4AV5A

Structure of a triclinic crystal of the fimh lectin domain in complex with a propynyl biphenyl alpha-d-mannoside, at 1.4 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
total genus 34
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av5A00
3MCYA 5FX3A 2JMRA 3ZL1A 2WMPB 3BWUF 4J3OG 5FLUA 3JWNH 4AUJA 3JWNE 2UY7B 1N0LB 2W07B 4BUQA 4AVIA 4XOEA 3ZL2A 1UWFA 4XOAA 4AVKA 4XO8A 2J2ZB 3ZPDA 4XO9A 1PDKB 2JTYA 4XOBA 1ZE3H 3ME0B 1TR7A 5AAPA 4X5QA 5IQNA 4AV0A 5LNGA 4X5RA 5LNEA 5F3FA 4AVHA 4XOCA 5IQMA 4AUYA 1N12A 5AB1A 4AVJA 5IQOA 4J3OF 5ABZA 2UY6B 4AUUA 5CGBA 1QUNB 5F2FA 2VCOA 4AV5A 3SQBB 4X5PA 5FWRA 3JWNG 5AALA 4J3OH 5JQIB 4CSSA 4XODA 2XG5B 1KIUB 1KLFB 4ATTA 4LOVA 5FS5A 3BFWA 4X50A 4CSTA 3RFZA 4AV4A 4CA4A 3BFQG 2XG4B
chains in the Genus database with same CATH superfamily
4PJIB 1GYAA 2R7EA 5J6HB 2HJLB 2L4OA 1F4WH 3MLWL 2Y7QA 1XB6A 3BKCL 1FNSH 4Q7DA 1EIBA 1EDHA 2BVQA 2ED9A 3ZTDC 2N56A 5F9WC 4I77L 5HI5C 1A21A 1CDCA 2X89D 2ICWB 3OZKA 5TQ0H 5KG9A 1UD3A 2F1EA 4G8GD 5IR1A 3LV3B 3S4SG 1SRDA 2Y2WA 4U1KB 4NRZA 1FDLL 4JPWL 3FSOA 1VAHA 3O9WD 1X7SA 3K0WA 4JM2C 5DEGB 1OAKL 4P5RA 3ZDZF 1PW3A 2HJKA 3RL2B 1N7MH 4P0DA 3TZVD 4YSPA 5FDYA 3IGFA 4YAQA 5J1AB 1FFQA 1PKQE 5TH2B 3D2UD 5C71A 4BCZA 1CFNA 1CD1A 2BNRB 1BJ1J 4HWBL 5BOPA 3DMMA 1QFUL 4K9EC 4AQAA 1MJ8L 4OFKA 4XO9A 2QADC 4G7RB 4L9LA 1J05B 1ZS8A 1AS8A 4FI6A 4GW5A 4NO2B 3VXTA 3JTBA 1S5HB 5EEWA 3MNWB 3AY4A 5K33A 1QABA 4XXDA 2D7PA 1V7NL 1KCKA 3IDNB 1N6VA 1PKQA 1WISA 2MNUA 2XTJD 1KFGA 3T04D 4PS4H 5D5MF 3VXNB 5CIPH 4DT2A 35C8L 3RDTB 3O9WC 1J0KA 3MJGX 1KT2B 1NWPA 4PV1C 3LEXB 5DQJB 1Y6KR 4OCXH 4K8RH 3EYFA 4QXUH 5CEXA 2QMKA 2FRGP 4CKVX 1BZ7B 3GXUB 3U9PL 1A6ZB 3G7TA 3R7QA 1N64L 3AW5A 3KLAA 3CHXA 3RWGB 4F7MB 1QBAA 4ONOA 1LNUA 1YEDB 2H8PB 1R6VA 3DPBA 2Q6WA 3WHXA 2GB2A 3EKCA 3UL4A 3LQZB 4RGOH 3ZIMA 2E9WA 3O2VH 5I1JL 3N04A 5FKPA 1LO5B 4HIIB 2A6DA 2GY5A 3C09C 2RA1A 3O6FC 4X6EA 1LGVA 1WWAX 4N2FA 4OCWH 3ZTNL 3LN9A 2FB4H 4RZKA 1T21B 1CICC 1U58B 4APXA 2F58L 5C9JB 4C56E 4PVMA 1FRGL 3LQAL 2NCEA 4L1HA 5MENE 1W91A 2R8SL 3ECUA 1SOSA 3I9GH 3NOIA 4XC3H 3J7HA 1ASQA 1DFBL 3H9ZA 1U8CA 3UC0L 3WNKA 4I88A 5IOKA 3IU4L 3ILEA 4XP6H 3RWCA 5E4AA 4J6IA 1PNDA 3CZJA 2AP2A 4HAKA 1OWWA 1JVOA 4MZRA 4M7LH 2CH8A 4ODSL 4PJCB 5ADOH 2KLTA 2B59B 1YMMD 1Z9OA 2CJUL 2VGLM 3BKJL 3DXAB 4C56A 5CKAA 5MENA 1F4YH 3EGSA 3P11L 4DP5X 2Q8BL 4MA7H 1CVRA 4S1RL 3T1WA 3TBYA 2DEXX 1I4FA 3WFZA 2NY2D 1T2QL 3FB7A 4GRWB 4OGYL 3HI6L 3M1OA 5F7EH 1J8HE 3VGBA 3ULAB 3TA3C 2N3JA 2E46A 3SYOA 1SN5A 1QOKA 3VRJB 1XBRA 3RFRA 4NZUL 2UWEF 3UFIA 1QD0A 3QCVL 1FN4B 2IPKB 1EJFA 5DJZA 4H8WH 5CEYA 3OR7A 1ZT1A 3VI3F 1DZ0A 2XWTB 4U6HB 1KB5A 4F2FA 4G6FD 1L9OA 1E3XA 3ZE2B 5D1XB 1F6LL 3QDGA 1CQKA 4QTFA 5DD5H 2DMCA 1XGZA 4UOZA 1MRDL 3HE6C 3E6FB 4IMKC 2CLZB 4H0IA 4JQXC 4X7SL 5IHZA 4TVPL 1P5VB 2NY2C 3PP4L 2X1PA 3S2CA 5EDSA 3INUL 1GR7A 1MFEL 5GZOA 2BSRB 3FCTA 2YD1A 4PW9A 3SE4C 2H0JA 4NAMA 1KXQE 2FSDA 1UWXK 1W6WA 2MQGA 2WKGA 3F8UB 4QXTA 2DYRB 1N0XL 2PXYD 4KZCA 2XVGA 3SE8H 1GPOL 5D96C 1VZGA 2VR5A 1WVZA 1JTOA 4OM0H 4PP1D 5D2LB 1U0QA 2XT1B 3LN4A 4L2LA 4HMDA 3TYFB 3GMOB 4M7JH 5JXED 3UACA 3Q8BA 1T1ZB 1C8PA 3KPNB 3S36L 4JKNA 1PZUB 3E1F1 3M86A 5DGRA 1VFMA 1KULA 3FRPB 2DQCH 1ORQB 2EYRA 1EJOL 5L4JA 4E9VA 1GJIA 3LNIA 1PF3A 2JB6B 2JJTC 5F21B 1UTDA 1UJ3A 4WGWB 3F84A 3C60C 1KJ2A 3W0WE 3PWPB 3Q9QA 4NZ8A 4AYDC 1YAIA 4LCYA 5C8JA 2W07A 4GUPA 3SD2A 3IF1B 1R3LB 3TEWA 5B3SB 3BAXA 4PB0H 4XXWC 3ETSA 2PXYC 2H0PA 4R84A 1E4WH 5ILTL 4MA1C 4EN3B 3VUAA 1XR8A 4ATTA 5FO9B 3ZDWA 1TKWB 4PP1C 1DBKL 3KJ4B 1B0WA 4LCWD 4JKPL 4Z0XB 4I3SL 4MJ2A 1RURL 2NXYB 4X7TA 3VU2A 1G9NC 5LAXA 4ZFOA 4AENA 4GG6E 4LQFH 4UDTB 1TZAA 5TFSH 5I6PA 3HNVL 4LVHC 3H2WA 2W0PA 3K1KC 3H85A 1S9WB 4WWKB 2R2BA 3SYPA 5A2CA 3C6LD 3G6AA 4H8HA 5F7BA 5E00B 1JGUL 1MCKA 4JB9H 1S78C 3FQNB 3QUGA 2CMRH 4ES9A 2YRLA 1X9QA 3UBXG 2GPZA 2OJEA 1QBLL 4M7KH 5KYXA 2D7OA 1NJ9B 4XHQA 3K3QA 1DVTA 5K1VA 4RMTA 2WP3O 4Y4HC 4L0ZA 2ZUWA 5KW9L 5KYWA 1AP2B 4Y1SA 1SJEA 5KVFL 4K5MA 5CUSH 3NVQA 5AOKA 4QTHB 4JFQA 1SLWA 4WU7B 1YPZA 2X28A 4G3YH 2EXWC 5E4EC 2QELA 3GSUB 1PNCA 3S7GA 1SN2A 4J1UB 2WN2A 5EOQL 1LP9B 1NLBL 4JM0A 3NEEA 3HI5H 1TFHA 4JFFA 4TNGA 3T4AA 4GB9A 4HIXH 3HRPA 3HI1B 4GPVA 4KO7A 4WI2A 5ELIA 1QUPA 3S88L 2ARWA 4HLZH 1EUUA 1KIRB 4GUOA 4MXQD 2AW2A 2XBDA 5CSGA 4AKQA 3B3IB 1BQUA 1NC2D 2QVTA 3L9RB 3QC5X 4KFZC 4XWGL 3ULSB 5I0DA 3V79C 1ZHLA 5E03A 3GK8H 1EO5A 1VKXA 5CF3A 4ATWA 1XBDA 4KKBD 3HW7A 1IBZA 1XH0A 2W59A 4CMMB 1ERNA 3RKPA 3PHAA 1EAQA 4L3EA 1RZ7L 4CW1B 2JCCF 3ABMB 4G70B 4Y4KA 5F7LB 5EN2A 1SXZA 3OKKB 3QQ9D 5GGRB 4MBRA 3DRQA 1QFPA 3FK3A 1IUZA 1LK3L 4N8VA 3JT0A 3Q8CA 3WE6A 1VZHA 3TP4A 3KPRB 4PLNC 2UZXA 4HWEL 1YY8B 1G1YA 2VDKH 3RVUC 3DJTA 4KV5F 3VFTA 3UC2A 4L1TA 5FA4A 3ZYZA 5DUMH 3AFLA 4WFED 3EG9A 1U92B 1C08A 3BQUD 3DBXA 3ZLQC 5CZVL 2AABL 1GSMA 4B0MM 5JHMA 4OVVA 4MXQC 4RIRB 5EEVA 2WXOA 1YEEH 1P5UB 2F7RA 4ZAKB 3SDDA 2AJUH 3QI9A 4WENB 5D7LD 3X1BA 5I28A 1GTFA 4KZEH 2DQGL 1YY9C 2FH8A 3V0FA 1SY6A 2W9EL 4PJ8A 2D8KA 1QI4A 2KZWA 3RG1C 1IGIL 2MPVA 1ADQA 2CDGA 