN5B 4YFDB 3K72B 3VFOB 2AJUH 2NZ1A 5KYYB 1XF2B 1DVXA 2H41A 4PRDA 3S5YA 4Q97A 4BRJA 2WBJA 1ZHBA 2W38A 4Z7VB 4Z3TA 5DURD 3AVEA 2FQDA 1YN7B 4NQEA 4NQUA 4Y19E 4YBLC 3FSOA 4PTUB 4F7MA 3KJ6H 1ZTXH 2FWLB 1C12A 4OLUH 5BCAA 1P4BH 4FGMA 2AAAA 1AS7A 3STZA 3GSRA 1NFDF 3IMVA 5JW4Q 3ZDXE 3BE1H 3B8YA 2D7MA 4DKAA 1CFVL 3KCWA 2E46A 1MCQA 5IW1B 1EEQA 2IVFC 3S8GB 1A1NB 2HJLB 5EHFA 4X99B 3U0TB 5JDSA 3QUYB 4YHZH 5DK0B 3ARFB 4JLRB 3DBXA 4IM8A 1JGVH 2GCYA 4ZZFA 4JPWH 3G6JA 3DBSA 3I2CL 1UKSA 3IFPB 5I9QB 1G7IB 1IBFA 2ORBH 3N44B 1PY9A 5D93C 2X4NA 4EE2A 2E8ZA 4CNIA 4AL8C 1FRGL 1NEPA 4H8WL 4OJCA 3RVXD 4RSYA 2XNAB 3NSJA 5I8EA 3F6LA 5C8JA 1QLEL 3ILDA 5LAXA 1Z0MA 1WBZB 2QVFB 2H2SC 4UINH 3K6FA 5LXGL 4GJTB 4X6DF 2DWDA 4AGOA 3GBNL 1A7NL 2E7MA 3FL7A 3AACA 1ORQB 5DS8A 2J88H 3U7YL 2DJMA 4LLAA 5E7BA 4ZO7A 2BLFA 3ULVL 4Y5XA 4AE0A 5JPMA 5EA0L 3UTTA 1D6VH 3W39B 3BPLB 3IKKA 2BFVH 3MRIA 4MJIA 1RJYA 3V4PB 3VFRB 1JRHH 5DD3L 1W0VA 3TCLA 1NMCB 4PY7A 4KMTH 1R3HB 5IK3B 4FYRA 3SYOA 1L5GA 5CBAB 5L88L 2MQ3A 5JHBA 4J3OD 1T1WB 3MLRL 3O0RL 1JGEB 2GK0B 3M88A 5F9OH 2FR4A 2V5SA 4ZUVA 4OCXL 1MQKH 1NDMA 5SX4I 3OZ9H 4WSJA 5FO7A 3DO4A 2B9BA 1L6XA 3H3PL 1N6VA 4QXGL 4XNBA 2ENJA 3UBXA 4HT1H 2K6ZA 5F96L 4LGRB 1A6VL 4V2CB 3M86A 4ZW5A 5AZUA 5I71B 3WXWL 3ARUA 4JQVC 4WJKB 3BXNA 4P99A 4CVXA 8CGTA 2PPFA 2V4LA 5CGTA 3W11C 1B6DA 4XWOD 1KYUA 2WLIA 3WFZA 2Z93B 4ZW6A 3TTYA 3VXRB 1NFDA 4X4ZA 4PJ6A 4PR5B 2VDNH 4G42A 1N5YL 5DJ8A 3ZDYE 3QQ4B 5HD8C 1KG0A 2WVSA 4Q0XH 4Q89A 1A7OH 3L7EB 3TZVB 4Z7OF 1S9WB 2IQAB 1NFAA 4Z76A 4KO9A 4IJTA 4P5MA 1XR8B 1A6PA 1A47A 3WKYA 2DOCA 2FHFA 2Y07H 3HI5H 4LE8A 1FFRA 4GMTH 3Q43A 5I1AB 3ELQA 3OTTA 4QI3A 3BRFA 2E59A 1WS7A 2X3AA 5DT1L 1X7QA 5DJ2A 5F6IB 1JV2B 2YAFA 2DYPB 2ZKHH 3L54A 4TUJA 2JB6B 4OZHF 5J5EA 5IBLC 3TH3T 2ITDA 4G8EA 5IT2H 4TSBH 1YEJH 1G1YA 3LKNB 