3S7GA

Aglycosylated human igg1 fc fragment
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
208
structure length
208
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural Analysis of an Aglycosylated Fc
rcsb
source organism Homo sapiens
total genus 33
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s7gA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s7gA01
3SE8L 4MCZB 1A3RH 1K4CA 2OXGA 4M1DL 3GMMB 2ICEB 5KSBA 3O3EB 4LDLB 1OSZA 4X7CC 5IK3B 3WJJA 3PP4L 5DHVB 3QXVA 3WCYA 1HHHB 3OV6A 4NZTL 2H32H 3N50A 3VGAB 2V5YA 3GHEL 1T6WA 3CZFA 5I15H 2I60L 4OZGF 4JFDB 3FCTA 3CZJA 3SQBA 2RCSH 5HHMB 1LNUB 2WBJA 1EMTH 2FX8L 3FB7A 1P9MA 1QKZH 4HWBH 4JFFA 1JMXA 4XCYA 5HPMB 1BIIA 4M6OH 3RWGA 5GJSL 3VXUB 2A0LC 4TRPH 3MRJB 5FYJU 25C8H 4FFZH 5D2LF 1AGEB 3WNPA 3MQIA 1FZOA 1KIRB 2VZ3A 2P43B 5T5FH 3M8OH 3MRNA 2J7LA 5K33A 5C0ND 3FOMA 5FA3B 5DMIL 1CVSC 2AJ3B 3Q2CA 2XRAH 3QXTA 4OCXH 4AMKH 2V2TB 4YJZL 3B2UD 2ED7A 1KNOA 4M7KL 2C3VA 4K7PY 2CUHA 3LKNA 3DURB 3MRCA 3AXLB 4LKXB 1HZHL 4O2EB 1I9IL 1SJHA 1RK0B 3DUUB 5I66A 3DVGB 5BRZA 1XGRA 1QVOA 1VA9A 5DJ2B 4HUVB 4FQLL 1R3JA 4C4KO 3QG6B 3SJVA 3FAXA 3C8KA 1IGFL 3L5XL 3EOAA 4NQDA 2FX9H 2WWMD 2DB8A 1IGMH 3CFBA 1INEH 4MA1C 4JRXB 5T3ZE 4R9HA 5C3LD 1TMCB 5IFJB 1N26A 1E4JA 3MODL 4NBYB 3KYAA 3NVQA 3BEVA 3ZYJA 1T0MB 4Q6IC 1JPFB 3H7BB 2R56H 5F1IB 1NGZA 1IQDB 1MQ8A 3U79A 3HNTL 1RMFL 5DQJB 4HS8H 3NMEA 5JPMA 4G6KH 15C8H 3VFNB 5JHDB 4PRIE 3V6BR 2Z8WC 2Q86A 3BPLB 4NCC2 2V9QA 4JFPB 1NGYB 5I1AA 2HH0L 5JW3L 3SCMD 4MA3B 3OKMA 2BVYA 2HP4A 2Z8SA 2B8OT 3NZHH 4Z8FL 5AZ2H 4Y4KA 4Q9RL 4XRCA 3V0AC 5H35A 4DQOL 2DQCH 4U2ZA 2FX7L 4ZNCD 2AI0H 3DUHA 3Q6GL 4BZ2H 3QP3A 4JPWH 4JFDD 5K9KB 4I18B 5EZJB 1Q0XL 5HHMD 5EUKA 1JPTH 4J6RL 1JFQL 3B2UC 1IQWH 4TSAH 3AM8C 5ETUB 1T89C 1T3FB 5IT2H 2W92A 1FYTB 5C07B 4JPKL 5T3XE 1L4IA 2UWEA 4L1DA 4U6XA 3VXUD 2IGFL 3LRHA 3O3AB 5D7LB 2NZ9C 2VLKD 1KB5L 4ODTH 1NLBL 2AQ2A 1E27A 1M7XA 4KRLB 4OFPA 4JQXA 4G3YL 4NN6B 4WUUB 5H94B 4XVJH 5H8DA 4TN9A 3SDYH 1OTTC 1OAQL 3ES6B 4OUUB 3PWVB 2Z92B 1BFSA 2OTPA 2VLLB 4FQCH 1WUNT 5D1ZB 5C0GA 1A6ZA 5BCAA 3HRZA 3GMOA 3RWEB 2VSCA 1D6EB 5C0AB 1RAMA 1H0DA 4YHMH 5F93C 3OKEB 4JM2F 3N1GC 4JQIL 2G60H 3THML 3RZWA 3BUYB 4JPVH 1DQQA 4XNZC 2H1PH 4ODSH 5JOFB 4PJFF 4X7SH 2OL3A 5ANMB 1FH5H 3AS0A 4N8PA 2ITDB 3U4EA 4MJIA 4F80A 3TO4B 3MC0A 5I8OL 2JJVA 3T0EE 3O2DA 5DK3A 4JRXD 5L8JB 5EU7E 2BY3A 3DVIA 3WNLA 2EC8A 2EO1A 3NAAH 4XP6L 5CGMA 3OG6B 5IFHL 4AM0B 1PAMA 3U7YH 4KTYA 1GGIH 3NFNB 2R1XB 4MJ2A 4ONGH 4RNRB 1VDGA 4JFOA 4IOSD 2UVFA 1T66D 4EI6A 5GGQL 5JHDD 1KIQA 3PGCB 2IADA 3ISWA 3RPKA 4MXVF 4B53A 1RUPL 2EIZB 1QSFB 1HYRC 3ARGB 3OKLB 3CJJA 1G7MA 1IGTB 2AXGA 1CLYL 1T2XA 2XXCB 4JM4H 3BZFB 3MV01 3WN5A 4YHYC 3VRJB 4KRNA 3BQUB 1W72L 4PJ7E 3DMMB 4MLSA 2ICWB 4F57L 3L3OA 4MB3A 2I5YL 4AEHH 2VDML 4NDMB 5BV7B 1MFCL 1DCLA 1OP3H 3G6JB 4C54A 4U1JA 4NNXB 3U30B 5B8CA 5E08H 3KPPB 1FYTD 3BZEB 2GFBA 3IFNH 2VLRE 1U8IB 1YEHL 5C07D 1Y6KR 5JXEC 1KEGL 1TZIA 2DLEA 3GRWL 4UINL 3HG1B 3OKKA 3V0WL 1SQ2N 5D7LD 4I5BA 2VDKL 2QR0B 1AR1D 4YGVB 1UYWL 5ALCH 5B3JF 1U8QB 3GJFH 1F2QA 1K8IB 2NNAB 4WUUD 4QGYA 2Z31A 3MOAL 4NZDA 3BHBA 1QBML 2VDPL 4S1QH 4OCRH 5HGHA 5I2IA 1RU9H 1T21B 2LAGB 4YHLH 1LO5A 4HG4J 5D7KD 4BSWA 4GBXB 5IR1B 2XFXB 5JW5A 1FVCB 4QXUH 5GS2D 2GITA 1RVFL 4U6VH 5F1OB 4HUXB 1C1EH 4OZHF 2ESVB 2ZOKA 3JWDC 1IEHA 1E6OL 1J9CT 1T66C 1AGCB 3FN0L 4OV5B 1H3XA 3IFPB 3HAEG 4FQHA 1X5XA 4WY7L 2JJUA 1MCHA 3FZUD 5HDQH 4PJEB 3GSNL 1QO3A 4IRSC 2A83A 4JHAL 4MQ7A 4KDTC 3TO4D 4FFYL 3IVKA 2Q76B 1OVZA 3HUJB 3NZ8A 3IKCA 4ENEC 4M93C 1IGYA 2HLFD 3CPLB 4G5ZL 2ENYA 2R0WL 4HJJH 5HYQB 3ARDC 3LMJH 5TDNB 3GBNH 2KUTA 3RWCA 1FAKT 2NY6B 1FORL 4WTZG 1ZLUK 3MLRH 2FJFA 5A2FA 2WUBL 4G9FA 1MJ7L 3VXNB 5KSUB 2GAZA 4GG6A 1T1WA 2Y9RT 3VXMA 2NY2C 1QSFD 3ARGD 4NN5C 4L3CA 1WWAX 1PGRB 3TP4A 2G9HA 2VB5A 1YNTA 3AS1A 3MRFB 1OTSC 5E99L 3BQUD 2PXYA 1GAFL 4Z78A 4NRXB 3S4SB 3DMMD 3MLSH 5T33L 1BVLB 1GXEA 4NN6C 1RJCA 3I6LD 4HFWB 4ZS7L 4M03A 2XZZA 1VCAA 5KSVB 2BMKA 4TPRH 5H37G 1T04B 3EFFB 4JN1L 3MRLA 4MNGA 4GMTH 4JFEE 3DVNB 1QEWB 3VFVB 3LDBC 1KB5A 1SVCP 3FB6B 4WHCA 3HC3L 1UJ3A 4ZUSA 1Q9WB 2H9GB 3G5ZB 5E5RB 3P0YH 4X9IA 5AWNL 5ESAB 1LWRA 1NFDF 3HG1D 5JO5B 4DEPB 4P2OB 4F15B 1FSKC 3LRSB 4O5LL 4MXWL 1RHHA 4AEIH 3PHOA 1I1AB 5DK0B 1JHLL 3ARBC 3UBXB 4QHUA 3FFCB 5DHVH 5IJKC 1N59B 2XWTB 3AUVA 4U1NB 3OX8B 3DXAA 2HLFC 1S7XB 8FABA 4GBXD 1S3KL 2FB4H 4I2XA 1MEXL 2J5LB 5E8NB 1FL5B 4WTWA 2YC1A 2VO5A 3WHXB 4X5XB 4X9HA 2CD0A 4Z7WA 3PV6B 2ESVD 4GQ9H 1GC1H 1EO8H 3W5MA 4HGWA 1CIDA 4YXKL 3W0WB 3EJJX 4QXTA 1R24A 4Y4FA 2R2EA 4H20H 4ZSOB 5E94B 5GGRY 4UDTA 3T4AA 4PRPA 1OLZA 1TETL 4NBZB 1RZ7H 1SYVB 2FJGA 4M7JH 4L4VE 3DX8B 4WFEE 5EZOL 4HWZB 4LPYA 5BV7C 1CG9A 2NY6D 2YD7A 3RGVB 1MI5A 2VJXA 3GMRB 3GJEA 3AAZB 4KDWA 4RBPH 1IAOB 4OQ1A 4X5LA 4Z5RB 5LBSL 1JGEA 1W72A 1ACYL 1MJ8L 2HTKC 3K8KA 3ZE0E 1G7JB 2IBBA 1C16B 3VFTB 2C5DC 4PGDB 5E00B 5HGDB 3UPRA 5KS9F 4K3EH 3MOBL 3B6SA 2AKRB 1IBGH 4KKAD 4JHWL 3IJYA 2DLGA 4JDVA 5GGSY 1BF2A 2O61A 4CDGC 4L8SA 1Y0LB 3NCBB 4S1SL 1ZKAA 4R4ND 2P5WA 3GRWA 4GBXC 1U9KA 4HHAA 