4AV5A

Structure of a triclinic crystal of the fimh lectin domain in complex with a propynyl biphenyl alpha-d-mannoside, at 1.4 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title The Tyrosine Gate as a Potential Entropic Lever in the Receptor-Binding Site of the Bacterial Adhesin Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 34
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4av5A00
2XG4B 3BFQG 2J2ZB 1KIUB 2UY6B 2WMPB 4AV4A 5AB1A 4AVKA 5ABZA 4BUQA 3ZPDA 4ATTA 5FWRA 3JWNH 2W07B 5F3FA 3JWNG 4AUJA 5IQMA 4X5PA 4AVIA 1ZE3H 4X5QA 1UWFA 5FS5A 5IQNA 2JTYA 4XOAA 4XOCA 5LNEA 1KLFB 1QUNB 4XOBA 4J3OH 4AV5A 4AUUA 3SQBB 4AUYA 5FLUA 3ZL2A 4X50A 4XOEA 4J3OG 3MCYA 4X5RA 4XODA 5F2FA 5LNGA 5AAPA 4XO9A 4CA4A 4AVHA 2VCOA 4AVJA 5JQIB 5FX3A 3RFZA 1N12A 1TR7A 5AALA 4LOVA 3ZL1A 5IQOA 4XO8A 1N0LB 4CSTA 4CSSA 2UY7B 2JMRA 3BWUF 3ME0B 2XG5B 4AV0A 1PDKB 3BFWA 3JWNE 5CGBA 4J3OF
chains in the Genus database with same CATH superfamily
5ACLA 5E08L 3BKYL 1FFRA 3HI5H 3AJ7A 1VFBA 5KJ4A 3P9MA 2P8LB 5ECGA 2P24B 3NJLA 3BISA 2A9DA 3JUZA 5AWNH 2NNXA 2LV4A 3QZWG 4HISA 5ESVA 2UXTA 3FQWB 3LRSB 3EYVA 3WL9A 5EEYA 3CZLA 3MTXA 2GSMB 1X7QB 4JO8A 5I1AA 1IBDA 2N0KA 5K9OB 4GRMB 5JHLH 3UL4A 1UEYA 4UI2A 1NGZB 3KYAA 5I9QB 3Q44A 1HWHB 4OQ1A 5FV2A 4H1LB 5DJCB 2WXGA 1MJ8L 2WLLB 3FQNA 5ID0B 3DX9A 1S7XA 4ZW3A 2JK5A 1DFBL 4Y5VC 3SDYL 5JW5A 1MVYA 3WIHH 3HAEB 4LPVA 1JNNL 3DUSA 5DF0A 4YWGH 1S9YA 4F33A 4NKIL 2HLFC 4OI9A 1L9QA 2ZUVA 3TT1H 5CWSA 4PGEA 5JW4Q 1KCSL 2BSRB 3FB8B 4U3SB 3P30L 1UKSA 4YDLB 2BINA 2QVTA 4NAJA 4LCYA 1AAJA 5C0FB 1PY9A 2PXYC 4I3RL 3VXSE 4CSPA 4J3SA 4OUOA 3IFLH 4ZMTA 4TVPH 4MAYD 1AI1L 2C1OA 4ZQKA 5I2IA 3JV6A 4M5TA 1JPGB 4FCHA 3CFBA 2R2BA 1EZVX 1SXZA 5DC2A 5DSCA 1JIBA 3SQBB 2MMXA 2FWOB 4MAYC 1QBLH 4H2CA 5D2NC 5EOQL 2PYFB 4NQTA 1UKQA 3CN4A 3NFPB 1XCTA 4N2DA 4X4XB 4YIQA 3F84A 2P8PA 1QKZL 1HCFX 2BOBB 4FQ1H 1G84A 1HSBA 4X6EB 1SVBA 3L95B 2CKNA 5D71H 4YHKL 2F19L 3VFOB 3KPSB 3BUBA 1H5BA 1NANH 3TJEH 1W0YT 1CZ8L 1R3HA 1WLHA 2CDEB 4UANA 3QQ4B 1VF5C 1AFVH 2VZUA 1NCUA 2GJZB 4LOVA 1R33A 4OZHF 1XMWA 2PYEA 3BVWA 4LCWA 4ZMXA 4MNHB 3V4VH 2BC4A 1KJ2H 1G94A 1PLGL 2DMHA 1ID2A 4ZMNA 4L4TE 3P3UA 1I85C 3QZWB 5IV2A 4ZOEA 4WTXA 3UTTE 1SJVA 2HTKC 3FRUA 4LNRA 2HG5B 4P4KD 3EFFB 4UQ3B 5DQDL 1EJ8A 5DD3H 1KLUB 3ZHDA 4XMPL 4ANXA 1FVDA 4CVXB 4U4IA 1ILUA 4OGXH 1SY6H 4DSYA 1LO5A 3K8MA 2GC4C 3CBRA 3FYIB 3IGLA 5I1GL 2C4XA 3DNKA 3L8QA 2NY4C 2BVOB 5TF1L 3RQ3A 4P4KC 1FG2B 4LFHD 4ONFL 5E5UB 3X2QB 3ZT7A 1R5WA 2F1BA 2JKNA 1MUJA 2YGNA 3ULUL 5BOPA 2WPGA 2FD6L 2P8MB 1MRCH 2OL3A 5DHVH 3X13A 4NS0A 4JFDA 1L0PA 1T6BX 1EVUA 2X4PB 2A2QT 5T5FA 3VXME 3MKKA 4B7IA 1T83A 4YSAA 3GJFH 2JJWA 1U8HB 3LEYH 4KJYA 4NN5C 1TVHA 3WLWD 3UEQA 1J9TA 3WY3A 4XPBH 5KSBB 5DS2A 1A14L 1N19A 4NERA 4PLKC 4NUPA 1T2QH 1JNLH 3L4XA 1M9WA 3BQVA 3QDHA 4DN3L 4NN7B 1EHNA 1D5ZA 1RFDL 1CBJA 2Q86A 4YDZA 2PYED 1PNDA 4GKOA 4LCWD 2LVCA 4LE8A 5DS8A 5LAPA 1U92A 4NP9A 3B2DC 5IVXF 2GG1A 3NPSB 3S8WA 2Z7UA 4FNLL 1GYWA 4HKJB 1HI6B 2AVGA 3NABL 5CNHA 2FEJA 4ZSOE 4KJPD 1KC5H 4NQEA 2A4CA 1RUPH 1JZIA 3BC9A 3V0DA 5GRJH 2RD0A 1RULL 1PIFA 2Y3NA 3REWA 1BZ7B 3OB0H 1C7TA 3ZUNC 2NZ9C 2QTEA 3EYQC 1HHKB 1LQBC 2XUWA 3V5KA 4OU3A 5F9WB 3S3PA 1JUFB 1LEGA 4BYHA 4P46B 3FHQA 2E7CA 5ADPH 5DLMH 1U93A 1J1OL 1ZT4A 2CIKA 3G04A 3A67H 4KFZC 4HPHA 1NAKL 4JFDD 2P5EE 5JPNB 5I19H 1KLGB 4P5TA 4U6TA 3R8BB 2GI0A 4F80A 3BRFA 3Q6GH 1AZVA 1MWAA 3QIUB 4OFKA 1MRFH 2EIJB 2UZXA 4M7LH 4ZFGH 3P4NB 4JRYA 4BZ1A 3ARGB 1P9MC 3UG5A 1A22B 1WSST 3MLVH 3SKNB 3WJMA 1U95A 1VJSA 1YY9C 4PJ5A 2K9FB 1IBHA 4X0KB 2UZIL 3ZOAA 1ET5A 1MCBA 4BQBA 3EXLA 3APFA 4AX3A 3GZKA 4BFKA 5EZIH 1P4BH 3KZ8A 2EQDA 2C3HA 2NY6D 3EHBD 1CYWA 2EDRA 3O4LE 5L9DL 1KGXA 1OSPL 3R4RA 5AVSB 3FB5A 4AGQA 5C0RL 1KEMH 3IF1A 4NQED 2A9BA 4L8SB 4NC0B 4B97A 5C2BL 1CGYA 4CNIB 4W9IC 4UM8B 4X5XA 2GJRA 1R47A 2X1PA 4GXVH 5J12B 4NNYA 1IM9A 5JOEA 4L48A 4AV4A 5HYJB 1UJTA 4LCVA 4XN5A 5A43C 4B60A 3QP3A 4D7BA 3KLQA 2P45B 1NGXB 3HC4H 1G7IA 5D7JA 1KENL 1MHEB 1G7QB 2MCMA 4P5TD 2Y2WA 3HC2A 3Q2NA 4NQDA 4P5SA 2R29H 3MA7A 1DN0B 2WBKA 2F7QA 3G6DL 4BQ8A 3KEDA 2ADIB 2J25A 4ODVH 4JRYD 4ZG1A 3HNVL 3NCWA 3MLUL 4YL4A 3AS0A 3QUHA 4XTRD 4Z8FH 1FLRL 4JFFA 3U79A 4C56E 5EEXA 4PJ5D 4P5TC 3T0EC 3QO1A 5EIIB 4JM4H 4YSPA 1T4KB 5EU6E 2WZ0A 5FS5A 5GGVH 5E5MB 1IB5A 4YHYB 4XVUD 2Z35B 2CJUH 3X14A 1XV8A 4MX7B 1C5BL 4KHXH 3LXBA 2PCFB 1RJZA 1IKOP 4NN6B 3UZQA 4N0FB 2H26A 4KPHH 4ZI8A 1E67A 1JWMA 1OAZL 1KBVA 3QORD 4XVUC 4WTWA 1UH2A 4NOFA 1XF4A 1RU9H 1NCOA 5H35A 2PKDA 3FONA 1IM9D 2ZONA 2NW3B 2VDOH 3CCHA 3GI8H 1A2YA 5D7IB 3SD5A 4DO4A 3QORC 1PAZA 1QBBA 4QRTA 3SDDA 4F20A 3EJZD 5CZXC 1NCAL 2J55A 1OAJA 3QUXD 2E7MA 5HI5C 3QDMA 1M05B 5AB0A 2CBOA 4WFGD 5AW5B 5DZOA 1T21B 2D7QA 4H26B 1INEL 4NQDD 3WEAA 1TMCB 4YFDB 5B3SB 4PJCA 3C08L 5E7FA 3EJZC 5KSBF 4E9LA 4MCZB 3QUXC 5KJRL 3LMJH 4PR5A 1UC6A 5F7WC 4JFFD 5C7XH 2G30A 3C9NA 4LSTH 3HI5L 3KGSA 3KPNA 2V9UA 4I2XE 4BFNA 1V8HA 2XIBA 2XQYG 3PL6D 1A9BB 1MIMH 2WC7A 3CSBA 3K74B 3PWVA 4UIMB 1PDKB 1KIPB 4JRXE 3ZKXC 4O2FB 5HHNB 4JFPB 4PBXA 4JO2H 1ZPUA 2VDMH 