1ND0B

Cationic cyclization antibody 4c6 complex with transition state analog
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG2A
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 222
sequence length 222
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0B01
2XWTB 2VL5B 4XAWL 5AWNL 2X4TB 4WFGE 3HI6L 2WBKA 4NQSB 2X4QA 1KLUB 4LSTL 4AENA 3GSUA 5HHPB 4X0KA 3CVHL 1JPGB 4GAFB 1W0WA 1BBDL 4LSUH 5DLML 4KDWA 3MBEC 5GGSA 4R7DA 2DWEA 4RDQG 1N2RA 4LCCC 8CGTA 4OB5H 2QADC 2VZTA 5DHVH 3P4NA 1TJHL 3IJSB 3MYZA 5TF0A 2OJZH 4RSVA 1I4FA 2A0LC 2IPKB 3MCLL 1ITBB 4M6NH 3TFKD 3Q2CA 2XKNB 5DHVB 5IFAL 1FH5L 5EBWA 3FHQA 4UILL 3G5XB 1TQCC 1Q1JL 1VGEL 1ZA6A 5FF6A 2VL4A 4PJXE 1VKXA 3PHSA 2F53E 2XA8H 1HHGB 2YS4A 1EIBA 1P4BH 3I2CH 1PLGL 4PJHB 3WNOA 2F9BT 5IESH 3FONA 3U82B 43CAB 1ZGLA 4LLWB 4P5MB 4XHJC 4GBXA 1A4JA 2BRRH 4I77L 4XPAL 2ICWA 4GW1B 1DQLH 1U3HD 1WCQA 4JHBA 2YKLL 2VDOL 3BKJL 3MRFB 4PRIB 4O2EB 3BZFB 3VFVA 4R7NA 2BFVH 4OCWL 2XZZA 3T0AA 4HJJL 4LPXA 1JGUH 4FQXC 1CZ8L 2FX8L 5D8JL 2ZSVA 1OD9A 4JPIA 3DLQR 1CDBA 1K3ZA 3S37X 1X6LA 1QUNA 2VC2H 5E2VH 5LCVL 5KSBA 3D39E 3P11L 4GG6A 4XP6L 4UNVA 1MCKA 4UQ3B 2IAMC 3DJ9A 5HGDB 4CADA 2AK4A 2GJZA 2W9LA 1L7TL 4Z0BL 1EXUB 3CX2A 2OCFD 2GCYA 4NWTH 2YD7A 5L6YL 2P24B 1Z3GH 1CVSC 4X4MA 3H9HA 1PAMA 5EIIB 5FA4A 2EDYA 3JV6B 1JWUB 3TCXA 3VGEA 3BHBA 3PNWB 5C0CE 3RTQB 1TZGL 1OP3H 1U95A 3IJHA 4P4KC 2ITCB 4KTDH 4TVPD 4X6FB 1OAUL 2LVEA 5IHUH 2UZIH 2R29H 2WINA 4ZYKA 4HUNB 5CEYB 2AABL 1YMHB 4J8RA 3O3AB 5D2NE 5FKAB 2V7NA 5C8JA 3GB7A 5AZEH 3C5ZC 2R1YB 3FFCE 1CDIA 3NN8B 4QHKI 2CLZB 1KACB 4MWFB 1HSAA 3AC0A 5KOVC 4JM2C 2NTSP 3VJ6B 3B83A 3I75A 4PJAE 5AZ2H 4XB8A 3MYJB 1M6OA 4K3EH 5JTWA 2FATH 4YDLB 3DXAD 5DD0L 1UFUA 1YYLL 4H0IA 4ODXB 5ICYA 1PBYA 2IGFL 2C1PA 3GSNA 5C0NC 3KGRA 1Q0YH 1AO7D 1KYOK 3BQUB 2AJUH 2Y06H 3M45A 4OCXL 4DOHB 1HYSC 1Y6KR 2OR7A 3AS1A 4M43H 4EQ3A 3H3PL 3QG7L 1A6ZA 3UJIL 3UTZA 5CSBA 5CAYB 4G7VH 4OZHB 1LO2L 1ZWIA 1LE9B 5EU4B 4KKAC 2NY2C 2VLKD 1KF9B 1NQBA 1EA9C 5C0GB 2BSSA 3JWOC 4BJLA 1I9RH 1JGLH 2V7HA 4U1SB 4N8CH 4PJDE 4ALAL 2I9LB 4ZUTA 4RMTA 3I9GH 2ED7A 3ARFD 2W1NA 3WHE1 4ZOBA 3CFEA 5KVEL 3I6GB 3LDBB 1YMME 4PJEE 3DX8A 5GS0D 3QJHB 4G6AD 4LAJH 3TJHD 5EN2A 3QFJE 3I84A 4ZNEA 1H3GA 2FEDD 5JIIA 1CBVL 1EVUA 1I8IB 1TCRB 2CDEB 2FECI 3WXVL 4NM8H 1JTPA 1CE1H 3UTPE 5IJVA 4YDIL 3S5LA 1NFIA 1A0QH 3KJ4C 2DQHH 3C60D 1XR9A 1N6VA 2QV2A 3DX6A 3F6LA 5HI3C 4TNVK 1C5BH 3P30H 3LKQB 3MOBL 4WGWB 2HJFB 3F7YA 1CD9B 5CZVL 1WT5A 5EOQH 4MQTB 4PJXB 1HHIA 2F53B 2DL9A 3TH2T 1AI1H 3ZHDA 3RHWF 3S96B 2PN5A 2ZKHH 1G7MB 2FD6L 1YA5A 4LFHG 1DQJB 1YY9C 1QTYT 2JELL 1MI5E 4ENEC 4KZEL 1UJTA 3T1FB 2GAZA 4GBXC 3RP1A 4BFEA 2FJGA 5ITFA 5F1OB 1B6DA 1HI6A 4RFEA 3RVUC 3EYFB 1JRHI 2DDQL 3NIDE 5F88B 4TNWF 5D7IA 1T1YA 3EBAA 1YN6A 5GGTH 4KJYB 3STLB 4QTIH 4Y5XA 2Z31D 1ZV5A 1NGZA 1T5XA 3PGDA 3WD5H 5JOEA 3A67L 4OLYL 3U4EA 4NZUH 2JKXA 1MRCL 4YHML 1RURL 2YD1A 1QLFB 4I0CC 3D39B 4X7DC 3G9VA 5ITBL 4XP1H 2RR3A 2W07A 3HAEA 1J8HE 4IRSB 3ZE2F 1D5BA 1FAIL 3TPUA 3EOTL 5DSCB 3ZHKA 1KPUA 3MO1B 2BNUB 3V6BR 3NTCL 2IPTH 4YWGH 3ULVC 4HS3A 3H7LA 3K46A 1QQDA 3PWNA 1MSPA 5C0CB 3QDHA 5LWYH 3S88H 1IT9H 2DTMH 2IADB 4OF3A 4U1IB 2Q76B 1NCTA 4HWBA 1PJ9A 1N4XH 3CVIL 1PX4A 1U3HA 1NGQL 1CIDA 5D2NB 4DVBA 3D25B 4FZ8H 2O5YL 2QQLL 1G6RH 5HGBB 1MH5A 3FFCB 4HJGA 4ZFFB 1NCCL 2UZXB 4HZLA 4FFZL 4MA3B 1NAKL 4WI6A 2OL3H 2X40A 3MLYL 4DZBB 3BT2H 5DD1L 1G6RB 2GEEA 1NEZA 5A2FA 5DJ6A 1CFQB 1KCRH 1QA9A 2E9WA 1C7TA 3VMOA 4GQ9L 2OL3B 4Q9CA 4PJAB 4I13B 5AAMA 2VERN 4HMCA 3LQZA 4C59B 4KQ3H 5B8CB 4NKMA 3MRMA 1UWGL 3TP4A 2OSLA 1D5MB 3BH8B 3RTQD 8FABA 4PR5A 5TFSL 4WEUD 1IZKA 5E1AA 5GS2H 2MJWA 4HS6B 4DCQB 2X1OA 4O2CB 3TT1L 1MWAH 2NR6D 5F7WC 4M3KB 1WEJH 5ENWA 1P69B 4NZTH 5DMKA 2CUHA 3C8DA 4XBEL 5GRJL 4C57C 5F1KC 5CLWA 1MWAB 2QLVB 4TUKL 4J23A 4UINH 2VXTH 4P2RE 4AMKL 1RJCA 1EEUA 4LOUD 4GKNB 3OTTA 1VEPA 4EXKA 4JDVB 3VXRE 2VUOA 4KI5C 4WHYG 1Q9OA 4CUCA 1YPZE 1KIRB 1T80A 1GZPB 2CLRA 3QO0B 2J12B 1EMTH 3VD5A 1XF1A 3SO3B 4PJDB 1S78C 1T7VA 4MA1C 2MTPA 1DUZA 1T7ZA 4MXVE 2OTWA 2FLBT 1GIGL 2NW3A 2K7PA 4UI2A 1AD0A 1LK3H 4O51B 3ISWA 1JYVA 2PUQT 3DX7B 4WI2A 5CJOH 1JNHA 5J1AA 3QFJB 5EUOA 1QO3B 4Y5YC 4YHYC 5C0RL 1BIHA 1CK0H 1PSKL 4E5XB 2NY6C 3ZTJH 4M5ZH 3V2AR 3PABB 3CU1A 3DXAA 5IQ9A 3T09A 3TBWB 5C0DA 3Q5YA 3QJFB 3CLEL 4MJ6B 1NCNA 1HH9A 1OCWH 3O2DH 2WIIB 3FN0H 4NSKB 1U8IA 5FDYA 4I48A 5I30L 3T4YA 3DX9A 4ELMB 1WIOA 4HKXA 2I07A 5TDOB 3FMGL 3EJZD 2YBRA 5DJ2A 5GHWL 1WT5C 1MCQA 2PF6A 4QHMA 1YDPB 2ZSWA 1NCBH 1Y0LB 2A9NL 1GZQA 2H8PB 4U31A 2DBJA 1KT2A 4M7ZC 4XCNA 1JYNA 4QY8B 1JE6A 4JN2B 1TJIH 3ARDB 3KLAB 1M7DB 3M1BB 1A1NB 1FL5B 3HPJB 5DJDB 4YH6A 3ARFA 4NQCE 2QJDA 4N0UB 5ELIA 4LHUB 4WO4D 2R0KL 3BVNA 3QNZB 1NMCB 1T04B 2UWEF 3KPRB 3GIZH 5TE6L 1FSKB 4N9GB 1BREA 1J05A 2FCBA 3C6LB 3WSQH 1MLBA 4G6KH 4Y5XC 3IDNA 2OR8A 3WL9B 1DBJH 4JKWA 5FAAA 5EC1A 3VRIA 4XPGH 4PGEB 2F53D 3AS0A 1DSFH 4DKEL 5AYQA 1J8HB 3DROA 2VDQL 1FFRA 5E2WH 4OFKA 5I1DA 4GXUM 4Y8DC 2EDJA 4LCIL 2VNCA 1T0PB 5E8OA 1X6NA 2HFEA 2JCCF 3TFKC 1K8DB 3ARGD 1SVZA 2XWTA 