2F53D

Directed evolution of human t-cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without apparent cross-reactivity
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
193
structure length
193
Chain Sequence
b'MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIPFWQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRPTSGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen
publication title Directed evolution of human T cell receptor CDR2 residues by phage display dramatically enhances affinity for cognate peptide-MHC without increasing apparent cross-reactivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2005-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2f53D02
4MQ7A 1JBJA 3MGAA 2BDNH 4ODVL 3QJFA 3GSNL 2RB8A 3QHFH 5I2IA 5FV2A 2DQEH 3IDJA 2IEPA 2NR6D 2C4FT 4JFDA 4PJDB 3C2SA 3O41A 4U0RB 1NGQL 4AEHH 2BSSA 1FO0A 1YEHH 2X1QA 1FCGA 2OXHA 3BHBB 4JKWA 3EOAB 1DBKL 5E94A 4OF3A 2X4SB 3PWLB 4XC1L 1MWAB 3VGGA 4Q9RH 5CZVH 4CW1A 4LP5A 4F7EB 3LQMA 3C9NB 5D2LF 1YEJH 3DETC 3ARGC 2APTA 1G7MA 4JANB 4DUVA 3L9RB 3VFOA 4LPTA 2YA0A 5EOQH 4PB9L 3BZ4B 2X10A 5FV1L 3KPRD 3LEXB 2NXZD 1TTFA 3OAUL 1HH9A 1RY7B 2GITA 5BS0A 4PLJC 3S5LA 3GM8A 4PJHB 2EH8H 3X13B 2YZ8A 4R3SA 3LS4L 4JFOB 1ORSA 5IEKB 3MGOA 3FFDA 3VI3E 3GB7B 1F58L 2H41A 4YHOH 4LRIC 2PW1A 3QDHA 3PXHA 1A7RL 1MNUL 2IMMA 1Q72L 5EBLB 1UH3A 3R1GL 2CGRL 1OTTC 4LSPH 2CIIB 1B3JA 1CXHA 2A38A 1T2XA 5EUKA 4OCXL 4QOKD 2UVEA 1A6WL 4NKOA 5ALCL 1BLNB 3QEQB 4ONFH 3GIVB 5C0JB 5JR1H 3KPRA 3TNNB 2Z35A 2B8OT 2BHYA 2DDQH 1UCTA 2W9DL 1AXSB 5HD8D 3QISA 3EO1B 1J87A 2YUVA 4PY8I 4YXHH 2XZQL 1L6XA 2RBLA 1FH5L 3BP5B 1KUMA 1IC1A 1M7DB 3P77A 3QO0A 4WEBH 4N8VG 4PTUB 1UXWB 1CVSC 2VL5B 1NEZB 3LS5H 3MO1A 4PBWD 2ADIB 2JCCF 4PJIB 5CHNB 2NZ9C 5DK3A 3OMZA 4QY8B 4HKXA 5A2KH 4MD4A 1EEZA 4FZEH 2ICES 1BQUA 2SEBA 3LKNA 1FIEA 2GJJA 4RRPG 2C7UA 4NZDA 3A6OA 4QOKA 4WV1C 4PJ5E 3WN5A 4I3RL 1A6ZA 4Q58C 1A1MA 1NGPH 2J6EH 5F88B 4E41B 2CRIA 4JHAH 1F5WA 3BQUD 4MA3A 3B4NA 5DRNA 3WO3B 4LLYA 4L5FH 5LGHH 2IQ9L 3C8KA 3G6AB 4NQUA 2OSLB 3P9LA 8FABB 5I1LA 4C56B 3V4UH 4PG2A 3GJEA 4WO4B 5IG7B 1FZOB 4APQA 1U3YA 1I7ZA 2CR6A 4EKXA 4P4RA 2X1WL 4P2RA 4QCIA 4R7NA 2HTLC 2MWCA 2MHAA 3IDYB 4JCLA 3VJ6B 4XMKL 3OB0K 1WIOA 3UAJC 1P7KB 4J4PD 4KRNA 5DMGD 4UINL 1SY6L 4XXCC 1A7NL 1C08B 3P40A 2R29L 3V2AR 1NGWB 1K8DB 3MGTA 1TNNA 1IJ9A 3N1FC 5E8NA 1CTOA 2Z9TA 1FGNL 4NRYB 4KQ4L 1QSEE 4HPYL 3MSPA 4O9HL 4ZS7H 2R2HB 5DEGB 5F9AC 3PXJA 5C0NC 5FB8A 5CP7A 4FXKB 4QTHB 5B39B 1T7WA 4WHYG 2CKBH 5EA0H 3OR6B 5D9SA 5J6GB 1BQLL 1J1PH 5A3IC 4XNZC 5IUSA 1IKFH 3VG9B 1CDCA 1MFAH 2BNRD 3HNVH 3ZYIA 2EECA 4ZPTA 4ZD3L 3L5HA 5E8OA 1GGBH 1TQBB 4UUJB 3FFCE 4KTEH 3JV5A 3WIFA 2ZP0T 4Y4KB 3QQ9C 5C09B 4CDHA 3CVIH 4HZLA 1Q38A 4MB4A 1TJHL 1HKLH 4JPKH 3X11A 2HAZA 4PV8B 4G6AD 5ILTH 5GSVB 1I8LA 3H7BA 1P2CA 5K59F 1JPSH 3D25B 3GSQB 5F3BB 4PBXA 5E8DL 1G7PA 4GAGL 3VDAA 1HQ4A 2DLEA 1SEQH 5KSBB 5AAMA 4PRNA 3QI9B 2Z31B 1BVLB 2O5XH 4IRZH 3QJHB 4Z7VB 4LDEB 5C9KA 5ID0B 1X5GA 5A2FA 1PBYA 2OI9C 4N90E 1TZHB 3GBLA 1GVIA 1DQTA 3RJQB 3L1OL 1KYOJ 3HS0B 1G0XA 3ME0A 5DJCA 4CAGA 3N85L 1KENH 2HRPH 4Q6IB 1C5CL 4Z7UB 2Q7NA 5D1ZC 5C0DA 3DBXA 4QHKI 1WUNT 1A7OH 2DQJH 1DBJL 3B9EA 3DVGB 3OAYH 3TJEH 3OJMB 1R3JA 3L3DA 5GS1A 5FAAA 2BK8A 2IH1A 3I75A 4GBXA 3I2CL 1R5IB 5ID1B 4RGNB 1TZGH 1QRND 2DKSA 1OHQA 3SDXA 4PLKC 3IXAA 3MCG1 2RJMA 1FFPA 3BGAA 3CVHH 5GJSH 1DUZA 5ACZA 4YAQA 3SE9H 5FYKU 4FHBD 1P7HL 3X3FL 4LCCC 3FTGA 4IRSB 4ZAKD 4OSUL 3QIUC 4YGVB 1BF8A 1C12B 5FEBA 3MA7B 5JIHA 2JJTC 5TQ2L 2Q76B 1QBBA 1KCSH 4UI2A 5TE4H 3OR7B 1OM3H 2J88L 2ICCA 3NFSH 3IDGA 4PJXE 3SKMA 3ILQD 2IH3A 4HBCH 1A6TA 2Q8BH 5C8JA 3WFEH 1J0HA 5JO5A 2GSIA 2IFGA 1CXEA 2ZUQC 4TSAL 1MAML 2NY5H 2NYYD 4LKXA 1U8JB 4DVBA 4AENA 1Y18A 4K94C 4WY7H 1CLZH 1QRNA 3DX9B 3O11A 5FYLD 4RGMB 5KW9L 4HZAA 1LD9A 4I3SH 1MWAL 4LSTL 2F19H 3V6OA 1U8PB 2YMXL 1Y6KR 4JR9L 2UUDK 4ODUB 4CJ1A 1B6UA 3QUMA 2HT4D 5TE7H 4ZAKA 5A43C 4YZFF 3MLZH 5HVHC 3IU4H 1UADC 3CDYA 2VLLA 4BFBD 3DPBA 3LH2H 2QEJA 3AS2A 1BJ1J 1DQLH 4M1DH 2BVYA 3WFDL 4HMCA 4KJQD 2LAGB 6CGTA 4RFNB 4LHQB 4QXWA 2XPGB 4HUWA 2W65B 2E27H 5C86A 1RAMA 2V2XB 5DUML 3MYJB 1QOKA 4IMLA 4LSSL 5DHVB 4RWYL 1MIMH 4LU5H 1ED3B 5I17A 1BD2B 1CF8H 4H5SA 4R4BB 2GAZB 3GUTA 3D69B 4M9OA 4LSUH 4NZUL 3C5ZA 4X98A 4Y1AD 3QPXH 3L95A 4TRPL 4CJ0A 4S1QL 4K2UL 4KI1A 5HGAB 1JGUL 3LKSB 3KDMB 5TPWH 1XIWB 3O4OC 1DSFL 3QCTH 2I9LB 3GSRB 4HIJA 1F6AB 1WFOA 4EDXB 5GZNC 4NSKB 2R2CA 3UTTB 4ODSH 4WTZA 4PJGA 4LQFL 1DQQA 3LVEA 1Q9KA 7CGTA 3BGMB 2BVOB 1WZKA 4HFWA 5GJTL 2YWZA 3MRGA 3T0BA 1RIUL 4JZJB 4UT6L 4PJEE 3BDXA 4JKLA 4HLJA 2D31B 5ISZB 4TQEH 4Y4KD 4OM0H 1AIFB 5IT2H 4MNHA 4XVJL 3OJDB 1JF6A 4JVUA 1QNZL 4LARL 4OLUL 4N1CA 1U58B 4Z78B 3DI2B 4KKCC 4ZQKB 1TCMA 1PYWA 2VH5L 5MERB 4PG9A 5I1HL 1QBML 4DZ8B 1TENA 1JHLH 1ZLWK 2IAMD 4JO4H 1BZ9B 2XFXB 5DJYA 3RGHA 4NO2A 5T3ZL 3V5HA 3SO3B 5AYUL 3S4SA 1OSPH 2ZCKL 3NOIA 1BFOB 2CJUH 1F3DJ 5AZEH 3BP6B 3QI9D 5JTWA 1I8IA 3L7EA 1DBAH 3LD8C 4EEEA 1J1XH 5HYSB 4U2ZA 3MBEC 1LDPL 2WBKA 4Q9QL 1CDJA 2YEZA 1PAMA 1G7JA 3PGFL 4HT1H 2IPTH 5IVXE 2EICA 1DEEB 3MJ8A 4ZFFB 2V5YA 