1ND0B

Cationic cyclization antibody 4c6 complex with transition state analog
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN IGG2A
total genus 45
structure length 222
sequence length 222
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0B01
2JCCF 2R69H 5FYLL 2NY2D 3ROLB 5E8DH 4K3JL 1AGDB 2FIKB 5HGHA 2RHEA 2OZ4L 4J6RL 4X5LA 2AQ2A 1QRNE 3KJ4B 4LHUA 4DGVH 4LPVA 1UXWA 4NKDB 4PS4H 4XCYB 1U92A 4OQTA 5I1GL 3VWKA 2AXGA 1Q1JL 4R2GD 4XP5H 4RX4D 3VWJB 5F88B 1CE1H 4KDTC 2EE3A 1AR1C 1KPVA 2WWMD 1CXIA 4XTRD 2CKBB 1KT2A 2J8UF 4P23A 5C0CE 5BXFA 3UJIH 1KLUB 1C16A 2YMXH 4X99B 3A6OA 4K7PL 2UVEA 3D3VA 4WHYG 4I4WB 1EEZA 3K80A 1LEKB 2H41A 1U91A 2C4FU 4ODVH 1S9VB 4NQTA 3TNNB 1S78D 3FB8B 1J5OH 2EO9A 2Q86A 1CFTB 3MOAH 1NBZA 3MBXH 2IPKA 3H8NA 4DEPB 4CVZB 1H0DA 2B1HH 3TNMB 4LKCA 3RVTC 5E08H 3OXSB 5TDNB 4IOIA 4V1DE 4D9RD 2BVEA 3NA4A 3NIFF 1NC2A 2W65B 3D9AH 1A47A 3I6KB 3VFOB 3CSGA 2FEDC 4R97B 4YHZL 1SVZA 1HYSC 5I1JH 3FQWB 4YDVB 3ARZA 1QBLH 5FECB 2H2PC 5IHUH 1F90L 2H26B 5BOZG 2JTDA 1EBAA 4C58B 5FECA 2X42A 1OAQL 2YUWA 1BFSA 4S1DC 1UG9A 4OZIA 1U93B 5DSCB 5IMLB 1Z5LA 4JPKL 5D2NE 4FQHA 4X4YB 1ZT1B 2J88L 5KG9B 1LP9B 4JZJA 1J0YA 4F9LC 4FQJL 1NBYA 5KG9A 4M5YH 3I6LD 5DJCA 5E8NA 1JGVH 2HFEA 3IKCA 2LU4A 1YN7B 4JLRA 3FFCE 3T4YA 5IMOA 4N8VB 3CFDB 1MCIA 4I0KA 3SDDB 4M8VA 4WO4B 5M7QA 4ONGL 5I2IA 1UB6A 2H6PB 2AJ3B 3Q5YA 3SE3A 3PP3H 1LEGA 5E5RB 4TNVK 4LQFL 3D0LB 2ARJQ 2X2YA 3UTPD 1KB9K 5T5FH 1DSFH 5FUCE 2HRPL 4WUUA 2Z8RA 1GH7A 4X4ME 3ZYOA 4Z7VE 2DMKA 5LAXA 4NRYB 1VGKB 4QWWC 3HAEB 1YYLH 1CCZA 4PJ7A 4HCRH 3QDMA 2J12B 3PHSA 5K59E 1F13A 5HHXH 3QWQB 1WIUA 3U0TB 4OCSL 4OQ1A 1JBJA 4YEFA 1N7ML 2BOBA 1LD9A 4R7DA 5T33L 1PX4A 4KHXH 4U1LB 3P9WB 2J8UB 3B83A 2A0LC 2CGRH 3R06A 3K2UL 4MQ7B 2AABL 1QKZL 4ZQKB 5IW3A 5KSUA 1YZZA 3SE8H 2P24A 1MQKL 5CHNB 5I8CA 1I3GL 1NCDH 1NEZB 1T4KB 2LAGB 1OP3H 4LCCC 5E8OB 2R1XB 1KTDB 3VU2A 4HIJB 4LLDB 4JHAH 1LO3H 1V7NL 1AQKH 4XPGL 3K8LA 3MO1B 3Q48A 5C0RL 1K4CA 3MLPA 4JN1L 4OF8A 4R26L 3V6OC 1Y18B 1UCBL 3D39E 4MXWH 1IGTA 3GMNB 1CXLA 2R2BA 5IB2B 3WIFB 3MRKA 4PJAE 3SY0A 1IEBB 1BM3L 5I71B 3CVIL 4JPVH 4S1RL 1AXTL 3VXRD 4XPBL 2ADIA 2A2QT 1FG2A 2X9WA 4OZHB 5FV1L 1OTTC 4WFEE 3ARFB 4XBEL 4WWKD 2ADIB 1A5FH 1P7QD 2XG5A 4XXDA 2NXYB 4FFZL 2PYEB 4HKBA 2UVFA 4M62H 1VDGA 3H9HA 4M8QB 3ULUC 2MCG1 2YC1A 3WIIH 1I9JH 3EUUA 5TF1L 3OX8A 5EOCH 5FYKH 3I6LE 4XWGH 1YNLL 2P49B 3VXUA 2WUCL 5JPMA 1IGJB 3N0PB 4S1QL 4OZIF 2WWMC 5D1ZB 1KELH 1SQ2N 5D7LA 2Q7NA 1J10A 3KDMA 5MERB 1PZ5B 2FEEL 4KTEH 1PZ5A 3HB3C 3GDBA 4CUCA 5JOFA 2R4SH 3HUJA 2FR4B 4JO1H 3IJYA 1FO0A 2O61A 5IEKB 4PYHA 4DW2H 4LDEB 5JHLL 3SDCC 1B2WL 3L5XH 1N2RB 4L3EA 2LE9A 3OJDA 4R0LB 5IESL 4LSSH 4QHUB 4PRAA 3SDAC 3H9SE 1YNTA 3S3SA 1TZIA 2VL5A 4FTVE 1MREL 1CGYA 3STLB 4P23B 4GQ9L 3FN0L 4PJFF 2B1AL 2F53A 2XT1B 2Z93A 4OLEA 1BQHG 4KMLB 1CICC 3T09A 2IMMA 3P4NA 1BWWA 4HMEA 2I60H 5LCVH 2DLGA 3QEHB 4O51A 5I8OH 4HQQL 1J05A 5IHZB 3U9UA 1KGCE 1UZ8A 5FXCH 4UQ2A 5FOBB 1NGXB 5IBUG 4OTXL 4ZO6A 3TN0C 3UMTA 2HWZH 4I9WE 2HP4A 3RY6A 1AXSB 3MRMB 2NY3D 2BSED 3C5ZD 2CLZA 4LCWB 1JWSA 3S35L 5GZNC 5I71C 2QQLL 3S3JA 3K3QA 1IBGL 1HH6B 1S7QA 1IGCH 4RA3A 3HI6L 1IGYA 3QFJB 4R6UA 2F5BH 4G6AD 2AK4D 3T4AB 3P40A 2O93L 3BPCB 1TTGA 1JWUA 3U9PL 5L8KB 5D2LE 1I7UB 3CH8A 5DHVH 3RPIA 4BSVA 3KPSD 4QHNA 2EYSB 3GI9H 3SN6N 5B8CB 3ZTJH 4WO4A 5I2IB 5D1QA 4F57L 3S4SA 3QUMH 2EDXA 4LBEA 3P0GB 4R4BA 2IG2L 5C2BH 4OIBA 3PWVA 4AYFA 4WUUB 4APQC 4WCYL 3TLRA 1BJMA 1J1XL 3VXNB 1U93A 4D9QE 1WSST 2ITCB 1L0XA 4ZOCA 5KN5A 5EU3B 4PJ7B 5IBTH 3CVHB 5HPMB 1XCTA 5F7EL 1P2CB 4FXGA 5DJCB 5DMKA 2C3WA 2RQ8A 2XACC 4YHZH 4UBDD 4ZSOB 3U4BH 2QHRH 2RIKA 2XYCA 1RK0B 3UYRL 3E6HB 2CKBA 3BUYA 4ORGA 5EC2A 3T65A 5HJ3B 4Z7OF 1MRDL 3IDNA 5TQ2H 5BVJA 2A6KB 1A9EB 1YEFH 2BZDA 4HHAB 1WCBB 4NQCD 4ZO7A 3O3DA 3QIWC 5HI3D 3ALPA 2DLIA 5F6IC 5DJ0A 3QUKB 2HJFB 4ONGH 2H2PD 1OAKH 4KDWA 4HGMA 1F8TL 4W4OA 3MRNA 3LRSB 3GMMB 5D71L 4DOHB 4M6ML 4KGLA 3VD4A 4NT6A 1S7VB 4PJ9C 3D1MC 4MVBD 3WJJC 1MI5B 2PXYC 2OS7A 5GIRB 3ARDD 3T3ME 4ZFFA 1KXQE 5D7JD 3EYUL 4GMTL 3V5DB 1I8MB 5BS0B 1L7IL 3WHE1 1EHLL 2BHZA 3CX5K 4EI6B 2AK4E 3QWRD 4K3DL 5IFJA 4NFBA 5HHXL 2FCBA 2R1XA 4OBRA 5E00A 3RDTD 1QFOA 4TOYL 1F4WH 1T89A 1OY3B 1MCOH 3O6FB 4NHUB 1HXYA 5FHBL 5E2JA 3LEYL 2LU3A 3LQZA 2CQVA 1IGTB 3OSKA 1C5DA 1LO0L 4JY4A 2NY0B 4YXLH 5I9QB 1E4KC 3CUPB 3DX8A 1YECH 3LN5B 4RDQF 2MKLC 1N6QH 4UT6L 1PEZA 5H37G 3GKWL 1VB9A 1Q9LB 5F1SA 2F54A 1FFOA 2AGJL 3C5JB 1MF2L 1FZJA 2C3VB 3C5JA 1KTLB 2CK0H 3VGAB 3CMOH 1OAYL 4APQD 3RWFA 3VW3H 5GRUL 5JXAH 3T0BA 1EV2E 3BWUC 2YS4A 1K2DA 3KS0H 1Z9LA 3OKOB 1RUMH 4NQCE 4LSQL 4I3RL 4OD2A 3VI4F 4JDZA 1X5FA 4DZBA 3CXHJ 2QV2A 2HLFD 1QSEB 3PWJA 4KH2A 2FLRT 1KEMH 1WLHA 4M62L 1QSEA 4AIXA 4FQLH 3O9WD 4X0KA 3H9SA 1YN6A 3VFRB 2WUBL 2I25N 4JQXC 1MHHB 3U4EB 5KSVA 3EYOA 2DD8H 1T03L 3NFNA 1A8JH 1IM9A 1S5IL 1WBZA 4FA8A 3O9WA 4NO0D 5ENWB 5ESAA 4L8DA 4AG4H 4IRSC 5HD8C 2GFBB 1ZVSA 3GSWB 4KXZI 4NQDE 3CAFA 2B0SL 4NC0B 1OF2B 1FG9C 3C6LA 4YE4H 3SE9L 4L4VA 3U7WL 5E94B 3T4AA 2F74A 2LAAA 3U46B 4ZTOH 1PW3A 3JWOL 3LH2L 