1ND0B

Cationic cyclization antibody 4c6 complex with transition state analog
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
b'RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG2A
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 222
sequence length 222
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0B01
3B5TA 5HXMA 1JZ2A 3TPUA 5IMMB 4G80B 5DHYA 4M5ZL 1PSKL 4GRLD 3EYOA 1T1WA 1RZ7H 5BVJA 4OBRA 1FYTA 5JW3L 2JCCF 5TE4L 1AXSB 2W65B 4YK4C 4OIBA 1TMCB 1GL4B 4Y4FA 3CDCA 5GRYA 2G2RA 1AD9B 5JXAH 5D2LA 3VD4A 3L3DB 3LD8B 5IK3A 2JB5L 3KXFD 4PJDB 2FSEA 5ENWA 2YPVL 5F7MC 5KSBB 4E9LA 1LK2A 4G8IA 1I4FA 1FORH 1CGTA 5E00B 3QHZH 1OLZA 1YEHH 4K71B 4K3DL 3H2WA 12E8L 4ZDHB 5ESQB 2XN9A 3FRUA 3W9DB 3QG6B 4RWHA 1MHCB 3BVNB 4UNVA 3GIZL 2QQKH 5CP7A 1FG2B 3EGSA 3HNVH 1I75A 2X2YA 3QBTB 3C2AL 1WFTA 2QSTA 3C08H 4GXVH 1EX0A 1PDKA 2BCKA 3MRQB 4XBGB 2XKNA 2YPLB 1NLBL 3K3QA 4OZGF 3NVQA 2Q8BH 4PLNC 3WJLC 4JEGB 1T21B 1AFVL 5JMOC 1CFNA 2VIRA 2WINB 5IHZB 4RDQG 1HXYA 1EVTC 4OCWL 5K59E 3RY6A 5T3XH 2W9LA 4IDJL 1OAQL 4NN7B 1WFUA 2P5EB 3PWPD 2D7QA 4D0BA 2VJXA 1JPGA 4J8RA 3BIKB 5F88A 4OLWL 4WWID 3BZ4A 3UAJC 4NNXA 3EDKA 3BKMH 5ISZE 4P23B 1SVCP 3P30L 2XQYK 5ACMA 1S7VB 1F4YL 3TH3T 3UO1L 3GDBA 1F97A 3O2VH 1SYSB 1UM5H 1MHPL 3GSVB 3NZHH 3AUVA 5D1ZD 1UB6B 3U30B 3O4LA 3ARBB 1J8HA 1FO0A 4JO3L 3RUGA 4NRZA 3P4MB 1JGDA 2E27L 1P7QB 2G5BB 1WFOA 4PJ7E 5FOBA 4LSVL 4J6RL 1JYVA 4N1CA 5MEOA 1QBAA 5EORL 3VRIB 4Z7UB 4X4YA 4RFEB 4Y19D 5J1AA 2CMRH 5K33A 2DQTL 4Q6IB 3TWCL 3C6SA 4C56A 4JCMA 3IXTB 4OD1L 4KUZH 3D2UB 1I9IL 1K9TA 3QDGD 5JHDB 3ARZA 4IRZH 2GUOA 3DV4A 1NPUA 2N56A 1G9MC 3LN9A 5C0EA 3ESUF 4GRLA 2IFGA 2V5TA 1FIGL 5D1ZC 1F8TH 1A1NA 5J4MA 3KYKL 5TDPA 3SY0B 3V95A 4HUVB 5GS2H 4FQ1H 3MJ9H 3QCUL 4Q58C 3WJLA 5F71A 2OCFD 3LAFA 1YEFH 1A7NH 3LDBC 3WBDA 4QRRE 3KXFA 2GCYB 4DFHA 5EU4A 3SPVB 1IEAB 1Q0YL 2WANA 2NY5H 4YHZH 3SJVE 5FEBA 5EIVA 4L9DA 5HHXH 1ETZB 1KLUB 3ULUE 3LKQA 5IKCA 4JFDD 3H9HB 3T65A 3CNKA 1UXWA 2BHZA 4QEGA 5CHNA 2Q8AH 1NH6A 5D1XB 5DEZA 3BEVA 3RJQB 5EOTB 4MD5A 1JWSA 3VFMB 1BREA 4JRYB 3QR2A 1A9BB 4XP5H 5L2KA 1TIUA 4WHCA 3S34H 4OTXH 5BRZD 2R9HC 2AI0L 3IF1B 1Z3GL 2IPTH 1L7IH 4L8SB 3CFEA 5AZ2L 3SKUD 3HAEH 4R7DA 3TVMD 3WO4C 1CICB 2BX5A 3C2SA 4UT7H 4L4VD 4M8QA 4ZNEA 5T5NG 4JFXA 5J13C 1HOCB 1T80A 1MCIA 5DVKA 1SMOA 2CRMA 2VZSA 3PWPA 2FX8L 4D3CH 2VR9A 3HR5B 2DLFH 2C9AA 2DQIH 3I02A 5HVFB 4GG8A 2VDMH 1IAII 1XGTB 5E8OB 1KGCE 4LCWD 4I3RL 1NCDL 4JVUA 3DX6A 3QI9D 3OAYH 3UTSE 3LN4A 2CDEB 5C08D 2DLTA 3V2AR 3VXOB 1P5VA 2KQNA 4EXKA 5D1ZA 1S5IL 2HP4A 3PGCB 2FATH 3GNML 3NA9L 1IM9D 1KT2B 4Z7VF 5HGAB 3TVMC 2I24N 4PJFF 4PJIB 2FCBA 2W0FB 2YD8A 3MYZA 4XGZB 4UOJA 5H37H 1Z0MA 1AR2A 4PV8B 1T7YA 1WLHA 3GJEB 1UZ6E 4Y19A 2VLKD 4OM1L 2BERA 3SKOB 1VFOA 5EIIA 4WI2A 1QO3B 5DRNB 4XVUD 1DEEB 4PJEA 1MIML 5E2VH 5H8DA 4Q0XH 1NMAL 1YNKL 5LVEA 4QHKJ 1ZHKB 3QDGA 4JKPL 3H7BB 3MV8E 4FRWA 2IGFL 2HVKB 3KPTA 1E27A 3RTQB 3V5HB 3QI9C 1W72B 4JRXB 4IMKA 4NQUA 3U4BH 2F8VA 2DQEH 1DBAH 1OTTD 4NQEE 1OCWL 1EUTA 1A4KA 2SEBA 3IDGA 1NGQL 2XXMB 1AQKL 4EN3B 3QG7H 3GB7A 2YUVA 1FN4A 2BSSA 3FCTA 4R4FL 2AJYL 3T8XB 1X5LA 2XICA 4Y4KD 3NAAL 1AR1D 4RSVA 4OGYH 6FABL 2C3VA 3HE6B 4YXHL 4S0SD 2ZZUT 3OX8B 1AQDB 2APXA 3C5SB 1KJVB 3IKKA 3TYGL 4U1KA 2IMNA 4QKXB 4XVUC 4CVZA 4JFDA 2ADJA 5C0FB 5D2NE 3LS4H 3UJTL 2FEEI 2R69L 1WUNT 3ULSA 1I3UA 4G7VL 4K2UL 5E6IB 3BAEH 2Z31B 1S9XA 1J1XH 5BO1L 2AJZB 3TT3L 3MODL 5CSGA 3D0LA 4Z0XB 1NBVH 4XPBL 4MJ5A 4F2MB 4Y7MA 1FQ9C 1HSAB 3CCHA 2R1YA 4OZHF 5CIPB 4RMVA 5BRZA 1RZ8B 1ZVYA 1FDLL 4JM2F 3UJIL 2UWEF 3CFIC 1A21A 2MJWA 3OKLA 3MLUL 4O5LL 4ONOA 1JHLH 1A6VH 5IFJB 3TVMA 3LV3B 5C86A 1NMCC 1CLYH 3QUMH 1OP5K 4PRDA 3NTCH 2VLJE 3F7PC 4L4VA 3VMNA 1AR1C 2E9BA 5GRUH 1OGTB 2FLBT 1QSEE 4LDLB 4QY8A 4ZOEA 1J1PL 3UTZA 5C0ND 4Y4HD 1EO7A 3H9SD 2Z8RA 1EJOH 3CFCH 4NUJB 1DQLH 2FD6H 5B21A 2EECA 4LF3B 1N0LA 4LCWA 4ZD3H 4ZUSB 5E8PB 2RGSA 3GKWL 3QI9A 1LDPL 1MHEB 3WUWB 3BPOB 1T66D 1W0VA 4PRHD 4PJGA 5C08A 3LZFL 3MJ8B 3RWDA 1D5ZB 5HYJB 5F72S 4MZ2A 4EUPG 2GJJA 4Z7WF 2J5LC 4BZ2H 4LFHG 5BMFL 1IM9A 5KJRL 4ODVH 3QIWB 5HD8D 4JGUA 3IFOA 3C09C 4U1GC 1EHLL 3STBA 3ZZ1A 5DI8B 3TBVB 4W6XB 5C0NC 4Y4HC 3MRMA 2ZKHH 1IC1A 2PTVA 2VLKA 3GJFH 1N6QL 5E2WH 1N0XL 1EXUB 4ORGA 2OXHA 4LSTH 3BOVA 1C08B 4EVNA 2FJFB 1FE8L 1KCVL 4X8JB 5GJTH 5ITFB 1D3CA 2X40A 3CDYA 1JIBA 3SQOH 3RDTB 3BW9B 1KNOA 3N50A 4L9LB 3MRDB 2ATPA 2EIZA 1T66C 2WLYA 4CMMA 3AXLB 4GKSA 5L8KB 1S5HA 2F54E 3P0YH 1R5IB 1F4HA 3JTSA 5TQ2H 1DVFB 5I1JL 3GHEH 1NFIB 5B38B 3DUHA 1A0QH 4FP8L 3DURB 5HD8C 1CD9B 3SDXF 4Y4KA 5JDJA 4G6JL 3C6LD 1KN2L 4HF5H 4XVTH 5T33H 1F58L 4DUWA 5I8EA 2QQNH 5D7LB 2NW2A 1K4DA 2R0KL 5A2FA 4LEXL 3V7MA 2ITCA 5DRZA 5GRZA 3GMNB 4KTEH 4Z8FL 5CZXD 3CFDA 1I7RA 4PJ5B 4PJAB 3IDNB 1MH5A 2F74B 1KJ2H 4X80H 4I18C 4MJ2A 2HYMA 1KJMB 5T1MB 1W72L 5IROC 3AROA 4I9WE 5C0JB 1H3PL 5GRVL 3O11B 5GRJH 4BSJA 4R3SB 5M7QA 2V7HB 4G8GB 3TF7C 1CFSB 1M7DA 3X12B 4ETQA 4GKNA 3CX2A 5KSVB 3VXNB 32C2A 1S8DB 2AXFB 4XPGL 5JUEH 3BESR 1AH1A 1VA9A 2CKNA 4GMTL 5IFHH 1FV1A 1WTGT 3X17A 5F9WB 3CSBA 1X5GA 