4AV5A

Structure of a triclinic crystal of the fimh lectin domain in complex with a propynyl biphenyl alpha-d-mannoside, at 1.4 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FIMH
total genus 34
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av5A00
1UWFA 4AV0A 4CSTA 1TR7A 5FWRA 4AVIA 2XG5B 4X5RA 3ZL1A 4AV5A 4AV4A 2UY7B 1KLFB 4CA4A 1PDKB 2W07B 2JTYA 3JWNG 5FS5A 3BWUF 3ME0B 5CGBA 4AUJA 5LNGA 4X5QA 3ZL2A 3BFWA 2JMRA 4AVHA 1QUNB 2WMPB 4X5PA 3ZPDA 4J3OG 5AALA 4AUYA 5AAPA 5IQOA 5JQIB 1KIUB 2UY6B 5F2FA 5F3FA 5ABZA 4XOBA 4XO8A 2J2ZB 4XODA 4AVKA 5IQNA 1N12A 4CSSA 2VCOA 3SQBB 1ZE3H 5IQMA 3BFQG 4J3OH 5LNEA 4ATTA 3MCYA 3RFZA 2XG4B 3JWNE 4X50A 4XOAA 4XO9A 4LOVA 4AVJA 1N0LB 3JWNH 4J3OF 4XOEA 5AB1A 4AUUA 5FLUA 4XOCA 4BUQA 5FX3A
chains in the Genus database with same CATH superfamily
3DV4B 1J8HA 1KY7A 2W9EH 2FJFA 3II3A 3QDGD 5C0FA 1JYVA 3VFVA 2D7PA 3BIAX 3C60A 2XWTA 3CJJA 5LLIC 1C1EH 4HUCA 3ZIYA 3X14A 4L3CB 2OMVB 8CGTA 4D0CA 3HZMA 4MNHB 4TNWF 2QKSA 4AYDC 4KNUA 4MNGA 1AH1A 1TG8A 4G6FB 4UDUB 4BKTC 1M3JA 2GTQA 2D03H 2W94A 3O6KH 4YXLH 4ZUWA 2YD2A 5DJYB 4Z7NB 1JRHI 3BVVA 4XVTH 5CILL 5LBSA 3VRLE 3NABL 1X5AA 1GL4B 3MREB 3OPUA 4EVNB 5KBDA 3TNMA 1RP8A 3RX7A 1TR7A 4OCYL 4XN4A 3QEUB 4I0PC 4LOFA 2VXQH 1EBPA 3KYNA 4XCCH 1HAWA 2MEJB 1UHVA 2FD6L 5T3ZD 1FC1A 3BVDB 3HBGA 4C47A 2B59B 4XOBA 2R0LL 4XNMB 1J9TA 2PUQT 1A14L 1WK0A 1UUSA 2MQ0A 4WW1A 4D9LH 4LEEA 2YGQA 5MENB 3S3PA 1T0MB 3DIFA 2ZX8A 1DQVA 3MRLA 4U1GB 1KB5L 1WCBA 2WHVA 3A67L 3L1EA 5C0DA 1D6VH 2CGRL 5HJDA 2G5UA 5ANME 1IBGL 1TPXC 1KPUB 2DQIH 3KZ8A 3ZZ1A 1F58H 3VI4B 2GIYA 3VFMA 3UOAB 2YSSB 2F54E 3IDMA 1A4BA 1JPSL 2WKLA 3GSQB 4F7TB 2Y36H 4XNQA 5B22A 2C3GA 1CG9A 4YXKL 5IY5B 1HDMB 4HBCH 3VTTA 3FC8A 1A0QL 4BXVA 3R0NA 3QNYB 5F71A 5D70L 4JZJA 1E67A 3QUKA 1KTDB 3T4YB 2QZ5A 5MERA 2Z65C 3JYCA 2J8UA 3F7PC 1D5MA 1KYAA 2GBTA 1BDYA 4IBWA 1L7IL 2GEQA 4P48A 3ZUCA 2QSQA 2JTYA 3HG1D 3L08A 1TZAA 1R5WA 5DHDA 2LTQC 2H4EA 2WYTA 5I6KA 2DICA 2YHGA 1JF5A 3DO3A 4RGNE 3NJKA 5EUKA 3C2AL 4OZGA 1VPOL 1Z3GH 1QVOA 5HGAA 5H2BB 4HXBL 1FYTA 7PAZA 4YGAB 1MFEL 3TA3D 3B9DA 5CHNA 5E7FA 5I16B 1E40A 3M86A 5EBLA 3IDNA 5TFSH 2NX5A 2MPAH 2O93L 5JW5A 2PO6A 5D1XE 5HHQB 1E4KC 3EDFA 1MCBA 1AY1L 1IVLA 4RRPM 5F0MB 3H4FA 3MV11 5G4MA 2J1KA 4LEBA 1D6EA 3NAAL 3LQAH 3HNSH 4FGMA 5F72S 5LGKA 5D4IA 3BRFA 4JFPA 1UM4H 4HIHA 2QGDA 3RNKB 2DDQL 4WUUA 4B9FA 3T5WA 2X1OA 5MEQA 2LAAA 3MXWL 4FJYA 1MFAL 4B9GA 4A39A 1LD9A 5EMYA 4TSCH 5IEKB 5DC2A 2CJUL 4L4VE 1IKOP 4E68A 3QYNA 4HJGA 3KNBA 5FGBC 4IDLA 3FH7A 2GJ6B 4YHPB 1S7XB 1JPGB 3THMH 1URZA 4NQDD 2LLLA 4ERSH 2XZAL 1A64A 3DIDA 1QW8A 4QRPB 3P4NB 1X5YA 2HSIA 4JPVH 3DURA 1JWSB 1U93B 2DQUH 4YXKH 2ADJB 3FUHA 4CAGA 4DGVL 3K6DA 1P4IL 2A83A 3MNZA 1T7VA 5H94A 3G5ZB 2X41A 1R24B 2PPCA 3MKGA 2GHWB 3NJGA 4L5FE 2TSAA 1Z32X 5KVDH 5T5NF 1HWGB 2DQIL 4GJTB 4BSVB 3DRQA 3L4CA 4XC1H 4G7QB 1ZT4A 2H45A 2X4QA 4IBTA 4NNPL 1TCMA 4P2QE 4LP8A 4DESA 5C08A 1ZA6A 3EO1B 5FDYA 3U82B 2HLFD 2JB5L 3AB0C 3OKEA 5MEQB 1U3YA 1VEMA 3RBGA 3I6GB 1UB6B 2J8UE 3SDCB 5ICXA 5FYJL 3WJLA 3MFFB 4L4VD 2YOAA 2XG4B 3GHBL 4GP4B 4PLJC 2WIMA 1VPOH 2HFGL 3M17A 4CNIB 4KROB 1RZFH 4J1UB 3CFMA 5AW3B 1RIVH 2WBWB 2QQQA 1FPTL 3CPUA 5JXED 3OPZL 2UXGA 5SWSE 1I7RB 3WD5L 4Y89A 5JMRA 3VFWB 1N5YL 4YXLL 2DOCA 3HZVA 2J3SA 1GGIL 1H3WM 5F9WB 5DHYB 1RIHH 2I9LA 3Q2WA 1I85C 2BNRB 2JV6A 3CXHJ 3PGCA 3DIFB 5IMMB 5DJZA 3EFFB 3KLQA 5D70H 1P0SE 2IV9A 3MV8B 5IMKA 5FUCC 3NCMA 3T8XA 3IGLA 4GSQA 1IAKB 3FU8A 3W9EA 5C0CD 4LSVL 3PDDA 2OMUA 3MBXL 4GRLC 4XNZB 4H8QA 3ECWA 4JO3L 2P5WB 2YLHA 4S1DC 5JNYB 2VLJE 3HE7A 2FYYB 2ATAA 4GEJA 3DHJA 3RWEA 1G6RA 3FU7A 3KGRA 1ZVNA 3MV01 1RSFA 4CC1A 2HWZH 3RQ3A 4PB0L 3OKMA 4FFVC 2X7LB 5IVOA 5C09B 1NL0L 5ID0B 4NJ9H 2P7TA 1MAML 2CXKA 3NN8B 1U91A 4ODXA 2XJLA 2Z7ZA 3P30H 4UTAH 2AXHA 5E23A 2OMTA 1J48A 3TT3H 4OQ1A 5I74B 2D0FA 3UYPA 5DS1A 4DUWA 3W81A 4OR1A 5DK2B 1XX9C 3HNTL 4ZT1A 3KDMB 2IOIA 2ICCA 1UD4A 3HFFA 5F1SA 4BH7A 2HTLC 4J3SA 2ZAIA 4G70B 4ZFZB 1RZ8A 2X0VA 1CURA 4XVUD 3F7RA 1GYWA 4KMTH 1KJ3H 4GAJH 4G6AC 1LO2H 1SPDA 3HTLX 5CINH 2YPLA 5DURB 1CD1A 3NZ8B 1BQUA 4HLZG 4JKNA 3MRNB 2XJKA 5L8JB 5LGHL 1N2RB 1AYOA 3Q9QA 2VSKB 4WFED 5F6IB 3NACH 2EDDA 4L8SC 5HHNA 3QXUA 4CADB 1N5AB 1P5UA 2B1AH 2PXYD 3DHMA 1T0MA 4GSXA 1HHJA 4IJ3C 2XXFA 4YDNA 3HR5A 5DYOB 1WICA 4JREC 4OZHA 2ESVB 4OCRL 3D85A 1ANUA 5FM4A 3TIEB 2G0LA 3HAEA 1KIPB 3U4EA 1MCPH 1PKQB 4AZ8A 1T1ZB 4H2CA 3ERXA 4R6UA 1I8KA 2IGLA 4XB3A 3C09C 3IF1B 1UEMA 3LS5L 4RQQB 4OGZA 5B1BB 1YCSA 1VCAA 2L7UA 4NPYB 4FP8L 3UMTA 5CEZE 5A7EA 4MJ4A 2WOYA 2G2RA 4NAQA 3QQ4B 3RHWF 1R19A 1WDAA 2EIEA 3NJXA 5F1IB 1XH0A 2UWEE 4XXDB 5FCUH 1YEJL 3MYJB 1AS8A 1Z66A 3T2NL 2JLLA 3F7LA 5DLML 1ZEAH 5MERB 2BMKB 4AGQA 2FGZA 3APNA 2PWFA 3KPSE 5IESH 3RGVA 2AJVH 1P1ZA 4Q2ZB 1I8IB 4GRLD 4UT7L 5FK9B 3GZPA 1CFTB 4K7PY 4LEXL 4ZSOB 3KYMB 5ESQB 5MEOA 3FAXA 4K71B 2VLRE 2NSMA 1GYVA 4JFXA 4JM2F 3GJFK 5DYOA 3MJ9H 4N2IA 1DBKL 2EVHA 4MMZB 3WXVH 3LH8A 5C0DB 3VWKC 1ID5I 1TXKA 3W0WE 4IDJL 2X1WL 4I0PB 4OM0H 1SDDA 2EAEA 3BE1L 4UAOB 2B15A 3P73B 4GS7B 2QVFB 