5F8QC

Blood group antigen binding adhesin baba of helicobacter pylori strain s831 in complex with nanobody nb-er19
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Cell adhesion
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
total genus 27
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f8qC00
1WFOA 3BGAA 2MWCA 3RVUD 3VFRB 3MRQB 2A6KB 3AS2A 4ZYKB 3ARTA 3MNWB 3G5VB 3GKWH 1Y18B 2X42A 5D1ZC 5FM8A 3IVKA 3UYPA 2C3XA 1F45A 1SJEB 1UYWL 1WJ3A 1EFXD 1P6AB 4QHUB 1T2JA 2LQRA 1KG0B 4PGEA 1QHOA 2Z93A 1U9KA 3G6AB 5E8OA 1DBKL 2ZOKB 3I3DA 1FVCB 1MREH 5B39A 4G9DA 4K9EC 2EEAA 3D2UB 2OZ4A 1MI5B 2VR5A 3V4UH 3G6AA 1YEFL 2GCYB 2UY6A 4X7FC 2V17H 4A6YB 1F58H 4PJ8A 3DMMC 4I18B 1R5IB 2UVFA 4PP1D 2LU3A 1JBJA 2W60A 4PJAF 4Q58C 2YD3A 3QI9D 1ETZB 1OW0A 4P2QA 2DF3A 4R97B 3CFDA 4XPFH 3MRNA 2ZP0T 4Y4HD 4MNQE 5DK3A 1BD2E 5E6ZA 3EYOA 4QHKI 5E0QA 3S96B 1CFVL 1U8OB 3T0BA 5T3XE 3FN3A 2WUCH 3PP4H 3I6GB 3S9DB 2R4SL 3RY5A 2HTKD 1HK6A 1GHFL 1BVZA 2QL1A 4MCYA 5K59F 3T4YB 3NBNA 3WLBA 1I1RA 1KACB 3TIDB 3OF6A 3CSYB 1IKFH 2HH0H 2DWEA 4X5XA 2QKIB 2VZSA 5FECA 5IFAH 3HR5B 4X4ME 2AEQL 4AEFA 3QDJB 3TBVA 2DYPD 1F90H 1JPGB 3RL2A 4M1CD 4NO5B 5TH2B 1EIBA 3GSRA 4WFGE 5IT2H 4IIQC 1OAQL 1I1FA 4PRHB 5MERB 2FGWH 3NABL 1VEOA 2ADJA 2NY0B 3MV11 3DBXB 4O51B 3VW3H 1OGAA 2AKRB 1Q38A 3LQAC 3WEXA 1YEEL 3CDCA 4WI2A 3V5HA 1NDMA 2BVOA 4NDMB 1N5YL 1TZIA 3SE8L 3F8UB 2APTA 4OZGB 4OLEA 5D72H 4JR9L 4RIRB 5DZNA 1ZLSL 3U46B 4Y19A 1VACA 5FYLH 3OKLB 4QHLA 1FFNB 1F4HA 3QUXD 2Z35A 4L1HA 3P3YA 5K93A 4FQXD 5EBGA 1HXMA 5CINL 3S88H 2HN7B 2AV1A 4O2EA 4O58L 4QLRA 4AT6A 1IGML 1L0YA 2VTFA 3VWJA 3CD4A 3RAJH 3OKLA 5IEKB 2FBOJ 3ETBF 5ANMA 3KLDA 4X5WA 2DS4A 5I1IL 2EZ0C 4G6KL 2CDEB 4JRXA 4LVOC 1TVHB 1S7WA 2VXVL 4OGAD 5L7XL 5ANMB 4CMMB 4EOWL 3R0MA 1LO5B 1FFOA 1MNUL 5EA0H 4PRBA 4C56B 1FG2B 1EFXA 5DVNA 1CFQA 1MRCL 5HDBF 1RIVH 1NLBH 4IHOB 4OLYL 4YFLF 3N0PB 4J8RA 5H35A 3OKEA 1NAMH 2QHRH 5FM4A 1I3UA 1QP1A 2DQJL 3K2UL 3DPBA 2DOCA 4ZOEA 3T65A 4I5BB 5HI4D 3AAZA 1PY9A 3GIZH 4G8GA 3Q5OA 3W11C 4JR9H 4PJBF 3H9ZA 3N1PC 1A02N 4W4OC 5JOFA 3J7HA 4QRUA 2GSIB 2R23A 1B0GB 1H3WM 3GGWB 3O3BB 2F19L 4BUHA 4UT9L 1X4YA 1IAOA 2IQ9L 4HS8H 2EXYC 4PRHA 3FO0L 3F58H 5C09B 2AGJL 4WNQA 3SDAC 3OGCA 2W07A 3BESR 5HDBE 2DQIL 1HWHB 4NDMA 4GRLA 5T1MA 3CXDL 5AEAA 4XGZB 5E9DA 5EU6A 2NY6B 1G7JA 1OSZB 2NY5C 3RWJB 2NTSP 4JDVA 2MCPH 3FO2A 4ODUA 4PY8I 3WO4C 5HHOA 15C8L 3MUZ1 3QDMB 5D7JC 1QQDA 1A21A 5GHWL 4CRPA 3I02B 3NZHH 2H45A 3WXVL 2YD4A 2IANB 2CJUH 3JV0A 5CAYB 1I9IH 3B9KD 4P2OB 4QHUA 3BD3A 4E9LA 1NGZB 1TVDA 1NMAH 1FQ9C 2A6DB 4DOHE 4LQFL 2XKNA 4IRSB 2G60H 4ZODA 1NDGA 3U4EA 4LSDA 3DECA 3B6SA 4H1LH 3QHTC 4L4VB 4D9LL 3ULVC 3SKJH 4ZAKD 3EYUH 3STZA 1RK1A 2O93L 4PJEE 3VFMA 3RWEA 5TQ2H 4LHUA 5I8KH 1V5JA 5EU3A 4EOWH 3VFOB 2BHYA 2GQHA 4MYWB 4NJ9H 3L3HB 3VXME 1N59B 3CLFL 3LKPA 4FFYH 1JTOA 3KPLB 4QRUB 4DVBB 5HTSA 5JW4M 2DIBA 3QUYA 4HHAA 3KHQA 2OR8A 1KB5H 2D7NA 2VAJA 3IXTB 3F7RA 5D2NB 1VGEH 1KCRH 5H2BA 3BRFA 4M00A 4HQQL 1SBSL 3BQUA 4E5XB 5HPMB 3GMNB 2I07B 4KWUA 4EVNB 4PRNA 4CVZB 4ZNCD 4ZSOE 3BIKA 4YR6B 1IFHH 4PLNC 1HINH 4PJIA 1ZANL 5DR5H 4J8RB 1Z5LB 5H35B 3BPNB 3QNYB 3VXSB 1LO0L 5HVGB 5IB3B 5EIQA 2Y36L 1PZ5B 4O2FB 2J8OA 5DD6A 2CXKA 2F5BH 4K7FA 3CAFA 1F3JB 4MJ5B 5ESQA 3QO0A 1NCCL 3JV4A 3ILQD 4XC3L 4B5EA 1HOCA 3V5HB 4TULL 3GGWA 3O3BA 4Z7OF 1T22B 5TE4H 3VE0A 4PV8B 1R6VA 1KJ2H 5DRNB 3MNVB 4X6DF 2DQDH 4J1UA 1VFAA 2C1OB 4QHNB 1AKJA 4R4NC 5I15H 1P4LA 4M61A 5MHSD 1D6VL 4WTWA 3UROR 3EYVB 4U2YA 1G7QB 4YK4B 3FTGB 4ZUVA 4BZYA 5CBEB 1AY1H 1JRHI 3MNZB 3SKOB 4IRSD 5B3JF 2MJWA 1ZT7B 1VPOL 4X98A 1YECH 5L88H 4P23C 1XT5A 4XX1E 4XBGB 1JGDA 5DD0L 3HB3C 4YDJB 4NOBA 1TVHA 1BM3H 2QADC 2Y6SC 1W0YT 1QSFE 1FIGH 3EFDL 3ARRA 5B3JE 3PWLB 5IV2B 1QBBA 1Q9LA 1BBDL 1YA5A 1QNZL 2FO4A 2FJGB 2R1YB 3DXAB 5FV2A 2ORBH 5DC9B 2IMNA 4NNPL 1CIUA 4HG4J 2H3NB 1CT8B 1MVFA 1E27A 3UTTE 2DM2A 3JTTA 4ZNEE 3BPLC 3ZKQD 3QUKB 5F6IB 4ODBD 3TZVB 2JJUA 1AP2A 1DLHB 2IF7A 2L7UA 2DMBA 3VXRD 5GS0H 2RAMA 4JQIH 4M7JL 1IZKA 3SKNB 5LAXB 2PTUA 5T1DH 3BP7B 2ZCHL 1NBYA 2M1KA 1BEYL 2EEBA 3V4VL 3T2NL 3K8MA 1P7QD 5E8DL 3TZVA 1AR1C 4G6FD 3TYGH 4WUKH 2G2RA 3AY4C 3K1KC 1F4XH 5DHYB 3WYRA 2JCCA 5DJYB 3BKYL 3NFNB 2VSCA 3CMGA 2KZ1B 1KB5L 4EIGB 1M05B 3BH8A 3KWWB 5BOPA 4PJ8D 4DK3A 4TSBL 1R3IL 4X9HA 1IQDA 3NCJL 1MI5D 2X4SB 5MHSE 4JHWH 3UTSD 1J0IA 3VMPA 3LB6C 4Y4HA 2XT1B 4L3EE 5D1XC 1CXIA 3D1MC 5JHDD 1CGUA 3SDDA 3IKCA 2IPKB 5JW4Q 3GSNL 4C83A 3VRJB 3LH2H 2KUTA 1I7ZA 4U1KB 2AJSL 1VESA 1KTKE 1XGTA 3W39A 4YXHH 3S36L 3HA0A 1JHTB 1PEWA 5E00A 2WMPA 5TDOB 2IALA 4G6KH 4YE4H 1KPUA 3VXUA 4M6OL 2FHCA 3B9AA 2HJKB 5E2JA 3UJIH 3BZEA 1U8KB 3C5JB 3X11B 4X7TB 4Y16C 1CL7L 4J3UA 3DROB 3EDFA 1ORQA 5F7NC 3U46A 4UT7L 1KPUB 2XZAH 1MCLA 5C0EA 3EYVA 2NYYC 2BNRB 2P5ED 3GSXA 3IFOB 4JHAH 5IM7A 2GFBA 5L2JA 4NQXB 5JHDB 3FO9A 2EDXA 5B38G 4N90D 1GVIA 2VZVA 4XCYA 4XH2B 2X89A 5LGJA 3R06B 5CJOH 3BPOC 5B39G 1K8DA 4L8CB 3NN8B 1T4KA 4EJ1C 4PJHB 1KLUA 3VFVA 1ZGLB 4R90L 1WAAA 4CVZA 4HS8L 4C4KT 4Y5XA 4D9QE 2E9WA 4Z7VE 1RUQH 4TUJB 1WZLA 2NW3B 2FGZA 2AXGA 