1ND0B

Cationic cyclization antibody 4c6 complex with transition state analog
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
222
structure length
222
Chain Sequence
RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSHNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN IGG2A
publication title Structural Basis for Antibody Catalysis of a Cationic Cyclization Reaction
pubmed doi rcsb
total genus 45
structure length 222
sequence length 222
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nd0B01
4P23C 5E8DL 5F1NA 3RJDA 1XCTB 2P49B 5MEQB 2HG5A 1LP9A 4FQ1L 4WWKC 1KLGA 1QZ1A 1U95B 1TQBC 4UNUA 3C60A 1CGXA 5JHDA 4QY8A 1ZWIB 4JPWH 3PWLA 3WCYA 5HVHB 2AABL 5DUPL 1QSED 4NKQB 5HHPB 3HMXA 3OKMA 1S3KL 3K4AA 2XQYG 3CFBA 2ZUQC 1W72H 1FFPB 3DSFL 5T3XH 5C0BA 1T66C 3KPSB 5CGYC 1YMMB 2X4PB 4JRXB 5F3HB 3PP3K 4X6CA 4QEGA 5E00B 3V4PL 3BDBA 2HMID 5HHVL 1WBXA 4FNLL 4PLKD 3UTQA 4N0UE 5L88H 1QKZL 3QIWA 3S36X 3RVTD 4JHWH 4P4KA 2GITB 3AU1A 3NN8B 1FZMA 4OZHF 3UC0H 1YEGL 3D87B 1R3LB 3IT8D 3BGFB 2FGWH 5ACZA 3BP4B 1OW0A 5B39G 3N1QC 2PO6B 4F7CA 1D9KD 1SY6H 3AB0C 2BSED 1DANT 1KIQA 3D85A 4PB0H 5CMAB 3BN9C 2NY2C 3MQIA 4PJAF 1AXIB 1MF2L 2YWZA 1FORL 4G80A 2VC2L 3DHJA 4JM2C 3D39D 3QXTA 5D93B 2NNAA 2AXGB 1RUQH 1AE6H 4HBCH 2AQ2A 1LEKA 5EO0A 3EO9L 1JL8A 1P4LB 5FEBA 1IGML 3B83A 1IL1B 1BZQK 3O6MH 4WEUD 3IDMA 5F7EH 3L9RA 4UAOB 1D5MB 3QAZC 1VENA 2O5YL 2VLJD 4EDXB 3PE9A 3D0VA 4UDTA 4HWBA 2LAAA 2FH6A 2IPKB 2PXYB 3UO1L 3GSRA 4E41E 3OR7B 1EEZA 3ARYA 1MUJB 2VDPH 1P2CB 2P8PB 3QEQE 3SE3C 1AKJB 7CGTA 5I8KH 4WFGD 1AC6A 1CLZL 1SY6A 2J8UE 1I1AD 3KVQA 2M1KA 3KR3H 4X9FA 2C3WA 5HGHB 1HN1A 3PHQB 3FQNA 4HZLB 1T5XB 5ID1B 4I9WD 4R2GD 2ZUYA 4OGYL 2GSIB 4LKCB 4NJ9H 4HC1A 2DOCA 1C16A 1H8OA 5CJXA 4GXUN 1CYGA 5JIHA 1UXSB 