3F7LA

X-ray crystal structure of alvinella pompejana cu,zn superoxide dismutase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
AIHAVCVLKGDSPVTGTIHLKEEGDMVTVTGEITGLTPGKHGFHVHEFGDNTNGCTSAGGHFNPHGKEHGAPEDENRHAGDLGNVVAGEDGKAVINMKDKLVKLTGPDSVIGRTLVVHVDEDDLGRGGHEQSKITGNAGGRLACGVIGITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper,Zinc Superoxide Dismutase
publication title Superoxide Dismutase from the Eukaryotic Thermophile Alvinella pompejana: Structures, Stability, Mechanism, and Insights into Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Alvinella pompejana
molecule tags Oxidoreductase
total genus 44
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3f7lA00
1DO5A 1HL5A 1Z9NA 2AQSA 4A7TA 3CE1A 4FF9A 4BCZA 2R27A 2GBTA 4A7GF 3CQQA 2ZKXA 1CBJA 1E9OB 2WYTA 3GTTA 5KBMA 4BD4A 1IBHA 1F1GA 1SXNA 2Q2LA 4L05A 1E9QA 1UXMA 1OAJA 2VR8A 1SXSA 3MNDA 1OALA 4N3TA 1Z9PA 4MCNA 3KH4A 3QQDA 1IBDA 1YAIA 2C9UA 1B4TA 1YAZA 1EQWA 3ECUA 1N19A 2K4WA 4OJAA 2WZ5A 2VR7A 4A7UA 2AF2A 3GQFA 1SPDA 1SXCA 1L3NA 1QUPA 1OEZW 1IBFA 1AZVA 1BZOA 3HOGA 1OZUA 2APSA 1DSWA 1JK9A 1UXLA 1N18A 1TO5A 1TO4A 1SXZA 2ZKWA 2ZKYA 1PZSA 2WWOA 5KBKA 2GBUA 3LTVA 4N3UA 1SDAB 2XJKA 3T5WA 1SDYA 2AQQA 2AQPA 3H2QA 1BA9A 3GZQA 3KM2A 1E9PA 2WYZA 3S0PA 3L9YA 1E9QB 3SODB 2GBVA 3ECVA 2AQTA 2WKOA 3PU7A 1PTZA 3MKGA 1HL4A 2XJLA 2C9SA 1SOSA 3L9EA 2WWNA 3QQDB 1KMGA 2SODB 2E47A 3K91A 4MCMA 2Z7WA 1B4LA 1F1AA 2Z7YA 1XTMA 1XTLA 2ZOWA 2NNXA 5KBLA 2JLPA 1SXAA 4A7SA 2C9VA 1F18A 1IBBA 4A7VA 3H2PA 3F7KA 3KBFA 4A7GA 1E9OA 3KBEA 1COBA 2WZ6A 2Z7UA 4U4IA 2LU5A 1P1VA 1SRDA 3HFFA 4OH2A 3KH3A 1SXBA 4A7QA 2V0AA 4B3EA 1U3NA 1JK9B 1PU0A 1IB5A 3GTVA 3GZPA 2E46A 2WZ0A 1S4IA 3RE0A 1RK7A 3GZOA 3HW7A 2AQRA 3KM1A 2Z7ZA 4BCYA 3ECWA 5CU9A 1MFMA 1E9PB 2JCWA 3F7LA 2WKOF 1F1DA 1ESOA 2AEOA 1JCVA 1FUNA 2VR6A 1OZTG 2AQNA 1CB4A 1XSOA 1EJ8A 1YSOA 1Q0EA 3CQPA
chains in the Genus database with same CATH superfamily
4AWJC 1Z9NA 1SVCP 2BY1A 4DAGH 1CDYA 4K15A 4U3HA 2NSXA 3KVQA 3UZQB 4F3FB 4ZOAA 3ESPA 3GBEA 4KK8D 4BZ1A 2X3AA 3GHBH 4PJXF 1CDIA 1IAIH 5HD8D 4L3CB 3T2NH 1CIUA 2DBJA 2P8PB 4G8GE 1QI5A 3G5XA 1XCTA 3TNNA 3B9DA 2ZUQC 3IXAA 2X1WL 2R2BA 4JM2B 4UDUA 3HI1A 4NERA 4D3CH 4GFXA 4M48L 1DJYA 4L4VE 2Y9RT 5G5DA 4I77L 5ILTL 2BM3A 5E94A 3L13A 3SKNB 2MH4A 1U3YA 2UZIL 3T8VA 1OALA 3U83A 3KPRD 5HDBB 3PL6D 2DW5A 4W81A 4X9IA 4ZW7A 3SGEH 2NX5A 3EJSA 4F7EB 4GMTL 4LHQB 2BDNL 2QQKL 3FUKA 3DVIA 4JHZA 3KLLA 4P3CH 3BDYH 5EU3A 4GMSH 3VRIB 1DVZA 2FRGP 1T7YA 3B1TA 3UIYA 4KMTH 4PEEA 3GRWL 5AYUL 4FE9A 3W2DL 3ZKND 3BSZL 1E4XH 1A66A 4H2AA 4J2QA 1LEKA 4FABH 1CLCA 4UZGA 4JRFA 4YDLC 4KV5F 2MIZA 3MRFA 2CHXA 4Q7DA 9PCYA 5AOZA 5E2JA 1U8HA 4BRJA 3RL2A 5JYMA 4FFZH 4WTXA 4G6ML 2XV3A 4AZ8B 5E5MA 3PY9A 1AQKH 4HLEA 4ZFGL 2TSAA 3VVVA 5I75C 1A6UL 3IDNB 3N3EA 1GTNA 1LEGA 3LKRB 4OF0A 3P30L 3GS7A 2VLRD 3K0WA 1X9QA 3NABH 2LE9A 2MCPH 4FFTA 5ETUB 3QORC 3LKNA 5F6HI 3L4XA 1YRKA 4FP8H 3UFIA 2WGNB 1CD1B 1TMCB 1OTUC 2EE3A 2KPWA 3C5ZA 3E7JA 5FM5M 4OLUH 3PHAA 2WXKA 4FQIH 2FX7L 1DQQB 1PG7W 4Z7QE 4CVUA 1E4WL 4NYLB 3NTCH 2BZDA 1EGJA 1N2RB 2HKHH 4QTFA 1CE6A 4Y9GA 4CGTA 4G42B 2CBOA 2HN7B 5IESL 4Y8DC 4AI7A 3RTQA 1Y6MR 4GJTB 5J4MA 1E27B 3ALPA 4JS7A 4Z7VF 4EIZC 3GZOA 3QUGA 1RMFH 5D71L 4MZ3A 2HFTA 3WIAA 4UAHA 3LN4B 3ZRFC 5C8JB 2A38A 1T5XB 2AAVA 1WAPA 4IK6A 3HB3D 1MI5D 1TKWA 3V4UL 3T2LA 2FBJH 4K8RH 3V0VA 3F58L 3WNPA 2E74C 4Q0XL 3RURA 4D0CA 3SSGA 1TQSA 4B9GA 1EFXD 3MCYA 1MWAB 5A6LA 1RIUH 1JDDA 1I7UA 1JPGA 4K3DL 3ZY7A 2W92A 3IXTA 3WKNA 2OSWA 3GIZH 1O6VA 4YSDA 3L5WA 4YHIB 3ULVH 4ERSL 2J8HA 4X6EB 4JUSA 4RDBA 1HJBC 3K74B 2FLBT 3RWFB 1KC5L 2HVBA 4JG5A 3W38A 4F2MB 4QRAA 4ZFOA 4ICXA 4Q52A 3HG4A 4LLWB 3BE1H 4ZBJA 3QDHA 3LN5B 2Y5TA 3VFWA 4KROB 2XWTA 4NBYB 5B1JC 4CJ0A 4R4FH 1U2CA 1AD0A 2CCLA 2ADIA 4FI7A 1J1XL 3L08A 3W0WE 1FN4A 3CPLB 5IROD 1E28B 4XOBA 4Y4KD 5C7XH 2CDGB 1C5BH 1EXUB 1A64A 3SQOH 2F53E 1P84K 5KSBF 2RCSL 3O11B 5IFJA 3VFNB 2W8CA 3F05A 3QAQA 1R19A 2FD6L 3IJEA 5T5NG 4NNPH 4AENB 1ZT4A 1B3IA 2BOCB 2OLDA 4I9XA 1PLCA 1MIML 3IM1A 4XP1L 3TBWB 3KBHE 2ZUUA 1O6TA 2CA4A 4RCAA 3VCLB 3V4PL 2IIJA 5DMIL 1BA9A 1PKQA 3IMUA 4K9EH 4OFQA 3NJLA 3FT1A 4KZEH 3FO0L 4U1JB 4HP5A 4FERA 3PIQB 5IJDC 4DJMA 4R8WL 4PG9A 3TASA 4UUJA 4P4KC 1QLRB 4NN5B 1UB6B 3HR5B 1EHLL 5AVZB 3DTDA 3VO0A 4DQOH 4CVXA 4F7CB 3QQNA 5I1LA 4HUWB 4UNUA 4YDKH 5D1QE 1MJ8L 3EJCA 4U1KA 5FUZH 4M61A 4FNSA 2WGXA 1HHIB 4D2NA 4AQ1A 3VD2A 2IH8A 3GM8A 4HJEA 1DVXA 1G6RB 3HFFA 3ULVE 4FFWC 4JY5L 1WS8A 1B0RB 4TTDD 1BGXH 4DPRA 1PFCA 1S2EA 4M7LL 4P07A 1MFDL 2DEXX 4RFNC 5DF0A 4Y8AA 4YHZL 4HUXB 2G9KA 2X5PA 2BRRH 3QNZB 35C8H 3FN9A 4NZUH 3A6OA 3VWJC 1X9LA 3T4AC 1K5NB 3D39A 3FSOA 5JPMB 1AXTH 3STZA 1VGEL 2E9WA 4Q9RH 5FHAL 5AENA 2JCCE 1G7PB 1XGTA 1RJCA 5BVPH 3MRRB 1HIML 4GW5A 4R7DA 3A6CH 2C1OA 1CD9B 5CCKL 2N0MA 2K78A 5DO8A 3KPRB 1M2VA 3PL6B 5BRZB 1MRCL 2VDMH 4JN1L 2WJ7A 4UWQB 1XV8A 5CGBA 4K9JA 2ADGA 3G08A 3UTTA 4A63A 4YSEA 1MQ8A 4DH2A 2I5YL 3UCRA 1NGXB 3GJFH 2AQ1A 5ACZB 4XBPB 1FF5A 1S9YB 1J5HA 4YX2L 1NBCA 2BP8A 4HFWB 3IMVA 3WENA 3QJTB 1H15B 2X89D 3SO3C 4NQXB 3VXSD 5CCHE 5FECA 3VW3H 