2ICWB 3VXRB 3VRIB 3ZKMC 3VFWA 1RIHH 1B6UA 1ZAGA 1S78C 2JJTA 4QKXB 2EYSA 3GGWA 1CU4L 3PWLA 5MEOA 5C0BB 1IGML 2VLRB 1JF5A 5I8OL 1SY6L 4DGIH 3PNWA 4X7SH 3SDAD 4NGHL 4L4VE 2H26A 3ZYZA 5IB4A 4JR9H 2VDPL 4PJDB 3NIFE 3QCUL 5E1AA 3K2MC 1I1YB 5DGQA 1S8DA 4Y2DA 4KWUA 3T04D 3QIWD 1XCTB 3WYRA 2IAMB 4OFPA 1EO8H 1U0QA 4WENB 3MJ8A 4GMSL 1HNGA 3KYOA 4XVJH 4TULH 3HNVL 4GRMB 3N1MC 4R7NB 3LS5H 3WEXA 3SPVB 3IB4A 5ALBH 2ZUQC 1RMFL 3A6CL 4MWFA 2E8YA 4PPTA 2F15A 2I5YH 2M26A 4KUZH 1ZLWK 1LEGB 1QQDA 2VC2H 3AS2A 1UJTA 3IFOA 1T20B 1ZT4B 2NY5C 3FRUA 4AT6B 2VAAB 3DUSB 3UAJC 1L9NA 4OLUL 4QHLB 2CRZA 2EZ0D 3DTXA 3T2NH 2OQJA 4PGEB 1ZK9A 2VSDA 1GZQB 4UDUB 4EQ3A 1HHKA 3MRNB 1AY1H 2NZIA 4FABL 4HWBH 2C1OA 4GUPA 4BA8A 1U3HA 5C6WH 1GIGH 1HZHL 1ZA6B 2XY2A 4QRRA 4G8IA 4QRUB 3ZDYF 1U8MA 1RZGB 4LASH 4L5FL 1I1CA 5IFHH 4NO2B 1H8SA 3ZKMD 3TVMD 1GZPB 4WY7L 3DXAD 4E41A 1HH9A 1XF4B 3IAQA 5GSVB 3WHXA 4AEIH 5TE4H 4D0CA 4OLXL 1RVFH 4OV6F 4X7EC 2ZSWB 4WWID 4WNQA 4OCRL 1BD2D 4NKOB 4UUJB 3QUYB 1LHZA 4N0FA 3ZKSD 2OL3H 1ACZA 1EJOL 3TJHC 4R0LC 1AFVL 4P2OC 1CF8L 1U8LA 5IEHA 3FT2A 4WTWA 1OSZA 5AG9A 1ADQH 4YJZL 1B0RA 5DA0B 3LEVL 1Q9LA 1IKNC 3LMJH 5CBEB 4WV1A 1G9MC 4KZEH 5DMJB 4B50A 5E00B 4W6YB 4EUPH 2X7LB 5GSRA 4I2XA 4X5WB 1FNAA 3C09B 4MA8H 3WNKA 1H3XA 5DMIL 2DLFL 1I8IA 1CVRA 4OCMC 3SO3C 3TZVB 4ONHB 3EO0B 3GBML 1T1ZA 5KTEH 1WZ1L 4F2MB 1YEIL 2CRMA 3R06B 3HMWL 4HPYL 4ZQKA 2FBOJ 2H9GA 3V5KB 1CFSA 4P4RB 3EDJA 3QYCA 3B9KB 4MS8D 4PJIB 1CDJA 3MSPA 3MGTB 4WFHD 2DOCA 2BNQE 2YD9A 4ZYKA 5DD6A 3GO1H 1QNZL 5F6HI 1EXUA 4PRHB 3BP7A 2EE2A 2VLRE 2E27L 3MBEA 4LVHC 1YEDB 1RURH 4MD0A 1ACYH 4Z8FL 3QCVH 1X5ZA 3KPPB 4MJ6A 4HWZB 4CMMA 4G6FD 1OAXH 3I50L 3BRGC 3ILPA 1JGDA 2HJKA 3S88H 3QIUA 3WIFA 3MV9D 2XQYK 1QBMH 3V0VB 4PJDE 3KG5A 4GW1A 4XAKE 4WW1B 4NKMB 1DANU 3O2VH 1NMCB 3QO1B 3A67H 1CFQA 4OFDA 1FNSL 4DAGL 4JZNA 3Q6FB 1MAKA 5CHNA 5I8CB 3VFWB 4EOWL 2LV4A 2J6EH 3MRCB 3QI9D 4HX1B 3G6JF 4JRYE 3EHBC 4JKKA 4M93B 4MLIA 1G0DA 1MLCB 1TIUA 5GRZA 3RVTD 4AQ1B 4P57B 2FJFA 3V52H 3BP6A 3BD3A 4RRPG 1K5NA 4FQQA 4KKLD 1NCNA 5E6YA 2UZXB 1B9ZA 4NN6C 3RI5K 5EOQL 3BIKA 3AMKA 2XWBB 3WXVH 4PB0H 4C57C 3UTTA 1PFCA 4NHCH 1D6EB 3VXSE 5IGXL 4JKWA 4MJ4A 1IGFL 2Z0BA 4G80B 2GSIB 3BOVA 2GY7B 1QYGH 2HJLA 4JANA 1HCVA 3HG1D 3NIGF 3K4AA 1MFBH 4PJAA 1BBJB 5HVHC 1HWGB 2F53B 3DXAE 1JRHH 5IB4B 1ES0B 3RBGA 5D1XC 1IKFL 2RCSH 2GJZA 1J8KA 1FO0H 3F7VB 2JIXB 3BIAX 3B6SA 4GAFB 1QSVA 4QWWD 5C0CD 1KPUB 2F5AL 2H2SC 1MFAH 3PF2A 4YDLC 3VWJA 3INUH 1E4WH 2VR9A 2GJJA 4KRPD 5C0NC 5C0FB 3F65A 3O9WB 4RAUB 3MCG1 1EHNA 2CLZB 4LCWA 4IDJH 3MGOA 3QA3A 3GMLB 3VWJD 4P9MH 1KPRA 1OP5K 2BCKB 4YX2H 1I3RB 1U91B 3WHXB 1MUJA 4M61B 5FK9A 5H8DA 2GJ6D 3HE6D 3CPLB 1K3IA 4G6JH 1XT5A 4NQSA 1QP1A 2DQGL 3QHZH 5BZDB 1M71A 2AI0L 2EYRA 1QFWM 2HYMA 3ARTA 5FCUH 5I1JL 3OKMA 4DZ8A 3IETB 4FHBD 1CG9A 1E27B 3TYGL 4KKBC 1W8OA 4AIOA 2DL2A 5E2UH 1NLBL 4XWOD 4G6KL 3MUGB 1EO5A 4KJYB 1XZ0B 3CH1B 3D2UD 1JZ8A 4Y4HA 1RJZA 1FFPB 4XPTL 5A3ID 3WFCH 3MRBB 4UNVA 4NDMB 1I8MA 4PRDB 4OD1L 4TNWK 3BW9A 1T1WA 1ORQA 5F1NB 1LO5A 1HHIA 1WGOA 5E7BA 5KSBB 1U8PA 2A9NH 4KVNH 4JM2C 5DC0A 4ODTL 4P3DA 2V5YA 1U3HD 1AHWA 5I1IL 5JLZB 3OKLA 3OR7B 4QHNB 2XKSA 3BPLC 3GSOB 2NY1C 3UZVB 2IGFH 3QUZC 5IVOA 3DX7A 1JTPA 4QYOB 3DHMA 3RWJA 3WNMA 1T04B 3EYQD 2LFGA 1XF1A 4A6YH 3KPMA 4OGXH 2ZNWA 3LN5A 4MXVF 2OK0L 1TTUA 4I18B 2VAAA 3DUSA 3L7FB 3S35X 1R3KA 5D9SA 1X5HA 3SGDI 3HI5H 4WEMB 3HZVA 1AGFA 3TO4C 4WWKC 5J1TC 4HF5L 1IEAB 5IB3A 2OI9C 5K9JH 3VRLE 5IROA 3V0AC 5C0DA 4P4KD 3LKOB 3HNTH 5BVPH 2CMRH 1XGUA 4X98B 3ARQA 3ULUD 4HUVB 1K8DA 2AXFA 4YDJA 4CDHA 4MB5A 5D70L 5EO1A 4LLYB 4NPYA 3OKEB 5C07B 3FFCA 1GPOH 4L29A 5CP7A 3GJFB 4K94L 3AS1A 3RL1B 4H26B 2C4XA 3HG1E 4P57A 1BVZA 1WZ1H 4U1JA 1RU9H 3U7YH 1RPQA 3NACL 3DGCR 1KJ2B 4U1JB 4XGZB 4KPHH 3NCJH 3TV3L 5DJZB 5IMMB 3PL6B 3HCVB 5EUOF 2DIJA 5EH1A 5EO9A 4RGNC 2X5PA 2P8PA 4XP4L 4NWUL 4JRYD 3DO3A 5L0QC 1KEGL 1AE6L 3VXPA 3MODH 2D31A 3P4OB 3AAZB 4TSAL 4Y5XC 1JNLL 3UXFA 1AKJD 1GOGA 2AEQH 5KS9F 1T83A 1N8ZB 4ODHL 4QRSA 5JIKA 5KZCB 5JPMB 5ANME 1RUKL 2OI9B 3MRHA 5F9WB 5LVEA 1CBVH 2PXYB 2PO6D 3BGFC 3A67L 4PY7B 3ARBD 3D3VD 1DBKH 3WO4B 2PCPA 5I1CL 5TQ0H 5KAQF 4RMVA 2E7MA 4NZTL 3CCHA 4PV8A 1B2WH 1DFBH 2N7BA 3FTGA 3MJGX 1FNEA 1V3KA 4CMHB 5C0AB 1PD6A 3VG9C 1SBBA 1U92B 1S7WA 1SYVA 3BN9D 3ZE0F 1U6AL 3TBVA 1V7ML 4HWBA 2GFBA 3DSFL 2V9TA 5FO7B 5T3ZL 1PYWA 4JDZB 4DZBB 4NKQB 3PL6C 1W0VA 4NQUA 4B41A 3VFTA 5FDWB 1IGFH 4Q7DA 1R6VA 1YPZF 3QQ9C 1GAFL 4S1DD 5DEFA 3IS1X 4LVEA 3P0YL 2CH8A 3H9SB 3HI1B 5HHOA 2FO1A 1M71B 3UDWA 4BZ1L 3QPXH 3HE6C 4FZ8H 3PWLB 1WWWX 4WJ5B 1BFVH 1EGJA 3KWWA 3ESVF 1IGCL 1WZMA 4XC1H 1RZGA 2NR6D 1OM3H 5DMGD 3U30C 2R4RH 3V4PH 1UB5A 4N68A 1QRND 3OB0K 1GZPA 4OLWH 1PJ9A 4P5MA 1F4YL 1MVFA 1S7SB 2PO6C 1NDMB 1DDHB 2BFVH 4P46B 1H5BC 5B39G 3DVNA 4P46A 3PV6B 4EUPA 3QXDB 3S36X 2ZUSA 3HZKB 3T4YB 4C56A 3QXDA 5I18L 1FNGA 1FYTD 4K23L 3HE7C 2QQQA 3W5NA 4XC3H 3G04B 4ALAH 5DVKA 1U8LB 1BM3H 4WCYH 5IEHB 3FMGH 5HDBF 4Z7QE 4S1RH 4GKNB 1KC5H 4TN9A 2GUOB 3JV4A 3STZB 5IVNA 3ZKND 1IQDB 4NDMA 3F7VA 3D39B 