3ZHKA 3BP6B 2IH3A 4EN3B 5HDLA 4UV4L 3IAGC 3OJVC 1NH6A 3ALWA 3RGVD 3FOLA 4HHAB 4MVBC 4DK6A 3JTTA 1A7QL 4NWTL 5ACZA 5HHMB 1T2QH 2A1WL 3MNZB 1X9UA 2CRZA 1FZMA 1RERA 3AMLA 3MYJB 2NY3B 2YUZA 5CEYA 1TZIA 1YEHL 2FL5B 1QPKA 1DN2A 1SY6A 4N9GB 3TIDB 2CU9A 4GQZA 3HUJF 1SZNA 4NNPH 5EU6A 3RWJA 1FG9C 3NPSB 5EORL 2EUWA 4KH9A 4O2EB 2LE9A 1RURH 3CH1A 5LGJB 2YZ8A 1P5VA 4PUBL 1EXGA 2P80D 1PY4A 1S9XA 1GS6X 4PMEA 5I28A 2H5UA 4HKBA 1P6WA 5I74B 1AYRA 3FBQA 3M1BB 3VRJB 2CMRH 2N7BA 4LSUH 3MRDB 4QIRA 3VI4F 5BO1H 4U6VL 2K78A 1UM4H 4CVZA 4NKDB 4HDIB 1BFOA 3ULUH 3C5ZA 3RJDA 2APXA 3DPDA 1U8CB 3CC5A 2GJRA 3DRQA 5HDQL 1MHPH 3GUTA 2A38A 3D07A 3ZKMD 1B4RA 2UY6A 2IDCA 1BBDL 4R0LC 4UM9B 2O72A 4NN6C 4U2YA 2VB5A 3HBPA 5JNYB 4S2SA 1Y6NR 4QHNA 4B3VA 3WELA 1PFOA 1BAWA 2ZUSA 4FFYL 1ZS2A 1RUKH 2V7NB 2JH2A 2H32H 4JVPA 5AKSA 4I13B 4N90D 5D7JD 4NRZA 3V6OE 2GSGB 5I1IL 3EDJA 4DP8X 1EEZB 3FCUB 4U6XA 2WIMA 4KOCA 2RA1A 2B1HH 3NEEA 3PWNA 4Y1SA 9PCYA 1EZSA 3ARXA 2IO5A 4U31A 4WDIB 1FL6B 5K1VA 3BN3B 4IIQC 1E9PA 1BM3H 5FGBC 4P2AA 5DMGC 4ANKA 3KPPA 3W38A 4PJHF 3ZL2A 1CQKA 1S3KL 3DX1A 5IM7B 4L1LA 1LP9B 2MTPA 5A2CA 4OZHA 2GUOA 2HJKA 5HHPA 1HQRA 5IHHA 3IPFA 1CYXA 2YPVH 3AB0C 3FO9B 1C08A 2BIMA 1N7MH 3LV3B 1R4XA 1WS8A 2GBUA 2J21A 2RQEA 4AQZA 4HUWA 4X6BB 4G6FD 2NDGA 4HS8L 3FQWA 2WKOA 3RZCC 2A77L 2VDMH 1UD5A 2YO3A 3DWTA 5MEPB 1MEXH 2EXYC 5E08H 1Z32X 4OJDH 1XGTA 1KTLB 3LKQB 4LMQI 4N90E 3JTSA 1QVOB 1P7QA 2GHZA 4QXWA 3ZE1B 1Q9OA 3W5MA 3DA0A 4ZD3L 2JXMB 3S88L 4RFNB 2VXUH 4J3BA 2X0WA 1IUZA 4Y2DC 1K5NA 3TN0B 3FFCD 2WOBA 3HUJA 3M8OL 1FFTB 4P5TC 5DMIH 4F2EA 5FOBA 4Y4KA 3RWGB 4LQFL 3TCTA 5L8LB 1V10A 4LARL 2JJSC 5CINH 4Z1PA 2QVIA 1D9KD 4QOKD 5ELIA 3K7UA 4B96A 1DJZA 3S35H 2VXSL 1G0DA 3ARQA 3HLAB 1RP9A 1YEDA 5BV7C 3IXTB 1AQDA 3QFDB 3VTTA 4DFIA 2BVEA 1KCKA 2X28A 2Y72A 3S36X 2R29L 