4JDEB 3X3GL 2QQLL 3I6KB 1RUAL 3OXSA 1H8NA 4ZOBA 3MUGB 3BAEL 5E2VH 5SWZD 3TXAA 1JS4A 5IFJB 2GK2A 3WKMH 3MGOB 5AL0A 3QCTL 1B3JA 1LDPL 2H7WA 2VUKA 2H2SC 2WAHA 3CVIL 4OQTH 1N59A 1AY1L 5IMKA 3VFPA 1D7FA 4FQLH 2J72A 4NQVB 4I0KA 4LSVL 2DWEB 1IAKA 3QEGH 3V4PH 2AI0L 5SWQB 2JK5A 1X5LA 3FQUB 5MEQB 3E2HC 1CMOA 2O6PA 4Y19E 1T5XA 1MFBH 4UWQB 4CC0A 4CN4A 5BVPL 1LWHA 4ZMWA 5GS0H 3KW7A 3RI5F 2F5BL 5CO1A 3MJ7B 4N8CH 5GJTL 1BAFH 4PV8B 1RP8A 4N22A 3NYKA 3IDGA 4EXKA 5ETUB 1RZJC 4YHYC 3FYIB 3F65A 2WMPA 1DVFC 2YEZA 4NRYA 5L4FA 1V7ML 4LPXA 1JNHB 2E76C 2YPVL 3RIAF 3WEMA 7PCYA 2YOCA 4OGXH 2IGFH 3LPFA 1AVAA 4ZYKB 1LL1A 2YEVB 5FOBA 3T4YA 5IHBA 3A47A 2PO6D 2F53D 4PR5A 3QH3A 4Y19A 2CRIA 3RVXD 3B34A 4Z7WB 3CN4A 4XCEA 4AIZB 4DP8X 1RPQA 3EGDA 3N2JA 3IDXL 3MODH 1VJSA 3NZHH 4F2MB 1CFTA 4NPKA 2YBGA 4MQXC 5JMRA 2ZT9C 4PLKD 2JTDA 2HVKB 2RH0A 4P3CL 2V6HA 3CX2A 4P2RB 1BVKA 2ESVD 2VZTA 1P4IH 1T0MA 1JPEA 4OGQC 3OG6B 3OQ3B 4K07A 3H2PA 4OM1L 5E6UB 4FFWC 4JDZB 1KB9K 4ZUSA 3IT8D 4F7CB 1I1FB 3EOBB 3DUSA 2GG1A 1OSZB 1MFMA 3CSYA 5C0JB 3CHPA 1MF2H 4J3OD 4MD4B 2WQVA 5EIVA 4KXBA 3IVKB 2X4UB 2QFPA 3FXIC 3UJJL 4JO3H 1AO7B 1W0WA 1INEH 4LLUA 5D7SL 4O4YH 4YEFA 3TPKA 1EEZA 2WXHA 4HK0B 5HYIA 2O61A 4E5XG 3RVXC 1BVNP 3OMZA 4QCIB 4TSCH 5KVGE 4J3OH 1R1CA 1XH3A 2DQ6A 3WFDH 4HX1A 5CJ8A 2E5EA 5ABDE 1N4XH 5IEHB 2OXGA 2EO1A 1DLHA 1KELL 3EBGA 3IAPA 4TQ8A 5EUOE 1MLCB 5F3BB 1A25A 1QO3A 1UACH 1T4KB 1IBHA 1IKFL 1T1YB 4HIQA 5EWIH 1N6QH 2EUVA 1XH2A 3CFNA 5CJBA 2O5YL 4PTTB 4XVJL 5CWSB 2BOCA 3MRJA 2V3DA 3GNML 5ENWA 4LZKA 4Y5YA 5AZUA 4WNSA 1MHHA 3VYOA 5I8OH 4QNPE 3Q5TA 2G5RA 2HFGL 2A77H 3H3PH 1AR1C 4R26L 1A7RH 4PW4A 1Z0MA 4MVBC 3EO0B 3FPYA 3PWNB 3LS4H 5B4MD 5K1NA 4JREC 4Y0GA 3NFNA 1RPUA 2L7UA 4UOQA 1JUFA 2EE9A 3CMGA 1AGEB 3HMWL 1B4TA 1U6AH 3HPLA 1JNNL 1F5WA 3RWHA 1NKOA 2JE8A 1YHPA 2B16A 4PJHB 3II2A 1NDMB 1DJYA 3PHOA 4IBYA 4YBHA 3CXFA 4V1DB 1R3JA 1Y1DA 4FG2A 4MD0A 4OD1H 2ZF9A 1T03H 2CHWA 4ZRGA 1JXJA 2B1OA 5GRUH 2ZXDA 5JORB 4D8PB 2R51A 3Q43A 3RA7H 4OFIA 1PZ3A 3P9MB 4AVIA 3DMMD 3VXMA 2CUAA 3CFKB 3ECWA 2FBJL 3NIDF 2PCXA 3F7YA 4QOKE 3ATDA 4GBXB 3K2IA 3DJ9A 1FH5H 3ATFA 4X5WA 3S3BB 3KBEA 4Z7NB 5EZOH 5B4MC 2O5XL 2FWUA 3OAUL 4GO9A 3L3HB 1JD9A 1IC7H 3HRZA 4LLWA 2VC2H 4F1ZA 1F6FB 3AS3A 1BJ1H 1LK2A 4GJTB 4NBXB 3N1GC 1CU4H 5DZNA 2Z8RA 3L5WB 4MAYC 5D96B 5B1CA 2GSIA 4EVNB 2YGNA 3FBQA 1G9MH 4XBEH 1DBBL 1MHEA 3FU3A 1LO4L 2Q7AA 1RJLA 4LLDB 3ARFA 4YNYB 3S48A 4XH2B 4HKXA 2ZSWA 1EZVX 3UBHA 1XEDA 1U8QB 3KWTA 2J71A 2Y4SA 4RAVB 4RMWA 3OJ2C 4PGEB 3KPPA 5F71A 5MP6H 3W9EA 5CMAB 1IEBB 2EKSB 4XMLH 4BELD 4IBWA 3TEZA 3D51A 1BGXL 2AK1H 5D70H 3VDCA 4G6KH 3X3FL 2XA8H 3GXIA 3FFDA 1SPDA 2COVD 2ATAA 1U9KA 2VCOA 1JZ3A 3CVHL 2F18A 1WK0A 2R69A 1PZSA 4HGMA 5K59E 3VXUA 5DD6B 4F5CE 4JCMA 1BZ9B 2OL3A 1EO8H 1VF5C 5ADPL 4J12A 4ZMNA 3HG0A 3MV8A 3PAVA 1J1PH 4DTGL 3ARVA 4B5ZA 2WQSA 1TU2A 1ZHNB 4MAUL 4KI5F 4GW1B 1IE5A 1C5DA 1MCBA 2K0RA 3LTVA 5MEND 4C56D 4QGTA 1OW0A 1BFTA 5BCAA 1SEQH 2VR8A 3JWDH 1RERA 2G60H 2NW2B 4HKBB 1I9IH 1ZCRA 2X53A 5EC2A 1R19A 3I50H 1AOHA 4XBGA 2AJXH 3FQTA 4RCAA 3QXDA 4MMZC 4XCNB 4YVNA 1AMXA 1Y18B 3I75B 3O45A 5KN5B 4TYUA 5CSBA 5IBLD 4LMQE 3BAKA 4WFGD 4A2FA 3DO3A 1IVTA 2XLLA 4GKNA 4GKLA 5E4OA 4QRRE 3MHZA 1XMWA 4A37A 4OLZL 3WEXA 3BVWA 3QNYB 1JBJA 4F93B 4GS7B 4Y4HB 4Y5XB 4F8TA 4JO2L 2BP0B 5D7KD 1MW3A 3CLEH 3KPSA 2ZWSA 5HHMB 1JWUA 3JV4B 2WKOF 4J3WA 4M3JA 1YJDL 2A1WH 3CFIC 2VL4A 4MCYA 1R3IH 2EDJA 4IBSA 2BHFA 5DU7A 1U3HA 1ZA3A 2LU5A 4L37B 1K8DA 2GY7B 3EOAA 1C1EH 3KLQA 5IK3B 1KN2H 4FXLA 5CEZL 5SV4A 4XPAL 3HG1E 5HYEA 1JCKA 4NM8H 1HYSD 2R0ZH 2X2UA 3B3BA 4PRIE 4XXCA 2QPSA 4RGND 3K4DA 2VO8A 1VFAB 1OPGL 1BX2B 2R1XA 4RRPG 1FI8C 2VDMH 5GZOD 3FRUB 4R97C 4BSVA 4Z7OF 5IBLC 5CBAA 2IADA 1T22B 5I1GL 4NNPH 1Y6MR 3W82A 1B2WL 4FQCH 4DERA 5EH1A 4G6MH 5C1MB 4YHML 5KVDE 3ENEA 4PJAF 5IJVA 1BMZA 1VADA 2AXFB 3LRSA 4PRIA 3GB7A 5JIHA 4F7EB 5I2IB 2ITEA 1MCFA 4RISH 4XNQB 1FJ1B 3HNTL 2XWBB 4L3AA 5GRVL 4HUXA 3AGVA 4K5PA 3WL9B 3QIUA 5ICXB 4W93A 4OLWH 2Y7SA 1HYSC 2JV6A 4XPGL 3U6RB 4I13B 3UJIH 2D0HA 3TT1L 2ZG3A 5F9DC 3NRFA 1SHSA 5GZOC 3SDCD 4AMWA 5L2KE 2I24N 2G3ZA 1X3DA 1HJCA 1A14L 1YYCA 1WCBA 1KJ2H 4PRHB 4HEPA 1E5YA 3VFOA 3BLKA 2KI6A 4M1DH 3WDHA 5KS9B 2A0LD 2GT9B 1KLFB 1F58L 1U91A 1UD4A 2YARA 1A1NB 1URIA 3GEWB 3W0WD 5TE7H 3F01A 2BXZA 2IALB 2YPLB 3KD4A 4H0HB 4PEEA 5EULV 2AXHA 4N1HB 2E9GA 3D25A 3FSVA 3BT0A 3HC0B 4O02L 4U33A 5EPMB 5KSUB 4G72B 4J3UA 1T80A 1KTKE 2V9QA 3QRGH 2V8MA 2IBBA 2K70A 3L8QA 3MV11 4FHBD 4NHUB 4FLQA 1ZJAA 4JHUA 3UZEC 5I1HL 3P4OB 1MCOL 2B5IC 4KXZH 4M03A 4M6MH 1FLRL 3SDCC 3BUYA 3MCG1 5IT2H 1K72A 4M62H 4DIXA 1OP3H 5EF1A 1O9ZA 1HDMB 1WC7B 5IJBC 3GJEB 1GHFL 4F37F 1GTNA 4AGOA 2I60H 3DTUB 4JAMA 4PS7A 3GBLA 5FLUA 3GSVB 2BFVH 1RIVH 1ODUA 1HI6A 4H8UA 1A4JB 1DQJB 4HLZG 1QR4A 5AYTA 4PPTA 4DVBA 5CFHA 1MAML 4YC2C 1MAJA 1BBDH 3GI9L 5JNYB 4YHYB 1DVFB 4X6CF 3MRGA 1GJWA 4LOUD 4GRLA 2ENJA 3OX8A 4L4VB 4QHLA 5CKGA 1T83C 4QRTA 3DX8A 4X6DE 2P9RA 1EDYA 4OIIH 5F7NC 3IGLA 1HHGA 3PF2A 3ZKNC 1T0NA 5E8DL 3LZQA 4JFFD 4JEGB 2LW3A 8CGTA 1FBIL 1BZOA 