5F8QC

Blood group antigen binding adhesin baba of helicobacter pylori strain s831 in complex with nanobody nb-er19
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Cell adhesion
total genus 27
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f8qC00
5TPWL 3QH3A 4PJBF 4YC2B 4YWGL 4KGJA 4MJ5B 1JMZA 2XQBL 4PJDA 4Q6IA 3BWAA 4LAQH 4QRQB 3AU1B 2GQHA 3INUL 2XXCB 4JPKL 1X5IA 2YWYA 2APWA 3ULSB 2JCCA 3BW9A 1XFPA 3LN5B 4PJCB 3FO0H 3FB7B 4WHYH 1F6AB 2EH7L 1D5XA 3ECBA 3LB6C 3MA7B 4KROD 1P4BL 2PXYC 1FE8L 1ZA6A 3ULVL 4S0TD 5SWSA 2DBJA 3K2UH 1MQKH 3DYOA 2VZVA 1KCRH 2BY2A 3MRKA 3O2DL 4M1DH 3O8XA 1HI6B 4N0YL 4TVPL 4TRPL 1J87A 3FQXB 3IU4H 3PWLA 3JWDC 1GGBL 1OD7A 4JE4B 4XVTH 3QDMD 5I19H 3PV6A 1IGFL 2D9QB 4MWFB 1UG9A 5SWZA 4JDVB 3GSUA 4OCYL 4DGYL 2Q76B 1YNLH 2X4UA 1TVHA 1CD1A 2CXGA 2OP4H 2WBJD 3CCHA 4NUJA 2PW2A 1GC1L 2W9DH 4GKOA 3C2SA 3H9YA 3MV7A 5E5MA 4R26H 4YE4H 3IDNA 5EU6E 1GSMA 3HRZB 3EUUA 4ONHB 3VG0L 5I9QC 4ZUUA 4I9WD 4OQTA 1J1XL 2BOCB 1A6UH 2X70B 2VDKL 3BPCA 4L29A 2OXGA 4KJQC 4ZSOE 1AC6A 3IFNL 4S1QL 3O6KH 4F7MA 1W72A 4FQXC 3QUYB 1CICB 4HV8B 4N0UB 2ED8A 5C0DB 5DZOA 2OL3L 5D5ME 2DQHL 3UPAA 4EOWH 5F9AC 4C4KO 3O6LL 1R5IB 1A4KA 4RFEB 2H2SD 5CSBA 1UB5A 1CXKA 5B39A 1NDMB 4HXBH 4XI5C 1PZ5B 4L1HA 4EI5D 1BIIA 1AFVH 1JWUA 2BXYA 4P3CL 5EOTA 3RNKA 1XGPA 3HE7B 3QA3B 2YPVL 4PUBH 5T3ZH 1YMMD 4K71B 2LVEA 4AIZA 4TVSa 2YEZA 4ZS7H 3NN8B 4OD2B 2DM4A 2CO6B 4FABH 1PQZB 4GH7B 3TPUB 1TLKA 5CEXA 4G3YH 1P2CA 5GS0C 5KBNC 5DJDA 4PREA 5C6WH 1ZTXL 4M61A 5A2JH 3HE6A 4ELKB 2V5RA 4X4MA 5JHDB 2F54D 3O3AA 5BJTA 2H8PB 1ZT7A 2NY3C 3LY6A 4MCYA 4ODVL 5DTFB 3HS0B 4RQQA 5GHWL 4N0FA 3QB7C 4QLRA 1F45A 4PLJD 1FORH 5EU7C 4M7JL 2GJ6E 1A7PH 3KYNA 4YDIL 3QWOA 1V7NH 4JFQA 4JZJB 3JTSA 1G9MC 1MPAL 1CDHA 3WLWD 5IMOB 1WC7B 4UIKH 4XAKE 2ZSWA 5DQ9A 3OKOB 2AXGB 3BQUD 4PJ9D 4XPGL 2NZ9D 4GO6B 5C0BE 3TN0B 3NPSB 4QXUL 3GO1L 1KCSL 4HIEA 2FNBA 3BT2H 4X6BA 4UB0L 1RJLB 2CJUL 3KYKH 3MYJB 4NQCE 5E4EC 4HH9A 4WNQA 2DM2A 2YD4A 1XIWC 2ADGB 1FZJA 2Q7YA 3BGMA 2HKFH 5EZOL 1AIFA 1KPRB 3L3IA 4UINL 2JE8A 4G9DB 5DJAA 3DUUB 5MERA 3T1WA 3EZ8A 3BPLB 2EDNA 1NGYA 2ZG3A 3TO4A 4Z7OE 2CSPA 4O4YH 1ADQL 4WFHD 4Z7OF 3VXUA 4NO0B 2BSTA 3CNKA 3MRMB 1A6ZB 4GRLD 1DR9A 1GH7A 1Z9SA 2Y9RT 3BGFC 1YUHB 1FNAA 4PJGA 2KBGA 4Q58C 1AGEA 5GGUA 5LQBH 2GCYB 4CVUA 1RUML 4PJEB 3BIAX 4PJHB 5DRZB 1NGXB 1E27A 3FO2B 1WV7T 4X5XB 3W2DL 2W65A 1AD0B 3NFNA 4M03A 3LS5H 4ZFGL 2XXMB 1TZGL 5E24E 3WE6B 1VADA 1WICA 2X7LA 5D1ZD 5DJ0B 4UDTB 1KNOB 2DBLL 4BUHA 3VJ6A 2VSCA 4O5LL 4X7SH 3NOIA 4GG6A 3IFLH 1OM3H 4FQIL 1BZ9B 1X5XA 1DANT 3U0TA 3VXSA 3LRHA 4X80L 3H7LA 1CFNB 2DMBA 2R1XB 2D7PA 1E28B 5CP3A 3Q6GL 3RTQD 5HYIA 1QFUH 4UUJA 4KJWD 1J8KA 3MGOB 5IESH 1MCPL 4IOSD 1QQDB 2V9TA 3ES6B 1YDPB 4CVXB 1IT9L 4J6RL 1CI5A 4ODBD 3G5ZB 5DRXA 3KXFA 1F3DJ 3CXHJ 5GRZA 3DXAD 35C8L 4LLUA 2P48B 2CO7B 4N9GB 3FAWA 4JVWA 5EIIB 2VLKA 3BXNB 3F58H 4TNWF 3V0WH 4P3DB 3X13A 4PJ8C 4F7PA 1OAKL 1TQCB 3REVA 1I1AA 5FM5O 5ITFA 3KPPB 2F5BL 2OCFD 1TZIB 2YK1H 3O3DB 2NR6C 1QHOA 5KN5A 3BPNC 4MSWA 3L3JA 4HKJA 3TA3A 3UJTL 4PR5A 5FXCH 1WT5A 1HEZA 4EVNB 2A6JA 1OSZB 5A40E 1AKJB 4E42A 3OL2A 3UX9B 5IB3A 4ELMA 5GRUL 1WBYB 4JGMA 5FUZH 4HCRA 3KYAA 4OZFB 5J3HC 2IAMD 2X9XA 3QO1B 3QJFB 1IKFL 3L9RA 5GZND 2NXYB 2VDOL 3CDGA 3MLRL 5BO1L 1FFNA 4LLVB 2QSCL 1W2KT 2B20A 2FHFA 1IEAA 4LLYB 3VFGH 4QRSB 1OW0C 3O4LA 3AY4A 1RUAH 1DTUA 1D3CA 3V7AG 1PGRB 4XHQA 1UJ3C 2ENYA 3KLHC 2AEIT 5JQ6H 3WFHA 5H2BB 5IROA 4YDLC 1OAYH 5SX4I 2R8SH 4XMLH 3CVIL 2HWZL 3NGBC 5K9JH 3JTTA 5F3HA 3S3JA 5I8CB 3MBXL 3HFML 1QKZL 1YPZE 4XBPB 3QEQB 2FL5A 4UTBH 5DJYA 1YPZF 4ACPA 2P44B 1A1OA 5IM7A 3HUJE 2QKIA 5CEZH 1U3HC 3HUJF 3V4UL 4D9RE 2CLRB 5L8KB 4W4OA 2FIKB 4HHAA 1OAXL 1KF9B 4GMSH 1Y18A 4JZNB 3X3FL 2R4SL 1UVQA 2IPTH 2VXUH 5C09D 1DVFD 3KR3L 2ENSA 1OB1A 1A3LL 3SKOA 1F02I 1K8DA 5E9DA 3CUPA 3QH3B 1FP5A 1J9CT 3U1SL 3MMEA 1MCFA 4JKMA 3AC0A 4Q6IB 4NQVA 3QIUC 4DVRL 5TE6L 4W6WB 1CK0H 1OLLA 3GSVB 1I7UB 3I02B 2JCCB 3LS4H 5E94B 2IJ0C 3UZQA 5A2IH 1FHGA 1NANH 1G7IA 5I2IB 1EEYB 1UEMA 4NQDE 4HQQH 3WIIL 4OJFH 5FO7A 1JZ3A 3VFSB 5SWSB 1PY4A 1VGKB 5D71L 4B53A 2E8YA 1RZ7L 5GRJH 2MSPA 3MRKB 4LLDA 3QUZB 1N2RB 3PGCA 4MA8H 3ZYOA 3O8XB 1J8HA 1X5AA 5KVMC 3N9GH 4RNRB 3A67H 4B0MM 1IM3A 1HSBB 4OZGE 2HT3C 4XAWL 3OZ9H 4MXQD 4F3FA 2BDNL 2X4UB 5JPNB 1TVHB 4CUCA 1A9BA 3CCHB 2COQA 4NUJB 2PW2B 3OXSA 1SVZA 4X7TB 1OGTA 5E5MB 3RVTC 4P99A 5I8EA 1JPSH 1R3LB 1KSRA 1SQ2N 3TYFA 1P4LA 2Q8AL 3RI5K 4G5ZL 4Y4KC 4IEFB 4ZUUB 3I6GA 4Y89A 5BS0D 1ZT4B 5AAMA 4C83A 3GJEA 1A2YA 1GC1C 5D9SB 2BVOA 1JUFB 1RZFH 4QY8B 4F58H 3DRTA 2D7TH 1N8ZA 1I1RA 4ZFZA 1Y0LA 4ODSH 5DMIH 3RVWC 1TNNA 4TNVF 4PIRF 1AP2A 1B0RB 1KTRL 4L8BA 1A4KB 2P8LA 1UB5B 5B39B 2OTPA 5HD8D 3LH2H 4D3CL 4ETYA 3LDBC 4JY4A 4PJDE 1BVLA 3IDGA 1JWUB 4PJDF 5EOTB 1XGPB 4PGEA 2DTMH 1RFDH 2CDEB 3HZYA 1RZJL 1OP9A 1RJCA 4ONGH 4W68A 4AIZB 5DD1L 5E8PA 1MF2L 4JQIH 4R4FH 4XPBL 2ZCKL 3K4AA 2VIRA 3BP7A 1SMOA 1JNHA 3RGVA 4D9QE 3BMWA 1LO0L 2C5DC 2XZCH 3K1KC 4LHUB 4DOHB 1I1CA 5CEXB 4PREB 2IG2H 3MV9A 4M61B 2XN9D 5GJTL 4F15C 5BJTB 2FX8H 1K8IA 