1QNZL 3AWGA 3C6SA 1I8LC 2NY1B 2AP2A 3ZL4H 4DN4H 4QI3A 1M2VB 4IU3B 3MOBL 1Z9NA 3PL6C 3QUGA 2ZYRA 3RIAF 5HPMB 3KD4A 3FU3A 1EXUA 3QIWB 5JHLL 1AMXA 2P5WB 3PHOA 4ZUSA 2BCKB 3B2XA 4DCQA 4OB5H 3DPBA 4Z7UA 3KWTA 1UT9A 5E6RB 1MFNA 2W60A 4JPKL 4O2EA 4NPYB 1FGVH 2Z7YA 3T3ME 1ZSHA 3AADB 3SDDD 1EX0A 2C9VA 1UJ3B 2OV0A 2ZYHA 4Q2ZB 5LCVL 3WIHL 4DGWC 8FABA 5T3ZH 1OF2A 2B5IC 4EDXB 2XTJC 3QDMD 1D2PA 1KG0A 3SPCA 3RJDA 4J5VA 5JDJA 4JMXA 1CFSA 3D18B 3VFSB 4V2BA 1XF3A 5ALBL 5FYJU 4TVPL 2H2SD 2G4GA 3ZDYB 2YRZA 2VN4A 1ET8A 4NO3B 5DR5H 4IBSA 4GRLA 5J6SA 4BINA 1IU1A 5HVHC 4GSXA 2R0ZH 3WJLA 3H9SA 4DGYH 4JZNA 3V4PL 1GS7A 3JWDH 4UNUA 2ZXDA 4QTHB 1T5XA 3FU7B 2Q10A 1MN4A 2EE9A 2ESVE 2JWYA 4IOSD 5IUCA 1ZJBA 2XZCL 3PLYA 3QEQE 4EQ2A 4M7LT 1G7LB 1WZ1H 2BM3A 4FQ1L 4P2OD 5BQ7A 2GABA 2CLVA 1HHJA 1W0VB 3MV8B 3FPXA 4LLQB 3LX9A 5D71L 1F8TL 4FG4A 3C12A 1DSYA 3NAAH 5I18L 3TIDA 4ETQA 1WFNA 1E3XA 3U9PL 1QTSA 1I7TA 3UG3A 3AABA 1AIFA 5H94B 1AFVL 1ZIAA 2BSDA 4MA3A 3ZO0A 5ICYA 4P2OC 2FJHA 3M1CA 2YLKA 4JQXA 1XIWB 4PGZA 4PJXE 1FWXA 4ZTPH 4CMMB 1EMTH 3IFOA 2OMNA 3V0VB 1VEMA 3DUHA 1WVZA 3V4VL 5EZLB 2CO6B 2MSPA 4L0YA 5MHSD 2A99A 1WBXA 1W2KT 5F3HB 1TFHA 2ENJA 4TYUA 3MRDA 4GG6E 1Z9OA 3BXNA 2VQTA 5E2VH 1FFQA 1L7TL 5A6MA 3QIBB 4OGXL 3C6LB 1A1OB 4FMVA 1FL3B 1QI4A 5J11B 4GRLD 3GRWA 3L4WA 3DWTA 4J4PC 4F8NA 5IFJA 1GZQB 4P3DA 1WITA 4W9KC 1MFAL 3MRPB 3F6LA 1U21A 4HUXA 1MCWM 3H9SD 3QDGE 2G9HB 3PWUB 3QPQC 4XP6H 2X42A 2X4NA 3BUQA 4I9WD 3FB6A 3HEIB 4IOFD 1WA0X 2EKSA 1KJ3H 2G0KA 1UZ6F 4WWKB 3VXPB 3MRKB 5KTEH 1MF2H 4OJYA 1CF8H 3VFMA 2KI6A 1MHPH 2E86A 3F7YA 5F1IA 1JBJA 1PYWB 4OFYA 1V27A 4LSQH 5DQJA 2PF6A 4CBPA 1H6FA 4MMZB 3AU0A 1RHHA 4LP8A 1T2QL 1JNLL 2HJFA 1PFOA 4H25A 4OLYL 4XCNB 1JCVA 4DPCX 4IBUA 1LK2B 4BHUA 5EIVA 4CU6A 4GSQA 4H8QA 2FE0A 2VWEE 4UDTA 2QPUA 2N7SA 3S5LG 1CI3M 2IJ0C 3CV5A 3RIFF 4KGLA 4QAWA 4L4TB 4NWTH 4XNUH 3EOAB 5FF6B 1AGBB 4S1SH 3W0WE 4AK2A 3PQYE 2IV9A 1H0DB 3VD4A 1KC5L 3ULVH 1RUPL 4N0UE 3OPZH 5F44A 2V8LA 3GMNA 3QYMA 5IB2B 4GAJH 1NJ9A 5E00A 2Y6TE 5IMOA 4YFEA 4ZO7A 4DETA 4LLMB 3CG8A 1DQLH 2BVEA 2J6WA 5ADPL 2GK0A 5IFAH 5DMKB 5HGDB 4MJ6A 3A67L 2ERJC 4LGSB 2FDBP 3FB7A 4D0CB 4L23A 2NY7H 2NY0B 5C0DB 1EUTA 3GMQB 4U0QB 1QQDB 4YHIA 5I19L 5E6IC 3H2WA 4G8EA 1MY5A 2WWMD 3MCYA 3Q6GL 5F88B 3VXMB 1BX2B 3FQ4A 5KG9A 3INUH 1E50A 4ZFGL 5IMMB 2MOVA 1WISA 2CGRH 3RUGF 2QQNH 4OFYD 2A0LC 5F70A 5T3XL 3MLVL 4MNGA 4ZD3H 3M17A 1JYWA 3HI6H 3K72B 1O7DE 4GB9A 3QXAA 2WWMC 1TIUA 4WNQA 1FL6B 2EJ1A 4WHCA 5H37A 3SDCA 1Z0NA 1TLMA 2HKHH 3RFZA 4KVNH 5ETUB 2XG4A 3QUYB 5CD3B 1EPFA 2VSCA 1FORH 1JWUA 3VRJB 1EHKB 5AD0B 4LBEA 3ZQWA 1M7DB 4BKTC 1AQHA 3HZMA 4JRLA 2MQ3A 2WLYA 2Q3AA 1MCHA 2WAHA 3NZUA 4IEFA 1CFBA 5I6NA 4CDGC 4N85A 4ZSOB 3TF4A 4GJTB 4GXVL 1A7PH 3OM3B 5CXPA 3ASNB 1NGWB 1Q94B 1UZGA 1ZDSA 1KTRL 1WBYA 3C5ZB 2FSEA 3AG1B 1FVEA 1U41A 1X5FA 4OCMC 4AJWA 4UU9A 4LGPB 4F3FA 2VRQA 5CP7B 1JS4A 1HXKA 3KLKA 5D7HA 3S5LB 5AZUA 3T4YB 3L3OB 3ZMRA 4Y7MA 3HC4L 1ZLDA 1DVZA 4CL7A 5I1LA 3DJRA 4TSCL 3SBWA 2P5EB 2Z34A 4PYHA 2HPTA 3GM0A 4P5KB 2I9TB 4HJJL 1MFBH 4FQIL 2D9CA 1UB5B 4TQEH 4R0LA 1IC4H 2ED7A 4YQXH 1IGYB 5C09A 1T6WA 3X1EA 3W5MA 1DVTA 5GGUA 2OCCB 3TPUB 2K78A 2NQCA 4K2UH 4JM4L 4TQ8A 2YR3A 3NZSA 4IDLA 2ZSWA 4PJ8A 1YJDH 5DHYB 3SE9L 4F92B 2WLKA 2CO1A 1A9EB 2WO3B 4AQ1A 1WHPA 3VWKA 3T71A 2VLRA 3FRPA 1J0IA 4KROB 3RWIB 2WQUA 5IJVB 1X5IA 1J18A 1COBA 3DXAE 3PAYA 3VMPA 2RFXB 3O4LB 3L45A 4EVNB 3UACA 4TN9A 2HVJA 3EAKA 4BSWA 3PXLA 1BVKB 5L8KB 1RU9L 1GJIA 3NT0A 5CR1A 3NJGA 5FDYA 4CUCA 2VDOL 3OJDA 5GS1C 5T1KB 3L1GA 2PTTA 4KI5C 2BVYA 4IJ3C 1NGQH 2Y0SA 3D2UA 4N24A 3HHSB 4XI5D 5EN2A 1KBGH 5SV4A 4ZO6A 2E6QA 1BFTA 4LCCA 4OF5A 43C9A 3HC0B 2GB2A 3LRLA 1P84K 3WN6A 3VI4E 4HJGA 3V4UH 1I8MB 5HVWA 4MJJA 1TITA 3FXIC 3TYFA 4XHJC 1PKQE 3GXNA 2HRGA 2ATAA 5EU5A 1T5WB 3LMJL 1V7MH 1URZA 2E9WA 4LSTL 2V3DA 1KB5B 3QJRB 3U1SL 2I24N 1OPGH 3VH8A 1DBMH 1MIML 4KJQC 5EU6B 4JFYA 3RWEB 3KAAA 4KRPB 3Q7JA 4U4BA 2SEBA 2LGNA 1WBZA 1CDBA 2VLRD 5J7CC 1OARL 2V37A 2VDML 5GSRB 4O9HH 4DKTA 4P99A 4DN4L 1WS8A 3ZL4L 3BZEB 4N0CD 1RPUA 2V2WB 2CUMA 1OANA 4WFEE 3MSPA 2HT2D 2G5UA 2F1AA 1WAEA 4JHBA 1DDTA 4MWFB 2EACA 4AT6B 2UWEA 4NKOA 3S2AA 2VAAB 2BERA 4LRNH 4OB5L 1HKLH 3IXTB 4BKSC 1LDSA 2HFGL 4G1MA 4PY8J 5DFVD 2XY1A 3CHOA 2ZG2A 3D2UD 43CAB 4PJGE 1MDAA 2JKWA 2BIMA 4PRPE 3ELQA 3BVDB 1JTTA 4K9JA 4M7JH 4PJHA 4Y4HA 5CMAA 2WNKA 2FJGA 4KXAA 4WFFD 4HIQA 2OTPA 4XX1E 1NGYB 3DX8A 3DLQR 3TZVA 4EXKA 1D7BA 4FG0A 2BWQA 1BQHB 5AENA 4LCCC 5DR5L 1XR8B 2CJ3A 3AM8C 4UMGA 5EBLA 3TVMC 3QS3A 5KYUB 1K5NB 3RKDC 2RHEA 3PGCA 2P9RA 4LB8A 5H2BA 4I3GA 4YH6A 2VZ1A 3PXJA 5L4IA 3L3IA 4YHZL 2ZWKA 2CPCA 4DO6A 4RZCB 4B27A 2WXFA 5IEHB 3ULUD 1BIIB 2N1KA 3T0DA 1WZ1L 4OKDA 3IJSA 1AQKL 5F9OH 4LKCB 3SE3A 3EG9B 4KTDH 1ZHBA 5IEKB 4Y9FA 3T8XB 3NAAL 4NKDA 4ANWA 2DIBA 1J86A 1GZHC 1BA9A 1YVLA 4P23C 4Z0XA 5FYKH 3ULUC 2YKLH 2Z8RA 2YBRA 4ZTPL 1AC0A 1EMTL 3T3MB 5IF0A 4L1SA 3H42H 4S1QH 4YDKH 4XR8C 4J2XA 3UJIH 2GSIB 4NRYA 3GMMA 5F93C 3RP1A 1GPOH 3LD8B 4Y4HD 5C0BA 1JHLL 1Q9KB 4NKMA 1XBRA 5KN5A 2WBJA 2D0GA 4Y7OC 1CL7L 4YBHA 4YBQD 3TZVD 