3F7LA

X-ray crystal structure of alvinella pompejana cu,zn superoxide dismutase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
AIHAVCVLKGDSPVTGTIHLKEEGDMVTVTGEITGLTPGKHGFHVHEFGDNTNGCTSAGGHFNPHGKEHGAPEDENRHAGDLGNVVAGEDGKAVINMKDKLVKLTGPDSVIGRTLVVHVDEDDLGRGGHEQSKITGNAGGRLACGVIGITK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper,Zinc Superoxide Dismutase
publication title Superoxide Dismutase from the Eukaryotic Thermophile Alvinella pompejana: Structures, Stability, Mechanism, and Insights into Amyotrophic Lateral Sclerosis.
pubmed doi rcsb
source organism Alvinella pompejana
total genus 44
structure length 151
sequence length 151
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 3f7lA00
3SODB 2AF2A 1U3NA 2NNXA 2K4WA 2APSA 4OJAA 4MCNA 2AQRA 2E46A 3CQQA 2C9SA 3F7LA 2Z7WA 1SXSA 4A7GA 4BCZA 1YSOA 1E9PB 1PU0A 2GBUA 1TO4A 3L9YA 1JCVA 2VR7A 1OALA 4B3EA 1HL5A 3GZOA 1F18A 2LU5A 1UXLA 1DO5A 1IBHA 1BZOA 2C9UA 1OZUA 2ZKXA 3KBFA 2Q2LA 2Z7ZA 3MKGA 2C9VA 1SPDA 2E47A 4OH2A 2XJKA 3GTVA 1XSOA 3RE0A 1AZVA 3KBEA 1SRDA 4MCMA 1FUNA 2R27A 2WKOF 1E9OB 1JK9A 4N3TA 3GQFA 2ZKYA 1L3NA 3HOGA 2AEOA 3KH3A 1Z9PA 4BCYA 2GBVA 1TO5A 3K91A 5KBMA 4A7TA 5KBLA 1E9QB 3GTTA 3H2PA 1IBDA 2JLPA 2ZOWA 3ECVA 1P1VA 1SDAB 1SXZA 1IBFA 1XTMA 2VR6A 1MFMA 4A7QA 2WWOA 1B4TA 3HFFA 1ESOA 1SOSA 1Q0EA 4L05A 2WZ6A 4A7GF 1EQWA 4U4IA 1CB4A 1SDYA 2WYZA 3HW7A 1PTZA 1BA9A 1F1DA 2V0AA 2WWNA 1UXMA 4A7UA 1SXBA 1E9PA 3S0PA 1S4IA 2XJLA 1F1GA 1QUPA 5KBKA 1CBJA 2Z7YA 1N18A 1Z9NA 4A7SA 2WZ0A 1OEZW 3H2QA 2ZKWA 1HL4A 3LTVA 2GBTA 1F1AA 1SXNA 3ECWA 2JCWA 1YAIA 1COBA 2AQQA 2Z7UA 1SXCA 1DSWA 3L9EA 2WZ5A 3CE1A 3QQDB 3CQPA 2VR8A 1EJ8A 3F7KA 1OAJA 2AQPA 3MNDA 1E9OA 2WYTA 1IBBA 1SXAA 1JK9B 3KH4A 4BD4A 1XTLA 2AQNA 3KM1A 3GZQA 2AQTA 1E9QA 2WKOA 1OZTG 4FF9A 1PZSA 3KM2A 5CU9A 1KMGA 4A7VA 3ECUA 3T5WA 1B4LA 1IB5A 2AQSA 2SODB 3QQDA 1N19A 1RK7A 3GZPA 3PU7A 4N3UA 1YAZA
chains in the Genus database with same CATH superfamily
3TBSA 1N12A 2AF2A 4Z0BH 3GT6A 2BHUA 4M7ZB 3RVTC 3UG5A 1R19A 4GXFA 4E9XA 1LVEA 1XF1A 4WKZB 2E8YA 2R4SH 3W57A 1HOEA 3P11H 5JW3L 3ZL1A 2ZAIA 4OCWL 4KK8D 2VO8A 1WC7A 3N41F 3VFVB 3PGDA 5E4OA 3GUTA 4RNRB 4C56E 4F27A 4GBXA 4NN6C 3MXWH 3MRNB 5EN3A 1NUNB 1IBGH 4K5NA 3QRGL 4LHUD 2XFXA 4YH6A 2E27L 3SGEI 3SKOB 3KWXA 4WU7A 3ZXAC 4E42B 4AQOA 4IRSB 2PWGA 4PRPE 4EQ2A 2Y1ZA 4YWGL 4GRWE 2EACA 2K70A 3EYSL 4LKXA 3M6DA 2R4RH 3CCHB 4BCYA 1MCIA 2B16A 4JQXC 4KTDL 3QUXA 1AGCB 4YHKL 1LD9B 3T8XA 5MP6L 4W9HC 2HA1A 2LR4A 3QXTA 4PBWD 1P69B 1ONQB 1QKZL 1TVDA 3ECVA 4MAYB 5F9WC 2H6UA 1WICA 3BQUB 1CGSL 4G8IA 4HUUB 4NZTH 5D1XA 5TFSH 3U4EA 3T2QA 4U31A 4AIZB 4LU5L 5GS2H 4LVOC 1WV7T 4HLEA 3LHPH 3DRTB 3CFEA 1CICA 3WOVA 8CGTA 1W8OA 1DANT 3K1DA 5EORL 3FQWB 4W4OC 1I75A 1IQWL 1KBGH 5ICZB 4OFPA 3L5XL 3STBA 3EJSA 2ERJB 1ET5A 3BT0A 4GINA 5IHZA 4OF5A 1W9XA 2VXTL 5CGTA 3FN0H 1JGEB 2AANA 5JMOC 1AIFB 1OT4A 3CNKA 1B0GB 1A1NB 1FZJA 3L8QA 4P2AA 4Y9BA 4JFHE 1K4CB 3LQMA 3MRQB 2OMZB 4XCFL 3V5KB 1FO0L 1RD6A 3LEVH 4PWGA 2NY2B 1EZVX 4A2LA 2NY6C 5T5NG 2E7BA 5HY9A 4PHZA 2C1OA 2K45A 2LU3A 5CCGE 1SOKA 4LHUG 1EK3A 2AITA 2ICEA 4J3OH 5FEBA 5KSUA 3PWJA 1BVKB 3W2DL 2BWIA 3L3DB 3NGBC 3QIBC 2AZUA 1UM6L 4F8TA 4HW6A 4PRIE 3TFKC 2GT9B 4JPSA 3ZJAA 3U7YH 5JLZA 5IVXB 4WI0A 4FC3E 4PBXA 2HH0H 4L0PB 2DIBA 1QYGL 1KGCE 5D4QA 1UQSA 2R69L 2NDFA 2VKXA 3IJ9A 5DF0A 1KTBA 3OAZK 1JGUH 4RBPH 5FKPA 3K4DA 5DQDH 1ACZA 3QT2A 2RFXB 3GMOB 4NQUA 4CMHC 4U6YB 4HJJL 4D0CB 1PZBA 5C0AB 5J11C 1HU8A 4HS3B 3SGEH 2CRYA 2DYRB 1YRKA 2CO7B 2G60H 3EH1A 2GQHA 4PRHA 3T4YB 5LGJB 3WENA 1MNNA 4P59H 3G6JB 1O7SA 1JWMA 1CDGA 5DJ8A 2XWZA 5ANMA 5J1TC 3HMXH 5JIDA 1J5HA 4JQVC 4OLVH 1RU9H 1QLEL 3BKCL 4JB9L 3IDNB 4KUCF 3GS7A 4KH9A 1IZJA 4OD2A 4OF0A 3QEQB 3TM6A 1NGQL 4R7NA 4Q2ZA 5I71B 1CFBA 5JXAH 2FR4A 1EZUA 4PRNB 3VXUB 4MQXD 2K3HA 4KJWC 1MJJA 3UP6A 4AUYA 2WMPB 3SQBB 1BGXH 3GM8A 1SM3L 1J1XL 5LAPA 3ZE0B 2ZP9A 1U3HD 4KPHH 4XWOD 1J5OH 1ZA3B 2WAHA 2RBLA 1A14H 3G9VA 2VABA 4QTFA 5E0QA 3QUKB 5HJ3A 1TLKA 4YHIB 3TCLB 4FFYA 1A0QL 1ORQA 2UZIH 1EPFA 1S5HA 3KPMA 4PMFA 2Q3XA 4LLQB 1BQSA 3DX3A 4LASL 4PB0L 5SWZE 3ZKND 2MPVA 1AXIB 1PEZA 3CGTA 2DTMH 3QA3A 5D6DA 1G9ML 3X3GH 1FFNB 2GEEA 5BZWB 1BQLL 2C3GA 2BY2A 1T5KA 3P9MB 3DNKA 2ISDA 2CGZA 1BBDH 1T0OA 1KB3A 2XOTA 3BUYA 2YPKA 4NO0A 35C8H 4A2FA 5KANG 3MROB 2UWEF 3O0RL 1SEBB 1AC0A 4JQIH 2BVTA 2ZYHA 1N8ZB 2AJ3B 1NKGA 1XXDC 4PMEA 2ZX5A 3Q6GL 1I3GL 4AX3A 1WTLA 4LCWA 2BWDA 1JPGA 1JGDA 1BEXA 2AJZA 1U6AH 1ITCA 2YK1L 4WCYL 1NCWL 4K71B 3VFGH 1HS6A 1ROWA 4MJ6B 4O5LH 3V4UL 3K72B 5BS0A 1IEBB 2DICA 2WLJA 5IQNA 2JVUA 5LB1A 5DSCB 3QUYC 5KANI 2D8KA 4PJ9D 1MLBA 4K8RD 3CAFA 4LVEA 5CLYA 3D1MC 4GRMB 5I8KL 5D2LB 3VQ2C 1SLXA 2WQRA 4BUGA 1T22A 2QFRA 2DN7A 5H35B 3LPOA 1HESA 1MDTA 4ODWB 1BAWA 5IHLB 1FPTL 1A4AA 1BW8A 1MG3C 1W72A 2IV9A 5FYKE 1RZJL 1WHPA 5IWLC 3HCVA 1CFSA 1IGTA 5EOTB 1WK0A 1JPSL 3NZHH 3BKYH 5DI8B 5IROA 1WAEA 5INDB 2QLYA 3C5SA 2ENQA 3VXSE 3QCUL 5GRWA 2AJXH 5I6LA 4Y4KA 1A6UL 4Y5YB 1DVFB 2CA4A 1WBZB 5DD6B 3SE4A 4WWID 4JY4B 1VGKA 3CXFA 4W9GC 3X13A 5IFJA 5HPMB 4IEFA 5D7JC 5JO5B 3RDTA 3US9A 3UJJH 4JRYA 1I1CA 