5EU5B 1TQCC 2QHRL 1QRNA 1A0QH 2B1AH 1D5IH 2J88H 1MFBH 3CXHJ 4OLYL 3EDDA 2PYEA 4P2OD 3WFEL 2OBGA 3VRLF 5CD3A 3TBSB 5C0CA 4PV9A 5EBGA 1YPZA 1K8DB 4D0BA 4IIQB 3KJ6H 2AXHA 1X5ZA 5ELIA 1WTGT 5LG1A 5GHWL 5DS8B 5DT1H 4F7PB 1I1AD 4ZFZA 3LKQB 4ZUUA 4L9LA 2Z8VC 3FFCD 3CSYA 5FA4A 4P9MH 1MAML 1U3ZA 3DYMA 3QCTL 3G5VA 5I75C 1JGLH 1FL6B 3BN3B 4UQ2B 1MHPL 3DPBA 4UOW1 4ETQA 3MREB 1MUJA 4F58H 3MMEA 4I48A 4MCYB 5DFTA 1MWAA 5EU4A 1T5WA 4NP4L 2NY6C 2MWCA 1FG9C 3GSNA 2QQNH 1YECL 1TVBA 3IFLL 3V2AR 3ZDXE 3TA3B 3OF6A 3W0WD 4LGSB 1C7SA 4ZO8A 3NFPB 4URTB 4L8BB 2HJKA 1XCTA 3A0OA 3KPSD 3RNKA 4J2XA 1URLA 4PG9B 3MNWB 3IDNA 3MGOA 4XC3H 4O00A 4MAUH 4JKPH 4WI2A 3WEXA 4IEFB 4MHHG 5F7DB 1YJDC 4NZUL 3H9HA 3RGVD 1QSEB 3V6FA 3WFHB 4R4NC 4O9HH 2FD6L 5GS2H 1ZGLB 1EHLL 1ROWA 4FQXA 5F1SA 4WCYH 3X14B 3LEVH 2NXZC 4AIOA 1ZTXL 4KKBD 2A9MH 3KYMA 4GRWB 1IL1B 2XTLA 1WZKA 2IALA 4LLQA 2FSEB 3R4DA 3RQ3A 1IFHL 4AH2A 5DEGA 2C3GA 3O6ML 3BKJL 1A1NB 4JFDE 2FGWL 1VEPA 1YDPB 2BHZA 3SDDA 5HHME 1EIBA 1E4XI 3O2VH 3BYTA 1GPOH 1UXWB 3AY4A 3CZFB 4I9WD 4QHLA 1EUUA 4O4YL 4PG2A 3VXUE 5D96B 4O58L 2QSCH 2AJXL 1H3VA 3KYNA 1G0XA 2VLKE 2NMSA 4F9LC 2I27N 2XICA 5KOVC 2YWYA 3UMTA 5L2JB 1RQ5A 4EUPH 2A38A 3KPOB 3EYFA 3S5LG 4OZIF 4JY4B 1J7VR 4G8IB 5SWSA 2NYYD 4GKZA 4LVEA 1QFUH 1B0GA 2E5EA 4J1UA 3X17A 4QOKA 3DRQA 1Y18A 2F74A 4OCWL 1EJOL 3K80A 4NIKB 5C92A 1CIUA 5AD0A 3BD5A 4NSKB 5INCA 4YDVB 5F9JB 5F9OH 3DROA 1TJIH 5T1MA 3FTGB 2Y06H 5IOPB 4LHUB 5BV7H 3O4LB 1NFKA 1MH5A 3MRCB 5DD1H 4ZD3H 4ALAL 1Q9OA 1WBZB 4OGAD 3X3FH 2BVPA 4JY5L 3NPSB 4HBQA 2DMBA 4JRXE 1CI5A 4LRIC 3TA3D 2N56A 3EOAB 5HI4D 2QQKL 1U8HB 4NQDB 4AL8L 1DQMH 3VI4E 2B5IC 3BKYL 4KKBC 4P3DB 3BMVA 1FE8L 4JFZL 1KC5L 3CFBB 4LOUC 2OZ4H 3RFZC 5EC1A 1JTTA 4K7FA 2V7NB 1MCBA 4ORGB 2CKNA 4EIGB 2R9HC 5I71C 1DUZB 3T0BA 3S8WA 4X6EB 3F58L 1YEKL 2Y07H 1NGWB 2C3HA 5JHDE 3WS6A 5I1CH 2UUDH 1BHGA 3C2AL 1EFXB 2XWJA 3IDYC 4JO1H 2Y36L 4WUKL 3U46A 4RGOH 4YPJA 1N0XH 1QSED 5I1HL 2FWOA 4ELMA 3R8QA 2NQCA 4Y1AB 3TBTA 1L0YA 4UUJA 2Q86B 1AIFB 1E0OB 4UIKH 3ULVL 4JDTH 5KVGL 4XP5H 1K4DA 5IHUL 4ODUB 2A77L 1UB6A 3QUKA 1KTKE 4WRLA 1EVUA 2JJSC 1IJ9A 4XRCB 3QI9B 2HFEA 3WXWH 4LNRA 4OFKA 2DDQH 3LKSA 2EDEA 4F9PC 3FO1A 3H3PL 2DTML 4IOFC 1FYTE 4HCRA 3R0MA 4MA7L 5T1KA 5C07E 1NLDH 4KU1A 2CPCA 1YEGL 3I6GA 4NKDB 4PJXE 5D7LE 3AB0B 2BDNH 1VADB 3VI3E 4MLIA 4CU8A 4CUCA 2UWEB 5DO2D 3T0DA 3VMOA 4ZYKA 4WUUE 4ZTPH 3QXDA 4U6TA 4M8QB 1E27B 5F7EH 4X83A 2AV1B 5D7KE 3VFSA 4QHNA 2UZIH 1KACB 5C0AE 4M62L 1IM9A 1NCNA 4WHYH 5I6XB 3QFJB 1XCQB 1U8LB 4KJWD 4TYUA 3SDXF 1LO3H 3F62A 3WD5L 4M6NL 1KPUA 1HINH 1C5DB 1YQ2A 5C0GB 3QWRA 5A43C 3IDGB 4LHUD 3O4LD 5ANME 1R3IL 5E70A 1YJDH 4NNPH 4I3RH 3SOBH 1KPVB 5JPNA 2GT9B 4AT6A 3GIVB 2VZUA 1BQHG 1DQQB 3GMNB 4UILH 5I30H 5FO8B 2XNAB 4H8WH 2VL4A 4KTEL 2EYSA 3U4EB 3MXWL 4NQDD 4ODVL 3BDBA 5KTEL 5GS0C 4HF5L 4LLMB 2OJZL 3ZDXF 1UM6L 1OCWH 1WFTA 5I8CB 4RDQF 2DMKA 3WJJC 3EHBD 2HRLA 4D9QD 3S88H 3U4AA 3WFDL 1LILA 1TJHL 1EFXD 3L3GA 3BDYL 5D7IA 3X12A 3RVTD 2GEEA 4N1HB 4XCNB 1I85A 4Q7DA 3PGDB 3CMOH 4OCYH 1QSFE 1OW0A 3VGEA 2VLJB 2WBJC 5D96C 4Y1AD 1P9MC 4P4RB 1E4KA 4X4MA 2OR9H 3JXAA 4J3TA 2CRYA 5HTSA 1FZMA 2DF3A 4JQVA 2IADB 4U1SB 5GGVL 4EN3A 1UM5H 3IETA 1TITA 5DJXB 3GUTA 4MWFB 1PYWB 2OJEB 3U4BL 1WZMA 3QDAA 4XI5D 4Z18A 3QQ3A 4M43H 1GSMA 3I6LE 2R69H 5D1QB 1EEQA 3DGGB 2AXGB 1QQDA 1HHJB 3QI9D 3G6JE 3ILQD 3G08B 2LQRA 4LVNB 4IOIB 3CFJB 3J7HA 4CADA 1J1OL 1RZ8B 2YBRA 3QXAB 1B0RB 4KUZL 1P4LA 3E2HC 4X6CF 1FN4A 3MLPA 4KJWC 2GJJA 1C5BL 2YEZB 1MAJA 4UT9H 3HG1E 1FIGL 4BSJA 4OGXH 2GFBB 4QRPB 5DDHB 2I9TA 2P5EB 4MD0A 3F12A 2X6MA 5EBWB 3TIEA 5CKGA 3HZKA 2NY4B 5FM5M 3TBWA 3BH9A 4YHZH 2AJYH 3NPSC 5DD5H 1HXMA 4U6HB 1X5FA 3QQ9D 2E8YA 3FONA 3L3DB 4C58B 4R4BA 4R6UA 3OJ2C 5GGUB 4M5ZL 2I25N 3F5WA 3U9UA 3QO1B 3V8OA 3QFJD 1XR9B 4P46A 4UTBH 4IDJH 3PGFL 1UZ6E 4HC1H 1F3JA 2C1OB 3VD5A 2C3XA 1NDMB 2ESVE 2B7DT 5BXFB 1V05A 3OSKA 4JFQB 1FNGA 4WI8A 5E2TH 4JZOA 1MHCB 3B2VH 1M7IA 2BSED 1H15A 4NJAL 2BVOA 4K94C 3RVTC 4PJEE 4L8DA 2NX5A 2ZOKB 3VD4A 1KGCD 3B9KB 3H6JA 2GK0B 3HUJE 5C0JA 3WMSA 1FFOA 1EERB 4XPBH 3MRHA 4OD1H 4AYFA 2ICES 1OB1A 1PX4A 1U8JA 2JJTA 5DD6B 4LASH 2H8PA 3LH2H 3UZQA 3LN4A 1FJ1B 1MCDA 2DOCA 3ILQC 4TSCH 1YY8A 2WWKT 1FHGA 2VZTA 4X6DA 3C6SB 1UGNA 3FO2A 1Z5LA 3VRIA 3SY0A 3TH4T 3V52L 3QPXH 1JL8A 4JN2B 3T2QA 2HKFH 2VLJD 4CGTA 2FJFB 4HIXH 5D7SL 3AB0C 2X1QA 2WQ8A 3MLYH 5CZXC 5J12C 1J12A 4ZUVB 3LQAC 3HPJB 1I7ZB 4JFYB 4L5FL 2IG2H 5AG9A 3FB8A 4N9GB 2VE6B 5D1QD 1YNTB 1QA9A 4UT6L 4WGVB 4LF3B 1JUFB 1WLHA 5L7XH 2CH8A 4JQXC 5FGRA 5JR1H 1K9TA 5HHNA 2JK5A 2COQA 3QFDA 3TN0A 1ZS8A 1UVQA 1FGNL 32C2A 2YUWA 4OF7A 4WV1A 1NCCL 1F4YL 1L9MA 3FT3A 3VXPB 4U3HA 1FV1B 1A5FH 2P5ED 4Y89A 3L5JA 2CDEA 2NY5C 4TNVK 1QHPA 1HH9A 1UJ3B 4KK9D 4PJXF 1S7UA 2NY4D 3C5JA 1TZHB 4HEME 3U2SB 5EIQA 3P73B 3RL2B 4JG0H 3WIHA 3G04B 4DTGL 1IAIM 3FFCE 2VNCA 4EI5A 3T8XA 5IROA 3LD8C 3LS4H 5IKCB 1F11A 5GS0H 5HY9B 4GRWH 4ZQKB 1PVHA 2CJUL 3PHOB 3A67L 4FG6C 2PETA 1KT2B 4ZPTA 3TH2T 4QHUB 3OJVC 1OT2A 5DGRA 5AG8A 3D0VA 3GI8L 3E6FA 5KANI 5CHNB 4JO4L 4Y5XA 1BP3B 3P11L 1DP0A 