2E5EA 2HKFL 4YR6B 1NGWA 1UZ8B 3G5XB 3ARGC 4AKOA 2ALAA 4XN5A 1NGXB 1WBXA 5AVWB 5I1KL 3MYJA 1EHLH 4LPWA 4LVNC 1GXEA 2KERA 3FBKA 3UC0H 5JOFB 4NQCD 5ITBL 3B2UC 2C1PA 1MFNA 1AGDA 4ODUA 3ROOA 1NBQA 3GMNB 3U6XS 3LKSA 3UAJC 4YO0B 4QOKE 3WTVA 3QR1A 3ATFA 3B5GA 4MASA 4NRYB 4PP1D 1EHXA 2IQAB 3CFCH 3FO9B 3C5SB 1GPOL 5DFVC 2GTWB 5FDWA 1NCNA 2FWOA 3HG0A 1E5YA 3SQOL 1YECL 1PJ9A 2KS0A 4PJEF 4JJHA 5BV7C 4O2CA 3JWOH 3BWSA 3BAWA 1B88A 1QFWI 1LLAA 1L9RA 4ETQA 4PP2A 3EOTL 1W72B 4FS0A 4PWIA 3MLPA 4OGQC 2VWEE 5D4QA 3S36L 1RUKH 1J8RA 3WIIH 5DQDH 1AR1B 3IN2A 3QUXD 4AYSA 1JWSA 1T66D 3LEXB 3L7FA 1ETB1 1G4RA 4LQ1A 4GBXB 4J3VA 1TTAA 3HR5B 1PG7W 1B2WL 2PABA 3GSWA 4HAKA 3S36X 1ETZA 1RVFH 2JXMA 1X5MA 4E9VA 1MCLA 4N2EA 3L8QA 4OB5H 5JHBA 3BSGA 4W9ZA 2ADGB 4FFZL 1KTJA 2EO1A 3HW7A 3I2CL 4UNTA 3FOMA 5DI8B 2F74B 1OP9A 2NQDA 1G5GA 1BHGA 4QRBA 3C5ZA 3SKJH 4ONGH 3HMXH 1AZVA 4BHUI 4YDKH 1RSYA 1WO2A 4M4RB 1JF6A 3Q2VA 1YJDC 1BBDH 3V4PA 1AGEA 1TCRA 3KEDA 4HD9A 4AUYA 1QFUL 3CX2A 2VMJA 3OMZA 2WD0A 3RNQA 3K74B 4KKQA 1E9QB 4GFTB 4MJ6A 4YGVA 4BH8A 2X70A 2NY7L 3PU7A 4G43A 2W0FB 4ZZKA 3BZ4A 2DQEL 1UZGA 2CUIA 3L95B 3QIUD 2OSXA 2YSTA 1T5XB 3C5JA 3NJMA 5KUMA 4AM0Q 3HRZB 3L3HB 5E94B 3WS6A 4NN5C 4AQ1B 1G7HA 5D2LB 1SM3L 1A6TB 2AXGB 3I6LE 1L7TH 3QIUA 3ZKQD 4LCVA 2VZ1A 2VDQL 1FRGL 5AZUA 4XH2B 4UMGA 4NX0A 3FQRA 1JZJA 4OLYL 1HHJB 3EFFA 2GVYA 4DTGH 3FSWA 1Q0YH 2A3TA 3E9UA 3S3CB 4MJID 5KSAA 3BVXA 1BBJA 4JHAH 2OMUB 2Z35B 5FGBA 1HHKB 5FHAL 3IDIA 3DYMA 1CZ8H 1F1AA 1LD9B 1LMKA 1QNIA 2IQ9L 1NDMA 2VXQA 2YQBA 5E9DA 5BZWB 3SDYH 5CLYA 1FO0A 2E76C 3PV7A 2MKWA 3UTOA 2EE3A 3L4XA 3Q8FA 5CIPH 4HUXA 2XQYG 5INDB 2X4TA 5GS2D 4CNIA 2I07B 2CKBL 3WGVB 2F0CA 5H37H 4OFQA 3TFKD 4OCWH 4WUUB 1UC6A 1QKZL 5CKGA 5ADOL 1MCIA 1EEQA 1MIEH 1J05B 1KIUB 1XGQB 5GXBB 1OF0A 2CDEA 4JQVA 3MLSL 1QTPA 4G8GD 4C56A 4Z76B 3SGEI 3GI8H 5CM1A 4AH2A 4QTFA 1OW0C 4FRWA 1FFRA 4JG9A 3JXAA 2Y0SA 4Q74A 4AOFA 4U3SA 1E3XA 1GIGH 1U3HD 1JV2B 2Q2LA 4D9QD 4LAQL 1MDAA 1ZA6B 1DQLH 3PWPA 5CEYB 3ZJAA 2P5EA 2BSRB 5F7EL 5GRVL 3QO1A 5D7IB 5IKCA 4CSPA 2Y24A 3CFQA 1F90L 4RISH 4QXGH 1S9WA 4NWTL 1EBAA 3DXAE 4IIZA 3JTTB 1MJ7L 5D7LE 4E5XG 1HOEA 1YUHA 2X2IA 4H1LH 1U0QA 2UZPA 4MZIA 1CICA 4QHMA 3REWB 2DL2A 1MQKH 4Q0XL 3KBPA 1X5XA 4YK4B 1XCWA 3MUJA 5JO5A 3FYIB 3ZKXB 4LDLB 4BWTA 2ZP0T 3RWHB 3B9AA 4Y16C 4RBPK 4ESKA 1O6TA 1ZHBA 4X7EC 4B9IA 4M4RA 4WO4A 1UVQB 3NFSH 1W15A 1AG0A 2C9SA 2YEVB 3G6AA 4W9FC 2AHIA 3V52L 2K7QA 1XF4B 4MJ5B 1GJUA 5EU6D 1O5DT 2X3CA 4Y4FB 5LJYH 4AYFA 5L4JA 3VW3L 5IFJA 3SY0B 2BRQA 2E8ZA 3C08L 5C6TH 5KN5A 3EW3B 2R7EA 4RAUB 5IOPB 2FYVA 5DD0L 4OQTA 1SXZA 1X9QA 5DDHB 2X7LA 3L7FB 4HUKB 4BQ6A 2JCWA 3ULVH 3UTSB 1N4XH 1E8ZA 4FTVB 2PETA 5CZRA 5F2FA 3MRJB 2H6PA 4OGYL 1SXNA 4H8HA 2NY6C 3BO8A 1PGRB 3H2PA 3L2LA 3S5YA 4ORGA 5JMOC 5C9JA 3HC4H 3VVVA 5DGRA 1HESA 5K93A 1T5WA 5PAZA 1CFSA 1J0HA 2K1MA 1QSFA 4X7FC 5BOJA 3STBA 2CO4A 1IKNA 2Z9TA 3L4UA 3H0TA 3RGVD 2Z8SA 3G6DL 5F7WC 1IGMH 3EBGA 1CLOL 2GUYA 3GK8H 4HK0A 4MQTB 1T1YB 5C07B 3W5NA 2A77H 5E6YA 2ARJQ 3SE4A 2IFFL 4B9YA 2H32A 3VXOA 2J43A 3IBEA 3H1ZA 2AMUA 4BBWA 2WBJA 2DM7A 1RP9A 4ES8A 3S9DB 4URKA 2B0SH 1LEKA 1J8HB 4U4IA 3SKOB 3GPEA 1E8WA 1PLGL 2BVOA 2K70A 4I3SH 2F19H 4UU9A 4YHML 1JXFA 4D8OA 5LBSH 4XX1G 5BJTA 2Y7MA 2FJHA 3GHEH 1A8ZA 1GH7A 3K1KC 1TTRA 1IKFH 3Q6GH 1OTSC 1RZJL 1V10A 4P5SA 4NHUA 5KYUA 3DX1A 2Y6TE 1QUPA 3T04D 2OTPA 2FBJL 3KS0J 1BEYH 3BH9A 3OGCB 2JJTC 1BQ5A 3MI6A 1KJVA 3QQ9D 4JG0L 3LEXA 5DHEA 4ZQKB 3UC2A 4PS7A 2DM4A 3RDTA 4GRMB 4MQ7A 4KPHH 4DFHA 4WI0A 1ZANL 1T1XA 2GK0B 2FQGA 2XQ0A 3NYKA 4JPQA 4U6XB 2H3NB 4NUGL 4OCSL 4H2AA 4KO9A 4IRSA 1PD0A 1EDHA 4CVXA 2XTJC 2XVLA 4HEPA 1CGVA 35C8L 1OK8A 4TM9A 3DETD 4B41A 5IIEA 2HFEB 1D5BB 3HG1E 3VXUB 3GSRB 5GIRA 3ZPDA 1BXVA 1BAWA 2Z8RA 5DTFB 5BPPA 2VRAA 3FFDB 5FOBA 3WFCH 4APQD 2VZOA 5HJ3B 1L4IA 3D0VB 4XMZA 3FHEA 1DJSA 3D4YA 4N8PA 1TITA 4QXUL 5DZVA 1JDCA 1U8LB 1N6QL 3EYVB 4D9RE 4XWGL 1LK2B 5FC9A 3GM8A 1BJ1H 4UTBL 1DVQA 5A16B 4KDVA 1A1NA 5KBPA 2VDPL 2YXVA 1RZ7L 2FNWA 3MJ6A 4UTAA 3T0VA 3V0VA 4QD2E 2VJXA 3OLEA 5DFAA 1N7MH 2GKIA 4LBEA 3UAJA 4ZW5A 4JO4H 4WUUE 35C8H 4P46A 1AJ7H 1SRDA 1UM5H 4I18C 4KKCC 2Y1AA 3H3PH 4AEFA 4E5XB 4YSSA 4GKSA 5EU3B 2C9RA 4NO5B 2XA8H 5LGYA 3ZE1F 3M17B 3MRQB 1WS7A 3HG5A 3NCJH 1NFDF 2ICWI 3E6HA 4YFDB 3WLBB 1QBMH 4X99A 1JNLL 5HJ3A 5CJ8A 3AADB 5I1HH 2KBGA 1NKRA 4ZOAA 5IV2A 4O2CB 3ZTEA 3O6LH 2H47C 3R06A 4ODWB 5EOCJ 5GRZA 1B3IA 5IB2B 1CVSC 3LQZB 3DSNB 1KEGH 5I19L 4ADJA 4WI6A 2C1PB 1F4WH 3ARYA 3DHUA 4LLMB 2QSCL 3SBRA 1KOAA 4R8WL 2VL5B 1CDUA 2APWA 2E7BA 1LE9B 2O5ZH 1CD0A 2YMTA 5ESAB 1KIQA 3ZX1A 5A2BA 4ZRGA 3V6BR 2B0SL 4OLXL 3EDJA 5F7MC 2D3VA 4HT1L 4XNUH 3DBSA 4URTB 5EUOE 4NQCB 2LW3A 2ORBH 3KJ4C 3H54A 3PXJA 4TQEL 3BH9B 3CQPA 4JRYE 5EZLA 1HJCA 1XD0A 5ETUB 5ANHA 2X4UA 4W70A 5F7BA 3ULVF 4PJGA 2BC4A 4MQ7B 3UBHA 1IUZA 5JXAL 3ARPA 5JOPE 2D9QB 4AQEB 8FABB 2PW1B 3QK0A 5DJ6B 2XNAB 4Q8BA 4L1TA 4N9GA 5EU6B 3CN1A 1SBBA 1N70A 5SX4I 4K3EH 3KDPB 3O2VL 4NAJA 3WS6C 5KSUA 3ARBC 2MHAA 3FB7B 4NUGH 5E6IC 1N4XL 2KQNA 3IXAA 3GT6A 2C9XA 2YFOA 1HYSD 4F9PC 