3NCYS 2YAOA 3DARA 2DKUA 3WS3A 5BOPA 3RVTD 1QRND 2HB0A 3FUIA 1C16B 1DUZB 4MXWH 1QZNA 2FCBA 4FQ1H 3TO4A 4C4KO 2L4OA 3BVNB 5D6DA 2DQEL 4QRUA 4EIBA 2EDLA 4UQ2B 2FQGA 2QLVB 4ZFOL 1YPZB 3L3IB 1HZHL 1NC2A 3MRFA 4ZNCD 1AOZA 3KVDD 3HZYB 5IIEB 3R7QA 3ESPA 4DKFH 2VDRL 3SE8H 2AV1B 4NM8L 3ZHDA 4HJEA 4PWGA 3DHJA 1SXSA 1UZ6E 2ZYSA 5I0VA 2CUMA 3CBJB 3FFCE 4XOAA 1JWSA 2V0AA 1FDLH 1J1OL 4PS7A 2JI1A 1KEGL 1V3MA 4K8RH 4KTYA 5LNDA 1F18A 4RGNB 4QOKE 1HH6B 3CX5J 1TXKA 2AJUL 4HFUH 1IAIH 4PJHA 5IG7A 1NGYA 1EFQA 3DHMA 2RB8A 1HXYB 4HWNA 3L4UA 4GO6B 2QADB 1YC8A 3RTQD 1JCVA 1KTDB 1AH1A 1OARL 3HZMA 3GXMA 1C5DA 3WJJC 4BUHA 3BKMH 2WMPA 3X1NA 4XPAH 1WUNT 3K71A 1E3XA 2NTFB 2WHVA 1QRNE 1Y1DA 3KJ6L 3MNWB 1XD1A 3TYFB 4MCMA 4OLUL 1P4BL 1WDAA 5HYJD 4FX5A 2VR6A 3MLSL 1XQ4A 2BM3A 4NPYB 3NRPA 5EEWA 2HTLC 3NGBB 1KBPA 4LCYB 3VYPA 3HG0A 3LQZB 2QMJA 3MACH 4PJBF 5AVZB 5AENA 5KN5B 2FBJL 4KQ0A 1OAKH 2Z7ZA 2E76C 2Z0BA 3ARGA 3L3GA 4JZNA 5EZLA 2ZXWB 3D85D 1KJ2A 4FL4C 2BMKB 5C0CA 2BWQA 2YMOA 2C3GA 1E5AA 5H37A 4JPWL 1LO2H 4AENB 4DZ8B 1VHPA 1LEGA 4X4ME 2OPCA 2ORBL 4L9DA 1PLCA 2E9BA 4WVRA 3BWUC 5D7SH 5E6IC 1EUUA 1F1DA 3NEXA 4LEOA 2BRQA 1KPRA 1NPNA 1O5DT 2KZBA 4MJJA 3OKEB 5KBKA 1QD0A 5F7EL 5FXCH 5JA9A 5ECJE 1OF2A 1JV5B 5AWNH 4UINL 5AW5B 1ZXQA 4UDTB 3TASA 4PHZA 1YNTB 3ABLB 4BJLA 1MCWW 3AQYA 2FBOJ 4XVOA 4XX1E 2BNRB 4KRPB 1MFDH 5ABZA 3PCYA 3JWNH 1HINL 3UIYA 5HYJE 3L7FA 2EAEA 2IMMA 2XPGB 1D5XA 2ESVB 3FTGB 1D6VL 3CVHB 4A04A 2BFVL 5CN2A 2G75A 2ZONA 3WXVH 4S1QL 3QHTC 3WS6A 1JRHL 4GY4A 4N8PA 2YQ2A 4KJYB 4KMTL 4P4RA 3QI9D 4Z7QF 1N64H 4O51A 4K71C 1PYWA 2DMBA 3QDMB 3RFZB 1QHPA 2R1XA 3MU3A 3T0EA 3O6FA 4NHUB 3O6KH 4LHJB 4E5XA 3GYRA 1F4WH 1OE3A 2YOCA 1QQDA 1MQKL 3X12A 3JT2A 3OZ9L 4GSDL 4EKXA 1RLWA 5E2UH 1UWEH 3NQKA 1OKEA 3WN5C 2YZ1A 4MZRA 2QT6A 1EDQA 4ZOEA 2CWRA 1KBKA 2BVYA 