1VGKB 3QO0A 2FGWH 2XIIA 4JW3A 3ZHNA 2W9DL 1MFVA 3ARYA 4V1DA 5CSBA 4A67A 1T7ZA 4TQIA 3MC0A 3DRTB 4Y4HC 1P7KA 4BQ6A 4D9RE 3U6RB 2N4IA 1F3DJ 2XPYA 2ZUYA 1GZPA 3I6LD 4YBQC 5HYSB 3TZVC 1TJIH 4FQXA 3BH8A 2VDRH 3CMOH 5HYFA 3SCMD 2ESVB 3VUAA 2VM3A 1JRHI 2H5UA 2YD0A 4PW9A 1NDGA 3QEQB 5AVVB 1GA2A 1MH5B 1FV1B 3RTLA 3K1DA 6PAZA 1IAKA 3B2VL 5CKGA 5KTEL 1CF8L 2QGEA 4ODWB 4K7FA 3GXTA 3L1OL 2JKLA 3LRMA 3UTQA 2VAJA 3SCMC 3DOHA 2W95A 1P7QB 3HZKA 3UGXA 5F96H 2O61B 1XH1A 4X4YA 4GUQA 4LVNB 4Y2NA 4I89A 3V0IA 3PDDA 1NWPA 3KPLB 2CIIA 1UKTA 4ZX5A 3RWJB 4NWTL 1I3RA 2V7NB 4PVMA 3FUIA 4XNUL 2Z93A 1D6VL 3JUYA 4Z7WE 5E8DL 1OM9A 2V5MA 2WBJD 3QDJA 2QQKH 4GAJL 4OF6A 3GXDA 4V1DD 1S4IA 1NSNH 3ZRSA 3MCLL 1AYRA 2ENQA 4ELKA 1DQLL 1RK0A 3RIFK 1MLCA 5IFAL 1F90H 5DD6A 4AM0A 3NUKA 4FQXD 3QDGB 4Y5YA 1A4CA 1XH3B 3MGOB 2EDFA 2IH1A 2JI3A 1IBBA 2DLFL 4UQ2A 3NA9L 4K94C 4ORGA 1CO1A 3CZUB 1UFGA 1RIUH 2VLLA 4D0DA 3INUL 3SGEH 1NBVH 2F6AA 1Z9LA 2CGRL 4FQXC 3HJ0A 2QQNL 4P59H 3DVGB 4MYPA 3ARDA 5D6DA 1VFAB 5DO2D 5C0JB 4N8CH 3KJ4C 4WHTA 3PFUA 2AJYH 4PG2A 4QYOA 1M3JA 4FYRA 3GB7B 4HV8B 5C92A 4RGNC 3MLYH 3QUMH 3AQDA 2HKHL 3KPTA 4RGMB 2WCGA 1JXGA 3OVUB 4AL8C 1JYNA 1OT2A 1FNEB 5DO2C 4ZYKB 1I8IB 1FORL 5BZZA 4C57C 4ONOA 1TJMA 3G6JF 1JI2A 3BP5A 3LKPB 3MUJA 3PHQB 1TCRB 1B0RB 3D6GA 4JJHA 3W0WB 2YQBA 1AS6A 3PQYB 4KK5D 4GI8A 4JFHE 2E7LA 1CT8B 4N0UB 3EYUL 4JB9L 4PRHE 4U1JA 1A7PL 2IH9A 2ZX6A 3MRCA 1DVQA 4XPAH 3MRNB 3TWCL 3D12B 5IB1A 2GSGA 3AAZA 3D25B 4RFEB 5JHLA 4YXLL 5IM7A 2W59A 3C8HA 4Z76A 4AH2A 3RWFB 4WV1A 3VI3E 2NDFA 4OLZH 2F5BH 5BRZE 1HSAA 4MDIB 5IW6A 1M2OA 3NIFE 5D4HA 3EUDA 1QACA 1A6WH 3EGSA 1KCRL 5LCVA 3WIHA 5B1BB 4WIQA 2XWTA 5I73C 3A6CH 4WSKA 3A6OA 4JJOA 4OZ4A 1RIHH 3QQDA 4OF0A 4XCEA 1RZFH 4PJBA 2Z9TA 1JZ4A 3ARDD 5FA3A 5SX5K 4K2UL 4FTVE 3O3EA 2F61A 1HL9A 5ENWB 3VA2C 1G7JB 1DHKA 1LWJA 3OXRA 3PJSB 1YJDL 4LPWA 5FM5O 5ABZA 4JPVH 5EEWA 3T3MF 3TIEA 1HL4A 2BS8A 3ARDC 3GUTB 2Y25A 1T89A 4GKZB 3V4PA 2V2XB 4FEMA 4NAMA 4E9RA 3C09B 1WE5A 3HUJF 3O0RH 1DDHA 1HINH 3W56A 2R59A 4PJEB 2X28A 5AW8B 2WGXA 3S88H 3QEUB 4ILDA 2YO3A 3F6IA 1XQ4A 5JORA 1M57B 4PN6A 3O3DA 1KACB 1ZLEA 5B21A 1JWSA 3QAZC 4JRWA 1YC8A 4XBGB 4M7ZB 3MLRL 3I2CH 1SN2A 5BZWA 3ZT5A 2GY7B 2CO3A 4I48A 3P3RA 4C47A 1KWKA 3F7VA 1WQVT 3S4SG 3BVVA 5CGMA 1N2RA 2C4FT 4HD5A 3VJ6A 4GH7B 5TDOB 5EO9B 4DZ8B 1FIGH 4PBDA 3CAFA 2EYRA 3ILPB 2UX6A 4WV1C 3CMGA 3KLAA 5DJZA 1A1MA 1EJFA 3ZGIA 3B56A 1V7ML 3GD1C 3VSTA 3OBAA 5G5DB 1U8CB 4NHUB 5HHOA 5DRWB 3MRFA 4TVPD 3DSNB 1NEZB 5F9AC 3TJHD 1OPGL 1R3KB 1DBML 5JO5B 3ZIMA 3ZN6A 2ZCLL 4PJXF 1AR1B 4B5EA 2YUWA 1TTBA 5DK0B 2AHIA 5TPWH 2JE8A 4URTB 2C5DC 2GFBB 4IMLA 1OGAD 3D0AA 2VLMD 3ULSB 4RIRA 3FNKA 4LLUA 3K7UA 5DHVA 3DXAB 3IN2A 1ZHNA 2EDBA 3H0TB 3KPPB 2F0CA 4GG6F 2D7PA 3AACA 4XX1G 1E9PB 3PHAA 3RNQB 3C2AH 4NM8H 3GJFA 4J28A 5JPMC 2IPKB 1HKLL 4N9GB 2HLAA 3GSQB 2UZPA 5TDNA 3GMRA 4OGYH 3ALXA 3RGVC 3N1GC 3LSOA 2EE6A 2XKUA 1CGTA 4PB9H 4ZUVB 3KMDA 4ZFOB 3UAEA 3HNSL 1NDMA 4MXQD 1S8DA 3CC1A 4Z3IA 4TL4A 2W07A 4FFZH 2H7WA 4L3AA 3T6WA 4ZMOA 5A2BA 2DWTA 3VI4B 4DP5X 4BRJA 3BH9B 2B59A 5ELIA 5T1DH 1B2WL 1RIVH 3MOAL 5CFAA 1ITCA 1F58H 4JM2C 5J1SC 5B38A 5IG7B 3RWCB 1K4DA 1IGTB 3O8XC 4MXQC 1WICA 4GEIA 1MZYA 5HHOD 1MREL 3VFVB 4H8WH 1TJHH 2AMUA 4QRQA 3VQMA 2RTTA 1F4XH 4PJDE 3U46B 3LKNB 3OKDB 4WU7B 1FFTB 4AITA 2Y1VA 5E23A 4WUUA 4NYLA 5I6PA 3EYOB 4MFHA 2GJPA 4TF4A 1GOFA 3FW6A 1J1XL 3CHXA 4R3SA 2Z0UA 3GYRA 4MD0B 4PM1A 3I9GH 5IKCB 4KXDA 3ZHKA 4G6AC 5E51A 4RZKA 3SPVA 3IFPB 4GKNB 3CK0H 4GQ9L 1F3RB 5IW3A 2NCMA 5DUMH 4ZS7L 4D9LH 4G43B 2YZ8A 4HZLB 2YKLL 3JZYA 3WENA 4G9DB 2Q8AH 5DO8A 2VLJE 4Q6IA 2WN3A 1QVOA 3CJJA 3WN5A 3S36X 5DWUL 4ONHA 4PJ9D 4PJGB 4YDKL 1CDHA 4PRPB 3UJIL 1VIWA 1T7VA 4PYGA 3V0AC 2XWBB 5B8CB 3DI3B 3LEVH 1T5KA 2VL5A 4MRBA 2WIIB 4IDJL 4QCIA 2HFEB 5FO9B 5D6CB 1YMHA 3MUGA 3L5WA 4NQCB 1QHPA 4PJ9C 2WXHA 1I7UB 1MJJA 4PGCB 2C3VA 4IQHA 4GKLA 3Q06A 2LU7A 3RI5F 5IHLB 2LLGA 1T0MB 1QPPA 2KZKA 3BIKB 3FUJA 5JDSA 5AZEL 4X7SH 2NUTB 4Z23A 2JJTA 2X10A 3BCFA 5F97E 3V52H 3WU1A 3HRZC 1X5YA 5LO7A 3NESA 1OP4A 2OI9B 5IESH 3CMOL 2E7HA 3BOVA 3KPOA 5J1AB 3MFGB 3ZDXE 1YEHH 5MENE 3GI9H 1YAIA 1UM6H 4NRZA 5EO0A 3B9KB 5D70H 3LVEA 4KTGA 1KSRA 2O72A 3L3KA 1G1KA 3EYSH 1SF5A 4F9PA 2QL1A 3G08B 3K8LA 1IVTA 2CGZA 3IJ9A 1Z3RA 3VB9A 1TJGH 1JGDA 4OJAA 2X4TA 2J1WA 1DP0A 3FF8A 3ECVA 5FKAA 2DKUA 3L5JA 4NCDA 2CJSA 4XPTL 2DJUA 3JTSA 1CLZL 2CDFB 3OKLB 4WJG3 3TNNA 1HZHL 3L2NA 1NL0L 2NQ3A 3ESPA 1NMAL 4G7QB 4S2SB 3IE4A 1Q1JL 3CFMA 4Y4FA 2BOCB 1CDYA 1X4ZA 3EFDL 3WG7B 1FPTL 5IIEA 3KBPA 1JMZA 4LPXA 2VZVA 1S7UA 3FU0A 3BX7C 4IK6A 1GJWA 2QQKL 1TVBA 1QZ1A 5IVOA 2W91A 3HC3H 4JPIB 1SMDA 4U0RB 3I3BA 1NSNL 2IFFH 3M1BA 2W81C 3L5XH 3RZCB 3FH5A 2B9AA 2D2OA 3TOPA 3UIZA 4EE2A 3VX1A 3MREA 1N6QH 3TXAA 4BUHA 2Z1KA 1YEKH 2GAZA 5BCAA 4J2QA 4P49A 1JPFB 4HIHA 1N7ML 1EBAA 2E47A 2K45A 2R27A 1E30A 1ID5I 3HB3D 3WMSA 1RIUL 3MUHL 4MD5B 1C08B 1IGIH 2PMZA 5ESAA 5I15H 4P59L 1MCQA 1PY0A 2R0LH 2MCG1 4NNPH 4QEGA 3QG7H 5BJTB 4PV9A 3OHXA 3MLYL 4G8GA 3QUML 5HGAA 1EA9C 4JY5L 4NBXB 3RDTC 4F9PC 2EE0A 4ENZA 4WQOA 5EZJB 