1Q9KA 3WUWA 4PRIA 3VXUD 5K9QI 4LKXB 4LSRL 2E3VA 4Y4FC 1VENA 2I07A 4X5XA 3U0TA 1WAAA 4G6AC 3RY4A 1NGWB 2F53E 5IG7A 1ZA6A 5D5MF 3FAWA 4M6OH 4NQVB 2IALA 4ZUUA 3MJ9H 3J8F7 5EC2B 3T65B 5H35A 4YDKL 5JXEC 5IQ7H 3ISWA 3MLRL 5KVFL 1VESA 3UC0L 4A2LA 4LP5A 4BH8A 1OT1A 2PR4H 3B5HA 3O3EB 1AXIB 3IU3A 4DQOL 4B53A 3SDYH 1LMKA 4PTTB 3OWEA 1WZKA 5HYQB 3F7YA 4RZCB 1FVEB 1KJ2A 1NGYB 1U8IB 1XGQA 5IHLB 1EK3A 1HNFA 4H88H 3EYUH 4GMTH 3REWB 2V9QA 3ZHKA 3NH7H 5C0GA 2IBGA 4YH6A 3PL6D 4JJ5A 1X4YA 2PTTA 3HI5L 5I73B 2XV6B 3MV8A 4CGTA 2XA8H 1DL7L 1VCAA 4R4NC 5F7HA 2XA3A 4V1DB 3UBXB 4F58H 4OB5H 2OL3B 3PDOB 3BN9C 3KPSE 1A1NB 1EH9A 4UMGA 2FYYB 4BQ6A 4M6NL 4MLSA 3EOTL 2YUXA 1MCRA 1UKQA 4RWHA 3D6GA 4EZMA 1FH5H 3QZWA 3M17A 2C4FT 1E0OB 4OQTL 5JUEH 2QSCH 1S7RB 2FLBT 4HD9A 1AQDB 4F2MA 3IS0X 1T1YB 2XICA 1G6VK 2BK8A 3HI6H 4I0PA 2HT4C 1CDCA 1B0RB 5JHDB 3L3IA 4ZODA 4F7TB 3DV6A 1J0KA 3EDKA 1P7KA 2ATPB 3OAZK 1DEDA 4U1NB 4HS3A 3EOAB 4Y19D 2XY1A 1IEAA 2WWKT 4XVTL 1NDGA 1K2DB 1YNTB 5D1QC 4G9DA 2HT3C 5EZIH 3P9MB 4PP1C 1I8IB 2YKLL 3PABA 2CK2A 1XGUB 5GJTL 5EZJB 3VFGL 2PUQT 1S7TB 1CN4A 2Z92A 3B5TA 5IM7A 3T77B 5GGUB 1N26A 2IH3B 3E3QE 3T77A 1N5AA 3T0XA 3AREA 1TNNA 3ZDXF 1AKJB 3HFML 1BOGB 2NY6C 4OZFA 1RHHB 2CIIA 1VADA 1NMBH 4XCCH 3IJSB 3LPGA 3S36L 4P48A 3HRZA 5K9OB 2W0LA 3WO3B 3U4BL 5SX4H 2B0SH 1DN2A 1WBZB 3EDFA 4Z7WE 2R0KH 5TQ0L 5C6TL 2WLYA 4XMPL 4P49A 4JRXD 1YEEH 1WV7T 4CDGC 4BELD 3BWAB 5SWQA 1SYSB 1Q8MA 2XKUA 3PHOA 1G9EA 1KNOB 3QR2A 3DX6A 2V7NB 2D03L 1MIEL 1ZEAL 5IR1B 1O0VA 4XHJD 3VXUE 5CS7A 4PJGF 2X6MA 3NA9H 1UM6H 4JVUA 4NC1E 4QHMA 3SQOH 2VTFA 3HN3A 2BMKA 1OAKL 2FX7H 2YPVH 2CSPA 2EYRB 4UQ3A 5DJ8B 3L3HA 4LMQE 1ORSA 4CVUA 3UAJD 3E6FA 4LLVB 4QRTA 4U3HA 2QADB 5D7IB 2UZIL 4OUUB 3WFDL 4R8WL 2ID5A 5HYJA 4JB9L 3I9GH 4MNGE 3RNQA 1EA9C 4J1UB 1JYWA 3MLVH 1DVFA 1XH3B 5CSZB 4P5MB 1E6JH 3PGDA 3QEQA 4PUBH 5HHOD 3PE9A 4QXWA 5ADPH 1WWCA 5IEKA 3JTSA 3CFKB 4LCWD 3IFLL 3N9GL 2X4OA 5KSAA 1Z6JT 3S4SG 2P42B 3PGFH 4PB9H 4UINH 5B21A 1RIUH 2WW8A 1DBAL 1RZ7L 2DQUL 5HXMA 4ORGB 4E5XB 4KJQD 1WBYA 2NR6C 4UB0L 2A1WL 3DI2B 1FGNH 4JG1L 3RAJL 3TIEB 4OZHF 4G7VH 4WEBH 1DE4B 5IHZA 4IM8A 4WDIA 4OZGF 2NX5A 2BHYA 3X3GL 3CC5B 3CMOL 4W6XB 4XC3L 3H0TB 5DUMH 1SMOA 1IL1B 2P5WD 3WNLA 2D7TL 2V17H 2D0HA 4U49A 2BX5A 2VKWA 1UM5H 4IOIB 4MJID 1Q72H 1A0QH 5E2WH 4U1MA 4WY7H 4LAQL 2FL5B 4NO2A 5EO0B 4H1LH 5IKCA 5TE4L 4KAQL 1RIVL 4WHCA 4W4NA 1MAJA 5J11B 4TTDC 4PD4J 5CIPA 2I26N 2ATKA 4I4WA 3MV7D 3B4NA 3SDCA 1BQHA 4OIIH 1QBLL 5A2FA 3QEGH 3MJ6A 2VLME 5KSBE 1NCAL 2EDYA 5EU6D 3SGKC 4O00A 1OAZL 4Y4FD 2EIEA 3CDGA 2NYYC 3EYFB 3M17B 4WI4A 5IQ9B 1G9NH 1B4RA 3UC0H 3P4LA 2ERJC 1QSFB 4JRXA 5ABDE 3WO4C 4NO5B 1FIGL 4FQ1L 2KZWA 4EQ2A 5E95B 5JHDE 3O4OB 3MV01 4KVCH 1YPZE 4HGWA 2BSRA 4ZOAA 4PJHB 2XQBL 5C08B 3SBWC 1K8IA 2A83B 2IC2A 2JJTC 3PGCA 5K33A 1G7IB 3QPQC 4JG0L 1OQOA 3FOLA 4GW4B 1OCWL 3N1FC 3G6JE 2BXYA 1J1PH 4JFEA 3SCMD 4X6BB 3TESA 4RQQB 4V1DD 4D9RE 1JGUH 1G7PB 1FZMA 2F53D 1JWMB 3LKQB 1KBGL 4F15B 4X98A 1H15B 3AVEA 3LKQA 2YZ1A 4LLQB 2ESVA 1F4XL 1A6WL 5E8PA 3UJTH 3T0WA 3L9RA 4MCYA 1FFNB 1EVUA 2EDHA 4G3YH 4NC2B 5DQ9B 5D9SB 4HLZH 1M7IA 3ARFC 3FQUB 5EFIA 1EHXA 3KPPA 4MJ6B 4PTUB 1VFBB 5ESAB 1XFPA 1JP5A 1CLOH 5E70A 5EORH 2YPLA 3OF6D 1TZIB 2NW2B 1PKQE 2HLAB 4KUZL 3BI9X 3GBLA 1XMWA 4YQXH 3G5ZA 4KXZH 4TSCL 1V7NH 4Q9CA 1QVOB 1W0VB 2Q1EA 4N0UA 3QEHA 2MQCA 4OF7A 4PJFE 4EI6A 3S9DB 4J4PC 4JGJA 4EN3C 1FN4A 4FQXC 3B9EA 1LEIB 4EI5B 4Y0GA 3SDXB 4H0IA 4JE4B 4KKNA 1T6VN 4UQ3B 3MLYH 3D25A 1LDPH 4FABH 1V3MA 5JIPA 3VFGH 4POZD 3ET9F 4PJHF 1K4CB 4PBWD 2R0LL 3P77B 3RWIA 1CTNA 4N0RA 1M7DA 4BQ9A 1N59A 3MREB 1T1YA 4GH7B 5GS0L 1F45A 5D93B 7FABH 1SYSA 3QUZD 4HIXL 5ACZA 4NHCL 5CWSA 5D6CB 4BZ2L 2ZP0T 5ADOL 2VUOA 3MNVA 3DV6B 5E6IC 1S7SA 2VLKB 1YPZB 1P7KB 3TCLB 1U58B 1FYTB 4OZIE 4P2YA 2WSKA 1GGBH 4N5ED 4ZAKB 4XAWL 2XWTB 4J12A 3S37H 2DS4A 2O5XL 4G80A 5DVMA 3BXNB 1CL7L 3OX8B 4XBPB 2DDQH 2UZYB 3G5VA 4PJ9A 1RJLA 1J88A 2OXGA 4DW2L 2PXYA 5GGVL 5E24E 4WO4C 4R4BB 3WXWH 3RVVC 4HIEA 1PQZA 4GRWE 4PJBE 1A7PH 1UQSB 1RULH 5TE6H 4HKXA 3ARFD 2IH3A 4RMUA 3KLHC 4QXTA 4O02L 5IBUB 4N8VG 5DEFB 4L3ED 1KPUA 2EXYC 2CLRB 3FN0H 4NC1C 3P3YA 3CFKA 5LGKA 1SJHB 5F7KC 5CSBA 3H9ZA 4ONFL 1TDQA 2X44D 3RUGF 4KMTL 3V7MA 1FAIL 4U7SA 2QADD 4U1MB 2BNQD 1A2YA 1BAFH 1ZVSB 4KK5D 5F93C 4AM0A 4FFWC 5MENA 1JPGA 5GXBB 2Z93B 1INDL 4HMDA 2X1PA 4FQXB 2F19L 3KLDA 2AAVA 3V0WL 1H3VA 4RBPH 4JFDB 3MLTA 1SEQH 1HINH 2BNRA 2OR9H 3GRWA 2EKSA 2DWDA 4Q9QH 1NGXA 5KVEH 4YZFE 4ODUB 4I0PD 4BZYA 3VD5A 1NLBH 2VB5A 5J6GA 1FGNL 1BECA 1FVEA 2HT2C 3T2OA 4N9GB 4U0RB 4CBPA 4YFEA 2FRGP 1BD2B 3U48A 2NYYD 5EZLB 3T2PA 2YA2A 1RZ8B 1UACH 3HKFA 3WJJA 1ZTXH 4G42B 4FS0A 2V6HA 4OGAC 1RZJL 1FYHB 4MAYA 4JQXA 1KCRL 1JK8B 1K4DB 2G75B 4GAYA 4DKFH 4HH9A 4M43H 4ELMA 5KZCD 5CGMA 1PEWA 4E41D 4BSJA 3BPOC 5GGTA 1R24B 4YGVB 3SKJH 4HAGA 3JV6B 1P4BH 4XH2B 4OM1H 5DLMH 3QDJD 1T04A 4KGJA 4XNYH 1KGCD 3ULUH 1ZVYA 3EDDA 3NCYS 4KY1L 5HDLA 1I8LA 3MLSH 3PHQA 3W5MA 4TUKH 4HUWA 5MI0B 2GW5A 3LQAL 4PREB 3HUJE 5DK2A 3VFUB 1QTYT 4GW5B 3CU1A 2G5BA 