2P5WD 3GF8A 3QDMA 3IPBA 3GSUB 5KS9B 1BBJB 1H3UA 1HHKB 3D5OF 1EGJL 3N40F 4HG4K 2ED7A 2DQFB 5LXVA 4OJEH 1U8NA 1GZHC 3QFDB 1P5UA 1ETZA 5BPPA 4TVPD 3COOA 2CR0A 2YA2A 3CSBA 1QWHA 5EO9B 4CL7A 2D3NA 3L1EA 5AYUH 3T6VA 3OXSB 5JW5A 5L8LB 3T2LA 2B8OT 4HJ0C 4HUNB 1HZKA 1YJDL 2EZ0D 1MWAB 1L4IA 4RDBA 3SPHA 2VH5H 4JFEB 5H37A 4JKWA 5BV7H 1SXNA 3SYAA 2HRLA 1LQSR 2R1XB 3PAVA 1YEHH 4AV0A 4RAVA 4H0GA 3VXPA 1DVSA 2WO2B 2DQMA 4O9HH 4F91B 3V8OA 2YWZA 3VD7A 2VW4A 3E3QC 3NRQA 1D7BA 1FGNL 2P8LB 4GRLC 1B6DA 1XF2B 5L9DL 1CDYA 1ET8A 4Y19E 5CINH 1FHNA 3ZTCC 4MA7L 1C12B 3BCFA 5D7LD 2WY3B 4LARL 3UTSB 4JHWH 4DEPB 2QADD 3UH8A 3A6CH 1OKEA 3HAEG 3FFDB 4YNYB 2QQKL 1DLHA 3VFUB 2J8HA 2VJXA 2CH8A 1MCLA 1GKOA 3IDIB 4ABVA 4HQQL 3O8XB 4URKA 5TE7L 2OZ4L 3O3EA 1ZA6A 1GOFA 4FFZL 1IC7L 4TUJA 4JO8A 4ONGH 5FPIA 2GY7B 1U8JA 3DV4A 3MLYL 4P8QA 2J71A 4UQAA 4I2XA 3T0AA 2W60A 3E7JA 3CQQA 4FEIA 1P0SE 4TSBH 5C7XL 4TL5A 1TPXB 4PAZA 4ACTA 1E9PB 3L9YA 4XVSH 2ZXGA 2QDVA 3CFCL 4R4FH 4XN7A 2VDPH 2B4CL 1KENH 4GAFB 3VSTA 4OCXL 2H9GB 3LS5H 4PJGF 1LO3L 1PSKL 1HEZA 4NNXB 1K3IA 4OCRL 4JQXA 3BPLC 5IBUB 5IIEB 4L9DA 3VW3L 1OK0A 4HK0A 1ED3A 4H0HB 3LH8A 5E2JA 4L1LA 3AT0A 4WEBL 1F5WA 1BVLB 1U8CA 3GSQA 4GI6A 1T6BX 4OLZL 4XP1H 3T0EC 4XNMB 5I74B 4NKDA 1IC0A 2BJMH 1AJ7H 2BY0A 4I5BA 2E6PA 5GRUH 3UDWC 4GIAA 1BREA 1KV3A 2BNQB 1NUGA 1S7RB 2BERA 1A9EB 2D31B 3SDXF 3HZMB 1PKQE 2VQ1B 2HX9A 5I1IL 4V2CB 2BFVL 4PY8J 2BMKA 1CE6B 4XPBL 1OANA 3LN9A 1V3KA 3D4ZA 1I1FB 5DUPL 3IJHA 4W4OA 4HAGA 4N0RA 3HKFA 4AM0Q 1KB5L 4GW5B 2WQUA 1J9QA 5HDQL 2EINB 1XEUA 2OQJB 4LGPB 3BEVA 3CUPA 5DLLA 4ZZKA 2D2OA 4MZ3A 5E5UB 1EQWA 4FI6A 4C56B 1U8PB 4PS7A 2LVCA 4KKCD 1MCBA 5IW1A 1MFBL 3CIAA 3SCMB 3E1ZA 2I85A 3CFIC 3GMPA 4JFUA 1XH0A 2FX8H 4ZRGA 4S1QH 4YUEL 3ETBJ 3PY9A 4PRPB 3RJOA 4NM8L 1F1GA 4NYLB 5B7EA 1CLYH 4GRWB 2R2BA 1FAIH 3HB3D 3S35H 5BOZG 5GRYA 5I1DA 3GI9H 3RFZC 2DI9A 1G5GA 1UYWH 2AFNA 2VXVH 3NJXA 4LDLB 1HFUA 4MNGE 3RB7A 5GJTL 1ASPA 1Z0MA 1A65A 2W81C 5I75B 2X12A 3UIZA 2ZCLH 3LKSA 4MVBC 1MCSA 3BFWA 1UJTA 1ETA1 4JG1H 5GZNC 1TUPA 1OHZA 3QIBA 2XWEA 3UG4A 3MLSH 1MNUL 1UGNA 1I1AC 4K3DH 5LGHH 43CAB 4IK7A 4JDZA 4K8RH 1E27A 1UATA 2X1QA 4GSDL 5IVZA 2O93L 3SJVD 3AG3B 3AUVA 4XCCL 2N7SA 1GY1A 5I5IA 1IEAA 2G4GA 4V2BA 1Z9MA 3KNBB 4I7ZC 4OJCA 4MXVE 3B2VH 4U3HA 2AQSA 4JFSA 1NFDF 4X6CA 4O2CA 5F44A 2J5WA 3CFUA 1VFBA 3BAYA 4PRHD 1MEXH 2AK1L 5E7BA 3RGBA 4XXCC 3SQRA 5D72H 1JZGA 3L7EB 3V4PB 4BK8A 3EYOB 2VDML 2Q20A 4OU3A 2BIPA 5DS8B 2BH0A 5ERWB 5B7MA 4CC4C 4XZ4A 2WSDA 1B0RB 3HS0B 1N6QH 3CH1B 5E8EB 2IXQA 4YC2C 4AVHA 3Q1SH 1UZGA 1KC5L 1ES0B 5IB4B 2H0EA 2OXGA 4LRIA 5CU5A 3MYZA 3RWIB 6TAAA 1EO7A 2X4UA 2VLJD 4JKKA 1L6PA 4U1LB 1T6VN 3QXVA 4H88L 5EIIA 4BFOA 2VDQH 4WUUD 1E4WH 2ZOLB 2CHNA 3JTSA 2QBWA 1WFIA 4PRIB 3APMA 2JB5L 4TVPH 3Q5TA 4G72B 3DUSB 5CZKA 3QVAA 3TNMA 2WXKA 3HBGA 3W81A 3NQIA 1ZMYA 2XV0A 5DEFA 1YNTB 2A9AA 1P4UA 2PYFB 4B9FA 4OZGF 4ZUWA 4K9EC 3PABB 2ITCB 3F65A 3TBTB 1AOZA 3GMMB 5E6IB 5KYWA 1XR9A 3T2NH 3IFLL 2EDNA 3ULSB 3DO3A 4PBDA 2HT2C 4FQIL 5HYQA 3OKOB 4ZYKA 3S3BB 1TETH 2M8XA 1I4FA 1C5DA 1WZ1H 3AVEA 4PYGA 5CJQL 3VG9B 2XIDA 4UT6H 2H0JA 3WD5H 1J05B 2KPWA 1R5IB 5FFOA 4DPCX 3P77B 2G0LA 4HOWA 1PLGH 15C8H 3ARDB 1ASOA 2WUBH 2X0WA 5F9DC 2F5BL 1ZHLA 4DK5A 5T3ZD 3VU1A 3V0JA 2VZ3A 3U1QA 3CHRA 1IIIA 3J7HA 1ADQL 5DK0B 1U8LA 1WWWX 1UB6A 4R0LA 1GR7A 1TJIH 1HHJA 2X2YA 3NA9L 4L3EA 1EJOH 4UMGA 1TZHB 1S7TB 5TDNA 4MNHB 1PG7L 2XRAL 5KYYA 5C0ND 1TYRA 4RX4A 1XF3A 4M5SA 4IDJH 3SKNA 3RY6C 3IMRA 3FT2B 4J6IA 5I73B 3F58L 4DQOH 4XMKL 4ZUVA 5FUZH 3FB7A 3B8SA 4YLCA 3OJ2C 1VEMA 2YPLD 3P3UA 1XH2A 3CWGA 4NO5A 1URZA 4HPYL 1EEYB 1QLRA 1I9JH 2X53A 3QK0A 1Z2KA 4A39A 4JDVA 3CFDB 1KCUL 1GS6X 3BT2H 4KKLC 1LGVA 4U1HB 1Q72H 1W16A 4NQEB 5BRZA 1S3KL 1FG2A 3GJEA 3DJSA 3ULUD 1KLFB 3BAWA 4UANA 5SWZB 2OSLB 1Q4NX 4Z7NF 1JNLH 4Y4KD 1K8DB 1G7PA 4NKOB 5IWLA 2OMXA 2CO4A 3RAJH 1H9VA 3SDCB 1TLMA 3WIHA 3JSSA 3BO8B 4X6EB 7FABH 3U4BL 4PP1C 5L2JA 4G43A 4X80L 4MKMA 5K9JL 1CR9L 3QPQC 4XNYL 3N5AA 3QDMD 2CM6A 2OK0L 4DUXA 4G11A 4IIQB 2N1TE 4TVUA 2YD0A 5FUOL 3ET9F 4N0UE 3EDEA 1HSBB 4UDUB 1S9WA 3TYFB 3MRIA 4OH2A 4CKVX 4XCNA 3BEWB 3HNVL 5JZ7C 5AVSB 4XMTA 4M4RA 3DHPA 3TEZA 1RQ5A 1NPNA 1GZHA 1TVBB 1T4KB 1JIBA 2I32A 3KH3A 1OD9A 4XP9H 5AW2B 1ACYH 2GJZA 2GK2A 3I75A 1I9EA 4HHAA 1RZIB 5HVHC 2LABA 3DXAA 3RWHA 1NCBL 1TMCB 1LHZA 2ZP8A 4PJFE 4OZFH 4WSGA 1QPPA 1FVDB 2WLIB 2GIXA 4N6RA 4CKQA 1RZ7H 1YNKH 3DX6B 4KK9C 1OLLA 2WCPA 4K7PX 4NUJB 2Y1AA 4XC1L 1RZ8A 2GCYA 4LB8A 4LSTH 4DW2H 3OMIB 2HFFB 3LAFA 4AL8L 1VZGA 1MJ7L 5E5MB 1BA9A 1UA7A 3BWUF 3IWVA 1JF1A 4U1MB 1RJYA 2GUOA 3HHSB 1YEFL 5JIKA 3RUGE 3VXSB 4YDKL 4DK3A 4FADA 3BWAA 3RVTD 4R7DA 4GRLA 1FSKB 2HJKA 5DMJB 3UYPB 2C3HA 3O9WD 4KTGA 3P3TA 5I76A 3GO1H 2ZWNA 3MNWB 5DYOB 5I17A 5K59E 1SJEA 3LPFA 4FFWC 1P2CB 3EO1B 3SIKA 2Z0BA 3MRCB 1A6ZB 5GPRA 3HE7D 4YXKH 3MR9A 3EOYG 2D7MA 1YEWA 3VFNA 1L0XA 3QJZA 4PW3A 3LRHA 4JG5A 4A2DA 5C09D 4NNPL 3FB6A 4GIPD 2PXYB 5E8PA 4CU8A 3ZIYA 4F9PC 4UWQB 3ZYOA 3CK0L 3CVHL 1XF4A 2NUPB 1CLOL 4H5SB 3QHTC 4JE4B 3DV6A 3QQ4B 2VMJA 3C2AH 4GSXA 5SX4I 1ZGLA 2I24N 3O2VH 3VSUA 5H37G 4KQ3H 3DK0A 4XPAH 2GEQA 