5T3XD 4R8WL 4HWZA 5MP6L 3L3HB 5I18H 2ZPKL 5C07B 2B2XL 3QDHA 4LLUA 1ORSA 4EDXA 3C6LC 2WUCH 4PLJD 4X4MA 3ZT5A 2MFNA 4ZNCD 1NGPH 2Y1VA 4Z76B 5DD1L 2GITB 3HPLB 4Y4HA 1I9JH 3G6JE 3H9SA 5CZXC 1U2CA 4HJ0D 2GAZB 4ZO6A 4OIIL 2YN3A 3FRPG 1U3YA 3AM8A 1NDGB 3D9AL 3T2OA 3PWUB 4I0PB 4PRNA 2H2SD 3MA9H 1KTLA 4Q6IA 4OLXH 5DDHA 3VXUD 4M6ML 3N1PC 2P24B 5D2LF 2ZJSL 2J4WH 3QULB 3D2UA 1ZGLA 4PRHA 4LLWA 3CPLB 4WHDA 2Q20A 3ILPA 1JN6B 1GIGH 2LAAA 3MRGA 3FO9A 3VCLA 5KS9A 1YZZA 4Y5VB 5JPMA 3MLWL 5DRXA 4H8WH 4U2YA 5C0CD 3KHQA 4ZUUB 2VDKL 3WFEH 5CWSA 1T2JA 1KCSH 3F6IA 3SDDD 1I3GH 5GGUB 1OWRM 1YECH 4ONHB 1CE6B 1LE5B 5DJZA 1WIPA 4HJ0C 3MFGB 5F6HJ 4CMHC 35C8L 2FIRT 4X9HA 4I18A 2J6EH 1QKZH 1RURH 4AG4H 5HI4C 1HH9A 5IROA 2AJXL 1CGUA 2H2SC 1IQWL 3L5WA 3ZKQD 3ULVF 1JGVL 1JHTA 4PREB 4Z77A 3HB3D 5FCUH 4TUOB 2X4RA 1HHIB 2B4CH 4L29B 5D1XA 3VH8G 3GSWB 5GS2D 1PBYA 3HMWL 3VGGA 4NQTA 2H32H 4HDIA 1FSKB 2DKMA 2DICA 2GSIA 3IDJB 2HFGH 4K8RL 4BFGA 4ZO9A 1R3LB 3S35H 1A3LH 3FZUD 3KYNB 4KXZH 3ZDXE 5HDLA 1OW0A 3DX8B 3RL1B 1RUKL 3UP1A 3C6LA 3MX0A 2YUWA 1HE7A 3BP4B 2RAMA 5FYLE 4KU1A 2ICEA 2FLRT 3CVIH 2XQYG 4RIRB 5BJTB 4I77L 4S1SH 3GK8H 4LHUB 4MQ7B 4JZJC 5MEPA 2JJSA 4JHWL 4WEUD 3TA3D 1DBBH 3RUGF 3FT4A 4ODWA 3T77B 1BZQK 4LQFL 3WXWL 1KIRB 1IRAY 1YEIH 2HJLB 3NGBB 1WBZA 1J5OH 1WEJH 4ZFFB 3MGOB 3MFFB 1T1ZA 4H1LB 3CJJA 1I1FA 4YX2H 4JQIL 2LVEA 1U91B 1R3JA 3O45A 4O2FB 3VFGH 3KPNA 2HKHL 5FKPB 2HLFD 1PSKH 1HKLH 2EE6A 2NY5C 2Z35B 5DF0A 1F3RB 2EKSA 4NT6B 5ISZB 4X6CA 1I7ZA 3C9NB 3OQ3B 4F7PB 2X70A 4IIQC 5EA0L 1JWUA 3HLAB 3LEVL 3QHTC 5C0AB 4XHQA 5C0BE 3STZB 4BSVB 3SHSA 4IHOA 1LO3L 2YPVH 4JQVA 2DQHH 3TA3C 2V2XB 1FVDB 5AWNH 5ADOL 5LG1A 2ZSWB 2L7UA 3GSXB 3W0WD 3V4VL 3ZSTA 2KL6A 1DQJB 4HIIB 3VXUA 5BZDB 1JYXA 4K3DH 1YMMD 2EH7L 2NNAA 1TCMA 2R4SL 4PJXE 2Y5EA 3PIQB 5D71H 2EKJA 3NPSB 2FX7L 5D93C 5I75C 2EO9A 3CFJB 4XNZC 5KAQF 1IGML 3S3JA 1BFVL 2HLFC 3C2AH 4L3EB 4PYHA 2VLLA 5C0CA 5J12C 1A14H 4WCYL 4R4BB 4YPGA 5D7IB 3TIEB 3IDMA 4P2QD 5JW5B 1FFPB 1HHJB 1I1YB 1NLBH 4QRPB 3SDDA 4UV4L 4N9GB 2X1WL 4W68A 4WUUB 1NFKA 1IFHL 5D7SH 2CGRL 4PTUB 4HSQA 5AG9A 4JZJA 4PBXA 2DL9A 1HN1A 3MA7A 4TRPL 3D0VA 2BNQE 4CAGA 1IGYA 3FL7A 4RFNB 4LNVA 3G5XA 4D9QD 3S88L 4CN1A 5IEKA 4M6AA 3IVKA 1HNFA 2D31A 4AIZB 1Z9LA 3OB8A 1LWRA 4JN1L 2D7TL 4J12A 1KLGB 3MJ9A 1FVEA 1PKQE 3VGHA 2GFBB 5EC2B 5T3ZH 4XWGL 5IB2A 3DV6B 4X7EC 3UO1H 4PD4J 1MHPH 4ALAL 2XNAB 4BA8A 4DGIL 1MUJA 1S7WA 5KW9L 2BY2A 3GMQA 2GKIA 3OJMB 2P48B 2KPNA 2E27H 5H94B 4Z78B 3BDYL 1NC2B 4IIQA 2CLZB 3OKEA 3B9KB 3WFCH 1HINL 4LPXA 4F15B 4LSVH 4GRWB 4XC3L 2NY3D 4JZOB 2XPGA 5H2BB 2D03H 5DD3L 4X98B 5FXCH 2C3WA 4L3AA 4G43B 3W9EA 2DQTH 1ZK9A 2P7TA 1NKRA 4KKAD 1XGRB 2V9TA 4PFEA 2BY0A 5IVXB 2LU3A 3HAEA 4YHPB 4E5XA 3THML 2R56L 4LF3A 4PJBB 4IOIB 1NAML 5I17A 2WWMD 3PP4L 4X4ZA 1QYGL 2MPAH 1R3KA 5E0QA 4PJEF 3OG4B 1FIGH 1S7TB 1VESA 3OR7A 5TDOB 3KYKH 4JY4B 4ZSOE 3BD3A 3KPLB 1RI8A 1SJHB 1UQSB 4LCCB 3ZDZE 4OLEA 3VD5A 4LLMB 3BKCH 3WS3B 3QCUH 1FZKB 4XXDA 4ZPTB 1NC4D 3U0WL 3TJHC 3FO1B 3QEQB 5CEZE 1NDMB 1SJEB 4WI7A 5FV1L 4JFPB 1SJXA 2NY3C 2EXYD 2ZUXA 3BX7C 1U8IA 5E8NB 4F7EA 1LE9B 3G5ZB 3KPPB 2C4FT 4PP2B 5F93C 5CJXC 1GXEA 4KKAC 3MRPB 1C08A 5I30L 2AKRA 2XV6B 4CKVX 2HG5A 2FJFA 5FUCE 1YMMA 3QT2A 3CXDL 2ZWLT 4YIQA 1WJ3A 1S9VB 4QXUH 5FDWB 2GT9A 1XGUB 1CG9A 3B8YA 3RDTA 1Z2KA 3ARFB 5DGQA 2WWMC 3V6OC 5K9KB 4TPRH 4DJMA 3CC5A 1QRNB 1BQHG 3U79A 5E08L 2X4TB 5DK0B 1G0YR 5CKAA 3U0PB 4P2QA 1JWMA 1DVFA 3BP7A 2FGWL 4JPWH 4P9HL 1WZMA 4X7FC 5AZ2H 1IAKA 3E2HC 5L7XH 5E2TL 3P9MA 4U0RC 3EYVA 3AVEA 3VD7A 1MWAB 2JB6B 2AK1L 3UJJL 4PRIB 3RKDD 5A3ID 1A9EB 1P6AB 5D7LA 4NM8L 4OLZH 2V7NB 5JIHA 4ODUB 4F58L 4ZFGL 4LSRH 2YC1A 1ZT7B 1YPZA 3NA4A 1KBGL 2JJVA 1CDUA 1NCWH 4WFGD 1CL7L 3PL6B 2PW2B 3R1GL 2C4FU 1XGQA 5C0JA 1G7HA 2GTZA 5I71C 2DS4A 1NCDH 2EDEA 2V7HA 2X09A 3MRNA 1HHHB 2CJUL 4NJAL 4K7PY 2D7PA 2D9CA 1S8DA 4LLYA 2W92A 1NEZG 5JTWA 3F62A 3BJ91 2VDPH 5GZOD 3TIDB 3QFJB 5FO8A 3GNMH 3NA9H 2ARWA 1AGEB 4JPIB 3WFZA 1NFDB 2D4DA 3VMPA 3QQNA 1Q9KA 4PJGF 1M7XA 3RKDC 2VDNL 4WNQA 1BF8A 3WLBB 1NGWA 4OZFB 1SMAA 4AH2A 2J8UA 5I1DB 4OM1H 1DN0A 4M48L 5CJXA 5DR5L 1SY6H 1F2QA 1NMAH 1YNKH 2N7BA 4QHMB 3B5GA 1EHXA 2VERN 2H2PD 5FV2A 2VITA 5F7YC 3K81A 3QUMA 4X4XA 2HWZL 4YE4L 3X3FL 3BIAX 5ECJE 3V6OA 3Q3GB 4WW2B 3EHBD 3CMOL 1YC7A 1H8OA 5GZOC 2GYSA 1P53A 2UYLB 3UPRA 1VDGA 3ARPA 1CDJA 4LVHC 3ZTJG 3KLAB 1MCJA 2FB4H 1CT8B 2AJYH 4GW4A 1NC4A 4PRPE 4LKXB 4OUUB 3NPZB 5TH2A 6FABH 3HCVB 3BSZL 4UTBH 2DL2A 1RULL 3D18A 1QP1A 3WJJC 4JY6A 4YXHH 3QDAA 1KXQE 3F7RA 5ID1B 2CIKB 5DHXB 2UVEA 4HWUA 1ZGLP 4MX7B 3LCYA 2FH6A 5E94A 2X4OB 5IHUH 5ESVB 3QQ4B 4XMPL 5IQ7L 2AJ3B 3Q6GL 1GZPA 3WE6B 2H2PC 3OB0K 5D6DC 1SBSL 4ZUTB 1R5WB 3V8OA 4EI6B 4K2UH 1NBZA 2EYRA 4Z9KB 5BO1H 3TT3H 4UQ2A 5DJXB 4XPBH 4MA7L 3EZJB 1LO0L 4OD2B 5E70A 2C26A 2GJ6E 3EHBC 1ROWA 2Z93B 1FDLH 3GJFA 1TJGL 1XAUA 5JDSA 5BXFA 3MLUH 4O5LH 4QTIL 4LVOC 3PWJA 4FFVD 2PNDA 2PXYB 3VFVA 1JPFA 4A6YL 2EDOA 1Y18A 1V7NH 5I1LA 4PJ8C 3IETA 3ESVF 4J3WA 1NCUA 4NRYA 5FUOL 2R1XB 4RIRA 1VEPA 5JQHC 4NWUH 3TBYA 3CSYA 4JFEB 