3G6AA 2WQUA 1ZLSL 3FU8A 1LLAA 2R29H 4EIUA 3DPBB 3CZKA 1MW3A 1NUGA 2OTUA 4N2OA 1PYWB 3MUUA 3OJVC 1JMXA 4KI5D 4JFYA 4UANA 1ETJA 3IFPB 1LE9B 1E5YA 3L3HA 3Q0HA 4GSUA 2LU4A 4JQIH 4PRAA 4XGZB 5DRZB 1AD9B 4HFUH 4GT7A 4H8PA 4WI4A 3UTQA 1XF3A 3CVCA 3QCVH 3QUZD 3U1SL 4QXUL 3MRPA 1BM7A 4ODUA 4APXB 4ONFL 4MMZB 5I6PA 4OF7A 3QXDA 5T8IA 4LARL 3S5LA 2JJWA 4AEFA 4P2RD 3KGSA 3WHE1 4V2CB 4JZJA 4NC0B 2QL1A 5SX4I 3GMQB 1TZHA 3WTSA 3PAZA 2Y72A 4PJ8A 4BSVB 1XGPA 3CVHL 5CSZB 1A8ZA 1FAIL 4KTDL 1LO0H 3FQWA 3TYFA 3MRLA 1ETZB 3ML9A 3CLEH 2ARJB 1GS6X 3TBBA 5HYEA 1CDJA 4RAVA 3Q9QA 4OIFA 3HC4L 5KYWA 3LZPA 4NDMB 3L9RB 3HB3B 3EW3B 2X6UA 3EGDB 1F11A 2J88H 1A3RH 2J20A 1DN0A 4PV8B 1K4DA 3MFGB 1EFXB 5FCUH 4RAHA 4NQTA 1LP9F 3GKWH 1XZ0B 5CFAA 1YEDB 3EOTH 4XBMA 3ZL4H 4MD4A 5FW8A 4HV8A 1KGJA 1QKZL 3PPEA 2XKNB 1KJ3L 4A68A 3SE9H 4IRZH 1BFTA 4K0OA 5CBAB 1TTCA 1N67A 3LSOB 4OLXH 5A2LH 3MRKA 2EC9T 5F7NC 2EDJA 3SD2A 3AREC 3B9KA 1T0NB 3DURA 4WKZB 1I1AC 2GJ6E 1JNHB 3TEXA 5C0GB 4R7NB 1Z2KA 3JV6A 4WF7A 5HVGB 1NFKA 2Z8RA 4XTRD 4L8DA 5T5FL 1X5LA 1MHEA 3N44B 4D94A 2YO3A 1ZSHA 3T77B 1WVZA 1N64L 3H3PH 4PJIB 5JXAH 4X2UA 1VPOH 3AWFA 3MRGA 3BGFB 3QZBA 4P2AA 4TNWK 2AVGA 4Z6AT 3HHSB 2A9BA 4PYGA 5H2BA 4GIOA 2GHWB 4N26A 2QKSA 4M43L 3ECUA 4FA7B 2YSSB 2DLGA 5FO9A 1JP5A 2ZWNA 5CBEB 3CZSA 3OL2A 4ILDA 4ZMPA 1A6VL 1H19A 3NZSA 1MJJA 4TOYH 4ZTPL 4JFFA 5IQ7L 3U2IA 1DSFH 4AYGA 3INUL 1IFHL 4QEGA 2QQLL 4DKEL 1TEFA 3UTPE 3FB7A 1G9MH 1OEZW 2HH0L 3CDYA 3CDFA 1GS8A 5ID1A 3S37L 3QDJE 4AGMA 1DLHA 3O9WD 3P9LB 2PPEA 5EUKA 4AE0A 4ELKA 3NIFB 1FGNH 4FQCH 4Z78A 4JFDD 2OJEA 1G6VK 5DHEA 2WO2B 3L1OH 4JFPA 4NCC2 5GS1B 4M6MH 2FSDA 4L8CA 4LRNL 2WOYA 3VRJB 1SDAB 5CWSB 3MRHB 1IGJB 2DDQH 3Q1SL 4Q8BA 4U31A 4Y7MA 4GG8B 5I19L 1FZOB 2OJ1A 4HKJA 3NJIA 5CHNB 5IVOA 2OQJA 5D70H 1E42A 3UJJH 1IC1A 2WLYA 3OR7A 3ROOB 1KMGA 2WWNA 43C9B 4XMLL 4XE0A 4MWFB 4KWUA 2FE0A 4C58B 4QKTA 3QUYD 5DMJB 4A6YH 3D85A 4HSQA 5KW9H 2ZJSL 3LJ3A 3U46B 3ZPDA 1AI1L 4X50A 4YXLH 3UBHA 2AAAA 2YRZA 3DETD 2D9QB 3DX7A 3NDZE 1R0AH 2YLKA 1CO1A 4P9MH 3QRGH 5EOTA 3OKOA 1R5WB 1TFPA 1FPTL 1E8XA 1ILUA 1WZAA 5CJOL 5AW1B 4D0DA 1TZGL 4PRIA 1OTUD 4Q9QH 1Z5HA 1CL7I 3LMJH 4P23A 5BVJB 4HK0B 4BKSC 1LILA 1KXQA 3BPCA 1KTLA 1BQRA 2E59A 3H53A 1AHKA 2FYVA 4UBDC 5FEBA 4PJDE 4Y2NA 5HDOA 3P02A 5FOJA 2L4OA 4IMLA 4Y2DC 4DSYA 5DC4B 3C09B 5TDOA 3GSXB 1P4IH 4HZ1A 2VMJA 4XZUB 2J55A 2I07A 3QO0B 2GABA 3RUGE 2A5UA 3KEDA 5F3HB 1FNSH 3IDIB 4HJTA 4B9PA 2KPNA 2HVJB 1FZKB 4NIYE 1BXXA 5T3ZH 1YEJL 2IOOA 2DLFL 2VR4A 3STLB 4L9LA 3G6DH 4HU8A 2Q7YA 5C3LD 3VFVA 3VI4A 2F1AA 3BUQA 1M7XA 4JM0A 4Q6KA 1XGUB 4BD4A 2NSQA 2BZCA 1JZHA 4OM1L 2ERJB 1RU9L 3C5XA 2A6KB 1AO7A 2FEDC 3I6GA 4OD3L 2P28B 5J1SC 2EUXA 1QI4A 2EICA 2NNFA 2X53A 4H1LA 4KH2A 5KJRH 2AEWA 2D4DA 2DQIH 3CVDA 3W82A 4ZUWA 1P6AB 4NFCA 3U2SB 2WWMC 3TO4D 5G4MA 2ENJA 1N0LA 1HKFA 5I30H 1ZGLA 1X3DA 5FGBA 2ETWA 1KCSH 1VGKB 2AJXL 5EIIA 4TNEA 4QRQB 1KBVA 4CSTA 4YMPA 1WV7T 2YA2A 2PWDA 3PYCA 1RUAL 4JRLA 1F02I 3QUZB 4JQVC 3ZE2E 3VVWA 3BUYB 1MY7A 2PWHA 2Q3AA 2APWA 4N0YL 2F18A 3ZRCC 4OJDH 3JV4A 2W9EL 4ISVA 2WWOA 4P2QD 2XPGB 5DZLA 4ALAH 3BZ4B 1W6LA 1WK0A 4N2DA 2DJMA 5C0CE 3IAGC 2Z4QB 4OGXL 1DJSA 1NANI 4WU7A 2DH3A 4WY7H 4RMUA 1SJHA 2QMJA 1ZHKB 4OCXH 4WFED 1UVQA 3LVTA 4PGCA 3QG7L 5KAQG 3U7WL 4AMKL 3MLPA 4DGYH 3D4ZA 5ALCH 3GGWA 2DBLH 3FUDA 1SOSA 2P5WD 1J0ZA 3HAEG 2EDLA 3FQNA 4LFHG 5BS0D 5DURD 4LBAA 2LOEA 3IKCA 4NN7B 4NZFA 3Q2LA 3G5YA 4G11A 1UFUA 4JFZL 4ANXA 1PNDA 4I0PD 4IBLT 2YA0A 3JTTB 4P4KD 3RWIB 1OCZB 2DQTL 3DJZA 3ZDXF 3AGVA 3RA7L 4CKVX 2YRPA 1F86A 3QIWD 5T3ZE 2ROXA 3QS2A 3DROA 1QQDB 2UWEE 2UYLB 5IB2B 4J8RB 1U8JA 2DB8A 2FWSA 3JWDL 1EO5A 5HJBA 1SY6H 3B3IB 3ALWA 2Z64C 1SYSB 5JNYB 2EDKA 3RNQB 5I1AB 1RK7A 1U58B 4NO2B 5GZOD 4ZS6D 5F1OB 2ODIA 4OKVB 1F3DH 1L9QA 4PREB 1E9PB 2JLLA 1ROCA 3M1CA 5HGDA 1JXFA 1Q9WA 1EAPB 4OZIA 5B38A 3GSNL 4G6KL 3SCMA 1R3LB 3AROA 2DLIA 1G43A 3ATDA 2AQSA 1I8UA 1RZ8B 3IVKB 4PRHD 4JY4B 4DTGH 5JHDE 4LPWA 3IU3A 4N2BA 1IGML 2NXYD 5FWRA 1G1KA 4XOAA 2V9RA 4HMCA 4XPGH 2A0LD 2WLZA 1H8OA 1NC2B 1JOIA 1KYOK 5GQBA 2QLVB 2AEQH 4OZHB 5GRJL 5KVDH 2W59A 1IBGH 3MJ6A 5L2KE 4ABQA 2GK0B 5SWZA 2C9UA 1KT2A 4G6JL 2VXQA 1MJUL 2GEQA 3HCVA 3O9WB 5DD1H 3ETBJ 3AS1A 2AANA 2BSEA 2MPVA 3FFCE 1OGTB 4JFDB 1HHGB 4X4XB 5EUOB 3HZKB 5DFAA 2IDQA 4ZDHA 3HC2A 1ADQH 3IAPA 3OKNA 3LH9A 3VE0A 5JPNB 1L3NA 2CBTA 2W9LA 1DBMH 4TSAL 1J8HB 2Z35A 3D2TA 3DSNB 3QEHA 1A0QL 4CNIB 4NN6C 1WYJA 1R6VA 4PJGB 4J3OH 2DM7A 2P46B 3U30B 5HPMA 4HHWA 1HH6B 3LTVA 4RDQG 2CDEB 3WS3B 3QUYB 3VGAC 4P9HH 7PAZA 4QOKA 1KYDA 1QVOB 4D9LH 1T1WA 2C7UA 3U6RA 3FO1B 3NJVA 2B08A 4ZMOA 5DMGC 5E4EC 3KPQA 4ZS7H 1KXTA 4LAQL 1LO4H 2VXVL 3P11L 1S7WB 4JPVH 3MJ8A 4JDVA 4RWYL 1MN4A 3DMMA 5JOFA 2HKFL 4S2SB 5IQ9B 4OCYH 2AK1L 3N1FC 4X7DC 3SDXB 4IKKA 1ASQA 5FW6A 3WN6A 3RVXD 4LDOB 1WRFA 2CNZA 2W80C 4H4NA 2VZ3A 4HUCA 3F2LA 1QFWH 5D2LF 4LLMA 4BELD 12E8L 3M7OA 3GKZA 4PJEB 4PCSA 3ZUCA 2Y3NA 1TXKA 3HA0A 4R96A 3FB6B 5CR8A 5KVDE 4ZW6A 1PLGL 5L4IA 1ERNA 3GMRA 2Y7SA 4YZFF 3JWDC 3V0DA 2X41A 1LM8V 1UCTA 4G9FA 5I1HH 5FKPB 2VAJA 1XFPA 3QHTC 4QRPD 4OKDA 2NRDA 3LEVL 4Z77A 3BJLA 2C7FA 