2YZ8A 4JDTL 2ZOTA 1Q9KA 1ZV5A 4WEBH 5A6IA 5DD0H 5CFHA 4KKAC 5JIHA 1DP0A 4GRLB 2W92A 3PWPD 3KG5A 5LXVA 5K9OB 2I9TB 2IH8A 4BRVA 4KI1A 1YNTB 2ARWA 3KW7A 1J9QA 3LXBA 4JRXA 4HWBL 1V3MA 1FDLL 4AVIA 3RWFA 3DECA 5H37A 4KX9A 1P4LA 3O9WA 1RPKA 4XCNA 3VMOA 1JZ3A 1R24A 3NFSL 4ZO7A 5AB9A 4KITB 1H5BC 1MUJA 4HFUL 4TYUA 1CBVL 3QNXA 4KRPD 1HVXA 2VXTL 4K7PH 2WCPA 4JQIA 4F8LA 4UIMB 4ZODA 1XF5A 3CBRA 4JQXC 2DLEA 3MLWL 3PE9A 1AQMA 4J3OH 3ZDYE 1O75A 5B39B 2YA0A 1TQSA 3PS6A 4MSWB 5C3LD 4ODSH 1CC3A 3CFBB 1S78C 3IMVA 1F11B 4QXGL 4XT1C 2VLLA 3VFWA 1UJ3A 1H8NA 1NMAL 5I8KH 1WS8A 4S10A 4HUVB 4C56B 4N8CL 4R97B 3S96A 1MIML 2ZJSL 4ZW8A 2YOCA 1EXGA 1NFDA 3TEXA 4MJ5A 3U6RB 4P9HL 5D7IF 1H9DA 1RCYA 1JHTA 4CILA 2O61B 2IG2H 4M1GH 5G4OA 2EH8L 2COQA 4UUJB 5FCSH 1OVZA 5D1XC 1QZNA 4OFPA 2G4GA 2R0KL 5C6PB 4I8DA 3GXFA 5L0QB 4HSAC 3QZLA 4HBQA 4N90D 3UG4A 2XV3A 5EU5B 4EEEA 4LT7A 5CZXC 5C6TL 3B7TA 2J6WA 5DD6B 3VW3H 2RH0A 4R0LA 4OCWL 5E6UB 4KRPB 3SDXE 3VFOA 4WKZA 2BNUA 2ZWZA 4LK4A 3VXUE 3KWUA 3DETC 3Q1EA 3I84A 4U6VH 1SFHA 2FAUA 3D39A 5EB9A 1YYLL 4PJHF 5EZIL 2C3XA 2CQVA 3QEHB 5CJXC 4XPTH 2X38A 3WHE0 2V2TA 43CAA 2NOYA 3KNBB 1Z2KA 1KGJA 1OT2A 2XQYA 5KBKA 1JMZA 4MDIB 4KRPC 2HKHH 1N59A 2QQNL 1FNEA 5C0CB 4QT5A 4EZKA 2MH4A 4GW1A 2J20A 3R06B 3GMLA 3MJ8B 4BE5A 4RISL 4W9CC 1FRGH 4MA7H 1GSKA 4BFJA 2E6PA 2HTLD 4FHKA 5GGQH 4IBUA 1JGVH 1Q0XH 1OGPA 5CSZB 1NC2A 3SDDC 4X8GA 2CKBB 5F7EH 3UGXA 3W0WD 1XF4A 3ELQA 4K0OA 3DVGB 3QRLA 4N6QA 4MTMA 1JMXA 4P3WA 4RMWA 2G2PA 1HL8A 1Z1WA 4WHTA 2I7SA 4ZTPH 3BHBB 4F8TA 2A74B 2XETA 4L4JA 1NBVL 2IJ0C 3MLSH 4NM4L 1ZPLA 1UB6A 4OLWH 2BDNH 3K2UH 3SDCA 3NGBC 1FZKA 2Y5QA 2VRQA 3OTTA 3QH3A 1MZZA 4FMVA 3CX5K 3L5XL 3QNXB 5HJGA 3SDCD 4K9EH 4FNLH 4WCYH 1CPUA 2OMBA 1R33A 4BFGA 1WWCA 4RFEB 4CDHA 3L1FA 3VG9C 4UV7H 3U7YH 5AG9A 3CCHB 2WWNA 5E5MA 1E3FA 4L1SA 4G11A 3RFZB 5HBBA 1IMHC 1D5IL 2DY2A 3TH3T 2AQSA 4Y2DB 3ZU8A 3O3BB 1EIBA 3T65A 3OQ3B 1NDGA 3TBTA 3ARVA 2WLHA 3ATEA 3QWOB 3FU0A 4P06A 1A02N 2IQ9H 3ULAB 4HJGB 3X1EA 1B2WH 4ZPTA 4NZTH 4F92B 2X89A 2KDGA 3HG4A 3P0YL 4XMUA 5GIRB 5IW6A 1INQA 4JFFB 3OAYK 4ZUTB 1K6QL 3KPRE 4OBSA 1MFCL 4FFYA 2OTWB 3CNKA 1GW0A 2AJSL 2J5LB 4EQ3A 5MI0B 4X4ZA 3N3EA 1HCVA 3U0TA 3JWNH 5AVZB 4AENA 3DV6B 1JNHB 3GM0A 1LEIB 2YS4A 3AW5A 3P73A 1NSNH 2XKNA 3EGDB 3IWUA 1XGYL 3DJSA 4LRNL 3N1GC 4WW2F 1TJGH 1FGVL 3B7UX 4X6DF 2A9DA 4KXCA 1C5BL 2AEIT 3U2SB 4LHUB 4KO6A 1LO0H 1NAMH 2ZUSA 5DZ9A 1FIEA 4DFIA 4YHKH 1QASA 5L8KB 4LPYA 5KYUB 1IAOA 2EIKB 2K9FB 5CBAB 2NY4C 2ICEA 5I66A 2YD1A 4PJFA 3V5HB 5C0ND 5A3IC 5IG7B 2JJSA 4MSWA 2X4UB 4ZYKB 5C0EA 3FCBA 4JFEE 1XL4A 3PAUA 3OR6A 1QA9B 3CG8A 5E8OA 3T3PE 2PYFB 2UVFA 1M9SA 4OM0L 4HGMA 2P8MA 2NY2C 1CB4A 1FL6A 3QIBA 1E30A 3CSYB 3MRIB 1U3JA 4QXTA 4UANA 4YX2H 3HR6A 3ZZSA 1KTRL 3FCSB 4BCXA 4YDJA 1IARB 4NQDE 1TETL 4XBPB 4ACTA 5I6OA 2R1XA 4XGZA 2C3HA 2EACA 2HG5A 2XVKA 2LLGA 1I8MA 2ZAHA 2WUBL 3KW8A 3OZKA 4UUJA 5IVXE 3ROLB 1F8TH 4PTUA 5D1XB 2W60A 4EKXA 2DLFH 2IADA 2AJVL 3TYGH 1ACYH 4IKKA 2BVTA 1SFDA 5E4OA 4U1SB 1LE5A 1F3RB 2CA4A 4NN6C 1XGRB 3BKYH 1HEJC 4JFVA 2N01B 2HN7B 3FONA 2CPUA 2OYMA 4BKLA 2DQGH 3OSVA 3TONA 1NUGA 4PV9B 3AB0B 4IRJA 1W0VA 1BIIB 1UTDA 2Y6SC 3RB7A 2FLRT 3ALXA 3OJVC 3BEVA 1PYWB 4O02A 3WFDL 4PY7B 1DJIA 1BFOA 2FT7A 2P8PB 4QHNA 4N0FB 3E2HC 3DMMA 1ZIBA 5CP3A 3UAAA 5IWLC 2W65B 3VA2C 2HX7A 4N0RA 4LVOB 5HI4D 2VTFA 4KVCL 5TDOB 1UT1A 3R19A 2FECI 3HEIB 5MEPA 1PZDA 3T4AB 5IROC 2D3LA 3FFDA 2HUEA 2F7OA 1RK0A 2VKXA 4LEOA 1KCSH 5KJ4A 3P9MB 4IDJH 1PFOA 4QKTA 2BP8B 2BP0B 1XGRA 4L8CB 1MFUA 2CH8A 5IW1B 5KSVA 3WXVL 4AGNA 3RY6A 5CINL 3B9VA 1BREA 1MF2L 2OZ4L 4KUZH 5FR3A 1YEHL 3G3LA 2DQTH 3P0VH 5CCKL 1V3JA 5D93B 1JFQH 1OAYH 2F5BL 2P5WA 3O3AA 1Q9LB 1TZIB 2BHYA 1FC2D 3QORA 2HT2D 3E8UH 4MMZC 1H15A 4NO2B 1G6RB 2D3NA 3FU7B 4J4PC 4GO9A 3QEQD 1YPZE 1YYMH 4HC1H 3EH2A 4N0CC 5C2BL 3OQRA 3V6OA 2VLMD 2QJDA 1WF5A 1NGPH 5LNEA 3KCPA 2JK5A 1TKWA 4IS6B 5E00B 5T3ZH 1USZA 2YMXH 4TUKL 5DHVB 2GBVA 2QT6A 2DBJA 4QHLA 4HGWA 1CXFA 4D2NA 1TSRA 4N2MA 3GIVA 3V5KB 3ECVA 2YBRB 3SN6N 3VXQA 43C9B 1X5FA 5CP7A 4UTBA 2WLLB 4FNQA 1MXDA 1CGUA 3D9AL 3GBMH 4TVPL 4Q2ZA 2OR9L 5FK9A 4F27A 5F7AA 5HHXH 5DQ9B 3D25B 2HG5B 1AQHA 2Z34A 4PR5B 4OCMC 5FW7A 4Z95H 3GGWA 4X8JA 3ZRSA 1E43A 2JIXA 4U1JA 1SQ2N 4TXVB 1UKSA 1I3GH 5D7KE 1FNSL 4TNWK 1LK3L 5DHVH 5DWPA 4RAHA 1RZKH 2AV1B 4KK8C 3WFEH 4NQDA 3T6ZA 4HK3J 1T6WA 1OZTG 1O0VA 4HPYH 3AS2A 2G30A 4M8RA 4C83A 1B2YA 3IFPA 4AX3A 5BCAA 4XPAH 1YQVL 1A7RH 5AZEL 2ITEA 4WI0B 3SE8H 4BK5A 1HZLA 5EIQA 2OMYB 4I1RA 3TN0D 2WLIA 4JFEA 5AW8B 3HG2A 3B7RL 1J86A 5K9JH 1KLUA 4FQXC 4LPTA 4P2QB 2Y07L 2XWZA 4JR9H 1JPGA 4PJHA 3TF7C 3OAZK 1GS8A 1XZ0B 3A3YB 2VW7A 4FX5A 3MBEA 4YGVB 4LLYA 2EE9A 5F97E 3RWIA 2CE6A 4NUJA 4NNPH 4RMRA 2H1PL 3T6WA 2VKWA 4GQ9L 1AHWC 3PQYD 3VI4E 2Y2YA 3Q8CA 1BECA 1YC8A 4NOBA 5AWNH 4FFTA 1FL3B 2ZZUT 1OEZW 2AEWA 3GKZA 3QIBC 4QLWA 1H3PL 5DRWB 1YN7A 5C0BA 1IX2A 3A47A 3BFQG 4FQQB 4ZFZA 4XNBA 3RVTC 3EYVA 4G5ZH 4HA1A 4L4TD 3MBXH 2J44A 3FB6B 2N56A 1IE4A 2BJMH 1TUPA 2N0MA 2ZAGA 4I2XB 4P5TA 3F65A 2BRRH 1QSZA 1E5AA 4UQDA 5FUCE 1WFUA 4JHWL 