4PG9A 1QZ1A 3BP5B 3HZMA 3OJDB 5KOVC 4HPOH 2W9EH 4U31A 5FM5M 4WU7B 4JDTL 1B2WL 2CXKA 4LGSB 1G7PA 2HAZA 3T77A 5IB4B 5F97E 3BQUB 3GKWH 1LDPH 2OL3L 3FB5B 5JOEA 2P4AB 4FZEH 1FJ1A 1RUQH 3LZFH 3PHSA 3CVHB 3QUKB 2GK0B 1A7RH 5F3HA 1P69B 4G9FB 5F3BB 1ZTXL 1QSFD 5KJRH 2NY6D 1MWAL 1T22B 3TJEH 1KJ2A 1P1ZA 1YJDL 5E7BA 4CW1A 2XWJB 3FFCE 4NQSB 3O41A 4RGOH 1BVZA 4FFVC 4LARL 2YKLL 1MJJB 5T1DH 5EN2B 2NXYB 3WJJA 1NL0L 2ADFH 1YYLL 4OFYD 5KS9F 5HI3D 1N6QH 3MZTA 1MQKH 2LVCA 2B4CC 2G75B 1RUPL 4YBQD 3SN6N 1T5WB 1T20A 1FE8H 1KCVH 5IEHB 3BO8B 1GAFL 1QNZH 4ONGL 5D6DA 3FTGB 4L4TD 4PBVC 3BT2L 4OV5B 4HZLA 1DQJA 3G6JB 3O3EB 2WNGA 3IB4A 4L1HA 1D9KD 4U7SA 5CJ5A 3GMLB 2F5AL 2PYED 2OJEA 1X5IA 3OKKA 4FQXD 2G9HA 1MY7A 2XIDA 3U9UB 3E8UL 1AKJD 1IGIL 3MQIA 5I1JH 2IH3A 2NY6C 3B9AA 2VMFA 5GS1B 3WHE0 5FF6A 2XKSA 1JI1A 4MZ3A 4G6JH 3EZ8A 3B2UD 5EBLB 1F58H 1L4IA 3GMOA 5CZVH 1EEYA 4D0CB 2H6PB 2DF3A 1YQVH 1U3HD 5B4MD 3WL9A 3R06B 3HUJA 5HI3C 4Z8FH 3C8KB 4EEEA 2FZ3A 1S78D 1JGUH 1CR9L 1MPAL 1FZJB 4OF7A 5E56A 5C70A 1H3PH 4AT6A 5EO1A 3PNWB 2NLJB 2A6JB 2VRAA 1KULA 5HDBE 2YA0A 1DFBL 1U95B 1NSNL 2E9IA 1D9KC 4HIHA 4XPGH 3O3AB 2LTQB 4MB5A 3UYRL 4QYOB 2YA2A 2QHLA 4FQXC 4YFLF 3OHXA 1SM3L 3NCYP 3C60B 4PRBB 3HN3A 3N0PB 2GHWB 5MP6H 1O7VA 2BOCB 5MENB 2J6EA 3QQ9D 4MNHA 1JGLL 2Y5TB 1MFEH 4RGNE 3UBXB 2MSPA 3B2UC 1ITCA 5LWYL 1KTDB 4EQ3A 3MUZ1 5KAQG 3ALXA 2ZCLL 3GSRB 1C16A 3T0XA 2CH8A 5IGXL 2ID5A 3EKCA 1U3HC 3QCTH 5CZKA 5A2KH 5B4MC 5CGMA 2CLZA 3K8LA 5IBLD 1N59B 3L3JB 2JJTC 2NY1B 1S78C 1KELL 4OIIH 4AENB 1WQVT 1H0DA 2H32A 3ZHDA 3QO1B 2IBZY 5T3ZD 3D9AH 3DNKA 4NHCH 2IAND 4KVNL 4JVWA 4X6CF 3RFZC 4M6MH 4P2OB 3VXTA 1AE6H 3HNTL 3FQXB 4FN0A 2O5YH 1DJSA 1V3JA 2R15A 3DETD 3PP3H 4FQLL 1E4XH 4Y5XC 1GPOL 1QSFA 3K74B 3UTTB 5L88L 3MLWH 2APVA 3VE0A 1EH9A 3T04D 2Y7QA 4M3KB 2VDKH 4TSCL 4OAWA 2WAHA 3KS0J 4G9DB 3KPLA 4WO4D 3DYPA 5DD0L 4FXLA 1NUFA 4HLZG 3RVUD 4HUWA 2VXTL 4JFFB 4OFYA 4GG6B 5GSVA 5L0QB 4WWKD 5IBLC 1A1MA 2QKIB 2EYSB 4JFZL 4UDUA 35C8H 3U9PH 3QWOA 2CIIA 4M6OH 5C1MB 3T0ED 3AS2A 2HA1A 2PCPA 2CLVB 2AJXH 1CLCA 5SV3A 3RX8A 1BD2D 5JPNA 4QXGL 1ONQA 1IQWH 2ADGB 2ZOKB 4L4TA 4RWYL 2I9TB 1W8NA 3HZVA 3UYPA 2C1PA 5TQ0L 1TPXB 3CVHL 4XCYA 2AJVL 1D9KA 2NYYD 1MREL 1KPRB 3DETC 1KB5H 4P5KB 4KZEL 2H8PA 3HMWH 4CADA 7FABL 1X5KA 4JZNA 4FQXA 4GAFB 5EUKA 2MCPH 3K80A 5C6TL 1DE4B 4OFPA 1AKJA 1X5AA 2Z9TA 4K8RH 5HHME 5DJ2A 5EBMA 1H3XA 3WHXA 3C5ZD 2ADIA 3PWLB 1JHKH 3WNPA 2YEZB 2ZUYA 3OWEA 4ZXBB 3WD5L 1RUKH 3U1SL 3BZEB 2ZUWA 1IVLA 5ADPL 2DLGA 2K1MA 5IF0B 4WO4C 3VFTB 2RQ8A 5KZCB 3RVUC 2NR6D 5IOPA 2PKDA 4M93B 4KUCD 1U3HA 2HLAB 3FHQA 4EIZC 2HH0L 4CL7A 4WWKC 5D9SB 5D5MA 2JJTA 2KZ1B 1U8QB 3BKYL 1XGPB 4LVNC 4U6YB 2VO5A 1YEKH 3U46B 3T0EC 3LKSA 4P4KB 4CUCA 4XP1H 2K7QA 3Q6FA 4DZBB 4TULH 1U92B 1X7QA 2CD0A 2FX9H 1J0ZA 4LQFH 1MCBA 3N1QC 3WXWH 5KVGL 1KIPA 3OAYK 1U8MA 5E2UL 4XBPB 3LKPB 1IEBB 2NYYC 2PW2A 5DC9B 3OXRB 3QAZC 1DZBA 1X4ZA 5JOFB 2IFFH 4Y5XA 4FQJL 2BNQB 2AEPH 2Z4QA 1E0OB 1XCTA 3BH8A 4ZTOL 4MNGB 5ID0A 5CEXB 3EO1B 1F5WA 2HKHH 1HHHA 1B0RB 2R2BA 4CU8A 5FM5O 1IKNC 2OR9L 1LEGB 4OLYL 4CDHA 4HQQH 2V17L 2VABA 3RQ3A 1ADQH 2AV7A 2W0KA 2VDOL 1BLNB 1WV7T 2QADD 1T1XA 5EZIL 3I50L 3QWRD 3EYFA 4OZ4B 1UZ8A 1J87A 3LEVH 4N1HB 1KYOJ 4OKVA 1K3IA 1H15B 1EK3A 2VH5L 3MGTB 3ELAT 1DCLA 4LEOA 5DJAB 5ADOH 1KLFA 5HGBB 2IANA 1X9QA 1EHNA 3PQYE 3V4VH 5IJVA 1KCUH 3MJGX 5CD3A 4YHYB 5DJDB 2OR7A 1XZ0B 5IVZB 4Z7VE 2EH7H 3H8NA 4Y1AE 1HYSD 2X1PA 3MV7E 3SDAB 2D7NA 2FX7H 1ZMYA 1PG7L 2BVPA 3B9VA 1Y0LB 2YR3A 3CK0H 2A9NH 1IGMH 3A6CL 4X6BA 1DR9A 1J11A 4UIKL 1X4YA 4MA8L 2NY2B 4WCYH 5SWZD 3NBNA 5LBSL 3QXVA 1K5NA 5J11C 4G6ML 3O0RL 4UV4H 2QADC 3QJHB 2JIXD 2CGRH 2RHEA 1OTUD 4N90D 3RKPA 1P5UA 5FYKE 2YN5A 1UKTA 3IU3A 3U4EA 2DRUA 5FYLL 4CVUA 3T0EA 3BISA 2BVQB 2F5BL 5EPMA 3S88H 1PJ9A 1UM4L 4KRMB 3TGXA 4V1DB 1EV2E 1SVZA 1F6LL 3LN5B 4GAGL 3PV6B 1B4JH 5ANMB 3V7AE 5GIRA 5TE6L 4OF3A 3VXMB 1CDHA 5SWQB 4DN4L 3TV3H 1MAML 4XWGH 4LL9A 4KI5D 3F58L 1AHWA 3D25B 1YPZF 3PHOB 1IKNA 3C5ZA 5F7LB 4DGIH 2QL1A 5KSAB 5KW9H 2ENSA 4OCXL 1I3RB 3QNXB 1C5BL 4HULB 2I07B 4FTVE 3OKMA 4ZYKA 3BDYH 2CDFA 3VJ6B 1HINH 1OTUC 2A0LD 1UA6L 1BIIB 4XC3H 4LCUB 4J1UA 5C0GA 3O9WB 1TETL 4JO1L 2WWKT 3ZLQC 3O81A 4OZHE 1A2YB 1K8IB 3V6ZA 5F44A 3S96A 1I3VA 4NQCD 1OSZB 2UWEE 4GKZA 3BN9D 4F37K 1UJ3A 2ARJA 3VG9C 3GSQA 2VXSL 5EO9A 3IJHB 2H9GA 1H5BC 4XAWL 1BWMA 2PETA 2AQ2A 5CSZA 5DUPL 2WM0A 3QIBB 1RIUL 3BQUA 1NAMH 4KI5C 4X5XA 4LDOB 5MERB 5EUOB 4M5YH 3RWFA 5I74B 3QNZA 1FGNH 4GKOA 1S7QB 3MRBB 4WTWA 4TSBL 1MVFA 4UINH 3T0DA 1KFAH 4OCRH 3DX7A 4G6AC 1WICA 5DJ0A 3UTPE 3WN5A 5F3BA 1M05B 4GAJL 3QWRA 4HS3B 5MEQA 1ES0A 3GJFK 3MXWL 4M1DL 3U0WH 2HT3D 1AGDA 2W07A 1TVHA 2BHYA 3SDCB 1Y6NR 5HYEA 2AQ1A 2P8MA 1MFBH 5DQ9A 5DHVH 1D5MA 4KZDL 2C1OA 4U1MB 4ZQKB 4TQEH 4F33A 5LGKA 5INDA 2MMXA 4I5BA 4QOKE 1A6WL 4Q6YA 1XF4B 4KHXH 1LGVA 3IGAB 5I30H 4BH7A 2E7CA 1OQXA 3BN9C 2DQCH 2JF1A 3QEHB 1FL6A 3CXDH 2X4PB 5DT1L 1IGCL 2VL5A 3EO9L 4YEEA 4EOWL 3P4NA 2CUMA 1MCOL 3GSUB 5GS0H 2X4QA 2KZWA 2Y25A 5TGBA 4F37F 4J7RA 2HTKD 3K4DA 5DK3A 2DYPB 4XX1E 4ZUWA 2DKSA 