4XCEA 3GSQA 1BFOB 2H45A 4P23A 4N0FA 5IM7A 1N59A 1AGEB 5D9SA 5I9QB 3TCXA 4FZEL 4OGZA 4WWKA 5SX4H 2XTJD 3T65B 3K8KA 2Y06H 2DQHL 3H9SE 5EPMA 5FYJL 5IBLC 5KSVA 3D0LA 2NX5E 4K2UH 4OQTA 4DN3H 1H0DB 4HH8A 2NY4B 4X6FA 5BXFA 1AGBB 4HQQH 4TUJB 2OJEB 2VXVL 4QRRA 4HCRA 5C7XL 5E6IB 1I9IH 1QO3A 1QHOA 5E9DB 1T0MA 1C5DB 4OSUL 3RJQB 5B39A 2ADIB 1E6OH 4PJDA 4WWID 2RB8A 1F90H 3LB6C 2LV4A 4KPHH 3FB6A 5HGAB 1DEEA 3PXJA 3ZKMC 5I16A 1ZSDA 2W0KA 2JK5A 4JPVL 5H2BB 2V9TA 1DVFD 3RWEB 1TTFA 4KHXL 3DBXA 1DE4B 2P5WD 5DLMH 4J4PD 4HF5L 3VH8G 1IT9L 4XZUA 1SVZA 5BV7L 4PJFE 5J6HA 4FFYL 1V7NH 3AREA 5IR1B 5AUMA 4J3XA 5HHOA 4OIAA 4OCRL 4PJ5A 2VRAA 2OLDA 3G6DH 5DC4B 2XY1A 2H2PD 5HPOA 2AJXL 3MCLH 4L3EA 4NQED 1ZT1A 4HUXB 4JM2A 2APBA 5GS0D 3VXRE 2O61B 3QI9C 1JNJA 4M3KB 2OTWA 5DGRA 4FXGB 4P5TD 1U3HC 1AO7E 4V1DD 3WFEH 4OLYH 3D1MC 4F33B 5L2JB 4YO0A 1A1MA 4APQD 1U0QA 4YGAB 4G8FB 5HGBA 3UX9B 2B0SH 1I7TA 2BNRA 5C0IA 3PWJA 5IB5A 4CN4A 3SE3A 1GHFL 4HXBH 1KGCD 3Q5OA 2JIXA 4C56A 4EIGB 3ARGC 3UPCA 1Y6NR 1A4JB 1KLGB 3VWJC 4ODXA 1F3JA 1X4ZA 5D7JD 5JHDB 3BH9B 4BUHA 2BK8A 4E5XA 3HE7B 3OQ3B 3WE6A 4PJXE 4QF1B 4OZIB 2RBLA 3C8HA 1FNSH 3REWA 3WHE1 3DX8B 2DM7A 3LQAC 2X1WL 2QQLH 1KULA 1T1WA 1C12A 1E27A 3CFBB 5L2KB 1KENH 2H26A 2P48B 1KF9B 2RCSL 1BEYH 3VRIA 5EBMA 5F97E 3BDXA 3QYCA 3TT3L 4JKWA 4IMLA 4ORZC 5E7FA 2MNUA 1WBXB 4TNWF 5I1HH 3QIWB 1I8IA 4YFLI 4P4KB 1RU9H 3AU1B 4I0KA 2EDXA 4P46B 2HVKB 1NBZA 5F88A 2Y07H 1NDGA 2WNGA 3GZKA 3VH8A 3UBXB 2N56A 2OCFD 3UTSA 4XP1L 1V05A 3ILQD 4LOUC 1MJ8L 3FHAA 2ZPKH 3D18A 1PSKL 4X4XA 3VFRA 4WFEE 4KZEH 3VFMB 2CIIA 4GRWH 4FZ8L 3HNVL 3MX0A 2IH3B 4TTGA 4G80B 3ULUL 3MRHA 2NNAB 4Y4HD 3BKCL 4K9EC 3C5ZC 3O2DA 5BW7C 5DVKA 4FTVA 2F53A 1ONQA 3B2UC 1LO3H 4OZHE 1GGBH 1TIUA 1BJ1H 4G8EA 5HVWA 1FZJA 3VFNA 2EIBA 