2F53D

Directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
193
structure length
193
Chain Sequence
MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIPFWQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPTSGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen
total genus 39
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53D02
3VFTA 3LN9A 2FX8H 4UOW0 3C2SA 3TT1L 1K4CA 3U7YL 4RBPH 1QRND 5DJYA 3FQUA 3WXVL 5K9OA 1CFTA 1MSPA 4M6MH 3MPCA 4MDIB 3WS3B 3IJHB 1VFUA 5IJVB 3V5HB 5I0ZA 5D8JL 1SYSB 3RU8H 5ADOL 3QT2A 1A14H 1ZHLA 3O2WL 4N8PA 2FIKA 1NUNB 4Y16C 5JPMB 3S8WA 1EHAA 4OIIH 4PJ8D 4HKBA 2NW3B 3E3QE 1C1EL 4KK9D 4Y0GA 5CJ8A 3GHBL 4LF3B 4CN6A 4ZO7A 5HGGS 1MCEA 1OW0C 1KLFA 1EHLL 1I1FB 2XNAA 3WV0A 2BNUA 3ARYA 1I1YA 1LQSR 2V2XB 4PJ7F 2WV3A 3IFLH 1BVLA 2QBWA 3TIEB 3TZVD 1CFNB 4KJWD 4IM8A 2X4TB 2D2OA 2GFBA 5LXGH 2HJLB 5IQ9B 4QRTA 1TENA 3LKPB 5F9JB 5I8KH 3QPXH 3SE4C 4PJIA 4LKCB 3BOVA 2VIRA 4I4WB 5HYSB 3G6JE 1F58H 2BX5A 3PGDA 2EIBA 4PJCA 1YMMA 5KVMC 1GOGA 4PD4K 1J8HD 2AJYL 5HDOA 4LLUA 3NIDE 5I2IB 1BZ7A 3AS3A 2E6JA 5FGCB 3BYTA 1MVFA 5FCUL 3MSPA 2A74A 2MQ3A 3G5ZB 5E2JA 2ZSWA 1DQDL 1AKJD 1BLNB 4HWEH 4JFED 4JE4B 4K7PX 1XF5A 2DRUA 5EU3B 1G7HA 3VGBA 4WTZA 1OAKL 2BNQA 4JDZA 1BZQK 4JRYA 4QHUA 5B3NA 5KSBE 2OR8A 4D0CB 1CDJA 3MLSL 2OXGA 1NGPL 3MMEB 4GQ9H 1MWAH 2PYEB 2VDKL 5HI5D 1M7IA 2JJUA 4U2YA 4NZUH 2DQFB 5GHWH 4WTWA 2BVUA 2C3HA 1HH6B 1KEMH 3MBEC 5DJAB 3ROLB 3T1FA 3DMMB 1F4YL 3V0VA 1JMXA 3QXUA 1UZ8B 3CUPB 4LARL 4N9GA 3QO1A 4FQJL 1CD1A 3MRFA 4ALAL 2XG4A 3LOWA 4GXVH 1YN6A 3HMXH 1OP3H 4G9FE 3WIFB 1RUQH 2X10A 1BWMA 1WZ1L 2PNDA 4HS3A 4PJXF 3GMRA 4NNYA 1NGXA 2J8UB 1XF4A 3V6FB 5FUCE 3D9AL 4EIGB 1NBZA 4QHLA 2GITB 1TZHA 1RZKC 1I9IH 3WFBH 4YO0B 1MI5E 5F9OL 3VI3E 3DXAA 1GRWA 5FB8A 3C6LC 3FL7A 3VFGH 5KVDH 4OZHA 5IQ7L 1T20B 2H32H 4MAYA 3GJFA 2B39A 3RTQD 1CQKA 2GJJA 2QADC 2WINA 2IPKB 4FFZH 5JIHA 4KK5C 3LRSB 4F37F 5IW3A 2R1YB 2GT9A 3WL9B 3ARDA 4LKXA 5BV7B 4ONFH 3Q3GB 5FXCH 3LEXA 3N06B 4LK4A 2EE3A 3GJEA 1ZGLB 3L95A 4NQCA 3ARFA 5EULV 1IAKB 4WCYL 1NGYB 5CJOL 4D0CA 3KNBA 5J8OA 3EOAA 3FZUD 2PYEA 3FFDB 3BP5A 4OCLC 1XIWC 1VCAA 3QEQD 1M7IB 3VA6A 2D7NA 4AEHH 4LFHD 4KQ4H 3VWKB 4L3EB 5GGUA 5I6XC 5IHUL 4Y19A 4TTDD 2QQKH 1FRGL 2ADFH 2CMRH 4ODUA 4Y7MA 3MRKA 3WO4B 3UJTL 3SDAA 4PS4L 5D1XD 3FKUS 4I0PC 1QR4A 5BO1H 4K7PL 4G7YL 3RIAK 2Q8BH 2XTJE 3SGDH 1T0MA 1OAQL 4NJAL 3IJHA 4Y8AA 3U7AA 3WNMA 4LLWB 1B0RA 3TA3C 2FCBA 4X99B 1OAXL 4WNQA 1RIVH 5E08H 1D5XB 4GRLA 5D1ZA 2VZVA 3KPMA 1ZEAL 2P24B 2UVFA 3O6FD 3MV9B 2NY2C 2XA3A 1G7LB 1HHJB 4U49A 2G9HA 3G6JB 3QIUC 4JO3L 1PW3A 5JW4Q 1DL7L 1K85A 4NM4L 4D0DB 5D71H 2ORBH 5FO8B 2BC4A 2LFGA 3GBNH 4DZ8A 4YR6B 4XPHH 5L7XL 3OKKB 4ZTPH 1OSZB 4LF3A 3U7YH 4Z9KB 3K4ZA 4N1CA 5JW4N 1PVHA 3TO4B 3V4PH 3B43A 4WU5B 4XVTL 3B9AA 1FL5B 4E0RA 2XNAB 2AXGA 1I7ZB 1ZS8B 5KTEH 3BX7C 1X5FA 1LILA 5IGXH 2HVJB 2HG5A 2DIAA 3BMWA 3NZ8A 1Q72L 3RZCC 4QXUL 3F12B 5KZCD 3ZDYF 4FTVA 5LAXA 3L7EB 5K9KA 4CADA 4N8VG 4IOSD 2VABA 3U36A 2EYRB 4KI1A 3BAEL 5MENA 1EDQA 2YBRB 1MWAL 4BH8B 3TH4T 3VD3A 5IWLC 2F5AL 4XPGH 4DGYL 1S5IH 4PGDB 1URLA 1QNZH 2XN9D 4RFOL 5EG6C 4UDTB 1HHIA 5E2VH 1SEQL 2P5WD 4XMKH 1LHZA 1UYWL 5TGBB 1EO7A 3VMOA 1YPZF 2FATL 1YEDA 1KFAH 3OHXA 3T0BA 1JHTB 4QNPE 1U36A 4F57L 3RVVD 4E5XA 2BXZA 2V9RA 1KPVA 3BW9B 4PIRF 1I4FB 4M62H 1BQLL 1AQKL 3ULVH 4YQXL 1ZVSB 2X89D 3U46A 3STLA 1FVDB 4Q97A 5GISL 3REVB 5D7LD 4FMFA 3H3KA 3LKNB 3QHTC 5T1KB 4MJIE 1FVCA 4JPWL 1WZ1H 2DL9A 3BD4A 3QDJD 4K3GA 2F19H 3BN3B 4NKOA 3O6LH 5CJQL 5BZWA 3DIFB 1T0MB 1NLDH 2WBWB 4Q2ZB 4Z95H 2XOTA 3CUPA 2AGJL 1F45A 5DK2A 2MQCA 1X5KA 3D3VE 1U3ZA 3RY6A 4KHTL 4RISH 4TQEH 3JVGC 1IKFL 2YUXA 4PP1D 2BDNH 3WJLC 5GS0L 5IQ7H 4PJ7E 2XQBL 1P84J 3GRWA 2A38A 2QQLL 3R1GL 3DMMA 4LCYA 5E2WH 3MJGX 4UILL 1RV6X 3QDGD 1NCWH 1B4JH 3V6BR 1W72L 5SV3A 3FB6B 1NC4D 3STBA 1NBQA 3BP7B 2FYYB 4IOFD 3OAZK 1OSPL 5HY9B 3BO8B 3LQMA 5E8EA 4GG6B 3OGCA 4HKXB 4BYHA 1TQCC 5DK0A 2XZAL 2AAVA 1FGNL 4LSTH 4C83A 2A6IA 4HIJB 3WNNA 2R1YA 5DQJA 2O5XH 2VH5H 5DQ9A 2PW2A 2OJZL 3BPLB 3PIQB 1EAPA 1BFOA 4PJIF 1J8HA 3FQRA 1LE5B 3WHE1 4DEPB 4OLUH 2ZJSL 2GY7B 1CXLA 1QSFB 4ZAKC 1QLEH 3C60D 4OSUH 3MLSH 2DQHL 3V6OE 4MJ6B 3BKCL 4CVZA 1DQQA 2Z31B 4B0MM 1YNKL 2ZUXA 1B0WA 1YEDB 3MLUL 2F9BT 3WS6C 4W6XB 4U1LA 5CEZD 3V9FA 1C7SA 4GH7B 1K5NA 4R4BA 5B39B 4OGXH 4ZYKA 2UWEB 1F4YH 3MGTA 5HPOA 1MI5D 2HFFB 4XGZA 4POZD 2B5IB 3CFCL 5FYJL 1EMTH 1FSKC 4WY7H 3G5VA 5EOTB 3MRCB 2E5EA 5D7LB 3FOLB 5GGRY 3ZLQC 3HS0A 5KSAC 2IBZX 5TDNB 4P59L 1EEYB 1NBYA 3MZGB 2R2BB 4XMLH 4W6YB 4X6EB 4NC1E 4KROD 4OGAC 4HUWB 5IW1B 3DX7B 2FR4B 2Y07L 2YD8A 4HIXH 3LKQA 2HAZA 1KG0B 4PJEB 3ZO0A 3KYOB 4G9DA 4AEFA 1I9IL 5DD3L 2D7TH 2HLAB 4KJQC 1GL4B 5D1QD 2K9UA 3IETB 3QULA 4GG6E 1DQMH 1FHGA 3BXNB 4IBLT 1B6UA 2ZUTA 3QCUH 4PJCB 3FN9A 1REIA 2I27N 4X4ZA 1DLHA 4CNIB 1NBVL 2DTSA 2YZ1A 4PJ8C 1CLOH 2X9XA 4I2XB 2VIRB 4I4WA 1NC2A 5T1DL 3MV01 3UJTH 1F8TH 2A1WL 2DBLL 5EU7C 3RKDD 3G5ZA 3IXTB 1UJTA 5HD8C 4OGAD 2O5ZL 2X2YA 3VFPB 4M6AA 5A2FA 1TZGH 5IM7A 1RI8A 4XH2B 2PO6C 4OV6F 4M1CD 3HAEA 5I66A 1XGQB 3UYPA 