4AV5A

Structure of a triclinic crystal of the fimh lectin domain in complex with a propynyl biphenyl alpha-d-mannoside, at 1.4 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 34
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av5A00
4BUQA 5IQNA 1QUNB 2VCOA 4XOBA 5FS5A 5F3FA 1N12A 4X50A 5IQOA 4XO9A 4X5PA 4AUYA 3BFQG 5AB1A 3JWNE 3SQBB 4XO8A 5F2FA 1UWFA 4AUUA 4ATTA 3BWUF 3ZL1A 4AVKA 1PDKB 4LOVA 2W07B 5LNEA 4XOCA 3ZL2A 4AV5A 4J3OH 4J3OF 1KIUB 4XOAA 1KLFB 4AV0A 5FX3A 2XG5B 3ME0B 4AVHA 4CSTA 5CGBA 5LNGA 3RFZA 3JWNH 2XG4B 5AAPA 5FLUA 5AALA 4J3OG 2WMPB 5IQMA 1ZE3H 1N0LB 2JTYA 3BFWA 4XODA 4CA4A 3MCYA 5ABZA 2JMRA 4AVJA 5JQIB 4X5RA 2UY7B 3ZPDA 4AVIA 4XOEA 3JWNG 2UY6B 4AUJA 4AV4A 5FWRA 1TR7A 2J2ZB 4CSSA 4X5QA
chains in the Genus database with same CATH superfamily
15C8H 1CG9A 2VXUH 3PY9A 1JWUB 4ODWB 4Z7UE 5EDXA 3NCWA 3OL2A 2JQAA 1SMOA 3QCTL 3HCVB 2E76C 3WG7B 1N5YL 4YHIA 3MNZA 5DQDH 4YPJA 5EZPA 2E56A 5A2FA 3QJQB 4OM0H 4BSJA 1PZBA 1MAML 3A24A 1AHKA 1OO2A 4IDLA 1FYHB 4RSVA 1G1CA 1BQHA 5FA4A 5K59F 5DUBA 3T3MB 2WVVB 4F57H 1M7DA 4KKCC 2FZ3A 3HR5B 1TU2B 4NIKB 2FRGP 4FHJA 3FBKA 4XO4A 5FOBA 1ZANH 1ETZB 2QADD 2H41A 2N4IA 4OF8A 4JRXB 5FYJD 2J1KA 4A6YA 5A2KH 1IZKA 1MKFA 3LKNB 1NIAA 3I6GB 4JQIL 4JFDE 2J43A 2EVJA 3LH8A 3CFBB 1JN6A 3PIQB 4XBGA 1CYGA 3OJMB 3KCPB 1HH6A 4HOWA 4HLZG 5CN1A 2W0KA 2QBWA 2IQ9L 1MRFH 2R4SL 4F2ME 1E42A 3ARBC 2WLYA 3RI5K 3UBHA 5JIMA 4ZFGH 5HYJB 3M8OL 5JHLH 4WI3A 4YE4H 3MRMA 3QZWG 1HE8A 4JG1H 4G8GA 5I8KL 3NSFA 4UIKL 1U8CB 1E9PA 3GKWH 1VACB 2I5YH 5J6SA 2XRAL 2NY7L 2V2XA 1PG7L 2W1NA 4LKXA 3WJLC 2XFXB 3HC2A 1F1GA 2KLSA 4GXFA 3GXTA 5IHUL 1YEGH 2WNWA 4WW2C 5JLZB 1WBZA 5LG6A 2Z31A 1UWGL 5JA9A 1EJFA 1GTNA 3Q8AA 2VITB 1YQVL 5IIEB 3RNQB 3ULVE 3J7HA 1A1OB 1BFSA 1QSZA 4FHKA 4UILH 4MQ7A 2PR4H 4XGZB 5BW7C 4XC3H 4ODUA 1MHHA 1MDTA 2ADFH 4QHUB 3IDGB 1VSCA 4R97C 4KNQA 4XPBH 3C6LB 1KGJA 1DZBA 1NCWH 1ZVSB 3EFOB 3TBTB 3ZHNA 4DGYH 4ZMAT 2NLJB 2R2CA 2DQHH 3F12A 2DBLL 1KTRL 1XT5A 3VXQA 4XP1L 4IRJD 4DH2A 2ICWA 3TFKD 3C5ZD 4OZ4A 2VLMD 1EFQA 1TXKA 2DYRB 4JCWA 1PD1A 4TNWF 5FS5A 5DJCA 3RUGA 2OS7A 1CLZH 3LZPA 4L9LA 2PO6D 5C0BD 2RB8A 1GTFA 3V6OA 4R4ND 4R4BA 4Q2ZA 5DRWB 2AITA 5I1GH 4JL1A 4K73A 3WTWA 2CIKB 3D6GA 5C1MB 2NZ9D 1G6RL 4JFDB 4DPRA 4KQ3L 3C60B 3KPSD 3WY3A 1IKFH 3P77B 1VZHA 1BX2A 4JO2H 5CD3B 5AOZA 5G4NA 2OAAA 3GRBA 1MJ7L 2FBOJ 4JFYB 2FO4A 1THAA 2ALAA 1IGCH 3D4YA 1UT2A 4UV7H 4UCFA 4FA7B 3UZVA 2GI0A 2IALB 4MCZB 4OZFG 4FYQA 1CXIA 3L2NA 1ACZA 1MUJB 5GSRA 3WFEL 1N5AA 1S9XA 1YAZA 5KUMA 1MFBH 4E68A 2QVFB 5LHDA 4HPYL 3HPLA 5F0PB 5HGHA 1HCVA 2K1MA 3QIUD 4K4KA 3TESA 4ORGB 1G0YR 4XAWH 1TQCB 3ZSSA 3LN5A 3QCVH 3RLSA 5GJSL 2WLNA 2XYBA 4WGVB 5JDSB 4KRMB 1GYVA 4IOSA 5DD6A 1IT9H 3T6VA 4F58L 2ZXBA 1M6OB 2WOBA 3FU6A 4FQXC 1J0KA 1EAJA 1JGVH 3BAIA 1UJ3A 4ZUVA 2KL6A 5JMRA 4WTWA 4CC0A 1AGBA 4BFRA 2AZUA 2AJ3A 2WGNB 4EZLA 4JS7A 3EUUA 3RL1A 3X1FA 4HKJA 4IBUA 3PLYA 2BVOA 2V4LA 1QLEH 3LNHA 3SDAD 2YN3A 1U8NB 5DWUL 1BLNA 3OC5A 2PLTA 4TUUA 4BKLA 4XXDB 4EUPA 2XN0A 1FZJA 2UY7B 3C08L 3FOLA 1NEZA 3OR7B 2GEQA 4Q14A 3KVDD 1RJLA 1S7UA 4JB9H 4R83A 2D3VA 4HH9A 3I85A 3GS0A 4XP4L 4APXB 5IVXF 3VYOA 5FECB 3K7UA 1MWAL 5JHDE 2BVTA 2AJZA 5DFVD 3UCQA 1FLTX 3QARA 2PWGA 3MBEA 1CG9B 1Z9OA 3BN9D 5GPRA 5J06A 2A4CA 3V4UL 1FZKA 1NFDE 2IH1A 3WAJA 2ED9A 2JB6B 4BFKA 3SDCD 4MDJA 3TS8A 4J5VA 4I77L 3L9RA 2XKSA 4OLUL 1SHSA 1E4WL 5E8OB 4KK9C 4TNGA 4YHIB 4PRID 1TVHB 4PJGE 4YDKL 1KT2A 1MOEA 3ESOA 1PLAA 4HIHA 1I3RA 3CVCA 5DD5H 1BQHB 1P6FA 5FA4B 2AJSL 3ULUE 2EEBA 1PY4A 2XWJA 3EIFA 3LB6D 1OLLA 1L9NA 1PG7X 1PCXA 2BOCB 2DWDA 1RUPH 1ZPUA 2Y1VA 4AEHH 3TJPA 4MAYA 4P2AA 3L5JA 5DK0A 2X0WA 3V6OE 5JIIA 3H7LA 4QXGH 1A8ZA 3V4VL 3NCCB 2EXYC 3QULB 3NTCH 1VJSA 5ID1B 1P4LA 4XHJC 1PKOA 1L0PA 1Y0LB 4KKAD 5DHVH 5DQ9B 5DRZA 4R7DA 1EEQA 1JN6B 3MKKA 2W5PA 4XAKD 4YFLI 1HH6B 2Y7NA 3D18B 1X4YA 5D7IA 4YWGH 3L5XL 5EU6A 3WFDL 5I1IH 2X4SB 3NDYE 1NC4A 2XQYA 5DHYA 1KXTA 2HH0L 1QBLL 1XH3A 2Y23A 3EYOA 4HFWA 4B9KC 2CLRA 5BS0A 5J13C 4FKKA 4UDTB 1QFUH 4HK0A 1KB3A 3MLSH 4ZUUB 3WKNA 3BJLA 4G8GB 1NCHA 4YDVB 3V4PA 5C0IB 2NYZA 4NEHB 1BVNP 2J1XA 2V2XB 1IKNC 2YAFA 3BYTA 3IU4L 2WINA 4JRXD 1ADQH 1BQHG 2BIOA 2ESVE 2IAMC 4UQ9A 2WM0A 3SYAA 4OLVH 2EDFA 1A6ZA 1WBZB 2LW3A 5EFIA 3ET9F 4LP8A 1EBAA 2X4QA 3MUJA 3QC5X 5IHLB 1IUZA 4Q0XL 3P0YH 5J1SC 2AK4E 2CHNA 3AADB 1YYCA 5JHDB 1UYWL 1S6NA 4POZD 1WQVT 2B08A 1WWBX 3D87B 1NAKL 5HYJD 4HCIA 5SWSE 1MHHB 3OJVC 5I0WA 2IQAA 1IAIL 2XPZA 3HI6L 2JJSA 1MCOL 1J1OL 4FULA 4IBTA 1YNKH 4AV4A 1NDGA 1E30A 4NC2B 3SZ6A 2BVUA 2Q7YA 4PJGB 4DT2A 3ZZLA 3VXOB 5T5FH 3VXQB 1V05A 1VERA 1YEKL 4WHTB 1Z3GL 2VSKB 1S46A 2A5UA 3ARWA 4N6RA 3JV6A 2J8HA 2VDKL 3QE5A 1P4BL 3UG5A 1G7LB 3RTQD 4BUQA 3HN3A 5ESVA 3SE8H 1A2YA 2X5PA 5IB1B 2AQ3A 2WQAA 4Z8FL 4PLKC 3BPCA 1IVLA 1S5HA 3HFML 3AWGA 4Q2ZB 5SX4H 2WYIA 4X6DF 3VFSA 4BDVA 3ESPA 1SYVA 4Q8BA 3NEEA 3BIAX 3O4OC 3GXIA 3TO4D 4I3SH 4X5PA 1JK9A 3SGKC 1OM3L 1HSBA 1I8IA 5B3NA 2VDPB 4JRLA 4KRLB 3QJVB 2ZOLA 2ICWI 2FO4B 4NZJA 1BOYA 3LDBB 3LS5H 3WIHH 1XDTT 2J5LB 5LN8A 3GSOA 3FSWA 4MHHI 