4PJIF 1G0XA 4D3CL 5I15H 3BRDA 1QHOA 5I16B 1JE6A 3WXVL 1PLGL 2Y9RT 4QHLA 2VXSL 4JRXE 3OJ2C 2HWZL 3E2HB 4HJ0D 2VZOA 3L3DB 3QI9C 3RWGA 1VFBA 3MUY1 1DQJA 5L6YL 4BH7A 1ULVA 5HI3C 3KLAA 1RSFA 3IU4L 2D4FA 4OJFL 5BCAA 3ZMRA 4PJ9D 3ZE2E 3EFDH 1T5WA 1TZGH 5IT2L 2ESVB 4HDIA 3QJHA 3QQ3A 4N0CC 5E9DA 5JA9A 1MJ8H 5M95B 3DI3B 4OCYL 1I7RB 2YBRB 5HGBA 3C6SB 4DUWA 1V05A 5FO8B 2PW1A 4R2GC 4O9HL 5KVGH 1N4XH 3LAFA 1N0LA 1KTDA 2DQIH 3QUYA 3KLSA 2VE6B 2XPGB 2ZUQB 2GT9A 4QOKD 1D6VL 2EH8L 3P77A 3RWIB 1SM3L 1A7NH 4XTRC 5LBSH 2CJUH 4L8DB 3OKKA 2JCCB 2FNBA 2NNAA 3PIQB 3TZVD 4WFED 4JRWA 3OAUL 5I1EH 4JY6B 2HT2D 3BIKB 1NBQA 4QOKA 1JNLH 5BS0E 4HBCH 3SE4A 2ZOKB 4MB3A 5IWLC 2VABA 4Y1AA 4YFLF 4O2CA 4NUGH 2HH0L 2DKMA 5GPRA 2QBWA 2R23A 2IH1B 4JDVB 4LIQH 3VXTB 1ZLSH 4BK5A 1QFHA 4K8RH 2AJYL 4RNRA 2R2HB 3QIBB 5CGYD 1G6RL 3VWKC 4Q0XL 5EBMB 5B4MD 4CADA 3DRTA 2HAZA 3ZTJG 3AROA 3CFJA 5TE7H 3GRWL 4FFVC 1S7TA 2D3VA 2FBJH 4NRXA 3ROOA 4FQIL 3QZWG 1I1YA 4KQ4L 2F8XC 5A2IH 1XGYH 4UV4H 4LSQH 1YMHA 5D7KE 1U6AH 3QHTC 5F6IB 2VXTL 5GJSH 4NCC2 5GGQH 1WJ3A 4K2UL 6CGTA 2VLMD 4YAQB 4GRMA 4POYA 3A6BL 3MRDA 4PJFB 3MRIA 1YEHH 2KBGA 5DR5H 5I1HL 2XXMB 3WD5H 5C0EA 4HUMB 1H3PH 2W9EH 4RA0C 4CN1A 1C16B 2OR8A 3C6LB 2OK0H 1IFHL 5HYSA 5E99L 2X09A 4KQ3L 5J1AA 4PBVC 1UXSA 4LPXA 4YXHH 1Q94B 1CL7H 4NSKA 5DURD 4ZFGH 1M4KA 4KRLB 1I85A 4K55A 3S8WA 2BC4B 1KB5L 4G9FB 4QRRE 1UZ6E 4OLVL 3LRGA 1T22B 4Y16C 2OP4H 4TRPL 4LLVA 3DETD 5BVPL 2OZ4H 1E4KA 1ZLUK 4XXCA 3T8XB 2G9HB 2XTJD 4LSUH 3LSOA 1U3HC 3WE6A 4OLYL 1YECL 3Q0HA 3WFZA 1TPXC 1QLRB 5HHQB 3GI8H 1DBJH 2P5EB 3PQYD 4PG2A 3C5ZA 3LKNA 5I1GH 2JKXA 5E2TL 4JFDA 3ES6B 3UEZA 4NFCA 5FKAA 2P7TA 4I48A 1FZKA 1EEYB 4YBQD 5DD0H 1FC2D 1FVDB 1PGRB 5ID0B 1II4E 4YHYB 1FGVH 3RU8L 2Y72A 2FD6L 4HV8B 2WM0A 5F89B 5MEOB 4HWNA 4LVNC 1AH1A 3G04A 4NUJB 1JTTA 3V0WH 2IADA 2CDGA 4HJGA 3MOAL 1IGJA 4X80H 4GW5A 2J4WH 5D1XB 2NY0C 1JMXA 3X13A 1NCCL 3LS5L 1J5OL 4M3JA 1QOKA 4LSRH 5L9DL 3KDMB 3K46A 1AJ7L 3VXNA 1OSPH 1T83C 2VC2L 1S5IH 1TITA 1C12B 3JTSB 2AK1L 5B39A 4PJ5A 3VFPA 4GRWB 3JUYA 3VH8B 3WNNA 5HGAA 4KKAC 3DBXA 4JRYB 2BVPA 3T2NL 1R5WA 3C6LC 3TFKD 3RGHA 1S9WA 2VH5H 2HTLC 4HK3N 1GHFL 5ICXB 5HHNA 2P8LB 1CFVL 5ICZA 1A14L 1RZKH 4FQJH 3MQIA 3EYSL 3WV0A 1WFNA 3MLXH 4ZO9A 3BH9A 3MJ7A 5DVOA 4U1IB 4LQFH 2M1KA 5FFLA 5DJ0B 3TYFB 4UDUA 3U36B 4YWGH 5JNYB 5F1IA 2GY5A 3F8UB 5B22A 2YPLB 5CILH 2NW3B 2R1YB 5DJYA 2Z8VC 3FT2B 5H94B 1CXEA 3PL6A 2XA8L 4MSWA 4HCRL 1OGAA 1PSKL 3CJJA 2M8XA 3D85B 3QQ3B 1JPSH 5GIRA 3QULA 2F58H 5DD5L 4OZHE 4E42A 4L4JA 3JWNC 1DEEA 2N4IA 1AO7D 3F6LA 5EU6E 2ZUXA 3O4LA 2ZCKH 3PWNB 1A1NA 4AH2A 1CZ8H 1B0GB 3S7GA 3HHRB 1PKOA 2NY1B 2A73B 2VKXA 5DWUH 3ULUE 5I1DB 5FM5O 1AO7A 5FYLE 2CIKA 3RWJB 4X6CA 2YN3A 2DKUA 4LHQB 3H3PH 4PREA 5K93A 2KKQA 3NBNA 4XMKL 4F33A 1FO0B 5DFVD 6FABL 4OT1H 4P46C 1CE1L 1YY8B 3H7BB 4F7MA 3L5IA 2BP3A 4XP1H 2AKRB 3NFPA 3QUYD 5BV7L 5EZOH 5D96B 4F8TA 1R5IB 1IQWH 5F44A 1Z2KA 1CGVA 3B2UD 3PABB 1A5FL 1I1RA 4LFHD 2A9MH 5IMKA 2FDBP 2Z91B 5DQJB 3T0AA 2HTKD 5KSUB 5CKGA 4JZOB 1ZLVH 3WLWD 3C08L 3RHWF 3T3PF 3CLFH 4QXTB 5F71A 3Q6FA 4HLJA 1CICB 4LDOB 2CLVB 1A9EA 2P5WE 2VLLB 1BBDL 3G6AA 4HWEL 1D5IL 2KQMA 2VERN 3ALXA 1FCCA 2ED8A 1AI1H 3NFNB 3L5JA 4P2OA 1AFVH 5ITFA 5K9KB 1GGUA 1Q9WA 4LLMA 3ABZA 1AGBA 1LGVA 3QUZA 4P2OB 2E9BA 4OLZH 4AQOA 5J12C 2XZQL 5TGBA 4TVPH 2Z8WC 4PBXA 4Y16D 4PJ5E 5IMMA 3LHPH 4ZUTA 3MRLA 3QDGA 4HK0A 2NZ9D 1JPGB 1ITBB 1RUAH 3FO9A 3SKNB 4QOKB 5ITBL 1TJGL 3B3IA 3OTTA 4OD3H 1OD9A 5HVFB 1MCFA 3T3MF 1Z3GL 1X5JA 3V6ZA 3HZKA 5HHPA 3EO1B 1ZHKB 1E28A 3NZ8A 4XCEB 2FHFA 2JF1A 4S1SH 2UZIH 4PJXF 3ECBB 2A77L 3DARA 3S98A 1WWBX 1AC0A 1W72B 2W60B 5D7IA 5T5FL 5C0BA 2DQEL 1FE8H 2UWEB 1DSFL 3RQ3A 3ARPA 3TA3D 5HYJB 4GKNA 4HEPG 5HHMB 3GHBL 3GSUA 3DIFB 1ONQB 4HT1L 4PYGA 5D6DA 2CD0A 4JKLA 2MCPH 4NRXB 4ZFGL 1NC4A 3BO8A 1FFPA 2MSPA 3V79C 1NC4B 5C08E 3ROLA 1HQRB 1T1WB 1KB5H 3CVHL 1DVFB 1XH3A 3U6RA 3RGVD 3I2CL 3LDBB 5D96C 1JV5A 1DBAH 4PG9A 2UWEF 3BJLA 4LLWB 2CDFA 4L3CA 3R4DA 4TNVF 4JCMA 5FGCE 4OLYH 4P2RA 1TVBB 5DQDH 2CGRL 2Z35B 4GAJH 4X4MA 3UPCA 4OCWH 2NY2B 1KENH 3HRPA 1I3GH 1NCDL 2F5BL 2QQNH 3AXLB 1MFAL 4X4XA 4PJAB 4LHUG 1KIRA 1NEUA 35C8L 1KLUA 3VXQA 5JMOC 1HSAB 1MJJA 2NY7L 3S34H 2HFFA 3C09C 1DQJB 1JHLH 4ZAKD 2RGSA 4LAQH 5GGUA 1NANI 3GMOB 4WO4D 4XCYA 3IXTA 1GRWA 2IQ9L 2MJWA 4RIRB 4WWKA 5IBLC 4HS8L 1JUFA 2J8OA 2P48B 3B8SA 5SWSB 4N90E 3RWEA 4G8GB 1U8OB 2DLTA 3D18A 4ETQB 4L8SC 5TPWL 4NN6B 2XTJC 3WL9B 4JFYB 1F11A 5EDXA 3W11D 3RBSA 5E6ID 2D7NA 1GVIA 1L4IA 1EEZB 4FQHB 4X4YA 2A6JB 4NOFA 4TTDD 3MJ7B 4I77L 1R3JA 4UT7H 4KU1A 3MV7A 4QXGL 3N1PC 3W0WD 5BZDA 2FX9H 3NPSC 1QEWA 1A6TB 4HK3J 2VH5L 1FNGB 5B8CA 5IV2A 5JDSB 1IC4H 5J6GB 5BQ7A 3QFDA 4LGSB 4WI9A 2MPAL 4NQEA 1S7RA 3SDAB 5FA4A 4S0TD 1QLFB 4ZMAT 1JPTH 3QBTB 1B3JA 4IDLA 2GQHA 3C60D 1T5XB 1VFMA 3RWDA 4F33B 3WN5A 3LKPB 4XPHH 2P8PB 4NRZB 1K8IB 3ZO0A 1Q38A 2R2EB 4S2SA 3IDYB 3QEQE 4ZNCD 1A9BB 1K85A 1U2CA 5J3HC 5CZXC 5F3BB 2WINA 3SCMA 4NJAH 3V4VL 4L4TA 2CUHA 1NBYB 3U0WL 3FOLB 2QTEA 8FABB 4MA3B 3B2UC 1YN7A 2DMCA 5F6HJ 5EOTA 1CQYA 