5F8QC

Blood group antigen binding adhesin baba of helicobacter pylori strain s831 in complex with nanobody nb-er19
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Cell adhesion
total genus 27
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f8qC00
1N3NB 5MEOB 3P77A 4BH7A 1ED3B 2IADB 1U91B 4XWOD 5I74C 1RHFA 3ZHDA 5C0CB 2XN9B 3ALPA 3HHRB 5TH2B 1CFTA 1NBQA 3SDCD 3VD5A 1BOYA 2EZ0D 3AXLB 2H6PB 5DFVC 5C09E 4J2XA 3PGCA 5KJRH 2ZOLB 1U3HB 3KWWB 3O41A 3E3QC 2GUOB 1AE6L 3SE9L 3CDGB 1BP3B 5F70A 4LLYA 3MJGX 1YMMB 4WUKL 3EO0A 4MXQC 4F8QA 1OVZA 5BJTA 3MJ7A 4WTZA 3OGCA 2APTA 2IBGA 4HKJA 3QUZC 4O02H 5E8DL 3MV8A 1DFBL 4MCYA 5I0ZA 2DLFH 4FQQA 4CMHB 3ARGC 4J6RH 5SX5K 1HHHA 1BIIA 2A6DA 5C0BB 3UZVB 2DLEA 3L5IA 5HYJA 5JPMB 2VRAA 3OKOB 3SBWC 1Q1JH 4QHNB 3S96B 4OGAC 3TESA 1FLTX 4X0KA 1GL4B 3IDIA 1L7TL 3NIGF 4HC1H 4HZLB 2VSCA 4J3XA 2VWEE 4HWZA 3ULUF 4NPYA 4YZFE 4XTRD 2WWMC 1WWAX 2BVTA 3SKOA 2R1XA 4GAYB 1IZJA 2NX5E 1P53A 1LEGA 4MDJA 2YD4A 1FPTL 4LSPL 2NR6D 2MQ0A 4PLOB 4Y19E 3VCLA 1V7NH 5ISZA 4FFYL 5E5MA 1K2DA 3QRFM 2P8LB 4GW4B 2DM7A 3O2DA 1C16B 3QSKB 1GGIH 3QP3A 2YR3A 2ZCKL 1UWGH 2OMNA 5D70H 3P0VL 4ZUTA 1J8KA 1XGQA 3CXDL 1S5IH 5ESAA 3X13B 1GHFL 3WNPA 1T1XA 3LEVL 4TVPL 4GQ9H 1ITBB 1CFVH 5K33A 5D6DC 5K93A 4GLRH 3MJ9H 2PNDA 4NUGL 4JANB 4X7TA 4UV4H 3TN0D 3DTXA 2KL6A 4FQIL 3DYPA 1MFBH 4X9HA 4EDXB 3PWPB 4C57C 4BFIB 4I48A 4PG9A 1QSFA 2X41A 5DJ8A 3DO7B 4Q2ZA 1B4JH 3MRFA 1NCCH 1G6RB 1D6EB 1QRNE 3K8LA 4N9GB 3VXRD 3KLHC 3IDGA 5EZOH 1BZ9B 2NY3B 2FX7L 5IB1A 2CKBB 5D9SB 3PQYD 2YD3A 4O00A 3VG9C 5C9JA 1LWRA 1EGJA 2COQA 1ZA6B 5JUEH 2XWJB 1RV6X 4M5ZH 1CXLA 3MC0A 1R3IH 4NM8H 5KVGH 1RY7B 2DJ4A 3CH1A 5AZ2L 2EYSB 4HG4K 1ADQL 1G84A 4HS3B 1H5BC 4XPBL 2NZ9D 1D5XB 2R0KH 2R23B 4YNYB 5DURD 4KROC 5DHVA 3V7AG 5FYJE 5D1XB 4Q74A 4OLWH 4O5LL 5TQ2L 1S7SB 4WU7B 1OTTD 4OZHA 3NAAL 1BOGA 2WBWB 3QULA 3QQ9C 3OQ3B 3BH9B 4KKAC 2DKUA 2DB8A 1QBAA 4LEXL 3QAZB 1NFDA 5MEQB 4HPYH 3K1DA 2XNAB 5MENA 3MA9L 5TE7L 4F9PC 3HZYA 4Z6AT 2ZUSA 3UJJL 2FX8H 5BQ7B 5F3HA 2CDGA 4XX1E 5I8KH 3I75A 4KHXH 4X6DE 3VGAB 2Z8SA 3IFLH 3GGWB 1D6VH 2V7HB 3M17B 3P73B 4LLUB 4DEPB 4YHYC 5LGHH 4ONFL 3BD3A 3ZDYF 3EZJB 1QG3A 1ZT1B 3CK0L 4HSQA 4X6CF 2D03L 4H8WC 5AWNL 5HGAA 1A6TA 3ZL4L 5FIEA 4ELMB 3VE0A 1F5WA 4YBQD 4LSVL 2YD2A 1N8ZA 5IF0A 4GS7B 1XF4B 4DKEL 5I15L 5CILH 3D1MC 4Y5YC 4NQCB 7CGTA 3G5VB 5HY9A 1X9QA 2DQFA 3VMPA 5I9QB 4H8WL 1KN2H 3BZDA 1J11A 4NCC1 1M7DB 4LCWE 2O26U 5ESQA 4OM1H 3SHSA 4G8GB 2WV3A 3JWDL 4UAOB 4JY5L 3D3VE 1CG9B 3VW3H 1MHPL 3C60C 3BFOA 1PLGH 2FZ3B 1BD2E 1UWXK 5T1LD 4YXHH 1KPRA 2OP4H 1BVKB 4U7KA 4Z7OE 4U1HA 5E2VH 1S7UB 2F74A 2PYEE 5C7XL 5K9QG 4LGSB 4ZFZB 4XC1H 1HSAB 3T1WA 1X6LA 1XGYH 1KEGL 3GJFH 1CGSH 2FL5A 4C59B 2GCYA 1WBXB 3KYAA 3OBAA 2CUHA 1BJMA 1IC4H 1XGPB 3MTRA 2F15A 4F37K 1YMHA 4HCRL 4OZFG 1OTUC 1QR1B 1RIVL 5I17A 4AENA 2GTWB 5ERWA 3UCRA 5E6IA 1KT2A 5E8OB 1AXTL 2B4CC 3WMSA 2WM0A 1G1CA 3EFDL 1RQ5A 3RWDB 1DLHB 4KK8D 5DMKA 2X1QA 4L4VA 2UZIH 1NGPH 1QLEH 3UTZB 4LVOB 3KLAA 1LK3H 1QFWM 3U48A 2WLYA 3F5WB 3JTSB 3QQ9D 2ESVE 3PJSA 5DD6A 1W0VA 5C08E 2B4CL 4HUMB 3TBYB 2DN7A 5BZWB 4NKDA 1YA5A 4UINH 5IFHL 5EU4A 4LMQI 1BX2A 3MNWA 5CP3H 1MCRA 4P2OD 3SJVA 1L7IH 4OIAA 1NFIB 3HZVA 5C71A 5I66A 3UX9B 4LMQE 4HUWA 5J7CC 3IXAB 4OCWH 2XWTB 2F53A 3EAKA 4RSVA 3QUKA 5L0QC 4J4PD 4KJYB 1S7WA 1W72B 5C07E 4FFZL 3HUJB 1KLUB 4FQXD 1BQUA 4ZFOA 1VEOA 5D7LA 1VGKB 5HVHC 3NCCB 3BP6B 1A9BA 3BO8A 4XMPL 5DJCB 5DT1L 2PTTA 5FHBH 3IETA 3FB6A 3QXDA 1KLGB 5HDQL 4P4KB 1NEZG 3LIZL 1JMZA 4JM2A 2QBWA 2B20A 3HMXH 3VFPB 3OAUL 1T1WA 1MRFL 1YEGL 3QEHA 2GK2A 5IB5B 1LEKA 5I1CH 3STLB 3CU1A 4RMUA 3QNYA 1RJLA 4MXWL 4M7KL 3LN4A 2WANA 4HWEL 1XGRB 5IHZB 1DQDH 1X7QA 3GRWA 3ILPB 2ILLA 3BT2H 3A67H 3DVNB 3MCKA 5MEPB 4PGCA 1H3VA 1AJ7L 2X10A 4P2YA 2B1AL 2FSEB 2ZUWA 5D1ZB 2FLBT 12E8H 3DX7A 2CLZB 4GKSB 1IAOB 4PJ5E 4OQ1A 3WXVH 2HJLB 4YGAB 2YRZA 2Y5EA 5EU6D 2VDPL 3HE6D 3O11A 1QKZL 4PY7A 5CZXC 1CYGA 1IEBA 1FIEA 3RA7H 1ZS8B 1QYGH 4F2MB 1F8TL 1XH3A 2X4OB 3MLTA 1IT9L 3RNQB 4I0PD 3O3UN 5CJ8A 3RVVC 3V0VA 1M7IB 2X5PA 4OLXH 2Q7YA 1H0DA 2BXZA 5F6IB 3OZ9L 1AY1H 3QFJA 4PJCA 3QIUD 1MCFA 2CPCA 2NY4B 5SWSA 4OD1L 3MRDA 1G7JA 2I9LA 1ZANL 3HZMB 4G3YH 5IB4A 5CIPB 3VI3E 1DVFD 3TZVA 3D85B 2IBBA 4GMTH 4WJ5A 3QQ3B 4NQDD 3D0VA 4S1RL 1K85A 4N0CD 5L88H 3QA3A 1FL6A 5DUBB 2W65B 3QUYA 1CE1L 4NKOB 3STZB 4EEEA 5IFJB 5EU7E 2QQNL 1U93A 3HRZA 4WY7H 2P5WE 4MAYA 5F7UA 3ZKNC 5L7XL 2FHBA 4F9LC 3QEQE 5CJBA 3HNTH 1B2WH 4UBDC 4EN3C 2VLKA 3ARDC 3K80A 4JFED 5EOCH 1T80A 4JRYB 5FO9A 1IGTA 4MDIA 3I9GL 1JHTA 3PHOB 3ZKXC 4Y5VC 4LVEA 5E6YA 3V52H 1X5IA 1IKFH 3QBTB 1HQRA 3EJZC 1RU9L 4HXAL 2PR4L 4HWNA 5DEZA 3GMQA 1MJJB 5D7IF 3TO2B 4PP2A 3EJJX 4LASH 1T7YA 3VFGH 3AREB 3WXWL 2FGWH 2A83B 4JRXE 4UT7H 1HE7A 4JREC 5KANI 5CEXB 4WGVB 5EWIH 3MZGB 5JW3L 3CFBA 1T89A 5B39B 1AGEB 5EZJA 4OUUA 1PQZB 1T7XA 1FDLH 2Z8RA 3T4YA 1AO7D 5L2KE 2ADFH 5I76A 2BSRB 4KI5E 4OF0A 3KJ4B 4ZPTA 3BPCA 1MI5E 1KN4L 3ZKMD 4GG6E 4KV5E 3NABL 3HZKA 2XICA 4CNIB 2OTUA 1ACZA 1A7BA 2MWCA 2C1PB 4XRCA 2CR3A 4KHTH 3PIQB 4HF5L 3RWIA 2ZCLH 