4MCYB 3HUJF 4XNZC 1GCFA 1KIRB 4KVCL 4XXDA 4OZFG 1V7NL 4LQ1A 1J0KA 1EJOH 5C07E 4PB0L 1UEMA 2HG5B 5A43C 1MCQA 2XQYG 5E1AB 5HYSA 3X3FH 4QTHA 1G1CA 1HEZB 1L7TL 1C7TA 3KXFB 3LDBC 1ZHKA 5GGVH 4GXVL 4DW2H 3PP4L 2VISB 1RURL 3EJZD 1OM3H 4TVPH 1JPFA 1E6JL 3HFML 1KXVC 3MRRA 4U1LA 5GGSB 1JGLL 5IJVA 1LEKA 4PB0H 4XGZA 5DGRA 1PYWB 3MJ8A 1DR9A 1FNFA 3IXAB 3LS4H 5C9JA 1J1OH 3OL2A 5IW3A 4G7VL 5T3ZD 1KG0A 3GDBA 4PGEB 2ZCLH 4JANB 4U1IB 2QADD 3TEUA 4DW2L 2HKFH 2ADGA 5FYJL 1S9WA 5HI3C 3NPSC 4ZAKA 1DBBH 2ZJSL 4HJJH 5EOCH 1WCBB 1GPOL 4LCUA 3P4NB 3ELAT 3H0TA 2D7QA 3CDGA 4HEPG 4P9HC 1BGXH 1RZGA 2XZQL 3MODL 1MAMH 3P30H 1WIPA 2W0KA 3PJSB 4HC1H 3ZDYE 5ID0A 1FLTX 5EFIB 2KQMA 5C07A 3QWOA 3V4UL 5K9KB 2HRPL 3IF1A 4Y2DD 5FGBA 1RUPL 5C6TH 2NTFA 3QUMB 5GZND 4P5KB 5IVXB 4NHCH 5ICXB 2XQYK 1B6DA 1E4JA 1T6WA 3QXDA 2OLDA 5I1JH 4PRPE 4YEEA 4XHJD 3O3DA 2HTLC 4PJ5E 2Z91A 3OAYK 2FRGP 1IGTB 2J8UA 4R7DA 3OZ9H 1DBJL 3MROB 2X4PA 1PG7L 3KJ6L 4ISVA 1NDMB 4HHAB 2JJTA 2NPLX 4G8GD 2UV3A 4POZD 4RBPH 4JPWL 2E7BA 2JB6A 4OSUH 3QEUB 4IHOA 2VLKD 2A74A 4NKIL 4BSJA 2MKLC 4KUZL 1UZ8A 2ZUQB 5IHUL 4FXKA 3S88L 1Q72H 4DKFL 2Z35B 2MNUA 2GI7A 2YPLE 5DUPL 3PWVB 2CDEA 4JRXB 4UQ3A 3ZSTA 3O8XC 4TPRL 3TN0C 1QRND 4KZDH 2OTPA 2KH2B 5FHAH 2F15A 4P23B 4M61B 5MI0B 5T3XH 1CICC 5HBBA 2VKXA 3PV7A 3QJHB 3QIUA 5I1AA 4DTGL 1KOAA 1URLA 4OF5A 4QHMA 2D2OA 5IIEB 3A67L 1E28B 3L5XH 4L3CA 3SOBH 5HHQB 1DCLA 2PF6A 3MRPA 3S98A 4IMKC 5DUBA 1Z0MA 3WFHB 1WZKA 4R96A 1S7QB 3QQ9D 4Q2ZB 5CD3A 3AS1A 2R2BB 1RULH 3JUZA 2WAHA 3LRGA 4OKVA 4JRXD 4D3CH 3HLAA 4W6XB 4Z7UB 2V7NA 4XPTH 1YZZA 3TLRA 4AIXA 2IFFL 1WUNT 2MTPA 3GUTB 4TTDD 4Y88A 5I0DA 3OKDA 2GJ6A 5CZVH 3MGOA 2NY2B 3QULA 1ZVSB 1RZJL 4XNXH 5JORB 1CVRA 2BERA 3DRTB 1I9RL 3HZKA 2MMXA 4PBXA 3UZEA 3QUZA 4S0TD 1NGXA 4YHMH 3TJHD 2VLJA 1YNTA 1HHGA 3HPJA 3SJVD 4APQB 2YD2A 4MLSA 5AZEH 4WWKD 4OTXL 4KKAD 5GS2D 1UH3A 4Y0GA 1S7SA 4I48B 5IOPB 5IQ9B 5AG8A 1PAMA 1MWAA 3H3PH 3KJ4B 1J7VR 2GJ6D 3WN5C 3U6RB 2NX5D 4EXPX 3UAJD 1H3GA 3BKJH 1AQDB 3B9DA 1FNEA 4R2GC 2P8LA 1M6OB 3IDGA 2BRRL 3VFWB 1T89C 1J11A 3F6IA 2DTML 1AP2B 1EO8L 4YO0A 5D96B 4QXTA 5FCUH 3RNQA 3U4AA 1NSNL 3QCVL 1T1YA 1ZMYA 1FYTA 2W9LA 5I76A 3H9HB 3TFKC 2D0FA 1F13A 12E8H 2DQUH 2GKIA 3O2VH 3K8KA 4LK4A 4K8RD 5FOBA 4F9LC 3WFCH 3E1F1 3MRJB 3K80A 4QHKJ 3KLAB 3H42L 2BY3A 3L3GA 3L7EA 5C0GB 5IUSA 3KPRB 1W2KT 1WWWX 3DVIA 2XN9D 4LKXB 4WW1A 1I9JH 2BHUA 3S5LG 5I66B 2YC1B 1I7ZB 4U1KA 1U91A 3X14B 3MRKA 1HCFX 1CXHA 4JRYB 5BZWB 3UYRL 4HFUH 2VUYA 4M5ZH 5I2IB 4X6DB 1MHEB 4DZ8B 3I6LD 1T83A 2R0KL 4Q9RH 4NQCD 3WBDA 1NJ9A 2HWZH 4G42B 2EZ0D 1F3DH 2BVQA 3PWUB 4IJ3C 3PWJA 4TULH 1G9MC 5DSCB 5C0NC 5IVZB 3G5ZA 2V2XA 4HQQH 4ZUUB 3VRJA 5FYLD 4FP8H 2VNCA 1I7RB 4J1UB 4FABL 4MDIB 2B5IC 1HCVA 1QRNA 4XWOD 5JIKA 3WFDL 3G04A 5C92A 4ETQA 4NQDB 1RIHH 3VFRA 3VXSE 5ALCH 4EDWL 2VZ1A 3MUHL 3FQUB 3JTSA 5HY9B 4NO0B 4CN1A 5BXFA 5BS0B 1V3KA 1I9JL 2R2EB 4UTAH 1GIGH 1DVFB 5DQDL 5GPRA 3MJ6A 1WZ1L 4APQD 1RD6A 1IAIM 4RQQA 3R06A 4M93C 4A6YL 4U3CA 4GAJL 4MS8D 1RIUH 4MA8L 1OQXA 1QRKA 2VDLH 1MIMH 1NBZA 1P2CB 4H25A 3L7FB 2X4OA 4R8WL 5CWSB 3VXMB 4Y4FD 4BELD 5GS1C 1Q9WA 3MREB 5K9QI 3VDBA 4YDJA 5FV1L 5JR1H 2VXQH 3U82B 3BFOA 5KSBA 1OPGH 2NX5B 1WVZA 1Y6NR 4PBVC 4UTBH 2DD8H 3H3PL 3WFCL 1IEHA 5DEGB 1J9CT 4ZFZB 3GHEL 1Q9WB 3MREA 3IDGB 5F9JB 3WXWL 2X4RA 4N1CA 2HVJA 3ILPA 4RFEB 4Z0BL 5TQ0H 3MJ8B 5HHPA 5E6IB 4LP4A 3MJ9L 1IAII 5FHBH 1G7IB 3ZKXC 1BZ7B 4IOIA 3TC9A 1WBYB 1Q1JH 5E2TH 1AGDB 4OQTA 1FBIH 5ACLA 1TQBC 3RGHA 4I77H 1EGJL 3BKYH 1VFBA 3BP7A 4PTTB 3RUGF 3QPXL 2OJEA 4QT5B 4FZ8H 5C1MB 5EIVA 5HGBB 2R56L 4UI2A 5IK3A 1RZGB 5A2JH 1LEKB 1N7ML 3O3EB 4OI9A 2PYED 3RIFK 2ZCHH 3SGKA 3IS0X 4X9GA 4B50A 4GG8A 1XCQA 1E6OH 4YNYB 2XFXB 1V05A 4UOW1 4Z8FH 1SEBB 4HPOL 3E3QC 1W72B 1WWCA 3QUML 3O3UN 4PJBB 2EDRA 2XA3A 4FQQB 4ODTL 3MLSH 5DSCA 1XF2B 2W38A 5D7KE 5FUOH 4L8DA 4XP4L 2ATKB 5ERWB 3OAUH 2XWTA 1ZGLA 1ZHLB 4AENB 1MLBA 4DVBA 2RFXB 2FH8A 3QXTA 5TF1L 1LEGA 1JZ4A 3T77B 4G9FD 2HFFB 3S96A 3T3ME 3CH1A 2WWMC 1BLNA 4XPGH 5E8NB 1U6AL 1D5IH 4NO0A 3SDXE 2NY0D 1J8KA 1KIQB 4K71B 3I84A 4XI5D 4XVUC 1NFDF 3HI1B 3AFLA 4OD1H 3NCBB 1ES0B 3KS0H 3E8UH 1CLZH 2CKBA 1Y6MR 3C60A 5JZ7C 1D6VH 2AV7B 1ITBB 5A2FA 4OCYH 4U1JB 5DA0B 1MQKL 4NOFA 5JHDA 1GC1C 1YC8A 4I9WD 1JHKH 2DDQH 2R2HA 2X1WL 1I3GL 3PHQA 5DTFB 4UV4H 4ZUWB 1CR9L 2BVOB 3HCVA 5F89B 5AYUH 5IGXL 1CFNB 1UT9A 3BH8B 1KELH 4HG4K 1TLKA 4YHZH 1JYXA 2IFGA 1A1OB 1MFAL 5TDOA 1T1WA 3OB8A 4MAUH 4OF8A 4PJGA 2V2XB 1P4IH 4QTIH 1QZ1A 5L2KD 1X5AA 4YX2H 4KJPD 2F5AH 3L1OL 4NC1C 4EXKA 4AL8L 3MRGB 2PO6A 5F88A 5I30H 3MZTA 5JQ6H 1P84J 4ZPVA 2VLME 4GH7B 4QRQA 5J56B 3QB7C 2AEQH 4PG2C 3ECBA 3MGTB 5ALBL 4WTZG 4CVUA 3IB4A 5FDYA 3VWKA 5HGBA 5C07B 5IP4A 4Y4FA 3CFBA 2Y5EA 4NZUL 5KN5B 2I9TB 1RZIA 3Q6FB 4ZTPH 4YXKH 1OSPL 4BQ9A 2E27L 3BH9B 3EJYD 2VOTA 4PJAB 1TJIH 5CIPB 2HJFA 3L3IB 2CGRL 3ALXA 3D85B 3TYFB 5ILTL 2H2SC 2VLMD 1G7HA 3VFUA 4OGXL 3VRIA 1FZOB 4F7EB 2I26N 1HHGB 3HPJB 1N64H 5KVEL 1T0MB 3PGDA 1NUFA 5FDWB 4NC0B 3MV01 4FHBD 3VXMA 3WDIA 5DJXB 1G7PA 1RUAL 1G9MH 4MD0B 3UX9B 2K3TA 5C6WH 5EU6E 1U8IA 