4EIUA 3DV6B 1QSZA 1QBBA 2K4AA 3GXPA 4HT1L 1WJ3A 5HGAB 1U4FA 4WNQA 4YHKL 3WL9B 3HKZA 1CLCA 2GBAA 4JUSA 1VFBA 1X6NA 2AANA 3QIWD 3EGSB 4GQPH 1ND0A 4P9HL 4PRBA 4QO1A 4R97C 3CHPA 1QFOA 1BF5A 2IADA 3HTLX 1IAMA 2CH8A 4QXUL 5IREA 1KN4L 4EI6A 2GEQA 2VDNL 2OULB 5F0MB 4A2FA 2VLKB 4P2QE 5SX5K 3B2DC 4DPCX 4MD0A 3DX7B 4PJBA 1A7OL 4XOCA 4Y1AB 5IBUB 1D7CA 1O7VA 3TGXA 4JFSA 5EUOF 2DKSA 3B5GA 1IGTA 2MOVA 3OB8A 5CP7B 3W0WD 4OGQC 1OPOA 4XN4A 5I17B 3ECUA 5CCJA 2NNAA 3FB8B 2K7PA 2Y07L 2NY7H 3SD5A 3DO7A 4GMTL 3ROLB 4BE6A 3TV3H 3V4UH 5C0FB 3J2PA 3CDZA 2XICA 1USQA 3IS0X 1SFDA 1BQRA 4PJ7E 1JAEA 4U1SA 1FUNA 1L9PA 3VTAA 3SPCA 1KIRA 5GRWA 5IT2L 2WVVA 1LMKA 4NO2B 5CLZA 2Q86A 4FEIA 2V9UA 2HG5B 3K6NA 4JO4H 3F7LA 1Q9WA 2QSVA 3GHBH 3L8QA 5C07D 1M1XA 1RFDH 4PJ8D 5EF1A 5INCB 1E4XL 3HAEG 2UWEE 3POCA 3QYMA 3D1MC 4N2CA 1XGRA 2IOIA 1IFGA 2OSLB 1IB5A 1XFPA 5E1IA 3H42H 2F68X 1I9JH 1AKPA 4F7PB 1KJMB 1E4HA 1A6TB 4HMDA 3IMSA 4X5PA 5CCHE 1ESOA 4LLMB 5E9NA 1T2QL 2ATAA 1AZRA 3DOIA 3SJVD 5C0EB 3O2VL 4NJ9H 3LIZH 3ECBB 2ZP0T 5KYUB 2J1WA 3G5VA 3W0WE 3UYOD 3NT0A 3FW6A 4YBHA 2FX7L 4GYBA 4NNPL 2NY4B 5D2LB 1FNGA 3B9VA 5DR5H 4N2GA 5HBBA 2B4CC 4B9IA 3V4VB 3WTTA 2OXGB 1RURL 1TYRA 2C8NA 2HFFB 3GC3A 1XR9A 2WCGA 5F7UA 4GINA 5INDA 1C5BH 1QFUH 1FZOA 2ZOKB 2WIIB 2YAHA 4C4KT 4DUWA 2ICEB 3SDDA 1KYOK 4J12A 2V2WB 2BIOA 1ZT7B 5DTFA 1J8KA 3ULUL 1HHGB 1EJ8A 4HMEA 3LHAA 4PIRF 3RDTD 3MROB 2HSIA 4M7KH 3KGSA 1YEKL 3DIDA 3PREA 4OFYA 5C07E 5T8IA 5I15L 4JM2B 2QFPA 4MMYA 1FC1A 1FI8C 4XN9A 4OGAC 1CCZA 3GIVA 3LVTA 3OGCB 5I1DB 2NW2B 3TWYA 2VAJA 2XTJB 1BPLB 3PUCA 4G7VH 1JK8B 4IU3B 2WVTA 3GZQA 1NEZA 2X4QB 5KTEH 3SGKA 3MR9B 1DQIA 4LOFA 2A9CA 1S7XA 5JW4N 1GC1H 1RUKL 3WHE0 4ZNEA 5K59E 3CK0H 2VMFA 3PV6B 3SJVE 2YN3A 1DCLA 1FVDA 1O6TA 1JPGB 5EUOA 3PXHA 3IDUA 3SE9H 1AGEA 1FV1A 4ZW3A 4UNIA 2GTWA 