1GL4B 3AM8A 3MLVH 1KN4L 3A6BL 4PJ9D 3C5JA 4KH2A 4PREB 4XH2B 4U3XA 5HDLA 2EEBA 2FO4A 2DQGL 3M17A 2DI9A 1AGFA 1ZHNB 4JG0H 4OBRA 3UMTA 1UM4L 4S0SD 3BPOB 1AQKL 1QR1A 1G6RH 4ONHA 6FABL 5GS0H 1UVQB 2IAMA 4PJXA 1EBAA 4JFZL 1VPOL 4OCSH 2VZOA 3HPJA 2ITCB 4ZUSA 3L7FB 1A7PH 2O26U 4UTBL 4FS0A 3DYOA 4DZBA 3EDJA 5DJ2A 1QSFB 4M6OL 1AHWC 1SJEB 3UTPD 5KVEH 3HLAB 3LB6D 4WU7A 2OR7A 5F7WC 3DLQR 4W6XB 1CQKA 4WFEE 1P6FA 1ZMYA 2BVQA 1TMCB 2ZG2A 5C3TA 4PR5B 1Q0YH 4O2CA 4OM1H 5CP3A 1NCCL 1DZBA 4LCYB 4JFFA 2IQAB 3PABA 2G60L 1W8NA 3IETB 4ZFGL 4YHML 3LKOB 1N59B 1HINH 5GSRA 4OV5B 4XCCH 3WCYA 4P5TD 4JHZA 1A47A 1YN6B 2ARJA 5KG9B 1FNSH 3IDXL 1YPZB 3CSYA 1KPRA 2AK1L 3SJVD 1S7UB 3QT2A 1RJZB 4XNXH 4DFHA 4N0YL 1B6DA 5DEFB 2V5MA 4UIKL 4W4OA 1KELH 5T1KD 1A3RH 2CDEA 4LL9A 3IU3A 5F1IA 1N2RA 1CFSA 1URLA 1CFNB 1JE6A 3OKNA 3WDHA 2APVA 5I73C 1RJLA 5FHBH 1M6OB 4QTIL 3DRTA 4X4MA 3ROOB 4HQQH 5IP4A 2VABA 3VFGH 2LABA 4V2BA 3T2NL 4P5MB 1RUQH 1RULH 3V6BR 1DLHB 3SDYH 3TBSB 5LQBL 2EIDA 2FWOA 2GJZA 1QG3A 3RWIB 4P5TA 1U92B 1J1OL 3MUHL 3S34L 2AV7B 4H26B 2ITDB 5LAXB 5I66B 4B41A 5SWZE 4K8RH 3WD5H 5F7KC 3AB0B 5L7XH 4NQEB 3VA6A 4TULH 2UZIL 1YDPB 4DGVH 4AZ8A 1EJ6A 4UQ3B 2XKUA 5E6ID 3QWQB 5L9DH 5B38B 1GJIA 3TPUB 1JWSB 4M03A 1G6VK 4LIQL 5F9DC 1IE5A 3QQ3A 3O2DH 4Y16D 3B5TA 2R8SL 3Q5YA 5EOTB 12E8H 1WSST 5I9QB 1J0JA 5HPMA 5EZIL 3QIBC 4F58L 1T21A 1OTUD 3SQOL 3MUY1 4ZTOH 5KSAB 3IDNB 4L4VB 1P4LA 2XZCH 4F15C 2R4RH 5DR5L 5HYQB 1NL0L 4PRHE 3I6KA 1NCAH 1P9MC 4ZSOB 3M07A 1ZA6B 1J5OH 1A3QA 2XTJB 1AE6L 2P5WE 2HJFB 5FHAL 4A6YH 1MRDL 3LY6A 2P43B 3HZVB 4JHWH 1FO0H 3VFSB 3VI4E 2ZUTA 4XC3L 1AXTL 3JTTA 3HR5B 3IDUA 4U3HA 1QBLH 3QZWB 3RX8A 3BEWA 4QRSA 4FMFA 5IB2B 4Y4HC 2G5BA 4Y16A 4EN3C 1BFTA 5CIPB 3V5DB 3ARSA 3GI9L 1JRHI 3KPQB 4BK5A 1NBZB 4JFPB 5D70L 5F7NC 4XHJD 5JZ7D 5D2LA 2PW2B 2NY2D 3NGBC 4MB3A 1HN1A 2JB5L 1T80A 4HJ0D 5D96B 3SY0A 1RIVH 3Q1SH 5E8EA 5IMMA 4R0LA 2BZDA 3UJJH 2H8PA 2VZTA 2Y07H 4NUGL 3VXPA 1A6AB 2XWBB 3MACH 4M1GL 4BH8B 5J6HA 5K59E 3UO1H 1SMOA 4Q74A 4TPRL 4I4WB 2HN7B 5ECJE 1UZ8B 3LDBC 2OJEB 4GRLD 2FD6H 5DZLA 1TJGH 3IFNL 3RWCA 5I18L 3MRJA 1HHIB 1X5ZA 3S88L 3NZ8A 4XTRC 5DUBA 3WHE1 2OR8A 2RHEA 1FNAA 4J23A 1JMZA 3ULVL 1R5VA 3FO9B 4CMMA 4GLRH 4X9FA 5BJTB 3DHJA 4NP4L 5CJQH 3ARTA 3AY4A 4KKAC 5MP6H 3VFRA 2NW3A 2DQTH 1MRCH 2HJKA 1NC4B 4N1EA 5EUOA 5HHVL 4D9QD 1IQDA 1MJ8H 3IKCA 5I74C 1EJOH 5EC1B 4FQ1L 4N0UE 3BEVA 4JFQA 4PGEB 5JHDE 3VFMB 4HKZB 3LZFL 1I1AB 1DUYA 2FHBA 4PJ8A 3BKMH 3GO1L 5I6XC 3F7PC 3RIAF 3VDBA 1N0LA 4J3XA 3G6DL 1EO5A 1Q9WA 1REIA 1YNTA 1I1YB 2Q1EA 2VLKE 4HUNB 4GRLA 1D5MA 4DOHE 3U30B 2ADGA 1DQJB 2DWDB 4LVNB 4G80A 4PGDB 4JB9L 4BFGA 2RCSL 1LWRA 2QQLL 5H37G 2JCCA 5E9DA 3DI3B 2Z8VC 4MD5B 2VDQL 1GGTA 4GG8B 4HS3B 4HGMA 4XVUC 1E4WH 4PJDF 1UWXH 4YDKL 4HK0B 1CXIA 4CVZB 3MJ9A 1YEFH 3P4OA 3SKNA 3EOYG 1EGJL 1JTOA 1I7UB 4X6DB 1XH3B 1T0MB 3BAEL 3DO3A 4X9HA 4OZ4B 1XR8B 3W9DA 4HS8L 4GW4A 4K3JL 1CFBA 3PL6C 5IQ9A 4KRLB 3RNKA 1OAXH 1A3LL 5FGCB 5C2UB 3X3GL 4I18B 2BP3A 4U1MB 1P84K 3EYOA 3W39B 5CEYB 3FKUS 1PX3A 3QPQC 4ZXBB 2ZOKB 3RBSA 2MPAL 3EJJX 3NPSC 4LASL 4YZFE 3SBWA 3T4AB 3QNYA 3SDCB 1EHXA 4LEOA 4M62L 4PRHA 3JWNC 4U6HB 5D6CA 1BMGA 1M7IA 4LOUC 1XGTA 4U3CA 4F33A 2JJSC 4FQJH 4P49A 2XKNA 2ZSVB 4JAMA 1SQ2N 4GAJH 1UM6L 1G9NL 1YYML 1U95A 3FOMA 4GRWB 2ATKA 2VLRE 4FQLH 4IRJC 2FX9H 2YPLB 1UC6A 2X1PA 2X4UB 4XRCA 2Q6WA 3RWHB 5BQ7A 3U4AA 2YPVL 3ULUE 4HG4J 3HG1D 4KY1L 5AWNH 1N3NA 4JN2A 4AH2B 2VUOA 5B3JF 1MCQA 3HE7A 4C55A 2PR4H 3FB5B 3ETBF 3CLFH 5JW3H 5I8KH 5JXAH 3RIAK 5JIIA 3RJDA 2VC2L 2AJZA 2DJUA 3QUXC 4H8WL 3U36A 4JFEB 1NUNB 4J8RB 4NQXB 4HXAH 2XTJD 4JY4B 3C60A 2PCPA 4KKBD 2IG2L 2X2YA 4IHOA 3Q48A 1LEIB 3F6LA 3HFML 1YEGL 1A14H 4KROB 2YC1B 1WWCA 4AL8L 1MJJA 4OI8A 4KVCH 1A7BA 4JM2B 1ADQA 4Y5YC 2YBRB 4YFLF 3JWDH 4L8BA 4FTVE 4R97B 2IADA 3V4VL 4KMLB 4NM8H 4J2XA 1H3VA 3TFKC 5CBAA 4OUOA 3HG1A 2KQNA 1QFWI 1OGTB 1U8LB 3QUKA 4DCQA 5I1AB 3KNBB 1AO7E 1AGDA 2BVPA 1FL5B 3CMGA 4YHLH 5K9JL 2AXGB 5B4MD 4YDIL 3REWA 1JFQH 3VWKC 2E7HA 4I8DA 5JDSA 1GZPB 4KJYB 3TO4C 3GRWL 4X99B 2HT3D 1INQA 1CE6B 4I5BB 2BHZA 1ZS8A 1KC5H 2VAAA 3ULUC 4G7YH 5FA4A 3GSUA 3GDBA 4N0UA 3RZWA 4RAHA 4BH7B 4CVUA 4LPXA 3CJJA 3H9YA 2H26A 1I9RL 1KLGA 4HAFA 4WHTB 3AREB 4IOIB 4OD2A 4FQQB 2J1KA 1FPTH 1HXMA 5HDOA 4FP8H 3LRHA 4RAVA 1JPGB 4N9GA 1U8NA 2UWEF 5E4IA 5C0RL 8CGTA 3WNKA 4HUVA 2ZNXA 3KPMB 1RUAH 4M8QA 3BIKB 1R5WA 2ATPB 3ARDB 3B43A 1E6OL 1ZWIB 3NFPA 3LEYL 3QEUA 3ARUA 1U8QA 3RWDB 1BIIB 1OAZL 2B1AL 5IVOA 4M61B 1VACA 1OSZA 1WTLA 1N6QL 3ESVF 4TUKL 3H0TA 2VSCA 1JJUA 1K2DA 4HIIB 1Y6NR 1CS6A 2A1WL 2QQNH 4NJ9L 4R2GC 5HI3D 4BSVA 1CGTA 1MCJA 1FFRA 3PQYD 3JVGC 4OD1L 4E0RB 4WWKA 3C09C 1D9KC 1U36A 4HUKB 4KAQH 2V7NB 1E6JH 4N5EC 1L0QA 3QUMH 1FP5A 4MWFB 4G8GB 5K9OA 5FOBB 2ARJQ 5C0BE 3VFPB 4MJ6B 4CKVX 1JZ3A 4HIXL 3SOBH 4XP5H 5KSBF 4UTAL 4MJ2A 4KDWA 1NDMB 2X70B 4D9RD 1HHHB 3WFHB 4B50A 5EFIB 3SEPA 1L7TL 4NHUB 4GT7A 5ANME 3AUVA 1ULVA 5J0BA 3MUGB 3RVWC 1ZGLB 3H6JA 1Q94A 5KVFL 1XF3A 3EW3B 3BIBX 4NPYA 4YDLC 4BZ1H 5C07B 1T04B 2IANB 4G9FD 2NY4C 4H1LA 3PQYA 5FYLH 1IQWL 1IGMH 3WDIA 2DLHA 4NNYA 1HYSC 2OTUB 5L8KB 4OLZL 