3HPJB 1LO3H 1AGCA 3MV9D 4XP1H 2H26B 1PY4A 3C08L 2CLVB 1P7KA 5CCKH 4EN3A 5LGHL 4CJ0A 1OGTB 1T1ZB 1IGML 1KJVA 4ZQKA 5AZ2H 3KYNA 4JRYB 2R29H 4JZOA 4NT6A 1UXWA 3KJ6L 4JM2B 2E27H 1DL7H 5AG9A 3X11A 3SDAC 4NZJA 2P1YA 4PRHA 5T3ZL 1ROWA 1ZTXH 4PS4H 3B6SA 2HFFA 4XGZB 3JWDC 1CFBA 4KUZL 4XBGB 3VXPA 5AD0B 4W70A 5DJ8A 3HZVB 5DFVC 4O2EB 3SJVE 2ATKA 1K5NB 5B39A 1VA9A 5KTEL 5DJ0A 4LGPB 1N7ML 1YEEL 3THMH 1A9EA 3QIWA 3MGTB 5BXFA 3OV6A 4Y1AB 1BEYH 3O8XC 4WWKB 1MI5B 5ITBH 5EZIL 3RA7L 1MFDH 2BJML 1AJ7L 2AEQH 2GUOB 4HT1L 1WBYB 5F7NC 3S36L 1CFQA 1GIGH 1R3HA 4PV8A 5JDSA 2BP3A 2EDLA 3CDGB 5CZKA 2GEEA 2VXUH 4YFDB 4OZHB 5D71L 1QVOB 1CU4L 4XMKL 5DVLA 3P73A 4UNTA 1CGSH 1BP3B 2IBGA 1AP2B 1B88A 3ULUL 1AGBA 32C2A 2YRLA 2R0WL 5IVXB 3P0VH 1D6VL 5D1XB 5T3ZD 4LPCA 4PB9H 1DANT 3DUUB 2LE9A 2EDEA 1V7MH 3GKWH 1LNUB 5D7KD 4W4NA 2VE6A 4KDTA 5GXBB 1T7YA 5MEOA 5DEGB 1CQYA 3UTTB 5F88A 1SMAA 4EOWL 3DROA 4NQVB 3DVGB 5IWLA 3MGOA 3K2MC 3VXUD 1P9MA 4LKCA 3U0PA 2QHRL 4NRZA 4NQDB 4S1RL 4AIZB 1MAML 3BQUD 3LH2H 4BJLA 2IAND 3NN8B 2AGJH 4ZQKB 2EDKA 3VXOA 5GGSY 3OBAA 1GPOL 1L0YA 5JW4M 4AT6B 2VXTH 2Y06L 4OGXL 4OGYH 5KVFL 1H3XA 2VLKB 4AENB 2CJUL 4FXKA 5DD6A 4U0RC 3BP4B 3DURA 5ANME 2WIMA 1DBJL 3QXAA 4U0RB 5I8OH 3U0WH 1JHLL 1UXWB 1OTTD 3MYZA 2EDOA 3TFKC 4HKZB 4P3WA 4N5ED 5EU3A 3PWPD 4QLRA 3GSUB 4KJPD 2AXFB 3ZKSD 4X7EC 1XZ0A 4PJ9D 1J88A 2ZSVB 1JGUH 3LKRB 5EFIB 2I9LA 3MRPB 4JKWA 4J3TA 2F19L 3OZ9H 1UH4A 3ES6A 3O3BB 5SX4I 2NZIA 4YE4L 1WBYA 4NKDB 5C07B 5SX5H 2X89A 1IBGL 2RB8A 4P5MB 3CDGA 3MOQA 4WNQB 2FBOJ 3VE0B 3NCEB 2IF7A 4DKFH 4WUKL 2VOTA 4PJFA 3ARXA 4K3EH 1FFPA 3IDIB 5CMAA 2YUWA 2WUBH 3GMPB 4R4ND 1S7TA 5I15H 3CFIC 1I9RH 4ELMA 2BOCA 5E2UH 1FCGA 4Z18A 4WHTA 1JYWA 3JUZA 2XA8L 4WU5A 1HH9A 4MQSB 4APQD 1MCOL 3FOLA 3CCHB 1EEZB 4HULB 3V6OC 4R2GC 3T4AB 5KSAA 3NZ8B 5CEXA 1EK3A 2VLRE 2JIXA 4MQ7A 5JR1L 3BE1L 4UNVA 4KRMB 2X9WA 3UO1H 4N0RA 4W4OC 2X1QA 5HDQL 1AGDA 2W0KA 1U0QA 1AGFB 5C9JA 1K3ZA 3E3QC 1GZPA 4JJHA 1A5FL 4H88H 4QRRB 2HG5B 1H5BB 1RJYA 3FOMB 3B9DA 3ZSSA 1D5MA 4UQ2B 3QCVL 3QIUD 4XHJC 1IGCH 2DN7A 3BRFA 2E7CA 2VLKE 1K4DB 4DUXA 5IW6B 5HVWA 3DVGA 5GRVK 1LO5B 43CAA 5T3ZH 5I1DA 2EXWC 1CFVH 2HVKB 3CX2A 3HPJA 2YKLL 3GO1L 1K4CB 1P4LB 4GT7A 3DOSA 4RAVB 1EGJA 3QDGB 3RKPA 4HCRH 5BW7C 5I71B 5IOPA 3QG6A 2ENSA 1N7MH 3MLUH 3EBAA 5C6TL 4KI5E 3MXWL 1WC7A 3SDDC 1RZIA 1KTRL 4XBPB 3NCFB 5EZJA 3H9SA 1PAMA 4ELKB 5DJYB 3QQNA 2YA2A 2Y25A 5J1AB 5EUOA 5EZIH 4U0QB 2C9AA 4S1QL 3V7AG 3FONA 3RAJL 2GTWA 1NUGA 1DANU 4NOBA 5ITFA 4P48A 4Z7QE 5AZEL 5MEQA 5I8KL 3LN4B 3VFOA 5EN2A 1LEKB 5J06A 2AJSH 3QHFL 3VRJB 1MI5A 2Y1VA 2OSLB 5CJBA 4EI5A 2AS5M 3QEHB 4F7CA 4TNVK 5E9DB 2Y07H 2LU7A 1MOEA 2R8SL 5DR5L 2NLJB 3NPZB 1UM4H 4ZS7L 2ATKB 1I1AA 2D7TL 1IGIH 3ALPA 2VNCA 4P5TB 1ED3B 2PO6D 1U8MB 1ZKAA 4XXDB 4D3CL 4K94L 1MQKL 3MV7E 1T4KB 4QGTA 3MLVL 3EDEA 3MRMA 4P2QB 3FO1B 3ZTNH 1ZVYA 1JWSB 4BFEA 4LMQE 2E8YA 5LQBH 4S1DD 2YEZB 4GKNA 2IAMC 5DZNA 1BFOB 4LBEB 3UTOA 1J8HB 3FQRB 1A7RL 1QVOA 1BVKB 2OTUB 4CVUA 2AK4D 1E4KA 4ENED 4L9LB 1VADA 4LP5A 4X80H 5LJYH 5C0AE 5C0DB 4XNXL 4J8RA 3PL6C 1MJ8L 3BN9C 5HYSG 2XTLA 2FJHB 4NN7C 1U92A 2BMKB 3VCLA 2ESVE 3DXAE 3QNYA 2MFNA 1XR9B 4IMLA 3P2TA 4L8BA 2B20A 3H9SB 1F3DJ 1AO7A 1VEOA 1I1RA 2CLRA 3OF6D 5HGHB 4Y4FC 1TVDA 4J6RL 5IOPB 5HDBE 4PJBA 2CRYA 5HHPA 4HWUA 3BEWA 5D70H 5JOPE 2FJGB 5HGBB 4N9GB 1DEEA 4RQQB 1OTUD 5BRZE 2J8OA 4J7RA 5DJAA 1MRFH 1DBKL 1IFHH 1A1NB 1QRNA 3K80A 5EU6B 5DSCB 4K7FA 3VFOB 4GAGH 5FYKH 1JPST 4FXGB 4CDHA 3G5YB 1GCFA 4F7CB 5C70A 1L0QA 2NQCA 3S98A 4RNRA 5FGSA 1KNOA 1MCOH 2XRAH 1CG9A 1G1CA 3S34H 4GKSA 5ENWA 1OVZA 4MYWB 3ALXA 3P30L 4UT7H 3NCCB 3EOBB 1CICA 2B0SL 4DTGL 2VXTL 1UEYA 4QRPE 2O5YH 1FC1A 5ICXA 4QXGL 2VLJE 5HDLA 1ND0A 4NQEE 2VC2L 1UVQA 1DUZA 5D7JC 3QCVH 1R5WA 1N6QL 5D9SB 2DIBA 2W92A 3FT4B 5IMOB 2OM5A 1MCHA 1TNMA 4XWOC 2PO6B 1BJMA 4HZLA 2XZCL 2BNQD 2HH0H 1JHKL 1JK8B 1CL7H 3WEXB 2V5MA 1OGAE 3I3EA 3X3GL 4Y1AD 3CXDL 2G60H 2VDQH 4PGBA 4F9LA 1CE1H 4WU7B 1OP9A 4ERSL 4G42B 2UYLA 5F9JA 1C08A 2D31A 3ZHLA 3QEUA 3HMWL 4NJ9L 4NM8H 4LLDA 1M1SA 3ZE0F 2W9DL 3CCHA 1BHGA 1EEUA 2VLLB 5B38B 3VW3H 4NT6B 5F6HJ 5KVEH 1KLUB 5GGUB 4K7PH 3GMMB 1H3PL 5DFTA 2BRRL 3CH1A 2H9GA 1N5AA 2B1HL 4KUCF 4P9HL 3OB0K 4RQQA 1A8JH 5F9AC 1J86A 5DMJB 1BAFL 4P49A 3WIHA 3H7BA 1YNTB 2IBZY 5J6GA 3BE1H 1EVTC 1MCPH 2SEBA 2R56H 5I74B 3UTTD 5DR5H 4GJTB 1SMOA 1A5FH 5DJ0B 4O02L 1S9XB 1WIPA 4MJIA 4NQDD 1PFCA 5I1CL 2C3WA 2XTJC 3S4SB 1WIOA 2BHUA 2NMSA 3WFCH 4OQTL 3WBDA 3WLWC 1I9RL 4N9OB 4YHOL 1IC7H 2QR0B 4RFEB 4WW1B 4MB4A 3TH2T 4GKSB 3ZZ1A 1X4YA 3C6SB 5F7YC 3DYMA 4FQIH 3EOBA 1C5BH 5I16B 5MEQB 1E4KC 4P46B 1QR1A 3MTRA 3P73B 1FO0A 4WUUE 3NOIA 3PWPB 4BUHA 4JPVL 3TBVA 3QFJE 5E6IA 1QPPA 4XP5L 1MLBB 1P2CB 3GMRB 3QI9D 2F5AH 1FYTE 3FT2A 1H8OA 3AFLA 5D96C 2FLRT 3IXAA 3HZYA 5EIQA 3S37L 2VLME 3GSQB 4HBQA 3VXOB 4HFUL 3SDDD 3QULB 1NMAL 3K8LA 3FB5B 3L3IA 4K23L 4AIOA 2IADA 5H2BA 8FABB 3DSNA 2DD8H 3S88L 2VR4A 4MLIA 1DVFA 3D6GA 5IMLB 5K9JL 2IPKA 3SKMB 1BF2A 3CH1B 5IMKB 5KW9L 3IDXL 4LRIA 3LEXB 2ZUUA 1KIUA 2DQIH 1ZHBB 1I8IA 2QQNH 3EO1B 1K9TA 4U1GC 