5I0DA 1PEWA 5HI3D 2WAHA 3ZKMD 1CF8L 4G80A 4OGYL 3MFGB 5TFSL 5CP7B 3W0WE 4KMQA 4ZSOE 3B9KD 1G7PB 4OT1L 1G1YA 4PJHA 1DQLH 4GSDH 4YC2B 4LSQL 4TUKH 3IDIA 4FXGA 1ZHNB 4ZOEA 3WDIA 1UH4A 1R24B 5FDWB 4D9RD 4Y8AA 3IXAB 2K7PA 5EFIB 3FO0L 1PJ9A 2J8OA 1A9EB 1NMBL 3QH3A 3E8UL 2Y7QB 3MRIA 3WN5C 2IFGA 1C08A 4XCFH 1NGPH 4LVNC 2CLVB 3MRKB 3QA3A 2X70B 1XGYH 2HA1A 2R29L 4OB5H 3D2UB 1TTUA 1KV3A 4JANB 2QKIB 5C0BA 5J3HD 4BQ9A 4XMKH 4CVXA 5B8CC 5C8JA 1J1XH 1OL0A 4H1LB 2K3TA 3SGJA 1ZA6B 1DFBH 1CZ8L 5A2IH 4Z7QF 5D9SA 5HHPA 4CVWA 1MIEL 2MPAH 5DUPH 2A9NL 1S9WA 3P0VH 4GFTB 4I9WE 3TF7C 1HKLH 4ZS6C 3KPTA 3K7UA 5EUOB 2GSGA 3UPRB 1JPSH 3V5HB 3ZKXB 1QBAA 4KPHH 2W60A 4JE4B 3BKMH 3R0NA 2Z31C 1NCBH 1V7ML 3G6JF 3UJIH 3C5ZB 5KVFL 2CLZB 1LEGA 3AMKA 4OSUL 3WXVH 4JDVB 3DLQR 3SDCA 3LRGA 3ZDYF 4R97B 3FT2A 2P5WB 3REVA 2XT1B 3RPIB 3WO4B 2QHLA 4HUUA 3CH8A 1Q9KB 5IBLD 3MO1A 3ARQA 2D4FA 4K94H 4R90H 4KGJA 5M95B 4KK8D 5HI3C 4EOWL 4G8GB 5DRXA 4Y88A 5L2KA 5C2BH 1YPZB 2QQLH 1U0QA 3MR9B 4Q58C 3O6KH 1F02I 4CL7A 4OGZA 2BNQA 4FN0A 5E8DL 3NIDE 5F88A 1CFQB 5D8JL 3T1FB 2RQ8A 3DXAD 4XWGL 3KHQA 3GSWA 3PIQB 3WIFA 1BX2A 1AXTH 1JNLL 4HWEH 1A6WH 4M1CD 3MCG1 3I9GH 1S7QA 5J3HC 4DFHA 3GSNB 4N68A 3V4UL 2QEJA 4HLZH 5ICYA 4Y5YA 1V7NL 1YEJH 1J8KA 4HIJB 3R1GL 3TVMB 4F7EB 3TV3L 4BKLA 5E7BA 4IMLB 1YEIL 4CVUA 4NWTH 4GW1A 1XCTB 2YA1A 4OZFB 5A2LH 5FYLL 4PS4L 4YK4B 5I8EA 5GS1A 3BIKA 2PXYC 1LP9B 1QSEE 5CINH 3GEWB 3D2UD 2D0GA 5IJVA 3BP7B 1PKQA 1ZE3C 1W0YT 1IGJB 2AERT 4PJ8B 3FQXA 4RZCA 1Q72H 5EN2A 2IPTH 3UTSA 4GRWE 2X4TB 3DSNA 1FFRA 3HMXL 4XWOD 4QRUB 5FHAL 3EYQD 1A6UL 2NY5H 4D8PB 2YS4A 4FQIH 2WBWB 1UJ3C 2IALB 4B7IA 4CAGA 1EGJH 3KPNA 2W9EH 3BW9A 1VFBB 3BWAB 2MCPH 3ZO0A 1FRGH 5HVHC 3CVIL 2H2PC 3GDBA 4KY1H 3SDDB 4L8CB 2P47B 1UXSB 2OQJA 1WWCA 4FZ8L 5CSGA 3Q3GA 3LZFL 5LKNA 3C5ZD 3KR3H 3HAEA 3RI5F 4BFGA 2JIXA 4MDJB 1U3JA 5HI5D 2P5WD 5T1DL 3JTTB 1I1FA 3CDGB 3QNZA 1M71B 1XF4B 3STLA 1QP1A 4JRYB 1FP5A 3GSVB 4G8GD 1CR9H 1AC0A 1DR9A 3D39A 2DYPA 1HOCB 3SE8H 1II4E 3F6IA 1T22A 3MUZ1 3V0VA 5ITBL 3PP4H 3DYPA 1B0GB 1IARB 4OLWL 5LAXB 4WTZA 4NGHL 5D5MB 5I0ZA 3DRQB 4Y4FC 3VXOA 4NZTH 3V5KB 4E41B 5CEYB 3O4LE 1CT8B 2ORBL 5AD0B 4IRJB 2I60H 5IEHA 1WBYA 3VFOA 3BH8A 5T1MB 2FX8H 4XTRD 4X6BA 3QNXA 5ACLA 4PJIB 4WW1B 2YPLA 5IVXB 4NQDE 4JR9L 5GJSH 1TNNA 1OGAB 4C83B 3VFRA 1LE9A 2PF6A 1ZLVH 1F3RB 2BVPB 4XWOC 4X98B 3IDXL 3Q48A 3O11A 4GAYA 4WJ5B 3ARFA 3OF6D 4YPGB 4Q97A 3J8F7 3VFMA 4GUPA 3RVVC 1P6FA 3TVMD 1CGVA 5FKPA 4YZFE 2X4NA 4D9QE 4H5SB 2WSKA 1DL7L 5DMIH 1SYSA 1MVUB 2NY7L 3RGHA 1DQJB 1E4WL 4Y1AE 4NZJA 3WV0A 1ZLWK 4PJ8D 5GIRA 1ORSA 1HZHH 4I3SL 2V9TA 4L8SC 1VFAB 1JE6A 5HI5C 5GXBB 4UUJB 1J11A 4LSRH 2QL1A 1YYLH 1MCKA 3OGCB 3VG0H 3L5XH 4D9LH 4UZGA 5FM5O 1G0YR 4IMKA 1UFUA 1IEAA 4HUWA 5D70L 5TE7L 4LP5A 1NQBA 4RIRB 3MODH 2BXYA 3BWUC 4HKBB 3SDDD 3RTQA 3UAJD 1H5BB 1X5YA 1ES0A 1NUFA 3VDAA 1N2RA 4L9LC 4ODXB 4UOW0 5T1KB 1OARL 4EVNB 1KJVA 2UWEE 5DC4B 1I9RL 1RUQL 3HNTH 5IMOB 1OAYL 1RMFH 4P49A 5AZEL 3TPKA 4XTRC 4Z9KB 5TDPB 5CFHA 1MHEB 2HRPL 1MJJA 4LU5L 1Q94A 4JRYD 4Z6AT 5JW3H 4ZYKB 2WANA 2F53A 4KKCD 4QXGH 3QUML 4Z8FH 3QFJE 4NKOB 4DQOH 2YUXA 3H8NA 3KYOA 4C55A 5JXAH 2BOBB 4E41D 3TZVA 4KZDL 2ED9A 2G5RA 4C56B 3Q6GH 1NUNB 3L9RB 3QZWG 4ZXBB 5E1HB 2X89A 3DX7A 1FG2A 2LE9A 4IRJD 1T80A 1XGTA 2VDNH 1VERA 4TUJA 5IB5A 1KJ2L 3NIFE 1KGCE 1JFQH 3NIDF 4J6RH 4LLVA 5J1AB 1JGDB 4GKSA 4JKMA 1WWBX 1B90A 2WZPD 3UTTB 4DN4L 4JPKH 2HLAB 1OGAD 2Z91A 4BH7A 1ZWIA 2IGFH 5E8PB 1Z3GL 5DEZA 1Z9OA 1DVFA 4IHOA 1X4XA 4ERSL 2EYSB 1NLBH 4LQFH 4FQXC 1KTLB 3S7GA 1T1YB 1YC7A 4JO2L 1XF3B 4NQSB 4G3YH 4GW5B 4BQCA 3F7VA 5FGBA 2FEEL 1OAQH 4NUGL 2ZOLB 4EXKA 1AY1L 1I8IB 5KG9A 3SDDC 4M8VA 1TDQA 4F33A 2VLJE 3ARUA 3UAJC 3HMXA 43CAB 4GS7B 1LD9A 3CLFL 3Q5TA 3U7AA 4GJTB 3PV7A 5EZLB 3AREA 1T5XA 1FZMB 2WV3A 1SY6L 2WP3T 4GRWF 4JKLA 4WHTB 3KS0J 3GK8L 3GIZH 3KPLA 5KSBF 3R06A 1J0KA 4QWWD 5CEZD 4I77L 1AE6H 3QEQA 2ZCHH 4RFOL 5AUMA 3QHZL 3A6BL 1KYOJ 2MFNA 2IANA 4ZFOB 1MFAL 1WIUA 1P4LB 1GCFA 5IFHH 3MJ7A 4QRPE 5T1KD 1U41A 2P5EE 5C0RL 5EO0A 4C59B 1L7IL 2OR8A 2X4PA 4ZNEA 3CVHL 1AHWB 2IC2A 3D25A 2MNUA 4XGZA 5GGQH 5SWZB 4F37F 1KELL 4QF1B 5KJRL 5TQ2H 4WFHD 4GO6B 5EU3B 2BHYA 5INDA 5I1JL 1JMZA 3HZKB 3UBXI 1RUPH 2NY3B 2AJUL 4H1LH 3B4NA 3FQWA 4YFEA 3WHE0 1CLYH 3F7YA 1W72H 1KTRL 5B39G 1JYXA 4GQPH 2NW2B 1MF2H 3MUHL 4C56D 2UYLB 2VXTH 4ZXBD 5HDBE 3BOVA 2VDMH 3W9DB 1JIBA 4R96A 1MFCH 3K1KC 3PDOB 5DF0A 2C4FU 4CW1B 2XKNA 1XIWA 1JP5A 2PTVA 1PZUB 3KDMA 1M7IB 4APQA 1YEHH 3K4AA 5SX4H 1KEGH 1VFMA 4D9RE 4HPOL 4PV8A 3GRWH 4UINH 3U0PB 2MQ3A 3V0WH 4WI3A 1FFOB 2VDKH 4NQEB 2WLZA 3MRQB 1YY9D 2FYYB 3EAKA 1UYWH 3VGGA 1RY7B 2K1MA 1X5AA 12E8L 1P7QA 2A6IB 4QWWC 4H0GA 3FN9A 1QBMH 2VDPH 4ZFFA 4JLRB 2AJVL 3KLSA 3P9WB 4M7ZC 2NTFA 3CD4A 3QG7L 4YZFF 2CMRL 4PLKD 4DZBB 2AJZA 1MVFA 1WC7B 3CFCL 4Y19B 3S5LA 4P5TA 5E8EB 1JYVA 1NBVL 1KN4L 1MLCA 1T7XA 4YDLC 1ERNA 4F2MA 1E6OH 2P45B 2WUCL 5ADPL 3X11A 4MXQD 3DX9A 5F6HJ 3GSNH 4PBVC 1U3HB 1EUTA 4JHAH 4FFYH 1WQVT 1HWHB 1TCRA 1A6VL 3BGFC 1S9KC 4YEFA 4YR6B 4G5ZH 1Z9SA 2R0WH 2IAMB 5DR5H 4GRMA 3BI9X 2YZ1A 3TN0B 1PD6A 