4JDTH 4Y4KC 3DRTB 1T04A 1JFQL 4ETQA 5C92A 1OCWH 5C6TH 3P4NB 5IR1A 4Y16C 4FFWC 1EAJA 2R69L 2J88L 2ZZUT 4OFYA 1OPGH 3WO3B 4OZFH 3EOAB 3QQNA 4WFFD 3CSYA 1IVLA 5KSUB 2MHAA 3H9ZA 3QCUH 5H37H 4DFHA 1GCFA 1F02I 1HHJB 1Q9WB 1XFPA 4ZNEE 2M26A 3WUWG 4O02L 2CDFB 3RTQD 3WFHB 3K4DA 4RAUB 2FGZA 1NL0H 4HIJB 4POZC 1FNFA 1N3NA 5D7SL 5BV7B 5MEOA 1ED3A 2OL3H 2IADA 1WCQA 4J6RL 4P3DB 1J86A 1U91A 4OLYH 5C0CA 2XN9A 2HA1A 2BMKB 5TH2A 4Y7MA 1AHWA 4R26L 3U83A 1BQLL 3AXLA 2H6PA 4G5ZH 2CIKB 3GJFK 4IMKC 5L6YL 4R2GD 3O4OC 1A3RL 2ZOLA 4HC1L 3U4BH 1U3HA 3KWWA 5D2NC 3THML 2GUOA 3C87A 1WWWX 1UB5B 4PB0H 5C09B 3CDGA 1JYWA 5CINH 5DEGB 1YMMA 2XI9A 3X3GH 4MB3A 5B8CB 3BGFC 4JFDD 4HEPG 5HI3D 4LPTA 3BAEH 2DI8A 4HQQL 1JN6B 2EDOA 4KRPB 3VFSB 2EDEA 4MLIA 1JZ2A 1V7NL 4GSDH 1WZKA 3P0YL 3WLBB 5ICZB 2X7LB 4HK0B 1YNLL 3VXUB 2R2CA 5C0BA 4PY8J 1OP5H 5JPMA 1KCKA 3OKOA 2M8XA 4QHNA 2EDJA 4QHMB 3S96A 1UWGL 3B2UD 3QDJB 5I8OL 2NXZC 4HZLA 3WIIH 2YK1L 1S5IL 3GO1H 1CFVL 4GOSA 5E4IA 4GAYA 4UV4L 3KLSA 5MERB 3QJHB 4YDLC 4ZQKB 1OAZH 1B4JL 4RZCB 1NCCL 2NX5B 1C1EL 2Y7QB 1VFMA 3SE8L 3RHWK 4LP5A 5EZOL 2MSPA 4NCDA 3DGCR 3HC4H 1BBDH 4AH2B 1C5CL 1RZJH 1A47A 2P8LA 2YPLE 1EJOL 3QDMB 4GW4A 1C16A 4OSUL 2CXGA 3DXAE 4YBHA 5I16B 1V3LA 4LVHC 1CIDA 4M5ZL 4RCAA 4I5BB 1QFWI 3HCVB 3TVMB 1ES0B 2DQIL 3OL2A 1OAQH 5IM7B 4TULH 3HG1D 3X13A 1WCBA 3C6LC 1MCBA 1Z9MA 1OW0C 3RDTD 4S2SB 5EUOB 4JANA 4JKWA 3V8OA 4Z7UF 2MCPL 4UTBH 3ULVE 4EDXA 3PWPA 5DD1H 2Z91B 4LCIL 4BFIA 3DO7A 1LE5B 3UO1L 1G6RA 4K94H 3O6FD 2XQBH 1D6EA 5K9KB 4BH8B 5DZOA 4N9GA 1FNEB 1HWGB 1BZ9A 1JIBA 2CKBA 5JW5B 2W9DH 3WIHH 5D9SA 1KXQE 2BFVH 5D5MF 5DRXB 4Z95H 5B21A 1MQKH 4EI5C 5JZ7D 1QRNB 4ZS7H 4NBXB 1AD9B 3H9YA 1ZA6A 2FX8L 3TM6A 2XWJA 5KSAD 5I8KL 3IFLL 1D6VL 4AEEA 2EYSA 2CMRH 1F4YH 4HS3A 2FH6A 3B5GA 4D8PB 3QXUA 1D5XA 3UYOD 1CDCA 2R23A 3MV9D 4P49A 1BZ7B 4YNYA 3PWNB 3UJIL 4B7IA 2XYCA 3D39B 5D1XA 5IJVB 2OTPA 1S7SA 4WU7A 5J89A 5E70A 1RVFH 2WBJB 2XT1B 3R0MA 5CILL 4JG0H 1UZ6E 2EDBA 5EOQH 3INUL 1RAMA 1MCEA 3BH9A 4ODVH 5FYLH 3RGVD 3U7YH 1HSBB 1F3DJ 1OWWA 1SY6H 1JYNA 5MEQA 3FN0L 4OM1L 1MNUL 1I3VA 2XNAA 1HCFX 2ITCB 3SDXF 5JHDD 1NBYB 4PJAB 4O58H 3QCVH 5BQ7A 3VW3L 3BDYL 3MLVH 1PLGL 4LLUA 1F2QA 2V7HA 3GGWA 3M17A 1PVHA 3P73A 2IEPA 4HKXB 2OP4L 4NN7C 4QTHB 3S36H 1ZT1A 4HMDA 4XCCH 4FABH 4X6DB 1T4KB 3CAFA 4ELMA 3C2AH 3B43A 5D7JC 1CGSL 1XF4A 3R06B 4XVUC 4IEFB 2P5ED 3PP4H 4N0FB 3HR6A 2W91A 1IC4L 5F7KC 4NQCA 3G5VA 2NY1D 2VZ1A 5FM4A 2AEQL 2HFTA 1R3JB 4UDTB 4PJBB 4R4BB 4MAUH 1M7DA 4Z76B 2YD5A 4PRPD 1EX0A 5D71H 3CX2A 4G8GA 4X7CC 1CG9A 3IS1X 3T3ME 4L8CB 4KMTL 3SGDI 5GZOD 1G7MB 2FZ3A 2J6EH 2YSSB 1LK3L 1KTDB 1MQ8A 3RAJH 1BVKA 3TIDB 4MNGE 1WIPA 1S7UA 4MWFB 1SM3H 5EN2B 5E99H 2C4XA 4HWBA 5JTWA 3UTSE 1MREL 4R4FL 4ZFZA 1RZIB 1HSAA 4ESKA 4CVXB 3R1GH 3PWJB 2E3VA 3HE7C 4WI3A 1DQTA 2W0KA 1WBXA 5AG9A 2GK0B 4BQCA 1XGPA 4KKLD 4OCWL 4XP9H 3TWCL 3GIVB 1QR1A 3EUUA 4KTEH 4WI4A 2W59A 2GTWA 3HAEH 3QHTC 5E8OA 1N5YL 4P2CG 1T6VN 2Z92B 3TBWB 1ZMYA 1OL0A 3RWDA 2J8HA 1TETH 1DLHA 4NQSB 4QTIH 3VFTB 5FHBL 5F72S 2NY2D 3UTZA 2HWZL 4FA8A 3MFGB 3ME0A 3N1MC 3DV4B 3F5WA 3JTSA 6FABH 2J12B 3SE3A 3TJHC 1K8IB 5I1CL 2ATPB 5GGTA 3QNXB 3TBYA 3TZVC 5BZWA 3U1SL 1CFSB 4QRRE 1OSPH 2ESVB 2SEBB 1PKQE 4FXGB 4YHLL 1TJGH 4E9LA 1DQDL 4HW6A 1LDPH 1CWVA 1GGCH 5E9DE 1NFIA 2QQKH 4FQPA 4D9QE 2GJ6E 1BGXH 3IXAA 2XWTA 1OWRM 5I18H 1A6WH 4KJYA 2NMSA 12E8L 1W72A 3VJ6B 4P23C 4U49A 2E7BA 5FKAB 3VXTB 3WXVL 3HUJA 1KLUA 3VFWB 1IGIL 3S3SA 2EE2A 2DTSA 1VGKA 1RULH 3BP6A 1RD6A 2F54B 4LGPB 4K3EH 5DJCA 3RA7L 1KLGA 1QYGL 4P4KA 3IKCB 3UDWA 3QUYD 5D7KD 3VFPA 5TDOB 5IB5A 1DP0A 3STLA 4F7EB 4P2QD 5JW4Q 3O8XC 4HG4J 1MRCL 1P9MA 4I3RH 4TRPH 1ZVYA 1XGRA 1P6AB 2VLRE 4P5TC 4EQ2A 5IHZA 3K0WA 3ILPA 1TZHB 3W81A 4AEHL 1A6PA 1CLCA 1W0WB 2R2BB 3DVNA 5MEPA 3MRPB 5CGYC 5F7EH 3ZYOA 3LRHA 4XX1G 3MOBH 2DLIA 2FSEA 3QZWG 5D1ZA 2CLZA 3G6JF 4GKSA 4Z0XB 1IAOA 5LBSH 3PDGA 1OP5K 2HJLA 4UOJA 5GISL 4LBEB 5L88L 1JTTA 4PJ5B 3SO3B 1NCBH 1ZS8A 3PABB 4F2MA 1IEHA 2X4OA 3MROB 1H3XA 3RNQA 5E4EB 5HPMB 4WHTB 1G9NL 1RUKL 5J3HC 4AMKH 4JHAH 3UEZA 3HFML 3QG7L 4WFHE 3MUY1 1M7IA 3VRJB 3MCLL 3MJ6A 5E56A 5EOCL 4K3DH 5GRXG 4O4YH 5T5NG 3NGBC 3MBEC 3HZMA 5D1QB 5FGBC 1MPAL 3BP5B 2LAAA 2CO7B 3L3IB 2NXYB 2VH5H 5CIPA 3D85A 2WWKO 2CUMA 3QQ3A 5C2BL 1IKFL 2HT3D 1UACL 2VABB 5DUBA 3WHE1 2W65A 2OJZL 4NKOA 3STZA 5IFJA 3CFDB 4LASL 4LSRL 5GHWH 5AYQA 2Q86B 3OHXB 2FGWL 1B0GB 5E8NB 5C0AD 2Q1EA 2AXFB 1AGCB 2BHUA 3O81A 4PRIE 5GZND 2P5WB 1FDLL 2ZPKH 2D31B 4JRYA 3L5HA 3O6LH 1U3JA 3QEQB 2EEAA 3V4VH 4P46C 2HH0H 3PHOA 1TVBB 4JY4B 1JRHL 4ZXBD 4Y1AE 2AEIT 5FGRA 1LE9B 3ARVA 1U95B 4N0YL 3QIBD 4P5TD 2HRPL 2ZCLL 2A9NH 4E0RB 1R5WB 1MJJA 1DANU 2Y4SA 4F7TB 4WWKB 3TO2A 3B3IB 5I1HH 2VXQH 3FRUB 1OCWL 3KPRB 1FAIL 3AREA 3VDCA 4NKMB 5GJTH 2A83A 2OI9C 4UZGA 4FMFA 1YQVL 5CEXA 2FRGP 4K7PH 1T2QL 5B39A 5T3ZE 1AGEA 4JRXB 1PQZA 3DUHA 4I18C 1IQDB 3R0NA 4NFBA 1MFAH 1CL7I 5J13B 2BSRA 1JI1A 1CS6A 1YMMD 3BYYA 4HX1B 5L2KB 4CNIA 3DYOA 3SGJC 1NL0L 2BSSB 4DGIL 1MI5B 2C1PA 5GGSY 2PO6D 3PIQA 1EGJH 4HJJH 4NRZB 3DRTA 1J12A 