4PJ9D 1RZ7H 3HRZA 4FFYA 1CB4A 4XNAA 5D8JH 2IBZY 1L7IH 4LVEA 5E2VH 2GTZB 4HIJA 4IJ3B 1IQWL 2Y2WA 1KCVH 3VI3E 5D7IF 4MB3A 2FIKB 3TO4B 3X14B 1WEJH 1NINA 2W65B 6TAAA 2BFVH 1OAQL 2X9WA 4OZ4A 1G9EA 4NB7A 4ZXBD 3FU5A 2OZ4H 3NA4A 5C2UB 2DD8L 1ZHLB 4PG2A 5I73B 2WOBA 3BISA 4AVIA 1IKNC 3T65A 4K3EH 1I3RA 1JZJA 4UQ2A 3OKDA 4HWNA 4B96A 3WY2A 2FEEI 2GUOB 1OSZA 1YMMA 1CGTA 5DHYA 5EN2A 4FDWA 2WZAA 3A6BL 5FYLL 1FJ1A 4WO0A 3ZTDC 3DV4A 1AACA 3PWPD 4N5UA 2APSA 3RKDD 1ZCRA 2E4FA 1BEXA 4URKA 4QHLB 2FWOA 3IFOB 1EAJA 1EANA 2P5WB 5CEZL 3BI9X 2Z92A 3L8QA 3QUMH 4GEJA 3U25A 5BS0B 4KKZA 1JTPA 2BVOA 1MQKH 1NAML 5DVMA 2X0WA 4N90E 3VFMB 2CIIA 1NH6A 4I0PB 2OL3L 1W72B 5BJTA 2M8XA 3QVAA 2VJ8A 3CXFA 4EI5C 3MROA 3O81A 2J1XA 3QIWB 2DTMH 4Y1AE 3F3HA 5E00A 5BXFA 2A3TA 4F7PA 4XAWL 3VDBA 4PJCE 3P2BA 3Q2CA 4ECNA 3UZQA 2VW4A 4F3FA 1OM9A 2F19H 3Q8FA 3OQRA 5GGTH 1A7OL 3ZKMC 4L3CA 2P8PA 1MPAH 4U1MB 3UACA 5KVMC 2CKBL 5K9QI 4H2CA 2Y6SD 4JM2A 3GSUB 5J5EA 3SKNA 2G30A 1MW1A 4CMMA 2NTFB 1A9EB 4OJFH 3RWDB 5AVQB 5BO1H 4F7EA 2OZNA 3HBZA 1T89A 1UACH 2WZ0A 3K6OA 2A1WH 5J6HB 5D6CB 5CFHA 5LCVH 5MEQB 2F74B 3FTGB 3VRIA 4PRHB 3EYUH 4YSQA 3OD3A 3BZ5A 5DVPA 1YG9A 5FGRA 2C3XA 2NXYB 1DO6A 3PPSA 2VDLL 3FH8A 4OT1L 3VXUE 4DESA 4ZUSA 4J3SA 2FX9L 4XHJC 1CFVH 2EH8L 1RZPA 5LGJB 4TMPA 4MA7L 1V5JA 3NCXA 2O5XL 3FHEA 3JVGA 2J5WA 4GXUM 3TN0D 2FB4L 3WN5C 5ABDE 1F1GA 4AZ8A 1P9MC 4BEIA 1WWAX 3E3QC 5GGQH 4DGVL 3KPNB 4G9DB 3IDNA 4KO6A 5C07E 3DXAD 3OC8A 3LKRA 3ESMA 3NJGA 5BW7A 1HHHB 4PVNA 4QXGL 1U8QB 3UH8A 5ETUA 3CHRA 4AH2B 4X6CE 2X38A 1CD1A 3VG0H 1CT8A 4OB5H 3SE3A 2WXMA 1ZT7B 5CINH 5C7ZA 4DGUA 1SJMA 2KDGA 2I85A 1DQQA 1LWRA 4LP4A 3L4YA 4NYLA 5EULV 4E5XB 4PWIA 4G42A 3R06B 2XSKA 3MCKB 3QCUL 5BV7H 5T3XH 1DYZA 4JFUA 1XCXA 1E27A 3EDKA 5F6IC 3VQLA 3VXME 3W1ZA 3DX8B 1OSPH 4LOEA 1AZZC 3MRMB 1FV1B 4OR1A 1C08B 3LN4A 1FZJB 5C8JA 2CK0H 3GBML 2CO7B 2EJ1A 1PY4A 3PAVA 2O4EA 1NCGA 2VSKB 3ISWA 1P4LB 5D6DA 2DQFA 5DVKA 1URLA 4WO4D 5IMMB 3MV7E 1WBZB 1A9VA 5CZVL 2VDQL 4KTGA 4Z95H 5IFAH 2VCOA 5DJ8B 5LNEA 3B37A 3L7FB 3Q8CA 3VD4A 1WFIA 3D06A 1FLTX 4JPKH 1N6UA 4TUJB 1IBBA 3WSQH 2MEJB 4G1EB 5JMRA 4YHIA 3NIGE 4EIGB 4X6EA 3QCTL 3RWFA 1P5UB 1SDDB 4LNRB 4G8FB 2X2IA 1SUHA 1JI1A 4OSUL 4F2MA 4QRPB 5EBGA 4XAKE 4LLWA 5C0AB 3UADA 3I9GH 5INDB 4DT2A 2F15A 2XICA 3LN5A 3CFJB 1TPXC 3QXVA 4PJ9B 3ARBD 3BEWB 1IGIL 2MJWA 3MBEB 2AJ3B 4L0PB 2Q76B 3BVTA 2WBWB 2VABB 4GQZA 5IOPB 5GRYA 3CPLA 1E28A 3VSQA 4BV1A 3QULB 5LG6A 1EXUA 3BAXA 4TKWA 5HYSB 3CZJA 1IC4H 1KCLA 1PJWA 3FCSA 3GO1H 1VAHA 3O11A 4FQHB 3VFNA 3ZIYA 3FQ2A 4N2MA 4IDJH 2ZPKL 1HOEA 4HU2A 1E3ZA 4AENA 2BOCA 3K4AA 3FF8A 3VH8G 5I28A 4BFNA 1GSMA 2PW2B 2N1TE 5F7LB 4ZXBB 3TBWA 2WBJC 2EVHA 4NBZB 3CQQA 3N55A 3LH2H 3VCLA 2HXAA 3E1F1 5T3XE 3D25B 1AR1C 2F5AL 1IBHA 1UCBH 4WWNA 1YEHH 5GXBB 3UDWA 2VLJE 1NOAA 4AC4A 1NCWL 1NBVH 1OWRM 1IMHC 5DVLA 4U1JA 4NQDA 2P5EB 3PIQA 4M03A 2AJUL 4OZGF 1RIHH 3RIFF 1FNGB 1Q1PA 1SJVA 4FNPA 5EBWB 1PAZA 1QLRA 4QGTA 3ZLQC 3S37X 2M2DA 1J48A 1NFDF 1UB6A 3A67H 3HR5A 4JM4H 1KTDB 3PWPB 4GUPB 3FQTB 3MODL 1OD7A 4F7CA 1WA1X 4UT9H 2EZ0C 4HUWA 3B7TA 1MXGA 2PYEE 4N8UA 5E0FA 4OUUB 3V6FB 3WKYA 1HHIA 1YECH 1Q0YL 1ZMYA 4YL4A 2XG4B 2IPUK 4L18A 1IBFA 5LNDA 1G6RA 1GGCL 3BYYA 4CC4C 5C0NC 1L7TL 4LL4A 1HKLL 4F37K 4KK6C 4JL1A 1UA7A 3IB4A 3KHQA 2IAND 2MOQA 1BXUA 1MCEA 5EO0B 1OP4A 4HUXA 4E68A 5CNHA 1GPOH 2NY2C 3QNZA 2WLHA 2DL9A 3ELQA 4L2LA 3OAUL 5CJXA 3KM2A 1K5NA 2AJSL 2LVEA 2X6AA 4P2OC 5HYJD 5JPMA 4FNQA 3RY6A 4JKPL 4XOEA 2HWZL 1KV7A 1G7PA 3MRRA 3L4TA 4AZUA 1P7QB 4NZTL 1GW6A 3BAEL 1FH2A 5DMGD 3ESUF 1J1OL 4GBXC 4MS8C 4PS8A 1WBXB 4M1CC 5BRZA 3NCYP 4GT0A 4GW4B 2CIKB 4QTIH 3V4VB 2QHRL 3OHXB 4K7PL 4B50A 4ZTOL 2J72A 5CUSH 3Q2WA 3MA9H 5KOMC 3V8CA 4X7SH 1X4XA 4FMVA 2QVMA 1TYJA 4NPYB 1RXLA 4Y7OC 3KH3A 1KJMB 1NGXA 3O2DA 1RULL 3OWEA 3QJFB 4Y4FC 4QHNB 2MHAB 5ACZA 3O8XD 1S9YA 2GVYA 4IRSC 5IIEB 1CXLA 1NL0L 4HFWA 4NP4L 5A2JH 3FSVA 5GRVL 1UD2A 3CZNA 3OHMB 4LVHC 1VZIA 4B60A 4X9HA 1H15A 3I50L 4GO8A 3BXNB 4NQXA 2EP6A 1X44A 2WSDA 2KL6A 3T3MF 1CL7L 3HNTL 3L3JB 4LGPB 1AY1L 5DEGB 3D9AL 2VR9A 3DPBA 1IC0A 4FLOA 4U7KA 1BQKA 3TN0B 1JAEA 1BQHB 4XNZB 3CQPA 2JQZA 1FDLL 1PYWA 4HUUB 4FXKC 4L1SA 4TQ8A 5ES4B 2I7SA 1A21A 3IFPA 1LE9A 1T0MB 1XF1A 3KYAA 3DXAB 2ALAA 4XGZA 5DRZA 4KKAD 1AD9A 1HT6A 5I1CH 3DO3A 2GSGB 4BA0A 4U6HB 2R0LH 4APXA 4OTXH 4WV1C 4MMZA 5E9AA 2H2PC 4M3HA 4F27A 2N01B 3GI9H 1F8TH 1CGXA 1AIFB 3GMQA 3L1EA 4KQ4L 4OCSH 4ODTL 5DQ9B 4UTCA 2AXGB 4I18C 1CLOH 4BSVA 5E2WL 5CSZA 2JK5B 3KWUA 1ZV2A 3IK2A 5E8DH 4PWGA 5EO1B 3X11B 1JI2A 3QUXC 2ZCHL 4Y9FA 4NENB 1ETZA 4PW3A 4RFOH 4OLZH 1VZGA 3WO4C 2XQBL 3GT6A 2SEBB 2ARJA 2C3VB 4FGMA 1D7BA 3RWEB 1F4WL 1HDMB 3BFOA 2Z34A 3KYKL 3O2VH 4YUEL 1EIBA 3RFRA 1GGBL 2A74B 1E4JA 1YQVH 2MNJB 4NDMA 3EOBB 1QWNA 1OZUA 5PCYA 3DSFH 4LEOB 3EGDA 4FNLH 4JB9L 4U6VH 4IW4C 2Y7OA 4HH9B 2YAHA 3B2VH 5MEOB 4WO4B 2QQNL 4BFKA 3CK0H 2DQJH 4PV8A 3RWCB 2P49B 4Z5RB 1EFXA 2EYTB 4XWGH 4N24A 2ZOTA 1XZ0A 1YEDA 2W88A 4PJCB 3K80A 4NKMB 2PWFA 4HETA 1Q9LA 2JF1A 1BVZA 2KZ1B 3SGDH 3ETSA 5EOQL 2JJUA 2XKNA 3KR3H 4HCRH 3FDWA 4K2UL 3TPUB 3UJTL 4ZFFB 2H5UA 9CGTA 1EMTL 1DL7H 