3IDMB 1P5VA 4TQEL 1C08A 3QI9A 1PJ9A 2VAJA 4WUUA 3D0VB 1NQBA 1J1XH 3BPCA 3GSRB 4EN3D 1IM9B 5TPWL 1U3HA 2RJMA 3LQAH 3VXMB 3OF6A 1VA9A 4QWWC 2ADGB 2J6EL 3D25A 4PJAE 1FG2B 1T7ZA 4I48A 5ESAA 1JRHL 1PEWA 3TBYA 2XACC 2OTUB 5CBAA 3KPNA 5F70A 4BZ1L 3FQNB 3OX8A 3JBG7 4C4KT 3EO1A 3CSGA 2XRAL 1YEEL 4J7RA 1KC5H 1R5IB 2W60B 3RNQA 3M07A 3CH8A 5DEFB 1S9YB 1IAKB 3GSQB 3PDOB 3IFOA 1MJUL 4G6ML 2DQUL 2NXZC 2PCPB 4X7FC 5D9SB 3HN3A 4LVOC 3ARGA 2ICWB 5IF0A 5J9PA 3VWJA 3BAEH 4ODVH 1TQBB 1FIGH 2FX7L 5TJWK 3MLZH 3D2UD 3DYMA 1VHPA 2DWEA 5EPMB 3D0LB 4ZAKD 3U4BH 1CFVL 2FO4A 4ZFOL 2KL6A 2DI7A 4ETYA 1OAYL 5FECB 1R3IH 1F4YL 3H0TB 3LKSA 3I6LD 5F9WC 1QO3B 2Y1VA 1ZHBA 1T0MB 1RHHA 4RA3A 1WQVT 3RZCC 3TYFA 2R56L 1J86A 5EU6E 5E1AA 3HC3L 4GG6A 5B39B 4I18C 3CSYA 2NZIA 2WQRA 1I1RA 2YN3A 5FK9A 2NYYC 4QXUH 5E5MA 4JZJC 1ZSDB 2VXSH 5C09D 3SDDB 2B7DT 1EFXD 2YC1A 2OR7A 3L3IB 4XI5D 1KTDA 2DDQL 2HTKC 3TC9A 2HH0L 4XZUB 2CPCA 4KK6D 1KEGL 4LASL 3AREB 3HUJE 5AUMB 1EJOH 3MRQA 2NY2B 4PJ5B 2QQKL 5C9KA 3JTSA 4Q97A 2YUZA 4M00A 4L3EB 1ZLSH 5D2NE 3MTRA 1NGWA 3C5ZA 3OAYK 5BW7A 1A7QH 1MCEA 4Q6YA 3IJYA 4F7MA 3V8OA 4XVJH 4KKCD 2MKLC 4QGTA 3KNBA 2H3NB 2OL3H 3HAEG 4EJ1C 1F58L 5HGBB 3A67L 3QAZB 5FGSA 3ARZA 4EI5D 4K7PH 5FYJD 3QDMA 4HH9A 5I76B 1TCMA 2BNRB 4YNYA 1I1FA 5C0IB 3PWJB 1MCWM 3VXOA 1NBVL 4LSSH 4XPTL 4RCAA 4XMPH 1IKFL 5INCA 4XHQA 1F3RB 1NSNL 3ZHDA 3R0NA 2R0ZL 5ALBH 2P5EE 4CJ0A 3W9EA 5F96L 2QBWA 1F3JB 3MLTA 3DXAE 5KS9A 2APFA 4PGBB 5CGTA 4E5XB 5B21A 1E4WH 3WE6B 3CX5J 2PTTA 5I1GL 3D5OF 3OHXA 2JB5H 1PW3A 3SGJA 4L4VB 4HFUH 5EU3A 2F8VA 1LGVA 2XXCB 3LPGA 1R3KA 1T1WB 1IEAB 5HYSG 4N9GA 2H26B 1T4KA 3FN0L 5SWQB 4JFYA 2O5XL 3WL9B 5ILTH 5EBMB 2ITCA 3X13A 5GGVY 4AQ1B 4AK1A 2DQTL 5C6PB 1UH3A 1JYXA 1I8IB 4DUVA 4MJ6A 2APVA 1G1CA 2UVEA 2VZUA 5F88B 