2JJTC 5FECA 4JRYD 4UIMB 1OSZA 3O3BA 2R2BB 4P46B 4RWHA 5JZ7C 1BM3L 4OAWB 5DHMC 4I48B 3WI9A 1H3GA 1XXFC 3HMXL 3BP4A 4YOKA 5C09D 3RHWK 4PFEA 3OAYK 4KI5F 3HG3A 4AW4A 2C3VB 4OD1H 3HE6D 3SBWA 5JQ6L 4JKNA 3ATDA 3EFOA 2QR0A 5MI0B 2J8UB 5FYJH 1JNJA 5FK9A 1MREH 4QRPD 2Q6WB 1TG8A 2X1OA 3EGDA 1N7ML 2EDJA 4QY8A 5SWSB 3U1SL 2J6WA 2VZSA 4EVNA 4GW4B 1JVKA 1YRKA 1U3ZA 4CVUA 2PPCA 3MGAA 1CD1A 3D06A 2VDML 2MHAA 4ZTPL 1MEXL 1EZLA 1P0SE 3ASWA 4LHUD 2E75C 5E08L 3TFKD 4LAJH 2CLZB 2AABH 3QQ3A 3LH9A 4AY0A 3HRZC 5HI3C 2EEBA 1UUSA 3NACH 4FQQA 4HCRH 1QTYT 4H20H 4W4OC 2G9HB 2FLMA 1SUJA 5KVGH 5HYQB 2D03L 3QPQC 5DMIL 3JYBA 1AR1B 1E50A 4JRYE 4P5SA 7TAAA 5JORB 3O2WH 4ODHL 2I5YL 3CN2A 3MSPA 1GH7A 1HAWA 1JL8A 2VZ3A 4R26H 4N2MA 4ANVA 5BS0B 1YO4A 3CFKA 4JVUA 4TQHA 3PL6B 4YXHH 1WZAA 4P23D 5C09E 4XNYL 3D4ZA 1A66A 4OLEA 3TJHD 4PG9B 4PP2A 1S2EA 2O6EA 4ICXA 5JLZA 3DSFL 1H8NA 4AM0Q 3G3LA 1SNRA 4QRPE 3ZQXA 4A6YA 3ZT6A 1I82A 2ZP8A 4EUPA 1Q8MA 2BNQD 3ZYOA 4IK6A 3APMA 4MXWL 4FQ1L 4QT5B 1TYEB 2DI8A 3A4EA 2ALAA 1ORSB 4CMHB 2PKDA 3B9DA 4FERA 4ZFOB 1SOKA 4RWYL 2B39A 2NY0C 5ICXB 3G5YB 2ZD0A 3SE8L 3IDGA 3IRCA 4FQXA 1PX8A 3TIEA 2V9RA 3OR7B 2Y06H 5MERA 4A38A 3MLXH 2IOMA 2AXGA 1P1VA 1QFWM 4AYID 5ITBH 2VIRA 5AVQB 4AVKA 2XWEA 4KK6D 4N2BA 5CJOH 3TH4T 2DL9A 3VVWA 4DZBA 3I6GB 4XMUA 4MKTA 4K8RL 4BFNA 4W6WB 3H85A 4NC0B 1JGDB 3MMEA 5HVFB 4DGVH 2OYMA 4WKZA 1RIHH 4HFUL 1IAIL 4KDTA 5GGTH 1ZT1B 4UU9A 2V6HA 3IGUA 3FO2A 3RNQA 4Z7WE 5DJZB 2DQJH 4XN8A 4KJQD 3BKML 3Q9PA 4XPAL 1U3HA 2QBWA 4NCC2 4WV1A 3E2HC 1HZLA 1GYWA 2UXFA 4PLOB 1MXDA 2BNQE 2C1OA 3SDXB 2WZAA 1T20A 3BGMB 1DJYA 3KPQB 4RGMB 5FKPB 4A7TA 3ARED 4G9FD 3F12B 3OB0H 2XKNB 2BHUA 4JHZA 1F4XH 1W8EA 3ZRSA 1A9EB 4QRBA 2SEBA 1P53A 4ELMB 1NOAA 1DJGA 3E9TA 4NNYB 3GSVB 1T7XA 3MRPB 4EDXB 4ELKA 2HMID 4NSKB 3U6XS 2J7LA 2ENSA 