4YXHH 5J1AB 1QSFB 4WCYL 4ENED 4M93C 4QRPD 2D9CA 3KYNB 3QWOB 4KK8C 3SDDB 3G08A 4OFIA 3TJHC 4C59B 1V3JA 1CXEA 3BP6A 5IK3A 5TGBA 5T1LD 2DQDH 2YWZA 4FFYL 2R0ZL 3HI5H 3VXMB 2ZSWB 5DQ9B 4ALAH 1S8DB 4HEPG 2NNAA 3CH8A 4H8WL 1CE6B 1I3GH 2F53B 1DUYA 4HIEB 5HPMB 2EDWA 3NAAL 5BV7H 1QHPA 1YZZA 2BERA 2BVPA 3VFOB 5I73B 4UBDC 2DI9A 4HH9B 1TITA 5C07A 4IMLB 4N90E 1T22B 4TPRL 3BGMB 3V7MA 2NYYD 2VWEC 5DHYA 5GGRA 4PJAE 1JRHI 1AIFB 5ICYB 4PJAF 3O41A 4YXLH 1G7MA 1OTSD 5DJAB 5DA0B 4OF3A 5MERB 1NGYB 3QXUA 4LSPL 2HFGL 5TE7L 2R39A 5FB8A 3LAFA 2UZYB 4P2RE 3FRPA 1X3DA 2C9AA 2BSTB 1NGQH 3E8UH 1S9KC 2CMRL 3WNPA 5JW4R 4U1HA 2H32B 2Z93A 1YEEL 3O6FC 1DDHB 5C0IB 1QSED 1F2QA 4LF3B 4HKXB 2FJFB 1S5IL 1ZLWH 4MJ2A 5I1EH 2YPKA 3W39B 3OKYA 4Z78A 3D18B 3VI3E 1S9XA 3VI3F 1GGYA 1HINH 2EKSA 4G6AD 4KMTL 4MJ6A 2QQKL 4M7ZB 4EUPH 4IJ3B 4X9GA 4WRLA 5JOPD 5M7QA 4KKBC 1RK1A 3MRRA 3LHPL 1T89C 1RUKH 4L4VE 3VI4E 1T0MA 5LKNA 3VI4F 4GMTH 4PRHB 1VA9A 3VMPA 2F5AH 3VJ6B 4XVUC 5GRYA 1T1WB 4TULL 4WTXA 3ARGB 5D2LE 4LMQE 4LSVH 3U0TB 5DUPL 5L6YH 4I18C 1HH9B 4DZBB 1VESA 1FJ1A 4N5UA 3T77A 4RIRB 3QRFM 1XGYH 4P2CG 4Z7WA 4L3CA 4ODWB 5C2BL 4EUPG 5BXFB 1OAUH 5CFHA 1NEZA 4QRUA 3RNQA 3IVKA 2RGSA 3PJSA 1KB5L 4DN3H 5IV2A 5BQ7A 3SKNB 5DRXB 3S97C 2MJWA 3KXFB 3T09A 4Y2OA 2XIDA 1RUPL 1GPOL 5BZDA 4M8QB 2WBJC 2ZUSA 3C08L 3L7EB 4LLUB 3D69A 1QVOB 3ZHDA 4HXAH 1U93A 2H26B 3QNYB 5EDXA 8CGTA 5IEKA 1L0YA 3SQOL 3I6LE 2IFFH 5K59E 4Q74A 5K59F 6CGTA 1I1AB 5ITFB 5EU7E 3U46B 1SY6L 1F4YL 1MCRA 3Q6FA 2GTWA 1A7QH 4M00A 4CAGA 5KN5B 5H8DA 3F12A 1IE5A 4MSWB 5FUCC 3QG7H 1X9QA 4PR5B 1HEZB 3C6SB 4RGOL 4FNLH 2QHRL 1KJ2L 3VXUE 3P3YA 5E2WL 2LVCA 5IB3B 5DFTA 2CK0H 5F7DB 3BD4A 1G7LA 4JGUA 4PJGE 4UT7H 1N0LA 4KKAC 2VE6A 4MQ7B 4IRSB 2AVGA 4QRRE 3CDGB 4PJGF 4M6ML 1DQTA 4HF5L 5ADPH 1A64A 1BPVA 3SPVB 3IAQA 5HI4C 3BH8B 1CE1L 4EI5C 1CWVA 5C08D 5MEPA 1BVZA 1Z3GH 2QQNL 4PJXA 1ND0B 4E41D 3D0VB 5J12C 5L88H 5D6DC 2NY1D 3TIEB 4C58B 5D1QD 4WEMB 3WFHB 2IQ9L 4X7CC 3TNNB 4OCXL 3OHXB 2ATKA 5F3HB 5GS2D 4JRYD 4GG6E 3N50A 2ZG2A 1XR9B 3I50H 4GG6F 4WU5A 1ERNA 4YHPA 2GIYA 4DQOL 1E4JA 1A1OB 4WUKH 5IM7B 4ERSL 1VCAA 5JZ7D 2FJGA 4EI5A 4HIXL 1B88A 2QEJA 4Y4FD 1A14L 2F58L 1CICC 4HHAB 4DK6A 5IVXE 2BVYA 2VZTA 1PG7W 3JV5A 1WFOA 1Y18B 1N6QH 1N6VA 3IFOB 1YQVH 3GSXA 2XKUA 2X89D 1UVQB 1A8JH 4BSWA 3P30H 3ZDXE 4WI7A 5GRVL 1EZVY 3ZDXF 1KBGL 3IXTB 3BKYH 3U9PH 2M26A 1TCMA 3SGDI 3WLWC 1BBDH 2EC9U 3SKOB 1JPGA 4CGTA 5IHUL 2YXFA 2VLKE 1WIUA 3BQUC 3HE7C 5E9DB 2P8MA 3STZB 1UM5L 3HCVA 2DQEL 1SYSB 4DCQB 4EDXA 2F8VA 1ZSDA 2A77H 3S35H 1K4CB 4AQ1B 3A6CH 4K71C 5CIPB 2R56H 3HC3H 2F54A 3ARFA 2B2XH 3FN3A 3QQNA 4Y4HA 2Q6WB 4XH2A 3WEXA 3D3VE 5F7LB 4KC3B 5JDJA 1Q1JH 2O61B 4KTEH 3GSNB 5EUOA 3EAKA 5T3XE 3CZFA 2Z31D 3TT1H 4ELME 4XP9L 3X3GH 2R4RH 4ELMF 3SY0B 3DVFA 3V4PL 4S1RL 3GI8H 5IOPA 5TDNA 4R8WL 1I9EA 2NY2D 2VXQL 3FT2A 1FAIL 3GNML 4KQ4H 5FO7B 3HA0A 3X17A 4PJ9A 2J6EH 2Q87A 4HBCL 2GUOA 1CDGA 4LLDB 4Y16D 5ANMA 4JZJC 1NCNA 2IMMA 2H1PL 1T5WB 1J8HB 3ROLA 2EDHA 2VZ1A 2Y25A 3UTTB 3BESR 1D7FA 1IM3B 2W9EL 4JHBA 1S7UB 1T03H 2NXZB 2UUDK 2OI9C 3TN0C 2IMNA 4OZHA 4BM7A 2HN7A 2CDFA 3NPSC 1A9BB 1ZWIA 3DYPA 1HYSD 4X6DB 5J11B 3ESUF 1YQ2A 3TWCL 1BM3H 4CBPA 1OGTB 3FFCA 2ERJC 1FC2D 5FA3B 5CD5C 5FYJE 4HJ0D 2AJUL 1T1XB 4GRLA 4M7LL 2IPUK 3BUTA 4HUVB 3GJEB 5F7EL 1I8IB 2BVOB 2YPLB 3S5LG 5CGTA 2R0LH 4K3DH 3DRTB 1E4WH 1QFWH 2WINA 4JPWH 3RTQC 1N8ZB 4GXUN 5JLZA 3H0TA 5IJVB 5INCB 5ABDE 1U8LA 4KI5D 4KJWC 2FJHA 3C6LD 1JFQL 2P24A 2X09A 4I3GA 1AP2B 4L8BB 1LO2H 5DURD 1CFTA 1A6PA 3LMJH 5D1ZA 2XPGA 3EOAB 2FGWH 3LKNA 4ZTPH 4XXDA 5IBTL 1HOCA 2UVEA 1BVLB 1IGMH 3KPTA 4PGEB 4ZOBA 4XNMB 5F1IA 1V3LA 4K8RH 1UCBL 3MXVH 4K9EL 5J7CC 1DBJH 3Q2CA 1S7VB 2VDML 3MRDA 3VDBA 4K94L 3GMLA 4OFPA 3VA6A 5DS8A 4QYOA 5KTEL 1JNHB 3RGVB 5EORH 4EIGB 5DJZB 1RZJC 6FABL 2P5WD 1IEHA 1UM6H 2BRRH 3L5XH 2PETA 4Q7DA 3GJFA 2MHAA 5JORA 4JQVC 2LAAA 1CL7H 2IAMC 4ESKA 3DXAA 4G6JL 1K8IB 4RAVA 5CJQH 1A1MA 4LSSL 4XVJL 1E6OL 1CIDA 4LGRB 1DN2A 2FBJH 3MRQA 1FH5H 2DLFH 1LGVA 3G08B 4HUWA 2BY3A 4ZYKB 2D03L 3H3PL 4MA3A 5FUOL 3VGFA 5F97E 2VR4A 4W4NA 1C12A 4URTB 5HDLA 5EZIL 4MVBD 2NNAB 1EV2E 3DO3A 2O5ZL 1MCOL 4Z0XB 4G7VL 1R24A 2O5XH 4O2EA 1CDJA 4OIBA 2V2TA 2BVPB 3MLUH 1IAII 1F90L 1LMKA 5C07B 3VRJA 1C5DA 2F8XC 2BVTA 3GHEL 4XGZA 1U8NB 1UEYA 5EOQH 5FM5M 4NSKA 1U8QB 4EQ2A 3MOAL 3NCYS 3ULVF 5IGXH 3IU3A 1D9KD 1BBJA 2HRLA 4G43B 1BQHG 1OL0A 3ALPA 5AWNH 2EH8L 2UZXB 4TVPE 4EBQH 4ZAKB 1W0VA 2VDLL 1U8HA 4HDIB 4LCCB 3BN3B 4YAQB 4U1JB 3SEPA 1J0ZA 3GM8A 4NM8H 43C9B 2GTZB 5IVZA 1U8KA 1KEMH 3OJDB 2YPKB 4IMKA 2C7UB 4XPTL 4Z78B 3U4BH 1S9XB 4JREB 3WKMH 1AH1A 1ZANH 1F97A 4NC2B 5ALBH 2O5YL 1LNUA 5JW4N 2Z91A 4KVNH 4BZ2H 3MPCA 1RZIA 5I1CL 5HI3D 2X1WL 1ZHLA 5D7LB 2VYRE 1LO5B 1FAKT 4CU6A 4BJLA 3MRRB 1QG3A 1DBKL 2DI7A 3L5WB 1DVFA 4CN4A 5JUEH 1NCCL 3EFDL 3S37H 1M05A 5IBUB 3TJEH 4IIQB 3KPRE 3T77B 25C8H 3V6FA 3REWA 1T21A 3CC5A 4L3CB 2QSVA 1JWMA 1NEZB 3UTPE 3IVKB 5KANI 4P46A 1H3TA 4R2GB 3T2NL 5EU4B 4LASL 1YNTA 2YSSA 1LDPL 3KLAA 3JWOL 3O4OB 3GSNL 4MXQC 5CSGA 4JM4L 5BZDB 3SDYH 1U93B 