2XICA 5ICZA 4OGZA 1QSEE 4X4MA 2OR7A 4RGOH 4ONGL 6FABH 2Z8SA 5F9DC 3MLVH 2Y72A 4HX1B 4Z7QF 5IB2B 2G75B 1RJZA 3B2UC 4YWGL 2EH8L 4Y19E 1KC5L 1MY7A 4K3HA 5F3BB 4MB3A 3IDGA 1PZ5B 5FCSH 3TVMD 2A83A 4KY1H 5T1LD 1EERB 2DKMA 5L2KD 4IDLA 3TBYB 1B4JL 1J0KA 2H2SC 3W39B 3QHFH 2AJSL 2ZNWA 1M05B 2Z35A 4PRHB 1G9EA 5J13B 4GLRH 2DTML 1CK0H 3QUZD 1QYGL 5E70A 5CEZL 1JNNL 4P3CH 5AD0A 1I8LC 3OKEA 2YD1A 1QTYT 2FGWL 3O2VL 5JXEA 4QRTB 5JUEL 4JO2H 1LP9E 3GIVB 5CILH 2I07B 1CE6B 5GJSH 4PJIB 2HKFL 2IQAB 3AAZB 4XVTH 1JGDB 2NY0C 1FFRA 4GRWE 1GYAA 4G8FA 1I3RA 4NM8L 2ITCA 2RCSL 1QFUL 1BECA 3T4AA 3ZDXE 2X4QA 5C0GA 3OJMB 2CUMA 5BZDA 4NHCH 2P49B 4ODVH 3RWJB 3O4LD 3CSYA 1JF6A 3FQWA 1JBJA 1OARH 1QFOA 2IADB 4L3EE 3V0WH 2W0PA 3V4VH 2VDRH 2A74B 5C08A 5DRWA 1JFQL 5F7KC 4EQ2A 4O2CB 2YPLB 4JAMB 2AABL 2UWEF 3CFEA 1KN4L 4RAVA 4MNGB 3QA3B 2DQGH 2O26U 3OSKA 1U3HD 3AMKA 4ZUSA 2HVKA 1IM3B 1V7NH 2VQUA 4R26L 3ZDZE 3CFCH 2ZP0T 5C0BE 4CMHB 4RAHA 4G8GE 2HTKC 4JFOA 2FECL 5ESAB 5F88B 3FB8A 4XNYL 2HT2C 4P5KA 5C0RH 5MENB 4JQVA 3CNKA 4F8TA 5EBWA 4O9HH 4N0UE 4LCWD 1EBPA 1T7XA 4Z0BL 5F3BA 3OX8A 2C1PA 3P4NB 1ZHKB 4I18A 5E94B 2FWOA 3ZYZA 2NY2D 2Z8RA 1EGJH 4XPFL 5IB2A 5DJ2B 4OD1L 4IHOB 3RVUC 2FJFB 2BOBA 2G60L 4PJDE 5D7LA 2FSEB 5HI3D 4HS8H 3QUXB 2UZIL 3GZKA 4HS6A 2NY4B 4BM7A 2Y36H 1PSKH 1RHFA 3KPRB 4Z7VF 2ZUWA 2JKXA 2CRZA 1IEAA 2B0SH 4MB5A 3NIGF 4OLWL 4YDIL 1WWCA 4X0KB 3S5LA 4YK4B 4LNRA 3RVUD 35C8H 5L8LB 5JZ7C 3I6GB 3QUZC 3BD3A 3QO0B 3HE6D 3UTQA 3KGRA 4PJGF 3VRIB 2OS7A 1AQDB 3GJFB 3X17A 1OPGL 4C56A 1DBBL 5T1LA 3A6OA 3EYOA 4G5ZL 3SQBA 4ERSH 1PEWA 2RGSA 1FC2D 3P0YH 3LVEA 1FAKT 4XNMA 4ZO9A 2E7HA 3QFJA 4QWWC 3QWOB 4RMRA 4PJAA 5GPRA 4X4XA 4JCLA 2OTUA 3CMOH 4XWGH 1BPVA 4Y2DA 5IK3B 3EYFA 1AGCB 5I73B 3ESVF 4RGOL 4YPJA 3D3VA 1TQBB 1TPXB 4X6CB 4H20L 4PJAE 1UM5H 4PB0H 3RKDC 1G9NC 3OKOA 2KZWA 4NO0B 2DDQL 4L5FH 2CKBH 2WNGA 3TBSA 2XZQL 2VXVL 1RU9L 2ED9A 1F4WL 2ZOKA 3V4UH 2J6EA 4P2OD 4ZXBD 4ZUTA 3SY0A 4H1LG 1UJ3C 3B9EA 3FFCE 2J5LC 2I5YH 3HFML 1X5GA 5HGBA 2GTZA 1RZKH 5D6DA 1MIEL 3WUZA 1VB9A 4LEOB 2O93L 1KSRA 2F58H 4N0FA 1PG7L 5D7SL 3MUJA 4TRPH 1CU4H 2OR9L 3D0LA 3MLTB 3B9VA 5D2NA 4R3SA 5I1CH 5T33H 5ENWB 5DI8B 3BESR 1N3NB 3Q0HA 3ULUE 3BPLC 5D7IB 4K23H 4QF1B 4X6FB 3GMLA 1A6AA 7FABL 1GZQB 2PN5A 1IGTA 1OAKH 2MQ0A 4RWYH 4AIXA 4M8QB 5JXEC 1UA6L 1X7QB 3C5JB 3SGEH 3QCUL 1MFCH 3V52H 3ISWA 2BSSA 3JXAA 3UP1A 3EDDA 1MFBH 4XMPH 1UB5A 2GK2A 3L9RA 3FT4A 1ZLSH 4K8RL 3IFLL 4LLYA 1J0HA 2QEJA 2WWMD 3BPCA 4HZLB 1Q9KB 1AE6L 1KBGH 2K1MA 2P48B 3TZVA 5DC9B 2GK0A 3CU7A 1DLFH 1LO3L 1FH5H 4JZJC 4LARH 2R69H 1OSZA 4CNIA 1G6VK 3QI9A 5C7XL 2BVOB 4P2RD 4PJDF 5AYUL 5CEYA 3ULUD 3O9WC 4M02A 5GZOD 1BFSA 4XNZC 5ETUB 1CF8L 1N5AB 1X5JA 1QSZA 3MJ8B 4XZUA 4BSJA 4ODTL 4RRPA 5L2JB 3SDCC 4U1IA 1CGXA 4K7PY 4AENA 4EI5C 2FDBP 1D5ZA 3TIEA 1OOAA 1UWEH 4FQQA 3OJDA 3PP4L 1KJ2B 3N9GH 4Z78A 1FL3B 4M7JH 3KPPB 2GSIB 5CWSB 5E8PB 1CDYA 4GKOA 3PWNB 3O81A 1GHFL 4HWBL 5IV2A 3NVQA 1X3DA 4PRIE 4KRPD 1XR9A 4IMLB 5I1EL 2WBJD 3GJFH 2Y6SC 4ONFL 1UXSB 5K9OB 4HGMA 4XAWL 1MCNA 3EYSH 4EUPB 1RUML 2X41A 5INCA 2CO6B 3LPFA 4JKLA 1HNGA 1JV5A 2A9NL 4PRIA 4QTHA 5C07D 5ACZA 1KB9K 1Q8MA 4KU1A 3S6CA 2W65B 1JIBA 2Y9RT 1KACB 1F11B 1YY8A 1HKLL 3BDXA 4NKOB 4YDLC 4R26H 4P4KB 2MCPL 3C8DA 3JV6B 4CDGC 3PNWA 1RJLA 5F6HI 4A6YB 4JHWH 4WEBH 5EOCL 3WMSA 4S11A 5CHNB 2ZCHH 4P46A 4QRRA 1CFQB 1QR1B 1NANH 4N0YH 1NJ9A 4OZFB 2PYFA 2OLDA 5L6YL 2H2PC 1IZKA 4Z0BH 3L7FB 3EZJB 1QBLL 4TPRL 4ZAKB 2ID5A 3GHBH 5EC2A 4F7TB 3LN5A 4H20H 4LDEB 3ROLA 3T1FB 3K46A 4G6AD 4I3GA 2FYYA 3B5GA 3QUXD 3I6GA 3TYGH 1GPOH 2YD2A 4NO3B 3DLQR 3KXFA 5CINL 2VQ1B 3BUTA 4OLZL 5E1HB 2A6KB 1P7QD 3IFPA 5ERWA 3VH8G 4FTVB 5LAXB 5DJXA 5E1AA 2MTPA 5AAMA 3IKKA 1TMCB 2AQ2A 5E5UB 4AEIL 4P3DA 4TRPL 2X7LA 5DK3A 1U8HB 1FGVH 2AXJA 4Z0XA 3RP1A 1QRKA 5FYKD 4YFEA 2WANA 4ORZC 1WT5A 4TNVF 7FABH 1JGEA 1P1ZA 1MHPL 5INCB 4J3SA 4I48A 1IGIL 3DV4B 4DOHB 3CX5J 3IJYA 3O4LA 1FNAA 4IOIB 3O3DB 3TN0A 4DKFL 1UCTA 2YPLD 4KV5E 4KI5C 4NIKB 4QTIH 3QQ4B 3L3OB 1NAMB 4ZPTA 5I15L 1W72B 1B0GA 3I84A 1SY6H 2GJZA 3NZHL 5C0CD 4I3SL 2V17L 2AP2A 4OCSL 4WHYH 1J0YA 4UTBH 3EIFA 3FHAA 1ORSA 3M8OH 3RJQB 2VN7A 3RBGA 3BSZL 2EDXA 4PB0L 4Q2ZA 2ZOLB 2RR3A 3U6RB 5DK2B 3UDWA 1PKQB 2ILLA 4ODXB 5DJ6B 2Q86B 3PP3K 4X6EA 2EDNA 5HDQH 1FNEB 1Z3GH 2N4IA 1KJ2L 3CIQA 1AIFB 4N0CD 2EIZB 1J8KA 2BSRA 3VH8A 1G7MA 4G43B 5E2TH 4MDJA 4JKPH 1LDPL 3KS0J 5C0GB 1OWRM 2EDRA 4WV1A 4H1LB 1KEGL 2F15A 1CF8H 4NYLB 4E41B 3CSYB 2HJFB 1AXSA 2EYTA 1ETZB 2EXYC 4KKLC 5FGBC 3VGFA 5IB5B 3VRLE 2GK0B 4AL8H 1F90L 4URTB 3GO1H 4XRCA 5T5FH 2E9BA 2EYSA 1AO7B 4F15B 2OJEA 1FQ9C 4JB9H 4QHMA 1JTPA 3GMQB 3GBLA 4HF5H 2Y7QB 4ORGA 3SDXA 3QUML 4LCIH 3TWCH 3WFBL 2MPAH 5D1ZC 4B7IA 4GUPB 4JHAH 4CUCA 1F4WH 4KKBD 2IAMD 3PIQA 4PJDA 3UPRB 4M8VA 4UBDC 4FTVD 4Z76A 1FZJB 2EC8A 4GMTL 1RUMH 3EJYD 5DJ2A 2F54A 4OF8A 4NKMA 3O6ML 1IRAY 2XWTA 4KPHL 2HWZL 3P4NA 3QUXA 1KBGL 2ED8A 4GOSA 1FYHB 1B90A 5T33L 3U7WL 4K9EL 5E95B 4JGUA 5DUBA 4JFFD 3U9UB 3SPVA 4NN6B 4XVSL 1HIML 3SEPA 5C0JA 5I30L 4J2XA 5FECA 2FD6H 4YQXH 3PQYD 4MSWA 1IL1A 1F5WA 1FDLL 3C60A 