2QPSA 5DZNA 3ZR5A 3HHRB 1R19A 3FYEB 5D7KE 2J4WH 1GHFH 2YOAA 5LQBH 1IM3A 3CLEL 4LIQL 3VI4F 2GCYA 1VZHA 2OX5B 5A3IC 2BH0A 3GSOA 1DE4A 4HIEB 5KVEE 3FFCE 2UY7A 4MMXB 4Z7WB 3LKQA 1U8QB 1XF1A 3SIKA 4JFSA 5GS2H 4XPAL 1IBGL 4OM1H 1ERNA 3MBXL 5DJDA 5F6IC 2JCCF 4NQXB 3I9PA 3T8MA 2EVFA 1TR7A 1MFCL 1WWBX 2F1EA 5EC1B 1QZNA 5HJ3B 4X2UA 4M9OA 4HOZA 2QSCH 2F5BL 3UBXA 4HX1B 3ARPA 3IN0A 1A6WL 2OTWA 4DFHA 1NUFA 4EO5A 2QSQA 1DUZA 2Y06L 3BEWA 5BO1H 1MI5A 3A6CL 4JFXB 5KSVB 3OTTA 2CHXA 3QI9C 1O5DT 3A3YB 1KF9B 5HDQH 1JHTB 4JKKA 4PGDA 3R7RA 4ZW5A 2YAEA 4L3FA 3KS0H 2J1KA 1BYOA 4GO8A 4K71B 2J2ZB 1H9DA 2DI8A 1Y07A 2WZAA 3SPHA 1BZ9A 3CZGA 4APQA 3O9WC 4G8GD 4FQPA 4JPVL 4FNRA 4QHLB 4KZCA 5LWYH 2G60H 2WMPB 4PJGF 3ATBA 3NSFA 2RBLA 4UOW1 5D4IA 4GS7C 3MV01 3FT3B 4F1SA 1X5ZA 3VO0A 5TH2B 2EDJA 2WB1A 2P26A 1ZT7B 4O00A 1G9ML 5A2KH 5AAWA 5M7QA 4WW2C 3C8DA 1IM3D 1D5MA 4G9FA 1HILB 3NMEA 1ZTXE 1L3NA 1HINL 3OHXC 4XPHH 1I3VA 5DJXA 2GTWB 4M5YH 1FYTA 1PX8A 4MA7L 1IKNA 1NTDA 4GNKB 1KB9K 2X9ZA 3HE6B 2WWKO 2I60H 4GKSB 3S88L 3L3HA 5DD5H 1N64H 4PJCE 5K59E 1BMZA 5HHQA 4PRHB 1OAUH 1P1VA 1T0PB 4WK2B 3X3FH 3CFEA 2Z64C 1SXNA 2V5SA 4B9PA 4AYEC 1M56B 5IGXL 3ETBF 3GNMH 2PP7A 1R0AH 4CVUA 4R2GB 4YXHL 3DJZA 4YHMH 2DQCH 1T4WA 3BWAB 4NPJA 3QGVA 5BRZB 5JHAA 2AKRA 3NIFB 3Q05A 2ZX8A 3M88A 2VR6A 4N2CA 1RL1A 3LPWA 4CMHB 1XEUA 5FYJH 3BWSA 1RZJC 4Y16C 4A7SA 1FIGL 2Y23A 2OZNA 1MI5D 3FQXA 4W4NA 4HUVA 1OY3B 2EO1A 4DK5A 1QA9A 3WS6A 4LOUD 3IMTA 2ORBL 1QSFD 1U91B 2CDGA 4F7KA 3GLEA 2H3NA 3R06A 4R7NB 4LSVL 4YJZL 5GGTH 4Q6YA 1TVDA 5E1IA 5DZPA 4MD4A 5B1AB 3ROLB 3UBXB 1D9KB 1NLBL 1WZMA 2IOOA 3MGTB 4N1EA 4QDGA 3VDBA 5DUJA 4FTVB 4WEBH 4APQD 1A9VA 3K0WA 4Z7UE 1RZ7L 4BWWA 2WUCL 4HT1L 5TPWL 2VXTH 4LFHG 4KQ4H 3GJEA 1JCKA 3MRGA 4QF1A 4QHPA 3SO5A 5ESQA 3MJGX 5DURD 4G9FD 5FW6A 1I7ZA 3P0VL 4LHUD 1OXYA 1BQSA 1FYTD 2XI9A 4JFZL 3K80A 4X99A 5KOMC 4O51B 4NM8L 3RBGA 1CI5A 5AAWC 3TH2T 1MJ7H 3JWDC 3ML8A 4PJAA 5FOBA 3VSUA 4BGLA 3MRIB 2WY3B 5G4OA 5DUBA 2Y6SD 1OTUD 1IKNC 3LN5A 2GUOB 4PB9L 1QEWB 4IRJB 4BBWA 2BRRH 2NPLX 3DO3A 3OC5A 2RQEA 4H8HA 4RAUA 3H3PH 4WU5B 4H44C 3EFOB 2X44D 1CTNA 4HHAB 3T8VA 3UBFA 2X6BA 4M6OH 2JB5L 4ORZC 3RWHB 2YAPA 4FXLA 1S9VA 2WN2A 3FAXA 4HD9A 3BVXA 5FV1L 5AW6B 5GS0H 5FM5M 3LN4A 5AVQB 4CN4A 4LOFA 3DBXB 4HJ1A 2CMRH 1SXCA 2PPFA 3GGWB 1CLCA 1SZNA 2HWZH 3L7FA 1TJHL 2HCZX 2VDPH 3IKCB 4LLYB 3WXWL 1A3ZA 3FCSB 2FIKB 5CCGE 1J10A 1E28A 2ATPB 1GW6A 1A0QH 1O75A 4UNVA 3RNKB 1WPCA 2V9QA 1ZT1A 1KPVB 1YMME 3NFSH 5C0CE 4ANUA 4AK1A 1AQ8A 5I1JL 3EBIA 5I1EH 5DGQA 3DDFA 5AEAA 3QFJD 4PJIE 4RNRA 5CHNB 5DUML 4FQ2L 3I02A 1Z9PA 2DW5A 4D9LL 4PRBB 1D7DA 1QATA 3ECBA 1YY8A 2AXJA 2IH3A 3DUUB 5D1QE 3K6NA 4MCYA 4GG8A 3VXRA 2WVVB 5LXGH 3HPLA 4ZW8A 1GR7A 2VZTA 4L2YA 1J05B 2R69L 3RTQA 4P2RA 2Z6FA 2QELA 4JN1H 4NENB 3LEVL 3Q5TA 4MB5A 4HULB 1QFHA 1A7RL 1HESA 1K6QH 1F11B 2HRPH 2XN2A 4PVLA 2PP9A 3LEXB 3KS0J 4J1UB 2VDQH 1GTNA 2CWRA 2G75B 2FHBA 2OJEB 5D1XA 2P1YA 4BE6A 3BI9X 5JW3L 1RZIA 1WHOA 3ZZLA 5CIPA 4X7SL 5DVLA 3V52L 3S98A 4KO9A 5FCUH 3UTZB 3UYPB 4NPKA 5A40E 2MPAH 4PJDB 2YPLA 4HC1H 4W9LC 1XGTB 2NYKA 3DGGA 2V5YA 3IAQA 3NRQA 4LZKA 3ULVC 1U9KA 3I84A 1ZA3B 1EEYA 4ISVA 5LN4A 1YEHL 4Z7IA 1NFDF 3TA3B 4QHNB 2WO2B 3GI9L 5D70L 3MR9B 3HBGA 1TSHA 3GINA 3RI5K 3EYSL 4U7MA 4UWQB 4EIUA 3J7HA 4U1LB 4GO9A 5A7BA 5ICZA 2GIXA 3F5WA 4Y2OA 1TJGL 2ZP0T 3WFBH 1CICB 4OF8A 5L2JA 4AV0A 3VI3F 3VXRD 2VLJB 2NY2B 1D5XA 4LSUL 1S7QB 3RTQD 4P2RD 2E6PA 3H2QA 3L4ZA 1FBIH 3GXUB 1AQMA 3MCKA 4YSDA 3U83A 1YUHA 2IBZX 3ISWA 4I1NB 4F2ME 1OGTB 4FHKA 1N18A 2AC0A 5BS0A 4W9CC 3KXFE 1AS7A 2WUBH 1QHOA 4AYBA 4KDTA 3RTQC 2X38A 4PJ7E 5D1XD 1GJUA 1X7TA 3Q2LA 2Z0BA 1YEFL 4MNGE 3CDGA 5KUKA 4HH9B 1N70A 3T9WA 5IK3A 3CFCL 5DFWH 3MV7E 2QHLA 3VYNA 1GTFA 1JZ3A 2NUPA 5C08E 1N4XH 2YPLD 4OIBA 1JF1B 4X8JB 3SPIA 3DGCR 1MCNA 5AOIA 1T20B 2VE6A 3II1A 3FSWA 4UV7L 4I5BA 5IVZA 4O02B 2E76C 4M8QB 1R5IB 3D2TA 1IGIL 3EOYG 5HHXH 5MENB 5DUPL 4PTTA 1E5ZA 4RFNC 1CGXA 1VAHA 4XH2B 2RJMA 1H8LA 1U3ZA 2R0LL 3F6JA 1Q0XH 4FLRA 4OJFH 3BT0A 4Z7VE 4EI5A 4YUEH 5IQ7H 2DEYX 4NCC1 4RMQA 1JNHB 3TBWB 1YEJH 2J8UE 3MLXH 4JE4B 3BMWA 1UWEL 2DQJH 3WNNA 5LQBL 4K0OA 2XRAH 4ZAKB 4GEJA 2X0WA 4B0MB 2AS5M 3KHQA 3D05A 5T1LD 1G0DA 1AKPA 3GSWB 5GQBA 2AJSH 4UMSA 3HG1D 1KN4L 5BS0D 4DH2A 2DLHA 1MKFA 4DGIH 1IEAB 5LDUA 2QVKA 2CHZA 4HWEH 1AJ7H 1YJDC 1PEWA 5DTFB 4OM1L 4P4RA 5I71C 2ZG3A 1X9RA 2H9GA 4KKLD 4A2FA 3IVKB 1CTOA 1FO0A 2WXKA 3KYMA 2X4OB 4JZJA 2Z7WA 1CE6A 4IKLA 1H3WM 4KUCF 2BFGA 3RWGA 2OA9A 2VKXA 1TFPA 3MA9H 4ABVA 1AHWC 4TTGA 1S6NA 1JK9A 3F3HA 5ITBH 3VFPA 3BO8A 2FZ3B 7CGTA 4IRSB 1KWGA 2Z3FA 3GXIA 4OI8A 3MJ6A 5GSVB 4A68A 3TBBA 1EHXA 2OR9L 3IGAB 4WI3A 5IFHH 2WYTA 4EIZC 2Z31D 4LCUA 3EYFB 3CFIC 4WY7H 5D7LA 3WEOA 5DS1A 4A6YH 3PJLA 2NTFA 5FUOH 3UX9B 4W70A 1G1CA 1PTZA 5GGSB 4M7KH 3P4LA 1G7MB 3F62A 4TQPA 1SQMA 4EI5D 2G60L 3BQUC 4U1HB 2Z31C 3ABKB 1KIQB 4Y4KB 4MLIA 1KCWA 2DBJA 4GMSL 1QBML 7PAZA 3OAZH 5KW9H 1KYOJ 4F57L 2WXRA 4K8RH 2X6UA 5DJ8B 1UD2A 2GK2A 1E8XA 1U3HB 2K70A 3BPCA 1DQDH 3QHTC 1FHGA 3KPMB 1AKJD 2KZWA 2W5PA 2BW5A 4E41E 3FFCB 1HS6A 5DD5L 