3RVVD 1TVBA 3BN9C 1F8TH 3U6RA 4LCYA 2YMXL 1CLOL 4TSAL 5HBBA 1TJHH 3N06B 5ESAB 2VN7A 1E4KC 4J3VA 3Q6FB 5FHAL 2GTWB 3T4AA 2DF3A 1DBMH 3QWQB 1AQKH 2A38A 3FJTA 4FXGA 4NYLB 1L7TH 5FCSH 2HLAA 2D7OA 4FZEH 2DLTA 3J7HA 1U8IB 4WTWA 3R8QA 5CUSL 3MGAA 3V5KA 1G7LB 1G7HB 3S34L 5T5NF 4MB5A 4XZUA 3CXHK 3QUZC 3RIFK 1B90A 4PGCA 3VWJA 3V6OC 1KB5A 3TZVA 5HGHB 4OQTH 2VWEE 3KLDA 4MD5A 2ADJB 2FSEA 1X5LA 1MHHA 1Q8MA 4PJXB 2Q3AA 4FXLA 1JGDB 4W6XB 2DQJL 2FYYA 3V5HA 4YX2L 3AVEA 1VKXB 3JWDH 3GK8H 1QACA 2EE2A 1CXLA 1YEIH 3M8OL 1D5ZB 3SGKA 2D2OA 1W72H 3CAFA 5FFLA 5I16A 1MFDH 3VWKD 4F2MA 5F21B 1SY6A 3TVMB 1PVHA 2B0SL 3PDOA 2ATKB 3QHZL 1SBSL 5IIEA 3B2VL 4NGHH 1KFAL 4X5WB 3QNXB 2FEDD 4FQ1L 4WU5B 3ZKMD 1DE4A 1KJ2A 3TV3L 4L4TB 4QHNA 2FJGB 3PWNB 4POZC 2DQIL 5BVPH 2F74A 2DM3A 1HE7A 2PCPB 4YLQT 4ENEC 5TDOA 4Z7WF 1G9EA 4CNIB 4NZTH 4BSWB 2AJXH 3OKMB 4OI9A 2DQCH 1E6JL 2DAVA 1N59A 2VERN 3DHJA 3WFCL 2C3XA 1KN2H 1CFVH 4AENA 1Q9WA 5C0RH 3VGHA 1FZOA 4RGNB 2PYEB 2OR8A 1ZSDB 3D1MC 3JWNC 2XN9A 1Q9LA 2FEEI 4MAYD 4HFUL 1BFVL 4L1DA 3ARFB 4DKEL 4LCWB 4Y4HB 5MP6L 3WEXB 2HFEA 1NCDH 1XF1A 4QRPA 4KJYA 5EUOB 1YEHL 2NX5B 1XEDA 3SGEI 1BGXL 1OTSC 4YJZL 4X6EB 3QDME 4RMSA 1TTGA 2PTUA 3VDCA 5T1LA 1RURL 3LRSA 4IOIA 1H8SA 1WZ1L 5GS0H 1LK3L 3FT2B 2ITCA 1WISA 4GKZA 4OZ4A 5I1IL 4J4PA 5IBLC 3SDDC 2H9GA 1PKOA 5CD3A 4JM2D 1NDGA 1WK0A 1T20B 3MRPA 3VE0A 3NCFB 5FUCE 1U8PA 1VFBB 4OV6F 3B9KD 4G6AC 5IF0B 5L8JB 3GI9H 3BO8B 1GAFL 2HN7B 3BD3A 5BRZB 2YZ1A 1T66D 4X6CE 1C8PA 4X6CF 3T0BA 2NMSA 3FT3B 4ZS6D 3ZL4L 3W0WB 3MRGA 1XGUB 4K3EH 3FFCB 4KMLB 2J4WH 1OTTD 3NTCH 3WXVH 4ZFFB 32C2A 1LE5A 4NNPL 4L9LA 1QSEA 5I1GL 1A0QH 4NNXB 4LL9A 1JMXA 2WK2A 4U05A 1I9JL 1G7JA 1RULL 5CCKL 1NFKA 2E9BA 1YMME 3PABB 4HG4K 5JLZB 3EYVA 2ZUWA 4J3TA 2Z35A 3I6KA 3BJ91 1ACYH 4XVSL 1JF1A 3S6CA 5JMRA 1TETL 4X7FC 1MWAH 3L95B 5HHVH 1CXHA 5EFIA 2Y72A 3LKNB 1FYTD 3VW3L 3DYMA 1XMWA 4Q9RL 2X9YA 4HIHA 3TBVA 2QV2A 2N7AA 1P6AB 4HWEL 3JVGC 5IMMA 5KVFL 4KPHL 1AO7A 4CADB 3EYFA 3HC0B 5ERWA 3OSKA 3G04B 3QIBB 4QYOB 1XF4A 1R3IL 5FKAB 1FIGL 4RWYH 4AMKL 3OR6B 3ARGC 1R5VB 4K9EC 5L9DL 3DVGB 5JORB 4K94C 3QQ3B 4RAVB 1A1MB 4HFWA 1QBML 1NCAL 4FQLL 3RAJH 3MRQB 3SDXE 3MBEA 4ZUTA 3SDXF 1BFSA 3IJSB 4JO1H 3V8CA 5SWQB 1B2WL 4KXZI 2G5BA 2H2PC 1P7KB 2JJTC 3ZDZE 4OM1L 1NPUA 4OZHF 1C12B 4FG6D 4R0LA 4XB8A 2A6DB 3ZDZF 4HUNB 1DFBH 4GW4A 2NY1C 3BDYH 1XH3A 1IBGH 5JHDE 5T3XH 4HULB 4ZNEE 5BW7C 3T0AA 4YHIA 4WFHE 4XP4H 5D1QC 2VLRB 4KKLC 1ORQA 2NY0D 5ACZB 4ZODA 4O2EB 1RV6X 1TPXB 3O9WD 4CVZA 2W91A 2MCPL 5IW6A 3QPQC 5GQBA 2BFVH 5FYKD 2OJZH 4CMHB 4AM0B 4NSKB 4JFZH 5AZ2L 4J8RB 2FZ3B 4OT1L 3IU3B 2GI7A 5C08A 4JHAL 4Y4FC 5ILTL 3D39D 4E41A 1B4JL 4U1MA 3V0VB 3U7AA 3HPJB 4IRSC 3MJ9A 1NCTA 2NY5L 4XMKL 4JQXA 1VGEL 1W0VB 1AE6H 1YECH 1U8HB 4U6XB 2XKNA 5D2NC 1MAMH 3UJIL 4O9HL 1DBAL 3V8OA 3UTQA 4NN6C 4E5XB 4HMCA 1S78C 5IB2A 5FYJH 3PIQA 5T1MA 1INQB 3UPRB 2BCKB 5GSVB 3FONA 4YUEH 1PJ9A 1NAML 4HJJL 1T7VA 3QDGD 4LNRB 4ZTOH 4Q6YA 1ZHLB 2WLZA 3D2UD 1OD9A 3QZWB 3H9HB 4MJ4A 2DDQH 1A7NL 5C0JA 1N0XL 1H3XA 2AP2A 3I3BA 4UAOB 1X4YA 2DKSA 1H0DA 1SYVB 1YYLH 1DVFB 5KSVB 4UZGA 5J9PB 1XZ0A 3FMGL 1QLRA 2X4SA 3R06A 4P2YA 5B3NA 2ZOLA 2AEPH 1JGUH 3RWIA 1KC5H 3V6FB 1RZ8A 1M6OA 1T21B 2WUBL 5GPRA 1JWMB 5SV3A 1KPVB 2VRAA 4JN1H 2JIXD 2DLEA 3L3KB 4P46B 1UM4H 1FC1A 4YEEA 2ESVB 3H9SA 3KLAB 1KULA 3UC0H 5EO1A 4P23D 4XMPH 5B4MD 3MACH 1CD0A 1J1PH 2AQ3A 2Z31A 4JDZA 4OAWB 1JZ2A 4YHZH 3OKNA 4Y19A 4G8GB 2DIJA 3E6HA 1FO0H 5E00A 1GXEA 4X7EC 2P7TA 4YQXH 5TJWK 4HJ0C 4L3EB 4WJ5B 3JWOC 4ZXBD 5C2UB 4Y16A 1OSPH 4OGYL 2K9UA 3O6MH 2CR3A 5HJ3B 3FHQA 2RJMA 1NGWA 2IALA 1DP0A 3RA7L 3N85L 5TPWH 4YWGH 3TH2T 2XQBH 5CWSA 5EIVA 1TJIL 3INUH 3V5KB 1ZMYA 4JPKH 1MIML 2FIRT 3NA4A 4MDJB 1AY1L 3G9VA 1JGEA 4RFOL 4ZDHA 2APTA 4JLRA 5HHOB 4C55A 5KG9A 4GXVL 3VWJB 2NY7L 4G80B 4MNGA 3TZVB 1ULVA 1DANU 2MOVA 3BRFA 4MD5B 2J5LC 2NXZC 2FSEB 1KT2A 1WCBA 5GGVL 1UJTA 2EH7H 2FYYB 3ZT6A 4DUVA 1SM3L 3MJ7A 1P4BH 1FE8H 3ULVH 2HA1A 3VCLA 2FD6L 5DR5L 5I1AA 5E1AB 3RL1B 5KS9A 4U3XA 3O2DH 5IEHA 3ZYIA 3QDJE 3H7BA 4N0YH 3PDOB 3QFJD 4TVPH 5C09E 3OXRA 5HYSB 3C6LA 2W60A 4LPUA 4TRPH 5F9JB 1GGBH 3BD5A 3ARUA 4OQ1A 5TQ2L 1IGFH 1NLDL 4OCYH 4DGYH 4QHNB 3VRLF 1IM9B 2WLYA 5J13B 4PRPA 2F74B 1GC1H 3MOQA 5TDOB 2VABB 4XPAL 1K4DB 2Q8BL 2J3SA 3RY6C 2HTKD 2DQFA 1JN6B 3VG0H 4JFYA 4ZOAA 3T2QA 1MH5A 1J1XH 1EZVX 3OKDA 5CLTA 5JR1L 4TQEL 3SBWA 5FYKL 1GCFA 2MQCA 2VDKH 2EXYD 2P5WA 3AMLA 2EIZA 4WW2A 5DC9B 4PP1D 5IFAL 3IFNH 4S1QH 5DEGA 5CAYB 3OF6D 4R4NC 2NLJB 1QBBA 2OL3H 2DQHH 3QUKA 2KH2B 1CYGA 4KJPD 4KJYB 3PWPB 3O6LH 1I8LA 3P77B 2XACC 4OLYL 4X4XB 3ZHLA 1IFHL 4WWKD 5CZXD 3SDCD 3QI9D 4J1UA 2B4CL 2RR3A 4P3CH 4MAUL 1U8MB 2AK4D 4NKIL 2MCG1 4Z7QE 1IC4L 4Y2DB 5GZOC 2D7MA 2YPVH 4IOIB 4QEGA 4LVHB 5TQ0L 1MJ7L 2ITCB 3RGHA 2Z92A 5LGHL 1BD2A 4JR9L 1MIEL 5A2FA 1JI1A 5CD3B 2EYTA 5F88A 2HJFB 1FVCB 5BS0E 3AM8A 3MRPB 2EYRB 3HAEA 3WHXA 2NTFB 1IAKA 3TBSA 1ZTXH 5EBLA 5DD6A 3RWHB 1K5NA 1ZE3C 2PO6C 4MJIB 2YRLA 4DFIA 4NKMA 4ODVH 5HI3C 1D9KA 1VHPA 5GHWH 1HNFA 3JV4B 4EDWL 3MRGB 4M7JH 4YDIH 1LILA 1P53A 