4LCCA 3UBXI 1NAML 1Z5LA 5L8JB 1QLEL 2PXYC 3I2CL 2VTFA 3AY4C 4JKKA 1CFSA 1KB5H 5GGQH 2QQKL 3U9PH 4TVPH 3MV8E 3QDJA 3JZ7A 1P69B 4RX4D 5F89A 5EIIA 1RJLB 5D96B 3G6DH 2NR6D 3W0WB 4U1JA 4OM0L 2DMCA 3CH8A 1PEZA 2QSCH 3P3YA 4PRPA 4H8WL 3H3PL 4LPUA 5HI5C 2PW1A 3D18B 1BZ9B 3LQZA 3QUYB 2EO9A 5IVXA 4YBLC 4QO1A 3KLHC 1BREA 1DBMH 5EU4B 4FZEH 1HDMB 1FORL 3AU1B 4QKXB 4M6NH 1SY6A 2M1KA 2YPVH 5I0DA 2HLFD 3LS5H 3SE4A 3EYFB 2VR9A 2H32B 4W6WB 4OCNC 3GBNL 4TULH 4LPWA 2J88H 3TO4D 3PP4H 5JMRA 1TJIH 1LGVA 5F7UA 4MA7H 5E1AB 5JXAH 5CZXD 2BFVH 2V9QA 3KXFE 5D2NE 2WP3T 4LSQL 3KLHD 1ZSDA 5FOBA 5IVOA 2AV1A 1DDHB 4DFHA 1XGUA 3VJ6B 1JN6B 1YNTA 5KS9E 4F9LC 4O00A 1BD2D 5TE7H 4KJYA 3RX5A 4LSVL 5C09E 5J1SC 4FFYL 4X6BB 1IEBA 1XIWB 5GRVL 2VKXA 5J3HC 4XCNA 3RDTC 3PUCA 5KS9A 4PJ8A 4PBWD 4UT6L 4PY7B 1N3NA 1NCCL 1VEMA 2IALA 5DT1L 4BSVA 1R3LA 3T3MF 3BRGC 1KJ2H 1YEHL 2FATH 3GMPA 2BK8A 1QSEA 5LWYL 3N1FC 4MNHB 3MGAA 2QSVA 3ZHDA 5SWSA 3EOTH 2Q7YA 5TPWL 2UVEA 1ZT4B 1JMZA 3HUJE 4YFLI 3EHBD 1R3HB 4PV8B 5HHOD 1MVUA 3GSQA 1ZTXL 1EIBA 4Z5RB 1E6JL 2EZ0D 3KPQA 3MLZH 4MZ2A 5FM8A 4QRPD 2KZ1B 3HUJF 4U6VL 4LASL 4Y5YC 3PJSA 2IPTH 5C0BD 1MHPH 3UAJC 3V0VB 4AH2B 2QQNL 4E41A 3UROR 2VB5A 3VW3L 1PD6A 3LQZB 4HJJL 2DQUL 4JFZL 4OAWB 5FDWA 2WMPA 5E8EB 4GG6A 1H0DB 4WHDA 2EIZA 4ZODA 1G7MB 1KUMA 1E0OB 2J3SA 3LRHA 2A6IB 4HIJA 1NCWL 1D5IH 3FHQA 1KJ3L 4GRMA 4ZUVB 4I9WE 4RSVA 4U33A 1TZGL 1BAFH 1LE9B 5BRZD 1G7JB 1D5ZB 4NQDA 5GGRA 4A2LA 3VD4A 4YAQA 5DRNA 2KQNA 3LQAL 1G0XA 4PRPD 5IFJA 1P7QA 2QQQA 4HCRA 1T22A 1T7VA 4IS6B 3HE7D 4XT1C 4S1SL 1FP5A 4CVZB 2AJYH 2HA1A 4NKMB 1OM3H 3VI4F 3QG6B 2XXCB 4KVNL 3SDXB 4IRSD 3GI8H 1UWXK 3MBED 2DMBA 12E8L 5CILL 3IRPX 3CK0H 4Y8DC 1FFNA 2CXGA 1CXIA 1VPOL 3DX9B 1VEPA 4OLUL 2ZJSH 4Y4HD 4I3RH 1XZ0B 1F6AB 3MOAH 1X6LA 4HMEA 3T3PF 1E4WH 2YR3A 5A1AA 3QUZB 4KRNA 1S7UB 4Z7VE 5KBNC 1YUHA 4PREB 4O51A 4MA3B 4BSVB 3UZEA 1N5YH 3HE7C 5TDNA 2CIIA 1NGPH 3TIDA 2VDRL 1HOCA 5ACLA 4DK3A 1UACH 3LHPL 4IRZH 3ZTJH 1HSBA 5KAQG 3HB3C 4XP4L 2KUTA 4JO1H 1HSAB 2AABH 4EZMA 1X5ZA 3FO1A 2OMNA 3D48R 5DJCB 1EMTL 2KL6A 1TZHB 5JORA 1KEGH 1ZE3C 5EU5A 3SGEI 3HRPA 1WAAE 1F2QA 4HSQA 5IVNA 5B39G 4HPOL 4XXDA 4NHUB 4AMKL 3OKYA 5IB4A 3SCMA 3LN5B 1AKJB 3A67H 1IGJB 1PY9A 5MEPB 2YPLA 4JAMA 4KK5D 5JXAL 2DJ4A 3PQYB 4EDWL 1RUQL 3ZTJG 4CW1A 4UOW1 2JK5A 5D5MF 3VGEA 3QUMH 5TF1L 3MLYH 5GSRA 3VXMD 5E5MA 1D6EA 1A4JB 3N0PB 4HC1L 4N1EA 3RL1A 3T0XA 2VDNH 4OLXH 4OCXL 4QCIB 1HWHB 4TVPL 2L7JA 1MF2L 2WUCL 3VI3F 3WKNA 3H7LA 4JFEA 3T0EE 3HAEG 4IHOA 3VXUA 5I1JL 3MRRB 3I85A 5GGVL 4OM0H 1A02N 2JE8A 4M1GL 4KY1L 2HP4A 5D1XA 2F74B 3ARGC 4M7ZB 1I3GH 3QZWG 4YDIH 4UB0L 4K9EH 3G6JF 3OKDB 2IANB 3ARGB 3G5YA 5SX4H 2FX9H 4PGCB 3ZL4L 3EOTL 5TPWH 4GAYB 4LCUB 3DPBA 3IFNH 2XWJA 1J5OL 2P46B 2YMXL 5EH1A 2YS4A 3LZFH 2C26A 1IGYA 1NH6A 2XPGB 4Q74A 3AY4A 2YKLH 1ZT7A 4S2SA 5ICXB 5EC1B 2X4OB 5CP7B 1CLYL 5DD5H 4HGWA 4ELME 4FRWA 5C08D 3QYCA 3SE9H 3RVTC 4HIHA 1WCQA 4DGVH 2N7AA 4P2YA 4UIMA 3MRLB 3MO1B 3PHOA 1IJ9A 5HI4D 2X42A 3P9MB 5AYQA 4HUXA 2IALB 4CVXB 4KXZH 3D39D 3RAJH 2AV7B 4GRWH 3WDIA 4LLVB 4XCEA 1A7PH 5I19H 1UM5L 3BYYA 4UINL 4X7FC 1WK0A 3DVNA 2BZDA 4TUKL 1V3LA 5IT2H 4LLDB 5JPMA 4AJ0A 1JGDA 4KAQH 3K4DA 4HV8A 3V4UL 5ID1B 1HEZA 3O8XB 4RZCB 1FNLA 3RWCA 5I74C 5CJ5A 1S9WA 4GAFB 5DFWH 1J1PH 1NCCH 2YXMA 3RI5K 2LQRA 5C08E 4QHMB 4FA8A 4O4YH 4O58H 4OJFH 3B9KC 1TJIL 3VFWA 4M7ZC 2BCKB 1MH5B 3PHSA 5BOZG 5J11B 4L4VD 1OGAD 1OM3L 1D6VH 3X3FL 2YOCA 3VWJB 2NX5A 2BNQE 4MJ4A 4RWHA 3VXMB 3CFEB 5L2KB 3RZCA 4NZRL 2WLYA 4DQOL 4MHHG 3W5NA 1LK2A 4TUOB 2VDOL 3KDMB 3FQTA 2VLKA 2OI9B 5IFJB 5FO9B 4OD1H 4NKIH 5JPNA 1T89C 3NACL 1DN0B 1E6JH 3MLZL 5I75C 4NQED 4Q9RL 2VLJD 1C7TA 3RHWK 5GGVY 4YPGA 1MFCL 2QHRH 3WN5C 5C1MB 3RZWA 3D0LB 3GMNA 4B5EA 2EICA 4R3SB 2DB8A 4OFVA 1G7JA 1YQVH 3BAEH 5GGRB 2FJGA 5HYFA 4PG2C 3GDBA 1ZT7B 1D9KB 1QRNB 1S5IL 1WJ3A 4R96B 5D5MB 5EUOE 1A64A 1F3DH 4OKVA 1S9VA 5JQ6L 4LAQL 1NPUA 2X4PA 4XCFH 2Z8WC 4U7KA 1OPGH 1ZOXA 4KGLA 4TOYL 1J0ZA 3QZWA 5A2JH 2Z31C 1BWWA 3KYKH 3EKCA 1P2CA 3HA0A 3L1OL 1HSAA 4JQXC 4U6VH 3BPCB 1CIUA 5C0FB 1SBSL 3OXSB 4O51B 4K71C 4NGHL 3VFUA 2CDFB 2AV7A 1I3UA 4OZGF 4KTDH 1WEJH 3TCXA 2VAAA 4HJJH 2F5BH 4QY8A 3LMJL 5FUOL 4WUKH 4YHYC 5HJ3A 3VXRB 5C9JB 2WUBL 4AM0B 2B4CC 2AK4E 4JY4A 2XQYG 5IMKA 3MV7A 2NNAA 4PGBB 5I1GH 5BS0E 2XA8H 5LQBL 2G5BA 3ZE0E 1ERNA 4BQ6A 3HMXA 3RTQB 5FOBB 3KPTA 2EDDA 1XGUB 1YN7A 8FABA 4NN6C 4NWUH 5C0AA 2ZNXA 3WN5B 4MX7A 3UO1L 1G9MH 3GGWB 5I17B 1ED3A 2LVCA 4X80L 3SKMA 2Z91B 1QHPA 4JR9H 5CWSA 1FO0H 1RSFA 1X5LA 3CLFL 5TFSL 4UDUB 5D7SH 3L3KB 1AHWA 3O9WD 5BRZA 4FQXB 3OG4B 3MUGB 3PV6A 4LSTL 3BKML 3X3GH 3WNLA 2F74A 4DW2L 4PJBE 3OKMB 1H8SA 2XKUA 2D4DA 2ZOKB 4F3FB 5DVNA 5KG9B 4BZ2H 4ETYA 5JDJA 1OW0A 4WFED 3MOAL 5EO0A 5FYLD 1A3LH 4Q0XL 4P4KA 4HG4J 4XPAH 5I66B 3BH8B 4YGAB 3ULVC 2M26A 4UQ3B 4KKAD 3RVTD 1NSNH 5EORH 1S7WA 1G6RH 2G5RA 4S10A 4U1SB 2DQHH 4L29A 4D9RD 1T1XB 4M5ZL 1JP5A 1B9ZA 3VFSA 1KTKE 2DQJH 3BPNC 5EC1A 4Z5RA 2EKSB 4KMQA 2E7MA 5F21B 4ZFGL 1KV3A 5ICYB 2JB6B 3H9YA 4ONHB 1J18A 3ZKQD 5E00B 3O4OC 2HLAA 4MQXD 5GGVH 3LKSB 4YC2C 