4N5UA 2EZ0D 2J1KA 4GAYB 2H3NA 3INUH 1G7MA 4LLQA 4YFEA 1G1YA 5SWZA 4PGDB 4DKFL 4X6DE 1T89C 1WF5A 1OP9A 1UACL 1GGUA 1S7SB 1F4AA 3IDYC 4J3OC 3GHBL 1QBML 1SY6A 3BGFC 3MBEB 5E2TH 1ZSDB 1XF5B 2JIXA 3BPNB 3EOBB 3PABB 1G9EA 1BBJA 1FFOB 1QLFB 2AK1H 4KXZI 3UJJH 1A6TB 4MHHI 5LXGL 2CDGB 1X5ZA 4O4YL 3DPBA 2BDNL 3D39B 4ZFGH 1QQDB 3GUTA 4NQVB 4XCEB 3X3GH 4KMTH 4NO2B 5L2JA 4TTDD 1D5XB 1KBGH 4CU7A 1UB5B 3DSFL 3K0WA 3ZKNC 3T0VA 3R1GH 5IT2L 3FN0L 1JZ8A 2ED9A 2L0DA 5DTFB 3SDXE 5HJ3A 4F3FA 1H5BA 4ZS6D 4JR9H 4XP6H 2A6JA 3HZYA 2HTKC 2CJUH 3HZKB 1NGXB 4AJ0A 1K2DB 2EH8L 2EZ0C 3F8UB 2E6QA 1B4RA 3U82B 2NW3B 1I1RA 2BC4A 4CDGC 3HS0B 3B2VL 4LLVA 1JRHL 5DJYA 4UDTB 4RMUA 2CK0H 2DQGL 3AGVA 4G8EA 3DROA 4XRCB 2VLRE 4DOHE 5I73B 2MQ3A 5C92A 5F21B 4ELMB 3RWJA 2AK4D 4R0LB 2EE2A 4QHKI 1JK8A 5C09B 5DSCA 4YHIB 3UC0H 2DWDA 3S9DB 2IH1A 1MJ8H 4EDWL 5I15H 1PW3A 1JUFB 5CEZL 1QEWB 4EI5D 5DR5H 4NQCA 4TTDC 2NX5B 1E6OL 1T0MB 1DQQB 3EOYG 4P4RA 4HKXB 1ZLVH 3KS0H 3DI3B 1T4KA 3E6HA 5I1AA 5HVHC 4EUPB 2F53D 2I5YL 2YWYA 2DD8H 5SWSE 3MXVH 2B5IB 1LP9B 3ULUH 4FZ8H 5D70L 2LABA 1HZHL 3X3FH 4OCMC 1F6AA 1CFBA 1R3HB 3SCMD 3JWDL 3S37H 5IB3A 3D3VD 5EZLA 4MNQB 4XPAH 1IM3B 3NFNA 3Q2CA 2Q76A 4FQ2L 1T89A 3OTTA 1BAFL 4PPTA 4NN6B 2EO1A 3WKNA 1FHGA 4ZMAT 3V4PL 3P77B 5F1IB 3V5DB 1PLGL 5LAXB 2OM5A 5JO5B 5JA8B 4OF8A 1WSST 5D2LE 5HHOD 5D7JB 1IZJA 5IHBA 3FQRA 4PYGA 3KNBA 2A6IA 2IPKA 3P4LA 1VFBA 4YC2B 3IAGC 1AI1H 4EI5C 4PR5A 1NCTA 1D7FA 2QKIA 4PJHA 4XMPH 5IQ7H 3Q6GH 4TUJB 2X89D 6CGTA 3ZE1F 3NCBB 1S3KL 5HYIA 2ESVE 1SBSH 1F3JB 3GM8A 3S3PA 1QVOA 4LP4A 2EEAA 4HJGA 4CNIA 2J8HA 3HG1E 3HUJF 4U6VL 3HRZA 3VXQB 4MA7H 1NGZA 4LLAA 4U3CA 1EBPA 1LO0H 3VFWB 4DEPB 2VLME 3RRQA 3W2DL 1TJGH 2E9JA 1NBYB 4K7PL 3KYOA 1VKXB 2NY4B 4QTIH 2JCCB 1VFAA 2EDQA 1EUUA 3P0VL 4ZXBA 5M95B 2CKBH 3SGKA 4A6YH 2VXVL 5E2JA 1A1OB 1PG7X 3GMRA 4WENB 5HHQA 2XY2A 5BZWA 4NSKB 2K7PA 2FR4B 1NKOA 3STLA 1U8QA 1RK1A 1XGPA 2IADB 3CFKB 2X4UB 1OT2A 4U1HB 1WCQA 3MRHB 3V52L 4GJTB 4K8RD 4OCSL 3RWCA 1B2WH 4P4KA 3QUYD 3ALWA 2MWCA 4MJIE 3WFBL 2OL3H 5E9DB 3VFNA 1ZKAA 5CBEA 5JOPD 3FKUS 1WAAA 1KENL 1W0WB 3VG0L 1QA9A 2AAVA 4QWWD 4OZIE 1GH7A 3TNMB 4KMLB 4MJ6B 5A2LH 1CF8L 4NBXB 3MLVL 4XCCL 1I8KA 3VXSE 4GH7B 3L95A 1YJDH 3AB0C 5DMIH 4OI7A 1HXMB 4OZGB 1LEIA 3MROB 2XTJE 3C8HA 1HHGA 2AK4A 4KV5F 3J7HA 4LARH 1H8NA 4JFQA 3BPOC 3FB8A 3FQNB 3VXRB 1JF6A 1HSBB 4OM0L 1FL5A 1KN4L 4APQD 1GGBL 2YK1L 4NQDE 4FXGB 4BH8B 2YWZA 4P2YA 4ZAKB 5DMKB 2E6PA 3QDME 1FL3B 3K4ZA 4EI5A 4OI9A 3V6FB 2HFFA 4RGNB 3QIWC 2YRZA 5DMGC 4XTRD 1GAFH 2R29H 4K8RC 1TENA 1TZHA 2F53A 2X6MA 1QFWM 3QUYC 2PW1B 1EEZA 4TTGA 2LV4A 1Q9OB 1UVQB 4GBXD 5I6XB 4WDIB 3SCMA 1P9MC 3RWHA 3D3VA 5GGVL 5J9PA 5HY9A 3DXAD 3L3OA 1IGIH 2FJGA 3C5JB 2I9LA 4KROD 3BH9B 3E3QE 5E4EB 3B3IA 3LY6A 4WVRA 5LCVL 3SE4A 5INCA 3PV7A 3PGFH 5HHOA 1DTUA 4XNXL 4LGRB 4APQC 5HHPA 2KKQA 3DYOA 3QJHA 3KPQA 4K23H 3WIFB 1UWXH 2IQAA 3GSOA 1B0GB 4JFYA 2V9RA 2N1KA 3VH8B 3HAEG 4HUKB 1AD0A 3SKMA 4BZYA 1EJ6A 2R0ZH 2DBLL 4XTRC 2X89A 4S1QL 3CLEL 2BY3A 4Q9QL 5FGSA 1RJZB 4GBXC 4HWBL 1Z5LA 5C0IA 3X13B 1DFBH 1NSNH 2V9QA 5DJ6B 4NCDA 5D5MF 3ZDYF 3QZWA 5L2KE 1XCQA 4TOYH 3DIFA 2WBJB 3KAAA 1Z9SA 3M8OL 3ARED 4KROC 2DN7A 5I76A 1RZGB 3WMSA 1OVZA 2R2HA 3MV9E 3G04A 2EE3A 4P2RD 5FO7B 3OKOA 1F45A 2HRPL 5EOCL 5LWYH 3CLFL 3RIFK 2DM2A 4OB5L 1QLEL 5HHVL 5DS8A 4ZNEE 4YNYB 2HVJB 4XAKD 4M7ZC 1MHHB 1C1EL 3V5KA 3KYMA 4GUPB 4O9HL 5CD5D 1HILA 1KB5A 1KELH 3Q1SL 4QRUB 5FA4A 2M1KA 3I6LD 5TPWH 4X7SL 5DD6B 3VGBA 4U1JA 2OSLA 3EDFA 4I2XB 3QUYA 1K8IA 4LLDB 2CXGA 5H37G 2NQCA 4YDJB 4RRPA 3RAJL 2IBBA 4FQCL 2A6DA 1FZOA 3HNTH 4XMKH 5DWUL 5E03A 2DI8A 1JZ5A 4LCIL 3ZYZA 1P9MA 4FFZH 3MNZB 4P99A 1NCNA 5E5UB 4NZTL 1GPOH 4U1IB 5FB8B 3VFOB 3BYTA 1YMHB 4OFVA 5FM8A 3TN0B 4HS8L 5L88H 1XF3B 1R0AL 1BZ9A 1CXIA 5EUOA 5F6HI 5I1EL 3W39A 4FQQB 1UT9A 2VXQL 1K8DA 4TSCH 3IKCA 4HWEH 2AABL 4JGJA 5DUBB 1A47A 2ZUQB 5DD0H 1CN4A 5HHNB 4LSPH 4APQA 2R2EA 5EFIB 4HIEB 3RVVD 4ODXB 5HYSB 1CCZA 5CD5C 3MRCA 3RIFF 4IRSB 3RI5K 1MJUH 5F6IB 1MCHA 4Y19E 4AEIL 5KVEH 1CFTB 1VGKB 3E1F1 2Z8SA 2YBRB 4WW2F 1V3LA 1U8JB 4P46B 1RZIA 1PKOA 2AXGB 2DJUA 2J8OA 1UH4A 2V2TB 3TNNB 4QXGH 4RWYH 4X99B 3QH3A 2CLRA 4GBXA 3NIDF 3G6AB 1ADQA 4NDMB 1SYVB 4M7KL 5B8CB 4KZEH 7FABH 4PGCB 2IPUK 1H3WM 3QRGL 5C6TH 1YUHA 3P2TA 4YHKL 3DXAA 3PQYB 1OAKH 1QFUL 3ARWA 4Y2DD 3OR6B 2KBGA 1IC5L 1FFNB 1VERA 2BVYA 2ZOLA 4HS6B 1T83C 3K2UL 5CMAA 3DI2B 3FN3A 3WD5H 3U1SH 4PJFB 3TBTB 1RY7B 4TNVK 5JW4Q 3HC3H 5FIEA 2NTFB 4MDJA 1OAUH 3KJ4B 4CN6A 2EYTB 4MAYB 2HH0H 4U1NA 3RVVC 1WBXA 5CLWA 4X0KA 3EO0B 4S0TD 3MNVA 1OP3H 2A9ML 4PG2A 1OF2A 4HIJA 2UZYB 1K6QH 3RI5F 2LU7A 5EB9A 3VI4F 2IG2L 5KVGH 5GGTL 2ZCHL 4KUCF 5E2UH 3PXJA 1YNLL 1UB5A 3T1FB 3KHOA 1AC0A 4HJJH 4ZTOH 3UTQA 1MELA 3AREA 1WISA 4U1SA 3NN8B 2OR9H 1FNEB 1BIHA 4P2RA 5J8OA 4WEBL 1XIWB 4G7YL 2VDOH 2FWOA 3NIFF 4JO2H 5EZIH 4IOFD 3I50H 3G08B 3PWVB 1H9VA 1TJIL 3H0TA 4C83B 4RNRB 1EDQA 5EZJA 4TNVF 3O6ML 1J05A 3L3KB 4YDKL 5I9QC 3OXSB 3MYJA 3TZVD 4M7LL 1XF2B 4K7PX 1A6ZB 4L3CA 5IB5A 4P5MA 3WV0A 4GSDH 3ARXA 3EOTL 3I6GB 4KAQL 4E41E 