1LE9B 4S0SD 3VFMA 32C2B 2CRYA 1H5BA 3V6OE 1LE5B 5D7IA 3DGGA 5D4QA 1MPAH 4NBXB 4X7DC 4OSUL 4K7FA 2YA1A 3VD7A 3LPGA 4XPGH 5BZWA 1PW3A 4IDJL 4RFNB 3IB4A 1JL8A 2V2WA 3DX6A 3UBXG 4QXUH 5KSAB 3GO1H 1FBIL 1BOGA 1KCSH 4ZAKC 4UB0H 3WHE0 1QNZL 4G6FD 4LCCC 3MRFA 2CJUH 1MCEA 2KKQA 3I6KB 4P48A 1KJ3L 3QISA 1V7ML 2YC1A 5JOFA 2XA8L 2FO4A 2F19L 3SKMA 1NGZB 4GSDL 4MDIA 5EZOH 3LEVL 5T5NG 3UTZB 3QT2A 5EFIB 4JREC 4UINH 1AD9B 3M1BA 2E7CA 3X11A 3D87B 3CSYA 5ID0B 3O3BA 3TBVB 1ADQH 4PRNB 1BQUA 5CINL 1TJGL 1AO7B 2P49B 5EBMA 5EBGA 3MODL 4HIJA 4W81A 4NDMB 5ERWB 2CKBB 3IETA 4WV1B 3RHWF 1I7RB 4MXVE 3N1GC 1RUMH 3KPNA 1NANI 5K93A 2RFXA 4XX1E 4GT7A 2GSIA 1FN4A 4M8VA 2LE9A 4OKVA 5T33L 5GGTL 3G5YA 5F72S 1Q9KA 3BRDA 4IIQC 3WDIA 5D7JB 5EU6D 3W2DH 2OQJB 1VSCA 2AJZB 2XTLA 4J3XA 4ZFGH 4CW1A 1TZGH 4R90L 1UC6A 3MBEB 1S9VA 4R2GC 2KUTA 4DOHE 2DBLH 4LIQE 3O4OC 4O5LH 2E6QA 2G5BB 2IGFL 4KAQL 4NKQB 2A1WL 5MENB 3CH1A 1CF8L 4WI6A 4FQIH 1KCKA 4GW4B 1XH3B 4X80H 2P45B 2WWKO 4YHIB 1QSFE 1TCRB 3AS0A 4YPJA 1J18A 3Q6GH 4KWUA 3MFFA 5HVGB 3L5IA 5E6ZA 2UY6A 3SN6N 2Z8VC 4JFOA 3VXQA 1QSEE 4FQJL 1F3JA 3QUMB 1MCPH 2FEDC 3ZKMC 5AUMA 1IT9H 4J6RH 4NC1C 3DO7A 1A21A 4KQ3L 3SCMB 5I15L 35C8H 5C08B 5DA4A 2F53E 1IAOA 5JO5A 5KZCB 1VACB 1T0PB 5K9KA 1XGQA 1OAKH 4MQXC 3SJVB 2F5BH 3GMNB 2MWCA 3B83A 2Y7QA 2H45A 3HC4L 3VWKA 2MPAL 3G5XA 3UTQB 3UJTH 3UCRA 2BSRA 4R9HA 5IHZB 5T1MB 1XGRA 4NHCL 1X5FA 2NY5C 3Q0HA 3W11C 5IB5A 3VXRB 1P7QD 5GRUH 1C08A 3MRHA 5DQDL 1IKFH 4L3AA 5JW4M 4MQTB 3ZYZA 1QPPA 3TVMC 4RGMB 2VDOH 3MLRH 1CU4L 5BO1H 2DQTL 5D6CA 2QSCH 3QSKB 5C0JB 4LOUC 2VOTA 1HHGA 4M5YL 1HQ4A 1WAAE 1XZ0B 1ZLWK 3HKFA 5JIKA 3G6JA 2ZOLB 4NQCD 2A0LD 5EO0A 5EG6C 3TBTB 3RWIB 1LK2B 5E8EA 1RZ8B 3R0MA 1M6OB 4MAYA 1CGYA 4HJGA 3CVIH 2HWZH 2OSLB 4RRPA 5C70A 1NJ9B 3MBXH 3HFMH 1QKZH 5EZJA 4PRHE 3FQWA 1H3PL 3MV11 3H9SB 1HWGB 1IQWL 1SJHA 5EO1B 1IAMA 1EHXA 1O0VA 4RGNC 3CFEA 2Z31B 4ODUA 3V4UH 3S9DB 4Z9KB 1T66C 3OKNB 4Y19B 1NCUA 3NCBB 3R8BB 1OAXH 1FFPA 1DBBL 5IMLB 2IWGA 4DUXA 4BZ1L 2P7TB 3X3FH 1KOAA 2R4SH 1VFUA 1BX2A 3ARBB 4LHQB 3KR3H 3DX7A 2ICWA 2P42B 2VSDA 4JFEB 1A3LH 2DQUL 1A7OL 1CT8A 1UZ6E 4JM2A 2IALB 1N5AA 4E41E 1BWWA 1UZ6F 1QR1A 3B9KA 3U1SH 1AI1L 4DVRH 2AV7A 5TE6H 4HGWB 1P9MC 4L8SA 2P5ED 4PB9L 3MR9A 1JGEB 3QNZB 4UIMB 4JLRB 2JELL 1KIQA 1AXSA 4JRYE 4I0PD 1OP3K 2ATPA 4RCAA 4MNGB 5AYUL 1NLBL 3ELAT 3HZKA 5EOCL 2WIIB 1WCBB 2GHWB 4LVNB 5IG7B 2IBZY 3PHOB 4RMRA 3WIIH 3QAZB 1IQDB 3GMOA 5DEFA 1FSKC 5D71H 1RZ7H 5CJXA 1T2XA 4R4BA 4RMVA 3KG5A 5IEHB 3H7BB 5D2NE 4LU5L 1KPUB 1A6AB 2W60B 3P2TA 4G9FD 2PTTA 1A47A 5ESVB 5ISZD 4DW2L 3AS2A 5DD5L 2EEAA 1EIBA 3RPIB 2ZKHL 4IRJD 4XAWH 1FYTA 1ZT1A 2CRZA 2BDNH 1AGFB 1MSPA 3B8SA 1KGCD 1EFXD 4PRPB 3KWWB 1AJ7L 3FQTB 3MV8B 4LCIL 2J8OA 3ZE2E 2W59A 1R3KA 1ODAA 1IC7L 3ZE2F 4U1IA 1ITBB 4G8EB 1CLYL 1LD9A 2XV6B 1LQSR 3S35X 4HZLA 3MLWL 4EKXA 2MKWA 1KXTB 3LKPA 2Q8AH 4DN4L 3HN3A 4G5ZH 4JFYB 4NBZB 5GRWA 1WBXA 3TCXA 2Z4QA 3G5VA 4B7IA 1U3YA 3OKDB 3RWDA 4OGAD 3QUXB 4GAGL 4OB5L 5JPMB 1PKQA 4XRCA 1OAZL 4XCNB 3GJFH 1IL1B 2WSKA 4DZ8B 2NY0C 4BH8A 2EIZB 4U6YA 1RHHA 2DKMA 5IMKB 1MY7A 2HTLD 1FLRL 4J2XA 1JHKL 1CG9B 1YJDL 3QIBC 4P3WA 4Y8AA 1DCLA 2IPKA 5E08L 3LV3B 4D3CH 4RDQF 4J1UB 3TNMA 5GGRY 2I07B 1JK8A 4A2MA 1FNFA 4EEEA 4POUB 1FRGL 4KUCD 1RZJH 2ZPKL 3OB0H 2MKLC 4OZIA 5DD1H 2Z92B 1H15A 4HK0A 1BD2B 1KLGA 5EULV 1RIHL 4Y5XA 1MF2H 1R5WB 4XPBH 2B4CC 2ZCKH 3O9WA 2EYTB 5F88B 1JCKA 1LO0H 4NQTA 3HAEB 3WHXB 3BDXA 3QUML 4XC3L 5EBLB 4HS6B 1NSNL 4WEUD 5DD6B 5C0ND 3FQNB 3KJ6L 3T2OA 5GJTH 1MCIA 4UOW1 5JW5B 4KK5D 1B6DA 1TPXC 5E6ID 3ZE0F 4KI5E 5KS9F 2EDJA 3FOLB 4WCYH 5TDPB 5JNYB 1J7VR 3D39A 4M5ZL 4KI5F 2Z8WC 3QIWD 4JANB 4JG1L 1NMCB 2XWTB 3DSFL 3VFMB 4LPVA 4CMHC 1H5BB 5D7IB 3DGGB 4TNWK 5F9DC 2BHYA 4K7PX 4YHYB 3GHBL 1N6UA 3UTTE 1T3FA 3CVHL 2GW5A 4FFYH 4K7FB 4LLWB 4DKDC 2ARWA 1UXSB 1UADC 2R0ZH 3WJLC 3WLBB 5IR1A 4H8WH 2V2WB 4KKCC 1BOGB 3BEWA 4LKCA 4X6DE 5IP4A 3BUYA 3NAAH 3VRIA 3MTRA 4YNYA 3IFPA 3WKNA 3QDGA 4OZFH 4EN3B 1JP5A 5IW1B 4UQ2B 5D70L 4TPRH 2YC1B 3D2UA 4DGIL 2CH8A 2FO4B 3PQYD 5IVNA 4YBQD 3HNSL 4P23C 3DVIA 4APQC 2V7NB 4XCYA 5B4MC 3NBNA 4WW2F 2Y1VA 3KPMA 5DZLA 3T08A 4LSPH 2GT9A 2HFGH 3O3BB 5TE7H 3T0ED 4JG0L 3GB7B 1PAMA 3OKEA 4JB9L 2CMRH 1IAIL 3U79A 4QOKB 4ZXBC 1YEEH 2Q20A 4X8JB 3QQ9D 4H25B 5FYLD 1NBYB 3IETB 3U9UA 1S5IH 2XY1A 1GGUA 1Z2KA 3NFPA 5F1KC 4QO1A 4KMTH 3RKPA 3WD5L 4PRDA 1ZHKB 3U36A 2NY6B 2QQKH 1O7SA 4WFED 3K0WA 1CZ8L 2BNQB 3ARPA 1CVSC 4I3RL 4O02L 4NCC1 5I0DA 1DLHA 4CW1B 1ACZA 3LHPH 4NFDA 4C4KT 2R2HB 4B41A 1RIVL 4WHDA 3FB6B 4AT6A 1GIGL 4HX1A 4FFZL 3OX8B 2C1PA 4H26B 4P2OB 4U7KA 5E8OB 3CH1B 4I2XA 4TULH 2BNRB 4JCMA 5DUPH 2NW2A 1F5WA 1YMHB 3TYGL 1ETZA 3LKOA 5GGSA 5C2BH 1CLZL 1F3JB 3MCKA 1KB5H 3OKKA 3WS6C 4HMDA 3MLXL 4PBWD 2X4RB 2MQ3A 3AMKA 1YY9D 3GDBA 1BJ8A 4QHLA 1RUPH 1GPOH 1S7WB 4WO4D 3C08H 4D0CB 3ARED 1IAOB 3SQOH 2L0DA 4PY7B 3RU8L 4HH8A 4X4ZA 1UZ8A 1XGQB 4H88L 3F7VA 3HZMA 1FZMA 2AJVL 3F7YB 1SY6H 1F4YH 4KY1L 2Y7QB 3VWKB 3G5XB 3C5ZD 3V5DA 3O3EB 3QFJA 1X5KA 1O7VA 4RGOH 2QHLA 4F37F 2ZOKB 2QHRH 1KJ2H 5E2WH 4PP1C 