1LDSA 4HCGA 2FIKA 3SO3B 4A38A 3DRTB 4G8IA 3OB0H 5DRXA 1R0AH 2QGCA 2Y07H 4AV0A 4HG4K 1IM9B 4MZ2A 2XZCL 4XZ4A 5DJYA 1XL4A 4GW4B 3ARQA 1NCGA 4N8PA 4HGWA 1EWHA 5MEOA 2YHGA 3MXWH 1SLVA 2HB0A 5CSZB 2OR9H 4QY8B 1I1AB 4LOUC 5J8OA 5DEZA 3CSFA 4YPGA 5FEBA 4PS8A 4YBLC 5F7DB 4UV7H 3LXBA 4L3ED 3DYOA 3LH8A 4K7FA 2LLNA 2EIMB 2X12A 3O3BA 3CFQA 5JW3L 1IM3A 1IGJA 4O00A 2FEEI 2GFBB 3FQXA 4H25B 5BW7A 1WBYA 1DO5A 1O75A 1OIOA 3QAZC 3BZEB 1Q1JH 1N0LA 1GW6A 4KK6C 1P0SE 1ET5A 2PWFA 3LB6D 4UANA 1X7QB 3I02A 1KACB 4N9GB 3W56A 2IH1A 2CIIB 1MCEA 2KZKA 2DQHL 1MZZA 4NUJB 4BKSC 3ETTA 5CILH 3DLQR 4HU2A 2FHBA 2XV0A 1GYVA 3F7RA 3SDDD 5HVFB 3QI9D 2JCCE 3CBRA 4H44C 2WNWA 1VACB 4PJ8D 2Y2YA 4PGJA 4QTIH 1UB5B 3D18B 3ZO9A 3MLPA 4FABH 5IKCB 2Y1AA 1M7DB 4POZC 2BNQA 3VXQA 2WYTA 4CADB 1JF1B 2IFFL 4K3JL 3BGMA 1FV1B 4URKA 3CCHB 1ICTA 3GEFA 5EBWB 3WLWC 2EDRA 1DHKA 1G0DA 2CAKA 1MW1A 4XNZB 2W65A 3B7YA 1S7UA 2HVJA 5K9OB 2A3TA 4ONHA 1KDIA 4BUQA 3K1DA 3MLYL 4GXUN 1JGDA 1BREA 2Z31B 3DVGA 3GXNA 5I6NA 4NKDB 1NMAH 1CL7L 1DQTA 3H42L 2WN3A 5HHOE 2QPUA 2WC7A 1OV8A 1EAPB 4HWZA 4DFIA 3PWUA 3DTXA 3B5HA 2WVSA 1QFHA 3K91A 4Z3GA 1U93A 4Y19D 2ZKWA 2GUOA 1U8NA 2LVCA 4CMHC 3PJNA 2F0CA 4URTB 4Q6IC 3DYPA 3BISA 5ESVB 4ETQA 2W1NA 4JANA 3HFMH 3BKYL 4LPUA 2EVIA 4B9JA 1NIEA 3CN3A 1A9BB 5AW1B 1YYML 4ELMA 2JI2A 2FK9A 2KZBA 3BCDA 1L9PA 3MC0A 3BPCB 3VMOA 1K4CA 5HHOA 5C07B 4K7PY 3KWXA 3MRCB 4P4KC 5E7BA 3O2DA 3PL6D 3S8WA 2JKJA 4IK7A 5JUEL 3EYOA 2HVBA 4PSPA 1ZV2A 4L0PB 1YZZA 1N18A 3KPOB 1JPFB 3AXLB 2P49B 2ED7A 3LRGA 5FM5M 4FNUA 1P4UA 3L5XL 4PQXA 2OX5A 3QQ4B 3QHZL 3OWRA 2ENQA 1KJMA 4NKMB 3IFPB 3VXRA 4M56A 2QZ5A 3GMMA 1MFUA 4J4PA 2X0WA 4PB9L 3BD5A 3MMEB 3ZMRA 1E42A 4GIOA 3HHRB 3EHBD 5B3JF 2HLFD 1M2VB 3IFNL 2ZAGA 2XHNA 2DMGA 3RWFB 1OSPL 3FT9A 3PL6C 5ITBH 3F6JA 4I9WE 1RZIA 3DSNB 4OJFH 5DS8B 2GCYA 1WIUA 3SSGA 4Q4EA 3VACA 3FU6A 4Q56A 4ZW7A 1AGDA 4ZXBC 1CCZA 1DVZA 1A6AB 5IOPA 1KBWA 2E27L 3IXTB 3RI5K 1LVEA 4FZ8L 4PWGA 5EUKA 5FX3A 2W9LA 3SGKA 3SY0A 3NFPA 1LD9B 5BUAA 3PV6A 4ZFZA 1S9VA 1KFAH 2NY5L 1G7HB 4Z7UB 5HDWA 3RIAK 1YMHA 4Z76B 3P30L 2AGJL 1V54B 1ZE3C 2DEWX 2CUMA 2FQGA 4K23L 4JQVA 5D7IB 5EIIG 1SDDA 4PFEA 2OMWB 1QR1A 1IGML 2HLFC 6PCYA 1VFBA 3VH8A 2O30A 1JFQL 1X9LA 2JKSA 3VD1A 1NCHA 3VXMD 4HV8A 4F9LA 2Y25A 5I19H 3S9DB 4Y5YC 1CK0H 5CCGE 2IJ0C 1JE6A 4EI0A 3F12B 4HP5A 3FQWB 1ACYL 2EDKA 1GGCL 2D03L 3NJLA 5LJYH 3II1A 4G80B 3THML 3NIGB 1QEWB 2K78A 4QIRA 1Z9MA 3VFRA 4YR6A 1TQCC 3S5LG 4Z1PA 1E50A 1FNAA 3J27A 3C08H 3PFQA 1FAIL 2PP9A 1XVSA 3BJ91 4YSAA 5DJDB 3CDZA 3QUMA 3ETBJ 4X4XB 2R1WA 4F7PB 4EI6B 3LD8C 1THCA 2ATPA 3ARFD 1W15A 3TGXA 4JNXA 1WUZA 1RUMH 5IHHA 4BFJA 2P5WE 3U4BH 3QQ3B 4NBYB 3APMA 3U7YH 3UCRA 1XF3A 2K45A 1GSKA 1E2VA 3CZKA 2VAJA 3OMNB 1G43A 1I3UA 1VESA 3HCVB 2XDHA 1WA0X 4KITB 1E2ZA 4KTGA 1XFPA 1AS7A 1HQ4B 4ZO8A 4BZ1H 3HG4A 3MBWA 1DLFL 4HUWA 1RZKH 3QEHB 3MV7E 3ARBB 1Z5HA 1K2DB 1NCUA 3V0JA 3WXVH 4UT6L 5CP7B 2ZOWA 4L4TE 4NOBA 2CR3A 4M9OA 3VXUD 1DVYA 2PWHA 3MRKA 2WO4A 1V3MA 2XC8A 3EFDL 2DKUA 2VWEE 3ARFC 2AXWA 5T3XH 2CLRA 2CXKA 2IFGA 1XSKA 4LMQI 1WAAA 5BRZE 1UGNA 2DBJA 1X5IA 1Q94A 3V0EA 2BP5M 5HDQH 2DDQL 4HHWA 3FCSA 2OL3H 5FCUL 2V5RA 1S9XA 4YHIB 1JHLL 4LOVA 4MMXB 3FU8A 2FO4A 2HH0H 3IM1A 3QWQB 2I32A 2J5LB 4L4TA 1S8DA 1UKTA 1HYRC 4RAHA 2PF6A 2BVTA 5A2BA 3TN0B 4NCDA 1A1MA 3JWOH 3EXLA 1B0GA 4WV1C 4TF4A 1FYTB 3L45A 5T1KD 3H2QA 4J3SA 3HN8A 3QPXL 1HNGA 4XPHL 3L4VA 2GBVA 5DRZB 2WZPA 4WI3A 5DWUH 1RJZA 4HXAH 1FO0H 5G4NA 1DQIA 3WFBH 4JKWA 4JFYA 3FC8A 4KI5E 4B96A 2XQ0A 5GGSA 4KVCH 3ZMNA 1UENA 2Z91A 4U6XB 5IHUL 4YDVA 2GSMB 4L9DA 4BRVA 1OTTD 3R4RA 5I1DB 1MCSA 5JPMC 3G6JF 3TBBA 4G7QB 1ND0A 4IOFD 3RZCA 2Y06L 3I2CH 1CBVH 1BVLA 4AKPA 5CBEB 1NUNB 1D5ZA 1U3HD 5I16B 4BH8B 1ETA1 2QLVB 5B38B 3NFSH 4KH2A 2XXFA 3KXFA 4A66A 5JO5A 4AQEB 2B9AA 4CVXB 1QMUA 3U1PA 2FWSA 4P59L 1ZKAA 4YWGH 1TTRA 1DDHB 3H56A 4UMGA 4XVOA 2F8IA 4YUEL 5HJDA 4MQSB 3AT9A 4BM7A 3MJ6A 1UT9A 2BS8A 4MNGA 1JRHH 4NJAH 2I9TA 5LWYL 3UYRL 2ZP8A 4BUHA 3S96A 1LQSR 4N0YH 3HG1D 5JR1H 3US1A 3CD4A 4C59B 1D5MB 1MAKA 3MREA 4PRID 3EO9H 4QRSA 5GGQL 5CLZA 1OTTC 1G5AA 1WFIA 3MFFA 4WI8A 4KDWA 4YBLB 4IOFC 1UCBH 1ZVHA 2WZ5A 1F97A 3U36B 4BQ9A 3MLZH 4M8QA 4ONFH 4OLUL 4N2AA 2J8HA 4K71B 5AG8A 5EEZA 3N41F 5F7KC 3GHBL 1Q0EA 2M26A 5D6CA 3QIUD 3DO4A 5H8DA 3K0YA 1WEJH 3L1EA 2W88A 1HCZA 1AQKH 2DQJL 4P9HH 3PV7A 2Q7NA 4NKIH 2VJ0A 3NIFB 5JQ6L 4PJAE 1GGBL 2EDEA 1I75A 1RFDL 1X44A 5IFHL 3GD1C 1SF3A 2FX9H 3CN1A 2ED6A 3ZT6A 3GKWL 1P4BH 4S1QH 1MIEL 3MRBA 4FQ2L 1PZ5B 4NAQA 3T2NL 3R1GH 3CXDH 4R4BB 5LAPA 3ULUL 3RB7A 3LQMA 4UQ9A 3NH7H 3G04A 4JDTH 1TMQA 5ANMB 5GSVB 5DR5L 1C5CH 4F3FB 3KCPB 3MO1A 1CD9B 4PRPA 5AAMA 4G7YL 3REVA 3BGFB 3T65A 5L2KD 3S37X 2WY3B 5E99L 3L9EA 1UURA 4XNUH 1QVOA 2J43A 1QUNA 1OAXH 4L8DA 4YHKL 1ULVA 1Z66A 2HT2D 2ICEB 4K0OA 4O2EA 4M61B 4OZIE 4JPKL 4HJJL 5J5EA 3K6FA 4I1RA 2EVGA 1F8TL 4HZLA 2NY3B 3SDXF 3H9HB 4JJOA 3P4MA 3FOLB 2FHCA 1G7QB 5TPWL 2ZXQA 4LF3B 4O2FA 3QS3A 4ZMQA 1QSFA 2ZYHA 4DGYH 4AT6A 4HW6A 3VGEA 4NHCH 5E6IA 5GHWH 1UZGA 2A9CA 1EJ6A 3CFJB 4NUQA 5LQBL 2NX5A 3RWJB 