3W11C 4P57A 3FT2B 2VB5A 4DN3L 3WXVL 4RMRA 3TP4A 4P9HC 5C0RL 3E6FA 1LO2L 2KQMA 4NZRH 4X7DC 1DDHB 3LVEA 2C3GA 3M45A 4PJGE 3F12A 2HN7B 5I19L 3LQZB 5E5MA 1U8PB 4JM2B 3K2MC 5F70A 2AGJH 4UIKH 1KC5H 5JXED 1T83A 2CRZA 4MA8H 1LMKA 4GQ9H 1MF2L 4JKMA 5CBAB 3F7VA 2Y6SD 4QRRD 4MAUL 2AEWA 2Y23A 3K8MA 4IOFC 4XCFH 1N5AB 3DUUB 2DMKA 3SJVD 3LSOB 1QPPA 5B3NA 3U0TA 2HMID 4XNMA 5JO5A 3ULUD 3QDJB 1NAMA 2JK5A 4I0KA 3TZVC 1BP3B 4PJDE 3EYSL 3GRWL 4LU5L 2F5BH 3M17A 1UM4H 3RVWD 5KSBE 4UT6L 5IMKA 4MXQD 2ERJB 3QXUA 2CO7B 5ALBL 3GO1L 1LEKB 4WW1B 4NRXA 5TE6H 3LEYL 4DN4H 1NCAL 4XZUB 3F58H 1N3NA 4PTTA 1Z6JT 2QR0A 4Y2DA 1DSFL 1JF1A 4G6KL 4WFHE 5D6CA 4Z7WB 5DHVA 2ENYA 5JXEC 4ZFZA 3M07A 2N4IA 3RVTD 4OCXH 2Y6SC 1K85A 3QEUA 1QOKA 4KPHL 4OUOA 2YPLE 4WU5A 4X7TB 5TF0A 1V7ML 1BJMA 4JFHE 4ONFH 5IESL 4KK9D 4OLUH 1QFWL 4UB0L 1VACB 4KVCH 43C9A 3ULUC 4OCYH 4LSUL 4QTHA 3GSNH 4QHNA 4HLJA 3VFRA 4MS8D 3BGMB 1E6JH 2BVTA 2Y07L 4OQTL 1QLRB 1Q9WB 4P59L 3RVWC 2OMNA 2P5EE 1MFAH 3L5HA 3P4OA 3MR9B 1NEZB 4MD4B 4U1HA 3UTSD 5CILL 3B9KC 1P4BL 1PYWB 4ELKA 2VXSH 5EOCJ 2EIEA 4F15C 1OY3B 4Z5RA 4XAWH 1FCCA 4GO6B 1A6AA 3GBNL 2I25N 3N06B 2AW2A 3H7LA 3DO7B 3UX9B 3QP3A 1RJLA 4QRTA 1DLHA 3MRKB 3BWUC 5EC1A 1ZA6B 4ZFOB 1ZWIA 4PJ7A 3Q5YA 3BP6B 4TSBH 5J7CC 3O6LL 4E0RB 1E4XI 2Z91B 4Z7QE 4YHOL 3RPIB 3RVTC 5B39A 5GZND 4U1LA 4YX2L 2PYFB 4GAJH 1J0HA 1MLCB 5E8DL 3MXWH 4M1DH 2FL5A 3O8XB 1BM3H 1CLZL 3L9RA 3FRPA 4KK9C 1RZFL 3P40A 1ZHNA 4LSSH 3FQNA 1A4JB 3TZVA 4MS8C 5I2IA 4JAMB 2OXGA 3MV8D 4DOHB 5FYKL 4Z7UE 1T1YB 3D69A 1FNLA 1HQRB 1KCRH 3D87B 5JZ7D 2BXYA 3QXDA 4D8PB 1A7OL 1IGCH 3EO9H 4OCLC 3ZT7A 4EOWH 2C4XA 3UTOA 4YFDB 5EO0B 1ZOXA 1MCOH 4NQED 3Q5TA 5JHDE 3HI6H 4N0UB 4GG6F 2NCMA 3WIIL 5CAYB 2BNRD 5JXEA 1UH2A 1AO7D 1GZQA 3MOQA 2UV3A 4PJHF 5CJQL 3QO0A 2X9XA 3BRFA 5BQ7A 1UACH 4UOW1 3VW3L 4QRRA 5GZNC 4P3DA 3I3DA 1UYWH 3MJ7B 1QBMH 3C5JA 4JCLA 4DVBB 1EO8H 5DJZB 4PD4K 3SJVA 3TPUB 3IDIA 4L5FL 3ARFC 1R3IL 4HMCA 4CBPA 5DHYB 4E42A 4MHHG 4O4YH 3TO2A 3EYOB 3L3IA 2BDNH 1T1WB 3EYUL 4HZAA 5BVJB 5GSRA 1FYTB 5HPOA 3RNKA 5JZ7C 1G7JA 4I3SH 4Y4FB 3RWEB 2G2RB 5IT2H 3FN0H 3HC4L 5D2LB 1YJDC 5IK3B 1AXTH 1F11A 2FSEB 4YDVA 3SKNA 5ENWB 3T0WA 3X13A 2EH8H 3MRIA 3CZFA 4LSDA 4JRYE 5FGCE 4DGVL 5A2JH 2IQ9H 4POZD 1R24A 1LK2B 1ND0A 2DLIA 4G8IB 4OT1H 4QRQA 1JRHH 1S7UA 1I4FB 5ICZA 3O6FD 2VLJD 5F9JA 1QSED 2V5RA 3ARGB 2XN9B 2WQRA 3FRUB 1WAAF 4KWUA 4HFWA 5CP7B 4YHLL 4RGMB 3EGSB 2HT4D 3SGJA 1OM3H 4EDWH 3D6GA 4R2GD 5D2NC 2A73A 4F7CA 5CEZH 2BCKB 3G5YA 1JNLL 1GGCH 1CDBA 2XKNB 1RJYA 5J6HA 4ZO7A 2H1PL 4G6FD 3UTSA 3PP3K 2I5YH 1CFNB 4PUBL 3F7YA 1HXYB 3GIVA 2YZ8A 3U2SA 4G42A 4QCIA 4X9GA 3RNQA 1D5IH 1E4WL 2CKBA 4A6YA 4D0BB 3MMEA 4POZC 1JPGB 4J8RB 4IMLB 5F88B 2A74A 3BZ4B 1BAFH 3JTTA 5IBUG 3MRLA 4NNXB 2OMBA 4WFED 3SKJL 3V4PH 3QA3A 4X6CE 1PLGH 2NTSP 3RWGA 4PGBA 1IAIL 4IS6A 3K7UA 2HT4C 5I0ZA 2OL3A 5HHNA 3DRQA 3SBWA 4R2GC 1FBIL 3O4LB 4H0IA 1J8HB 4HAFA 1FO0B 3MV8A 5FO9A 4NRZB 3RUGB 1JGDB 4O02L 1HH6A 2XTJB 3LRGA 2OR8A 4YK4B 2ICWJ 5FOBB 1YC8A 1S3KH 5EH1A 2AXGA 4B50A 3HPJA 1XGYL 4NQEA 5KANI 2F54D 1G6RH 4U6VH 4JPVL 3ZT6A 5MEOB 2CUIA 4OFDA 4X4YB 5J1AB 4JRXE 1MCFA 2BNRA 3L1OL 1AO7A 5SV4A 4BSWA 1C5DA 4C56B 3W2DH 1TVBA 3UPCA 2R8SH 3S4SG 1KEGL 3KLDA 1CE1L 3EFFA 1AIFA 1BQSA 1M6OA 2GUOB 4DGYL 1MCPL 3DV4B 1XR9A 2Q7NA 4ZTPL 1V05A 5C0EB 1G9NL 4GRLB 2Z0BA 3EIFA 3EOAA 5D2NA 1TLKA 3H3PL 1WVZA 1CGSL 5TDPB 3VU2A 4Q74A 1Q0XL 5BVPL 1WWCA 1XR8A 3ALPA 1EGJL 3V52H 5IR1A 1NAKH 2RFXA 1JE6A 3DGGA 2PO6D 1YQ2A 4NBZB 2YD5A 3KXFB 4NKDA 5B3JE 5EU4B 1CDIA 3VFPA 3DUSA 1KENH 1JV5A 4OQ1A 4KGLA 4ISVA 4W4OC 4HXAH 3DJ9A 1ITBB 4X83A 5IBTL 2FH8A 2Q3ZA 3C8DA 3LKQB 5IKCB 1JPST 3O6FA 3T65B 3MLVH 2VLJA 1UXWB 5CHNB 5IFAL 1QSEA 1YYML 3VGDA 3BEVB 4UIMA 1FNEA 1JWSB 1DBMH 4NZUL 1DEDA 5IJKC 1YN6B 1XT5A 1UM6H 1T7VA 4OM0H 1QR1A 1GGBH 4L8CA 3IT8D 4ZOBA 5EUOF 5I1IH 3SE3C 3CFEB 4R7DB 3DVNB 2E8YA 2ZNXA 4M8QB 5AG8A 4M1GL 2NY0D 1FNGA 3JUYA 4JFXB 4PGJA 1NGYA 2DWEA 4HV8A 5DUMH 5CCKH 2FYYA 5F9OL 5DJCA 3FHAA 2BSRA 3PWPB 4Z0BH 5GGVH 2GI7A 1N5YL 1LNUA 4NHUA 4YHNA 4YR6A 4MDIA 2CSPA 3RGVD 5HYJE 2BSTA 3I02B 4GG8B 3O6KL 4GW1A 1BOYA 4XI5D 4XMLL 5LCVH 3DX6B 4PJ9D 1MCRA 3RHWK 5J1SC 1T6WA 3LN4B 1FGVL 2X4NA 3VWKD 3WDJA 2IPUG 2EDTA 2BFVL 5D1ZB 3DUUA 3ULVL 1IGTB 2DDQL 3DHMA 1TNMA 4Q9RH 4NO5A 2DBLH 2EDXA 5TF1H 4Q9QH 3CLEH 5ITBH 3LDBB 2Z92A 2VOTA 4N0YH 3LEXA 5GJSL 2NY0C 4JANA 3CSGA 3MREA 4P9MH 5HPMB 4XPTH 2F54A 2R1WA 1VPOL 1MI5D 4TVPH 4DCQA 4FS0A 4W4OA 4Y19B 1BQHA 3B43A 5EIIB 2W0PA 4HCRL 4BELD 4EZMA 3OJ2C 3RGVC 3VA2C 4PJEB 5JORA 2OTPA 4ERSH 3M8OH 4XH2A 3PXHA 1YEEL 3QDGB 1VB9A 1DL7H 1E27B 4PJ9C 2HRPH 5EOCH 1E28A 3V0WL 1CGWA 5IJKA 2E7BA 4OB5H 5HHVH 1OB1A 4XP4L 1E4KC 1MCNA 2VZOA 1N6VA 5F1NA 3ZYIA 1VHPA 3VWKC 1MSPA 1C1EH 2P5WD 3P11H 1A4KB 3MUGA 5D7LE 3RHWF 1B0WA 2SEBB 3IDGB 4FHBD 3Q1SH 3GB7B 1FN4B 1WBYA 4JDZA 1JJUA 2BSSB 5D4QA 3SE3A 4RZCB 3FCTB 1HWGB 4PJAE 3GGWA 3REWA 3CUPA 4HG4J 2PO6A 2FNBA 4C4KT 1MVUA 4QF1A 2C3VB 3RAJH 5J13B 5KN5A 3CDGB 4LCIH 4MD4A 4BZ1L 4TNWK 1UWGH 3OV6A 4G8GE 2VDQL 1BFTA 4U1KB 5F7DB 4Q2ZA 5GGRA 4JFDB 