1AXIB 2JF1A 3VD5A 5F72S 1JTTA 5BV7H 2ESVB 5GIRB 3LHPL 5IJKA 3OZ9H 2EE2A 2NY0C 1Z5LB 3DNKA 3ZMRA 1T1ZA 1WT5A 3SDDB 2CLRB 4F9PC 3KYKH 3VW3L 2QL1A 5GRUL 4HIEA 4GSDH 4ZUTA 2ZG3A 2H2PD 1J9CT 3IS1X 2J4WL 4YHKL 2GUOB 2ZWLT 4XP9H 1GHFH 1U93A 1VFBB 1KG0B 4MJIE 1ZTXH 3HRZB 1P5UA 1P7QB 3W11D 3V9FA 4HAGA 3TWCH 4FQXB 5IV2A 4PGBA 5J7CC 5CMAA 3G5ZA 1QKZH 1JP5A 2B5IC 3O9WC 4LHUD 3PNWB 3I50L 1CLOL 2AXFA 4BSJA 5ADPH 2VLJD 2ZCLL 1AFVH 5TH2B 1AO7A 1NAMB 3HI5H 3MCKA 3O3UN 1S8DA 4QRRD 4K3EL 2AI0L 1UQSA 5GRVL 2VUYA 4DN3H 1OGAA 4HWEH 2N1KA 1OARL 5GGRB 5GZOC 5INDA 4KV5F 4EUPA 3ZYOA 4PRBB 4U4BA 4MXVF 1JV5A 2P5EB 3MREB 2EC9U 1EAPB 1W0VA 1I85A 4LK4A 4LSRH 4RDQF 2CLZB 3J7HA 1TVDA 4ISVA 1NC2B 1MIEL 4GMTH 4JRWA 2HFEA 5J1TC 4NN7C 4G5ZH 5ETUA 2F58H 3QEHB 4BJLA 4FQCL 4MQTB 4LHUA 3MRNB 4OZHB 5F44A 2ZSWA 5IB1B 1RZIA 1FLRL 3R0MA 1O7SA 1L9MA 3GMLB 4EOWL 4WW2C 5KVGL 2J5LB 4M7LL 4OLYL 5DA0B 1FL3B 3WIHL 3GHEH 5IVZB 1F97A 2MSPA 2NXZC 2IF7A 2W92A 4G6MH 5F7FA 4PGZA 3GKWH 1XGPB 5KAQF 2G5RA 3S3SA 3IGAA 2G2RB 4MXQC 2XXCB 4N0FA 1U8KA 2R1WB 5DRWA 2VITB 3E6FA 3QFJD 5L2JA 4JRYA 5CP3H 2B2XH 3QDJD 5C6TL 1FORH 3MRQA 1EDQA 1MLBA 1K4CA 3E2HB 4AIXA 3ULVF 5I0ZA 5C0BA 1ONQB 2XIDA 5GS3A 4O02L 1B0GB 3CH1A 4YDVA 4P9MH 3WSQH 1NEUA 4OF6A 1JNNL 1P84J 5C7XL 3RDTC 5AD0B 4NCDA 1F90H 1J1OH 5A2JH 1J0IA 1H5BB 2DS4A 5B8CB 1S9WB 5CUSL 2F5AH 5HD8C 2WUBH 1X3DA 2L7JA 5DLMH 4NQDD 1NCWL 1Z9LA 5ENWA 2EYRB 4RMVA 4RGOH 3FQTA 1T7VA 2R0KH 1UA6H 4D3CL 2V2WA 1T6WA 4DGIH 1X44A 1RZKH 3L3OA 3LN5B 3QDJA 4R4NC 2BNRE 4PRDB 2JK5B 3ZKQD 2P48B 4M7LT 1MPAL 1ZGLM 3WXVL 4AEFA 3LQZB 5FYKD 5IFHH 1YEIL 1FYHB 1P4BH 1U3HD 1AKJD 1YNKL 3DVNA 2NLJA 1UGNA 1KJ3H 3N50A 4NFDA 4LLWA 3BQUC 3NVQA 5TF1L 3SKUD 1VEOA 3I85A 43C9A 1CK0L 1LO0H 5I1JH 2C3GA 4ZS6D 3ZE1F 1MCPL 2YN5A 4BZ2H 4NQDA 3RY4A 4G9DB 3MLWH 4PJDE 4WCYH 3ZTJG 5HHMD 2J3SA 4U6VH 2IALB 2V9TA 1N26A 4LLUA 3UYRL 2GFBB 3S96A 2XZAL 4J4PC 5KZCB 1XF1A 5DMGC 1NFDA 2DD8L 4OTXH 3SDDD 4P2QD 1HWGB 4JDZB 4Y0GA 3VFUB 4WI3A 4OCRH 1AY1H 4UV4L 1DBML 5LXGH 2W59A 3FOLB 3T3ME 4CDGC 3TYFA 4M7KL 1S9XA 1GC1L 5IGXH 3FO2B 1HOCA 1NUFA 1AKJA 1CE1H 4KPHL 4P2OB 1OAYH 3KPOA 5C2BL 2JKXA 2V6HA 3MLUH 4M6AA 1RZ7H 4FQIL 5D1XA 2VR4A 1C5BL 4NN6C 2V7HB 2QKIA 4PJHE 4WTWA 4X5XB 5GRXG 4R4FL 4QGYA 3W2DL 2FIKA 1SEBA 3FO0H 2EDKA 2OZ4H 3P0YH 1FZMB 2GK0A 1L4IA 1A4JA 2RR3A 4RNRA 1UACH 5CSGA 1YYLH 2QHRL 1RIHL 4NHCH 4E5XA 5KS9B 1N5YL 1YPZF 2P8LB 4P9HH 1F00I 4OQTL 2HVJA 2P5ED 4G6AC 3TA3A 3PGDB 1CZ8L 1DN0B 3MRDB 4U1KB 5B3JE 4U0RC 1VERA 2JE8A 4PJFB 4U1IA 5CD5C 4MNQB 3Q2CA 5KSUB 3KPLB 2FB4L 3D87B 2I60H 1JK8B 3QEQE 5HHOD 1YMMD 2AJUH 1WWBX 4IIQA 4LCIL 1YNLH 3D9AH 1NC2D 5DMIL 1V7NL 5ESQA 1D5BB 3O8XD 2F8XC 3NCFB 3DTXB 1ACYH 1IAIH 2CD0A 1KB5A 5IK3B 3GZKA 3TP4A 2E7MA 2N4IA 1WZMA 3N9GL 3L3HA 4U6TA 3JTSA 3MXVH 5JW5A 1QEWB 3ARWA 1MQ8A 3RWFA 4JGMA 3TIDB 4AM0B 4P5KA 4PJIE 4OGYH 3Q6FA 4WEUD 3Q6GL 3C08L 2D03H 4WU5A 5C0EB 4O5LL 1WBYA 4PGCB 1CFQB 2NW2B 4NO3A 4ALAH 1L6ZA 3CXHK 5E5UB 1QYGH 5DSCA 5IBLC 4E41E 4J3SA 4JGJA 2D9QB 3V8OA 2EKJA 5MEOA 5JLZA 3RU8H 1B0WA 4HJJL 5DD1H 1OT1A 3T77B 2QJDA 1UENA 4JY5H 1QLRA 2LVEA 4OGAC 1NAML 2HFFA 2ZPKL 2D0HA 4F37F 1JGVH 4G6KL 5IIEB 2NPLX 3DUHA 1A5FH 3QCVL 4I2XB 4X7FC 5F93C 3H3BC 1UJ3A 4Y1AE 4TVPD 3O6FA 4EIGB 1WBZB 1KPVA 5I19H 2V5TA 2B0SL 3FB8A 3TIEB 5JOPD 3KYNB 3KYAA 4G3YL 3ZKND 3EFFB 4F7PA 4O4YH 1KTDB 5I30L 2DM2A 4XX1E 2YSSA 1XEDA 2H9GB 3BSZL 4IEFB 2YD6A 3MJ9H 5ALBL 1RK1B 2BJMH 1J8HB 4AEIH 4LSVL 4PJDA 2VXSH 2R1YB 1V5JA 5I15H 2HT4C 1R0AL 3C5SB 4CVXA 2PTTB 4XPBH 1J11A 3TM6A 2BFVH 2A6KB 3ZHDA 4F7EA 5TDOA 5EIQA 4M4RA 4ZOAA 4UNVA 5F7UA 4JANA 2LTQC 4KJQC 3FT3B 1JZ6A 3RWGB 4ZDHB 4WO4C 1L9NA 2A6JB 1N6UA 1ZV5A 1A21A 4R7DB 3IDYC 2P46B 1MHCB 3VXMD 2XWJA 3HUJB 3D39B 4Z7VE 2ZCHH 4XZUA 5F9JB 3ALWA 3QHZL 1UYWL 4JDTH 3TZVA 3RRQA 4HHAA 4OQ1A 5DJ6A 1GAFH 1UKQA 4GQ9H 3O6MH 1CL7L 1EUTA 4XVTH 2AJSL 2VZSA 4HX1B 2EDYA 2ERJB 4WFFE 1B2WL 4Z7UE 2BNUB 2WBWB 4WDIA 4X4YA 3U46B 3NN8A 3VG9C 1BM3H 3CFCH 4F37K 2FSEA 2VLME 4DK6A 4H88L 4QXGL 1TQBC 2EIZB 3MYZA 4Y4KC 5FKPB 1IILE 3M8OL 3IAGC 5I8EB 4MMXC 1AXSA 1I1RA 1BZQK 4U49A 4QHNB 3LV3B 1FYTB 4P3WA 2DQCL 4M5YH 5EU6D 5BZDB 1RHHA 1ADQH 2WBJD 3VGAB 4UB0H 4PTUA 4WEMB 5B21A 3LCYA 5DFWH 1S7QA 5A16A 4OZGB 2A74A 1QRKA 4S1DC 1XCTB 3R06B 4OKVB 4ZTPL 5HI5D 1JGDB 5LVEA 2H3NA 1IC7H 4DN4H 2FJGA 4MNQD 3GSOA 1C16A 1B0RB 4PJBB 3DO7A 3ROLA 2H1PL 3MLRL 3QI9C 2Z31C 4MGXA 4LIQE 3OF6D 2FECL 3OKLA 1Z0MA 3RGVB 4PRPB 3DX8A 1XF5A 2FEEL 5E0QA 3S3PA 3I9GH 3RY6C 4X6DF 3NCBB 4DAGL 5DTFB 5F88A 4E41A 4JVWA 5JW4R 1C7TA 5JOFB 3EJYC 1CD9B 3WFBL 1MJUH 4I0PD 4Q2ZB 3P4LA 4KRPD 1IGCL 5FUZH 4Q6IC 2OSLA 5D2NB 4Z6AT 4PJ9C 4H0IA 4KV5E 3BDYH 4C56A 3BX7C 5IG7A 1FZOA 4MCYA 3HTLX 4MXVE 3SJVE 5ITBL 4OD3L 4D0DB 3QUZB 2EKSA 2GW5A 3CFDA 4XCFH 3VGHA 4XPAL 2VDPH 2VDKL 4Z0BL 5C6WH 1RZJH 3OGCA 1ZEAL 1C08A 2GTZB 5FCUH 4YQXL 5CKAA 1NGWA 4FNLH 5ESVB 2BNQB 4XCYB 4PY7A 2CXGA 1J86A 2UWEA 3OF6A 1JPTH 1GGIH 3FQXB 4NRYA 3WKML 5HYEA 3T1FB 1CFTA 1LEGB 1VFMA 4S10A 4GRWF 4IRSC 3CXDL 3VXRB 5B39A 3TV3H 5FYJD 1ZHLB 4I0PA 4XP6L 1BD2E 1MCFA 1FNEB 1T0NA 2IPUG 4JKPL 5LCVH 5HYJD 1LP9B 1OLZA 