2VL5A 3GI8H 2VR5A 1W72H 4NQSA 5BV7C 2I9TB 1W72B 5F9OH 5FYLE 5F93C 5HHPA 2YRZA 2Z93A 3LN4A 2EDDA 1KEGH 1MFDL 5T3XE 3D39D 4P9MH 4AL8L 1U3HC 4NQXB 4V1DE 1SBSH 4XC3H 2I60L 2IPKA 3DVNA 4OF6A 5DHVA 3MUY1 2Z31A 5IGXH 1I1AB 4NC1C 3G5XA 2ZZUT 2IMMA 4IRJB 1YNKH 1G0XA 2BK8A 2NXZB 2YA0A 5C0CD 1AD9B 1GAFH 2VH5H 3KR3H 5CBAA 1JPSH 4QKXB 1XEDA 5E8PB 4G43B 4XXDB 5F6IC 43CAA 1ZHBB 4MQXD 2NW2A 1IE5A 1T2XA 4P5MA 4JDZB 1JTTA 1W0VA 4MJ5A 3G5VA 4EUPG 2YEZA 3CSPA 2F19L 4PUBL 2LABA 2I5YL 3EDFA 5DJ0B 5C3LD 4P2RB 1U8OB 2FECL 1P7KB 2QTEA 4JRWA 1BZ7B 3FFCD 3FAXA 3VXRB 4QF1B 1NGWB 3RIFF 5I19H 2NY4B 1DN0A 2EDEA 1YPZB 1IGYB 4JFHE 1U6AL 1GCFA 3IS0X 1RVFL 1QYGL 1UXSA 2ADFH 2BY1A 3MLTB 1MCDA 2FJHB 3PXHA 1C5DB 1QNZH 5IP4A 2UZYB 2YD6A 2ZUYA 2PETA 1YEJL 4JFDE 3VXUD 2ICES 3TN0B 2Q8AH 4UQ3A 5EU7C 3FTGA 4UMGA 3WFHB 1ZT7B 1EXUA 1VEOA 5DI8B 5JXEA 5EIIA 4MX7B 4P2QE 2OR9H 4ZMAT 5HDLA 1T0MA 3VWJD 1O0VA 3O11A 4BK4A 5ABDE 3HG1E 4LU5H 4Y4FB 2X9WA 1UH2A 5DEFB 4L5FH 1UB5A 2ITCA 2DQIH 4HK3N 1LEKA 1KN2L 5DURB 4X6FA 1DANT 4YXLL 3GMQB 2E6PA 3MLRH 5CWSB 5JZ7D 3TT3L 4HMDA 5CEYA 2B5IC 4P5KB 2LAAA 1YC7A 4OM1H 4PJ8D 1SYVB 1TVDA 2IBGA 3O3AA 4PBWD 4FQCL 3UBXB 1SVCP 1YMMD 3T77A 5E2TH 2R1YA 1JMZA 1XIWB 2X4RB 3NN8A 2CLZA 5T5FL 4JPKL 1UM6L 3HZKB 3JTTB 1LILA 4PRHA 3H3BC 4JGJA 3VJ6A 1J7VR 5I1HL 3MYJA 1MRFL 5FECB 3UTPD 2Q7YA 4JRXD 4NQCB 2YSSB 4ODXA 3BWAB 3MJ9H 4LPWA 3BJ91 3C5SA 3ARFC 4Y7MA 5J11C 1JBJA 1BD2B 1T89A 4XAKD 5F96L 5E8DH 4GFTB 1DQML 4TUOA 2D0HA 2DM4A 5I1GL 4Q9QL 4OQ1A 5GS0C 1RZKC 1CXIA 4G6AC 3F7VA 1CFBA 3RX5A 3ZE2E 1VFAB 1FG9C 4OB5L 4P3DB 4HS8L 1J88A 2VR4A 4XGZA 2FEDC 3RPKA 4OZHA 2OJZL 3PWVB 4KMTL 1CIUA 4BSWB 4LLAA 2DQFB 5C0GA 1UWXH 3K2MC 3QUMA 5H37H 5GJTL 1MI5D 4YR6A 4U1SA 1HSBB 4JO1H 2R0LH 3EJYD 3BN3B 4NPYB 3VXME 3LEXB 5IBTH 5IJKA 2F74B 3O3EB 1QFOA 1OT2A 3I2CL 2EH7L 3W9EB 3I6GA 5IESL 4GG8B 2PO6A 5I1KH 5FYLH 1ZHNA 4GUPA 3QJHA 4R4ND 3C9NA 4ODTH 4ZPTB 4WTXA 1ZLUH 4LIQE 4NNXB 3B6SA 5JIPA 2Y36H 1OWRM 5T3XH 3BIBX 4ZAKA 4F7EB 1TCRA 2CDEA 3LKPB 3MXWH 3MROA 1YECH 5T1DH 5F3HB 2VZ1A 1IC5L 4WO4A 1JGUL 2WUBH 1BPVA 1QRNE 4JHZA 1P53A 3MA9H 3KXFE 2ZJSL 3Q1SH 1OP3K 2Z31C 3B5HA 1AHWB 5EA0H 2C3VB 2AERT 5DRNA 4ZUSB 1CGTA 4ZUUA 1IJ9A 3D9AH 2R0ZH 1AGFA 1G7MA 3FQWA 3MRIA 1DQJA 3VXNA 1OSPL 5CP7B 3MGOB 3QIBD 3SQOH 2AJZA 4OD2B 2XPGA 3KPLA 3T0DA 2QQKH 3IXTA 4MLSA 5B3NA 1MELA 3ARGA 1NFKA 3QH3A 4CMMA 1ZLWH 2PTUA 3STLA 2DL2A 1YUHB 2R29L 5IEKA 2XQYG 5HHOD 3V5KB 2ID5A 1I1AD 3EZ8A 3MRNB 2HLAB 4YBLB 1ADQL 1VFMA 2C7UA 2XXMB 4U1JB 1NSNL 2NXZD 5C2BH 3TIDB 1T21B 1QLFA 4JFDB 3D39A 3K80A 2E9IA 2O26U 3PHOB 4M6MH 1NUGA 3HC3L 5LGHH 2E7HA 4HH9B 2AQ3A 3OAYH 5BJTB 5AZ2L 5F72S 1NBQA 1OAKH 1GPOL 4QYOA 3JV0A 2NX5B 3JUYA 2FATL 2ICEB 4O58L 3PQYE 3THMH 4P2QB 3L5IA 4P2RD 5JXEC 1OGAD 2NY0D 4ETQA 2WK2A 3TLRA 1Q0YL 1VCAA 3KYNA 4K3DL 4TRPL 1IAOA 2AJUL 1RZJC 2Y06L 3VFGL 1NANH 3VXRD 1XCQB 3HG1B 5C0CA 4M93C 2NTFA 1MCBA 1KB5A 5C7XL 3R8BB 1AR2A 4M43L 2OX5A 4U1IA 2PW1B 2Q76A 4GKZB 4G7VL 4N0CD 4J3TA 1B9ZA 2NR6C 3QG6A 3P73B 4WHDA 1TFHA 5ECJE 3TGXA 4AT6B 4FQHB 2HP4A 5D2NA 4HLZG 3D25A 4POUB 3S8WA 1ZVSA 2AQ1A 3FFCA 4ZFFA 1KIQB 2X89D 1JGLL 2BVQB 3NZ8B 4LOUC 4MA3A 1KCKA 3OMZA 3PV7A 1UGNA 3MNWA 5MP6L 3I9GL 2UWEE 5F9WB 1YEKH 3UCRA 1JFQL 3HMXL 1AC0A 2XFXB 4FNLL 4PJAA 1CXFA 5C86A 1QRKA 1I7RB 2ADGA 1HXMA 1RULL 4PGDA 4OAWB 1D5MA 2Z9TA 3BH8A 5FA3A 4Y4FD 4JR9H 3VXUA 4N1EA 5IHBA 3OZ9H 2WSKA 3FT2A 4HHAB 3H3KA 1T89C 2XWJA 4NN6B 5DURD 1EO8L 4LSDA 3NCMA 5C70A 4X7SH 4NM8L 1IAKB 1CE1L 2RHEA 1IAIH 4PGCB 1MWAA 3QUZD 1A0QL 4UNTA 2MPAH 3T4AA 3VWJA 4QRQB 2LU3A 1C08A 2JCCE 4GKNA 3SDXB 1C5BL 2APFA 3ORJA 3LPGA 2PYFB 1QP1A 5EFIB 2WLZA 2D7QA 1F3JB 3VG0H 2FH6A 1KEMH 1KIRA 1FFNB 1GZPA 2HT4D 3QIWB 4PV8B 4RQQA 4JFXA 4PJDA 5TDPA 2H1PH 1FORL 1KJVB 1UZ8B 4JO2H 2HTKD 1OAZH 5IJKC 5DJCB 4PJ8A 5GGRY 3RGVB 4NZJA 4H8WL 2ZKHL 1YMMA 3DWTA 3KJ6L 4PJEA 5FYKU 5T33L 1CFSA 4JFOB 4S0SD 2PO6C 1KIUA 4O51A 1ZEAH 4NO5A 2Y25A 4HQQL 5HSFA 1QO3A 4RMVA 2J1KA 4GLRI 1X7QB 4ZAKC 5GGTL 4JRXA 2C3HA 2J5LB 3BISA 3FB6B 3EJJX 4WO4C 4MJ6A 3UJJL 5FOBB 5D1QB 4OI8A 1HH6A 1QRNB 3SE8H 1CT8A 1FVDB 1OD7A 3LKNB 2QQNL 4Z7VF 2F15A 3KXFB 3ETBF 1LGVA 3HC0A 1MREL 1JV5B 2QR0B 3FOMA 1Q94A 1F4WL 1C5CH 3ECBB 3O41B 4M00A 4LSVH 1A22B 2IANE 2GITB 3LAFA 1J10A 2F8VA 4QRSB 2ZG1A 5DJYA 5FYJL 5FYLD 1FV1B 2H8PA 3IFNH 3OQ3B 5BMFH 4PJIF 1MI5A 4QY8A 2IPTL 3KLAA 1M7DA 4YWGL 1A1NA 1YJDC 5T3XD 3HPJA 5DJDA 2V9QA 5FCUH 1T04A 3KYKH 4NO2B 1IT9L 2DTML 4V1DD 3ARGC 3FT4B 4YPGA 3S6CA 4F9PA 4HUXB 4UQ2B 2E7CA 1WAAE 3DYOA 3MV9E 1RI8A 4D0CB 1GOHA 1N4XL 5E0QA 3WL9A 3ZYIA 1A47A 3U6RB 3BD3A 4FZ8L 1G6RL 2JB6B 2OJEB 1BQSA 4YK4B 4P3WA 2ZG3A 2PR4H 3BZ4B 4MDIB 3ARQA 1BBJB 4X7EC 1KCRL 4GO6B 4CGTA 2ORBH 1DQDH 5FGBA 1A6WH 4KQ3L 3IXAA 3PQYB 3IU3B 1Z0NA 3T2NH 2NXYD 3NA9L 1IAIM 3BN9D 5D1ZB 1F4HA 1DLHA 2X1QA 1AGCB 3VFWB 4JDTH 4OFDA 1BQHB 1RUQH 1KPRB 2E7LA 5I0DA 4UINL 2VXTL 1R5VB 5DJZA 3QIBA 4LLVA 1I8MA 3BKYH 4YFLI 3TO2A 1NBVL 5GGVY 4JFDD 4RMWA 4WHCA 4FP8H 4TN9A 3VFRB 3I02B 4NQXA 4J7RA 5D2NC 4P9HH 4XWOD 1EMTL 1CFVL 3HZVB 3L3OB 3KLSA 