1LO2L 1L7IH 3BAEL 4LL9A 4JAMB 4BQ8A 5M94B 4BUGA 5J13B 1MCOL 2X40A 3EO0A 4LCUB 3BHBA 2Y6SD 1D9KC 1TFHA 1U8NB 1X5IA 2FHCA 2R8SH 2GAZB 2ZCHH 4K71B 1OGTA 4OI9A 1DQQA 2JJSA 1FNEB 3B9VA 3FT4A 5F96L 43CAA 3WFEH 5KBNC 5DT1H 2CMRL 5KSAC 1MH5B 2E7CA 5KANG 3O3AB 4NZJA 5FCUL 1A4JB 2WP3T 3ZKNC 4YR6B 5D2LA 4KHTH 4QT5B 1XGQB 1QACA 3TVMB 3KPRB 3NTCH 2Y7QA 3FCTB 5I17B 1KJ3H 4OV5B 2IANA 5EC1A 4M00A 3VW3L 3VXOA 1SJEB 4MD4A 3RVXC 4AMKH 1LILA 5CJXA 3L3OA 3RL2B 1EBPA 3MRGA 2AJZB 2R56L 3CSYA 3SQBA 2VN4A 4I3RH 1HHGA 2UYLB 4HUKB 4OFYA 1Q0XH 2FJHB 4AK1A 2E8ZA 1AHWC 2Z31D 4Y2DC 4PJ8D 4D0CB 5I1KH 4BKLA 3MRHB 1U8HB 4IRJD 4TUOA 5DVNA 5LGJA 4JLRB 1EAJA 4HEME 4OUUA 4FP8H 1J0JA 4OFYD 1KLFA 5C92A 3RA7H 4JFZH 1GGCH 1XR8B 2DQDH 2AJVL 1IKNA 1T7VA 5GGRA 3IDYC 4ZUSA 4K94C 3RZCA 2WNGA 1O7SA 1A7RH 3MJ8B 1H3WM 3B5GA 4FTVA 2OMBA 2FZ3B 1CI5A 1JHKL 3IDXL 2OR7A 1DP0A 2PO6A 5IROC 4JFOB 5D7SH 4DKAA 4R96A 2CUIA 4MVBC 1DFBL 4Z7NE 4HPOL 3BT2L 5HVGB 1MHEB 3BDBA 4QCIA 2ERJB 1TJGH 3OZ9H 2YK1H 3KS0J 1EMTL 4ZTOL 4MHHG 5I19H 4HFWA 3WDJA 5I73C 4TTGA 4H20L 3O4OC 2NXYC 2ZSVB 3F58L 3VH8G 4K3EL 3VI4E 3MC0A 4OZFB 3IJYB 3TO2B 3DX9B 5A43C 1OB1A 1X5AA 2EE6A 5JW4Q 4G9FA 5GRVK 5AZEL 2D9CA 5FUZH 4MMXC 1X5LA 4QY8A 3T0ED 3G6DL 1KBGH 4YHPA 4O5LH 4K7PH 1EHLH 2E7LA 4UZGA 5HHOE 4DVRL 3UJTL 3PHOB 4RGNB 2YEZB 5I9QC 2WQ8A 3ARBB 1TVHA 2V7NA 1JJUA 1NSNH 5FYKD 5HYSB 5JXEA 3OBAA 4G3YL 3O45A 2FJGB 1BQHB 4ETYA 5FKAB 4NKOA 4UUJA 4IMKA 2R4RL 4ODHH 3SKOB 4RGOL 4NQSB 2E9IA 5MHSD 5TF0A 1ETZB 5FF6B 3CDGB 3ORJA 5IQ9A 3VGAC 2RJMA 3ECBA 3IDMB 3WKMH 4EXPX 4PP2B 2ENYA 3DUUA 4E41E 3IETA 5B3NA 3BESR 4GG6F 3OHXA 4KK6D 4XNQA 2VDQH 4L8CA 4WUKL 4MXVE 3DMMA 1NFDF 4U2ZA 1KIQB 5IW1B 3WBDA 4TSBL 5CEZL 3QEUB 2NTSP 2YUVA 3CIQA 4FXKB 3LKRB 3ES6A 4RMSA 1P4BL 4Q2ZB 1KJ2L 1UENA 5FKPB 4ZXBA 2ARWA 3DVNB 2I07B 4HC1H 3UTTB 5I66A 4FFWD 4ISVB 1NUDA 2EDLA 3E1F1 4IRJA 1HHHA 1FL5A 2YD7A 4Q97A 4Z7VA 1XEDA 3SDDA 3W0WE 5DRNB 4OCRH 1QQDB 2EDTA 3KXFE 1T7YA 4HIXH 4B0MM 5D1XA 2NY6D 1FBIL 1INEH 2HT3D 3DVGB 3I84A 3T0EE 3DRQA 3SJVE 1P53A 5D2NC 1HDMB 3O6FD 1VGKA 4HS3B 2OSLA 3R0MA 4N9OB 4JFQA 1EAPB 3FZUD 3MOQA 3RDTB 5T33H 1ADQL 5IW6B 2NY0D 4P9HL 2FWOA 5T1KA 3IF1A 2ED9A 5GRJL 1XGTB 3V4PL 5E8DL 4JAMA 2FX8H 3UX9B 4ZUUB 4MSWB 5H2BB 1MHCA 1WFTA 3P73A 4DGVL 3MV8B 1NAKL 3T0EC 5E9DB 2DQIL 4PJCF 2Q7YA 4AY0A 1FNHA 2DLFH 2NLJA 4KTDH 2FSEA 1A7NL 4GO6B 1LEKA 5ETUA 1NMAL 1KSRA 5F8RC 4G8GD 5ESVB 3GBNL 5DMGC 1I7UA 3NN8A 1T21B 3ARDB 4CW1A 4TUOB 4PTTA 5TFSH 4MD5B 2QSTA 2BSSA 2C7UA 4GRLB 4C83A 1MCWW 4NM8L 4PRPE 5L8LB 5GGRY 1NL0H 4JFED 4ODSL 2B20A 3EYVB 4ODVL 1CT8A 3TBWB 2AS5M 4X7FC 4LHUD 4XVJL 1ZWIB 1SEQL 2H3NA 1XR9A 4GKSA 2OLDA 4XWGL 2ZOLB 2VO5A 2VIRA 4UDTA 1V5JA 4K8RL 2DBLL 3O11B 1T0NB 5IVXA 3BW9B 1I1AB 3DPBA 1F3DJ 2FECI 5DHVA 3MRRA 1JYVA 1JVKA 4R4FH 2K7QA 4K9EC 5SV4A 2VR5A 1GC1C 3VWJC 5MEPA 1E4XI 3PG2A 3MV9A 2BOCB 4KTEL 5FA3B 1FNLA 5DD3H 4JFPA 4X6CB 3Q5OA 3DYMA 4N1HB 4DN3L 1XCQB 4PLOB 2PCPB 4CNIA 4FFVD 3UPRB 4MNQD 1ZANH 2ZKHH 4UNUA 3OGOE 5DD1L 4RMTA 3CXDL 4DKFL 1FL3A 4YIQB 1H5BB 5F9OH 3OQ3B 3V52L 4CVWA 4K7PY 1OPGH 5C0FA 5JOPE 3WNOA 4JO2H 1CLZL 3S3PA 3QCTL 2AW2A 1NH6A 1WT5A 3O6KH 1BX2B 4XVSH 1CDIA 2XZCL 1G7MA 1I8LC 2QSVA 4KY1H 4ZDHA 3QAZC 4J3VA 3GMQA 4H1LB 1P6FA 4R3SB 4O2EB 4IJ3C 2WIIA 4O2EA 3C8KB 2I9LB 4P23C 1QR1A 2R15A 3HZYB 1HQ4B 5E03A 3SBWA 3LY6A 4L4TE 1B4JL 5E6ZA 5D7KD 2DWDB 4PGDA 4Y19E 4TRPH 2FJHA 5C07D 4LPWA 1JRHL 4YBLC 4NBXB 3P9LA 2APXA 3ARGB 3VDBA 4P3CL 4JKPH 3LMJL 3MNZA 4JGMA 3F58H 1D9KD 5D8JL 5T1KD 4PRPD 4XZUA 3DIFA 4M1GL 3UP1A 2Y5TA 1SMAA 5CWSB 1EDQA 3OPZH 5C0CA 4HH9B 5C0IA 4ZFOB 3QXTA 2VXUL 3Q2CA 4WUUE 1U8PB 2GTZA 4LLWA 1ZA3B 5LQBL 4U1SB 4I3SL 4HV8A 4U33A 3BUTA 2ZUWA 3NPSB 3EOBB 5IVXF 1R0AH 2BY1A 4GXVH 2VLJA 3RWCA 1BJ1H 2PTUA 2E7BA 3HR5A 4MJ2A 3CD4A 2G5BB 4YHML 1J1OH 5BO1H 1FL6A 5F1KC 1P6AB 5F7EH 3LKSA 5ESQB 3F7QA 1ND0B 2GSGB 2OTWA 2X89A 3RWHB 4RGOH 3H42H 2RB8A 3DRQB 4NN5B 2VDKH 4NNYA 1PKQA 1RZ7H 2DQUH 4CN4A 2IQAA 2DQTH 1W72L 3SHSA 5BMFL 3FB5A 1I9JL 3AFLA 3H0TA 5TF1H 1L6XA 5C0AA 5HGAB 4HSQA 3GB7A 3LKOA 5T1KB 4WWKB 1UZ6F 2AQ1A 2NY1D 3WUZA 3MXVL 1CD8A 5HTSA 1F5WA 1BPVA 2ITDB 3VGFA 3RTQD 4DKEH 4E9LA 1WBYB 4PJEF 3D18B 4KVNL 3SJVD 5GS2D 4CAGA 4YBQC 4OZ4B 3RPKA 5T3ZD 1G1YA 3C5SB 3LV3B 3RGVB 5CLWA 3FT4B 4HIIA 5JIIA 3ZDYE 3P2TA 5I8EA 4Z7UF 4NZUH 2BHUA 3MTRA 4HKJA 5T1DL 3OKNA 3FQXA 1Z9OA 4YR6A 1H0DB 2W9DH 1T2QL 5EIVA 3UTSA 5IIEB 2XN9B 5T3XD 3BZEB 3TGXA 3DUUB 2IPKB 4R97C 3C60A 1F6AB 3DETC 3G5YA 5JQ6L 3KPNA 4HQQH 1DUYA 3S5LG 1HSBB 5FYJU 1HEZA 4OF6A 1CTOA 3ZL4L 1AIFA 1MCPL 2X7LA 5IK3B 4PR5B 1S9YA 1ZHBB 1TZHB 4Z0BL 3HS0B 5I66B 3SOBL 4EJ1C 4RNRB 3HE7A 1HXMA 1MIML 4KROC 4Y7MA 4NQCA 3GSOA 1V3LA 2ARJA 3SJVB 5FB8A 5I1DA 3LD8B 3GKWH 4PLKD 5T1LB 1RFDL 1A64A 4L8SB 1X7QB 4JY4B 1NFDA 4RWYL 1YEKL 1XR8A 4KTDL 2F5AH 1AP2A 2ZCLL 3NACH 5T5NG 1OAYH 1MJ7L 3WN5B 3FN3A 4JN2A 2DM7A 3RGVC 1FFNA 4M1DL 1YDPB 1S9XA 3QPQD 3P0VL 3BQUB 4NYLA 3CXHK 2D7TH 1G7IA 3FQUA 5EFIB 1VACB 2X4RA 4PJEA 5JR1H 1RJYA 1A1OB 1OARL 2BVYA 1K6QH 1S3KL 4OUOA 1C8PA 2YSSB 3QP3A 1LE9A 