2DV6A 2J2ZA 2KQMA 3W56A 5CJXA 1N5AB 3B5TA 4HALA 1S9XB 3IDUA 3VUAA 5TPWH 4P5TA 2CLZB 4EIUA 4OCMC 1J5CA 2ZCKL 2OMYA 1NAMB 3N0AA 1EVTC 4OSUL 2OMWA 4RWYH 5DA0B 3SPJA 5HGHB 4G7VL 1OALA 4OF5A 3LNFA 1GL4B 4ZX3A 3LN5B 3FT3A 2XSKA 3QJFA 3GMRA 1IBDA 3NN8A 2WP3T 4JY4B 5C0ND 1DR9A 3BPOB 1CICB 2ESVB 3NJFA 2A2QT 3ZKQD 4JFDD 3HB3D 4PS4H 3N04A 3C60D 3DGCR 5EIIB 3RBSA 5KG9A 2Y2WA 5DHEA 1UJ3B 4MHHG 1KIUA 3RURA 3H9SE 1UH3A 1A6TB 3B8SA 3S37L 3TVMC 2ZSWA 3CZNA 4TNFA 4NN6B 2EYRB 3S0PA 3VI4E 4E41A 2XTJB 3FU0A 1QZ1A 4ZK8A 2XETA 4WO4D 1AS7A 3ULSA 1R3JB 2LOEA 5FFLA 5SWSB 1HZLA 2CZNA 3OAYH 3K71B 1N0XH 2EXWC 2IH3B 4N2EA 1B90A 1S4IA 2XACC 3EG9A 3WNKA 3QXVA 1QG3A 2P5EE 1BLNB 2VDQH 1TETL 4BKLB 4L3FA 1ECZA 2ZNXA 1T1WA 1NEZB 3QRGH 3M86A 4K7PY 1R34A 3B56A 5IQLA 1Z0MA 1S7UB 4B9FA 4HH9B 4P57A 5AYUL 2XWTB 3M45A 4CN6A 4ZMPA 3TO2A 3CN4A 4HDIA 1IBGH 4IMKC 2OXGA 4QTHB 5KVEE 4JN2B 2XC8A 3F7LA 3BKYL 4Z7VE 2ZUQC 5E99L 4DKAA 1KY7A 3NEOA 2ZF9A 1P4UA 1FZKB 4AIOA 2IH1B 4I48A 2CRIA 5I1DB 3D0AA 2OJZH 4NM4H 4FQJH 2FEDD 4OAWB 3NRPA 1BDYA 3NBNA 3LOWA 5BQDA 3D5OF 3V52L 4L3CB 5I75C 2WXKA 3UTSD 3EDEA 1T0OA 2BP3A 1Q38A 4YHYB 3NACH 3Q06A 3Q01A 4DOHE 4UT9A 1FNGA 4RFEB 4U1SB 1KT2B 1SEQL 4M7LT 1HL9A 1VFOA 3T6QC 4NQEA 3C6EA 1I3RB 2P9RA 2EIEA 2YGNA 2VT0A 2WSDA 3ERXA 2DWDB 4OFYA 4XC1L 2UZIH 3GZKA 4MAYB 5IV2A 4ODXA 3RDJA 4LSTL 5DK0B 1EZVX 5EEYA 3LPWA 4EUPG 4XBPA 1NEZG 3OGOE 1DVFA 1P4LB 1OXYA 2YO3A 5DRZB 3O41A 3OF6A 3V8OA 3DVNB 2FJHA 3EZ8A 3H3PL 4FG4A 2YZ8A 4U4BA 5L0QC 4KXZI 4FNUA 4XMVA 4ZFOB 1RV6X 5EU6B 1A7OH 1VA9A 1GYUA 4XNMA 4FTVE 4QRAA 1OGPA 4F8TA 3H9SB 5ABDE 2FYYB 5DHYB 3UGXA 4YXKL 4LCCA 2NZIA 3EYOB 3VI4B 4HK3J 5EU7E 3V55A 1KGUA 1YEFL 4IKNA 3ZYOA 4HK0B 1AR1C 2HT3D 5C09A 4EDWH 3MRLA 3V4PB 4BQ9A 4GMSH 2Z64C 2P5EB 4YFDB 4HAKA 4WNQA 3VXUA 4OJYA 4LHJB 4NQDE 3ZDXE 2P8MB 5EORL 3U1QA 2WINB 1B4JH 3H54A 4NJAL 4MA3A 2OSYA 5GISL 4M1DH 5AZEH 1ADWA 2X38A 1NIEA 5AVVB 1L5GB 4H8WH 5BVPH 2AK1L 1CB4A 2X4QB 4PJEE 1LO0L 3TFBA 1KCLA 1KG0A 4O2EB 1MRDH 4MNHA 5E6IC 3G5VA 4NLAA 3AW5A 3O81A 1G87A 5D4IA 5IP4A 4QRPE 3FC8A 3TIDA 4G8EB 3LV3A 4S1DD 1CYXA 1EIBA 2IQAB 5ICXA 2JKIS 1YLBB 3N9GL 1J8RA 1E28A 3HE7B 3I3DA 4G8GD 4M62L 1NDGB 1QNZL 2O5XH 3NIFF 2Q7YB 4DOHB 4PY8I 3GXDA 3T2QA 3QW9A 4ZMQA 5KSBF 2AEQL 3KYNA 1DJWA 3ILEA 3GNMH 5CKGA 2GSIB 3BRFA 4HEPA 4IBVA 3MBWA 3NEXA 1HJBC 1IBZA 1L4IA 5E6SB 5BNXD 4N6RB 3JV6B 2Z31D 1AI1L 3UAJC 3L2LA 4P5MB 4I1NB 4NLHA 1A2YB 1X5HA 1S78D 2VWEC 3O6KH 1J1PH 4N25A 3LPGA 3HZYB 4FJYA 3BPCB 1FFRA 4AYEC 5FYLL 4S1QH 3C09B 3S37X 3VQ2C 2EDQA 1GKEA 4KXBA 4DF9A 1I1RA 3QA3A 4XO5A 3STZA 2BP5M 3M1BA 3MLTA 3AZUA 5E4OA 3CC1A 5DVOA 5CR8A 4NQEE 5LGJA 4XO9A 5SWZE 2ZOLB 4OLZH 3ZHDA 1BBDL 3E80A 4GJTB 4FTVB 2YMOA 1WA0X 3TBVA 3H3BC 5IK3A 1CLOH 5PCYA 4Z7NE 4ZXBA 1UQSA 2CO4A 2EDTA 4WSKA 1JSYA 1UD4A 5LAPA 4KUCD 2VDNB 5DMYA 4P5TB 4L8CA 1HILB 4KZDH 1KOAA 4XBMA 5JYMA 2OMYB 2HT4D 3ZUNC 2CPCA 4MZRA 5GGVY 2VQ1A 5ECGA 1WLHA 3CZUB 4RESB 2VZ3A 4XN9A 2Y6SD 3O6ML 2A77H 4RNRB 5DEFA 4OGAD 5D7EA 3ZDXB 4NQDB 4RMTA 5DI8B 3QJFB 2YK1H 5F6IC 5GZOA 3H7BB 2OL3L 3F7QA 1IEAB 4OB5H 2FR4A 4OGXH 4J2QA 5D1QC 2W07B 4IKIA 3U9UA 2Y5EA 4AGOA 1CFSA 2QVMA 2MCMA 3IGFA 1M05A 3CFCH 2CO7A 2R1XA 2VERA 4PJEB 3SCMA 2A74C 1KIUB 4QJ4B 1WUNT 2GHZA 2ID5A 1NL0H 1UGKA 4FNSA 4QRPB 2JKSA 4ZPVA 5CHNA 1NCIA 5AYTA 3FMGH 3GSWB 5I24A 4NKMA 1CZ8L 1C1EL 4P3CL 1HWHB 4HJJL 3UOAB 4WW2F 4KJWD 2WLJA 4FAAB 1FG2A 2AV1A 2UZYB 4PB0L 1BVLA 4PJ8A 4BELD 4W9CC 5I23A 4QXWA 5K93A 4F3FB 3OAZK 3HI1B 5EUKB 4RIRA 5CMAB 2BX5A 3E38A 4CSPA 1T2XA 2H2SC 3IE4A 4TUOB 1TFPA 4LOEA 4P59H 3AACA 1CICD 4UM8A 4Y7OC 3KEDA 1OOWA 1IGML 3TO2B 4HDIB 5HDQL 1NMBL 5H2BA 1C08A 3HC3L 1SN0A 3DGGA 2CIIA 2AEIT 4DAGL 4LVNC 4UNUA 3R0NA 1KPRA 2PR9A 1XTLA 4HCRH 4I48B 2J8UF 2XTJD 4QHMB 4FXGA 5L2KE 2B1AH 4HUUA 2ORBL 1JWMB 5F89A 3TONA 1R5WA 4IBYA 3U0WL 1DBAL 1FNGB 1NGQH 2CBOA 4JDVB 4NQEB 5SWZB 4AG4H 3P73A 5F3HB 5EIVA 12E8H 2K0RA 2BS71 4YZFE 4ELME 3MJWA 4M1CC 4Y9BA 3S6CA 2BHFA 5D7JC 3V5DA 1ESOA 1V5JA 3IDXL 2B2XH 3H53A 4JR9H 4KY1L 2D03L 5DD1L 1F90L 2X4TA 4DKTA 3NJKA 4F7CB 3MBED 2FECL 4MAUH 2KKQA 4G83A 3QHZL 4XBPB 3FF7A 1FORH 1TYEB 1G7HA 4GBXA 1YEHH 3HS0C 4TSCL 3ES6A 5B8CC 4JKLA 5DMJB 4U1NB 5C0GB 4ALAH 2FJHB 1B0GB 4ZW5A 4GG8A 1NOFA 4XNMB 4XP6H 2R69L 3BLKA 1ND0A 2G5RA 3MA7A 4C58B 4LAQL 5HYSA 5G4MA 2XYCA 4FQLL 4LCCB 2WCGA 3VFOA 4OZIE 2MCPH 4PYHA 3ILQD 1SMAA 1HCYA 4MAYD 3CSPA 5C09B 3V6ZB 4Z7IA 3MRLB 3UMTA 2YUVA 4H1LA 4FZEH 1RD6A 1RZPA 4NN7C 3EBHA 4WNQB 3VXUB 4LRIC 4LASH 2NY2B 5KS9A 3GMMA 2Z6FA 2X2JA 1S7RA 4FFTA 4MWFA 2NPLX 2EKSB 1AH1A 4K2UL 2HWZL 3ME0B 3I75B 1Q0YL 3IN0A 5CCHE 5EU6D 1X4ZA 3EGSA 4GAJH 2ZP8A 4BFNA 1NC4D 4MASA 3CFUA 1GAFH 4NUGH 5HI4D 4HYTB 5ICXB 5CGYD 5L2KB 2NY1C 5C2UB 1HK6A 2KDGA 4JO3L 2EP6A 3ETBJ 4OD2B 3DMMC 3IFPB 2BY1A 1KCWA 1YHPA 3VGDA 5DLLA 2Z8WC 4LLAA 4RH4A 1GOHA 3A6CH 1WTLA 3I74A 3PFQA 3T0DA 4Y4FA 3KYNB 3MBXH 3UEQA 2FD6H 4HT1L 3ULAB 5T3ZE 5AVTB 2JNZA 3UH8A 5I15H 4NJ9L 4ELMB 3MGTA 4N9GA 3IPEA 5AKTA 4FFVC 4NQCE 2AHIA 4JRFA 1IM3B 3QS3A 3SBRA 4KROD 3OD3A 5JYLA 2FLBT 1YY8A 