5HVHC 2BNUA 1WEJH 1XAUA 2A73B 3QUZD 4UBDD 4LDOB 4OCRH 3ARBB 3BZ4A 3MLRL 2Z31B 1JTTA 3TGXA 3LH2L 4N0YL 4NFBA 3ZSSA 3UZVB 5CZVL 4J3WA 2E8YA 3FOMA 4ZMAT 3BP4B 4FOMA 1T1ZB 4ODWA 2KZWA 3PXHA 1NFIA 3ULVL 2O5XH 2AP2A 1ZLUK 3IDJB 1B6UA 3Q5YA 1B0WA 2V7HA 1KJVA 5AWNL 3WCYA 3T0EA 1UM6L 1DQDL 1AO7A 1B0RA 5ACMA 4GRWF 1HKLL 5EIIA 3QFJA 2HG5A 5C3TA 4QOKE 2AK4B 5EDXA 2BSRB 3MXVH 2E7MA 4F7MB 4JY5H 1KEGH 5JA8B 1BIIA 3UP1A 4ZXBA 1ONQB 1JGVH 4MJIE 2CO6B 1DEEA 4EIZC 1T3FB 1TITA 2R0ZL 4XAWL 1I75A 3RL2B 3MOAL 3AY4A 2AJ3B 2EIEA 3PHOA 5D6CA 5DTFA 3BXNA 3WNPA 4X6CF 1KCLA 4GAYA 2QQKH 2HA1A 3FFCD 5BS0E 3Q0HA 4KMTL 3QH3B 3QQ9C 3K7UA 1T3FA 5B21A 4K9EL 1KB9J 1GAFH 3BQUD 3RWHA 5F1OB 3HE7A 1TQCB 1EAJA 4IOSD 1H3TA 4N8CL 4ZSOA 4W4OA 5DMJB 2NY1C 4HZLA 3G5ZB 1YNKH 4ZUTA 3L9RA 4WO4A 2ATKA 3DSFH 5ERWA 1QFUH 1T0NB 4DEPB 1MRFL 2EDBA 4J3TA 1K4CA 2Q1EA 2E27H 3QDGE 2YUWA 1F3DJ 3OR7A 5CGMA 3EO9H 3CH1B 1M7DA 2HYMA 3LEXB 3DX8B 1KJ2B 4GG6F 4JLRB 1UM5H 2QLVB 3MCKB 1P5VA 3DVFA 2ESVA 4HK0A 4KQ3H 1HHKA 4NHCL 5SX4I 5JDSB 1S7WB 4I18C 2N1KA 3NFPA 1UWGH 1N0XH 4J6RH 2HKHL 1Q0XL 5HHMB 2VLJD 3O6KL 3JVGA 1OGTB 2PCPB 3LIZH 5ESVB 3BSZL 2BC4B 2IWGA 3VFUB 1MHPL 1YJDH 4NKQB 4FQHA 2UWEF 1R3HA 1GC1H 1FYHB 2FJHB 1T7VA 4NO5A 4GMSL 1RIHL 5CMAB 3QEGL 3NIFE 4AG4H 3H2WA 2NW3A 3K4DA 4GOSA 4JY6B 1UJ3B 1IE5A 1TIUA 1B4RA 1ZVSA 3IDUA 4FFZH 4WIQA 2R4RH 1NMBL 2CIIA 1DE4A 4UDTA 2DKSA 3VXPB 3HMWL 3K0WA 5J11B 2AI0L 3DXAD 2ITDA 3HLAB 3WFEH 1CGVA 1YEKH 1PG7X 4NN7B 3KXFA 5CCKH 3MRQA 3V52H 2QKIA 5IQ7L 3T4AB 5EOQH 3MGOB 1QLEH 2ITDB 4PRID 3ZKND 1NANH 4HLJA 2GEEA 3NIFF 3WN5B 2FYYB 3P4LA 2YSSA 3C8HA 5IB1A 5KG9A 1NEZB 2MQ0A 3TBWA 5I15L 4JLRA 4OGYH 2OTUA 2QR0A 2EDJA 1NKOA 2DQJH 1XGQA 4Z7UE 3PABB 5FYKD 3REWA 1UB5A 4POUB 5FEBA 2VQUA 5C0CD 5INDA 4O4YL 1XIWD 4FQ2H 1VPOH 4XPHH 1CK0L 3RWFA 5I8KL 2DQTH 1CFSA 1ZS8A 1PVHA 3L3JB 5TQ2L 5ISZB 1QO3B 2BY0A 1NAMB 3MRDB 4XBGA 1AY1L 1V7ML 5E7FA 1Q1JL 1W0WA 3BPCA 1MCNA 2OTWB 1OF2A 5JNYA 4I2XA 3NH7L 4YHYB 1XGUA 1YEDB 5MENB 4UDUA 2DJSA 1J0HA 4PRAA 3QUXA 3K3QA 4NKDA 1F2QA 4CU7A 3E6FB 4PGCB 3FOMB 1EO8H 1A5FL 1B4JH 5I8CB 1D5MA 2AJXH 3VD7A 5F8RC 4L4VE 3T08A 2VITA 5F7DB 5CZXD 2O61A 1YY9C 2A38A 4F33B 2BVEA 3MRKB 4JPIA 1A14L 3NH7H 3LKSA 3HPLA 1JPGA 5DLML 2F5BL 1FJ1B 1NBYB 1H3PL 4HUNB 4AYFA 4IS6A 2JK5A 4N9OB 4WVRA 1NJ9B 1OAZL 1NMBH 1DEEB 5FOBB 1F6AA 2FATH 1QR4A 2WWKT 3SE3C 5HYQA 5MEOB 5HYJA 3BP6B 4ZOAA 4L9LB 3KDMA 1IT9H 1YN6B 1U93B 5IG7A 4WEBL 3FAXA 3V6ZB 3KPNB 1U8NB 1LVEA 2PNDA 5B22A 1GGIL 4NQDA 2XNAA 1VA9A 3N1MC 4EKXA 1JMZA 2E7LC 3DV4A 3GKZA 1PQZB 3SDCB 1BVLA 3F7VA 4KKAC 8FABB 2E7LA 4AK1A 1IC4L 4JO4L 1GZPA 3CMOH 1CLOL 3B8SA 3QI9A 3SJVE 4HGKC 3TVMA 4KQ4H 4IOFC 5DVMA 3L3IA 2VDQL 1JMXA 4H26B 2H2PC 1U8LA 3HE7C 5GSRB 3ZDZE 4AEHL 1HQRA 5FKAB 4JKPH 1HHIA 1Z9MA 3GJFA 4PJEB 4KK6D 1LD9A 2VE6A 3VH8G 4H20L 1XGRB 4FQIL 1X5ZA 4DUXA 5KG9B 3X17A 5HHNB 3GUTA 3BVNA 4OCLC 2GK0A 1UQSB 3EW3B 4WEUD 4IRSA 5EPMB 3BGMB 3RUGE 4A2MA 2J3SA 3BMVA 3LVEA 5DC4B 3TT3H 4EI6B 3G6JE 5DHVH 4WV1A 3S34H 1AR1D 4JEGB 3M07A 3FB5A 2MCPL 3IFNH 1DUYA 2EYTA 4WV1C 4XPHL 4HXBH 5GJSL 5DJ6B 1NAKH 5IW1B 3DRQA 1IGFH 4YDLC 4KV5E 4I3RH 5C08A 3B2UD 3D25A 4NM8H 1VB9A 4M48L 3W9DB 4HIJB 5ISZE 3BP6A 2XQBH 4H1LG 1C12A 1XGPA 3ISWA 1ZE3C 2WQRA 1DUZA 1FNEB 2YUZA 3IJHA 4OZHB 4GRLB 5D7IF 5IMMB 2B2XL 4U1MA 4QXGH 5J1TC 2I07A 5AAWA 1V8HA 3T1WA 1K2DA 1S7VA 3G6JB 3AREB 2HFEB 1T1WB 2K9UA 2K1MA 4H20H 4WI3A 1QOKA 3WV0A 4XNYL 2O61B 2B4CL 5C0BA 2WK2A 3HB3D 5I9QC 1JYNA 4N9GA 3PV6A 1S3KL 3CFCH 4P23D 2DYPB 1YNTB 5KSAB 2CK2A 4G80B 3PGCA 4NWTH 4KRNA 2VDOL 1JHTA 1MHHB 2L0DA 1G1YA 3M8OH 5BV7C 4X7EC 2HT2D 4AIZB 4FFWD 1RURH 4OFYD 5FUCC 3SGEI 2ORBL 2BNRE 4G6JH 4JZOA 1KB9K 1OCWL 4ONFL 4X6DA 3RWGB 4CADB 1ZAGA 3DSNA 2UWEB 4YE4L 1AR2A 2EO9A 3HG1A 1ADQH 5HHNA 2EIDA 5DHXB 5I71B 2FCBA 1IM9D 4WEBH 4AENA 1HYRC 3HC3L 4YHOL 3OAZK 3B5HA 4KY1L 2P49B 4R3SB 5IT2L 5KSAC 3QHZH 1INDH 5I30L 3Q3GA 4JKWA 2EDKA 4U1JA 2QEJA 5TDPB 4ZFOL 1X3DA 3DROA 3UJJL 1W72A 3RVWC 4FS0A 1VADB 2R1XA 2RB8A 3L3OA 3U2SB 1TVBA 4PJ7A 1Q94A 4NYLB 3S36X 1CGWA 3KYAA 4MWFA 4Z7VF 4KHTL 3LN4A 4NQEB 5HXMA 1WIUA 2COQA 3C5ZB 1NMCC 1BGXL 5C08E 1DSFL 1K6QH 4TSBH 3ARGA 5A3IC 5BQ7A 1I8KB 1PLGL 4YAQB 1TETL 5GISL 5KW9H 3NCFB 3MMEA 2I25N 1KBGL 4QY8B 4Y5VA 4MA1B 2P5EE 4Y1AD 4LSRH 4X6BB 3OTTA 2A9NH 3RHWK 1FZOA 3PDOA 4F7EA 4TRPL 4K3JL 4RFOL 3UC0H 1PSKL 3LEYH 2WM0A 4P2QE 3BAEH 3GSVA 2DLGA 3N06B 1P9MA 3VXUE 4EI5A 2ED9A 5CUSH 5HHPB 3SKNA 3RVUC 4CBPA 1A3QA 2BOCB 1I8IA 1JYVA 5IHLB 4OV5B 4UU9A 4HZAA 3AB0C 4NP4L 1HSAA 1YDPB 2C3WA 5GSVA 3NFSL 1YQVL 4HWZB 5H37H 5IGXH 2NY1D 4YXKL 5I74B 3UJJH 4LFHD 1KB5A 2JCCB 5DJYA 3BZDA 4LSTH 1J8HA 2I60L 5A16B 3EUUA 3FOLB 2XZAL 1UJTA 3HCVB 5CHNB 1MQKH 4GW4B 1B2WL 3ILPB 3P11L 3PQYB 4Y7MA 5DO2C 3P73B 1DN2A 5TPWH 1ZA6A 1FPTH 3VWJC 3FOLA 4RA3A 4G3YL 5D7JD 1CTOA 1WCBA 3SE8H 2ZSWB 4PJGB 4JDVB 5C0AD 3WS6C 1OGAE 5F7HA 1HHJB 4JQXC 4YQXH 4BFIA 2NZ9D 3BH9A 3L3OB 1ZS8B 3L3JA 4HJJL 5EOCL 5ISZA 1QEWA 1T80A 2ZG1A 2OI9B 3WHE0 3UO1H 1YNLH 1IGIL 3I9GL 3QFDA 2OCFD 4IIQB 1XGYL 4LGSB 5FDWA 1GXEA 3S97C 1ZEAH 