5MI0C 2ADJB 3A0OA 4A2MA 4HS8H 1R0AH 2BRRL 3ZE0E 4U49A 2VXQH 3ULSB 1TQCC 4NZJA 4P2OC 1MFNA 1LO5A 1S9XB 1RU9L 2AABH 5FYJE 3D0LB 1U58A 5C0BD 5C07E 4MJ5B 4EQ2A 5FUZL 3CCHB 1RMFL 2R1YB 3O2WL 3NCJH 5BRZB 1ZLSL 4ZO8A 1IAOA 3TYFA 1T03L 4AEIH 3PJSA 3OKLB 3WIHH 4JFOA 2HFEB 2FDBP 5AD0A 3TVMB 3G5VA 1ZA3A 2O5XL 4PRDB 4L4VB 1BBDL 3GM0A 5C0DA 3L6FA 2GQHA 3C87A 4QY8B 1AP2A 1D6VH 1MNUL 2Y06L 3ZKXC 4C58B 1KV3A 4M7KH 2I60L 4O51A 1I7TA 5EO0A 3IFNH 3RGVA 2RB8A 1IL1A 4H5SA 4HH8A 1QFUH 3QQ3A 4TNWF 1IC5H 3K2UH 2QHRL 4LCWB 5L6YL 3QI9B 1TPXC 3QCVL 4ACPA 3IFLL 3S5LA 1W0VB 3H3KA 1E4KA 4PJGB 5C08B 1I9RL 3RWDB 3VWKA 5F7EH 3SE8L 1NJ9A 1GHFL 2A9MH 3BPLC 1IM9B 1CXEA 4NCC1 5TJWK 1BQUA 5DEGA 3TH4T 1I7UA 1KUMA 3IFOB 4LDEB 3HC0A 4POUB 3QSKB 2IG2H 3T3PF 4D9LH 5GGTH 2ZCHH 2Y72A 1EZVY 4M93C 3DWTA 3MRMB 1MI5A 3RWEA 5F96L 2VLKB 4ORGB 2B8OT 2RBLA 4B41A 4LNRA 4EVNB 3I9GL 5IW1A 3MLYL 3NMEA 3TESA 5ERWA 2PTTA 5CUSL 5T1LD 1OARL 4F7TA 4NN5C 4WEBH 2QSQA 1XH3A 2HJKA 1KNOB 3UAJD 2ATPB 2EIZB 1FC1A 4NP4L 4CMMB 2P5WA 3ARGA 1EMTH 3MO1A 4GKSB 1INEH 1U8NA 1FNFA 3T0BA 1S5HB 1ED3A 5DRWA 3JTSB 4M7LT 2CPCA 1ZLVK 3V4UL 5DYOA 5FM4A 3MGAA 3CZJA 4Y4KB 5CJOH 3EOTH 4KAQH 3SDYH 5I8EB 1CDYA 2VN4A 2NW2B 1K4DB 3SO3C 4DN3H 3WXVH 1CVRA 1I9EA 4OGXL 2ITCB 5DRZB 1LO2H 1B90A 2OX5A 3CFDB 1I7RB 5ETUA 3LRSA 1MH5B 5CEYA 4Y8DC 3FONA 3O3BA 3DO3A 2BP3A 1U8OA 1RIVL 4MLSA 4YZFF 3OL2A 4LBEA 4K3JL 3AU1A 4HKBA 1L7TL 1OT1A 3GSNA 3WNKA 4IMLA 5ACLA 1M7DB 5CEZD 4ETQB 5IV2A 4GKNB 4HK0A 4MAUH 5C0BA 32C2B 3X14A 1DLFL 1OOAA 5J1TC 5F1KC 1FV1B 5C7XL 3LB6C 1P7KA 5KTEH 5BW7C 1V8HA 3EDJA 4K3EL 4HWZB 3LMJL 2B1AL 5C0AE 4YBHA 4LLUB 1ORSB 3C09B 4PJXA 4U1GB 4EDXB 4KK5D 2GTWA 4UT6H 2C3HA 4NYLA 1Q94A 2EIDA 4WV1C 4ODHH 2ZG1A 4Y4HB 5LGHL 3GO1H 1ZS8A 3H9SB 1YY8A 1VADA 3IFPA 3LEYH 4MQSB 1H3UA 5DJ8A 3BWAA 3ULUF 1LVEA 3DTXA 4LAQH 2KUTA 3PF2A 1DSFH 4PRNB 1BJ1J 3LOWA 3B6SA 1DBKL 1KTLB 2P8PA 3KJ6L 5DDHB 2E9WA 3I75A 3RL2A 2YXFA 5FHBH 5AYUL 4L3EE 4NKMA 3P73A 1ZGLB 4PRHB 4LLWB 3LKNA 4JM4L 3ZE1E 1NEUA 3MRJA 5D7IE 4KPHH 4RAUA 4FNLL 1YNTA 3ILPB 4QRPE 3MRGB 4YWGH 4OSUH 4WUUE 3FO9B 3VCLB 1QFWH 4UB0H 3HUJE 5KS9B 5JPMB 4LSUH 4M61A 5DRXB 4LIQE 3I3BA 5CGTA 5FUCC 3WKML 1L6XA 2R9HD 1U0QA 4CGTA 5CWSB 4PB9H 4KK5C 1I8IA 3ZTNH 1PKQA 1KYOK 4S11A 4DZ8A 3U7WL 1PZ5A 1P4BH 4JLRA 1Q9LA 4C54A 2FO4A 3GBNH 3NCEB 4NQXA 4I18B 2EDFA 5EU7E 1HH9B 3JUZA 5T1LA 4DTGL 2X5PA 3L5WB 1JHTB 3O6LH 3KLSA 4K94H 4Z77B 3HFMH 4M7JH 3QPQD 2X4RB 4HXBH 4H25A 2DQDL 2QLVB 1D6EA 1ACZA 3NFPA 4AMKL 4HDIB 3L7EA 3QJFA 3H42L 1RZKL 3TLRA 2AXHA 4PRAA 1H3GA 5FGCB 2GSIB 1RUAH 5FFLA 1YN6A 5BW7A 3VRJA 3MOBL 2O5ZL 3BKJL 4GMSL 4HUXA 1A64A 4GRWE 3T0AA 4OGZA 3C6LB 3QZWG 5D96C 4BK4A 2AJUH 1F4XH 1BQLL 2ICEB 3DX9A 3MRFA 4KQ3L 3IAPA 3CIQA 3DVNA 1EAJA 3UROR 5MEPB 2DIAA 1JNNL 2ICCA 3FMGH 5IVXE 2GEEA 4ZSOA 1MCQA 3OBAA 4PJBE 3WIIH 3FT4B 4BFBD 1HEZA 5CJQH 4ODWB 1QSFE 4OF5A 1I8MA 4HHAA 3O2DL 2ORBL 1Q72H 4PRPD 1YY9D 3FO0H 1WBZB 1X5HA 3VW3H 3QPQC 5ALCL 2FBJL 3FQWA 1T1ZB 1I1FB 4DKEL 5IIEA 4DKDC 3TCLA 3BD4A 1UWXK 4JO4L 4L5FH 1R3JB 3O45B 1F42A 4H26A 2XT1B 3KPNB 5FHAL 4HIXH 3QEQE 4NGHH 4RRPG 4NM4L 3EYUH 1P4LA 2EKSB 4K3GA 1IGTA 3X11B 1JMZA 4X6CB 1A7PL 1I7ZB 2XACC 4UUJA 5FYKU 1RHHA 1OQOA 3ZSSA 5DQDH 3BPNC 2X70B 2G60L 1RAMA 4KDTC 1JWUB 4GS7B 1A5FL 4LPCA 2DJ4A 1ZAGA 4DUXA 4CMHB 2GJ6D 3ES6A 1G0XA 5HPMA 4IHOB 3BUTA 1KF9B 4NKQB 5D1QD 4DGVH 2E8ZA 4HMEA 4EBQH 5H35A 3VXUB 1YY9C 3IXAA 4WI3A 4MLIA 2NNAB 2XQBL 1G7QB 1QRNE 4LPVA 1REIA 5F7WC 4O58L 3RGHA 3FQUA 1VFMA 3VGAC 1ZHLB 4XPFH 4UQ3A 2WSKA 3ZDYE 3T09A 1G6RA 2K3TA 2VLLB 5C0CB 4PRIE 5A40E 4TVPD 4LPUA 4YPGB 2DMCA 3IDMB 3JV4A 1VGEL 1DBJL 1SEQH 4NFCA 3SDDB 2H1PH 2XG4A 4RZCA 1F90L 4R0LC 3BYYA 1TZIA 1U8HA 1O0VA 5FKAA 4JZJB 1CS6A 1DQDH 1MCCA 3MA7B 3RWIA 1CU4L 3O4OC 2Z8VC 3D0VB 3ZE2E 3CDGA 1E4WH 1IGYB 3D5OF 5D1QC 3G5XB 1NANI 4I48A 5IEKB 2MQ0A 4R90H 2P1YA 3IVKB 2D31B 3FFCD 5F7DA 4NJ9L 2FEDD 4PLOB 4XWOC 3ZYJA 5I66A 5EBWA 4XC1L 3SKJH 3QFJE 2B5IC 5CINL 5IQ9A 3UXFA 4YHML 1FVEB 4BJLA 3SEPA 5F1SA 5IB2B 1D5BA 1NFDE 2VC2L 5GRWA 1UCBH 1MUJB 1S7WB 3IU4H 3MACL 4NN6C 3GMQB 4JVPA 4O02H 5D8JL 5T5FL 5BV7H 4LRIC 2HFEA 3OAUL 2C3XA 2EDLA 1L9NA 4IIQB 4KDTA 5KG9A 3OKEB 3LQMA 5F9DC 3U6RA 3F65A 2XPGB 4H88L 3DOSA 1RD6A 3TA3B 1RZ7L 5KANG 4MA1C 3W9EB 3L1OH 2P7TB 4ZOCA 4YUEL 43CAA 1DQML 2FEDC 2PR4L 2ZP0T 1NMBL 3OGCA 2AP2A 4E5XB 3HAEB 2HT2C 5TFSL 1KPVA 5E1HB 5D93B 3T2QA 1FAKT 1IBGL 5I75B 4XNZB 1OP3K 1MCPH 2E7LC 5I17B 3NIDE 4YEFA 1I85C 2WLZA 1MLBA 3DBXA 1N8ZA 1G9NH 1N2RA 3I2CL 4PS4L 1R3KB 3FQTA 5J12B 3OR7B 1FORL 1ODAA 3BEWA 3H3PH 4HMDA 1U42A 1CGSH 3QHZL 4YDIL 1Q0XH 4HGKC 4J3TA 4XXDB 2EICA 1FVCA 3QXWA 4HPYL 2BK8A 2GJ6A 2RCSH 4KK8D 4DWHA 4YO0A 3C08L 3NH7H 1U8IB 4GXVL 4F7EB 5A1AA 5D1QA 3HE7D 5C8JA 3KPMA 3W0WB 4Y88A 3CXHJ 2AKRB 2HG5B 3O3DA 1YMMB 5IFAH 1YYMH 1NLDH 5F8QC 1G7IA 1EFXD 3ARUA 2BSED 4YIQB 5KOMC 1C12B 2XYCA 3PDOA 2GT9B 1A7QL 1CG9B 4J3XA 4XB7A 1MCSA 4OGAD 4TUKH 2YPKA 3MLTA 4RFOL 2BOBA 3CC5B 3KG5A 4P2QB 4W4NA 1JWMB 1DUZA 3BP7B 3BKML 1IAKB 3SOBL 4LRIA 4K3HA 1OAXH 2HFTA 5L9DL 3P9MB 2V5SA 