3WUWG 5IB5B 2VB5A 4ZUSB 1C08B 3MRHB 1YC8A 4A6YB 4M6MH 3RUGE 4HF5H 4KJPC 1U91B 5D6CB 4NT6A 3RUGF 4K07A 5CJBA 3B3IB 3QI9C 1CE1H 4NPYA 2QQNH 2PXYD 3BZFB 2DYPD 3SGJC 4NQEA 4LSUL 1ONQB 4P9ML 2EO9A 5F1SA 4N90D 1JPTL 3L7FB 2IQ9H 1FNEA 4OCXH 3OF6A 1AGBA 4ZPTA 1TNMA 5DJ2B 5EZJB 4KK9D 4QF1A 1QYGL 4DQOH 4ERSH 4WWKA 2OJEA 4P2RD 1ZGLB 5DJXA 3LKSA 5I17B 4TNVK 3SDCA 1IAIM 3EOTL 4FTVD 4HIXH 3GIZL 2NTSP 1A14H 2F58H 1QRND 5IJKA 4GBXA 4YBHA 5CMAA 3QR2A 1BX2B 4UOJA 1QO3A 1RU9L 5FA4B 1KBGH 3OGCA 4M3KB 2ICWB 3JXAA 2NY4B 4MX7B 3EFFA 3HNVL 1M7DB 5IHUH 1FYHB 3QP3A 4Y2DC 4JEGB 4P59L 1UM5H 5F70A 2OX5A 4LIQH 2DQEH 3RDTA 2BNUB 4FQXD 4WHTB 1QR1B 3IKKA 2XOTA 3H3KA 4Z5RA 3O0RL 3T2PA 4LAJH 1GRWA 4XX1G 4L4VD 4ORZC 2K1MA 3L6FA 1KEGL 1CGSL 3KPOA 2AEWA 1M4KA 1OARL 4UNTA 3ARXA 5IKCB 2ATPB 1BP3B 4CN1A 3ARDA 5FYLL 3CFJA 4PJBA 4XP9H 4NC1E 3UJJL 2ITDB 4HPOL 4U1NA 4S1DD 3U82B 3V4PH 4YDKL 4S1RH 5FHBL 4R8WH 1EAPB 2VXQH 4H0GA 1FAIH 3GNMH 4WFFE 5B38A 5F7MC 4HBCH 4OF6A 3BP4A 5LGJB 1T80A 5DVLA 5LAXA 3NIGE 1L4IA 1MOEA 1MI5B 2H1PH 2PTTB 2VDPL 2V5MA 2ZNWA 2W9EH 3G6JE 1YEFL 3G6JF 1U92A 5C92A 5KSAC 1TIUA 1ZT1B 1R3HB 2J8HA 4PJ7E 1X4XA 2P8PB 3GMPA 3DBXA 4YFDB 4PJ7F 3V95A 1JZ5A 3IF1A 3TWCH 1INEL 2ZUXA 3F7PC 5DDHB 4OCRL 3NIDF 4U1IB 4PJIE 5KJRL 1S7SB 2JF1A 2AJUH 3DX9A 4HZLB 4D0DA 3LKPB 4PJIF 1WBXB 1FDLL 2H32H 4M7LH 3ETBF 2Z4QB 2PYFA 3G5VB 2BY0A 3OAYH 5F7EH 3RWFB 4D0BB 4XRCB 4C56E 3B9VA 4L4TE 4M7LT 4QRTA 1HIML 4QRRD 4BH8B 1YC7A 1RHHB 2EDRA 2G75B 1XIWD 5EU6A 3CDCA 4R7DA 3UEZA 4QTHA 1BFOA 1JFQH 1UKQA 4P4KB 4WV1C 3NCJL 3L1OL 3KAAA 2IPKB 4JZOA 4JM2F 3C2AL 1QBLL 2A83B 3PWUA 4EUPA 5IBTH 5EC1B 3TNMB 4OF0A 2DIAA 1JK8B 5D7JC 2PYEE 4I4WA 1RIUL 3H9ZA 4JKKA 3RL2A 1UCBH 4K9EH 4LCWE 5E99L 4U31A 5D5MA 2VO5A 4Q97A 1H15B 2VDMH 4Y5XB 3FO1B 4Y5VA 3OWEA 4K94H 5C0AD 3WIHL 1EUTA 2YKLL 5KTEH 3O9WB 3I84A 4MMXC 1CGUA 4HUXA 4GAJL 2AJYL 6FABH 5LXGL 3L3DB 2H41A 2Z8RA 3QULA 4DJMA 1EPFA 2AV1A 2W0FA 4G6JH 2FWOA 3WJJC 4O51B 1WLHA 4LSSH 4XVJH 1E6OH 3VGAB 2P47B 2B1AL 1OWRM 2BVEA 2UVFA 4U1KA 3WFBL 3W9EA 1CS6A 4GAYA 3WN5A 1EERB 2D03H 3H3PH 5IB4A 4AG4L 5FUOH 5ETUB 3FB5A 5GS2H 3SCMC 4BKLA 3LPWA 2DLGA 4F7CB 4NQUA 4KRPD 3MOBL 1MJUL 5EZIH 2X4QB 4NUGL 1QSVA 5E6YA 5BRZE 3D3VD 2O5ZH 1MCOH 4PTTB 3BEWB 2MTPA 4G7VH 4JDTL 4LKCB 1N5YL 2GJ6A 3W0WE 2HRPL 3MLSL 3IFPB 5JDSA 4U3CA 3UTSD 1LDSA 1F90H 5T3XD 4A6YL 4JKLA 2EDTA 3NH7L 5FV2A 5I75B 4DKFL 3GHEH 5JA9A 2DD8L 4N8VA 2QR0A 3QEHA 2X4NB 4XCYB 5JXAL 1AHWA 1Z5LB 1OGAB 2LABA 3MOAH 3HR6A 2GFBB 5C0BA 5HYQA 2W0PA 4PJ8D 1NC4D 1UACL 2NW3A 2GT9B 5F3BB 3AS1A 2EH8H 3OPZL 3ABZA 3M07A 5D7KE 3HTLX 2ED7A 4RGMC 1CFQA 4NQCA 4PV8B 2VDLH 2NR6D 4EIZC 1JNLL 1MCJA 4CKVX 5DJ8A 5F6IB 3UZEA 1CGVA 4F9LC 1RUQL 5GIRB 3CVHA 4R97B 2X42A 3VD4A 4XPTH 5HYJD 5C71A 3CXDL 5J3HD 3U4EA 2OTUA 3QFDB 4PRDB 5F1OB 3U36B 2O5YH 4OD1L 4OZIF 3I75A 5I1CH 2NQCA 3IKCA 1UWGL 3DROA 4LKXA 2XICA 3HI1B 3VXOA 3M17B 1DBKH 5FYKE 1G6RB 4IHOA 4O58L 4QNPE 4P2QE 4QCIA 3AB0B 4PRBA 3LN4B 4HX1B 1MHPL 2VL5A 3KPLA 5I6XB 2C1PB 2IANE 3LKQB 1NCCH 4I2XB 3EFDH 1N3NA 4PYGA 3KLHD 1OP5H 3CU1A 3WBDA 3WS3B 2E6PA 2NW2B 4PB0L 4UV4L 2GAZA 3EO9L 1ZEAL 3KYOB 5JHLL 3TH4T 2YZ8A 1KIUA 4JPVL 5EN2A 2VZOA 3U0WL 4LEXL 2BVQA 4UU9A 4F7TA 1NFIB 3ARBC 1Z0MA 4GLRH 4DK3A 3UDWC 3T1FB 2P5EA 4NHUA 3MCKB 3OKKB 3T2NH 4KH2A 1G9ML 4XXCC 4LASH 4MNQD 1U3HD 5E1HB 3CPLA 1LDPH 2FB4L 2VLJD 4I0PA 4NQSA 3JWOH 1HILA 2FR4A 4QHLB 3GSNH 5L2KD 4JM4H 3MRJA 3MA9L 4D9LL 3SDAB 4OIAA 1L6ZA 3MRBB 4MHHG 4RDQG 3VH8A 2YMXH 3S36X 1CLOH 4TSAH 5T1KB 1G84A 5TH2A 5C9JB 1NC2A 5FHAH 4H5SA 4Z7UB 3DURA 5IQ9A 3VGDA 43CAB 2W0LA 3WHE1 4OGAC 3C5JB 2ZJSL 3R1GL 3V5DB 3TIDB 4XCFL 1CGXA 2J6EA 5F8RC 3QJHB 3QIUD 3QAZC 5CUSH 3CLEL 1EXUA 4LPXA 4IRJA 4NRZB 4YHNA 4JRXE 5DQJA 3DTXA 3S34H 1EFXA 2CUMA 2XY2A 5JXED 4FQPA 3KPSE 4FFWD 2FH6A 3MFGB 2YD7A 4P5MB 2DQJH 1YEJL 4YX2H 1D6EB 4NQEB 1F4XL 3WNMA 4V1DB 1C1EL 5KVGL 4XBGB 4JJ5A 2OMNA 3M8OH 3V6ZA 5F89A 1S7XA 4JAMA 3D85D 3HRPA 1FNEB 3QEGL 4PGJA 4KDWA 5F9OL 4NQXA 1AGBB 1ZA3B 2B0SH 4UDUA 4S10A 3QHZH 1SBSH 3NZ8B 5GJSL 4HMEA 3B2VH 1KFAH 5HHMB 3QUXC 4FQ1H 1MCCA 3BH9A 5ITBL 2UZIL 4GQ9L 3T0WA 1FVDA 2OJEB 3TV3H 1KG0A 1ZOXA 2DL9A 5DJXB 3SDCB 4KK5C 2DQIH 3D9AL 4HKZA 3RVTD 3THML 5TE4L 3QIWC 2YUXA 4GBXB 3BJLA 4Y4KD 3OKLA 4DKAA 5CMAB 3GUTB 1QO3B 4XHJD 1DQML 1YPZA 3VFWA 1E6JH 1JGVL 3OGCB 2J88L 2WWMC 3WFCH 3C8KA 2C3VA 2ESVE 4IBLT 4UILL 3EFFB 5FYJU 2OR9L 1ZGLM 4LLMA 4PGBA 3RDTB 2V7HB 1LP9E 1PX4A 2VQ1A 1EBAA 4HFUH 1BFVH 1LP9F 3RVWD 4Z5RB 4DKEH 5KOMC 5MP6H 4BK4A 1X7QB 2ZUQB 1RK0A 3NACL 5E6IA 1HXMB 5E8NB 3DVNA 1BZ7B 3IYLW 5FM4A 1YEHH 2VJXA 3ARDB 4AQOA 1BGXH 4PJBB 1S7QA 1A1NA 3UTOA 4OLUL 3T0EC 2D4FA 1RURH 3EW3B 1UKTA 4ODXA 1MVUA 1WZ1H 1LK3H 4HWZA 5C0CE 4AEHL 5I1IH 3VFNB 2IBGA 3MRIA 2VDNL 3AFLA 5HHOE 3PV7A 1U8OA 4ETQA 4YHYC 1F58L 2AI0L 3PQYA 4BQCA 4FQQB 4N1CA 1JYXA 4DUWA 5BV7B 4NQDA 1NFDE 1G9NC 2HT4C 4PJ5B 1NL0L 1GAFH 3H2WA 1NFDF 3GMPB 3OJ2C 5CJ5A 4EQ3A 3ROOB 1T1YA 5DK2A 2X6MA 2MQ0A 2WBWB 3TJHD 3TPKA 3ZL4H 5D1XC 4EN3C 3FHAA 1IZJA 2I9TB 3DX9B 4HAGA 4HS3A 3BYTA 3QWRA 4NNPH 5C0GB 