5C08D 3LKNA 3MYJB 2P5WA 3MRBA 4HC1L 4I0KA 4NQED 4WFFD 3MV7B 3QIWD 4UILL 2HFFA 3RZCD 3V95A 3HG1B 5FYJE 5GRJL 2F8XC 1B3JA 1X9QA 4JFXA 1U3HC 3O11A 3UTTA 1EHNA 4LLDB 4TVPE 2IAMA 2DI7A 3G5YA 3GZKA 4Y1AE 4WHTA 4ZO6A 1D9KD 4OKDA 5TH2A 1MRCH 2YZ1A 3U30B 4Q7DA 4O2CB 1K4DB 3HHRB 2I9LB 3DV6B 4NSKB 4ZTPL 5DD6B 4U6YB 1MH5B 5DUML 4J7RA 1FPTL 2Q8BL 5CEZE 1AO7D 4LRNH 4YXHL 3LN4B 5EH1A 5D1XD 1F2XK 4MX7A 3AM8A 3KPOB 4OLXH 3RGVA 4RNRB 3SO3B 4F58L 4EVNA 5IB5B 2QQNH 3MROA 1QBLL 1JPTH 4Y5XB 2IQ9H 4QF1B 3KR3H 3HUJA 3KPPB 5MEND 4JM2A 2VWEC 2GT9A 3IS1X 3W81A 3VD3A 5J1AB 1OY3B 3W9EA 4G6FB 1JL8A 3GHBH 5EN2B 3FQNA 5BZDA 1XR9B 4NQDD 3TWCL 2Y23A 5CP7B 4KU1A 3C6LA 1L7IH 3RWIB 1A7PH 5EIIB 3TBVB 1U92A 1MCDA 2IANA 2XA8L 1UJ3A 3GSWB 4HIHB 4XNMA 1YPZB 3VFTA 4CJ0A 2Z92A 2F58L 1HQRB 4KZEH 1RUQL 4OLVL 4N0RA 2FX8H 2XKNB 3ARSA 3UJTH 4AJ0A 3BO8B 4LVOB 1G9NH 4UIKH 2XTJC 5I19L 1I9IL 2CMRL 3BQUC 2G5BA 3VXNA 1PEZA 5DMKA 4BK4A 1BVLB 1HE7A 3F7VB 3EZ8A 3DUHA 1PKQA 1GHFH 1RK1B 4E42B 3FN0L 2PTTA 2QQNL 1I1YB 3H6JA 3SDCC 1W72L 1CD8A 1T5WB 2P24B 3FCTB 1LE9B 2XV6B 1CU4L 4FP8L 4JHBA 1MCBA 3V0VB 3MFGB 3L9RB 3B43A 2CDFB 3EDEA 5J9PA 2JKXA 3EFFB 3V0AC 5IW1A 1YEGH 2H32A 5GGTH 3U83A 4HJ0D 1CYGA 4FZEH 4ONGL 4TUOB 4XVSL 4E41B 3OB0H 3VXMD 2VZ3A 4U4BA 4L9LC 4CUCA 3VFPB 5JPMB 3TBTB 3MRNB 3ULVE 1KPVB 3RVXD 2NY0C 1QBML 3ARFB 4BQBA 3SDCD 3U7YL 4PYGA 2WWMD 3K1DA 4LVNB 4EI6A 1YYLH 1JGUH 2WBJB 5TDNA 4F7TA 4JM4L 4UIMA 3LQAH 2C7UA 3GSUB 4FMKA 5DMIL 1GGCH 5CBAB 1QFWI 4A6YA 2BVPA 2W0LA 2C3HA 3QUZC 4UBDC 1BECA 5ESVA 1DDHB 4Q9QL 5T1MB 3QIBB 4DFIA 3QXUA 2JK5B 5DT1L 3O2VL 3JV4B 4XMKL 4NC2B 2FIRT 2ED7A 4P3DB 4YBLB 4FQ1L 1PKOA 3NA4A 3EOAB 1F02I 2ADFL 4DVRH 5HHOE 3DURB 1D7FA 1FAKT 15C8H 4W81A 4RMWA 2C1OA 1X5LA 3ULVF 2B8OT 4H0HB 5HHVH 3VG9B 1FCCA 2MSPA 1FZMB 5EU4A 5C0CB 4WI6A 1CN4A 5D8JL 5E9DE 4RAUA 4G9FE 3GMRB 1FO0L 2UYLA 4XVSH 1S9XA 2ZSWA 2X4QA 5IVZA 3VFGL 3ZL4L 4AQ1B 4RIRA 5E99H 4S1SH 2JIXA 3OJ2C 4KKBD 2R1WA 1A2YB 2BDNH 4GBXB 3V5KB 4G80A 1XGQB 1N3NA 4HZLB 3Q1SH 1OT1A 3CK0L 3WXWH 5FGSA 3E6HA 5D5ME 4LCUB 1FO0H 4EBQH 3QEHA 4N8VA 1RUMH 4KUCD 5E95B 3WNOA 1XIWB 4N1EA 5TF0A 2A73A 1JRHL 1YEKL 3DOSA 1LO4L 2QJDA 5F9WB 4PTUA 2J4WH 5FYKU 1NCWL 1IAMA 4H8WH 1VGKA 2EKSB 5SWSA 2PYEE 3KWWA 4OLWH 1HH9B 4MAYA 4FQ1H 1FCGA 2M8XA 2NMSA 2OTUB 5HD8D 5L2KA 4BQCA 4U1HB 1FNGB 2WBJA 3HE6B 1HIMH 3EOBA 1NCBH 3LAFA 4ELMB 3QA3A 1CDIA 4O02H 3MRLB 1MFDH 1WZ1H 4QXTB 5BRZD 5DJ6A 4I0PC 4R7DB 4KJQD 1JF1A 2WP3T 4ZFFB 1OTUC 1MCFA 5B3NA 3KAAA 4G43B 1OF2B 4O00A 3N9GH 4YDIH 4QRSB 3O41B 3WEXB 5BQ7B 1GGIH 4RX4A 1KCSH 5HGDA 4TN9A 4W4NA 4ZS6D 4ODSL 1FL6A 4QNPF 1UJ3C 1KULA 1H9VA 3ZMRA 2BRQA 4UNTA 2FJFA 3IAGC 4O02L 4JFPA 3CFDB 1PG7W 2VDKH 4IRJD 3SDXA 4KJQC 4XPBH 3AC0A 5C0AE 3EDJA 4LF3A 4ODXA 5BO1H 3SDDC 4P3CL 3DGGA 4TQEH 2FJFB 3N1QC 3RWIA 3VFSA 4B53A 4LARH 1X5JA 3S4SA 5GZOD 4X9IA 4BUGA 5KSBF 2VDNL 3ARDA 4RDQG 3RIAK 2R23B 3KXFD 1RZFH 3O4LB 3GB7B 3UTSE 5BV7H 4MJIA 4BSWB 4MJID 3ZKSD 3MRCA 1K8DB 5DVKA 3S7GA 3SDCA 3ARDC 2G75A 2FJGA 2FX9H 1A7QL 2DQEH 5F6HJ 3B5TA 3DVNB 3L3GB 1CFTA 2V5YA 3KNBA 2CDGA 2IC2A 4YDKH 2VABA 3SO3C 2A77L 1NCAH 3L5IA 4OCSH 3L6FA 4FQXA 2DIAA 3PNWB 4R97C 2AEPL 4MD4B 5FKPA 3FZUD 5A2LH 1MJ7L 1MCWW 4H1LA 2F53E 1IGCH 2HLFD 3HC4H 4JAMA 4LVHB 3MCG1 2H8PA 2APVA 2HJFB 4WI9A 3O6MH 3QUZB 4HIXH 4XNZB 3TF7C 2BMKB 4NFDA 1J5OH 1K2DB 1S7VB 4JGJA 2OZ4L 3QDGD 2Y7QA 3WIHL 4G6JL 1WT5C 1P4BL 4ZFOB 3QXDB 3BX7C 4IDJL 1RQ5A 1EHLL 4I0PA 3RI5K 4Z76B 1T4KB 4D8PA 5C0JB 3G5VA 4QRSA 1Y0LB 4XCCL 2X1QA 1PGRB 3MPCA 1EVUA 3RVWD 5DRXA 1IL1A 3O9WC 1B2WH 2NY5H 5AZ2H 2W1NA 2DQDL 4R2GD 3SE9H 4JO2L 5FB8A 1X44A 1MVUA 5FUZL 1JWUB 1FNGA 3U48A 4HFWA 2IPKA 5E2VL 4UB0L 3RPIA 3ULSA 5ID1B 1CBVH 4NN7C 1CFBA 2OSLB 5L9DL 4JM2D 3IAPA 1DSFH 5IMLB 1S9WB 1FL3B 2HFEA 1SM3L 3WIIH 3TESA 5CSZA 2P45B 3Q6GH 3HG1D 3KLHC 4LP5A 2XZCL 4JKKA 3NABH 1CWVA 4FFWC 5T5NF 1I4FA 1PBYA 3CXHJ 4HK3N 4Z9KB 4JVUA 2MQCA 3EIFA 1S9VA 4LSRL 5EU7E 4TNVK 1ORQB 2A74B 4XCFH 4JO4H 2AV7A 1AHWA 5DURD 3S35L 3CLEH 3PWNA 1KXTB 5IROC 4N0UA 4M4PA 3MA7A 1LO3H 4Z7VA 2AJVL 3C8DA 1CLYL 4JO1H 4PB9L 1LWRA 2J7LA 2CUMA 3RDTD 3S35X 3TH2T 4A6YH 1U8PA 5DRWB 2NNAA 3TIEB 3VMNA 1T2QH 1SEBA 5HYJD 3ARPA 3VXRE 4NO3B 3U36A 5CJOL 2VB5A 1OAXL 5L6YL 4MJIB 5DUPH 1KENH 4CMHC 5IJVB 4LAQL 2Z8VC 1OD9A 3S34L 4X8JB 1MCKA 2FX9L 2AXGB 4KK9C 1MNUH 5EA0L 1I8LC 1CCZA 4DKAA 3F7PC 5I73B 3HI6H 3DYMA 3DVGA 3HN3A 3VD4A 4GRMB 3BRGC 4W70A 4FXGB 3T0DA 3A0OA 1EHLH 4K94C 3QA3B 3OV6A 2CLZA 1UVQA 4L29B 3NA9H 2BSTA 9CGTA 1GZPB 4P49A 4P2YA 3IVKB 5EU5A 3TZVC 1BFSA 4LLWA 2P8MA 1WK0A 4GG6A 4NT6B 4HWZA 4M6AA 5IJKA 4YC2B 1VERA 1WTGT 2BSED 4HV8A 5I0ZA 2IPTL 1Q9LB 1YEHL 1A6TA 1CXKA 5KW9L 2AEIT 4UILH 4PRPB 4TNVF 1TETH 4TUOA 1CQYA 1YN6A 3ARDD 4PJGE 3MV9D 1QG3A 5AYQA 3ARQA 4K8RC 1ACZA 1XGUB 5JLZB 1KLUB 3VFVB 5GS1B 5K9OB 1N8ZB 1OLLA 2RBLA 3LN5A 4QY8A 3PP3K 3TA3A 5FYJU 2FEEI 4LLMB 4JM2B 4NQUA 4PRNB 1RFDH 1MVUB 4QRRB 2K7PA 5CGYC 5F8QC 1QVOA 2HMIC 8CGTA 1D9KC 2UYLB 2NY6C 2Y06L 3C60C 3OJDA 1DQDH 2DM7A 1E28A 1VSCA 4LDLB 3RZCC 3HTLX 1YYMH 1K3ZA 1QFHA 1Q9OB 3LMJH 