1OP5K 3IFOB 5IESH 1FORH 4GRLA 4O02L 3ZHKA 4KAQL 4HUMB 1G6RL 3UP1A 4CNIA 3WUWB 4MJ4A 4QCIA 2WUBH 5SWZD 1KENL 5DVNA 3WL9A 1J0IA 4KK5D 1XGUA 1QFWM 3QUMA 2UWEF 2YPKB 2LU4A 2VMFA 1MJ7H 4M6AA 4N8CL 4LCWB 2ADGA 4MJ5A 2AS5M 3DNKA 5BVJA 3RJQB 3VU2A 2F5AH 5DD0L 1F11B 3QJHB 2YSSB 1FO0L 5E99H 1QR4A 1GAFH 2DI7A 5TH2B 4OAWB 5T33H 4JAMA 3CC5B 1KJ2A 4Y7MA 4ZS7H 4Z7WE 3MRRA 1CDYA 4K9EH 3CX2A 4PRBA 4JN1H 4LMQE 2IEPA 4Y5XB 3QXUA 4EJ1C 2OK0L 1N64L 1ADQH 4GS7C 4QTIL 1DTUA 3NIFF 3O2WL 3HC3H 1HQ4B 1I85C 1NCAL 1N8ZA 1CYGA 3W9EB 5IUSA 4K71C 5AWNH 1OW0C 3BIBX 1E4KC 2PO6A 2Y4SA 4O5LH 4PJGA 4G8FA 1KLGA 3I50H 4MXWH 4JQVC 4OBSA 4EN3C 5EA0L 5C0FA 1CFBA 3RNQA 5I73B 5F71A 1HSBA 1MCWM 4MXQC 2P44B 3MJ9L 1JRHL 1RJYB 3MRIB 1HNGA 1S5HA 3MNVA 1P1ZA 1U8OA 1NSNH 5E03A 2V5SA 1U93A 3GGWA 5HVWA 1F4HA 2QSQA 1S3KH 4PJCA 4Y19D 4DVRL 1MEXH 1SY6A 4M7LH 1CLZL 3PJSA 1TVHB 3HE6B 3QXWA 4JO3H 1AKJB 3QWOB 4N0UA 1AHWC 4PP1C 4V2BA 3I02B 1EZVY 5EUOE 4JEGB 1UQSB 1DN0A 4RAUA 4YXKH 1XR8B 4U05A 1U3HD 1A22B 3P4NB 3HCVB 4QY8B 4F7TB 3RUGB 4AK1A 4N9OB 4PJ5B 1ZLUH 1CDHA 5DUMH 3WKML 4N0YL 3SPVB 2NXYC 4XPHH 4ZAKA 3M1BB 1TETH 4B5EA 4PJDA 1BQHA 3W39A 1RFDH 2P5WE 3BP6A 3CVHA 2IAMD 2VQ1A 2FLBT 4WEBH 3TN0D 4U1LA 1K3IA 3L3IA 4RMTA 4G8GE 3RA7H 4HGKC 5IMLB 4YHOL 4HWNA 3SDCB 3T77A 1YMHB 3D69A 4LAQL 1TZGL 3PHQB 4OM0L 4MSWA 1CFVL 1RZJL 1YPZE 5JHLL 5F6IB 5CZKA 3BAEH 2AJSH 5LBSH 1ACYH 1MJ8H 4AQOA 5ECJE 2IMMA 4XC1H 3O9WA 5LQBL 4P9HL 1XAUA 4PGCB 3UX9B 4D0CA 4G8EA 1RUKL 4P2RA 2F8VA 2BNQB 3MOBH 2B4CH 1KEML 5CEZH 1KPRB 2JJTC 5HHQB 3HZYB 3B43A 3ILPA 1ZOXA 4JHWH 4JJ5A 5IP4A 1NMCB 1R5VA 4HFUL 4GG8A 4S1SH 1XH3A 5I16A 1BX2B 4K23H 3QSKB 3GFUA 5DD3H 1LE5B 3GJFK 3FQUB 3T4YA 5J11B 3FT4A 3ULVC 3TWCH 3P30L 4OLYH 4HG4K 5IQ9B 1YUHA 2W9DH 1WZLA 2DJ4A 4HKJA 5E2JA 3WFEH 3GHBH 4RX4A 2BCKA 1UH2A 3RVUC 2PW2B 3GM8A 1LP9E 5BW7A 1K2DA 4S0TD 5F70A 5GHWH 1AD0A 1YEFL 3IAPA 3TIDB 3P4MB 4NUJA 3KPQB 4NO2A 3S37H 1XGQA 1PLGL 3DHMA 5GS1B 3BIKB 3QCTH 5MEOA 3MV9A 1MHPH 3U1SL 4PRDB 3HI1A 4RZCB 3TN0C 2J1KA 3C8DA 4XCEB 4NP4H 3HE6D 1PQZB 1AKJD 4QRRA 2PYFB 1CXHA 4WV1C 3NA4A 1YECH 5BJTA 1J1PL 1R3LB 5F9AC 1MIMH 1YN6A 3H42L 2GTWB 1Q8MA 3BW9B 3STBA 5FUCC 5IV2A 4B0MM 4PJ5D 4MVBC 4EI5C 4JDZA 4JB9H 2DN7A 5IROC 1AI1L 1JZ8A 1GGBH 2OQJB 5HXMA 4E0RB 2QADC 5EU6B 5J89A 1G6RA 5EBMB 1G7LA 5CILH 2JIXB 4JRYE 1G9NH 1S7WA 2DI9A 4NZUH 5IB3A 3SDCD 3MX0A 2A6KA 4Y5XC 1ZSDA 5SWQB 3NCJL 4HAGA 4KV5E 1I1FB 4N0RA 4Y8DC 3P9MA 5TF1L 2FD6H 2FIKB 1EHLH 2D31B 1TNMA 1ZT1A 5D5ME 1N5AB 1FO0A 5CJXA 4E41E 1NJ9B 3PWLA 1IFHH 1F4WH 3ZTJH 3O6MH 3LN9A 5CLWA 3BKJH 2VAAB 1N5YL 4Z95L 5IHZB 1HHKB 5I73C 2BNQD 2XG5A 1T1ZB 5IFAL 2DQEL 1TQBB 4PJIE 1UACL 1FZKA 2J4WH 5IVXE 3ORJA 1JV5A 1YC8A 4O4YH 5CWSA 1MCQA 1OGAE 4J3SA 4P3CL 4Z7UB 5JQHC 1HSAB 2BY2A 4X6BB 3MJ6A 4PJAA 2AJXH 4Z7WF 1QSVA 2XZCL 2EDJA 1NANH 5EZIL 2YPLB 5CBEA 4PUBL 1YEEL 2I9LB 5IB1B 3MFFA 2VWEC 1IAII 1MCLA 1T0NB 4GW4A 4K7PL 3VFRB 4UV7H 1BQUA 1AP2A 4L3EA 3O11B 1MREH 1OQOA 3SGJC 5BZDA 4R26L 1IC7H 1UCTA 5ABDE 3MRMA 1INDH 4LLDB 5FKPB 1WT5A 3SE3A 1S9YB 1A6AA 4CKVX 4OCWH 1WAAA 1EJOH 1S7TB 3GNML 4NHCL 2Y5TB 1DN2A 2FJHA 5L8LB 1ULVA 4M3JA 5FHBH 2YRPA 5FYKL 3BJ91 3LKPB 1Z9MA 5DHYB 1NL0L 3M17B 1MPAL 3PQYB 3PABA 2WBKA 4OD2B 1ORSB 3NACL 4ALAH 3SDCC 5CEZE 4JY5H 5DFVC 7CGTA 2G2RB 3MSPA 5ICXA 5TDOB 4PY7A 2M1KA 2QQKH 4AL8H 2IPKB 3DETD 1SM3L 4L29A 3BX7C 4LEOA 3BKYH 1G7QB 1FE8H 1KC5H 2DQTL 3OR7A 2IH1A 2WQRA 4MJ6A 4LSUL 5GISH 4PBWD 3X13A 3VJ6A 4MQTB 2XPGA 2VDRH 3F58H 1HDMB 5EU6D 4Z7VA 4QHMA 5M94B 2Q8AH 2Y5EA 5GRUL 1M6OA 4RBPK 3SN6N 2EECA 3FQNB 4WFHE 3C2AH 4D3CL 2JIXD 1RZFL 4WUKH 3KPMA 5DJYB 4XBGA 1FFNB 3WYRA 4P5KA 4U2YA 3TBYA 3W5NA 5I1HH 2GI7A 1ZVSA 3AS2A 2DQGL 2X4RB 1QHOA 1ZVYA 2CDGB 1SEBA 5KVGH 4ZO7A 2A77H 2W0FA 2DYPD 5I17A 2GJ6A 4C56E 1YPZF 1I1RA 4ELKA 2CK0L 4Y5YC 5HVFB 2WINA 2V5RA 1AO7B 2SEBB 3KYOB 2IH3B 1AH1A 3CXHK 4LIQH 3H3PH 4RFEB 5TQ0H 4YAQA 1BZ7A 3BGMA 4MA7H 1YEGH 1UCBL 5GS1C 1I1YA 2BNUA 2BRRL 3CK0L 4CRPA 1KJ3L 4M3KB 4YUEL 2YPLD 4C4KT 5A16B 3QYCA 3PL6B 2CIKA 2GSIA 4KJYA 2NLJA 5J13C 2BY1A 4WIQA 2E7LA 1UM4L 1NPUA 3DV6A 4WWKB 5DZLA 5HHOA 5D7IE 4XPAL 3B8YA 1L7TL 3WD5H 5CMAA 4M6NH 3KLAA 4F33B 4OBRA 2P8PB 4QRSA 1A4KA 5J6HA 3TNMB 3RWHA 3ZKNC 2ZNXA 3QUYB 4NQVB 4MX7A 3PQYD 2BK8A 3NN8B 1F8TL 5B38G 1RJZA 4OM1H 2X4SA 4LNVA 4A6YL 4X7DC 4L9DA 4XMPL 4XP9L 1B2WL 5ILTL 1OAXH 2EH8H 4HKZB 5E56A 4KTEH 2GTZA 3DUSA 4BFEA 2ADJB 3QISA 4ODVH 3B9EA 4YQXL 5KTEH 1CU4L 1JCKA 4J3VA 3DIFB 1UM6H 5FO7A 5KZCB 5IM7B 2D3VA 5FIEA 3FRUA 4HT1H 5DHXB 1D9KB 4NRYB 4RGMC 4K3JH 4MZ2A 1QLRB 5SWZE 4KTDL 2HT2C 4X0KB 1KBGL 1TQBC 1TJHH 3EJZC 4YNYA 1M1SA 3BDYH 4KHXL 4KXZH 3MBEA 4X5WA 3JV4A 2EE3A 1IKFL 3D25B 4XGZB 3HA0A 5LGJA 1BJ1H 4F7MA 4JGJA 5C86A 5ERWA 1B4JL 5GGVH 2OS7A 4NO5A 1I3VA 5DJZA 1LEKA 3V4VL 4KV5F 5J8OA 5IBTL 4H0IA 4POYA 1XF5B 3L7EB 1NMAH 1A7QH 3ARFC 1OD7A 1AO7D 2UY7A 2VR5A 2DWEA 1J1OH 2MQ0A 4E42B 3HPLA 4KUZH 1Y6MR 3TYGL 1NCDL 4N1EA 1HI6B 2R2CA 4PRNB 2XKNB 3EO0B 3JTSA 3DSFL 4F3FA 3QHFH 1FIGH 4PGBA 1TIUA 2ZSWA 3NPZB 4NQEE 1HNFA 4Y4HB 4KVNL 1JHTA 3O41A 1W0WA 3PL6D 3X3GL 3Q0HA 