2RIKA 1BBJA 3S4SB 2UY7B 4OLYL 4G9DA 2OZ4L 4GRLD 5IGXH 4OZIA 3B8YA 5K9QG 4JL2A 3UIZA 1QLEL 2DL2A 3UTPE 5IP4A 5DEJA 3O4OB 3WLBA 1FGNH 2QV2A 2DYPB 2X1QA 4J8QA 2JVUA 1NEPA 2HT2C 1CZ8H 3CIQA 2OULB 1Q9KB 4OZ4A 3PDOA 4UQ2A 2N7BA 1NINA 2VITA 3H9SE 3WNPA 3MRFB 3TT3H 2R0WH 4XOBA 1VPOL 5I8EA 2OK0L 5C0EB 2FNWA 4N8VG 2IIJA 1XGUB 4OZHB 2EH8L 4PJ9B 4QT5A 4X6CE 3TPUA 3FO2A 2WSPA 3NUKA 1NPUA 3KWWA 1PBYA 5K9JH 4ZO9A 2ORBH 4JW3A 1I7RA 2CKBA 3D0AA 4TTDD 1OZUA 1FNEB 3O6MH 2CJTA 3NCJH 2E0PA 2FYYA 5DFAA 3C12A 3PWVA 1IU1A 3FPXA 4QR7A 1QEXA 4IGBA 3SIKA 1GXEA 1JI2A 2AQ1A 3P73A 5L2JA 4XRCB 1HEJC 1G1KA 2FGWL 1ES0A 3ZE0F 1IM3D 1EJ8A 1ZDSA 4ODXB 2NLJA 1CF1A 4LL4A 4R7NA 4BFRA 5A16A 2B15A 4U1GC 3RVTD 3KR3H 4TUOB 1PSKL 5DJAA 5C0GB 4MDRA 4V33A 3BAYA 2V17H 4GAYB 3BT2H 1Y0LA 2IBZY 4PU2A 5HGDB 1C12B 7CGTA 3MRHA 1RV6X 2YUZA 3HMXL 3LKPA 4Y5VA 1F3DJ 1JAEA 4KQ4L 4GRMB 3L95B 4YFLF 3LEVH 5HJ3B 2RACA 3MJ9L 3OHXA 4CSSA 4IEFA 4HIEB 4ZW8A 4F37K 2X44D 4E9LA 4NWTL 1OF2B 3EYVB 4ZXBB 4TTDC 1HXYB 2A9ML 4X4KA 5T1LA 3D0VA 4AXWB 5FUZL 2A5UA 3J2PA 2ATKA 4HMEA 3BFQG 5JIPA 4YMPA 5DRNA 4K9EL 3IRPX 4NNYA 4XMKL 4L8BB 2WD0A 1EBAA 1U8LA 1WTGT 1WWBX 4HXBH 2RFXA 3RVTC 1F1GA 1OAUL 4FQHB 2XRAH 3VRLF 2QSCL 3VSUA 4U0RB 1HX0A 3TBCA 5ECGA 4QDGA 4JDVA 3S37L 5ITFB 3ZQWA 3MRDA 1NCCH 4BZYA 1RHHA 1FZMA 1Q0YL 4PHXA 4B9ZA 5DLMH 5C0FB 3ABLB 1OHQA 4FZEL 1J0IA 3GUTA 5T1DL 3MBEB 4I4WB 4QRBA 2WB7A 3I3EA 3PYCA 3CSBA 3KE0A 1RZFH 2ITCA 2QQNL 1WS7A 1OT2A 2MSPA 1U8MA 3N43B 3N42F 1M7IB 2X1WL 4G71B 1PG7W 4BK5C 1BM7A 3I3DA 4PJDF 2DWYA 1KMGA 1F18A 3FKUS 4R83A 4Y4FB 3L9BA 4K8RC 1U8PA 4S1DC 2EKJA 1NH6A 3CMOL 4PJGB 1AZRA 2B4CC 1PDKB 3OPZH 4EI5A 5BS0E 5H94B 5IFAH 3LNHA 2V4LA 2MOVA 2XX0A 4GLRH 1UZ8B 5E70A 1MQ8A 2BIQA 4HC1H 3ROOB 3UERA 4A6YH 4KX9A 3HVNA 4OZGB 1DANT 2R1YB 2YZ8A 2VDRL 5HHOD 2P8PB 2PCPA 3FTWA 4P2OC 4JO4L 3MFGB 1DSFH 3EJYD 3PREA 4PGDA 4FNRA 1W0YT 4JFZH 4LAQL 2GTWA 5IWLA 2FL5A 2X3AA 3PGDB 4EDXA 4EEEA 2VXVH 3HS0A 4XBPA 4TULL 5B7MA 2TSBA 3FOMB 2R2EA 2Z92A 4JFHD 4QOKB 1OCZB 5F3HB 4W9ZA 4CKQA 4J4PD 1AI1H 4U7MA 1G0YR 4AMKL 3VJ6A 3ZDZB 2FT7A 4JZNB 3S8FB 5BZWA 4OD3L 2WXRA 1JYWA 4MKMA 1LJMA 3GLEA 2UX7A 5J7CC 2JXMB 4JFDA 4E9QA 1GL4B 1ZGLM 2WINA 3RVVD 4HS8H 3PXLA 3TLRA 3BP4A 3EJYC 3NACH 3X12A 4UQ3A 3GF8A 2F08A 1EHAA 1TTCA 2BWDA 5JA9A 4P23A 2V2TA 3C2AH 3MTXA 1GJUA 2I5YH 4WK0B 5LLIC 2B1HL 4DKFL 3QZWA 2QHRL 4R5TA 3DTDA 5I17A 1ZV9A 2HLEB 1HILB 2YLKA 3KJ6H 5FHAH 3UADA 3MRRB 3TCTA 2HRHA 5IB3A 4X8JA 5IMLB 3NDYE 3IE9A 2XA3A 2ZWNA 3BUIA 3W37A 2V7HB 2NNFA 5D5MB 5FGSA 4J4PC 3V2AR 3BH9B 3FJTA 5IJKC 3TVMB 1MCPH 1OCWH 4AITA 1OGAB 1OAYH 2OSXA 3ZQ9A 3LZPA 5DTFA 5BVJB 3K72B 4TVUA 4HWBA 1S9YA 1KBVA 4Y1AE 2HWZH 1JK8A 2VLLB 5AOZA 3RVVC 1MFAL 1J1XH 1SXAA 4FADA 3M1CA 2FBRA 1T6VN 1F3JA 2OJZL 4ONGH 5IW1A 3GSOB 3UBXB 5BO0D 1HXKA 2EE2A 2SEBA 1QNZL 5E8EB 3X11A 1K8IA 1CE6A 1BVZA 4JY6B 1K3IA 5E1AA 3OGCA 4KKZA 1D7DA 1L9MA 1L9NA 1N9PA 2DWDB 3SQBA 1DVSA 2GJPA 4G8FA 4FQXC 2NW3B 8FABB 4G1EA 2H41A 1UOVA 4F20A 5L9DL 1DBAH 2L3BA 4YHPA 3RURA 3ZT7A 5D4HA 5D7JB 1JMXA 4JQVC 2H26A 2XXCB 1E5UI 3VWKC 2VKWA 5KYYB 2CA3A 3QUMH 1J5OH 5DYOA 1SGKA 4AX3A 1NCOA 1DYZA 4BEIA 1QFWI 4BSWB 4X5RA 3P3TA 3SGJA 3DVFA 2Q76B 4BA0A 4NQDE 1ANUA 4AQZA 1XX9C 3QG6A 4DGVL 5LXGH 4KROD 2EJ1A 5AVXB 1XF1A 3RPBA 3JTTA 3TO4A 4I48B 2XFXB 3D2TA 3L3IA 4Z3TA 3ZQXA 1G9NL 3KEHA 1OSEA 4FCHA 3HE7B 3GO1L 5A43C 1KBKA 2A74B 1GGIL 4I3RL 1NIDA 2IDFA 4PY7B 1BQHA 4X98B 5EEUA 2BLFA 2UWEB 4PWFA 5JTWA 15C8L 5GISL 4F33B 1I7TB 2PABA 5I1KH 4JFOB 3ARDC 3OSKA 2K1MA 2FSEA 2ARJB 3F3HA 3VI3B 1ITCA 3GJFK 1NUGA 1QLFB 2L7JA 2WCGA 1DQDH 3ZJAA 1PAMA 3MJ8B 3P9WB 1XGRA 2E7HA 1WDAA 2ZD0A 1XSOA 4L4TD 3V0VB 2CGZA 5BZZA 4FGMA 1OM3H 4G83A 3MUUA 2HUHA 1W8NA 2R23B 1LO2H 4JRYE 4XPFL 2WLLA 4KROC 3OJMB 2WBKA 5BRZD 1QZNA 4DETA 3L3GB 2EDDA 2VDPH 3MKKA 2WZPD 1TJGL 5BRQA 4TVPE 3TNMA 1A9EB 4U1LB 2LE9A 4N0UE 4N2EA 1ZANH 3QUZA 4YXHL 4L8CB 1G94A 4OLXH 3JV0A 2DLFH 2OXHA 3HN3A 4FQQA 3NSDA 5C0IB 3TCLB 4U1MB 3GI8L 4AK2A 4LBEB 4P49A 5H37A 4EBQH 4IHBA 2D7MA 1XEUA 2KBGA 3JWNH 5D55A 3UCQA 1IQDA 1TIUA 3KXFD 4ZG1A 1WT5A 4I2XE 4JHBA 4ZUVA 5I30H 2VWEC 4WKZA 5FYLH 3OB0K 3PQYA 2HFEA 3LHAA 5DHYB 5FGBC 5LGYA 4Z7VA 5F89A 1AHWA 4KAQL 4YDLC 5CGYC 5AENA 2X9WA 3R19A 3KDMA 2A83B 1EHLL 1UT1A 1LTXA 1U3YA 2EYTA 4PTUB 3G6JE 5KSBE 5JW4R 1A6UH 2J8UF 1HCVA 2ZF8A 5CZXC 1QKZL 4FG6D 1I8LC 2AAVA 5C6PB 3T3MF 4M43L 3F6IA 4A67A 2R29L 1OP9A 1KYFA 4I2XA 2OMYB 3KW8A 4YE4H 4I18C 5BV7B 5ACLA 5GS1A 4RNRA 1JN6A 3UG4A 1KJ3L 1UVQA 1PX4A 3SQOL 4KDTC 4LNRB 4QRUB 2X4RA 4G8EB 3PXJA 3P0YH 3US0A 2Z0UA 4JVWA 2ZKYA 5A40E 3G5VB 4KI5C 5KSBA 1H3XA 1IAMA 2AV7B 4MA8L 3TV3H 3W5MA 3HB3D 5F7HA 4MX7B 3IJHB 4HJ0D 4CVZA 1RZQA 1PIGA 5EO1B 2C4XA 4ELMF 4OFQA 5G5DA 2BVYA 4XN1A 1QSEB 3TX4A 3TURA 1B6UA 3OVUB 3Q1EA 4ODTH 4P46A 1HK6A 3CC5B 1KEML 4R0LA 3HNSL 4OD2A 4I1PA 2XQBH 3LPWA 3VXSE 1B9KA 3OR6B 1AXSA 4YXLL 4IRJA 4IBZA 5HY9A 4PRPD 2P7TB 4FTVA 3KYNA 5IVXE 1MIML 3BDYL 1OOAA 2Z34A 1DQLL 4LP4A 4WUKH 4B7LA 3VU1A 1KLGA 3QQNA 1JPTL 3OKEA 4GH7B 1TVDA 4Z3IA 3LSOB 3VE0B 2MHAB 2GC4C 4AIXA 