3O9WD 1NDGB 4I18A 5HY9B 3UTSB 3D18B 4X4XB 4QRPA 4JZJA 5F6HJ 4MA7L 3KWWA 5D1ZC 3I75A 2ZSWA 3CC5A 1HKLH 1Y0LA 1ZHKA 1A1OA 2YA1A 5J13C 2E5EA 2WWMD 3WSQL 4PRIA 3OL2A 5CIPH 4ODHL 4O51A 1YECL 4HKXA 3Q5YA 1OM3L 3NA9L 4QYOB 5DQDH 3WEXA 2BY2A 3KPQA 4X9IA 1ONQB 2IEPA 1BD2E 3EJJX 3K2UH 4G9FD 4M6OH 4PJGA 1HKFA 4G8EB 3HAEA 2VDKL 2C1OA 3B9KD 1C08B 3MZGB 5DD5H 2F58L 3QI9B 3O8XC 3GI9H 1WWWX 1KYOJ 3IVKA 3QT2A 4Y19A 5J4MA 4Y7MA 4MXVE 4CN1A 1H3PH 3S8WA 4X0KB 3D25B 4JFZH 4I48B 5ESAB 6FABL 4NO2A 3U4EB 5DA4A 4PGJA 1JWMA 3M1BA 5CBAB 3KPNB 4G5ZH 1EO5A 3EO1B 2BVYA 2XZQL 3WN5A 4W6XB 4ZO9A 3FMGL 3HPJA 2K7PA 3K4DA 4PY8I 3EZ8A 5DR5H 5CIPA 5BMFL 4YHKH 3ZHLA 3CUPA 4YXKH 1NCTA 4YE4H 4M7JL 4TRPH 5GIRB 4GBXD 1UH2A 4H8WC 1KCUL 1FBIH 3GK8L 4FN0A 1IGTA 3QULB 4BSVA 4NZTL 4WCYH 3DMMC 3T3ME 2V17L 4RAVA 4BKLA 4OZGE 3THML 4KRLB 4Q9QL 2JELL 4C57C 4NQVB 2NY0B 4LAQH 5GHWL 2FX8L 3I3DA 2L4OA 3S96A 5C9JA 2Q86A 4KMLB 4WDIA 5F44A 1EERB 2P4AB 5IVZA 3T0VA 1IGCL 3LKSB 2AP2A 5TDOA 2CD0A 5LGKA 4N1HB 1INEH 2QL1A 4MD5B 4HUKB 1BFSA 1ZHBB 3ULUD 1RHHB 5KSUA 1MFAH 1D7FA 3TYFB 5JORA 5GGSA 5J12C 5KW9L 4GG6B 1A5FH 3CSYB 3ESUF 5CJOH 2ZOLA 1JZ4A 1AQDA 1YEIL 3K4ZA 5E5MB 5IESL 2DRUA 3NTCH 1JGDA 1MFEL 3U46B 5E4EC 3TF7C 2YC1B 1J05B 3GKWH 3S5LG 4KY1H 4LCWD 1YPZF 1KTDB 2GY5A 3VD4A 1UFUA 4I77H 1EHLH 4ACPA 2B4CL 3L3KB 4OF6A 5MEOB 4I4WA 2EC9U 5D1ZA 4XH2A 1RIHH 3MRQB 5J8OA 1AXSA 3MV01 3EUUA 1FVEB 2B1HL 1J88A 5DJDA 5C0CA 3JTSB 4H26A 4KK8C 3KJ6L 1KT2B 1JGLL 4JDZB 2A6JA 1Q9WA 3AMKA 5L9DH 2DIJA 2R2CA 5FF6A 1MCCA 2X2YA 4ZXBD 4LCCC 1RUKL 2OZ4L 2XN9A 2C3VA 3L3DA 4O00A 4BUGA 4K94H 2BDNL 2I24N 4F37K 2BNQE 4Y4FC 4D0BA 4U1MA 1UB5A 4OCLC 3QDMB 4JRYE 1I1FB 5LWYL 3SE9L 4PY7A 3VXOB 3UJJL 1N6VA 4ONGH 5C2UB 2CUHA 2NPLX 3PHOA 3X3GH 3I02A 5JIIA 5LG1A 5HYEA 1XIWB 