3JTBA 4I3RH 2NSMA 5CBAA 3BQVA 2OYKA 1ED3B 4ZK8A 1TVBB 3SYPA 4BZ2H 2AXHA 5KJ7E 3ARBB 5JHLA 1T0NA 5TPWH 4WKZA 1MZZA 3F7KA 5FFOA 4JRXD 1FO0H 3HG1D 3OG4B 1JNHA 3UZEC 3WXVL 2DS4A 5C0GA 4R7NA 5F8QC 4PSRA 4PYHA 3PGFH 3VFOB 5IMOB 1RUQL 3CQFA 5F7DB 3U79A 1BLIA 4TSCL 2VNCA 4CMHB 4H8HA 4LHUG 2R59A 1U8CB 2EXWC 4NHCL 3T77A 5JQ6H 3GXNA 2YQBA 4PJIA 2VMFA 3ZYOA 5AZ2H 2A77L 2WQRA 2XZAH 3HHSA 4KDTC 1U8NB 4XPHH 1X5MA 2YSSA 5CBEA 1NEZA 5AQ0A 4OBRA 3AMKA 4CAGA 1DR9A 1MZYA 1OAUL 4HIXL 1P0SE 1FYTD 1NAKH 3DV6B 3QB7C 5DD5H 4TULH 1G7JB 3BYTA 3EH3B 4TSBH 1KY7A 1YSOA 4LPUA 3U82B 4J4PC 2R0KL 1DO5A 1X7QB 5J0BA 3CFTA 2GYSA 3T04D 4JGMA 3F7YB 3P9LA 5CCJA 2CRMA 5AOLA 1RURH 3P73B 5GS1A 4TTGA 4PH8A 3HHMA 1NGPH 2XOTA 3HVDA 4XO4A 3VRJA 3S34H 5CWSA 3G3LA 3E2HB 4Z8FH 2VLRE 2VC2L 3C08H 3MRHA 3QUHA 3ZZSA 1IGJA 4BQ6A 4K23L 1CLZL 2ZKHH 4GG8A 1FZOA 2AEPH 4MHHG 5IEHB 3ZHNA 3ROOA 3DJSA 2EUWA 3O6KL 43C9A 4MWFA 1WFMA 2RAMA 1F4YL 3BSGA 1CYXA 3HZYB 5LG1A 2JFCA 3U46A 3D2UD 5F2FA 2OTWB 1EJOL 2L7QA 2ZYSA 3KGUA 3NJJA 4IGBD 4MXWL 2XYCA 2IANB 3NMEA 2UY7B 3GBLA 2VQ4A 3ASWA 4P06A 2DIEA 3B9AA 1R5WA 3U4BH 5ICZA 4NN6B 3LNHA 2WQAA 1BZOA 4O2FB 4TUOB 4J8QA 2AFNA 4HK0A 4PAZA 5DUBA 4YHKH 5BVJA 2G4EA 2K0RA 1P69B 1YNLL 5DGQA 4JKKA 2AGJH 4BSJA 3QPKA 1MI5E 1WO2A 4PGEB 4YBLB 1GC1L 3O0RH 3GSVA 1N4XH 2JNZA 3FAWA 4JFHE 4OGYH 4S0TD 1C5CH 2UZXB 4WI9A 3ARGD 5IBUB 3GZQA 3WO3B 4NNXB 2WWKT 1PF3A 5FYLD 1CDGA 2GY5A 3GSXA 3ECVA 1E2WA 4OI9A 5AZEH 5FYKL 4XZUA 2XI9A 2H1PH 3QO0A 1I8LC 4TNGA 5C09D 3DYPA 2BVQB 1ZAGA 4LLYB 5CEZD 5F3HA 4AVJA 1K6QL 3IDIA 4GP8B 1UD4A 4HS3B 2EIZB 3WGUB 2HVJA 1NM4A 3O8XB 4HH8A 3O4LE 5D7SL 4BK5C 4XBEL 3STLA 1KEML 3WMSA 1WZ1L 1XGUA 1G0DA 4NWTH 4XX5A 3NSJA 3RX5A 1A3LL 2A6KA 2O5ZH 2MTPA 1LVEA 2VDKB 5BQ7B 1FH5H 3FQRB 3Q6FB 3C60C 3JT2A 4WEUD 4U1IA 3MLYL 4XB3A 1WCBB 3U2SA 4X9YA 2B4CH 3FH5A 3CN2A 3GBNH 1S7XB 5AW5B 4JE4B 4YEFA 4PVMA 1F1DA 1VGKA 3ZE0E 1G4RA 2EE6A 2G2PA 4HGMA 5BPPA 4FNRA 2IV8A 2VXUL 4MGXA 4GW1B 4OBSA 3QUZA 3SJVD 3BUYA 4Q2ZA 1CXHA 1DQLH 1TTAA 3MU3A 4XVTL 3MA7B 5HP5A 4M8QB 5EEYA 3ZE1E 4EUPB 4OIIL 4B0MM 4H8QA 2CJUH 3AMLA 2YKKA 3BQUD 2XPGA 1Z5YD 3BZ4A 1KFGA 5GS2H 3S9DB 2Z4QA 1Z3GH 4KKRA 1H9VA 5HGBB 1H3PL 5D5MB 3K1DA 4XC1H 4JFOB 4P99A 1ZHKA 5EF2A 4HG4J 1I8MB 4N1HB 3WNNA 5SX5H 4LLAA 2J8UE 4Z18A 3M86A 2WO3B 3AC0A 5DZOA 4UQAA 5CJBA 2EH7H 2QJDA 5E08H 1E2ZA 4KH9A 3WY3A 2AP2A 2GPZA 2CA3A 3QFJE 3I6LE 2DWSA 4QRRB 1KJ2H 3RAJL 3L5HA 4F7MB 3JTTA 3RWIA 1FBIL 1ZTMA 2Z31B 1E5ZA 1JXKA 4JDTH 1K8DB 4WUKH 4QCIB 4AITA 3GFUA 3LXBA 4PBVC 5AALA 4EOWL 1QQDA 3MLUH 2UYLA 3MNZB 4J8RA 4B7IA 5IB2A 4KVCH 2CLZB 3B3IA 1CGUA 1E4HA 1SYSA 3OVUB 3OJDB 5JNYA 4TV3A 3RNQA 5KBKA 1ZXKA 5I1AA 5F7HA 1U58A 2FEEL 4NO2A 4PJXE 1M9WA 5SWSD 3FTWA 4OKVA 2R2EB 4NWUH 3EFDL 2B7DT 5ITFB 1X5ZA 4PREA 1E9PA 4PJBF 5LGKA 1GC1C 4G3YH 2XXMB 2GBVA 1EAPA 5H37G 2C5DC 4ZMQA 2MRYA 4BH7B 3IDGB 1QBLH 4UV4L 4JRXB 3HG1B 1I85C 1CFSB 1R3LA 4WHYH 3LN9A 4ZUUB 1T03H 4MZIA 2I9LB 1RZ8A 5I76B 3IVKA 4DVBB 4JY4A 4N2KA 3WIHH 5HYSG 4DETA 1X5GA 3GSOB 2WLNA 1E6JH 5I26A 3S97C 1NC2A 4HAGA 2VWEC 3DK0A 4RMTA 5GJTH 5FDWB 2EC9U 2YMXH 4N9GB 4OZHA 4RRPM 2BIMA 2A9ML 1QTSA 5F8RC 1FYTB 3MYJB 1Q72L 1ACCA 4D9QD 5DFVC 3PRZA 1MFAH 1AH1A 2GK0A 3ASOB 3PJLA 4KV5E 3HUJF 4LCCA 4H8UA 4OCWH 1A1MB 4QRTB 1XGYH 5AL8A 4KUZL 2DAVA 3MC0A 3O9WA 4G7YH 4PJFF 5HDRA 2DQCH 4RETB 4ZTEA 2MFNA 3PWLB 3V0AC 3P40A 4D7BA 1OGTA 4JFDA 1HHGA 4X4XA 4DVRL 5EUOA 3Q3GB 3HZKA 3WHXB 1T2XA 1JTTA 1ITBB 4BH8B 4IU2B 4G82A 2P52A 1OPOA 4PHZA 1MUJB 2PMZA 1J8HA 1KB5H 3DSNA 3QAZC 4LSTL 4CNIA 4HWUA 5EBLB 4PJGA 1ZEAL 5CXPA 5GJSL 4FF9A 4ZO8A 5CLXA 3EJZC 3I2CH 1NQBA 4LBEB 1IGYB 3SBWC 1HH6A 3W5MA 1XT5A 2CDEA 2P4AB 3WS3A 1KY6A 1CBJA 3B43A 2X88A 4G6AC 3HKFA 3QUYA 1KBBA 4GG6F 4P2RE 4WTWA 1QVOA 3D2UB 1HTYA 2X87A 3AB0B 3FO1A 4IGBB 3AG2B 3GM0A 2C9QA 4FTVE 3RU8H 1W91A 3T0BA 2VZVA 5F9OH 3WBDA 1S7WA 1DBAH 3T6ZA 4Z7VE 5IQ9A 4JKMA 1YAZA 1TETH 4M4PA 3BFWA 3SDXA 1P4BL 3O4OB 2K4WA 5C2BL 2C4FT 1A7RH 2W1NA 3GJFA 5JIPA 3W5NA 4OM0L 4GRLC 3HI6H 4HUNB 4MASA 1JPTL 3CBJB 3ARGB 2LW3A 1KV3A 4PJEA 4PMEA 2VDNH 4OFYD 2F54E 4HUMB 1DP0A 1UKSA 3BMWA 3R8QA 4PJAB 1KG0B 2F8IA 1HQRB 4JFQB 5C09B 4NJ9L 3FOLA 4KAQL 3FB6A 3H0TB 1H3GA 4Z0BL 2DYRB 2NY6B 4Y4HC 5JIHA 4NUGH 2ZX8A 1KN4L 1R47A 5C9JB 1P53A 5GHWH 3BP7B 2WD0A 5FKPA 1FL6B 1WSST 1NAMB 2UVFA 5FLVA 5IMLA 5J8OA 1MVYA 4O2CB 3DWTA 4I2XE 5DQDL 2EIKB 5AKVA 4JQIA 3HG2A 3WY4A 2ISDA 4Z7WF 4U6YB 2GTZA 5E95B 1FGVH 2GJZB 2MCAA 3EIFA 4M7KH 4B95C 2BHZA 3KYNA 2FIKA 3B8SA 2UY6B 2E9BA 3TO4A 3U0TB 3X14A 3ZIMA 3OLEA 3TXAA 1JMZA 2W65A 1SF5A 5KSBE 4OH2A 1JPFA 4JG9A 1QZNA 4B3EA 2BCMA 3ZHDA 1KELH 4AL8L 1ZHLA 2F1EA 1BBJB 3SJVB 1P84J 4LVNC 2KBGA 5IW6B 4B9IA 4OQTL 3BQUB 3CDZB 1YEFL 4N28A 2GUOA 4GPVA 5FYJD 4IBSA 4HF5H 1Y6KR 5EZIL 3ABKB 5GGVH 2ICEB 4P2YA 3UAJD 5IZ7A 4PCTA 3C8KB 5C08D 1WD8A 3HLAB 4W68A 2V3FA 4R26H 4O02B 5EORL 5BZDB 3GBDA 4QHLA 1YEIL 4GS7B 3IFOA 2P5WA 1JPEA 4U0QB 3LOWA 4GI9A 4TPRH 4XNYH 4AMXA 1N7MH 4M48H 4IRZA 3VFMA 3ZTNL 5ILTH 4I77H 4I0PA 1T83C 1W72A 3QQ4B 2GHZA 5HGHB 2PTVA 2ZICA 3QIWA 1V27A 2DH2A 3EYQD 4GMTH 2QQKH 4AE1A 5FOBB 3MPCA 1BG1A 4CW1B 