3M1BB 1CK0H 1KYOJ 1QO3B 2Z7WA 1QR1B 4KKNA 1WJ3A 2WTOA 3SGJC 4GI8A 3BP7A 5IMOB 3T0EA 1XQ4A 1OQXA 4FFYH 3N42B 4J3WA 4PREB 2DWEA 3GMLB 4Q97A 2WVUA 3IMBA 5HGDB 1AXTL 4HJTA 1F18A 1DR9A 2NY4D 2VDNL 1I8IB 1MQ8A 1SF3A 3EDKA 3VG0H 1DLFH 1MOEA 1BCIA 1GIGL 3LDBB 4J6RL 1P1ZA 4UQDA 3BN3B 2ZX7A 4GAJH 1EJ6A 5E8NA 3TURA 4UQ2A 3RWDB 4L4TE 1RV6X 3TC9A 3CPLB 4DZBB 5IW6A 4WFFE 2NYYC 5D8JL 1II4E 2CLZA 5TE4L 4UTBA 5T3ZH 2WZPA 2CLVA 1RURH 2B9AA 1J8HA 2Z92B 4UNUA 2GAZA 3U36B 1Z3GH 2C4FU 2WXNA 3INUL 1QSEA 1MFEH 3S36H 2P7TB 1IV8A 4HXBH 1IM9A 2GHZA 2Q5BA 3R19A 2IAMD 2EE0A 4UF7C 2HFEB 1WPCA 1XHHA 2FCBA 3HPLA 3NPZB 5ICYB 4MX7B 1U92B 2CBMA 1FP5A 4KVNH 2N3JA 5HXMA 1GYUA 1WAAE 4A04A 3QAZB 2J44A 2CM5A 1N59B 5E2WL 1U2HA 2ESVA 4R84A 4AQEB 1PLBA 3C2SA 4Y2NA 1E7UA 2V0AA 3K2MC 2VT0A 5EDXA 5GZNA 4DUWA 1X7SA 4OVVA 3PXHA 4A6YL 3ALWA 1QAWA 5PCYA 1WSST 5C6PB 2H45A 2VLLB 1C5CH 3CLFL 3PWPA 4JG9A 2VM9A 1I1AA 4X6FA 1ZGLP 1ZANL 3EFDL 4WU5A 3NRPA 3OR7A 4N2DA 4MQ7A 2NNAB 3BGMB 3J8F7 3D25B 2ADGA 4AYGA 2WQSA 3DROA 3UGXA 1HQRA 5AW3B 4DQAA 1DJGA 3ULUH 2BOCA 2OMUB 1E4KC 1MREL 1IGML 2JKRM 4MXWH 4BA8A 3QJSB 5B3JF 1AQKL 3QWQB 1LL1A 4CC0A 3FUJA 8PAZA 3ARGA 1FNAA 3UAEA 1BPLB 2EIZA 1BQUA 3VNZA 2F58L 4OQTL 3EO0B 4XXCA 1SN5A 3PHOB 3QFJE 4AUJA 5D1QC 3U4KA 4PTTB 2YAFA 3M46A 2IBZY 3ABLB 3NACL 3PV6A 4CC4A 3MBEC 5SX4H 3WTUA 1NCTA 1GGBH 3QQNA 1UWEL 1S8DA 5DFVD 4MNGB 4BFJA 1QNZH 1G84A 1ND0A 5E2VL 3FTYA 3ME0A 3BN9C 4I1RA 4FYTA 4GAYB 5T3XL 4FNLH 3PYCA 1JZEA 1OGTB 3VD1A 3T6QC 1M7DA 1HQ4B 3JTTB 3PJSA 3BZDA 5CMAB 1SYSB 4QTHB 3O2WL 4FHKA 3F05A 1MIML 4Y2DB 4QPEA 4I9XA 3ZIMA 3FO1B 3V0WH 3S3PA 5A3ID 3FF7A 2O5XL 2MSPA 3KLLA 4HC1H 2WYIA 4U05A 3KLHD 4D3CH 4U3SA 1DTUA 3B37A 1S7VB 5DFAA 3O6FC 1OTUD 1AY1L 2UWEA 3NSJA 3MX0A 4BSWA 1G6VK 3QUMB 1NAMB 4WO4A 4XAWL 1DO6A 2VM4A 1OPOA 3FDWA 1C1EH 1EO5A 1WIOA 2WKGA 5DEZA 3TO4C 2YOAA 3E9UA 1X5ZA 1K2DB 2DQEL 1JPTL 1RPQA 5DWPA 1ZE3C 1ET7A 3BH9B 3MGTB 3MV9A 1KTCA 3O0LA 4L3ED 1CTNA 4FRWA 1BLNA 4Z5RB 4LQFL 2YEVB 1J5DA 2DQCH 3RX5A 1A6WL 3WS3A 4OGZA 2X6BA 4RX4D 2PP9A 1KXTB 3NTCH 4JREC 4L1HA 1E5YA 4NN7B 1MVUA 3T77A 1RUPH 5E0FA 1EERB 4AQ1B 3JV4A 5EIIG 4MNQE 2BW5A 4AMKH 3QNZA 4D9LL 3SDDC 4NXSA 3RY6A 2Z7YA 4JFFE 1PIGA 2PO6C 4BA0A 4M5ZH 4QOKD 3WY3A 5IHHA 1DQVA 5EEYA 4P3WA 3BLBA 2Q9OA 3QRBA 5LNGA 2DW5A 1YAIA 1X9LA 2CWRA 2DQUL 1XCQB 1Q94B 4OZHB 4U6XB 2IDSA 1E5UI 5BRZD 5KG9A 4PP2A 5IZ7A 3QUGA 4APXA 3VMOA 5DVLA 1TYEB 4WFED 3QEHA 3QJVB 4R4NC 3TVMC 1I8KB 5K39A 1ZVSA 3GGWB 5BUAA 4KNUA 5E9DA 4FKHA 4IK6A 1I9IH 1G1KA 3LZRA 4XH2B 1UXSB 5EN2A 4ZFOL 1ETB1 4YHNB 2C3XA 5GS0L 2HKFL 1N0XH 3OR6A 4D7BA 3V9EA 1SLWA 5IVXF 1P7KA 3KYKH 4TUOA 4WW1B 1S7XA 4ODVH 3H8NA 3BUDA 5FKAA 3UYRL 4IRJC 4V1DB 5JIHA 3BRDA 4GKSA 5EUOB 4KROB 1R3KA 3VDBA 2B3IA 1AIZA 3MRFB 3BWUC 4X4MA 4G70B 2K4AA 2IMMA 3POHA 3FQUB 1C5BH 4ELME 4KTDH 1AR1D 3IU4H 2ZKMX 3I6KB 3QJOA 5IKCB 3F6LA 1PZAA 1RXLA 2UXFA 3I02A 4NZUL 1JAEA 3DOSA 4ZMZA 1CGSH 3WFDH 3G6JF 2F54D 3AMLA 2DJUA 4MCYA 3OKMA 1FFOB 2A6DA 3HVNA 5EBWB 5GRJL 2XWBA 2X44D 5GSVB 4A2GA 3GNML 3V5HB 2I9TB 1T7YA 1ZXQA 5I1LB 1CXKA 4U1KB 3FU5A 3LZPA 4O02L 1GZQB 2WVVA 4Y0GA 3U46A 3W9EB 3V0VA 1YMMD 1Y07A 3OKKB 4RIRB 5DD5H 4RRPA 3F01A 1Q9WA 3AG2B 5E94B 3T0DA 2R9HC 4N0CC 2CZNA 4UAOB 4A7QA 5C08D 3KD4A 4LLUB 3QQ3B 5AZ2H 1TQSA 1HXMA 3GXTA 4CADB 1WIPA 4PJGA 4JO1L 2QMJA 3HR5B 3QZBA 4FG2A 4Q0XL 4UZSA 5GGVL 5I6NA 2ODHA 2VR9A 4N0UB 4MJ5A 3I3EA 4UYPA 3IGLA 3VA2C 5T1LA 1S78D 1ZPUA 3I9GL 4ODTH 1INEL 1JE6A 4LCUA 1KPRB 4TLKA 2A6JB 3RWEA 3W39A 1NLDL 4BFBD 3SDXA 2WTPA 1SF5A 2FJUB 1HYRC 1KN2L 2EIEA 2G5RA 3RPKA 4QF1A 3B7UX 1PQZB 1W91A 4PJFB 4F9PA 4PJ7E 2EVIA 1YQVL 3BI9X 4FGMA 4Z7WB 4AI7A 1GAFH 3EYVA 3KCPB 3TCXA 3MODL 3S7GA 2EDTA 4FKEA 4WGWB 2FWUA 2CALA 1EHNA 2JCCA 5KTEH 5I9QB 2DEWX 3NIGE 3DOIA 4OBRA 3KM1A 1YEJL 4H8WH 1E9QA 2R23B 3KYMA 1FHGA 4HJJH 3RUGB 5ADPL 1MI5B 3VRIB 4Y4HB 5DZAA 1IJ9A 3MRMA 3SGJA 3KGTA 1M6OA 2QVMA 5ESQB 4M56A 2ZCZA 4JJHA 3QQDA 1YEGH 5FA4A 3K6OA 4U1SB 2JSFA 1FN4B 2ZWKA 4GI9A 5DJ6A 5D2LF 4KZDL 1H6TA 5F9OL 5GHWH 2WZPD 4U7KA 3IRZA 4KTEH 4ZNEA 3IGKA 4WK2B 3KS0J 2K0RA 3GMQB 1PEWA 5A2FA 1WA2X 3BKCH 4JB9H 4NJAL 3G6DH 1QSED 3A5VA 4ALAL 3FQYA 4DTGL 2Q7NA 4TOYL 4WTXA 2FATH 4JFQA 2EKJA 3V6FB 1P4LA 4I87A 3F6IA 1MIEL 3QEUA 1RK0A 3Q01A 5FK9A 2JJVA 1OF2A 4DP5X 1FNHA 3PGCA 4DNLA 4OZ4B 9PCYA 2CUAA 5H4YA 2FJGB 3QZWA 1NFDA 2WNKA 1NMAH 2ESVD 5F89A 2CK0H 3GXUB 2MKLC 1G0XA 1HEJC 3TBWA 1IAIH 3QI9C 3BYTA 2YD1A 4FNUA 4N1EA 3JYCA 5FYKU 1A0QH 1A4JA 1JPEA 1SBBA 2BSRB 5HI5D 5ICXB 4ZX4A 5CD5D 5KS9F 3II2A 3PWPD 4KDVA 5D2NE 1XR8A 2YA0A 4DVBA 4ENED 2BCKA 5IOPB 4M7ZC 5F1KC 1NEZA 4PB0H 4TNEA 2W9DL 2CE6A 4XMLL 4XN5A 4EQ3A 3NVQA 2DMCA 4AIXA 4EKXA 4HOZA 1B4JH 4NUGL 2OP4L 1U8IA 3BZ4B 3ARYA 3BP6A 3HRZC 1WWAX 3AITA 4KKBC 4Q9RL 1LWHA 4GQPH 3DJRA 3MBXL 5FXCH 2J1XA 3BFOA 4A7GF 2GTZB 1OAYL 4F33A 3ARGD 4Z77A 3D2UA 5JHBA 5I6MA 4E2OA 2KLSA 4HJGB 1E4KA 1QFUL 1HKLH 1K6QH 2XA3A 3ASOB 2YAMA 3V0IA 3WIHH 4JFDA 4YOKA 4ABUA 1DQJB 1DCEA 1PW3A 1QASA 4P04A 2DF3A 5SWSB 4O51B 1BHGA 4PG9A 2W9EH 5I24A 1QX1A 3B2PA 3H0TA 2P80D 1V10A 5D1QA 1ZK5A 4IRSC 4XODA 3JVGA 4E9VA 1I3GH 4JFPA 2R0LH 