1CCZA 5DZLA 4BYHA 4XAKD 2YMXL 3P0VL 5AYUH 2BOBA 5DD1H 5I1KL 5I1LA 1I85C 1GRWA 5CLTA 5EDXA 2PTTB 3OHXB 1A7OL 3GIZH 4RGOH 3SKUD 4QGYA 2BHUA 4LVOB 3DMMA 5EU3B 3T0DA 3C5SA 4ZFGH 5EU4B 4KJWD 4MJID 2VJXA 2ARJA 1N6QH 2AW2A 5IHUH 4B41A 2ESVE 1T4KB 3GMMA 3DARA 1FQ9C 3MRPA 2C5DC 4JFYB 1VGEL 3JV6B 4GKZA 3IS1X 1CGSH 5DVLA 4P9HC 3JWOL 5ADPH 2ITCB 3X13B 4EZMA 2E9BA 2OP4L 3TYGH 5KTEL 4MD0B 1SHMA 5CUSL 2WBJA 1CE6B 4P57B 5DUMH 1HZHL 1Z3GH 4MJ6B 3S5LA 2Y36L 1FFQA 2FECI 3QNXA 1NDMB 4ZD3L 4I18B 1RAMA 3MRCA 4ZG1A 3KAAA 1FLRL 2EE6A 1QFUL 3VXQA 4BQ9A 3BWUC 3VG0H 5IJVB 3I75B 3ZKND 3QO0A 3IGAA 3QFDB 1ZHKB 1XCQB 1A1OB 1QSFB 3UTOA 2PYED 3VRJA 4POYA 5F89A 4R8WL 3VFOA 3LEXA 3QRFM 4Z7WE 1BPVA 5EC2B 1N64L 4HKXB 5HI3D 3RIAF 3WEXB 2YKLH 1CL7H 5F9JA 2NW3A 1HCVA 4BJLA 2EICA 3S88H 5E08H 2V5MA 4PJGB 3EW3B 5CZXC 4P2OB 3HAEB 5A40E 4ZOEA 1K85A 2V2TA 1JHKH 5I1JH 2OK0L 5DJCA 5DJ2A 3OV6A 5DMKA 5C86A 4RMWA 4YH6A 4LCCA 4OGAD 1RV6X 3WS3B 4JFDE 1JF1A 5DRXB 3MRGA 4KKLD 3HKFA 1X5IA 4NO2B 4L8BA 4LKXA 4L4TA 1JWMB 5JO5A 3HE6A 5ESVA 4Y4FA 2R9HD 5F3BA 3MLUH 1G1YA 1U36A 5C3TA 3WN5B 3CFCL 4HUWA 4JR9L 4S0SD 3HPJB 1HE7A 1JWSB 4AIOA 4S1SL 4LF3B 3CUPB 5C07D 1ED3A 1MCOH 4JJ5A 1DBML 2HMIC 5J56B 4PLKC 5FHAL 1IGTB 3UZVB 3RVTC 1JMZA 5KVDL 43C9A 2EH8L 5HYSB 1NCDL 3SOBL 2J1KA 1RZ7H 1P6AB 4JO3H 4NC2B 5I75C 2R4RL 4P2QE 4WW1A 5C9JB 1D9KC 2Q86B 3FRPG 3TWCL 2AEQH 5KSAB 3CMGA 3VFSB 1CBVL 4HIHA 4CMHC 2EDJA 1WUNT 4Z7VE 1NAMH 2NX5D 3BSZH 4UBDD 1XGYH 1RULH 5M7QA 1QOKA 3WYRA 3T4YA 4DTGH 4UT9H 2R2EA 3ZSSA 1ADQH 2A38A 3CVHL 3WIFA 5BZWB 4JREC 4Q58C 2YN5A 3KXFE 2G60H 4P99A 4OZIF 2V9QA 3OXSA 4QT5A 2KUTA 4MZ3A 3MNVA 1SQ2N 4PJIA 2Z91A 1A6VH 3W0WA 3LEVH 5D4QA 4NKOA 1EZVY 4I4WB 1TVBA 5D1ZB 3ZT6A 3BYTA 4PG2C 4MDJA 4XX1E 2F19L 4OM1L 1BFVH 3UTTB 4LEXL 