4HJ0C 3NZ8B 4YXKH 4QJ4B 2XIBA 2FLBT 2V2XA 3IGKA 3TZVB 2W80C 2XQYG 2KKQA 3A6BH 4POYA 3DVIA 3SBQA 1J5IA 3E0GA 1QRNB 2GC7C 4AZ8A 5IVXA 3VSQA 1FVDB 4Y2OA 2O5NA 1RD6A 1NC4B 5E6ID 1D6EA 1SZNA 5EFIA 2YXFA 2EZ0C 5CIPB 1I9JL 2GI0A 1L3NA 1R5VA 4ZSOB 2VSDA 1U8JB 2V2WB 3AREB 2DLIA 3ZSTA 2GBTA 3ESOA 3UXFA 1JGLL 2JKRM 4H5SA 4JGUA 3T8MA 4HHAA 3CBKB 4MQ7B 2OTWA 2Z0BA 1T7YA 3SB3A 2XTJB 2EH7H 3V4VL 4CC4A 3GKZA 1CLOH 3QHTC 3P77A 3WS6C 5A6LA 3IKCB 3MLRH 3WN5A 4WTWA 3RYMA 1EEYA 2X2HA 3VQMA 4N0FB 1SFHA 5SWSE 2Y1YA 1F6AA 1A5FL 1VCAA 3LRHA 4XMTA 4P5MB 4HS6A 1CXKA 4LRNH 3V5DB 2IG2H 4D7BA 4M7ZB 2MKWA 4P2OB 5HHVH 3WY4A 5HHNB 5DJ0B 4WK2B 3C9NB 1G4RA 1BWWA 5E6IC 5FYKL 2Z7UA 5E9DE 2ZG2A 3QJVB 3G9AB 5HJBA 3BCFA 3EOTH 3M07A 3P9LB 4GQ9L 4XX1G 3IJEB 4BFIB 1GOGA 1XQ4A 2F1AA 2ZOLB 1N2RB 5SWSA 4ZPTB 2VL5A 3A0OA 4D0CA 2GJZA 2MIZA 2BRRL 3WAJA 4KO5A 5DZAA 4FFZH 3MV9B 4Z77B 1E6OH 2CKBH 5GS2H 1MNUH 2OMTA 3ETBF 3Q5YA 2ZWYA 2MCPH 4IJ3C 2X7LA 4F57H 5B7FA 3TNNA 1RJCA 4UTCA 2AVGA 3L2MA 3D39A 5EZIH 3WNJA 2NCMA 1J1OL 2F74A 4JBSA 5INCB 3RE0A 1UM4L 4P4RB 2OMZA 4PY8I 3FTXA 3L7FB 2YK1H 3KVQA 4NAJA 5PCYA 3WGUB 4JLRB 3BOVA 3LPOA 1JXGA 1HAUA 2VR3A 5BMFL 1I8UA 3STZB 1P6WA 1A22B 2BJML 4K94C 4XX5A 4ZTOH 1FH2A 5CJOH 5T1LD 3QR0A 4GSDH 4ZOEA 2KC0A 1ED3A 1S5IH 2E47A 1SXBA 3OXRA 1TPXB 2OYMA 4NFCA 3SOTA 3T2OA 3ARZA 5D2NB 1BD2E 4X7DC 1UQSB 3M7FB 1UASA 3MACL 4FKHA 2VISB 1ASOA 1YNTA 3WTWA 1B3IA 2F2HA 3KLKA 4D9QE 4G82A 1Z7JA 4EQ2A 4B3VA 1NGQL 3Q5OA 3V6FB 2WBJA 4GAJL 4Z6AT 5C3TA 4ENZA 2DIJA 1WHPA 2AANA 1L4IA 5HGHB 3M17B 1X9UA 1MFCH 5E08L 1EUTA 5FK9B 1T5WB 5CNHA 1AC6A 2J4WH 4RZCA 3C5SA 2WVTA 3PDGA 3ATBA 4HJUA 1YN7B 2OTUA 3C5ZA 2BHZA 2OP4L 4XNMA 3GXPA 3IETA 4TLSA 2YQ2A 4BCXA 4FQXB 3VRLE 1R5WB 2QKIA 2CE6A 2CQVA 4N6RA 3NABL 3MLXL 4ILDA 4DO4A 4DQOH 4EI5D 1F2XK 1YEHH 2PW2B 4L8SA 3ARGC 2QQQA 4MKTA 1UB6B 1UG9A 4HOZA 1A8JH 2OA9A 1J5HA 1XF4A 3N44B 3Q05A 5J6SA 2HKHH 3FU7A 4PJFE 1KPVB 3T0BA 3JZ7A 4YHZL 3T0EA 1BJ8A 2GAZB 1WCQA 3L3KA 4K3DH 2IPTH 3UYPA 3RJDA 3CG8A 3BH8A 4PJBA 1IGTB 4U3SB 4EO5A 5E1GA 4PJDE 5IQNA 1ETZB 3RTQA 4Y2DC 3SDAC 4KWUA 4PRBA 3GHEH 4NPYB 2ADJB 3IDMB 3IXAA 4DP1X 4JHWL 5BS0D 2H9GB 2DW5A 1T6BX 2K3HA 2P4AB 1YC7A 4TQEL 3WSQH 4MXWL 5I1CH 3QUYA 3T1FA 1J8KA 2IC2A 3Q1SH 1MJ7L 2DQDH 2DL9A 2EYSA 3FTGA 2EQDA 2VYRE 1UXSB 1JFHA 3LXAA 3K8MA 4EI5C 5E0FA 2JJSA 1TETL 1CXEA 1Z32X 1NFIB 2D7TL 2X6AA 3BZ4B 3EIFA 3OMIB 5JIQA 4HPYH 5L6YL 5AUMA 1PU0A 2RB8A 4LCWB 4J6RH 4JZOA 4AQ1C 4OR1A 4ORGA 2VRQA 1IVLA 2YR3A 5D8JH 1DEEA 2VXQL 1CDIA 4ELDA 2OJ1A 1S7QB 4Q2ZB 1Y7VA 4CRPA 2NYYD 5MEPB 3D87B 3TO2B 3GRGA 3JUYA 3QIWB 1SVBA 2YD2A 4AC2A 2YZ1A 1XF2A 4BZ2L 4P23D 1H3UA 3OAWA 1E27A 1CLZH 2JNZA 2PTUA 1HXMB 3MLWH 1T6WA 2AV1A 2EC9U 3PIQB 2BNUA 3NIDB 4YK4C 3BKCH 3VFWA 1UWGL 3TF4A 4ALAC 3SKMB 3HS0C 3IBOA 2UXVA 3NK4A 4I77H 4LLVB 3QJZA 2CWRA 1RU9H 2AJVL 1XCQA 4N3UA 4OCLC 5F93C 4CDGC 5DZPA 4UILH 4QRPE 5I15L 5KSVA 1P2CA 5IF0B 1M7XA 1GC1C 3DX0A 4TNWF 2FQDA 2X6CA 2IDSA 5LG1A 1SUHA 1FDLH 2JELH 2WXFA 4JPSA 2Z8VC 5GGVY 4FXGA 1UZ6E 5F1OB 3CH1A 4MJIB 2YUXA 5H2BB 4IBVA 4DK6A 3ZYJA 3PE9A 4U1SB 2GIYA 4ZUWA 3CPLB 2Y23A 4E41B 1MDTA 5E2JA 1M1SA 4ODHH 3B9KC 3OC8A 5DVOA 4QRPA 3DDFA 3D3VB 4PJCF 4P23C 5C0CE 2KERA 2XG5A 4HWBH 2HX9A 5D7EA 3FHQA 2N0MA 5CN1A 2UZIL 6PAZA 1QFUH 3HUJF 2FWLB 5CJQL 4Q74A 2BSED 4Q6YA 4WZ9A 5J1SC 1FZJB 1Q9LB 2BOBB 4UINH 1IGYA 1T7WA 3VD3A 3JVGC 4DW2L 4XP5L 3V5KA 1UCTA 2R59A 2XN9B 1D9KD 4GRWF 4YN3A 4Y1AD 1NANH 5AVVB 4FQJH 1DVUA 3KCWA 5FWQA 3ZSSA 3UTQB 4PGCA 1ADWA 5HPMB 35C8H 1SXNA 3OAZH 5C0CA 3GIVB 1G7JB 2GK0B 3VTTA 1GS6X 4X9GA 4RA0C 1A1OB 4O2CB 2LTQB 3LS5L 2W38A 5JHDE 4OIAA 3L3JA 4Q97A 3HOGA 5E8NB 4PJXE 1X4XA 3LOWA 2H6PA 1WPCA 1I3RA 3VWJC 4BXVA 1FHGA 3APNA 4U3CA 4YL4A 3RWIB 3TO4D 4L0YA 3CVHA 5FLVA 1NGZA 3VNYA 3AJ7A 3QARA 4RA3A 3KNBB 4RFOL 5K9QI 3UYOD 2RGSA 1D9KC 3KHOA 3QQXA 3ZTNH 2F58H 3BQUB 1FRGH 1JGEB 2FJFB 4NENB 3QEQA 4KHTL 1MFDH 5F7YC 4PVNA 5C0BA 2FBOJ 2QTVA 3LNGA 3MRPA 1HHKB 4JQIL 5IESL 1DFBH 1FFNA 5F7UA 5D7LB 4AQ8C 5IV2A 1D6VH 3IU4H 5D2LF 5MERB 2CHZA 3ZDYF 1N10A 5EBLA 1ZLUH 3L08A 3AT0A 3JWNG 4G2AA 4PJ7E 4BGDA 4H20H 3SGJC 4Q0XH 5ESQA 4ZI8A 3QAQA 1KXVC 4YIQB 4ODSH 4QMEA 1KC5L 3V4PB 2CO7B 5DVKA 1NICA 2CJUH 1X5ZA 3GDBA 3P11H 3LQAC 3QZOA 4HBCH 5DDHB 2Q8BH 1SLXA 1YSOA 3I74A 4P57A 4S1RH 5CEZE 4WI4A 4WFFE 3T0XA 2X1XR 2HN7B 3AC0A 3QUZD 2GSGB 4Z7OB 1HOEA 5E1IA 5HYQA 3Q9PA 5EBMA 2I9LB 3UTTA 3UTZB 3DIVA 3FCGA 4NZUH 2BS9A 5D1QB 3OC5A 4JRYD 4QYOA 3QCVH 1MCDA 5ALBH 3Q13A 4MCNA 4PJAB 1T0OA 3QIBA 4OCYL 5T1JA 1P1ZA 2A9AA 2DM2A 1PLAA 3WEAA 4ESKA 3L5IA 1N5YL 1DFXA 2WTOA 3MA9L 5F1IB 3FU0A 4TVPD 4XX1E 3ZKXB 3UZQA 4WU5A 1KIUA 3DROA 5CU9A 3LNFA 4UOW1 2A4EA 4LKCB 3SY6A 1LEKB 3PQYD 2X0UA 4P2QA 1UYWL 1WH0A 2R39A 2YMXL 1DQKA 3KLLA 4ZUTB 3EJUA 4X7SH 4OTXL 5FUOL 3SODB 3M1BA 1S7XB 2Y3NA 3LKOB 5HDBB 4CL7A 3LH2L 1RLWA 3INUH 1MFEH 4KNSA 2VLRB 3RX7A 5I5JA 2LHAA 4AJWA 1IGCL 2OCFD 1E4XI 4FP8H 2Q7YA 2K6WA 3OSVA 4ZMAT 2ZICA 3Q2CA 5JLZB 3CFCL 1EXGA 2CK0H 5C0AA 4NDMB 1TLKA 1GPOH 5L8KB 2QT6A 3MRNA 3V0AC 2XPYA 1E5ZA 4LLYB 4DPCX 2VTFA 