4JFEE 3EYVB 1FH5L 4M1GH 5FK9A 4UNUA 2NZ9D 4KK8C 3UCRA 1UM5L 4O2EA 5HGHA 1WIUA 2Q7YA 3HE7C 2YC1B 1N5YH 4X9FA 4OF0A 1YPZB 1CTOA 2W38A 1VENA 1OL0A 3FFCA 2NPLX 4RGNC 5JNYA 5A16A 2A6KA 3OKDA 1GOHA 1XGQB 3QNYA 1G7HB 4G9FE 2GTZB 2ZUSA 3ZHLA 2VSDA 1RPQA 4S1RL 4FMKA 2E7LA 1RK0A 3I6KA 3MRNB 4OGAC 1I85A 1FGVH 4AM0A 1TFHA 5GHWH 1LO4H 3M1BA 4LLYB 4NNYA 3KDMA 1JCKA 1JNJA 3NCMA 1BJ1H 3QFDB 4KUZL 5FO8B 3BMWA 5E4EC 5DD5H 4HKJA 2CO6B 4M02A 1N64L 1FRGL 1Q9KB 5HVGB 4M3JA 4OF6A 4U2ZA 5GJSH 2NY3B 4MSWA 2BVOA 4WNQB 5DLML 1VPOH 2NZ9C 1NGWB 1FAIL 5EOQH 3MCG1 4AH2B 2J8UB 5B39G 4NC1E 5HHMD 1DN0B 4HCRH 3BDXA 4I4WA 1MFDH 4D9RE 1HI6A 1TTUA 4FQ1L 2P45B 4YBLB 3QEGH 3R0MA 3WIHA 5HI4D 1YEFL 1A7NL 5DQJA 1K4CA 2VITB 1YDPA 1RHFA 2FIKB 5LGJA 4JPKH 3V0WH 3QUMB 3KWWA 4X4XB 2NY5L 4YLQT 4YHZL 2VXUL 4XP4H 1JRHI 1EEQA 3KPOA 1KG0A 4JREC 2WBJC 5HHXL 3TBWA 1RJCA 3WDIA 2QV2A 3UPRB 4PY8J 2X1OA 4LHQB 4HK3N 3E2HB 5JHLH 4RMTA 1QHOA 4GW4B 4U0RB 1NC4B 1ZV5A 4Y16D 1SBBA 3F5WA 1MCEA 5TH2B 3QISA 4UV7H 3D18B 2JELH 1S7XA 4JY6B 3S34L 3T1WA 4P2CG 1A02N 4BZ1H 1YEGH 4OTXL 3U36B 2VDQH 1TCRB 3HE7A 2XWTB 2R23A 4N8PA 5TDNA 3NCCB 2IPTL 5E94B 1L7IL 2MHAA 3KR3H 2FGZA 1GZPB 2H26A 4KK6D 1EFXA 5T1KD 4R96A 3LHPL 5ELIA 1G7LA 1NBZB 4X5WA 2EYRB 3N1GC 4MMZC 1RU9H 4B0MM 5KVDL 4QGYA 1X4XA 5MENE 4UQ2B 4DVRL 5GGTA 2JKXA 3EW3B 3O2WH 4LMQE 1ZLSH 4N0CD 5CS7A 1T04A 1T03H 3GJFB 3TN0C 4HX1A 2DQIL 5JDSB 5BXFB 2ATKA 4NQCE 2OS7A 1ZHBA 1LILA 4PB0L 3PWJB 3ARQA 4Y16C 4Y1AD 8FABA 4NO3A 4XPHH 3MV7D 1DUYA 3VFVB 1JPFB 1CLOL 1T3FA 1RSFA 1Y18B 2I27N 1HIMH 5I1LB 3IETB 4NRYB 1GRWA 3DGCR 2YD6A 4Q9BA 5F6IC 1JZ4A 3TBYB 4I0CC 4NNPH 3CSYB 3OSKA 4PG9B 2E7HA 1WK0A 3HZMB 3EBAA 1QUNA 4PJXF 5CKGA 5FAAA 2LFGA 4GRMA 4KK6C 4F7MA 1G7PB 2QHRH 1NBQA 3NACL 3PG2A 3UTTE 3AY4C 5L6YH 2X42A 2OZ4H 3IFLH 3JSSA 4JY5H 1FJ1B 3SE8H 1KEML 4N0CC 2V2WA 5F3HB 5E2VL 1BOGA 4Y2OA 5JR1L 4JFFE 4GG6E 4LVHB 4BQCA 5A2IH 1KJ2B 1P1ZB 1U3JA 4M5ZH 2ITDA 1TQBB 4CW1B 4JDVA 3VMOA 3O41B 2A1WL 2ICWA 3U4BL 5JW3H 3X11A 5JIPA 2DQEL 5TE4H 1DBAL 3PUCA 4K94C 2EC9T 4U33A 5F96H 5JMRA 4OJFL 5IUSA 1BF2A 1JYNA 3QG7L 2JB5H 3B9DA 2ZUVA 3PWNA 5AAWA 1T20B 5GGSA 4RA0C 2EDYA 5CUSH 4WIQA 1OARH 1U3ZA 4FTVD 2YD9A 4HZLB 3GRWA 5IVOA 3RBGA 3U4AA 4GW5A 1G7QA 12E8H 2OJEB 3OKKB 2G9HB 4R4ND 3V8CA 1KIQA 3L3GB 3LKRA 1ZHLA 3GIZH 5FYJL 2IH3B 3LS4L 5FF6B 3V4UH 3FB7A 4LVOB 2XWBA 4Y16A 3BAEL 2HRLA 5F89A 3OG6B 3GMOB 1EEYB 5JQ6L 1F02I 4WTZA 2F19L 2GSGA 3T4AA 3WL9B 3ZYOA 4OGXH 2WWKO 5GXBB 3HUJB 2XI9A 2UZIL 3NOIA 1AFVH 3BJLA 2FZ3B 3ILQD 4OCWH 2EC9U 1JHLL 1J86A 4IDJH 1CIUA 1OAQH 1CLYL 3UTPD 5HGDA 1AGFA 4PBWD 3PHQA 3DSNA 4AT6B 4KJYA 4MCZA 1ZT1A 1L7TH 4MNGE 5EO1B 1J0IA 1QFOA 2YSSA 2O61A 4L8DA 4OLWH 4RQQA 3VFUA 4HIHB 4NPYA 1B3JA 3WNMA 3OAZH 1EJOL 3CFCL 3DARA 3OHXB 4R4NC 1DQLL 3P30H 4QOKD 3ZDZF 1F4YH 4LCYA 3AS1A 3VI3E 4K3EH 3LMJH 2JJWA 1CK0L 4Z7VA 4MNHB 1CGYA 3QIUD 2D9QB 4Y1AA 3MV7A 4JO3H 2F53E 2CRIA 5HDOA 1C16B 3V9FA 5LGHH 1PX3A 1U93B 3ILQC 3TJHD 5J6GA 3DMMD 4BZ2L 1H0DB 2H32B 4J6RH 4ODVL 1B88A 1AC6A 5EORH 1JP5A 3QYCA 1S9YA 1IGJA 5I8CA 3TA3A 2XZAL 1DBKH 3KJ6H 2FJHA 3TWCH 1ZT4A 4OD1H 5E95B 1JZ6A 3D1MC 3VXTB 2ERJC 5AYUH 5K9JL 1W0YT 4QNPE 4KMQA 2ZKHL 1I9IH 4QO1A 3ARDD 5E2WL 2WQ8A 5AUMA 4N5ED 1CVSC 1EAPA 5GJTL 1MAKA 1QSFB 2EDKA 2NY6B 3VE0B 5DURD 1OGAD 1JI2A 2Y7QB 4Z7NE 4UILL 3WHE1 1Y6MR 3WKMH 3SQOL 3QIUC 4OAWB 5DMJB 3QUZD 4JHAL 3BPCA 2J3SA 4FFYL 4HUWB 4V1DE 5GSVB 2M2DA 4N8CL 1A1MB 1AGCA 1BECA 3DMMC 5ANME 1NUDA 4EXPX 3GHEL 4UDUB 4IRJD 3B4NA 5ICXA 3MZGB 3QWOB 2PF6A 2CIIB 1Q0YH 3VXME 4ENED 1KCKA 2PCPB 5JPNB 3SO5A 1ONQB 2VLRD 1X5FA 4HF5L 4FTVA 4L4TB 3W0WA 5T33L 2YHGA 3KPRD 3HZVB 2C1PB 4XCYB 3KPSD 1D9KB 3CSPA 1MEXL 3ARDC 4KTEL 2DQDH 2H8PB 4CADB 2PYEB 5BV7C 1C12A 3H42H 4JZNB 4FQXB 4N5EC 5EUKB 2FHFA 4WHTA 1KJ2L 4X80L 2MTPA 1AKJB 4WI9A 2E6JA 2UWEA 1V5JA 1FNHA 2O5ZH 3BKJH 5DJ2B 5EBMB 3FFDA 3WHXB 4P49A 2ADIB 3QUXD 1M71A 2KDGA 2AI0H 5KSUA 5SWSD 3QUZC 1Z3GH 5IMLA 2DKUA 1EFQA 5JUEL 5IB1A 5IOPB 1BQLH 1U3HB 1OAYL 5IBUB 3GMPB 3PGDA 5D5MB 2GIYA 1WGOA 2IALA 3VFSA 4IRJC 1JNNH 5DA4A 4ENEC 5I18L 2EIBA 3LKSB 2IC2A 2FX8H 1B6DA 3GBML 3Q6FB 1G9NC 1QD0A 1X7QB 3O2DH 5EUOE 3CFBA 1KIPB 1U8MB 3HA0A 3GMMA 1I9JL 2X4SA 2VQ1A 4GLRH 4DKEH 4WI8A 4Y5XB 4I3RH 3HI5L 2Z4QB 3BH8B 1XCTB 1ZVHA 4JO4H 5C3TA 3WFHA 3F7QA 3SGDH 4QRSA 5ID0B 4QOKA 2A2QT 3JXAA 2NXZD 2VNCA 2R2BB 4NM4H 2C7UA 3QUXC 4X6EB 1VEOA 4UAOC 2J88L 2VABB 3QIUA 3T2PA 1S5IH 2ESVD 1K3ZA 3QFDA 2AV7B 3WO3B 1A7PH 4B53A 1T1XB 3S7GA 3HG1D 1XFPA 3HI1B 3EYFB 4LIQL 4MA3B 2W60A 3BUYA 2PN5A 1UZ8B 1A5FH 4MQXD 3DMMA 4OKVB 4UBDD 3EUUA 4BFEA 4X6DA 4H8WL 4LEOB 4LGPB 3W5MA 2IANB 4U6XA 4MVBD 4FG6D 5IJVB 4CN4A 3LQAL 5CD3B 4G8FA 1KCSL 4JRWA 1I3GL 1MIMH 2MOVA 3D85D 2AXJA 5EU6D 3ARDA 1P2CA 2BXZA 4JKPH 1OD7A 3LS5L 2ED7A 1DANT 1WFNA 2IGFH 5E24E 4YGVA 2FIKA 2BVPB 3Q5OA 4HBCL 4OI8A 2J6EL 4HUUB 2NXZC 4X6BB 4AG4L 3MCKA 3G6DL 4U6HA 1OGAA 3VRLE 1OCWH 5ICYA 5FCUL 1NGQH 4MJID 1AQKH 1K5NB 1OAZL 3QUZA 3D39E 4WO4B 5CSBA 1XMWA 2X7LA 3WS6C 1CXLA 3DVIA 4R4FH 3IRPX 1S7RA 4UNTA 4MQXC 4WWKB 4ZPVA 2HFGL 3NAAH 