3LPFA 3OSVA 4BELD 1N64L 5FHBL 1LJMA 4FZEH 1OAUL 3X3FL 2PNDA 1R0AL 1KV3A 1WS7A 2Y22A 2O6PA 4YGVA 5FKPB 2DKSA 2DQCL 4NQUA 2OJZH 4V33A 4YDNA 1YYLL 5EV7A 2VMEA 5E6UB 1BVNT 1W72A 4KNSA 3S36H 1E2VA 3QZBA 4X7DC 1IJNA 2AJUH 3OR6B 2L4OA 2YGQA 3NIDE 4OZIE 1EHAA 3FO1A 5B1JA 5I66B 4JCLA 2ICEC 4S0TD 5DQ9A 4L8CB 5ISZD 4P2QE 1VRSA 1HZLA 4DHLA 4LHJB 5GGTL 1NFAA 4YSCA 1ES0B 4G1EB 4PH8A 1KNOA 4MJIA 3MROA 3KG5A 4I77H 1P5UC 4WEBL 4A2DA 5KVFH 3SE4A 3L3DA 2Z65C 4XBEH 4ZXBA 3WUWB 2MKWA 2GITA 3CIAA 5E4EC 3VMNA 5ADOH 4F93B 2VXTL 3HCVB 1MFMA 3B4NA 4KRLB 4R96B 3ZL2A 4AEEA 2DMBA 3RLSA 4OBSA 1U2CA 2FUQA 3IJEB 5J9PB 3TEUA 3CFJA 3Q1EA 3WUZA 4OF7A 4OJDH 3F00A 3EGDA 1TF4A 5IVXA 1TQVA 4WTQA 1IFHH 4M9PA 5J13B 1BAFH 2A6IA 4AG4L 3FN0H 1RK7A 1DBAH 1ZVNA 4FP8L 1XR9A 2VC2B 2B1OA 4EF3A 3O41B 3J07A 4G3YL 3WTXA 3GPSA 5E1GA 3VFNA 3LS4H 3DK0A 2EH7L 4UQ9A 4OCYH 4JKWA 2BRRL 4UTAH 3H3PL 1KXQA 3SYOA 3W39B 1PU0A 2CCVA 3F12B 3LXUX 4MB1A 2DY2A 2P8LA 4OM0L 2P24A 4XN1A 5K1JA 3ZDXF 4Q97A 4K3JH 4YBLC 5BUGA 3F64A 1QLRB 2LLNA 1SHSA 2CRMA 1DSFL 3WDJA 1J5HA 3TM6A 2FJSA 4EMZA 4JG5A 4WVRA 3FQWA 2W9EH 3LRSA 4HGWB 3W9DB 2UXFA 1X7QA 2ZUXA 4MJID 5K9OA 3RILA 1NGZA 2BFVL 3BUPA 4P9MH 5F7NC 3DX1A 4ZXBD 4HFWA 5B1JC 4XPFH 3SHSA 5DJCA 1AGCB 2WLLA 5ID0A 4OZGE 4S1DC 4RDQG 2KLTA 1RZ8B 1A0QL 2FK9A 5EEVA 3S6CA 5DHXB 1A6UH 3T0BA 3HAEA 4RA3A 2NYYD 3NFSL 1Z5YD 4KHTH 3V5DB 5KVMC 1XX9C 3ARFA 1Z32X 1CFQB 5C0BE 2Y69B 3ZRFC 3FB8A 1SFHA 1F02I 4U3SA 2AEOA 4TPRH 3C60B 3CVHH 2BIPA 5C0FA 4JQIH 2F8XC 2QSVA 3TEXA 2YXVA 1GKEA 1B3IA 1NKOA 4TNWF 3CSYB 1A4JB 2FWLB 3EO0B 4JDTH 4JL1A 1L7IH 4LVEA 2A9NL 1JPGA 4GSUA 4KJWC 1CGVA 2EINB 4AE0A 3QUMA 5EH1A 2GBVA 4ODTH 4JN1L 3SQBA 2X9XA 3DV6B 2FWOA 5CAYB 1KTCA 2HRPL 1NCJA 3ZW3A 5B4MC 1OE1A 2L7JA 3WDHA 2PYFA 3NFPA 2D7OA 4X4XA 3BYTA 3H9YA 5DK2B 1TENA 2BOBA 2I9LB 4JREB 3O6FD 5FW8A 2Q8BH 4GUOA 4UTBL 2ED8A 4X6EA 3L95A 5DT1H 1AVAA 3SY0B 3VFOA 4IKNA 2XZQH 2Z8SA 2YAHA 4PRIE 2I25N 5FCUL 1FSKB 2CDEA 3QQ4A 3WNLA 2MPAL 2EIKB 4NO0B 3VD2A 4J6IA 1UD6A 1FQ9C 5INCB 3O6FC 5T1JA 3SQRA 3H4FA 4KUZH 2EADA 1ZMYA 2HKFH 4YL9A 4MNHA 4JVPA 4LVHC 4F2EA 1YMMB 5C0CB 3ARFD 1YUKB 2A9MH 4NNXB 1IQDB 3QZWA 5T1MB 4PLNC 4P9HL 4B9ZA 5JQ6H 4PJIB 5IROA 1FZKB 1PJWA 3L9YA 3QDJE 1I8UA 5I26A 4ZOCA 4UQ3A 4FQCH 1KLUA 4CVXA 4FKHA 3WFBL 1KB5L 1SLUA 3UG4A 1MAML 4F91B 3ARFC 3NJKA 2UUDK 3RE0A 2Y5TB 4R4FH 2BVOA 1AZRA 1JFQL 5H37G 3U1QA 3P0GB 5JLZB 1FG2A 3GEWB 4M48H 4RLDA 4OI7A 4EN3B 2WTRB 3L2LA 4IBVA 2P8MA 3HOGA 2HPOA 3LPOA 4IIQC 4LEBA 2A6JB 2WUBL 3C87A 1ONQB 1E65A 2X4PA 4HKZB 3BDXA 1U8HA 1UXWB 1E9OB 3IU4H 5T33H 5D5ME 2X70B 1LHZA 5KSBA 3VVVA 2QHRH 4ECNA 2UYLA 2NLJB 4JG0H 1YEGH 5G4NA 4IIZA 3D0VA 2F7IA 4EUPB 3ARED 1N4XL 3KLDA 2VXSL 5BV7B 2WXQA 1BM3H 1GMEA 4AYSA 4B9KC 4JANB 2PUQT 3U0WH 3BRDA 4HKJA 4HLJA 3AREC 5C6PB 4TSBL 1HI6A 4PJCF 1A4AA 5IROD 2IANE 4OJFL 2Q3ZA 1CGSH 1BZ7A 2ZWLT 2APFA 3P11L 1UQSB 1H6EA 1TOXA 4NZRL 5BW7C 5G2NA 1YEJL 3K4ZA 4OZFB 2JKSA 4ODSL 4PS3A 1JUFA 4P46A 3IPEA 4W68A 4YDVB 1ZS2A 1I7RB 5IR1B 1VZGA 3GBML 3L9BA 2XRAL 2FAUA 3FRPG 4RWHA 1J8HE 5CEXB 3LIZH 4N22A 4EJ1C 2WKGA 2AJSL 4F2MB 3AQZA 5FDWB 4YDIL 4DGIL 3MUY1 5JPNA 3KXFB 1HXMB 1KLGA 2J21A 3P54A 4X9IA 5E9DD 1RAMA 4HWEL 3T2OA 4HLEA 1NEUA 1WV7T 3TEWA 3BLKA 1AD9B 3OKEB 3U2IA 2FT8A 5DVKA 3P4NA 4PJ7B 4ELME 3ARGA 3BEVB 1Z0MA 5DA4A 3ABGA 1UA7A 4L8BA 5EBMB 5ANME 3LQAH 2MCPL 3SKNA 3TBTB 4Z7UF 4HF5H 4Z6AT 3D4YA 1LLAA 5LGJB 3O4OC 3U7YL 3MV7B 4X0KA 4B6ZA 4Q9BA 4A7GA 2A73B 5C08B 4XAWL 1XF2A 1OCZB 3D09A 1KTBA 4K73A 3VRIB 1YNKL 3ASWA 1BFOB 1IC7L 1Z7JA 5CJXA 1IGCL 5IFHL 3ZYIA 2BP0B 2DKMA 1O6TA 5IQLA 3COOA 3UDWC 4GW4B 4HUKB 1ADWA 2OLDA 3RY5A 2Y2YA 2R51A 3ZL1A 1EO7A 4A6YL 1BM7A 4L8SA 4N0YL 3CX5J 4PSPA 4CNIA 2QVIA 4UM8A 5E2JA 3Q01A 1HL8A 3V4LA 4Z7VB 1FNSH 2R1XB 2Z4TA 4X7TB 3VH8G 2I69A 5C8JB 3GTVA 1DVFB 5HYJA 5KW9L 3QPXH 1BF2A 2J8UB 2QPEB 4HIIB 4ZOBA 4YSSA 3L17A 4LESA 1GRWA 3C5JB 4RQQB 3QXUA 3JV5A 1NGXA 3S35H 4HCRH 1MHEA 1G7QA 4PCTA 2CBQA 1PZCA 4YZWA 5HYIA 2FJUB 1DN0A 3GSNB 3VNYA 4MTMA 2ADIA 3ARGD 3IPBA 1LDPL 1TEYA 2QFRA 2JV6A 3ATFA 5JPNC 2PWDA 1WK0A 5EIIA 1T4KA 1NC2D 3NGBB 4L1BA 5E5MA 4MS6A 3S36L 2Z35A 4UV4H 4W9FC 1CL7I 2WXLA 4Q8BA 4EEEA 2AJUL 4NKQB 2R69A 3LB6D 4K5LA 5DJ2B 1CU4H 4MX7A 3G6AB 3NZ8B 4ZJ9A 2PCFA 5IB4B 5C3LD 3IDIB 4N0FA 1XCQA 4NSKB 2BWDA 3OKYA 3E3QC 4OKVB 3VGDA 3V0WH 5C9JB 1VCAA 1UOWA 2LAAA 4AWJC 3LB6C 5CJXC 4KY1H 2PP8A 2WYHA 3ZJAA 3I75B 1UZ8B 1BZDA 1A7NL 2MQCA 2NW3A 1ZANL 3GXMA 4R26H 5HYJD 4KV5F 4RDQF 2C9QA 3RA7H 1PJ9A 4OUUB 1AMYA 3ECWA 4UT6H 5DRZB 4GSRA 2H1LM 3AW5A 5MEQA 5FGRA 2DM3A 4BWTA 1NUGA 3LZRA 2DWSA 1M05A 3RVVC 5F7KC 5JIPA 1OAQH 1T21A 1IFHL 3DIFB 4H26A 5DDHB 1BAFL 4H8WC 5EDXA 4E41B 2A9CA 2R9HD 2DQGH 2DICA 1DBAL 3QQ9D 3DPDA 5IMKB 3V0FA 4DVRL 5J3HD 3BIBX 4MCZA 2XX0A 2B15A 2WJ7A 4M5SA 4KXCA 1FA4A 3LS4L 3MU3A 4Q7DA 1HE7A 2PETA 4W4OC 4OCYL 4HAGA 4HXBH 4QXWA 4YK4B 1E3FA 2EC8A 3B7TA 4HQQL 4OCLC 5DZAA 4N2EA 4UTAL 5IB5B 4OD3L 5ALCL 4AKOA 4NZUL 1OB1B 1XAKA 2LTQB 3QQ9C 1A9BA 5GJSL 3QR1A 2XA8L 4UIMA 4W1TA 1OAYH 1PDKA 2XVGA 4K3JL 1KIPA 4QHUB 4WUUE 1CIDA 4O2FA 4KDVA 4JFPA 