1U8MA 3ROOB 5IMLA 2ZOLA 2UWEB 3GHEL 5HHOA 1I1AA 3GMOB 5ICXB 1NDMB 1RMFL 3MR9B 5HGHB 4KK8D 1V5JA 3MV8E 1WJ3A 4YUEH 2LTQB 1CD0A 4R9HA 3K0WA 4ONFH 2AJ3A 1AD9A 1BJ1H 4WEMB 4G43A 4XXDA 1CXLA 1G9MC 3OB0H 1R3JB 2ARJA 3FB8A 3C87A 3D6GA 2HMID 3IGAB 1MCNA 5EUKB 2ZNWA 1T20B 2NZ9D 4P2RA 1OGAA 1FZKB 1OCWL 2JCCB 1JPTH 3REVA 1PKOA 3VWJC 3NCYS 3FN0L 5HY9B 1NCAH 3VXRA 4Y4HB 3LQMA 1NUNB 1KG0A 4ORGB 4MCYB 5KZCB 3I3DA 4WW2B 5HHXL 1KJ2L 3WKNA 4X8JB 2BC4A 4NQEE 3SO3C 3NCEB 5DVLA 3ZDZF 1FNSH 3OAUL 4OCYL 2NY1B 1HEZB 4H1LH 5JZ7C 1EFXB 3FRPA 4OZFG 1MAMH 3PWPB 4PJ8C 3HLAA 3D0LA 5BZWB 5I76A 4H1LB 3S36X 2R4RH 4JGMA 3SBWA 2X89A 3PE9A 4LFHD 3QP3A 2Y07L 4B5EA 5HYJE 4GRLD 1Q72H 5C08E 3PP4L 3V95A 5F1IB 5J4MA 2D9CA 3CFDB 2DQUH 3FT3A 4MXWH 3MX0A 2VSCA 4HIJA 1CL7H 3N50A 1CU4H 4F3FB 5JW4R 2BY0A 1TCMA 3QQ3A 1GL4B 2YZ1A 4Y4FA 1ZS8A 2VXUL 4WTZG 2B7DT 5C0BE 5DEFA 4BQCA 1N6UA 1DBJL 3CH1B 3SKMA 4I2XE 3QIWD 1JZ3A 1H3TA 4IBLT 5CBEB 1ROWA 1VPOL 2JB5L 3VXMD 4XNMB 3LH2H 2HKHL 4Z0XA 1DSFL 4P5KA 2GIYA 2YR3A 3X12A 3QUZA 3RGVD 1UG9A 4EQ2A 1QLRA 1NPUA 3UBXA 4MB3A 2BSED 3VDBA 1JK8B 2IANB 4JKMA 4K7PH 2CK0L 4HKZB 1SM3H 1AP2B 1MJ7L 4LVNB 1WLHA 2BVYA 4L3CA 3V0VB 4P4RA 4XP4H 3GI8L 2G2RB 1FGVH 3EJYC 1U8JA 2VZVA 4DUWA 3BPCA 2DWDB 4LP5A 2QKIA 5ADPH 4GRMB 5KJRL 3SY0A 1NMCC 4WI8A 1KJMA 1FSKC 4FMKA 3MV9B 4F7PA 4F9PC 1F42A 4YE4H 4A2MA 3V9FA 1S7TB 3KXFD 5EPMB 4R4NC 3P0YH 2V9TA 3MACH 4NZDA 4RIRB 3VG9C 4P9ML 3WIHH 2DQEH 5E08L 1VFAA 1HHJA 2GTWB 3DV4B 1BVLB 1ZGLP 5B39G 3LB6C 2DAVA 3WLWD 1OTTD 4BH8B 3LZFH 4BQ6A 3GK8H 3TBYB 4X4YB 5IGXL 4NQDE 3KDMB 3C2SA 5C0FA 1DANU 3IYLW 4WTWA 2VLLB 2FL5A 3WLBB 3WO4C 3OXSA 4I3RH 3QUXD 3IF1B 3SGJA 5FGBC 5K9JH 2F74A 3O3EA 4NFDA 4X5XB 1GAFL 4X4XB 2GW5A 3DPBA 3L3DA 1ZLVH 4P2YA 3D0VA 4YHNB 1J1PH 1QBAA 2DIBA 3HRZA 4ZPTA 1S3KL 1EEZB 3L5HA 1NGYA 2EE9A 1MIEH 1SEBA 1U8LB 4YFLF 1ULVA 1WISA 3S4SG 2C3GA 3STZB 2E7LC 2XG5A 4NRZB 1DJSA 3QIBC 1G7IA 4AK1A 2C5DC 3F7QA 1HWHB 2XQBH 5I19L 5EZLB 1IARB 1ES0A 5DA0B 4WNQA 4V1DA 1I3RB 7CGTA 2ADIB 3QIUD 3PQYD 3VDCA 5CSZB 3DTXB 1I1AC 4LDOB 3DMMA 1N26A 4G80B 1AHWA 4HUMB 2VXQH 1WZMA 3AAZB 5D1ZD 4XMLH 3SGEI 4CN4A 3HMWH 2NXZC 2Z91B 4R8WL 1IC4H 2RIKA 4HXBL 4JO3H 2YK1H 4OQTH 3AUVA 4OD2A 5D4QA 5C09D 1W0YT 4PY7A 4Q0XH 3ARXA 5KW9H 1JUFB 1JGEA 4LU5L 1XF4B 2P46B 2DQIL 2NY0C 2W9DH 1UC6A 3SGDI 4YAQB 1CG9B 4FABH 1FJ1B 1RIUH 4F7CB 1YUHA 4GJTB 4NBYB 4WVRA 1RUMH 4EIZC 1A3QA 5CKAA 3G6DL 4NQEB 4N0RA 5A16A 3I3EA 4M7KH 4LLDA 4N0CC 5L8KB 4OF8A 4JFDA 1NLBL 5ESQA 1BJ1J 4JB9L 1L4IA 3PHOA 5JPMB 4LPVA 4P2OB 4PJ5E 3RBSA 3SN6N 5DRZB 5BJTA 3SBWC 3IDMA 1KENH 5HYJB 2ICEA 5C08B 4TYUA 1FGNL 3MJ9L 4J3WA 4PG9A 5MERA 1UWXK 2GTZB 3VFTA 4RZCB 3ARSA 4ZPVB 4AEIH 4Y19B 5I75C 5E8DL 3GMPA 4XVSH 1P5UA 1XCQA 3SPVB 5I1EH 3H42H 4R2GB 1KJ3L 4Y4FC 4I2XB 3MMEA 4XPFH 4YHKL 2PW1A 1NMAH 2EYTB 3RAJH 5DRWB 3VA6A 5SX5H 1LO0H 4HZAA 1AGEB 2NY1D 3P73A 1ZLUK 3OPZL 4NJAH 3OGCB 3LQAH 1B0RB 3QQ9D 4AT6A 3DV6B 3QUZC 5TJWK 4M7JH 4MMXC 3BDBA 4Y89A 2BVQA 4LVEA 2R0LL 3KYMB 4OT1H 5IBTL 5EO1B 4TVSa 1BFSA 2XFXA 2HT4C 3LKSB 2HVKB 4Q6IB 3H8NA 3GMMB 4UTAH 1KB9J 4JQIH 1OGTA 1QR4A 4FQLH 1Q9KA 4LSQL 1FE8H 3QULB 2DJSA 2HTKC 5DZLA 1FNFA 5F8QC 1KPVA 4Y2DB 1FPTH 5C07B 1R5WA 2DIAA 3MXWL 4IS6B 1CFNA 1IAKA 5GJSL 3G6AA 3IAGC 4GRLA 3MLWL 2MKLC 2VDMH 4R26H 1ZHLA 2WUBL 1KCVH 4D3CH 3QPXH 3RA7H 2OK0H 3P9LB 2IBBA 3JV5A 1CLCA 2IAND 4QNPF 4UDUA 2VQTA 5EFIA 2PYFA 1IGFL 1A14H 1LDPH 5D5MF 4NQDB 1F3JA 2J8UB 1FFNA 4PV8A 2R2BB 2YA1A 4LKCA 5F7NC 1K5NA 5EA0L 3PG2A 4I0PD 4M48H 3QAZB 1KJVA 3T0BA 3VXMA 4IOSD 3S37L 5I8KH 2IALA 1UZ8A 3SGJC 2VN4A 1NGPH 3RGVA 3U0WL 3I50L 1QHPA 3EFDH 2AGJH 4JFOA 1NFDE 4HEME 2YRLA 3VDAA 1PZ5B 2P7TA 4DEPC 3IRZA 2B0SH 5ALCH 4D0BA 1X5XA 2G60H 1OHQA 3OAYK 2EEDA 5BRZB 3CZFB 3ARTA 1VERA 5B4MD 1HCFX 5EZIL 4PP1D 4G5ZL 4JPWH 3E1F1 2GK0A 3VXPA 5FOBA 4PJGF 4S1RH 3S35X 4XVTL 1R0AH 1EDQA 3AB0B 3OG6B 3FQNA 2DLGA 3KXFA 1PZUB 3V5HA 1FVCB 1JV5A 3DMMC 1J1OH 3B9EA 3FN3A 1AHWC 1WCBA 3RU8L 1JHTB 5D70H 1SY6A 2IQAB 4YHPA 1WWAX 2GJ6D 2CDGA 4KGLA 2GITA 2Y5TB 1ZSDA 2FRGP 1A9BB 4KK9D 4PREB 2Q87A 4QRSA 5DZOA 4S1SH 1DVFD 1Q8MA 1I3GL 1QPPA 4DKAA 5HI4D 4RGOL 3GHBH 2EDFA 3FZUD 4J1UA 2BP3A 3QUXA 5IVNA 5DF0A 3T8XB 3U4AA 2NXYC 1G84A 1MFAL 4NQVB 3MFGB 4LASH 3HRPA 4UDTB 4D0CA 3EYUL 4YDKH 4E9LA 4LKXA 3BGMB 4MLIA 3T3MF 4Z7WE 2VYRE 4S10A 3MV8D 4LNVA 1CWVA 4YBLC 1BVZA 3RIAF 5IB1B 1KXQE 4KVCH 3BZ4A 3NIFF 2KDGA 1YEKL 2I25N 4PJ5B 1NEUA 3NBNA 4XWOC 2GSIA 4ODWA 2VQ1B 3WHXB 35C8L 2DLHA 3QIUA 3BPNB 4F37F 1NUDA 2HKFH 1MCPH 3GSRA 4I3GA 5D1ZA 1HQRA 3KPSE 5IMOA 4X7SL 1AGCA 3VFWA 4DKFH 1IAIL 5IMMB 2Q8BH 4S2SB 4XCFH 3KVQA 1BQHA 4FZEH 1KPRA 1R5VA 2MPAL 4NQED 4XCYA 3UYRH 4XX1E 5C09A 1IGML 4L8BB 5E70A 2HMIC 1J0KA 4NQTA 2NZ9C 3VG0L 4P2OD 2JK5B 3OKOB 4L4VE 5JDSA 1AIFA 2R9HD 3HZVA 5DYOB 5HYJD 3ROOA 3EOBA 2UWEA 5I74B 4JFYB 2GQHA 4HK3J 4PTTB 5DS8B 3GMOA 1EEYB 1SMAA 4O5LL 1NDMA 5HGHA 1TITA 5J56B 2OMBA 3MRDB 5E95B 4UAOB 5C0BD 1NJ9A 3RQ3A 1NLDH 5GSVA 1K9TA 3MNZB 4IOIA 1GC1L 3VD9A 5DFVD 2X41A 4HKBB 4G9DB 3DHJA 2KQNA 3IGAA 1I1YA 5EUKA 4GRLC 1RUAL 1FZKA 