4JFXA 1Z9LA 4PV9A 4RX4D 2CDGB 4J23A 4ZO6A 1ZXQA 3BE1L 5I1GH 5EU5B 3C60D 4JHWL 3E6FB 2AK4E 4OZGA 1K2DA 5DMKB 1I9JH 1RULH 4JY5L 5CCKH 2J8UE 2Q3ZA 2J8UF 2QADC 1L9NA 4FHBD 1BJMA 4UBDD 2A9ML 2PW1A 4RA3A 2A6IA 4RISL 5EUKA 3HG1D 3SKJL 1TZHA 1OTUC 4MGXA 4QTHB 3TO2A 2X4PA 4P5TA 1ZHNA 1EEZA 3RKDC 3ZT5A 2ADIA 2QQLL 1K9TA 4XVSH 1TETH 5F96L 4YFLF 4TYUA 3GBML 1HZHL 5TF0A 5JOEA 4EUPB 3PWUB 4KVCL 1G6RL 3VW3H 1T83A 4ZSOB 3AREC 3MO1B 3U0PA 4Q9RH 2EIBA 3S3PA 3ARQA 5E95B 4HWEH 3GSWA 3O6FD 5KVFH 3IJHA 1NBZA 3RL2B 4KPHH 1MFEL 4MS8C 2YBRA 5J89A 5ESQA 1L0QA 4LQFL 1Z0NA 3C5ZC 1MHEA 1R3IH 1FIGH 4HUXB 4OLZH 4P2OC 4AMKH 1KJMB 2XWJB 3X14B 1S7TB 2YUVA 1DL7L 4PP2B 5C6PB 4PRIE 5L9DH 4NKDA 2AV1B 2W0FB 4Q0XL 2FWOB 4KKBD 2OBGA 4WO4A 3VU2A 1IGIL 2I5YL 1QBMH 3W9EB 2I9LB 1T7YA 5C6TL 3P9MB 1NCAH 4FQLH 1JWSB 4GAYB 2XFXA 4CMMA 3WN5B 4XVUD 3UMTA 1F3RB 5DF0A 1MUJA 3BHBB 4N5EC 1EA9C 1B2WH 4Z8FL 1HHKA 5FGBA 4OM1H 3CX5J 2VISA 4MJIE 3ZE1E 2Y5TA 1FL3A 4I5BB 3ZE1F 3DLQR 4ZFOA 5DHVA 2OTWA 4Z18A 3U30C 5H94A 2GJ6B 3SE3C 3BVNA 3A6OA 1I3RA 4Y1AD 2MCPH 4KK9C 5JW3L 4WHYG 1ZS8B 2EYSB 1G7PB 1T2JA 4PGDA 1P4IL 5AZ2H 4MA7L 4OT1H 4HS8L 5C0BB 1MRDL 4ODHL 2PXYA 4JHAH 5ILTH 3RZCB 1B4JH 3U4AA 4L8DA 2NY5H 1GGCL 1GZQB 1CFQB 4XMKH 2LTQC 4BUGA 1VGEH 3QRGL 1MJJA 3QEUA 3UYOD 5C7XL 2RB8A 5DJ8B 4M3JA 4ZPVA 1M1SA 3UJIH 4O9HH 1IEBA 1IKNC 1DBAH 3L5JA 4PJAA 5AD0A 2XKSA 2WUCL 1ZVSA 4DWHA 3QXTA 3GKWL 3RWEA 1JHLL 2UWEE 3KHOA 3U4EB 2YD1A 2UWEF 4YK4B 4KKAD 4P2RA 1NAMH 5D5MF 1UWXK 4HJJH 3I75B 3RWJA 4Q9QL 3GSRA 3LZFL 4KKNA 3IKCB 4FTVA 3DROB 4LKXB 4DEPB 5HI4D 3DMMB 1WFNA 1A7NH 1N0XH 3N1FC 2PKDA 4E9LA 4RRPG 4PS4L 4PRBB 2D31B 1H3WM 5CHNA 2VL5B 4S1DC 4GW1A 4TUJA 5FOJA 5IT2L 3FMGH 4L8CB 2HKHL 2HYMA 5AAWA 1N3NB 3FO9A 5I74C 4U6HB 3EZJB 4NKOA 4FQXA 1T1ZA 8FABA 2WUBH 4JVPA 4HD9A 2WBKA 3VFPA 2A6KA 2BVQB 4LCUA 4L4VA 4NHUB 2EXWC 2NY4C 4NQSB 4I0PB 5D2LA 2FR4B 1JPFB 5ALCL 5JA8B 3QUYD 1CICD 3DV6A 4OCNC 5I1KL 5MI0B 2VMFA 3WFEL 3OAUL 5HGAA 2HAZA 4G8IA 3STLA 3TH3T 4GRMB 5SX4H 4JPIA 3HLAA 5IB1B 5TH2B 4XP1L 3OGOE 1NC2B 4H5SB 5IQ9B 4IOFD 4DVBA 3HE7D 4OGYH 2EDFA 2CIKA 3WL9B 3RA7H 3KGRA 5M95B 3QQ4A 3N85H 3MCLL 5EU3A 2HJKA 4M1CD 3HPLA 1EXUB 1MCDA 4YHNB 2HVKB 4KHXL 1TJIH 4OLVL 1EHNA 1MIMH 3LEYL 1Y6NR 4M4PA 3S5LB 1EFXB 1AY1H 3SJVE 3GMQB 1HHHB 5B8CC 1EMTL 1OY3B 4RFOH 4JFDE 4GXVH 1NKOA 2NY7H 3K8MA 5GS1C 1G7QA 1F11A 4NO5A 5JHDD 1YN6B 3VFTB 3PL6B 5HTSA 4XCCL 1KUMA 2B5IB 5GGVH 1PG7X 1NEUA 2AK1L 1SM3H 1XGTA 2VDRL 2CIIA 5ELIA 3O11B 1J5OL 3K81A 2Y06L 5FDWA 1HSAB 2DIBA 2FD6H 5F89B 4QRRA 5DR5H 1S7XB 2YN5A 5DK0A 4FP8L 3VFVA 1XIWA 3IDMA 4YDVA 4NQXB 4I48A 5C0EB 1CFBA 3TN0D 5TQ2H 3BH9B 5J1TC 2APVA 3LQMA 3OG4B 1FVDB 1NLDH 2LU7A 1JYWA 1RY7B 4HKZB 3D25A 4M9OA 1MWAA 4UMGA 5CD5D 1ZKAA 5CKAA 3SQBA 2P5EE 1HQRB 1X44A 4XPAH 3OKLB 4P4KC 4IM8A 1MELA 2Q8BH 5KVEL 1Q72L 1A9EA 1RHFA 4QHUA 4S1SL 3RWCA 3VFWB 5C0AA 3P4MA 4M1GL 4RAUA 5EPMA 4GFTB 1EHAA 3C8KB 2C3VB 3HUJB 4M62L 5HHNA 4TQEH 4BQ8A 3HMXL 5JR1H 4KRPC 1P5VA 4Z7VA 5FYKH 2JKXA 2E27L 3FZUD 4NO0D 2KZWA 2BSSA 3ZKXC 5IFAH 1DEEB 5C0FA 5IVXA 2GK2A 2IADA 3B6SB 1V3KA 3RWGA 3BGAA 3GGWA 3QCUL 3ZMRA 4HW6A 3HMWL 4G9FE 2CUIA 4OLYH 2CRIA 2R0KL 3WV0A 5ISZE 1IFHH 3EJZC 4JFEE 1XCQB 5DRWA 2B4CH 3PP3H 4JHZA 4OFVA 5LGKA 2D0HA 2BY1A 2HLFC 4MAUH 4NKIH 1IC4H 4GW5B 2XTJB 1KGCE 1XCTB 2AXJA 1ZLSL 5CILL 1A3QA 2X4TA 3VGAC 4HWZB 5TQ0H 2VAAA 1YY8A 3I2CL 1MJ7H 4NWTL 1C5BL 1Z6JT 1OF2B 3D3VA 4MD4A 1NQBA 5LGHH 2BJML 4JR9H 1MIEH 4M6OL 3S4SG 3MRIB 3O45B 1BQHB 3DNKA 4ETQB 3UTSA 4NRYA 3WXWL 1D5BA 4L5FL 2QLVB 1ZGLP 5I66A 1LEGB 4POYA 4G42B 4NQDB 1UWEL 3UYRL 4B50A 4BSVA 3L3GA 4JFPA 4RA0C 2Q86A 3F8UB 3P4NA 5AZEL 3QXDB 2HVJA 4LARL 4XTRC 4PJ8A 1NC4A 5DK2B 4EDWH 3NCEB 5DVMA 3FQUB 2G2RB 3EO1A 4U33A 1RPQA 1UGNA 3WO3B 3U7WL 5I75C 4KDTC 2NCMA 4NZJA 3L3OB 4Y5YC 2CPCA 2ARJA 3SE4C 1LHZA 4PV9B 4WUUB 4QGYA 4GKNA 4OSUH 4BFGA 3QCVL 1NGPL 3KJ4B 3JV6A 4FOMA 3GIVA 1GGIL 5HYJA 2BOBA 4IDJH 4KUCF 1FBIH 3MV8E 5HGBA 5EUKB 2C26A 3P4OA 1QNZH 5F6IC 4LEOB 1TZHB 3TO2B 1KJ3H 4P5TB 4AH2B 1EEZB 1WJ3A 1V7MH 2ADIB 2F19H 2XA8H 1AKJD 1OW0A 3AGVA 5EC2A 4GSDH 3LEVH 4D94A 5ICZA 3PGFL 2VZUA 4OUUA 3U0PB 2NXYD 1L7IL 1UJ3A 1OAQL 3Q3GA 4QHMB 1W0YT 3QDJD 3GSWB 3GSQA 5CINH 1NBZB 2HFFA 1TJGH 3GJFK 2A74A 4ISVA 4YIQA 4LVOB 2YBRB 3MODH 1U6AL 1FPTL 3IGAB 1JNJA 5MEOA 5FCUL 4AEIL 1UH2A 4YR6B 3AB0C 1MHEB 4YXKL 1LO3L 1DJSA 1P6FA 4HC1L 5I6XC 4PJDB 3EYQC 3BWAB 5T33H 5GGTH 1U3HA 5CZKA 2QTEA 2K7QA 5L2KA 3BW9B 3V52L 3QEQD 2JLLA 5JXEC 1MCLA 4R90H 3L3HA 3S98A 1CTNA 1U36A 3PQYE 5HVHB 3OB0K 1D5XB 3ECBB 4FFWC 3UPCA 3CDFA 1HHKB 5L0QB 2IGFH 1ZA6B 4KAQH 4F33A 1FO0A 1JVKA 2A1WH 1CF8H 3SDAC 2VISB 4NNYA 4KZDL 1FNGA 2AGJL 3EDDA 3T0EE 3RQ3A 2PF6A 3T65A 1FL3B 5I30L 3QIUA 4ZFOB 3AXLA 5H94B 4CU7A 4HG4J 3PWLB 3RVXD 4XNQA 3ZT7A 5D93B 5FYLE 4ODTL 4FQJH 3PV6B 5SWZB 4PRAA 3GSUB 1WZLA 4KTYA 3BKJL 4PD4K 1CD1B 4OZGF 3B5GA 2IH3A 3GKZA 1FL5A 5I8OL 5GGQL 4KQ3H 3MV7B 5I15H 3BSZL 3UP1A 1P1ZA 3BN9D 4WGWB 2YD6A 3X12A 3IDNB 2O93L 3H8NA 1IGJA 4WFEE 3MUJA 4MB4A 4L8DB 4R6UA 1WWWX 4HWBL 1JPST 2AAVA 4XHJC 3QEUB 