4ONGL 4M1CC 5C0CB 1J88A 4IDLA 5E1AB 4ZFOA 5IHBA 2PKDA 15C8L 3Q3GB 5C09A 3EOBB 2VDOH 1ZLWH 1NCTA 2DAVA 1BP3B 2H6PA 1MF2L 4U1SA 1DDHB 1QA9B 4X5WB 1W0WB 1S78D 2P7TB 4Q6YA 5AUMB 1X5KA 3HE6D 4RQQB 1PKQE 5IB4B 3LOWA 3U82B 5I1EL 4LRNL 4N5UA 4RGMC 4PV8A 4O2EA 3ULVE 1J8HD 3MCLL 3D0LA 4NQCD 2HLAA 3D25A 3GSQA 4WJ5B 4K23L 5DVOA 3ESUF 4DKEL 4JM2F 1T20B 5DWUH 1YUHB 5T1DL 3KAAA 3KHOA 4YEFA 3V7AE 4X6CF 2B4CL 5KSBA 5ISZE 4V2CB 1N64H 3G5YB 4LLVB 3CFEB 3PWNA 4TOYH 1YY9D 4KKLD 5C0AB 5HDBE 3GI8L 4OGZA 5DRZA 5HYJA 3A0OA 4NT6B 1MY5A 1TZHA 3CSBA 1G9EA 1IEAA 5LG1A 3NCYP 3KR3H 1OOAA 3T8XA 4RFNC 3L3GA 2LAAA 5DQJB 5GGSB 1G7QA 1NCDL 5B3NA 3HS0A 4XPTL 3QIWB 2I5YL 4U1HB 4RBPH 3WFZA 3MLSL 5DO2C 1CGSH 1NGZB 5DJZA 3DVGA 3HE6A 2VXUH 2EDQA 1G0YR 4B7IA 5L0QB 1EO8L 4N8CL 4P23B 4GW5B 3ARFD 4NQCA 1R5IA 4F7MB 5ID1A 5IW1B 2AEPH 5FYJL 2IWGA 5BRZB 2ZNWA 4MAYA 5E6IC 7FABH 2O5ZH 4C4KT 4G6FD 4S1RH 5FUOL 5GISH 3RZCB 4Q0XL 3BRFA 2B20A 3RAJL 2VZ1A 2BRRH 2FHFA 1IM3B 3HZYB 3ULVC 2XY1A 3V79C 3ZE1E 4NN5C 2Q76A 3AMLA 1S3KH 3QDGD 4JZJC 3OR7A 3GBNL 3FT4B 5LBSH 4AIZA 4OIIH 2KL6A 1HILB 1FE8L 1QPXA 2PN5A 1JUFB 5EORL 4XBPA 4QYOA 1FYTD 4OCYH 2VR9A 4EUPH 4JN1H 1JYNA 1QSFE 4JLRA 4PJCB 2LV4A 3VD3A 5C6PB 3GBMH 4OLVH 2J12B 3CXHJ 1MCOL 3DX9A 4HMEA 4X8XA 3BE1L 3T0DA 3U4EB 4XBGA 3EUUA 3BT2L 5SV3A 3LQAH 2Y5TB 1NGYA 4EQ2A 3Q0HA 1SYSB 1XF4A 4YHYB 2J8UB 3F7RA 1T03H 1E4XL 1H3GA 3PP4H 1A7QH 4H0GA 3TT3L 1MH5A 3SE4A 4YK4C 3A67H 2R0WH 4UOW0 4GXUN 5H94A 2FRGP 3WJJA 2M2DA 4Y19B 5KVDH 3KXFD 4PJAE 1WF5A 1Q0XL 4MNGE 4JJ5A 4K9EH 3ULSB 2XRAL 1YPZE 3FN3A 3LKPB 4NC2B 4GO6B 4H1LG 5E2UL 4ZOEA 1XR9B 2I26N 1ED3A 4FN0A 1EFQA 2GAZA 3D69A 3BPOC 1AGBB 4KTYA 4N1HB 1MLCB 5HDQL 1DBBL 4EVNB 3RY5A 3S36L 1MVFA 3MXWL 3MRBA 2CRZA 4ETQB 1UCBL 2GSGB 1XIWA 3FQRB 1TVBA 3MRFB 5FM5M 3GSRA 4YHPB 2OBGA 4EDXA 3TYGH 1VFAA 4NSKA 3UTTA 1MCSA 1OPGL 5DJAB 5HGDB 5KVMC 4DGYH 4MXWH 1FJ1A 2FBJH 3D0VB 3QRGL 1CICD 5F96L 1KCRH 3BGMA 1QFUL 3JWOH 4ODWB 2BVOA 5EO0B 4LF3B 3EO0B 3KXFA 2XY2A 5IR1B 4QRUB 4QXTA 1F2XK 1G9NC 4HPOL 4NQEE 1AIFA 3IF1A 2OXGA 1A9EB 2DMCA 4GW1B 1KIPA 4XPHL 5DD6B 1JI2A 4JY6A 2PXYA 1H3UA 1OT2A 3NTCL 4ODHL 4UBDC 1KN2H 1PSKL 4XPGL 4UZGA 5EN2B 4H8WC 5IOPB 3FZUD 2Y72A 2YPKB 3Q5TA 1BZ9A 2XFXA 4I13B 3VXQA 3SKOB 1KTLB 3BKJL 2XWTB 5FK9B 4MZ3A 3W81A 2Z92A 4QXUH 3PWJA 5FM4A 1CICA 5A40E 1NBQA 1D6VL 3MBXL 5HYSA 2AEQL 3PWVB 5DVMA 2FR4A 1DLFH 2J7LA 3O2WL 5C0IB 1R3KB 1D5XB 3EHBD 4ZSOE 1DEEA 1TZIB 1MVUB 3KLHC 2VDRH 2XTJE 1INDH 5IBUB 2R9HC 4JRXB 3NACH 4DWHA 3THMH 5DC4B 2DQUL 5DI8A 5FO9A 2FCBA 1F3JB 3WUWG 2KUTA 4P3CL 5F9OH 3GSWA 5DC0A 5E6YA 4EI5D 3HC4L 3ARBB 5KN5A 5JUEL 1NFKA 2EYSA 2Q87A 4Q7DA 4N9OB 3HRPA 3L7FA 4XMLL 2AK4B 3VWJD 4FQHA 3BH9A 1TITA 4HFUL 4K7PX 5FYKH 3PIQB 1YJDL 3X17A 3QIUB 2MFNA 5D72H 3BZEB 1W8OA 2K3TA 1ZLSL 2DBLL 5C71A 1KPUB 3DXAB 3MRMB 1WAAF 3ZYJA 1GIGH 5JXEA 5I9QC 1MFNA 4Z76A 1IM9B 1RU9L 3OAZK 4PV9A 1X9QA 5KSAC 1RSFA 3CFJA 4GRMB 5C08D 5KANI 3QULB 2J8OA 4X83A 4WFGD 3IETA 5DZOA 1A6VL 4JFXB 1AGCB 3LKOA 1N59A 1JHTA 2D4DA 4EI5A 4MD0A 1JF5A 4NUJA 4OV5A 3GMPA 2XTJC 4R9HA 3P4NA 1MRFL 3RVXD 3VWJA 5F97E 2CR3A 1IT9L 3H3KA 2EIBA 5I1KH 3BVNA 2ENYA 1XF2B 1YMHB 5HVHB 1OP9A 5DEFA 5IESH 5DQ9A 3H9SD 4Y5XB 3WBDA 1XZ0B 5HY9B 5BVJA 1ZSDA 3MC0A 3T2OA 1KB5H 4PUBL 3KWWA 5T33L 2A73B 5CSBA 3LRSB 1YEKH 1P1ZA 5C08A 1CT8A 2EXWC 4M7JL 5B4MC 3HMWL 2I07A 1MI5B 3O3BA 3GIZH 3T0ED 3D18B 1G7HA 5C9JA 3ZZ1A 3O3AA 3P3YA 1QR4A 1RFDL 2NY1D 2HT3C 3T2QA 1U92A 5F7DA 4MYWB 1C5DA 2YS4A 2A2QT 5J12C 3TN0B 2ITDA 2ADJB 1P4IH 3MLXH 5EBWB 2OCFD 1DQMH 3QH3A 3B9VA 5E8PB 2IPKB 3UPRA 2R0ZL 4U1JB 5ADOL 3EYVA 4OZIB 3OKEB 4D9RE 5IB3B 3G08A 3H9SA 4D9LH 1I1CA 4L8CB 4HK3N 2A6DB 3S37H 1KLUA 1HQRB 5IMLB 2CH8A 4ACPA 3QCUL 3IFLH 1JWSA 4S2SA 1BEYL 1ZA3A 3HMXL 3VFNA 5BOPA 4XNYL 3FAWA 5E2WH 5FGCE 5EOTA 3P11L 1HEZA 1RZ8A 2F54D 3MV8A 3QG6A 5D7SH 4RIRB 3MRKB 1I1AC 1RZGA 4HJGA 1OCWH 4L4VA 4JREB 2V2TA 5HYQA 2NY6D 4KI5D 4UDUA 3U30C 2BCKB 5E6ZA 4NQVA 5EULV 4JQXC 3OHXB 1RZFL 4LVNC 5DDHA 4Z5RB 1ZA6A 1NLDL 3HHRB 5D6DA 3GHBH 1JPFA 3MRRA 4P3DB 2HJFA 3QUYA 5KS9F 2YPLE 2XXMB 3RPIA 5CEXA 4YHZH 2Z93B 1BAFH 1U8MB 1ZANH 3NH7L 4JO2H 1UEMA 4GXVH 2ZOLA 4QF1B 3HR5A 5GRYA 4EBQH 2VAJA 3UJTL 4KJWD 4PJFF 3OSKA 1U3JA 4WI4A 2FX8H 1T2QL 5IB2A 5MHSD 4Z7WA 4ORZC 1G7LB 4TVPH 1NQBA 3F6IA 4WFHD 3FQWA 1KEGH 3C6LB 1INEH 4JFEE 3KPQA 2GY5A 1NBZA 4JFPA 1UJTA 2GJ6A 4HV8A 2PYEB 2VLJE 2PW2A 3JZ7A 1NBVH 4NZRH 2LU4A 3M8OH 4F57L 5FUCE 1A6AA 35C8L 4I18C 4BH8A 1KB9K 5JHLH 1N4XH 5HHQB 1TJIL 2HN7A 3ARBD 5KTEH 1JNLL 1SBBA 2WW8A 3ARVA 3NIGF 2AK4D 5FDWB 5I16B 3VMNA 4FFYH 3MV9A 2A9ML 4OGXH 4CNIB 5BJTA 1UH2A 4Y5VA 2WINB 1A4KB 3CLEL 4J6RH 4LBEA 5E08L 2JELH 3VH8B 5SWSD 2IFFL 1I4FB 2E7BA 1H3TA 3I02B 4OZFA 3VXUA 2VERN 5L2KD 3F58L 3RHWF 2AABL 4Y89A 3NIFE 2G75A 5EC1A 3V7MA 1DL7L 1ROWA 1CDYA 2DJSA 3WS3B 3UC0L 5DD0L 32C2B 1OD9A 4GAYA 4PRIB 1MJ7H 5GGTA 4POYA 3KS0H 2P8MB 3V4PL 1FSKB 5E00B 1T1YB 2BVUA 1NBYA 5F89A 2HWZH 1DQJA 3FHQA 4Z7OE 1OF2A 3W9EB 2Q86B 3GGWA 4AT6A 3WO4C 5FUCC 4M4PA 3QFJE 1T4KB 1AD9A 2CMRH 5MEQA 2R0LL 1UEYA 4HF5L 4RX4D 5F7EL 1S7SB 3HC3L 4F7CB 4NCC2 5EOCL 4JM2C 3CIQA 