5HHNA 4X4KA 4L29B 1J11A 5IQOA 4OZIB 1ROWA 1HEJC 5F7BA 1M2VA 4IU3A 5HPMA 3HTLX 2W9EL 1JAEA 4MHHI 4P2QB 4PV8B 5EU7E 4OGQC 4PSRA 4ERSH 3MJ9H 3OR7B 3QIWA 1FFOB 5C07A 1QNIA 3SYQA 1DQJB 1T7XA 2ROXA 2BCKA 1EZSA 3NN8B 4G5ZH 4XPFL 1OL0A 4NN6C 1V05A 3ARVA 4NI3A 1ZA6B 2AQPA 4JVUA 3MO1B 4NPYA 2XTLA 4HIJB 3CN2A 3ARSA 5HJDA 4Q2ZA 1A6UL 1UJ3A 2B4CC 2BJMH 4W93A 3GSUB 4EDXA 3NTCH 2DIEA 4LSPH 3ZT6A 1J87A 1TZOA 4QXVA 2IMMA 1XSOA 4HYTB 3ESMA 1MFUA 1WT5A 1KCVH 2YSSB 2EXYD 4RMVA 3VXQB 1QSED 1RSYA 1ZXQA 3D48R 3A6BH 4Q0XH 3D18A 3VFSA 4F37K 3BRGC 4LDLB 1DVXA 3LHAA 3EDFA 3ARTA 1L7IL 4G6FD 2B0SL 3T04D 3DETC 1TSRA 3AUWB 5HXMA 2O5YH 2YARA 4NO3A 3RL2B 4XBPA 3UJJH 5TGBB 4QRAA 2WINA 5I8CB 2JJSC 4KFMA 4OJEH 1G0XA 3FU7A 4QTHA 2UUDH 3CSGA 2V9TA 4DEUA 2NY1D 4TNWK 2OM5A 1TZAA 3VD0A 2NSXA 1G7LA 1QW8A 3CC5B 2Q8BL 3IKKA 2P49B 1X9QA 4NEHB 3RGBA 1TQBC 4LLQA 3MV8A 1G1YA 1NKGA 3QIWD 1IFRA 5C07D 5I75C 2W9LA 3OLDA 4Z7VF 2GTZB 2G5BA 2XZQL 3ABMB 4L9DA 4XP9H 2VSDA 1M71B 1XGYH 4UILH 2DI7A 4M62H 5H94A 1QX1A 3T0VA 2J8UF 5E4OA 4Z3EA 4E2OA 1W8EA 1CLYL 3U48A 4M61A 1SJHB 4OZGB 4CMMA 1YLBB 3V0VA 2NNFA 2PPAA 7PCYA 3L3JB 1RERA 4DIXA 4OCWH 5EZLA 2H8PB 5DC9B 1QRNE 1UYWH 2CO6A 2A9ML 3PAVA 5F3HA 3MRJB 5IJKC 1UD8A 1CLVA 4K7PX 1OAKH 4B96A 3AVEA 2YEZB 3BD5A 4LP5A 1QO3B 1SBSL 3DRQB 4JDVB 1JPST 2CH8A 2X89A 3QIBA 1C5DA 1CGWA 2IO5A 3C6LA 3LDBB 3T77B 1A1OA 2IAMC 2ZUQC 1FL3A 1WFIA 4R6UA 4R4FL 1GZQA 3TF7C 4N20A 1QSZA 1OOWA 3MRPA 4M48L 5HJBA 5KSAB 2O5NA 4OLVH 2G9HA 3FQTA 5T8IA 2I7SA 1MW1A 3UTPE 2VDKH 2A6DB 4H8VA 3ARZA 1PX3A 5FGBA 2QQQA 2CR0A 1UA6H 2V7HB 4WWKA 3MRKA 1E8ZA 4Z3TA 3PAZA 2FQFA 4B9FA 2RAMA 3IU4L 1DANT 1VB9A 4CJ1A 3ZKSD 5D9SB 1PYWA 1PVHA 2QHRL 5D2NE 5GS2D 1PCSA 4MMZA 4JG0L 1ND0B 2BMKB 4M6MH 3RVXD 2C9UA 4PRIB 1IC5L 1DL7L 3AXLB 3NIGB 4XCNA 5TK2A 3CLFL 4ZFOL 1LK2A 4F7CB 1BM3L 2WXNA 4WO4B 1TCMA 4G7RB 4Y2DB 3VFGL 2B39A 9PCYA 4JQVC 4OD2B 4TNFA 2GBUA 3BAYA 1TYJA 1Q9OB 3L9RB 3RVXC 2M1KA 4G8AC 5IBUB 3U0WL 3DHJA 3QS2A 3ZDZF 4L4TA 1MPAH 2F8VA 4Z7QE 1ZPLA 3EOAA 5FF6A 5KEZA 1AGBA 2X9WA 3KNBB 4FLQA 4Z3HA 3LHPH 1H0DA 3VQLA 1GC1H 3OGCB 4OLXH 3UTTA 3W9EB 3RB5A 2VO5A 3VXSD 3QIBD 3DYPA 2C8NA 4MA1C 5IB2A 3TS8A 5GGTA 3SKOB 1J9QA 3C6LD 5DVMA 1F18A 4O5LL 3JBG7 4LLMA 5AW2B 1S78D 3WY4A 4QTIL 3DX6A 4WEMB 4BGDA 1FRGH 5DMKA 3N04A 1JGEB 2EEXA 4D0CA 5CJOL 2YXFA 3NIDF 5C0DA 4XGZB 4I0PB 1JDCA 1QQDA 1AXTH 1BFVL 2JQMA 2FCBA 3DROB 4WWKD 1S78C 5F88A 5BZXA 2Z8WC 3VXMA 1BX2A 4A2HA 8CGTA 1NCWH 2NMSA 4N2HA 1EXGA 3KBEA 4QLRA 5IMMA 4AIZB 2UWEF 4GUPB 5D5MB 4F8LA 3EJPA 2AXGB 4R8WH 4HF5L 2C9SA 5FGBC 1IC0A 3K72A 3RVWD 3QFDB 4ICWA 4YR6B 1FL6A 4A39A 3B34A 4AC2A 1AD0B 4JGJA 3QARA 2VDLH 3RJQB 4Q6KA 4X5RA 1HOCB 3MLPA 5ETUA 4ZX6A 5ANHA 5F3BB 3QUYA 5CD3A 4X80L 3VRJA 5AD0A 3RVWC 1M7DA 5AYUL 4L4TD 1Y6MR 3DMMC 4LLDB 4XVSL 3UTTD 4ZSOA 2IANB 1SJEB 3TFKD 3KPRE 5JYLA 5JQIB 4E9VA 1YA5A 1O0VA 1NGWA 1Q94A 1OV8A 4U6YA 3WNJA 1QR1B 2VO8A 4DGVH 3C5ZA 2IH8A 2NZIA 1TO5A 3UTOA 4JY6B 1THAA 4XX5A 1WF5A 3EH2A 1QASA 1ZLSH 5CP7A 3TFKC 4CSTA 3T4YA 3EJRA 4XCFH 3S5LA 3L3OA 4NUQA 1J8HB 1I75A 2NY0D 4HCRL 3EO9H 1TQCB 3MBWA 1EIBA 1OCWH 1I9IL 2XACC 2P5EA 4NUGH 1UD5A 5J5EA 3VXMD 4P5KA 2H1XA 5AAMA 4CDHA 2FRGP 2VXUH 2X1QA 3THMH 2I9TA 5D72H 1I4FB 1CG9B 3L2MA 1UB5A 3LH2H 2E56A 1WZAA 3BAWA 3BN9C 5AKVA 5GGRY 4ELMB 2J3SA 3IDUA 5D1ZB 3VRLE 3U4BL 1G1OA 3WFEH 5ANMB 2ENSA 2IDSA 1HKFA 2XBDA 1PGRB 3VXOB 4NO2B 4A66A 3GS0A 5EEZA 1FNLA 4G6ML 5DHYA 1A9EA 4UV4L 2NY3B 3N55A 2EXWD 3OMNB 4WGVB 1V10A 2KPNA 4F1ZA 2QDVA 4PHXA 2Y7QB 4X5WB 1CU4L 3QUYD 4AGPA 1MCDA 5IJVA 5E2UL 2Z4QB 2I5YH 2RFXA 3BAXA 5T5FH 3O4LA 3MODH 1IBFA 3ZZSA 3QCTH 1GCYA 1IAOB 2UXVA 4HGMA 1QLEB 4LEOB 2EXWC 4NLHA 4EVNA 5GS0D 4PG9B 3MZTA 1BVKA 1DVSA 4HJ0C 1JRHH 1NAMB 2Z91B 4DOHE 4UTBA 5M95B 3VG0H 1OVZA 1S7TB 4A38A 4GINA 3C5ZD 5DRNA 4PAZA 5T1KA 3HMWH 5HDBF 1NCTA 4X5PA 3LKOB 1CFNB 1FNGB 1CDUA 1Q8MA 1NBCA 3HHSA 3Q8AA 4LVOC 4TTDC 5GS0C 3OXSB 4AIEA 2CKBB 2J57A 2XJKA 2NT1A 2QFPA 3ELAT 4OBRA 3HC0A 5EFIB 4R9HA 4KZEH 1MRDH 1OAQL 2KH2B 5F7AA 2P5ED 1I8MA 3LNGA 1VESA 4JPSA 3H1ZA 2DQGL 2VR4A 1U42A 3GHBH 4GXUM 3K2KA 3D85B 1T1YB 5CZRA 1T5WA 4POZD 3ZSSA 1TTCA 3DI2B 3KGUA 1E6OL 2Y07L 3NSYA 1FF5A 1SGKA 1J5CA 3EJYC 4JO1L 5D96B 4KVCH 2WYZA 3VYOA 1CVRA 1KB5A 2AK4E 2XXFA 4C56A 1FNHA 3JT0A 3SPGA 2KDGA 1KJMB 1U2YA 1ULVA 5EU6A 3RWEA 1UA3A 4FC3E 5A2IH 2IQAB 2R2CA 3MRMB 1HCVA 1PLBA 3N9GL 5GSRA 3T0EE 3CNKA 3H3BC 3DIDA 3BZEA 5JIDA 2V2WA 3PXHA 4CA4A 3K6SB 3BZ4B 1SDAB 3B7YA 3O4LD 3TU6A 3VTMA 3V6OC 2QDWA 5D55A 3L4CA 3LZOA 5I8EB 4TUOB 3U25A 4ERSL 3MJ9L 1FH5H 4MWFA 2HH0L 4AT6A 5I17B 3RPIB 1YNTB 1N5AB 2VAAA 2EDXA 2ZP8A 3LRKA 2FATH 3NCMA 4D8OA 3IXTA 2BSTB 2QQLH 4FQJH 5GIRB 3SYCA 4MQXD 43CAA 1HQ4B 3DKHA 5JYMA 4OCNC 3OF6A 4O2CB 2BJML 3GBNH 3TFBA 4OR1A 2E4TA 4YXKL 2XTSA 2ZSVB 2BP3A 2XV3A 3VFTB 2OMZB 5EU3B 1RV6X 3B7UX 2DQ6A 2R56H 2VYRE 4Q0XL 3S3JA 4N8UA 3UIYA 4A37A 3GSRB 5HTSA 4E0RB 3WO4C 1NGYA 2X2HA 3NJMA 3BW9B 1SEBB 3EADA 1MW3A 2O5YL 2CUIA 4K9EH 1XR8A 4CKVX 1DYZA 1FLTX 1C1EH 2IC2A 4PLJD 4C56D 4QXTB 1K5NA 3UJJL 2OTUB 3WXVH 4LRIC 5EU6D 4KRPD 4WWID 1PZBA 