4PV8B 2V9RA 3TPUB 3WKNA 2AQ3A 2EKSA 3FQTA 4AY0A 2FZ3A 4BQBA 3L3HB 2OTUA 3TGXA 1GZQA 1WCBB 4N1CA 4JVWA 1RJLB 5FB8B 3I75A 1D5ZB 4WWKD 4ONHB 4IMKC 3GKWL 4Y19E 4M5ZH 2AXFB 1P53A 3PGFH 3QUZB 3DBXA 4OKDA 2HFFA 2FHCA 4KK6C 5L88L 1A1MA 5E8OB 1WZ1L 5F7FA 3WFBH 5I1EH 1WITA 3QUYD 1P4IL 3F8UB 3EO9L 2WIIA 3SGEI 4NJAH 4AIZA 4ELMF 2H6PA 3VMNA 1KCRL 3LQZA 4LIQE 3LKOB 4CVZA 4JM2B 1FL3A 5FF6B 1CLCA 4G43B 3HNSH 1MRDL 3OKOA 4YDKL 2VQTA 3VFWA 3KXFA 1GOGA 1FGVL 5F1NB 4P23B 1KG0B 3C60A 5KZCD 1I4FA 3NABL 3PF2A 5D2NB 1FC1A 1RSFA 1D9KD 5DMGD 3D5OF 4S2SA 1A02N 4AEFA 3EIFA 4TOYL 5B3NA 2PW1A 1OAZH 3NCYS 4U1IB 2XN9A 1LMKA 3WL9B 2G75A 5D7SH 4XBPB 2FDBP 3MLZL 4NBXB 4L5FH 2I07B 5DQDL 1NBZB 1KTDB 1CD1B 2ADGB 4MJ5B 3F6LA 2RFXA 1DVFC 4UT6H 1AGDA 5C6PB 2F15A 3O6FA 3EDKA 4HZLA 2M26A 4M61A 3RL1B 4WWKC 1FNSH 3AVEA 2YRZA 4OIBA 4NQUA 2V5MA 4HX1A 4HMDA 4PGJA 3NIGE 4GXVL 5FGBC 5IWLA 4GLRH 5GZOC 5C7XL 1FGNH 3QDJB 4POUB 5I76A 1LEIB 1KCSL 1REIA 4ODBD 2CRZA 1NCCH 1F4YH 4KJPD 4LVOB 2HMID 4DZ8B 3QUYC 4Y4HD 4XZUB 1HILB 2XA8L 3Q6FA 2DQJL 5FGSA 4NO3B 1FDLL 3LEYL 1HCVA 3S35L 1LHZA 1A7RH 3EGSB 4DTGH 3OL2A 4LHJB 3HZVA 1A6PA 3KNBA 2FL5A 1P7QD 3A67H 1ZHLA 4S1RL 4YXLH 1L0QA 3QUZD 4U3CA 4GAJL 1ED3B 1QBBA 1Z6JT 1ORQB 1U93B 1OF2B 3GI8H 4YDJA 4A6YA 1UZ8B 5D7IF 1TJGH 3P11H 3MJ8A 5DMGC 4ZFGL 3ZE2F 4M00A 1CF8H 4OGYH 2I26N 4DCQA 1I3GL 4NHUA 5FV2A 3SKOB 3QIBB 3RUGE 3QZWA 4JM2D 1MFEL 4PJ5E 4OZHB 4G6ML 4LSQH 5DYOB 2Q6WA 1SJEB 1R6VA 5E4IA 4OFYA 4OLVH 4W6WB 3INUH 3VD7A 4WW2A 3FO0H 2ZCLH 1NMBH 4P23D 3VXQA 2P7TA 2P24B 3HFML 5H37H 3ZTNL 4F8TA 1CDJA 3EYSL 3U36B 1EO7A 4RCAA 3BP6B 2R29H 3L7FA 3GSUB 3AU1A 4YBLB 3VW3H 1FBIL 2A2QT 1EDQA 3NFSL 5HGBA 2R2HB 3ET9F 4Q2ZB 1IEBB 1XZ0B 1XIWC 2PTTA 3D69B 5HYIA 2BERA 4R3SA 3BEWB 4LPVA 1CZ8H 1WBXA 4XXCA 4APQC 1CGWA 3DRTA 2XWBA 3FOLB 4OD3L 1J88A 2BNQE 2ZUQB 1YN7A 2GY7B 3HC4L 5J4MA 5I18H 1DSFL 3LEXA 1A7OL 4YHPA 1F4XL 3QIWA 4XNXL 5L9DH 2VZVA 3MCLL 1V7MH 1U8KB 3OAUL 1R0AL 1FAIH 4XHQA 3QDJD 1R5VB 5IG7B 2KH2B 3BGAA 3RKPA 5FO9B 4K2UL 4JFXA 2N4IA 4Q0XL 2CUMA 3BIAX 4UT7L 3GSRB 3S97C 3D0LB 3K2UL 5IW1A 2O5ZL 4BH8A 4L4JA 5KANG 1BAFL 1R5IA 2XTJB 4FXKB 3RVWD 1NFDB 4ZOCA 5MP6L 4OTXH 1KJMB 2YMXL 4LEXL 4M4PA 3MUJA 4U33A 5E8DH 4NUJB 5D8JH 3QNYB 2GUOB 3JV6B 4X6FB 2A1WL 4N0CC 4BSVB 1EBPA 2OP4L 5GSRB 4NKMB 2Q8BL 1ODAA 4PRAB 3G6AB 4FOMA 4KZEL 3HI1B 3ULVF 1JNLH 1DLFH 3VXSA 3GMPA 2J8UA 4YHNA 2EE6A 4GRLC 1VKXA 3V4UH 4ETYA 5B39A 3O0RL 5DC0A 1VB9A 4YDIH 4HV8A 2XQYK 1IC5L 1H3WM 5E2UL 2AVGA 1MCJA 3TV3H 1UJTA 5EU6E 1KIPA 1BF8A 1YEIH 5K9OB 2LV4A 3VWKA 3FMGL 3LSOA 4PTUB 5AAWA 1T4KB 1P84J 1RUAL 2OMBA 3QIUA 5K93A 3W2DL 4DAGL 1P5UA 5FCUL 2LAAA 1G6RB 3LKRB 1BMGA 4HPYL 3AC0A 4UAOC 5DRWA 5DSCA 4NPYA 3TM6A 2HG5A 2Q3ZA 4LVOC 1LO4H 2NY0C 1A6UH 2Q3AA 4DGVH 5B22A 3EDJA 2QTEA 2AGJH 2WLYA 3HLAB 2XZAL 4P4KA 3C6LA 4X99B 2YPVL 5FK9A 3HR5B 3MLTB 3CVIH 3T0AA 4PRHA 4KMLB 3VWJA 3OHXB 4HK3N 4XH2A 1CGSL 4Z7UE 5F1KC 1CE6A 3K0WA 1AXSB 4NFDA 1JN6A 1YYML 4FZ8H 1FNEA 5KS9B 3LZFH 2J12B 2YPLE 3IGAA 5C0DA 4WU7B 1IGCH 1CICB 4MNQA 1QFWI 1VGKB 1ZA3B 3QQNA 5T1DH 4I0PA 4RFNB 5ID0A 3OB8A 3TJHC 3BFOA 1FZJB 1XEDA 4MGXA 2XACC 1BZ9B 4RX4D 4OKVB 3S36L 2XTJD 3WNMA 1DQDL 3QB7C 4AG4H 4OLWH 4NGHH 2ADIA 5GGRA 4J23A 4Z0XB 5A1AA 5ENWB 5H2BB 4TSBL 1WJ3A 2VISA 3PQYE 2ORBH 5TGBB 2O93L 3I6KA 4FQ2H 5FECA 5JUEL 3MNZB 1UKQA 1AC6A 2DQFB 4R0LA 4F37K 5I9QB 4YBLC 4BQ8A 4JR9H 3EJYD 5CJQL 5IB4B 3RJDA 2X4OA 2NW3A 4QRRD 5JORA 2R4RH 5D2LA 3CCHB 4PJ9B 4FZEL 4GKNB 1RIHL 2YK1L 3IDXH 2D7MA 4IM8A 1E6JL 3BPCB 4Y2OA 5DWUL 5CGYD 3BSZH 3OKNB 1S9VB 4DW2H 2NY1C 4MJ6B 3T3PE 2NY7H 2XPGB 1DEDA 4LSPL 4NT6A 2EO9A 4KQ3L 4Z7VB 4WEMB 3V6OA 2AAVA 5GRVK 1D6VH 2OTWA 4J4PA 5ACZA 4LKCA 5GGSA 2MHAB 2ZCKL 3QUXA 4XAKD 1NC2B 1RULH 3WBDA 3UC0L 1AO7E 1G9MC 5ICZA 1LK2B 2W0FB 1MY5A 4LRNH 1YNKH 4XNMB 4HEPG 4HJGA 4PB0H 2QLVB 1CXFA 7FABL 3SE4A 5D70H 1OWWA 4LK4A 3GMQB 5TE7H 2XTJC 4OCNC 2UY6A 1IKNA 3ESUF 3QAZC 2JELL 2DBLL 4FHBD 5T3ZL 4ZMAT 3TFKD 4ORZC 3QCVH 4UQ3B 3BXNA 1G84A 1CICD 2RBLA 4Z76B 3SKJL 1RZKL 1I9RH 3D85B 1RUQH 1CD8A 1J8HA 4F7CA 3ARWA 5KN5B 1FVDA 2X4QB 2HRPH 4LU5H 2E7MA 1F5WA 5JW4M 4GAFB 3EJYC 3T2PA 2DM7A 2ID5A 4FFWD 2CRMA 3TCLB 4JFEB 4PLNC 2FO4B 1MCSA 4HH8A 3GMLA 3T0XA 5IVOA 1XF2B 4OZIB 4I0CC 5J56B 1NGXB 3RP1A 4KZDH 4NQXA 2RGSA 5I19H 3VDCA 1RZGB 1A7NL 2MOVA 1BOGA 2EDNA 4HSQA 5C09A 1KJ2H 4R4FL 1SHMA 1MCCA 4CMMA 4YHKL 2H26A 1I8LA 3C9NA 3OBAA 4YE4L 4DN4H 1HYSC 1DBJL 2X4SB 4XPGL 5DEFA 2BJML 3CDCA 3ULSA 4WGWB 1A2YB 1BQSA 4PJ9D 3F7QA 1Z3GH 4ERSH 2GTZB 3MRBB 1MCOL 1I8MA 1OPGL 5GRVL 1ZLWH 3GSXB 5T3XL 5CJXC 4WO4A 2P8LB 2NCMA 1JF1A 4X4XB 2A73B 3PWJB 4NUGH 1AY1H 1KSRA 4ZNEE 2DMCA 5GS3A 1HHGB 3MBXL 5D6CB 3T65B 2K9UA 3VFUB 1A9BB 4CN4A 3LN5A 1NCWL 3O3UN 4PJFA 3TFKC 1KIUA 4JREC 1VHPA 4ZTOL 5ERWB 4RFNC 3MV8B 1SY6H 3MV7A 1KCVH 4PGZA 5CUSH 3ZMRA 1LEKB 1F4AA 4OCMC 3GK8H 2C4FT 2GJ6D 3GJFB 4HDIB 1U8PA 4YIQA 4MA1B 5BQ7A 2WK2A 1C5CL 1UB5A 2JTDA 3DYOA 2DLIA 4R7NA 4RFOH 3QHZH 2RCSL 3A6BH 3VXRB 1WT5C 2F54A 3SE3C 2BXZA 1P7KB 1MFAH 1QKZL 1T20A 3O3BB 1S5IH 4XNUL 1U92B 4Q6IB 4OF3A 4OQTL 5FYJD 2BSTB 