2F53D

Directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
193
structure length
193
Chain Sequence
MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIPFWQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPTSGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen
publication title Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53D02
4IHOB 2YD7A 1L0QA 3CFKB 2WZPD 3C08L 3TNMB 1OARH 1SEQL 3OWEA 2R69H 4R0LA 5CIPB 1CFBA 4K7FA 5HYEA 3BXNA 1C12B 3RTQB 5F44A 1I1RA 2X70B 3CMGA 5ACLA 4L1HA 4JG0L 4ZSOB 3FO1A 3WFHB 2VR4A 1EAPB 4OM0H 5TPWH 4WRLA 4L3CA 5DJZA 4NKMA 2BVYA 1OARL 4JZOA 2R69L 4PJHB 1AGCA 1UVQA 1HQ4B 4PJIE 1YMMD 4FNLL 2AK4A 3QI9C 3I75B 3SDCD 1T2JA 5B38G 2VQ1A 1JV5B 4ZFZA 4TOYH 5BZDA 1KPUB 3KYAA 3OQ3B 1NGZA 5TPWL 2X4QB 4GBXB 2QADD 5J57B 2CLVB 3FAXA 4HV8A 4MSWA 4WTWA 3TO2A 1MQKH 3L5WA 3O9WB 1I8MB 5FKPB 4JZJA 1C08A 4XVTH 1SVZA 2F5AH 1QVOB 3P2TA 4OF5A 2EXWC 1GZQB 2V7NA 1VA9A 4E0RA 4HAGA 1BFSA 4TOYL 1Q9KA 5CZKA 1J8HB 4Z0XA 1YDPA 4PJXB 3RUGE 1PG7L 4WFHD 1MQKL 5IG7B 2NY0D 5IJVA 4GG8A 4UV7L 4XVTL 1RJZA 3MROB 2F5AL 43CAB 4XZUB 5KSVB 4MA7H 5DD1H 4FQ1L 5EU4A 3TPKA 3GSXB 1CXEA 3C8KA 3MOAH 3O6FD 1G7LA 3ZT5A 4PRHE 2DKMA 3DV6B 3STZA 5GSRB 2YS4A 1I7UB 4M43L 5EOCH 2H8PA 5A2KH 2YA1A 4MA7L 2EDFA 4KKAD 4UTBH 3RGVC 3LKPA 2D7NA 5CHNB 5CSBA 4P5MA 3QEQD 4P2QD 5CGTA 1VPOH 2ZUTA 5EOCL 3W9EA 1QBAA 3BI9X 3VXSB 1T7WA 3IGAA 4LSUH 4KROB 2GTZA 3T0AA 3S35X 1R3KA 5HYIA 4UTBL 5HVWA 1T80A 1SYVB 3G5ZA 3PL6D 1LP9A 4HF5H 1LP9F 4OD1L 5I17A 4ODUA 2F53B 4HC1H 1U3ZA 4RSVA 1A02N 3NACH 4F57H 5I71C 1QSED 5JR1H 3L3GA 1N0LA 3GM8A 3QDGA 3H42H 1UWGH 4U7SA 3MFFB 3C09C 4YQXH 4NYLA 4UBDC 4NJ9H 3QXVA 4HC1L 1XGQB 3C2SA 3SCMA 1I1YA 1UM6H 2GKIA 3FQUA 4K2UH 1X4XA 4MNQE 1FFRA 3NACL 5INDA 4F57L 4L8CB 5JW4M 1FYTB 5JOPE 2I5YH 3MV7D 1W0VB 4M1CD 4X0KB 1R24A 3H42L 1UWGL 2AXGB 1FBIH 2CLZB 2MMXA 4NJ9L 1MI5E 5C0GB 2PYEB 3TNNB 1UM6L 5LXGH 1WEJH 1HYSC 4ISVB 4EDXB 2FIKB 1MRCH 3MJ7A 1H3PH 1KJMA 5L6YL 2DIBA 2I5YL 3ILQC 5M94B 3QAZC 2DMCA 1FBIL 2BSSA 3O3BA 3B9VA 5GRVL 5FOBB 2YD1A 4JLRA 1WEJL 4MD5B 4PV9A 4U1NB 3RGVB 1MRCL 2Q8AL 2BVEA 5LVEA 4MWFB 2HG5B 4D94A 2NXYD 3ILPB 1JGLH 4JN1H 4PG9B 3GO1H 4U49A 3L7FA 1Q9OA 1G6VK 3VCLB 2QKIA 2VL5A 2AJ3A 2DB8A 1MVFA 3BE1H 2AV7B 3VD4A 1FFPB 4OFDA 4ZODA 2RR3A 4QYOA 4GAYB 3RNQB 2ARWA 3D2UD 3QEUA 1XGPB 4G6JH 4MCZB 4Y19E 2YXMA 2XY2A 1JGLL 1S7UB 4JN1L 3GO1L 1P1ZB 4MDJB 2YSSB 5IB4A 1T6WA 4PY7B 3BE1L 3GKZA 3MV9B 1NUGA 3TYFB 2ARJQ 5I71B 4X98B 3RVXC 1VACB 3SOBH 1N4XH 2WIIB 5FFLA 3RZCA 2QQKH 5GGVH 4KI5E 1MHHB 3F7VB 3LRSB 4F2MA 5KS9E 4Y0GA 1CGVA 1ZT1B 5FGCE 3IDYC 1T5WB 4ODXA 3VXTA 3UPCA 4WFFD 4L4VB 5DRXA 3I6GB 4AIZA 2MNUA 3VG0H 3TO4D 3SOBL 2MPAH 1N4XL 3OKNB 3V7AG 2QQKL 3D85B 2P44B 4CNIB 3VDBA 3Q3GA 4P23C 2APVA 5EPMB 1RK1B 1HQRB 3C9NA 3BGFB 4Z78A 1UGNA 3RWIB 5F1KC 3PF2A 4IRZH 4WV1A 4DCQB 3W9DB 5DMJB 5TH2A 1BQHB 5K9OB 4XPBH 1HE7A 4GW4B 1JF5A 4AQ1B 1T4KB 3ZZ1A 1IAOB 1E4WH 2ZPKH 3UZQA 2R0LH 4DVBB 1DBMH 3LRHA 4JRXD 4U33A 1MHPL 5KVEH 4IRZL 4CU7A 5EU6A 1DJSA 2KZ1B 3FRPA 5JOFB 3AAZB 4XPBL 4NRXB 4PREA 5JPNB 4LHUA 3D0VA 1JPFB 4PJEA 4UDUA 4W70A 1FVCA 2ZPKL 3WHE1 1MREH 4PJEF 2R0LL 1U93A 1DBML 1A5FH 2V2TA 5ANMB 2PTVA 5DD6B 2BP3A 3GIZH 1T1WB 5T3XL 1RHHA 4ODWA 3M45A 4DAGH 4NQXB 4QXTA 1RJLB 4PTUB 3U83A 3DUUA 3QH3A 1MREL 3S36L 1A5FL 2F19H 5HYSB 5F7NC 5CD3B 5I1JH 4OZHB 4A2MA 1E4JA 1LK3H 5BV7C 4KK9D 4MZ3A 4Y88A 2X1PA 3GIZL 5BRZA 1IEAB 4DAGL 2X9XA 2H2SD 12E8H 5D71L 3GSNA 5K9QI 1PKQA 3W0WB 4Y5VA 2F54E 5CD5C 5T1LB 2F19L 3DURA 1YN7B 5I1JL 1A6VH 1YQVH 2ZUQC 4G8EA 4P23B 5DUMH 5HY9A 4IDJL 5GJTH 3RZWA 1HDMB 1VFMA 1BLNB 3CSYA 3KS0H 2HJKB 1A0QH 4LMQE 4NHUB 2G75B 1JVKA 4ZOAA 2C26A 1UEMA 2WBJA 5J3HD 3IFLL 3LKRB 5HPMA 4OD2B 3CSPA 4OI7A 2HT2C 1A6VL 1YQVL 1IGCL 3I3BA 3MRRB 5DUML 4G9FB 5C09A 1FYHB 4NBYB 5GJTL 4PD4J 5GS0H 1ZOXA 4LKXA 1A0QL 2DKSA 5FDWA 1OT1A 1DBAH 4JANB 3MRCB 4PRHD 5GRUH 4Y4FB 1QFOA 3V6OC 1AP2A 3BN3B 3FO2B 1SBBA 2DQFB 4IRSD 3N50A 2ADJB 1HCFX 5GS0L 5ESVA 1LHZA 1NCDH 4ODTL 3CDFA 1QLRB 3EYUH 5H2BB 1JWMA 1JMZA 1WFUA 5FYJU 2JB6A 3BKCH 3KLSA 5IVZA 5GRUL 2ATPB 4KZDL 3U46B 4I3SH 1HN1A 1D9KA 3MJ8A 3ZKQD 4GSDL 1T22B 2R23A 3VWJC 5DMYA 1NCDL 5JHDE 2NCMA 3HC4H 3EYUL 4PLKD 2VDLH 2P46B 2YD9A 1FV1A 3BKCL 1UB6A 3IJHB 1KXQE 1HHIA 3RPIA 5J11B 5AAMA 3CC5A 1Q1JL 4JFDA 4L3EE 3RDTA 4I3SL 2C3HA 3BPLB 4I8DA 4NO0D 5D7LA 5E2WH 4KKCC 2PO6A 3KG5A 1CFNB 3GK8H 4BFEA 1WJ3A 4O4YH 1BMGA 3DVNB 2VDLL 3GMRA 3ZHLA 5L0QC 3BD3A 4P46C 3QIUD 4E42A 5A2IH 3D1MC 1HHGA 2OR8A 3FO0H 4KGLA 4R0LB 3J8F7 3IFPA 1NEZG 5CAYB 4K7FB 3DSFL 2FWOA 1VGKA 3BXNB 2W38A 1JGUL 3GJFH 5E2WL 1LILA 2B1AL 3UTSA 4NKDA 1MCFA 4JRYA 4O4YL 1KYOK 1MELA 5D1QA 2BVUA 3TJEH 3FO1B 4MNQD 4Z95H 1ZV5A 1PYWA 4L3CB 2PUQT 5DJZB 4JZOB 3P0GB 5JOPD 1AGCB 1UVQB 3PWLA 2AK4B 2YOCA 1JUFA 2AS5M 4LOUC 3T4YA 3RWJA 1NEUA 2WAHA 4OQTA 1KF9B 2CKBH 2VQ1B 1MI5D 3NZHH 5JUEH 4ZFZB 3TJEL 4PJ7A 4Y5XA 5BZDB 1NGZB 4Z95L 3VH8A 2ICEA 4HV8B 3GMPA 4MSWB 3TO2B 3ARGA 3T4AA 1I7TA 3L5WB 4EOWH 1XIWA 4JZJB 1C08B 4AEIL 1FNAA 3G08A 4NO5B 3MUY1 1MOEA 1A7OH 1FFNA 2V7NB 4E0RB 