4TPRH 4OCSH 3QHZL 3SE8L 2JCCA 4DZ8B 2DQTH 4UOJA 3UTTB 1EHLH 1N64H 3OX8A 3GSOB 5GRYA 5A2LH 4FQJH 3O2WL 5HHQB 3G5YB 4NCC2 4WFHE 3PHQA 3JTSB 1KUMA 3RL1A 1C5CL 2VABB 2CUMA 2EDLA 1K4DB 5LQBH 3QXAA 1HEZA 1B2WL 1EBAA 1ACYL 1PKQE 3T65A 1LO3H 3RVTD 1TVBB 3RGVC 2XACC 1NFDB 1L9MA 4Y88A 1KTDA 1NMBH 3O0RL 1U93A 1XGYH 1X5FA 2P8PB 5F1IA 4XCCH 3K74B 5C6TH 3ZT5A 3QA3A 3CFDA 4JLRA 3RWHA 3MGTB 4HIIA 5FO8A 4DN3H 3FB5B 1F2QA 4F3FA 4XTRC 3L5WA 4PYGA 4UNUA 4HLJA 3WN5A 1AQKH 1TENA 4FXGB 1IC7L 2FB4L 4LGSB 1S9WA 5KG9B 1BOGB 3MRHA 3BW9A 1RIHH 5IVXB 2PR4L 1Y6MR 1TQBB 5I1AB 1JYWA 3NABH 1WZLA 1II4E 2FHCA 2IANA 3P4MB 1UVQB 2ORBL 3UTSE 1DQDL 2AI0L 3K1KC 1A6WL 1N5AA 3WLWC 1OTTC 1S7VA 4HKZA 4R96A 1F90H 2JIXD 3K7UA 3T2NL 4S1DD 3ZSSA 3TZVB 3V0VA 4OV5B 5ALBH 2EH8H 4MNHB 4I0PA 3V6FA 3DSNA 4TTDD 5LXGH 3QUXC 2MCG1 15C8H 2DWDA 3BUTA 4WY7H 4JDTL 4GRMA 1RUQL 4HUKB 4HFUH 1P7QB 1ZK9A 4OUUA 3CFJA 4OZ4B 5J1TC 5DQDH 5HHNB 3G08B 4GKSA 4OLEA 1S7TA 3FO9A 5EPMA 5HGAB 2DLEA 4RIRA 3BKCL 4M9OA 3AROA 3Q3GB 4KHTH 2VDPH 4FP8L 4Z7WB 2D31B 4TOYH 2PYEE 3GRWL 3CFKB 4HUWB 4M6AA 1BVLA 2VDNH 2XZAL 1CGYA 4MVBD 1LP9F 3S34H 4BH8A 3UYPA 1R5IB 4X4YA 4G8GE 4GMSH 4LLYA 4NZRH 3MSPA 5JXAH 2R23B 3KDMA 3KPQA 3PIQA 4MJIE 4L4TE 4YHIB 3C5JB 4NBXB 3LV3A 3WLBA 5A1AA 3P9MA 1RZFH 4YUEL 1HNFA 5JW3H 4XVUD 1INDL 3MLXL 1UACH 4OCRL 3QIUC 1E4WL 3QSKB 1V7MH 4GAGH 2I27N 4OBRA 4ZSOE 5H2BB 3U2SB 1IQDB 1CD1A 2GJ6A 4XPHH 5D1ZC 3E6HB 5J9PB 1DVFA 4ONGL 2YUXA 1QSFD 3RWEB 1QFWI 4URTB 3WDHA 5K93A 4NWUH 1JPTL 5I17A 1M71B 1NCAL 1UB6B 2YWZA 2EYSB 3EYQD 4CN1A 5EZLA 5F71A 1G0DA 5JLZB 4G8FB 3TVMB 4YC2B 4L4VB 2VLJD 4PJ5D 5E94B 4HG4J 3MJ7B 5KOMC 2F5AH 4KQ4H 3K1DA 4TULL 1TZIA 1MAML 3EO9H 4G80A 3MV8A 5CJBA 5E4IA 4HAGA 2R4RL 3O45A 3RNQB 4Y5VB 2Z91A 3GBMH 3IS1X 4X80L 2YC1B 4Z18A 4GAYA 3S36H 3HE7D 4QNPE 2DQUL 1CICB 1NKOA 3HMXA 4MXWL 4ZTPL 4OBSA 1FAKT 4RX4D 5J06A 1CL7L 5I71B 1CU4L 3RIFK 4Y16B 2AJVH 2FIRT 4ZFOL 1GOGA 3VXSD 4YAQA 1FJ1A 1H3UA 4DW2H 1LE5A 2KBGA 1ZLSL 4MMZC 3RNKB 4OUOA 4YFDB 1H9VA 3RWFB 3JWDC 3GSXA 5TE4H 4Z78B 4EDXB 4NQEA 1JZ7A 5IM7B 4ZFZB 5CLTA 4M1CD 1PKQB 1N6QL 3T08A 2NY1C 2DKSA 3WIIH 1SM3L 1FLRH 3QQ9C 1IZJA 2WBJD 3V7MA 1H8SA 1R3IL 4P2OA 2R2HB 4HIEA 5DRZA 4X6DF 5A2IH 1IEHA 2VZUA 3H6JA 4XP4L 5HYJA 1A4KA 3H7BA 1JZ8A 1FZJA 2KH2B 1F4AA 2PNDA 5E8EA 1ZT1B 5EBMB 4RZCA 4ZPVA 5D2LF 2CKBH 3TBVA 2OTPA 4PRBA 4YE4L 1QPXA 3ARYA 3QDJB 1UQSB 5IFJB 4TSCH 5C0BA 2CKBB 2KUTA 3LRSA 3MACL 3H9SE 4I2XA 4OTXL 3EYOB 3GSVB 4PB0L 3WIHL 1WIPA 1ZLVK 3BP6B 2DMKA 2VWEC 5D7SH 4YX2L 3WN5C 3NCCB 3IDJB 1BVKA 3QDGE 3TIEB 4CNIB 3DGGB 3W11C 1RJLA 1YY8A 4ORZC 1QSEE 1B0RA 1EGJA 3GK8L 3OKYA 5T3ZL 4Y4KB 1IL1A 4KTEH 3UTSB 3IVKA 5GGQL 3VD7A 4NYLA 5EO1A 5F89B 1QOKA 1A7OH 3ZKXB 1X44A 3LKSA 4Q6IA 1TVHA 3SCMD 3REWA 2AEQH 1WBYB 4LCUB 3C8KB 3LIZH 1NBYB 1J1PL 2NYYD 4I0PC 3DO7B 4KZDH 1OVZA 3QULA 3CXHK 2NY5H 3IDXH 4U1GB 5CEXB 3QNXA 1DBAH 5I16B 2V5SA 3NACL 4LQFH 3NIFE 2MMXA 5IROA 3BE1L 3FFDA 4WDIB 4DGYH 3O4OB 5A2KH 2GY7B 4IOFD 3RI5F 2ZNXA 2P5EE 3QI9D 3U9PH 4C56E 2X4PB 4U7MA 1JVKA 5CUSH 5B4MC 4G8GB 5TGBB 4PP1C 2VTFA 3FO0H 4XMPL 3GGWB 5EBGA 4MJIB 1V7NH 2R2BA 2XRAL 4X9BA 1Y6NR 4JE4B 4ZFGL 1BMGA 3LD8C 5C0IA 3O3BA 5CHNA 4UIMB 1MFBH 2R8SH 5HHMB 3VD3A 1OB1B 5T5NG 4ZSOB 4U33A 2M8XA 1FNLA 1F6AB 4WHTB 1H3VA 4KK9C 1F3DH 2JIXA 4YGVB 1DVFC 5F7MC 4JFQB 4JZJB 1AGDB 2W0PA 3J8F7 5I1CH 5HI4C 3RUGE 2HFTA 4Z7UE 5F1NB 1OAYH 2AXFA 3ILPB 4FABL 4KK5D 4NGHH 3FCTA 5I18L 1P1ZA 3F7PC 1RUML 3GJFH 4RMUA 5CGTA 4QGYA 1SQ2N 5BO1H 4WW1B 1YNLH 4XH2A 3V7AE 3KNBB 3T2OA 1DBBH 3GJFB 3CSYB 1ED3B 1IVLA 1CLYH 5T5NF 5DUML 3Q6FB 1FVCA 1H5BA 5IG7B 3B5GA 5IR1A 1DFBH 3HS0B 2GFBB 3ZYJA 3KPSD 5FK9A 3MV11 1DBKL 2NY7H 1Q0XL 5L9DH 5FYKL 1A9BA 1K6QH 1D6EA 5HHVH 5HBBA 4HXAH 3IKCA 5SWZE 4XVSL 2APWA 4G6FB 2XN9E 3C08L 3H42L 4MAUL 1G9NL 1MY5A 3TVMD 3T0WA 1FFPB 4FQ1L 2LE9A 4NQVA 4XPFL 4E41E 5GRVL 4MJ2A 3CMOH 3O6MH 4R97C 1FBIH 3FQRB 4CVXB 4NJAL 4OLXH 4W6WB 1QSFA 4PJ7E 2QEJA 3DVGA 3T1WA 4JKKA 4NKOA 5IB1A 1CTNA 3F12B 2B1AH 2VLJA 4IRZH 1U41A 2N56A 4WUUB 5HYIA 3KHOA 3MBEB 1KJ2A 2XQYK 2VQ1A 4NHCH 5DGQA 4JQIL 3WHXA 2R9HC 5JOFB 2XKSA 4F2MA 1LEGA 2HWZH 4A6YH 5IQ7H 3B2UC 2QADB 3CZJA 1UM4H 4LQ1A 4Z7VA 4A6YB 5B21A 2DB8A 5B38G 4XMKL 1HDMB 1N8ZB 2EZ0D 5DHXB 4LBEA 2BHUA 4WI9A 4MD0B 1B90A 4V2BA 5DTFB 3QRGH 1L9NA 1P7HL 3H9SB 4WFHD 4R26L 1TQCB 3OKEB 2RFXB 4UT9L 3HE7A 4D3CL 3MODH 3RA7L 5DFVC 2OK0L 3QDGB 4L8BA 4RFOL 5DUBB 3TBTA 5ISZB 4RX4A 1KN4L 4YO0B 1QSEB 3CH8A 2LVCA 3VXSA 3UC0H 1JHLH 1XH3B 2JK5A 3I3BA 3OKOA 5E7FA 1GGYA 3GNMH 5DYOA 1AQDA 3G5ZB 4XZUA 4M48L 2P8MB 5CKGA 3NCFB 4Z7NF 4Y2OA 4DUXA 1EEYA 3ZT6A 1LO4L 1A9EA 4IHOA 1U42A 2SEBA 4WI4A 1I7TA 2X1PA 4Q6IC 2W60A 5FOJA 4W4OA 4KMLB 1A21A 1A3LL 4Z95L 4FQXB 2B0SL 5ALCL 4IMLB 3TBSB 2WBJA 3RVTC 3O6KH 2MNUA 2G60L 3KPOA 1KLFA 5FDWB 1LP9E 3U7YH 4G9DA 4RMRA 3QEHA 5TQ2H 5IROC 1GGTA 5KSBE 4TUJB 5M7QA 2VXVH 2IAMB 4OZIF 2P5EB 4PYHA 3TEUA 4C56B 1TTGA 2DKUA 4U6VL 5I1JH 3UTSD 4N8VG 3GSOA 3QR2A 2EICA 4X6CF 5HHQA 1E4JA 4U3XA 3S35H 4R6UA 2XA3A 2BOBB 2FGZA 3MQIA 1J1OL 1S7WB 1XF2A 1HXYB 