3VG0L 3U4AA 3SCMC 4HPOH 5F1IB 5HDBF 4DTGH 3WKMH 4YC2B 3B9KD 2MHAB 1KXTB 1YDPB 4V1DB 5DRWB 3QUKA 4AEIH 1J05B 1T6WA 4LLQA 4PRNA 5GS0C 1RUAH 4R4FH 1A4KA 5GSVB 3FTGB 2AEWA 5TF1H 1BVLB 2Z92B 3WFEL 5CZXC 2F54E 4NUJB 2EXWD 4K3DL 4HC1H 5J1TC 3IFPB 3VXRD 4XCEB 1U93A 1X4XA 3NACH 5CAYB 2P5ED 3BWAB 5DMKA 2Z91A 3PL6B 4FQIL 1GGIH 5GQBA 3HNTL 5F9WB 4BH7B 1HYSD 3JV5A 4L4TB 4I77H 3MRQA 3WHXB 4QTIL 4KGJA 5I1EH 3D39B 4G6JH 4I18B 4QRQB 5IMOA 5HHVL 2YD3A 1DE4A 5C09D 3NFSL 4JG1H 2GAZB 4M1DH 4PUBH 3BSZH 1R3KA 1BD2E 2BRRH 3QB7C 1A6TB 1G0DA 4FXLA 1BOGA 5EO1A 4PRDA 2UUDH 3EDFA 4MXVF 4PJHE 1AY1L 3NAAL 4LLMA 4HX1A 4HDIB 1E28B 3SE3A 5J89A 2YK1L 2BVQB 1RK0B 3S88H 3HI1A 2IPUK 1FVEA 1KTLB 3N1GC 1NANI 1R24A 1HSBB 4H0GA 1D5XA 4PGEB 4XCCL 5F8QC 5ADOH 2VN4A 4UQ3A 4KZEL 4L4VB 4JCMA 3C9NA 5AUMB 5BVPL 1LD9B 1OP5H 4K3JH 1QACA 3BHBB 1N6VA 1JV5B 4QTHB 4BKLB 5HHQB 5I6XB 5DQDL 2GW5A 5EU6D 4NRYB 5EUKA 2HTLC 4NYLA 3AMLA 4GMSL 4RMSA 1DBKH 1A21A 1IFHL 3D2UB 4G80B 4WFFD 3VH8B 4HWEL 5BJTB 3WFHA 1XGTB 3BUYB 4IIQB 1FFOB 4YBLB 2EE9A 1FV1A 5KANG 5I1HH 2IFFH 5FEBA 2WQ8A 1KELH 1CLZL 3HLAB 1RVFH 2VZ3A 4I0PA 2Q87A 5SV4A 5DYOB 5TE6L 5EOQL 4HT1H 1IGJA 3DI2B 4OFYA 5JW3L 1Y6KR 2ZG1A 4QRUB 4UOJA 3VXUE 4AZ8A 3CVHA 1JI1A 5DLML 1MCRA 4AM0A 3QDJE 5F1NB 2JCCA 3CZFB 3TBTB 3MA9L 4MJID 4OKDA 1N6QH 4HAGA 4U05A 3BGFB 4YDJB 2DQCH 2BVEA 4HFUH 5IMMB 3P0VL 5IK3A 2ADJA 3C6SA 2X4SB 3E2HC 1OQOA 4TOYH 3U82B 1EUUA 5T3ZE 4Y4FD 3JV4A 1H0DA 1U8KA 2APVA 5LKNA 5AWNL 5F1KC 3KPLA 4APQC 1V3MA 1JWUB 3U9UA 5KOMC 4CMMA 4XI5C 3BW9A 1I85C 1I4FA 3D85A 3AGVA 3L3KA 5GZND 1A14L 5A3IC 4QRQA 2XN9E 1NL0H 2DYPB 3TV3H 4TTDC 4HDIA 1MJ7L 3QXDB 3PV6B 4HJ0D 4JY5H 1Z9MA 4M5ZH 2H1PH 2ZSWB 1R3KB 1JZ5A 3A6CL 1A6TA 4DWHA 5TE4L 4N8VB 2SEBB 5IG7A 1KCRH 5TJWK 4DVRL 3FB5A 3L3IB 1NCAH 1S7XA 5FYLH 1A6PA 3RIAF 1EPFA 4NFDA 3UMTA 4FQLH 2CJUH 3O45B 2B1HH 2D0HA 1SJEA 3DUHA 1CT8B 5IEKA 1Z3GL 4YHIA 5ID0B 1IM9B 3H42H 3RWIA 3SJVD 4FQJH 4BUGA 1A6UL 4QRSB 4QF1A 5SWZB 3WFHB 1MPAH 4G8IB 4ALAH 3OXRB 4JLRB 2ARJB 2R56L 4XB8A 5C09A 1FG2A 3VDBA 5DDHB 3PG2A 1HH6A 2QV2A 3O9WB 5J1AA 3QUZA 3RUGE 4Q6IB 1I7TB 4BFIA 4NPYA 4U31A 1I9JL 2X4UA 4KHXL 3PXJA 5CSZA 3REWA 4Q6IC 1ZHNA 5F70A 5T5FL 5L9DH 3TO2B 4J3WA 3GNMH 4X9HA 1RFDL 2B7DT 2YPKA 4P57A 5DMYA 4HMDA 4C4KO 3TWCL 5SWSE 1V3JA 3HCVA 1HHJA 1NGQH 4P23D 3CSPA 3TPUB 1ZA3A 2W07A 3MJ9H 3T8XB 4M5YH 3U4BH 1F02I 3T0WA 3C8HA 2V2TB 4PLOB 3FO9A 4HMCA 4PUBL 4XP5H 4YXLL 4ODHH 1KN2L 4JPKL 5FKPB 1VGKB 2RFXB 2Y5TA 2VXQH 3KPLB 4XB7A 4FHBD 4UT6H 2VISB 1JRHH 3ARTA 3PWNA 3L3JB 1CS6A 2ADJB 4I2XA 5FA3B 3MJ8A 4XZUB 3S37H 2P8MB 2OL3H 1U3HA 4F7EA 1EFXB 3NFNB 1NMAH 1IC5H 4Z7VA 3RX7A 4B41A 1R3LB 2EE6A 3SKJH 4ZYKB 4KZEH 1CWVA 2IQ9H 2XI9A 1MFEH 1C5DA 4K3JL 3G08A 3ROOA 5BW7A 1WTLA 3T2PA 1MJJA 4JG0L 2XY1A 3MRCA 3KYMA 1NGYA 2LTQC 1RUAL 1N4XH 1ACYH 3KNBB 3ARBA 2A83B 4JFFA 5A16A 3LKOA 1MVUB 2OMBA 1OAQH 3BP5B 4NJAH 3B8YA 4CJ1A 5IGXL 2XZZA 4JY6B 1AI1H 1XCQA 4K71B 5D7IF 4GAYA 4PGZA 1Q1JH 5FECB 3TVMB 5EBLA 4S1QH 5GGSA 4KMLB 4ZG1A 3DVIA 4Q9BA 4LP4A 4DUWA 4JZJA 4YHYB 5ILTH 4FQXD 2XPGA 4NOFA 3WKML 3T2NL 4JO3H 1S3KH 2HJKB 3JV6A 4Z8FL 3BZEA 3EJZD 3AB0C 4YX2L 35C8L 4X9BA 5JHLL 3TC9A 3D25A 1EZVX 3DHMA 1UJ3A 4EQ3A 5D1XC 3INUL 4HUVB 3LQAH 5EBMA 3RVXD 4A6YL 4TUJA 2YEZA 1KNOB 3ILQC 1T66D 1LE9A 2A0LC 4F33A 2NPLX 5C3LD 2JJSC 1HXMB 4RGNE 5DJXB 2XV6B 4E9LA 3P4OA 1LVEA 2CIKA 3K4AA 3I50H 3BN9D 3ZSTA 1B2WH 5KANI 2VDMH 4N5UA 3QRGL 3FB6A 1AHWB 1D5BA 3WNKA 2ADFL 5DYOA 5IB3A 1WQVT 2DICA 4OD2B 2H1PL 1T66C 4LOUD 4YHKH 3HC3L 1G7LA 3MCG1 1KOAA 4G7YH 5T3XE 1T22B 3E1F1 1JGEB 1VKXB 4HFWB 1N5YL 1SBBA 1SEQH 1GC1C 2WWKO 3RWEB 1AE6H 2HKHH 3PXHA 5SWSD 3PABA 2J8HA 4LRNH 2NY3B 1FL3A 3H8NA 4OLEA 1QO3A 1WZLA 4H5SB 2ATPA 3ZYJA 3NAAH 1AY1H 1UKQA 3BIKB 3H42L 5HHOA 4JM2D 4JFEE 1ZEAH 2OZ4A 4F9PC 2X6MA 5HHMB 5JW3H 4FABL 1Q0XH 3MXVH 1R0AL 3STZA 3PE9A 3P4MA 3SO5A 3HC0A 1TJGL 4JPWH 4NN5B 4X7TB 5I8EA 4ZSOB 1PQZA 1FL6B 4L8CA 5JDSB 1JHTA 4D9LL 4L4TD 4CMHC 4PY7A 3F7VA 5ISZD 1RFDH 4MCZB 1T5XA 5KSBF 4P2QD 3EJYC 1HINH 4GXUN 1XCQB 4X0KA 3SBWA 4MMXC 1QBAA 1GH7A 4LNRB 5HYEA 3DO3A 4U3XA 5HYJE 1YY9C 1LMKA 4Q6IA 2ZSVA 3VFGL 2UZIH 5EO9A 3TV3L 3KWWA 2F53A 1S7VB 4HAFA 3RX8A 1ZHNB 3X12B 2Z92A 1NJ9B 1ULVA 4OZFA 1KCLA 2NY6C 1UZ6E 3GHEL 4QRSA 1CIDA 4D9QD 3SGKA 2EC9U 3JTSB 5C2BH 3FO0H 4PRNB 1ZAGA 4XPGL 4DGYH 5DD1L 1KCVH 3HE7A 5D7IA 1JPFA 2UYLB 4TN9A 3L3GB 5CIPB 4LSDA 2NW2B 3NTCL 2NW3A 4OUOA 4NRXA 2J2ZA 5HI4C 4DCQA 2GITA 4WHTB 1WISA 3RVXC 4XX1E 4R97C 2LABA 1A3RL 4LIQL 1OCWH 2BNUB 5D72H 3UJJH 5DD6B 1ZANH 2F54B 4PPTA 2NX5E 3I75A 3RY6C 1FZMA 3H3BC 3OKOB 3SKNA 5CD3A 2NXZC 3GJFK 4LSUH 5L6YH 4PRDB 1QA9B 2NXYD 1I9JH 4NC0B 4PD4J 3KLAA 4TPRH 3LEVL 1TCMA 3TPUA 1D9KC 4G7VH 2M2DA 1YNKH 3FCTA 4Q9QH 3VFRB 3GNML 5E4EC 4OCYH 1LP9A 1HHGB 2CDEA 5HYSA 5EFIA 4N90D 3A6BH 3VD9A 4LHUA 4E41E 3HC0B 3EYUL 1OAZL 3BIKA 5HHOB 5I8EB 1K2DA 4NKDA 1O5DT 1X9QA 1QFHA 5HD8D 2QQLH 1I9EA 5HHME 3F8UB 1Q94A 1OP5K 1Q9OA 1IEHA 1W72H 4OFIA 3IDMA 5KN5B 4HLZG 4Y4KC 3HR5B 1BLNA 3U4BL 4L3EA 2L7UA 4FQCH 1PDKA 4LPTA 5C0JB 3GSNB 5FM4A 3MRKB 5I2IA 