1MFVA 1MIEL 2B15A 2A6IB 4UMGA 1FL3A 3P0GB 2DLHA 4ZNEE 5BZZA 4OV6F 1G7MB 4DP8X 5DHDA 2XTJC 1DQVA 1OAYL 4U1MA 5AYUH 3BSZH 5GZOA 5SWSB 1RJYB 3ZKSD 4EQ3A 3EAKA 2X0UA 3FTVA 3GSUA 5F96L 5DK2B 2NTFA 1A9EA 2NYYC 3RWDA 1O75A 4YSPA 1UXLA 3DDFA 2DLTA 4Y5VC 3WELA 1A7BA 3A4EA 5J6HA 5D6CA 5MEQA 3CHQA 2F74A 2LLGA 3FTGA 4G6MH 2VERN 4E9QA 4PRHA 3RHWF 1CYGA 2C8NA 4N8VB 4ZFGH 4D8OA 2ENYA 2N56A 4K7PX 3OKEB 1S5IL 5HDQL 4ZQTA 4ZMAT 1OK0A 2R4SL 3P30H 5F7YC 3TV3L 5CJQH 1GW0A 3WFCL 2YIHA 5E4OA 5LGJA 1I8KB 4MXQD 1OQOA 2J8OA 4MD5B 4CSPA 4CN4A 4IIZA 3N41F 1E4WH 4ZMYA 5JIIA 4HEPG 1U21A 5B22A 2HJFB 1BZDA 1OTSC 1Q9OB 1KTKE 4PRBB 4XB7A 3VXPB 4F37F 3KPNA 4TVPL 4TVUA 3P77B 1FFTB 5EZOL 2DLEA 4G9DA 1Q0XH 4UV7H 5DZPA 2Z1PA 1HHHA 1YNTB 1U8QA 5D71H 4JZNB 5KZCD 5I5JA 5DJCB 4AH2A 3EUUA 1BBDL 1CDBA 4AJYV 2P3YA 4AL8C 4LRIA 1B6UA 3GLDA 1AIZA 3Q5YA 5AKRA 4I9WD 2EO7A 3V4UH 1ZT7A 3V9EA 1QSVA 2V2WB 2VSCA 1HOCB 3C6LB 4RGND 4AYID 4N0UB 4WSJA 3IDXL 1AHMA 4E5XA 4Q0XH 4P2QE 3R06A 5F7MC 1VENA 4PJHF 3MCKA 2IOIA 4K3DH 2AMUA 3FT0A 2VKXA 3K1KC 4ZPVB 3FT9A 5D93C 3DX8A 4ZAKD 4ERSH 4RA3A 1EHKB 3EYOA 3MRMA 3EHBB 2WYTA 1FV1A 1OE2A 1C08A 1B4JL 1FZJA 1KC5H 1Z9LA 3U9WA 1RPUA 4HBCL 2CO7A 3KLDA 2R1XB 5JDJA 2DWDB 1KYAA 3RX7A 4BZ1L 1P4LA 2Q86B 5DFWH 4AK2A 5IVXF 3QJSB 5IMMA 2HX9A 1WBZA 5IBUG 3AXLB 4X5XB 1S5HA 1L9TA 3FU7A 4IYKA 1X9UA 1XH2A 1J1XH 5DJ8A 5F6HJ 2NY4C 3L7FA 2OR7A 2BNQD 2E7BA 2ZP0T 1LP9E 4TUJA 43CAA 1G9NH 4G1EA 4A7UA 3K4ZA 3CIAA 1MFNA 2H32H 4GLRI 5FGSA 1P5UA 3QQXA 1SDDA 4ZUVA 5FV1L 2DQMA 4G8FA 2FD6H 3X1FA 4QLWA 4QRPA 1MIMH 5C0AA 4XP1H 1LD9B 2EAEA 1TCMA 4PJ9A 4MJ4A 3BEWA 5EBMB 2KYIA 3MBEA 5CGYC 2AJ3A 1B88A 2D7MA 4F8OA 2Y07L 4AQEB 4JHWL 2VABA 3H54A 3KVDD 3L4ZA 4MNHB 2GITB 4R97B 5DMIH 2WV3A 5IOPA 5JHDA 4C4KO 3QULA 3SODB 1X4ZA 5KUMA 3TH2T 1WQVT 3ZXAC 4FQHA 1F45A 3NGBC 3SOBL 2FGWH 4JZOB 1B4LA 5EA0L 4B7LA 4ZZFA 1EHLH 5IKCB 5E5LA 2FUQA 3HMXH 3RI5K 1VB9A 2PW2A 3CX5J 4ZXBA 3MMEB 1IEAB 4JK0D 1JGEB 1GZHC 3HG0A 2VDRH 1MJ8H 1LO5B 4YH6A 1RD6A 4JJ5B 1AP2A 4EZLA 2CPCA 5JXED 3D25A 4NXKA 4Y5YC 1DFBH 1CBVL 1A4JB 4R90L 3SY0B 2O6CA 3QIBD 3QR2A 2P5EA 4GSRA 2BIPA 3MOAL 1FNGA 5HI5D 1MFDH 3EG9B 4YHZH 1EGJL 5C08B 3HE7C 1KTDA 3PWPA 4GUPA 4UM8B 2V2XB 3FQTA 5DFVD 3GI8L 5FV2A 1VGEH 2IXQB 4JMNA 3WMPA 2QDWA 5FHAH 4MXVF 4OUUA 1JFQL 1J5DA 3V6FA 3VXRD 3QHZL 4QD2E 4FLHA 2XG4A 1HIMH 2HT2D 1INDH 3NJHA 2FGZA 5CCKH 1YZZA 3T0ED 1UZ6F 3MX0B 4KRPD 4FTVB 1BD2D 4NKDB 5I8KH 2LTQC 2VN4A 5BRQA 3NJFA 5EO0A 4GB9A 2QPEB 4XI5C 3MBXH 2EEDA 4KXCA 2FWLB 2BRQA 3L3OC 5T1JA 2I5YH 4PLJD 1IJNA 4F7KA 1QATA 3EJYD 3NPZB 2MNUA 1E6OL 4LVOC 4ZSOE 1MG2C 1GGIL 1J88A 3SYOA 2AK4D 5IGXL 4M7ZC 2HA1A 3KH4A 3O6ML 2NMSA 1P7QA 5DZJA 1YYCA 3APCA 3IFLL 1KIRB 2Z91B 5HI3C 4HJGB 5HI4C 5BRPA 2PO6D 1LHZA 4ZFOL 1PX8A 3KLAB 1RUPL 1TQCB 3NFSL 4GW4A 3V4VA 2CIKA 3ZHFA 3OHXA 4XCEB 5J6GB 4JO4L 1HZHL 4NPYA 3OPZH 1KJMA 3QJFA 4AKPA 2P8MB 2MHAA 4QHNA 4O58L 4LSPH 5IIEA 4Z0XB 1W15A 3CFIC 4FKKA 2AEIT 4M29A 2ZUVA 4E9WA 3JWNG 1BOYA 4OCRL 4HGKC 2EECA 3U1SH 3IBEA 5IG7B 1ADQA 2R7EB 3BXNA 3JTSB 5ALBH 4ONFH 3ZR5A 3L3JA 2QGEA 4PRPD 4LPCA 5DEGA 3WE6B 5CM1A 2N59A 3QSKB 5FKAB 1BQHA 3RILA 3TN0A 3GJEB 4QRUB 2W0FB 4HUUA 2IPKB 1BMGA 2WM0A 4FAAB 3CVHH 3ZO0A 2CALA 1FAIH 4KTDH 1T0MA 4L8SB 4GI8A 2CQVA 3TJEL 1PBYA 3DXAA 1GXEA 4DW2L 3KMDA 1AKJD 5H35B 4TXVB 5DMKB 5KZCB 4HJ1A 2GSGA 3P4MB 4U6HA 4U4IA 5CN3A 1N10A 3MGOB 2X7LB 2BWQA 3BT2L 3HC4H 4QHKJ 2XN9D 2V0AA 2WQXA 4RGNB 2PLTA 5LWYL 2P7TB 1ORSB 2KZKA 5ECJE 3Q2NA 1DVQA 2MCMA 1AIFA 4N2CA 4P3DB 3C5ZC 5DQ9A 1WAAA 3VWKD 2OI9B 4FQ2H 4OLVL 3B56A 1BXAA 4DCQB 2JK5A 4KXDA 2E75C 3MGTB 1XB6A 2DI7A 4PI0A 1GYAA 5I5RA 2DQUL 3X11A 1LDPH 3MRBB 5JW4M 3QZLA 2AEOA 1QKZH 3QJHB 4NENA 4ZAKB 1LXMA 1OXYA 1KJ3H 2SEBA 2WXJA 4FI8A 3RTQC 3RWEA 4HXAL 1HDMA 4PJ5D 1T5WB 4ONGH 2A74A 2BS71 1QFUH 3EOBA 2XY2A 2CRYA 3O45B 4XN4A 4A2HA 1SM3H 4HH9A 3Q8EA 3D3VD 2F7QA 5MEOA 4WO4A 3HIZA 4GKZB 1MCSA 3BAJA 4XP4L 1I9IH 3RWCA 3K2MC 1AC6A 4Z5RA 4NZDA 3TBYB 3ZDXE 1GHFH 3WFHB 4C59B 4L3ED 4PJCA 1J9CT 3NFPB 3QPXL 4NKMA 3AG3B 2BNQB 1NCHA 1UXMA 1A02N 2MSPA 4TNFA 1DANU 4X0NA 1CE1L 3CMOL 3I6KB 3Q13A 3UMTA 4B9JA 3TPUA 4ZFFA 3R0NA 2DJ4A 2VJ0A 4M3JA 2XHNA 4UILH 1NCDL 2QFRA 1HC1A 2PYFB 4H0GA 4ABUA 4PUBL 4J5VA 1ED3A 1VIWA 4YDJB 1MW2A 1TVBA 2VRAA 3FNKA 1NBZB 4R84A 1JZ7A 2KHAA 1A6VH 3ARBA 3RDJA 4MJID 5IT2L 5IQ7H 3P0VH 3RWHB 1BZQK 3HN5A 1IFHH 2G0LA 2IGLA 4DKEH 2QQLH 2HH0H 5DZAA 3VFOA 2AJVL 5F7DA 5IMOA 1OD9A 1R17A 3LKPB 4HLJA 1T66C 1GIGL 1GOFA 2COQA 3S37H 1U8CA 3KCWA 5FHBL 4FQJH 5LNGA 4LSRH 3VXTB 3M88A 2EKJA 3VXUA 2ZZUT 1U8NA 2YRBA 1OGSA 2NYYD 1EAQA 4F57L 5DJZB 2GB2A 3FUNA 4HPYH 4AKOA 5CAYB 2WJ5A 1OF0A 1MFBH 2EDOA 3DV6A 1M7IB 4G5ZH 3KWXA 2PR9A 3HRPA 1J9SA 5GRUL 5E2TL 1BYNA 1X7QA 4FQLL 2ZJSH 4DKFL 3QIBB 1AI1H 4XMKL 1NPJA 2XG5B 4OJYA 1KYOJ 3P73A 1N3NB 2ZF8A 3T6VA 3LEYL 5IQNA 4YFLI 4LSVH 4XCNB 1FPTH 5CJOH 1KGXA 3BWUC 1TZGH 2DJSA 1HXMB 2QTEA 3MLWL 2J7LA 1CC3A 5T1DH 4E9YA 5CZXC 3VXRB 5IEHA 5KJ4A 2Y36L 3IJSB 2AI0L 2YD6A 1KLUB 1E7UA 3DVGB 3HZYA 3WLBB 4LT7A 4MS6A 4ZNCD 3T0EB 2OTWA 4KRPB 1BD2B 3VXMA 4AQ1C 4ZMWA 2UY7A 2H0PA 5KSAD 1VHPA 5I8EB 2NUTB 2AQNA 