4OJFH 4M6AA 4X6BA 3ZKND 3NZHL 4OD3H 5JUEL 2L7JA 1Q9KB 1TETH 1IT9H 2ESVA 3O81A 4Z0XB 1WZMA 1YDPB 1YZZA 4LGPB 3TC9A 5IJVB 4EOWL 1ZVYA 1RJZB 5HI5C 1HHHA 2HKFH 2YWYA 1EIBA 1CD9B 3IRPX 4OJFL 3N1GC 1H9VA 4OD3L 3UBXG 1I85C 5EU4B 1KIPA 1IT9L 3C8KB 1G7LB 3NPSC 4WTXA 2LVEA 3STZB 4PIRF 4Y19D 2V2WA 4WI8A 2W0FA 3D18A 2H8PB 1INDH 1M4KA 4YZFF 2HKFL 1NGQH 5FKAA 1SY6A 3I6KA 1EERB 4GRWE 4KMLB 3U1SL 2ADGA 4MAYA 1KCVL 3FFCA 1F5WA 4F37F 2XG5A 1NBYA 2BHUA 3LKPB 4WEMB 1GOGA 1QHPA 1X4YA 3CU7A 4KI5D 4P5MB 3MRDA 5KAQG 4JFEA 2EEAA 3DHMA 4YGAB 2A77H 4YHNA 3W9EB 1INDL 2ICWJ 1MWAA 2P45B 4Z0BH 1NGQL 2MJWA 1CD0A 4X5WA 3IGAB 1S78D 2GTZB 3OJVC 5F7FA 1QHOA 1R3KB 3HZMA 1HK6A 2JJUA 3G5ZB 1LP9B 2DM4A 1FAIH 2A77L 1B2WL 2VH5H 4XRCA 3FN0H 4YFLF 5I17B 4ODUB 5GIRA 3QI9D 4Z0BL 5DHXB 4WIQA 3ROOA 3ZTNH 3C60A 2IAMC 2NYYC 3N0PB 3LS5H 1FL5A 4C4KT 4UOW1 1VCAA 3L3GB 1FAIL 3QDGB 4P5TC 4PRPE 3UP1A 4ORGA 3BPOC 3S37H 4NYLB 3FN0L 4AT6A 4X8XA 3NIFF 4A2LA 4POZC 3SCMB 1I1YB 2X1XR 3WSQL 3FQUB 4ZUUA 3BRFA 3TBSA 5INDB 1Z9MA 4LRIA 2XTJB 3A6OA 3LS5L 4M5ZH 4BQ8A 1N64H 3R8QA 2IFFH 4OCXH 1R24B 4S0SD 3V5KA 3JWDC 3S37L 5J12C 1RFDH 4JN2A 3SGDI 1OGAA 1NGWA 4TYUA 1Y6MR 3UTTE 1OQXA 4WV1C 4ELMA 5F3HA 3NPSB 3MJ7B 4NQDE 4ELMF 1N64L 1KJMB 2IFFL 3IDXH 1RFDL 2BSSB 1UWXH 4ZTOH 3SQBA 3O3BB 1G9MC 2DLIA 4JLRB 2FGZA 1C5BH 4PV9B 2BXZA 2EXYC 4LSQL 1TLKA 5D96C 3OAYH 2LAAA 3MRHA 1BQLH 1D5BA 4APQA 1R3IH 3L7FB 1Q9OB 2NLJA 2QKIB 3T0BA 2AJ3B 4H25A 2EDXA 1MEXH 4ZTOL 2M8XA 2F54D 4K55A 5DEZA 4PBXA 1ORSA 4QYOB 1C5BL 4YK4B 3QEUB 4LSVH 1HH6A 4NZTH 1BQLL 1XFPA 2PXYC 3ISWA 4L4TE 4XGZA 5IB4B 1MEXL 5I76A 4HPOH 3EUUA 4P2OD 3RZCB 1NFDE 3LZFH 4NZTL 4F2MB 4DGIL 4OZIA 5DYOB 4PJFA 4TTDC 4Y2DA 4OZIF 3VXTB 4UBDD 4TUOA 3VMOA 2GY5A 4HPOL 5DRXB 4M3JA 3NH7H 4M9PA 1ZLUK 5C0IA 2P47B 5HDBF 3U4EA 3HPLA 5BS0E 1MPAH 3B9EA 3LZFL 3Q3GB 5D1XD 2RJMA 5J12B 3C9NB 3B5TA 3W2DL 2MKWA 4Z78B 1B6DA 1FP5A 1KV3A 4PB9H 3G5YA 4A6YH 5CFHA 1B3JA 3E6HA 3NH7L 5TH2B 5JMRA 1HYSD 3K2UH 1MAMH 2ZP0T 3BDBA 1MPAL 5EDXA 4GXVH 4DN3H 3PWPE 5DURD 4Z7VA 5JHDD 1G1YA 1KIRA 4AH2A 4G8IA 3ZDZE 4DKEH 1FGVH 4Z7VF 3VRJA 5F3BA 4PB9L 5EU6B 1SEBA 5D96B 4L3ED 4A6YL 2ED9A 3K2UL 4DVRH 3B9KC 3NOIA 1P9MC 4GXVL 4DN3L 4PREB 1IBGH 1HSAA 3VXME 5F9WB 4LHUB 1T5XA 3D0VB 4MJ6A 4PJEB 4UDUB 4DZ8A 1FVCB 5E5MA 3Q5TA 4NN7C 1FGVL 3I6LE 2V2TB 4MJ5B 3ALWA 3SE3A 4KUCF 3UYPA 5FYJH 4PJ8C 2P5EA 1IBGL 1RHHB 5KZCD 3WS6A 4ODWB 4QXTB 1F58H 3QCVL 3AS1A 3DUUB 3QH3B 4ZXBC 3LKSA 4LEXH 3T0VA 4BH8A 3QUXC 4KKBC 2GHWB 3WUZA 4XB7A 2J88H 4JFQA 5E1HB 4OCSH 3QUYA 5FYJL 3G6JA 3EGSA 2RB8A 3TBTA 4R2GC 3VDAA 4FXLA 4QRPE 4OLUH 3G6JF 4ZAKD 4CU8A 5DS8A 1UXSA 3GSNB 1F58L 4PLJD 4RGMC 3B2VH 2LU7A 1PKQB 2B4CH 4Y5VB 3DURB 3BQUC 4ZUSA 5KJRH 4GKOA 2J88L 4OCSL 3TVMC 4G8EB 3HZVA 3HNVH 5HY9B 3CSYB 4OLUL 3DYOA 1DQTA 2LVCA 4LL9A 3DUSA 3OJ2C 4Z7QF 5MENB 5D1QC 1XF2A 3BDYH 3B2VL 2B4CL 2WBJB 1G7QA 4U1IA 5CP3H 1KCKA 3ZTJH 5HPMB 4Y1AA 5EU3A 4U05A 2OP4H 4KRPB 5L2KB 5C09B 3V5HA 1QBML 4QNPF 3LEVH 3GNMH 5F7LB 4XAKE 4LKXB 4P2RA 5HHQA 5FDWB 1I9JH 2COQA 4EUPH 3WFBL 4QRRA 2ZUVA 1AP2B 2DI9A 2EE9A 4YO0A 4AEHH 2OP4L 1XIWC 2GEEA 5D4QA 4NGHL 3LSOA 1PAMA 1JWMB 2JB6B 5LQBH 2HKHH 3WBDA 3TA3A 5IVZB 4HUWA 5SX4H 3OKDA 1T3FA 2K3TA 1AO7E 1D9KB 3MJ8B 4AEHL 1Z0NA 4OAWA 1PD6A 2R23B 5GZOC 2O61A 2XN9E 1C1EH 3LKQA 3DO7A 3VD3A 1TJIH 1FV1B 3DX7A 1DR9A 4JHWH 5LQBL 2HKHL 1UB6B 4OF3A 4UTAH 1HHIB 4QGTA 3QFJE 5DGRA 3RPIB 4KZEH 1V7NH 3CC5B 4I4WA 1P4LA 3I85A 4JFDB 4OV5A 3RDTB 4LCWE 3IDGA 1JPGA 3AS3A 5D7LB 2PO6B 4R2GB 4PGEA 1L9NA 3KNBA 3HE6C 4Q9BA 1T89A 1NC2D 3GMRB 2F5BH 3TP4A 4E42B 3OKLA 4U7MA 1HHGB 5HGAA 4KZEL 3QUKB 1V7NL 3VFOA 5I8KL 3IFPB 4OGYH 3S5LA 1YYLH 3K4ZA 1VGKB 2Z8WC 3NA4A 4PRPD 8CGTA 3CH1A 1DQJA 4C4KO 3UTSB 4NKDB 2Z35A 4JRYB 4MQSB 3ZYOA 3G6AA 3VGEA 3OBAA 3DMMA 1LD9B 5D1QB 4QCIA 2F5BL 4LPCA 3SJVA 4H1LH 1PYWB 4GW1A 1V3KA 4GAFB 4OGYL 2DQIH 3PWLB 1YYLL 5CEZH 1JUFB 3T4YB 2HT2D 3RWJB 2J8UA 4WVRA 1CR9L 1FO0H 4M62H 5L8JB 1S5HB 5C0CE 3UTTD 2J8UF 1MFBH 2D2OA 3FN9A 4Y5XB 3C60C 2BHZA 2DN7A 3VH8B 3QR2A 2ICEB 3GMPB 4NQDD 3ARGB 5T1KA 2DQEL 1CVRA 3QWQB 4GKZA 3T4AB 5IF0A 1XIWB 2DQIL 2K7PA 4YHMH 5CEZL 5IW1B 1I1FA 3G08B 4K3DH 1FFNB 1Z0MA 4Y5YC 1FO0L 4M62L 4X6BB 5KOVC 3LH2H 5FV1L 3RVUC 4NKIH 1KLGA 1MFBL 4XBEH 4PGDA 4XAWH 1CF8H 2ESVB 1J87A 4JKPH 2QHLA 3PHOA 1BQHG 1HHHB 5FYLE 1I8IA 5DD0L 4EVNA 3VWJD 2DYPD 4N5UA 4N5ED 3LH2L 4NKIL 3JZ7A 2WQRA 4XBEL 3I9GH 4XAWL 1CF8L 1UM4L 5FV2A 4JKPL 2V2WB 4HS6A 2W0FB 3D18B 3LKNA 4XB8A 1TTGA 1YMHA 2YUWA 3CVHH 3I6KB 3OG4B 5FKAB 3ULVC 1RULH 2ADGB 4U1GB 4MAYB 4I77H 3FFCB 4H8WH 4KH2A 1U8JA 1NBYB 5I18H 3I9GL 3T0WA 5C0NC 4P46D 4EBQH 4K8RH 3AM8A 3MRDB 4ONGH 5EO9A 4XNYH 4JFEB 4O51A 2A9NH 4YHNB 2XACC 5DO2C 1X5AA 4MA3A 5I1HH 4X5WB 1JZ8A 1MCCA 4I77L 2DDQH 4Z7NE 4NQCE 3CFJA 2XKNB 3HZMB 5HYSG 3OAUH 3KPOA 4EBQL 3CPLA 4JDTL 1JFQH 5BS0D 1NCNA 4PRIA 3V5DA 4K8RL 2E8ZA 1YY9C 4PJBA 1SMAA 4XNYL 3VGAC 3PWVA 4XRCB 5GGVY 4PJBF 4PS4H 5GIRB 4JFHD 3S37X 4HH9A 5I1HL 2OL3H 1BJ1H 4XVSL 1QOKA 3BIBX 1VFAA 4ZTPH 5GRWA 2DDQL 2GSGA 5DVNA 3OAUL 1F4YH 3LDBB 4AIXA 1JFQL 1FL5B 1EGJH 