3FTYA 1KIPB 2F5AH 2Y6SC 3DX4A 4HPOL 1ZLSH 5F0PB 3S36H 1BDYA 3L3DA 3ZL4L 4EOWL 1BLNB 1A6WH 2YKLL 1NDGB 2E9BA 4ZJ9A 1EQWA 4MWFA 2GTZA 1G7LB 1E9PB 2QVFB 1AD0B 2J25A 4YX2L 4ETYA 1FCGA 4FX5A 1NFDA 1N8ZA 4FLRA 4APQC 1IBGL 2YD0A 1HH6A 4IRZH 4MJ6A 2FWOB 3RFZB 1YQVL 2CR0A 1RUQL 2AITA 3H0TB 5DUJA 3VFUB 5EOTA 3N9GH 4NT6A 5EOCJ 2Y7QB 4HCRH 4LQ1A 2WQXA 4P46D 4B9GA 5C08B 4NZDA 4C83A 4NP4L 5ILTH 4PCSA 1YNKL 4IRJD 4NRXA 3PPSA 5GS1C 4FTVD 1DBKH 5H4YA 4RBPH 5J11B 3CUPA 4OUUA 5KG9B 5BOZG 5F0LB 4I3SH 3B83A 5IR1B 1L0QA 3DUUA 5GRXG 1N70A 3MU3A 1LWRA 2HJFA 2F54A 2UUDH 4KMQA 5DO2D 4NRZB 3TESA 2WSDA 1LILA 1XL6A 3HNVH 4TRPL 3AG1B 3WNOA 3LXUX 4CNIB 2X40A 1S6NA 2NXZC 4X42A 3ARRA 4IU3A 5TDOA 4B97A 2OQJB 1K4DA 4BH7B 5C7XH 2J1YA 5C2BH 1LQBC 2EABA 3VXSD 3FFOA 3U1SH 2VSCA 3G6DL 2CGRH 2DD8L 4YAQB 4QHMA 3RUGF 1JGUH 3ZX1A 4UM8A 1F4XH 1WBZB 1CFNB 1SHXA 3O3DB 3WY3A 2O1AA 3F85A 3MXVH 2IXQA 2Q3AA 4NWUL 4G9FE 5F6HJ 3NCYP 4IS6B 3ZL1A 2VC2B 5D9SA 1QBLH 1UEYA 2J8OA 4X4YA 4YDKH 1J5CA 4L9LB 3ECBA 4XBMA 2WNXA 2AK4A 2EXYD 3KVPA 3MROB 4HDIA 3GSXA 2MOQA 4AZUA 2FEDD 5KVFH 3CLFL 5B39A 2C9QA 4LL9A 4XXDB 4QHNA 4JCWA 3VQ1C 1NL0H 2FEEL 5EIIB 1QA9A 5JYMA 4PSRA 1SEBA 4G9FA 1CFSA 5CZRA 3EYFB 5T3ZE 5EOQH 5C2UB 4H7VA 3BYYA 4R2GD 3FO1A 3VRIA 3ZZSA 2G3NA 3KL0A 1ZGLA 2XV2A 1EAOA 3BJLA 2Q8AL 4M4RA 3PHQA 4G5ZL 1LNUB 2F7PA 5ACMA 3DPBB 3PP3K 2Q6WB 4JRXA 1T0PB 4QEGA 1CDJA 3C75A 3ULVE 3S88H 1I3GL 4P5TA 5I6OA 3S5LB 2RQEA 5FKPB 1TO5A 3UGUA 3VFVA 2A6DB 1RZGA 3G9VA 2EXYC 4GQZA 1YEIH 3NCWA 2J7LA 4X6EB 2Y5EA 5B22A 5E7FA 5SWSD 4P06A 4XWGH 2C1OA 4APXB 5JHBA 4DZ8A 5I1IL 4F7TB 3EH5B 4HQQH 1SDYA 4HJGA 12E8H 3L3OA 1V8HA 4X8CA 1U8CB 4WHTA 4K5OA 5E9DD 2CBPA 1UWYA 2BPBA 2VJXA 1DJHA 1A7QL 3RILA 3RWCB 3QDAA 4AQ1B 1TMCB 4X80L 3VI4F 4Z7WF 2JLPA 4B9FA 2WBXA 1L5GA 4XP4L 4HWEH 3UTSE 5A2AA 5KYUB 2EVJA 4X6BA 3QHFL 4F80A 3KPQA 3EGSB 1R34A 1ZWIB 3MJWA 2HKAA 1T3FA 4AM0Q 2N1KA 1N3NB 3TBYB 5CZVH 4ZZFA 1I53A 2AABH 1I4FB 3LEYL 3MOAH 2X6MA 3VVWA 3FB7B 1CXIA 2FJHA 3WUWA 4XP1L 4KMTL 1H0DA 2DQGH 5EU3B 2W9EH 4ODWA 3POHA 1YEKL 1XIWC 2FYVA 1CGTA 3GSQA 3Q6GH 4JO1L 2QQLH 1YDPA 3GQFA 3QEUB 2GJ6E 4NJ9H 3F7LA 4G7SB 1IJNA 5DJZB 3TL5A 3OR7B 1ZT1B 2NDGA 4XI5C 3QCTH 3X13A 4W68A 5F1SA 3CVIH 3OLEA 3L2NA 5EB9A 3WEBA 3QZMA 1AY1H 2W8CA 3QB7C 3QJOA 3RWEB 4LSVH 4NLHA 3QDGB 3M6DA 5DHEA 1EERB 1A7BA 1TSHA 2HT4D 2DLHA 2A2QT 2AI0H 2VDMB 2WXGA 3A67L 3F62A 4FG0A 3S3JA 5IHZB 5BVPH 3ARUA 4RGNB 2JI1A 4LRIC 3UDWA 5JOEA 3C5ZD 4FKKA 1E8YA 3I85A 3ZE1F 4LHUA 3SJVE 4D9QD 1A3ZA 4D94A 2BHUA 1TQBB 1JJUA 3GS7A 3EJQA 4NC1E 4YDJA 4MNQE 2XJLA 5J9PB 4G1MB 4QXTB 4ANVA 1WFOA 3K71A 4AEIH 4S1SL 1G4MA 4QHUA 1CWVA 1MDAA 3A3YB 4F9PC 1SMAA 3HHSB 1RULL 2J2ZB 4P5KA 3T0ED 4PCKA 4PJIE 4PJHF 4J7RA 3IDXH 1LO0H 3U83A 1KG0B 2B9BA 4M6NL 2HT4C 4KRPD 2HKFL 3IKKA 3RTQD 1NAKH 4P3CH 1WFTA 1NPJA 4G7VL 3VWJB 5AAPA 1KB9J 1L0PA 1UJ3B 1X5KA 1KJ2B 3C5ZC 3K2KA 1NFKA 4OM1H 4J8RA 1OANA 4LCYB 5C8JB 1UM5L 3L4XA 4H1LA 3IMVA 3QUYD 3H6AA 1S7RA 4DP0X 2XZQL 4G43A 5KJ4A 4PJIA 1KEGH 4L5FE 5J6HA 3MSPA 4HJTA 4K3EL 5HDRA 1O9WA 1GW0A 1HESA 3UJJH 5KSAC 4XVTL 3QZWG 1W6LA 5D7SH 2FZ3A 3MAWA 3KBHE 3K4AA 1ZTXL 1LEGA 2ICWA 2ENSA 3KYOB 3OLIA 5I0WA 4X7TB 1I8IB 2BNRE 5LAXB 4AENB 5E8PA 2XBZA 1V3LA 3CZUB 3LV3A 4FMKA 4FXKA 1OLLA 2LU3A 4UM9D 4U1KA 1BIHA 3EYSH 5JW5A 2LVEA 4JHZA 3PHSA 4JN2A 4AV5A 4PLJC 1IKFH 1PY4A 3RL2A 3G6AB 2ZCLL 2A4ZA 2WNGA 2R0KL 4FFYL 3M7OA 5J1AA 3CC1A 4B3EA 3RAJH 1UA6H 3QUYC 2N7SA 5DGQA 4EUPA 2YGVA 4R26H 2BNRA 4X6FB 2OJEB 1IC5L 2JJSC 4TUJA 1O7SA 1J05A 1GYUA 4NO2A 3HMWH 5KYWB 1BECA 1SJEB 3SKUD 5CD5D 1THAA 3MNWA 4JZJC 5FYJH 3QDMA 4JFQB 2BIHA 2VXUH 1YPZB 3VXNA 2AQQA 4LVOB 2VE6A 2V33A 5IBTL 3W11C 4E5XA 1KT2A 4ZMVA 4LLQA 3LEXA 4QRPD 1JDAA 5DQJA 3V4LA 1SJHA 2DWSA 3HAEA 3PAUA 4JFFB 4N2OA 4C47A 1A65A 1S7WB 3BVVA 4R5XA 3T4AB 1IGFL 3KG5A 3RWGA 1VHPA 3MYJB 4F7MA 2WANA 4Z18A 1AQHA 2BINA 2H8PA 4KZDL 3BYTA 3BD3A 2O5XH 3DI3B 3VA2C 3LQZA 3PGFL 4XZUA 4N90E 1M3JA 3DO7B 1AKPA 2XZAL 3BMWA 4HFWB 4EN2A 1O5DT 4Z7QF 3EH4B 3HJ0A 2OFQA 5C0CD 1ZHLB 3J07A 3WNMA 5CD5C 5CINL 4PJCE 1UH2A 1LO4H 2R4SL 1YECH 3QFDB 3DXAE 4UT9L 3X1FA 4NB7A 3HUJE 2WQAA 3W81A 4V2BA 2HTLC 4L3EB 2YO3A 4LHJB 4Y4KB 2KDYA 1KCSL 4WJ5B 4B7IA 1MNNA 3EJZD 4GRWE 3D07A 5EN2B 4DFHA 4DKEH 5TE4L 5JXAL 3DRQB 3P2TA 4N8VB 1MEXL 2DBLL 1U8HA 3WE6B 4UT6A 4NBZB 2CRZA 2E7MA 2MCMA 1BGXH 3AUVA 3RBGA 5MI0C 3WNIA 3X3FH 1K3ZA 2B59A 2AXGA 3GM0A 3MNMA 3R0NA 5I66B 1ONQA 2E74C 1C08B 4GP8B 1PL3A 3DSFH 3QEQD 5TE6L 4HJ1A 1SJVA 5KVDL 5CGBA 3ZE2E 5D1XE 1RH8A 3JUZA 3LVEA 5EF0A 1JHTB 1BF8A 1JSYA 1RQ5A 2PETA 4PJ8B 4OLVH 4JG1L 4TNWK 3IRCA 3KS0J 3P4NA 3GMRB 4DTGH 1P84J 2FJGB 3FT4A 4TTGA 2Y9RT 3BEVA 3IFOA 1H6TA 3DC0A 1FN4A 3WMPA 2ZCKH 4H0GA 3FUIA 5AWNH 3QRBA 3NJNA 3UBFA 4U6HA 4IJTA 4MFHA 3VFPB 3GMLA 4OI9A 2VLKB 2AEPL 5BUGA 5D1XA 2ZUQC 4HIPA 2X4TB 4AGPA 3U9UA 4Y9FA 2JK5B 3QSKB 4RMBA 2YAMA 5D2LE 1SF5A 4UB0H 1T5XB 4GUQA 1CDYA 2CLZA 2A6IA 4N0RA 3FT2A 1I1YB 1I9RH 4N2IA 5ALCH 5IIEA 4NQXA 4LBAA 5GRJL 3QIBD 3IDGB 2BSRA 5KS9F 5BRPA 2WMPB 3STBA 1HHIA 2YEZB 4NRYB 4WFFD 5CEZD 1A3QA 