3VXSD 4GG8A 4HS3A 1EV2E 3KJ6H 4R97C 5L2KA 4HK0A 4CVZA 4XMPL 3CDGA 1UWEL 3L5WA 5ESAB 4X6DA 3LIZH 2HFGL 1T0MA 3WFCL 3OKDB 2NX5A 4Z8FL 2AXHA 2FL5A 3KPTA 1XR8A 2CKBB 2VL4A 4G8FA 2JJWA 5D7LB 4KMQA 1KFAL 3QQNA 2WANA 4KK9D 4G8GE 5C0GA 1BVKB 4FABH 5F7YC 3TN0D 3RUGA 3CX2A 5FKAB 3SCMA 3JWOC 2YKLH 5CEYA 2DYPD 1T1WA 4ZXBA 5JA9A 1I7TB 3GSVA 3VXNB 1D6EB 4U6XA 1PX4A 4FZ8H 1D5ZA 3SDCA 3AREC 3VXSA 2MQ0A 1ZT1A 4Y4FB 5SX5K 3TH4T 1KJVB 3BZFA 5EC2B 3UYPA 3P4MA 4LAJH 1GCFA 1AJ7L 3U0PA 4NDMA 1MUJA 3K8LA 3ZDZF 1B4JH 5D4QA 1WBXB 2YPLA 3GI8H 4ODTH 5C07E 2IANE 2X7LB 3ARDC 4J7RA 3RHWK 3DRQA 3WMSA 1HI6B 4RFEB 4K94L 1KXTB 1CCZA 1KJ2A 4UU9B 1S5IH 4F15B 1PW3A 4KRMB 4PJ7F 1U8HB 1GC1C 2YD8A 2ESVE 2X4OA 3F7VA 3M1BB 1R6VA 5J1SC 4N8VA 4JFEA 4O2FB 2VIRB 1DVFD 1LO2L 3SKJH 4JY4A 1EERB 4ZUUA 3MRCB 4HSQA 3ZE2F 1KEMH 1PG7W 4FRWA 2FO1A 4F9LC 5CILH 1RVFL 3VD7A 5BMFH 4OZGF 5GGSY 3D2UD 1NEZG 4Y4HB 4EN3B 3BH8B 2ZUXA 5EU5B 4I77L 1U9KA 5KANG 2AJXL 4P99A 4X6CA 5TE6L 1G1YA 1MAJA 3N0PB 3NGBB 4UT9L 3QNZB 5T1MB 3K3QA 5D7IF 2PYED 5I1AA 3CVHB 4YHIA 1Y0LB 1FL5A 1Q9LB 2AXGA 4NO0D 1U3HC 2ICWA 3IVKB 3WNPA 1YECH 4IMKC 3U9PL 1G7IA 2XICA 4KDTC 1DVFA 4D0BA 3LDBB 3DMMB 4NKIL 3PGCA 2VDLL 4DJMA 3W0WD 1KULA 1AD0B 3O4LA 1F4XL 5SX4I 2UZXB 4WNQB 2XN9D 4L3EB 3HAEH 2P5EE 3PWPD 1IAOB 2H32H 3U0WH 1T66D 2YHGA 4POUB 2BDNL 1LK2B 2EE6A 3SGJA 3QR2A 4DEPB 3D2UA 3SDAB 2NZIA 3QHFL 2DQEL 4WHTA 5I1DB 4IOIA 1BQHB 1YMME 2BHUA 4PP1D 3CDFA 3SDDC 1V7MH 3WS6A 4AEHL 4YIQA 5I74B 1JPGA 4P57B 1YEHL 1I8MB 3MMEA 1ETZA 4OZHE 2VRAA 4NOFA 4Q9RL 3AROA 5CZVL 3G5XB 3F12B 3SQBA 2XACC 4XX1G 1ZWIA 1E28B 5FXCH 5LGJB 1YEJL 1J05B 4NO0A 5B39G 5I6XB 1WFTA 5JPMB 4N8PA 2X4PA 1LMKA 2D3VA 4FQXC 4M61A 1EH9A 3CAFA 1LP9F 1RUMH 4U7KA 3W0WA 4JZNA 1LNUA 5JQHC 2XN9A 3PWPA 1JWUA 1JWMB 1YQVH 2HYMA 2EH8L 2G9HB 4LQ1A 3IJSB 3IFOA 3MV7B 2HKHH 2BC4B 1BBJB 2W0PA 5C0FA 4YHOL 4K3GA 5BVPH 4G8GA 5FOBA 1AQDB 1PQZB 3MOAH 1BX2B 1CGYA 3VDCA 4MJ6A 5D7JD 5DC9B 5EDXA 3LPFA 4LSPL 1NDMA 2HT2D 5CZXD 5MI0B 3MFGB 1RI8A 1HSAB 4AQ1B 4DTGH 4NHUA 2FGWH 1FZKB 1NSNH 4QGTA 3MUGA 1ZGLA 4NRXA 5I1IH 3O8XC 4ONFL 3CZFB 4WGWB 5JR1L 2ICEB 3CCHA 2DDQL 4KK8D 1IKNA 2IGFH 5JHDB 1E4KC 1QO3B 4NNXB 2J5LC 3STZB 4Q9CA 4LNRB 4YXHL 4RZCA 1KNOB 3QAZC 3GEWB 4U1LB 2OTUA 3TJHD 43CAA 4WEBL 1EBPA 3U7YH 4U2YA 3LS5L 1ORQB 3BPCB 1CN4A 2YD3A 3UPCA 4IRJB 5D7JA 5JOEA 4FZEL 5HVFB 2QR0B 2Y4SA 1UKSA 2X4TA 5IQ7H 1E0OB 3P30H 3E2HC 1NGPL 2J6EL 4POZC 2W0KA 1KG0A 4JHAL 3WV0A 2AJVH 4M9PA 4JEGB 4X8JB 4MQXC 4L5FL 5LGHL 3BOVA 3MRIA 1OB1A 4HS6B 2R1XA 2AQ2A 3V4UL 5EU7E 2HH0H 1HSBA 2F5BH 4YR6B 3VXME 4KQ3H 4HIHB 1H5BC 1KIRA 4DKFH 5B8CC 5TH2A 4NIKB 1T1XB 1CLYH 3FMGH 2CDGB 4HH9B 2W9EH 5EIIA 2AKRA 1KBGH 4V1DB 4Y5YB 1LE9B 1TTUA 1S7VB 2PYFB 1MQKL 4M00A 2YRZA 4P59H 5IMOB 5IF0B 3NA9H 4PRBA 4L3CB 1G6RB 2HFTA 3UTZB 2FYYB 4ZS7L 1IGYA 1NGXA 5FGSA 1K8IB 1EAPA 2D0FA 2J8UF 1N5AB 4L8SA 2CKBL 5EA0L 4BFIB 2D7OA 2BX5A 3DROB 1J1PL 4RDQG 2E7LC 2DL9A 1IKFL 1IAMA 1MFAL 2OK0H 3HNVL 1FG2A 2NY3B 4HKJA 4PRAA 3B6SA 1CG9B 4XP4H 5HGBA 1GGBL 3T0WA 4KTEL 4YBQC 3MRNA 5D7KD 1ZOXA 3EOTH 1A6VH 2F74A 5KS9E 5FIEA 3OTTA 5EU6E 3U0TB 3ZE0F 3GMLA 3DJ9A 3CVIL 3R8BB 4L3ED 2EH7H 4OCLC 1FL3A 5IVZA 3S3JA 5I1CH 4PJFE 1HKLL 1SJVA 1LO5B 4JPKL 4MNQE 3SDAD 4NKQB 5H2BA 3MZTA 5EU7C 1P53A 1UXSB 5ILTL 1JPSL 2GT9A 3QXAA 4R6UA 4QHUB 5KAQG 3D48R 5CLWA 1X7QB 3VD9A 4F8TA 3RA7H 1SEQL 1TETH 4JPIB 3JV4B 5CKGA 2X4QA 3HI1B 2VITA 3S37X 2O5XL 4IRZL 4JDVA 1G0DA 4K3HA 1FV1B 1WAAA 3F7YB 4ZFZB 5JNYB 1GZQB 4P2OC 2NXYD 1B0GA 3UCRA 5TDNB 1KENL 2HRPL 4MA1B 4LCWA 1DTUA 5JIKA 4HWZB 1A7OL 4NGHH 2DQJL 5AD0A 5J13B 2CK2A 3TJEL 1IC4H 2O61A 3T3PE 1MHPH 4X9GA 5DJXB 1S9WA 2FLBT 2ZUYA 3GMRB 4I9WD 4NZTH 1YY8B 1MCLA 5HI4D 3KPPB 2WIIB 1TZGL 4BQCA 2WBJC 2OL3H 5EO9A 3NIDE 1FRGH 3ZKMD 5FYJE 3CVHL 2FX7H 5GJSL 4TSBH 1H3XA 3MROB 3SE9L 5JORA 4PRDA 4JM4H 4HGKC 4I2XE 3H3PH 4HCRA 3UTSB 3BDBA 4QHMA 3FN9A 5HYSG 4S0TD 1KCSL 5TE4L 1OM3L 4YDLB 3DV4A 3NFSL 2Q8AH 5I8CB 1JPST 2D7QA 1RK0B 2B4CC 4ZYKB 1N7MH 4GKNA 3ILPB 3DYMA 4HBCL 2Q8BL 3TCXA 3WFEL 1DE4B 2E9JA 3KVQA 4P46B 1ZT7B 2C1OA 2NY5L 1I7RA 4XWGH 4WY7L 1CLZL 1J8HE 3D3VD 3X12A 2OR9H 4HUXA 4UQ2A 2IALA 4I3SL 2F19L 2F53B 2GFBA 4MQ7B 2DLGA 3QJFB 1PY4A 5TE7L 1FVEB 3IDJB 5HTSA 3VFUA 4FQ2H 4JFDB 3TBWA 4A6YB 4J1UA 3O41B 4XAWH 3MLZL 3MJ7B 3PG2A 3IU4L 3CUPA 4CL7A 1FO0B 1RUKL 2GQHA 4O58H 4KUZH 4PGJA 3LH2L 1NMCB 5E94B 1DQLL 2PO6D 4M1DL 4OF5A 4NBXB 4P48A 2GI7A 4CW1B 1OAUH 2CLVB 2Z4QA 2E27L 3IXTB 4KK6D 3V5KA 2NTSP 4JJHA 1G7MB 2E9BA 4ELMA 2V7HA 3VFOB 3WL9A 2A0LD 3HUJE 4X5XA 1MIML 1WCBB 3D39E 4LU5L 3OKOB 1CF8L 2WWMC 1FGVH 3D3VA 3TVMD 4LSUL 4XXDA 1NANI 1HH9B 4BM7A 1SJXA 3QPXL 3IJHB 5AEAA 3NCMA 2GITB 5A2LH 5BS0B 2BSTA 3S5LB 4HUUA 4OB5H 3TH3T 3FO1A 3RWEB 3PHQA 5TPWL 2B1HH 1FBIH 5KS9A 3ALPA 4H20H 2P8LA 1JL8A 1KTRL 1ORSB 1PEWA 5GS0D 3MGOB 3FFDB 3SGDI 4QKXB 1I75A 4HWBA 4ODSL 1GXEA 5D1QD 4U1KA 2Z91B 4LSQH 3B2VH 4ZO9A 4S11A 2NY3D 3L3KB 2QSVA 4IOSD 5DHYB 1ES0A 1FAIH 1YY9C 5EWIH 3B9KA 1D5BA 3EZJB 2XOTA 4KKLC 2Y36H 5DQDH 5EUKB 4TQEL 1FYTE 1OW0A 4K71B 4OM0L 5AYQA 5IT2L 4WW2B 4NKOB 2DLFH 4JFHD 4L4TD 3KPRB 3KYMA 4X4XA 1J8KA 