4LVNB 4PLKD 3HR6A 4IRJA 1CU4H 5FECA 4UBDC 3IU3B 2FHCA 3S35L 3U4EB 1A3LL 2DLEA 5DEFA 3T0EB 1OHQA 4PJ8D 1GVIA 3S5LG 1BD2B 3U36A 3VXSD 1TCRA 3LIZL 4HKZA 2VAAA 2VLRA 2XWTA 4FG6C 4MVBC 5EPMB 3TYGH 3KPRA 25C8L 1KB9J 3MRRA 3KPSA 5GIRB 5E8EA 4XC1H 1IZKA 2BMKA 4S1SL 3UJTH 2R69H 3QAZB 1X6NA 1WCBA 2EDJA 4NQDD 4BUHA 1A3RL 2ICWI 4G7VH 3QDMD 1AHWB 1KCLA 2WP3T 4LVEA 5BOZG 4ELME 1DBBL 3MODH 4XNQA 4KY1L 2VC2H 3C5ZB 4N8VA 3WEXA 1DANU 3BRGC 3QUXA 5C09E 1YN7A 2EEBA 4W6YB 4XNYL 3JV6B 2BNUA 5I16B 3MACH 1J5OL 3UJIH 5SWSA 5D8JH 2UUDH 4PY7A 3OKMB 3OAUH 5DK2A 4ZYKB 3ZHKA 3DRTA 2NX5E 2CDFB 4JJHA 1BFOA 5JW4N 5C71A 3U7YL 1X44A 4J1UB 3VFGL 4PLKC 1IILE 4H88H 3FB6A 5C0GB 4Y5YC 1HKLL 4JJ5A 1J1PH 1T2XA 1LP9E 5ESAA 3IJYA 3V6ZB 3S96B 1G6VK 5MHSE 2GJZA 1FPTL 3GEWB 4YUEH 5IM7A 2XTJC 5EU3A 4GKZB 1DQMH 1HKFA 1SEBA 3QXAA 1UJ3B 2PR4H 5D7KE 2ARJB 1Y6KR 2F8OA 4MNQE 1NMBH 5DZNA 5I1HL 4LASL 4D0DA 1UWEL 3GSQB 1U8LA 5EO9B 5K9OA 1GC1L 2H9GB 3RZWA 5TFSH 3P9LA 5CSZB 3RVXD 2Q6WA 2VL4A 1IBGH 3RPKA 4Z6AT 1T7ZA 2XZCL 4ORZC 4X8XA 3OKYA 4X5XB 2DQHL 5AWNL 2W1NA 2GW5A 3I2CH 4PS4H 3RWFB 3QNZB 5HYQA 3CX5J 5JW4M 3OZ9L 3V0VA 2ESVA 2Q87A 2IJ0C 1IMHC 3DX7B 4YDIH 4PJCA 5DJ0B 3WN5B 5J11B 2Q86A 5BMFH 1QFWI 2QADB 3HG1A 1CWVA 3WS6A 5D71L 5MEQB 1ES0B 1AGDB 3CU1A 3MSPA 1DN2A 1TVHB 4N0FA 3OPZL 1EHLH 4HPYH 3T08A 2VDRL 5L2KD 3ARTA 4MQTB 5DQ9B 2P8MB 1D5MB 4GRLC 1BX2A 2C1OB 1PQZA 4F33B 1A14L 3E3QC 1O5DT 5INDB 3GBLA 4I5BB 1N0XH 3OKNA 2OQJA 3MV9D 3MUJA 4K07A 5HDBF 1T0NA 4HWNA 4BH7B 4ODSL 3U7AA 4LK4A 5D7SL 3D85A 1FL6B 5EU6A 2CRYA 2VL5B 3P4NB 3RVXC 1A7QH 3T3PE 2X4QB 5TGBB 2JCCE 4ZUWB 4JN2A 1EZVX 3ZO0A 3GFUA 2C5DC 2H3NB 4RFOH 4TN9A 1G7MB 4LLQB 1JNHA 2WIIA 1C5CL 5SWZB 2W0LA 4MJIA 3L3GA 4HCRA 4AQ1B 3SOBH 5AEAA 5L9DH 2ZSVA 4FP8H 2JIXB 1BBJB 3DVGA 5T3ZL 1FH5H 3QXTA 3VWJD 2IAMD 1KN2H 4OZIA 1EEUA 4UMGA 1BEYL 4Y5YA 4M62L 2R0KH 4PJ8A 1Q38A 4LEXH 5E9DE 3GUTB 3VXSA 1INQA 3VXPA 5L2JB 4HGWA 1O7SA 1EHAA 3VG9B 4F8QA 5ACZA 1W72H 3WFCL 5HJ3B 4F3FB 2DI9A 1H5BB 4NQDA 1NQBA 3R8QA 2D03L 1I1AD 4S1RH 3QDMA 4JKKA 2OYPA 3HZYB 2P47B 4OZGE 4FQHA 2VISA 1KPUA 5F1OB 1YEDA 2FHBA 3AAZA 1CD1B 5BCAA 2BC4B 3QWQB 4XCNA 3VXRE 4GMTH 4LLVB 3VDCA 2LU4A 5DJYB 2AV1A 4KHTL 5C9JA 2PUQT 4ZUVA 4G8EB 3DROB 4UZGA 4R8WH 3FOMA 4YZFE 1N64H 5FOJA 1FRGH 2ZPKH 4QHLA 3RWJB 4L8BA 2B2XH 1LD9A 4DUVA 3VWJC 2IAMC 3RX7A 1JK8B 2YXMA 2DQFA 5DSCB 5DLMH 3WNLA 2DWDB 2MPAL 1FAIH 2IH1B 5DD1H 4XHJD 1Z9MA 3MCLL 1BVKA 1U93A 4NQCB 3VGEA 3HTLX 3OGOE 4P4RB 3L7FA 3BKCL 1T4KB 2BVUA 3E6HB 5I1AB 3OJVC 2VE6A 1I1AC 4HH9A 2VXUH 5CIPH 2WUBL 1F6AB 2ZJSH 5IB3B 5EZLB 5GQBA 3NFNB 3IDXL 1TDQA 2Q76B 1MCKA 5C2BL 1INDL 3FO2A 3IDYB 2OTWA 2APWA 4HK3J 3S36L 3BGFB 3BXNA 4QXUL 1IJ9A 3G9AB 4IMKC 3A6OA 4TPRL 5BS0D 3FQRB 3KNBB 2A6IB 2OZ4A 1EPFA 2X9WA 1ORQA 2IPKB 4XHJC 1VFBB 1B6UA 2VN7A 5GISL 2DLHA 3OMZA 4HFUL 4PR5B 3MV9A 4JPWL 4PJHB 4KRPD 5L7XL 1UG9A 3UZQA 2MCG1 1N4XL 3LHPH 4PV9A 1CQYA 1QVOB 1S9WA 1JGVH 4HJGB 2W9DL 4CNIB 5KVDH 1F6FB 3HRZB 1FZMA 4OLZL 4DVRH 1NGZB 2APBA 4LSRL 2P8LA 1IQDA 2PYEA 4F80A 1NCWL 3KYOB 4E41D 3BZFA 4P0DA 4NO0D 1VFAB 4PB0H 1IGFL 3RZCD 3TO4D 3VWJA 2IAMA 3VGFA 4Z18A 1CLOH 4I2XE 4IJ3C 3GMRB 4P5TD 5HHQB 5BZWB 3ZL4L 2D3VA 3NZ8A 1T5XA 4P3CL 2VDPL 4I77H 3STLB 3GMPA 5HSFA 5TE7L 4R7NA 1RK1B 4KRPC 3ZKSD 4JHWH 5FA3A 4POYA 3RWCB 5HVHB 3NACH 4CVXA 1BVLA 3VFNB 1BHGA 5IG7A 1I1AA 5CBEB 5J3HD 1DQTA 3FT3A 1QA9B 1KEMH 5HYFA 3S35X 4FXKA 3MNWB 4JQIH 2EDNA 4I3GA 1SY6L 4F57L 5JR1H 3TBSA 1I8KB 1RZJL 3L95B 5JLZA 3S97C 4EKXA 1BZ7A 1UXSB 1JGEA 2WBWB 1LEIB 1HHGB 4JG1L 2AK4B 3RZCC 4X6EA 4WI6A 4YDLC 4QT5A 2A1WH 4JFQB 3TO4C 1JZ7A 3FB8B 1FL5B 4P5TC 3IJSA 4O2CA 2APTA 3HI1A 1ZVSA 4QHUA 2UVFA 4MA3A 5EA0H 2J12B 4WFHD 4OJFH 5HBBA 5AAMA 4EI5B 3S4SA 4HG4K 1RV6X 5DVOA 2BNRE 1AO7E 1RZKC 1SQ2N 2HFFB 5LQBL 2FB4L 1LO3H 3HNSL 2QQLL 4UU9A 1TZHB 2F53B 1EEZB 4UTBL 4KRLB 2YPLD 2OTUA 5J3HC 4PGEA 4JFHD 4KDWA 3IAQA 3SCMB 3RWHB 2JTDA 3CGTA 2R4SH 3D3VB 4PJFE 5J9PB 3LD8C 5HY9B 3ROLA 1VEMA 5IHUL 3A67L 5SX4H 3L3OB 2ILLA 3BHBA 5FYJH 2FJGB 2I9LB 4HUUA 5IW6A 2P5ED 3B3IB 4QXTA 5EU5A 1BFVH 2A83A 3TCXA 3K46A 1TXKA 1HHKA 5INCB 5JQ6H 5HHOB 4K71C 2F19H 5BS0A 4WO4A 3W81A 1OTTC 4K7FA 5HHPB 1IFHH 3KPQB 4URTB 2UZIH 3N85L 4P23D 2IQAB 3GSOB 4JFYB 4WWKA 4ZODA 1AD0B 3Q48A 3SKMB 3P3YA 4R6UA 4TRPH 1HDMA 4WFFE 4Y4KC 5IMOA 3ARBD 3EDDA 4JHZA 1BD2A 3TH2T 4NIKB 4MXWL 5I8KL 1Z5LB 5C0IB 1V7NL 1NCBL 1P7QD 4JN1H 4Y8AA 3QZWB 1HQ4A 1A8JH 2D7TH 3QB7C 4NWUL 3ME0A 1XCQB 3DIFB 3I3EA 2HJFA 4MCYA 4HPOL 4NN7C 3BDBA 2W9EL 2G5RA 5I76B 4E41A 5EDXA 2R2HB 5FYJU 3T4YA 4YXLL 3AB0B 4IDLA 1CK0H 4NO0A 1ZE3C 3G04B 2Y36L 4ALAH 3OKOB 3RZCA 4BQBA 3JV6A 3D2UD 3KGRA 3TO4A 4S2SA 4M4PA 4AEFA 5I16A 4FZEL 3GZKA 4G6AD 4LKCA 1RUQL 1CZ8L 5DS8B 3B8SA 5JHDD 1U6AL 4P5TA 1MY5A 3V5KB 1RVFL 3KYMB 1A7RL 4B7LA 4P23C 1HILB 1KB5B 5FA4B 4KDVA 5IMMA 2FECI 4G80A 2DIJA 5DD3H 3TJEL 4U1JB 2VZUA 2XZAH 2OSLB 3U30C 3ARBC 3DVFA 3QUYB 4RGOL 4KFZC 3FAWA 5T1DL 4WFEE 1AXSA 5K9JH 2A6DB 1FZOB 2W65A 3UYOD 2QTEA 5JA9A 1AD9A 2ADFL 1JF5A 4NKIL 1MQKL 3L3DA 3PE9A 3THMH 2R56H 4PJDA 4X6DF 3CDFA 2J8UF