4HIIA 3ZYZA 3I6LE 1DANU 1G6RA 2IBGA 1M7IA 3CFNA 3DVGA 4WKXA 4G5ZH 1PLCA 1FN4A 2FHFA 3HC4L 5CP7B 3U82B 4P5RA 3QA3B 3STZB 4G7YL 4HMEA 3A5VA 1IAKA 1GS7A 1W0WA 4DW2H 3KPRE 4XNDA 4FNPA 4IGBA 5FUCC 2WW8A 2ZXDA 4C4KT 1NOLA 3ARRA 3OKLA 2JXMA 2V9QA 4RAUA 4WVRA 1SHXA 1YMMA 3FTXA 1QEWB 5J11C 1U0QA 5FUZH 4L4TA 3TBVB 3LJ3A 4AQ1A 4AT6B 2B77A 1UQSB 1WIPA 3U7WH 4CW1A 3FUHA 3U7YL 4OZIB 3GHBL 3MZGB 3MRIA 4I3RL 5FO8A 5DURB 3T1WA 4XPFL 5JPNA 5JW4R 2VQ1B 5LWYH 4FEMA 5DD0L 1EPFA 1H6UA 2OJEA 2ZG2A 3POCA 4YK4C 1G9ML 3UJJH 3U9PL 2VSDA 3F5WB 4HEPG 3L08A 1PPIA 5TQ0H 1F56A 1KFGA 1BFVL 4TUKL 2IWKA 4XVOA 2DQJH 5CZVH 5D4QA 4PREA 3U9UB 1M05B 4LIQL 4LCWE 1A14H 1A4JB 1JHKL 3V0EA 1T89A 3QVAA 1U91A 5D2NE 2WO3B 1FVCA 4LCYA 4PJIF 1U3HC 4FTVD 4YPGA 1I9JL 3CLFL 2JKJA 2X6BA 3P9LA 3FPXA 4ZPVB 3MJ8A 3EOBA 4GRLB 2BRRL 4KK8D 3TJEL 4UOJA 1T03L 3T8XB 3EFDH 4OGZA 3VH8A 4P5TD 4ZMXA 3RAJL 1FG2B 4Y1AE 1P7KB 2AV1B 1ZXQA 1ZY9A 2OP4L 4G6KH 5KEZA 1BVLB 4PJ8B 1BAFH 3S35L 4Q58C 3UTPE 1KTDA 4QHKJ 2O6EA 3OPZL 5CGBA 4BA8A 2GT9A 3ARDB 5FLUA 4LQFL 1MHEB 1SLWA 3BUYA 4ZAKB 4ZMVA 3CHOA 4KOBA 4UM8B 4FLSA 2OMUA 1DBBH 4ONFH 3QUKB 5F1KC 4KBPA 3AABA 4TRPH 5H2BB 1VLXA 4HUMB 4HIXL 3DGGB 2CIIB 4NQCB 2X28A 4CKVX 1FH5H 5BV7H 4AYGA 4H8WC 4S11A 4E41D 3UDWC 1UCBL 3EHBB 4FXGB 5F9WB 4MMZA 2AEPH 3X14B 3BPNC 1JHLL 1WCQA 1WS8A 4S0HA 1BVOA 4NDMB 4UQDA 1FYTE 1R5WB 1MCFA 4N90E 4GPVA 4Z0XB 3G5ZA 4YXHH 5HBBA 2K4WA 1EO8H 1JNNH 4ACPA 2CJ3A 4A67A 4HPOH 3WEXA 4QRFA 1ROCA 1CL7H 4KDTC 4ZNEA 2YMXH 4OCXL 4YQXH 1W0VB 3D30A 2OYKA 2F2HA 3AG1B 4H88L 2MH4A 2B14A 3CZEA 1K3ZA 1WAAF 2X4TB 2LVEA 3CQPA 3FK3A 2EH8H 3ARFA 4WJ5B 2WTOA 3WDIA 1BZ9A 2YSTA 2D73A 4GBXB 3UROR 3KAAA 4NQSA 5JIHA 5EEVA 4WWKB 1MCKA 4KTYA 1M42A 3BOVA 3WFHB 4LU5H 4MD0B 1LO5B 5SV3A 5AFAA 3MTXA 2WPGA 3IDIA 3BFOA 3JZ7A 2E0PA 1BXAA 3V9CA 4NQED 3WHXA 3WMPA 5I8CA 5SWZD 1FFQA 1WD9A 3MA7B 5GZND 3SHSA 1TENA 3FQRA 3GBNL 5D2NB 3VFOB 2KZWA 8FABA 4LEXL 4G7QB 2R0WH 4ZFZA 5L6YH 1TQBB 1OAKL 4XPTL 1FFOA 3DKHA 2CDGB 4H1LB 3L4XA 3MU3A 2IPUK 3H6AA 3BP7B 3BSZH 4GQQA 1P84K 4Y1AB 4XO3A 4WUUA 2WUCH 5D8JH 4PBVC 1G7PA 1SOSA 4JAMA 2Q8AL 3S34L 3WMQA 3ZVVA 5LCVA 3NIGF 2KERA 1CU4L 3OF6D 4MWFB 1GJUA 4U0QB 4HU2A 1HKLH 1NCNA 2BSBA 3B3BA 2F5AL 4B50A 1DQDH 2CBMA 4NFCA 1AFVL 4EJ1C 5FDWB 2E9GA 3Q05A 1MLCA 5GRYA 4PN6A 1V54B 1L9SA 4OTXH 2J6WA 4GW1A 3VE0A 2YPVL 1WFJA 1H3UA 3RL2B 4N2HA 2HKFH 1X9LA 3FH5A 4GT7A 4JO4H 3VMNA 2GJPA 5C09D 2QPDB 1W2KT 3CJJA 4PLJC 2WXPA 4XNYH 2I9TA 4P5SA 5IVXA 1FYTB 4YFEA 3JZYA 2WN3A 1CFNB 3SOBH 3DBSA 3B9VA 1MFNA 1QATA 3VXUD 4MB1A 2R0KL 1T21B 5HYSG 4CVWA 1CXHA 3B9EA 4PFEA 4P2RA 4E9TA 3JWDL 4OH2A 3TNNA 4P9HL 2EVGA 4UINH 4DJMA 5CN2A 1W6WA 2DAVA 1MI5E 3LN4B 3ZDZF 4GINA 1X9UA 2CALA 4H1LG 3KW8A 4OLXH 4DTGH 5HTSA 3KLDA 3WCYA 1XH1A 5TFSL 4UANA 1YY8B 3GS7A 1SHWA 1HEHC 1G6RB 1PW3A 3DVGB 1QI5A 3O0RH 4AEIL 1U6AL 1FN4B 4U3CA 2X12A 4YDLB 3ESMA 1AZCA 4HWZB 5DJAA 4OGQC 5I18H 5C9JB 1IAKB 3HNVL 3QJXA 4CKQA 1BG9A 1CVSC 2Y0SA 3LZFH 1SDAB 3OKLB 4U1KA 3ZHFA 4RAUB 4DVBA 1YMMB 4ZS6C 1X5AA 3OAUL 4PRAA 3S35X 4K5PA 4DQOL 4WKZA 2OZ4H 1JZ5A 3HNSL 1OF2A 4AQ8A 2HJFA 2C3XA 6CGTA 5F7UA 4LLDB 5FO8B 2LV4A 5F3BA 5K69A 2NY0B 5DQDL 3CLWA 3VQ1C 1KB5L 4DKEH 4PU2A 2OJEB 3SKNB 4K9EH 3BFQG 3DV4A 2FX7H 5D5MF 1VFBA 1J5OH 4PLNC 3H42H 1BEYH 1ZHKA 3FQXA 4X6CF 3HJEA 1NCCL 3QUXA 4NHUA 1TQVA 1T7XA 2EH7H 1XGRA 2YXVA 1HTYA 2H6UA 2WXGA 1KTKE 5JORB 4DKDC 3UYOD 2IV8A 5J57B 1BYNA 5F1NB 3BH8A 5I74C 4YC2B 2CKBL 1ZANL 4L1DA 1FVCB 5IVZB 4U7MA 4WI4A 2VLLA 3P9LB 4Y4HC 5FYKL 3ZMEA 1TZ8A 3NIDF 4D9RE 1BBJA 5T33H 4S2SA 5D1XC 1U58A 4JANA 1UM4H 3F7KA 3VH8B 3SIKA 4AV5A 4R6UA 5EBWB 5A2IH 1M2VA 5DURD 4UTAH 3T09A 4JQVA 2G5BB 4V2BA 3SQOH 5H94A 5E4IA 1KTDB 3BZEA 4X5XB 4JM4H 1T6VN 4L8DB 1F4AA 1WT5A 4GUPA 4OF7A 4Z3IA 4RGNC 3CCHB 3QG7L 4ZFGL 1ZLUH 3BUYB 5GZOD 1OAQH 1MWAB 3K91A 4FQIH 4NRXA 5CJ8A 1KTLA 3S3SA 2Z0BA 4PJDF 3W0WA 3VG0H 5K9QI 1FNFA 5I8OH 4LHQB 2AXFB 3QFDA 5DGQA 4I13B 4WI0A 3MXVH 4GRLD 5AAMC 2G75A 2DY2A 2O6DA 2BNRA 2HVJA 2LABA 5J4MA 5IVXE 1XR9B 2NT1A 3OMNB 3KLHD 3BI9X 3MKGA 5D6CB 1MREH 3Q9PA 4Z3EA 4PJ8D 2G2RB 5FHAL 3SPIA 4P2OC 5IT2L 1QO3B 2I60H 1C5CL 3SYPA 3VXPB 1KBGL 1O6SA 5K9QG 1FLRL 4I89A 2CHXA 3H2QA 1ZVYA 4XC3L 4HIQA 3RX7A 3BAKA 1TKWA 3LZLA 1MCPL 1LEGA 5T3ZD 3K6SB 3VH8G 3ZO0A 5LKNA 3KYKH 1K85A 3V0HA 5A6LA 1SUJA 4NQCD 4EOWH 1RHHB 1IBHA 4S1SH 2EVIA 1ZTXE 3LEVH 1LK3H 1RFDH 1BZ9B 1KCBA 1AGEB 3GINA 4G43A 3EHBD 5E6UB 4URTB 4YDIH 3I6LD 4PJCF 1N12A 1ED3A 1B4TA 3GRWL 3K4AA 3MO1A 1V3MA 4GIOA 5J6GB 5D6DA 4X9YA 4PJHA 4GAYB 4L3EA 2X1WL 5I9QB 2XN1A 3F01A 4X8CA 5CEZD 1TDQA 3MCKB 5E6YA 2HPOA 3MRNB 2ATAA 1GZHA 4WW1B 5AW5B 1AQKL 4W4OC 1PZSA 1II4E 4DP0X 3WEAA 4OU3A 5JR1L 4WUUB 2BNQA 1ORSA 1WC7B 4Y16C 2G5UA 4AEEA 4WTZA 1G7PB 3RJOA 1DEDA 1OLZA 2YQ3A 3E6FB 4JAMB 1PZAA 2NXYC 4JPQA 4GBXD 2BC4B 2JCCF 4CU6A 2RR3A 3LNGA 2YEZB 3CH1A 2DQIH 1ZEAH 5CUSL 1VESA 2LTQC 1C7SA 5C2BL 5C08A 3S88H 4LOUC 2FCBA 4PJAF 4UOQA 3K8LA 4ISVB 4B9GA 3VE0B 3D8MA 4GW1B 4PJBF 1C5DA 4OLYL 1YECL 3QCVL 2FK9A 2JWYA 4N0CD 4NNYA 4ZTEA 2OMXB 4AVHA 43C9A 5D7KE 1EHLH 