3VFPB 5GISL 4AT6B 3MLZL 5EFIB 2BJML 3Q8BA 4AYEC 4O2FA 4TUOA 4MX7B 1MCNA 1S7VB 25C8H 2H8PB 4YQXH 3HTLX 3B6SB 1WIPA 3ZDZB 1FIEA 2AK4B 1D5BB 4RWHA 2X2UA 2DLFH 2X70B 4PGEA 3K3QA 5DEZA 4Z1PA 5IR1B 4PP2B 1T20B 4BFIB 2UZXA 4NQCD 2PO6B 5D72H 4L05A 4OM1H 5D2LE 1R9FA 4NNXA 1RU9H 4JUTA 3EGXB 4OD3H 3KVPA 1RK0B 1JE6A 4OZFG 3ME0B 2DOCA 3DIDA 1U8PB 2BVQA 4OVUA 1HYSC 5E7FA 2ZXBA 2QV2A 4LLYA 1AGDB 4N8VG 1NCAL 2H3KA 3FYIB 2EIZA 3II3A 3MXWL 4HEMA 4HS3A 2A2QT 3O8XA 4YZFE 4EDWL 3TVMD 2VR5A 4X7EC 3NCBB 4PR5B 6PCYA 4GQ9H 4MKTA 1L0PA 8FABB 4N2GA 4ESKA 5E9DD 2NY3D 2V5MA 5IB4B 1SXCA 1CFQB 1ZWIB 3UABA 1L9OA 3AS0A 1UEYA 4F8LA 1IL1B 3B5HA 4QRBA 3BAIA 4N0YH 4FYTA 2XVBA 5E8OB 4DFIA 5BQ7A 4G83A 4PRPB 3FQRA 3Q6FA 2W9EH 1TEGA 1WCBA 3MV8E 1MG3C 4HYTB 4OGXH 5D7IE 1X9RA 3B8YA 3DPDA 2EDQA 1SNRA 1S7XA 3SKOB 5AAWA 4IU3B 1GYUA 3QG7H 4AMKH 1AKJB 3L54A 4LEBA 3OPUA 4GW1A 5AL0A 1TJGL 3BJ91 4CC1A 3MHZA 1SMAA 1EBPA 2RGSA 4NC1C 3LXUX 1DQML 4NKIL 4YSSA 3MA7A 1UM6H 3RGVD 4M8QA 5IJBC 2XN9B 4K5NA 5HHMD 4FYSA 4JFZH 4EUPA 2B0SL 3X1GA 1M42A 3CCHB 3KDPB 2FH8A 4WTZG 4WEMB 2OMTB 3BSHA 1ML0A 4LCVA 4GRWH 1AGBA 3VWKB 4BIKA 5HGBA 4JO3L 3NPSB 3LV3B 5D5MA 4JFOA 2YD7A 3SGJA 1I8MA 3F5WA 3JWDH 1FNFA 2YEZB 4JZJC 4QYOB 5I6NA 3QPQD 5TE4L 4Y5XA 2JJVA 3PFUA 4PJ8C 3T2QA 2KQNA 2APFA 4LL9A 2D03L 4PJ5B 5AKSA 1F6FB 1JXGA 5FGCB 2H32B 1OP9A 4QRRA 5K93A 1T2JA 3QWQB 4UAOB 2DQGH 3MNWB 1ZLUH 1QFOA 3D3VB 4GKOA 4NQUA 5D7HA 3ZKQD 2Z31A 4F7MA 3BWUF 1ET5A 3ULAB 3GSNH 1K8DA 4ATTA 5E23A 3HE7D 2Z8VC 3EO0B 1WT5A 4QCIA 5AEAA 4L3EB 1PZBA 5ICXB 2YBGA 4PV1C 4JKNA 3MNZA 5EC2B 2CLZA 3ZYJA 5HYJE 1Q8MA 1IGMH 3WNJA 3OJDA 3S36L 2XU9A 2X2JA 5F9AC 1PEZA 3JYCA 4F5CA 1U33A 1AAJA 4D9RE 4NCDA 2R2EA 3BZEB 4PIBA 1FP5A 5ITFA 4GKLA 5IUCA 1CN4A 3Q5OA 3SPCA 3SZKC 1QSEE 1KCUL 4YLQT 4MJIB 4BH7A 3IDGA 1X5XA 5SV4A 4JRXA 3HG1A 5I0ZA 1CFSA 4G6JH 3UX9B 1SEQH 2Q9OA 4ZUUA 1MJUH 2PPFA 2I9LA 3B9KC 4V1DE 5I76A 1MNUL 4DVBA 2ITFA 4E9RA 1W8NA 3MJ7B 3GSQB 4K5PA 3GSOA 3KLHD 5ERWB 3BPNC 2VXTL 2B16A 1U4EA 3D4GA 3F83A 1VLXA 4PWEA 2JELH 1A7QL 2GSMB 3PDOB 5G4NA 3TZVD 5FDWA 2DQDH 3QRFM 2HMIC 4N9GA 1DQDH 4DN4L 4GRWE 1FYTA 3MYJA 2H47C 1KXVA 4PIRF 5DHXB 2D0HA 2CR6A 2E27H 5ABAA 2FAUA 2H6UA 4QRTA 1A1MA 5GGRY 1MCPL 3PWLA 4F1ZA 3MUGB 1U3ZA 5KG9B 3Q3GA 3PU7A 3WHXA 1I3GL 2JXMB 1JJUA 1HEJC 1PX3A 4BH8A 4IU2A 1GTFA 4LAQH 2VXVH 2LU7A 3P11H 1F4HA 1JZ2A 3MAWA 4GKSA 4RWYH 5DJAB 1I7ZB 3RLSA 3PUCA 3L3KB 1UJ3B 3UAAA 5I0XA 5CGMA 4LBEA 5C3TA 1IGYA 3PHSA 3DGCR 1JCKA 3EYVA 1ZSDB 4N4YB 4XVOA 1IILE 1OAXL 4ICWA 3VFSB 1LMIA 1H6TA 2XN0A 1N5YL 3NA9H 1JBJA 3DJTA 3D2UA 4RH4A 5GPRA 2ZCLL 1ZK9A 4IGBA 3FUJA 1DBJL 2G4GA 3CMGA 4A55A 2BNUB 2V5TA 3B2XA 5KSAB 1G7IB 1M7DB 4FI6A 1Z3RA 2JKNA 1PLGH 2IH3B 3I3BA 3MJGX 3ZSSA 4K3JH 4WI8A 3ECWA 1IFGA 1QLEH 2JCWA 3WEXA 3FU6A 3WFDL 3LEVH 3X1EA 2MTAA 3C5ZD 2PKDA 4P23C 3O6FD 1RHFA 4ABVA 4NQCB 2ZXWB 3ARGA 3U7AA 1YLBB 3QR1A 3Q48A 5EH1A 3GC3A 1OAZL 1IQWH 4N68A 4PJAA 3THML 1KG0A 1HQRA 4PB9L 4JFQA 5C09A 3H0TA 2QZQA 3AITA 4J7RA 2ZCZA 5C9JA 4Q9CA 4WNQB 3BP7A 1U9KA 4PWKA 4LCWE 3IMSA 1FL6A 1OAQH 3FKUS 4Q6IB 5GIRB 4ELMB 3T1WA 4O2CA 3TVMB 3BRGC 3HPLB 4B27A 5ISZE 1YJDL 3B2PA 3T0DA 4LDCA 3DK2A 5GZND 3T8XB 1JRHI 5E9DB 2NY3B 2YN3A 5L8KB 4LO9A 3SO5A 2HJLB 1KEGL 4U6YA 1HS6A 5T33L 2R2CA 1NLDH 2B3IA 4J1UB 4L9LC 2KT6A 5K1VA 2B5IC 3NRPA 2AJZB 2WCPA 4MA1B 3FONA 3S48A 4XO9A 4OJAA 2UY6A 4XXDA 5HVHC 1NUNB 3U0TA 2VH5L 1MEXL 2BC4B 4QNPF 2YXFA 4MYPA 4YC2B 4FL4C 2VXQL 2X9YA 3ASNB 3A6BH 2EEAA 4EN3D 2OAAA 1MRDL 1FRGL 4BM7A 1T1XB 2MQCA 4ODSH 2DF3A 5BNXD 2FLMA 1BBJA 4PS4L 4WK4B 3KL3A 1T66D 3SJVA 1CD8A 5FGBC 2G75B 4X8GA 5AUMB 3RGVB 3QI9D 1TVDA 4YVUA 2BO0A 2D7OA 3PLYA 3UPAA 2OL3H 3BQUA 2G3MA 3CDZA 3CFNA 3U9UB 3ECQA 5TD4A 4B9CA 2ZX7A 3QDME 1HU8A 1QNZL 3VGHA 4DERA 5I8OL 2RFXB 2ICEA 4G70B 3KPOB 3NRQA 1T7WA 4OZGE 5EU6D 1R75A 1NDTA 3HLAA 4NZRL 3H2WA 2OMXB 4O02A 5BZDA 3R7RA 1NFDE 3LRLA 1HAWA 2V8LA 1RVFL 3CSBA 3N43B 2VM3A 3ILDA 1A7OH 4MA3A 1O6SB 1PSKL 3TPKA 2EQDA 3KBFA 4A7GA 3VFGL 4YHLL 4HCRA 2CKBH 1RV6X 5D55A 2Y7QA 3BVDB 3IGAB 3E3QE 4AUUA 2NCMA 3MRNB 1ZVNA 4BWTA 3QQ4A 2J56A 3SKUD 2EUZA 5HGHA 1WPCA 3HE7B 4PD4K 1I1FB 1TZIA 2FH6A 4F93B 2JJTA 3ZKXC 1UUSA 2VDOL 5DRXB 5FOBA 4CW1A 4A39A 4OGZA 4KKNA 4HX1B 5JUEL 2A6IA 2RHEA 1FVEB 2W0PA 4OI8A 3C5JB 3MFFB 3X1NA 3QZPA 1ZVYA 4WCYH 1JZGA 1G7MA 2VDLH 1LYQA 5SWSA 1RJYA 1A7PL 4N2EA 2Q8BL 4R4NC 1HYRC 1V8HA 3RI5F 3KGRA 2WVVB 2FX9H 1VACB 4NGHL 5DK2A 4GXUN 2ZG1A 2EH8H 3CHSA 1EZUA 1A1OB 4MA7H 3DVFA 4Q6YA 5FYLE 2VM9A 2O5XH 4KY1L 4PI2A 1GY1A 4R5TA 2JB6B 2FB4H 3QR0A 4F2EA 2AV1B 4PCYA 5F1KC 3SCMC 4N8VA 4ETYA 1HILB 1O7VA 3ARZA 3OKEA 5C6TL 2XBTA 2X2HA 4OCNC 3TCLB 1UB5B 3SZ6A 5DJXB 3TZVB 5MENE 4QXGH 4X6FB 3B83A 5DD3H 1YJDC 5FYKU 1URIA 4NUPA 5E6UB 5T1LD 2L7UA 4IK7A 3QJQB 3ZT6A 1SOXA 1I8KA 2CUAA 1WFJA 3JWOL 4XNXL 2FATH 5B1CA 4MD5A 2XQYK 2ITCB 5D7IB 1UYWL 2YD1A 3H7BB 3T3ME 4M3KB 3MNMA 2QSCH 2HJFA 2XY1A 3UTTD 3MVSA 1DUYB 1Q9OA 2EDRA 4PRBA 3V8OA 3VXPA 2BNRE 5J12C 3P77A 1SYVB 5E1GA 4RIRB 4Y9CA 2P42B 3IGKA 3HZVB 4MNGE 3UEZA 1SXZA 1AZNA 2W07B 5EV7A 1F6AB 4XPTL 1YNTA 4GIPD 3VI4F 4YGVB 4JZNA 1NIFA 5FM4A 5DJCA 