3L4WA 4QD2E 3WNJA 4Y1TA 4A68A 3MBEA 1R3LB 2VMDA 3PXLA 4U1JA 2UYLB 2AVFA 5FDYA 4FERA 2VAAB 5I5MA 1FF5A 4MAYC 4ZMLA 3B5GA 4ZFFA 2WXJA 3EYUL 5DC2A 5DLMH 3VFOA 2CO6B 3Q5OA 1FPTH 4ZQKB 3O11A 3RNKB 1YZZA 2OSYA 3NMEA 4GB9A 3VFRB 1QTPA 4HIEB 4L4VA 5HD8D 3KYNA 5G55A 3UZEC 1RZJH 3WHXB 5F7LB 4F9LC 1GGYA 2W95A 2PW1B 2YEZB 5FGBC 2J4WH 3JV5A 2HT2D 3T08A 1NSNL 3AWGA 2BNRB 1OE3A 2ERJC 4ZO8A 2NOYA 1S7WB 4WO4D 2FO4B 4WKXA 1N5YL 3GMNA 3PUUA 1R9FA 1A6UH 5DRXB 3O6FA 3IF1B 1AD9B 1FIGH 5DHXB 1MCFA 2EDBA 3GSXB 3FU7A 5F0JB 5AVQB 1PJWA 1PIFA 4AJYV 5J3HC 3TJHC 2PYEE 4K7FA 3L4ZA 3UTZA 1L9MA 3QFJB 3TO4A 3PQYA 3L3KB 4ZS7H 5IMMB 2B2XL 5EF1A 2UY7B 1TR7A 1VKXA 2NT0A 4RZCB 2WO4A 3Q8CA 5E70A 1XGZA 5D7EA 3OJMB 3G08B 1TJGH 4CNIB 1ZT4B 4B96A 2JI3A 5I15L 2XA8L 3EJJX 1IGYB 5F88B 3ILQC 1A7PH 5CZVH 2C1PA 2XKNB 2WNWA 3BVNB 4EUPH 4MAUH 4LEBA 2BOBB 1F02I 4EDWL 1FQ9C 1OSZB 5D7IA 4NDMA 2A0LC 3IPFA 5ISZA 1DFBL 5EUKB 3SYOA 5HJBA 3MRDB 4JL2A 4J5VA 2V3EA 5EBMB 3E9TA 4JCMA 2H32A 3LS4L 3VRJB 3B3IA 4NIYE 4KK6C 4GRWF 3PHAA 5FDWA 4QNPF 4MD5B 5E9DD 1PTZA 1OP5H 2AXGA 2IG2H 1OTTD 1CGWA 1PF3A 4FFVD 4MD4B 4ZMAT 1T3FA 1N6VA 3N44F 4W68A 1MW0A 3GIZH 1CBJA 2N1KA 5B1CA 1EAOA 25C8H 5CHNB 3BDYH 4HGWA 2JCWA 5DEJA 1SQMA 3KPNA 4JE0A 3ZGIA 2CLRB 5DMGC 3O6LH 1IC7H 1XGTB 2DV6A 4XPTH 1BSIA 3MLYH 2CUIA 2J6WA 3C08L 3IDJB 3MNDA 3P30L 4UTBH 3K6DA 3ML9A 5ITFA 1A6VL 4IBWA 4IRJA 2PCFB 4OY9A 4L1BA 3SO3B 4JKMA 1SXAA 1Q9LA 1IGFH 3MA9H 3FSWA 1HN1A 5T1KD 5DQJB 3RVXD 4MNQB 1GGCL 5FA3B 3A47A 3L4VA 4YBHA 1FYHB 1INDL 5F9AC 4OCXH 2IPUK 1L9SA 5HHNB 1LO3H 4NFDA 2H26B 1V5JA 1NBZB 2YKKA 4Y1SA 3IETA 4CN4A 4TVPE 4AC4A 3K4ZA 1TMQA 1HCFX 3VGHA 4B9ZA 4Z95H 1BMWA 3IMSA 5ITBL 4L8CA 1VLXA 1BD2B 3S2CA 2ZX8A 3BX7C 4IBTA 4N68A 1EZLA 3I50L 3Q8AA 4MMYA 2OTUA 3DPBA 1UEMA 3NFPA 4IKLA 4R26L 4JCWA 2QSCL 4G8GA 2V9QA 1G7MB 3WNLA 3CX5K 2NZ1A 1XGUA 5I1IH 2ZICA 3L16A 4AEIL 3VXRA 1EMTL 2OYLA 2VM3A 2C26A 4KHXL 4N8VA 3SPVA 5EH1A 4AZ8A 1G6RA 4LE8A 3OLDA 4ZXBB 2KUTA 2D03H 4R4BB 1ZLDA 2IAAC 4UQCA 3P9WB 1SYVA 4XXDB 3WTYA 1YNTF 4ODUB 5FYLE 2GW5A 1AXSB 1OOWA 4ICXA 4C83B 2Z93B 4FFWD 4POYA 5J1AB 3HG2A 4DP6X 1RMFL 4OCYH 4MWFA 3MYJA 1NFIB 2QKIC 4U1NB 5A6MA 1ZSDB 3IGFA 3P0VL 3IVKA 5C0GB 5FHAH 4UDTA 4BJLA 4ELMB 1WUZA 5D1ZD 2Y22A 1KJMA 3GTTA 2OL3A 5IB1A 4K71C 1G7HB 2W0KA 5TQ0H 2XTJE 5EZOL 2BIQA 4HJSA 3DDGA 2DD8L 2J2ZB 1QPXA 3PFUA 5I1GL 1LO4H 4P5TC 4Z3JA 4KHTH 2Z35B 4ECNA 2X2JA 4ZAKC 1TQCB 5E4AA 4BHUA 5JHMA 3ARWA 4URTB 4APQD 5IGXH 5I8OH 1CDBA 1HHHA 1DSFH 4YSPA 2BVOB 3ILPB 4X4XA 1BAFL 4NWTL 2VC2L 3VI4A 2TAAA 2FECL 1JZIA 3UBGA 2JQZA 5D4JA 1XT5A 3FFCA 5D1XE 4AT6B 1HVXA 4FQCH 3ZYIA 1CO1A 1GZPB 4TLTA 4Y5YC 4RRPG 4YPJA 4KRPD 3B83A 1DFXA 5CN3A 1CJYA 2I27N 3II1A 2H1LM 2VDMH 3EYQC 5TPWL 4CJ0A 3EADA 3TX4A 5LDUA 2BXZA 1L0PA 2YKLL 2DYSB 5T1JA 1XH3A 3GSOA 1KC5H 2B9BA 4NHCL 3OKEA 2QZQA 2FT6A 1EAPB 3MFFA 5L0QB 4Y16D 2F68X 2AEQL 2ENPA 4G5ZH 4XO8A 1MFCL 4ONFH 5BVPL 2K8MA 4G9FA 4CVXA 3N43F 3RU8L 4QRRA 5FW6A 2GKIA 2QT6A 3L2MA 2YQGA 3MJ7B 2Y5TA 1B2WL 3D6GA 3U6XS 3EXLA 5B39A 4XP6H 1G4RA 1BWMA 2YGVA 4LHUB 5CEZE 2B1OA 5CSZB 5E1IA 3I6GB 3L4CA 1CFTB 4NGHL 3P54A 3MRGA 4F8LA 1NDMA 1PY4A 2FWSA 2W59A 3OSVA 5A2BA 3CZNA 2R2HB 4BXVA 1FG9C 3NIGB 1D6VL 1E0OB 1NL0L 2X88A 4GOSA 5KVDL 4D9QD 5AYQA 5D1ZI 1CIDA 1MFAH 4JHAH 3NA4A 4G8FB 4MS6A 4DEPC 4HCRH 3ZLQC 3ZTEA 3SKMB 3D2UD 1FBIH 4AK2A 1MHPL 1TZAA 3HRZA 2A6IB 4OCSH 2Z4QB 4N1CA 2NQDA 4L1TA 4L29A 5AW9B 1BFVL 2H8PA 3WFHB 5D4HA 5FM4A 4MB4A 5CKGA 3FB5B 3NA9H 5GGTA 3VFVA 2C9AA 4DGIL 3IDGB 3I84A 3R4RA 3MLTB 4POZC 5D1QD 1GJWA 1LP9E 3V9FA 1E42A 2WSPA 1IBFA 3EBAA 4EZMA 5B38A 4PRHE 4LSVL 4FMFA 1TPXC 2MCMA 3SKOA 4E42A 1LO2L 2MHAB 4IRSA 2LLLA 2CNZA 2WB7A 3FUKA 5ANME 1IKFL 1KJ2H 2F53D 1OB1A 3VNYA 3NJLA 3B7YA 3CCHA 3MJ8B 4P2OD 2HRGA 1P7QA 3KXFD 1NGZB 1S4IA 3QZWG 3FAWA 2FJFB 4JVUA 1P4BL 1T04B 5DO2D 3K2UH 4DETA 5JR1H 4QXGH 4HHGA 2VLJE 4MAYA 4HUUA 2GK0B 4HMDA 1YDPB 3ESMA 5CGMA 4N85A 3H1ZA 5BV7B 5D2NB 4KVCH 4L8DA 4ORZC 3S3JA 2PNDA 4X0KB 1JHKL 3ETBF 1OY3B 3FULA 3MRLB 4ZTOL 1N0LB 3L9EA 3DURB 2A9BA 1JXJA 4JGNA 1JF6A 3D33A 5IV2B 3PXJA 4CVUA 3UZEA 1FE8H 1CF8L 2A6KA 2DLTA 2ZAGA 3FQWA 4F9LA 3SPGA 4TVSa 3BYYA 5FGBA 4E9QA 3VFMB 1DUYB 2EYTA 4AGLA 3LKRB 4UILH 2X10A 4LDEB 2OMBA 2EVGA 1CR9H 3A6BL 3PQYD 1B0GA 1TZGH 2XQYK 3OGCB 1Z9SB 4YBLB 1JRHH 1LM8V 1CDHA 3ZDXE 4OTXL 4C8XA 4Y9FA 2XZAH 3MRQA 2K78A 3FW6A 5T3XD 5E24E 3AU1B 4NKIL 4XNUL 4B41A 3QDHA 4KXAA 4KZEH 3N42F 3IPEA 2NW3A 5K9OB 4LZKA 4JO4H 2AQ2A 1Q90A 5I75C 2KLRA 1F90H 5JNYA 2P9RA 1RUKL 1BDYA 1H6UA 2RJMA 1DJWA 1BVKA 1V54B 4ZD3L 5C0FA 1NIAA 5DJZA 3GLZA 5CP3A 2F8IA 2WANA 2IF7A 2GT9A 2VDPB 4AZUA 4LCWE 3UAAA 1P6AB 2OJ1A 5AVVB 3U9PL 4ZW8A 1LO0L 4UAHA 2Q2LA 4X5QA 4AL8H 3L45A 4JJ5B 1UENA 1J0IA 5BS0E 1HILB 2E76C 3MKKA 2LT9A 2FO8A 5HHXL 1NLBH 3F6JA 5EA0L 1BQHA 1DVZA 1U3HB 5HHOD 5JDSB 1YEFH 3N1PC 4ORGB 2R7EB 4HU2A 4QRTB 1AQ8A 1XB3A 4JM2F 3PCYA 3UEZA 1GW6A 2R1YA 4K94H 4PR5B 3CLEH 4D0CA 4B50A 4NRXB 1MN4A 4HS3A 1DQTA 2VKWA 4QEGA 4Q6YA 3S35X 3ULUE 5DQ9B 4S1SL 3AUWB 5GGRB 1BYOA 1KYOK 3G6JA 2Y07H 1B0WA 3T4AB 2DAVA 4N90D 3IDYB 4QJ5B 5KVFL 4RZKA 4EZLA 3VXNB 2AK4A 