3T0VA 4OZGE 4C58B 5IB5B 3SE3A 3STBA 4AM0A 5CJOH 3VFWB 4HLZH 5LGKA 1S7XB 1KCKA 4PJBE 1JHLL 3PDOB 4JO4L 3FAXA 3P77B 4XAKD 5HHNA 1A2YB 3QO0B 1OP5K 4BK4A 4KC3B 1RURH 1X5HA 3ARFC 1CFQA 1OSPL 4PRPE 5D1QA 4OZIF 2CJUL 3MO1B 5AZEL 4OZFH 3FB6A 5E99H 5EB9A 5IWLA 1CU4H 1DBAL 4HKXB 1EEZB 1J1XL 4LP4A 1CD1A 1ZLVK 5MEND 1DP0A 2NTFA 3LKNB 2X4NA 1SJHA 5B38G 2ERJC 5D2NE 4BKLA 5GGTH 2C7UB 2HFGH 4HT1L 2IPTL 4QOKB 3FCTA 1A6ZB 1A1MB 1MCWW 1XGRA 1EO7A 3MLVL 3VMPA 5JA8B 4Z95H 4MA3B 1KYOK 4LNVA 5DRNB 3C8KB 4OLWL 5L88H 1F4HA 1LO3H 4YO0A 1NCUA 3P9LB 5EG6C 5I1LB 3GJEB 2BNQE 1G6RL 1I7ZB 5GS0L 1VKXA 3KYNA 4P4RB 4QCIB 4OCSL 1T89A 2HJLB 2MHAB 3KPSD 3BW9A 3VGAC 1KTDA 1ACZA 4NWTH 1A7PL 2BY1A 1XCQA 3E8UH 5HJ3A 2EO1A 1RK1A 3MGTB 5KVEL 5E8NB 5MENA 4P4KD 5FFLA 1NKOA 3OBAA 3CFKA 2MCPH 1LP9E 3QZWG 2ADFH 5FB8B 5C0CE 3C5SA 4LFHG 5CP7B 5KJRH 5D9SB 1Q0YL 4OM1L 4ODXB 3BQUB 3K4DA 1I3UA 4ZPTB 4P46D 3HC0A 3WIFB 4QWWD 1HINL 4EI6A 5ELIA 4PJEF 4XCCL 5CWSA 4OUUB 1CIUA 4HZLB 3QUZC 1X4ZA 1FNSL 3WNLA 3RTQD 4ODBD 4X6EA 3MFFB 3I84A 1K85A 3X11B 2BSRA 4KGLA 3PE9A 4AMKH 2MTPA 4XNXL 5C0AE 4GRWH 1P2CB 3MUZ1 4JFDD 1KELL 3O81A 3TO2A 1A3RL 1EFXA 4HC1A 4PTTA 1HQ4B 5DFTA 5MEPA 1KJ2H 5BZWA 5FHBL 4GMSH 4OCWH 4NN6B 3MA9H 5TDPA 4HQQL 4UMGA 4Y8DC 3VFGL 3U46A 1YJDC 2L0DA 4NYLA 4MAUH 1RUQL 3VE0B 1RULL 5ICXA 1WIUA 3SDYL 4PJ7A 4QRPD 2F9BT 1QLFA 2Y6SC 2VDLH 1IGFH 4GG6E 4MCZA 2EDNA 3UEZA 3RX5A 5I8EA 3HN3A 1TPXB 2VN4A 3RTQA 4K8RL 3WD5L 1QHPA 5BS0D 4MDIB 5L7XL 5CJBA 5BRZE 2PTUA 1R3JB 3L3DB 1VA9A 4HH8A 4TULL 4DGVL 1R24A 2W60A 3I75B 4MZ2A 4EZMA 4M6NH 2DQFA 1S7RA 3D85A 5L9DL 1BOGA 2WQ8A 4OKVA 4BUGA 1DFBH 1JGDA 3SDXB 5IJVA 5BW7C 4NOBA 3SGKA 5ACZB 2HMIC 4YAQB 3O2DL 2JB6B 1XGQA 4BFEA 4C4KO 12E8L 3FTGB 3BO8B 3SGDH 5IFAH 5ITFA 2QQKH 2D0GA 3GMQA 3RGVA 4Q97A 1ZHKB 5D7IA 4R90H 4MVBC 4WFGE 4NNPH 4QRPA 4FFVD 4U1GC 4ZTOL 5JOFA 1FQ9C 4WUUD 3B9AA 5D8JH 4PJCE 2XZCL 2R4RL 3IDGB 4WI7A 2RFXA 3SKMB 2X9XA 3QIWC 1YEEH 1NCAL 5D2NA 2IH3B 1A6TB 2C3VA 5GXBB 2C4FU 5JO5B 3CDCA 2GSIB 1J5OL 3EGSA 2QHLA 4AK1A 3QDAA 3ZDYE 1O0VA 4D0DA 4A6YL 4LKXB 4WHYH 5L0QC 5CEZD 2J8UE 4AENB 4M3KB 4P23C 4JHWL 1QRNB 1FO0L 2GTZA 1I1FB 1QBLL 1CL7I 4U0QB 4PIRF 2Q3AA 1X5JA 4XCYA 4NM4H 1YQ2A 2LU7A 3QUMB 1QSVA 3QDMD 3REVA 4Y2DA 4FA8A 4NQSA 4ZAKB 4RAUA 1LEGA 4Y19E 3RZCC 1X5YA 1SMAA 3RX7A 3ZE0E 4L29A 3VXRA 4K3DH 3H42H 4YLQT 5T5FH 4QRTB 4WUUA 4XHQA 2AV1A 1RIVL 3Q1SL 1FNEA 3N06B 3UJJL 2VB5A 2Y07L 3MACL 3UDWA 5DVLA 4HUWB 3WXWH 3UO1L 4APQD 4GOSA 1WZLA 2R23B 4Z7NE 4IMLB 2B39A 2R69H 4P2RD 2FD6L 4H5SB 1TJGL 3L3JA 2HKFH 1QA9A 2CK0H 5GHWH 3C5ZB 4X98B 1EVUA 3A6CH 5IB4A 3L95B 1NJ9A 4ZG1A 3PHSA 1IAKA 4ONOA 2CUHA 4XNMA 3U79A 5CJQL 5MP6L 3QDMA 3KG5A 2DQTL 1MRCL 3DUSA 4L9LC 5BV7B 3QWOB 4X7TA 1II4E 1BOYA 2FECI 1YUHA 3WE6A 4YHYC 3IDMA 1T5XA 1MJ8L 1EJOL 4CRPA 2FEEI 2FEDC 2O93L 1WJ3A 4PJGB 3G5YA 5DFVD 2VDMH 3CFEA 1DQQB 3X14B 1Q9KB 3ARGA 3V0WH 3C2AH 3QBTB 2LTQB 1AGEB 3ES6A 4HFWB 3BKML 1X5IA 2A77H 5ICYA 3T0EC 1ZGLP 1U91B 4PPTA 1FFOB 4AJ0A 4Y1AB 5J3HC 1KV3A 3QWRA 4MX7A 4PG9B 4IBLT 1EEQA 1MQKH 2X4RB 4IDJH 4LRIA 5DJYB 3QA3A 2WM0A 4NO2B 3V5HB 3ZO0A 3WLBB 1E4WL 4JQIH 3S4SB 4WFHE 5IEHA 1YEFL 3VI4F 1IGJA 3L7EB 3EYFA 1VSCA 5T1LD 2YA2A 4X5LA 4JRXE 3HZYA 2YEZB 1G7JB 1JNJA 1IMHC 1JI1A 1IBGH 3MJ8B 4KUCD 3ZKSD 1OAXL 3FT4A 3C5JB 1E4JA 5ERWB 4Z0XA 1IZKA 1NDGB 3M17B 2AK4E 4JO3H 1MFCH 1AGFB 1NUGA 4JCMA 2NY6C 4KI5C 2HTLD 3S9DB 1QR1B 1SBSH 4ONHB 4GBXD 2IAMB 3T4YA 3ZYZA 2V17H 4LGSB 3DXAE 2R2BA 3FN0H 1HYRC 3OAYK 1S9KC 3RVVC 4ZUSB 4FQJL 5FECB 4PB0H 2FJFA 3O6LL 2Y5TA 4GAJL 3U9UB 1SYSA 4DZBB 5DJ2B 5T1LA 4FQLL 2FX9L 1T22A 2J8UA 5C0ND 4WV1A 4KJWC 1S7TA 3BXNA 5AWNL 4PYGA 3MR9B 3C87A 2BVQB 5A3ID 5GPRA 2PR4L 4ELKB 1LDSA 5JW3L 3CLFL 4O2CB 3FRPA 5I8KL 5JXAL 2Q20A 2VISA 4PJ9B 1HZHH 3PABB 1HHGA 5HGGS 3ULSA 4PJ5D 5SWQA 4JG1H 4HXAL 4RISH 3LEVH 4XXCA 3B3IB 4OI9A 3DGGA 1AGBA 3ARBC 2GCYA 1A14L 2KQMA 4X0KB 1MLCA 4Q9BA 1JZ2A 3L6FA 3INUH 4KVCL 4ETQA 3EDEA 3JWDL 3OPZH 5DJ8B 4NM8L 4XBEH 4YHPA 25C8H 5F7MC 3O45A 4CBPA 4CU6A 1RUPH 2CDEB 2IPUK 2MQ3A 1N2RB 1MI5E 1CFSB 2PETA 3OKNB 5IHUH 3D1MC 1RJLB 4JZOA 4YHLL 3UXFA 4ODWA 1G84A 1JFQL 1QSED 3DRTB 2Y5EA 3VGBA 2VABB 3HZMA 4QRUA 4PJ5A 5FM5O 1KC5L 4G7YL 4OZIE 1UWGH 1MCKA 3WNOA 3STLA 1G9MH 4P5TB 5DD6A 5EPMA 1I9EA 3C5ZD 3FQNA 4X6FA 2X89A 3FFCD 3K74B 5TQ0H 1TNMA 3SJVB 1WEJH 2P44B 1FPTL 4TUOB 4FP8L 2YPKA 1YZZA 3OKMA 4YC2C 3SKOA 1E4XI 1KTLA 4HCRH 3FRUA 5T1KB 3K80A 1RUAL 9CGTA 1RUKH 4Y5XC 1QACA 3VA2C 1J0KA 3PWVA 1QSEA 3G9AB 3QQ3B 4UNUA 4YNYB 1FAKT 3CSPA 1CDGA 3QFDB 4IS6A 1A8JH 3FQUA 5HPMB 1T21B 1MVUA 4O51B 5D1ZA 3ULUF 1AP2B 4OF8A 4DW2H 1MCBA 2QQNL 1HXYB 1P4LB 3AS0A 4JRXA 4N90D 5IHZA 3I6KB 3FFCA 3SE8H 1F3JA 3TN0C 4KAQL 1E6JL 1WISA 4BQ9A 3I3DA 3QUML 4RFOH 1FZJB 4KK5C 5E6IB 1U8IB 5DK0A 1S5HA 1BFVH 5BXFA 1XGYH 1PKQB 1NMBH 3JTTB 3B2UD 1XGUA 4HD9A 4ZPVA 3PIQA 4XP5L 3SOBL 4LCCA 1MFEH 3QEGH 2PYEE 3KPNA 2KZ1B 3QIUA 4QRSB 2FH6A 4NN5B 2JJTA 2G5BB 4Y16B 4DVRH 3F62A 2M8XA 4CN1A 5HHXH 4U1NA 2R2EA 4LEXH 4M93B 5D2LB 3S35H 3BMWA 1V3JA 3NABH 2WMPA 4BZ1L 5IMMB 5FYLL 4R0LB 1IGML 2K7PA 3P2TA 3QO1A 2H8PB 3QULA 2EDXA 4JREC 4BSWA 