4CMMB 2EXWD 3OKMB 4M7JH 5E2WH 4B53A 1ZT7B 4NFCA 3P4NA 4I3GA 4G5ZL 3RVWD 2R1YB 3AB0B 5DHVH 2DBJA 5F9OH 3O2WH 3EOAA 5FEBA 1NBZB 4I2XE 2W9LA 5JXAL 5CINL 2JK5B 5KSUA 2AJUH 3DHMA 1F45A 5EO1B 1HHJA 1HNFA 1Q9WA 4EVNB 2GJJA 1P4IH 3SCMC 2PXYB 2CDFA 3Q0HA 3WFHA 4RAUA 1RZ7L 5F7FA 4XXDB 4HIJA 1A6UH 2RHEA 3GHBH 4FTVD 3F62A 4P3DA 4GG8B 5I73B 2O93L 1MWAL 4LHQB 1IAIH 1KNOB 2BMKA 4LDLB 4M02A 1BREA 3WFBH 1IQWH 4PS4L 2CIKA 5JDSB 4N1HB 1CDHA 3WIIL 3CD4A 1D9KB 3GO1L 1ACYL 2A77H 1HQ4B 1ZHLB 3BD4A 2NYYC 1UB5A 5C09A 1A1NB 5DEGA 1N64L 4NZTH 1JPGB 1RZJC 5B8CA 2O5XL 3SQBA 1B3JA 1V3JA 1JVKA 3VFSA 1JN6A 4IRSC 3UROR 2X89D 2DLHA 1C7SA 2IFFH 4G6KL 5TF1H 2LV4A 3JTTB 3N9GL 1BBDL 4JQXA 2HKFH 4G8FB 4OLUH 5MP6H 2X7LA 4HK0A 3WLBA 5ICZA 1PGRB 1RURH 3MV7B 4MZ2A 4TSBH 3VXUA 1RZJL 3I6KB 3UMTA 2BOCB 2QADC 5EBWB 4U1LB 2WINB 1KB9K 2A0LC 3AM8A 3GNMH 5BOZG 4QHMA 5DF0A 1EAPB 4UUJB 3QDJA 2OR7A 4P9MH 5C70A 1WITA 4HPOH 4FZEL 4TULL 1ETZB 1OGAB 1R3HB 4K94C 4X80H 3V4PH 5J11B 4F7MB 2CSPA 3S34H 1T22B 1TCRB 2CK0L 3EO1B 1LDSA 1PG7W 4MJIE 2K7PA 5CP7B 4JB9H 5MERA 3QJHA 4ZQKA 4RISH 1X5KA 4OJFH 1I85A 1FIGH 4RZCA 1ZGLM 2HMIC 2RIKA 2NX5A 5DDHB 3RY6C 2Y7QA 4MA8L 1U41A 4X9GA 1JF6A 1ZVSB 2R0WL 1NAMB 4AH2A 2RJMA 4Z95L 1MQKL 3MUGB 1IKNC 1RMFL 3BESR 3WFEH 3QDMA 4CN6A 3OB8A 5I16A 1IM9D 3CSBA 5EDXA 1PG7X 1KCUL 4I5BA 3TVMA 3SCMD 1KCVH 1ES0A 2AXGB 2YPLB 5T3XD 2CMRL 5IM7A 2OK0L 3CSPA 4APQB 2R1WB 1CGXA 2VLJD 2P47B 4C83B 4S2SA 5EUOA 4PJ8D 5FCSH 3E3QE 2Z91A 2MQCA 3RVTC 1OLLA 3SKNB 1LE5A 1MCDA 4G7YL 4PY8I 3T0EC 3MRMB 2CDEB 5K9KA 2IPTL 2YKLH 4BH8A 3SDAB 1FNEA 3KPSE 3T0DA 1RUQH 4ODVL 3KXFD 3U7YL 2XRAL 4HUNB 5JW5A 5DQDH 5DRXA 1GAFH 1D5ZB 5EIVA 1QRNA 4Y4HB 1H15B 4LSDA 1AD9A 1SVCP 4ZTOH 3O0RH 4HD9A 5FECB 3MPCA 3ZYJA 4KUZH 4PB9H 3MLVL 5SWZE 3IT8D 1R3KB 4MZ3A 2KH2B 1PY4A 3HI5H 3DOSA 1BPVA 2I5YL 4FQHB 1NDGB 4D8PA 4RFOL 5DJZB 4S1DC 4FABL 3L3KB 4CU6A 5IHLB 3PWNA 4GFTB 3C2SA 3CDCA 1A64A 3OF6A 3D39A 4LSUH 4KQ3L 4NNXB 5IJVA 3BKCH 3PP4L 1QHPA 3F7YB 2WBJA 2A1WL 3BVNB 5HHOD 3T0VA 1UEMA 3TO4B 5JQHC 1WIOA 5AAWA 3WNLA 3ZE1F 2PW2B 2W0PA 2R56L 2Z31B 3DMMC 5IQ7L 4DN3L 3SDDB 1HSBA 4Y5XC 4R0LB 4YX2L 1H3PH 1DBBH 1X4ZA 5D71L 4XNUL 4CGTA 1FGNH 3MRJB 4MA7L 2ITCA 5FM5O 5CCKL 1NBYA 1NCTA 4PJAA 4X5LA 4JZOB 3NMEA 4XNYH 3GSNL 4YDJB 4TVPE 4S1QL 2WQ8A 2FEDC 4HKXA 4K71C 3REVB 3U6RB 3KG5A 2KUTA 4QTHA 4QGYA 3HTLX 1EFXD 1Z2KA 5JA9A 4X6DA 5E99L 1T4KA 2DIAA 3SKMB 1R24B 3QXVA 4XPHL 2CJUL 2JTDA 2VB5A 3MLZH 3R1GL 4M4RA 3R06A 3T0BA 4N0FA 5BMFH 3VRIB 1BMGA 3OG6B 4IOFD 3RUGB 3UTTE 3LKQB 4DK6A 4PJ9C 4WFGD 1FE8H 1MF2H 3PWUB 1WVZA 4YHPB 4XP9L 4M93B 1IM3B 1R3JA 4N90D 4UDTA 4XNQB 4UILH 3GHEL 4PJBA 4BSWB 4R4BA 4Z76A 3QCTL 4G6AD 1XAUA 4ZFGH 1CN4A 5FYLD 1DBMH 1TLKA 4YPGB 3DVGB 5C0JB 4KY1H 3CVIL 3BKMH 1JNJA 4PV9B 4L8CA 1A7NH 1INDL 4JN1H 1G7MA 1HYSD 4WO4D 4NCC2 2YSSA 3GSWB 2IAND 3T8XB 1KTDA 5I71B 6FABL 1A2YB 4G80B 3TIDA 4LL9A 2ADIB 4RIRB 5I19H 4MWFA 1TZGH 5EN2A 4ZPVB 3VXOB 4EBQL 1I9EA 1OSPL 1RZIA 2ZUTA 3B5TA 4CVXA 3PWJA 4MNGB 4OGXH 1QSZA 1TJGL 3EFFB 5FB8B 3NIGE 3SPVB 2PYEA 1NC2D 2K7QA 5AZEH 2L7JA 1GGCL 2GK0A 3FKUS 4PFEA 5EBLB 2DKMA 2QQKL 4EOWH 3FMGL 4P2RB 1BGXL 1GGBL 4PRHD 1G0XA 2R15A 5TE6H 3GIVA 5ENWB 1A6WL 1SJEB 3D87B 2DMBA 4J7RA 5T1MB 1I1RA 1A4JB 3S97C 2Z92A 3TBWA 3TCLB 1SMAA 4URTB 4AM0B 3QUXB 4NM4L 1RULL 4NQSA 4YWGH 5HHNB 4K3EL 3VFTA 2UVFA 3QUMH 4OV5B 3WNOA 2P1YA 1CICD 1WFTA 3DV4A 1YNKL 1K8IA 1JPSH 3L95B 2ATPA 3WN5B 3QNXA 2DQCL 2AAVA 2XKNB 5DEFB 5IBTH 3SN6N 1CFSA 1Z9LA 2Z35B 2ESVA 2SEBA 4TRPL 2NW2B 4FXGA 2VO5A 4R97C 3T09A 3V6OA 3IJHB 3D69B 4M43H 1VGEH 1X4YA 3SOBH 5E6ZA 3RVUD 4Y2OA 1PKQB 1WIUA 4X4MA 2P8MB 3MOBL 1MFEH 1DN0B 2OLDA 3MLYH 1EHNA 1I7RB 3VJ6A 1XIWD 5LBSL 5FKAA 3VXTA 1SYVB 3VFWA 3T2OA 4KK5D 2AW2A 3O3EB 2F54A 2VDOH 1ZTXH 4J3WA 5KSBB 2IPUK 2P48B 1NCBL 2W07A 3IKCA 1CGYA 2H2PC 2IH1B 1TFHA 5TDOA 2EH8H 5ADPH 3F12B 3S37X 1JZ8A 2WQRA 4F7EA 4AMKL 2YA2A 4RWYH 5GXBB 1I3GH 3FAWA 4JM4H 3W5MA 1SEQL 3DX6B 3HC0B 4M6MH 4YHML 2PUQT 1TZHA 1W0WA 2R2BA 3ARUA 4Y4FB 3MRPA 3BPLC 4K3DL 3L1OL 3TH4T 1PY9A 1LHZA 4O4YL 3PL6D 5CKAA 3DX8B 1VKXB 3N1PC 3O2VL 4CRPA 4BZYA 2JIXB 4H1LB 4Z0XA 2KKQA 2EE9A 1RZ8B 1BECA 1OT1A 1GIGL 4M4PA 3H7BB 1NMAH 3IFOB 2FD6H 3S6CA 4ENED 3S88L 1L9NA 4LBEA 5E94B 4PJ5A 1IBGH 4WI5A 2I26N 4OZHF 3PABA 4Z7UB 1EVUA 3U82B 3E1F1 3MROA 4E41D 1DUYB 4JJ5B 3KPNB 2Z8WC 5HPMA 4WHTA 1E4KC 3UAJC 2X6MA 1NFDF 5DUMH 5HDLA 2NNAB 3VRJA 5EOCJ 2H3NB 4XAKD 2ZPKL 2MQ3A 3I6GB 3IJSB 3DX9B 3FQUB 3O6LL 2V2WB 4X5XB 3A6CH 4NQDE 1FCGA 2AQ1A 2VXUH 5EOTB 5D1QA 3BP5A 4ZYKB 4QRTB 3L3IA 4HLJA 3GM0A 4JZJB 3FQRB 3O4LE 5LQBH 5C0DB 5C0RH 3O2DL 1BLNB 3QH3B 4G6ML 2VABA 1PDKA 4MQXD 4HBCH 3K7UA 4I3SH 1KCSH 5F1SA 3MXVH 5I1HL 2VXQL 2OZ4H 5BS0B 5I1LB 3CFDA 3QWQB 2VC2H 2Q86A 2KQNA 4U6HB 3OHXA 4OZGF 4WW1B 3VG0H 1B0GA 5E8NA 3UP1A 2YPVH 4XVSL 2AXFA 4XP5H 1AGCA 4WHCA 2P5WA 4LRIA 5C0FB 2FBOJ 2D31A 5CEZH 1BQHB 3QEQA 2YPKB 1NAKL 5KAQF 2R9HD 4JY4A 1TVBA 4MLSA 3HPLB 3BQUB 3WS6A 5DFTA 5HYSG 1MH5B 1LE9A 1U95A 4NQVB 1ZSDB 2WP3O 1EGJL 4HJJL 2IMNA 4QT5B 4E0RA 2ENYA 5HI4C 1R5WA 4F7TA 