3PWPD 4ORGB 1V3LA 4HKJA 4G6MH 5B22A 4AT6B 4YJZL 4QXUH 4Y2DC 2OL3L 1WT5A 1EJ6A 4LPWA 4LKCA 4ZTPL 4ZUUB 1S7VA 3TBSB 5EIQA 3L5JA 3HUJE 1F4YL 1EGJL 3VXMD 1QFWM 4F58L 2YK1H 3V5KB 2WV3A 4XNQA 4OLEA 4NC0B 4JN2B 1OWRM 5HI5D 1OGAB 1NGWB 2CK0L 1QTYT 3H6JA 1TCRA 3UTQA 4YBHA 3I6LD 2YD2A 5I1DA 4ELMB 5IBUG 5F3HB 1ITBB 3V2AR 2YK1L 5GS1C 5I8OH 4M6OH 1SBSH 1TPXC 3HAEH 4PV8A 3P9MA 4FQJH 1T7YA 1FCGA 4LPTA 1IM9A 4ZS7H 1OP3H 4ALAL 2ZSWA 1INQA 5GS2D 2AABH 1RMFH 3SDXA 1D5BB 3H9ZA 4QRPD 4APQB 1T03H 3BKMH 1CT8A 1X5JA 4M6OL 1SBSL 3SDXF 2NLJB 2UUDH 4H25B 3MLWH 1N8ZA 4ZS7L 4RDQG 1ORSB 3B5GA 5GPRA 1ZGLM 2UVEA 1NAKL 3MA7A 4YHZH 2RFXA 2ZCLH 1A1MA 1ZTXH 4ESKA 4MZ2A 1CL7I 4CMHC 1HH6B 1RMFL 3WNMA 4PFEA 1ES0A 1QSFE 5K59E 3TM6A 3RY6A 3WS6C 3BKML 5MERA 4H20H 4XGZB 1U91A 4JREC 5I75C 1DZBA 4HC1A 3MLWL 1N26A 5I76B 1SJHA 1CWVA 1I8LA 3UMTA 4QT5A 2ZCLL 1ZTXL 1YQ2A 3FKUS 2FO4A 1FRGH 1FGNH 2R0KL 3S4SA 2AQ1A 4OZIB 1J0KA 4X4MA 5IBTH 4M5YH 3M1BA 4H20L 4XAKD 3SGDH 3TGXA 4K3JH 4Y2DB 1JF1A 2ORBH 3ABZA 3TH2T 1QO3A 4YC2B 3T3MF 4TUOB 4POZD 3QPQC 5C0IB 2AXJA 3EDEA 1QPXA 3HPLB 3U4EB 3MFGB 3EDKA 4YHIA 2F8VA 1FRGL 2IBBA 1FGNL 5IBTL 3FQRA 4M5YL 3WIFA 1CU4H 1WWWX 2ORBL 4J3UA 3W5MA 5EUOE 1IVLA 5J8OA 3G5YB 3E6HB 1GOHA 1AO7D 4HMEA 2VYRE 2VDNH 4HS3A 3T2NH 1UZ6E 1LO5A 3ARQA 3ARYA 3QRFM 3OL2A 2XN9D 4Z7VB 4XMPH 1GPOH 1JI1A 5I1CH 1KIRB 4AH2B 2B5IC 4G8IB 3KLHC 1PFCA 3VRJB 3QFJD 2CGRH 3QWRA 5F3BB 4NQUA 4HGKC 1SEBB 3IU4H 3TN0A 4LCWD 5E95B 2C1PA 2VDNL 2XICA 1HSAB 1UT9A 3T2NL 3WYRA 3HI5H 1T5XB 4DZ8B 3CZJA 4WU7A 5E5MB 3W11C 1GPOL 1P6AB 3VD5A 3UPAA 4NWUH 2AJVH 4JQIH 3S34H 4GG6E 2CGRL 3IU4L 1HOCA 4CMHB 4XCFH 2P5EB 1MFEL 3HI5L 2FGWH 1BX2A 1JL8A 3LKSB 5L7XH 4NWUL 4BH8B 2AJVL 1GXEA 1FLRH 4JFQB 5IHLB 1OHQA 4WHYG 3QUYB 3UJTH 3QUMH 3G6JB 4XCFL 3EGSB 3TBTB 2R8SL 1T66D 5AWNH 5LGJA 4ODBD 5DS8B 5C8JA 1YEFH 1WIOA 1UXSB 5C0CD 2FGWL 1YY8A 2FDBP 4TTDD 4G5ZH 5L7XL 5DRNA 4ZUSB 1FLRL 3H9SE 3UJTL 1MCQA 1EBAA 3HZVB 3QUML 4O5LH 4Q7DA 4ZG1A 4N0UE 1YEFL 1KCUL 2YPLE 2J4WH 3DUSB 3BYYA 4HIJA 2IMNA 1XF2B 2ICCA 4G5ZL 1G7QB 4U1IB 1PZUB 4ZSOE 2FO1A 4UIMA 5J1TC 4HZLB 4Y1AB 5EU3B 1RUMH 4O5LL 3WD5L 4UT7H 3V5HB 1R5WA 4KJWC 1WGOA 4FN0A 4N1HB 4P2RB 5HHQB 2QHRH 3MUGA 4B50A 2OXGA 2G2RA 4NZRH 4QRRB 5TF1H 3UC0H 5CJXA 3S3SA 4YO0B 4HPYH 1RUML 3TBVA 2H2PC 3B9KD 4PRBA 4UT7L 3VXUA 4PRNA 3QNXA 3LSOB 4FTVA 4OGAC 5DJ8B 3SO3B 2QHRL 3TA3B 5DVMA 4NZRL 3UC0L 5TF1L 4HUWB 3NPZB 3OKDB 1CXLA 1T3FB 5CUSH 3D6GA 4HPYL 5DMGD 1EH9A 3B6SA 2UY6A 4OAWB 4U6XB 5MEQA 4PJ5E 4PJ8D 5EUKA 2O61B 5BOZG 4YIQA 3LKQB 4JVPA 4FA8A 3DO7B 1UKSA 3FQTA 4J8RA 2BNQE 4NQCD 3DX7B 1NSNH 4ZXBD 4LQFH 4W4OA 3BGMA 3JV6A 4I4WB 1P4LB 4OV5B 3QUXD 4KKBD 3IDGB 1JPGB 5CUSL 2CMRL 4TNWK 1UACL 1OTSC 3INUH 4PGEB 4HMCA 3KNBB 3QB7C 1XGRA 1HEZA 5E8EA 4K3HA 1NCBH 1NSNL 1ZHNA 3OKLB 2AK1H 5AG9A 5HGAB 4G8FA 4L9DA 3S96B 4V2CB 3VFOB 1A6UH 3BQUD 3S5LB 4HJJH 3CFBB 4OFYA 3CH1B 1DQJB 3TVMD 3INUL 2OJZH 2RBLA 2Z35B 2Y5TA 5I15H 1JGEA 3G6AB 3DMMB 4R7DA 1NCBL 2Q20A 4QCIB 1RUKH 5HGHA 3SJVB 3H9YA 4GW1B 1T0NA 2AK1L 3WXWH 1RUAH 4JFYA 3ROLA 4HZAA 4U3HA 1A6UL 1WLHA 2LU4A 3SO5A 4HJJL 4JVWA 4LGSB 1WAAA 3TESA 5E6ID 5JLZA 2J8UB 2OJZL 3BAEH 1U42A 1WAAF 5I15L 2BNUA 3QZWA 1RZJH 1RUKL 3WN5A 5E1AA 2H45A 1UWXK 3WXWL 1RUAL 3MRKA 5T1KB 2X4TA 4GKZB 2BRQA 5IF0B 1TFHA 1I1FB 4HGMA 1JTPA 3ARVA 3BAEL 3PWJA 4PJGA 1KLGB 1TCMA 1RZJL 4PJCE 1DQLH 4PGDB 4PJGF 5TDPA 3PHOB 1ADQH 1MRDH 4TNVK 3BN9C 4XCNA 3EYVA 1I8IB 4EVNB 3VU2A 1NCAH 1RUQH 6FABH 4JPIA 3AY4C 2PR4H 2BNRE 4MVBC 1GYAA 4XP4L 3FRPG 3QNZA 2AQ3A 2NY3C 3MCKA 5ISZE 1ADQL 1QSFD 4HS6B 3LKNB 4WNQB 4KK8C 5CJ8A 4YDIL 1YMHB 1ZVSA 1NCAL 2AJXH 1RUQL 3Q0HA 1FIGH 1U8JB 1A6ZA 3HE6D 1F00I 4PBWD 5I1LA 1FFOB 3QIWD 2OLDA 5D70H 5C6WH 4ACPA 4WDIA 3O2WH 3VFVA 5EO9B 2EC9U 2IPTH 4O51B 3GJFA 4MA3B 5F7HA 2WP3T 1ZEAL 5CEXB 5T5FH 4PRAA 1FIGL 4YE4H 3CFJB 4S1SH 1FH5H 5D70L 4ZUTA 2HJLA 3KPOB 2QQNH 3CPLB 4LLVA 4PRIB 3V5DB 5E0QA 4PJBB 4JM2A 5DUBA 5C0DA 2IPTL 2WWMC 3PWVB 3RY6C 4JM2F 5F9OH 3QDJA 1U2HA 4HH9B 2DMBA 2CKBA 1KUMA 1IC1A 5T5FL 1VFAB 4YE4L 2GSGB 4LSTH 2BDNH 1I8LC 4S1SL 1FH5L 1KCLA 2QQNL 1U8PA 5LGHH 4J6RH 1H8NA 2XA3A 4HKJB 5F9OL 4LIQH 3GUTA 4LKCB 4M7JL 3JBG7 5K33A 3CDCA 1J12A 2BDNL 4URTB 1QP1A 2SEBA 1AGDA 4L4VE 4J6RL 3VJ6A 4XNQB 3KXFE 5ICXA 4FXKA 1HI6A 1TDQA 1TCRB 3UTQB 5IVXA 2V2XA 5F97E 4LIQL 1JWSA 3QG6A 2FBOJ 5I1DB 5IVXF 4K23H 1OQOA 5C0BA 5DHVH 4PPTA 2VB5A 5ICYA 2X05A 5DRWA 3DROA 4F7CA 2AERT 1OAQH 3H8NA 3P9MB 5ADPL 1Y0LA 1IM9B 1AXTH 2VNCA 2NXZC 4RBPH 2I07A 1INQB 2ZSWB 4K23L 4RRPA 4O2FA 1K6QH 3TN0C 4HEME 1KXVC 4X4YA 1BP3B 3ARDA 3MBEC 4QRQA 3SDXB 2X7LA 1RIVH 5CZXD 1CT8B 3O8XC 2KL6A 1HYRC 3REVA 1N8ZB 1G0XA 2FIRT 4Y4KA 1MHEA 1AXTL 2VZSA 3WJLC 3MA7B 4I0PC 4JO2H 3H9SD 2RFXB 1A1MB 4W6WB 1OP5K 2APBA 1K6QL 4TSBH 1ES0B 2JJSC 2CDGA 1RIVL 4C56A 5ANME 1YY9D 4DFHA 1SMOA 2EEDA 2YPLD 1U91B 4XMLH 4JJ5A 4LRNH 1ERNA 4QT5B 4JO2L 5AYUH 1RQ5A 4JO3H 3BRDA 5GSVA 2FO4B 2BSTA 3D0LA 3S4SB 2YEZA 3M1BB 3QIBA 1JF1B 3K2MC 3EJJX 1QO3B 4LLWB 4WUUE 4MMXC 1R3LA 4JGUA 4DFIA 1JZ4A 4YHIB 1H5BC 3UX9B 4I0CC 4RMWA 3PWUA 4HBQA 