5EU6A 1YJDH 3RY6A 5HHPA 2FLRT 2YD3A 4PJ6A 1D2OA 1JTPA 2PR9A 1U95B 3IS1X 1YNTF 5KJRH 2ZX5A 3T4YB 5FOBB 1ID2A 3KLDA 1TQSA 4X83A 2JKLA 3ZKMC 2JJWA 4PR5B 3QH3B 4P2QD 4XCEB 2BWIA 4KKPA 4XPAH 5DMJB 2WLNA 1XD1A 2ODHA 1T1ZA 1CFTB 3VXOB 3GMQB 1CBJA 5BV7L 4X99A 3MRIB 5AVUB 2MNWA 3U7WH 4ECNA 1BVKB 1T0MB 2JB6A 4DVRH 4I0PA 5I1GH 1NCNA 3WJLC 1GZHC 4NQEA 2PP7A 4W70A 1B2WH 1MWAH 1WYJA 3PWPA 4XO4A 3BX7C 4YHMH 2CK2A 2YUVA 3IF1A 1PZBA 3ULUE 2WQWA 1N68A 4N5ED 4NCC1 1SN0A 1FNSL 2YFNA 4YLBA 4WFHE 5AD0B 4EN3A 3ML9A 4LLUB 7FABH 4LP8A 5FO9A 3VW3H 1E67A 1EEZB 1TKWA 1R33A 4PGZA 4DOHE 5TQ0L 1XH3B 2JQMA 1PVHA 4Z0XA 4HX1B 1MHCB 1WLHA 1OY3B 2ZOKA 5FYJU 1WE5A 4UDTA 3DETC 1OOWA 3ZUNC 2KS0A 3EHBB 2VMDA 5DZ9A 3OWEA 3SDXB 5I8CA 5J6GA 1N7ML 1S9WA 2VUYA 1BQSA 3AG2B 4WEUD 4WWKA 3LIZL 5IQ9A 2BOCB 2UXTA 3MRJB 4WW2F 1A14H 1MHHB 2IAMB 4N3TA 1EEQA 3HZMA 1F58H 3EUUA 4N5EC 2C4FT 1BMGA 1AMYA 4KU1A 4AGQA 3IJ7A 3HC4L 3O3AA 5H35B 1TXKA 2VDNH 2RQ8A 1EANA 3RWHB 1AP2A 4WJG3 1G6RL 5F1KC 1KCRL 1NUFA 2VW4A 1AC0A 5F6IC 1R3JB 2UVEA 4MD0B 2LFEA 1COBA 2BY0A 2MTPA 4Y7MA 4PS4L 5F7AA 4OI7A 1NBCA 2VAAA 3QZLA 5I1HH 4S2SA 3VFSB 3CK0L 2UZYA 4R9HA 3B9AA 3GSUA 1J12A 4OCXL 2AHIA 1J87A 4K8RL 1LP9A 3NA9L 3VXMB 3V0HA 3F7YB 1ASPA 4QKTA 3UAJC 2B4CL 1QPXA 1CUOA 1TTAA 3AQXA 3U9WA 4X5WB 3U2SA 3CPUA 4ABUA 1GGTA 1EHKB 1MAMH 5HTSA 4RGOL 3GI9H 3HRZB 4LLWB 3LKQA 4TUKH 4AC4A 4XHJC 3ZKSD 3VM5A 1LK2B 1JL8A 5C9KA 4M93C 1B4JL 3BEWB 4OBRA 2AC0A 3RUGE 3KPRE 2VQ4A 3C6SB 2GSIB 1RIHL 4H40A 1MHEB 4NP9A 2FB4L 2LV4A 4G9FD 3ZE0B 5DFTA 1RJLB 3APFA 3SKOB 3Q0HA 4RSYA 5E8DH 1AXIB 3H9YA 3I9GL 4AEFA 5AZ2L 1XGQB 4UQBA 5ABAA 4CMMA 1FBIH 3FFCA 4HFUL 2BSTA 4JRXD 4HG4J 3KPPB 5GGRA 4P5TD 5LCVL 3W9EB 1GCFA 5KTEL 4IHOA 3KPRA 1I7UA 4UZSA 4YSCA 4UF7C 2C5DC 2NY6C 3VD5A 3FFDB 4K73A 1A6TB 5T3ZD 2E56A 1F4YL 2WCSA 3STLB 5D1ZB 4MCZA 4MA7L 1KCLA 2YLHA 3EO1B 1OVZA 3VXUB 4RIRA 5KSAB 1NMBL 1CYWA 4S10A 1E4JA 1UWEL 2OL3B 4QXGL 4ZAKA 4UV4H 3RHWK 4ZMZA 4NO5B 3ULVD 3COOA 5F70A 3EADA 2FDBP 3BC9A 3MV8B 4U6YA 3HMXA 1L0XA 1BZEA 3JV5A 1P1VA 2YD8A 3IMBA 1CL7I 1TU2B 4JDEA 3I6KA 3PXHA 2VIRA 1RK7A 1WBXA 1C5DB 3BRFA 3CVCA 2BP8B 1EXHA 1V3KA 2XWXA 2DI8A 3MJ9A 5HPOA 2VT0A 3LVTA 4JM2A 3I6SA 4P5TC 3QUXD 4U1IA 2WNKA 2MJWA 4FI8A 4DWHA 1FO0B 2DQHH 1EFXD 4XBGB 1E8WA 3FQTB 1XGTA 1VEOA 3QXDB 3G5XA 5DD5L 5SWQA 3O45B 2A6JA 4I7ZC 3UBGA 4Z7WE 3UTSD 3N42B 3MJ7A 3WEXB 2Y7OA 4MLIA 4RGMC 4F2ME 4MLSA 3ULVC 1OHZA 2X89A 2X70A 2ZP9A 3WIHL 1HKLH 3KPSB 1JWUB 5HVHB 1X6NA 4JZJB 4K3JH 4P2RE 4MCYB 1A47A 4M02A 2MPAL 2I69A 3ILQD 3O9WA 4OM0L 1U3HB 1ZA3B 1K8DB 3QUXC 1U4FA 4M7JL 1EGJL 4QWWD 1JZEA 3SYCA 4AIZA 4BFOA 1AOZA 3RU8L 2GJ6D 3V6BR 1R3HA 1T89C 1JGIA 3N6YA 4I87A 3I9AA 4KKCC 4LHUD 1XGPB 3MLYH 5CR1A 1AO7E 2DQCL 3OJDB 4HKZA 1BXVA 2F7IA 3ROLA 3VXPA 2ICWI 4BSVB 5C0RL 5CBAB 4OGAD 2IADB 5A3ID 3V6OE 4KVNL 1ZT7B 4A2LA 3PS6A 8FABA 1CPUA 1NWOA 3H42H 1AYRA 4JDZA 3RKDD 1E9OA 1WZ1H 3O6FA 5IJVB 1OSZA 3HC3L 3IPBA 3LRSB 4PB0L 1CICA 3GB7B 2AERT 1BZDA 1XXDC 5T5NF 2OS7A 4Z7UF 2WB1A 4ZS7H 3WNNA 1HC1A 5TK2A 4JFVA 4DPAX 3BKYH 1PZ2A 4HUXB 4JKMA 4LIQE 1D5IH 3QIUB 2XPGB 3QPQD 4QCIA 2IH9A 1F90H 1GAFH 2CKNA 2EE3A 4LQFL 2ZKHL 3T77A 3D7PA 2V3FA 1ZEAL 2DQTH 5F3BA 1FQ9C 3DOHA 4Z5RB 4ZTPL 4P2CG 5KVMC 1S7VA 1KCVL 5K1JA 1J8SA 3X1GA 4ZFQA 4PJHE 3WI9A 3R8BB 3RKDC 2CMRL 2DH2A 3L5XH 1IKNC 4HMCA 3SGEH 1U91B 3X1EA 2ZUSA 4G6AC 1DJZA 3QHZH 5AW9B 3TA3A 3W1ZA 4KKLD 3EO0A 3PWNA 2HFFA 5KJ7E 3S97C 1FL5A 3GXDA 3W39A 5E1HB 4LSRH 2LAGB 1ZIBA 3BVDB 1AGEA 4NC1C 1BPLB 4BFKA 3LNEA 2QGEA 3D25B 5CUSL 1XF5A 4NEHB 4IK6A 4RDBA 4Z7NE 2DWXA 3FCUB 1NFDF 4V1DA 3V0WH 1JZ5A 3A24A 2ZUQB 1OSPH 4DCQA 3NESA 3NGBB 3ZN6A 3V0GA 4FQ1H 1KXTA 3MRQA 4D8PA 6CGTA 3CU7A 2BNRD 5DEFA 4XAWH 4ZPVB 4W9HC 2AQRA 5LB1A 3HE6A 1H6FA 4IMKA 5L0QB 2E27H 3CFKA 2ZQKA 1X5YA 4FZ8H 2NOYA 2VQUA 1C16A 5I0VA 4I9XA 4GBXA 4D0BB 4DVBB 3EYUL 4EUPH 4F8LA 3JWNC 5HSFA 2W0FA 5CU5A 1TENA 2NY5H 4UCFA 3CFDA 4RAUB 1L6ZA 3SE4A 4EIZC 3MRGB 4N26A 1G7PB 1L9QA 3OX8B 3QNZB 1ZHKA 4IRSB 4QHLB 3APDA 3SPVA 1T1WA 4EZMA 1PJWA 5BO1H 3TIDA 2J56A 2VKXA 3L5WA 5HDLA 1RUKL 2EEAA 3OKDA 2BIIA 1HHGB 2WXMA 3NK3A 1T0NB 1JFQH 2B2XH 2BO0A 3L4CA 3KYAA 1IQWH 3MLSL 4DEPB 2FIKB 4PGBA 5EF2A 4XMVA 3RPIA 1PLGL 4RAVA 1ZPLA 3HAEH 3IGAA 5TF0A 2JJTA 4PBWD 5DJYB 2VDKL 3G5ZA 3C60A 3IPFA 1IV8A 3QA3B 2VRKA 4HGWB 2P43B 3MX0A 4HD5A 5DUML 3WO4C 2D4FA 4F15B 4Z23A 4FKEA 3FTZA 3V4UL 4XXWA 4YPGB 3BQVA 2UV3A 4YHOH 3DWTA 3RDTC 2FH6A 5DD6A 4K7FB 1YCSA 3UROR 3EDKA 4YLQT 2BCKA 3O3BB 5IB2A 1CF8H 4KZEL 1IM3B 1IGJB 3Q44A 4N90D 2J3SA 4LE8A 2X4NA 3DARA 3FQXB 2PPDA 3BDBA 4PRNA 2JQAA 1OAZH 1WBYB 2Z65C 3CN2A 4K7PH 1C5BL 1SYSA 3D50A 2P5EA 5EU4B 1NEZA 4Z7QE 3BWUC 4UDUB 4ZQTA 2AEQH 4FQLL 4LLMB 3GMPB 2IH1B 4UT6H 2NW2A 4BQ8A 1PD1A 1PTZA 3IK2A 5HHME 3O4LA 2VXSL 4RBPK 2DJMA 3QEGL 2PP8A 4Q9CA 4J5VA 3EFDH 4M48H 1BZQK 3FN9A 3I75A 1ZDQA 3FUDA 1MFBL 2UUDK 5KN5A 4HK3J 4G59C 3ZOAA 5GS0L 1F0LA 5I1AA 2F68X 4N8CL 1GIGL 2DDQH 1LMKA 3GTTA 3VGDA 1AACA 2K3TA 4TQIA 2BNQB 3CDGA 3E6HB 4Y4HA 3VXQB 1CURA 3K2MC 3TJHC 3BGMB 5T5NG 1TYJA 2YAEA 3BUDA 5D1XD 