4WWKA 3B3IA 3FRUA 3B8YA 3KPRA 5E2WL 4BFGA 3LB6C 4NKMA 3EIFA 1F2XK 1AO7E 4UNUA 2X4PB 5F9OL 5LGJB 5TJWK 2GTZB 3B9DA 4JRXA 1IGYB 4R4ND 3QO1B 1IQDA 4L8SC 1AC0A 2NQCA 1LNUA 1G6RH 5BO1H 3I3BA 4PP1D 1P4IL 4HX1A 2NLJB 3SQOH 5AD0B 5IOPB 4ALAL 3ORJA 3B2VH 5L2KA 4GO6B 1AXIB 4LCYB 2BSSA 3BPOB 5IIEB 1MI5A 3GHBL 2VKWA 5EO0B 3TFKD 5HHMD 2E27L 4MB5A 2YWZA 3GBNH 3C08H 4MMZC 2Y5TB 5CGTA 4M48H 4NRZA 3GBMH 5C3TA 4CMMA 4H1LG 3OKMA 2H8PB 1ZT7A 4GMSH 3ARPA 1IQWL 3WFBL 2JJSA 4LF3B 4PJIE 4NC2B 2R1YA 3LPFA 1BVLB 1S78C 2V5SA 1TENA 4HUVB 5T1KD 4JO4L 1DQJB 2A77L 1NBZA 5BRZE 4GAJH 5CLTA 5EPMB 4PLKC 2JK5A 4PUBH 3NCYS 1EEZB 4NZTL 4JM2F 1QFWH 5EO1A 3MGTB 1QLRB 4Q9BA 4BZ2H 4EVNA 2PXYA 4PGEB 5IB3B 4OBRA 4XXDA 5J56B 3EYQC 2IFFL 2ARJB 1EVTC 2G5RA 5TF1L 4OLUL 4PIRF 1FN4B 2NX5D 1UH2A 1MIEL 4GG8A 5F3BB 1JPST 1SJHB 1KNOA 2X42A 4Y19D 3SDCB 5A3IC 3GNML 4OQTH 4NZDA 5JDSA 4S11A 3G6AB 4YBLB 1D9KA 4I0CC 1AQDB 4F33B 3F7QA 2ZUVA 3DECA 1HQ4A 5E6IC 2JJVA 4XMKL 1B0RB 3VH8B 1A1NA 3TBSB 1Y18B 1CFBA 5HI4D 3TA3D 4XCFH 1JPGA 2IH3B 2LTQC 4X98B 3U79A 4TYUA 1GPOH 1I1AD 1F6AB 4YK4B 4DUWA 3ZKQD 3JTTA 3BN9D 4G8FA 4NQUA 5DD0L 1BQHG 2VXSH 3MV7A 3I6KA 4WI6A 3WFEL 2MCG1 2BOCA 5EBWA 5FGCE 5I1EH 5I2IB 4PJCF 2WINA 4U1LA 1QRND 4OFKA 1IGJB 3RVXD 2F19L 4U3XA 1EAPA 4UUJA 1KCVL 2P24B 1H8NA 3VFUB 1NDMB 1CXIA 2Y36H 2IAMC 4MCZB 1ETZA 1OGAA 1R3HA 1U8LB 4F7MA 3G6JB 3MLXH 4MQ7B 3QI9D 5DMGD 3LMJH 1T22A 1TCRA 4NQXB 3EO1A 1FORL 2Q20A 3CLEL 5CP7A 2BRRH 3MACH 1I75A 1P69B 4JM2C 3O45B 1TQCB 4U1GB 2R0LH 3LN5B 3B9VA 2WBJD 2RBLA 4OM0H 5DDHA 2AXJA 4ZFOL 5M7QA 1ZVSA 1G9MH 1NAMA 5T1DL 5DQDL 2J4WL 2Q7NA 3MUGA 4RRPG 2R39A 1AP2B 4ODUB 5FUCC 4ODTH 3TCXA 2X2YA 1J1OH 4ZTOL 3S8WA 3SKUD 1RZKL 5GGTH 2AXGA 2YPLA 3HI5L 5FGSA 1E4XH 1Z5LB 4APQA 3BN3B 2R1WA 1GGUA 2VITB 2DRUA 3NACL 4PJGE 5D7IE 5IB2B 5AEAA 4NNYB 3GRWL 3CGTA 2DQHL 4C83A 1VCAA 5K9JH 5ADOH 4ODHL 3SGDH 1PJ9A 1WT5A 3SKNA 1WQVT 2AJZB 1ZWIB 1FNSL 1W72H 4IOSD 3MRMA 2CDEA 2BVEA 2JB5H 3T4AB 1C5DB 3SDAA 5EG6C 1AKJD 4KPHH 4ZDHB 2F8XC 1H3PL 4H88H 4QWWD 4Q9RH 2B1HH 1DQQB 1D5ZA 1FGNL 3KNBB 4Y4HA 4M61B 1H15A 3RPKA 2RR3A 3KPSB 4GLRI 5FECA 5JXEC 4XNYL 1X5GA 3MREB 4RGNC 1R3KA 3ZHLA 1RHHB 4U0QB 4LCWD 1TPXC 2OR9H 3SDYL 1T83A 1ZHKB 4JAMB 4FQHA 1MHEB 1NDGA 5DJZA 5DURB 3D3VD 2RGSA 3L3KA 5SWZB 35C8L 4R90L 4U6VH 1WV7T 4FQJH 4A6YH 3Q6GH 4KTYA 1BD2D 1ZEAH 3MLZL 4NNXA 5DO2C 3DSFL 4HIIB 3P30L 3RBGA 1P5VA 3F7YA 3BVNA 4GW1B 3TO4A 1FE8L 2BZDA 1LO4H 1MAMH 2PYED 5HDBF 5FYKL 5SX4H 2PW2A 4M7LH 3TH2T 2Z31A 1JTOA 4M62H 5EIQA 1MJUL 4MAYC 4UILL 3SDDA 5JORB 4Z7NE 3SGKA 4R0LA 3FQNB 4RX4A 4ZFGL 3N1GC 1DBML 3MRJA 3QHZL 4HFUH 3V5KB 1IGFL 3ZKSD 1K6QH 4KY1L 4XPGH 4JZOA 1JZ6A 4NKIH 2E7HA 4YDJA 3GMLB 2P46B 3U6RA 3REVA 1I1CA 2QHRH 5HXMA 1A1MB 1I9JH 1TZGL 3MLWH 3SKMA 3RWJB 3RRQA 4HJ0C 5B38B 5JR1L 1R24A 4OGXL 4DKFH 3VRIA 2ESVD 3NIFE 3RUGA 3LKQA 5C08D 1X44A 5IFAL 4J23A 4EOWL 4U0RC 1U42A 3PWUA 4YHPA 4YLQT 1PBYA 4IRJC 4ZUUB 3V0WH 1J0YA 1IM3A 3UTTB 4XNQA 2XA3A 4BSWA 3WDHA 2AGJL 2H1PH 4DCQB 1T89C 3JSSA 4YPGA 3DVGA 2VXTH 4YWGL 5C0JA 2AJSL 5T1LB 4PV9A 2ZSWB 2QSVA 3GSWA 4PJ7E 1H3UA 4G6JH 3T8XA 5C07D 1A2YA 4G80A 3S98A 4LPXA 5F9AC 4LLAA 1KB9J 2ADIA 2OJEB 4GW5A 4RIRA 1I9RL 4ZPVA 3CVHH 3VXOA 5GS3A 1RIUH 3VG9B 2IALB 4MNGA 5MI0B 1FFRA 2J8UF 3EFFA 3VXME 3SPVA 5FB8A 2X1OA 4JO1H 2XTJC 3MRGB 3IVKB 4ISVB 2HT4C 5EBLA 5JDJA 1F4WL 3K2MC 1DJSA 1EMTH 1M71B 4P2RA 4RMQA 1N6VA 4M6NL 5ENWA 1N2RB 4GQPH 1SJEA 2WNGA 2EYRB 5T1MA 1A4JA 3TCLA 4OCNC 15C8L 4D2NA 4AM0A 3QUXA 4U1SB 2Q87A 5GSRB 3CX5K 5HHNA 2VDOL 1ZTXL 3NPZB 4OV5A 5J57B 5GQBA 4ZOAA 1JZ3A 1NH6A 2X44D 4W6XB 5ADPL 3WE6B 3L95A 1VHPA 1A14L 5F96H 3WN5A 2XKNA 5EBMB 5DEFA 4RWYL 2HTKC 3LQZB 2Z35A 2NW2A 4JM4L 4X4ZA 3ARFD 3G5ZB 4M6ML 1R5VB 5CEYB 3IJHA 1VACB 3D69A 5LVEA 3S36X 3UTOA 4M8VA 4U3CA 5DA0B 1PKQA 1DE4B 3IJYB 1HN1A 2P8MA 4K7PY 5DJAB 1DN0A 1KEMH 1A6VH 4KWUA 1I7RA 2VQ1B 2UY6A 3QEGH 2VDKL 1U3HC 5GGVH 1EK3A 1SYVA 2VISB 2FD6L 3VGHA 1A6AB 4L5FL 3O3EA 2WW8A 1CDGA 2J8OA 2VDRL 3MODL 5KSBA 1JL8A 4Y5YB 5TQ0L 4HH9B 2X1WL 3KPQB 4X83A 4KRLB 2IH1A 4NHCH 3VGDA 3JV0A 2D0GA 3F12A 2L4OA 4O51B 4XPTL 1RIHL 5KBNC 1FL5B 2IC2A 5F6HJ 1N0XH 2AK1H 5IESH 3CNKA 3P9WB 5DUML 4N68A 3DX6A 3HC0A 4B50A 1Q0XH 4Y4FA 4FN0A 2P5WD 1TITA 3A6CL 3JUYA 1U2HA 3EJYC 1CVRA 2L7UA 1VKXA 3DX8A 3O3AB 1FGVL 5B38G 1II4E 3QEQD 3QNZB 5BV7H 2ED7A 5KS9B 4MJ4A 3ES6B 2JIXA 4H1LA 4YR6B 1RZ8A 5EU6B 3H7BA 25C8L 3IFOA 3C9NB 5HHXH 5C0RL 1G7LB 1IC1A 5IVZB 4LIQL 4MQTB 1MHHB 5E94A 5C2UB 2BJMH 4HBCL 3OJ2C 4Z7UA 4JPIB 4YEFA 2YS4A 4I0PB 1DUYA 1SJXA 4JJ5A 3KPNA 2GSGB 3SDXE 1KSRA 2I27N 4DZBB 4WWKD 4PLNC 1YC7A 4U33A 3VG0L 3V2AR 1NGQL 5CD5D 3PGFH 5T5FH 1QFHA 5LWYL 4XP5L 2IFGA 1C8PA 2NNAA 3B6SB 1KV3A 2H3NA 4MJ2A 1WEJH 3QIUB 1INEL 3I6GA 3IJSA 1A9EB 3DX9A 3FQUA 2Y23A 2V2WA 4X5XA 5CEZL 1RFDL 4X5WB 3MFFB 4XP4H 5EOTA 4F57L 4ZYKA 4QRTA 1DVFB 1Q0YH 3RY4A 1G0DA 1UM6H 2DKSA 4NQED 2A73B 2BERA 2XZZA 3CZJA 2YBRB 3FQRA 4JZJA 4NQDB 4ELMF 2DQUH 2G2RB 5L2KD 5C0DA 3HC3L 3T2NL 4KI5D 1BLNA 4WWID 1P7QD 1U8HB 2OCFD 4XNZB 3QH3A 3RPIB 3FAXA 5HPOA 3UBXI 5IT2L 