2ZUUA 1FAKT 1DN0B 2VDOH 4G8IB 4QRUA 5LGHH 1KV3A 1U3JA 3PWUA 5IBTL 5JHDD 4G6JL 3HC4H 1CWVA 4TSAH 1X3DA 3KR3H 1CICA 4XP9L 4MAUH 2Z31A 1C5BL 4NZRL 3I75A 3TH3T 1TJHL 3HMXH 2W91A 1DUZA 1AKJA 4P5TC 3O41B 2WP3O 1EXUB 1MFCH 2NZ9C 2R29L 1WIPA 4CKVX 2EDBA 3WSQH 4U6HA 1VEMA 4QTIH 4G5ZL 4AZ8A 4MDIA 1HHJB 2QSQA 1X4XA 5DJ6A 1D9KB 5TH2B 3IDIB 5HGGS 1WEJL 1RUQH 3QG7H 1U36A 4PRHE 3V0VA 2WLZA 1NFKA 5F21B 3WFHA 5JW4R 3SKMB 2R0LH 2PTTB 4PJIE 4Z0XB 5I0DA 5DFWH 4HW6A 1D6EA 1ZHKA 1FLRL 3O11A 3QI9A 1QO3A 1SY6A 2X70A 3GMRA 1T3FA 3WIHH 1NPUA 2DTSA 4QRPD 5C0JB 5E8EB 1QFPA 5DVLA 2XNAB 2PTVA 1EZVX 2OL3A 4A6YL 2W60A 4I13B 2RFXA 4L8BA 2W38A 3NFSH 4D9LL 4DTGH 4HFWB 1FVCA 3LS4H 3GK8H 1EZVY 1ES0A 4UT9L 4FRWA 1SJVA 4K3DH 5KAQG 4Z7UB 4I0PB 4JFDE 4PLKC 4DUXA 4JY5H 1NFIB 2VXVH 3LKRA 4YEEA 5ALBL 2PETA 5BJTB 1JGLL 3P4MA 5JOPD 3MRDB 1OM3L 2X4QA 1CIUA 4JM2B 4X6FA 2Y1VA 5D7JA 1WFOA 4WHDA 4PJGA 2G2RB 4X8JB 32C2A 3L5WA 5KW9L 1BBJA 5TDOB 3U7AA 4B7IA 1IC1A 3KHOA 3L7EB 3TIEA 4J4PA 4EN3A 3C8KA 2CK0L 1QR1B 4FQXA 3TPKA 1EVTC 4EN3B 5HSFA 2PW2A 1MF2H 4P5TB 1UM4L 1FV1B 5F72S 3M1BB 4U31A 5BV7H 4XNZC 3GMOA 3VGDA 1EERB 5C07E 3TH4T 1NANH 3VWKB 1KC5L 5D1ZD 2X4NB 5E4EC 5JA8B 1BFTA 3V8OA 2GITB 2OR9L 1OGAB 2DYPB 2OXHA 2R0WH 2Q3AA 4OAWA 4Y19B 4LVOC 4X83A 3K1DA 3QWOB 5FYLD 4X9HA 3N85H 5E6IA 5ERWB 5I30L 4PRHD 4PV9B 3MRQA 5L2JA 3NOIA 3GIZH 4ZXBD 5L7XH 1EGJL 4JFYA 2DJUA 2HTKC 1G6RA 1I7TB 1N6UA 5HY9B 4PY8I 4Q2ZA 5IR1A 1ZLUH 1I7TA 1UH3A 2XFXB 1CF8H 3MLRH 4BM7A 2VE6A 2KZ1B 3SKOA 1KCSL 2BY3A 1BGXH 4AG4L 1AO7B 1ZHLB 5F89A 3QDAA 3QUYC 4I5BB 3BVNA 4ZPVB 3QFDB 5C0BE 5AYQA 1EIBA 4GRLC 1VGEH 5B38G 3E6FB 1JZ6A 4TQEL 4M7ZC 3AY4A 5C86A 3MACH 4N0YL 1EFXD 4AIZA 3BGMA 3ZE1E 5LXGH 1EFQA 5FO9A 4H88L 1OLLA 1U8QB 3TJEL 1IGMH 4IOFD 3JV5A 4MNHA 2C1PA 4QXUH 1ZV5A 2P43B 3MRPA 4O2FB 4TUKL 2IAMD 3SE4C 4S1SL 2X4PA 4EIGB 3GBMH 5T3ZH 4PJ5B 4NKDA 3VFPB 1U8KB 3I02A 4Y16A 1T80A 5GS2H 5JW3L 2V2XA 4XH2A 3IF1B 1VEOA 5CEZD 3R1GL 4NGHH 3M07A 3VXMB 1INDH 1RZJC 1VFAA 2DLHA 4CRPA 4EVNA 3IDNB 3AS0A 2Z31B 1OWWA 3JVGA 4OCXH 2BXZA 3BUYB 4TULL 2P8MA 4OJFH 3HA0A 3MCKB 4K9EL 3GUTB 4HIJA 3RJQB 4G6MH 3H6JA 4RZCA 4EUPG 3AB0C 3RDTA 4XX1G 4RWYH 1WISA 3BKJL 2OM5A 4P4KA 1NC4D 2IANB 4FFZH 1ZHNB 4WUUD 4PLJD 2NTFB 1KNOA 1LD9B 4P5KB 2VNCA 4R7DB 5C8JB 1MY7A 3SDXF 3LEXA 4JFDD 3V5DA 3QRFM 2HKFL 4XPFL 1A3LL 1KULA 1DQML 2F9BT 4MDJA 4ZFFB 2HTLD 2ZPKH 4PJHE 4MQXC 3L3OB 2NY7H 3RL2A 1F58H 1DQDL 2FECL 2X70B 5IVXE 3B2VH 1WK0A 4XCFL 4Y8DC 4BKLB 3NZ8B 2IANE 1ZE3C 2LABA 1BQLH 2BC4A 3ESUF 5FM4A 2DRUA 5ESVA 3SGKA 3THMH 3MFGB 3HE7B 3IFNH 1HKLL 4L1DA 3WFBH 1MLCA 3KGRA 2UWEA 4N1EA 4YDLB 1NUFA 5CJ5A 3QFJD 2B4CC 5DJ6B 2DWEB 2ADJA 4HG4K 2HMID 4F8QA 1UB6B 3BO8B 1A6UH 3T0EB 1BZQK 4KRPC 1VPOH 4S11A 3C2AL 1A1MA 4XBGA 4KROD 5HI5D 4OLXH 5DJ2A 3UTZA 1NCWH 4Q0XH 1BVKB 3VMPA 5CEYA 3WLBA 1EJOH 1HN1A 1A7QL 1KB5B 2FX9L 1G84A 3RWFB 2YK1L 2DICA 2NQCA 4U4BA 5D7LD 1N7MH 4M1CD 1LQSR 3ULVH 1MHPH 4DOHE 5FHAH 2VXTH 5GJSL 4K3EH 5GS1B 1QRNB 1ZSDA 4KI5F 4EBQH 2EYTA 2Q6WA 3SQOL 3ZT6A 3OXRB 2EIZA 1UGNA 3LKSB 5ESQA 5C8JA 1U8JA 2YPVL 1KFAL 1MJJB 2HN7B 2B7DT 2VDNL 2B8OT 4IHOB 3QXVA 4LF3B 4YO0B 3D87B 5AZEH 3OKEA 2KUTA 3U0WH 4MMZC 1IBGH 3FRPA 3HB3D 1UXWB 5J89A 3BP7B 4U7MA 4RMRA 5JQHC 4OKVA 3TC9A 4YXHL 1BQSA 5ADPL 3ME0A 1DL7H 4JPVL 3ULVC 1MAMH 3U1SL 1TTFA 3RRQA 1CXKA 3BPLB 2JJWA 4NO3A 3SE3C 4L4VB 4KKCC 2P8LA 1D7FA 4PFEA 4JM2D 4H8WH 4P59H 3WFHB 1F3DH 3BPCA 3HZYA 1ZVHA 2XFXA 2HH0H 4Z8FH 1RV6X 2DL9A 3HI1A 5HHOB 5CJOL 4JQVC 1G7LA 5C1MB 4LMQI 1OTTD 1ZLSL 1DBJL 3EYFA 1ZLWH 2A1WH 5DJ8A 2HVJA 2NXYD 2D7MA 2YN5A 3NTCL 4Y4KD 3KWWB 4S10A 1KUMA 4QOKE 5FCSH 5CEZH 4Y19A 1OT2A 5DD0L 5HYEA 3W82A 4UIKH 5CMAA 1X9QA 1G1CA 1PY4A 1TMCB 3VXSA 3BRFA 1WBXA 3SGEI 4EOWH 4F37K 1HI6A 1MNUH 3PV7A 4BQBA 2F8OA 1DDHA 3O2WL 2O26U 4MNQA 2DMBA 4KJWD 1S9YB 5IESH 1CFNB 5F7UA 3HC3H 4OF0A 1FVDA 3VXSD 1JWMA 2ARJB 3SJVA 1AJ7H 3KPLA 3U30B 1C1EL 5DDHB 5F7FA 4EVNB 2JIXD 4WI7A 1BD2E 2O5YH 3QO0B 3NMEA 5I6XC 2AK1H 1KIRB 3RZCC 4ZPTB 5CGTA 5SWZA 4QRRD 4AT6A 1DE4A 5B4MC 1L6ZA 3ZYJA 3BGMB 2AXHA 3VFVB 4AL8L 2PW2B 4MA1C 1KN2H 1I85C 3TIDA 3VDCA 4OTXH 1R5VA 4ZS6D 3HMXA 2OMNA 4GOSA 4B7LA 2X4RB 2CO7B 2DM4A 2FX8L 3EO9H 1BVLB 2NW2A 4WI3A 4FQ1H 3C60B 1UJ3B 5EU6B 4MA7L 2RCSL 2B2XH 5GS0D 2A6DA 1QVOA 3MGOB 5T1MA 2VDRH 4KKLC 3NABH 2W9LA 1L0YA 5BS0A 2PN5A 5CINL 3C6LD 3TFKC 3X14A 2K9UA 1J1PL 3WS6A 1AO7E 3G6AB 1DUZB 4HIIB 2Q7YB 5BV7B 1TETL 4PR5A 1FCGA 4L29B 1QLEH 1IE5A 1F4XH 1A6WH 3FRPG 1JPSL 3QUKA 1DLFH 2FYYA 2L4OA 3ZHDA 4GQPH 2OX5A 3FQXB 1FHGA 3EYVA 4XP4H 3WJLA 4C55A 1I7ZA 3GSQA 2JK5A 4LNRA 4PJ7E 5TH2A 4QNPF 4HK0B 5I6XB 5DFTA 3U0PB 5BW7C 2GTWB 1ZWIA 2DQGH 3LKPA 4DVBA 4PGJA 3VG0H 1RUML 2ORBH 2A83A 4UINL 1CLOL 4G42A 3BPOB 1KB5A 3VXPB 2H1PL 3GJEA 4JFOA 3MZGB 4Z76B 4FXGB 3MYJB 1TCRA 4J23A 3LPFA 4PJEE 2HKFH 4TVPE 4XPFH 1AGCB 4N1CA 1DN0A 1BF8A 2EIDA 5MEQB 2ENSA 1R3HB 1YNKL 3DX7B 4OGAD 3P11H 5GGTL 2DTMH 3F7PC 3QQNA 5EBLB 3NAAL 4CU6A 4Z77B 1CLCA 1MWAL 4IHOA 3D0LA 4DN4L 1SBSH 4MJIA 4RAVB 5GHWL 3KJ6L 1F4AA 3W9EB 3EJJX 2VZSA 3UYPA 1TJIL 