2EH8H 2R1YA 2VO5A 4V1DE 3FQRB 1BFOA 1S9XA 1X6NA 4U6YA 1AI1H 3VH8G 1KGCE 4NN6C 2CIKA 3MRFA 2FATL 3KLAA 1S8DA 5IESH 2B7DT 4FQXC 4BZYA 4ODVH 2W60A 4HS3B 4PJ5D 1LO5B 3L3DA 4LHJB 2EH8L 4X5XA 5HHNB 1N5AA 5F8RC 2BNQD 2ZUXA 4QRSA 3T65A 2E6PA 1AI1L 5FYKU 5IESL 2C1PB 5JQHC 2IANE 2JLLA 4KV5F 3F7YA 3PQYA 1KB9K 2VABA 4WU7B 3LRGA 1GIGH 4JHBA 3IU3A 3ZDYE 1HOCB 4MD0A 1JNLH 3EHBC 2QJDA 4YAQA 3RI5K 2DBJA 1QYGH 1FFQA 4QHNA 4MAUH 3WDJA 1E28A 5TF0A 1BX2B 5BOPA 4K71B 1PKOA 1Y18A 1GIGL 4W4OC 3IXAA 1B6UA 3TWCH 5D7SH 3T1WA 1JNLL 1RK0A 1QYGL 4RFOH 5LGJB 4ZQKA 5C8JB 4MAUL 5DVOA 3H3KA 3JTSA 3ZKSD 1YY8B 4CW1A 4AEEA 2NNAA 3CXDH 5ACMA 1UQSA 3TWCL 4HUMB 5D7SL 1M05A 4XWOC 1QSZA 7CGTA 2HAZA 2IALA 4RMTA 1E6JH 2IQ9H 3HI1A 3MRJA 3BZ4A 4OQ1A 4X5LA 4NC2B 4JCLA 4UIMB 3CXDL 4HLZH 4A6YA 4O58H 3JUZA 1WIUA 1R5WB 5E4IA 4GRLC 3DTXA 4XI5C 4S1RL 4KJQC 1XF1A 4N9OB 1E6JL 2BNRD 2IQ9L 1U3HD 2WNGA 3MUGB 5SWZA 2G2RB 3WN5C 2EKJA 3KLHD 3UYRH 5ISZD 1GH7A 2A6JA 4WU5A 3UDWA 1DLFH 3TBVB 4PRBB 3VXUB 4PRNB 4FTVB 1BBJA 1TNNA 1VGEH 1OM3H 5F1IA 3H3BC 2X9YA 2QEJA 1MCIA 5C3LD 3V95A 1J9CT 4LLAA 3B6SB 1DLFL 1ZGLP 3W39A 4H0GA 5MEQB 5EUKB 3VA6A 3EAKA 4YIQB 2IBGA 1VGEL 1OM3L 2HFGL 3FQTB 4J8RB 4FOMA 2WP3O 3JV6B 2JE8A 2X89A 1DDHA 4GRWH 3RHWF 5HI4D 4U1JA 1EO5A 1M7DA 1XGRB 1HEZB 3PE9A 5E8EB 4BA8A 4PJAE 1J1XH 1EFXD 1ZHNB 4G8FB 4HS8H 4HUVA 2L7UA 1JHKH 3EJZC 3WEXA 5J1AA 1VFOA 2Y5TB 4IRJC 1JGEB 5J13B 4R7DB 1J1XL 1JI2A 4NUGH 1HNFA 1LNUA 5HGHB 5BV7H 1T0NB 4JFYB 5CP3A 3ROLB 5IHBA 5J4MA 4HS8L 4L4VD 5J7CC 1JHKL 1BHGA 4P4RA 3VE0A 4MA1C 2OTPA 5JLZB 3D85D 3KXFD 3UROR 3BMWA 3F6IA 2BNUB 3QZWB 3SGJC 3U7WH 3WFDH 2R4SH 4NUGL 2EDQA 5E1AB 4EUPA 1X5XA 5BV7L 3MRKB 2X4TB 4Z5RB 4QY8A 4GFTB 4M8QA 1N6QH 4GAGL 3PWJB 4X7SH 4PJGB 1XGTA 3QDGE 3UZVB 4G7VH 1X5HA 4OGAD 1MJUL 5TDPB 5BMFH 3U7WL 3WFDL 1ZSDA 4WW1A 2VZVA 2VSCA 3MJ9A 3MRNA 4XCNB 3EYVB 3LB6C 4LDEB 4PTTA 1N6QL 2E7CA 2OSLA 4X7SL 4JPIB 3WS3A 2XT1B 3P11H 3HE7B 3O45A 3QBTB 5BMFL 4QHUA 3QNZB 4YFLI 3LPFA 4DUVA 4AQOA 3MCKB 2J2ZA 5KANI 3H7LA 4B5EA 1A6AB 3EO1A 4NM4H 1Z2KA 1IL1A 2W9EH 2W91A 4CMMA 1ZVSB 3H7BA 1OTSD 3SKMA 1IAKA 3GHBH 5SWSE 4OFPA 5IJKA 1A6ZB 5DWUL 3P11L 5I1LB 5HPOA 1PQZA 4WDIB 3VFVB 4F7PA 4MX7A 1G1CA 4NM4L 2HJFA 3ARDC 3GJFB 3VI4E 4Z77A 2CDFA 2FECL 4WUUD 4PRAB 3EOBA 4Y4KC 4JO1H 4ODHH 3DX9A 4H1LA 2HJLB 1Z5LA 3OB0H 1P4BH 4LLVB 4JKMA 4F33A 4JM2B 5DUBB 3VWKA 5C0DB 1P7KA 3JWNC 4V1DD 3QDJB 4WW2A 4XX1G 4Q97A 1FO0A 2CKBB 4WW2F 3W5NA 1KGCD 3P4NB 5L9DH 4JO1L 4ODHL 5DK0A 4QTHA 1KTLA 1CXFA 1O7VA 1P4BL 1LWRA 1S7RA 1U8PB 5KSUA 1MCNA 1KN4H 4EN3C 3SDDD 5KG9B 3K8MA 5C6PB 1KEMH 4WUKH 4N90E 1BM3L 3WNOA 3GUTB 3BUYA 2X4NA 1YMMA 2DICA 3IDMA 1SJEA 5L9DL 1OSPH 2R4RH 2VXSH 3O2DH 2SEBB 3SDCA 1HWGB 4Y4FD 2IAND 1XCTA 3VJ6B 1KN4L 3FT2A 3BN9D 5K9JH 5ICXB 4FXKB 1J05A 1KEML 1HI6B 4WUKL 5IVXB 1A6TA 2V2XB 1JWSB 4DGYH 3QG6B 3ARBD 3JVGA 2R4RL 2VXSL 4MVBD 3O2DL 5C0BB 5DK3A 5ICYB 5DRWB 4YXKH 3DROB 4F7CB 2NY3D 1TQCB 2Y1VA 4WGWB 1WFNA 1JHTA 5K9JL 3CVHA 3OAZH 4UZGA 1L7TH 1Y0LB 4MXVF 1FVEA 3QQNA 4HQQH 5GGUA 1XF4A 2BFVH 2PTTA 5IT2H 4DGYL 3KPRE 3E6FA 3CXHJ 3EDFA 4O2FB 3WO3B 5E6ZA 4X4YB 5M7QA 3ARDB 4QRQB 1DBKH 2X7LB 3FT3A 3MGOA 3SDAA 2WBKA 2WBWB 4F7TA 1JNJA 4WWKC 5F7UA 2NTFA 3REVB 3CUPA 3O6FA 1B4JH 1L7TL 4Y4KB 1MHEB 2DRUA 4PJEE 3SBWA 2BFVL 5IT2L 2EDHA 1BGXH 3HN3A 4XVJL 1E4XI 5H37G 2AEPL 2N1KA 1DBKL 2CDGB 4C56B 2QTEA 3DIFA 5FYKL 2EDKA 1EVUA 1U58A 2WWMD 2MQ0A 1MCJA 5GS2H 4JJ5B 2DLFL 4P99A 2OL3A 1U92A 1RZGA 1IAII 3QEQA 3REWA 4P2QA 1RPQA 4OCLC 2NZIA 5GSVB 3WE6A 1EGJA 2BSTB 3D0LB 5I30H 1TQBB 2YEZB 2K9UA 1ZLVK 2GYSA 2NX5E 3QIBB 1DQDH 4I3RL 1Q9WA 4C59B 5FUCE 4OV6F 4NFDA 1R3LB 4IEFB 5T1MA 4J7RA 1KJ2H 1UJTA 2WMPA 4PLOB 3PWNA 3TZVC 3IJYA 4XCYA 3VFUA 3P9LA 5DD5H 3PWUB 5I30L 2R1YB 3FMGH 1I9IH 1BFOB 1KG0A 1S9XB 3S88H 1QSEA 1PBYA 2EE2A 4U6YB 5FA4A 2CIKB 3MRFB 3KLAB 5E2VL 3C5JA 1S8DB 5MENE 2W60B 3L3DB 4G6KH 5DD5L 4X5XB 1N5AB 3FMGL 3HAEA 1I9IL 5L2KE 4QRSB 3P30H 3S88L 3T65B 1ZGLA 4UINH 1F90H 3MV7A 3QXTA 2BVPA 2NXZD 3R4DA 2YD5A 5C0AE 2DQGH 2WUCH 1UH4A 2BOCA 3JWDH 3UDWC 3U0WH 3F7YB 3PQYB 2V5TA 3MBED 3QQ3A 4G6KL 2LE9A 5ADOH 1LO4H 2VABB 4NOFA 3O8XD 3L7EA 4KGJA 4AL8H 2GK0A 5I1IL 4C57C 3P30L 4UINL 4YDLC 2E27H 5DLMH 4I0PD 4MD0B 3JWDL 3CFDA 5D9SA 4YAQB 5FAAA 3U0WL 1JPTL 4QHNB 1G9MH 2D0GA 1E28B 4WO4D 1LO4L 1QPPA 1Y18B 4JR9H 5LCVH 4Z7UE 3IXAB 1MJ8L 4HXAH 5BXFA 3D3VE 1F4XH 4KXZH 1A1OB 1LO3H 1LVEA 1RK0B 3KPTA 4HGWB 4ZQKB 4D9LH 1G9ML 2JJTA 3JTSB 5JIPA 2DQCH 3D2UA 4ONHA 4CW1B 3RWDA 4FABH 4JR9L 4P2YA 5LCVL 2NNAB 1QA9A 2EYTA 5D7KE 1UQSB 1F4XL 2AXHA 1AH1A 1NGYA 4JGJA 1M05B 1LO3L 4W4NA 1FIEA 3VFNA 4XVUC 3VRLE 3NFNA 4J3WA 1ZS8A 2IALB 3QDGD 1AQDA 3OZ9H 4S1DD 4ONOA 3HI1B 4HJ0C 3MRJB 5LWYH 2YXFA 4NUJA 3BZ4B 4FABL 4EXPX 3RY4A 3PIQA 4RGNC 4A6YB 5JMOC 3MPCA 2B0SH 1WFTA 4HKZA 4FQXD 2W92A 4PJDA 3WXVH 1UCTA 2C3VA 2N4IA 5EC1A 5MEPB 5DC4B 4PJDF 4FFWC 3OZ9L 3N1MC 1A4KA 3RWHA 3TO4A 5F89A 2EYSB 4L8BA 5SWZB 5HHMB 3F58H 4I5BA 4XP1H 2VDKL 2A6JB 4WU5B 2V7HB 3AS2A 1S7QB 1X44A 3GSNL 4M3KB 1BBJB 1T04A 5SWSD 3D9AH 5F1IB 4UNUA 1OD7A 2EC9T 5EG6C 3ULSA 