1FO0B 4MNQE 1G7MA 5C9JB 5ESVB 4N85A 1ZSDA 4QHKJ 1OGSA 1T22A 2BOCA 1MFAH 4U6TA 1FORH 1RU9L 3LIZH 1XZ0A 3GTTA 4K8RL 5C0CA 1QO3A 1NIDA 3SDDA 1YC7A 3U79A 2GHZA 4ZMYA 3EYFA 1URLA 1G7PA 3P3TA 4DGYH 2AK4D 4MCYA 3SB3A 4Y2DA 2Z92B 3MN8A 1KT2B 5D55A 4L0ZA 1EZVY 3WAJA 1VF5C 3FAWA 3HS0C 5JHLH 1SQMA 3TBVB 4JK0D 4Y2DD 3QEHA 2K8MA 3QUGA 1QAWA 3QUMA 4ZYKA 5JPNB 1RMFL 2V5YA 2QGEA 3QHFL 3SDAC 1S7XA 3KYKL 1MCOH 1WC7A 2KKQA 5GJTH 3MKKA 3FTUA 3CIQA 1WHPA 2NXZD 4TULL 4M5ZL 5BXFB 4OZIA 2Q76A 3QFDA 4XNAA 3QDMB 5GSRB 1S9XA 2GJZA 3HC3L 4L3EE 4Y5YA 5GJTL 4HDIB 1MCOL 1RD6A 1U8HA 3ARXA 3KYKH 4I4WB 4APXB 4P2CG 5A2IH 2EEAA 3ZKSD 3FTGA 3KPTA 3NFPB 4QY8A 2NXYD 1LP9A 1HH9A 4L3EA 3GHPA 5E4EC 2Q6WB 5CWSA 3W9DA 4JCLA 4LLQB 5EN2B 1DQDH 1U2YA 1DVFB 1M56B 1DANU 25C8H 3VRJB 1JF1B 5MEND 3A23A 1EJOH 4K8RH 3T3PB 2A4ZA 4P2RB 4DQAA 2BSCA 2IXQA 1QI5A 2QL1A 4GIAA 1TTGA 2IH3B 2AS5M 3K3QA 1SN2A 1W72H 4GXUM 5AW6B 4N0UB 2ZWNA 4G5ZL 5KTEH 2FO8A 2Y36L 3BN9D 3WNLA 1IEHA 2E86A 1F4AA 4NERA 3VQ2C 1PVHA 3EYOA 1UM4L 5IEHA 2Y2TA 4ZAKB 5EH1A 2X87A 4FOMA 5BO0D 2RR3A 5C08D 1BZEA 4F3FB 4RAVA 1DBAH 3LZOA 4I7ZC 2H1PH 4AYMC 3ULUC 1Y6MR 2MFNA 2Q3AA 4Z76A 2V9UA 1BZ7B 2E3VA 4G43B 3DVFA 3PGCB 1BX2B 4GAGL 5IMMA 2I9TA 1SY6A 3CDZA 3QHFH 4MNQA 4JR9L 2P24A 3AWFA 2Q7YB 4A7UA 4DOHE 4D9LL 4Z7IA 3WCYA 1DQIA 1WWWX 4S0HA 4PJ9D 3CDGA 4JRXB 4WHYH 4D0CB 1U8CB 2AERT 4KRNA 4MZ3A 2VLKA 4Q7DA 4TL4A 2A74A 2CBOA 4B95C 2YJLA 5EC1B 4U7KA 1A7RL 4YVNA 1TQCC 2FHFA 4WWKD 5KVEL 3BSZA 4WU5B 3N85L 3QZBA 3FTVA 5F7DB 5I1DB 3DV4A 3ZDXB 4P5KB 4XC3L 2Z3FA 3WUWA 1BXUA 4GSDL 2JKLA 4B9JA 1VA9A 4AJVA 4UNVA 5HVFB 1ROCA 3WGUB 3CSBA 1MPAL 1U58B 3L5JA 5ICXB 5IWLA 3O2DL 3BCFA 2AJXL 3UG3A 2D03L 1JWMA 2R2BA 3Q44A 2GY7B 5HTSA 4E9RA 1I1AA 1FIGH 1D2PA 5DR5H 5E2TH 4CSTA 4KROC 4CW1A 3PRZA 4PN6A 3UACA 1FUNA 1I1AD 1MCNA 4KTEH 5DFWH 2F6AA 4J6IA 4XAKD 3F85A 1KYUA 4MKMA 3LRKA 1U3ZA 2RD0A 3GS7A 1G7LA 3MV7E 2H9GA 3UPRB 1DQMH 1ONQB 2LQRA 4LLDB 4UM9D 4F7MA 5GGSB 4JGNA 5DC9B 3ZKMC 4Y4KD 3UCQA 3L4WA 2ZUQB 3CU7A 4YVUA 3CZFA 3GXTA 4BA0A 1XD1A 2E6JA 4NQCA 1WIPA 2XV2A 4LOUC 4F37F 3FO1A 4O00A 5HP5A 3BRDA 3ARFA 3SO3B 5LDUA 2OA9A 4CL7A 3SCMC 3S98A 4N6RB 2BIMA 2JJVA 3ILDA 3ARFD 3GGWB 4BYHA 5DEGA 3KLAB 4Q9QH 4LIQE 2OMVA 1ZLDA 2ESVD 4HPHA 1TTBA 4DGWC 1T1ZA 4AGLA 4ZMQA 4NC1C 1YQVH 4IRJC 1OAYL 3BIKB 3O45A 4JW3A 4XPAL 4Z7VF 5DRZB 1BLIA 5JHLA 3RNKA 5B1JA 3UH8A 3PUCA 2R0WH 1IU1A 5C0EB 3WFEL 4BA8A 1QR1A 4NKDB 1DJXA 1O5PA 4P3DA 2WV3A 3PIQB 4Y7MA 3STLB 3VNZA 4WU7A 2GB2A 3A4FA 3LN9A 5AW9B 2OJEA 4B7LA 4ZUSA 2XNAA 1ZT7B 1RH8A 4UM8A 1JFQL 1VKXB 5FO2A 1R3HB 2WQ8A 1G9NC 4JFHE 3V5KA 5CCKH 1XGUB 3RZCA 4KGJA 3HNVH 5IJKC 4D7BA 5TJWK 3F6JA 2YPKB 3CVDA 4NZFA 5CHNB 1YAZA 5HHXL 1KLFA 3P4MA 3WN6A 2VR7A 3ZZQA 3EAKA 4IQHA 1A1MB 2A9CA 1A6ZB 2TRHA 3RWGA 1IQWH 2W9DH 3VTMA 1P7QD 1IFHH 4G1MB 1HFUA 5FX3A 5TGBB 4GMSH 3UBXI 1ND0A 5AAMC 3DUSB 5IW1A 2VZUA 3WJMA 4IOFC 2V5MA 1KCVH 3V4PL 3VI3E 4AVHA 3HCVA 5C08B 1MREL 3I50H 4ZW7A 2PN5A 2WNXA 3FN0L 3U4EB 1T20A 1IGIH 3VWKA 1KBKA 4HOWA 3QPQD 3HB3C 1IGJB 4RDBA 4BWWA 4G6KL 3F83A 4BHUA 1SY6H 4R96B 4DVRH 5FO7B 3LN4B 1BQKA 5TF1L 3X3FL 1IO4C 2DEWX 4L4VA 3NA9H 5FLUA 2DQJH 5CGMA 1E6JL 2DQTL 5EZJA 5DWUL 3SBQA 3ZQXA 1XB8A 4G82A 3RPIA 2XPGA 2P1YA 3PHAA 2DLFL 4XI5D 1P1VA 5DJ0B 5TH2B 1BLNA 3VD9A 4UT6H 3OMNB 4WNSA 1U8MA 2YD3A 4KZEH 1CI5A 1CD1B 3VXPB 4E0RA 2OMXB 5CCHE 2JI3A 4KROD 3S37L 1KCWA 4NB7A 5C0JA 2DW5A 3SPCA 3N41F 1NUFA 1THCA 2GT9B 5K1VA 2FJHB 2JELL 2H0JA 4TRPL 1B0GA 4PLKC 4WUKL 5I0ZA 1DVFC 3EZ8A 4M6OL 2XV0A 1UXMA 4RBPH 1JZ7A 5T3XH 4HJIA 1S7WA 5KSBA 2PP9A 3NRQA 4OZGE 1KV7A 4DKFH 2VDNH 1NOLA 2IGTA 2LU7A 1FNLA 5AOIA 2IAMA 2AV1A 4XMXA 4PRPD 4Y2DC 2VXUL 1GMIA 1HL5A 2GK0A 3HE6B 3VXUD 1RPUA 2QFPA 1QEWA 4AVJA 4YHKL 1XGTA 2CK2A 1P4BL 4IRSB 3HBPA 4KKCD 2QZQA 3DPBA 3O3BA 5T1KB 4CW1B 3D4ZA 2JWYA 1BV8A 1F8TL 3WELA 4XNZC 1EAPB 2AKRA 3EUDA 4FEIA 5F0PB 3Q9PA 2HH0H 3AQYA 2YAHA 1HNYA 1A2YB 4K23H 2X4RB 3VXRA 3GRGA 3TM6A 2XQBH 4PG9A 3SYPA 4RZKA 5J6GB 4FA6A 2BOBA 5F9WC 2ZOWA 4B96A 5GRJH 1MFCH 5DRXA 4YHOH 2VLRB 3BN3B 3ZE0F 5ANMA 3V2AR 4HUWB 2XYBA 3QDGE 2BVOB 4DP4X 5BMFL 5GS0C 4CA4A 5HGHA 2I85A 3ME0B 4H26A 1JDDA 4JRLA 1Q4NX 3DVGA 1AGCB 4FULA 3VTAA 4HKZB 5A2JH 2OMTB 3K2UL 3RVUD 1HINL 1ZLUH 3RWHA 4W93A 4ZFOL 5H35B 2ZIDA 1WVZA 3EH5B 4M8QB 4GRWE 1NAML 5J1TC 4MAYD 3N40P 3EHBB 1O7VA 3KL5A 5HI3C 2AK1H 3FJTA 3B8YA 1G6RL 1RUAL 4GKZB 1KZYA 3O41B 3GSNA 3SYCA 3HC0A 1FGVH 5HYJD 1UWFA 4R3SA 2XA3A 2IEPA 3B5HA 2CM6A 3C09B 3RIAK 3V9EA 2EINB 2AXWA 5T1DH 2ENJA 1BAFL 2X4NA 4OD3L 5BS0A 4ZZFA 3TV3L 2UWEF 4MCYB 4MD4A 4OI8A 4JQIL 4RAUA 3RAJH 1TNNA 4M5SA 5DK0B 4DSYA 5EEVA 2KUTA 3U36B 1N5AA 2HKHL 5FYJD 4BH8B 4IYKA 4H1LA 5HSFA 5KYYB 1WJ3A 2CNYA 1AFVL 3WO3B 3TO4B 4R7DA 1EZUA 2D31B 1LO3H 1GSMA 3E7JA 1E2VA 3F8UB 1YNTA 4FHBD 3T8XB 4HIJB 4G1EA 5AZ2H 3OAUH 3WIHA 2EC8A 1ZGLM 3TEUA 4XPTL 3FT9A 2GAZB 3MJWA 2ICES 4P5TB 4X4KA 3OXSB 4G7SB 3ZE2E 3BSZL 3LKQB 4XPBL 5L2JB 2WBJD 1QACA 3NZSA 4WEMB 4WV1C 1V27A 3VM5A 1GJWA 4UIKL 3VG0H 4LPXA 3AABA 2X40A 3VFVB 3PCYA 1TLMA 2WAQA 3GIZH 5I8EA 4HIHB 1BG1A 