1JN6A 3FONA 5GGUB 1AGCA 5J6HB 5CAYB 3HR6A 5BV7L 2EDHA 4FFZH 2OYPA 5EZOH 1QD0A 4OIAA 4PFEA 5DD3H 3RWCB 3OZ9L 4IM8A 3D6GA 3IJYB 4HWBH 4QNPF 1EHLH 1WGOA 2VDNH 4XNQA 3K81A 3FT2A 4CMMB 3KYKL 1CD0A 1XF2A 1YMHA 4GSDL 1ZHBA 4YFDB 2O5YH 1GSMA 4PRIE 1I3RA 2NW3B 4XP9L 1GHFL 2HJKB 3QXDB 4YK4B 4YH6A 1EX0A 5EUOB 1VGKA 5FF6B 1ZTXL 2DQDH 3IKCB 3TWCL 3C6LC 4HG4K 4D0CA 2NY2B 3FHAA 1PG7H 3BEVB 1ZVYA 4JFFD 3V6ZA 1QKZL 3CMOH 4OLWH 2FH8A 5DJDA 2A83A 4LGPB 1CWVA 5ADPL 1AFVL 3HI5L 3B5HA 4GRLB 4QEGA 1IGIH 2ADGB 3MODH 4DN3L 1NH6A 4B7LA 1W72A 4MDJA 2LFGA 3ALXA 1A6PA 4HWEL 4G80B 1L7IH 5IKCA 3AU1A 5E8PA 1IZJA 1UM5H 3ET9F 2BRQA 3SGEI 3TBTB 3ISWA 3FJTA 2JCCB 2Q7YA 1K4DA 5E9DB 2ZKHH 4L8CA 1EMTH 1RJYA 3TC9A 4LSRL 3TESA 2FGZA 2E9WA 5E2JA 3PWUB 3MBED 5D7LE 3P4OB 4GMTL 1EAJA 2KDGA 4G5ZL 2F58L 1F8TH 1NAKH 1CFVH 4J3TA 3MRKA 3QQ4B 3LKRB 4GH7B 3W9DB 5DS8A 4GW4B 3GNMH 2N7BA 2ZG1A 1FSKC 2MJWA 5IQ9B 5DEZA 3LSOA 3OXSA 3GHEL 1WZ1H 4G6ML 4PJAB 2BCKA 4MNGB 5CINH 3O0RH 3OHXA 3GKWL 2CKNA 3BD5A 5EZLB 1FG9C 3BUYB 4W4NA 4P3DA 3QNYB 2W0FA 3PP3H 3GSXA 5KBNC 3TCLA 3U6RB 5IFJA 2BERA 3KGRA 1BREA 4LLDB 5HGHA 4YXLH 1K5NB 1R3IH 1EIBA 1C7SA 2B2XL 2MKWA 2XKNB 3MBEA 4JAMB 4G43A 1FORL 4GKZA 3GJFK 3FOMB 1U95B 2DIBA 2ATKB 5GGVY 4XRCB 2HT2C 5CZXC 5BQ7B 5E03A 1KCUH 3HB3D 1N3NB 4P9ML 3WSQL 4JN2B 1LILA 5FO7A 2AP2A 2E5EA 4KZEH 4WW2F 3O3EB 1F90L 1Q9OA 2AJZB 4U05A 1NCBH 3ZDXE 1YEDA 3TGXA 2F5AL 2WUBL 4PJEA 2HTKD 1RMFH 3ABZA 5HHQA 4HGWA 5DLML 2PCPB 4KJPD 2YXMA 4RGOL 2FIRT 1CR9H 4HC1H 2R0KL 5IM7A 1U6AH 1UA6L 1AHWA 4Y4FC 5I16A 4DGIL 4XNUH 2YRLA 1TIUA 1MJJB 1RZKL 2C26A 3VFTB 2IADB 4ERSH 2A6IB 3DYPA 2UV3A 5D7KE 4X9BA 1EZVX 5CBAB 3HG1B 2EDTA 5IFHL 2QSQA 2VXTH 5CBEB 1P4BL 3QUKB 4G42B 3TBVB 4DCQB 1KJ3L 2XNAA 4L3EE 1KIQA 5H37H 3V8CA 3REWB 2A9NH 1LO0L 4LSDA 3EYUH 5I1JL 4KMTH 4WFED 5JDSB 1IAIM 5IVXA 4ORGA 1INQB 1MCHA 2NNAB 1NLBH 4BZ2L 2VAAB 5FA4B 3GSUB 3MLWL 4WCYL 2BY2A 3LN4B 5E2TH 3FB7B 4U6VL 1I3GH 1MHEA 4HDIA 4QLRA 5J1AA 2HG5B 2Q86A 2H26B 4OTXL 3DSFH 1JVKA 1T4KA 4F8QA 2EEAA 4OCRL 4OD2B 1AY1L 1HXMB 5LXGL 5FO8B 3RL1A 4DKAA 3HI6H 4RAVB 2XQYK 3MRHA 4N9GB 1U8NB 5LKNA 1FVDA 5IGXL 1T83C 5I8OH 2E9IA 1ITBB 2H2SC 1MFDH 1CE1L 2HLFD 1OAYL 1R5WB 3NFPB 3MLUL 4N0RA 4DQOH 1RZ7L 5ESAA 2OTWB 1U8QB 1MAKA 1QFHA 1Z3GH 1VACB 4PJ8D 1OSZB 4UOW1 4UNTA 3MV7E 3H0TB 1U2HA 2DWEA 5J12B 3FO0L 2OZ4L 3DMMC 1K2DB 3P0YL 1F4AA 3T0AA 1BVKA 1F02I 2DM3A 1UACL 4BSVB 3CFIC 1YYLL 5E56A 4D8PA 4NHCL 4WWKB 3MV01 4FFWD 4OFIA 1I7TA 4DEPC 2FZ3A 4P9HL 1D6EA 3SDAC 3VXNA 1PZUB 3UJIH 3K2UH 4R26H 2NY5C 5E9DD 4EQ3A 5SWZD 2I60L 2HRLA 5T3XH 2AJUL 1YNLL 3D9AL 4WIQA 2JJVA 4UV7H 2K1MA 4LHJB 5F8RC 3QIBA 4ZUWA 3NZHH 3TNMA 1ACYL 1HI6A 1IAIL 2EYTA 4RFEA 4NO5A 4XI5D 3DUUB 5CEZH 3LKQB 1XF3B 1WTGT 4NPYB 3R0NA 3MXVL 1P9MA 1LHZA 1KCVH 1MREH 4OGYL 3PQYB 1ZVSB 1QLEH 5FGBC 1JGLH 2VIRA 2D03L 1A22B 4NNYB 5ICZA 1LE5B 2DB8A 1X4YA 5F1SA 3H9HA 3PJSA 5HI4C 4ALAL 3JUZA 4PRHD 1QYGL 1RJCA 4S1SH 5SWZA 4RMQA 5HVWA 3KHQA 1T1ZB 1VFUA 4Y4HA 4EN3A 2HVKA 3BH8A 4KKAD 2P5WD 3RU8L 5DD1L 1PJ9A 4JY5L 5MI0C 2VOTA 1MY7A 1A6UH 1U93B 5T1MA 5IROC 1JGVL 3T3MF 2CQVA 4UDTB 2FATH 3AXLA 3CVHA 3HE7D 1A5FL 1Y0LA 2OP4H 1CVRA 3DVFA 4G9FB 1MCDA 3IVKA 3TT1L 5CMAB 1VEPA 5I19L 4V1DE 3OJ2C 2D7TH 2RQ8A 1J0ZA 2EE3A 4KZDH 3C60D 3T1WA 4CN4A 4PJHF 4E9LA 4O4YL 4TTDC 4HMDA 1S8DB 1IAOA 3VGEA 1UQSB 5F7HA 1LK2A 1OGAB 4FOMA 3MJ9L 2OJZH 5FGRA 3BKCH 2BJML 5INDB 3O6LH 5I1DA 4EUPB 2P5WA 4AEIL 2VXSL 5I71B 3RVUD 4OT1H 5H35A 1JV5B 5I15L 3GMNB 3CPLB 4XPBL 4ZOCA 2BFVL 4ZO6A 4JFHE 4JO1H 4Z77A 4L4TE 5LGJA 4ISVB 5GGVH 3WIIH 1Q1JH 3MNZA 5ETUB 3B9DA 2V5SA 3PL6D 2DJ4A 4LHUB 1R3HA 2ZSWB 4LDOB 2Y06H 4KK6C 5FDYA 2VLJB 5HBBA 4XAKE 2A0LC 4QRRB 2IBGA 3LRGA 3UZQA 3WO4B 1BZ7A 1RV6X 3TVMC 1IL1B 3QPQD 1SYVA 3UPAA 3GK8H 4X80H 2G9HA 3IJSA 4PJIF 2ZCHL 2E3VA 3DVIA 4JDTL 4ZNCD 3PV6A 2VLKD 5DHXB 1KT2A 5EU3A 1BBJA 4CGTA 3OX8A 4LOUD 2YUXA 1OP3K 1GAFL 4GQ9L 5GS0C 3O6ML 2C3HA 4XVTL 1BX2A 1F2QA 5DRWB 3E6FB 3P0VH 5L2JB 2ZUVA 4M5ZH 4OLXH 5IBTH 1WFUA 3U2SA 4F2MA 4J3UA 1D5IH 1BM3L 3CFCL 2NY3C 3F5WB 1JRHH 3PL6A 3EDDA 2AQ3A 4PD4K 3W82A 4HKBB 4YDVB 2Y7QA 3R8QA 1JHKH 4GQPH 3BWUC 2ICEA 1NMAH 3QUXD 5F1NA 3KPSE 4QNPE 5JHDA 4BA8A 2Y25A 1QO3A 4YDJA 4NNXA 4ZO7A 4LNRA 3BJLA 4P2YA 4WWKD 3UYOD 5EZJA 1KNOA 4M5YL 4RMWA 3TBYA 1ADQL 1LO4H 3AAZA 4LAQH 4UB0L 2VLKA 4OJFH 5E2VH 3WLWC 3NCEB 3QRFM 3O3DB 5ENWB 3UTSE 2JJSA 2D7MA 1IC7L 4DN4L 3FQTB 1DANT 1TQCB 4G7VH 4IRJA 3QFJB 2V2WB 4I48A 1I8KB 3BWAA 3QDJB 3L3OB 3TFKD 5DUPH 3G6JE 1FL6A 3I9GL 3L5IA 2OTPA 4GFTB 2DI8A 1MJUL 2VZUA 5DA4A 3QUXA 2I27N 4FG6C 2NLJB 3VWKD 5FUZL 3S35X 2XG4A 4HK3J 4MA1C 4LLWB 3TO4D 3BDYL 2F53E 3ULUD 5J13C 4JFYA 4HW6A 4YGAB 3L3IA 1T5WA 4XCFL 4NQDB 4M48H 4JFDE 2VDPL 1RZJL 2VYRE 2XYCA 2CDGA 5FCUL 3QXUA 1GOGA 1WICA 1LEKA 4LLUB 4R96A 4L1HA 4V1DA 4FNLL 4Y5YA 3S96B 2PYFA 3AC0A 3GMMA 2OM5A 1NFDB 1U8OB 3VG0H 1JNHA 5IMOA 5IF0A 5DT1H 4L3CA 4K8RC 1JPTL 1GGIL 2ED9A 1JYXA 3HCVA 4Z7VF 4KHTH 5TFSH 4P4KC 1FIGH 3TV3L 3KLAB 4OAWA 3TYFB 4BFIA 5LWYH 3DROA 1U3HB 5D71H 1AKJB 2X09A 3VWKA 2APWA 2VLRA 4DK3A 1JTPA 5LCVL 2WNGA 3NFNB 4FTVD 5TGBA 1PG7X 3TO4A 5JPNA 2AJYH 