3PDDA 4J8RB 4U1MA 2ICCA 1L7IH 1NEZG 3D85D 1BBJA 1BFOB 2R23B 3OPZL 4XVUC 5EC2B 1KELH 5KJRH 3KLDA 1JHTB 4OIIH 4QXWA 3T09A 4ZPVB 1W0WB 5DQ9B 5I1JH 3MLXL 4U1GC 5F21B 5FM8A 1F6AA 2AV7B 3M8OL 1H8OA 1P2CB 1VACA 3EYOB 5DURB 1PG7W 2EXYC 4OCXL 1ZHKA 4UIMB 4JVUA 5C0EA 1GJIA 3U0TA 3D9AL 2CSPA 5C2UB 2OSLA 1N4XL 2RB8A 5M7QA 1S7RB 3FFDA 3SO5A 2HFFB 1DDHA 5I8KL 1G7IB 43C9B 3SDXB 4R2GD 5F8RC 4TQEL 1U58B 3O45A 1CFSB 1LO2H 1RZJC 2FX9L 5K9JH 5FUZL 1IGML 2X4UB 2A0LD 2EDFA 1DUYA 1INEL 4WU5B 1I7UA 5GRXG 4P9HC 4ZO9A 4Z0BH 5D2NE 1F58L 2AK4B 4PP2A 12E8H 4OF6A 3SQOH 2OL3L 5JLZB 2R56L 1BFTA 2AJVH 4XXDB 4PB9L 1I4FB 3QG7H 2JKXA 4GXUM 5DI8B 4HS8L 1CFNA 15C8L 3CFCH 4JZNB 3O2DL 1NBVH 1WICA 1J5OL 1V3LA 4PGEA 1KN4H 3EYUL 5EOTA 3S34L 2CK2A 4LP4A 2G75B 4XNZB 2A74B 1WCQA 3REWB 3MV8D 5C9JA 2WUCH 5DVMA 5ADPH 2DQCL 4KKLD 4PFEA 3O8XA 5GSVA 4G42A 3C5SA 2R1WA 4E5XA 4DUXA 1NUGA 3TESA 4JPWL 2ATPB 3CH1B 3QDJE 2E7LC 4LLYB 3VXRD 4L4TA 3CUPA 1EAPB 2Z35A 4HX1B 4TSAL 4N0FB 3UBXG 4Y5VA 3T1WA 1TVDA 3TNNA 3PP3H 1E28B 4O02H 3WO3B 4X6CB 1G6RH 4FRWA 1V5JA 1D5XB 4ZUTB 3OJMB 2R2BA 3MUGB 4ODTL 4R2GC 2E6QA 1U95A 3EZJB 4PRIA 3KJ4C 5B3JE 2DIAA 5F3BB 3CLEL 2G5BA 5DURD 1Q9LB 2VLKB 4HK0B 5DD0H 3IXTB 3G6DL 4X4ZA 1TPXC 4YHYB 1HCFX 1JTPA 3KNBB 5MEQA 1OAUH 1DLHA 2PCPB 4YX2L 2HJLB 2C1PB 2W65A 2H3NA 4YHML 1WF5A 3MTRA 4NO0A 4NYLA 2VH5H 4J3WA 1DBML 2XKSA 1NDGB 1VEMA 2OYPA 2OK0H 4JPVL 2HTLC 3MJ8B 5I1DB 2H1PL 1OAKL 1N64H 4ODSL 4X7SL 4OZHE 4LL9A 4QTIH 1FH5L 4BYHA 1CDIA 5JW4R 5FXCH 3OG4B 1NCAH 3MBEC 4KJQD 5E24E 4KI1A 1XFPA 4QRTB 3QZWB 2NZ9D 2FIRT 1JWUB 3G9VA 3D6GA 1D5BA 1ZHBB 3OKDA 2AK4D 3OXSA 4KKLC 4WFGD 1NC4A 1S8DB 3MJ9H 1JRHH 4FNLH 1OTTD 3P4LA 3C09B 3U7YL 1GGIL 4ONGL 1A21A 4NM4H 3NH7H 3DO7B 1FCGA 1S7VB 2KPNA 3HC0B 3QEHB 4MNHB 1R3KA 4WNQA 1BVKB 2D9CA 4LSVH 1CLZH 1KYOK 3ARRA 2H32A 1MAKA 3V95A 4R3SB 5HDLA 5HYJB 4U1KA 5F3HB 2BC4A 4NFBA 2EYTA 3OR6A 3S3PA 4U4BA 5EOQL 3HZMA 4X8JA 4JPIA 1OP5H 4I3GA 4IRSB 4G6AC 4RRPG 3RDTA 4W6XB 1QZ1A 3KWWA 4M93B 3WKMH 4N0YH 1BD2B 3L3JA 4OQTA 5B38A 5GGVY 3ARDB 3VD3A 3IFNL 4XMLH 5EPMA 5HYSA 1FVEB 4YHOH 3LIZL 4JZJA 2X40A 5HJ3A 4LAQH 1T1XB 4OM0H 1I7TB 2C7UB 2XTJE 1RD6A 4JFXB 4N5UA 1CFVH 1RZJH 1J05B 2IWGA 1NFDE 3EBAA 2NY2B 4BFIA 4HH9A 2V7HA 4KJQC 4NN5B 3IAGC 5DJDB 4PJXB 3C8HA 4S1QL 5KAQG 4BUGA 2FH8A 3U6RB 4XVTL 3SGDI 3WLBA 1QACA 2F58H 1I8KB 4PJ7A 2VXUL 1KEMH 5LCVH 3U0WH 4PR5A 2ADFH 4U6VL 1MRCH 2VAJA 1HN1A 3C60C 2FR4B 2XZQL 4HFUH 4QRRE 2D7TL 2HYMA 4ISVA 1GGUA 2IBZX 1SBSL 3K74B 4YGAB 4KKNA 2X7LB 4FMKA 1YMMA 3LDBB 5FYJH 4YLQT 1NAMB 5FYKU 2VLRA 1I9EA 2HVJB 4PREB 5JXED 3D18B 1VKXB 2E7CA 2B1HL 4XAWL 2BVQA 4ZDHA 1JWSA 3BO8B 1FSKB 2HN7A 1DQTA 4X4YA 1NBYA 3L6FA 3RWDB 1AJ7H 4HJJL 1KIPB 1JZ6A 4ODWB 1T2JA 1XGPB 1YEFH 3QJFA 5F9WB 1TFHA 3GBNL 4TUOB 3ARBB 2GCYA 4LVHC 3UTQB 4Q9BA 3O6FC 3P4OA 4XAKE 5CSBA 1R5WA 5I1KL 1YEDA 1M05A 4PD4J 5IVZA 1AQDA 2QBWA 3U1SH 5K59E 4HXBH 4JFHD 5DK2A 1BPVA 5ID1B 5IWLC 3VXTA 2HFGL 5DRWB 1AFVH 4EUPB 4AENA 2EYRA 4O2CB 1J1PH 3TBVA 5ISZB 2CKBB 2EDXA 3BN9C 2ATKB 5HYJD 3RWJA 3H42H 1GYAA 1C7TA 4G6FB 5DRNB 4RWHA 2E9IA 2VABA 4P4KB 3LV3A 4IRSD 3WSQL 5KS9E 1EEZA 4ENED 5JW4N 1BD2D 4XH2B 1AI1H 1X4YA 3QIWD 4Y16B 2IFFL 5DTFA 5DMKB 3ARDD 5EO1B 4HQQL 4A2LA 1C12B 4MAYA 3P0YL 2VITB 4CU7A 1LVEA 5DJ8A 3NCJH 4LCIL 5TF1H 4FQJL 3PNWA 1ONQB 3V7AG 4DUVA 3VRLE 3WIIH 4PJGF 2NY2D 5EO9B 1WAAE 3OTTA 4W4OA 1FFPA 1CFTA 4G9DA 1N5YH 5DUBA 4Z95H 1OTSD 1VFOA 5C08B 1EEYB 2ZJSH 4S10A 1IAKA 4WW2C 5IFAH 2DQEH 5I1IH 3P9LA 1BEYH 3C09C 4RQQB 2VDQH 2VL5B 1JK8A 1CXKA 3UJTL 4PJCF 4P3CH 3T2NL 1PY9A 2JE8A 1MQKH 1AGBB 3H0TA 4MDIB 3HS0A 4IS6B 5EZIH 1TQCB 1GC1L 2B2XL 3N85L 2ARJA 3QRGH 1EBAA 1YEEH 5KW9H 1T03L 4H20L 1S7SA 4HS3B 5DJ0A 3H9SA 3ELAT 3NTCL 3T0WA 3S96A 1OGTB 4HIHA 1MWAL 4XXCC 4R26H 4ONFL 2F5BL 4XNQB 2HJFB 4U6YA 2A6JB 4Z7VE 1RZ7L 5SX5K 3EO1A 4M7JL 4NHCH 3CDFA 1I9JL 3ARBD 1QFHA 3CNKA 1W0VB 1WK0A 3DVFA 3QIWC 5I75B 1NL0H 3UYOD 1HEZB 4QRQB 1MPAH 5E1AA 3P77B 5BS0A 2DD8H 3NACH 5LGKA 1CXEA 1MHHB 3IDMB 2GJ6E 2YN3A 3CIQA 2XQBL 3V79C 5ISZD 5CBAA 4WWID 5DMYA 3SKMA 4OLXL 4G6FD 3RZCA 3MOQA 1SM3H 4P4KD 2CIIA 3HE7B 3C6LD 4XPFL 2R1YB 1TXKA 2DQTH 4I4WB 1UG9A 1HHIA 5HGGS 3SDAB 5FYJE 3L5WB 4LSUH 1CD9B 1JNHB 4Y16D 4XNYL 5JNYA 3BE1L 1OHQA 4NNYA 5MHSD 3RWFA 4L4VA 5GRUH 5ESVA 4D3CH 3GB7A 5FAAA 1RZFH 1J8HB 4DVBB 5BZWA 4BA8A 4XVSL 2DQGH 2EIDA 2J6EL 2NXZB 4OZIE 1OSPH 1G9EA 3FO9B 2Z93A 5DT1L 2HTKD 2Q7YA 2CK0H 1JPGA 5DJ6A 4P9ML 4M5YH 4QKXB 5C08D 3IF1A 5GGTH 4EBQL 5EOCL 4F58L 3VFGH 5F9WC 1FNFA 3VWKC 3PWUB 1UCBH 3QIUC 2P8MA 4M9OA 3BRFA 1SMOA 5IF0B 3IU3B 1CGTA 2DKSA 2BRRH 3CK0H 4N8VB 1KJ3H 4YUEH 3M07A 4NRZA 3LHPL 1ZANL 4GXUN 5E5MB 1GGYA 2YOCA 4HKXA 1PBYA 1MLBB 3ALWA 2JB5H 3EYVA 5JDSA 2IQAA 5BOPA 1QSZA 3VCLA 4QYOA 4MAUL 1DEEA 4P4KC 3CAFA 3C6LC 3MGTA 3WE6A 1ZT7A 2Z4QA 1L7TH 1MNUH 3KPSB 2KKQA 1KCKA 2DWDA 3VWJC 4O51A 3OAZK 4Y16C 3IDJB 4O9HL 4XB8A 4X7TA 3LN5B 3BKCL 3MV8E 3PXJA 5GPRA 5MI0B 4WCYL 2BP3A 4YHIB 1GZPB 1F8TH 4UB0L 1RZIA 5K59F 2DLTA 5MEPA 4XMPH 1JBJA 5F89B 5ILTH 4I0PC 2AW2A 1U8MA 3ZYIA 4LCYB 1FPTL 4YO0A 3VG9C 4YQXH 1H8NA 