1XF5A 5DD1L 4WU7B 2PO6B 5F88B 5DEZA 2VAAA 3DI3B 1A6UH 3MBED 4AG4L 4KKCD 4NSKA 1A3LH 1U95B 4GG6E 4XBPB 4I0PD 4YHNB 3B8YA 2MPAL 1KJMB 4KVNL 3FQNB 3AB0B 3G6DH 4O51A 2PXYD 4KROC 5KVGH 2O5YH 3FQRB 5F72S 4R26H 4HUKB 3TNNA 4MAYD 1U8JB 1ERNA 2A0LC 4MJ6A 3NIGE 4Q9QH 2X4PB 1U58A 4ZOBA 2VDPL 1NCBL 4AMKL 3MACL 3D3VB 5J3HC 2ICEA 3D9AL 5F1IA 2XYCA 5AUMA 4JFZL 4MJ6B 1MREL 2H32B 1QEWB 1P1ZB 1ND0A 3EO9L 1CLCA 4MDJA 5H8DA 5T3ZL 4OM1L 5LQBL 1IAKB 3AREA 3LKRB 1C5BH 4DGVH 5D70H 4M3JA 4GW5B 3HNSH 4X0KA 4NO2B 1Q72L 4DKFH 2ESVD 5GJTL 5IM7B 2EYRA 1TQBB 2EEDA 3O8XD 5J0BA 4IBLT 2F8VA 2EDLA 3RRQA 3SDXB 5FK9A 2EKJA 5DYOB 4LHQB 3T4YA 5IEHB 1MUJB 5DQ9A 3M1BA 1YUHB 4GRLD 5DK0B 4KTEL 4JFFB 1EEUA 5D70L 3TYFA 3OGOE 5KVMC 4HT1H 1TJGH 2CRYA 5KS9F 1N6QL 3BISA 1LMKA 3X3GH 3AU1A 5D2LE 3MR9A 1IEBA 5ALBH 3RQ3A 3WJLA 3KPRA 4LKXA 4V2CB 2ICES 3GBNH 3O4LE 4JCLA 5BRZB 3RWDB 3QO1B 2L4OA 1EUUA 2CIKA 1NUGA 4M43H 2AJXL 5DEGA 3STLA 3QXWA 1F90L 1UZ8B 5GZNC 3MO1A 1IQWH 1OSZA 3ARGC 3TO2A 1HDMA 1KCUH 5JXAL 1LE5B 4ZFGH 1AJ7L 4OCMC 5E5RB 1A4JA 4UV7H 1YEEH 1B90A 3P4OB 1Z9SA 3MTRA 4PJCA 4NCC1 3I3EA 4BH8B 3MFFA 2EE2A 4BSVA 2BRRH 3VWJB 2P8PA 3U79A 3UDWA 1T20B 2EIBA 3L3DB 4OQTH 3MNVA 4JZJA 5DI8B 2R9HC 3P77A 5D6DA 3FHQA 12E8L 2DQUL 4N8VG 2OM5A 3BN9C 4MAYB 43C9B 5GS2H 4L4TE 5BS0A 1RHHB 5EFIA 2HLAA 5IMKA 4AZ8A 2QTEA 1J1XH 3QUKA 3G6DL 2DKMA 3EOBB 1N2RA 2GAZB 3F5WA 4LHUG 5FCUL 3ZYZA 1MCWM 4XRCA 1QRNE 1CXLA 3U0WH 4DCQA 1FGNL 5LBSL 2VXTH 5MI0C 1QBLH 2Y5TA 5C0RL 3QUXB 1VGKB 1NBZB 4IIQA 1F4XL 1FORH 3TA3C 3OXSB 3R0NA 3REVB 4QNPE 1RVFL 3UTSA 2CLVA 4FQIH 3GMRA 4KK9D 5CZKA 4EUPB 3NIDF 3O3AA 3BPCB 1JF5A 3UTTB 1HQ4B 1U2HA 4OM0L 1DQJA 4NUJB 1AXSB 1EGJA 1JWSB 2P5EA 1IKNA 1ZHNB 4TYUA 1OVZA 4XNXL 1P84K 1E4XL 4HKZA 1U2CA 4P46B 3R1GH 1DUYB 1D5XA 3O3DB 1RJZB 4N0CC 2CK0H 4KJYA 3QDJA 2F53A 4FQJL 4LNRB 4K2UL 5ETUB 5I75C 5LWYL 2CR3A 3OB0K 4QRTB 3OKKB 3BN9D 1RJCA 2AQ3A 3GMPA 4OTXH 1J88A 1GGBL 1KPRA 3GI8L 4HPYL 1HSBA 1NGWA 4D9RE 5KBNC 3P0YH 3DGCR 4XB7A 2W92A 2XRAH 4DFHA 2NXZD 3HZMB 4L8BB 2W0FA 4IRSC 5GSVB 4NIKB 3KPQA 1G0YR 5JOPE 4OCNC 3S37L 3FO0H 2VISA 2UY7A 2X89D 2AXFB 1CL7H 3BGFB 3SPVA 5D7LE 3NAAL 4XC3H 1YEJH 3CVHB 4Z95H 1XCTA 3BJ91 4JAMB 5KOVC 1SJEA 3RVTC 4P3CH 4X6DE 2BSTB 4S2SA 4Y2DB 2V2WA 3TP4A 4YHLL 2YK1H 3RWEB 1T66D 1AI1L 4ALAH 2VJXA 4PJCF 1WSST 3M8OL 4JHZA 2VE6B 2Q7NA 2H26B 2VO5A 1NCDH 5CD3B 2RR3A 3PL6C 3RKDC 4F8QA 2VERN 3H7BB 2VC2H 3KPLA 3ECBB 3MGTA 4L3EA 1CD9B 1JGDB 3MLTA 4Y19E 1NC4D 3ULUF 1U8KA 3C5JA 2H2SD 4GRLC 1FRGL 1NGYA 1YC7A 5GGSY 5GGRB 3QISA 4F37F 5E6IA 2VABB 3O81A 3WIHA 3QJHA 1DLFH 3MV8E 4G9DB 1CFVH 4BZ1H 3HI1A 4G8GB 5D2NE 3HNVH 4PJ8C 1IEAB 4ZFZA 2CQVA 5CSZB 1OTSD 2ZSVB 4Y8AA 5D93B 2JTDA 5CJBA 4YFLI 2HP4A 2APXA 4WU5A 4BZ2H 4K23H 1LILA 2FX7L 4MZ3A 5T1KB 4WI7A 3FRPA 4QEGA 3JUYA 5T1LA 4XBEH 1X5HA 1EGJH 1KC5H 2FL5A 2YPLD 1IMHC 5TE7L 5J3HD 4U0QB 5D1ZB 2FD6H 4Z7NE 4R4BA 4EN3B 3OQ3B 4LLMA 2MKWA 4HGMA 1AIFB 4LEOA 1KIPA 3ZDXE 2BZDA 4JY4B 1BBDH 1ITCA 1J86A 2EDWA 4QWWC 4B7LA 4Z0XA 4HS6B 3JWNC 4N0FB 4BH7A 3HUJB 3KPPA 5D7IE 3KYOB 3GKWL 3G08A 4WI8A 2VLRE 1PSKH 3Q6GL 4RFOH 3ARUA 2ZWLT 4XPAL 3ROOB 2Q7YB 3KYMA 5CINH 1R5WA 2E6PA 4OT1H 1MEXL 4RAHA 4ZUTB 2O5ZL 1F5WA 2FD6L 3C09B 4L3CB 5HHQA 3LV3B 5CEYA 5C0IB 1G6RB 2AKRA 1R3JA 2D7PA 3MBEB 1E4WL 4C58B 5JW3H 1ZK9A 5JZ7D 4Z77B 3D2UD 4Q9BA 4GAGH 5TDNB 3C60D 1CD1A 5KSAD 5T5NG 3FO9B 2LU7A 4LCYA 2EDFA 1AGEA 1LHZA 2P42B 4ORZC 3SDAD 1H5BB 4RGNE 2Q76A 4HBCH 4LPTA 5DMKB 1IKNC 3OKOA 1DLHA 4GAGL 3O2DH 4BFIB 5J6GA 5JO5A 3PXJA 3EYSH 3IDIB 3WUWG 5IBTH 3M1BB 5DK0A 2PW1A 3BP5B 3GMMB 3OKOB 2FIKB 1KXQE 5HVWA 4PIRF 3GIVA 2PETA 3C9NA 4PJFB 32C2B 1FVDA 2B0SL 5LGHH 1IEBB 1I7UB 4M8VA 3RDTB 3C6SB 1UM4L 3C5ZA 1S7SB 4I48A 5IOPA 1CZ8H 4ODVH 2CIKB 3U4BH 2ZUYA 4Y19B 4TRPH 4NWTL 1AHWB 2PCPA 4TUJA 2OK0L 3JWDC 3VG0H 1N26A 4OZGF 2N4IA 5DFVD 2V17L 1KYOJ 5DHVA 4LPWA 5GRXG 1EBAA 4R8WH 2F54A 3UBXA 4UAOC 1NLDL 3TVMD 5MERA 4KZDL 3QZWB 3BDYH 1IC5L 5EWIL 1VFAB 3LKQA 3L95B 4IRJA 3LEXA 4EEEA 1MF2H 4PREB 2CLZB 3ORJA 4XPGL 5IBUG 4OKVB 4AY0A 4J4PD 2W9DL 5JIIA 4KKLC 2BSSA 3OAZH 5E1HB 5HDQH 3BWAA 3ULVD 5DJAB 4JGMA 2ZUWA 2PYEA 3BT2L 1I1AC 1JHLL 4PJ8B 3IDMB 4PJ9B 5GJSH 3IETB 2KPNA 1AE6H 2DBLL 2YPLA 4HWEH 1A7NH 2GW5A 3V0VA 1JI2A 1NCNA 1SHMA 1DFBH 2G9HA 4R7NB 4XH2A 3B9VA 3MC0A 1ULVA 5CMAA 1NBVL 3KXFE 4UINH 2O5ZH 3ZYOA 1MFEL 4RZCB 5IVNA 3FFDB 4I2XB 1S8DB 4PJHA 4R26L 4WI4A 1JHKL 1OWWA 2DDQL 4KXZH 3B2VL 4I18A 1T03L 3G5YB 1ZEAL 1LK3L 4LPUA 1NC2B 2D7OA 2RJMA 2HTKC 4J3OC 3LD8C 1G9ML 1BVKB 3PE9A 1XH3A 2ARWA 2ZCKL 1FNAA 5D7SL 2EC9T 4CN6A 1NBVH 3LY6A 4E0RA 3E6FA 3VGBA 4GQPH 1U95A 1A1NB 4YO0B 4L3AA 5AUMB 4Y4HC 2BFVL 1E6JH 4HLZG 4ZXBD 3T0AA 4U6HB 4P9ML 3FT2A 4YGVA 1ZANH 4MNQA 2IGFH 5DR5L 4D0BB 5B4MD 5DGQA 1J8HE 5C0EB 1NANI 5B38B 5GRUH 2UWEE 3EO0B 1U8QB 4YUEH 1BF2A 1FLRH 1TENA 4FQCL 3SCMA 3GJEA 4Q6IC 5C0JA 3KPSE 2YKLH 1KCKA 3SEPA 1UWEL 3CH8A 4FZEL 3HNSL 4U6XA 1KJMA 4X4YA 2YC1A 3RPKA 5BVPH 4FQCH 3ARFA 3O4OC 5TE4L 4M5ZL 1A9BB 1Y6KR 2BY2A 2UZYB 4YHKH 2EE3A 3QXVA 2NZIA 4NC1E 1AD9A 5F7EL 4W6WB 4ELKA 2J88H 3TPKA 