4YMPA 2ENJA 2Y1YA 5IVXB 5JXAL 1C5BL 5DWPA 3EADA 2OA9A 3RWDA 5KVGL 2BW4A 4IRZH 1K9TA 1UACH 4O00A 3T8VA 3LYRA 1P84J 1OT1A 2ROYA 2OMNA 4PRPE 3VO0A 4DPAX 4KRPC 4RISL 5BZWA 3V0WH 2VDKB 1NC2A 5C0CA 4P2RB 4HCGA 3V10A 3TNNB 4BZ2H 2Y1AA 1VGKB 4ONHA 4JFEA 1A7QH 1PZ5A 3GLEA 1MEXL 3VGGA 1QHPA 3TURA 1EJ6A 3F7VA 2ZIDA 4PJ6A 4X4XA 1IARB 3D25A 5DJAB 1WITA 3VFPB 3C8KB 3QEUA 4BQ6A 3TJHC 2K78A 5BV7C 4NGHL 5I71B 3ATEA 1CGSH 1NGZA 1ZLVK 3GUTA 4G8FA 4R7VA 1FYTD 2FL5A 1F3DJ 4H2CA 4N90D 4XWOD 5DRXB 4DFHA 2XY2A 3MNWB 4X6DE 3RGHA 4PRAB 4Y4FD 4EI6B 4JJ5A 3AS3A 4WKZB 3GXUB 1WVZA 1OAUH 5EN2B 2X2YA 1OF2B 1KCKA 5IQNA 5DVNA 2HJFB 2VXQL 3HUJE 5I6KA 6FABH 3V0AC 3D50A 2ADGA 1X44A 5FKAA 3LKPA 5DZ9A 2F74B 4L5FH 1RUAH 3ATDA 4H8UA 1WZ1H 5J6HA 2K3HA 1UH4A 1VFBB 1L7IH 3TA3A 1UA3A 3UYRL 1ZHKB 3ABLB 4Y2DC 4ZX4A 4WEEA 5FFGA 3QFJA 4G6FD 2WLIA 2W9EL 1I1FA 3QUXB 4NHUB 4B97A 5DS8B 1TJMA 4GSQA 4LSSL 5CR1A 1XF2A 4IGBD 2ZICA 2JIXB 3MVSA 4MKMA 5F7DB 3IBOA 1HN1A 3WU1A 1YMMD 4OQTH 3U2SA 3QUZA 3IDNA 3ZZSA 5TDNB 3VFTA 4L4TD 2VLLB 2KI6A 1NGXA 4HX1A 4JHUA 1I8MA 1BBJB 1IFHH 3MROA 4HBQA 4MNGA 2IANA 3RWEB 2X4UA 1TTFA 1U58B 3BHBA 2AI0H 5IG7B 3J27A 4I0CC 1KIRA 4MMXA 1RH8A 4ZDHA 2YPKB 3KWTA 2OXHA 2NY0D 4ATWA 4JY5H 4KAQH 4NP9A 5H94B 1KEMH 4F27A 4KV5F 3BZEB 3LVTA 5DFAA 3HS8A 5F0MB 4M93B 2L7QA 1IRAY 4PRPB 2H1PL 2SODB 3L6FB 2MFNA 2BK8A 1MCSA 4JJHA 3I6KA 3MGAA 3AY4C 4L8BA 4WDIA 3N43B 1QFUL 2QSVA 3VXRE 2Y7QA 3F00A 5JZ7C 2Z93B 3QFDB 4NWTL 5AAPA 3K5SA 5LXGH 1MQ8A 1UKSA 5IB4B 2OR8A 4I0PA 3HZMB 5KSBA 3D06A 1ADQL 1DBJH 5DJ0A 4K3DH 2BNRB 2HVJB 2WKLA 3QUYC 2O61A 1UT1A 4QWWD 1J9QA 2W0FA 1WEJL 1FL6A 4NQVA 2QGCA 2DM2A 3P11L 1Z6JT 3NT0A 3IPBA 1QNIA 2YR3A 4W9ZA 2CDFB 2FGWL 3SD5A 4HGWB 1EEUA 3L7EB 1G84A 1FQ9C 1FIGH 1O6SB 2EIMB 4JGUA 3I84A 2DQUH 4X6DB 1MRCL 4GRWH 1R24A 4H2AA 4BZ1H 4KVPA 5FYLE 3AREB 1DUYA 1NBYA 3D85A 5IB3A 3OKEA 1CDCA 1CXEA 1YNKL 3LZOA 4K3JH 1DTUA 1JVKA 4KJQC 4TOYL 3VFRA 3GXPA 4HUVB 3WIIL 3TWCL 1H15B 2DMHA 3HC0A 4G43B 4FLHA 3R0MA 2M2DA 1FIEA 5TF1H 2WMPA 4FI6A 5F1OB 2A7BA 3CSTA 3U0PA 1INDH 3A47A 3BUIA 4FS0A 2BXYA 3GMNA 4ICWA 2WVUA 5TE4L 3LIZH 4GQRA 1GJIA 4JBSA 2F7RA 2OQJA 2F1AA 4UTCA 3ARBA 1AG6A 5HHVH 4D7PA 4PHXA 4NAMA 3QNZA 2BIPA 1T4WA 1KJ2L 3L1GA 3CGTA 4E0RB 3P4OB 1AC0A 3PL6C 1BJ1J 1KJMB 4WFHE 1YUKB 3UC2A 3FO1A 1L9PA 5CIPA 3OBAA 5CO1A 5ACMA 4RZCB 4IHBA 3WJLA 4K9EC 2COQA 3DXAA 2OTPA 5GS2D 4ZFFA 4WW2A 5C08B 2IBZY 1KF9B 1LO4L 2A99A 4ODTH 3VXRB 2FUQA 5J7CC 2YUWA 5KVFL 2ATKB 3AXLB 3T6XA 4BGLA 2JKRM 1KBBA 1RZIB 1I8KA 1MXGA 1JF6A 1F58L 1RVFL 5MERB 2A1WL 1SJEB 3HTLX 4K5LA 4WFFD 1TPXC 4L1HA 5BW7A 43C9B 5IEKB 5A16A 1OAYL 2M26A 1J9RA 3KPTA 2ITEA 2R9HC 1UWEH 5HSFA 3U7AA 4K8RL 2R23A 1PKQA 1BZ7A 1Q9LB 3D69A 4WUUD 2YFOA 5J1AB 3KH4A 1RZKH 2IOOA 3QO0B 3V0VA 3DJSA 5BZWB 2ZNWA 4Q6YA 2J8UA 3CFEA 2HRGA 1I9IL 4Q9BA 5C0CB 3WFZA 4A7QA 2HTLD 1FO0H 5FKPA 1LNUA 4IKLA 3PWJA 3A4FA 3NP3A 5AVQB 2YPLA 5EU4A 1BJMA 3ZT7A 1NPJA 3PABB 1N26A 1XGPA 1ACYL 4HS3B 4TQPA 2FSEA 3RX5A 4Z23A 3BT0A 2DD8L 4WTZG 4QRTA 3GSNA 5I1KH 4X4XB 3QUMH 2E7LC 4O5LL 5EOTA 1AXTL 2GAZA 1Y7VA 3WNNA 1I7RA 3INUL 1SXBA 4LGRB 4HCFA 3GUTB 4G8FB 5ALBL 1QPKA 3EYQC 4OD1H 4GEJA 3T2LA 1V27A 4K3EL 3TM6A 3QS2A 3OAYK 4NI3A 4QYAA 1HNYA 1YMHA 2Z7UA 2W65A 2P5PA 3DROA 5MI0C 5GS1C 1VAHA 1LQBC 3MLXH 4P2RD 5JHAA 5E8EA 2ADGB 2VAAB 3NPSB 3IEAA 3MRDA 1JDCA 1E8YA 3RVXD 4KVNH 3VXSA 1EXUA 3FN0L 2IXQA 4N22A 5J6HB 2OL3B 2K7PA 3ZE0F 4NC0B 1G7IB 3TA3B 5GIRA 5DMGC 3AS1A 2YSSA 2AERT 1XAUA 2X1XR 3QFJB 1A64A 5CM1A 3HAEA 4N8VA 3EJYC 5E70A 1XGUA 3IDYB 3C5SA 2P8LB 5ESQB 4FQXA 5F97E 1RZFH 3ECWA 4OCWL 3VFTB 3M17A 1U2HA 5E5UB 4HS6B 4HX1B 1A6WH 3B3IA 1BM3H 2AXHA 5K9OB 4MNGB 3FDWA 3K0YA 4UU9B 5EWIH 4C4UA 4M48L 4OCYL 4AZUA 2HLAA 3ZL1A 4H26B 4TLUA 2OXHB 3KYMA 4NI6A 2MQGA 3KM1A 2C5DC 4N2IA 1EJ8A 1A7OL 2W38A 3F3HA 2F61A 3QR0A 1T0NB 2V3EA 5DZJA 3QUXD 3Q2NA 5DEGA 2NX5E 1HHIB 3IXTA 4Y4KC 4WHYG 4OZGF 5F7WC 1DQLH 1NDMA 35C8H 3U6XA 1D5ZA 1JXDA 1OP5H 2O61B 4M1DL 2HVKA 1QASA 2JB5H 2VDMH 4NQVB 4QRSA 4BWWA 5BVPL 1G9HA 1BWMA 2C8NA 3TEYA 3PWNB 3HG5A 1Z9PA 2WZPA 3QPKA 2WBKA 1S9WB 4X9IA 4K9JA 2J8UE 1JRHH 3CPLB 3GK8H 3MREA 4PRPD 2XWXA 3DX6A 1OTSD 3POHA 5IESH 4YHPA 4TL5A 1QFOA 2LU3A 3KWXA 3L3IA 2WLMA 4MXQD 4AVIA 4ZI8A 3QRBA 1NBYB 4J3SA 3VVWA 3W0WD 3DX0A 2ZWNA 4O9HH 3S36L 3VFRB 2O5XL 3KS0H 3RZCC 2EECA 3FB8B 5JQHC 3MYZA 4TNEA 4KHTL 1TJIH 4X83A 1YCSA 2X10A 2BNRD 3GZQA 1JG9A 4G42A 3U0PB 2R8SH 1G43A 1HSAA 2VZTA 3SKJL 2R1WB 5HD8C 1QWHA 1OQOA 4TNVF 4IBZA 1DBML 3PE9A 2R29H 3GMNB 4MCMA 3VFWB 1JGLH 2A9NL 1AQMA 2WKOA 1FRGH 3ARBB 3H9YA 5B38B 5H37A 4S1QL 1FFPB 3QORC 3QNZB 3CC5A 4M6NH 5E94B 3VD5A 1FV1A 1P5VA 4WRLA 3ARED 4LHUG 5FIEA 1X9QA 1FVDA 3G9VA 1JZ4A 4MD4A 1JZFA 1UXWA 3FONA 1YQ2A 1RPUA 1KGWA 2VN7A 5C07E 3SY0B 1LE9A 3K6DA 5IW1B 5CIPB 4PJIA 3WJJC 4PJ5A 3EBGA 4FMFA 4LIQE 4W9LC 1IKNA 1CLOL 2F54E 1XV8A 3QI9A 1U3YA 2IGFH 3P4NA 4UTBA 4ATTA 2IAMA 1EAPB 1MXDA 3K80A 1Z3RA 2EIKB 4WW2B 4EN3C 1AVAA 1X7SA 3OLEA 5I1AB 2P46B 4CMMA 3VW3L 1K6QL 3T8MA 4M1GH 3RRQA 2ITFA 1ET8A 5AEAA 3UADA 3SD2A 1JZEA 4NXSA 4L18A 