5FYLH 2B20A 4YDLB 3F58L 1HIML 5KVFL 4MXWH 1DBJH 3AS0A 1DANU 3O3DA 4YUEH 4JRXA 5DVLA 3EHBD 1P6FA 1QLFB 1K3IA 2DLHA 3D9AL 5JHLL 5FYLL 4OI8A 4UT6H 3FZUC 1DDHB 4NSKA 5GGQH 4R97C 2XNAA 4YBLB 1H3UA 5TE7H 4U1JB 2JTDA 1F3JA 4HKXA 4XNZB 1PY4A 4XWGL 3QWOA 1M7DB 4YZFE 4Y16C 1E0OB 3ARTA 5DZOA 5EBGA 5KVGH 5IJKC 4YHOH 4JKWA 1FNHA 1CIDA 3H3PH 1U3JA 4UT6L 5GGQL 2VXUH 4HUVB 1I9RH 1R3JA 5TE7L 5BZWA 3WEXB 1G7JA 5J1AB 4XWOD 3OKMA 5I8CA 4N90D 1ZT4A 4C58B 4ZO9A 2RQ8A 5KVGL 5GISH 4YHOL 1JZ3A 1LNUB 5BVPH 2O5XL 1QD0A 4ERSH 3OF6D 1I9RL 2E9BA 4P4RB 3VE0B 4P4KD 5C07E 5J06A 1EHXA 4NP4H 3S4SG 1J5OH 2KKQA 2AAVA 1XGYH 4PP1C 2GSIA 4GRLD 4XI5D 4ETQA 1ZLWK 3OMZA 2DM3A 5GISL 2VDPH 1ZHBA 4EUPB 5BVPL 3X17A 2X09A 3DO3A 4ERSL 4QY8B 2QBWA 5EN2A 3H0TA 2JF1A 1BREA 1D6VH 4M8QB 3ZMRA 3AMKA 5EOQH 1J5OL 1YC8A 1XGYL 3BP6A 1XGTB 4CN4A 2VN7A 3LPGA 2YD3A 3NIFE 3RUGA 1LEKA 1Q8MA 4NQVA 1ZSDB 4WW1B 2VDPL 3RUGF 1S3KH 3KPRD 2VN4A 3SDCC 1K85A 1BQUA 4BZ1L 4KJYA 3CDGA 3RVWD 4KMQA 3MRNB 4JY6A 4PTTB 2DTSA 1YEEH 2OSLB 4PRHA 2QADC 4JVUA 1AHWA 2AJZA 3WS3B 2PKDA 3O45B 1NCCL 1TJHH 4HFUH 4WTZA 4NZUH 4IRSA 1S3KL 4QHUB 1KELL 1KULA 3EO1B 3U82B 4NNXA 1IL1B 2A6KA 4CMMB 1G9EA 3H7BB 3SKMB 1WBYA 1EAJA 1IAKB 1YEEL 4LCYA 2X5PA 4U1KA 4KJPD 1D5XA 2XPGA 2OM5A 3UO1H 1TJHL 2W0PA 2NY0C 4HFUL 3T04D 2XYCA 1DUYA 4IJ3C 4RMSA 4XC3H 4F7PB 4KAQH 2XY1A 4MX7B 2HJFB 3BZEA 2DD8H 2NX5D 2VITA 1WUNT 3EJZD 1MJ7H 4Z77B 2CDFB 2D0HA 3EOBB 4IRJD 4NO0A 5IROA 1L0YA 3DX9B 3UO1L 4H1LB 3LEYH 1Z5LB 3BVNB 3DARA 4K7PH 3RIAK 5IMLA 4XC3L 4KAQL 5CS7A 3NIDE 4F33B 3VWKB 1ND0A 1SY6H 4L8SB 5A2LH 1P7KB 2DD8L 3F65A 5E56A 4DUWA 3QIUA 2WSKA 4WW2B 4KKAC 1FO0B 1DBBL 1MJ7L 4M6NH 3OTTA 1NCWH 3FB5A 3C5ZC 5GGTH 5DJDA 5DK0B 3WHXA 3LEYL 1KTLB 1MCEA 1S9YB 4QTHB 5AUMA 3TFKC 5F8QC 4K7PL 4C55A 1CFTA 2WBJD 1MAKA 1MWAH 5KSUB 3SY0A 1SY6L 1MFDL 4MNQA 1C5CH 1W72H 3MA9H 1FSKC 4U3CA 3WL9A 5L2KD 5EU7C 4M6NL 5EORH 2X4OA 3GB7A 5F93C 5HBBA 2X4NB 1YMMB 3PL6C 5GGTL 3IDMB 1SJEB 1W2KT 5C0AD 3VRIA 2NY6D 4AMKH 3SDCB 1ADQA 1MI5A 2ZKHL 1MWAL 1XCTB 3FT2B 1Q0YL 2CK2A 3LQAC 5FHAH 1W72L 3LB6D 2ZZUT 3MA9L 4F9LC 4I18C 1J05B 1L0XA 9CGTA 3A6CL 1A6TB 5EORL 1O7SA 3UTZA 2ZG2A 3O41A 3OXSA 4AMKL 2D7TH 5C0JA 3ARED 3OJDA 3M8OH 5IIEB 5TJWK 3MLTA 5FHAL 2F74A 1JHTB 4HBCH 3CVHB 4RGOL 1FVEB 5GGUB 3QJHA 1XF4B 4OLVH 2PTTB 3DJ9A 4M1CC 3D3VD 3ARWA 5I73C 4IJ3B 2R39A 1IKNA 3E6FB 2D7TL 2YBRA 2DQDH 1N6UA 3M8OL 3MGOB 1K8IA 3SDAB 3IB4A 4F7TB 5GGRY 2NTFB 3CUPB 3O6FB 3QXAA 4Y19A 2G9HA 4OLVL 4RWYH 5D7KD 4L29A 1AR1C 2Y7QA 2I9LA 5FO9A 1L9MA 1OAKH 2YUXA 2VDOH 5EOCJ 3OPZH 2DQDL 3ULVH 2XRAH 3DIFB 4MNHB 2MQ3A 2NY2B 1U58B 4MQTB 4LP5A 3ZE2E 3NCYS 2P5EE 2IJ0C 2CD0A 2OL3B 1U92B 1RZGB 1UA6L 2DJ4A 3QEQB 4OFKA 4P2QB 3REWB 5KS9A 2EDWA 4OM1H 3IFNL 4RWYL 3JV5A 5KS9F 1U8OA 4HIEA 3WE6B 1AC0A 1OAKL 3HZYA 3LIZL 2VDOL 3OPZL 3ULVL 1BVLA 2XRAL 4EN3D 1FSKB 1Q9WB 1C7TA 3MLVH 2NZ9D 1ZT7A 3P77A 3BH9A 5C6TH 3MV01 5CILL 4OM1L 3BIAX 3OR7A 5T1MB 3QEHA 3HR6A 4X4ZA 2HWZH 3QI9A 3PWNB 1MCPH 3IJYB 4XCYB 3VFUB 3P9LB 4CBPA 4R9HA 4MJ2A 5L2JA 1H8OA 4OGZA 3V0VA 3S35H 1LMKA 4HK3J 1C8PA 2BJMH 1KG0B 1QSEB 4Z7QE 5C6TL 2N7BA 5FA4B 5F96H 1DEEA 4LAJH 2OMBA 3C5JB 3QHFH 5AD0A 5DHVA 2HWZL 1MCPL 2CXKA 4FQCH 4AYFA 3HAEB 1A9BA 1WBZA 3S35L 1BVZA 4R3SA 3TO4C 2DS4A 3ULUC 1ZGLB 1WWCA 5F96L 4WGVB 5I73B 1E4XH 4FQIH 4OUOA 2BOCB 3QHFL 2XWTA 3NCBB 4FQCL 1ULVA 3QQ3B 3QXDA 4OT1H 4WWKD 2GK0B 1FNSH 2B8OT 2A0LC 2JK5A 1E4XL 4FQIL 1ZXQA 5IFHH 3CFDB 5D9SB 3DVIA 2CIIB 1RZ7H 1BZ7B 1OCWH 3K81A 4HWBH 3V9FA 1IAIL 1OAUH 2E6QA 2NXYB 1D5IH 5BXFB 4KK6D 5CGYD 4JFOA 1CXIA 5IFHL 1REIA 1JPSH 5C07D 1RZ7L 4NQEE 1UJ3A 2EDRA 2Y72A 1YYML 1FDLH 3HKFA 1MLBA 3D2UB 4ONHB 4HWBL 3RWDB 4YHYB 1B0GA 1OAUL 1D5IL 1QA9B 2OZ4H 2EYTB 4J2XA 5D1ZD 4HK3N 3KPNA 1NGYB 5AYQA 3CJJA 1P7QA 3VFNB 4OLXH 3V4UH 3NFNB 3QT2A 4LDLB 3TZVD 1ZS8B 5CKAA 1FDLL 1NLDH 1AQDB 1H0DA 4P2OA 4NUJB 4KK9C 1K9TA 1AXIB 3PIQB 3RIAF 4RX4D 2Q86A 5D7JC 1T7VA 1BFVH 4HKZB 4PJDB 4OLXL 4K3EL 3V4UL 2C3VB 5FUZH 5EC1B 4KDVA 1NLDL 1GGCH 4AM0A 1A4KB 3RWHB 3TO4B 5F89B 4RAVA 4L8BB 3VG9C 1AXSA 5EU7E 5D1XA 4ZO8A 4I5BB 1QKZH 1QRNE 4TVPE 4WY7H 1BFVL 3BKYH 2XQYG 2X44D 4X7DC 3X3FH 5FUZL 2A38A 5GRJH 2OR9L 1NGXA 1T04B 2WWKT 2Z91A 3ULSB 3OHXA 2KQMA 2ERJB 1QKZL 2CRIA 1PW3A 1NJ9A 5JXED 5JHDA 3UPRA 2F15A 3NCJH 3OB0K 3O3DB 4WY7L 3I02A 3BKYL 3P4OA 4Q0XH 4JRXB 5GGRA 3ZKXB 3X3FL 4S0TD 5GRJL 2C5DC 4L3EA 1AHWC 4NSKB 4RRPG 2BSED 3LS4H 2XNAB 3QUMB 3KWWA 4Q0XL 5CGMA 1F3JB 4HKXB 5CJQH 1SVCP 3QWOB 4QHLA 1RZFH 2WLYA 4PD4K 3F5WA 1RZKC 3IDNA 5T3ZE 2DL9A 3VMNA 3WV0A 3ZLQC 4LLMA 1MCWW 3LS4L 1R3JB 5BZWB 1LEIA 2D7QA 3OKMB 4KDTA 5CJQL 5GRXG 3V6ZA 5I8CB 4XVUD 1ZT4B 2NTSP 1RZFL 3I50L 2DQHH 4DEPC 4WHCA 5IROC 2NW2A 1OLLA 4OUUB 4HJ0D 1OTTD 4OZ4A 4AZ8A 2GT9A 1X5FA 1IKFH 5I0ZA 3QCUH 5KSAC 5T1DH 4XCCL 4HUNB 3NVQA 1CTOA 3O3UN 1F4AA 1DE4A 3QIUC 4PJBE 2GSIB 4PGBA 2F8OA 4ETQB 2NY4D 4J12A 1KB5H 1XEDA 4OFIA 3UJJH 3VG9B 4F15C 1ZHBB 5J9PA 3STLA 1I3GH 2FD6L 5EN2B 1IKFL 3H0TB 3QDMB 4UAOB 3QCUL 2H26A 4O9HL 5T1DL 1SQ2N 4Y89A 1DSFH 2APTA 3D39E 3BP6B 4HUXA 3EDJA 3RUGB 3SN6N 3TT3L 