2IBGA 4RNRA 2XI9A 2P7TA 4GXVH 3K74B 5HDLA 1F00I 3EYUL 4RMSA 3ES6B 1R3KA 3VH8B 1DQQB 3ZT7A 4YPGB 4PJ9A 2D4DA 3HAEH 3GIZL 2HFGH 4HXAH 5CEZD 4U1IA 1TJGL 3MJ7A 3MFFB 3V6OE 3TCLB 4CN4A 4KUCF 1WQVT 3T4AA 5FECB 2H9GA 4UU9B 5IBLC 1RJYB 1RVFH 4DN3L 4LLAA 4IMLA 1BIHA 1A9EB 3EGSB 1IGJA 3BEWA 3RTQA 3MRCB 2MPAH 1DBML 2PUQT 3AS0A 3VXNB 4X8JA 4QGTA 4ZQKB 4UNVA 5EOQL 1KNOA 3WJJA 1JPFB 5D1QA 5GZOC 3FQTA 5DJZA 3QUXC 1BAFL 2MOVA 2P5WB 3MRBB 1T5WA 2P24A 3GM8A 3QO1A 3GBLA 4P5TB 4Y5YB 3RUGB 1GGUA 2W9EH 5HGHA 4KUZH 3LKSB 4FA8A 4AQOA 3WNKA 3I2CL 4GG6B 1G84A 1C08B 4WFHD 3OKEB 1CU4H 4X99A 2DQFA 3L3KA 1AH1A 4ZO7A 5DS8B 2NW2B 3U9UB 1C5DB 4HC1A 1MUJA 1I7UA 4WWKC 4RMVA 5ITBH 4HXAL 1TZHA 1C5BL 2Z4QA 4QXWA 3SE4C 1NGXB 5LG1A 25C8H 3BI9X 1JIBA 2X4TB 3SJVB 3WHXA 3DETC 5FYKL 2PXYB 5DJ2A 1JTPA 4GAJH 3RWJA 2NZ9C 1JZ6A 3IGAA 1FFQA 3H42H 2BXYA 1MFDL 2V9QA 2GT9B 1QFUL 4XI5C 2A83A 4XVUD 1Q0YH 5HD8C 1JP5A 1FFNA 4OLZL 3AAZB 3ALWA 4OUOA 5D1XB 4E41D 1KT2A 4PRAB 4XNQB 3BUYB 4IM8A 3CXDH 1F4WH 4U7MA 2E6JA 3CLFH 4LCWD 4LVNC 2QSQA 5C9KA 3MRPB 3OZ9L 1YY8A 1I3VA 1IRAY 1I9RH 3BGFC 5I1LB 2ADJB 4LNVA 3IYLW 3RTQC 1A2YA 1H3XA 4PS4L 3G6JA 3RGVC 4OF7A 1XF4A 2OR9H 4WW1B 5I66A 4D0CA 3C08H 4BKLA 3NZ8A 4JM2F 1HXYA 2BHZA 1BBJA 1HKLH 3GMQA 2QR0B 2J6EL 1R5IA 1XF5B 4FZ8L 3KPSD 2QQLH 3GB7A 4M7ZC 2BNQE 2HFGL 3QSKB 4NUGL 1D9KA 4MHHG 1N2RB 4OD3H 5TDPA 3BQUB 5HPMA 2UVEA 4U1SB 3PWUA 4PJEA 1BQLL 4XXCA 3QCTL 2IG2H 3ULUE 4P4KD 2J12B 5A3ID 1X7QA 1HYSC 1AQKH 2X9XA 4P5TD 3TBWB 1ZSDA 1RULL 4H1LB 3GSQA 1UB6A 4N1HB 2A6IB 5T1DL 4NRZA 1WFUA 4GG8B 3SCMC 3FQXA 1KFAL 5ITBL 2EC9U 3VFWA 3PQYE 5C0RH 2DAVA 2MHAA 4XVJH 1AI1H 4ALAL 3RVXC 4PRDA 2IAMC 3O2DA 4ZD3H 5L0QB 1PG7H 4N8PA 2NLJB 2YRZA 1GOHA 1M71A 4LHUD 3MRLA 3QPQD 1ZHLA 2J8UE 2FJHA 3C6LD 1JGEA 2FDBP 4Y4FC 3D0LA 2AEWA 3HRZB 4X80L 4R4FL 3SE3A 5GRYA 4WWKB 3U9PH 1FFPA 5CJXC 3CU1A 5JHLH 2RGSA 2R29H 4Y1AA 4RWYH 5T5FL 1A6PA 2LAAA 4Y4KA 3SDYL 4YNYA 1F97A 4BSWA 2BX5A 3HNVL 2EDTA 2BP3A 3S8WA 4NKOB 1OL0A 2Q8AL 1JZ7A 5C08B 4JB9L 5C7XL 1EMTH 4XTRD 5KS9B 1VADA 2R1XB 4R6UA 3U2SA 4QRTA 1OARH 1A6VH 1AE6L 2ZPKH 3H9SE 4X6FA 3JXAA 4QT5A 1CBVL 3D0VA 4YHZL 3WL9A 4JJ5B 4I13B 3ARGB 3PP3H 1FL5B 3TVMB 1B4JL 2W0FB 3LKRA 1HH6B 2VXUH 4OCSL 5DXWA 4OD2A 4ZXBB 1NCCH 3B2UC 3VD9A 1U3YA 3DTXA 3MODH 1EEYB 5D2NC 3CJJA 4U1GC 3VGHA 5HHME 1Q9KA 1A4KB 3P40A 4YC2C 3V79C 2YK1L 1Z3GL 5I8OL 4X80H 4URTB 2ZPKL 1AXTL 3Q3GB 4JRXE 5I1KL 4JG1L 3QH3A 2GFBB 4PJIE 1G7QA 4U49A 4YWGH 3WHE1 5L2JB 4FQLH 3BKCL 1GOGA 3MRIA 1ZA3A 4RFNB 1E4XI 1A1NA 3CUPA 3ESUF 5T1KA 2LE9A 1JI1A 4P46C 2X41A 5IWLC 1GRWA 4LIQH 4GT7A 5ICXA 5C09E 1L6ZA 4OT1L 1L7TH 1CR9H 2UWEA 1UXSB 2AV1B 4B41A 2AJSH 1MLCB 3RVVC 4LBEB 1TTGA 3EOTL 3QDGB 4PJIF 2A1WH 1MH5A 3QQNA 5GS0C 3IRZA 5L6YH 1VDGA 5IROA 3UTSB 1K4CB 1ZTXL 1XZ0B 1A6AB 2EC8A 2AJZA 5I74C 3ZYIA 2F8OA 4OFDA 3HE7D 5FUCE 2OL3B 4M3KB 4WFED 3TA3B 2NYYD 4P4RB 2BK8A 5GGRA 3BP4A 3VRLE 4AL8H 1CK0H 5I76B 4C59B 2A9MH 5IB3A 4C56E 4BH8A 4BSVB 3QIWC 2ADGB 4Y4KC 1S5HA 4OJFL 4M02A 4JFDE 1S78C 2AAVA 1HSAB 1YDPA 3VRLF 1E6OL 2YN5A 5KZCD 3O4LD 3A6OA 3BKML 4M5YH 3RX7A 4MD0A 5FO7B 3H0TB 3TCLA 5F7UA 2VXSH 1F58L 2BXZA 1YEHH 2IPTH 3NCJH 1C1EL 4JHAL 4M8QB 1HH6A 1G6RL 4I3GA 5F97E 5EOTA 2ZOLB 3LB6D 3MUGA 3RWDA 4MD4A 5FKPB 3QDJD 4LSPL 1DBBL 5CILH 1FVDB 4UNUA 3KYKL 3E3QE 3PG2A 2DN7A 5DEFB 2J5LC 4MA7L 2Z31D 4RAVB 4BFEA 2Y1VA 2MCG1 2VR9A 1CI5A 2YPKB 4HKXA 4XAKE 2OTWA 4KHXH 1U8HB 3OKDB 3VRIB 1EJ6A 2V2WB 5TQ0L 5KOMC 1QLRB 3JWDL 3N85L 4PP2A 5C07D 2DQHL 1NKRA 4OUUA 2DQGL 1UXWA 3VFNB 3TIEA 1KEMH 1U8IB 5I1CL 4FXGA 3EOYG 4PJGF 1TJIL 1BMGA 4OI7A 4KXZI 5D9SA 1CG9A 4KTYA 4E41A 5DMYA 4NO2A 4NP4H 1IILE 5EZIH 3IDNA 1T7XA 1EAPA 5FYKH 4XXCC 1U8JA 2FX7H 5E8EA 5J1AA 5FK9B 4LMQI 5T3XD 3RL1B 2JCCF 3BAEL 3NGBB 3N1GC 2Q76B 4M6NH 4OZFH 1KGCD 1IGMH 6FABH 2JELL 1JNNL 5I1GH 3X13B 2XG5A 2XWBA 5E08L 4HGWA 4NWUH 1BQHG 5IV2A 4DN3H 3OJMB 4EUPG 4XCFL 4J3XA 3RP1A 4HBCL 2OL3H 1AFVH 4U0RB 4XP1L 3JSSA 1NUDA 1ONQA 4KTDL 3RGVB 1FH5L 4S1QL 1OAYL 5IR1A 5KAQF 4OB5H 3O6FC 4JG0L 1FNSH 3RU8L 3LZFL 2D7TL 4CGTA 5I1CH 1JGVL 1LQSR 4RZCA 1YNKL 5I17B 3A6CH 4NPYB 3V2AR 2ZJSH 3ZDYF 3DARA 2ARJQ 2NCMA 3VGGA 5IB4B 2VLLB 5GGUB 3RA7L 1RUKH 4RAUB 2VLRD 3X12A 5GJTH 1QSEB 3I2CH 3KJ6H 5F6HI 5F7DA 4WCYH 4MX7B 4O2EB 4AT6B 3BYYA 1BIIB 4TVPD 1IKFL 1CF8H 2HH0L 4F7PA 3D25B 5M95B 1A0QH 5I1DB 3MV9E 2ITCB 4OZIA 4KROB 3LKNB 3EOAA 4XCCH 4C54A 4CDHA 5EBLB 5HGAB 5I1HL 3IU3B 1N6QH 1N6VA 2FGWL 2VYRE 4MS8C 2J88L 4PJXA 2HVKB 5IBUB 1LP9A 4G5ZH 4E0RB 3W2DH 1D5BA 1SEQL 5FYJH 3VXRB 4HF5L 3WO3B 4MQ7B 3O6FD 2DLIA 4LIQE 5CCKL 2KQNA 5IVXA 3D5OF 4PJ7F 2UUDK 5IWLA 1MFBL 2W91A 1AJ7H 1UVQB 1OAKL 3QAZB 3VFMB 1QBAA 3HE6C 4P2OD 3TT1L 3BOVA 3HZVA 5FM5M 4JJHA 1Z6JT 4RX4D 1MJJA 1EXUA 4XP6H 4XP4H 3HC0B 3DLQR 2B7DT 1FO0A 4XCEB 1T0MA 3IDIA 3B83A 3QYCA 1OSPH 5HVFB 1SYSB 2YSSB 2GY7B 3UEZA 1BOYA 1A7NL 5DJCA 1H0DA 1LK2A 1FC1A 1FO0B 1YQ2A 4P4RA 5C0BE 4DUWA 4JY6A 5IBLD 1BAFH 4YLQT 5EB9A 3JV6B 1N64L 3P2TA 1X4XA 3BSZH 5F7FA 4OLXL 4ONGH 2Y06H 4MCZB 4ORGB 5KSUA 3WUWB 3CX2A 2OXHA 2DM4A 1FFPB 1BD2D 4OLYH 1IJ9A 