4RSYA 1RLWA 2HPTA 1GYAA 3FT2B 2A77L 1I8KB 4JDTL 2L0DA 1S3KH 2R2BA 2BP0B 3FAXA 2G4EA 3H85A 5EBLA 4ELKA 5DYOA 5A16B 1CUOA 3MYJB 4KZEL 2FH8A 3FHEA 1OT4A 4QEGA 4R97B 2EKJA 2EDKA 3G9AB 5C70A 1QRKA 3TCLA 4JVWA 3VI3F 1KLFB 3OKNB 1I85C 4B53A 4WEBH 3HE6C 3JV5A 4MA1C 3V0VB 3SDDC 1KLGA 2J8UB 1NL0L 3UTTA 3VD4A 3QNXA 3VFGH 4ZYKA 5HHNB 2YGVA 3DX3A 3BUQA 1Q0XH 2K8MA 3O2DL 3JTTA 4FZ8L 1CN4A 4YBQD 1XGPB 3B9KC 1JV2A 3HI5H 4N1CA 5C08D 3FCGA 5JIKA 5IQ7L 1QR1B 5TDOA 3VXRD 3PWVB 4NZRH 4XBEL 3F2LA 3IKKA 4H0HB 1WK0A 4QRTB 4OI8A 1I8LC 1N70A 5E24E 1KC5H 1A4KA 4JPSA 2DQEL 2FEEI 1JXGA 4H13C 4PGBA 1HXMA 3E6HA 2GAZB 4IRSC 4HKXB 2DQCL 5FGBC 1IC5L 2IMNA 3PGCA 4NYLA 5FUOH 5I1EH 3MLPA 4MX7B 3QIBC 1WAAA 2GJRA 3QQDA 5L7XH 3SGKA 3MI6A 1N8ZA 4IK6A 1U8LA 1IBFA 1YMHB 2IFGA 2W65B 3DROB 4XZ4A 2NXZC 5FAAA 1K5WA 3S2AA 4TVPD 5C0CD 2B1AL 3KW7A 5DJDA 3RZWA 3ILPB 3UJIL 4B9JA 2WANA 4JFED 2B0SH 3T2PA 2CJSA 3CMOH 5FYLD 1B4LA 2BVQA 3VXSB 1A1NB 4ZODA 1GIGH 4X80H 4WI5A 2DM4A 3RDTC 4QAMB 2E4FA 1XXFC 3HHRB 5GIRB 2DJUA 4NUJB 5FHBH 5C07B 2YSSB 4OCLC 2R0LH 1JF1B 4OZHF 2I9LA 3HAEB 4N8VB 3FCSA 4NN5C 2VL5A 3OHXC 4XN5A 3X1BA 3BWAB 1E2VA 3G5WA 3BDYL 4UOW1 3IKCA 1XEDA 5DHXB 4FQXB 4X7DC 3RVWD 3S3PA 4RA0C 2EXTA 2YA0A 2MCAA 4F33B 1SXZA 1T66C 3M17B 3B3IB 1YEHL 4LSRL 3TVMA 1JP5A 1E5ZA 2VRQA 3ARGB 1IGIH 1JGIA 5AAWC 4MFHA 5I1HL 3FSAA 4YDMA 5ACZB 4OV5A 1A4BA 1MF2L 2VM4A 1CE6A 4LEOA 2ETWA 3ALXA 3VU2A 4ODSH 4PJ5E 2YUXA 4YSEA 3TA3D 2Q9OA 3S36X 4WFHD 2DQMA 4XCNA 1ZTMA 5JHLA 3N41B 4N0RA 3QFJD 5KANI 3QT2A 2NY4B 2OJ1A 5C7XL 2TRHA 3APNA 3BAEH 2OCCB 4PJ9B 5EF0A 5E1QA 1RK7A 1DCLA 3VACA 2BP8A 1ZV2A 5E2UL 3UPRA 3T2OA 4E42A 2NW2B 3N91A 3QUZD 1FL5B 1TMQA 4GW5A 4JFQA 1HL4A 1MH5A 2LVCA 2C3VA 4OD3L 2VB5A 9PCYA 5I30L 4MYPA 1G1YA 2IAND 2LLNA 3TPUA 3HAEG 4N8VG 4HWBL 4FRWA 4CSTA 3O3DA 3ZO9A 3FF8A 4I4WA 3PNWB 5IJCC 1S7SA 5KANG 1LVEA 1A22B 3MZTA 2F08A 4FQ1L 4HA1A 2PETA 3L4TA 1F13A 4TVSa 1G9NH 5I19L 4LP5A 2OMVA 3SB3A 1FNLA 3DX6B 1GAFL 4JQXC 3QCUH 2SEBB 4NUGL 4PBXA 3DBXA 4YHPB 2MEJB 1HHHA 1RZKC 3L3IB 5JW4N 1ODAA 4PV9A 2JMRA 5EA0L 4U49A 1DP0A 5KVDH 1LL1A 2BRQA 3ARVA 5DJ6A 4F2FA 3FQWA 1TZAA 2NQDA 6PCYA 2P47B 2YKLH 1I7TA 4CMHB 1T0MB 5EZLB 2ZE0A 3NSXA 1ZOXA 4P04A 3QIWC 1EMTL 1E9QA 4G42B 2Z8SA 1P5UC 1DBKH 1VPOL 4AZ8A 4Q9QH 2AJVL 1WAAE 3GLZA 3O2VH 1GHFH 4UI2A 1ODUA 4E9YA 2NR6C 3DHMA 3WSQH 2RQEA 1Q1JL 1V7ML 4KMTL 5D5MA 4R4FL 4ODHL 4M6AA 1Z1WA 2F7PA 4YSUA 4OFKA 1AKJA 4UB0L 4X6CA 2OMZA 4F7EA 3ZSTA 2J71A 1RUMH 1P5VB 5LAXB 1OF0A 4DEPC 1X5YA 3CFKA 3D85D 4GXVH 5J13B 1MQKH 1JPEA 4KKCD 5AVZB 4YSAA 1FVDB 3QXWA 4MD4B 5E2VL 1I1AB 2CMRL 4N2GA 1RURH 1LE9B 5DZPA 1NCUA 4JPVH 5FUZL 4BWTA 1NZRA 4PJ5B 2DLFL 5FYJU 3S98A 3QJHB 3TYFB 1A9BA 1RJYA 1E4KC 1RIVL 4J8QA 1VDGA 2K70A 2XWRA 9CGTA 4EZKA 2WKGA 4GI9A 1R3HA 5DJ8A 5FYKE 4LO9A 1O5DT 2CWRA 2XVKA 4CVZA 4MD5A 2H0EA 5E6IA 1ACXA 2A6DA 3ARBD 3NIGE 3LH9A 4WI6A 4JE0A 2R2BB 3DURA 2Q86B 1CLYL 4NP4H 5KUKA 3CHSA 1M71A 4N2AA 1N6UA 5CZVL 1I9RH 1AS8A 2HB0A 2XNAA 3CVDA 4U6VH 3D3VE 2ITCA 4LMQI 4LSVH 1BPVA 2QQNH 5D1ZB 2CJUL 4I88A 4BE5A 3UTTB 3GI8H 1OZTG 2P1YA 4TULH 4MVBC 4GUOA 3DXAD 3EFDL 3V4LA 4DESA 2NDFA 5TDOB 1OSPH 2ICEC 3A67L 3C5XA 1SBSH 1HQ4A 4OM1L 3UAJA 3WUWB 4LCUA 5C0RL 2J88H 2J7LA 5EO1A 5EEUA 1OY3B 4NOBA 1WE5A 1Z9NA 4FQ2L 5JW5A 5IM7A 4MB4A 1L6PA 3E6HB 3L5IA 2X2IA 3T3PF 2A0LD 4L37A 1MCIA 1MFCH 2ZSVB 4HBCH 4LDOB 5TE6H 2BOBB 1E27A 3W11C 2DLEA 3QQDB 1WUZA 1KCUH 1U8MB 2EDMA 1N8ZB 4YN3A 2QKIC 1A7NL 1YJDL 3QNYA 1D9KB 1AGDB 1QW9A 2W91A 5AOLA 3QEHB 3RB5A 4CJ0A 4Z3HA 3EYVB 1SZNA 3FRPA 3MLRH 1KGCE 4PJCA 1KB5B 3O3UN 4CADA 5SWQA 5GSVA 1WFOA 5EBMA 1O9WA 3IYLW 1IQWH 1G94A 3FNKA 1KULA 1GZQB 3PGDA 3E8UH 4MJIA 2I85A 3D0LA 5TE7H 2QV4A 5I1CH 5LGHH 3O9WB 1NCAL 1DVYA 4XVSL 1AGCA 5I6MA 1JPSH 2RHEA 2OTUB 2I9LB 4EN2A 3FCSB 4YHMH 2NNXA 1HDMA 2VLRE 3DYPA 2BY2A 1TJXA 1WCBA 2CKBB 2EE2A 1I31A 4FNLH 4FFZH 1FNEB 5EO9A 5KBPA 3FO0H 5D1QA 2AGJH 4JKPH 4M8VA 3MCLL 4GAAA 5DHVA 3JVFC 2A74A 2UZXA 7FABH 3IB4A 2AXGA 2APFA 2JCCA 1J1XH 3NIGB 2Z35A 4D3CL 3GMQA 2WZ5A 3Q2WA 5FYJL 5GS0H 4LU5L 3SZKC 1TO4A 4AUYA 4AIEA 4HF5H 4R7NB 2WUBL 3CIAA 3P02A 3PWLA 1MPAL 3VXSD 4LEOB 4PJAA 1OD9A 5JIPA 3D3VB 1KACB 3CK0H 4M6OL 4PJBA 3A3YB 3NIDE 4U6XB 5C07D 4G5AA 3E2HB 4AH2A 1SLXA 3AAZA 3NFSH 2F8VA 2QDWA 3ABGA 3BT2L 1XIWC 4NZ8A 5L4MA 3WKMH 3KPLA 5C0FA 1A3QA 2RTTA 2BP8B 3BSZL 4FQXD 3UPRB 1JVLA 3GMLA 4GEIA 3BGAA 1ADQA 1TQWA 4XCFL 2X05A 2C3VB 3B7TA 2DEYX 2ZUQB 3T0EC 3CN2A 1CIDA 4AIZB 1MJUH 1NLBH 5KVGE 5BCAA 4GOSA 4Z77A 3ISRA 3BH4A 3BVDB 1DUZB 4PJDE 3CZKA 3NCXA 3Q9QA 3U48A 5FGSA 4N0YL 2B8OT 3VXME 3CNKA 3GB7A 5AD0A 4FNTA 3QEGL 1KCSL 2C9VA 3G5YA 4OTXL 1L6XA 2OI9C 4PJFE 3BEVA 1NWPA 2XG4B 3L48A 3OVUB 4YXLL 4P9ML 1JERA 2VDLH 7TAAA 3DBXB 3T4AB 2NW3B 5CINL 1CFVL 5J0BA 3L5WB 2AJUL 1A6UH 4J7RA 3C9NA 5C92A 3QUHA 2OK0L 3DX8A 5D7JA 5DJ6B 5T5FA 3RU8H 3U46A 4BSVA 4QJ5B 4Z78A 2BIQA 3SOBL 4PWFA 4NPYB 5DD3L 5B22A 1AMYA 1AO7A 3EYSL 1ZHNB 4GP4B 4PRNB 1FH2A 4V1DE 1EHKB 4LLMA 3HS0A 4FDWA 4AZ8B 5B8CA 1KJVA 1BAGA 2XQBH 2VLRB 4JZJC 5F7EL 2WZPD 3NDZE 4YHKL 3KDPB 3S48A 