2BRRL 4KFZC 5EBLB 4QHLA 5KSBA 4HH9A 4JRYE 1UD3A 3CK0H 1TSRA 2V37A 3CVHH 2O5ZL 3QDME 1R3IH 5AB2A 4TTGA 1LDSA 1PZ5A 3RWCA 4HF5H 4DVRL 2EP6A 4ENZA 1JERA 2CJTA 1ANUA 5DD1L 3FUMA 4AMXA 1T6WA 1DBBL 4MD0B 4JBSA 5LBSL 5E6IC 1KB9J 4GEJA 3RHWK 4GY4A 5E7FA 1K5NA 2IALB 4G8GD 1KELL 5E00B 1F97A 3M45A 2RR3A 4KNTA 5DJXA 1HH6A 5DRZA 2WWMC 4YE0A 3SEPA 2ARWA 3E8VA 4YHIA 4D8PB 4ZOCA 4PJIB 1TQBB 2XI9A 4PJ9B 4PWHA 2MTAA 4RQQA 3VG9C 4DP0X 3Q2NA 2H2SC 1QRND 4LLQA 1UOKA 1ZOXA 4W93A 1AH1A 4KJYA 3TJEH 3F00A 5TDPB 3HG1A 1ID5I 6CGTA 4FG4A 3RL1B 5I8CB 3LRSA 4BH8A 3WNMA 1FFNA 2ED8A 3SODB 5BZWA 4DGYH 3S9DB 5E08L 5D8JH 4WWNA 5B1AB 3P9MA 1JZFA 1I7TA 5J12B 3O2DA 2B20A 2VDKH 3GJFK 4HEMA 3DRQB 3SGDH 3ZN6A 4RFNB 3MROA 2CBPA 5CLXA 2OYPA 3QWNA 1JCVA 1SEBA 2KKQA 4ZW5A 5GZOD 1N8ZA 1VEPA 2QKIA 2VL5B 3EOTL 5I73C 1MCEA 2RIKA 1UFGA 1L6XA 2WIMA 4EMZA 1L7IL 2DQIH 3BKJL 1T2QH 4P9HL 4N8CH 3MDJA 2VDQB 2JK5B 2G3XA 3GRWA 4I2XE 1JV2A 2QPSA 3A21A 1JS4A 1IEBA 5K1NA 4Q6IA 5C92A 2WNGA 2JKNA 1AOHA 4P5TA 4XN8A 4GRMA 2EVFA 3S34L 3QR0A 3HKZA 3BH8A 4QRPD 5J5EA 3CLFH 1A4BA 4ZAKA 2L4OA 1I3UA 2XWDA 1UOLA 5CM1A 3FFCD 2ZG3A 3DHUA 4XMPH 4A2EA 1WS7A 5HI4C 2CBTA 3VXQB 3WJLC 4S1RH 5AKSA 5EEZA 3EZ8A 4NQCA 4ZMPA 3LRGA 4JG0L 3RDJA 2YMXL 4LNRA 1UM4L 3HC0B 4P5SA 2FSEB 1KSRA 4K9EL 4N8VG 1IGMH 4S2SB 3SDCC 4A37A 4X9FA 1T03L 1QACA 3I3BA 1V7NH 3TBSB 1KJ3L 5DD6A 3HI5H 3BKMH 3L4UA 1AZZC 3N1MC 3K6SA 1A7RH 4K3JH 3V4VL 1BVOA 4RH4A 1JZJA 2XYBA 4WTQA 4OZHF 3VSVA 5D7LB 3QNYA 2QADB 3BGAA 4L1DA 4Z7UB 4IU2B 4JKPH 3LZLA 1WC7B 4ELKB 4FKKA 2A9NH 1X6NA 1AHKA 5AKVA 1ZE3H 3PGDB 3FCTB 4G9FD 5I6XB 3QFDA 4GBXB 5T3XH 3NJNA 4HUKB 5FO9A 3KWVA 4EN2A 1MCKA 3GK8H 4Z3HA 5ID1B 2ODIA 3WO3B 4DZ8B 4Z18A 3OXSA 2XFXB 4WU7B 3IWUA 4FQ2H 4PCKA 4BKSC 1A4KB 2WXPA 3D3VA 4MA1B 4LKXB 1MWAA 3HJEA 4YE4L 1L9TA 2VOTA 1QFPA 1TIUA 2YAQA 5JXEC 1LMIA 2OSWA 1UWXK 3QUXB 5EUOF 3T8XB 4X8GA 3RKDC 4FHBD 3VWJC 4NBZB 2L8AA 5TF0A 1AY1H 2WJ5A 3SDAD 2X3AA 1YYMH 3QISA 1YNLH 3MLWH 1O6TA 5E5LA 4N0YL 4I89A 1CXEA 1FSKC 4Y8DC 1BXXA 3KCWA 1OM9A 1A7NL 4M1DH 4UV7L 2VSMB 5E2TH 5DUBB 2VZVA 3K2KA 3CFEB 3O81A 1CICB 5I16A 4I85A 4AEFA 1JZ3A 1OP9A 1TJHL 3UTSA 2V3FA 2DBLL 2X9YA 2OA9A 3VD4A 2OMTA 1N5AB 4YNYA 6PCYA 3MRHA 5DD0L 3VFUA 4HAFA 5IHZB 3F7YB 3IDIA 4MBRA 2H4EA 3IFOB 3QJFA 4CMMA 4X6CE 2FJSA 3S8GB 2XWRA 1R4XA 4W6WB 3NABL 4BZ2A 4D0DA 3OPZH 4CUCA 4MJID 2NNCA 3ZRCC 4DJMA 3GSVB 2PXYC 2WGNB 4HH8A 4NP4H 1QG3A 5KVGL 4KJPD 3BJLA 2W91A 1PBYA 2FT7A 3SBPA 3D09A 5HI3C 1SRDA 4P46D 4Y5XA 4HOXA 5JORA 5DUJA 3PRZA 5K93A 3VTMA 4X9IA 4LBEA 2C1OB 3NFSH 5B39G 1BYPA 4WSKA 3SB3A 1GYVA 3HB3B 2ICEB 3QZNA 4A55A 4DHLA 5KSUB 4NNXA 4PWKA 3GSNL 4GUPA 4EIZC 4OZFB 4X98A 4W70A 4M8QB 1RLWA 3LXBA 2YXWA 2ARJA 4WI0B 3N6YA 1TNNA 2IH3B 2ZG1A 3EFOA 5EFIA 5J7CC 1TXKA 5DZLA 2BNQA 4GO8A 3KPQA 2J6EH 1XCTB 1GL4B 4KY1L 3HZMA 4FNSA 4LSPH 1G9EA 1VFOA 1N67A 1KTLA 3QH3A 3LDBC 5LKNA 5FKPB 3W0WD 1I1FA 4M1CC 5D71H 4Z7WF 2A1WL 2XZCL 3H7LA 4JN1L 5CXPA 3ZDWA 2IFFH 4FNTA 4XE0A 1S7QA 4AXWB 1BFSA 5BW7C 1U8PA 1LP9B 4B53A 4TRPL 1VAHA 3FMGL 4PRHB 4BGLA 2AQPA 3NIFE 5D7KD 5B38G 4OGXH 3Q13A 3RUGF 2JJUA 3WUWB 1JWMB 1MCPL 1XDTT 4BK5A 4DKFH 5DJ8B 3RX8A 3DUHA 3FO2A 1UADC 4JM2C 4NYLA 1QEWA 1RIVH 1IMHC 1KT2A 4WUKH 5E2UH 4XCEA 4RSVA 3WAKA 2F15A 4L3EE 2Z8SA 4IGBD 4MJHA 2CGYA 4QCIA 2OL3H 1LEKB 3LIZA 4H26A 2VLME 4MDJA 4ZOAA 2BZCA 1RZGB 3LPPA 2BVEA 2VLJB 3GM0A 5JUEL 5GRJH 3BIKA 4DO4A 3GYRA 1MELA 1I3VA 3GNMH 3HPJB 1MJJB 4JDTL 4IRZA 4WUUB 3MLZL 3KL3A 3PHSA 2X6CA 3V10A 4Z3GA 5IEHB 2AJVL 4LCCA 1QBMH 2WP3O 2CR3A 5E1GA 3WNNA 1EVTC 1F41A 1D9KC 3TBBA 3GRGA 4QOKE 3LPWA 3F5WA 5HJ3B 5L4FA 4NC2B 3MRRB 4PJAA 4QXWA 1ORQB 1CL7L 1S5HB 3KNBA 2XACC 5BRZE 4F20A 1YY9C 3OMAB 1TTAA 2MOQA 1TTFA 5I26A 3VYPA 4MA8L 1XB8A 1KOAA 3S36X 1F42A 3L7EA 3EG9B 3SPJA 5CFHA 4JO1H 5ERWA 4Q0XH 3V0HA 2DYPD 3ZDXB 4YLQT 1M05B 3QA3B 4BSJA 3MCKA 1MZYA 4YXLH 1AGFB 1RUMH 2HN7A 3A23A 2AK4D 5E8EA 1Q9OB 4OUUB 1U2CA 5DZOA 4RBPK 5IB4A 1MVFA 5I1CH 3BUYB 3MLXL 2ALAA 3RWIA 3GSWB 3ULVD 1UUSA 1Z6JT 3EJYC 3K5RA 4X2UA 3VRLF 1P1VA 4WNJA 3GXFA 4W9ZA 4M02A 1RERA 3WKQA 4QJ3B 4S0SD 4AQAB 4OUOA 3ZZSA 4LCWB 5IJBC 4Y2DC 4XC3L 2AJZB 3FQXB 3HS8A 5ABDE 4BQ8A 2A2QT 1OCZB 1JN6A 4NI3A 4ODSL 2ITCA 2ADJA 1WCBA 1SDDB 1SXBA 2ZWYA 3GMMA 1YEJH 5E6IA 1UTDA 2VJ8A 3PDDA 2YPLB 1E65A 3FT1A 4N2GA 4Q4EA 5E1AA 1ERNA 3FZUD 3SQOH 1BQHG 1T22B 4C4UA 5IG7A 1CDUA 4MXQD 2F54E 3HG1D 3ECWA 2EIJB 1CFMA 4KC3B 4N2EA 1WS8A 4PLKD 1I53A 2WVTA 1JYVA 1JGVH 1W72B 1J05A 2BRQA 3KL5A 1JXGA 4ABQA 3WNIA 3CQPA 4U6TA 4L18A 3HCVB 1IGTB 5TDOA 3LQAC 3G6AA 2ZOKB 3MOBL 3PS6A 1I8MA 1UCTA 3E3QE 1YMME 3GKWL 3F8UB 3OWRA 1DJHA 1CLZL 4Y4KB 3UPAA 1JOIA 4KQ0A 4TL4A 4KI1A 5AEAA 5CGYC 1G0YR 3CZGA 3OKDB 3CXDL 5J8OA 5IFJB 2OJZH 4K3EL 1QR4A 4IEFB 3BXNB 5IM7B 4P4KD 3RDTB 3R7QA 2QKSA 2Z6FA 1MQKL 3GDBA 3JWNC 4JRYB 5KAQG 3TZVD 5C8JA 5A2LH 3GRBA 3QDMB 2UZPA 5ENWB 1J1OL 3ASNB 4WF7A 3RTQD 5FF6B 4EBQL 4R9HA 3IDXH 1AYRA 1U8NB 1CPUA 2NNXA 3H54A 3U1SL 1J9TA 1E3ZA 4FNQA 5EZIH 4AYFA 4BQBA 1VJSA 5LLIC 1FVCB 3PLYA 4RISH 3RIFF 3KWTA 1K4DA 5DZNA 3C8DA 3TS8A 4LHJB 1KBPA 1NGYA 3U7AA 5JW5B 4LMQE 1EEYA 4L3CA 2ZUXA 2DLIA 2XN9A 