3MRDA 3VXRE 1F00I 3O2VL 3ZDZF 2B5IB 1CU4H 1GPOL 1S9XB 3HE7D 3HI5L 2AQ1A 4HIEA 3SDAD 3OQ3B 5IIEA 3QWQB 1K6QL 1U8NA 3ROOA 5I71B 1ITBB 1T20B 5FKAA 3QQ4A 2KDGA 3K4DA 1KBGH 1AD9A 3IDYB 1ZT4B 4KHXH 4LBEB 3SCMA 1J8HD 1A6TA 1I7RA 5DZOA 1IKFH 4MCZA 4R0LC 4V1DB 2ICEA 4HCRL 1B4JH 5IK3A 5DHVA 2NXZD 2AABL 1DE4B 1HHHA 3QDHA 3JWDH 5IBTH 5FOBB 3MRPB 4UU9B 1VACB 5J9PB 3U9PL 3Q1SL 3BUTA 1X5LA 1RIVH 4JFDA 4K55A 1ZHKB 1WAAF 3E1F1 1PFCA 2ZSVB 3SDXE 1LNUA 5MENB 2NR6C 2OSLB 4FQQA 4LSDA 4LGRB 5DD1L 3TYGH 1NCDH 5HPMA 3FFDB 2LABA 2YUZA 1BQLH 6FABH 3DSFH 3V6OC 3ECBB 3GSOB 3MRJA 4J3UA 5JZ7C 4KVNH 3CFDB 1UA6L 3D1MC 2AK4E 3FHQA 3QUXC 3X3GH 4P5MB 4WFGE 1KIRA 4NFCA 4J3OC 4PJBB 5FA3A 1KLUB 1JWMB 2AJ3A 1L6XA 4KMTL 2Y07L 4P57B 3HE7C 3GKWH 1CL7I 3SE4C 4KRPB 1R3HB 4FXLA 4OLUL 3SDAC 4Z7VF 3K81A 1IKNC 4RGOL 4LKXA 4O2EA 1RK0A 3DUUA 3G5YA 3DVGA 1UEMA 5L88H 1OLLA 1QLFB 1WZ1H 5DJ2A 5IW6B 4UDUA 3MYJB 3QG6A 1ACZA 3EO9H 4JDTL 5A3IC 5EDXA 3CFKB 1JNJA 5EOTB 2DAVA 1KCRH 3DWTA 3IJHB 1KFAH 2QQQA 1VGEH 5DJAB 1MRFL 4K07A 1F6LL 1NAMH 5C0IB 1RV6X 5IFJA 1MRDH 4QTHA 1CCZA 5EWIL 3EUUA 2FH6A 4E5XB 1FGVH 1K4CB 4LOUD 1T0MA 1JPFA 5KSBB 4MMXC 5BMFL 1OSZB 3BP5A 2R9HD 4L4TB 3CUPB 4X6CE 5DQJA 4XT1C 3VFNA 5JHDA 4TOYH 4Y5VB 2AEQL 4JFPA 1NGYA 3FCTB 2J6EA 4MA3A 5E5UB 3E3QC 2X1XR 2WBJB 3FB7B 3AFLA 4JHZA 4JFFB 2R2BB 4V1DD 4XCYB 5DZNA 1BIIB 3RWGB 2CKBH 1JGVL 3MYZA 2YXMA 2DLFL 4YFLI 1NKRA 1T2QL 4I18A 5FOJA 1FZOB 4WO4C 2F19L 5MEND 2AEIT 1Z0NA 4PBXA 3MRNB 5KOMC 4IOFD 3E2HB 3D48R 3FOMB 1T3FA 4NYLB 1FYTA 4I3RL 5C07A 5C7XH 1KCSH 8CGTA 1JZ3A 2ERJC 1GRWA 1KNOB 3O3AA 3SE9H 5I1GL 4OI8A 4H8WL 2C3VB 2YR3A 3LKNB 5MI0C 4OF0A 2XA8H 2DQJH 2CXKA 3BD3A 4DK3A 1SJHB 3QCUL 3LEYH 5I66B 3S6CA 5BRZB 1XGRB 1QVOB 4WUUA 4EDWH 3ES6A 1R3JB 4OUUA 3SJVB 1WIOA 2Z92A 5E2WL 3C8KB 3GO1H 1QPPA 1GIGL 2VLLA 5D1ZA 5E4EB 4S1RH 3RWEA 4JFHE 2R15A 1D6EA 5C0AA 4FQPA 4KRPD 5TPWL 3WJLA 2FATL 4GAJH 1JNNL 3CMOL 3BEVB 3BUYA 4KRMB 1JVKA 4OCSL 5ANMA 4ZFGH 5HYJE 4NN7C 1CBVL 4W70A 1NGZB 1EHAA 2EXWC 1I3GH 1A4JA 1WWWX 5CEXA 4QO1A 5JPMB 3TO4A 1MFEH 2Q1EA 5CAYB 4G6MH 3DI2B 2BC4B 5C70A 1BD2E 5GQBA 3NA9L 3UO1H 5I1AB 1O7SA 1J18A 5GS0D 3OKMB 4OF5A 4WI5A 4QNPE 5E6ZA 3HFMH 3BYYA 4Y4KB 4AM0A 5B38B 3SHSA 2R1XA 3EYSH 4L4TD 5H35B 4RNRA 4NKIL 4FFVD 4UT9L 3RY4A 2X9WA 3T08A 1FBIH 3PGCA 3NFSH 4N5ED 4EQ2A 5JQ6H 1QG3A 3V4PH 2EIZA 5GJTL 3ARGA 5EUKB 3G5XA 2WBJD 3OKLA 5EBLA 4MA8L 1OTUC 4JFFD 4W4NA 1IGTA 2DM4A 3BZFA 5J12B 1UADC 2L7UA 3VRJA 3BQUA 4U6XB 2V7HB 3DMMA 2ICWA 4OZ4A 5F7KC 4NDMA 2VC2L 4IDJL 4HC1L 4K3DL 5IBUB 3P40A 3G6JA 4NNXA 3CMGA 1F4XH 4XNXH 3MCLH 4OZFG 3KPPA 3WIHL 3OAUH 1R0AH 4KRPC 3BZEA 1U8IA 5JMRA 2X09A 1A3QA 1A6ZB 3HG1A 3HRZB 3GMOB 4LHQB 1YMMB 2QR0A 1DBKH 4NM8H 3WFZA 1H0DB 4K2UH 1ZGLM 1S78D 2BOCA 4XPBL 4YGVA 2ZNWA 5D6DA 4UT7H 1DANU 1U8QA 4NC0B 2VN4A 1K8IA 2NNAA 3QEGH 5BRZD 2JF1A 4ZDHB 2X41A 2HN7B 2O5ZH 3SBWA 1BAFH 1T83A 2OL3B 4LASL 1W2KT 3SJVD 5CZVH 4TSCL 3LD8B 1T21A 4MJIB 1NEZA 2YMXH 4BZ1H 3O8XC 5DGQA 5IR1A 2F9BT 2XFXA 3L5IA 1FVCA 4DGIL 3QPXL 2A1WH 4HUXA 2APBA 2OP4H 2ESVA 1AQDB 1RZKC 4FFVC 4KZEH 4HIXL 3MJGX 3UTZA 1J86A 4KWUA 5ISZE 3MGAA 5F9DC 4OV5A 1AGCA 4RISL 3ZZ1A 3IFPA 1WGOA 3MLYL 4Y5VC 4P2QA 2DQUL 4PJEA 3W11C 4N5EC 3QR2A 4AENB 2IG2L 4JFOB 4Z7QE 3O0RH 5LJYH 4HMEA 4EI6B 3HUJA 1KIQB 1IC5H 5L7XL 3CPLA 2VABB 5HYQA 4G7YL 5ITFA 5MHSE 2VLMD 1BM3H 5TDNA 3IS0X 1G7MB 4Y4KD 3WN5B 3FMGH 1RUAH 4DAGH 2D03L 3W2DH 5FCUH 3L3OB 3RKDC 1RHFA 1NFIA 3B3IA 4HPYH 3ZDYE 3IAQA 1EXUA 5KSUA 2XV6B 3KPRA 4U1JB 5B8CB 3L5HA 5J7CC 4Y2DA 4XX1G 3QT2A 4G6JL 1FLRL 3MRFA 5CP3A 1ETZA 5CZXD 1S78C 4LSSL 5C08E 1TZIB 4NRXA 3S4SA 2XZAH 1BVLA 3OKKB 4MB4A 1P4BL 4I5BB 5EIIA 2DBJA 5I74C 1T04A 3EFFA 1CGSH 4J7RA 2QSTA 4RAHA 1IAKB 1YYMH 5E4EC 2Z31B 3RX8A 3P9LB 3BHBB 3DVNA 3VFVA 3UEZA 3JUYA 5HGHB 5I2IB 1H3UA 3FB6A 4WI6A 1LO5B 4X80L 1Q9WA 3G5ZA 5CCKL 5JTWA 5ESAA 3BJLA 4JVPA 4BSWB 5JO5A 1X7QA 1DQLL 2YD8A 4GSDL 4P2OA 4W81A 4XP4H 1YMMD 3LRSA 3H0TB 5JW5B 4LLUA 2GITB 3PG2A 5J06A 1VPOL 1QYGH 2M8XA 1TTFA 5DJ0B 3K8LA 5CGTA 5T5NG 5L0QC 1I1AA 1MSPA 1A14L 5DK0A 5IHBA 3S36H 5JIKA 3BVNA 4FQHB 3UBXA 3V9FA 4TVPL 4XCFL 1N59A 4WW2F 4U1NA 3OX8A 4MJID 3O4OB 3ZYOA 1QO3B 1S7XA 2D7PA 4FG6D 2V17L 4OB5L 2A83B 4TSBH 4MQ7B 1Z9LA 3IVKB 1C8PA 5E8NA 3RDTC 1FL5A 3WHXA 1GHFL 3NZ8B 4X5XA 3IKCB 5EU7C 4Y4KC 5ESQA 1IGYB 5JUEH 2PTUA 3PV6A 3B9VA 5GRZA 2AK1L 5BS0B 1EHXA 3RWCB 3UDWA 4HJ0C 3W0WA 3P0GB 4JZJC 4ZSOA 5E94A 4FZEH 1RIHH 1FC2D 5CBAB 4Q9CA 5JIPA 4G9FB 3RZCB 3SKMB 4GG6B 2GAZB 1T1WB 3VDBA 3VXMB 5DWUH 1P5VA 3HI6L 1I3RA 1SYVA 4L3CB 1NCBL 3DX8A 2G9HB 3UJIL 3BT2L 3WXVL 4LSPH 1J8HE 2PXYB 3EFDL 4KQ3H 4NNYB 4QNPF 3RGVA 3TC9A 4Z78B 4M48L 3ZSTA 3RWFB 5E95B 3GMRA 5ESVB 3AAZA 3NCFB 4MAYD 2BMKB 3K2MC 2ZCKH 2VDLL 4Z5RA 3MRLB 1RIUL 4MNGB 1U3YA 1G7JA 3UC0H 2FO1A 1C16A 3VFTA 4PGDA 2QQLL 4H88L 5E00A 4H25A 1KB5B 4HC1A 3TLRA 5HGDA 2R0LL 3LB6D 3TO2A 1CK0H 4ZUSB 3PWPA 2AKRA 5HVHB 4ZS6D 1LO0L 1RHHB 4FTVA 2J2ZA 2ITCA 1Y0LA 2JELH 5A2KH 1AXTL 2DBLH 2Z31D 3GI9L 4HWEL 5T3ZH 4AQ1B 5EU5A 4NCC1 3SKJH 3DXAB 3LQMA 1H9VA 4FQ1L 8FABB 4RRPA 1BJ8A 4MQXC 1CE1L 2J8UF 