2ZZUT 2WIMA 3HC4H 4DAGL 3D85A 1IEBB 1B3JA 2MPAH 3BPCB 4NN5B 4PJAB 4L29B 2YD2A 2XG4A 1ZVSB 1P7HL 4XT1C 4YHOL 2J1KA 4NHCH 4F7MB 3MUHL 1W72B 4JRWA 2X05A 4BH7A 5KSBA 3PWVA 5BOPA 3O2DA 1J05A 3QUZD 5DQDH 2X4OA 3O8XD 4K7PL 2V2XA 5C1MB 3RWJB 4XNYL 4O2FA 1HKLL 4QOKE 4TUKL 1CU4H 3FB8A 1IGYA 2DQTH 3MRCA 4Y4KA 3EO0A 2ICWJ 3R4DA 1BIIB 4PBXA 3RNKB 4D8PA 4M5YH 3QXAA 5CHNB 3EYOA 5CP7A 3T3PE 3PNWA 2YEZB 4UT6L 4U6VL 1KCVL 3IDJA 1T1ZB 3IAPA 1JI2A 8FABB 1P2CB 3VFPB 2A6KB 2DLIA 5DJDB 1CBVL 4TSCL 1X5YA 2WAHA 3HE6B 1YEGL 4NP4L 4OGXL 1AR1D 5E2VL 3O3AB 1HXYA 1H3PH 3NCYP 1U9KA 2ICEA 1ZT7B 3CSGA 4MCYB 3RX8A 4POZD 1IQWH 4RQQB 4N0FB 2BNRE 3FTGA 4A2LA 3MREA 3OMZA 3DV6B 4F57L 1U8JA 2LU4A 2OL3A 3IXAA 3KPRA 4Z0BL 1U2HA 1EGJL 4IS6A 1WBZA 4JFQB 1DBBH 4G8IB 3JTSB 5I1DA 2ZUQC 4BZ1H 4KK6D 1MCQA 4U2YA 2GSGA 3DUSA 4J3WA 4LNVA 5F7KC 3MCG1 5C3LD 4DVBB 2E7LC 3C60C 2DQUH 1A7OH 2GITA 5DHXB 4BYHA 3GSOA 3MRNA 1KV3A 4X6BB 5F93C 2NY3B 1RZKL 5EU3B 1AI1H 2HJKB 5GGVY 4WNQB 1I8MA 1FZJB 3IJYA 2Q7YB 2X5PA 4LHUD 4Q2ZA 1J0KA 4PB9H 5CBEA 5B38G 3MLZL 3UBXA 2JELH 3L3IB 3F7QA 1F11B 5AYUH 1QEWA 1HK6A 1NLBH 4U1GB 3SGDH 3TO4B 1UFUA 1QSFD 1W8NA 5EOCH 4RX4A 3VXUB 2VZ3A 3C8DA 3HNTH 1MHCA 4QXTA 3TBWA 1XGTB 4FTVE 3OJMB 5SV4A 1MFNA 4OLWL 5IBLD 3SDDD 4PJGB 1J88A 5FDWB 1QRNE 3LPFA 4LSTL 4PLKC 1AGEB 5GGUB 4X99A 1KELL 3MGTA 5DK0B 3MNZA 5E4EB 4M48L 3HG1A 3GMRA 3P0VL 1E27B 4I48B 5F6HJ 4LU5H 3VXMD 5HDQL 3ESVF 4DW2H 2W65B 5DD5H 2F53D 3VXPA 3NFNB 4H0IA 2ZKHH 3BP5A 4YHKL 1R0AL 2EICA 5SX5K 2QBWA 3D25B 1AJ7H 1VADB 2X7LB 1MWAB 4LCIH 2AQ1A 2CGRL 4U7MA 5J56B 1GGTA 3Q5OA 1IC7H 3O6FA 1CLYH 3BGFB 4GG6B 3MLWH 4DN4H 4OV5A 4QHUB 3RVUC 3VXSB 1QFWM 5D2LF 2EDXA 4RAUB 1ADQA 3HZVA 5EPMB 5HHNB 4GAGH 1CDUA 4JJHA 4OB5H 1OAZH 5C8JA 3RHWK 4UUJB 2VXSL 5C0FB 3RFZC 4X98A 2IADB 3ULUD 1FLRH 1HH6A 3S3SA 1JHKH 4WI2A 1YJDH 1T89A 3GGWB 5IFJA 4WW1A 4YC2C 1X5GA 3ARYA 1XF2A 5E08H 1BWMA 1NMAL 5T3ZE 4H1LA 5DZNA 2VLKB 4HPYL 5GRVK 2R69L 3CX2A 1T0NA 3TP4A 4OLXL 3X13B 4F7PB 4I18A 3REVB 2LFGA 1FRGH 4YPGA 1S3KL 2ZPKH 3RP1A 2X4TB 1MAJA 1PSKL 2A73A 3ILQC 5E4IA 2VAAB 1YY8B 3I9GL 2O26U 3TA3B 3L3JB 4HKJB 3C09B 4PRHD 1RIHH 4ORGA 3DPBA 2GK0A 3PE9A 2A6JB 1J1OL 3ARGD 4E42B 5A2LH 4NRYB 4ELMB 3QDMA 3QUMH 4XC3H 1NSNH 3L9RB 3OJVC 2WBJA 3KJ6H 4BSVB 3L3GB 3AU1A 4JFPB 1FFNB 3P4NB 1MVFA 3FCTA 4GRWE 2JJVA 2HVJB 5KVDL 5DI8A 4GRWF 1IEAB 4M5ZH 3VXTA 3DETD 3O4LB 1NUFA 3EO1B 4JG1H 5DO2C 3DSFH 3ZKNC 1NCWL 1MI5E 2H2PD 3KXFD 3LN5A 3BKML 3BPNB 3FB7A 2KPNA 2ARJB 5JW4Q 3B5TA 3EJYC 3GHBH 4X9BA 5I0ZA 5DT1L 3MZTA 3CVHH 1WFTA 3MA7A 4KKLD 1RJZA 4N8VG 1SEQL 4JFFE 4X6CA 1OPGL 1I1AD 3RZCC 2BOBB 4JFHD 4PJFE 3SE8L 5BCAA 3JTTB 4PJFF 3WFDL 5HGBB 3P4OB 2KQNA 3D6GA 3QPQD 4M9PA 2FL5B 5C0AE 1HI6A 5DJYB 4PG2C 1PEZA 3FQXA 5D70H 5GGSY 2QKIB 4DGIH 2N4IA 1SJXA 4Z7VE 1C7TA 3HNSH 5IVOA 1JYNA 5EC2B 4Z7VF 2D7NA 5ICZB 4MWFA 4JDVA 3QUYC 2EZ0D 5IVXF 5D6DA 4IRSD 5DJCA 1YMMA 3I3EA 3OAYK 3Q3GB 4JG0H 5JIIA 1OOAA 2HFFB 2D4DA 4YDLB 4DEPC 4JB9H 4ONHA 1IAIH 3DMMC 3V9FA 1KJVA 1OB1B 1I85C 1S78D 4IOFC 1K8DB 2BOCA 3CUPB 5HHQA 4LIQL 3MMEB 5IWLC 1UENA 3KPQA 2X70A 1M71A 1WWAX 4NQVB 4OF8A 4EZMA 1TENA 1CDYA 4M1CC 3WD5H 4M6NL 2VLME 4OD3L 1CICA 5DVKA 5C0DA 1CZ8H 2HJLA 4I3RH 3UTSE 4O02H 5E8DL 3BKCL 2CLZA 1R5IA 3MNVA 4RFEA 1G7IB 1RIVH 1I1YA 2YHGA 1GIGH 1UCTA 4FFZH 1FO0B 1WF5A 2GKIA 3BQUA 3HE7A 4NNYB 3QA3A 1FNGB 3PDDA 3ZO0A 3PGCB 3TYGH 3NN8A 4B7LA 4OD2A 3SDXA 4XNQB 3KLSA 1CLZH 1F4HA 3VH8G 3MUY1 1KB9J 1ZK9A 2W07A 3F62A 5E9DD 2SEBA 3MLXH 1FV1A 4CRPA 4XP5L 4F3FB 1FVEA 4LP4A 1N7ML 5HYJE 2IH3B 5JHDA 3OXSB 2W1NA 4ZNEA 1P1ZB 2H8PA 2EIDA 3HS0A 5I8EB 5I1JL 5C9KA 2JJSC 3LVEA 1P4LB 3TYFB 3RU8H 3I6GB 4H88H 3CX5K 4C83B 3V7AE 1A2YB 2AJVH 4JZJA 4KY1H 3ULUL 3BPLC 3MYZA 3PL6C 5IMOA 1WQVT 3UXFA 3FZUC 2AXGA 2EDKA 2VN4A 3TN0A 4FMKA 4ZFZB 1Y0LB 4BH7B 3PWVB 1E4XL 1MREL 2X4OB 2F15A 4K2UL 1J8HD 1RJLA 3MYJA 4GQPH 2AABL 2P8LB 2M2DA 4O2FB 1X5ZA 3UTTD 3FB8B 1IGYB 5FO8A 5EO9A 4JY4B 3MRCB 3IDGB 4Y4KB 2NXZD 3EO0B 4MNQE 3R0NA 2VLJE 3HZYB 5KANG 2VR5A 3EJJX 4G9DA 3DUUA 1I9RL 3EYOB 5L2KE 4YHLL 3PNWB 4LSUH 2ZUYA 5E8PB 4P9MH 3RTQA 5A2KH 4NO0A 2XYCA 2VIRB 3BP7B 2X10A 1A6ZA 1JPTH 1E0OB 4HLZH 3IDJB 2KDGA 3IRZA 5E7FA 3MJGX 1DLFL 3MV9B 2GCYA 2BP3A 2YPLD 2FRGP 4PJHA 5GISL 5DRZA 1QYGH 1FFOA 1NGXA 2ICEB 4K8RC 3FO2A 2CKNA 2E5EA 3FTGB 3E3QC 2EDQA 4X5XA 1U8JB 4ZO7A 3QPXL 3KPRB 1AD0A 3EOTH 1WBZB 3GIZH 2VH5L 3V4VL 3EYUL 2FX9L 4OBSA 3FT4A 1OP5K 3WE6A 3P9LA 3BP6B 5IK3B 2EDOA 4UDTA 5TGBB 4HLZG 1RU9H 3CLFL 4YBLB 3DUSB 5CSZA 1DQDL 4JO2L 1BZ9A 1DUYB 2GITB 2XZQL 1TQCC 3HNVH 5FK9A 4F9PC 2IH1A 4P59H 4ZMAT 2XTJC 4JQVA 2IAMA 4HCRL 2WWKT 4R4ND 1E28A 1ED3A 3IJYB 3O0RH 3NA9L 3RGVD 4M93B 5DHYB 5GGRB 2N56A 5CBEB 1WIPA 1KEGH 3O41B 1CGSH 4Z7UE 1QQDA 3UBXB 1OARH 1YDPA 1G7MB 3QYCA 4WGVB 4Z7UF 2GYSA 5EOCJ 1QEWB 1RZKC 5FYLH 5KSBE 4KGLA 5GZOD 5FGCE 2ILLA 3CFCL 3UJJH 5FB8B 5KSBF 2NXYC 4LRIC 4N9GA 4HPOH 4YDKH 1AXTL 3CGTA 5EIIA 5FHBH 3BXNA 4U1HB 5JTWA 1X5HA 2Z93B 3QDAA 2JB5L 4XNXL 4X99B 3MGTB 1TZIA 3O3DA 3LQZA 1BIHA 2EKSB 4EVNA 2VDPH 1T04A 4MJ6B 1DQLL 3SGEH 