2MMXA 3GSOB 2WSKA 3O4LB 4L8DB 1TQBB 1A6ZB 5I1LA 5BS0A 1AQKL 2BNRE 4U6HA 1XGUB 4WW1A 3MOAL 1O0VA 2GY7B 4JEGB 5HVHB 2NY3C 4YHNB 1MCSA 3Q1SL 1MJ8L 4M7LT 2DLTA 4JFEB 4OTXL 4CDGC 3BDBA 3GI8L 1W2KT 5C0FA 3H9SE 3LEXB 1U6AH 2ZCHL 4H0GA 2DM2A 2XOTA 1PD6A 2VZSA 1BQHA 3B83A 1KBGH 5DVMA 1G6RL 2YPKA 5BO1L 4ODBD 3IF1B 4PG2A 5E8EB 2XZQL 3HPLA 3BQUA 3B2VL 2CKBL 1GH7A 1MH5A 1FG9C 3MRNB 4OGZA 1D5IL 2PXYD 4UNTA 1JF5A 1A02N 4NQVA 1ZSDA 3WHXB 5L8KB 4QT5A 1UG9A 3C08L 4NO0D 4PJDE 5DJYB 3EDEA 4PBVC 4M48L 43C9B 1IARB 1EIBA 3QXWA 1CCZA 3GK8H 5CUSL 1ZGLB 3VFNB 1NJ9B 1KJ2B 4GMSL 3GKWH 4DGVL 3W11D 3E6HB 3BP4B 1LO2H 1ZKAA 4OZIB 2Y9RT 2X4PA 3MOQA 5LGJA 2GTZA 5DMIH 4WW2F 1AO7B 3QXAB 3S4SB 4OCMC 1IGYA 4G9FE 3QO1A 3M8OH 4PUBL 3L3DB 4XVTL 1WK0A 1OAUH 3MQIA 4DEPC 2NLJA 3AUVA 5IOPA 5AD0A 3K81A 3QG6B 4LCYA 5IIEA 2PETA 3H42L 5E1HB 5EO0A 1T66D 1B4RA 1MAJA 2Y07H 1OTSC 2Y5TA 2HLFC 3QPQC 3KS0H 1ZK9A 1MLBB 1S5HB 2A38A 4PGZA 2D7TH 2H8PA 5I9QC 4LF3A 3I6LE 4EIZC 1Z3GH 1BVLA 4X0KB 4HUVA 3RIAK 3HUJF 3DYMA 5DC0A 1DQJA 2NTSP 1LD9B 4PJIB 2XXMB 4C4KT 4U7SA 4UAOC 5EPMA 1EEZA 4XCFL 5EUKB 4WUKH 5DRWB 3K4ZA 3MGTA 1QLRA 3RTQB 4QY8B 4PGEA 4TTDC 5F88A 4CVUA 1S9KC 1PEWA 2KBGA 2ARJA 3B4NA 5I6XC 4LSTH 3MRHB 3AS3A 4IM8A 3ARDB 1FN4A 3SE4A 1WAAE 4FZ8H 3NFNB 4QOKD 2PYFB 5F3BA 1PZ5B 2I9TB 5I1EL 2AI0L 1SJHA 1O5DT 2C5DC 3SDCA 3MLUH 3VXPB 1YNTB 4KXZH 4JFFD 3ZKXB 4Y5VB 4RAHA 3IDMB 4HWBL 4Z7QE 1J05B 1FC1A 2Y36L 3G6AA 1ND0B 1AQDA 3QIWD 4F33A 5JMRA 4WU5B 3DXAD 3MLXL 2FEEI 2P44B 1B0RA 3VH8A 3LMJL 4KK9C 1G9MC 2XWBB 3TBSA 1Y18A 3FHAA 2DI7A 4JFDB 2IH3A 2HN7B 2BRRL 3MACL 4U05A 4RQQB 5HVGB 4LVOC 4X98A 1BAFH 3FQXB 1S9WB 1FPTH 4K7PX 1CGVA 1F6AA 3SE3C 2OX5A 2XV6B 4OM0L 3B9EA 5F97E 1TIUA 1G9ML 4XI5C 4RMSA 3ULVD 2BVUA 3FTGB 4PJXE 1NUDA 3G5XB 5H94B 2AK4E 5I2IA 2EYTB 4ODTL 2GYSA 1J1OL 1NEUA 1H3TA 1IGJA 2FR4B 2IQAB 4KMQA 5GGTL 5FGCB 2P24A 2EDFA 4PJEF 2BHYA 1NDMA 1E4XL 3VFUA 4EUPG 2ICWI 4MCZA 3CXDH 4J3UA 1U8LA 1WFUA 3PXJA 3G6JA 4MQ7A 3VXNB 2QLVB 4NQXA 5K9JL 5GS2H 1PX3A 4NHUB 4NQTA 4NN6B 4P4KC 1WBZB 2DS4A 3O45A 4D0BB 3LN5A 3DETC 1W72L 3OKNB 2LU7A 5J6GB 2DLGA 4HULB 2Z31D 2DQGL 2FX7H 1IAKB 3OAZH 4Q9RL 2A6KB 5ITFB 1AP2A 4ODUA 5HGHB 2FYYB 1UJ3B 2VLJE 2CO6B 3E0GA 1K4CB 2ENSA 2OR9L 3HG1B 1P6FA 4QEGA 1OGTB 5D1ZC 1Z5LA 3RDTB 4XPBH 2VITA 5IB2A 4I0KA 3WEXB 4NNYA 3MRCB 4FQJL 3Q6GL 5F7DB 4K8RD 3QDGE 3RWFB 3LAFA 4PJGB 5TPWH 4IJ3C 4NO3B 3O6FB 1MAML 2AJZA 1ZWIA 4LEOB 2GFBB 3LKOB 4CJ1A 3S5LG 3T4AA 1C5DA 4M62L 5JOPE 5CGMA 4QXUH 3ULUH 4PD4K 4ZDHA 4OZGB 3TEUA 4LEXH 4H0HB 3PHQB 4M7ZC 3CFCL 1CQYA 3NTCL 1DQQA 4QHUB 3KNBA 3I02A 4M61A 4HFUL 5KSAB 3GMMB 3KPSA 1K6QL 3MA9H 3VD7A 4HHAB 2H2SC 2HG5B 5F6IC 4NKIL 3MREA 3OJVC 1IE5A 1RHHA 2C3GA 1RK1B 2NY4C 4HWUA 2VDNL 1NANI 1ZHKA 4JAMA 1MHEA 3CK0H 3MV9B 5HHOE 2W38A 5SWZA 3MLWL 2I07B 3E2HB 5F7HA 1AR1C 5AWNH 2E9WA 2AJVL 3ZL4H 1P1ZB 3EYOB 3AMKA 5IMKB 4XB7A 4LSVH 3ZE0E 1UT9A 2NY0C 4HIIA 5CWSB 4GKZB 4GW1A 5K9OB 4ODWB 5GGSB 1JGDB 3UTSD 4PRAB 4OUOA 3RGVB 4LAQL 3V0WL 5AG8A 3AGVA 2EC9U 5JORA 2H1PL 3FQNA 1ZHBB 4TNVF 5JHDB 3BDXA 3KPMB 3V5KA 1C12B 3ILQC 3JWDH 4JY5H 4GBXC 2E9BA 4LSQL 3GMLA 1JWSB 3CC5B 1YN6B 5EH1A 4HIXH 4LDOB 1A1MA 2DI9A 2XACC 5DS8B 2QKIB 5C9KA 1ODAA 1RIUL 5C7XH 3RWJA 5B38A 3LH2H 5FO8B 2P5EB 3WBDA 1KEGH 2BVQB 2IMMA 4JY6B 4JO1L 2MNUA 2NY1B 4U3HA 1IAIM 1T3FB 4F3FB 5FYLE 1MHCB 3VFMB 4TSAH 1KTLB 4Z78B 3C6LB 4QRRD 3AREC 4ZUUA 3NA9L 3UTTA 4PRPB 3EOTL 2HJFB 1UKQA 2IANE 4XGZB 1WWBX 2Q76B 1ZLVH 2DDQL 1AXTH 4DCQA 5E9DD 2GJ6D 3MGAA 5T1LA 3IB4A 1ZLWH 2ZSWA 5HD8C 3RKDC 2WIIB 1K4DB 1JNNL 2F5BH 2EDWA 2OJEA 4QO1A 4K23L 4BKLB 1Z0MA 1S7XB 4F8TA 4PJ7B 1FP5A 1GOFA 2IALA 1QP1A 5IFHH 1HXYB 3MRGA 1F4AA 3IVKA 4ISVA 4M1CC 4DKAA 4XXCA 2HAZA 3A6BH 1M71A 3VXMB 2KPNA 4WVRA 1DUZB 1MCWW 2ARJQ 1N2RA 1A6VL 2VLRD 3CPLB 4EZMA 2EYRA 3MRRB 3UC0L 2JIXD 4U1SA 2NY2B 5GSRA 4FS0A 3ARBD 3SGEI 1SJVA 3IDJB 4MXVF 4YZFF 1R3LB 2BNQD 4NHCL 3WE6A 3OAUH 3WL9B 4CKVX 5F7WC 1MFDH 1GC1L 5EBMA 3ROLB 5BV7C 4D9RD 3LQZA 3VRLE 5DVKA 2BY3A 4HLZH 1F6LL 3G5ZA 3T3PE 3GJFB 2WZPD 1R5VA 4GBXD 5CEYA 1N59B 1JZ4A 5B3JF 1VACA 3BMWA 3KYOB 2EE6A 5TFSL 1T1YB 2C7UB 1DE4A 3RGHA 3IJYA 4WUUE 4J4PA 5DJAA 5BV7L 5IVXE 4WFHD 2B1AH 1NMBL 4BK4A 2VQ1A 2V17L 1A3QA 4K7FB 2PW1B 2DM3A 1XCQB 2VISA 5D4QA 5F8QC 1J88A 2F5AL 1A6AA 3I3DA 3ZDZE 2VDPH 4Y5YA 4HH9A 2BJML 4AEIL 3KPQA 1IGCL 5B8CC 1DLFL 3OKEB 3FFCD 4POYA 4KRPC 4P2QB 1QFPA 4O51A 1I8KB 43CAB 3EYUL 1DZBA 4WEBH 3PGFL 1FL5A 1E6OL 3HS0B 5T5FL 1JGEB 4YE4L 5HHQB 1NLDH 1OOAA 5J8OA 4WRLA 4QYOB 3O6KL 3OZ9H 2DWDB 2X4UB 3AM8C 3C5ZD 4KKBD 3MRLB 3O3AA 3OJDB 5KS9A 3QNZA 1T7ZA 3ES6A 1ZANH 1IEAB 4YR6A 4G8EB 4PRID 1UM6L 3K46A 5EU6A 3BQUD 3HE7B 3C9NA 3PDOB 5GS0H 1KIPB 1JHLH 3ZE1E 4WFEE 1G7LA 5FUZL 5IVZA 2Q3ZA 2VL5B 4YFEA 4S1RH 1MHHA 5KSVB 5LAXB 4CUCA 5ID1B 3E8UL 1CE1H 1U92B 4C56E 4NZUH 4E42B 4JPIA 4FQ2L 4Y1AD 4I0PA 5DR5L 1I85C 2GSGA 3UZQA 2QQNH 2LFGA 4DZBA 5I1GL 4CL7A 3QRGL 1FH5H 4QRPE 3SO5A 5L7XH 2LABA 4MD4B 1JHKH 1CR9H 1VEPA 3B6SA 1QO3B 4MJ6B 4KJPC 3QIUA 1XF3B 1A9EA 1NLBL 4X5WA 1KENL 5K59E 2EDKA 3T04D 3TVMC 