4Z7UB 3DO7A 1BQHG 2BNQB 4JDZB 2AI0L 1SM3H 1N0XH 3TJEH 2WBJB 2B4CL 1VACA 3VG9B 3WDJA 1SEBB 4WO4B 3DETD 3HZMB 1FFOA 1CICD 2WBJC 1KPUA 4TSAH 3C6LB 2I24N 4XNUH 1HN1A 3I9GH 3S5LG 5FFLA 2L4OA 2C3VA 3KPSE 2ZCLL 4IRJA 4KRLB 2H45A 1QLFB 5JIPA 2VDLH 5IIEB 4JDVA 3Q1SL 4OZIB 2ZCHL 3DMMD 2R9HD 2BRQA 4WW2F 1H5BA 3PWLA 1FIGH 1I8KB 2CRIA 4EVNB 1UA6H 2NW2A 4MAYC 2X1OA 2DOCA 5J13C 3CPLB 3QQ9C 1DVFD 3U2SB 3HE7B 4IDJL 3T0VA 3UTSA 2HJKA 4UTBL 3NPSB 2FECI 5MERA 3RL2A 4OB5H 1NFDB 5SX5K 3BGMA 1G0YR 4Z7OE 4P9ML 2AEIT 1BIHA 4NNYB 3UBXB 1I8IB 2OL3L 3N50A 5E2TL 1AJ7H 3PDOA 5T5NG 3VXRE 1O7SA 1IGMH 1NBZB 2P8LA 2QLVB 4JRWA 5F9WC 5ICZB 1KB5B 4UIKL 3PGFL 1OF2A 3TT3L 2R0ZL 5I9QC 3FAXA 2GQHA 4OZFH 4PG9A 4Y4KB 4UI2A 2YD9A 5EC2B 3AVEA 1UGNA 1JN6A 1KCSH 1XMWA 3ARBC 4H8WC 1QQDA 2R2HA 4A6YH 5DUPH 3OR6B 3D39A 2NZ9D 1P9MC 3BI9X 4ZOBA 4C59B 2APFA 3ILPB 2EC9T 2NXZD 5GGTH 3HR5A 4DFIA 2ZPKH 1ZLWH 4YHZH 2JF1A 1HHKB 4HWZB 3QEHA 1C1EH 3ARZA 2A77L 1BEYL 3NIFF 1U2HA 1C5CL 5I71C 5JXED 4JHZA 2DKSA 5FM5M 1IKFH 4S0SD 3VXSA 4WDIA 1HNFA 3DURB 4UMGA 1NBVH 3HR6A 4ONGH 1Z0NA 1R5VB 1JZ4A 1IC4L 4NC1C 3GB7A 5FUZH 2H41A 3GHEH 1IAOA 1QD0A 4D8PB 3HC4L 4RMTA 5T1KA 2MCG1 1F2XK 1KCVL 1OB1B 3GFUA 2VXSH 4M93B 3LY6A 3O4LE 3HG1D 5E94A 4PG2A 4R2GD 1ITBB 1QP1A 2R23B 3NCBB 1OSPH 5E8OB 4RAUA 1EZVY 1R5IA 3HCVB 4M9PA 4DGIH 2YC1B 5BZDB 1YEIH 1JE6A 5E7FA 4NDMB 4NWTL 3SGDI 4X9IA 5EU7E 2ICEA 1FO0L 5LGHH 3VG9C 1NCTA 3U48A 2Z31D 4NO5B 4NQEA 4GW5B 3L3OA 1CGYA 2BNRD 1A1OB 1L7TH 3QIWB 1MWAB 4J4PC 2DLHA 4X99A 1TVBB 3DYPA 1DQDH 4DQOH 4L4JA 3AREB 3RRQA 4HEPG 3O8XA 4RZCA 3V8OA 4ZFFA 1YMME 1SVZA 4ZAKD 4R8WH 3PGDB 4LQFL 4EXKA 4XPAL 1OGAA 1KB5A 3PDGA 2W0FA 4GO6B 4RDQG 3SGKC 5H35B 4ODVL 3EYUH 4C56B 1YEEH 4FQXA 1Q0YL 5EORL 2HKHL 4J23A 1AR2A 2X7LB 1HQRA 1KIQA 5B22A 4Y19D 4Z7VB 1D5MB 4UQ2A 3NABH 1JPSH 1BQHA 3OX8B 2VSCA 3MCLH 3MUZ1 4KQ3L 1UWXH 1A1NA 2F8OA 2X70B 5CINH 5GHWL 1KN4H 3AXLB 4DKAA 1NDGB 3K81A 4FXGA 1RURH 4KJYB 1V7NL 3R0NA 4PJHA 5D1QB 3RDTA 1ADQL 1M71A 2BSTA 3RNQB 3SDXE 4EJ1C 2R4RL 3VXNB 4UU9B 3KHOA 4PJ7A 4OFDA 3RWHB 3LB6D 4PLKC 1XAUA 4LOUC 3TNMB 5J11C 5HYIA 3O3AA 2J88L 3IF1B 2MKWA 3I9GL 4LSQH 5ALCH 5IG7B 4PGJA 4H0HB 5HPMA 4R4FL 4NGHH 4X6DA 3WO3B 1BD2A 3OAYH 4KXZI 5L88H 3D0VB 1RHHA 5D9SA 1MCFA 5SWSB 4U1MA 3MRPA 4S0TD 3HE6C 4JFQA 2NCMA 2Z93A 4HXAL 1FYTD 2HN7A 5DJZB 1AIFA 2CK0H 4DN3L 1GGIL 4G7VL 3DGCR 3QFJD 4O5LH 2R23A 5E8OA 3BT2H 2GKIA 3NZHH 1LK3H 3S4SA 1QFPA 3E8UL 1FVCB 5DT1H 1XF4B 4ODSH 5AAWA 5FV2A 4NHUA 1MCIA 2LTQB 4WTZG 1JZ8A 2R39A 1G9ML 1LO0H 4QCIA 5I1KH 4LPVA 5IFHL 3RGVD 3RNKB 1DBML 4HPYH 1P4BL 5EDXA 1ZWIA 1IMHC 1R3IL 5FHBL 1VHPA 3QI9C 1A7OH 4I0KA 4Q6YA 3WL9A 3WNPA 1X6NA 3PDOB 1ZLVH 3S97C 4AL8L 3TF7C 1CFNA 4WI2A 4NQSB 1KTLA 4JFPB 5KSAB 3OKLA 4KUCD 4JFYB 2HT3D 4LLMB 4KZDL 1XGRA 3THML 3C09C 3MV11 3BHBA 1FNGA 4PBXA 3U0TA 2CXKA 5CLTA 2DDQH 4L5FL 1EAJA 1FIEA 4LL9A 3RTQC 4FOMA 3ULUC 5B3JE 2FH6A 4ZUWA 1FFNB 1U6AH 4Y5VA 1QLRB 1M6OB 3RPIA 1IQWH 1BD2B 2HFEB 3GK8L 4HZAA 2AI0H 4ELKA 4C83B 1EFQA 3RWGB 4OQTA 1NMCC 1Q9WA 4O2EA 4ZNCD 1F97A 2NXYB 1T21A 3K7UA 4FP8H 4J4PA 4LVOB 2ZG2A 3UYRL 2XKSA 4JFFB 3VWJC 5LGJB 3QDGA 1FZOB 2AV1B 2GJ6D 1A9EB 4GG6F 1JZ3A 1PZ5A 1UKSA 3R8QA 4LDOB 2D7OA 2DQCL 4Y4HA 2OTPA 2YN3A 4QYOA 4M6OL 1DTUA 1FDLH 3HUJA 4I3RL 1U8JB 3GB7B 5CSBA 3PDDA 3RWDA 4DKDC 4QXUH 3AM8A 1KCUL 1GAFL 3QI9B 3RIFK 3CLEH 1MAMH 3LSOA 3QUKB 2YUZA 1MJ7H 3LN4A 3V7MA 5IMMA 4ZPVB 1C5CH 2EDWA 4PLJC 3T0ED 4UV7L 1IAIH 2B2XH 1S8DB 3DETC 3MNVB 5TDOB 1NFDF 4UV4H 4JPIA 4MD0A 3HRZB 4HQQL 2C4XA 1Z0MA 3OR7B 4YBHA 4HJGA 5I76B 4G9DB 3F7RA 3I02B 2I60L 2X1PA 4MNGE 2R2EA 2EDFA 2NX5B 3SO3B 2UUDK 3P30H 4UT7L 5E8PA 1DLHB 5M7QA 5D7JD 2DYPD 2PYED 4HWNA 1AQKH 5C7XH 2CSPA 4F15C 1KCSL 1N0LA 1VADB 2XFXB 3V5KA 5C0DA 4AG4L 3OZ9L 4MNGA 3BH9A 1C16A 4S1SH 1CDUA 4Y5VB 1QKZH 3SDAD 4Z7WB 4PJAF 3BISA 4R90L 4EI6A 4PJ8B 3IS0X 5ERWB 2Q76B 5FUCC 3GM0A 4M48L 4QEGA 3QIBB 3T4YB 3Q6FB 4LSRH 2HTKD 4KWUA 3CX5K 5E8DH 1EJ6A 4X98B 2NR6C 2NY0B 1SHMA 4KK8D 2NYYD 1AFVH 1RVFL 4HGWB 5IIEA 4YXKL 5DSCA 2FWOB 5JNYB 1FLRL 1YMHB 4JFXB 4XP9H 4Y4HB 1Q0YH 1SEBA 4WO4A 3HI5H 4L9DA 1FNFA 3B6SB 1LO0L 2IEPA 2GJ6B 3L5JA 3FN3A 4M7KH 1WZMA 4Y4FA 5JHDE 4JY4B 2VL4A 1N64L 6CGTA 3CXHJ 4WVRA 2BNRE 4IRSA 5E99L 4QOKB 3GSVB 4F7PA 3WLBA 3QWRD 1R3IH 1MCDA 5CZVL 1XR8A 4Y16A 4HIEA 4EDXA 4GRLB 5HJ3B 4J1UA 5D2LA 5E4EB 1G9NL 1JYNA 4ZFOA 1DUZB 1CFVL 1YEGH 3RL2B 3JWOH 4PY8I 1MFEL 2V2WB 5ESAA 3HG1E 4HKXA 1MRFL 4IIQC 4LLUB 2FEEL 1Y18B 1RK1A 3VGGA 3TA3B 5F71A 2J1KA 5FYKL 3TJHC 2KPNA 5J3HD 1WIUA 3BQUC 3B2UD 1IC7L 3HG1A 4Q9CA 1KXVC 1AI1L 4KKCD 1G7QA 3MROA 5A16B 1ZT1A 3W11C 3SCMB 2Y6SD 5JO5A 1D7FA 4HWZA 3LPGA 3CFBA 1LK3L 2VUYA 4QOKE 5MEOB 2JELL 3DTXB 4YPGB 3QFDA 4HBCH 4GW1A 5HGAB 5T1MB 3DROB 4NQVA 3X14B 3A0OA 3U0PB 2B1AL 2E9JA 5BV7C 2J6EL 2NY1B 1R3JB 1CR9L 4M93C 5HHOE 4ZFOL 4ZD3L 3Q5YA 5DEGA 2FBJL 1N8ZB 1VFAA 3QJHB 4ZS7H 2CDGA 2VLKD 3Q6FA 5FO7A 4L3CB 3D5OF 1G1YA 2GTWB 1T0PB 3DX8B 2CH8A 4MXQD 2CIIB 4HLJA 3SE8L 1OAUL 1A7OL 1CD0A 1WF5A 2NZ9C 4PGDA 2PTVA 3PHQB 2NY0D 3HMWH 4NJ9H 2Z0BA 4HK3N 3CLEL 1ZVSA 3U46B 