3LN9A 1DUZA 2PO6D 3FOMA 3S36L 2RIKA 4FXKA 4MHHI 1YEFH 3VXPB 4WI8A 1A6VL 1WBYA 1P69B 4OZFA 2XNAA 1RK1B 3QJFA 1QRKA 5C07D 1T0MB 1INEH 4GLRI 3QDJA 3O6FB 4OCRH 2ZUTA 5C09A 4LLYA 5KJRH 4QRSA 4OV5B 1DSFL 1FDLH 5E5RB 3RPKA 4DTGL 3HZVB 4JGJA 1FJ1B 4R96A 2AJSL 4ZAKD 5EZLA 5C8JB 4Z7WB 4ZD3L 1HIMH 4QRUB 5H2BA 3RNQB 1F4WL 3PJSB 2V5TA 3RVXC 5BOZG 3VA2C 5IV2B 5BQ7B 5D7SL 4WW1B 4XBPA 3B2UC 3NCJH 3L1OH 1MFBL 1XF2B 3D69B 3C2AH 4Q6IC 3TCLA 1QBLH 4S11A 1MJ8L 4IDLA 4N1EA 4KROB 5IEKB 2CLRA 1T0NB 4PPTA 3DV4A 5D7LD 3LSOA 3BIKA 2FIKA 1VPOL 1RIUH 2A73B 5DHVH 3F12B 5E99H 3W5MA 5FGSA 1OWWA 4ORGB 5HVHC 4GOSA 2GK0B 4FRWA 4UI2A 3WIHH 2ICCA 3FRUA 4ZG1A 2YKLH 1WUNT 3B4NA 1IMHC 1J0IA 3ZSTA 1EK3A 4GAJH 3IRPX 2AJYH 5EA0L 3ME0A 1EDQA 3QDMB 5LXGH 1QLEL 4WENB 4N9OB 2FO1A 2WBJB 2VE6B 3O8XC 3FCTB 2Z0BA 3HG1E 5DI8B 2B1AH 4R2GD 1T7WA 3WFBH 3GSVA 3Q1SL 5D93C 3VXTB 3NFSL 1I7UA 3WUWA 1CCZA 1E4KA 2ADFL 3I02A 4UOW0 5MEPB 5K9QG 3SO3B 5BS0A 2LAGB 5E94A 1QFHA 4AG4H 3LEXA 5I2IA 3K1DA 1EEYA 1RJZB 4PJ5E 3MOBH 1MJUH 1MY5A 1YN7A 4X6CB 4NUGH 3VFSA 1VGKA 4JDTH 1N5YH 1VB9A 2HRPH 3QUZA 1N2RA 3MLSH 4TOYL 4YHPB 4F37K 3DUHA 1B9ZA 4A6YH 3V6OA 1AR1C 3NH7H 4NN5C 4RNRA 3O2WL 4DKFH 3MLVL 2DD8H 4FFVC 4KXZH 4EI5B 2VC2L 5JXAH 1HSBA 4WFFD 2X1PA 5J12B 2R1YA 5JPNA 5DJCB 1YMMB 3GSXB 1UACH 3CSBA 3CMGA 4N68A 2YD9A 2OR7A 4MQXD 3OPZH 4KK6C 4X7TA 1R3LA 1JNLH 5ACMA 4BQ9A 1KJVB 5DD0L 3BWUC 1JPGB 2DWEA 1N4XL 1ZT4A 1RUQH 4OFKA 2P8MB 3T0VA 5HHQB 3HCVB 4EDXB 3ARTA 5HY9A 4LP5A 5D9SA 3W11D 4UTAL 3KPQB 4N0CC 1JUFA 1M71B 4QY8A 1PFCA 4J7RA 2F54B 3CXDH 4XH2B 3TVMD 4OD1H 3TM6A 2HT2D 1II4E 1A6TA 2DB8A 1UWGH 2HJLB 1BEYL 4Y1AE 4LOUD 3CZFB 1B0RA 3HE6C 2CLZB 2FX7L 5IHLB 4OCMC 3MNVB 1MLBA 1Q0XL 1IC1A 5DUML 4C56D 4L4TD 4J3SA 4O58H 3RZWA 3TGXA 5IOPB 5TDNB 1I1YB 3B9DA 1MHPH 3EHBC 4KV5E 3BQUB 4PJ9B 4KV5F 2CDEA 2GUOB 2A9NL 1NCBL 4B5EA 2EC8A 4HWUA 4PB0H 1ZLUH 4UV4H 3U7YL 3EO9H 2I27N 1ZEAH 5ANMB 3IDXL 1MEXL 12E8L 4KDVA 4NCDA 4F7EA 3ROLB 5JHLH 1A3RL 3WO4B 4JPVH 4BQ6A 3SDXB 4PJCE 3U0WH 4LEXH 4PJCF 3PXJA 1FGVL 3TT3L 4LHUA 1GHFL 5DUBA 2HMIC 5DMGD 2SEBB 2DMKA 4OZHB 1G9MH 1FV1B 4RGND 2CDFB 2PYED 1FVEB 5AYQA 2FB4H 1ZWIB 4TTDC 4AL8L 4ONFL 3ARFD 4CDHA 5I73C 2VQUA 3MA9H 4LCWD 4Y4HD 4D9LH 5J1AA 5I1HL 1QSFA 3PGDA 3QCTL 3CMOL 3EBAA 5FIEA 3E2HB 4GRLB 2NX5D 5LBSL 3SDDA 4GRWH 4KZEL 3CFKA 1JTTA 4U1GC 1I3VA 3TO4C 2ZJSH 3R1GH 2WINB 5HVWA 3VXMA 4XCFH 2RAMA 3H0TB 3BZ4A 3O81A 1S8DA 2OI9B 1U8LB 1CE6A 2F53A 2X1OA 2FJHB 1KLFA 1JNNL 3CLEH 5HPMA 2P24B 3ULUC 5CEYA 3VFOA 1MCNA 1CFTB 4N1HB 1GYAA 2ERJB 4IMLA 4K55A 5D1ZB 1T22A 2XPGB 2G60L 4XXDB 5EO9B 5FO8B 1HOCB 1G0DA 5ICYA 4M7ZC 5BRZD 4IJ3C 3EYSL 4NRXA 2DS4A 5F1IB 4H0HB 1CDBA 2ORBL 1YEJH 3ZYJA 4N0UE 3W0WD 1D5IL 1CD8A 3MRDB 3FFCD 1F4XH 1C1EH 3RTQB 3GMLB 5KVGH 1CDIA 4XP6L 1F42A 5DS8B 2H32A 1DDHA 4OLZL 5C0IA 5H35A 4LF3A 3QEGH 2FJFA 4HKXA 3RX7A 1YEKL 5F9OH 5GJSH 4KHTL 3GJFB 7FABL 3W39A 1CQKA 2MHAB 2DQGL 1WAAA 3D18A 4U1LA 1FFOB 3DXAB 5T5FL 1CR9L 5ITBH 2UZIH 4GQ9H 4M43L 5D7KD 4GG8A 3D9AH 1JZ8A 3THMH 3JVGA 1TTUA 4HUWB 4BSJA 4MA3B 5TE4H 3DETC 3MROA 3BMVA 3FT4B 3P9LB 3HB3C 3RJDA 1DQMH 1RVFL 4PRHA 1JGVH 5CSZB 2OMBA 2J88H 1T1WA 1BECA 3ARGA 4UILH 2OR9H 1R24B 5FK9B 1LVEA 1HH9A 1XF5A 1I1AC 2IH1B 3PP4L 4DZBA 2V2TB 15C8L 3ZHKA 2IAMB 4RIRA 3VRJB 1C5DB 1ED3B 4ODWA 3QIBD 3TA3C 1UXWA 5BXFA 3C09C 4XGZB 5MHSE 1WT5C 3NACH 4P2QD 2V17L 2IAND 3SE9L 4MCZA 1BBJB 3SKNA 4J12A 5J4MA 4XPHL 2JJTA 2EZ0C 4M8QA 3L7EA 1QVOA 4OLUH 3O3UN 2H26A 4ZNCD 1GOFA 3QNYA 5BW7A 5D1QA 2WP3O 5DC4B 2EIEA 1K3ZA 4AEHH 3U46A 3AY4C 5IVZB 1U8KB 4Y7MA 4JRYA 2VDNH 4NC0B 3LQZB 2ICWI 4XWGL 2FLBT 1F58H 1K6QL 2AI0H 3C6SA 1FNLA 1T04B 3OBAA 1DUZB 2VLRD 3FOMB 1LNUB 4FXKB 4LLAA 2Z91B 1MFCL 1RZIB 3TFKC 5IROC 1RI8A 1G1CA 5DSCA 5F7DA 1NL0H 4Y4FA 3WIFA 2XNAB 3FN0L 5E56A 4MQ7A 4IRSA 4NOFA 2R29L 2X89A 3QG6A 4PJEE 1H8NA 3QDJB 4PJHE 1FL6A 4MD0A 1OVZA 3RIAF 5D2NA 3SPVA 4PJEF 5C09B 1K85A 1CD9B 4PJHF 1I7TA 3VGGA 3I85A 1EEQA 4M7KL 3BH8A 4XBEL 1M05B 4W4OC 3V6BR 3BE1H 1ND0A 3MV01 3D0VA 4OCWL 1U2CA 4JHWH 4JRXD 3REWB 4KKCD 4R96B 3CC5B 4JY5H 5EZLB 3TIEA 3RY4A 1U0QA 1VEMA 2A9MH 3H6JA 1X6LA 4LFHD 4NFCA 4RISH 3LCYA 3KPSD 2DI8A 3TNNA 3SKJH 1I8KA 3OHXA 1NBVL 1YNTB 2YSSB 4AIOA 1CIUA 5J6GA 1DQQA 1PG7L 2QQLH 1XR9A 4APQD 1QSZA 2OK0L 5F96H 5GS3A 3TCLB 3OB8A 3GBMH 1HZHH 1TVBB 4KVCH 1G6RH 3ZTJH 3U6RB 4LCYB 3DV4B 3E3QE 3LSOB 3BIKB 5FGRA 3T4AB 3IFOA 1MFEH 1FCGA 4FXGB 1JF5A 3IXTA 4NCC2 2HLAB 3FRUB 4LQFH 2VXVL 3DI3B 3ZTNL 4TSBL 3FL7A 3JZ7A 5FEBA 3STZA 1SYSA 4WY7L 4DCQA 1DL7H 2EO1A 1K4CA 4XZUB 5CIPA 3ZTJG 2XTJE 4PGCB 4Q0XH 1TQBB 3BOVA 3PP3K 2Q6WA 1KB5B 2IBBA 1IGIH 2I5YH 4P46D 1ZLVH 4NFBA 5C6TH 3WUWB 2O61A 2ESVD 1EAJA 3GSNA 1MHHB 5BS0B 5J0BA 3V5HB 1EUUA 5F6HI 2J12B 4Z8FH 3DHMA 3LEXB 4G8GD 5J11C 3SY0A 4OM0L 3VG9B 5KW9L 4K23L 1MFAL 5FYKU 1BJ1H 5I16B 1YN7B 4F2MB 5L2JA 1EO8L 4L3ED 2AXHA 1F6FB 1OLZA 1V5JA 5IIEB 3CFBA 5F71A 1EJ6A 1T5WA 5EWIL 3WYRA 2YUWA 1DE4B 4NZUL 2C4FU 4QHKJ 5JW3H 2G5RA 1KJ2B 5E03A 1GJIA 3UTTA 3ULVC 1T6VN 3ARWA 4WUUE 1S7UA 2ZCHL 4G6ML 1P4IH 5B21A 2R0WL 4MA7H 5C0CD</