2VABA 5ESAA 3ULVE 1K4DA 1OAQH 3QAZC 1MVFA 2V2TA 4XNQB 4P4KB 4AEHH 5DEGA 2A74B 3BYTA 2WWMD 2Q86A 1NFDA 3T04D 1YQVL 2X4NB 3FQTB 4NN7B 4CVUA 4MCZA 5FUZL 1TETH 5I2IB 3SEPA 1GYAA 2PYED 1TPXC 3BAEL 4K23H 3C5ZB 4Z7UB 3RUGB 3L3JA 4HG4K 3K4DA 3UDWA 4CVZA 4P48A 4S1DC 3SCMA 1M7IA 3HNTH 1G7JB 3BMVA 5TF1H 2DICA 4TTDC 4G8GD 2AXGB 1MJJA 3RKPA 4MJID 4L4TD 4QRPE 4UUJA 3WXWH 1L7IH 1UCBH 1IM9B 4P59L 2HT3D 5KG9A 5CS7A 3MLVH 1BM3H 3F58H 4JY5H 1HWGB 2OP4H 5I1AA 1H5BC 4YDVB 1R3KB 1RUKH 3VCLB 2X4OA 3QI9A 4LVOB 1DR9A 1KCSH 3ZMRA 4B7LA 4MVBC 5DD5H 5GISL 3TH3T 2W9EL 4G8EA 5LVEA 4WU5A 1EHAA 2HKFL 5D6CA 4OLUH 1MCPL 4ZO8A 4WUUD 3JWOH 5SWZB 4MNHA 2B4CL 3KPMB 2NY2B 2WWKO 3BYYA 2MOVA 4BA8A 5MENB 2XN9B 1P4IL 4HFWB 4XVUC 2Q8BL 4Z7OE 4XCFL 2OZ4L 5ESVA 2RQ8A 5I8EB 1FRGH 3CXDH 4E41B 3OKLA 2QHRH 1XGUA 2ARWA 5HHNA 3NFSH 3G08A 4XRCA 4KKLD 1UADC 5BS0E 5HGAA 5IOPB 3CFCH 3FO1B 3Q3GA 1ZAGA 2L7JA 4PJ7B 3P4OA 3TV3L 4AZ8A 2XI9A 4WCYH 3P0VL 4K2UH 4PY8J 3CDGA 4XVJH 1WWWX 1R5IA 4AENB 3EYQC 3E3QE 5D2LE 2R23A 4LLQB 2CK2A 3HFMH 3DURA 5EOCJ 5ACLA 4X0KB 4JAMA 4YHIA 3VFNA 3C5JA 1W0WB 5CJ8A 1OTSD 2JJVA 4PV9A 4YXHL 1XCTB 2OQJA 3Q5TA 4G6FD 4R7DB 5GGSB 2DWEB 1ZTXH 3BRFA 3KJ4B 5C0AE 4OZFA 3FRUA 3P4NB 2B2XH 4UOW0 4JEGB 5K9OB 5H2BA 3KPSA 4MA8L 1IQDA 1I4FB 4OLWH 3E6HA 5EBWB 2H41A 2FH8A 4GW5A 1V05A 3DBXB 3RWEA 5FF6B 3HE7C 1VKXB 1EHLL 5IBUG 5J13B 1YN7B 1UB6A 5C6WH 2XWBA 4L29A 1X5KA 3MC0A 3TVMA 3FONB 1X5GA 4WTZA 3O3DB 5E94A 1TXKA 1ZGLB 4UIKH 2Y1VA 1A4JB 3L3IA 2VKWA 5LQBL 5ID0A 5I74C 5E4EC 4PY8I 4D9RE 4U6HA 1OOAA 3VFVB 4R7NB 4W4OC 1VACB 4M1CC 5CSGA 3H9SD 4MA7L 4UAOC 3VI4F 2EEBA 2YC1A 3GBNH 4UB0L 1J5OH 4U7KA 2WBJC 4K9EC 1MQKH 4XCCL 5C6TL 4ZS7L 3SKJH 4JPIB 3QDGD 4S1QH 5JW5A 3JXAA 3MLSH 3QCUH 4EBQH 4DN3L 5KSBB 1B88A 1JPST 4PGBA 1T2QL 3MNVA 2IEPA 3RKDD 4JPVL 2VDLH 4YZFE 5FUOL 3TWCH 2AK4B 2GJZB 4TQEL 2GI7A 2YXFA 2GCYB 3KPTA 3PL6D 3ULVH 3BH9A 4OD1H 5FA4B 1S7RB 5I9QC 4EDXA 4XPTL 4WUKH 5JORA 3WFEL 4ZFZA 1S8DA 4KUZH 3N9GH 5B39A 3BHBB 1XR8B 1PKQA 4JZOB 5DWUH 4QRTA 2Z4QA 1EAJA 1FIGH 3VFMB 4Q9RH 4ODBD 3IJHB 1F90L 3OKNB 4EIGB 4M03A 3MXVH 1NDGB 4HUUA 4RRPG 4NUJA 1IEBA 2WINB 1T22B 4ZYKB 4OIAA 1PVHA 2ADJA 2OMNA 2J2ZA 3BIKB 1BHGA 2IAMD 4XI5D 4QWWD 1CXEA 3UDWC 4C56D 4GAJL 3INUL 3SCMC 4KDTA 3WEXA 2ITDA 5DMGD 2NYYC 1AXIB 5GGUA 3G6JF 1HSAB 2YD8A 4HW6A 4MS8D 5IHZA 4S11A 2VDPL 5ADOH 3BP6A 4TOYL 3I75B 5AG8A 3S4SA 4CNIA 5DMIH 1TIUA 1QLEH 5DQJB 4XNYH 3S34L 3O6LL 5ICYB 4GMSL 5DUPL 4NP4H 2BOCB 4IOFC 4LEXH 2G5RA 1M4KA 4U05A 1G6VK 3QI9C 4FTVA 4P99A 1G7HA 1RZFL 2WLYA 4MNQE 5JW3L 3ULUF 5F89A 3AGVA 3AMLA 5FGRA 1A6ZB 3MV01 2V5YA 1JI1A 1GRWA 3N85H 5E6YA 1ZWIB 4JJ5A 5F3BA 3ES6A 1FL3B 4PRNB 2H32H 2BSSB 5CEXA 3MA7A 4L9DA 4TVPE 2IJ0C 2V7HB 1ZGLM 4JRYE 4L1DA 1CGVA 1WFUA 2H32B 5BS0B 1OF2A 4ZUTB 3E8UL 1B4JL 3OR6B 1NAML 1TLKA 2ZPKH 4HWEL 3UJTL 4OJFH 2PYEA 1YEIL 4I3SH 1NCWH 2CUIA 3DX8B 1EJOH 2X4PA 2F5AL 4KK5C 4G8GA 4RA0C 3ZL4H 5TGBA 4Y5YB 4KQ4L 5KN5A 4TSBH 3GGWA 5AAWA 2VZSA 5DD6A 4MJIA 4HGKC 4L4TA 3EO9L 1S9VA 2FX7H 5I6XC 3D5OF 1TNNA 5SWZD 4KKAD 3KLHC 3TO4A 5IJVB 2XN9D 3DI2B 4HC1A 4JN1L 1OB1A 3SJVE 1VADA 3S36L 1VFBA 3DX6B 4P0DA 5D96C 3IB4A 3OBAA 4G3YL 1S9XA 4HPOH 4PIRF 3MRKA 3NIGE 4WHTA 1UEYA 4QXUL 4BUHA 1S7UB 1JGVL 1NH6A 4JZJA 1AGDA 2YA2A 5D7JB 1AH1A 3ZYZA 5A2JH 4UU9B 3SE9H 2MHAA 4ISVA 1PG7H 3QXVA 2PW2B 5F1NA 3AS2A 4Z7NE 4X7TA 1OTUD 5F7EL 4LMQE 1VB9A 5D71H 2B1HL 4M7ZB 2VE6A 4N1CA 3TVMC 4WW1A 4JFEE 1JHKH 3KNBA 3GJFA 3CSYA 1A6TA 4JJHA 4AEFA 1ED3A 2GAZB 3W5NA 1RUPL 4RFEB 4OSUL 4A2LA 5HI3D 1T1YB 4U6TA 1YN6B 1VENA 2DI7A 5IEHB 1NGZB 3W82A 1T5XB 2DQJL 3KS0J 1A7NH 3PGFH 3U4EB 4XNXH 1T83C 1IILE 3LRHA 3B2VH 3HAEH 5D5MA 4MJ4A 4P46D 3OB8A 2Z35A 3MTRA 2ICWJ 1YY9D 3HAEB 4OI7A 5D7SL 3D2UB 1FFPA 3QT2A 3K8KA 3TPUB 4BFBD 2EZ0C 2DJ4A 2Z8VC 2HH0L 2O5XH 3PXJA 1AXTL 4CVXA 2DQDL 5CD5D 3S98A 2VSDA 5DHYB 3WYRA 3EO0A 4KTEL 4HS3B 3ARVA 1QQDB 1MY7A 3EHBD 4MB4A 4HWBH 3PJSB 5KS9E 2AEQL 3UX9B 4YNYB 5EO9A 3LIZL 4KZDL 4M8VA 1S5IH 1QG3A 4PJGA 1YEFH 3U1SH 3RJDA 2NY5L 4DVBB 2DLIA 3ULUL 4WU7A 1MH5B 5E1HB 1LQSR 2AEPL 4HZLB 4KDTC 2DQGL 3R06A 1BAFH 4KRPD 4LQFL 5IFHH 1CDCA 3H9SA 4APQB 3T0XA 1R24A 1T0NB 5DJ6B 3IFOA 1QA9B 1OSZA 2RFXA 3HI5H 1MF2H 4X6BA 3VW3L 3ULVD 3QDGA 5MEOB 3U9PL 2A77L 2ICWI 3B9VA 3PUCA 5D7KE 4EDWL 1F11B 5CUSL 2OSLB 4M02A 4X9FA 5E1AB 5F6IB 3TA3D 3C2AL 5FHAH 1PYWB 2A6KB 1T03H 2WWKT 4CU7A 4X6EB 5DDHB 3G5ZA 1D6VH 1HKLH 2BRQA 5JHLH 2P8MA 4K8RD 5ENWB 4OFVA 5GGVH 3GJFK 4NJ9H 3PL6A 5C2UB 2QQQA 5CZXD 5INDA 4BZ1H 3U4BH 4D8PA 1I3VA 1U2HA 2EKJA 4OCNC 4X9GA 5E2UH 4ZUWB 3RGHA 3ZE0F 4TVPH 4HF5L 1Q9OB 2IH1B 2XIDA 3F65A 4IMLA 3IJYB 4NC2B 1QBLL 5FGCE 3TBSA 1FC1A 4QRPD 2CLRB 4LSSH 2WWMC 3Q6GL 3WUWB 4JRYB 5I1CL 3O6FA 5BXFB 4Y8AA 1MCEA 5EU6E 1KSRA 4NGHL 1VESA 3FKUS 4J12A 4TUJA 5DQ9A 4KKCD 3SKOB 5DD3H 1YNLL 3F5WA 2NW3B 4C56A 1AD0B 4LARH 3O2VL 2HJLB 5J1AB 1DEEA 1U3YA 4OV6F 5BZDA 1DFBL 5FM4A 1AE6H 5L0QC 2HT3C 2NY7L 5GRZA 2WANA 1HIMH 3DXAB 3TO4C 5IQ9B 5C0DB 4HBCH 4JM2F 2A74A 3P2TA 4ODUA 1HH9B 2RBLA 3QEGL 5EOCL 3PWJA 1FFQA 4OLZL 2X4NA 1F8TL 4XWGL 