1YN6B 5GRUL 4I18C 1E4WL 2H8PB 5DC4B 4QOKA 3JBG7 3V6OA 3VWKC 4GRWF 4P2CG 1IAIL 2P8PA 2JJWA 1BQUA 4WEUD 1H3PH 1T1WA 3ILQD 1I1AB 1WBXB 4MXQC 1HKFA 4ODHL 4GW5A 3RDTD 3C6LA 1A1OA 3G6AB 3C5ZB 1ITCA 3RGHA 3OAZH 4Y5YB 2Q6WA 5LXGL 2VJXA 3JV0A 1GGBH 1IQWL 3T2OA 3EGSB 5I1AA 3DGGB 3TYFB 3V6FA 3L9RB 1KIQB 1NGWB 1MCPL 3NPSC 1UEMA 1C8PA 1YC8A 3L1OH 1Y0LB 3RWDB 2J5LB 5CEZH 4UIMB 3MYJA 5CS7A 1T0NA 4PP2B 2GFBB 1NLBH 1A22B 5BVJA 1A1MB 1FN4B 2IG2L 1M7DA 5ESVA 3LMJH 5FCUH 5DK0B 3BZDA 1G7QB 3MLYL 1BQSA 5CEYB 4OQTH 4GW1B 2W60A 3TJHD 2ZKHL 4X5WA 1WFOA 2RCSH 4IRJC 4GBXC 2VDNL 4OLXL 1U8LA 3MNWB 3LIZH 1FAIH 1IZJA 3HNSL 2IPUG 3MUY1 3WUWB 1XCTB 5T1MA 4K8RD 5HBBA 1IVLA 3MR9B 5HHNA 1IGYB 2IANE 1EH9A 3Q6GH 1XF3A 4BQCA 3OPZH 1CK0L 3O6FB 3FO0L 1JFQH 1KGCE 4R7DB 5KSUB 4PJ5D 4YX2H 5JLZB 1LWRA 4MJ6A 4P5TC 4RFNB 2W59A 4L4VA 4PLJD 5A3ID 5GZNC 3NIGE 2AKRA 4X8JB 3WDHA 2NX5D 1MFAH 4ODUB 5D7KE 1Z2KA 5HHQA 5KSAD 2Z93B 3WIIH 2GUOA 4HUXB 5EBLB 4PRPB 4QHNA 2VL5B 1DR9A 2GJ6A 4JZJB 3KPSA 2VWEE 1IAOB 3D18A 4ZOCA 5EZJB 1NAMH 5E8NA 4XC3H 3K74B 4H0IA 4BZ1L 4ZFZB 5BS0A 4N68A 4IRSB 2UWEA 4QWWD 1JI2A 3IT8D 4KDVA 5IBLC 4UAOC 1VFBB 4NO2A 5DRXB 5JHDB 4XVUC 3HC3H 3KVQA 1ZLUK 1RD6A 2RQ8A 3QO0A 3SBWC 4M48H 3SHSA 1G6RA 5EPMB 2Q3AA 4HS8L 1AXTL 3FQNA 2AJ3A 2M8XA 1PSKL 1X5XA 4M1CC 2EO1A 1KIRA 4FQ1H 3LRGA 3EDJA 4FFZL 3ZKXB 2VABB 2W91A 2DJUA 1WUNT 2EYRA 4P0DA 2PF6A 4XP9L 3W9DB 2BVPB 4HBCL 4JRXE 4L4TA 1X5YA 1K6QH 1U8NB 3TESA 1R0AH 2B1AH 5IB1B 1F58L 2ENYA 5F6IB 5B38A 2YPVL 5GS1B 3RUGA 4HKJB 3TJEL 4Y89A 1YYLL 1F13A 4EUPA 1PYWA 3VXRA 1EGJL 3F5WA 5JOFB 4XPFH 4CU6A 1BOGB 3NIDF 3FRUA 1U8PA 5GJSL 2PXYD 1XF3B 2DI8A 5C8JA 4M43H 1A7QH 1TCRB 4TTGA 1JPTH 4Y5XC 4EN3B 4YHOH 2VZOA 2Y36L 2EIDA 1A3LL 3OL2A 4MQTB 3DHJA 3T0EA 4XTRC 3MR9A 3QHZL 3RFZC 4KKNA 1NKOA 4Y5XB 3VWKD 5FV1L 1FPTL 1VACB 2YD7A 5GIRB 4L8DA 4P2OA 4ZXBA 2BVYA 1PZUB 3REWB 4L9LC 1CVRA 5T3XD 4GQ9L 1UG9A 5EUKB 3BEWB 5E6YA 3OB0H 4OB5L 4RX4A 5B8CC 1MY5A 1NCDL 5E8NB 3O9WA 5IROA 5HGHA 4HUMB 2FZ3B 3RWFA 1H15B 5DD0H 5F7MC 2YK1H 1L9MA 2D0GA 2I5YL 1U95B 4LIQH 5TH2B 4R0LC 3WFZA 1Z6JT 4K2UH 4M6ML 1NCUA 2VLRA 4P4KC 3TEUA 5EU6A 4PJ5A 4Y5YA 4IJ3C 4L8SB 4RDQF 1Z9OA 2ZCKL 5KW9H 4LSUL 4LMQI 3SO3C 5DJDB 1UH3A 2JB5L 3MRIB 4PJEF 1SBSH 1G6RB 4U3CA 5T1LB 3W9DA 5I18H 2C3XA 4HCRL 4YDVB 1T1WB 1NGWA 1FJ1A 2A6JB 5BV7L 1FE8H 3MODH 3GRWL 3IGAB 32C2B 3GGWA 1ETZA 1II4E 3RUGB 4HUKB 1U8KB 5CP3H 1GJIA 5CEZE 3G9VA 3MJ7B 5MP6H 3IFOB 4Y2DB 1KYOJ 2PUQT 1IC4H 5I1GL 5JOFA 1UVQB 4BFGA 3O3DA 4YHML 3TVMC 3D85B 3ALWA 3IRZA 3OGOE 3FN0L 4OUUA 3I3BA 2HVJA 2QHLA 2AEPL 4LCWA 1EAPB 2DBJA 1RAMA 1HZHL 4PJ9A 1F6AA 5KSVA 3L7EA 1U93B 3OKLB 2B4CH 2ICWB 2XQYK 1GC1L 3ELAT 4GG8B 1YEKH 4HUUB 3ABZA 1BVZA 4NRZB 4AIZA 1PKQA 3MRBA 4ODXA 5ITFB 4RMQA 4YHIB 5CBAA 5LVEA 4WFGE 2VDLL 5GIRA 4OD3L 5C0CB 1N59A 2HRLA 4ONHA 1FIGL 3CK0L 1E6OL 3QDMD 4XC1H 1YNLH 5E00A 5C07E 1MWAA 4Z7UA 5JORB 4IJ3B 4L1DA 4XBEL 2Q8BL 1DQJA 1AXTH 4PRID 5C07A 3CFJA 3GIZH 5L0QB 3LIZL 1R24B 3PWUB 4P9MH 2YPKB 4P57B 4XP4H 3JWDH 4E41D 4J1UB 4TUJB 4WWKC 5BZWB 4CAGA 4I0PD 4U6XA 3HFMH 4CBPA 1A4JA 5DFVD 4Y5VC 1F4XH 2A9NH 3QCTH 1NCBL 5EB9A 1V8HA 1NLBL 3W0WE 1NGXB 2J8UA 2YRZA 4G6MH 4O9HL 3KPRD 3TCLB 3ZHKA 3VXSD 3A67L 4K8RC 2JIXB 1ONQA 3DRQA 5J7CC 4MXWH 3CZJA 3BRDA 5EOCH 3ARDB 3D9AH 5ALCL 4JPIB 1JTTA 2EDJA 4JGJA 5E24E 3FOMA 1KCKA 4PJHB 2EEBA 3PF2A 3LRSA 2MOVA 2NY6B 1FPTH 1AGDB 1K4DA 3MCKA 5CUSH 1XGPB 3TNMA 4LKXB 1QBLH 3D85D 3C6LD 2GY5A 3UDWC 4M61A 3C60B 5C6WH 2BVOA 1MJJB 2VKWA 4X5LA 3MRBB 3U1SL 4WI3A 5GRYA 5DO2C 1QNZL 1LK2B 4ODSL 5AUMA 1A9BB 4QHUB 5HYJD 2HT3C 1KFAL 1IKNA 1RZGB 5DHVB 2FX9L 1CCZA 4K2UL 1T1YA 2DWEB 4KV5F 3FMGL 1CTOA 5FYKU 5K9QI 4KKLD 1K6QL 2YZ8A 5ACZB 5EA0L 3C2AL 4KTEL 2E7BA 4HPYL 2C7UA 4G6FD 2YHGA 4J3UA 1B0RB 1LO4H 1FGVL 5FAAA 1U3YA 4KROC 2JB5H 4YBQC 4ZTOH 2H2SD 3HLAA 1WCBA 1CDHA 5SWZD 1YEFL 1ND0B 4R96A 4HIXL 2OL3B 2PXYB 4OKVB 2D7MA 4Z95L 1R5WB 5TH2A 3QIUB 3N9GL 4EIZC 5DD3H 4MA1B 2MSPA 2FR4A 3FFCD 2VITA 3S7GA 4HW6A 3B8SA 2IWGA 4LAJH 4OLYL 3CZFA 4YIQA 1OAXH 3NABL 4KJPC 1F8TL 2A1WH 2DBLH 4HUWA 4RA0C 4V1DE 4NRXB 4YLQT 4DCQB 3GIVA 1U95A 3VXMA 2ED7A 1FLTX 4B7LA 4HIEB 4EDXB 1I7TA 4BFIB 4AQOA 1YC7A 5FDYA 1IAMA 2J12B 3NN8A 4G8FB 3FQTB 3HI6L 5INDB 4QHKI 3PV7A 5MI0B 1CE6A 2F58L 3C08H 5BCAA 2ITCB 4MD5A 25C8H 2MCPH 4I2XE 1OY3B 4LSSH 1CL7I 3HG1B 4LHJB 4PJBF 1ZA3B 3LDBB 4JN2A 4HEME 1TETL 1MEXL 1BVKA 1W0WA 4L9LA 3ULVE 4KUZH 3IDUA 1T21B 1U8IA 1QEWA 5D4QA 1KCUH 1UT9A 2HT4C 3DV4A 3F7YA 4I48B 4JFDA 4CU7A 4P5MA 2BNRB 4PRAA 3VFNB 2P5EB 4G8IA 1J0IA 5TE4H 5I1LB 4X6DF 5I8CA 1JPGA 1NFDE 3P0GB 3VD7A 1UYWH 1I7UA 2EE2A 2I9LB 2P5EE 4MMZC 3SQOL 4EVNA 4DK6A 1OWWA 2WW8A 3VFUB 3W5MA 5ILTL 1CI5A 2EDTA 4KJQD 3WXWL 1P84K 3MLPA 4NFCA 4P99A 5JQ6H 2R69L 1NEZB 3FFDA 4Z77A 4MXVE 1I1FA 1KPRA 2FHCA 1W2KT 4KKAC 1S7VA 4FMKA 3VWJD 2FIKB 3ARBB 5BS0B 5HVHC 3V79C 2QADD 2DF3A 3W81A 2PTTA 1VFBA 5CP3A 1KIRB 4U1HB 2H8PA 1TPXC 5HVHB 4FQ2L 5FK9A 4NZDA 1ZLVK 5ICYA 2DLGA 2CUHA 1JNLH 4NZTH 5F7HA 4HF5L 1FE8L 1G7IA 5GRXG 3MOBH 1DQML 4HKJA 1NFDA 2MMXA 1EJOH 5C71A 1GOHA 2YXFA 