1NCUA 1LEKB 2BY0A 2CSPA 1KB5L 4NQVB 4YPGA 1I3GL 1HINH 1T0PB 2J5LC 4KJYB 3CDGB 2YA2A 1SHMA 3HNSH 4JY6B 1X9QA 1DLHA 5ID0A 4Z9KB 4OLWH 4BFBD 1DSFL 2NPLX 4PRHB 4TUKL 2BCKB 1AHWB 2AJZB 4NKOB 4NQTA 2EKSA 4IRSB 1P5UA 3ULUE 4KUCD 1HINL 4BFIA 3HNSL 2XV6B 3ZKNC 4NNXB 4GRWF 2A6KB 5DF0A 5DFWH 4OLWL 2P5ED 3BYTA 2QSQA 1WBYB 1ZLUH 4B41A 4LCYB 5MEOA 1D6EA 5CZVH 4U1KB 1D5XB 2LTQC 1DUYB 4F8QA 1RHFA 4IOFC 1G7MA 1IGIH 4K7PX 1U8IA 2E7BA 3BFOA 4WCYH 1UG9A 2R2BA 4UNVA 3BZEB 4EIGB 2DLGA 2VITB 3S98A 4DN4H 5CZVL 4NO0B 3BP4A 5HYJE 5F88A 2VC2L 5IMLB 1IGIL 1JZ2A 4XXDA 1ND0B 1NCTA 5CP7A 2DM7A 1NC2A 4WCYL 2ZUSA 1OOAA 3LD8C 3QIUB 2YPKA 3FCTA 1KTDA 3NCFB 1EEZA 3RA7H 4DN4L 5EH1A 4YHLH 3FB5B 4PP1D 1KCRL 4KI5C 4F15B 4U6VH 4OTXH 5DJDB 4PRPA 3WHXB 1VADA 5AUMB 1IJ9A 1CICD 1CFTB 5IMOA 4N1CA 3SY0B 1S78C 5IEHA 5HVGB 1BVKB 3H9HA 1A7BA 1WQVT 3WL9B 5CJ5A 3RA7L 5F6IC 3U0TA 5F9JA 4YHLL 1OLZA 3DRTA 4U6VL 4ZPTA 5JW4R 3VRIB 1MI5B 3B8YA 1JIBA 3UTTA 1Z9OA 4BQ9A 3ARSA 1J0YA 4NQDA 1T83A 3UTZB 4OM0L 3V6OA 3O41B 3P40A 2P5WE 3EYFA 2EH7H 4G80A 3GEWB 3VW3H 3OXSB 5C0JB 4YDVA 2NR6C 3IKCA 3O0RH 3OJDB 4XBPA 2V17H 4KRLB 4DW2H 3MLTB 2F74B 4CRPA 4OLZH 2A1WH 3QJHB 1NL0H 4EXKA 5MI0B 2FR4A 3VW3L 2F9BT 4U1MA 2YBRB 3F62A 3VWJA 2DYPA 5E4EC 4JO4H 2OJEA 1K8IB 2V17L 4NQED 1G9NC 5HHOE 4DW2L 3R8BB 2CPCA 3QXAB 2V9TA 4OLZL 3O4LE 3L6FA 1PEWA 2A1WL 4Y19B 2G9HB 3KYNA 1NL0L 4L29B 4U31A 2Y7QB 4L4TA 2I9LB 3MODH 5FO9B 3WIIH 1G7IA 4JO4L 3RPKA 5SV3A 4LNRA 3UCRA 3K8LA 5DD1L 2XQBH 4P46A 1NFDA 1B4RA 1CS6A 4FRWA 4NPYA 5KS9B 3MOAL 4PJ9C 1U8MA 5FGCB 1A3QA 3C5ZD 3U9UA 3MR9A 4QEGA 1U8OB 2FRGP 3MODL 4HIEB 3WIIL 3TFKD 3HZYB 4TVSa 2YZ1A 3DI2B 1BVLB 5DJ6A 5I19H 1UJ3C 4DKFH 1XAUA 4OZGE 4Q6IA 3THMH 1JHLH 1IGYB 2XQBL 1ZT7B 5BS0A 3P77B 3BH9B 3ZE0F 5D2LE 3OR7B 1HXYA 1QRND 2F8XC 3O2DA 3QEHB 3ZTJG 3QI9B 5BO1H 4TVPD 1VPOL 4XPAH 1BOGA 5L2JB 5IMKB 3LVEA 5I19L 3V0VB 1JNNH 1EZVX 2VAAA 4LSUL 3THML 1JHLL 1NAMH 4P2OC 3PWPA 5C70A 1DEEB 1DANT 4EUPG 1WF5A 5AD0B 5DHVB 5BO1L 4HF5L 4X7EC 2X2YA 3LKOA 3EZ8A 1AY1H 4TN9A 4X6CE 5SV4A 3VXRB 1A9BB 5LAXA 1WBZB 2I24N 4R3SB 1NAML 3V0AC 3VXMA 2ZG1A 1KENH 3MRQA 4LCUA 5D1XC 2FSEA 1MCWM 2A74A 2XWTB 5JR1L 1S7WA 2KZWA 2ZUWA 5E4EB 4LEOA 4YQXL 1WC7A 3PGCA 1AY1L 3QXDB 5TGBA 1I85A 5T3XE 2JCCE 4K2UL 1GCFA 1UH3A 5K9QG 4CDGC 2JK5B 5T3ZD 1KENL 4YXHH 5DEGA 1P69B 3DV4A 1AR1D 1ZANH 3Q5OA 4FFYH 3X13A 4J23A 5DHYA 1N6VA 3L3OA 4ETYA 4MYWB 3MGTA 5SWQA 5EZIH 4CVZA 5LXGL 2OR7A 4X99A 2FJFA 4X7CC 5FO7A 2N7AA 3N85H 4QRPA 1H3PL 1UKTA 4YXHL 3WLBA 1CBVH 4JFOB 3QNYA 3JV4A 1ZANL 3CLFH 4W81A 5AZEH 5D93C 4RFNC 4MNGE 1UJ3B 4KTEH 1MLBB 4ZMAT 4FFZH 2C3GA 1B0GB 3N85L 4H1LG 2ZSVA 1CBVL 1KJ2A 2Q7YA 4OIAA 3KPNB 4HXBH 3CLFL 5AZEL 3MNZB 1P7QB 1LE9A 3D39D 4KDTC 4MJIE 2C4XA 1H0DB 1F97A 1NKRA 2IAMA 2KDGA 4P2OB 4G6JL 4HIXH 2Q86B 2XIDA 4ZAKC 4P5TA 3IDUA 3C09B 4PLJC 5I66A 1JGDA 1EK3A 4BUGA 4NM8H 4YBQC 4Z7OF 4AM0B 2Q76A 4RAVB 3GSQA 1AXSB 3SQOH 2QL1A 5D1XB 3ULUD 2X1QA 5GGVL 4HIXL 1M7XA 5EULV 5DJAA 2XZZA 2BRRH 2IG2H 1CDBA 1JNHA 1VSCA 4D9QE 2GTWA 4L9LC 4UI2A 1NGXB 5T5NF 2Z91B 3VGHA 1LDPH 1UWEH 4E9LA 3OHXB 1IM9D 3SQOL 3VG0L 2MPAL 3M17A 2A0LD 3UEZA 1NJ9B 5JHDB 3QAZB 5JPMA 3UPRB 2BRRL 5GGRB 5EC2A 1NFKA 3I02B 3P4OB 3AUVA 4JQXA 3QFJA 5IKCA 3T8XB 1B0RA 4LF3A 1YPZE 2D7MA 4L3EB 4LCWA 5JA8B 1A3RH 5KSBE 5HYJD 4JY5H 1LDPL 1UWEL 2VZOA 1RSFA 1JYVA 2D3VA 3KWWB 5FM5M 5FXCH 1E4WL 1JZ7A 5D93B 2QQQA 1I7RA 3B9AA 4WENB 4QHLB 3F5WB 4BJLA 5KVEL 1A3RL 4JY5L 5I8EA 1OPGH 4RQQA 3K80A 5HD8C 3IDNB 5KZCB 4F9PC 1MCHA 4LLMB 1M71A 4P9HC 4FP8H 4K7PY 2PXYA 2QR0A 2BXYA 3FTGA 1LEIB 3V6ZB 4ZFGH 3WJJC 2FBJH 1SYSA 5HVFB 2NW2B 5SX4I 3RRQA 4OZ4B 1LO2H 2GT9B 5C0CA 5HSFA 1K4DA 3IDYB 1HHJA 4FP8L 2QSCH 5D7JD 3V6FA 1DE4B 4ZFGL 3MXVH 4PGBB 1N5YH 1MF2H 2PW2A 1IZKA 2GJZA 2HLAA 4EKXA 2P5WD 3RAJH 5SX5K 3STLB 1INEH 1LK3L 4AG4H 3MNVA 1MCLA 1P84K 2QSCL 2H26B 3K46A 12E8L 3R0NA 3RL1B 3RU8H 4HUXB 5I1EH 3MXVL 1N5YL 1MF2L 3ZDXE 4WWID 4LLQA 3MZTA 3E8UH 3RAJL 4YPGB 1A21A 1INEL 2W9DH 4O00A 4I2XE 3QWRD 4AG4L 2VXVH 2JB5H 5A16A 2GCYA 5HHOD 1DLHB 1Z6JT 5ID0B 3C6LC 5HHPA 3NCYP 2HYMA 1GAFH 3RU8L 3HAEG 4KPHH 3O4LD 5I1EL 1ZKAA 2V9RA 3S9DB 1T83C 3NGBC 1UXWA 1EDQA 4JFZH 1VKXA 2EKSB 3IDIA 4X6DE 2CQVA 3PDOA 3B9KA 5IVXE 1P9MA 2W9DL 3BPCA 2DTMH 4GRWB 4BFIB 2VXVL 2JB5L 3KYOA 3QG7H 2Y36H 2QSVA 1GAFL 4HIIA 5MEOB 4FXGA 4KPHL 2D7PA 1D6EB 1DBAL 4CUCA 1GGBH 1OW0C 1NBZB 5B3JE 1RY7B 3DLQR 3F7RA 4PJ8A 1G7MB 3CX5J 2EDNA 2DTML 5JIKA 1J18A 1U8IB 3DUHA 4L3AA 4N5EC 2HLFD 2R2BB 3OV6A 3QG7L 3G9AB 4U1LA 4ZXBA 3MGAA 2Y36L 4Z7NF 4BYHA 4NCC1 1X5KA 2G60H 3C87A 3GMMA 2W0KA 3QUXA 3IXTA 2X4SB 1QQDA 1GGBL 3BP4B 5F88B 5JXAH 5BV7B 1UCBH 1CDIA 4XXDB 2DQTH 5CP7B 4IOIA 5ALCH 1NC2B 2PTUA 5KSAD 2YPKB 3FCTB 3HC4L 3A67H 1KTDB 4HIHA 1EEZB 3OR6A 2CKNA 3BQUA 1FL3A 5CBEA 1CQKA 3KPSE 5F1OB 4PRPB 1VADB 5CSZA 2ZUQB 3TVMA 5IMOB 1UCBL 4MXQD 2DQTL 3GK8L 4N68A 4Y4HC 1ZA3A 5ALCL 1M1SA 5IEHB 1QFHA 4BSVA 2FL5A 2R9HD 3H9HB 1WICA 4Q6IC 3EYSH 5I74C 3A67L 4MB4A 3U0TB 5F9JB 2YR3A 3DRTB 4NKMB 4QOKE 3B4NA 3FO0L 4ZPTB 1XR9A 3RL2A 5L8KB 4ZOBA 3IS1X 5E6IA 5A2FA 4X9FA 