5BS0D 1U8IB 1Q38A 3T4YB 1BF8A 4KRMB 3AU1B 1J0IA 1IBGL 2I07B 4HKXB 2DRUA 5DZNA 1U92A 4X5LA 4JZJC 2YBRB 5DJ2B 1YEHH 2M2DA 3OR7B 1DQQB 3V8OA 1GGBH 2ZCKH 2J88L 5AYUH 5E2JA 2P5WE 3GO1H 4OLXL 3VH8B 3T2QA 4IM8A 5L7XH 1KT2B 1UZ6F 4JFEB 3RRQA 4PRHE 4XCNB 4MDJA 1OP9A 2KKQA 2CLVA 1F4XL 4ZDHA 4PB9H 4KKLC 3LKOB 5J11B 4CAGA 5C0AD 1RPQA 1RZKH 3BDYH 3BVNB 3GMRB 4HGMA 2J4WL 1R3KA 4N90E 3VCLA 2ESVD 3MREB 1MLBB 5DR5H 1FO0B 5IQ7L 3IDNB 3VGGA 3QRFM 4O02H 2GKIA 1FLTX 1MFEH 5D7JD 1UM4L 4M7LH 3B43A 4G6JL 4BKLA 1R3LB 1OTSC 3KPMA 3WS3A 4OF5A 4G8IA 2XN9A 5CEZL 3NFPB 5KSAA 3DROB 4JZNB 5I8EA 1WGOA 1BQLH 4ODVH 3HNVH 4CVWA 5I1DB 4ERSH 1INQA 5E8OB 5GS3A 3RIAK 4FQIH 5I1IH 4I8DA 4K71C 5AUMA 4D9RD 5J6GB 4M61B 1CLOH 2MQCA 1EFQA 4JFZL 5I8OL 1U8HA 1WK0A 2CXKA 1A6AB 1IEAA 3HR6A 4F37K 3HZYA 4LLQA 1I1FA 1X3DA 2Z93B 3QDAA 5KS9B 5IB5A 3LN4B 1H0DA 1XCTA 3G6JE 4GRWH 2EIEA 1BGXH 5EIQA 4JG0H 3BSZL 4KPHH 4GRWB 3D2UD 5K9OA 3L7FA 2PXYD 1EV2E 3DVNB 4Q58C 2Z31B 4U1LA 1JL8A 5BW7A 2X4SB 4FFWD 3DBXA 2VXVL 2AJYH 3FJTA 4LSRL 3B9KD 1UCTA 5I1JL 1EERB 1YN7A 4P46A 1Q9WA 4D9LH 5CBAB 3O3DA 3S35L 3RKDC 3MOAH 2NW2B 4RDQF 4G42B 1WVZA 1W0VB 4MJ5B 3G5VB 3BD4A 2YEZB 2CIKB 1CE6B 3PL6C 4HIXH 1EK3A 3BUYB 5SWQA 3RWIB 4GG6F 4K7FB 3CCHB 2RAMA 5EU3A 2XZQH 1OT1A 1VACA 4N5ED 4ZOAA 1HHKA 1DN0B 5FGCB 2IQ9L 4APQD 2CMRH 5JNYA 4JM4L 4U1NA 5T1KB 3ESVF 1LP9A 1UXSB 3O6FC 3GSQA 5EU6B 3HNTL 2YZ8A 5TF1L 2HFGH 2YD4A 2H3NA 2DLFH 1U58A 4XI5C 4TNVF 4NBZB 4QWWC 1L7IL 1UCBL 3FTGB 1MRDH 4FQQA 4Z5RB 1I9EA 4WJ5A 2DBLH 2ZOKA 3K2UL 2M1KA 4MNQD 4RGNE 5DMGC 4FFYH 1F2XK 1RZJH 1KCUH 4MS8C 1S7RA 1T0MB 1A7PL 1RUKL 2UV3A 1WWCA 4M93B 3O11B 5MEQA 1XR8A 4JZOA 4IJ3B 1H15B 1AR1D 4GS7C 4DGIH 3OJDB 3VFMA 5HDOA 4M5YH 1MIMH 1I85A 1UB5B 3OKNA 1OARH 3VMNA 1HYRC 3TA3A 1LEKB 1NDGA 4JRYD 5JR1H 3JWOL 4DAGL 2HJKB 3SQBA 2Y5EA 2J8HA 1ZKAA 4NN7C 5FHBH 1T22A 1YEGL 4LRNL 3HC4H 3BIKA 5FO7B 3T77B 2IG2H 5FXCH 1FRGL 1UWEL 4KY1L 2A9MH 2CRIA 1BJ8A 2WM0A 3WNLA 4BZ2L 4RFNB 4QRPA 4PRHB 4L8CB 4PJCE 1RK0A 1T66D 3NCJH 4G6MH 1L0YA 1BFVH 1J12A 1R3HA 5CIPH 2Q7YB 5DQJA 2C4FU 1OWWA 4K2UL 3BKMH 3ZZ1A 3C5SB 2FO4B 1TMCB 1YYMH 2ATKA 3UAJD 3VXUE 2CJUH 5CIPB 3SJVD 2BOCA 4PJFF 4GT7A 4TUOB 2N7BA 4NNPH 1YQ2A 3S5LG 5DFWH 4LVOC 3MLPA 3K8MA 4KV5F 2AJXH 4KJQD 1ZTXL 3F7VB 4G7YH 4AIZB 5I73C 4P5TD 5HYEA 4XGZB 1JF1B 4N5UA 3PDDA 4FHBD 1X4XA 1PGRB 2LAGB 3A6CL 1DLFL 3QUMH 5KSUA 4Q74A 1A7RL 4Z76A 3QO1A 1FL3A 4OIIH 5DRXA 5IB4A 5HVFB 4PRNA 5KSAC 3QUMB 3U7AA 2Z8SA 4JFED 4LSPH 3V0AC 4YR6B 3GKWH 5EO0A 1GHFL 2DQCH 4E42A 2ZCLL 2H2SC 2H32A 5BS0A 4NM4L 1LWRA 3OR6A 2NCMA 3MRCA 2F8XC 4HGWA 1CCZA 4HJ0D 1JMXA 2PO6B 3PV6A 1ZHNB 1U91B 4GUPB 3U9UA 3C9NB 1LO5A 1OTUC 3RY4A 1QSZA 4Y5YA 5D2LA 3B6SB 2GSGA 3IU4L 4YQXH 2R15A 3L1OH 4UV7H 3L5XH 4ZAKB 4XHQA 3MROB 2RCSL 3G6JB 4P23D 1OLZA 4OGAD 4HIHB 3K4ZA 4JRXE 1N0XH 2YPLE 1IGCH 4WO4B 3V4VH 5C0AA 25C8L 4F7MA 1CFTA 3GBNL 5LBSH 1J5OL 1JNNH 3NCYP 1MQKL 1YEEH 4NKIL 2ESVA 4XAKE 1C8PA 3SKJL 1BIIB 4S1QL 3V6OE 3WFBL 1S7UA 5BW7C 5KSVB 5D7JA 2VDRL 4NUGL 3W2DH 4UU9A 1A6PA 2VDLL 1KELH 2PW2A 5F7YC 5DRNB 5D7IF 4ZUUB 4JO4L 5J13C 4P46C 1YJDH 2YN3A 5EWIL 1AGFB 4JFPA 3FQWB 4OD1L 3MRIB 3VXNB 1WZ1L 1CDHA 3ZE0E 3RVWC 2AJZB 3T3PF 2AK1L 2XPGB 3QQNA 4YIQB 4O4YH 3VXOB 3KPLB 1KNOA 3N9GL 4NDMA 5CMAA 3IXTB 5E5MA 4OGXL 4DTGL 2V2WA 7FABL 5CD5C 1FIGL 3ARGB 5K33A 2IBZX 4Q9RL 1M05A 3BEVB 1N59B 3QH3B 4CMMB 3SO5A 3VMPA 5IEKB 5IEHA 4YDJB 2ZUUA 4PS4H 5ACZA 3EHBC 4EZMA 5D72H 1TJGH 3DYPA 2C7UB 5EU5A 3EFFB 1DBML 5D7KD 3X3FH 1D5XA 2Z0BA 3VXQB 1NEZG 4EXPX 3VRJB 4L9LA 5HYSB 4DN4L 5HVHC 5ANMA 5ADOL 1FZMB 1VDGA 3D2UA 1X4YA 1K3IA 3JBG7 2PXYA 1F58H 3B8YA 1BEYL 4QYOB 1MHPL 2BZDA 4KDVA 1UM5H 3GSNL 5HYQA 4KRPC 4QXGL 4K3HA 3HUJF 4ETQB 1HOCA 1KB5H 4NP4L 5DHYA 4LEXL 3KYNB 3B9KA 1IAOB 1A3RH 2NTFB 1KB5B 5HD8C 5HDQL 2Z92A 1I85C 4F33A 5T1KD 2QSVA 1H3WM 3EOAA 5EZOH 3TA3C 3PJSA 4LDEB 3N85L 5EU6D 2AP2A 3VWKA 2BJMH 4YNYA 3LS4L 2BXZA 3QG6B 3OKKA 1A7QL 1KBGH 4K8RC 4ODSL 4JHAH 1IGIH 1ZVSB 2X9XA 5CZXC 1OL0A 4EOWL 4KAQH 4U1KB 3V6ZA 3HN3A 3P4LA 1UYWH 4O00A 1SJHA 3MNWB 5BVPH 5HHOE 1G7PB 1MHHA 4APQA 5JXED 3R1GL 1G9EA 1T0NA 4PJCB 2V17L 4I3SL 4KHXH 4UT7H 1NCWL 4GW4A 2ADGB 3MLZH 1HXMB 5MEOA 2A6IA 5SX4H 1G9MH 1F11A 4PGDB 5FA3B 1PG7W 3RPIA 3ZL4L 3VXUB 5HPMA 4NFCA 4TSBL 1U3ZA 3FT2B 4KKCC 3L9RB 4HAFA 2XWJB 1MJUH 1PYWA 2A6KA 1OQXA 2AQ2A 2FX7L 4X6EA 5DDHA 3LRGA 5CP3A 4MNQA 5D7LD 1PEWA 4QHUA 1OGAE 3T4AB 3TYGH 5ILTL 3VWJB 1J0YA 4ZUWA 1C08B 3U36A 1U8PA 2E7BA 1I9IL 2LQRA 4GMTH 3HCVB 4DGVH 2IH1A 4X8XA 2P5WD 3IJYA 1MEXL 4OD3L 4ZQKA 4PRHD 3MBXH 12E8H 4RQQB 5HI5D 3RI5K 1UXWA 3WUWA 4JRYA 4JFXB 4NOFA 5JQHC 1MNUL 3SE9L 5TDPB 3PWLA 5BXFA 4M62H 5IB2B 1RZ7H 1ZT4A 3ARRA 1BJMA 1A5FH 1E6OH 5FFLA 5HJ3A 3NPSC 2AV1B 4PJ8B 2HFFB 3SKOA 4N90D 1YMMB 1I9JH 4PJEB 1CFSB 2AV7B 4NO5B 1IFHH 2HJLA 2GY5A 5SWSE 1HNGA 3E3QC 2R69H 1GPOH 1WBXA 4XAWH 2P43B 2UY6A 1Y18A 3HHRB 4ZTOH 4JRXB 4LSTH 1T5WA 4U1MA 1E4XH 4LLUA 1JNLL 1NL0L 3SJVA 1GJIA 1HH6B 1F4YL 1BBDH 1CT8B 3CX5J 4MNGA 5DLMH 3OL2A 2PTTB 3CVHB 2VAJA 3B2VL 3CFBA 3TH4T 5EH1A 4HCRA 3HC0B 