4HCRA 5BJTA 3FONA 3QNYB 1X44A 1P7QB 1RD6A 1XF5B 4HMCA 3WDHA 4PRHA 5GGSY 5HYQA 4FG6C 4U6VH 4K3JH 4PRBA 4WI8A 5JORA 3QIUB 3BEWB 3G5XA 4NO3B 2NTFA 3VE0A 4POZC 1R3LB 2Z91A 3DXAA 3VE0B 3WN5C 1G9NC 3ARXA 4Q6YA 3VGBA 1UH2A 1A7QH 1CFQB 1OTSC 1HCFX 3R8BB 2RAMA 3CDFA 4Z5RA 3S97C 4IJ3B 2XZQH 4ENED 4L3EE 5I76A 4KRNA 4XVUC 5GGVH 4M93C 3BE1H 5IFJB 1T3FB 1EFXB 1RUAL 3P9LB 1EFXA 2XN9E 1IM9B 3ARGA 2B5IB 1TQCC 3MR9A 1FIGH 1HXYB 4M1GH 4WGWB 4WJ5A 1T22A 5D7IF 4HFUL 3OHXB 4LARL 1Q9WB 4LLMB 2GT9B 4K8RD 4AENA 4PS4L 4WTXA 3BP5B 1D9KA 1Y0LA 3HNVH 1NAKH 5SWQB 4ZUSB 5F7YC 1OCWH 2EKJA 5AZ2L 2HMIC 5FYKU 3MNVB 5CGYC 3W2DH 4BFIA 3A6CH 3RVVD 3SGJC 5J11C 3U46A 2NXZD 4Z7WB 4L4TD 1SY6H 3U7YL 4DGIL 1W2KT 3WIHA 2VXQL 4Q6IA 1R24A 5JXED 1CQKA 4YHNB 3TO4D 3KYNA 1MAML 2DM3A 5GS0C 1OAQH 4YHIA 3KPLB 3B8YA 3KLHD 4GSDH 4ODSH 4YHIB 3HR5B 1JL8A 2JJUA 4MQXD 3MZTA 1DJSA 4XPAL 4F7CA 3STLA 1QZ1A 5E7FA 4D94A 5D7LB 5CJXC 3KNBB 5IVZB 2HRLA 4A6YB 5IM7B 1KEGH 2AV7A 3Q1SL 4N5UA 2WUBH 1UEMA 5MHSE 4NFDA 3MGAA 2FH6A 5HGHB 4Q74A 1CBVL 3GSRB 5C7XH 1I1AC 1BOGA 4YDIL 4BFEA 1RUKH 3KAAA 2AEWA 5BRZD 3UROR 4EI5C 1CFNA 5CZVL 1C12A 1KLGB 1CD9B 2YRPA 1FZOA 5DMKB 3ZE2F 4OLUH 3OL2A 1FZOB 5DD3L 1EPFA 1V3JA 4JRYA 1GOFA 1YYLL 5INCA 5DJXA 4ETQA 1JRHI 4KJWC 1AY1L 4I3GA 4RISH 5TDOA 1I3RA 5HHNB 4FQCL 4E0RA 1HH9B 5EG6C 2IMNA 2BDNL 1KPRB 1NKOA 2PKDA 5FUCC 4JDTH 4LLAA 2IBZY 3C9NB 4KJPD 2YPKB 2AV1B 3VI3E 3M1BA 2N7AA 4KHXL 5JW4M 5JQ6H 1TQCB 5DUBA 4LSPH 2A77H 3NH7L 4JVPA 4XVSL 4HWUA 4ACPA 5I15L 3BZEA 4ZAKC 4PIRF 2Q86B 2FB4L 4H25A 4BSVB 3Q6GH 1PLGH 5CUSH 4AEIL 4HUXA 3VD3A 3UTSD 5IFAL 3TVMA 4I77H 4N8CL 2EDOA 2DI7A 2R69L 5FYLH 1VSCA 4ZOBA 5DGRA 2JELL 1LO3L 4OAWB 5FDYA 4RMQA 5IF0A 3ILQD 4MCZA 3L1OH 4XAWH 1CD0A 2CXKA 5F9AC 3PJSA 5IF0B 1CVSC 1I1FA 1E4JA 1UB5B 1Q1JH 2YA1A 4XNMA 4M6NH 3VFNB 1YUHA 4MNQE 4PGBB 3HG1A 3EJZD 1P2CA 1FPTH 4G8EA 2VQTA 5I8KL 1LK2A 4R7NA 2KH2B 5IV2B 1FRGL 4DUVA 4KZEL 3CFDA 5KVDL 5T3XE 4UV7H 2E7LC 2QQNL 2VLJE 3F12A 4J8RB 1FSKB 1MJ7H 1RK0A 1F4YH 2W07A 2ADJB 3KPMB 1YY9C 5AAWA 1AQDA 4ZPTA 4M3KB 4QYOA 5DMIH 5SWZE 3P30L 4BFGA 1D6VH 1ZGLM 1MEXL 4MXWL 1CK0H 1C7TA 2VXUH 4HHAA 3VGEA 3TIDB 3BAEH 4N90D 1MH5A 1YJDH 3FONB 4WU7B 1SM3H 5LBSL 2OSLB 1YEDA 3FO1B 5DS8B 3MRPB 4Z76A 3FJTA 4Q9BA 1A6VH 4M4PA 4UIMA 5ICYA 5BZWA 1ZXQA 2A6IB 4M1CC 5DT1L 1A1OA 3CK0H 5DO2C 1MJUH 4U0RC 3RHWK 1ZHNA 2ADFH 12E8L 2GK2A 3OAZH 5SX4I 4JPIA 3HTLX 3WIIL 4NQVA 3GHEL 2H1PH 2KPNA 2VITB 1MOEA 5GGSB 5ICXA 3QXUA 5EIIB 2B1HL 2HFGL 3O41A 3HAEH 4G5ZH 3MCKA 4OM0H 4QXGH 2Q8BL 5A2JH 2Y36L 3CSBA 2Q8AL 5FM5M 3TO2A 3X17A 4GRWF 1CD1B 1GGIH 2FO4A 1ZOXA 2I9TA 2H45A 1YNKH 3VA6A 1S7XB 4U6HB 3NAAH 1UKTA 1UWEH 4YXKH 2C3GA 25C8H 4Q9RH 3LEVH 1SBSL 3EFFB 5KVFH 4OZGB 3JWDH 4F3FA 3F5WA 1KN4L 4RDQG 3A6BH 4JHWH 4PRID 3ARBA 1W0WA 2QHLA 1TJIH 4Z0XA 2H3NB 5CIPH 2VLKA 4M7KL 2NX5D 5I0ZA 1BJ8A 3X12A 4ODXB 1MFEL 2DIBA 1D3CA 4O4YL 4U1HB 5J7CC 4XNYL 2E5EA 1J0IA 1DEEB 2WAHA 3OG4B 3BZFB 2W9EL 3VXTA 5SWZD 4DTGL 2VN7A 1NKRA 5EUKB 1SVCP 1LO2H 2QQKH 1MRFL 4PP1D 3IDJB 3LB6D 2XTJE 1ADQA 2FGZA 1IILE 1KG0A 3BP5A 5CMAB 2DWEA 1Y0LB 4XX1E 5CCKL 2ZCHL 2D7QA 4OLVH 2ZG3A 5JPNB 1JGLH 4J1UA 4M02A 3K4ZA 3PQYE 1PVHA 3GO1L 4Z7WA 4PB9L 4GBXA 5I19L 5JOFB 3P4MB 1FFOB 1CGSH 4P9ML 1R3IL 4Y4FA 5DJAA 2DQJH 1MVUB 1SYVB 4OQTH 5JUEL 1KTKE 1MY5A 2HJLB 4JANB 1S9WB 4PRAB 3GIVA 4FQ2H 4PJCA 5DRNA 1BHGA 4JM4H 1M7XA 1J18A 2Z9TA 4HKZA 2GYSA 4DCQA 3TBSA 2I9LA 1BREA 2VDLH 1WAAE 3DVGA 4F57H 1VERA 4O5LL 1KCUL 1IMHC 3BJ91 3TJHD 3ARYA 4R4ND 1MLBA 5E2UL 2YKLH 2DI9A 5C2BL 2I24N 4HX1A 2VLLA 4H25B 5EZIL 3GSVA 5TQ2L 3MUJA 2ZG1A 3G5YB 4ODWA 5CFHA 4M48L 4PJXB 3O4LE 4FP8L 4OKVB 3GMPB 1NC2B 2W65A 5F7LB 3O6MH 1GGCL 5FAAA 1X4ZA 2R4SL 3KR3L 2IFFH 3QUMB 5L2JB 4NUGL 3MRBA 5J1SC 4YDIH 3L3KA 5KS9B 3DUHA 4BFIB 2ZNXA 2QR0B 5T3XH 3D48R 2X4UA 4M6MH 1K4DA 4N8PA 1OAZH 2QR0A 4ELMB 3AM8A 1DQLL 4XCCL 5ETUB 3ULUF 4RMWA 1MRDH 1MREH 4YHNA 2EKSB 2Q76B 2GCYB 2DQHH 5ISZD 3BKMH 3WEXB 2WBWB 4M7LL 5AWNH 1JZ4A 2HVJB 1YEEL 4HUXB 2D03H 4KVCL 1KTRL 1CICD 5C0ND 4PJ9B 1P4LA 3EYSH 2NY4C 5DC9B 4TVSa 5ISZB 2FX7L 4U1GB 1IAOA 5FUOH 1RUPH 5ISZA 1ZLVK 1LE5A 1PKQB 3DLQR 3SO5A 3K1KC 4WFFD 5DHYA 2K1MA 2DN7A 1R5VB 4XNMB 4YBLB 5EOCJ 3LN4B 2ADGB 1HQRA 1LDSA 5JW3H 4TNWF 5IB3B 2QQLH 2YRZA 4R8WH 4OFKA 4LPYA 1BVLA 4XP6H 1LK2B 1WICA 5FYKE 5D70H 5BS0D 3TA3A 2V2XB 1T2XA 3RKDC 1OLZA 3HE7D 3EYQC 4X6EB 2GHWB 3MMEB 4M5ZH 1A02N 5BVJB 5FHBH 3VFMA 2APVA 2DQCH 3MYZA 2H9GB 3V5KA 4KZDH 4Z7WF 1N64L 3O4LD 3H3BC 3HNTL 2EDFA 5C07A 3C9NA 3C8DA 3EHBD 1YMMB 5I1AA 2YD2A 2AV1A 2OP4L 4KKBD 5ID1A 2W59A 1M6OB 4D2NA 5DRXA 3QQ9D 4XNXH 3QNXB 3TPUB 3I3EA 5C0DB 2PXYD 2P47B 5H94A 4G6KH 1WT5C 3LB6C 4PJBB 4OZGA 3OJVC 5F9WC 1XIWB 3LEXB 4WUKH 4L9LA 1XIWD 4JY6A 1CGXA 2CPCA 4P5KA 4KJYA 4Y4KA 5J4MA 3K7UA 2VITA 4BFBD 4OZHA 4N0UB 4APQB 1Q9OA 4WW2C 1XR9B 1V8HA 4G8FB 3O0RL 1P84K 3O2DL 3RVWC 1NEZG 2VABB 9CGTA 2APBA 3GMRB 4XB7A 2VISB 1ODAA 1UM5L 5MP6L 2PNDA 4QRPB 1F97A 2UYLA 1FIEA 2A38A 2A6JA 1MPAH 5B8CC 4P46D 3PQYA 4YK4B 1I9RH 4HULB 3OKLB 2BSSB 2C7UB 5T1LA 3OKKB 4YFLI 2NNAB 