4Z7UF 2RAMA 5BS0E 3FRPG 4JPVH 3CFBB 4JPWH 5LJYH 4P46C 3U0TA 2VDOL 5JQ6H 2LVCA 1AO7D 3BP4A 1KLFA 1SEBB 1UB6A 3C8HA 4MJ5A 5HHMB 2JIXD 2GK0B 1A4JB 1D9KD 3IRPX 1OGAD 2XZZA 3ARXA 4P2QB 1CDUA 1ZLVH 2HVJB 5DWUL 4F7TA 3QB7C 5EO1A 2LE9A 1N64L 3JV4A 4U1IB 2W91A 4TOYL 1FV1A 1NMCC 2P45B 3KPRE 1V3KA 4FTVA 3F7YA 5JNYA 4HBQA 3RVWD 1GZQA 3KR3L 5ESQB 4XCEB 1IEHA 5EBMB 5DRXB 1MHHA 1DR9A 4QT5A 3KLSA 1KB5B 3DV6B 2W1NA 2NY4D 4CADA 2QQQA 3JVGA 1CGSL 3L3HB 2JIXA 1FNGA 5JW5B 1D9KA 2VXUL 3MLTA 4K7PY 1WC7A 4P5KB 1HYSD 5EIVA 4LKCA 4WI2A 3E0GA 4WU5B 2WIIA 5J9PA 3DURB 1WBYB 2NR6C 2AEPL 4NO3B 3RBGA 3V6FB 1CGXA 4QOKE 7FABL 2O5ZL 4NC1E 5DSCB 1TVHB 2E6JA 4S1RL 3GSNA 1S9VA 5GISL 1YMMB 4JRYD 5HHOB 2UYLA 5E5RB 2BRRL 3N1MC 5JLZB 2BMKA 1QUNA 3GJFA 3O8XB 1F3RB 2C5DC 5C0BD 1DEDA 3ZTJH 1S3KL 1QFWH 1CGVA 3EFDH 5LBSL 1DQDH 4OIIL 4FXLA 4K71C 3WUWA 3ILPA 5IMKA 1NFIB 3O9WD 1W72H 3QAZB 5D5MB 5HYFA 4OCYL 1KPVB 4JN1L 5IBUG 4CMHC 1A0QH 2HP4A 3FB8B 3GBML 4OLVL 1GGCH 3S97C 1H3PH 1QFPA 3P9MB 2APBA 3VXTA 3B8SA 1A02N 4F9PA 3LQAL 4YUEH 2F53A 1Z9MA 2YSSB 1WVZA 3HPLB 1PZ5A 1FVEA 3S36X 1T03L 3PP4L 4A6YA 1A7QL 1BJ1H 4W81A 1CDBA 4TYUA 3MJ7A 3QSKB 1CXFA 2AJ3A 2EXYD 1GOFA 4CVXB 3NCJH 1YC7A 3A67L 3GMOB 2R0WL 4YHNA 2XA8H 2DQHH 3WN5C 4NC1C 2K9UA 4YEEA 2CLVA 2VKWA 3O9WA 5CGYD 3QNXA 5TDOB 5KVDL 5ANMA 5F3HA 3IXTA 2DM7A 4K9EL 5HDBF 3ZTNH 4C83B 4MJID 1IARB 3EJZD 3VCLA 1WCBA 3PF2A 3OKOA 5DYOB 4PG2C 4APQC 3L5JA 1IGTB 1ZT4A 3MJGX 3IJHA 4NRZA 4KHXH 3RWEA 2XWJB 1ZKAA 1BJ8A 4XZUB 3TZVB 4MXQD 3TYGL 5HHPA 4HHAB 4WWID 5DJ6B 3U7WH 4DGYL 4MXWL 2Z91A 2FBJL 2QTEA 2VXVH 5EUOF 2VXQH 1KCRL 3S6CA 4EDWH 5DFVC 3JWOL 3L3KA 3RNQA 5DHYA 3BYYA 4LCUA 4WDIB 1FFQA 4X4YB 5D1XD 4MLIA 5DURD 3NN8B 4WENB 4MJIA 2FSEB 4WW2A 2VQ1A 3RDTD 3MLYH 1X5FA 4L8DA 4M43H 3MNWB 5IB5A 2CIKA 1KN2L 2WQRA 5E70A 1VADA 3VXMB 3VFWA 3SDXE 1FVCA 2N7AA 2ZUSA 1S7XA 2DKMA 1ZE3C 1F3DH 3LMJH 3PDOA 1RHHB 1KJMB 1A2YA 3MNVA 4WUKH 4RSVA 1S7QB 3RL2A 5A16B 3TA3D 2A74B 1I8LC 4F3FB 2H3NB 2DTMH 3NAAH 1SY6A 2FJGB 4QXUL 3GSOB 4R4ND 3RFZC 1C16B 1MCIA 4AIOA 2YD7A 4UILH 3RIFF 3DO7B 3MRPB 3ROLB 1DLFL 3OKLB 4PD4J 3VD4A 3JWDC 3DX8B 1XF5B 3WNNA 1OTSD 5E5MA 2VDRL 3RDTA 1INDL 4XCNA 1H8OA 4IJ3B 2YWYA 2AEWA 1F6FB 1QRNE 3NACL 4NKMB 3THML 3ECBA 1WV7T 4ETYA 1HIMH 5F9OL 2YK1H 4MCYB 3V6OE 1TPXC 4PJAF 5EU6B 4PP2A 2WBJB 1EXUB 5FA3B 2EKSB 2EDOA 2HJLA 3CFDB 3VRIB 4EXPX 5GS1C 3G5VA 4GBXC 3OGCB 4X7EC 3DIFB 4PS4H 5FYKL 2ORBH 3V0VA 2CUMA 4XB8A 4YX2H 5D72L 5J89A 4PY7B 5L6YH 2VR5A 2NY7H 5DJ0B 2UWEB 1CFTB 1GIGL 3VXOB 4ODXA 3BQUA 4I0PB 1IC5H 4KRPB 3OB0H 1T0NB 2FHCA 5CCKH 4XPFH 1I9JH 5FYLE 4KTDH 3O6FD 4XVSH 4NKDA 4ZFOB 3E6HA 3UTOA 2EDLA 3NCYS 4U31A 4OUUA 2H6PB 4U1SB 3OKKA 4J4PA 1HDMA 4K7PH 4UT7H 1JGEA 3MFFA 4PJGE 4WHCA 4NBZB 5I1KL 5E95B 4O2EB 3V6OC 3D0LB 5IESL 2HLAB 5KOVC 3AFLA 5CD5D 1PLGH 2AW2A 2VMFA 4ZAKC 1KB5L 1JMXA 3BIAX 4H0HB 1M71B 1PVHA 3RIFK 1JF1A 3PWNB 3VH8G 4MSWB 2BNRA 1YEKL 5I1GH 3ZT5A 4MA8H 5DRZB 5HYJB 1KXVC 3ILQC 1IEAB 3TT1H 3T8XB 3O6KH 3GIZL 3VE0A 3L3GB 3LPGA 2R4SH 1G7QB 4K7FA 5DK2A 2YOCA 1S9YB 5GGQH 2NYYC 1F11A 1E27A 4X4ZA 1P4IL 2DMKA 3MLXL 5DJZB 1DQML 3HE6B 4C54A 4MDIA 4HWNA 1OAKH 3C5ZC 2R56H 1UG9A 1K6QH 1FN4B 4NQCB 3TZVD 4D9LL 3HAEB 2H32B 3S37L 5IBLD 2XQBH 5BV7C 3BHBA 3EOAA 3IFLL 2QSCH 3DGCR 1UB5B 2X4SA 3PWLA 4MAYB 1MWAA 3EO9H 4NWUH 1R3LB 4YPJA 5E2WL 3C9NA 2JB6A 5SV4A 3BO8A 5DVKA 3E1F1 1ZHKA 3V52H 5D7SL 4OGAD 2APFA 3L9RA 5I76B 5IVNA 1OCWL 1FFNB 3QEQD 4AIZB 3BZ4A 2ILLA 3LEXA 4LLQB 3L5XH 1P5VA 1RPQA 3O2VH 4XBPB 4NJAH 4QYOB 4PJHA 3BJ91 3X13A 3GHBL 4JFOA 3ARFB 2CSPA 4JLRB 5IEKA 4R8WH 4AG4H 4WGVB 3GB7A 4YHZL 1BAFL 1ZANL 4JO2L 4GXVL 4XBGB 3ARPA 1I1FA 4EBQL 3BGFC 5EBLA 1NGYB 4L4JA 2FX8L 4G6FB 1N0XH 3B2UC 1H9VA 1XF4B 2CIIA 4M6ML 4JFFE 4AY0A 4TVPL 1KEGL 1INEL 5T3ZD 2XV6B 1AI1H 1MH5B 1QP1A 2WUCH 5F1KC 3QDGB 4E41D 1GGYA 1ERNA 1BLNA 4QRTA 3QEQA 5CJ8A 1NBVL 3GIVA 2DQIH 5C0JA 4MA7H 3TNNA 4NZRL 1N6VA 5H94B 2L4OA 4X7CC 3AM8C 3MX0A 3EO1A 4C56D 4JJ5B 5JHLL 1N4XL 1MEXH 4WO4D 2AGJH 2R23A 3BP5A 5KTEL 1F6LL 1M7DA 2UUDH 3UTPE 1QTYT 1UXWA 2VL5A 1NEZA 3V95A 4B5EA 3HNSH 2IAMC 2ADIA 4PJIA 5CHNA 5HXMA 4FFYL 4QY8A 4OGXL 4YXKH 5F6IC 3MRBB 5CLTA 1KOAA 2FDBP 1TVBB 4J6RL 1M05B 2JELL 3ORJA 3QWOA 4X4ME 3ZL4H 4HXBH 1VFAB 2EDBA 2F15A 1FJ1B 3ZSSA 2KKQA 4ZMAT 4HULB 1JZ5A 2GIYA 3X14A 1MJ7L 1AGEA 3G6AA 2X1OA 2KPNA 2ZZUT 3KXFB 3WUZA 1WLHA 8FABA 4XP1H 3HNTH 5K9QI 4QXTB 4WO4A 1KXQE 3OXRB 3IF1B 5C09D 2IBZX 3U1SH 1U91A 2X9YA 4B0MM 2R15A 2HWZL 1IFHH 3VJ6A 4YE4H 3CU7A 1KIPB 1FFOA 1P7KA 5GRJH 3DX7B 1CTNA 4JY6B 4U6YB 2PXYB 4Y1AA 1BGXH 4LVOB 1K8DA 4TSCH 2X4RA 2CMRL 1GPOH 4S1DD 1ZVHA 2R2HA 3JV0A 5DEGA 3VXQB 3ARQA 1D3CA 3WLBA 3KJ6L 4P2CG 3LB6C 1C1EH 2DICA 1BQHG 4FXKA 4QTHA 4W4OC 3OR6A 2Z92B 2X41A 4G6JH 2Z31D 5J6GA 3PWJB 4I0CC 1CICB 3T0XA 2PTVA 1CQYA 3LIZL 3SO5A 2FR4B 1T3FB 4TUJB 1RZKC 4X7SH 4UUJA 1FNFA 3EJYD 4Y4KA 3I6LD 1VGEH 1SM3H 2VE6B 4WFFD 4DFIA 4FABL 5ERWA 3IDIB 1OAQH 3AMKA 1MCRA 1NDGA 1MFBH 2EC8A 2YKLL 4LPYA 4P5TC 5DI8B 5FO9B 3MOBH 2VLMD 1A1OB 3GSWB 4GLRI 5GSVA 4FZ8L 5KN5B 4RBPK 5F3BA 2EYSB 3BKYH 4RGND 5GRVK 5FECA 4FQHB 3BH9B 2DRUA 3QI9A 4MAYD