3MFFA 3OAZK 5ILTH 3I9GH 3OWEA 1CLZL 1DVFA 5T3ZD 4X6DF 1YEEH 1EBPA 2A73A 2EXYC 4MVBC 4EXPX 2YBRA 4NQDA 1RZGB 2G2RA 4U6XB 1U8JB 4PJHB 2DBLH 1U8PB 5DJ6B 1U8HA 4HXAH 3RPIA 5F6HI 2PR4H 3GSOA 3O4LA 4L8DA 3PDDA 4LCUB 3GK8L 1A6ZA 2QJDA 2GSIB 2LAGB 3WUZA 4R7DB 4NUJB 1LP9E 3AC0A 1XGUA 4PJBF 1LO2L 5C0AB 3WXWH 4DVRL 5IBLD 1KGCE 4YHNA 2DM4A 8CGTA 5DMIL 3CFKB 5JW3H 2UWEE 4JFEA 3LEXA 3M8OL 5CFHA 5CMAB 1QTYT 4BQ9A 4WGWB 5IBUG 5F9WC 5LJYH 1OAUL 3IF1A 1U3ZA 5E8EA 1T2JA 2VR5A 3IU4H 4ZXBB 2P43B 5HYEA 1HKLL 2ADGB 3RZCD 4KU1A 4XHJC 5HYJE 3MRNA 3QIBB 2D0FA 2PN5A 5T5NF 4P5TB 2L0DA 4X7EC 1PEZA 2FJGB 4Z7OF 3WHXA 2Y07L 4HF5H 5DJYA 5D93B 1PYWB 1CBVH 3O9WD 1TDQA 43C9A 4OAWB 2D7TL 3CX5J 1ZGLA 1AHWB 1JFQH 3VFNA 1NJ9A 1KJ2A 4PJDB 3E6HA 4LNRB 3BP4A 1Z3GL 4OZIA 5F1OB 3VWKD 4WV1B 2BNUB 3P9LB 2R69H 1HKFA 2J88H 2WUBL 5I8EB 5JOEA 2OSLB 1AO7A 3QXAA 4HV8B 3S4SA 5ISZE 4PLJC 5DQ9B 4GRWB 4U6YB 5FYJL 3L3DA 5DFWH 2C4FU 1TVHB 4LOUC 5HHME 2QR0B 1T6WA 2DL2A 1B9ZA 4JGMA 1N6QL 2R4SH 3LQAL 3CFIC 4FRWA 3QG6A 1N26A 4AEFA 4OF7A 4LSTL 2KZ1B 2PO6B 5D7SH 2N4IA 3W39B 3EYFB 4FZ8L 4DWHA 3NFSL 1T5XB 3OKKB 4HK3J 2VXVH 3F6IA 1MLBA 1S5HA 3BJLA 4Z7VB 2J8UB 3MLUL 4R26H 2VR4A 3PXHA 2OMBA 3GDBA 1KIQB 3FB5B 5EIIB 1BQLH 1BEYL 3PWVB 5L6YH 1A3RH 1QSFE 4KKCC 3WNMA 2KQMA 4XWGH 1G1YA 5DLMH 1LD9A 4QNPF 4PJIA 3THMH 1R0AL 5HYIA 2EEBA 4QRUB 3S7GA 4V1DE 4FG6D 5EUKA 5DRWA 3ROOB 2JCCE 1BAFL 3HB3D 3RTQA 3ESUF 2XA8H 4QY8A 1ZLVK 4HQQH 4JO3L 4F9LA 2Q8BL 2ITDB 5E00B 4FTVB 3L9RB 3MRHA 2NY6D 3ARDA 4JCLA 4MJID 4N1CA 3U30C 3MRIB 3MZTA 4OLEA 4ZMAT 3NFNA 3P0YH 2PYFA 2I9TA 1PZ5A 5GRWA 1YNLH 2EH7L 4TNWK 3VXPA 1YNTA 4Y5VA 1F00I 1NCDH 4MNQE 3IDMA 4M8QB 5IEHB 2A6JB 5I8OH 1J05A 3MLRH 4TTGA 3BD5A 1ND0A 2YK1H 4WU5A 1WCBB 3MCG1 4M9OA 2IBZY 1NUNB 4OZFB 2XWBA 2LE9A 1VB9A 4S1SH 1FNAA 4JFDA 2HFEB 2HN7A 1X4XA 4L3AA 1IAII 4RQQA 2W9EL 3FQXA 1T0MB 1S9WA 4U7MA 2OI9B 2GHWB 4UOW0 3EYSH 5DFVD 4AIOA 5ALCL 1RPQA 1C1EH 3UBXG 3M1BB 5DHYB 3SE8H 2OL3B 4KJQC 3FTGA 2FDBP 1FVDB 5IUSA 4PLJD 1C5CH 5FV2A 3G5XA 5H94A 2CXKA 2EYTA 1U8QB 3V6OC 1EJOH 4IIQB 4PGDB 3TNNB 1EO7A 4OSUH 1RUMH 2FR4A 4MXQD 3U0WH 2YRLA 3KPSD 2IQAA 3C6SB 3QUZD 1I8LA 4N8PA 2DQIH 5JNYB 3KPPB 4OD3L 3ARGD 4X7DC 3VXNA 3AVEA 4CW1B 3VFRB 3ULUC 5SWZD 3DO3A 4NHUA 1Q72L 2MCPH 1LO0H 5TPWL 4KZEL 1WBZA 4D0BA 4LCIH 5HJ3B 4OGAD 1RJYB 1CVSC 4NDMB 3UO1H 4HFWB 1HXMB 3OKNA 3FZUC 5HI5C 3QPXL 4QXUL 2O5YH 5J6GA 3ULUL 1NEZB 5JW4M 4TNWF 1M1SA 4IDLA 2YA0A 1J8HD 1IAKA 4BSVB 2A6KA 2WWMD 5ITFA 1M6OB 1IM9B 1UM4L 3V6BR 3V79C 3MXWL 5HGHA 2FYYA 1UJ3A 3SCMB 3LSOB 2V9RA 3W0WE 3LZFL 4UT9L 5B22A 5EB9A 1K4CA 3HG1A 1OGTA 2VLJB 3RI5F 3RDTA 1P4BH 2Y6SC 1ORSB 2LQRA 4RNRB 3WEXA 3MRCA 4I77H 4O2FB 5J4MA 4PJ8B 4X4XB 3UJIH 4JFOB 3ARQA 4TVPD 1UENA 5F7DA 4UV7H 1EFQA 3JWNC 4H5SB 4IDJL 3RWFA 4PJGA 3TYGL 3SO3C 3KR3H 1QHOA 3JWDC 4NO3A 2VYRE 3O6FA 3KHOA 1DQLH 4EI6B 4LEOA 2GFBA 3LKOA 2APFA 4L4VE 5E4EC 3QDGB 4RFEB 2E7LA 3INUH 5IHUH 3KXFB 2V5RA 4OKDA 4OZGA 4V2CB 3PHQA 1SVZA 3UTTD 4BSJA 3FOMB 4QHUA 3FN0H 1MNUH 5KSAA 3GMMA 4HHAA 2HG5A 4KGLA 4IRSB 5KTEH 4DOHE 5GGVY 3BDYH 4W81A 1RK1A 4HIXL 5D1QC 1T03H 4KI5F 3SJVE 3MV9A 1X5HA 3KLHD 2NXYC 4TUKL 4GG6F 2I07A 2EC9T 2IG2H 1NGWB 4KV5F 5SWQB 3LH2L 2NY5L 1P1ZA 3EYOA 3MJ9A 5CLWA 5IMKA 3GSUB 5DSCB 5HHOB 4KTDH 4HMEA 5CWSA 4GKZA 5K9OA 2G75B 1HI6B 4ODWA 5GGSA 5D7LE 2R29H 1JGDA 1CXKA 4TSAL 2XY2A 32C2B 1YYLL 4ERSL 4PRAA 2AEQH 4DGYL 3RGVA 5GS1B 3FO0L 1UM5H 3QO0B 1ZHBA 4P4RB 4KROD 5H37G 5JHDA 3DURB 1FSKB 3KPMA 1C12A 4LRIC 4WW2B 5DYOB 1KCLA 4MHHI 1JTPA 5E24E 4KMTH 1JWSA 1EDQA 1EFXB 3CC5A 1YN6A 2MKWA 1R5IB 2E7CA 2F5BL 3S3PA 1MRDL 2VR9A 3UTQB 1AGDB 4KKAD 5DS8A 2QKIA 2VNCA 2YUXA 5AUMB 1I4FB 2FBJH 3RJDA 3TPKA 1MREH 2P5EA 5FO8A 4R4FH 4EDWH 2BVQA 5HYFA 3X11B 3PHSA 4JY6A 1TZIB 2JKXA 3H6JA 1T3FA 4F3FA 4KJWC 1MHCA 3VFMA 3A6BL 1KTLA 1QLFB 4Z78A 3C6LA 4I4WB 3MRBB 4FQLH 4PRPA 2HJFA 3TWCH 1GGTA 1D7FA 1DQMH 4XGZA 1OAKL 2F9BT 1X3DA 2Q76A 1N5YH 3GI9L 2H26B 4GRMB 4H25B 4WO4B 2IANB 5J13C 2HWZH 4MS8C 4G7VH 3HPJB 2WIIA 1K4DA 3WO4B 2VOTA 3GSQB 3DBXB 4TSCL 4RGNE 3QFJE 4BKLA 1S7XA 1MFDL 4PJ7A 2C3XA 1GOHA 1CQKA 3U1SH 4W4NA 1NC2B 1HXYA 4YHLH 1WFNA 3DRQB 2HT2C 4RGOH 4GUPB 3C60D 2V5TA 4PRHB 2IF7A 3RWHB 3VXMA 1DUZA 2JJSC 2O61B 2FNBA 4KVCH 1DDHB 1J0IA 4KMLB 3CPLA 1OT2A 1U9KA 3AB0C 1M7XA 3MRRA 4HAFA 4UTAH 1IGIH 4N8CH 1MJ7L 4XMLL 1YY9C 1P7HL 3IDJA 3WHE0 1CICB 2B2XL 1R3LA 1TTUA 2VLKE 3JBG7 4IMLB 1OB1B 3EHBC 3WL9A 1OTUD 3ROLA 5CAYB 4WEBL 4YDKL 5HYQB 4YXLH 3BWAB 3WUWB 3NOIA 1MRCH 2FH8A 5SV3A 2IBZX 2Y1VA 3GJFA 3F58L 1N59A 5I73C 2H9GB 2A9MH 1T1ZB 5GS0C 1NLDL 4HJGB 3KYOA 4RGMB 2DYPB 4AEHH 1KC5H 1KOAA 1T1YA 2C7UA 5A2IH 1AR2A 5BCAA 1X5LA 1B88A 1N6UA 1XIWB 2BXYA 4XBPB 4FQCL 4K7FA 2PW1A 4PJEB 1D9KC 1XCQA 3LS4L 3HAEB 1NCUA 5ESVB 5GS0L 1JHLL 3DV6B 4YFLI 5GISH 4PD4J 4Y89A 3FOLB 3NVQA 5EU3B 2HKHL 2J5LB 4ZTPH 5B4MC 4FQ1L 4MYWB 4NZUL 3OKEA 3T1FB 5DI8B 3PF2A 4JKLA 4P2QA 3O4LD 1I8KA 43CAA 1G9NH 4N5EC 1FH5L 1RUKH 3HS0A 3HFMH 3ZHKA 1LO5B 1MY5A 4Q9CA 3B9KC 3KDMB 3QG7H 1JHKL 1JGEA 5HHQA 1CR9L 2CLVB 3KYMB 3MCLH 4QYOA 4OLZL 3PL6B 