1X7QA 4KAQH 2Y07L 2DAVA 1T1ZB 2FATL 3SY0B 3N85L 3LCYA 4X6DE 3EZJB 3F62A 4DGYH 3U6RB 1UADC 2BNUA 4JN2B 3CUPA 2OJEB 4PJGE 3ULSA 2WBJC 2ATPA 1YY8A 3H7BA 4NJ9H 1G9NL 4LPTA 3SCMC 4FZEH 4F7TA 4HF5H 4S2SB 1A3RL 4M7JH 1WFUA 4U6YA 2G5RA 1KTLA 3MLWL 3WHE0 2OTUA 1KN4H 5HGDB 2QLVB 4PJGB 3GIVB 5JORB 4JFEE 5GS1A 5J13C 1A7BA 4XBPA 4X6BA 2H8PA 3CFEB 2OYPA 1R3LA 4M7KH 3MOBL 1YYML 1ZKAA 2OJZL 2XOTA 4K71C 4U1LA 5J9PA 2JJSC 5J9PB 2YD3A 3QXAA 5JO5A 2EDRA 2WANA 5EO1B 2DIAA 2HG5A 5CEZE 2KQNA 1BZ9A 5D71H 1OP5H 3IVKB 2QQKL 1WZLA 2DQEH 2I27N 3W9EA 3IJSA 2ZUTA 3QDHA 3FAXA 5HYSG 4LIQE 2GITA 1A4JA 2VZ3A 3T1FB 1JN6A 1AGBB 1Y18A 1YY9D 3QUZB 2EEBA 3R1GH 3TBVB 2G9HA 5E0QA 1U3ZA 1MCBA 4HXBH 1OF2A 3BWAA 4NWUH 4URTB 3SKNA 4TOYH 4UTBL 3C5SA 1HIMH 3RGVA 4ODBD 4NM4H 3GSNL 3X12B 2XTJB 3DX6B 2VZVA 1EEYA 2Y5EA 3OKYA 2AEQL 1T1XB 1CLYL 2YMXL 4LPUA 4ZD3H 1A4KB 3V6ZB 1DVFD 1RAMA 1QUNA 1HHGB 5EPMA 3BKJH 1JNHA 1GXEA 1D5XB 3BEVA 5F97E 4CVZA 4HJ0C 2FEDD 1BIIB 2J3SA 4Z95H 1IAII 3JWOC 1ORSB 4JFFD 3ARWA 5LGJB 1IZJA 2IAND 2XZZA 2OCFD 2Z4QB 3GSXA 3D5OF 4MX7B 4FN0A 1ZANL 4NRZA 4YDVA 2FGWH 1B90A 2W1NA 2P5EA 2EC9U 2COQA 4AJ0A 3D39A 2XTLA 4KTYA 2EC9T 1JV5B 1Z5LB 5C0IB 2Q20A 1ZHBA 4LCCB 1O7VA 5IQ7L 1HILA 1HKLH 3PV6A 3GB7B 1NGQH 1HILB 3RPIB 2HFEB 5IG7B 3D85D 3W11C 4WFGE 1UFUA 3U79A 3BHBB 4F9PC 4MWFB 3KPOA 1UWXH 2P8MB 3FRUB 4JKMA 1KACB 2V5TA 3S37L 5BRZE 2Z8SA 1I8KB 4YPJA 2CR3A 2ILLA 4Y1AD 5CKAA 1YDPA 1MRCH 2ZSVA 4M7LH 5AWNL 4OSUH 3E8UH 1PG7L 3MCLL 4D0BB 3G08B 3IXTB 4LHUB 1EO7A 2QKIA 4NQED 4IRSB 5DK3A 4LKCB 3SO3B 4XHJC 1G7JA 1MCKA 2MHAA 3V7AE 1UJ3A 5EU6A 1MELA 3NCEB 4H0HB 4EBQL 1J9CT 2ZUVA 4NNPL 1XGTA 4CJ1A 4YHPB 1RULL 1LO4H 4O02H 4YDJB 1ZT7B 3EOTH 1U2HA 1XF4A 1OAXL 2ATKB 5GSVA 3VG9B 4PJXE 4KMTH 4QRPA 1LK3H 4LQ1A 4O58L 1FZKB 3PDGA 4BQCA 3MV7B 1HHIB 4ZO8A 4HPYH 1UA6H 4X7SL 1DBBL 2BVQB 3TYFA 3U36A 4NQCB 3UTOA 5ISZE 5JLZA 4OFVA 3ZSSA 2M2DA 4K8RC 1M05A 1A22B 1F6AA 2AXJA 1I9EA 4HBCL 5ANMB 3QJFA 4YHKH 3IDIA 5D1ZC 2V2TA 3UTQB 1T66C 3TWCH 3BISA 3SOBH 3DGGA 4JHBA 3W39B 5C3LD 1Q0YH 1FJ1B 4P2RD 1W0WB 3BKCL 1PZUB 3FQWA 2EEAA 4HS6B 3SKMA 4L8CB 4POUB 2QSCL 1HKFA 3ARSA 4JQVA 4PRDA 1L0QA 2PO6B 5CSGA 5B38A 1OTUD 1DANT 4WV1B 3VI3F 4EIZC 3I3BA 4Q9QL 4XNXL 2JLLA 2NXZB 3BDYL 2VIRB 4UDTB 2EZ0C 3C2SA 3FN9A 5C09E 5IHUL 2R56H 4WTZA 4QHKJ 4PB0L 4AMKL 1ZTXL 3BIBX 4YC2C 5EOCL 1R3HA 3DROA 2JB5H 4G8GE 2V5RA 1U41A 2YPLD 4CVXA 5EU5A 1QYGL 5JMRA 5FV2A 1MFNA 1NFDB 1BF2A 2EXWD 2PYFB 4KV5F 1KCRH 2AP2A 3I75B 3EJZC 1NGZA 1RHHA 5DLML 1QSZA 2BY0A 4MCYB 5DRWB 5CJQH 3SKJL 3T0DA 3HC4L 5DS8A 3RA7L 2EH7L 3TEUA 5GISH 1J0ZA 4YHYC 4EEEA 1I3VA 3IXAB 4N0CD 2VQUA 5C08D 4TVPD 1NLDL 1NAML 3JBG7 1MI5A 4LHJB 4LOUD 3I3DA 4NN5C 4IIQB 2J8UA 5F7DB 4MQ7A 5C0RH 3P73B 1MCWM 3ILQC 2DJ4A 3DMMC 3CDCA 3ZTNL 5FF6A 4Y5VC 1QR4A 3BKYH 5E5MA 4TUJB 3HPLB 3CVIH 1N6VA 4ZXBC 3V7AG 3NA9L 1QFWL 2H2SD 4IRZH 2D9QB 3QZWB 3PNWB 4UILL 1IZKA 3LZFH 3LSOB 1E4WL 2JCCA 3NABL 4IRJC 2XZAL 1MJ8L 2VWEC 3QUMA 4JHAL 5DJZA 4U1GC 4NJAL 1QPXA 3V4VH 3V4UL 2AVGA 4M1DH 4P2QE 4XMLL 1CR9H 2IAMA 3U4AA 1TETH 4Z18A 3DYOA 2FD6H 3L95B 8CGTA 3BYTA 3I9GL 5DZOA 2EH8H 3UJJH 1BIHA 4HUUA 1FQ9C 2WMPA 1E28B 4XCEA 3MXWH 1HHHB 3HMWH 3L3JB 2HA1A 5E9DD 2VDOL 4L8BB 3GI9L 5D2LF 4EI5D 4LBEB 1DBMH 3PWJB 3TT3L 3FKUS 1MCDA 1J87A 4JFFE 4LVOB 2C3HA 4Z7UE 5GRYA 4P5TA 2IG2H 5ELIA 1F3RB 3NIDF 5CJ8A 2ITCA 4RFOH 1IAMA 1IT9L 1J1XH 5KSVB 4OFIA 4LGRB 2X4OB 2AJYH 4KC3B 4H0GA 5K9OA 1N2RA 1JN6B 3MUHL 5J0BA 4OBSA 4YK4C 4QEGA 1TVBA 1WTGT 3LPWA 2IBZX 4OIIL 1E4XH 3QEQD 4IS6A 4XRCA 1YEGL 1N5YL 2VYRE 5MENB 1MIEH 4YZFF 3GMQB 4H1LA 3IGAA 3VRJA 1DCLA 5KJRH 2C26A 3S5LB 1KYOJ 2BNRB 4OZFH 4KUCF 2ZSWA 5EA0H 1A4KA 4M61A 5CUSL 5I1HH 3BH9B 1DZBA 2JJVA 3RUGB 5I30H 1MFBL 2Y06L 4QF1B 4LEXH 2IPTH 1TENA 3N50A 1UCTA 1I7ZB 2I60L 3GSQB 4QNPE 4I1NB 5EOQH 1TQBB 3ARDC 5DMYA 1G7JB 3QHFH 5SWSE 3F6IA 5AEAA 3ZKXB 4LRIA 1XZ0A 3CH1A 3MNZB 3PJSB 1JYXA 2RR3A 1T7ZA 5D1QD 1S7QB 1KCVL 2VXVL 1JZ5A 1F11B 1KYOK 2W92A 3FL7A 5IWLA 5FKPA 4LSUL 3VRLF 2E6QA 5HY9A 4ESKA 3RIAK 5L2KD 4Y16B 3QQ4A 1YA5A 3QQ4B 4QRPE 4FG6D 1OHQA 2ZZUT 5AYUH 4JG1H 4JG0H 3RAJH 2VSCA 1FO0L 5FB8B 2BVOB 3Q3GB 5E2TH 1CK0L 1QLFA 4G7VL 5J12B 5AZ2H 3DGGB 3W39A 4MA1B 5HJ3A 3SDCD 3IFOB 2YD6A 2A6KA 5EZOL 4AIZB 1Z9MA 4PY8J 4HXAL 3VFUA 4NM8H 4Q6IC 1UC6A 4I18A 5DQ9A 1VFUA 1N6QL 4P2RE 4UIMB 3RU8H 4R90H 5GRVL 2WINB 4O2FA 3SCMB 5DUPH 3FO1A 1GGYA 2YUZA 4M03A 4ZDHB 1C7SA 3TH2T 5B3JE 1X6LA 5E2WL 3BD4A 2ESVD 3MODL 4XWOC 4C4KT 5D5MA 3MJ9A 1MFDH 4GRLD 3LRHA 2CKBH 4K3HA 5EO0A 1MHCB 4NKMA 1OSPL 5GZOC 4LPCA 2DBLH 2EIZB 1VFAB 2ITDA 5IJVA 5E8PB 4LGPB 4LRNL 5EWIH 3PWPD 3WKML 4YO0A 1WCBA 3C6SA 4YXKL 1IC5L 2FHBA 3LQMA 4MD0B 1JYNA 2VDQL 5DD1H 5FYJH 3OR6B 4HLZG 4W81A 3BSZH 1CDUA 1W0YT 1F58L 1JPFA 1IAIM 1P5UA 3P0YH 3ZKXC 4J2XA 2Y23A 3QFJE 2ZJSL 3CXDH 3GMNA 4XXCC 3GSWA 3B9KD 5EO9B 4CU7A 5KS9E 3WFBL 1JPST 4JDTL 1JMZA 3TJEH 2D31B 3O6KL 3WLBB 5CP3H 1I9IH 3GJEB 4ZAKA 1IC7H 4P23D 4HG4J 1GYAA 1A6UL 2AJSL 4FNLL 5SX5K 3GZKA 1QPPA 3TO4B 5IK3A 1NLDH 3LD8C 4MA3A 4N5EC 5EUKA 2FJFB 1RJLB 3RX7A 2H8PB