2FE0A 3IFNH 4UQBA 5K1JA 4N5EC 4F8PA 1AZRA 4E9XA 4I7ZC 5D5MB 2XKNA 4KKLC 2PTVA 3FQUB 1YEJL 1Q9WA 2XTSA 3PDDA 1WFUA 2XN9A 4H8PA 1R0AL 1Z32X 2DLGA 4WCYH 4BFFA 5I18L 5EEZA 2QTEA 1D7FA 3MRCA 5ID0A 4NNXB 3LZFL 4EBQH 1ROWA 3WIHA 1DJSA 1MWOA 1GGIH 5CEYB 4U1GC 5D2LF 1XF3B 4JLRB 4LRIA 3QPXL 3NIDB 2EXYD 3GI9H 4GQPH 3MACL 3MV7E 4XHJD 5DRNB 5IKCA 4G9DB 2ZG3A 5D1QE 3ECBB 5CAYB 5DJ8B 2KMWA 1QRNE 1H5BC 4Z7QF 1FNSH 2XICA 4Y0GA 1ORQA 1KXQA 4MD5B 4HXAL 3P2TA 5DS1A 1AOHA 1RUKL 2JCCE 2A6DB 5AUMB 1KDIA 1RULH 1I3VA 1A1MB 2XT1B 1LJMA 4PI2A 3DURB 5KSVA 1W72L 1M71B 1E5UI 3M1CA 2EH7L 3DRTA 4RGOH 3H9ZA 4PJDB 1KCVL 5IWLC 3KJ4C 3BPLB 1GSKA 3TWYA 3DMMA 1I1AD 2BS9A 3VXMB 1XO8A 4OFVA 5F7KC 5CJOH 3LKRA 4Y9CA 1Z66A 3C2SA 1AIZA 4PJ5D 1FP5A 4U6TA 3W82A 4PJFB 3OX8B 5ERWB 4AL8H 2PN5A 5KBMA 2JSFA 1R3KB 3UTQA 2IAMD 4HHAA 4UTAL 3EXJA 1ZT4A 5CILL 4NQXA 4XTRD 5HXMA 1OANA 2O6CA 4LCUB 5HDWA 1JPTH 1IIKA 4BFBD 1KELH 3I9AA 5JW5B 3U79A 3CUPA 2EVFA 3WEMA 1S8DB 4HHGA 2HG5A 2J1YA 4L37B 1LLAA 2J6EL 5HVHC 4ZJ9A 4V1DB 4QI3A 2E9WA 1DL7L 5IB5B 5LBSL 1N10A 1OEZW 2HKHH 4WF7A 3F83A 3U1PA 3QNYB 1BCIA 1UM5L 3OWEA 2Q20A 2YKKA 4YIQB 5C8JB 1O9VA 3UTTD 1JNLH 2H5UA 4PJCB 3CZFA 1VRSA 3BAJA 4CADB 2DPKA 4PY7B 2G3XA 1G9NC 5E8NA 1NSNH 4XWGL 1TJGH 4KPHL 2UWEF 1R9FA 1ZLUK 2AABH 3IDJA 3O3EA 3PGDB 4KX7A 1Q94B 3WIAA 3D0LB 4X4YA 3SO3B 4MS8C 2I60L 1KNOB 2IGLA 2VE6B 1MIEH 4QAWA 3UBGA 4TTDC 3SDYH 1AGCB 4UWQB 3FTGA 4G9FA 2Z3FA 5IB2A 5F6IB 1U4FA 3G08B 3O8XC 3UBXB 5LDUA 1QUPA 3LIUA 1RZQA 4YHNA 3GSXB 5D1QB 4YL4A 1XF2B 5EEXA 4LNVA 5BZDB 2IDFA 1QRNB 4Q9RL 3NCJL 2NCMA 5DHVB 4ZUTB 5DHDA 5BRZA 1YNTF 4KU1A 3QYNA 2AQSA 4W6XB 3GQFA 5A7BA 2JCCB 2Z35B 4BGDA 1U3HA 1BYOA 5EB9A 1IQDA 2FO8A 3H0TB 4R8WL 1P4IH 4C57C 4GQ9L 3PWLB 3IETA 3PAYA 1U8JB 4J6RH 4R26H 1U8QB 4X8XA 1K5NB 4LEBA 1H8NA 2LGNA 2IFFH 1X5MA 4LBEB 5EN3A 2B3IA 1HHGA 3WNPA 2HUHA 2CK0H 2DF3A 4WGWB 4NSKA 4PJBB 3TA4D 5ITBL 1RLBA 3BQUC 3FSVA 2VLJE 3K6NA 4AH2B 3JWNE 1EGJH 2H9GB 3FUKA 3MFFA 1DN2A 5KVFE 4XO8A 3FRPG 4FQQA 3PP3H 1ETA1 5FV2A 1Q9OB 1A4CA 2WHVA 4J28A 1ZLWK 3ZKMC 5DUPL 1UXSA 5FYKD 1DVFC 2V3DA 3FBQA 1SLUA 1CFQA 1HEZA 3S8WA 1SVCP 1FA4A 3BZ4A 3GJFH 3HW7A 4CVUA 4OY9A 3TL5A 2E46A 4G6AD 3MLYH 3UDWA 2BFVL 3NQIA 1REIA 4IMLA 1HZHH 1QFWI 4R84A 2Y06L 3I2CH 3MOBH 4PEEA 2EXWD 3GB7B 5AD0B 5E2TH 3AC0A 2R2HA 1HS6A 4LP4A 1QFHA 5B7FA 2IPTH 1M2OA 3BEVB 2QSQA 4P2QE 5JTWA 5D72H 1JPFA 4KDTA 4ZPTB 5GGUB 4HK3N 1S7WA 2NNRA 3QG6A 3BJ91 1EEYB 1URLA 3C9NB 3DX8B 5D7JB 1VGEL 1U8PA 4F24A 3UIZA 4X9HA 3U46B 5FB8A 3NCBB 4Z78B 2QQLL 3O3BB 4GFTB 4F8LA 5DYFA 3Q7JA 1AO7B 1DHKA 1SEBA 3APCA 1JMXA 5HHQA 1C16B 3ESVF 3Q1EA 4LLMB 2N7SA 1C12A 3VRJA 3GXMA 1B3JA 1KUMA 1SYSB 1UUSA 1A02N 1A7QL 3MX0A 3QJOA 4GRWF 2XVBA 5DC9B 1YRKA 2OW7A 2VXVH 1ULVA 2WK2A 3FCUB 5DMKA 5HVGB 1KJ2B 5K9JL 4X0KA 1U92A 2GY7B 3L3DA 1A3RL 4X4ZA 2CUIA 1JWSB 5IQ9A 3WEBA 4M7JL 3JQOB 1ETJA 3GSVA 3VFVB 3IJHB 1BLIA 3ARTA 2IDTA 4JHZA 3CDYA 3IAQA 5FO9B 4ETQA 5ID0B 5L8KB 1Q9KA 5A2BA 1PLGH 2EO1A 4QYOB 4NN7B 1TZIB 2WYZA 4GW4B 3VXNA 4PGJA 2VLKA 3FHAA 2HX7A 2OSXA 2VLJB 4M61A 1TVBA 1KFAH 1Z5HA 5IKCB 1OGAA 5SX4I 1OPGH 3FOMA 5IREA 3IMSA 1DVSA 3D0VA 3PPSA 5IVNA 3LY6A 4X98B 4JHVA 3GJEB 2XA8H 1AGFA 3KYOA 4KTDH 3DPBB 1HAWA 4ODVL 3BMVA 1WZ1L 1MVUB 2LLLA 2XWBA 1OE3A 2CGRH 1R6VA 4A7GF 4D9LH 3DX7A 5KYUA 4TTGA 1AKJD 4OGYH 5JQ6L 5KSVB 2HJLB 3QXTA 4JPIA 2UXTA 3DRTB 5CGTA 1WISA 4BUHA 2YA2A 1LHZA 2YRZA 3L7FA 4W70A 4E9QA 4N2OA 1QSVA 1TITA 5GS0C 4OQTL 2EDRA 4XPAH 1HOCB 1EXHA 2WCPA 3FW6A 4GRMA 2WLZA 3CXHJ 3UTQB 3KM2A 4KVCH 4NKIL 4A2DA 1B9ZA 4LVOC 2VDQB 3IPFA 3MV8A 1ZT4B 4NQXB 5HJDA 4KAQL 4HAFA 4RWHA 1GC1H 1EHAA 5D7LA 3I50H 5FXCH 5MP6L 3EBAA 3BXNB 4CU7A 5GRXG 4FG0A 4AGPA 2XPYA 2VNCA 3C2AH 1DJGA 2HG5B 4J3BA 4QXUH 2EDHA 1BFOA 5E4EC 5M94B 5HYFA 3P0VL 1YYML 5F6HJ 3BC9A 4GO9A 3LQZA 3UXFA 2H6PA 3QZMA 4HCRA 3ISYA 3FB6A 2X9ZA 2CBTA 1EZVY 4BJLA 5C0AA 1FDLH 4B3VA 4KKRA 4F7TA 1J8SA 5J11B 4N1EA 2NY5L 1DBJL 4DSYA 5HHME 3BP6A 3BH9B 3CZFB 4IEFA 4E9RA 4F1ZA 2VUYA 5E8PA 5E8NB 1RAMA 2AQ2A 2XFGB 5I1LA 4XNBA 3UAJD 2YD4A 2A6JB 3O3EB 1COBA 2YXMA 3QFGA 4ZBJA 4X4YB 1TZHB 4WNSA 3D34A 3LPOA 2BH0A 1N9PA 2DQUL 1VZGA 3D39A 1YYLH 4AKPA 5HVFB 4ZO9A 4PTUA 5IFAH 4RMSA 4BV1A 1NCTA 2BVPA 4YDJA 1AJ7H 3NZ8B 4AUJA 5IB2B 3BW9A 2IVFC 1JTOA 3FQ4A 1QBML 4M5YL 4CRPA 4DO5A 4YHNB 3W38A 3JUZA 5LQBL 3L1OH 1ZHLB 2XWCA 3CZSA 1G0XA 3D09A 1O7VA 1KGYE 4Y19A 2PPCA 2R7EA 1U3HB 2YRLA 4KUCF 1U8KA 4Y4HA 2XZQL 1QLFA 3RUGF 2EDBA 2YC1B 4DEWA 2Q2EB 3NZHL 1BF2A 3OWRA 4R0LC 4X4KA 3IETB 4YSDA 5D1XA 4X5LA 1MDAA 2DQDH 5EZIH 2OR7A 1P53A 3VB8A 1AZBA 4XZUB 4MJID 3VWJB 1PSKH 1PZ2A 1YEDB 2EIBA 3LIZL 4OKVB 2KH2B 5HHVL 1A5FH 1DANT 3O2WH 4FQQB 2D7PA 1SDDA 2OTWA 2FJUB 5AW8B 1XZ0A 3OQ3B 5D1QD 5C86A 2WOYA 1UXSB 5DT1H 1CDIA 4TLTA 3H4HA 3U1SH 3T2NH 5KTEH 4OW6A 3BZ4B 3EGDB 4ZG1A 4EIBA 3MUUA 3FQNA 1I3GH 5D70L 3DPDA 3PXHA 4F91B 4A6YL 2YGPA 4MXWH 1XBDA 5AAMA 4IMLB 2V6HA 3BPNB 2ZJSH 3UTZB 4M8RA 2XV2A 2WTRB 4OZGE 1L9MA 1T3FA 4RGMC 4B9CA 2R2HB 3JV4A 4OJAA 4D0DB 3H4FA 4P2OA 4WV1C 1KBKA 1M9SA 2ZOUA 4NZDA 1JPFB 2X6MA 