5CZKA 5AEAA 2VISA 3AU1A 5FM5O 4AM0B 1YNTA 3FOMB 4HT1L 1Q94B 4P5TA 3SDAB 5D7JC 4KVNH 2EDQA 2PO6D 3MCLH 3OR7A 1DQQA 5IFAH 2VAAB 3MCKB 1BOYA 1FH5H 3EDDA 5B38A 4QGTA 2O5XL 4UILH 43C9A 5DJYB 3VH8A 2FBJL 1Q1JH 4JFEA 1VGEH 5BV7L 1MI5B 4ZAKD 3NAAH 1H8OA 3F8UB 4XCEB 3CSGA 2DOCA 4LGRB 3L5JA 3X14B 3LKOA 1PLGH 2IBZY 2NNAB 1K85A 4Y1AE 4GKOA 3GMRA 5DXWA 2G75A 4YPGB 3MREA 4I77H 3U7WL 3M17A 3BP4B 3ZLQC 1IQWH 5KAQG 2NY3B 4M1GL 3VG9B 1FO0A 4OZIA 1H3PH 2YKLH 1YEFL 4OLVH 3U1SL 1MQ8A 4Y0GA 2O5ZL 5DK0A 2I26N 3MZTA 3F62A 4OCWH 1R3LA 4MD5A 4L3AA 4P23A 4LRIA 4PJBF 5DJAA 1RK1A 1BAFL 1CZ8H 2UYLA 4K7PX 2FX8H 4L9LC 3NFPA 3CIQA 2EEAA 3V79C 1MHCB 4JZNA 4BFIA 1MVUB 3DIFA 3WO4B 4PJ9D 1SHMA 2PXYC 4DK6A 5LCVH 2QSQA 3IXAB 2C1OA 3P11H 2O61A 4PRPE 4XP6H 4JVUA 5L88H 2BVOA 5KAQF 1QFUL 4FFWC 5J6GA 4YHZL 4M61A 2WZPD 5FHAL 1L7TH 4Z0BH 4JANA 4NRYA 3B9KC 1DLHB 1A6AA 5JHLL 5JMOC 1WIUA 3IAQA 4E0RB 5FO9A 3OHXA 5DJZB 3QIBB 5KS9A 1FG2A 4LLVB 5TE7L 5TPWH 1D7FA 3VWKC 1I8MB 1TZGH 3TO2B 1B0WA 1ODAA 3MGAA 3CD4A 2J6EL 4LSSL 1OAUH 3BEWA 4PJHF 1WTGT 3QWRA 5MI0B 4P2CG 1ZVYA 4HH8A 1XGTA 1U8MB 4RGND 2FX9L 5IMLB 2ZOLB 4N5EC 5HHOB 5E8NA 2X4SA 4APQC 4PJFE 4R3SA 4H5SB 4U3CA 3AREB 3C8HA 5DD3L 4LEOB 4J6RL 4LARL 4KV5E 2AJ3B 3RX8A 2IFFH 2KZWA 5A40E 4JY6B 2YD3A 5F7UA 2A6DB 4G42A 1ND0B 4YHOL 1RFDH 1AE6L 2V5RA 2ARJB 5DD0H 3FB8B 1YYLH 3IFPA 2CIKA 2F58L 1HIML 2WNGA 1CE6A 1CLZL 4HBCL 3BUYA 5MEPA 3RWIA 1OGAB 2NY0B 2XTLA 4K7FA 3CCHA 4YJZL 3RX7A 1T7YA 3REVB 3D69B 2QL1A 2XTJE 4ODHL 1TTUA 3DRQA 1GGCL 2BHYA 1KG0B 3QG7H 1AR1C 1EUUA 1MHEB 2DKMA 3UJIH 5JIHA 3JWNC 5T1KA 4DKDC 2BC4B 4AH2B 9CGTA 5EU6A 4UZGA 4OGYL 4K07A 1GGBL 3IDIA 3RZCB 2B4CC 3RWGA 1W8OA 4ACPA 3GO1L 3HLAB 3D0LB 5I76B 4Z5RA 3RDTC 1C1EL 4PB9L 3FAWA 4B7IA 3U30C 1N0LA 1VHPA 5KVEH 5GS0L 3BDYL 3FT3B 5KVGH 5I75B 1WBZA 1T66C 2KZ1B 4P49A 2E27L 3CK0L 1DCLA 4HIJB 3B3IB 1H15A 3QQ3B 4QRRE 3OJDA 1ZS8B 3QXWA 5GRUL 3SKMB 3UAJC 1CBVH 2XZCL 3OKDA 4O02L 1MFEL 1JPFA 2HJKA 4ZO9A 4NCC1 4YDIH 4Z0XB 4U6XB 2QSCH 1Z2KA 3GIVA 5D7LA 3X12B 3QUZB 4KJQC 5CEZD 1QLRB 5FO7A 2K9UA 4P5TC 1BQLL 3HNVL 4LPYA 2HYMA 4FQIL 2MSPA 2ED9A 1ZVHA 5CZVH 2P5WA 5EORH 5SX4I 4K94L 3LN5B 4L8CA 2BX5A 4L3CB 4OM0H 5FIEA 4P4RB 2BDNH 2HN7B 1FVEA 1WUNT 1U8JB 2YPLD 3BPCB 4Y1AB 2QKIB 2FD6H 2FO4A 3UMTA 1JGDA 2JELH 5CIPA 3B9AA 3SY0B 2DD8H 1KJMB 4HJ0C 4KZEH 4F7PB 1OAXH 4LSUL 1PEZA 1PX3A 2BNQD 1XF5B 4AIZA 2DDQH 2BCKA 3SDAD 1HHJB 2E6JA 1TZHB 1JF1A 4XB7A 2ERJB 4M6NL 4K7PY 2D7OA 4P23C 4OGAC 4LRIC 3RZWA 3A67H 4OLYH 1I3UA 5FB8A 1BFOB 1DDHB 3HUJE 5EZJB 5I8CA 4PGJA 5C0FB 2W91A 1MRCH 4YHMH 1E27B 1D9KD 2FL5B 3OXSB 4MQ7A 2XA8L 3CFIC 4PRPB 1P4BL 4D9LL 2HA1A 1FAIH 2XY1A 5DJXA 3L3DB 3EOTH 3D0VB 1U91A 4DEPB 3A0OA 3NTCH 2NY3D 3HRZB 2BRRL 1NGYB 1WC7A 1DQLL 1SEBB 1E4XI 3ARBD 3LB6D 1X4ZA 3G6JA 4YPJA 1A6UH 1G7IB 4PJXF 5C0JB 2BFVL 4HIHA 5DVNA 4IEFB 1ES0B 2CMRL 1ORQA 4V1DB 4WNQB 3S97C 5D1XD 1BIIA 2BY3A 3RWDB 2VC2L 3AFLA 2HFGL 5E2VL 4PJFB 2QQLH 3DMMB 5KSVA 1NCCH 4FFZH 3OKMB 3MLYH 5DD1H 3N06B 1RZIA 1XGRB 3UPRB 4NWTL 1RZJL 4QOKD 4GQ9H 1Z3GL 1RJYA 3D48R 1S7SB 2CQVA 4PJ9A 3EUUA 4PY7B 4YIQA 3W39A 3VXOA 5TFSH 1JGEB 4DGIL 1J9CT 2V9RA 2NXYB 3BEVA 1N59A 3GJEB 4HKJA 4KTDL 1OARL 4UTBH 3TT1H 1CR9H 1N5YH 4NRXA 2XTJB 3ROLA 5IHUL 5GRJH 2UZIL 4X9IA 5K9QI 1SEQH 4TUKH 4YDJA 3TC9A 4AMKH 3SE4A 5AZEL 3ARED 5A16B 5DGRA 3EFFA 2VITA 3VXQA 4LLDB 3PWUB 3NA4A 2A9ML 3VRJA 5HYSA 5ESQB 4G9FA 3I6KB 4H0GA 4K3JH 2D0GA 2E3VA 1DQTA 4BM7A 5CCKH 4HV8A 1FZMA 3NCJL 3IDMB 1PY4A 1BFVL 4K3EL 2H9GA 2AVGA 3BKML 4PG9B 5MERB 3VFTB 5C9KA 4H88H 3CX5K 4M1DH 2ZCHH 3GMPB 4NNPL 2CRYA 5F7FA 4IJ3C 3D85D 2CO7B 2AJXL 3L95A 3MMEB 3TF7C 4NN5B 3SKNB 1J0HA 5C09E 4CRPA 3RZCD 3CLEH 4FG6D 1BQUA 5JW4N 3S9DB 4LSPL 4EVNA 1I9RL 4U1KA 2ENSA 4N8CL 3QNYB 5SWSD 3T0VA 2A1WH 1MCRA 1E6JH 1G7PA 1REIA 2EDHA 4PJCA 5GHWH 4RFNC 5HI5C 4UV4H 4EN3D 5F9DC 1OGTB 1FNGB 1Q9KB 4RMQA 2A9NH 3MJGX 5J57B 1KXVC 1BLNB 2EKSA 3L3KA 3OJVC 4YQXL 1AGBA 3HB3D 3RWCA 1KPVB 3L9RA 1R5WB 1YEDB 2H26B 4PJBE 1CFNB 1G7LB 4PJDF 3VFPB 3ZTJG 4ZUVB 3G6AB 4GRLB 2VIRB 1ZHLB 1IGCL 3V4VL 3PP3H 2DQHL 1KTRL 4LCWA 2FLRT 2Z8RA 4UDUB 4F15B 4KRNA 3G04B 3WS6A 5JHDE 3P30L 3HCVA 4XC1H 3MRPB 4LKCB 3GMNA 5EOQL 1K5NB 3W2DL 3E6FA 1KELL 5IB2A 3VXMB 2DYPB 3U48A 4DKEH 2IALB 1AI1L 4Y1AD 4QRUA 1YJDL 2AV1A 5BVJA 1A6VH 2HFFA 4HEPG 4LIQH 3EDEA 3DGCR 5GRWA 1BFTA 3M8OH 1ZHKB 3DUUA 4LHUG 2AV7A 1PQZA 2P7TB 5IV2A 4O4YL 4KXZH 4D0BB 1I8KA 1BZ9A 1T3FA 4PJHE 1B3JA 3J7HA 5JUEH 4CJ1A 4EI5B 4ELMF 1IC1A 5EC2A 4M4RA 1HILB 2YPLA 4QTIL 2MFNA 3A6BH 1BF2A 1FZOA 2B8OT 2GK0B 4KKNA 3UBXI 4PS4L 4U6YA 3VXPB 3WD5L 3CUPA 3HE6B 2VWEE 4HSQA 3WJLA 1MCIA 2YUWA 4RWYH 4NZUL 1TJGL 5D72L 2CRZA 2PTTA 3FQNB 4LNRA 3CVHA 3V6OA 1BP3B 4AL8H 1LK2A 5K9QG 4PRPD 3V5HB 2BNQA 1SY6H 4PLOB 1J8KA 2YN5A 4AM0A 4CW1A 5J3HD 1DUYA 4XP1L 3AXLA 3SDAA 1WCBB 4YHPB 1IM3A 4J4PD 2VAAA 2CDGB 3MCKA 2WQ8A 4JQVA 1ZSDB 1M7XA 4ZXBD 4P57A 3LCYA 1D9KA 1P84K 2YMXH 4XCEA 3WKMH 4J1UB 2JJSA 4PJ9C 4UT6H 3QUXB 3X14A 1A3RL 2NNAA 5LWYL 3S88L 3GI9H 3O4LE 5EZOL 5IF0A 1AKJA 3BP4A 4PUBH 2F19H 3MRLA 2W38A 4KTYA 