3FFOA 5EZIH 2ZP8A 4JO5A 3K2IA 4OIBA 2WZPD 4PRBA 4K5LA 1MCWW 4PY8I 4WW2A 5ACMA 2PR9A 2R0KH 3ZDZF 3TVMC 3RPBA 3PLYA 3MUZ1 4CMMB 3I6LD 5K9KB 1L9TA 3PV6A 3BKCH 4HF5H 3V0GA 3VSUA 4X5WA 4BELD 4BUHA 1SEBA 3H9SA 3DXAA 1B4LA 1VGEL 2HJLA 4FXKA 3HZKB 2D31A 2W0KA 3FZUC 4XNYL 3D05A 5C6WH 2YUZA 1KWKA 3KMDA 4HFWB 1RZKC 5I18H 2WTRA 2FWOB 2VR3A 1XR8A 4NHCL 5K39B 2OYKA 3BAIA 1YNKL 3QPXL 4HETA 5EUKB 2I60L 1M7XA 5FKAB 6PCYA 3SDXA 3KPSB 4JFYB 1UA3A 3CE1A 1VFBA 3G5ZA 4Y5VB 4P9HH 3TBBA 2I32A 1P2CB 3AGWA 1YEEH 1M2VA 1M71B 4UYQA 1EGJH 2ZJSH 1MIMH 4U6YA 4ZNEA 1NCIA 2QDVA 2AV7B 4G6FD 3S7GA 5FYLD 4DHLA 4L29A 2KI6A 1E27B 3QJRB 1BM3H 1U95A 1H3GA 4XPFL 5L9DH 3ESMA 1YYLH 5BO1H 5DUPH 4JN2A 4U1IA 1UA6L 5DEFB 5F7FA 3R7QA 2CAKA 3S4SA 1XBDA 3H42H 3PHQA 5I30L 5KVFH 4G8GE 3WJJA 2XACC 3H2QA 3EGXA 1JHKL 3S3BB 3QG7H 4LL4A 3N44B 5IJDC 1CFQB 3CVHH 5AG8A 4HJ1A 4LSUH 4IMKC 4IOSA 4OTXH 5IB4B 2NW2B 4PRIA 3QUZA 1INDL 2A5UA 3D85D 1A7NH 2AQ2A 4JFSA 5DD3H 4EI5B 4W6WB 5ALCH 3KEHA 4OUUB 2HJKB 1X9UA 3H9HB 2VDQB 2FSEB 2ITDA 4L1BA 3VI3F 4Z0XB 3N44F 4JMXA 2ITCB 3PJNA 1C9SA 3GSXA 2AXGA 2GTWA 5FDWB 1N18A 5ICYA 4PB9H 2PWEA 1KBGL 3GSNL 4H88L 4QRPE 4UAOC 1RV6X 2X4SA 3LPFA 2ZF8A 3GO1L 3NSYA 5AKTA 4ODSL 3PP4L 1GJIA 1EO8L 1G43A 3NCYS 4LLWB 4N2FA 3QH3B 5MP6L 3SDCC 3HS8A 5J6HA 3LN5A 2VZVA 4OZIF 1VLXA 2AZAA 4DVBA 4PCYA 4XXCC 5KOVC 3DJZA 4U1NA 3E6HB 1XGPA 3OWRA 3HI5H 3T71A 1WBXB 2FEJA 4JPKH 1EJFA 4HKXB 4XCFH 4XPGH 3X1BA 5I17A 5F96H 4OD1H 4TUOB 4PCSA 3VACA 3WNMA 5GPRA 1CFVL 3JWDH 4HS6B 3TO4C 4DP1X 1DBML 5FF6B 4NRXA 5EF2A 1KEMH 2I07A 4D0BA 3OAWA 1SDAB 2VMEA 3MVSA 1OP5K 5AAMA 3GS0A 1WBYB 1T0OA 1TKWB 3QRGH 1G7IA 4XP1L 1A7PH 3FUJA 4Z7VE 4QLRA 3STLA 4WZ9A 4YSPA 4F7KA 1W80A 3CXFA 4E42A 2YPLB 5I1HL 5L4MA 2YRZA 4KY1H 2VE6B 1R3HA 1WFJA 2PXYC 1GAFL 2X2YA 1ZLEA 4DN3L 2HLAB 1H6FA 3DGCR 1ACCA 4ZFFA 5SWSB 1XBRA 4GBXD 4AL8H 4BKLB 4YDIH 5DJAA 1YEIH 1ZVSB 5ETUA 12E8H 1BOGB 3IFPB 2EYSA 5BUAA 1XCQA 4N0YL 3WIFB 1DE4B 1T2QL 1OLLA 2F9BT 1U95B 1PX3A 3ECQA 1JZ5A 1DEEB 4AL8L 1GS7A 4JL1A 4PLKD 2I27N 1OB0A 5JYLA 4KKPA 3PWNB 4GAYA 4JPWL 4WGKA 3D06A 5HYJB 5EUOF 1IKNC 3NIDF 4UTBH 1KBWA 1AIZA 1LQBC 3GKWL 4XO9A 3TP4A 2CIIB 4KVPA 4B3VA 3HKZA 2Q8AH 5F3HA 4Z7UE 1IGYA 1IEAB 4XNUL 3IU3A 3JWOC 4QXUH 3VSTA 4XRCA 1M42A 1P69B 4O2EB 1S5IL 2C9UA 1NEZB 3LS4L 1JZGA 1JCVA 1NIAA 4JPWH 5EBMA 1G7JA 4OD1L 5F3FA 3SGJA 3B37A 4OF5A 1UJ3C 4AJYV 3V55A 2QSCH 3BGFC 5F21B 1OM3H 3BFOA 1WFIA 3NCCB 4ZBJA 5F9AC 2O30A 1NGYA 3CZKA 5MEOB 5FECB 1F1GA 4EIBA 4LSRH 3MRLB 1EWHA 1BOYA 3P69A 3C8HA 4DIXA 4HCIA 1QBML 3HE6C 4F9LC 4F7PB 4OZIE 2OJZL 2CDFA 4JN1H 3RIFF 2JJUA 1AHMA 2CSPA 1WZLA 3UO8B 4X0KB 3JV5A 1KBGH 2DIAA 3KPRD 5D2NB 4M3JA 4R83A 4P5KA 4TNFA 4HKJB 2R2HB 1DJHA 2I7OA 2I24N 12E8L 3B2UD 3C8KA 3HUJE 3NFNA 5E7BA 3IU3B 4BFKA 1ZANH 3KH4A 4UB0H 5DJDA 2HVJA 4OF7A 4GXFA 4ZUWB 2XY2A 5BS0D 5LBSL 3JSSA 3ETTA 4PJ8D 2F19L 1QFOA 2H41A 2IWKA 3QG6A 1MW1A 3X2QB 2WLYA 3B9EA 2MSPA 1W8EA 3EYSH 3LKRA 5CU5A 3PREA 1I3VA 2OXHB 3KPLA 4WEEA 4LSUL 3EYOB 1MI5E 1NAMB 2K6YA 5AAWC 5FUOL 1NOFA 2BWQA 4NNYB 3UTQA 1IM9A 4FQHB 1DQQB 3D6GA 2HJKA 3VGGA 1SNRA 2VC2H 4ZFGL 1X5JA 3WFCL 3UABA 2YXWA 2VCOA 3M8OH 1SYSA 1IIIA 5EU7C 3SDAA 3S48A 1EO8H 4G8IB 5F70A 1QYGL 4JFED 4OZFH 4G7YH 1T89A 4X6CA 1BM3L 4FQ1L 2GG1A 3DI2B 4PB9L 3IDXL 5EN2A 1OCZB 1NMBL 5D4HA 1VACA 4IU3B 3MBED 4KZCA 1IGCH 3QZMA 3G6DH 1DBBL 1PY0A 1YY8A 3MCLH 4RMVA 2HN7A 1RQ5A 3ECBB 3NQKA 4GKNB 2NY1B 4G8GA 2C7UB 4IRJB 3TBWB 4C56D 3BIKA 1A6AB 1TZGL 4IOFD 4FF9A 1LP9B 1A7NL 1L0QA 4KXZH 3RL1A 1XF2A 4B9CA 4FXGA 4LCWA 1F02I 4HK0B 2FL5A 1X7TA 3PAZA 2RCSL 5DT1L 5FO9A 5ISZE 3G9VA 4NO0D 3LZNA 2CM5A 3QPQC 3V95A 5FWRA 2XIDA 4I9XA 4BUGA 3GINA 4HEMA 4NZJA 3LPPA 4LL9A 4W9HC 1UWEH 5IIEB 2QMJA 2WWMC 3H42L 5KVFL 3ORJA 2AKRB 5IB2A 4U6HA 1NUDA 2YGPA 4NKMB 1E5ZA 4RGOL 3IJ9A 5GGSA 4OKVA 1BG9A 1PIFA 1IQDB 1L9PA 5DLLA 2WQXA 3HRPA 3SOBL 5FB8B 3S4SG 2ZG3A 4O51A 4BK5C 4XO4A 3QIUC 5D2LA 4FABH 2WK2A 4XOEA 3DTXA 3WFBH 4WDIA 1G7MB 1EXHA 1T0NB 4J3XA 3D18A 4XVSL 3U0WH 1NLBH 3ILEA 3K80A 4K71C 1MCRA 2Z64C 1RJZB 3MHZA 3ZZLA 2BSBA 3RKDD 1KPVA 3F84A 5IK3B 3ESOA 4TVSa 1EEYA 2KT6A 3Q6FB 4FG6D 2CJ3A 4PGEB 5I0XA 4PG2C 4XNYH 2NNCA 5AEAA 4WU5A 1EFQA 4WJG3 2Z31D 2KYIA 1PU0A 3IDMB 4JM0A 4Y9GA 3GXPA 4NWTH 3TV8A 3FSOA 3REVA 4HLJA 4XMPL 4UZSA 4XP4L 2A0LC 4UMSA 4MDIA 1BF2A 4HW6A 3IRPX 1KBBA 3QI9C 3TFBA 4PRDB 1WGOA 3ZKMD 2VDLH 4YUEL 1Y7VA 5E6ID 5BQ7A 1VFBB 5HHOE 2NDFA 3ABKB 1BSIA 2QADD 5J1AB 4FXLA 2R59A 2XKSA 1XF3B 3QZWG 4NO3B 3IKCA 1Y1UA 4ZX3A 5ELIA 1RUQL 4TQPA 3ULUE 3CZNA 3X12A 2A73A 4QWWC 3DUUA 3BSZH 3T0EA 3DK2A 2ZXEB 4C4KT 3NP3A 1TEFA 2OMWA 3VSVA 4DEPB 3QIBD 2WN3A 4OT1H 3F05A 3DUHA 2V5SA 3OB8A 2QLVB 4ZOBA 4NO0B 4MHHG 4XPBH 5GRJL 1MI5B 4JB9L 3V79C 4OJFL 4YHZH 3K0WA 2VIRB 1VJSA 2AGJL 5AZ2L 1EH9A 2DEXX 4LCWB 2V3EA 3FPXA 4BSWB 1CZ8L 1CLYL 3D48R 4EN3C 2FJGB 1NLDL 1QSVA 1NCTA 3ULUH 1ZD6A 3GEWB 4PWJA 5DEFA 4MA1B 4TNGA 5EBWA 1KGUA 1LDPH 4WWID 4A37A 3JVGA 3RFZC 2ED7A 1DUZB 3GRWL 4NENA 2WVTA 1JNNL 5GGUA 3TV3H 4QXVA 1PL3A 1QFUH 1XCTB 1L7TL 2HX8A 3TPUB 4RA3A 3UEZA 4ALAL 