2DWDA 2X4UA 4HKBB 5SV4A 2YRPA 3MRLA 3OJDA 1FZKB 4DZ8B 5ILTL 4X9IA 3RIFK 1JBJA 1IEAA 1MPAH 4G8EA 1YEEL 1F4XL 1QFOA 1CXFA 5FHAL 2XQYG 3HE7A 5J11C 3PDOA 1KIPA 5ANME 4WTXA 2AS5M 2BP3A 2DBLL 1FNLA 2VL5A 4ZSOE 5C2BH 5KSVA 1CFNB 1UACH 5LAXA 3ZT5A 2RB8A 4E41B 4OCXL 5ID1A 1U92A 2OJZH 4XNMB 1H3GA 1U58B 1UQSB 3R4DA 4E42A 2RCSL 3BIBX 3HMXA 1N4XL 1UYWL 4LSRH 1UZ6F 3MUZ1 4MD4A 5C0NC 1QFUL 1A22B 4QRSB 1MCOH 1QO3A 4KDWA 4MJ6A 4NQEE 1T5WB 1XF3A 5CZXD 3AMLA 1Y0LB 4GRLC 3VI4E 4C58B 4R9HA 2N7AA 3NCFB 3IU4L 1G7QB 1XCTB 1NAML 1JRHH 1WICA 3RVVD 4APQC 1RZGA 3H2WA 4U6XA 4N0YH 1U8JA 1ONQB 4PJHA 1U8PA 5DJ6A 5IK3B 1JK8B 1BIHA 3FJTA 4Q58C 3RUGF 2HRPH 1CBVL 4LCUA 2FX9L 2GSIA 3QT2A 4R7DA 4NUJA 1FAIH 5C0AA 5F21B 5FA3B 3D5OF 3SDAC 1XR9B 1T0PB 1YQVH 3CFKA 1LP9B 1T2QH 3AY4A 4Y4HC 3WCYA 4N1EA 3RIFF 3Q6FB 5CMAA 2UWEB 5FKPB 2R4SL 4ZXBA 4PGJA 1A7PH 4PYHA 3T3MF 2ADGA 3TJEL 2MPAL 1IC7H 1T83C 3QIBA 5BRZD 2HRLA 3ZKND 1YPZB 4P5TA 3B9KD 2CQVA 4PJFE 4DGIH 2FJGA 5GJSH 3KS0J 4ZUWB 1QZ1A 4QHLB 4UBDD 1FHGA 4PBWD 4EN3D 1G0YR 4WCYL 3ARDD 1OHQA 2VXVL 1PYWA 2FHFA 2DMCA 1OD7A 4OAWA 3BISA 2ICEB 3TO4C 2YUWA 4HUUB 4PJDA 3U9PL 2YZ8A 3WFCH 3HAEG 1ZAGA 4LNRA 1AGFB 5ALBL 4JPKL 4J3SA 5JIKA 4WV1A 2BNUA 4W4OA 3SDDC 3SGKC 3P9LA 4R0LC 5I8EA 4XWGL 5DLML 5CEZE 5HTSA 2OSLA 2QQLH 1JGVL 4HV8A 5E5UB 1IILE 3EJZD 1HEZB 5DQ9A 5JXAH 4U6YA 2JJTA 1TVHA 2QR0A 2H32H 4ZG1A 5C6WH 2XA8L 2FECL 2XPGB 3H3PL 3AAZB 3F7VB 4JFXB 2UUDH 1RZ7H 4JHWH 1F97A 5HHMB 2VIRB 2PO6A 3W39A 4QHKJ 3EYFA 4JFQB 1T5XA 1PSKL 3OKKA 3N0PB 2VDQH 1MWAH 3WLWC 4HGKC 4Z7VA 2J8UA 1EJ6A 1MCIA 5FGBA 4Q9QH 4XPAH 1INQB 1NCDL 5KW9L 1LGVA 1NGYB 4PS4H 1KIQA 3FB5A 5T1KB 5EIIA 4M93C 3PWPE 3MLRL 3PWVA 4YXKH 2DQJL 3L3HB 3UXFA 4KH2A 1ACYH 1A4KB 4KI1A 5KSBF 4QRUA 5JW4N 4S1SL 5BVJB 4Y4KD 1N64H 3ROOA 1QBBA 3RP1A 2O5XH 4ZS6C 4QOKE 5TE4H 4HIHB 1G7PB 4BZ1H 3HR5B 3EYSL 4V1DB 4D94A 2B5IB 2IGFH 2ITDA 5E00A 4FTVA 4Y16D 4FFWD 2JCCB 3L9RA 3OGOE 3NN8B 4JFFE 4G6KH 2J3SA 3H9HB 3MRIA 3N9GH 5GIRB 3IDYB 4Y19B 1BF8A 5FF6B 4JGJA 5C0EB 2VUYA 2ERJC 4TUOB 3FN3A 1X5JA 1RUML 2YN3A 1KCRL 3C09C 3U0WL 2V7NB 4M8QA 5IEHA 2A6JA 1DL7L 3GMRB 4ONOA 4P59H 5FOJA 3CMOL 4FZEH 4POZD 3BSZH 3IDXL 4OZFA 3TA3B 3QUXC 3P11L 2CK0H 2XZAH 2HFEA 2DMKA 1LO0L 5CD3B 1I1AB 1T0MA 2X89A 5FK9B 1NANH 1JP5A 5C1MB 1CLOL 3WN5C 3LDBC 3M1BA 4MA8H 2O5YL 5DHYA 3WYRA 3RFZC 1PKOA 2AJ3B 2EDYA 2OL3A 2R0WH 4L8SB 3T08A 4CU7A 4XB8A 1FBIH 1FVDA 4PREB 5DD3L 1RMFH 1U8QA 4IIQA 4PGDA 3TNNA 3RY5A 1FFPB 4LLVB 4Z7WE 4ELME 1KCUH 5DVLA 1HH9B 5GGRY 4Z8FL 3SGJA 4F7PB 3C6SA 5JNYA 3KPPA 4NT6B 2OK0H 1P4BL 3QI9B 4NQCE 2DD8H 5JA8B 4I77L 4CW1A 3VFRA 1F58L 4NO5B 5IVOA 2VJXA 4UV7L 1J0KA 2DQDH 1F3RB 3KR3L 1C5BH 4HS6B 2EO1A 4G8GE 5HJ3A 1DQLL 4UOW1 1RJYA 3GMPB 2K3TA 4G7YH 4NDMA 4ZOBA 4HFWA 1HXMA 5IHUL 2NXZD 2IPTH 1IC5L 1NEZA 5D2LE 4JJHA 3I2CH 5EZLB 2C3VB 2XRAH 4BSVA 4XC3L 5I8CB 4Y2DC 1M6OA 1IM9A 4AL8H 1T20B 5FDYA 2BC4B 3SCMA 3LSOA 3T65B 5KTEL 4Y4FC 3O3BB 5GRUH 3Q3GB 4LCCB 1YUHB 3G9VA 1T03L 2VLJA 3W0WB 2I5YH 4HK3N 4RFOH 4RNRA 1ORSA 4QCIB 4UB0H 2IG2L 4X4YB 4O2FA 1ERNA 4PJ8A 4X4XA 3QZWB 4JFOA 2ZSVB 1J1XL 2BVPB 4KQ3H 4H5SA 4KTDL 4X8JB 3MRKB 5F1KC 1S7RB 1T21B 2A1WH 4NC0B 3UTPD 4MB4A 2R29L 1AXSB 4EI6A 5MHSE 1CGTA 5I75B 1AKJB 3QDGA 4RFEA 2R56H 3KXFA 3BE1L 1UM5L 2HTLC 1HHIB 3GMOB 2IQ9L 1E4XI 3C6LD 5IQ7H 4DN3H 3H7LA 3ULSB 4X6BB 4YX2H 3QDAA 3FOMA 2DQTH 4XNUH 4UT6H 4MA7H 3P0GB 4M9PA 5CCKH 1CTOA 4IRSA 4WDIB 1Q9OB 4LCWB 4TVSa 1RUPL 3GSNH 3JV5A 3WJJC 1URLA 4S1QH 5CSZB 4HUXB 4MX7B 3D3VB 2X9WA 3ZTNL 4DOHB 2ZKHH 2V2XB 3BYTA 4NP4L 1NGWA 1BD2B 3LKSB 5SWQA 2EDQA 2FBJL 3TC9A 2BDNL 4EI5D 3VMOA 4EDWL 4XPHH 3GSUA 2CJUH 5DSCA 5HHOA 3SGEH 4YHKL 4L4TD 2PYEB 2G75A 5HHVH 4YUEL 1HI6A 5D8JL 2O5ZH 3UJTL 2IAMB 32C2A 2VDLH 4WHYH 4JQVA 4FQLL 5GS1A 3QO0A 3VXMD 4YC2C 3GHEH 2PTVA 1DQML 2N1KA 3WIHA 1YDPB 3QCTH 4P4RA 4M3JA 3DURA 4WW2A 5DYOA 3CVIH 5ECJE 2WIMA 1INDH 4G7VL 3WD5L 5DVNA 1EFXA 4PG2C 1R5IA 5J9PB 1R6VA 1S7VB 4S0TD 5SX4I 3UTQA 1AGDA 5AUMA 1IKNA 1I4FA 4ZAKC 4EBQH 3LEYL 1EO8L 4J3OC 4X6FB 3X11A 5C08B 2X4RB 3KVQA 4KK6C 1TZIA 3BPNB 4RGOL 1X5XA 1L0YA 2IPUG 2I60L 3RZWA 5KVFH 1QLFA 5J12B 3FMGH 4I4WA 1GGBH 3MRBA 4LLQB 4V2BA 4KVCL 4QF1B 3JV4B 4YQXH 1A8JH 1XGTB 3ZSSA 1CT8B 4DFIA 3GMNB 1SY6A 5JIIA 4UTAL 2A6IB 2EE3A 2H26A 3W9EB 4N8CL 4GRMA 5GSVB 5D7JD 1FZJB 4H25A 4NM4H 4WO4A 4XVUD 3VWJC 3BOVA 2IANA 4NKQB 5C07B 3HPJA 1TJHH 2CIIB 5HVWA 1L0QA 4ELKB 3GSQA 1CFQB 3DBXA 3TV3H 1YNKH 4JGUA 1EUUA 2EDTA 4I1NB 1D5BB 2DQCH 1H3WM 3VDAA 4YXLL 1NC2A 1G7HB 1X5AA 2A9ML 3DRQA 5T3ZL 2UUDK 4GUPA 1TPXB 4PRHA 1AD0B 1KC5L 1HZHL 1YY8A 4HT1L 3BZEB 3RWHA 5BOPA 3X17A 2O61A 1JJUA 4XCYB 1NKOA 5C0GB 2AV7B 1DDHA 1NCAL 3WJLA 2VSDA 3OKYA 4PR5B 2BNQE 3H8NA 1G9NC 1LO3L 2X09A 5ETUB 4FFVC 1DTUA 1IAMA 5FV1L 3HE7D 4ZTPL 2C3HA 4D9RE 1CICA 3WKML 2J6EA 5JMOC 5LXGL 3ZT7A 1IMHC 4IMLA 1OB1A 4DK3A 1VDGA 1YEIL 4AQ1B 4U1IB 1VPOL 1CDBA 3NFPB 3ARFB 4YAQB 4XWOC 5HYQA 3WUWA 3BWAA 3SE4C 2GAZB 3VA2C 4C55A 4OFIA 1SEQH 4YHMH 1I3RB 2H9GA 1T1ZA 4HJGA 3TBTB 2DYPA 3SDCC 2YMXH 1JUFB 2EZ0C 1T2XA 3L1OH 3OXSB 1XIWA 2VERN 