3UTTB 1IC4H 1FHGA 1IQDA 3WIHH 3MRBA 2CUIA 5T3XD 1EZVY 4NQDB 2A6DA 4GMSH 4PJ7F 3EYFB 4G80B 1EV2E 4HX1A 1YEGH 4HAFA 3JSSA 4YDVB 3IKCB 4XBPB 4LVOC 4G7YH 3P0YH 2EYRA 2CKBL 5IK3A 3BEVA 3WIHL 3FOMA 1FC2D 4GMSL 1SJVA 1JK8A 3TBYA 2VLRE 1QFWI 1YEGL 2FR4B 4U1MB 4GG8B 3BESR 3VWJB 4R26H 2DYPB 4IOFD 2OJEB 4JFFE 4PP2A 3WDIA 1A7OL 4WI5A 1S7TA 3P0YL 5B4MC 2I9TA 2B1HH 2NW3A 1YNLH 2GQHA 1TETL 3L6FB 3NN8A 4DQOH 3X3GH 4MLIA 1QSFA 3KYNB 2UZXB 3Q6FA 3VXOA 5E7FA 1I1AC 4L4TB 5K59F 4YR6A 4ZNEE 3A6BH 3OX8A 5E00A 4KU1A 1G7IB 4LNRB 4BKLA 3HE6A 3TLRA 1FC1A 3GI9H 4MJID 2B1HL 3HRZA 3QIWA 5B8CC 5L0QB 1YNLL 3EW3B 4P46B 4CN1A 4DQOL 1MFCH 4NPYB 2YZ8A 5GGTA 1KIQA 1U8MB 3U9UB 3MR9B 3VGDA 4HULB 5I6XC 3A6BL 4ZOCA 3EDDA 5DJ6B 4X6FA 1DVFD 3RVTD 1ZHKA 4Q6IB 3ET9F 1W72A 2P48B 4OZFH 2E9JA 5GS0D 1MFCL 1RV6X 1HXYB 2MHAA 4Z7WE 3BJ91 1CQYA 1BOGB 2AJSH 4D9QD 5EUOA 3QDAA 3PJSA 2BVTA 3WHE0 4RISH 5JO5A 2VAAB 1BJ1J 4G43A 5EUOF 3PWPB 2K1MA 3VMPA 4YHKH 1UZ6F 2P7TA 1CGTA 3RP1A 1TZGH 3QUZC 2NR6D 2VH5L 3LKOB 2AJSL 2BX5A 4Y5YA 3MRGA 5FUOH 3GMLA 5LAXB 1YEJH 3ZTNL 2HVKA 3FQXA 3MV11 3VXMB 3WFEH 3ARFD 3MRQB 2WINA 4LCUB 1EEQA 2FSEB 3Q2CA 2Y06H 3HE7D 5D2NE 2A74B 4LAQH 4YHKL 1S7WB 3QISA 3FB6A 1QEWA 1I4FA 1T2QH 4LEOB 4P57A 1WC7B 2MFNA 3PGCB 2EDEA 4Q6YA 4EZMA 4GG6A 4NRZA 5TGBB 3GMOA 1YEJL 4GG6F 5CEYA 5A43C 4WTZG 4M5ZL 5DEGB 4FQ2H 2Y06L 4OCXL 4KI1A 3DV4B 4OKVA 1X7QA 1T2QL 3X13B 2VZTA 5DHYB 5A40E 1GHFH 1VERA 4JQXC 4HG4J 3L3OB 5I1GH 3ULVF 3MGTB 5SWQB 5FHBH 5C08E 4CVZB 4X99B 2VWEE 2FJFB 5FO7B 4QRPB 3NAAH 3WLBB 3MNWA 4FQ2L 4PJ9D 3QNYB 3JV4B 1MFNA 3IJSA 1EHLH 3IDXL 3BMVA 4EEEA 2VL5B 1ZK9A 1GHFL 4KWUA 3H9SA 5FHBL 2D9QB 3AGVA 3DGCR 2ZSVB 4N0UA 3NAAL 2QLVB 1KJ2B 2Q7YB 2YPLA 5IMMA 1EHNA 2IBZX 1R3IL 3QYCA 4Q9QH 1EHLL 2I27N 1LE9B 1N7MH 5IEKA 4ZSOA 3OJMB 2IAMB 2R0ZH 2A9MH 4LSVL 5IB1A 1T66C 2RHEA 1ODAA 4XMKH 5C0EA 4P5TB 2D0FA 5D72H 2FHCA 3BPOB 3D69A 2DI8A 5CMAA 3CLEH 2E9IA 4Q9QL 3EYQC 4GQ9H 5I66B 1TTFA 4ODXB 1JGDB 3GKWH 5HXMA 1NDMA 4PLNC 4PJFF 3DETC 4WI4A 4UDTA 2Q76B 2R0ZL 2YRLA 3CFCH 1L6ZA 2A9ML 3GSQB 4AIZB 4ZFFA 3BP5A 5I2IA 5HDOA 4XMKL 2FEDC 5DJAB 1IGJA 4HLJA 5D72L 3CLEL 3SKJH 1JNHB 4JFHE 3GKWL 1SM3H 5DDHA 4LBEA 4WV1B 3HLAA 3DXAE 3QCTH 3U0PA 4F3FA 2V5YA 4PJ5A 3M17B 4O02H 5EZLA 3NCEB 5GS1A 5JPMB 2BNQA 5EC2B 3SKJL 1UZ8A 3QFJB 1SM3L 3BUTA 1B0RB 4Q58C 4LF3B 1CGWA 4HWBA 4LCWB 4TTGA 3QCTL 4JCMA 2BSRA 4PR5A 1MAML 1VHPA 2UWEE 4O02L 3AB0C 1I7RB 1TMCB 3STBA 1U93B 5F7KC 4DKEL 4GQPH 3HZKA 3DECA 2J3SA 4JKLA 3KPSD 2MCG1 5DMGC 5I8EB 2OZ4A 2NY1C 4DVRL 4YHPA 1QG3A 1M71B 2PXYB 2QR0B 5CLTA 3KHQA 4QRUA 3FTGB 4IMLA 1JF6A 2IQAA 2W0LA 3VGGA 3PV6A 2E7LC 1CVSC 4HUKB 1SYSB 2CXGA 4QOKD 5ILTH 5AAWA 1GGIH 5BRZB 1CXHA 5C0CB 4F80A 1UC6A 3BH8A 1HHJB 1M7IA 1U8KA 3V6FB 4ZNCD 4LPXA 3T0EC 5ETUA 1ZE3C 2PW2B 2GJZB 2HLAB 4LEXL 1QACA 1CI5A 4YBQD 4LP4A 4M7ZC 2FEEI 1IM3A 4Z6AT 1CGYA 5JW4Q 1Q9LA 1KJ3H 1CGXA 5FF6A 3MNVB 2CR6A 4PJCA 3WCYA 4KHXH 4PJCF 1OP5H 1IAMA 4QHKI 2VUOA 5KJRL 2VLRD 4LLQB 2OTUA 2YUZA 1KJ3L 3RGHA 5E6IC 3BISA 3HNVL 3SE9H 4JFFD 1P53A 3SPVA 1XMWA 5A16B 2GCYB 3V7AE 2BNRA 2Q7NA 1U3HA 5HHPB 3DSNA 5CLWA 2J8OA 5DJ2A 5E94A 2HA1A 3BDYL 3PQYD 5ISZA 1UXWB 1VKXB 3IDIB 3TBWA 3CK0H 3O6LH 3PDOB 4OLYH 3B9KB 1NBVH 3B5HA 2P8LA 1J88A 3BPCB 3MV8E 1W0WA 3SE9L 2EIEA 5ESVB 3KYOB 1FNLA 1KACB 3LEVL 3GNML 1NMCC 4NN7B 5F70A 1MUJA 4KKLD 3VFPA 4HIIB 1I9JL 4FXGB 4YLQT 5I9QC 3TJHD 3KR3H 5TFSH 3CK0L 3O6LL 4FZEH 3MJ9H 1NBVL 3DGGA 4PJ8B 4UOW0 4ZS6C 5D5ME 2VLJE 4P0DA 5HD8D 4FS0A 2DF3A 4PYGA 4U1LB 4ZXBB 5IUSA 2CUHA 4J4PD 2VMFA 4OGXH 3GMMB 4KMTH 3QUXB 1N59A 4XP6H 3IXTB 1QQDB 3KR3L 1OT2A 2VRAA 3T77A 3MJ9L 1IGTA 3O4OC 5D7IE 1PG7W 4IOIB 4MQXC 4YEEA 1EFXA 1A14H 4RGMB 1C1EL 3QIWC 1TJIL 3OR6B 4OGXL 4JHWL 2YRZA 4KMTL 4XP6L 3BQUB 1FL3B 4QHKJ 5CBEB 4UTAL 1ACZA 1KB5A 2I25N 4WI6A 3LEXA 3EYOA 5CSZB 3TVMB 2FWOB 4QHMA 1ZA3B 3TH3T 4BSVB 2FL5B 2XWBA 1A14L 4PB0H 4L4VA 1BD2E 3RL2B 1XR9B 2XG4A 3L5XH 5E6IB 4NNPH 3D85A 3KXFA 4AK1A 1CXKA 3OKYA 4MCYA 5EFIA 4RIRA 1IQDB 1EFQA 3MRBB 1G6RH 4PB0L 5I1AA 4PJ7B 3C6LD 4I48A 2CDEA 1G7HA 2A6DB 3G6DH 5HDQH 3OXRA 4HX1B 3L5XL 1I7TB 2UZYB 4NNPL 2Z8VC 4GRMA 1UH2A 1NMCB 2EYRB 5J56B 1D5ZA 5FYJD 5IK3B 3OKEA 4YWGH 3BEVB 1A6PA 2K7QA 5C08D 1EO7A 3LQMA 1G6RL 3FOMB 5HTSA 3G6DL 3D25A 5A3IC 1V7MH 3MSPA 1G7PA 5HDQL 1JK8B 3TBYB 1MAJA 5AG8A 4YHML 2DQUH 4PP2B 3LAFA 4K3DL 1S7TB 2I9TB 2NW3B 4YWGL 4BQBA 5FIEA 1J11A 4ENED 3NN8B 1KIPB 2ZG3A 3IAPA 5DQ9A 1QSFB 4CVUA 1V7ML 1H3VA 3Q6FB 1U8NA 4X9GA 3VXOB 2O5ZH 4F7EA 1TZHA 4YR6B 1HCVA 3O4OB 3QFDA 3OX8B 5E00B 2DQUL 1R6VA 1AD0A 3HE6B 4BKLB 4QXGH 3HRZB 3QIWB 1I3RA 4OFVA 5DJYA 5IWLC 1KIQB 3K4DA 5CZXC 5ELIA 2O5ZL 5B3NA 4KK5C 4P3CH 5C9KA 4WUUA 1MWAB 4X6FB 3CVHL 1ZHKB 4QXGL 1RULL 4Y4HD 1P4IH 1W72B 2HN7A 4H8WL 4CN6A 4M93C 5IHUH 1H3GA 5EIIA 5I18L 2NY7H 2MHAB 1RURH 4J3XA 3HC0A 4ONGL 4V1DA 4HLZG 2W65A 4M61A 4P3CL 2A9NL 4JKKA 4GS7C 3RTQC 3I2CH 2PN5A 5EUOB 1U41A 3PJSB 3P73A 5JO5B 1P4IL 1VESA 3ROOB 3C60B 4G43B 5IHUL 3DXAD 3KJ4C 3T0EE 2FHBA 4D0CA 3B3IA 1CGUA 2NY7L 5KVDH 1QFWH 5H94A 3RVVC 3SDDA 1RURL 4CDHA 5H35A 2V5SA 