3OLGA 4Y7MA 1I7UA 3FSVA 2AAVA 3LVEA 4XMLH 4P23A 1QOKA 4NQEA 1DANU 4NQCD 4PRBA 1VFAA 1TKWB 3M1OA 1KLFA 4RAVB 1K5WA 1NCGA 3T71A 2OSLA 4K07A 1OAYH 2DQGH 4QRAA 5B1BB 4F8QA 2ZPKH 1F58H 1ZT1A 1EXGA 4J3SA 5FFGA 1K8DA 2EUXA 1E4JA 5LQBL 4NKOA 3MU3A 4XHJD 4CILA 3SDCA 2ZKHH 2ZKYA 3RTLA 4X6EA 1EHLH 5E51A 1OAKL 4IM8A 3JUZA 4TPRL 5KBMA 2FYYA 2R59A 1XZ0A 4FX5A 3FC8A 3S97C 3O9WB 4K3GA 2OMWA 3X1FA 2VN6A 2VSKB 3WXWL 2WBWB 1DLHB 2IH8A 3NCFB 1T0MA 1HSBA 4UDUA 5KVFE 3U0WL 4MGXA 5BQDA 1M9SA 1ZA6B 1HIML 1SHMA 3F83A 3HE7B 3IMVA 3S8FB 4TUJB 1J8HE 3FQTA 5B4MC 1DVXA 1T4KA 1E5BA 1MCHA 1NCAL 3DV4B 3H9ZA 1WYJA 2WWNA 3KR3H 4I2XB 3HNSL 2XWXA 4LOVA 1FIEA 4M7KL 4NAMA 4QRSB 4EZKA 2D0HA 4HS8L 1HSAB 1QSEE 4KXCA 2ZG2A 4PCYA 1OP3H 3FUHA 3H4FA 4H40A 3TPUB 2W0PA 5C09B 1YLBB 1R0AH 5IQ9A 1AO7A 4Z9KB 2ZXBA 4KMLB 3QZLA 4N2NA 3ISWA 1WWBX 3S3CB 3ECBB 4ZT1A 4NUJA 1Q0YL 3DVNB 5JXEA 1LDPL 4HK0B 2F18A 1ED3B 3ABGA 1ZIBA 3Q8BA 2ESVE 3QUZC 3VWJA 1N5YH 4O4YH 3M88A 1VFMA 3GSQB 1U8CB 2ADFL 5B1KA 3EHBD 3LQZA 4WI5A 2CHZA 4BE5A 2NY7H 3HHSA 4I5BB 4J3OF 3S3DB 2BSDA 3DLQR 2IQ9L 5DRWA 3PWPE 4UV4L 1M7UA 4HUVB 1NGXB 3MNWA 1X5JA 4M61B 2H47C 2B2XH 2BMKB 4XNQB 2D7QA 2N59A 2WQVA 2QPFA 2JKTM 3JWDC 5DZJA 4Y4FD 1B4LA 2NY4B 2HRPL 1CCZA 5EO0B 3TT1H 3BEVB 3QHFL 4G6AC 5M7QA 4NCC2 5I15H 2XA8H 4Q9BA 5IW1B 5T1DH 5HYIA 4PGEA 3AU0A 1W80A 4GKOA 2WXHA 3WFEL 3SY6A 3IEAA 5BJTA 5CFAA 5GS3A 4ONHA 3U6RA 4EDWH 2R2BB 4UOW0 4PWFA 3ULVH 5DJ2B 4DKEH 1VB9A 3CD4A 3QQ4A 2H2PC 4JMXA 5AW8B 1I82A 3OVUB 1USZA 1YN6A 1A4CA 1X5HA 1VFUA 3CBKB 1QW8A 3LKSB 4FMVA 4Y2OA 3WKYA 4N9GB 2ED6A 2JQAA 2NPLX 2MFNA 3FCUB 3NGBB 4PS3A 1QO3A 2R2EB 4ELMF 3KGRA 1QR1A 3JWOC 2VSDA 2OFQA 3STZA 1KEGH 3UAJC 1B88A 2B0SL 4BRJA 2AEOA 4RDQF 3HG4A 4PREA 3X1EA 5C07D 4JDZB 1E27B 4NWUH 3NK3A 3UTTA 1DDHA 1UEYA 1A3RL 5HGDA 4HWEH 3ATBA 1I8IA 4RMBA 5LXGL 1R3HA 1KGJA 3WYRA 5F3BA 1WIUA 1DBML 2UWEE 1FC2D 1KFAL 1IEAB 1G6RL 1F4AA 2AXJA 2ZX6A 3MJWA 1TF4A 1ESOA 1SOSA 3RWDA 5BXFA 4O2CB 3DX8A 4DZBA 1VFBB 1NZRA 1OCWH 4J4PC 3QJTB 2XQBL 2C3VA 2FIKB 3RX9A 1CVRA 3O2DH 1E8XA 1VA9A 3QYMA 5EWIL 5BW7A 3F84A 4TULH 3L3IA 1LYQA 3MV9E 4P3DA 4M7LT 2VQUA 5AAPA 1DE4B 1J0KA 1INDH 2IXQB 5L4MA 3BLKA 4MKTA 2WZ0A 1FGVH 2HFEA 3EIFA 2FZ3A 2K9FB 2APVA 1U2YA 2CSPA 2N0MA 4JM2A 4OFYD 1UD8A 2EO1A 3PL6C 2C9QA 2WINA 4FYRA 3BAXA 4I3SL 1L9QA 5HBBA 1CVSC 4WI4A 5AUMA 1KCKA 1VPOL 2ZCKL 5ITBH 5EIIB 2WZ5A 2BIHA 3HVDA 4KU1A 3JTSB 4UIKL 5MEOA 4RGOH 3S5ZA 5IBUG 1ASQA 4I1NB 4CN6A 4Q6KA 4YGAB 1IIKA 3CFBA 3TH3T 2ZJSH 2D7TH 5DEFB 2A4ZA 3T3PF 1NUFA 5BNXD 4XX5A 3EXJA 3MOQA 4ZUWB 2OYKA 3ARVA 2DQDL 2CBOA 3U1PA 4BZ1A 3X12B 5KYWB 4NIKB 2NNAA 3BGMA 4XPHH 1CDCA 3S37L 1D9KA 3D25A 4J3BA 4BSVA 7CGTA 4YO0A 1QVOB 5HYQB 2ENSA 4ZYKB 4JFWA 1C5DB 2Q8AL 3VSQA 5E9DE 1S7UB 5E9AA 3SBRA 5J1SC 3WU1A 4OCNC 2V9RA 3BAEH 3EO0A 3PHOA 1MY7A 4XP4L 4YSUA 1JZ2A 1F3DH 3SD2A 1ZHLB 3I9AA 3NIFB 1RVFH 2NSXA 2ZUUA 1PNDA 1UCBL 1ZVYA 2E74C 1NOAA 3WDHA 4R0LB 1DL7H 4L3EB 1HHJB 1ZLSL 5C3LD 5L4IA 2XTLA 1HHIB 1BVZA 3LD8B 1TNMA 3D69A 4YHYB 5KYYB 2Q7AA 2GJ6A 5EU4B 4X4ME 4DGVL 1THCA 3N1GC 3SKNB 1LK3H 1ZIAA 1HQ4A 4X7CC 3NJKA 3RA7L 1WEJH 3FB7B 3FO1A 4HWBH 1FZMA 3IKKA 1JGLL 2FX9H 5DMIH 4HSAC 4NERA 1SFDA 2X41A 4IKNA 1Y1UA 4QOKB 4EIUA 4ELDA 2ZYRA 1Y18A 1T66D 2P8PB 1N4XH 1JK8A 2PLTA 1YECH 2YJQA 5BRZB 1AC6A 1FG2B 1E50A 1FYTD 4QAMB 3T65B 2KC0A 1I7ZB 1Y0LA 3PREA 1X5IA 4B95C 5D93B 3ZDZB 1G7PB 3L3OC 2ZXAA 4JFZH 4NHCH 4W9KC 5JPNB 2XJLA 4ZTPH 5KVEE 2PW2B 2HPTA 1Z9NA 1RIHL 4XRCA 4J2XA 2BVQB 3Q2CA 4R97C 2F6AA 2F7IA 4XPGL 3RPIB 5L2JB 4G43B 5BVPH 5GGTL 2CAKA 4JKNA 1KXTA 4PJGE 2ROYA 2HMIC 3G3LA 1ZJAA 3T6XA 4GEIA 1B2WH 2FDBP 4UTAL 2EH7H 5F3FA 4Z3EA 1GSKA 1V27A 2MWCA 1PGRB 4L8BA 2OXHB 1G43A 2FUTA 4M4RB 2RD0A 1AGEA 4BWWA 1WT5C 4J3VA 5I0ZA 3SDXE 3WELA 2XPGA 1X5KA 4PVNA 4L5FH 1IAIM 2EDJA 3MLVH 4RFOL 4P23D 3RWHB 2WAQA 2NX5A 4OZHA 2WBJA 3V0GA 3CVIL 3N1QC 1W8EA 4N6RB 4NS0A 1MFDL 4XMVA 2YPVL 5IB2A 4P3CH 2F54B 2QGBA 2B1AL 4LSQL 2Y23A 3BZ5A 5ADOH 4YXHH 1MHPH 2CQVA 3D85D 2JCCE 2Z8RA 3HMWH 4PS4L 1JD7A 4XN2A 1K3ZA 1UXSA 1MW2A 4YHNA 5GGSY 1BFVH 5G4NA 2XHNA 2FUQA 1JF1B 1RJYB 1YMMB 1QFWL 1U91A 2GUOB 4BCXA 5K5YA 1TO4A 1F11B 3BWAB 4DGIH 4R7DB 2HJKB 4WW1A 4MSWA 2YGPA 1IC5L 4X7SL 5I17B 4V1DA 1ZJBA 5EUOA 3SO3C 3B9DA 4FJYA 5C08B 4E9YA 4NO2A 2EIKB 3MRFA 2XZQH 3MR9B 1IKFH 2LHAA 4ZNEE 1YEDA 3UXFA 1PNCA 3JBG7 4FCHA 4J3OC 5DC9B 1H3GA 3MRJA 3FQUA 5L6YH 3N0AA 5IP4A 1ZK9A 2LOEA 5DDHA 3CN4A 4UM8A 2WSKA 4JANA 1P4BH 3THMH 1L7TH 3QO1B 4XVTL 3MI6A 1MRDL 3P3YA 1AO7D 4P5MB 3SO5A 3LIZH 1E6JL 5C6TL 2V5RA 5DD3L 3LRKA 4F7KA 3BP4A 4CU7A 1FFOA 5EBWA 4LIQE 5FCUH 3BVDB 5BUGA 3TH4T 1NFDE 2VQTA 3TGXA 3V5HA 4IRZH 4M6ML 3VWJD 2I9TA 1CF8H 3KJ4B 3B2UC 2WYHA 2E9JA 3W9EA 3MUHL 4JRFA 2P44B 2YWYA 4OW6A 2HT4D 3BSZA 1FA4A 5IFAL 3BPLB 3OKKA 2J12B 4ZXBC 2WBKA 1WH0A 4RIRA 2VGLM 1T1XA 3QUZA 3ZQXA 4DIXA 4PLJC 3BP7B 2CJ3A 5TK4A 2WNXA 2ALWA 3CMOH 3E8UH 3M86A 4U1GC 2F08A 5DJAB 2E5EA 1CURA 4WY7L 5JYLA 4IOFC 4LLUA 1BMGA 5CIPA 1A22B 4DO6A 2YUVA 1UG9A 4CADA 1XXFC 2YD6A 1KG0B 1GRWA 2BHFA 2XVLA 1P1ZB 1ZHNB 2E59A 2MPAH 1U30A 3NJJA 4UQ2B 4PJIF 3BAIA 1HZHH 1EAQA 3FTGA 1E9OA 5EOQL 