1A3RL 2AQPA 2G5BB 3NZHL 1X5HA 1Q9WB 1DQJA 2X1PA 3N5AA 5HHPA 1E90A 4UQBA 2WOBA 2ZYSA 4BV1A 3VXRE 5FGCE 1UENA 2FO4B 4ZMWA 1QBLL 1NBYB 2GI0A 4G8IA 3FQYA 3ULSA 4BKSC 3UAFA 2O6DA 3DTXB 1WZKA 3OKLB 4KXDA 3RTQA 1HZKA 3OLGA 1WUNT 2ZOOA 4S0TD 5I9QB 1A7QL 1XAUA 1IZJA 4MLIA 4AI7A 2BWDA 3TA3B 1RZGB 2BSRA 2OSWA 4MMYB 1PLAA 4UWQB 5CJQL 2X1QA 4B3EA 4UILH 3S0PA 4MD0A 3EJYC 3BIBX 3QI9D 3E0GA 2QPSA 5IMOA 4K23L 1I7TB 4UT6A 4Y4KA 4HOMA 4KZEL 1CU4L 2NXYC 3WEAA 1YEGH 3RL1B 5E2UH 5CEZD 4GAFB 3T09A 5J06A 2ED6A 2V33A 4YSTA 2N7SA 2LAGB 3AS0A 1K8DB 4O4YH 1I3RB 4P2RD 2DV6A 3B2MA 4X99B 3QNYA 4GB9A 2V9RA 4IGBD 5DHMC 2IBGA 1G6VK 4PJEA 2EQDA 1BFSA 2YD8A 1A7OH 1NIFA 3IRCA 2GTZA 1CXKA 1O7SA 5HHVH 4GO8A 3EOTH 4WO4C 2E6QA 4YE4L 3FRPG 5CN2A 3M6DA 1Q1JH 2DAVA 2PTTB 2FGWH 2FX8L 4C55A 1T6BX 3L5IA 4PGBB 4XHJD 2Z7WA 3O9WC 4EXPX 2ZWKA 3QDMD 5AVXB 2H2PD 5KVGH 3EXJA 4OCXL 1CGWA 1LNUA 2JELH 1E4HA 4NQEA 3PFQA 1J8HD 4Y9EA 5BUPA 3AG3B 2MTPA 1R17A 2VDNL 3G6JA 5E1AA 3FU3A 1H8LA 5G4NA 3TX4A 3Q05A 2WCSA 3ZN6A 3BMVA 5GISH 1IQWL 2W9DL 2XWCA 1FZOA 3UC0L 2DWTA 1HOCA 4XNXL 5C07D 1UYWL 4AQ8A 5F3HB 4U1NB 1P7KB 3K8LA 3PJLA 2W1NA 3RJOA 4BQ8A 3SGKC 3G5VB 1L9OA 1I31A 3W2DL 3UJTH 4RQQA 5L7XL 1CDIA 3FN9A 4H8WC 2IDFA 4GAYB 4IU2B 5LHDA 1ASQA 3QQ4A 3H6JA 4UT6L 2XC8A 5E2VL 4ZD3L 2VR9A 1RJYA 4XAKE 1SY6L 3BZ5A 4XCYB 4G6KH 3R8BB 3HN8A 3C5ZB 3B3IA 1J1PL 3OMIB 1WLHA 1U8IA 1FQ9C 3MBEC 4H20H 1B0RB 1KTLB 3DROB 5FCUL 1NFAA 3CFCL 3HKFA 2VUOA 3O6MH 2VXVH 2WLLA 5EORL 4AUUA 3I3EA 3RL2B 4PG9B 1KGWA 4FJZA 1PSKL 2OTUA 1BQHB 4KMQA 4NHUB 2HT2C 1Z5YD 2YIHA 4XN7A 1ZE3C 1ORQB 3NIGB 3V4PH 3ZDWA 3ZHDA 2LLNA 3QWQB 3PG2A 2WVUA 4NRZB 4IKJA 5H4ZA 5IJKA 3TVMB 1P4UA 4I5BA 3ZQ9A 5DYFA 4Y16D 5LCVA 1RJYB 5JIIA 2CHDA 4G7RB 2DWYA 2X42A 1NAMA 4PGDA 4W1TA 3S5LB 1D7DA 3F62A 1T1WB 3KPOA 3VM7A 3O9WD 1A3LL 2R1WA 4DF9A 3FT4A 4AV4A 5B8CC 4MKTA 2Y7QB 1LO2L 2NLJB 5BOZG 4XX5A 1QLFA 2B1AL 2W80C 3KGSA 3R18A 4LDEB 4KX7A 2Z8VC 1QTSA 2Y06H 2G2RB 3RGBA 2HT4C 3FUMA 2Z93A 1MPAH 3MRHB 2E46A 3CZJA 1EAOA 5LGHH 2ITFA 3WDIA 4X8CA 4JG1H 4NZDA 3ZQWA 2ZOLB 2WLMA 5LXGH 2Z0UA 2FCBA 2QQLL 1G84A 4XC3H 5DLMH 1GS6X 5JNYA 4LVHB 4HZLA 3TT3L 1SHSA 3MV7A 4OLEA 3GZQA 4PVLA 5F1OB 5GHWH 3QS3A 1VZHA 4X4XB 2NDGA 3JV6B 2FATH 4N25A 3IKCB 4M7ZC 1MAMH 4YLQT 2FJFB 1NL0H 4AH2B 1QQDB 1JXJA 2CRZA 4TTDC 3SHSA 3VGDA 4CU7A 4K94H 4ODHH 1FH2A 3BPCB 2RIKA 2WXGA 3ARGB 4XI5C 1GZQB 2VDRH 1NFDE 3LS5H 4TTGA 2DJSA 2WYZA 1CE1L 3GJFH 1A66A 2APXA 3M1BA 5AVYB 4P46B 4QRAA 4I2XA 1CL7L 4ZS7H 3VXRD 3NSDA 1R1CA 5LKNA 4DP5X 4Y19E 2LU4A 1OY3B 4B0MM 3EH3B 5DZAA 3LN4A 4KK6D 2NY3C 2ALWA 3M46A 3BW9B 2XRAL 3KLKA 1T6VN 2FQDA 2KPNA 3BJ91 3CZUB 3O6FC 3RTLA 5JW4Q 1FIGL 3U6XA 5E1QA 1CS6A 1GGIH 3A24A 3HB3D 3NSJA 5F9JB 4J4PD 4CKVX 3C5ZD 4QTIH 1YHPA 3DK0A 3W56A 3INUL 2OMZA 1ZTXE 3QQ9C 3VE0B 2PCPA 5T3ZE 4LSVH 5I5JA 2P52A 3CQFA 4FI6A 3G5YB 3GJFB 4PJ7A 1BD2A 2BW5A 2A4CA 4ZNEE 3GMNA 1KENH 4M7LH 3UTTA 2H7WA 3AXLA 3VWJA 1ZVHA 3OR7A 4ZX4A 2XV6B 2XZQH 3F12A 2ZX5A 4Z7AA 2X12A 1KBVA 1T2XA 3DUUB 3T0EB 1W91A 3X1GA 1JUFB 1ZHKB 1V8HA 4I48A 3T0DA 4ANUA 1KUMA 4OZHB 3DO7B 2CG9X 4OVVA 2P5EB 5FA4B 5DK3A 4PYHA 5E1AB 3ULSB 3T0WA 1Z9SB 4S1QH 3CK0H 5J13C 3H9SE 3TNNB 4J2XA 1GW6A 5BZDB 4RFEA 3V6ZB 1YMMA 4YHLL 1IV8A 2DQFA 4N68A 2Q6WA 1F41A 5C0IA 3RX8A 2IH1B 3TZVB 2I5YH 4B6ZA 4HH9A 3FQUB 2RAMA 3UTZA 3VRJA 5DVLA 4DPAX 2DLGA 2WBJB 3QCUL 1UADC 1RHHA 1ZJBA 5BVPL 2NNFA 2C9QA 4PJGE 4YZWA 1DUZA 3VFGH 2GSMB 1I9RL 1ZOXA 5EU6E 2J72A 1SMDA 4ODBD 2EVIA 3CHRA 1IFGA 3L3GB 1G9MC 4ZOEA 4DGVH 4TUJA 3QUXB 3J8F7 3TFKC 3DKHA 4DEWA 1T1YA 1I9JL 1B4JH 5AW2B 5DO8A 4E9WA 5B38G 4YBQC 3UTPE 1W72L 1RJLA 5AL8A 3VFSA 3L4ZA 4MMXC 1Z9SA 3IMUA 2TSBA 2DQ6A 4TQ8A 4R90L 5CKAA 1I9IH 1EAQA 4C8XA 3IMBA 1PX4A 5CXPA 2EDMA 1XEDA 5I6XC 2IOMA 4G3YL 5CCJA 2PKDA 2GBAA 3BFWA 3ETBJ 4K2UH 4WJ5B 5EO1B 5IKCB 1X5GA 2ZP9A 1QPKA 1CE6A 1J88A 3AY4C 4QKXB 2H6PB 3QORD 3L3JB 5ESVA 3V8CA 4NQQA 3MRBA 1RMFH 3OVUB 2W95A 4OIFA 1D5RA 1XB3A 4N0UA 2NNXA 4ZTOH 5CJOL 4PH8A 1HZHL 2EXSA 5LAXB 1HQRB 1CICD 2NQ3A 4QRRA 3BZDA 5LGJA 3SKNB 3VI4F 3AAZB 1AZBA 4OVUA 2YRBA 2AEQH 5EDSA 4QGTA 1C08B 4E2OA 1N10A 1YAIA 2LVCA 4M03A 4KH9A 5K9JL 2Y5EA 4LLVA 5DS8B 3T6VA 3K46A 1JNHA 5JHLL 1NPUA 2VM3A 3Q7JA 4TVPE 5SWZD 2WY3B 2Y1VA 4PLJD 2SODB 4H44C 3C2AH 2EP6A 1L7IH 1YMHB 1U6AH 4O02L 3ABZA 2WLNA 1U2HA 2V5TA 2JXMB 4YHIA 5J8OA 1YVLA 4JE4B 4EZMA 3ALWA 3LXAA 4IU3A 1KN4L 2K0RA 1UM6L 1KACB 4XH2A 5KYNA 3WEXA 1BP3B 1WIOA 2VWEC 1C7TA 1FYTB 1I3GL 5ABDE 3MRBB 5AQ0A 2GJ6E 5CZXD 2DD8H 1MFDL 3A4DA 3NGBB 1AANA 2Y1YA 4K5OA 4TL5A 4C83B 3VA6A 1UOVA 1YDPB 4P46C 1XIWB 3PUUA 3IGFA 3BZEA 3GPSA 3QORB 1SHMA 2VN6A 3IBOA 1XSKA 1ZTXL 2VSMB 3UZVB 3SJVA 4GW4B 4OZFG 3O41A 1JPSH 2IAMB 4WW2C 4BQ9A 4ZMXA 1DLFL 3OBAA 5HYJE 4QCIA 2R4RL 3T4AC 3LPWA 4MJ6B 3IM1A 2I5YL 3O11B 4X4MA 1IBGH 1A14H 4ILDA 3D25A 4HJSA 5DVPA 3UYRH 5KSBE 2NY2D 3VE0A 3MJ9A 4PGDB 1FO0L 3MACL 4HPOL 2YAFA 2FATL 4KC3B 4U1JB 4TV3A 3SO3C 1NGPL 1UH2A 1UB5A 2CDFB 3N1FC 3VXQB 3CBKB 5L6YH 5IM7A 2CKBA 2QQLH 5J12B 1KPUA 2OSYA 4PJAF 5E1HB 1TQBC 1U21A 2NRDA 3E8UL 1A2YA 3W0WB 