2Y5EA 1CLOL 1PYWB 5DZOA 1S7SB 2D9CA 1A6VL 4GW4A 3MNZB 3V7AE 1KC5H 2HYMA 4RGNB 2G9HB 1AGEB 1C16B 2W9EH 1BBDH 1RULH 5DMIH 4XNMB 3EYSL 3DX9A 1HHKA 3FFCA 2P43B 2Y06H 5KVFH 1KN2H 4JPKH 4JN2B 2QSCL 3QWOA 2CKBA 2F8XC 5I1DB 2LU3A 3VXQB 3BPOC 2DTMH 4U7SA 4WFEE 3BZFB 5F72S 1XGPA 1A3RH 1QQDB 2R2HB 1JUFA 3ARUA 5EBGA 4HK3J 9CGTA 4FABH 4NO0D 4KTEH 4X5WB 4U3HA 3AREC 4WEBL 3BKMH 4UDTA 3OTTA 1JPGB 1XF2B 1J12A 4KMTL 4JM4L 5DJCA 1MCWM 3MLRH 4KVCH 4DN4L 1YQ2A 3DSFH 2H2PD 3SPVB 1INEL 4J12A 4JRXD 5SWQA 5L2KE 3DI3B 3ZE2E 4NFBA 1OAZH 1X4ZA 3BFOA 3IJSB 2FZ3A 3RWFB 1OARL 4QNPF 3H7BB 3S96B 4IMKA 2BVQA 2Y4SA 5C0IB 1UJ3B 2IQAA 3AAZA 5MHSE 1LEIB 4FG6C 1Q1JL 4PJFB 5GS0D 4E5XB 1A4KB 5GSVA 1W0VA 3IDIA 5CMAB 5LBSH 2D3VA 1QSED 4GMTH 5GJTH 1S7TB 2F53D 4FZEL 3QSKB 3KJ4B 2HTLD 1MREL 3U2SA 4HS3B 4Z8FH 2VXUL 4FFWC 2EH7H 1BBJB 4K55A 3RY4A 4YDVA 3MJ7A 2E6PA 1NAKH 4FG6D 4M7LH 4ELMB 1NC2B 4WI7A 1NQBA 4AG4H 3M1BA 5TDOA 3MRNA 4MD0B 4X6DE 2IANA 1A6ZB 5IKCA 1U41A 3ZE1F 5CBEA 5I76A 3BJLA 1MFNA 4PJXA 1CDIA 3I2CH 3QRGH 3QJHA 1VFAB 4XCYB 2ITDA 3L6FB 4IDJH 2H26A 5T1DH 1K8IA 1KIPA 1CYGA 4TYUA 3LH2L 1OTTC 2VLJB 5KSVB 1OGTA 3QQ9D 2RHEA 1R3JA 3HAEH 1OHQA 2O5ZH 3STZB 5HPMB 1EO8L 3VJ6A 4OFPA 1YJDL 3RQ3A 4K7FB 4OLYH 3B5HA 1BJ8A 3CFDB 1PGRB 4LIQE 1U8PB 2P8PB 4XP1L 4NCC2 4AY0A 4HHAB 5F1OB 2N7BA 3TBWA 2R0ZH 4FQCL 4JKPL 5AZ2L 1U2CA 1NAMA 4FQQB 1JZ6A 3T0EB 1QSVA 1N0XL 1B0GB 4K94C 3ECBA 3QPQD 5IFAH 4NNXB 5KZCB 3S5LB 4HV8B 5ID1A 3TBYA 4QRRE 2VERN 3S35H 4U6XB 1MELA 4U2ZA 3HPLB 4P2RA 2Q7YB 3V8CA 4JB9L 2LU4A 4U1KA 3OAYK 5IR1A 1W0VB 5SWZA 2BCKA 4LCIL 3TBTA 5E4IA 4G8EA 1RZ7H 1MEXH 3UC0L 3ZDZF 5HYQB 2YN5A 2ZUSA 2ZKHH 2ARJA 5C09B 4KKBC 1MFDL 2DAVA 3VA2C 4KC3B 2AXGB 4WFHE 3T08A 1CD1B 1TITA 2ADGA 1RZFL 4OIAA 5TDPB 3FRPG 1MHEA 3O6MH 3TCLA 3MRFB 3QP3A 2PTTB 3UZQA 2J4WH 1ZWIB 3FB7B 3PP3H 1AC6A 1NEUA 1CGSL 3UPAA 4FS0A 5HGDB 1J1OH 1KYOK 4XTRD 3MV7B 3UTZA 1WT5C 4UIKH 1TLKA 4IRJD 4C56E 1HIMH 3QR2A 4YEFA 5IEHB 2X70A 3DARA 2VLLA 1NMBH 3FFCB 2FD6L 1E27B 3ORJA 5DF0A 3EYQC 4MS8D 1IAIM 3IU4H 1V05A 2BMKA 4ZAKA 4JO4H 3EFDH 3VXTA 1A2YA 4X9GA 2EDBA 4HUNB 1B4RA 3EUUA 4L1HA 1VGKA 2Y5TB 5L8KB 4MJ2A 3VXUB 2OTWB 1Q94B 2CLVA 4GW4B 1P7KB 4FN0A 4X6CE 4LASH 5DMGD 1DBAL 2NY3C 4XC3L 5FA3A 4RIRA 1RPQA 4HKZA 5IM7B 5C6TH 2AKRB 5F7EL 5JQHC 3EYQD 3FO2B 3QDHA 4GAGL 4MS8C 4IRZL 3QAZB 2JLLA 2D9QB 4GRLD 4OGYL 1OLLA 3OXSA 1ZLSL 4G8GB 4X6DB 2B8OT 4U6HB 3MV8B 4NKQB 5DHYA 2EZ0C 5GJTL 4UNUA 1HYRC 4GS7B 4D9RE 5CGYD 3IJYB 3O4LB 3B3IA 1S7WB 2IGFH 5B4MC 3ILPA 5EWIL 2O5YL 1P7HL 3CDCA 1JWMB 3VFSB 4P46C 5GRJH 4XPTL 3NFPA 1I1YB 2V2XA 3F58H 2WK2A 5JA9A 3HNVH 3MO1A 3PHOB 4RRPG 5L0QC 2VWEC 4JRYD 4PJFE 1T89A 1KT2B 2FH8A 5ESQA 3V2AR 5HYQA 4MQXC 5MERB 1JHKH 5DVKA 2IG2H 1U9KA 5C0EA 5C0IA 1IQDB 1S5HB 5DRZA 4GKZB 1XGYH 5FKAB 1MQKH 4XI5D 2XIDA 3FJTA 4K94H 5MEND 4KVCL 4G43A 2WUCH 3BWUC 1EEZA 4ISVA 4JRXB 2QSTA 4LLQB 4HWBH 3PL6D 5T3XH 3G6JA 2YWZA 3QHZH 5DEFB 1YMMB 1T83A 2Q86A 5DJ6A 2PO6A 3E8UH 3KAAA 1RJCA 1EO8H 5IKCB 4MZ3A 5EIVA 3RY5A 3ARBD 1E4XL 4XAWH 4N0UB 4NO5A 3OPZL 4YXLH 2LAAA 3MCLL 1CD9B 2EEAA 4G42A 5MENE 3L3HA 3ZL4H 2PW2B 5EZOH 1AD9A 5IHZB 2Z31A 3S35X 5BQ7A 2YMXH 3GMQA 4F58L 2JCCF 1LO5A 2OP4L 2BNRA 4PRAB 1P4BH 4WI4A 2CGRH 4OF7A 2B5IC 4JRYE 2OYPA 2EYSB 3RJDA 3WIIL 5K9KB 3WHE0 3K1KC 4XHJD 5H35A 2OBGA 4XPHL 1H15A 4PRPE 3DSFL 3RWEA 3MRGB 4NQXB 3SE9L 5KS9B 3LS4L 4ZOEA 5I73C 1S9KC 1QO3B 2ATPB 1GGTA 4YNYB 3S36X 5CSGA 1DVFC 4LEOA 3ULSA 4JQXA 3WFCL 1A7PL 2I07A 1T03H 5GS2D 1UB6B 4NNXA 3AC0A 5DGQA 2MJWA 1EO5A 5E9DA 3V5DB 3BDYH 3GI9H 2AJVL 3BQUB 2AW2A 1XH3A 2APTA 2Z8VC 4Z7UE 4XVJH 4XXCA 2N56A 1RUKH 2CIKB 5FK9B 4UT9H 3FQWB 3BEVA 1QG3A 5F96H 4IOFC 3TA3A 3QUMB 4P23A 15C8H 1NFKA 1WCBB 1FZKB 3OKNA 2NLJA 4M7LL 3QXVA 3EFFB 5FYJU 1CDCA 2WINB 2AEPH 1N2RB 3V6ZB 1SYVB 4YO0A 4X4YB 2W0LA 3BXNA 4NQTA 2FX8L 3Q5TA 2VAAB 1AGEA 1X44A 1T20A 4EBQH 2VITB 4JFQB 4OT1H 2V2WA 1HILA 2HN7B 4JVWA 2AJUL 3RWCB 3EYVB 5GISH 2MKLC 3RI5F 1Y18A 3ZDYE 3MRMB 2DJSA 1OLZA 3CXDH 1MHHA 2HFGH 2GJ6E 1FYTA 1T5WB 4Q9RH 5IVXE 3L3HB 2BVPA 4POUB 3JTTA 1JF1A 1Q9KA 4OD3H 5CKAA 1U8HA 1E6OH 4F80A 2NY5H 3K3QA 1S9WB 2H3NB 4NCDA 4OZ4B 1IM3A 5I17A 1YECL 3SDYL 5KVGL 1N59B 4MVBD 3O0RH 3S37X 4YZFE 3RNKA 3I6LE 4PLKD 2CLZA 2FJFA 3OAUH 5FIEA 2D0FA 4JZOB 4KQ3H 4TUKH 3RIFF 2Y23A 5IT2L 4I5BB 1QFWL 1P6FA 2C1PB 4HIIA 5IESL 3KXFD 1HQ4A 4X98A 4MD4A 4LVNB 7CGTA 2QKIA 4NWUL 4XX1G 1UZ6F 5GRZA 1QSFA 4Z78B 3MXVL 4I1NB 5DJ8B 3FONB 4WI9A 4QRRD 3TZVC 2BOBB 4P3CL 4LLAA 4WHCA 1U8IB 2CUIA 3IJSA 4R6UA 1QEWB 3MFGB 2R1WA 2PR4H 3BKJL 3VGHA 5I1LA 4JVUA 3TGXA 43C9B 3BEVB 1MIMH 5D5ME 5EUOB 5I18L 2BC4B 4JDTH 1UXSA 3EFDL 2FRGP 4U6HA 5FGRA 2NY7H 5DHYB 3E2HB 2I25N 5T3XL 4HXAH 4K9EC 2C4FU 2MPAL 4JQIH 5HI3C 5JMOC 1A7NH 4G6KL 1DBAH 1ZT4A 2KKQA 5LCVH 5D93B 1DJSA 3DV6B 1T3FA 4W4OA 3DECA 4Z6AT 2ARJQ 4CMMB 1JZ2A 4ZMAT 4RFNC 5CD3B 1K3IA 4GKZA 1I3GL 2APBA 2O61B 1Y0LA 4HQQH 2YSSB 3O6FC 3MREB 4JN1L 5FYJH 5C08B 1ZLUH 1U8LB 5DVOA 3VXME 4O2CA 3WD5L 1OT1A 1FBIH 3TT1H 2CO7B 5EWIH 3L3DB 2AK1L 4X8XA 4JFFE 4FXKB 3UJJL 4OFKA 2VLJA 3TN0D 1XT5A 1ZA6A 3GEWB