2XN9D 2F53A 2ZPKL 4LP5A 2EYRB 3KM1A 1KIQA 1QI4A 5F21B 1LO2L 5IFJB 1KGIA 4DETA 3D4GA 4ZJ9A 2PXYB 15C8L 3IETB 4N0CC 1JXDA 5D7LB 4B50A 5HDOA 3PWPB 3EYOB 1NAML 5D7SL 1S7TA 4HAGA 4AEHH 3LNDA 2VLRA 2G3MA 4TVSa 1CD9B 3KVPA 5DZOA 5AWNL 5HHVH 5AW3B 3KDPB 4K07A 4R96A 1I9RL 1YJDC 1ZK9A 1BZDA 2Y5QA 3VX0A 4A7SA 3LPFA 1NCGA 4QHUB 3EDEA 1E7UA 4TTDC 5BO0D 5KZCB 3H2PA 4G9FE 3PJSB 1VLXA 2VN5A 2WNGA 1NBQA 2B5IB 4NPKA 3P1VA 3RL1B 1HQ4A 2HRLA 4LSDA 2H8PB 4X7FC 4ABVA 4FNQA 2IWKA 1BG1A 1T5XA 2HFGH 3TBSA 2XN9E 1FO0H 1X9LA 3I75B 5DUMH 1FF5A 2EO9A 1QI5A 2RFXB 1HHIA 5TJWK 3UH8A 4PJ5B 1R0AL 3P4NA 4JGNA 4X2UA 3LZFL 2FJFA 1R3JA 2OQJB 2CD0A 4LRNH 4W81A 4BSVB 5K9QI 2P7TB 1KXTB 3SDAA 1OAUH 1R47A 4FEMA 3IVKA 4ECNA 4G7RB 5GGUB 1E8ZA 2HX9A 3AS3A 4N2AA 1H5BC 1MQ8A 3CXHJ 3PWJB 4OLVH 4OBRA 2XG4A 4XGZB 3EFFB 5LO7A 4Z3GA 5DMKA 4NOBA 3CFNA 5ALCL 5CCGE 4JPIA 4HKXB 2QGBA 1G6VK 3SDCA 1X6LA 2MTAA 1S78C 4X8XA 5ISZA 3ZIMA 3EYFA 3MNVB 2VQ4A 4GSXA 2BIIA 4MMZB 3NSCA 1LE9A 4ONFL 1ASPA 4XNZB 1HHKA 2R9HC 3E6HB 3H3BC 4NZ8A 5GS0C 4MA1B 1WWWX 5DEFB 1MWAH 3VFVA 1ML0A 4HOWA 4ZPVA 2F1AA 4PJXF 4MLSA 2NY7L 1BGXH 1DBKL 3Q6GL 4PJAA 5FX3A 3TBTB 3TV3L 5K9OA 3V4UL 1FIEA 3TPUA 3JT0A 4C4UA 3K2KA 3JUYA 4ZFGH 3RX7A 5FYLD 1WO2A 1T0OA 4JQVA 4MJID 3WIFB 4G80B 3NAAH 3L3DB 4RAUA 3NCEB 1WA2X 4XZ4A 1XCWA 1NCCH 4B9PA 1U91A 3P9LB 2GJ6A 2Z31B 2DH3A 4ENEC 3L3KB 2C5DC 2IFGA 1RFDL 2COQA 3G6JE 4OCRH 1QBLH 2AQPA 2EIBA 4PWJA 1BFSA 1IMHC 4MAUL 1MFAH 3F5WA 3BFOA 3H42L 3LDBC 4OZFA 5I26A 3I02A 4X80L 2OI9C 2UYLB 5TDPB 1MZYA 2BJMH 1GCFA 4BYHA 3MJWA 2NX5D 5JPNC 4NJ9L 3LIZL 3BAEH 3DTXA 3ZGHA 1KPUB 1KC5H 1JDDA 4Z7AA 5DR5L 3D33A 4JR9H 1ZXKA 3RVWD 4BKTC 4Y2OA 1CICC 3WE1A 4J3SA 4R3SB 2AHIA 2J2ZA 1D7DA 4XHQA 3RQ3A 3ZMEA 5ICZB 3TBBA 2I9LB 2L7UA 1SDDB 2EE0A 2V2XB 4WHTB 3NZHH 5F72S 5FYLE 1OD7A 1G9NC 2FH6A 