3RVVD 1KACB 1KN4L 1RUKH 2N7BA 4JFDE 5DT1L 4RAUA 5F7FA 3QIWC 2XU9A 4HUXB 3ZHFA 4UUJA 3B5HA 5AOIA 4I18A 2GAZB 1MJUL 4LLDA 5DJCA 5D1QE 2ITDB 5DVNA 1QSEB 4HJUA 1RZKC 3QDJD 1IM9B 1TQCC 2XG5B 1S9YB 3QXDB 4UIMA 4E9WA 3HPLB 2X05A 4Z7WA 3LXCA 1X7QA 3QZPA 2P5ED 1A3LL 4XT1C 1AGBA 3Q0HA 1K8IB 1YCSA 2X70A 2BY1A 5IQMA 1CF1A 4X83A 1X9UA 5EA0H 3H6AA 1FZOA 2JF1A 4Q9CA 2ESVB 3B6SA 1ZGLM 5F96L 3SOBL 5CUSL 1V55B 5IT2H 4ESKA 4G6JL 2ITEA 2V5TA 2FH8A 3SHSA 3TV3H 3UTTD 1D5RA 2E9GA 3AQXA 5IFHH 1MI5A 2DKMA 3VRIA 2EVHA 4QXUL 3PWPB 1BYNA 3UAJA 4M3KB 5ESQA 2H1XA 1I1AB 4X6FB 1Z3RA 2GJPA 3CHQA 1XGYL 4WJG3 3OR7B 4MQ7B 5AAMA 1KB9K 3DI3B 1AFVH 4NPJA 3DROB 1FN4A 3F7PC 1HQRB 3EJUA 3D52A 2BOCB 2YJLA 1K9TA 3ARQA 4LL1A 5L0QC 1J1PH 4H25A 4JPKH 2XPYA 1YO4A 1EUTA 2BRRH 2O6PA 3ARGB 3HN5A 5B3NA 2EIZB 4DN4L 4P57B 3C09B 3WEBA 4J4PA 2IVFC 5IOKA 2R0ZL 4L8SB 4NZJA 1MPAH 3PQYE 1CXHA 1BJMA 3X11A 1BJ1H 3PV6B 4LK4A 3V6FA 4I77H 4I9WE 1GYCA 3H3PL 1KV7A 1RI8A 2BZ7A 3H3BC 1DBBH 3A24A 4YEFA 1S8DB 5TF1H 4N8UA 4YC2B 2PCXA 2YXVA 1ND0B 2FJGA 3F7QA 3ME0B 1O5DT 3OAWA 2CU9A 3PL6A 5F1SA 4N0FA 4LSUH 4OLYH 1AP2B 5FUCC 3WN5B 2FK9A 1CWVA 3DJTA 4GUOA 4Z7NE 4Z7UF 3GRWL 5KUMA 2B5IC 1IBYA 1M7DB 3PJNA 3BESR 2EICA 3PJSB 5KBKA 1BM3H 5H8DA 1RIUL 3MQIA 5D7IE 5E1HB 5ISZE 4NC1C 1PG7W 3WFBH 1JDAA 1GJIA 2D73A 3GDCA 3BZ4A 4OJDH 2D0FA 4R90H 5ALBH 2AQQA 2WK2A 3DDFA 4U3SB 2JI1A 2EE3A 3QJXA 2QHRH 3DYMA 3O45A 4W6XB 4XWGH 1A1MA 3K71A 4TYUA 4BSWB 2VDMB 5CJOL 2JB6B 4HJGA 1IFHH 4WO4B 5LCVH 5CEYA 2CXGA 1OE1A 3LZNA 2UX7A 3FN3A 2X9WA 5DS1A 3SYPA 2A3TA 4NUQA 2DM7A 5HDBB 5SWSA 4O51A 4GMSL 4JM4H 1ZLWK 4HS6A 4ZDHA 4A2HA 1ZLEA 2PTTB 3K81A 3FU3A 4JY5H 2EKSB 1WWCA 4KI5D 1L7IH 4P9HH 3ZY7A 2QQNH 2F19H 2X6UA 1R3LA 2MKWA 2KPNA 2UYLA 4ZMYA 3N3EA 3OV6A 2FLRT 2VAAA 2GJ6D 3RY5A 4MJ4A 3T77B 1NCDH 3AQDA 2V17L 3DJ9A 4L3FA 1KTDB 5BV7C 4DAGH 2Y6SD 1XF5B 1ZCRA 2AHIA 2CO6A 2JELL 3BOVA 3KYOA 3RNKA 3VFRA 4CSPA 3ATEA 2WIIA 4J23A 1JTPA 1MWAL 4HIEA 5E8OA 2VE6A 3U7WH 5C6WH 1AD0B 3RI5K 1ZEAL 4X9YA 1J10A 4JG0H 2KHAA 2YMOA 5CLZA 4BUHA 2PW1A 1KPUA 1TTBA 3PUCA 4YX2H 2ZCHL 5EU5A 2BNRA 5KG9B 4ISVA 4APXB 5DRXA 4G8GE 4PU2A 3QEHB 3RE0A 5K39B 1ZVSB 3V4VH 4ZUSA 5MHSD 3GSXA 5E9DB 3VXRE 2H6PA 1JVKA 1TQTA 3ECQA 2UZYA 4IOIA 5EN2B 3QWRD 4IBSA 3QFJA 1TO5A 3K91A 3L3KA 5CCKH 4N2BA 3WI9A 5GJSH 4RZCA 3L3OA 2ORBH 5KYUB 5ILTH 3FQ2A 3NSCA 4KMTL 5C2BH 2VR3A 3AT8A 4RGMC 4X0NA 5FKAB 1FNSH 5C0RL 2XETA 4BZ2L 4CNIA 3CFNA 4EAEA 2K8QA 1RUAH 1R3KB 2AV7B 3NH7L 4OCMC 3RJDA 1IGYA 3AB0C 1C9SA 2GIYA 1KJ2B 1DQDH 5LHDA 3ULAB 4YE4H 2XKNA 4G2AA 4RGND 4H0IA 3S98A 5F21B 4L3AA 4MQXC 5T1KB 4Z7AA 1LP9F 3V4LA 3ZZLA 2JKIS 3KLAA 3DOSB 4O2FA 2NX5D 3GC3A 2WBJD 4E0RA 2FX7L 1U3HC 3FTXA 1OCCB 1WT5A 3WTSA 2YOCA 3VRJA 4G6KL 5KJRL 3H53A 3W38A 1NBVH 5HVHB 1PZUB 2A6DB 2X4PB 5TTRA 2XWBB 4TSAL 2DLEA 1GCYA 4WV1A 3NOIA 5E9NA 2IH9A 1ILSA 5AD0A 4KITB 3NP3A 1WQVT 1TJHH 1ZWIB 3HI1A 1FDLL 1A47A 2VUYA 3VI4E 3KH4A 1J5CA 3WLWC 2BIMA 1KTJA 3NCJH 4BFIA 3FFCE 1QFHA 3GZQA 1RH8A 4IKJA 4YS4A 1Q9WB 4BDVB 1I9RH 1SN0A 3PE9A 4L48A 3T4AC 3IDYC 4ADIA 4BWTA 2FWLB 3BPNB 2C7UA 2DLHA 1M1XA 2OBGA 5KVGH 3IN0A 1ODUA 5D7SH 3GBLA 3FB8B 4M1GH 3L4TA 5FR3A 4PB9L 4HGMA 5DXWA 2FTAA 2IOOA 4MJ5B 1XD0A 5DQJA 2FEEL 2BFGA 1KEMH 3JWNG 3OAZH 5FA3A 3DETD 3GLDA 1NFKA 4OKDA 1YEKL 4OFDA 32C2A 3B4NA 5LN8A 2I5YH 3RGVC 4C54A 4JAMB 3ZDXF 4AV4A 1DBAL 1MRCL 5D1ZB 4G9FE 3RWEB 1BG9A 2I25N 1NBZA 1E28A 3MV8A 4QRRE 4WAFA 3VFPA 2BS71 5F7BA 2NY0C 2XWJB 4QF1B 2R0KL 4EOWL 1BD2A 3E1F1 4PJ9C 5EHFA 4K8RC 3WY1A 4C47A 3EYVB 2ZUYA 1VEOA 1NWPA 5B3JE 4Y8AA 4KY1H 2E6JA 4BV1A 1M57B 3P9LB 4NLAA 5JPMA 3QUZD 2KERA 1ZTXH 2JCCB 4JPWH 4P48A 3CVCA 2W1NA 1E43A 1YMHB 4GAGH 1NCJA 5ALCL 1H3WM 4YZWA 1F3RB 1E9QB 4JPQA 3KYMB 3UBXI 4ZXBA 4OSUL 4W9JC 3TWCH 3CXHJ 4TUKL 4RRPM 3MRMB 3EBHA 5GISH 4YDMA 2W0FA 3FONA 1KCSH 1RULH 4HXAH 1WBYA 2LLGA 4RFNC 1QRKA 4U4IA 1W6LA 3QCTL 1ZKAA 1GSMA 4EF3A 3V4PL 5DJ6B 3BZEB 3OSKA 4P2CG 4QY8B 4WGVB 1IC4L 4PS8A 4U1NA 2GTQA 1ZSDA 3V7AG 3LZFH 1BEYH 4IKKA 4G42A 4UB0H 5AOLA 1RPKA 2XY1A 5L7XH 4UZUA 5I28A 1G7HA 3CVHB 4HFUH 3DGGA 1T5XB 2WLNA 3KHQA 3LKOA 4Y16B 3QIWA 3ULUF 4JFQB 3VFTB 2J2ZA 3QEUB 1RK0B 3L1OL 1UOWA 5FK9B 3OAYK 2Y06H 1OF2B 2Z35A 5JTWA 2EDEA 3PGCB 2Y1YA 2AEWA 5J0BA 1A7QL 3QZWB 4LLVB 5EC1A 3ARED 2CHXA 1GYWA 3C5ZC 4F7CA 4FABL 1OARL 3TBWB 3CMGA 1BF5A 3V5DA 1A4JB 1KPVA 4FP8H 1PCSA 2CCLA 4JFYA 3APCA 3REWA 1T89C 4AT6A 1AG6A 1XR8B 2DQTL 4DVBB 2MQ3A 3P2DA 3R1GL 2BCKB 2VR5A 2HX7A 1GJUA 1NEZB 4MA8H 3TTSA 1H5BC 3ZKQD 3G04B 4KMQA 4HGKC 4XP5L 3TU6A 3M7OA 3BP6B 4PVBA 2WTRB 4X6DE 1B3JA 2Q1EA 1OW0C 1G9NH 2O72A 2WO3B 3NT0A 4F33B 1TFHA 3OF6D 4Z77B 3CFKB 3D2UB 3EBIA 4JPVL 2VDKB 3VCLA 5I6XC 1OWWA 1PD6A 5BQ7A 3ARRA 3C87A 2WQXA 3CDGA 5DFTA 4YR6A 3TBCA 5IQ7L 2RAMA 5CZRA 1HWWA 3ARFD 4QKTA 1P5VA 1YYLL 1H8OA 4U0QB 3H0TB 3IJ8A 2NLJB 3RB5A 5D1QB 1BZOA 4FEMA 4JFPB 1T0PB 4MA1C 3MJ7A 1YC8A 4YDIH 2A9DA 5D7KE 3WLBB 4U1JB 4L9LB 1KY7A 4BK4A 5CSZA 4FZEL 2R8SH 1ZV2A 4FQJL 4PI0A 3BW9B 2JJSA 2F53B 3KW8A 2YZ1A 4ZFFB 4P2OB 3HJ0A 3BZFB 2R2HA 2V4LA 3KXFB 1D3CA 3VFOB 4GQRA 2VXUL 3NAAH 1CN4A 3O11B 1F00I 3OKNA 4ODHH 4N24A 1KLGB 