5EMYA 2V9UA 1LEKB 2DMHA 3H2QA 3UCQA 3HC3L 3GBMH 1XSJA 5KTEL 2TRHA 3IT8D 2VIRB 4JG1H 2V2WA 1J11A 1HOCA 3C6LA 3H9YA 5AYQA 4N0UA 4MD0B 3VB9A 2JQMA 4J2XA 4R7LA 2X09A 2YUXA 3PQYD 3RL2B 4K71B 1K9TA 3DUSB 2VDQH 4KZ0A 4UDTB 3EYFB 5CZVH 3ILEA 1ZLVH 4C55A 2DTSA 2P80D 4ZPVA 3TF7C 1WFUA 1ODAA 2EE0A 4X83A 2Q2EB 1VFAB 3N2JA 1V05A 3OX8B 5EOCJ 3QCTH 4KVNL 2YEQA 2N4IA 3FN0H 5LVEA 4ZMZA 4YXKL 1HN1A 2HFGL 2R1XA 1OY3B 2DWDA 1U41A 4Z7UB 1JGIA 5SX4H 2XRAL 1J5OH 1NWOA 2Q86A 3DMMC 5GGRB 4U49A 3O6FB 1BJ8A 1OP3H 2EIEA 2VUYA 1QW8A 3AXLA 4X5XA 5FF6B 5D1XD 1MFEL 4OFYA 3FBQA 4XNUH 2IBGA 3GDBA 2UZYA 3BPLB 3PP4L 2CO1A 4I87A 4UINL 3GPSA 4CN6A 4E2OA 4PJ8D 1UWXK 3OLDA 3OV6A 5C92A 4GAYB 3BW9B 1JL8A 1GAFH 5GS0D 2ZPKH 4G8EB 4LDEB 5A1AA 4CSSA 4F7TB 4UMSA 1YYML 3ESOA 1LD9A 4ENED 2FYYB 2HAZA 3SHSA 5L88L 3N40F 2AV7B 2J6WA 5EBMA 2BSBA 2Q6WB 5DD0L 2FJHB 1GMIA 1C16B 4AQEA 3ULUD 4D0CB 5DHVH 4MNHA 2F5AH 5J56B 3HRZC 4ONHB 3AWEA 3DVNB 3FULA 3PNWB 3PREA 4JPQA 3MV9D 2AJUH 3DHPA 4H26B 3PAUA 4HWZB 1NPUA 4XP6L 3CWGA 4JZOA 1KDIA 4EN3B 2BSSB 5IKCA 4OD1L 4GRWB 3KJ6H 2OXGA 3MMEA 1IEAA 4XWOC 5KS9B 1JGEA 1HZLA 2XZCL 3BUIA 4KDVA 4OZIF 3MQIA 3I9AA 1LO5A 4JJ5A 2PPAA 1Q0YH 1ZANL 3JWOC 4IBZA 4WWKD 1L9RA 3QI9B 5F93C 1A4JA 5KVEL 1GGCH 3SY0A 1FN4B 5I6OA 4PG2C 1L7TH 1HKLH 3X13B 3LPFA 3N85L 4H5SB 3AQDA 4KTEL 3U6XA 2XLLA 3RX8A 5ELIA 3EG9A 3UAJA 1RP8A 3M46A 2HTKD 1CIDA 5EU6B 1FIGH 4XPAH 5C08A 3IRPX 4ONOA 5JHBA 1BVNP 2V2XA 4UM8A 2AJSH 2IXQA 2RD0A 3H4FA 1MHCB 2BP3A 2EDEA 4JKPH 5C0RL 2MKWA 2ZXQA 4M1DL 1IX2A 3FUEA 5DJ2B 4M4RB 1QTPA 1YYLL 2AKRB 1TLMA 1KFAH 5DC2A 1OT1A 5JA9A 2FQGA 4NZTH 3NCYS 1UTDA 4BDVB 4NO0D 1J1OH 3MX0A 5IB1B 2QEJA 2CXGA 4FTVA 4NKDA 4L4TE 5DZ9A 2EVGA 1MCLA 1RJLB 5A3IC 2VMEA 2Y7MA 1KPUB 3DHJA 3W56A 4D8PB 4K7PH 2EDYA 4NQEE 1P7BA 2MOGA 5L4JA 1F3JB 4AV0A 4HQQL 2J3SA 5JDSB 1RULH 3C8HA 4M62L 1CR9L 4BSWB 4CC0A 3FFOA 4PU2A 1NL0H 5SX5K 1T2QL 4U1KB 2Z91A 5D1ZD 4HJGA 4BUHA 2AQRA 1WHPA 4YBHA 3I50H 2OW6A 3PHOB 4CA4A 3KLAA 3D85D 3FU9A 3LDBB 1VADB 1CL7H 4JM2C 4OF8A 1AY1H 3D9AH 3NK3A 4XCEA 5J6GA 1NMAL 2ZWSA 3MRCB 1CCZA 1BG9A 4IRJB 4G1MB 2Z8SA 1FDLH 3BKYL 1T89C 2P8MA 4LQFH 4ZMNA 2PR4L 3QHFH 3WTTA 4MHHI 3LIZH 2HTLC 2O6FA 4Z7OF 2ZCKL 2F61A 5DUPH 3VUAA 5IG7A 5T1LB 2R7EA 3JTSA 4JVPA 1SOKA 3P2DA 3CAFA 1Y1DA 6CGTA 5F7FA 4DKTA 4MJ6B 4YJZL 3WTWA 2FLRT 4UQDA 5I17B 4RMRA 2J5LB 3WE6A 4LIQL 3NUKA 5FKAA 3RQ3A 1FCCA 2YK1H 3GJEA 4QRUA 3UTTB 1JIBA 1TJMA 2W0FA 4KQ4H 4ODTH 5BMFH 2JKLA 2IPKA 5KSBA 4XP5L 4JO1H 2XA8L 5H4ZA 3M6DA 5E2WH 2K8MA 3JVGC 3LCYA 4L8SA 4JL2A 4F1SA 3HR6A 4ZODA 2ZCHH 5H35A 5DMKA 1RZFH 2XQBH 2R23B 3P4MA 2ESVB 1ASOA 3MGOA 3OMIB 1F4WH 2X7LA 4YUEH 1GGBH 3K0YA 4ZQKB 3GD1C 5BW7C 3N9GL 3K6DA 1BAFL 4EKXA 2A9DA 4PCKA 4RNRB 1FSKC 4E41E 1AO7D 2P7TA 3C2AL 1ORSA 2IC2A 3KS0J 2QQNH 4LKXB 4OCMC 3PQYB 3SE3C 4DPBX 2VN5A 1NIBA 3T6QC 2BX5A 1G6RL 1XGZA 3NCCB 4DCQA 1MVFA 1G1YA 4IBTA 3MGTA 4P5TD 1QACA 2NT1A 3MRBA 1S7UB 1XIWB 2HP4A 3QJHA 4ZAKA 5E8EB 1C1EL 2I60L 4K2UH 3UJTH 2YARA 3RVTD 1EMTH 3QQDB 1T5WA 4X5LA 4ZUTB 5CD3B 4MAUH 5IW1B 3BIBX 1NANH 2D9CA 3IJ7A 3O45A 2JLPA 4TLKA 2Y5QA 4GKZA 1JFHA 3A3YB 2B1OA 3P69A 4WFFE 3WXWL 5D1XB 5JW3L 3TBYA 3VFWB 3WFHA 1BF5A 3H9SE 5D6DC 1K2DB 2XDHA 2VRQA 2K70A 3NFPA 1RUQH 3TJHC 5ACLA 2BNQA 3AT9A 2E86A 4TSCH 4PJ8B 5HBBA 1NA8A 3UC2A 4HA1A 1CU4H 3KL5A 4NHCH 3I6KA 4C4BA 5I23A 2UZPA 4GAJL 1QFHA 4N0FB 4CILA 2FSEB 2H41A 2YPVA 4P04A 2A77H 4UQIM 1G5GA 4R0LB 5GRZA 2XCMC 3BLPX 1IBYA 3RL1B 4KNQA 2PYFA 4HWEL 5AVVB 4YDJA 2N0KA 1NBZA 3S36X 3WY1A 1L6ZA 4OD2B 4HIXH 3HBGA 3RWHA 4PJBE 1I9EA 4KROC 1AS8A 3LKPA 4ZX5A 4EXKA 1UZGA 1FQ9C 4LCIH 2YAFA 3MV9B 4FFVC 2YUWA 2YC1B 4LGRB 2IQAB 3VXTA 5I2IB 1K5WA 4R4ND 1R5IB 2WXQA 2WCSA 1LTXA 1VJSA 4P8QA 5DJZA 4JM2F 2IAMD 2VC2H 1DVUA 4UYQA 1WFOA 4FG6C 2GJPA 4K23H 4Z3HA 1D6VL 4JCMA 1B2WL 4RLDA 3IGLA 1M7IA 5HDBF 1QI3A 2ZWZA 4UNTA 3HNSH 2WN3A 5JXEA 4PJ7B 4HOZA 4YSCA 4WWKB 3BAYA 1IAKB 3K71B 2GG1A 1I3VA 1EDQA 2H6OA 2PP8A 3QIBA 3ZDYF 3HUJE 1AZBA 3QFDB 2XG5A 1EJOH 3GLZA 3F84A 1N3NA 4G7VL 3UDWC 6FABL 1UATA 1A6ZB 4XCNA 5F21B 3SDYL 3QDGD 4NIKB 1BWWA 1QD0A 4B9FA 5KVFL 1HXMA 1JF6A 4ACTA 4AY0A 2XIBA 1N8OE 3QARA 3VXRA 4PWJA 2WO4A 4UT7H 4NN5C 1YNLH 3IJSA 4JR9L 1KLUA 2I26N 5GGSB 1GC1H 3DVGA 3MRIB 1V3MA 1T1YB 1KN2L 2YSTA 5SWZD 3FB7B 3UMNA 3WLBA 5C0BD 1RZKL 4NO0B 5ID1B 3T0EA 1TG8A 4NM4L 1BD2A 4GG6E 1JYXA 2K45A 5FYKH 2FQDA 4W9GC 5E0QA 2G2NA 4PM1A 2NUTA 2OK0H 3VFPA 4BCXA 2OCFD 4AT6A 3ZR6A 3B2MA 5EFIA 3ZZQA 2NT0A 3NACL 3LNDA 1K6QH 1TJHH 3QJXA 1S7VA 2D0FA 2H8PA 4IHOB 4MX7A 4YHOL 3B6SA 4R6UA 1F2QA 2AK4A 1D5BA 2PW1B 5D7SH 4XBEH 2X70A 2TSBA 5CJXC 1IKFL 3NBNA 5JPMC 1V7ML 2X4SB 4KK8C 2IALB 3BDBA 1JVOA 5D1ZB 1HHJB 4PP2A 3RY6C 1T20A 3S4SG 4BFIA 5B3NA 2PO6A 5HD8C 2DM4A 1LP9A 1LQSR 1CF8H 3EGXA 3DYOA 4KY2A 4XXCA 1RK0A 3ME0A 3OXRB 3NFNB 4F80A 2X1QA 2VDPL 5JHLL 1J1PH 1ZGLP 3NAAH 3MLYH 3MZTA 5KAQF 4FEIA 1AGDA 3F00A 4OUOA 4PBDA 3UG4A 5I1DB 5F0PB 4RQQB 4TUKH 1ZIBA 4PR5A 1TLKA 3IMWA 2CUMA 8FABA 4R5XA 1TTBA 4IBYA 5IY5B 5IB4A 3NSFA 1CFQA 1ZWIA 1LK2B 1WG3A 3Q01A 4JRYE 5EWIL 4ACPA 3ZKNC 1CG9B 1GY2A 1UWEL 4XVTH 1IL1A 1TU2B 3LXCA 4IIQB 3S8GB 