4MJIE 3CHSA 1FHGA 5JXAH 4NLAA 3KYMB 1SJHA 4AV0A 3Q2CA 4PJDB 1UXSA 1DP0A 4BSWB 5GPRA 5E99H 1AO7B 3VG0H 3LKSB 3RWEA 1J8RA 3EHBD 3FT4A 4M7KL 3U9UA 1DN0A 1ZVNA 5AUMA 3HE7B 3FFOA 4I5BA 3DJ9A 4YPJA 4QHMA 4PRNA 1V8HA 4G7VL 2OL3A 5FO9B 1MHCA 5KTEL 5ANMB 2AQSA 4W9FC 4G2AA 2H32B 1II4E 1GC1L 3DXAA 3CK0L 3CWGA 2HPOA 2CZNA 4W6XB 2VNCA 2NX5E 1QLFA 1RPUA 3QAQA 1MI5D 3BN9C 2NY1D 5F3HB 4WW2F 1FP5A 4GRWE 3CZFA 4Z7NE 2NNFA 3BOVA 5D1ZC 4P2OB 3QAZB 5EOCJ 3DJSA 5HHOA 5DJ6B 3MNDA 3IWUA 3S8WA 1ES0B 4HIPA 4DVBB 3QS3A 1YA5A 3GMNA 3MV9D 3L3HB 1EANA 1QSFD 2BSSA 3KXFA 1GRWA 5HXMA 4UDUB 3QWNA 2H0JA 3C87A 1J0IA 3EDKA 3LXAA 3O3AB 1V27A 2CK2A 3HOGA 1MREL 4GQ9H 2Z7UA 1OCWL 5K39A 2B2XL 5DRNA 1Q0YH 5DQDL 3V4LA 5IVXF 5I1JL 4XPTL 1CO1A 4IGBA 2WY3B 1E9OB 4O58H 4PS4H 4NERA 4YNYB 5DFVD 3MTXA 4GW5B 2MCPH 4FQPA 4GIPD 3D87B 2D73A 4TNGA 1D5BA 3AQXA 1DVYA 3CXFA 1TMQA 1PGRB 2HVBA 3B6SA 2AABL 2VQUA 2EDWA 4IIQA 4JDEB 3CAFA 3KPMA 1IRAY 1MCDA 1NGQH 3M1OA 2FYYB 1MI5E 4H40A 1DVFB 4HCRL 4TQEH 4H20L 4CC1A 3EBGA 4OT1L 4YHLH 4XO3A 3UTQA 3O2WL 5DEGA 3QQXA 2P46B 3CHRA 5C2BL 2H1XA 2Z8RA 4HJ0D 2BK8A 2XTLA 3MV8B 3MV9E 1QSFE 1NTDA 4YXHL 3BIKA 3KDMB 5I16B 1DQLH 2YS4A 2FEEI 4H25B 4AK2A 5DWPA 4S1DD 3DJZA 3RZCA 1H8LA 4L8DB 4L37B 4XE0A 1F13A 4ZAKB 4LAQL 5TE4L 2B59A 4M5SA 4G8FB 4MXQD 5CUSL 3V0GA 1MH5B 2FHBA 4NI3A 4L8CA 1G7HA 1QA9A 3V0HA 4D0DA 2BVTA 3EO0A 4FFWD 2Y9RT 4Y2DA 2K9UA 4PJIA 4I77H 4RDBA 4P5TA 1MJJA 4K23H 3MDJA 5DZPA 1RV6X 1NIFA 1YLBB 1I9IH 4PBDA 1ZWIA 2NDFA 3V10A 3BPCB 4MCYB 4U05A 3C60D 4WU7A 5JUEH 4LL4A 2Y22A 3MLXL 2OM5A 4GS7B 4YHPB 2YGVA 3ISYA 5ESQB 1UJTA 3VG9C 5ITBL 3MRNB 3OJDA 1DQMH 1JXKA 1SVZA 1WRFA 3VQLA 5CJOL 1F90L 4N0FA 2XTSA 1LGVA 5DD1L 3UG4A 5IHUH 4BV1A 3MBEC 3BUDA 1BPVA 4DVRH 1QNZH 2BOLA 3S96B 4YHNB 2EINB 1RI8A 5EC2B 2EE2A 4LP8A 5GGTL 3MLPA 1M7XA 1PD6A 