4LRNL 3KYNB 2CJUL 3BVTA 4G8FA 1AMXA 4L1SA 1EFXD 3ABMB 3CFQA 3GIVA 3TYGL 5AAWC 3HRPA 4H1LA 5IVOA 4LEXL 4F3FA 2A6IA 4YHPA 1OV8A 1CZ8L 5AZEL 3WTXA 2Z4QA 4FNPA 4MDRA 2AVGA 3GMNB 4DGWC 3O6FB 4OT1H 1G7JA 2DDQH 2IH1B 2YN5A 3CXDH 2X09A 1U95A 1ZAGA 2B1HL 4OD1H 1EWHA 3FU7B 5IESH 1HCZA 2ILLA 3QQ9D 3MV7A 3MLTA 1S5IH 3UTZB 2Y2YA 3LEYH 3PQYB 3VWKC 4KKCC 4GW1A 4F92B 3BUTA 2W88A 2WLKA 3TJPA 4RSYA 5EB9A 1N3NB 4MZRA 3Q6FB 2WKLA 4BBWA 1NCOA 1Q1JL 4O58L 2AK4E 3HB3C 3MJ8A 2L7EA 4XO4A 1HZLA 3VI3F 2A77H 5EO1A 1UD5A 1OAZH 2VLKD 4OLUL 5KSBE 2QGEA 3D4CA 2PWDA 2FJFA 1T04A 1GMIA 4LSRH 1P4IL 4RVBA 1E30A 1EHXA 1TZIA 1NFAA 1YDPA 2C1PB 5T5FL 3RZWA 5JHAA 3D87B 3OAUH 4FF9A 3M8OH 2EO7A 5EU6D 3OMNB 3KPSD 2VMFA 4X0KA 5D7IB 3DGDA 4HUMB 1N0LA 1N7MH 3O6KH 4FXKB 5TK2A 1UACL 3UERA 1NBYA 4S0HA 1LEIA 2PPCA 3WMPA 3BP5B 2XWCA 1EEQA 4G1MA 4U7MA 2NY3D 3VB8A 2FD6H 5FYKL 3H42H 4F57L 1R1CA 1DUYA 3CZLA 3H7BA 2WXMA 3D39A 3BVXA 2AXGB 3CPUA 4JEGB 1SEQL 4GH7B 3LKRA 3U2SA 5EPMA 1NGPH 4XBEH 1T3FB 1DSYA 2X4OB 5HHVL 1UKTA 1T0NA 3HG1E 3OGCA 1Z9SA 2YUXA 3OG4B 3TH2T 2JKSA 1TCMA 4K7PL 5BO0D 5CIPH 3DPDA 4HGWB 3ATDA 5AKRA 3QB7C 4ATWA 3U0WH 3IAQA 4OGYH 3AGVA 3AU1A 1G87A 4P9MH 4GG6F 1KYAA 1ZPLA 4Y5VA 3LMJH 4H8PA 1DJYA 2YRZA 4DP2X 2DMBA 1P7HL 3JWDH 2WXGA 5K9OA 5CBAB 1NMBH 2EXWD 2FBRA 1XWVA 2BIIA 4HEME 1FUNA 3T2PA 5G4MA 5ITFB 3NDYE 1GOHA 3D9AL 4IJ3C 5LWYH 1IQDA 4NC0B 3QIUD 1WGOA 2G3MA 4WWKA 4J7RA 2HAZA 3HR6A 4JJ5A 4G7YH 4XE5B 5DJYB 3IM1A 3O6MH 4OBSA 4XGZA 1OOAA 1HK6A 5EZJA 1Z5HA 4Y1AA 5EOCH 4L8CB 2OR9H 4B9CA 1F4WL 3U0TA 1U3HA 3X3FL 1ILUA 3ZUNC 1BG1A 4ORGA 2OTUB 3DPBB 4QRTA 4HSQA 1E4XL 2IQ9H 4FQQB 3VGDA 3MFGB 4FQ1H 4G8GB 4UV4H 5C0CA 2X28A 5FECA 4YHOL 3FO9A 1XGUB 2QELA 4U7SA 2Q7YA 5I18L 2YRBA 4J3TA 3H2QA 3JWOH 3L5IA 5CJ5A 5HGHB 4OFIA 4NQCE 4N8VB 1NBCA 5PAZA 3SPVB 3DO7A 2PCYA 2O1AA 1PD1A 3FBQA 3KPPA 4GAAA 3S88H 4NZRL 4OZIA 1CGUA 4KGLA 1SYVB 5HP5A 4C4KO 3QHFH 2JQMA 3WXVH 5LG1A 3T4AA 2GFBA 2Y2TA 3D12B 4TNVF 2VR8A 5JDJA 2H6OA 3VXNA 4BEIA 1DQLL 2X4QB 4FZ8H 5E6SB 4BFEA 2GJRA 4MWFB 3MYJB 4PJEB 5DYFA 1BF2A 4LVNC 2J73A 1ECZA 3MXVL 3C5JB 3IVKB 4YN3A 5C0NC 3GXDA 1FNEA 4ANWA 5GGQL 1KJMB 3BQUD 2OL3B 3H9HA 3MV8D 2J1ZA 5DMYA 3IFPB 4MD0A 3LSOA 4YHZL 4YQXL 3RGVA 3NIFF 2VO5A 5M94B 3RPBA 4GQQA 3C8HA 1J0YA 3D3VE 3HC3L 1NKRA 2OLDA 3D18B 3ESNA 3WNPA 5KN5B 2V7HA 4I3RL 4F7MA 4PJIA 1J0JA 4PJ9A 1T21A 5LGKA 1HHHB 4X4XB 1RUQL 3QO0A 4QRPB 2X2IA 3VI4B 1TOXA 5A43C 4NQVA 5TDPA 3ULUC 1T83C 1U8OB 3FFCB 3RL1A 1Q1PA 4OI7A 2KL6A 2DEYX 2XXGA 2FT8A 3G5ZA 3LIUA 4Y4KC 4C59B 3ZTNL 4M00A 3WFCL 3BPCA 2OX5A 3SE4C 3UFIA 1MCWW 2A5UA 3QJRB 5LBVA 2E3VA 4HLZH 3UTSE 3KBEA 4UQ3A 3UMTA 4QHKI 3DRQA 1XCWA 3OLIA 4PGJA 5HYJD 4PJDF 2OMVA 4XTRD 4QHUA 2K3TA 4UT9L 1XH3B 3FT4A 1QBLL 3GSOB 3OKEB 2NXZC 2VXQL 3SKJL 3W37A 4OD3L 4GP5B 1N9PA 2P5WA 2QEJA 4D9RD 3APNA 2OMYA 2CDGA 2P49B 2WWOA 1VPOH 2HZHA 2ZCKH 2A73A 4XVJH 1T80A 2QTVA 2JK5A 3ZDZF 4G9FB 4CVXB 4HUWA 4NQXA 4CSSA 4HT1L 3V0EA 1FAKT 2FBJL 5ESAA 3CN3A 2Y5TB 4GQ9L 2VNCA 1JDDA 5IEKA 4JM0A 4NM4H 3QPKA 2DM2A 4WVRA 2FRGP 1EHKB 3MRGB 3Q8EA 3QNXB 5J6SA 2IAND 1ZY9A 1W0WB 4L5FE 4M43H 2E56A 4BE6A 3VXQA 5CEXA 4N9OB 5CZXD 2Q8BH 4BFFA 3GHBL 3C5ZA 1OGAD 2IPTH 2FSEA 4FMKA 3IMUA 3TT3L 3SDAB 3G5YA 1T89A 5F1NA 4TXVB 4LOEA 4UT6A 5J6GA 2BNQE 5ANHA 1P53A 2IFGA 1H5BA 2NYKA 3QUML 1VF5C 1DEEB 1NAML 2AJSL 3O9WC 4M62L 5T1MA 3KYAA 4JO2L 5FWQA 2QVTA 2QZ5A 3HRZB 1MF2H 3QXWA 1A7OH 1OW0A 4X4YB 4L29B 5D7LA 4IKIA 3DGCR 2H8PB 1TYJA 3DSFL 3L9BA 2YQ2A 2V8MA 3FFOA 4IU2A 4Z7UA 4ELKA 3GBNL 3HE7C 1RZFH 2ATPB 5I1KL 3FCTA 1OSPL 2HTLD 2JV6A 4KKQA 3A4EA 4YDNA 3VXUD 5AVRB 1E6OH 2CUHA 5ID1A 1TQWA 5B38B 4PGBA 2VLRA 4BQ9A 4DZ8A 3AXLB 1ML0A 4RDQG 3GHEL 4H13C 1A4KA 1F4XL 4X8XA 3WUZA 3VGAB 4GMTH 3W3BA 4QNPE 1OB1B 1SY6A 4MJJA 3FTVA 4UBDD 9CGTA 1T4WA 2EVJA 5I1EH 1P7QB 1UT2A 4F80A 2V8LA 5F71A 2LE9A 4Q4IA 1CFNB 1U36A 1D2OA 5K1VA 5E8DH 3BVWA 2OYMA 2C9XA 3D8MA 4TNWF 1DO5A 3GLAA 4N2OA 4QRBA 1CFVL 4K23L 4L8DB 3U2SB 1UM5H 1LXMA 3EDJA 3SGKA 5DUBA 2D9QB 2BM3A 5AOMA 5SX5H 1P7BA 2HJFA 5EU3A 2A6KB 4R6UA 4X6DB 1Z7JA 2VRQA 1M6UA 1XD1A 4M03A 2F1AA 5AAWA 2NY4C 3OPUA 4GW4B 4UINH 1N5AA 2EYTB 4PJAE 3A6OA 4QYAA 3HG5A 1P84J 3F7YA 3KPOB 3BUQA 3MV7D 4XPGH 3IFOA 1SGKA 2JLPA 5FYJE 1Z5LB 1OWRM 4V11A 3C9NA 4L2LA 4CJ1A 2J88H 1JVLA 3GSVA 2XUWA 3PGFL 2A99A 2O5NA 4HCIA 4Z76B 4HPHA 3VWKA 5F72S 1BWWA 2KYIA 4LSSL 2NW3B 5KBNC 4Z8FH 2IAMC 2EDMA 1EDQA 1O9ZA 1RJCA 5JNYB 1FL5B 4NO3A 3C8KB 2X4NA 5GGSA 1BQRA 2L3BA 5AYTA 2ZKWA 5C0FB 4B7IA 1SBSH 4OZFA 5DJZB 1JZ7A 3B9AA 4M8QA 2D3JA 3VYNA 2YFNA 4MCZB 4KK5D 4BINA 3L5WA 4LSQH 3VACA 4AW4A 4B6ZA 2IH3A 4S1DD 4M6NL 2OR8A 3MOAH 4PS4H 2W65B 5F6IC 3AAZB 2BP0B 3A0OA 1W0VA 1XCTA 3D39D 4MB5A 2DL2A 3WKPA 1DVFD 1PVHA 1YQ2A 1BQHB 1UB5B 3ROLB 4H1LG 1B3IA 4TF4A 1MCOL 1QFWM 2EXSA 3SJVA 2WKOA 1NM4A 3BSGA 2R1YB 2CHDA 4X7SH 2PR4L 3ABZA 1T1WA 3EJZD 4AXWA 4DN3L 3T5WA 2F7OA 4TQ8A 1LP9A 4JY6A 1FYTE 1FNGB 4LPUA 3T6WA 2OCCB 1F8TH 1NEPA 1I8AA 2DLFL 4N2FA 4XAKD 3WUWA 4WNQB 5I30L 4LRIC 4FA6A 2FEJA 4KJQD 3L7FA 2AK4B 3D7PA 5F7DB 4WW2F 4QHLB 5DFVC 5IQLA 3JV0A 5KSBB 1LEKA 4HH9B 1IGCH 4JFED 5JHLA 1RZGA 1ZHBA 4XN4A