4CADA 4JAMA 1HHKA 5EU4B 5TTRA 3V0EA 2BOBB 1BZOA 1BQHA 1RJZA 2UUDH 4PJGF 2VXQL 4Y1AE 2IV8A 3MRKA 1YY8B 4HZLB 2CHXA 2WLKA 3Q5OA 1KIRA 2XKUA 4NZ8A 3ENEA 2B9BA 2APTA 3KXFD 2NTFA 2V9QA 4RWYL 4CGTA 5DRZA 4L37A 3PJSB 3QDJA 4K9JA 2OYLA 2W9EL 1KCSL 3BP7A 3NH7H 4JFDD 4HZ1A 3IFLH 4MRBA 6FABH 2ZXGA 4JGMA 3LEYH 4AEHH 3KM2A 4X42A 2X4OB 2VW4A 4F7EB 3MROB 4KU1A 4LSSH 4TUKH 3P40A 1FWXA 2ZUWA 1KSRA 4FG2A 4TVPH 2R1WB 3U9UA 4RETB 4XO5A 2ADYA 3ML8A 4HHAB 4NI3A 2H2SC 4X7TA 4GYBA 2FE0A 3AMLA 3DSNA 2PYED 1I82A 2YA1A 1SEQH 3KYAA 4DP8X 2QR0B 2E8YA 1MW3A 4HC1A 3QA3A 1BOGA 1A8JH 2OMZB 2E9JA 1KTKE 4JFHD 1U8NB 4HH8A 2BZDA 4QAWA 4M7KH 2X1XR 2DYPB 1DE4A 2JIXB 1AQ8A 3EOYG 1ORQA 2CIKB 4WFEE 1H6EA 5HD8C 2CO1A 4KKNA 4RMQA 2OW6A 4KUZL 2D0GA 1IAMA 3BKJL 1SOQA 3G6JB 4E0RB 2EXTA 3GDCA 4AT6A 3F58L 4LVHC 5TDNA 4DNLA 5IHWA 3NABH 1TIUA 5D1ZB 3HN3A 4XVTL 3RIKA 1M7IB 3QDME 5D96C 2F58L 3K8MA 4PP1C 5K1JA 5A2AA 3WNKA 4W68A 1R0AL 3KCPB 2Y06L 1BIIA 3M1BB 4P23C 1TO4A 2BC4B 5EF0A 3VFNA 1N68A 1ESOA 1UWXK 2XX1A 4OD2A 4R7NA 4HQQH 4B7IA 4QRFA 5JOPD 3ASWA 3JYBA 3B2PA 4DO5A 4IBVA 4JFEB 4TUOA 4NC1E 4PJBB 5T3XD 2R39A 3EJZD 3NUKA 4A68A 4BQBA 4P4RB 1JHLL 4OFIA 2WVVB 4YX2L 4FADA 1V3LA 4XNXH 4YDMA 4YZFF 4NN7B 1ECYA 2NNAB 5GISL 4FYTA 1EO7A 3EGSA 4PJDA 5LNGA 1BQRA 1MFVA 3C9NB 4GQPH 1D2OA 2BHFA 4V1DA 4OUOA 1ODUA 2XVBA 1M6OB 1ZLVH 1QLEB 3T3PF 5IVXA 3OGOE 2RBLA 2QVMA 3MLUL 4MWFB 1ODAA 3BGMB 1D9KA 1TSHA 3FRUA 3VWKD 4AIOA 4DJMA 1NANI 1SJEB 2V0AA 1E28A 1QLFB 1NBCA 2Y72A 3C87A 3PHOB 2GIXA 4WO0A 4AW7A 1HEHC 2QMKA 5CEXA 3MLYL 3CPLA 4G7VL 4AYEC 3RKPA 4GG6A 3MFGB 4LGPB 4JANB 4ZXBA 2XG5A 4AZ8B 1HSBA 3B2XA 3D51A 1TJGL 4QRPD 4WI9A 3FFCA 1EHKB 4DK3A 3FQNB 3KPRB 4YHYB 2NQCA 4N2LA 4D94A 5T3XE 2G3NA 2ZKWA 1T7WA 4PJFE 5F89B 4YK4C 1OF2A 1JTPA 2P80A 2VDMH 3TYGL 1KYDA 3QJHA 4TQIA 1LWHA 5SX5H 1EJ8A 3AXHA 3HZ3A 2RFXA 4N3TA 5GS1B 3ESUF 5IF0A 4IM8A 1AQKH 3BAKA 4BUQA 1NCWL 3TWYA 2A6DA 4ODTL 5E8DH 1OALA 2CHWA 1IRAY 3AGVA 4D7PA 5FYKU 4Q56A 3QEGH 3AY2A 5IHBA 1F6AA 1PD6A 1QSEB 1TEYA 2LR4A 3EGXB 3MGOB 4IBSA 4W4OA 5CR8A 4D9RD 3MLTA 4FYRA 4FQIH 2RGSA 2DWDA 3RKDC 4U1HA 2FWUA 1E4WH 3ILQD 1HXYA 2NY3B 1UB5B 4W9JC 3O3DB 1HI6B 5D7JA 1LO0L 3IXTA 3L2NA 3UZQB 4DQOH 4AQOA 3UYOD 1GYUA 3LD8B 4X6EB 4QRSA 2OZNA 3ZIMA 4CVZB 1CBJA 5I16A 3QQ3B 3H9SD 5ADPH 3NK4A 4C4BA 5TPWH 2V3DA 1OCWL 3DUSA 2BLFA 4ORZC 1H6UA 4AK1A 4B27A 3CDZB 4ZTPL 1KCLA 4Y2OB 1TQWA 4XX1E 2JMRA 1L9MA 2BWIA 3IMWA 4FKKA 3X11A 4JFZL 3BKML 5HHVL 5JTWA 1HAUA 1U4EA 4TNVF 5JLZB 4MYWB 2P47B 2NTFB 3TA3C 3GLEA 1Q0XL 1TT6A 4CMMA 5K9KA 3SPVA 1QD0A 2Y5TB 3FKUS 3NJJA 4CN6A 4QJ3B 5B7MA 2AGJH 4NFBA 2YAEA 1MAKA 3AUWB 1MJ8L 4UV4L 3V4UL 1OOWA 2YPLD 3U7WH 1MY7A 2OJEB 1U58A 3LQAC 5IEKA 1JGUL 4R97C 4KUCF 2CCLA 2P8LB 1UQSA 5HDWA 4PMEA 4Z9KB 1S3KL 2UZIL 5TE7L 4AMKL 1O6SA 2MCPH 2FJSA 3HS0A 3I02B 1YO4A 4K9EL 1LEKB 4FNPA 4NN5B 1QPPA 4AQ1C 1EZLA 3FT2B 4JKLA 2K9UA 3MOBH 2BDNL 5KAQF 4IJ3B 2F54B 3U4KA 2XT1B 1NBVH 4LCUB 1BM7A 5DJXA 3CDGB 4U0RB 4FYQA 4JPSA 5DJ8B 4L9LA 2Y25A 1P5VA 3MTXA 3OJDA 4APQB 3SDXF 1RY7B 3KPSA 1BZDA 4K5PA 1H9VA 3EBHA 1HCYA 4P2OD 5CUSH 4CKQA 3MA7B 4KV5E 3B9KC 1JVOA 3VXTB 3EFOB 1BBJB 5DMIL 2XWBA 5D72L 4KAQL 2ICWJ 3EYUL 1JNNH 3DARA 3SGKA 4OM1L 2H3NA 3WLWC 4JX0A 1XXDC 2QV4A 1CE6B 3EBIA 1ZHLA 1BZ8A 1OANA 4Q6IA 3WIHH 4LSPH 1LDSA 1N0LB 1FGNL 1KT2A 4J8RA 1JGVL 3QHTC 1WBZB 3KJ6H 3L9RA 2EJ1A 2M26A 4PJAA 4WI7A 3Q8BA 3E3QC 3JWNG 2NR6A 4HU8A 3KYOB 4OI9A 1OCOB 2B5IB 2DN7A 3MRGB 1PNDA 5D93C 2MCG1 5DSCA 3VFTA 4FQLL 4L05A 5B7FA 2VUYA 4PRNA 5TE4H 5DJXB 3ZL4L 1E3ZA 2CK0H 4XB8A 2FT8A 4TUJB 4ZAKC 2CDEB 3BUQA 4PY8J 3S96B 5BXFA 4OZIB 4CVUA 1VHPA 3KBHE 2VXSH 4J7RA 5GZNA 3ZT5A 3L3IB 4L8BB 2EDJA 2VZ3A 1LO4H 1TZHA 1YLBB 3MNWB 2DM2A 3UJJL 2HMID 4B9PA 5IJBC 4I1NB 6PAZA 4YSQA 5A40E 4G83A 4HWBH 4NT6A 1DQTA 3GSUA 3LKQA 1CYWA 5ALBH 1KPVB 3WKNA 2E7CA 4LBEB 1WCBB 4PCKA 5B38A 4JFOA 4JVWA 5B39G 4L2YA 3ZKND 2Q9OA 2UWEA 3E2HB 1LJMA 4G9FA 1MWAL 4KTDL 4NWUH 4MCNA 5FYLE 1BYPA 1L3WA 2RJMA 2IWGA 2QVIA 3AM8A 1LL1A 1R5WB 3IGAB 2G9HA 3OF6A 4N0CD 1YY9D 1MJUH 4RFOH 2NY6D 3CH1A 3CZEA 2RQEA 3TZVC 1JXGA 2EIJB 1IGJA 5CN1A 1RAMA 3KPNB 3RX5A 4J8QA 3T6XA 2X4NB 2Y7QA 1EUUA 1N26A 1KTDA 1MLCB 4NYLA 1LO5B 3J2PA 3T4YA 5J1AA 1NMBH 5I8KL 4J12A 1F4XH 2F7IA 2O5NA 4HS3B 3CZGA 4LSDA 3TVMD 3K4DA 1J1OH 2IFGA 3VUAA 1HI6A 5D7JB 4IRZA 4V1DB 1BWMA 4Y1AD 1QYGH 1EXUA 4CU8A 1JK9B 1SYVB 4H0IA 4DERA 2CNZA 4M8VA 4Y1AA 3VXSA 2VC2L 4ZFGH 2WP3O 3GRWA 5D1QB 5CZVH 4FQQA 2IH9A 3H3BC 3L7EB 3L1OL 3ELAT 2VLME 2YSSA 4R9HA 4ABQA 1TQCB 1E27A 1GZQA 2E74C 3IDNB 1IGFL 1OTSD 5HDOA 1MCWM 2FX9H 3O2WL 3CXHK 2BSTA 3VXNB 5IZ7A 1A9VA 2VLLB 1UWEL 3OSKA 2EKSB 2BHUA 3N9GL 2NUTB 2YQ2A 3NZUA 1ZHLB 4MZ2A 3TO4D 3RJQB 2ADFH 4FD0A 3QGVA 3PY9A 5E99L 3V6OE 3ZSTA 3A4EA 5HY9A 4IRSC 4UIMA 2DLIA 4LPCA 4HWEH 5IHUL 1TQUA 5IB5B 1WZ1H 5M94B 5E8PA 1J0KA 4XHQA 3RVUC 4MB4A 4EDXB 4OJAA 1B4TA 3QAQA 3HZKA 4YZFE 2DB8A 2GIMA 3QCVH 4OFVA 2YD7A 4YN3A 2MQCA 5IQNA 3ZE1E 2WWKO 5KVMC 3H3PL 4TQEH 4UOZA 1AMXA 1FLRL 4PM1A 4DKDC 1UD3A 1L5GA 1GGCH 2AXFA 2LV4A 2R27A 2WTOA 3IJ7A 1DL7L 3QUYB 