5LVEA 3IPEA 3KS0H 3LX9A 4AIOA 2NUPA 3DIDA 4FMVA 2VDOH 4BXSV 2HVJB 1CGSH 3QPXH 4P3DB 1JMZA 2J8UB 4KPHL 1WWWX 2XYBA 1VFAA 3Q8AA 2FX7L 2UZPA 1BX2A 3DVGB 3T3MB 4DZBA 3P1VA 4LCUA 3B56A 3MLTA 3NSFA 1P4IL 5EU6D 2NZ1A 1T22A 1ZPUA 4P9MH 4AEHL 1JF6A 4HWZB 3PWLB 2E59A 2Y06H 4U1NA 1J9RA 3T8VA 3LXCA 4A6YB 2Q3ZA 4OJEH 1GYCA 2A73A 2GUOB 3BSZL 4ETQB 1E2WA 4LFHG 2VLJB 4F7EA 2FNBA 5I2IA 4JANB 4PWEA 5D1XC 3UH8A 1FJ1A 4KUCF 3L4ZA 1FF5A 3AXIA 1CFQB 1OAQL 2IPUG 4O4YL 4P59H 2W92A 4PRHE 1NLDL 4AW7A 4ELMB 3D33A 5ICXA 1CD0A 2B77A 5KS9E 2R29A 3QZBA 4YUEH 3BAJA 1K4CB 3U6RA 5DT1L 1N4XL 3I9PA 2K9FB 4NQED 3BIKB 3PWPD 1UACL 2NY6B 3LZNA 4AVKA 5LWYH 5FO2A 4GI9A 3BHBB 2YPLE 3EYOB 5FCSH 3OL2A 3QULB 5EWIL 5F9JB 1SHMA 1TZ8A 3QWOA 4DKDC 4W4NA 4BV1A 2XU9A 3HPJA 3O11B 4EN3D 2YQ3A 3KYMB 1WO2A 5SX4H 1BP3B 1NC2A 2EIZB 4OLUH 4BFNA 1A7RL 1J8RA 4AYSA 1T4WA 2GT9A 4BKLB 3LS4L 1KJMB 2E7LA 5I9QB 3S2AA 3VXRB 2NXYD 3GMMB 4K94L 2QDWA 2EVFA 1A1NA 1TEYA 4YSOA 3FUNA 5KBPA 1S4IA 1MUJA 2IALA 2YPLA 1U6AL 3DURA 1TJHH 5JQ6H 2VUOA 4QLWA 1TJMA 3ULUD 1FL3A 1OPOA 1GGBH 2B39A 3HC0A 4WWKD 4WFHD 5EPMA 1NZRA 3CFBB 4AJVA 4NHUA 4OD1L 5IFHH 1T03L 2W0LA 4OZHF 4XNYH 2X05A 1MKFA 4LEXH 4Y9BA 1MIEH 1CG9A 3P4OA 5GRUL 3RRQA 4L4VE 1JZ4A 3RA7L 3T2NH 4JG0H 3U46A 5I18H 1AGDB 1AZVA 3IMTA 4J23A 4BRJA 3GJEA 5IOPB 5DR5H 5DC9B 5E4IA 3I6GA 4MHHI 5EUKB 3SY0B 1A4JA 3B2UC 3X14A 2VXTL 1EAJA 5C0NC 4WWNA 5E2UL 5I1LA 5EZOL 4LSSH 3ESMA 4AEEA 1IC7L 2NXYC 4YSQA 4ZUUA 4KJWD 1YMHB 1DVFA 2WYHA 3INOA 2OYKA 1OZTG 4YHKH 2FLMA 5SWZA 1QBML 4L4VA 2Y7NA 1SDDB 4JPKH 4HJJH 4Z7AA 1YEFL 4OV6F 3ULUC 5DVPA 1OARH 1QR1B 1VFBB 4FRWA 4DHLA 3U25A 3BZDA 3LKNA 4HV8B 3ARPA 3IDUA 5DURD 3L1OL 4HS3B 5TPWH 3BWSA 1X6LA 4HOXA 2D9QB 2WLIB 4F7KA 2A6KB 3LZFL 2JMRA 1H8OA 1R46A 2VMFA 5F8QC 1PY9A 3V4VA 1IM9A 3REWB 2YA1A 1DQQA 5D70L 4A55A 2WWOA 4G6KL 3OGOE 1U2HA 3ARYA 3CDZB 3QUMB 4HU8A 4U1JB 1QLEH 1K6QL 4PRDB 2R1WB 4GYBA 2ATPB 2CBMA 3BVNA 4KJWC 5LGJA 5CSZA 1FORH 5AFAA 4QY8A 1NBZA 2IV8A 2EDYA 3WJJC 2K6ZA 4BD4A 3DBSA 3FFCD 1EHNA 1AKJA 1EO8L 1XF3B 2QVMA 4Q9RH 2Z9TA 4XC1H 3SBRA 2WPGA 1VPOH 4O5LL 4YDNA 4WIQA 2OK0H 1J1PL 2EH8H 4TOYH 2XVLA 3KPRD 1CXLA 1ETB1 2GFBA 4FLOA 4WDIB 2YAOA 2B0SL 3BD4A 5LXVA 1NGXB 2PPEA 5E51A 1AGCB 2NMSA 2XIIA 3LZRA 4WWPA 1SEQL 1JZGA 2JTYA 4N9GA 1NGYA 5GPRA 1KCUL 3C8KA 1AH1A 4NUJA 4MNHA 2AJXL 1MRCH 4ZAKD 5HI5D 3QDJA 1URLA 4QXVA 5AB2A 1VACA 2WLJA 2ZNXA 1Q94B 5ECJE 3VMPA 1H8SA 3FCSB 4ALAL 2Q5BA 3D18A 4FAAB 3HLAB 1ZLWK 1S9XB 2H45A 3CFEB 2FO4B 5EF3A 2VDPB 1FG2A 3HMXH 2VM4A 3CDCA 1BQ5A 4CADA 3NQKA 4NC0B 4KQ4H 4JE4B 5I8KL 5DJCB 2MCG1 1OP5H 1CDBA 1A1MB 3KEDA 3MJ9H 2NSMA 2P8LA 3N85H 1TYRA 4PI0A 1C1EL 1KN2L 2ALWA 4NWTH 2GVYA 2X42A 3ZGIA 3A4EA 4KQ3L 1BZ8A 1XD0A 2M83A 1SOQA 2QADD 1P5UC 3ATAA 1WF5A 4ZAKC 5GGSB 1E4KA 2L04A 4WWID 4NZTL 4GEIA 2Z91B 3HIZA 3HBGA 4E0RB 2OW6A 3H3KA 2C9PA 3HEIB 4LO9A 4BSJA 1G84A 4Q8BA 4K9EH 4XMKH 1XB3A 4NKDA 4FHKA 4UQEA 3RZCB 1ND0B 4FQCL 2YKKA 3BPLB 5C07E 1EAPA 4G6ML 5HP5A 3DGCR 2QSCH 4MAYA 2HRGA 1AFVL 3U2JA 5JIMA 3FO0L 3KXFB 4RISL 3WJMA 5ESVA 1RXLA 2Y3AA 4EKJA 4FZEH 3MNVA 2WXNA 4IW4C 3FB6B 5T1DH 5FOJA 4R96B 5IUCA 5JDSA 1A9BA 1ACXA 1X5MA 5FUCE 1YEJL 5K9KA 1KYUA 4P2RD 3V9CA 1HZHH 3UJIL 1BWMA 2WQUA 4B0MB 3VQ2C 1T7ZA 3ML8A 4YGVB 2CO6A 5AW2B 2O6EA 2ZXBA 3TC9A 3WO4B 1MPAL 3O6FD 3S96B 1KBBA 1GKOA 3GWJA 2WUCH 3KL3A 2KUTA 3HBQA 3W3BA 3MREB 1CICD 2H3NB 4JRWA 3LDBB 3WIIL 1C7TA 1I8KA 1L7TH 3AXLA 4W9FC 4ZS6D 2IQAA 4JVPA 2Y36H 3AAZA 4HKJB 4UAOB 2O5ZL 3UO1H 1N67A 2VDRH 1BG9A 2Z8SA 1U8OA 1HHJA 1J0HA 5FGRA 1FIGH 3AB0B 4IIZA 2EDMA 2CDEA 3DV4B 3MMEA 4PCTA 3GZQA 3IJYA 1J0YA 1SVZA 4YQXL 1XGYH 4LAQH 1HL9A 4N1CA 4XMUA 3B9VA 3MA7B 1BF5A 4Z7UE 3RIFF 3RWFA 4ZX3A 5I5IA 3MRBB 1XCTA 4GQQA 3AMKA 4M6ML 2GIMA 4TULH 3EH3B 3NSJA 4O58L 4L2YA 3DSNA 4M62L 1DN0A 3S5YA 4MMZA 5D7IE 3TA3D 3G04B 2VXQA 2ZYIA 3RX8A 2I60L 1I85C 1A6AA 4UBDD 3MO1B 1RIVL 4HUUA 4ZS6C 4PRPB 2Z1KA 4P2YA 2Q86A 3HC2A 3REVB 3T65B 1LD9A 2MH4A 3V6OC 4ZX5A 1Z3GL 1BBDL 1FNFA 4JFEB 4BZ2A 2OCCB 1QUNB 4XAKE 5CN3A 4L8DB 1F11A 3NIGE 4V1DD 3JSSA 2AQSA 4QRQA 5DFWH 4PMEA 1DJGA 3OKLA 3H1ZA 4O2EB 2J6WA 2PTTA 5GRZA 1Q9WA 4DN3L 5M94B 1T20A 3PDDA 4OIIL 4QO1A 4KGJA 1MLBB 2OMWA 3RNQB 1SOKA 3HUJB 3P4MB 4GOSA 3HE6D 4MA3B 3O41B 4GKSA 1AZNA 3M45A 4O2FB 2APVA 4ZOAA 1QSFB 2PCFB 3CH8A 5EA0L 4AT6B 3ZVVA 4GBXD 4B60A 4QPEA 3LHPL 4MQTB 2E9JA 3FQWA 1CE1H 2NX5B 2ZX8A 5EU5A 5BQDA 1VRSA 1R0AL 4UBDC 1CI3M 1QEWA 4G8AC 4CSTA 4HJEA 5CP3A 2EC9T 4D9LL 1RY7B 2VZOA 5ESAA 3GBNL 3MXWL 4K3GA 3M8OL 4WCYL 1WFMA 2HP4A 4R6UA 5CCKL 5T33H 1CGYA 1MFAH 4W9DC 1MXDA 3C5XA 2YGQA 1CTMA 4UV7L 3NZUA 3ZZLA 3LY6A 1J8HA 4UQ2B 2OJZH 1TTFA 9PCYA 4WTZG 3O3UN 4AYMC 1QNZH 4GIPD 3QS2A 3NCCB 3TPUB 2Z4QA 3ASWA 4PJEF 4GBXC 1U8IA 3C60D 4AUJA 3KWWB 2IO5A 3LPPA 1Q1JL 2MOGA 3QORB 5FM8A 4W4OC 2C7UA 2XN0A 2FECI 1I7RB 2CKBB 2J1WA 2VZUA 5CP7A 1Z9SA 1Y1UA 2FYYB 2P52A 2W81C 5I73C 5FGCB 5EZPA 5DC0A 2X38A 1V05A 4AYEC 2ICES 4IGBB 3K6SA 5L2JB 4MSWB 1A02N 5BOJA 3ZDYB 1ES0B 3FN3A 4NQCE 1FYTE 2IPUK 2KL6A 4QTIL 4ZODA 4DK5A 5DJAB 1PX8A 4FABL 2P5ED 1AAJA