4I2XB 1YEJL 2YC1B 2EC9U 1K8DA 4IIQA 4Z7WB 1I75A 5DS8A 1LK3L 3JV5A 3H9SD 4F7PA 1H3PH 4NWTL 2D7NA 3LKQA 4XBEH 3H3BC 1X5GA 3KPSE 4HGWB 5CINL 4QXTB 4UQ2A 4Y4FB 1T6VN 2R2EB 1X5IA 3OB0K 3NCMA 4UDTB 3T4AB 1B0WA 2Z4QB 1A7NH 4MCYA 2XIDA 4PRPB 4TULL 3H9ZA 1F13A 2FJGB 4R4FH 4YHKH 1E4XH 5BS0D 4YE4H 3TA3A 1CG9B 4MAYC 1DBJH 3SKNA 5F96L 2DKUA 2BJMH 1HWGB 1P84K 2W9EL 4HW6A 4WVRA 1MI5B 2MCPL 4EEEA 3NFPA 1FRGL 3GJEB 1I1CA 4L8BA 3DO3A 4YO0B 4HBCH 1MCOH 4G9FD 3RZCD 4PG9A 3MNWA 1AXIB 3VXMD 3LB6C 1JGEB 2BSRA 1W72B 4W4OC 1IAIL 5IIEB 2XY2A 4LPTA 5F7DA 4TNWF 2PXYD 4LDOB 1QSEA 3WFHA 4AJ0A 4UNUA 3ZHLA 2A6DA 3MLVL 3B6SB 4CMHC 4V1DE 1HIML 1ZGLA 1AD9B 1NCWH 5A40E 3IJYB 3NBNA 3X14A 4LFHG 1CR9L 2O61B 1IL1A 4L8SB 2W0LA 2FSEA 2XXMB 4ZTOH 1X3DA 4HHAB 1A1NA 1H8SA 5JIHA 4Z7NF 1QRNB 1X5JA 1YDPA 1ZVHA 2DQIL 2WW8A 3QRFM 5MENE 2PYEB 1UXWA 4FABL 5CD3B 1C5CH 1MOEA 3K8MA 5C0CB 4PV9B 2H2PD 4D0BB 5B21A 1LDSA 3O4OC 3OKYA 4XNUH 4FQQB 4ZFZB 4ZUUB 4L9LB 4R8WH 4OQTH 3CSYB 3I84A 5FA4B 2P42B 5L2JA 3G5VB 1K5NA 3OPZH 3KPOA 5F7WC 4PJBE 3RVXC 4JY4A 4ETQB 4G8IA 1MUJB 3MMEB 4I48B 1MWAB 5EU4B 1T5WB 1X4ZA 2O5YL 3MLXH 4EKXA 1TVBB 4DKEH 4XP1H 4NSKA 4HMCA 3JBG7 4YDVA 4K7PX 5F9JA 3RZCC 3LQAH 3D9AH 3LVEA 4Y4FD 3FTGA 2DIJA 2Z8RA 4UI2A 5IOPA 4LHUA 1N4XH 3O4LA 4KFZC 2HJKB 5JW4Q 3RNKB 2Y25A 4PRPD 2DQDH 3IDNB 3MGOB 3G5YB 5I8KH 1WBZA 4LSRL 3WEXB 3LCYA 1YZZA 4UDUB 1FYHB 1YYLL 4RWYH 4TQEH 1GL4B 3VG0L 4D9LL 2HT4C 1U8HA 5FUZH 2FEDD 3QDGA 3H9HB 3V6FB 4P3DA 3WUWG 1MI5D 1Z0MA 5KSBE 4LGPB 4FQXB 5F7NC 2V7NA 4ORGA 5JA9A 4L4TE 1IT9H 3RVVD 1DUZA 1F58H 4QTHB 5GRJL 3KYMB 4LLQB 4X6EA 1A47A 1NGWA 5J6GA 2OL3H 4GMSL 4AH2B 5DEGB 3BP5B 1EFXA 4PB9H 2W38A 1RUMH 1WTLA 5TE4L 2KZ1B 4Y1AA 4JFFE 4X8XA 3O2DH 2PKDA 4QHLB 1AIFA 1J5OH 1PG7L 3O6LL 4NOBA 3EYUH 2D7QA 4ODUA 3FRPG 4WDIA 3S34H 1LDPL 4QXGL 3KYNB 3QI9A 1QRND 2MKLC 5JXAL 2PYED 3EYFB 2P49B 5C0NC 4M1DH 5SWSB 5C0CD 4GKZB 2VDNL 2W07A 2LVEA 4J1UB 1NGQL 3BRGC 4NKDA 4QOKB 1Y18B 2F74B 5D1XA 1VADA 1CDUA 3GHEH 3A6CL 5INCB 1SMAA 2FLRT 3DROB 2WM0A 5BRZE 1JF6A 4BZYA 1A1OA 2DICA 4LPUA 3UROR 4D0DA 3KYKL 4LQFL 1MH5B 3SJVE 4NWUL 4M8QA 3ARZA 4U3XA 2WWMC 1Q9OB 2FEDC 3MXVL 2AV1A 3CLEH 3QFJA 1XCQA 1U8LA 3G6DH 2OMNA 5TE6L 1QUNA 4B41A 3VE0A 1C5DA 4YX2H 1WFOA 3IDGA 4DUWA 1DZBA 5BOZG 4P99A 5EC1B 4K7FB 1KPVA 1DBMH 2GT9A 4JKKA 4RGNB 3GIVA 1EGJA 3GMNA 1OAKH 3MA9L 4ZOAA 5FO8A 2XNAA 4M7KH 2VR9A 2VXSL 2XWJB 2R39A 4YWGL 3U46B 3SCMC 4OI7A 3DJ9A 3GIZL 4MZ3A 4LLMA 1I9IH 1A4JB 1SVZA 2FWOB 3GZKA 5CEXB 4ELMB 2VLME 3TBTB 4FQLH 1AE6L 4FQXD 5I8CA 2ZCHL 2ICWI 1IGFH 3GBLA 1K4DB 4IRZL 1UB6B 3W81A 3QUKB 3VGAC 3VD9A 4M7ZB 4RMSA 3MZGB 1GGCL 2HFEB 3KVQA 4XCNA 3PGDA 4LNRB 4QHKI 3FHAA 2VLJA 3LKSB 4P4RA 3FO1B 5TQ2L 1N6QL 5JDJA 4U1SA 5DRZA 1GC1C 4W6YB 5DJXA 1W8OA 1PYWA 1U6AL 2OJEA 3G5XB 4MWFA 3I6GB 4YDLB 5EBLB 5D1QA 2BFVL 4EZMA 3DGGA 1HHJA 3N1PC 4KQ4L 3G08A 2HH0H 5EOQH 3I2CL 4IOIA 4L1HA 3CFJA 1MF2L 1RZ8A 2VXTL 3KGRA 4OZ4B 4KVCL 3QXAA 2E6PA 1B0RA 3QXDB 5SWSD 1VESA 3BGFB 1FFQA 3H2WA 1BWMA 5DLML 1EEUA 1M4KA 1MELA 2EDKA 4Q9RH 3TEUA 2CO6B 2YEZA 4QOKD 3VFSB 2FX7H 4QHNB 1YMME 1IM9B 3ZT6A 4QRPA 5DDHA 2P5EA 3R8BB 2ARJQ 5EBWA 2LTQB 4ESKA 3LIZH 1KPUB 3HRPA 1Q0XH 5D93B 2BOCB 4IDLA 4U6HA 5JPNB 4MJIE 4OLEA 4AT6B 3L3DA 4PJBF 1NAKL 5GGUA 4N90D 3T2OA 4NOFA 3QO1A 1XR9A 1KB5H 5HGAA 4XVTH 1NEZB 2C1OA 5D1ZD 3DGCR 1NDMA 5BXFA 2VXUH 4JFQA 5C0AD 1MHCA 4RA3A 4RGND 2XZQH 3MROA 2D7TH 2ZG2A 3UTZB 3B9KA 1SBSH 2GK0A 1YQVL 4X7EC 4P3WA 3AY4C 2BVTA 1HXYA 3BPLC 3L3GB 4P2QB 4UV4L 5D7IB 3X12B 4DGYL 1CDBA 2CUIA 1QFOA 2B1HH 4XAWH 4K71B 4JQIH 3KS0H 4PG2C 3THMH 5DD6A 1KXVC 1FJ1A 4EN3B 3IETB 3GUTB 5ITFB 5K9QI 5DR5L 1LGVA 3QQ3B 3C6SA 5I8OH 1QQDB 5IESL 4JN2A 5I1KH 4I18C 4DKAA 1OOAA 4CADB 2YBRB 5I1LA 4XP6H 3GM0A 1NFIB 3B3IB 1EXUB 1FN4B 2HFGH 3KPRB 1EFQA 1OY3B 4ZUVA 3HPJA 1I7ZA 2EE9A 4JFYA 2FECI 4WI4A 2GK2A 4Y2DB 4N9GA 2VE6A 3RIFF 3MA7A 2KZWA 2HWZL 2W91A 2F5AL 1AR1C 1ETZB 4LF3A 1JUFA 4MD0B 2I9TB 3F12B 4IJ3B 3TIEB 3WSQH 3T0VA 3TBWB 1G0DA 2ZUYA 3BH9B 3U82B 5EIIB 3PP3K 2VKWA 1HXMB 2BNRA 4K9EL 2NXYB 2P1YA 2JCCA 3FONB 2IFFH 4R4BB 5D1ZC 4UBDD 2BVUA 1ADQL 1DBAL 4F57H 3U9UB 3F5WB 3DI3B 5CJ5A 1IM9D 3VXPA 4LDEB 3UPAA 1MCRA 2I5YH 5E6YA 1FV1A 1CQYA 3WJLC 4HQQH 4P46B 4POZD 1QBLL 1O7VA 1F3JB 2YUVA 4RGNC 5EULV 3U2SA 1TZHA 1X7QB 3QWRD 3P73A 3EZ8A 3H9SE 4LCIH 2EEDA 3RAJL 3RL2A 4FQJH 1FNGB 4LLUB 3I50L 3G04A 4JGUA 3EDFA 3WS6C 4JZOB 1H15B 2ZG3A 3FZUC 2BVOB 5F7HA 5IKCA 5HY9A 4L8DB 4ZQKA 2NX5B 4Z77A 5FUOL 2DQHL 3TO4C 1KT2A 5C0JB 3BVNB 4J3XA 2BSSA 4XHJD 1G9ML 1NSNL 4YFLF 3S35X 3MRHB 5CHNA 1OM3L 1OB1B 1U8JB 1CN4A 1IGIL 5BS0E 3MOAH 4BQ6A 2H8PB 3UJTH 5ESQB 3LN4B 4M7LL 1X6NA 5CP7A 1YY8B 4X6DB 4JO3L 3T2NH 2D0HA 1G7PA 1HH6A 2UZYB 4P48A 3FO2B 1Z5LB 3VRIB 4P2QD 3SY0B 4G9FE 1ZHNA 1RVFH 2B2XH 3ARSA 2O26U 3N85H 4GG6E 3VXME 4JG1L 1T03H 5FDWA 3MUY1 3ARGC 3IXAA 1QFPA 5EFIA 4GAGL 1A9EA 3NTCH 5CKAA 2Y7QA 5DUML 3FN0H 1MWAH 4WY7H 4XPHL 4ONFH 4EN3D 2F5BH 5FM4A 3BQUC 1RFDL 1I3RB 2CLVA 3MRKA 1UWGL 3DMMC 2X70A 3FB8B 3D2UA 4WEBL 2DL2A 4JANA 1QA9B 1I9JH 1JYWA 2QKIA 3RA7L 2MCG1 3U30C 4MNGE 4M1GL<