2VLRE 3HPLB 1KIPA 2BNRD 4LKXB 3DMMD 3ARBA 4X98A 1FQ9C 3SE4C 2K3TA 4JHAL 1IGIL 1PDKA 1MCJA 4WHYH 3O9WD 3OJ2C 4KAQL 2OL3L 2NZIA 2HTLD 3BT2L 5BVPL 3VGAC 2DM3A 1I7UA 3NGBB 1MHCA 4L8SB 1QYGH 4OFYD 4KHXL 1MVUA 3ELAT 2GSIB 5D1XA 4ODWB 3MFFB 4AQ1B 2EO9A 5LAXA 4AIOA 1G9ML 1YEJH 1U9KA 3QIUB 4RGNC 4LCYB 4OKVA 4POYA 4ESKA 3GSRB 4WI3A 2ZUQC 1MJUL 2EYRB 2XTJD 3N1QC 1HQRB 1MWAL 4QT5A 5IMOB 2GJ6E 1WITA 3QXTA 3KAAA 1WEJL 1JZ6A 2LU4A 4X83A 1X5YA 2RGSA 1A02N 4NZTL 4Z7QF 4QOKA 4E0RA 1T1ZA 2EDNA 4WIQA 4NHUA 4XCYB 3UZEA 3GFUA 5C09B 1QVOA 4PLJD 2CH8A 1JRHH 4DOHE 5CILH 3CSBA 4GXVH 2CXGA 4DGVL 2P42B 2FJFA 1KN2H 2R2EB 3KPPA 4UOW1 1RZ8A 5JDSB 12E8L 2P4AB 1AIFB 2BVPA 3TT3H 3FRPG 2BXYA 1QEWA 3EOBB 1J18A 5FEBA 1A5FL 1E6OL 4FQCH 2DM7A 1KOAA 4RAUA 2WW8A 4U49A 2EXYD 4H5SA 3AREA 2FR4B 1F6FB 1D5ZA 4LEOA 5T5FH 1LK3L 3B9DA 5MHSE 5CJOL 4GH7B 3V5DA 4QRRD 4JPKH 1IFHL 3BGAA 1ZE3C 1NJ9B 3RY5A 5L2KD 4JY6A 3U0PB 5GSVB 1YPZF 5I1HH 4IOIB 2EDTA 2A6DA 1CK0L 1MRFH 1ND0A 4PJBB 3FO2A 3AM8A 3NCBB 4ZTOL 4FQ2H 4M5ZL 2V2XB 1E4XL 3NPZB 1I1YB 5F96H 1DQMH 4MXVF 5I1GH 4Q9QH 5J6HB 3O2DL 3JWDH 3D69A 1BECA 3OX8B 5JHDB 2G5BA 3WS6C 3D85A 3UBXG 1MHEA 4HS8H 3PHQB 3RL1B 4KMTH 4KVNL 4AH2A 2UVFA 1EPFA 1U8QB 2F8OA 3QXAB 1NCBL 1H3XA 2YPVH 3T65B 3RZCA 1RZGA 5GJTH 2FSEA 4PFEA 1KTDB 3NAAL 1TJIL 3OGOE 1G1YA 5M95B 4I9WE 1U93B 5SWSA 2EH7H 4XP9H 1NANI 5HXMA 1IGTB 1P5VA 3QA3B 3GIZL 1KTKE 3LN9A 4JLRB 3RWHB 3RY6A 4EN3A 3QXUA 4HIIB 5FO8B 1AXSA 1IQWL 3B3IA 4N9OB 3WSQL 4G6KL 3L5WB 1H3PL 4OLVL 1T1XB 3WN5B 3WJLC 3UTQA 1S9WB 4XPGL 2DYPD 1IC5H 3MRHB 3BW9B 4U6XA 3V6OC 5H94B 5EIVA 1SBBA 2EIZA 4QHKJ 3IDGA 4NKDB 3SDAC 4MD4B 5H37G 5E2WL 1ZA3A 1UEMA 2GJJA 2ZJSH 5C92A 1N5AB 1S7VB 4R96B 4JQVC 3LN5A 5L88L 4EI5D 1LNUA 4C54A 1C16A 4I0PB 1D9KC 2XNAA 3V6FB 1W72L 4NCDA 2HN7A 4XTRD 2JJSC 3K4AA 5ACMA 3QXDA 4Y1AA 3CPLA 1OSPH 1IAII 5C71A 5F9OL 3HE6D 3O4LB 4OUUB 3CFJB 3BZEB 4EUPH 5FYJE 3BP7B 1RHHB 4GKSB 1KTLA 5TPWL 3FO9B 2WUCH 2VLRB 1KEGL 4I4WA 4O2FA 1JI2A 2NY3C 2X70B 4EUPB 3FOLA 4QCIB 1XF5A 4X99A 1PFCA 1J1XH 1TZHA 2DMBA 3ARBC 4W70A 2ZUVA 3T0ED 1SBSL 3JZ7A 4XC3L 1GOFA 32C2B 1XFPA 3H0TB 4LLYB 1EHXA 4RNRA 1BFOA 1DDHA 5EZJA 1ADQH 3KPQB 2R1WB 3PIQB 1NSNH 1S9YB 4LPCA 1E27A 3LV3B 1YNKL 5D1XC 4YGAB 3LD8B 3P9MB 1HQ4A 4LVHC 5L2JA 3QPQD 4PRPA 5J8OA 1WICA 3T2PA 3KR3L 3HC3H 2VH5L 1F6LL 2IFFL 1JPSL 5JMRA 3EW3B 4KXZI 2YUZA 4J4PA 1CD1B 2GJ6B 2NPLX 1QSVA 1RFDL 3KPNB 5BQ7A 4O58H 1DVFB 2YPKA 4ZXBA 4K3DH 4TRPH 3VFGH 1FN4B 4KK6D 4BYHA 5I17B 5C0JA 4QTHB 5C7XH 5IBLD 3EOYG 3TESA 3MJ6A 4GOSA 1XF3A 3UP1A 3TNNA 3TJEH 5MI0C 3BGFB 2ADFL 1Z5LB 1QNZL 1GSMA 4RAVA 2GT9A 3RWDA 2BNRA 4PJFA 3BPLC 1TZIB 4I5BA 2Q8AL 2WQRA 3CNKA 3U83A 1GH7A 3KLDA 3MV8B 1RD6A 3OKMA 3O45B 3AREC 3O9WA 5MP6H 5E00B 1XGRA 3ESUF 3UPRA 1JFQH 3HMXH 1KLGA 2X9YA 4FNLH 3VE0B 1S7SA 4GAYB 4OFYA 2K1MA 4DJMA 2OR9L 1RULH 5KVGL 2PTVA 4O9HH 4RBPH 3VGFA 3AM8C 2Y72A 4JG1H 2R56H 4YEFA 3IETB 3ZT7A 3GJEA 4L5FL 3WFDH 1EO8H 5FM8A 5JPNB 2D03H 1DEDA 4R97B 1LE5B 2C4XA 3MLRL 2ATPA 2QSCL 4OM1L 2W92A 4D0DB 1QSFE 2YXMA 3GSXB 1MCWW 3ALPA 5E2TL 4BSJA 1SJEB 1U8KB 3Q5OA 1BX2B 2MCPH 3GDBA 5DK2A 2IH3B 3PWUA 5IMKA 2FHFA 2H6PA 3X11B 2R39A 3EYSH 5F7KC 3I6KA 5EORL 2P45B 3RZCC 4ELME 4FG6C 1KXTB 4WWKB 2EC8A 2VLJE 1TTFA 4HIEB 1FORH 4OM0L 2BDNL 3GSWA 4X5WA 4U3HA 1A4KB 3JV4A 3H7BB 1WQVT 1FZJB 3MJ8A 5E8EB 2A83A 4H8WH 3KJ6H 5T33H 2DD8L 4Z7VE 3TBVB 3RY6C 4PRBB 4EN3C 1OAXL 5JHDD 4HQQH 1P2CA 4BH7A 3VRLF 4QRRA 5C0BB 4N0UE 3UXFA 3LRSB 1PY9A 4NO3A 5L2KA 3BD5A 3KPRE 4HK0A 3HB3C 1EGJH 3SKNA 1BVKB 2CR6A 1RJLB 1YY8B 4XBPB 3UJJH 4PJIE 1R6VA 4F8TA 5DMYA 3VXSE 1IL1B 2QQNH 3PDOA 1MFCH 5JO5A 1FNHA 1ITCA 3BIAX 4JO1L 3IVKB 3QNYA 1RIVH 1MREH 4NYLB 1F4WH 5FGSA 2NLJA 4OGZA 3QQ4A 1TVHB 3REWB 5I1KL 5FYLL 1FNGA 4EEEA 4F8QA 3SDXF 5FYJH 4ODTL 1BLNA 4RISH 5DC0A 2HG5A 2Y36L 2Y6SD 5T3XL 3QNXB 4PRID 3QYCA 2UVEA 1U36A 4Q7DA 1YEDA 2H26A 3IT8D 3W11D 1G7LA 1A6UL 1YECL 3VFPA 5IT2H 5T1DL 4ZUVA 3FFDB 2VIRA 3MRGB 4UBDD 2WP3T 2VN7A 3EYVA 2XG4A 4TSAH 4D9QE 4MSWB 4MQSB 3EGSB 3ME0A 1GVIA 3MA9L 3G04A 2ERJC 3BRDA 3Q1SL 3HUJA 1U8NB 1PW3A 4RGMB 3MRPA 1S7XA 2AW2A 4PP2A 2EDWA 2E7MA 1MJ8H 2DYPA 4Z7QE 5C0IB 5BOZG 1UH3A 3O3BB 5CHNB 3D9AL 2R0ZL 4OI9A 5J3HC 3O4LD 3BZDA 3KG5A 3D18A 1ZHKA 3SQOL 2OS7A 4J4PC 2VLRD 2QQKL 1B0GB 3NA9H 1TPXB 1CL7I 2JIXB 2X10A 4ZXBC 3HTLX 4EI5A 4UTBL 1N5YL 1CR9L 4M9PA 2AXFB 1HILA 2D4DA 2H2PD 3FCTB 4JCLA 3WE6A 3OXRA 1P1ZB 1SEQL 3HE6A 4XH2B 4KC3B 1NBVH 5C2BL 2HRPH 3FB7B 4HLZH 3OV6A 1H5BB 4FXKB 3RHWK 5IR1B 2OI9C 4K3JL 4M6ML 3MRBA 2D2OA 1CFVH 5CCKL 1BZQK 4WEBH 5LGHL 3RFZC 2ICCA 3T0EA 5FK9B 2J6EA 4PRDB 1OAKL 3O9WC 3GHEH 4HULB 2HTLC 1RMFH 3THML 1D6EB 2CR3A 3BQUD 4CMHC 5F9JA 5F6HJ 4H88L 4TNWK 1EH9A 2F54E 4M1DL 3IKCB 4ELKA 2ZCHL 5IB3A 4JKLA 1BQHG 4DWHA 2Y7QA 5DO2D 4RAHA 4IDJH 5INCA 5JA8B 3S3PA 3ZDZE 5I66B 3WFCH 3MRRB 5K9KA 2XTJC 1EEQA 3NFNB 4HDIA 3CXHJ 3HPLA 1QSFB 3VA2C 1AO7A 3DVGB 2JE8A 4NKOB 1JP5A 5MHSD 4PLJC 4OF0A 5HHXH 1KJ2H 2A1WL 1K4CA 1RSFA 1E6JL 3PP3K 4L8SA 2VLJB 4ZS6D 4PLKC 1E28A 1K8IA 3OAUH 1KJ2B 4OCYH 4UV4L 3MFFA 4WFGD