3TJHD 3FRPG 4XBPA 4R8WH 3O2VH 4YBLC 4PJEA 3TZVD 3FFCE 3HAEA 1GIGH 1OP9A 2YXMA 5ESVA 3DV6A 3S88H 3FOLA 5EU3A 3QUMB 3MYZA 4IRJB 3T1FA 5DI8A 2DQEH 4YK4C 1V05A 4P23D 3IAPA 1LO5A 3CJJA 4RBPH 3KDMA 1MCOL 4JQIH 3LVEA 3VWJD 2CLVA 2BNRD 3KYMA 4RDQG 3PL6A 1L6XA 4HKBA 3CU7A 1FZKA 2ZUQB 4DZ8A 1C7TA 4NBYB 1OM3L 4MHHG 3H9SD 4XTRC 3RWEB 3O8XD 4NJ9H 5DRZB 4AIZB 1CDUA 3TT1H 3O2DH 3LRSB 3K2UL 1H9VA 5ITBH 4G6MH 1CFNA 4E41A 3IRZA 4XNMA 1U58A 1NGZB 1UQSA 5ANMB 5CGYD 1OD9A 2NR6C 1TQCC 4U1GC 5DA4A 4ZSOB 1FV1B 5F1IB 4UIMB 3MNZB 2XQYK 4K3HA 4XVSH 4QRSA 3BXNB 1BBJB 5IWLA 1U8MB 1T5WA 3U4EB 1S8DB 1Y0LA 1LNUB 1NAKH 5I1JL 1PG7H 1G7QA 1A7PL 4ODSH 3JVGA 1RI8A 4NQEB 1XCTA 1IC7L 5J3HD 2R8SH 2J2ZA 4G9FD 3STBA 2FB4L 1P7QB 5FYKU 3GUTB 4O2EB 3H0TB 1ONQA 3TN0C 5GJSL 5IK3A 4GG6B 2MJWA 1JK8A 1K3IA 1DBAH 2M1KA 2J1KA 2VAAB 2XTLA 4TPRL 3GKZA 1XT5A 3WFCL 4NN5B 2VTFA 1RUAH 3MBED 5ICYB 4OFPA 5FA3A 1I9IL 1XR9A 3EBAA 3UPAA 1XEDA 1PW3A 5EC1B 1EV2E 4N0RA 1EXUB 1LP9A 2QQLL 1NBVL 4GAFB 1J0ZA 3I6LD 3Q6FA 3GSRB 2CKNA 3BZFB 2X9YA 5EZIH 2ICES 3VXUE 2UWEA 5FKPA 2P42B 2NTFB 2Z93B 2NZ9C 1BFVH 4JHWL 4ALAH 1YPZA 1U36A 1WTLA 4JDVB 2G5BB 1FZOB 1EZVY 3CCHB 4NO0B 2XY1A 3QDJE 4XNXL 4ZUWA 4QHLA 2E27H 1OAXH 1CF8L 3LY6A 3NA4A 1LK2B 2VDQL 1OTTC 5E2TH 4PJFB 3MMEB 2AKRB 2ICEA 4Q9QL 1EHXA 4XPAL 2VQUA 3IKKA 4HUUA 1UB6B 3PV7A 4P46D 4ACPA 1AGFA 1P4LB 4MXVE 4YXKL 2XZCL 3ISWA 4JO4H 1KPUB 1A7RH 3FL7A 1HEZA 1Q8MA 3DI3B 3SKJL 1SEBB 5GRZA 1JGUH 1E4KA 4K9EH 5TE4L 3R8QA 3QDME 5F1NB 2XPGA 4BZ1L 3ZE2E 3GEWB 5HGGS 4E5XB 3AAZA 3F7VA 2FWOB 4JFXA 5DK2B 5B3JE 2IGFL 2B0SL 4DN4H 2VIRA 4PTTB 4XVJL 4YBQC 4JFQA 1VENA 1MIEH 3I85A 1KJ3L 4LQFH 2BCKB 5ICXB 1KF9B 2G9HB 3D9AH 5KVEL 1UWEH 2APWA 3V6ZB 5EUOE 5L2JB 1INQA 1NGYA 4XH2B 1GZPB 1TNMA 5T1KA 4YHOH 4HIEB 4P59L 5GGUB 3FO1B 1FO0B 1JE6A 3L3HA 2AK4D 4UQ3B 3BSZL 4P0DA 1A4KA 3AS2A 4XMKH 4G6FB 1HYRC 5GGQL 4N8VB 3K4AA 4NWTH 2XZAL 5BVJA 3DGGB 3N1FC 1P7KB 4HIHA 4JLRB 1G7PA 4JFZL 3HR5A 4V1DA 3VXSD 1BWMA 2JCCA 3NN8A 4QOKB 1V3KA 2EDHA 3H9HA 5GIRA 3DWTA 5DC4B 5DD0H 1FBIL 4QLRA 5MI0C 1IL1B 4Y19A 1KIUA 5FF6A 5C0EA 3G9AB 4FNLL 5DTFB 2VZ3A 4JFFB 2MOVA 4TUOA 4DJMA 1CLYL 3GM8A 4XXCC 3D39E 2V7NA 1NC4B 2FJHB 5L9DH 5KS9F 2F19H 2MFNA 1MCPH 3NH7H 3QIWB 1UKTA 3GMRA 3DXAB 2ZUUA 4MA1B 1DBKL 2X40A 3MBXH 4U4BA 3RWGB 2DD8L 3QHFH 4MNQA 4JKKA 4KK8C 4WHDA 4Q6IB 4FHBD 3TA3A 3W82A 4B7LA 1FORH 1KG0B 4QHKI 3CLEH 2DQDL 1CE6B 5I30H 2P49B 1C5BL 1I1AA 5CD3A 2HVJB 4OF8A 1MUJB 5FK9A 4Z0BL 4KXZI 4U2ZA 3DI2B 4PJAE 1CD8A 3DVIA 1WZ1L 3UYPA 1AFVH 3RX8A 2D7QA 3QDGD 5DGQA 3I2CL 3BUYB 1PAMA 2AJ3A 4L8SA 5T1DH 3B8SA 2NYYD 4PPTA 4PREA 2J4WH 2APXA 4P2OC 2W0FB 4AL8L 4RMVA 3X3FL 2RFXB 3NCYP 4NNPH 3ZDXE 1FFPA 1YECH 4LLVA 1F4HA 4J1UB 5JOPD 2V9TA 1HH9A 2FATH 5DJ0B 5GRUL 4F7PA 1RZKH 4IRSD 4OCRH 4J4PC 4U6TA 4GKNB 5ID0B 5DZLA 4XPFL 4Z7WB 4NT6A 1FFQA 3QI9A 4FQXC 3NACH 4UB0L 4NO5A 2PKDA 3GRWH 4OI9A 4XBGB 2DQHH 3LCYA 4PJBE 4H0IA 2QADD 2V5YA 4A2LA 4ODHH 1J8HE 4HS6A 3GJEB 1NCNA 2A0LD 1FYTD 4RAVB 3V9FA 3GMPA 1FNSH 2YD9A 1A5FL 4RFNB 1CK0L 4F58H 1NGXB 5DMYA 3S37H 5IW1B 3OX8B 5E08L 5EZLA 1A1OB 2I24N 2C3VA 3ZZ1A 2B39A 5I8CA 2DQTL 2AABL 4UT6L 3ARWA 3G08B 1T20A 2JE8A 2BC4A 2DTMH 5D2LB 3LRGA 3T65A 4HXBH 5E1AB 3O3BA 3K74B 1E4WL 1FFOB 1NCWL 4HS8H 4RBPK 3TIEB 3Q3GA 4LCCA 5I6XB 1YUHA 4WTWA 2HMID 3SDYH 3W0WA 2ZKHL 3KAAA 3P4MB 4QCIA 4X4YA 35C8H 3HE6C 4R90H 1MEXH 2QTEA 4XP1L 3QZWA 2ZSVA 2BVPA 4X8JA 1F13A 3MRKA 3DSFH 3P30H 1S7RA 5HHVL 1T21A 5CS7A 5D72L 4I0PC 2O5ZL 1AXSA 5C3LD 4K3JH 5FYKH 2VDLL 1AKJA 4OZIF 5T33H 3DUSB 5JIHA 4N8VG 4BQ8A 1HHIA 3GMOA 4BK5A 1T0NB 1MJUH 2VAJA 4D3CL 5ABDE 3ULSA 4X6BA 2FIRT 1PX4A 3GSXB 5DQJB 3QHZH 3R8BB 1IGFH 3P4OB 3QIUC 2EKSB 5IROA 4WDIA 4X7SL 2EIBA 3J8F7 1Q9OA 4LCWA 1JV5B 3RVTD 3K1KC 4JPWL 5CSZA 2D2OA 4HUXA 4MX7A 3V6OE 3D3VA 3T0ED 1MCHA 3AFLA 1DVFC 4GW5B 1S3KH 2V2XA 5BW7A 1BD2A 3LKSA 1HOCB 4X4ME 3BI9X 4N0CC 3FRPA 5JR1H 3VGBA 4XNZC 3HNSH 4Q97A 5CBAB 1YJDH 4U1KB 4QXGH 1TQBC 5FXCH 3UTSB 4QNPE 3NCMA 3ULUE 2YHGA 4K55A 5IFAH 2F54E 5BVPL 5KVFL 2IAMA 4KDTC 4YFDB 3QDHA 5DK3A 3W9DB 4DKDC 1YEFL 1JNHB 3BUTA 4YQXL 4S1DD 4DQOL 1MCLA 1VERA 2AGJH 4PJIF 3C8HA 1YDPA 1EZVX 1ZLSL 2ED9A 5I1AB 4Z18A 2AJSH 1WFOA 1ZA3B 1TJHL 1YYMH 1NFKA 4AG4L 3TV3L 3K3QA 5J9PA 1S7VA 1I9RH 3DMMD 3V7MA 1KB5B 4XP6L 4F37F 4A6YB 5HYSB 4GXVL 4X6FA 5C08A 2X4RA 2B7DT 5HVFB 4F15B 4DTGL 3FONB 4QRRB 1F4WH 2ZWLT 2FEDD 2DYPD 5C0IB 4LLQA 4NWUH 2NZIA 3MV11 4QF1A 4M6NH 3JV4A 1ZLUH 1XGTA 5E9DB 1CT8A 3HRPA 3GMNA 1W0YT 2GJ6B 2A6IA 1QUNA 3W9EA 15C8H 3IXTB 4GAGH 2F58L 1FZJA 5GSVA 4IJ3B 4WUUD 2WAHA 1KJ2L 1DCLA 4PJ9D 5C07A 3ZKMC 2CIIA 4LNVA 4AQOA 4ELKA 1CFQA 1KPVB 1TMCB 2Q3AA 4M7ZB 1A14H 1D5BA 2XFXB 1QSEE 1A7QH 3TF7C 3L5JA 1G7HA 1RK0B 1WZMA 5JXEA 4C4KO 4W70A 1CZ8L 5F7NC 1KACB 4JFHE 2YMXL 1AD0A 3OR7B 3BZEA 1J5OH 2VLRB 5FM5M 1SBSL 4WI9A 4XCYA 5C0GA 2AV7A 4R8WL 5DGRA 2VZUA 1V8HA 1Q38A 4PR5A 2VDKH 5B3NA 3UPRB 3HI6L 2NY7L 2NY0B 5ETUA 1FCCA 3ARBB 3X12B 3N85L 4L5FH 3I50L 2VDRH 3MODH 1WF5A 2DJSA 2BNQB 2I25N 5TQ0H 1A3LL 1NUGA 2OS7A 3RTQC 5DWUL 1TXKA 2KDGA 4LLWB 5D9