4OF3A 1KUMA 2D9CA 2DLEA 3NCMA 3AU1B 1A1MA 5F21B 2XKSA 4AEIL 1I7TA 3W0WB 2VDRH 4JFEB 3RU8H 1XEDA 5FGBC 4J4PA 7CGTA 5ADOL 3DGGB 2D7TH 1IC7L 4XP9L 5FO8A 2X4TA 3SJVA 5A2KH 1OAUH 5DVOA 1U3ZA 2Z31C 5DJXA 4M7KH 2OL3L 1IBGL 3P4NA 3VGFA 3C6LB 4GO6B 3TFKD 2DQFB 3L3KB 2FX8L 4QHNA 1XGYH 5KS9E 2LFGA 1DQJB 4GKZB 4JPVH 1VEMA 5HHOD 5FYLL 1H8OA 4UMGA 1X5YA 5C70A 5LJYH 4Z7UF 2HT4C 3DUUB 2GJ6E 4HUXB 4R4BB 4EN3A 2HVJB 1UM5L 3MNZA 2F53B 2XZQH 1LNUA 5B39B 4G6AC 4JDTH 2WBJC 3K81A 3VGAC 2CLRB 1KF9B 4TPRH 5CP7A 2F54E 5I1DA 2X70B 5JNYB 2DYPA 4K2UH 1NPUA 3RVTD 1RK0A 5E2UL 4YJZL 3O6KH 1J05A 3KLSA 3MUJA 5GRZA 3BEWB 1B9ZA 3MMEB 1ACYH 3EOTH 5LGKA 1HXYB 4RCAA 5SWSB 3TBSB 4LQFH 3LEVL 5IVXF 3B3IB 2G60L 1IAKA 3HS0A 1YMME 5DF0A 4WW2F 4LEXH 5C0BD 5AZEL 4OLUH 2A2QT 1IL1B 2NXZC 1H3PH 3PWPD 4MGXA 3VXSA 1UC6A 1YY9D 2XFXA 3NCYS 4YHML 3NAAH 3T0EC 1PZ5A 3NZHL 1AD0B 3CX5K 4O2FA 3RWHB 3N1FC 3K2MC 1DQTA 4LCWB 2VLKA 3X3GL 4QHLB 3S5LB 4CU6A 1XMWA 2ZSVA 1A3RH 4GS7C 5J11C 2VZUA 1HIML 2APWA 4L8DB 3QFDB 5F7EH 4BJLA 4XWGL 4KKLD 4Y8DC 4K3EL 3ZE1E 2WSKA 1WEJL 4O4YH 4K8RL 2XPGB 3BKMH 3FFCA 2NY4B 4M5YL 4QOKB 2VITB 3HMXA 3TVMC 1QYGL 1D3CA 1Z5LA 4HXBL 2C9AA 5F93C 3VMOA 2XG4A 1IC7H 4XWGH 4GLRH 4F9PA 2GJZB 4WHYH 1NSNH 3PWJB 4LLQB 1XIWC 2FEEL 4D0BA 1KJVB 4KJPC 3FB5B 1A64A 1BQHB 1K8IA 4PUBL 3RY6C 5KSBE 3SGDI 4PV9A 4NRYA 5D93C 2VXVH 3D9AH 5KSAA 5SWQB 4DZ8A 4YK4C 2ZUTA 1I7TB 3V4VH 4GQ9L 1CDBA 3U0TA 1FNLA 4BZ2L 1H15A 2YMXL 1S8DA 3D69A 4JREB 5DA4A 5DJ0B 1ZSDB 1FAIL 2FEDC 4M1CC 4PS4H 1XCTB 4D9QD 2R2CA 1H3UA 5JA9A 2JB5H 1YMHA 1CD1B 1JGUL 3OGCB 4GFTB 4OI8A 1MWAB 2B1AH 5F44A 1C8PA 2Y07H 2H41A 1KC5L 4G8IA 3BMWA 3ARDB 1KGCE 4Y2DC 2YD7A 2VZOA 4ZS7L 4NZUH 1FGVL 5BMFH 5E9DB 5FA4A 1WF5A 3WDHA 2X4OB 2V5RA 1P9MC 1QA9A 4FQQA 5F1KC 1EJOL 5JIHA 2VXUL 3WSQL 4P3WA 1CGXA 4PG2A 4NT6A 1EFQA 5EZJB 3NOIA 3FO1B 4ELMA 2F58H 4CVWA 4U3HA 1RJLA 1LK2B 2KDGA 5M94B 3D39B 4MDJB 5JPNA 1QRNB 4WO4D 2APFA 1IAOB 2XPGA 2CUIA 2V7NB 3FFCB 4NZRL 3ROLA 2EXWC 1FSKC 2KL6A 2X7LB 1M71B 5SWZE 3RJQB 1AD9B 4OD3L 4QRPE 1CFNA 4GRMA 4YWGL 1I8MA 5ENWB 5BXFB 3C09C 3VDCA 2JJSC 2Z8RA 1IT9L 1R3LA 2PYFA 4JVPA 4OLUL 3ZDXF 5JXED 3CVIH 4WGWB 4JQVA 4EBQL 2AEPH 4WU5B 4GMTH 2X4NA 1G0XA 1MOEA 4JO2H 4XHQA 5IMLA 1OOAA 4GJTB 4UT7H 3U36B 2V6HA 1Q94B 3VXQA 1QSEA 3THML 1KFAH 3IJSB 5D2LA 4HCRH 3EO0A 5ICZA 4I9WE 3U9PL 4F2MA 4N68A 2BNUB 3I75B 2R2HB 5F1NB 3WHXB 1RZ7L 1NMAL 3QWRD 3GMOB 4KJWC 5BW7C 4Z95L 1P69B 5EBLA 5HGAA 4X8XA 4FTVE 3O2WL 4KI5F 5F96L 4XPFL 1FVEA 3QXAA 5C0DB 5C0FA 3RNQB 1FAIH 4WEMB 5E8PB 5E56A 3KYMB 4ZFOA 2HRPH 1NC2D 4X4XA 3LS5H 3VCLA 2DQCH 2A0LD 4P99A 4JZJB 5DI8A 4MAYC 1FLRL 3LSOB 3D39E 2XOTA 1I1FB 4N90E 2GTWA 2PXYC 4KROD 4LL9A 1RFDL 1RJLB 3NPZB 3B9KC 1QHPA 3MLXH 5JPNB 5E94B 1NMCB 3QUMH 3MYJA 1FIEA 4G6MH 2A9ML 4KPHH 1G7MA 1VKXB 3PNWA 4HULB 5GGQH 3FRUB 3E2HB 4JZJC 4QRPD 5FF6B 4S1SL 3QEQD 3IXAA 1J1OL 3BE1L 3RL1A 2G5BB 1G7LA 3BJLA 1HHJA 5GGQL 4X7CC 3QCUL 1S7XA 1T04A 5L9DH 3SCMB 2A1WL 2CKBH 5I71C 2ZG3A 3LPWA 2IPUG 3L7EB 5C0GA 2VDRL 2RIKA 5I1HH 4ZUWA 5D9SB 1QSFB 4Z8FL 4M62L 3KYNB 1ADQA 2EDQA 2CO7B 5HGGS 5FO8B 1NL0H 4XP5H 1A6ZB 4MXQC 4BK5A 4DZBA 2QSCH 2R0LL 1T0PB 3FB7B 5TPWL 3QDAA 4NFCA 3FAWA 2VH5H 4Z6AT 4YIQA 4OZGE 3PGFH 3QEQB 1CICA 5CGTA 4K3DH 3RAJL 4AH2B 1CDUA 1U8HA 5I1GL 3T0WA 4M7ZB 3HNTH 5SWQA 5J12B 3D85D 4YAQA 3X12B 5HI4C 1AQDA 3VXOB 1RIVL 5F9JA 4YHIB 5K9JL 3C8KA 2E9JA 1SVZA 5HYFA 1YPZE 1KBGH 5L7XH 5ABDE 1T0NA 5EZLB 1OAYH 3WD5H 1JZ2A 1J5OL 3VI4E 3MLWH 4RFNC 3PGCB 3BRDA 5LXGH 1T1YB 1P7QA 1U42A 3FKUS 3TZVD 4S10A 1RU9H 1AFVL 4XP1H 4J3SA 4MXWH 4UT6L 3RY6A 3QNXB 5I8OH 1UA6L 3LSOA 1ZVYA 5J12C 1R0AH 3OPZH 5K9JH 1KV3A 1AGBB 3MXWL 5SV3A 4X6CE 3I02A 1N0LA 1S9VB 1RZIB 3P9MB 4KVCH 1XGTB 3TA3D 3W39B 2V9TA 4YDLB 4MA3B 2P46B 2RHEA 3RNKA 2WW8A 1UG9A 1JVKA 1JZ8A 4PREA 3VD5A 4KHXL 2NTFB 1RZKC 1OB1B 1S7RB 2DM3A 4JY4A 4Z7WE 4ZSOB 3VGAB 1XCQB 1N5YH 3MLYL 4Z78B 5BV7L 1WFNA 1MCOH 1T6VN 4LKCA 3I3BA 1W8OA 4U6YA 4K3JH 1NGPL 4PJHE 3SBWA 1BZ9B 2AJYL 1KCUL 4JY5L 1UWXH 4GRWE 4FXLA 4LMQE 1MWAL 1NFDA 4RBPK 1EEYA 3DTXB 5IB2A 1Y0LA 1FNHA 4LLDA 3C6LC 3PL6A 1JCKA 4HAGA 4PR5A 3RWGA 2OMBA 3STLB 2CLVB 2APBA 3QPQC 5J06A 1JF6A 4YH6A 5D4QA 3GHBL 3RDTA 5F89A 1R0AL 5B38A 1SMAA 4NKDB 1B0RB 3TJHC 4OM1H 4JN1H 3GMNA 1ZLVK 1CVSC 1MIEL 3I50L 3ZTJG 4Z7WF 4F3FB 5LAXA 3LPFA 5BOZG 4Y5YC 1LP9F 2ERJC 1AGCB 3I85A 4FG6D 5CP3H 1W0WB 4F58H 3V6FB 3SCMD 4U33A 1KLGB 3DBXA 3I6KB 4JN1L 1U3HB 4HKJA 5HYJE 1S9YB 5C3LD 3JV5A 4HMEA 3MZGB 4NUGH 4P5TC 3WJJC 4F15C 3AVEA 1UWEH 2AERT 3KPTA 4LCWE 4DAGL 4U1MB 3HR5A 2NY4C 1KPVA 1HN1A 3F12A 4O9HL 1T5XB 1E4KC 1RUKL 4GW1B 4TVSa 3MLWL 5TJWK 3GO1H 3TNMB 3BZ4B 1ZWIA 4ENEC 4N0UB 5J13C 5ADOH 1YQVH 4NNYA 2NX5A 2GAZA 3F5WB 4AM0A 4L4VD 5DWUH 4OB5L 4XCEA 1LP9E 4Z7QF 4QOKD 4UZGA 3P4OA 5IESH 1A9EA 1QPPA 4OZGA 1LE9A 4DUVA 3T0EB 1DQMH 1INEL 1FYTD 5CS7A 2ICWB 4QCIB 1MJUH 3MRMA 2E6QA 3QG6B 1QQDB 2D31B 4Z5RA 3STBA 3UJTL 4KC3B 3ZKMC 5HSFA 4I1NB 2C4XA 4X6EB 5D1QB 4GKSB 3B2VH 4M8QA 4PGDB 3SKUD 4FFZL 3MRFA 1UH2A 5HHMD 3FZUC 3MA9L 2C1PA 3HC0A 2YZ8A 1FE8L 1NFDB 2ENSA 5B8CB 