3I2CL 4PS4L 1NPUA 3Q1SH 4Y5YB 3MRGB 2J6EH 2XOTA 1GZPA 2BY3A 1U0QA 3GMLB 4UU9A 3A0OA 2HVKB 4TVPH 3FQXB 3PHQA 2IANA 4GBXC 2WINB 4FZ8H 4MJ4A 3HC3H 5KVDL 5IQ7H 1QFWL 5C7XH 4CJ1A 3FB6B 3LQAH 1QEWB 1I4FB 2ADJA 1MCKA 4P57B 1WSST 4G6ML 3DX6A 3Q1SL 4GG6B 1D3CA 4QXUL 3ARBA 3AY4A 5B4MD 3GMOB 4HWZA 3N1FC 1F3DH 5CEYB 4FMFA 5F6HI 1F4WH 1CDUA 1MCRA 4FZ8L 1EA9C 1K5NA 3HC3L 4LMQI 4UILH 3AVEA 5IQ7L 5C7XL 3SGKC 1I1AD 4TULH 4OKVB 3LQAL 1X7QB 2UY7A 5INCA 1F42A 3VXQA 1CGSH 2X1WL 4IMKA 1F4WL 3P4MA 4BZ2H 1IE5A 3MNWB 3MRHB 5BJTA 2YD4A 3IJSB 4TULL 5I8OL 1KC5H 2BY2A 4S1QH 1CGSL 1CDCA 4FQJL 5T3ZH 3OG6B 4NC1C 15C8H 4M93B 3H9SB 3QJFA 2YN5A 4YNYA 3EOYG 1A7RH 3BP7A 2AABL 4BZ2L 1J10A 4N0UB 4FNLH 2YPLB 3VGAB 5IMMB 4GS7B 1T03L 1R3HA 1KC5L 4MGXA 5ABDE 4S1QL 3WKMH 5IEKB 4GJTB 5T3ZL 4EI5D 1IFHH 15C8L 5FGBA 4KROC 3KJ4B 4NNYA 1NAMA 4YHZL 4X9HA 2A2QT 4LFHG 5IB1B 1A7RL 4PY8I 5C0EB 4JPVH 3D69B 3ECBA 5CMAB 4PJFB 4B7LA 3QUZD 3WKML 1NDMB 4JQVA 4UDTB 1IFHL 5C3TA 4ZFFB 5I2IB 5F6HJ 3BP5B 4E41E 3MV8D 1PG7H 4FFVD 1FG9C 4UV7H 1IGJB 4JPVL 3L3JA 4NO5A 2GJ6E 1F11A 2VLKA 4K3JL 5DDHB 3SGEH 2QQLH 5CBAA 3QDME 4FQ1H 3PUCA 4LBEB 3HLAB 3BEWA 3U0PB 4F3FB 2EDTA 5J6HA 4PJ5B 3BOVA 2VLJD 25C8H 5EZLB 4QXWA 1BWWA 4M43H 5GS1B 2A83A 2VL4A 1TPXB 2BNQB 5F7EH 3GSRA 1CFSA 1UZ8B 3PP4H 1U3HC 4K8RD 1CU4L 5C92A 3ULUH 3SDAD 2QQLL 3FN3A 4ONFH 4NZDA 2FLRT 3U6RA 2WQ8A 2BSRB 3BX7C 3MBEA 4PR5B 2BMKA 5JIHA 25C8L 1PVHA 2M26A 1JRHH 3O8XA 3ZSTA 3GIVA 4MJ6B 4PJAA 5F7EL 2ED8A 2DAVA 3PP4L 1TVDA 4NOBA 4XMPL 4G8GE 2GK2A 3U9PH 4PJAF 5I1CL 3ULUL 2NY2D 2AP2A 4XXCA 3HZKB 4ONFL 3WJLA 4I0PA 4DJMA 5LGKA 4AJ0A 4KUZH 4NJAH 1LE5A 3DWTA 4YHPB 2JJSA 4PY8J 4WO4A 1EEYA 3ORJA 4GXUN 1JRHL 4OD1H 4JREB 4QRUB 5I75B 4IMLB 1NUNB 2IQAB 5EZJA 3Q6GH 1NBQA 3U9PL 2C7UA 3OKKA 3PV6B 4GW5A 5DFVD 1BD2D 4JQIL 3S34L 3PHSA 2PW1A 3HG1E 5IOPA 5HI4C 4KUZL 5C9JA 4NJAL 2YKLH 1ETZA 1HHKA 4GAJH 3BH8B 4JFPA 1K8DA 1M7IB 3SE4C 1U8KB 1GL4B 1CE6A 1J1PH 3EYQD 3Q6GL 4JDZA 5ETUB 3DETD 5HDLA 1IM3B 3FAWA 1Q9LB 2YKLL 1H5BA 4N0FA 2DJUA 1QBLH 5FF6B 3VFRA 3E3QE 4GAJL 1NANI 2FEDD 5AWNL 4PJCB 3ZO0A 1E6OH 4XP9H 4RAHA 4YFDB 4JHZA 1J1PL 43C9A 3QQ4A 4KQ3H 5IV2A 2Z31D 4RA0C 3MO1A 3DHJA 4OSUH 3VGFA 4XTRD 2DKUA 2OTUB 4FQXA 5L6YH 1QBLL 1CK0H 3SPVB 3IVKA 4PJHE 1PLGH 2BNRB 1E6OL 1U3HB 4XP9L 2J4WL 5JTWA 3BGFC 2B5IB 5DJ2B 4QWWC 5E94B 5ID1A 5ISZB 5A1AA 4KQ3L 1JWUA 1AKJD 3TBWB 4OSUL 2ADFH 2Q8AH 1ZLVH 2P8LB 4G6FD 1ZMYA 1JTOA 1W0WB 3DVGA 1CK0L 5SWSA 5DSCA 1PLGL 2JIXD 1MUJB 4NQSA 3VFPB 5DQJA 3RIFK 4U4BA 3PGDA 1ACYH 1N2RA 1BWMA 1I7ZA 3PP3K 2CO7B 2ADFL 3DGGB 1J8HE 4R4NC 1DUZA 2R1XA 2BZDA 2NY1D 3GSVA 4PJXE 3VI4F 2MOVA 4B7IA 1N59B 1ACYL 2FJGA 4N9GA 3T77B 1CFVH 1IGTB 3OGOE 1BAFH 1EFXB 1UFUA 4RNRA 3EBAA 2IH3A 4CL7A 1RZKH 3T0ED 4NWTH 4LQFL 4NC1E 3ZE1F 1KB5B 2FEEL 4XNMA 2R56H 3LEXB 1IGMH 2AJUH 1CFVL 3EYOB 1AJ7H 3MMEA 2YPVH 4QHMB 5BVJA 1WZKA 5DYOA 4OCWH 1BAFL 1BQSA 2XWBB 2FECI 3N1PC 2C9AA 1RZKL 3T0DA 4NWTL 3VXSE 3OF6A 2DIAA 2R56L 4P4KA 1IGML 2AJUL 1AJ7L 4RA3A 4FQPA 4LIQE 3KXFB 1XCQA 2D7OA 2YPVL 5DJ0A 4GRLA 3HB3D 5EFIB 4MCYB 4KFZC 4RIRB 4OCWL 4S11A 5ICZA 4KY1H 5I1AB 1IQWH 4I48B 1MHPH 2CDEB 1G7HB 2F53E 5E03A 3CAFA 1J86A 4OCNC 3OXRB 1BFTA 3SDDC 4GRMB 5T5NG 1D5ZB 5DI8A 5EA0H 3OKEB 1NC4D 2ZNWA 4KY1L 4F37K 1IQWL 3TCXA 3KPRA 5JDJA 2ID5A 3D25B 1G7PB 3VXRE 4Y4FC 1F6LL 4WHDA 5T3XH 2P24A 4ZS6D 1FYTE 5EA0L 4CU6A 3ARBC 3S36H 3HNTH 4UMGA 3GHEH 1DQLL 1KCSH 1X5ZA 3B8SA 5E2UH 1CG9A 4MJ5A 5DQ9B 5GZND 1U8NB 2PYEE 4DK3A 4F7EB 1MRDL 1TZHB 4TUJA 3QFDB 3WNLA 3SHSA 4LHUG 1AD0B 5D71H 1IEBA 1I3RB 6FABL 4MQXD 1EUUA 1DN0A 1HSBA 3HNTL 1FLTX 2PR4L 3LY6A 3OGCA 3GHEL 1KCSL 2X1OA 5E9DA 1M6OA 5E2UL 5DJYB 4IMKC 1EX0A 5J11C 2NX5A 3BPLC 1BOYA 4IDJH 2DBLH 4WUUB 4IRJA 2AJXL 2HN7B 1OTUD 5EIIB 1EPFA 3FQWA 3IFLH 3RWEA 4E41D 1P7HL 4R0LC 3RBSA 3O2WL 3HC0B 1QRKA 4V1DB 1IGCH 2R15A 2W65B 4M61B 4P5KA 2GJ6D 2DBLL 3CXHK 3QQ9D 3FJTA 5DFTA 3P73B 4XPHH 3QDMD 3WIHA 3SGJA 5MENA 1F02I 5FGBC 1CN4A 3BW9A 3NFPA 4D0CB 3B3IB 3MV9E 5FA3A 5H94B 3SDDB 1FQ9C 5H35B 1VEMA 5IB2A 5L2KA 1J1OH 1ROWA 3WNKA 4ODTH 2HTLC 1GZPB 4XPHL 4UU9B 3C8DA 5EWIH 5C0AA 4JQVC 2AQ2A 1S7VB 4LSTL 5IBUB 3PHQB 4KZDH 2IANB 2HTKD 5A3ID 4GSDH 5IVOA 5BW7A 4JZJC 4K9EC 5LGHL 4POUB 1J1OL 4H0IA 2G5BA 3LOWA 3DX6B 5FOJA 4G8GD 4V2BA 4LSRH 2OXHA 3ARBB 4HWZB 5EWIL 1WTLA 4U7KA 3AREA 2I60H 2AV1A 1Q1JH 2NY3B 1K5NB 3OSKA 4JRWA 3FFDA 3CD4A 4JY4A 2JELH 3NIGE 5INCB 3VXQB 1ZLWH 4PV8B 4Z7UA 3F7PC 4LSRL 3D3VA 3R0MA 4Z7UF 3HG1D 2I60L 2VOTA 3P4MB 5DRZA 1KJVA 4UOJA 3DSFH 2VAJA 1G9NH 1JGUH 2JELL 5BJTB 1ZAGA 1EJOH 2B1AH 4KK5D 2X10A 1OAQL 1PSKH 3RIFF 2E7MA 3QJFB 4OZFA 4XXCC 1MJJA 3NTCH 4PUBH 4YNYB 3QUKA 3BP7B 1G9NL 1UKQA 4WO4C 3VRLF 5MERB 1R3HB 1EJOL 2WIMA 1PSKL 3RTQD 1OSZA 1LD9A 1SJHB 4FG6C 4NNYB 4R6UA 1NAMB 3NTCL 4PUBL 2EC8A 2VQTA 3PABA 4QKXB 4TSBL 4TNWF 4TRPH 3DBXA 2D4FA 3VGBA 1PG7X 4AEIH 4EN3A 3RVVD 3ECBB 4OZHE 1CDYA 2ICWI 2X6MA 3L3KA 2R1WA 1ZLSH 4XMLL 5MP6H 1S5HA 3MLXH 3B43A 4LRNL 3GSUA 2EDJA 1C16A 5AYUL 3FONA 4KXZI 4JO3L 3W0WE 1YJDC 4P3DA 4GBXD 4TRPL 2QSTA 1IZJA 3L3JB 1D7FA 2YHGA 5IW1A 3O9WD