4JRWA 3LRLA 3GBDA 1TZHB 2DQJL 5FUOH 2EADA 4Q8BA 5AOKA 2EDOA 3BQVA 3H54A 4HGWB 4NXKA 4TRPL 4ZMZA 5CAYB 4KKAD 4C54A 5EUKB 2IQ9H 3LCYA 3NIGE 3DUUA 4Y4KD 1AHWB 4TV3A 3EH4B 4HZLB 2XT1B 3QQDB 5K9KA 3BHBA 2YUXA 1S7QA 4HS6A 4HJJH 3BZEB 3HRPA 4KZEH 3ARFC 1U0QA 1AGCB 3GZKA 3VFTA 1F4XL 4N20A 1OSEA 2OMNA 2ZSVB 2YD2A 4I1PA 1KB9J 2IWFA 4ZUUA 2BVQA 4X4KA 2HVJA 4GUPA 4LFHG 1YDPA 4UMGA 43CAA 3TESA 2P8PA 4NQCD 4KZDH 4YDMA 4XPGH 5C7XL 3WCYA 3D09A 2X1QA 4Y4FB 3Q8AA 1ZLWK 3CSYB 5CLYA 5LGYA 1EUTA 5ADPL 2WLLA 4JO2H 4OZ4A 3IDIB 5IMOA 1F11B 5DA0B 2L0DA 4N24A 1QRKA 3KPRB 3L4CA 3QO0A 2IF7A 3DX8A 2XZCH 2DBLL 4TOYL 4WUUA 5EZIL 3WNKA 1YQVH 2MKWA 2X53A 4QKXB 2D7NA 5DC9B 5HDBF 4AEHL 3AT8A 5LQBH 3HC4L 2WWMD 5CIPA 2DWSA 3GT6A 2WNWA 5HHVL 2VWEC 5KVEL 2OBGA 1T5WA 3NESA 4PRIA 5F7BA 5MENA 2JLLA 2KDYA 1M1SA 4LPYA 4ILDA 5ESVB 4WEBH 4A7VA 2BCMA 4Z7IA 1A4BA 3O45B 1YMMB 4KX8A 3V55A 1FNAA 4MGXA 4PJCE 4LRIC 5C0JA 4GBXC 2CR3A 1IZJA 3H2QA 1JDAA 2C7UB 3QULA 4X8JA 3US1A 5E9AA 2PYFA 3KBFA 1P2CA 4NQCE 3ARDA 1TZOA 2Y7OA 3LMJH 5KSBA 5E6IA 4L18A 1J5CA 5DUML 1NOFA 4DF9A 1LWRA 2DQ6A 3IJYB 1LWHA 2X7LA 3RU8H 1ZHNB 3LXCA 1HL9A 3N0PB 4YH6A 4ZMYA 1YYMH 1A1MB 2BS9A 1TQVA 3H9SB 3P4OA 4TPRH 5FFGA 3VDBA 4H1LH 4LRNL 2EP6A 1K8DA 3BUBA 3GJFB 3NJIA 3VFNA 1OAUL 2BZDA 2DDQL 3ARSA 1GGIH 5IW6B 4CW1B 1PL3A 1TQWA 3R4RA 4HIEA 1E28B 1N8ZA 2Y7LA 2FEDD 1JGUL 2WAQA 3ARGD 3L45A 3UTPD 2Z91A 5C0CD 1SN0A 1MW3A 3H7BB 2ROXA 1TTBA 3ZT5A 4FULA 4GRLB 3TEWA 3MLUH 5AW4B 3NJLA 4FRWA 4EZKA 1ZANH 1YYCA 3F3HA 1W6WA 4E9VA 2CXKA 2NZ9D 3OKLB 4GKNA 2G3ZA 4CVWA 4JZOA 1U58B 3N41F 1HESA 2HN7B 2OCJA 3MPCA 3PNWA 5FYJU 3MUZ1 2IEPA 2P48B 1FN4B 3U2SA 4AKPA 5DHYA 4Q52A 5IB5A 1WE5A 5AVSB 1BJ1J 4PGDB 1CVRA 1KJ3H 4HLJA 1O9ZA 3WD5H 1F4HA 2OKMA 4AG4H 2PWHA 1I1YB 1KLGB 4ABWA 3HBZA 4OUOA 4ZSOB 4PGCA 1N5AA 1I7TA 1MCRA