4WWID 5DMIH 2JJTC 4L5FH 4YQXL 1RJYA 4EN3D 1MCSA 2BFVH 2CPCA 4JCMA 4LLYA 3O45B 1QSZA 4LPVA 4PLKD 3HAEG 4PJEF 4L4TD 4BA8A 4KTDH 4CMHB 3UPCA 3S5LA 5ADPH 3MCKA 2IBBA 1BJ1J 1O0VA 3C08L 3MLZH 4S11A 4NQEA 2DQIH 4JDZA 4OCWL 3CFEB 4X4ZA 1RV6X 5DFWH 4H25B 4H88H 5JOPD 1OGTA 1J12A 2VL5B 1DVFD 3ZE0E 5CLTA 5C6PB 1RZ7H 3QQ4A 1LO2L 2ZUSA 2X1PA 4MJ2A 3MRRB 3R8BB 1JHLH 1KIRA 3GRWA 3WXVH 1FG2A 3Q2CA 5DC0A 5HI3D 1MCPH 1NCDL 1U3JA 3QNYA 2DL9A 5I1EL 4ELKB 2CLRA 1HI6B 4HUWA 4POYA 5CBEA 3FT4B 4RGMC 4F3FA 3VGDA 3HS0B 3IFPA 5HHXH 5E1AA 5HYSB 5DQDH 1S9KC 4LCCC 1M7IB 4X7SH 4BH7B 1RMFH 3K4ZA 5D2LB 4WO4B 4KMTH 4XMLL 2ZZUT 3V7AG 2BDNL 4KGJA 3W9DA 3DHJA 4JFFE 4LSQH 4U6VH 1T22A 3QIBD 3GSRB 1A7RL 2OQJA 4HBQA 3SDAA 2JB6B 4JFDA 5CD5C 4ZUSA 5EUOF 3QDJE 2D4FA 1MHPH 1YJDL 1BREA 5CP3A 1K85A 3QG7L 7FABL 3O3EA 3MLUL 5DMGD 5IHBA 4G42A 5IB5A 4ZNEA 2RCSH 5JW4R 1NFIB 5C6TL 5DDHB 2WQ8A 4Z7WB 4LLYB 4FTVB 4RA0C 2BCKB 1BHGA 4WUKL 3INUH 5SX5K 4HS6A 4N0FA 2VQTA 2ESVE 3PV6B 1WAAE 2WV3A 2V5TA 5DLMH 3C5SB 4PGZA 2BSRA 3W5MA 4RGMB 5IESL 1QR1A 1YEIL 3OX8B 4C56D 2V2TA 1T21A 2J5LB 5EZJA 5CJQL 4G43A 4YGAB 3AREC 5H2BB 3UYRH 3VXTB 4DGIL 2B1AL 1AHWC 3SPVB 4WDIB 5T1LB 3OSKA 1XGPB 4ELME 2W65B 4I3SL 3GMMA 2PR4L 4GSDL 5DJCB 3VFNA 4HIXL 5I18H 4DKEL 4R0LC 2AK1L 3BZEB 3ARYA 3GSOB 3SE9L 2D3VA 3OWEA 3QQ4B 1UKTA 5C8JB 1OW0C 2NY3B 4XPAH 1VHPA 1FP5A 2BY1A 4LF3B 2P8LB 1GGTA 4RFEA 1CQKA 5I18L 5B4MC 3DX9A 1H5BC 3ZT6A 5C09D 1UACH 3UAJC 5A1AA 1GZQA 3U1SH 1YEJL 1T66C 2EE6A 3FQXB 3F7QA 4ZD3L 3GSVB 1WBYA 3U7YH 4QXGL 4EDXA 2FB4L 2G2RB 4LASL 3V5DA 2VDLL 2WWKO 5C0IA 4MQ7A 3CVHA 4PJ5A 1YY8B 1NBQA 4JFFD 5GGTL 3RX5A 1AO7E 4K23L 4TQEL 3DNKA 2JJVA 5DD0H 2DD8L 2H32H 4K3EH 4U0RC 5GGTA 2C4FT 1I85A 4L8BA 4K8RH 2GJZA 4PY8J 4RWYL 3LPGA 3QI9B 4I3SH 4LLVA 3RJDA 1INDL 2YXFA 3VXQB 2DLHA 5BZDB 2DRUA 2HN7A 4L3ED 3K46A 1UWXK 5CJ8A 3T3PF 1YMMB 1TZGH 2AJUH 3QG7H 4OQ1A 4OIAA 1K9TA 1N3NB 5F6IC 1R3LB 5SWSE 2MFNA 3RBGA 1LDSA 4M7LT 1WV7T 5IKCA 3QI9C 4UOJA 2FIKA 4CVXB 1N4XH 1MJ7H 5EUOB 5HJ3A 5F9WC 4HJGA 1QSVA 2Q86B 2V5MA 5D7KD 2VC2L 5C0FB 3G04B 4M43L 3KDMB 4GXUM 4KV5F 1EFXB 3GSNH 1U0QA 1HDMB 4YPJA 3UZQA 1IM3B 4CW1A 1HH9A 2X4NB 4PGCA 3V7AE 1X6LA 4XBPA 4YHNA 3T65B 1IC4H 3VXUD 3F7YA 4XZUA 3JBG7 3T3PE 5ICZB 3IAQA 3EYQC 4JPIB 3AS3A 5FA4B 3WD5L 1FVEB 3QXAB 4HIJA 4Y2OA 1TVBB 1LDPH 3C2AH 3H9HA 4G8FA 4TUKH 3L3HA 1JN6A 2ZUVA 4Z18A 1OHQA 2AVGA 3O6ML 3S37H 3MXWH 4LGPB 2HWZL 1OPGL 3Q48A 1CD0A 5TF1H 4UDUB 4HWBH 4X5WB 5TE6H 2B4CH 1IAIL 4XHJC 3WSQH 3VG9C 2P43B 3QHZL 3PABA 3CFJB 3CFBB 3W0WE 4WWKA 3DUUA 4H8WL 3HUJE 5D7IB 1GGYA 2B0SH 5ITFA 3HC3H 4YHOH 1R3IH 5EPMA 3WMSA 3MLSL 5E8EB 4DCQB 1CFSB 2IMMA 4Y4KB 5GRVL 4KHTH 4M9PA 4MXVE 4MVBD 4J23A 1T1XA 2WIIB 4KDTC 2NY1B 4M48H 1S5IL 3HKFA 1JK8B 3BPNC 4MJ5A 5IW6B 1MEXH 3O0RL 2BOBA 2FWOB 4HIIA 2H1PH 3TJEL 1WC7A 1BFVH 5BO1L 3D69B 4WUUD 4U7SA 4NNXB 2OX5A 1N7MH 3BYTA 5BZWA 1JGEB 4NM4L 1PDKA 4GKSA 4MLIA 2WINA 3OF6D 4NJAH 3RNKB 1XGRA 5IBTL 2I27N 2YPKA 4L4VA 4L5FL 1OM3L 1K8IB 3V6ZA 5CJXA 1AC0A 3WLBB 1G7MB 2YRLA 2H8PB 3JTTB 3Q1SL 1U58B 2ICWJ 1DBKH 4MA8H 1A7OH 4KK5C 3VI3E 1DTUA 5HYJB 2O5XL 4P2QD 1KTDA 1H5BA 3EGSA 4KPHL 4FRWA 4U1GB 4YHIA 4EUPA 4U2ZA 1V7NH 2HFTA 3RWCA 2DKUA 1O7SA 1JPSL 4CKVX 2IBZX 1PZUB 1DFBL 1CGSH 4MNGE 2AK4E 3FMGH 4PP2B 3CVHL 5EO9B 4KMQA 2PW1B 4FXKB 1F4YH 4G3YH 4WI5A 3MACH 3QUYC 1V3MA 5KSBB 2ICCA 3MV8A 4JFYA 2XICA 1C5CL 4P2CG 2B39A 2V9RA 3WO4B 1QFWL 2VUOA 3CSGA 4KKBC 4PRPD 2R0WH 1I85C 4OBSA 4IS6B 4NBYB 5ILTH 4H26A 2QHLA 4JRWA 3GSNB 4O5LL 4V1DA 5F96H 1S7XB 4PJBA 2XXMB 2PN5A 3EHBC 2XN9E 4I77L 2GSIA 5E5UB 3NCCB 3IKCB 2YA2A 4ENED 3O6FA 1F11B 5EBMB 1M7DB 5T33L 3N50A 4ONHB 4Y5XC 1T7WA 3LMJL 2VLLA 5KVDL 5C0AB 1L4IA 3KYKH 4G9FA 4OZ4B 4PRPA 2WP3O 5DD3L 3LEYL 2Y72A 5JXAH 5D1QC 5KTEL 4KKCC 3FMGL 4YEFA 3BT2H 5C0DA 4YHKL 2GHWB 2A83B 4F37K 1G9EA 1MHEA 4KQ3L 4K7PH 4PJHF 4F7MA 1ZV5A 3ALPA 3ABZA 1Q8MA 5M7QA 1NEZG 5F1NA 2QBWA 4X6EA 4LHUB 1JE6A 1T5XA 3U7WH 2AJVH 4LFHG 5ID0B 3R8QA 3PHOB 4RMRA 3VXSD 1FYTE 1GPOH 4PJ7E 4DKDC 1IBGH 4OZHA 3KPSA 4N0YH 4HMDA 2DTMH 4NN6C 2CSPA 5EZIL 5GRUL 4HD9A 4RMQA 1OAUL 4IRJB 1SEQH 3O11B 3LKPB 3BGMA 4HKJB 4NZDA 3O8XA 4PLJC 4OZIF 3WS3B 5DD1H 5KSVA 1QKZH 1AGCA 1J1PL 4OCYL 4Y5VB 4M6NL 4DOHB 2N7AA 2GYSA 1A5FH 1IEAA 2PYEB 4JPVL 4ODVL 1A7PL 3Q6FA 4N8CH 1LK3H 3CX5J 2R0LH 3OMZA 2R4RL 3MRHA 2F54D 3P9LA 1QLFB 3FO2B 4ODUB 4S1DC 4YUEL 5FFLA 3EJJX 1MHCA 1YNLL 2ADIB 1EHAA 4X99B 2VLJE 3MYZA 4WTXA 4ZAKB 3U1SL 2OR9L 3T0VA 5D2LF 3ZZ1A 4X9FA 4TOYL 1QLFA 4M1GL 1FNSL 4D9LH 4LRIA 1X7QB 3MRMB 3EYQD 4K3GA 3C9NB 4PJFA 3D39D 5JPMA 4PJAE 5ACZB 3AROA 3BW9A 1HHIB 5FB8B 3MX0A 3SKMB 4JFQB 2C5DC 3OG4B 4KRPB 1NH6A 3B9KA 4G8EB 4G9FB 4QKXB 4LLQA 1JGLH 2DMCA 5E4IA 3W0WA 5LCVH 5E99L 2Q87A 4UUJB 5HDQL 1UM6H 4GKOA 2CK0L 5J6GB 3PDOB 1N0XL 1REIA 4J6RL 2GSGA 2EECA 5CIPA 3L1OH 1ZT4B 3QQ3B 5JW5B 3DUSB 4ODHH 3OKKA 4TOYH 2BOBB 3WNLA 3JWOC 5FO7A 2NY3D 4DTGH 2LTQB 3P4MB 2FHBA 3JWOH 5EUOE 1MQ8A 3IU4H 4JKMA 1JZ5A 2Q3AA 1ZLVH 3QJFB 1I8LA 3NCYP 3ZHDA 1A1OA 4NQCA 3ZE0F 5IVXE 5KVEH 4YR6A 4M1GH 3MCLH 3QBTB 3C8KB 3SGDH 2XACC