1PAMA 1S7WB 3QG6B 5DJ2B 1BYPA 4XT1C 2PYEA 2WYTA 5HHMB 1BEXA 1FVEA 1U8OA 4OT1L 5IR1A 1U8PB 5LVEA 1UWEL 4AL8C 1W0YT 3LRSA 1AXSB 3S5YA 3L17A 2ZOTA 4HS8H 1RZKL 3MLVH 3BLPX 3KPPB 3DUSB 4FG6C 5EUOA 3W9EA 1X7TA 2XN2A 3F7RA 5HHQB 1SDYA 1M56B 5TH2A 1MCQA 2HUEA 3VRJB 4NC1C 1QPPA 3ARUA 4PB9H 1IFGA 4X4ME 1H3XA 5A7EA 4DKFH 4FTDA 3PREA 4FLOA 3K72A 5EO0A 2H32B 4PI0A 4WAFA 1LO2L 4QUOA 5KYWB 1F4YH 5C0AE 1D5IH 4GAGL 4F80A 5CJQH 3QXAB 4IU2A 3ZE0B 4JRYA 1ETB1 4QMEA 3H9HA 3L3DB 4G11A 2UX7A 4XOEA 2FAUA 3GUFA 1QPXA 3OZLA 4NQTA 4OZHA 5FO7A 1OD7A 1U95A 4M1CD 5IQ9B 3RB7A 3OJDB 5D7JD 4W4OA 4ETQB 3FU9A 2D31B 3D52A 1CBVL 4EE2A 3G6JE 2M1KA 1B0IA 2QHRL 4YAQB 1AO7D 1OCWH 4Y16A 4ONGL 1XH0A 2KBGA 1CGXA 3MSPA 4M61B 1F11A 1TVBB 3MLXL 4PMFA 5IBTH 1OGAB 4O02H 4IJ3C 2FBJL 3FOMB 1YNLH 3SGJC 1ZDSA 5HHXH 4QCIA 1JYXA 1D7DA 5DK3A 1AGFB 1UOWA 2H3KA 5D4JA 2P80D 2XWBB 4KUZL 3LS4H 3WFBL 1JZ8A 4OKDA 3IXAA 4JVPA 1TJHL 4XPHL 5KYUB 4OI7A 2XN9D 4NRYB 1ZDQA 3EH1A 4JPIB 1KTBA 4Z7OF 3ULVH 5CBEA 1BVKB 3L7FB 4UDUA 5GJTL 4YDZA 1BQSA 5HJ3B 2JKLA 3RG1C 1A7PL 1N64L 4OZGB 3S3JA 3L3OB 1H3VA 2I07B 3SKUD 3VNYA 1LP9F 3STLB 4G82A 1BM3L 3KXFA 4GRMB 1ZV5A 2VABA 1CF8L 3F6IA 4ZOEA 3WN5C 1SQ2N 4C56E 1LMIA 1MSPA 1VEMA 1E40A 4N1HB 2V17H 3OQRA 3UZQB 2L4OA 3FRUB 3VI3E 3CFDB 2PXYC 3WJMA 2C9XA 2BY0A 1VFUA 2WNXA 4H8HA 4IIZA 4X7SH 3ZE2F 2G3MA 4IRJC 1KIPA 1N2RA 4A2HA 3OKMA 4UF7C 1OIOA 4K8RD 4PWIA 4WJKB 4R90L 3OR6A 2YOCA 2VC2L 2NY1D 4XNZC 4KTEL 1I7ZA 3DMMD 3ETSA 2PO6C 2JKNA 4OCSL 1JGDB 5C0AB 1DSYA 4RMVA 4KKBC 2EYTB 2IBZX 5JOFB 3BP6B 4IEFB 2P5WE 1M1XA 2K4AA 2NZ9C 5E8PB 4YHZH 3NAAH 3BKCH 1ZIAA 2GTQA 2X40A 3VD2A 1UD8A 3A6OA 4UV4H 5IW6B 5ESAA 4QRQB 2ZKHH 1FSKB 1Q1PA 3REVA 5CZKA 3IFOB 4M7ZC 3GBEA 5CCKH 2R56L 3GK8L 4ONOA 2A9CA 4PTUB 5E2JA 4W4NA 1OQXA 2BVPB 4YDJB 5IBLC 3BW9B 4APQB 4Y2DA 3ZGIA 4XX1E 4Y8DC 2CNZA 3KPMB 1H0DA 1NBVL 2W9LA 1L9RA 4ABQA 2E9JA 2ODHA 1ZLSL 3TBYB 1SJHA 2IG2H 3KPOA 4GMTH 4HZLB 2JKTM 4ZZFA 3MJ7B 3N85L 4JG0L 3WUZA 1U9KA 3STBA 3N1PC 1R3IH 3NABH 3MMEA 2X6AA 1QLFB 3MV9E 1WFMA 4A37A 3HHSA 5AVYB 2WAQA 3Q8CA 1YUHB 1A9VA 3RY6C 3X12A 4WNJA 1BXUA 1HI6B 1Q72H 4G9FD 1RZ8B 4RGNB 1IO4C 1KGXA 3ZTEA 1J9SA 1QX1A 3BSZA 5EOCL 1LMKA 1MHPH 2CR3A 4PGDB 3WTUA 3VDBA 1XZ0B 1HINL 2F19H 4C56B 3AY4A 4QTFA 3RWJB 3SDXE 2XXCB 2KUTA 2CO3A 2FEJA 3VI3B 1USZA 3MHZA 3WL9A 4WFGD 3NK4A 3HG1E 2Y3AA 3B6SA 2K6YA 2DKMA 3VG9B 4GT0A 4E9WA 4HKBA 1U3HD 3CIQA 1BD2E 3AMLA 3U6XS 1HJCA 1IC7L 5DZOA 4QT5A 1ASQA 4X42A 3QUYA 3UEZA 2Y7MA 5F9OH 3KZ8A 1PNCA 4BQBA 5DFVC 1RZGA 4M02A 3PGFH 1DLHB 5BO1H 2X4NB 4P2OB 3MNVB 1L0QA 3ML9A 5EF2A 1E8XA 4HSAC 1R3LB 2XA3A 3AFLA 4YGAB 2J4WH 4KI5C 5JW3L 3DIFA 4U6YA 1U8OB 3UPCA 4JFUA 5E08L 3GSUB 3QGVA 4M7KH 4E5XA 2YN5A 2BY3A 2PPDA 4AQEA 4AENA 1Q90A 3ULUH 3LRSB 1DFBL 4DUXA 4NZTL 3W9EB 3SBQA 2WLKA 4YZWA 2KLTA 3BO8A 1K4DA 2QPUA 5TH2B 5CU5A 4KGJA 5IOKA 2VR4A 2WXHA 3TZVC 3ZZ1A 4UYPA 1GC1C 4ZQTA 1Q0XL 4G8IA 5L88L 3DK0A 2OBGA 5EO0B 3QXDB 3MRGA 3L3GA 3CWGA 1CI3M 1NLDH 1ZKAA 3U2JA 2HRPL 1E0OB 2FX8L 4WLCA 1T1XB 1AP2A 3FJTA 5I17A 4JRYB 3WXVH 3H9HB 1HE7A 3TBSB 2H7WA 3QHTC 1TG8A 1XF5B 4OZHB 5FO7B 1BZDA 1D5BA 1U95B 1GGBL 5HHMD 1B0WA 4TSBH 3VJ6B 4YX2H 2CK2A 3F84A 1HEJC 5A3IC 2EE3A 2GYSA 4IIQB 3THML 1AD0B 3I3EA 1ZA6A 3MV9B 1FAIL 5L7XL 4BZYA 2OZ4A 3PL6A 3QJRB 3EAKA 5IW3A 4Y16B 3WD5L 3RGBA 1LDPH 5T1MB 1NAMH 2E4TA 3NA4A 4BRJA 1NMAH 1SPDA 4A63A 4Y5VB 3U4KA 3MXWH 5FA3A 1OV8A 2B0SL 4QCIB 3BE1L 3CDZA 4NWUL 4UYQA 3VD7A 2LTQB 2CCLA 2VIRB 5FYJE 1KN2H 1U3JA 1GIGL 2MRYA 3SDXB 3B9DA 2X4OA 2K9UA 1CT8A 3IXAB 4PJ7F 3HG1B 5FHBL 4IKKA 1RCYA 5CBEB 1J18A 3GBLA 3NFNA 3VNZA 3VDCA 3GYRA 3GO1L 4NM8L 3OGCA 1E4XH 5JNYA 4X6EA 4MMYB 1WD8A 2EYSA 1KSRA 1W6LA 2N0MA 4C47A 5EHFA 5EZJA 2BWIA 3DX4A 4FFYH 4Y2NA 4NOFA 2VLKD 2XDHA 5L2JA 4OCNC 1JZ6A 4JDEA 1OM9A 1S7TA 1TZOA 3BX7C 1MIMH 4UTAA 4K94L 1OGAD 1NPNA 4K23H 4M03A 4ZOBA 2ZUUA 3KLAB 4DCQA 1IGIL 1N6QL 4WUKL 4U7KA 4BK4A 4FABL 1GGCH 3C6SA 1HXYA 4XVTH 3GIZL 3QQXA 3WJMB 4Y1SA 4XP9L 4HFUH 2BJMH 2N1TE 3HN5A 2UXVA 3HBGA 2JFCA 4POUB 3QZBA 3NZUA 1KIPB 4FA6A 3FU5A 3AQDA 4BCZA 1E6JH 3QQ9C 2Q3AA 2E7LA 3BAEL 4OJFH 5KJRH 3QISA 3PP4H 4HJEA 4PLJD 1I7ZB 4F15B 3NJLA 4ZMOA 5F88A 1XR8A 3FT1A 2ICWJ 2UUDH 5GGRB 1S7QA 3DO3A 3Q1SL 2TRYA 4U1MA 3T3PE 2W9DL 5GS1A 4BRVA 1E6OH 1M1XB 4LLUB 3ZGHA 3GPSA 2R1YB 1NIFA 3C6LC 5I5MA 3MV8D 5KW9H 1KYFA 2Q7AA 1NA8A 3REVB 1DEEA 1OAZL 2FHCA 2ISDA 3VRLF 1INEH 1SF3A 2VLME 5E23A 4HV8A 3KJ6H 1MFUA 1NINA 3BCDA 1SXSA 3Q43A 4KZ0A 1KV7A 4OUOA 3N40P 4Y2DB 2KPNA 1OP4A 3P30L 2BW5A 2G2NA 1OW0C 1H0DB 3MJ6A 2F15A 5C0BE 4JFHE 2Q6WB 4UQ2B 3ZPDA 4IK7A 4X6BB 1URIA 1UWYA 3EJCA 4HUWB 4ZTPH 5C0AD 3WIFB 3U4EA 5B39A 4ZS6D 5GGTH 5D2LA 3P9MB 4NO0A 2FT6A 1T80A 3KPSE 3FYIB 4XN1A 1CL7I 1CR9H 1SGKA 4XVJL 1XGYL 2FQEA 5BJTA 2WXFA 2X7LA 4Z5RA 3N40F 5HDBF 3HHSB 3QHFL 3PHOB 1ZA3A 2WWKO 4N9OB 1U33A 4ZTOH 1E3ZA 1CE1H 1X7QB 5GRUL 4UT9L 4I9WE 4DGIH 1OGTB 4RCAA 3RWHB 1NCBL 1UD6A 3D39D 4U6HA 5F1IB 3SSGA 4CVXB 5KYXB 1K4CA 4ZSOA 2NY3C 5E0FA 4JFXA 3KE0A 2I27N 1NMCC 2BERA 3AGWA 3H55A 4HWEL 4J4PC 2Q76B 5G4OA 4X50A 1R47A 