4GLRI 5LGHL 2AJXH 3AS3A 4FI7A 4JHWL 3PV6B 1KBWA 5DEFB 3MQIA 3PGDB 4H13C 1BIIA 1GAFH 5KVEH 4HCGA 5HJGA 1RZQA 3HHMA 3UAJA 2EDTA 4LKCA 3PP3H 1IGMH 5JOFB 3EG9A 3IFNH 5IEKA 3AGWA 3JYCA 4TNVK 2J88L 3T8XA 4NHCH 1HFUA 3T3PB 3ZE1B 5E9AA 5CUSH 3QEHB 3GIVA 3DYOA 4JHAH 2WSKA 2F74B 3DVNB 3OMAB 4N87A 4AQAB 3T4AC 4XOAA 5C3IA 1BYPA 1J0YA 1R6VA 5I74C 2VERA 3OF6D 3RY6A 1X5AA 3CFDB 2MNJB 4OCWL 4HUWB 2CO7B 1VCBC 1E3ZA 3WIIH 1ORQB 2R1YB 2GSIA 1NQBA 1OAKL 2LABA 5DVPA 3OZ9H 1Q9KA 1ADQH 4G8FB 4PJBF 1VGKA 3FU9A 4N68A 4ELMF 2XTJE 4YNYB 1BMWA 3G5VB 1V3LA 4BZYA 4PFEA 1TYRA 1BXVA 1OTSD 1PKOA 5GRVK 2EDQA 3DRTA 3U6RA 2YK1H 4WJ5A 1TXKA 1SPDA 5SWQB 1MCOL 4UNTA 3PP4H 4JPQA 1KXHA 1JK8B 1RZGB 4JRXD 1OTSC 1IV8A 4YE0A 5JIMA 4ODUB 5MP6H 2ESVA 5IQ9A 5AKSA 5JW4M 3QEQA 1UA6L 2DI9A 1MH5A 1FV1A 3S8FB 5TF0A 1V3MA 3BKMH 4MZIA 3HN8A 4ODWA 1MFDL 3RHWK 2FB4H 2X4UB 3UAJD 4KAQH 4KQ3L 2QVFB 2VC2H 5BZDA 1UB6B 5DCCA 5DFAA 2VXVH 2WGNB 2ZPKH 1P7QA 2XWRA 4CC4A 2O61A 4ODXB 4EDWH 4DUWA 3ARRA 4QXUH 3VXUE 3E80A 4N90D 1QMUA 1KMGA 5E8OB 4PJXA 4N86A 5CEYB 3KPLA 3IM1A 1ZK9A 2X0VA 3RWJA 4NGHL 3IU3B 2V7NA 5E2WH 2IWFA 5EUOE 5AB9A 1Q0EA 1A4BA 3D30A 3LHPL 1GC1L 2B3IA 1I1YB 3TNMB 4GG6A 4Y5VB 1J5IA 3EIFA 2JQZA 3SQOH 3GBDA 5CD5D 2X6VA 2GW5A 2R4RH 2YGOA 4NIKB 4PU2A 2Y36H 4HGKC 4X4ME 4TLTA 4FHJA 2DWDB 1VADB 4NZDA 4X9HA 2PXYB 4E9SA 1YDPB 2P5PA 3GIZH 3BVTA 3QDGA 3MGOA 5CD5C 5MHSE 5C3TA 3A24A 2G3NA 2ESVD 4WK4B 5L88L 3QEQD 1P69B 3I3DA 3NDYE 4NM4H 5F7EH 3WHXB 4FXTA 4FZ8H 4UINL 2ZAHA 4P3CH 4KKZA 3DVGA 1NMBH 3TCLB 5C0JA 1VFAA 1EERB 4R8WL 1ZV9A 2FYYB 5D2NB 3FSVA 3LPPA 4K8RC 2MKLC 3D0LA 5F7MC 5L6YH 2WQSA 3H9HB 4ZZKA 3GB7A 1LM8V 1M6UA 3P9LB 5F72S 4UTAA 1SDDB 1FNEA 3UJTH 1QFPA 1T1ZB 1I8IA 5DHMC 2FQDA 5I6OA 4M5ZL 3RFRA 1KN2L 1UVQB 1KGIA 1N8OE 2NY5H 3G5WA 3LKPA 4ES8A 3PHQA 4P5RA 1TCRA 3AU1B 4Z7QB 1B0RA 2QGCA 3W0WA 3ZMNA 1MCIA 3PQYA 3BZDA 1CT8A 4N0UA 5D93C 4B3VA 1HNYA 1AO7E 2EE3A 4K4KA 4X42A 3IBOA 3MRNA 4E5XG 3FQRB 4JKLA 3AT9A 5D2LE 3D25A 4MXVF 4DGVL 3VXTB 1C9SA 4I8DA 4TM9A 3D69B 1L6PA 1S7XB 4GIAA 4U6HB 1ACYL 4UT9A 3RWFA 3F7PC 1ZLSL 4N1HB 3GO1H 5SWSD 3DO7B 1FYHB 4MDIA 2BVPB 3LQZB 3QDGD 5J89A 1V3JA 3BSZH 5DEJA 1S9YB 3TV3H 4HLZG 2NY4B 4WSGA 4OIFA 4NUGL 4WWOA 4CC0A 1HAWA 3CZSA 4P4KB 4Y8AA 2HMIC 2VXUL 4PREB 3U30C 5D72L 1ICTA 2L7EA 5TTRA 4HBQA 3T08A 2GIYA 1I1CA 2F8IA 1I9RL 3JVGC 3ZHFA 5ENWA 3PJSA 3NCYS 2BNQE 1A21A 4NN5B 5C6WH 3JYBA 4AEFA 1DJHA 3AMLA 1F45A 3ETSA 1PD0A 4KXBA 3GUTA 4Y89A 4GKZA 5L4FA 2V2XA 2Q1EA 2A4ZA 4BD4A 3R7QA 1BVLB 3L4UA 3H6JA 3LS5H 3QCTL 4R5VA 2EDNA 1BGXL 3W0WD 4PJEA 3EJSA 3PQYD 4RGMC 1ZOXA 3O3AA 2PO6A 3QEUA 4XXCC 1JZ5A 2HXAA 1JRHL 2ZWNA 1R3HB 3VG0L 5CSGA 4XC1H 1NLDL 4QRPE 4XBGA 3HMWL 3FQYA 4FQLL 2EVHA 3WNKA 2B9BA 1QUPA 5BV7H 2XZAL 3P2TA 1WIPA 5FO7B 3SO3C 3NCBB 4MHHG 4O02L 4RRPG 5J6GB 4U1SB 5JUEH 2BY3A 3AQXA 4MSWB 4EIGB 1MRDL 5TDOA 5EO9A 4K5MA 4DZ8A 5IP4A 4TS6A 3ZKND 2Q7AA 1W6LA 3P9WB 3ILPA 1YEEH 2BZ7A 3NSCA 4ZUTB 5EZPA 1OP9A 4AYDC 2PWFA 5C0ND 3HMXL 2OMWB 4K7PH 2HVKB 5G5DA 1U8CA 5DHEA 5DRWA 4E5XB 1NEZA 3DTUB 3T1WA 2C7FA 1R3KA 4PW4A 1H19A 3MRHB 4KOCA 5JO5A 1DEDA 5CZKA 5HYEA 3V6FB 4Y5XC 1MUJB 5DK0A 5I76B 4ACTA 2B14A 4LSRH 2IDQA 1H8NA 4APXB 1XBDA 2EDOA 3E1F1 4LKXB 1DN2A 3K2IA 3F7RA 5EB9A 3ULSA 3DXAA 4LEXH 5EMYA 2QKIB 3H0TA 3KPPA 2DPKA 2G2NA 4P57B 1E9PA 3Q2VA 4GAAA 2PO6D 4KC3B 4HDIB 3WSQH 3DVIA 3TCXA 2IPKA 1KTDB 2W94A 4N9GA 4DOHB 1SLWA 3GSQA 3C09C 2QQLL 3X1BA 4GBXC 2VMJA 5H37H 2VJ8A 1RUMH 1YHPA 1TZ8A 4ZUVA 4POYA 3GBNL 3M8OL 2PO6C 3BKYH 2DQDL 1KTJA 4D7PA 4ZFOA 3AXIA 3ZDWA 4PRDB 5E5RB 3AB0C 2X7LB 2JLLA 2ADYA 4KI5E 4DWHA 3VI4A 5HHVL 4NC1C 3BH9A 1E4XI 4FN0A 4LIQE 4OGAD 4ZBJA 5KVGE 4ZNCD 1MELA 5IG7A 1NBQA 3RWCA 1IGTA 3WKMH 1CXIA 3L5IA 3TN0D 3UO1H 4JY4B 1C1EL 5KYXB 2E7BA 1ED3B 4FL4C 3KPSE 2DTMH 3VFVA 2AK4B 1BXXA 2IMNA 4JFWA 2AFNA 1RURL 3O2VH 1AR1D 3PGFL 3WXVL 2OK0H 4YLCA 3U46A 3LKNA 2DMKA 5AYTA 4IM8A 3OKDA 1V3KA 2VTFA 2AJXL 3G04B 4RFOL 4WU7A 3SSGA 1KBPA 2C1PB 3TN0C 1CPUA 4L8DB 2P52A 3EYOA 1DFBH 1DBKL 4P5TB 1GAFL 2OMBA 4Z7QF 3IMRA 3SDYH 1PZ2A 3T0EB 4AMKH 5KVEL 3DXAD 4MD0A 1MWAB 3IS1X 3LQMA 5IKCA 3SGKA 2UZXB 4WI8A 2OS7A 3IFPA 4DVBB 3CGTA 4GKNA 4PMEA 4NHCL 3P30H 3B3BA 1OE2A 1OK0A 1HCYA 4G43A 1SBBA 4JHAL 2BHZA 4FX5A 2WP3T 4HZLA 1UXMA 4GI9A 5K69A 2BNRE 4G9DA 2A4EA 1AI1H 3P4OB 4DW2L 2ZCKL 1MLBB 4WDIB 2FT7A 2W92A 3AY2A 4PJGA 3VFUB 4PRPA 4Y8DC 3WIIL 3IYLW 2XWBA 1BD2E 2HLEB 4W6YB 1GMIA 3O11B 5CGYD 4XO4A 3SDAB 5B8CA 2X1XR 2WIIA 3MLSH 2LFGA 3QORB 5D6CA 1ADQL 2R0KH 4XB8A 3FOLB 3ESVF 2ITCB 3IJYB 2OP4L 3JT2A 1G9HA 3WELA 1I7UA 4PGCA 5L8LB 2F7PA 1QKZH 3AY4A 3OV6A 5GZNA 5E1AB 1TLKA 1YQ2A 5CGYC 4Z3FA 3BIKA 2YK1L 4DGUA 4YHKH 2NUTA 1XHHA 2VN3A 2VUYA 4MDRA 1MCKA 3PP4L 3FZUC 3QUXB 5AOMA 2MOQA 5J1AA 1G7IB 1ZTXL 2NRDA 4BK5A 5CJ8A 3QZMA 4PD4K 4WFHE 4NQDB 2K6WA 3BKML 3C2SA 1NKRA 3B9KA 4WFED 1PLGH 2FB4L 4HCRA 1MCRA 3WV0A 1INQB 2VC2L 5CILH 5M94B 3I85A 1I1AC 5C70A 3G08A 2VXVL 2K9UA 4A7UA 1D5IL 5DQDH 1SHXA 4EDWL 4G6JL 1X7SA 4QXUL 3PL6B 1BWWA 1C5CH 2CDFA 3DTXB 2WHVA 3OKLA 2LE9A 1ZLUK 3OC8A 1T1WB 1OQOA 2Q2EB 1PBYA 2YPKB 4FD0A 