1EJ6A 4Z7WE 4RMBA 5E8OA 4PRPA 4HHGA 4OIIH 2HG5B 3D09A 1X5KA 2OA9A 1GOHA 1DBBH 4NSKB 4ZW3A 3LZFL 5IW3A 3R18A 4BFBD 3RX9A 3ZUNC 3APFA 2XN1A 1JVKA 5KOVC 1H3PH 3IKKA 1UD8A 4HDIA 3SKOA 1HJCA 2CJSA 5F1SA 1IGTB 3BEVB 4IU3A 4H8WL 3QK0A 4GXVH 1AKJA 2RH0A 3BKMH 3FT2B 5GRWA 3F6IA 3N40P 5HHOD 3DJRA 5FYKE 4W9JC 2XN9A 3J27A 4U1HB 3UOAB 1TUPA 5AVWB 3WLWD 4Y19E 1AO7B 3CCHA 1FBIH 1JS4A 3RPIB 1CDHA 2OMTA 3A5VA 3T3PB 3GHBL 1XH3B 4MMZC 2VWEE 3VWKA 3LV3A 4EN2A 4XWOD 3Q05A 4N6RB 4EOWH 1OF2B 3D18A 4P5TB 1C7SA 1GRWA 1H6EA 2NXZB 1AG6A 2YEZA 4QYOA 2RQEA 2H3XC 1TO4A 2ZKYA 1P1ZB 1AMYA 1OGAB 4JKWA 2H32A 1BVLB 5MHSD 1GKOA 3MNWA 3D3VA 4GMSL 2WNGA 4J3TA 4BWUA 1RZKC 3AFLA 3EO0A 3KXFD 2YD9A 4KMTL 3HB3C 4L3EA 2VAAB 3DC0A 5ICXA 2AXWA 1HINH 2ZWKA 3TBTB 5EC2A 1BZEA 4FABL 1G5AA 4R4BB 1ZVSB 1UXWB 2B77A 1OLLA 4PVLA 3BZEA 1RY7B 4UOW0 4JANB 2IG2L 2Q3XA 4RDQF 1RUMH 3D6GA 3WDJA 5A3ID 4YPJA 5DJ6B 2PP9A 4MJIA 5J3HD 1Q72H 1AQKL 3HMXA 4BUGA 3LRHA 4NT6B 1KGCE 1W0WB 1QFWI 2NOYA 1YUKB 1NLBH 1H3WM 1WBYB 1OCRB 3TBSB 3NABL 1SJEB 1FFNB 3MJ7A 3GSQA 4S1QL 4DGIH 1IIIA 3E80A 4PPTA 5ERWA 4DVRH 1CLYH 1EO7A 4MNQE 4ZYKB 4OLUL 1LGVA 1DVFD 4FQIL 3PDOA 5IB5A 2JJSA 2IAMB 1LWJA 1Y7VA 3NTCL 3BGFC 4LSTH 1ZEAH 1XCQB 4Z7AA 5B38B 3UJIL 2R27A 4CU7A 3TP4A 3UBXB 3CH8A 3MUGA 4YR6B 4KRLB 5KG9A 4QRSB 1JGLL 2JXMA 1TSHA 1PMYA 2MMXA 3QDGB 1WFTA 2FBJL 4K8RL 4H8WC 2PPCA 1OAKL 1I7ZA 2XV6B 2D73A 3L1FA 3L3KA 1UJ3A 4GFTB 5GS1C 1QHQA 5KN5B 4OV5B 5C2BH 2H7WA 5D7KD 4TF4A 4C4UA 4OM0H 1ZSDA 3WNLA 5LLIC 5SWZB 3GIZL 3VFSA 1V3JA 5C0BB 3ULVL 1JK8B 3I85A 3LEXB 1PCXA 2X2YA 3O41B 2BNUA 4PJHE 3G6JB 5KSAA 1G7IA 1M7DA 1U6AH 1UEMA 4KAQH 4NJ9H 4Y9EA 3BE1L 4TTDC 2IH3A 1HSBB 2VN6A 4OQ1A 4ZDHB 4BE5A 3CX2A 4LSDA 1VCBC 3ILQD 3JUZA 1WWWX 1MLBB 4QMEA 1M05B 3STBA 4EEEA 5LXVA 3TEZA 1YPZB 4JDZB 4Z3GA 5DQDH 5C7XL 3MTXA 2WBXA 5ANMB 4NQCA 1C5BL 2LGNA 4ZOEA 4HJJH 5IVXE 2VQTA 1WIOA 3BWZA 3GIVB 4KXZI 4E42B 4Q4EA 2PXYD 5ITBH 4E0RB 4Q74A 3M8OL 4F92B 2DEYX 1QRND 2DYPD 1NSNH 3E8UH 3C09C 4WNQA 4HIHB 1KF9B 4JDVB 2WANA 4DOHE 4AIZB 3IGUA 4Q6IA 4JDEB 5DLMH 5GIRA 3TVMA 4ELMA 3QW9A 3HPLA 1ZLDA 2R8SL 3ML8A 3FK3A 4GKNB 2VJXA 4K9EL 2QGDA 3U9PL 3T8XA 1CICB 2BW4A 5E9DA 3S7GA 4DK3A 4AL8H 4Z7NB 4P2CG 4AQ8A 3FAXA 3TJHD 2E46A 1A4CA 2HJLA 5A6IA 5J57B 1KTBA 3H42H 4IOFC 4J1UA 4XCCH 2ATKA 3E9TA 3FB8B 2ZKMX 5CU9A 2AJZA 4OQTH 5TE6L 2VL4A 3TCTA 1CVRA 4HVBA 4CU8A 2ERJC 2XTJE 3VU2A 1MW0A 3FZUD 3BKCL 5IF0B 1IGFL 1XSKA 4TNVF 1MAMH 1MLCB 4FZ8H 3WI9A 4OLWH 1DFXA 2O6PA 3MJ9H 5J9PB 4KI5C 1GA2A 5HHOB 2YPLE 1O9VA 5IHLB 2G75A 5AUMA 3RGVA 4FFVD 5K9KB 1YDPB 2BRRL 3QUZC 2WVTA 3N44F 3U9UA 1QEXA 4ODHL 4PJIF 3C5SB 3TFKD 2K9FB 1AXTL 2ADYA 5ESAB 2RFXA 3KPOA 4FG6D 3PNRB 3O3DB 3B1UA 4Y9BA 2OMXA 1MIEH 1UADC 5CJ8A 5HDLA 1SMOA 4LASL 1RCYA 1IC7L 2JB5L 3GLEA 2YRLA 4ADJA 1RSYA 1TMQA 3BZDA 1O6SA 4K5MA 1OAYH 2VDML 3KPSE 1NOFA 4KK9D 1XB8A 4MXVE 1U93B 4WUUD 3IGAA 3MRNA 2XFGB 5F96H 1E2VA 2QPDB 4M93B 3NIFF 4JO8A 3KXFB 1I1FA 4NN7C 4NQDD 4U2ZA 4PBXA 5HGGS 1UZ6E 3K2IA 5DRXA 3S3JA 2CO6B 4PFEA 4CN1A 4HX1A 5LAPA 4Z3EA 1QBMH 4LLUB 1FVEA 3UEQA 2VLKB 5JZ7D 3C5JA 3QZOA 1C8QA 2FHCA 3HBPA 3MFFA 1S5IH 2EYSB 2WSPA 3VMPA 2WXPA 3WG7B 1ZGLM 3FSAA 2FVNA 4YFDB 4PW9A 3PJSB 2R29L 1C12B 3TV3H 2WVVA 4EBQL 1TNMA 2DYSB 1VACA 4X6DB 3WFCH 1WGVA 3CSGA 1A1OA 2JKSA 3NQIA 4ZOCA 3WE1A 3FFDB 3HNVL 2APBA 3D34A 1WAEA 4JFEE 3UTSD 2BK8A 4JQIL 1HWHB 2JB6A 2JSFA 4XMPH 2Z1KA 4HFUL 1L0YA 2AV1A 1ANUA 4LSUL 2ZX5A 1HILA 4MMXB 4TVPH 3IN0A 1J5IA 4F24A 4XTRC 1T21B 3TCLA 5L6YH 1DVFB 1UB5A 8PAZA 5DJXA 2F68X 2I24N 3TZVA 4A2DA 4X6FA 4M02A 4G7RB 4S1RL 3U0PB 4K9EC 1BIHA 1BBDH 1MRFH 5FX3A 1T5KA 3WFZA 4CMMB 3EKCA 1SQMA 3MV8A 5BRZD 3BIKB 3POCA 1LO0L 2ITCA 3LD8B 1QEWB 5D7IA 1RSFA 3FUFA 3H7BA 4XMXA 4FLSA 3EXJA 1DUYA 3CLEL 3KS0H 5I71B 4PN6A 2PCFB 3GMPB 4XT1C 3US9A 4FG0A 4HPOL 3TA3D 1SYVA 4RIRA 5HTSA 1XGQB 2XWRA 3HZVA 2X28A 3BKJH 1JGDB 2W07A 1F6AA 3O9WC 5FC9A 1F3DJ 4YGVA 5E8PB 2DWTA 3AU1B 2DMGA 4HAFA 4M6NL 1B4JH 4ZUSB 4HBCH 5FCUL 1DHKA 5D7LE 5JPNC 5FW7A 2CWRA 2VIRA 3ZL4L 2WP3O 3L45A 5HHME 1BMZA 4MD0A 5C0IB 1R33A 4S0HA 3MLRL 4DEPB 4UDTA 3DUSA 2ZUSA 3EYFA 4Q14A 5IWLA 2DIBA 2PCYA 4DIXA 4KI5F 3U30C 1SLUA 4FOMA 4IRZL 3SE9L 1PIFA 4YDMA 1W72L 3QUYC 1AHWA 4OLXL 1MCBA 1VFAA 1JZ8A 1IAOA 4HWBH 3OX8A 1CI5A 3ZU8A 2PTTB 3DETC 2K8QA 1KWGA 3B7UX 1FSKB 3MLSL 4RMVA 4Z7UA 3ES6B 3X3GH 1CT8B 4FADA 1GYVA 1DE4B 5GGRA 1IZKA 3O6FA 4L3AA 4M6OH 3HJEA 5C0DB 4LP8A 5A40E 4MJHA 2RTTA 4TVPE 5PAZA 5FF6A 1XBDA 1W2KT 3TTSA 3DOIA 4JHWH 1WIUA 2XJKA 5CU5A 3WJMB 2PXYB 4HIIB 4BQBA 1E9QB 2O72A 1QRNB 2DYPB 4C56B 5D2NE 5B39B 1HL4A 4GAYA 3RIAF 3BW9A 2QPSA 4P5KB 4G8EA 1VKXB 4FXLA 1ZLWH 4F7TA 2D0GA 2KI6A 2C9AA 1U8KB 3K4DA 4ETQB 2FYYA 5GZNA 1JN6B 2WYHA 2AV7A 2Q6WA 1WZKA 2DQFB 4K4KA 4K94L 3TWCL 4ADGA 2FJHA 1MKFA 1C16A 4FQCL 2XT1B 4F2FA 4ZD3H 2NY5L 1OKEA 3L1OL 3DIFB 5MP6L 1TENA 1NBQA 4ONHA 3QEQE 4R90H 4UZUA 2IQ9H 3DVNA 3I75B 3PNWA 1HCFX 3IDUA 2DDQL 2E4TA 2D7TL 3MOAH 3PWNB 4IJ3C 4H26A 1SUJA 4HWZA 5D70L 1E4KA 1V55B 3QP3A 4MRCA 4GSDL 4EN3A 4Q9BA 2BSSA 3BGMB 2VUOA 2ZUXA 3FU0A 4JX0A 4QWWD 1JZFA 1K4CB 4L4VD 3TO4C 3GI8H 5KS9A 5DSCB 5LBSA