4P57A 5J11B 2J56A 1AAJA 2ZXWB 5DEJA 1QW9A 3O3DA 4OV5B 3IDUA 2R2HA 3NTCH 1XCQB 5EO0B 3AQZA 4PR5A 2JSFA 2ZOKA 2P80D 3WNPA 5J5EA 1REIA 4RGMB 3KXFB 2ED9A 1UZ6E 3MRCA 1OAUL 4FKHA 4LCYA 1PLCA 5AVQB 1SDDB 1UXSA 3QZWB 5DU7A 4F7TA 4UQIM 1KJVB 4ZQKA 5DDHA 5FUOH 4ENED 2Q8AL 2PCYA 5DFTA 5LQBL 4YR6A 4L3AA 2Q3XA 3QXAB 2XFXB 1PS3A 3EYSL 5C0IB 1V55B 1W2KT 1PYWA 5FLVA 3KWWA 1JWMB 3MSPA 2XXGA 4OLUH 1CLVA 2WZPA 2FB4L 4PCTA 3MNDA 4A04A 2XA8L 3CD4A 2OI9B 2FIKA 3OV6A 4D0BB 4GMTH 2DQDL 1NFIA 3TBSA 3HVNA 2NY0C 3SDAB 5EBMB 1QWNA 9CGTA 4MJIB 1FSKC 3CN3A 5CEXB 3U9PH 3MPCA 5T1KD 4HG4J 1TU2B 4A2MA 3BOVA 1P6FA 3CLWA 3UXFA 1C5CL 3LB6D 3L95A 4NLAA 2ZNWA 3ZDYF 3WN5B 5ES4B 2Q3ZA 2J73A 3I74A 4CC4C 1BD2B 4E41B 1MW2A 1M71A 1GCFA 3HG1A 5H4YA 2IDSA 1SJEA 2EYSB 1MDTA 4FI8A 4KDTA 3C2SA 3EYQD 4PJ8B 1RZGA 2XWTB 2CR3A 4HKZA 5EO1A 4B53A 2UZXB 4LVEA 3VD2A 4MXQC 3NCWA 3IFOA 1IILE 2IC2A 4HJEA 3NOIA 4X6DA 1E8XA 2EEFA 1PBYA 2X9XA 5F9OH 3ZYIA 3PAYA 1ECZA 1K2DB 3L6FB 4C4KO 5IP4A 4X5WB 5I66B 5EU6A 4KI5C 1SLUA 3AITA 3D2UD 4J3OF 5HY9B 2Y3AA 4UNUA 1J0JA 1MHEA 4U31A 5JPNC 5JPMC 2FNBA 4NQXA 1KB5A 3OHMB 3LKOA 1YNTF 3CGTA 1PZBA 4OF0A 3UBFA 5IFAH 4XMKL 1E65A 1KELH 4NM8L 1NEZA 5AL0A 2J8UF 3ZW3A 4W4OC 3GO1H 2DQCL 1K4CA 4XN8A 3L3KA 3D87B 4XE5B 1B0RA 1RZIA 3DPDA 1OL0A 3EOAB 2O5XH 4PSPA 2DJUA 2EUVA 1MI5D 4WJKB 3LD8C 5DSCB 3IPEA 3LKNA 1ZT1B 4HP5A 5E5RB 4Y4HC 2VL4A 3TO2A 4ZPVA 3BCDA 1OW0A 1P84J 2EXYC 5K5YA 3D39D 5B21A 5F1KC 1BEYL 1WE5A 1FAIH 1INDH 1AD9A 4AUJA 1H0DB 1M2VB 2YXMA 4F15B 1SHXA 4DAGH 3HLAA 5KSAB 3E80A 4Z7NE 1WT5C 4PAZA 4FG4A 1NM4A 1A7PL 1IKFL 3Q6GL 4LRIA 2R69L 5ID0A 2WUCL 4YE0A 3FUEA 4WI2A 3RUGB 4DKEH 4EZJA 4F2EA 3D08A 4WJ5A 2PYFA 3ECUA 1KEML 1PY4A 4YHMH 4MD0B 4ES9A 5ABAA 3DMMC 2VGLM 4I3SL 2XTJB 1MY5A 3S35X 3TU6A 3V52H 3QAZB 1PNCA 3IDJA 4JPKL 4PRHD 2EDYA 4Q9CA 3HHSA 4A55A 2Z4TA 3BD4A 2R56H 5EIIG 2K4AA 3UJIL 5SX4H 4EUPH 2A6JB 2F54A 3U7AA 1IGML 3GK8L 1C7SA 4EI5C 4Y4FA 1MQKL 4Q0XH 3ZT7A 1G9EA 4OGYH 1NKGA 3ZXAC 5J57B 1WV7T 3FQWB 4PRDA 2E47A 3SOTA 2I60H 1QHPA 3VXSE 3H8NA 4CVWA 2WLZA 1KFGA 4LOVA 3FB6A 1LEIA 4X6FA 3I75B 4U49A 4OV5A 3ZTDC 4N86A 1R3IL 2NZIA 2P24B 4MXWL 5JW5B 4HKBA 3PL6B 4S1DD 4OGAC 4PLOB 4A2LA 4HOZA 4B5ZA 2IANB 3SCMD 4CMHC 3UZVA 4KJQD 2A99A 4JO2H 5IGXL 3WBDA 1KXTA 4TNEA 4J8RB 4GOSA 3US9A 4HX1A 2I69A 2LFGA 1YUHB 3CFTA 4PV1C 5IQ7H 5FA3B 1EANA 4XZUA 1S7RA 2DI8A 5I1CH 1B6DA 2H2PC 3H85A 4N4YB 4WI4A 5D7LB 1B0WA 5I24A 5KS9E 2R69A 4KDWA 3DVNA 3T1WA 3OLDA 1QLRA 3D1MC 1YEDA 4LHUG 5LBVA 1MNUH 1NBYA 5BQ7B 1I1AB 2BSED 4EKJA 3RRQA 5JQ6L 5BRZE 4IEFB 1A5FL 1NMCB 3HZVB 5FFLA 2NZ9C 1BEXA 3DVIA 1AYRA 3OC5A 3EADA 4JAMB 4NO3A 5AOMA 3SDYL 3SGDH 4AYFB 2IBBA 4HIXL 4H7VA 5E9NA 3ETSA 3S34H 1EGJL 1OSEA 2IWFA 1BCIA 4LSPL 3WIHL 3WDHA 1BJ1J 1MCQA 3QJUB 5KBNC 3CMOH 3Q5YA 4DTGL 4EAEA 3WSQH 4KO7A 2DS4A 3MYZA 5CS7A 3EYUH 3AU1B 2H26A 4XPHH 2X2JA 4Q9RL 3C60C 1S7UB 4WWKB 1YPZF 3INOA 4PJIA 4J3BA 2DI9A 5J0BA 2PW2A 4NZRH 4MS8C 5BRZA 3HUJB 3DNKA 3SKNA 2FO1A 4FQJL 2OULB 1DBJL 4XVJL 1JFHA 3WFZA 5D5MF 2WLIB 1TLKA 4DCQA 4YFEA 5E08H 1I7TA 3DOHA 3DIVA 5AW5B 1ET8A 4OZGF 3NK3A 5AUMA 3L17A 4MX7A 1J5OH 2O72A 3UJJH 3MOBL 3TBTB 4PRHE 1EX0A 4JKPH 4JY5H 1QO3B 3SDDB 5K59E 3CAFA 1ROWA 3GYRA 1UOLA 1ES0B 4S2SA 3C6LC 2OCJA 2H9GB 5BS0B 4Z7QB 4UIKH 1IM9B 2Z1KA 5B1CA 1G7HB 4NQCE 5JW4R 4HOXA 4N1CA 3TWCL 4OKVB 1MFBH 3FRUB 3NJHA 4UI2A 1Y18B 1NZRA 2OX5B 1TVBB 2R23A 1Q0YL 4U3HA 1G0DA 3APCA 4OLYH 3CH8A 3GZOA 3MV8D 4HULB 3W38A 2DMBA 3VXMD 1RZPA 1XSIA 4QPEA 3PWLA 5DQ9A 3CXDL 4LLUB 1I85A 1EEZA 3Q13A 4X5RA 4XMLH 3AJ7A 2NZ9D 4LCIH 1PMYA 4CGUB 4EE2A 2QHRH 5L2JA 5DRXB 4MDRA 1U8HB 4JFZH 4JZJB 4N90E 4F7PA 1FBIH 4LU5H 5EN3A 2ROXA 4PTTA 5HPMA 4KWUA 1NCHA 2F53A 4WV1A 2VISB 4KK8D 1T21B 1S7VB 2Z91A 2EO9A 2CO6A 3NT0A 4NDMB 4PJEE 4XOAA 3FQUA 4M6NH 3OKEB 3PIQA 3RPKA 1DHKA 3ESPA 3N0PB 1IB5A 4ONGL 1CQYA 2NY7H 4QHLB 4NUPA 4L8DB 5LN4A 2HPTA 4KJQC 5HVHB 3I2CH 3ZE2F 2RHEA 3QCTH 2KZBA 1E4XH 4PJHB 5EUOA 1CF8H 2EADA 1G1CA 4R4FH 3HMXL 3FTWA 2GBUA 3KPLB 4R2GB 5HD8D 2ZUQC 4HWBA 3NEXA 2MCPL 3R4RA 2EXWC 1AMYA 4NNYA 1MLBB 5TE7H 4H40A 3TEWA 1HHIA 3ARBA 2B8OT 2NCEA 5DA0B 4PJDF 1D9KB 3TS8A 7FABL 1I53A 3CVHA 4LMQI 3RVTD 3P02A 3EJQA 3OKMB 5C09A 4UV4H 2VM4A 4NQDB 4GPVA 4GFXA 4I5BB 2X6AA 4Y2LA 3VMNA 4ZMVA 2GJ6D 3EHBD 1E4KA 4MXVF 5FYKE 2IDUA 4NCDA 1E6JH 1B0GB 1YA5A 2DQJL 4Z77B 4CSSA 3OMAB 4LEXH 5KEZA 5IQMA 3BQUA 4G8AC 5IG7A 1J9CT 3GMRA 1V7NL 2MOVA 1TJIH 2R0ZL 1MHEB 3QT2A 4PJCE 1JPFB 5TPWL 1M57B 3NCBB 4ZUSB 3QR0A 4A38A 5KJ7E 2A9MH 1CO1A 5JHDD 3QB7C 3NZ8A 4G6AD 4N2BA 4DQOL 1DDHB 4ZDHA 4EO5A 1IM3B 1NH6A 3MRRB 1HTYA 4KHTL 4WWPA 1G0XA 2UYLB 3MRFB 3LH2H 2Q8BH 5CFAA 3JV6A 5E6SB 1RXLA 1XB6A 4RMBA 1QWHA 4KOBA 2D4DA 5TDNB 3VXMB 3FRPB 1QHQA 4PJ8A 1W72A 3BT2H 1XMWA 5EV7A 4GP5B 3IJHB 4DGIL 1IC7L 1YQ2A 1X4XA 1ADQH 4CN4A 3K4ZA 4YSAA 3RWFB 2DYRB 4CBZA 3P1VA 2KHAA 1P7QA 2UY7B 3F5WA 4L23A 3O3AB 5KUKA 5J11C 1IM9D 3IF1A 4BZ2H 2BVPB 4FFVD 2FEEI 4E9SA 3HS9A 3L4VA 3NACL 4ORGB 1WWBX 1YNLH 3Q1SH 3BH4A 3FO0L 1HC1A 1HOCB 1MRFH 5C0CE 3WV0A 4KKZA 7CGTA 5HYFA 4KJWD 1J87A 3S5LG <