4Y0GA 1T2XA 4S2SA 3DHUA 5TF1H 4R4BB 5CKAA 2EUXA 3NFNB 2BOCA 3FHAA 1ODUA 4PRAB 2FD6H 1PY4A 4OGZA 3LQAC 3SJVE 1DSWA 3CDZA 1GS6X 2P80A 4UOJA 1NOLA 1OLLA 2FJFB 3SQOL 2B5IB 2XTJB 2R4RL 4Z7OB 3MV11 4JPIA 3GS7A 3SKMB 3VCLB 5B8CC 3J27A 3MGAA 4J23A 4PHZA 3RZCA 2ZXAA 3U0TB 1AE6L 3GIZL 3FPYA 4J3TA 2AANA 3FCTB 2I26N 4DN3H 4M3KB 3FTSA 1JPFA 2CA3A 4X9FA 4PS4L 3AY4C 1JI1A 4C58B 2QR0B 3N3EA 5HVHB 1JDAA 4NM4L 5F7EL 3B9KD 4MD5A 1C08A 3WGVB 3ENEA 4FZ8L 5EU4B 2QLYA 5BNXD 4P3CL 1XDTT 2XQBH 1EEQA 1Q72H 1TTGA 3NABH 1LL1A 1T66D 2XZZA 4YPGB 4PGBB 4PJAF 5ICXA 1S7WB 3JWNG 5BJTA 4AE1A 2MFNA 3ARBD 3M07A 5CCHE 4KKBC 1UASA 1WFOA 3VXUB 4X5QA 2XNAB 3P2DA 3DA0A 3IGKA 4O58L 3BP4B 4BDVB 3UJTL 5EZJA 1T66C 1L3WA 3C6SB 1HC1A 3IK2A 5JR1L 2NY5L 3ARBC 3P77B 2XU9A 4P2OB 3VSVA 1P4IL 1G7HB 2DWYA 3BUDA 3PNWB 1NWOA 3OMZA 3QJZA 5EUOB 3SGDI 3H55A 1HQRB 1MVUB 2P80D 4HIEA 4MMXA 2M83A 4V2CB 4Z7WA 1U8QA 4FI8A 2ZYIA 1XL4A 1YPZE 5A2JH 3BP6B 4PQXA 2X2JA 4NQXA 1HJBC 1DJGA 3NA4A 3Q2WA 4O2EB 4D9RD 32C2B 5EC1A 3RZCD 5HJ3A 4F27A 2MPVA 5DLLA 1UADC 3FUDA 4NJAL 4XN4A 4M4RB 4RVBA 5HHME 3BSZL 4HX1A 1ZLWK 2UZIH 2B2XH 4NQSB 2R2EB 3TV3L 4XN7A 2KT6A 4RSVA 2DZEA 2IDTA 4HZAA 1DJYA 3L3GB 4JFXA 5KSVA 3CFKB 3D34A 2E75C 4F15C 3VFWB 1KY7A 3D1MC 1JHTA 4LU5H 1XF3B 2RACA 5L9DH 2NNCA 2IWGA 3D08A 3KL3A 5DD1H 2CBTA 2J2ZA 4MZ2A 1HL5A 5LKNA 3NH7L 4UNIA 4Y9CA 1LO2H 5C2BH 2J73A 5HGBB 4QLWA 5EPMB 2BXZA 2CRIA 3FH7A 4UTCA 4QHLA 2WMPA 1F1GA 3ME0B 5D7IE 1TYEB 3WAKA 2YXMA 3FT3A 4PCSA 4Z7NF 1C12B 5TH2A 1ZT7A 3UGUA 2VQ1B 4RGNE 1HILA 1LO0H 2KBGA 3NJVA 1G6RB 1U8OB 2GTWA 3NJIA 2CLVB 1HHJB 3M1OA 2LU4A 3VD5A 2ARWA 3HE6A 4GKSA 3WE1A 2V9RA 2YMTA 4PRHA 1AO7B 3NDZE 5DMJB 1ILSA 3G6DH 3US0A 5D2LB 3CHQA 5ICYB 2DB8A 3HNVH 3BKJL 3MLUH 1JFHA 5BV7L 5JOPE 3F04A 5GPRA 1HIMH 3X1GA 4H1LG 2YGPA 3BWAA 5JUEL 2W80C 2WK2A 5JXEA 1GGCL 5BRZA 5FYLE 5IHUH 3D50A 4WI0B 1BJ1J 5E4IA 5HDWA 3STZB 2OCFD 2BY1A 5KBNC 3HAEG 4J3WA 1Y6KR 1S9WA 2HX7A 1B2YA 2FQEA 1U91A 4K3DH 1SOQA 3WE6B 1UGNA 1HN1A 4K7PL 4AGMA 4R7NA 4PIRF 3ROLA 3SYAA 1AG0A 2JKXA 4ZRGA 1D9KA 3IB4A 5E6IB 4P3DB 5AZ2L 3MGTA 5EN3A 3ZUCA 2P5WE 4FTVA 3UGEA 4C83B 5CEZE 2BNQB 3V5HB 1MOEA 2BSBA 1NUNB 1HHIB 1ZVYA 2OYMA 4LSRL 2YMOA 3VWJD 2WQRA 2Y72A 4I4WB 1S2EA 4K71C 4XXDA 3Q13A 3HBZA 2ZUWA 1GYAA 3HZYA 4Z7AA 3HLAB 3HE6D 3OKKB 4O51A 1INEH 3B9EA 4N2IA 4JFHD 3VWJC 4KBPA 4XCYA 4PRHD 3C08H 4X8GA 4F8PA 4IGBD 3MRIA 4NO5B 4ZMYA 1WRFA 1OZUA 3NP4A 1XGQB 2KQMA 4C4KT 3GHEH 1H15B 5HY9B 1RUML 2GUOA 1QEWA 4IRJA 1EDQA 4PBWD 3CH8A 5JA8B 1SRDA 5DJ0B 5JXED 5BRZD 4WU5A 1RP9A 4AMWA 2EICA 3EFOA 3HKZA 3N1PC 4AENB 4P3WA 4HHAA 4IGBC 3MV9E 2GEEA 4LL1A 1SMAA 1LEIB 3RWHA 5IOKA 5I1HH 4LPYA 1QNZH 2V4LA 4K23H 3H8NA 5JXEC 3R1GH 1NJ9B 3LYRA 2DLGA 4GYBA 5E00B 3WKML 3WKNA 3DBXA 3MOBH 3MV8E 1NIBA 5JIHA 4FA7B 3UO1L 1CBVL 3GGWA 2ZJSL 2IPTH 3UMTA 1D9KD 2NNRA 2DTML 3GUFA 3WAJA 4FTVD 3F05A 3O2VL 3IKCA 4JM0A 4LLYA 2OK0L 4DKAA 3FCSA 2FIKA 1TZHB 2Y7MA 5GRVL 2D4FA 4HU2A 4TLUA 1QFUL 2NCEA 4JPKH 4BSVB 2FO1A 2ATPA 4KKAD 3SBRA 2J43A 1QW9A 1OM3L 1D9KC 4PV1C 5LCVH 4AMKL 3RNKA 4N28A 4AEIL 5EUOF 2R0WL 1KPVA 1V55B 2JELL 1F6LL 1H3PH 1Y7VA 1XSKA 2VZ3A 3KL5A 3VD3A 2Q3XA 1K3IA 4JS7A 1WFUA 4N3UA 4PRBA 5CP3A 3ISRA 3MYZA 5ALBH 3DUUA 1CD1B 1A3RL 3HZVB 4XNXH 1VFOA 1OGAE 1YYCA 2WVVA 4IRJD 4FERA 3S3DB 4XE5B 1J05A 2DD8H 2XN1A 5GRYA 2DJ4A 3ARWA 3GZOA 4RMTA 5MI0C 4NENA 3WMPA 3V4PH 5GS1B 3QJSB 1F11A 3MLSL 1PZAA 1MQKH 4IJ3B 2R0KL 3LEXA 2XZCH 1PW3A 3PWNB 1QLEH 3F7QA 4G80B 2G75A 2FHFA 2DLEA 2J72A 3JTTB 5EC2B 3UP6A 5B3JF 3MACH 1EJOH 4U3XA 4KOBA 5FCSH 4JPWL 3BJLA 1JERA 1F8TH 3S9DB 3S3SA 5I18H 1T7YA 4UU9B 4IKJA 1Z9MA 2DEXX 3U9PH 3UTZA 2EDMA 2D31B 4KUCD 4PJDA 1XGTA 1A6TA 3V8CA 1ZA3A 1P53A 3EDEA 3IS0X 3TA3A 3KBHE 4QHNA 3P3SA 3MR9A 1QYGL 3X11B 5CILL 1A3LH 4FFWD 4U1LA 4IBLT 1OP3K 1MCLA 4ALAL 4Z77B 2LR4A 2AABL 5D2LF 1AZUA 2NNAB 4G72B 1CDCA 3SKUD 3CXDH 1L7TH 3IXAB 1C5CL 1CICA 2BNRB 5CJQH 4Q56A 4AXWB 1VFMA 3IDYC 2VLJA 2G3XA 1EANA 1QWUA 1T1XB 2F53E 4W9EC 1BAWA 1S7QA 3WJJA 1MFAH 3UZVB 4JBSA 4XCCH 4OLUH 1BD2B 4KU1A 2ZWYA 1N9PA 4Q4IA 2XC8A 3BUYB 4MMYB 5LBSL 4WGKA 3RVUD 2W0LA 2CSPA 5AL0A 1TQUA 2CO4A 4H88L 2Q0ZX 4FNUA 4HH9A 4X7CC 4BCXA 5FAAA 3D2UB 1IAIM 2EDHA 4F58H 3RVUC 1TTAA 4OLYH 4QT5B 4X8JA 1JF1A 1L5GB 2HT3D 1EZUA 1T20A 3WLWC 2UY6B 3TA3D 3TVMB 4O02A 5CF3A 4TULH 3IMBA 2XOTA 1R5IA 1H5BC 2JQAA 4QJ3B 5MENA 2BS9A 2JH2A 2A83A 2TRYA 3U6XS 1CR9L 2XQBL 4Q74A 4XH2A 1Q72L 5I1KH 2OXGB 2HT3C 2RIKA 3QJUB 1P4LB 1FC2D 2XWJA 4WRLA 3K2MC 3HBPA 3HMXA 1OGPA 4X7EC 1CICD 2NXZD 3I6SA 3QXDB 5GZOA 1EDHA 2VLJD 4YO0B 4Z0BL 1BPVA 5TQ0L 1JNHA 5EIIG 2NY2D 3TBWA 2OMUB 4KJPC 4G11A 1JF5A 4P23B 3SBQA 3LKSB 3BUTA 2YAFA 4ZAKA 4TUKH 1RJYB 3FTGB 5EF3A 2NXZC 2HUHA 3GSWA 3WFDL 3SJVB 4N8VB 1IEAA 3HG4A 4TNGA 2NY2C 4PY8I 4J39A 4L1DA 1L9TA 1LP9E 5DTFA 1K3ZA 3MNWB 3IJ7A 3D4ZA 3OGOE 4HA1A 4XAKE 5T3XH 3IVKA 2X4OA 2NX5E 4ZW6A 2N0MA 4O4YH 3DOIA 5EORH 1QBAA 5F89B 4KKCD 1O9VA 2B2XL 5HBBA 1T83C 2FZ3A 2WLIA 4AC4A 3C6EA 1FVCB 3L7EB 4IRSA 3IAGC 2WOYA 4KO5A 4Y4HB 3IT8D 4AQZA 3CBKB 5GSVA 4W6WB 4LU5L 3UTSE 5MEND 1ZWIB 2BIIA 5LBGA