2X88A 1X5GA 5T1DH 4YLBA 2E7HA 1FZOB 2VUOA 3FB7B 4H20L 4Y4KA 2ZUWA 3BUTA 4M4RA 3GDBA 4FI7A 1RK0A 4Y19D 1FWXA 2YXWA 3FHQA 4HKBB 1IAOA 3QK0A 1YA5A 4Y4HD 1AY1H 1F02I 1M7XA 3NH7L 1YPZF 1U30A 4G1MA 4QT5B 1EH9A 3C75A 4FNRA 3BISA 3EJUA 3OKKA 4MB3A 5D1XD 3ZKNC 3CVHH 2X2UA 4QKTA 2IJ0C 3VFMB 3BP4B 3IU3A 3NYKA 3DLQR 5CNHA 1TZGH 4POYA 1PQZA 3K2MC 3DJ9A 3ULVC 3NESA 2GJJA 2ED7A 3E3QE 2LFGA 3T1FA 4RGND 1TQSA 3T3PB 4BFGA 1PDKB 3QQ4A 4U6YB 3T65A 4IRZA 3ZHKA 3GD1C 4E5XB 5CSZA 4AQEB 1ZJBA 2VH5H 2R27A 4AENB 4L2LA 2APXA 1LD9A 3CFMA 3OV6A 4NO5A 4HMDA 4BZ2A 1PY9A 1RY7B 3RZCA 3C5ZB 3FCBA 1DO6A 5BOPA 1F8TH 3B1TA 1U21A 2E6QA 4MKTA 1DSFH 4FQCL 4V11A 2OMTA 1MW2A 5DGRA 3MRGB 2FX9H 2OULB 5HY9B 2BSSA 1Z5YD 4X9GA 3ZU8A 1AP2B 4QHNA 2R39A 1L0XA 1ZS2A 4OJDH 4P2OD 4GG6F 5EOCJ 3APMA 4PW3A 4J2XA 4M6MH 4PJXA 2EC9U 2PYED 1D5BB 2C9SA 1IC4L 1N18A 4PRIE 1KPVB 3KPSB 3VD0A 3MQIA 5TE6L 3QORA 1DJIA 4EVNA 1BAWA 3MLZL 3KYAA 1E90A 4JUTA 2G60H 1YG9A 3NP4A 5BUGA 1H6TA 2GK0A 2VDNH 4UIMA 5IGXL 2CO1A 4AXWA 1YNTA 2R0ZL 1YDPA 2PP9A 4DP4X 3U30B 3WJJA 4OIIH 1MJ8H 1RPKA 4BEIA 3IJSA 5DO2D 5KSUA 5FA3B 1FE8L 4MNQA 4IDJL 3TTSA 2DTSA 3BVUA 4E5XG 4EN3A 4LARL 1RJZA 3G6AA 4YLQT 1ZSDB 5TE7L 3IGUA 1W72B 4JRYD 1CT8B 5IFHL 3FU7A 4M8QA 1UADC 1LO3L 3DX1A 5AW6B 4XAKE 1T04A 1JUFA 4O51B 1Y6KR 2ADIB 3QAZB 1ID2A 4TL4A 4OQTA 5JNYB 4ZX5A 4X6EB 3OKYA 2EYSB 2YLHA 2FHBA 4LLWA 4OFIA 5EZJB 2GSGA 3TT3L 2VR7A 2QGEA 3JWOH 3R8BB 3RIAF 4PY8J 3T3ME 3V6FA 4Y16D 5IQOA 1MG3C 2GUYA 7FABL 1I85A 1DLFH 3HE6A 2NXYD 4H5SB 1S7TB 3OB0K 1Y1UA 3SDDA 2MOGA 3MRHA 2QQKH 1R19A 4DCQB 3SDAB 3U0TB 3R7QA 3C6SB 1HXYB 2FIRT 4Q9CA 3D07A 3EXLA 4MJ2A 4XE5B 3B9KA 3DWTA 3HG2A 4LOUD 1T1ZA 5E9DA 4CDGC 4Z9KB 1J48A 1YSOA 1VFAB 3HOGA 4HJGA 1I8LA 4XMPL 2B9AA 1T2QH 2NNFA 2XZAH 5E1AA 2F53A 4KXDA 4PAZA 5D7HA 5B7EA 1MN4A 4MQXC 4IRSA 2BIIA 4YEFA 1V8HA 5FGBA 5GS3A 2C9PA 2G9HB 4M9OA 5KS9F 3QIBA 5HYJE 3O6LH 3M46A 4JO1H 5E5LA 5SV4A 2VXSH 3SDCB 5KVMC 2ZYSA 3KXFD 5MI0B 1H6FA 4WZ9A 5GS1B 1NLBL 3ALWA 5CBAA 3JSSA 3T6ZA 1FGNL 4KFMA 4C4KO 2AQ1A 3QJUB 1IGTA 5ANMA 3FO9A 3WV0A 3V5KA 1OSEA 1VKXA 3KPQA 5DJXB 1PU0A 1N4XH 5K9KA 1WDAA 1DEEB 1SY6H 2FB4H 2YD7A 4J1UA 4UT6H 4ZD3H 3Q3GB 1EBPA 1KB9K 5E56A 3CDCA 1DN0A 2JELL 4Y7MA 3RDTA 2FJGA 4BSWB 4BZ1A 3WGVB 3ULUC 3T77B 5D9SB 1IEBA 2JTYA 4EMZA 1XF1A 2UWEE 3G5XB 3HNTL 2BSTA 2W80C 3OHXA 3DO4A 3CX2A 2V5TA 4AVJA 3VGFA 1OP3K 3L1FA 4Y89A 3U4EB 4AMKH 5KYYB 3SGDH 5D2LB 5IUSA 3IJYA 5DXWA 1UM6H 4QKXB 4NBXB 3OXSB 4ZUSA 3QZWB 4UOW0 3KDMB 1WIUA 3QSKB 4JFFA 2WXMA 2X7LB 1D6VH 4GSDH 4NAQA 1T83C 3ENEA 3LIZA 3IRPX 5AAWA 1T1YB 2ARJA 5GGQL 3IFNL 4A7GA 2WXJA 2WGXA 2EE0A 2H3NA 3A6BH 4JFXB 4PWGA 4YHOH 4B7LA 4BQCA 3F58L 5CEZL 3IVKB 4Y2DD 1Z9SB 5EC2A 4WCYL 4KJYA 1EEZA 4H25A 3QZNA 5FCUL 4Y5YC 1GGIL 3UP6A 1S5IL 4PHZA 1RPQA 2X6UA 3RA7H 3QDGA 5DMIH 1Z5LB 1BQLL 1SVBA 2IADB 2VMJA 4TUJA 3BPOC 3Q6FB 1CICC 2DKSA 4G1MB 3N1MC 2XV6B 3WENA 1I82A 3R19A 3MUZ1 2UV3A 2Z4TA 3BUDA 4UAOC 1UXLA 5F71A 3WXWH 3A22A 1S9VA 1WWWX 3ABMB 4N8CH 5B39G 4HJUA 4UQCA 3L4VA 3SJVA 2FJSA 3DETC 3VMOA 3T0BA 1UZ6F 43CAA 1I53A 4JQXA 2ZKXA 3RE0A 5I1JH 4E9LA 2J3SA 1FF5A 1ZHBA 2YWYA 3ZQ9A 1LD9B 1JFQH 2XBTA 4LOVA 5JZ7D 4M5ZH 5MEQA 1FO0A 2GIMA 2WIMA 2Y4SA 4QR7A 4FA8A 1UA6L 4S0SD 1O7SA 2MPAL 3SE9H 5T1JA 3LXUX 1PG7W 2Z92A 5G5DB 3KGRA 3RTQB 1D3CA 1KYUA 3QUYD 3QIWA 3EO9H 1RUQL 3L4WA 4YOKA 5CLYA 4KMLB 2UWEB 4RQQB 1P5UA 1ES0A 2E74C 2ZPKL 1AHWB 3OSVA 3UC0L 1OL0A 2RFXB 3QUMA 4MB5A 4PIBA 1CQYA 5A2LH 7CGTA 5T1LB 1S3RA 4EPSA 3ZKXC 2FH6A 2NR6A 4OZFB 1F1DA 3UTSE 2MQCA 2W60B 3TV3H 3TO4B 3KLKA 3GZOA 2X0VA 4EVNB 3VMPA 3LQAH 4N20A 4XH2B 1KCRL 4XP5L 5C0JA 1JK8B 4YHYC 4UZGA 2HKHL 4A2EA 1CVRA 2AJXH 4AXWB 1YNTB 1LK2B 4GQZA 1JNLL 1EQWA 4KQ4H 3HZ3A 5INCA 3PV6B 4AGNA 2AXWA 2PP8A 2FQGA 1NFIA 4M43H 5BXFA 2ZCLL 5CLWA 5HYQA 5KSUB 3S3CB 1E4KA 5LJYH 3LEYH 3VDAA 5HYIA 2EAEA 1Q0EA 2WQWA 2VRKA 2PPAA 2PTTA 1ZVNA 3V7AG 3EH2A 2EIZA 4JFHD 5F7YC 1RJZB 2AABL 4PGCA 3ZDYF 2J72A 5J12B 1SF5A 2F5BH 3VTAA 4QRUA 2PYFB 2HT2D 2D7QA 1OCZB 2HFGH 3FU7B 3IN2A 3GSRB 1DFXA 1M4KA 4LVHC 3RYMA 3PHQA 3T71A 3HB3B 5LG1A 1BM7A 4XI5C 4NIYE 4D8PA 3T0VA 4X5QA 2OM5A 3B34A 4R96A 4LK4A 4KXCA 1P1ZB 2HFEB 3ZE1E 4LLWB 4PRBA 5F8RC 4HHWA 4XCCH 1M9WA 2BSRA 1JZDC 1FGVH 4M7LL 4HUXA 4I9WD 3FSOA 4WO4B 1SOQA 3TT1H 4MA1B 1AYRA 1D6EB 1TFHA 3MRHB 5HHOA 4D7BA 1DQTA 1KN4H 2EE6A 3BDXA 5DLML 2CR6A 1WWCA 4J6RL 2EIJB 3B9KB 5T3ZH 3ABZA 2ICEA 1AD9A 3BVNA 3FULA 1D5XA 4LFHG 4ENZA 4P99A 5E1AB 2NUPA 4QXTA 5FEBA 1KEGL 5EV7A 5DCCA 3W9DA 4HIEB 4WEUD 4KI5F 1EZUA 3DOIA 2Q5BA 3RX8A 1N5YH 4NZUL 2YIHA 1FFNA 4BKTC 1CTOA 3QWQB 2O5YL 2R9HD 2YMTA 2WQXA 3QIBB 5I6XB 1GGUA 5DC0A 1MAMH 4MRBA 1SRDA 2QKIA 2OCFD 1QZNA 4OV6F 4JFTA 2NXZB 2OX5A 4G8GE 1SN2A 1S9YA 3UTSB 3HE7C 5HGAA 3FO9B 2E5EA 5E8DL 3OZKA 1BXVA 4TQEL 3I2CL 5K9KB 2C9RA 4OJCA 4GRWB 4L8SB 1IILE 4GKNA 4J1UB 4Z95L 3HMWL 5CLZA 4Y5XC 4KWUA 1IEBB 3BZFA 4JQIH 1YN7A 3ESUF 4N8UA 4KITB 1L7TL 3QZPA 4A04A 1IIIA 3DSFL 2WBJC 3AU0A 2CHZA 3EYQD 1RHFA 1JPST 5J8OA 2IQ9H 2R4SH 3BVXA 4IHOA 1URZA 3LSOA 2VDRL 1GW6A 4G1EA 2HX8A 1HFUA 32C2A