1I1AC 3UEZA 2HT4C 3BX7C 5J13B 1MY7A 5C0CB 2AGJL 5B3JF 2GKIA 4H26B 4R2GC 3K1DA 3MRLA 1F13A 4YFDB 1A8JH 2QHLA 4H88L 2A6JB 1Q9WB 4HKBA 1TJHL 5FF6B 3RBGA 1NAMA 4HJ0D 5ACMA 5BCAA 4PJ7B 1T80A 1T2QL 4LSVL 5EUOA 2XN9B 4WFHE 3L3DB 3SEPA 1ACZA 3WIIH 4ELKA 5ICZA 2XTJC 5AAMA 3GMNA 4XB7A 3VXRD 1UB5B 1R3JA 3CD4A 1A7RL 3CLFH 1F4AA 1L6XA 1QSEA 2WW8A 3D69A 4RIRA 4M6ML 4HDIB 3KPSE 1YMME 3PHOB 4JRXE 1ODAA 1GZPA 1ZANL 2ZNXA 4HGWA 4WI3A 3TPUA 3JVGC 5GRUL 4JQIH 4RX4D 4GQPH 3T2NL 3H8NA 1N0LA 1MHCB 4NM4L 1RPQA 3LDBB 3U9UA 5I1LB 4NZUH 2AK4D 3Q5TA 4ONFL 2BVPA 3FRPA 3LEYH 1AQKH 5DYOA 3UTZB 5A16A 3DMMB 3C5SB 1QLFB 2CXGA 2EDYA 1EUTA 1DVFC 7FABL 2I26N 3SJVD 1FH5L 4PV8A 2IBZX 3K46A 3GMMB 4A2MA 5F72S 3OBAA 4J4PC 4HLJA 4XTRD 1D9KA 3BE1L 4GKZB 4RQQA 3VD3A 1CLOH 3LKRB 1IAOA 3GMPB 3OR6B 4FQCL 1EXUA 5DSCA 3WUWG 4M02A 2WBJB 3I50H 1I9JH 2H2PC 4M5YH 1U8NA 3MGOB 4IRSD 2VLRD 1N2RA 1VSCA 2VDNL 3D39A 5GS0C 5IEKA 5KOVC 3HCVB 3QNXB 3S36H 1OF2B 1MAML 3ROOA 3DO7B 4YAQA 5DFTA 4LPYA 2V5YA 3ZTNL 3VXQB 4U1GC 4OFDA 2DTML 5IMKA 1AGCA 3QA3B 1JK8A 4APQC 1K2DB 2QADD 3QO0B 3T0XA 2DQGH 1RUPH 2VLJA 4LCUA 1A6AB 3NAAH 2QJDA 5F89B 5EOTB 1OLLA 5TE6H 4Z8FH 5I18H 3DGCR 4LLVA 4PG2A 4S1RH 1YY8A 4KDTC 5D6CB 3UP1A 4XCNA 1I1AA 2XY2A 4WHYH 1LEIA 3BUYB 4QO1A 1P4BH 3ARBD 1F4WH 5D7JC 4X4YB 5DJ2B 1KACB 3MJ9H 3ULVC 1D6VL 5E5UB 1JHLH 1JF1B 4RNRA 5IIEA 3NABH 4GJTB 3GM0A 1CZ8H 1WT5A 3BHBA 1F02I 1WEJH 4L8BB 2OR9L 4G9DA 4L4TB 1ZT7A 3HE6B 5ESVB 1CK0L 3BRFA 4MLSA 2WINB 1WFNA 4HUWB 1IAIL 3R8BB 1CFQA 1OGAD 4PJBF 4OIIH 3RWHA 5E9DE 3MGAA 1JZ7A 1ED3B 2EDHA 4JJ5B 5SX4I 3OZ9H 4JLRB 3JVGA 3LPFA 3V7AG 2HFTA 3VDCA 4ISVA 2P8MA 3QG7H 1OAQH 3GBML 4R3SA 2NCMA 3K74B 5DQ9A 3RGHA 4PGEA 3SDXA 2NTFB 1MOEA 1XF3A 3F7PC 1GPOH 4WW1B 4LGRB 3ILQC 2W0FA 4PBWD 2VL5A 4DVRH 3MV8B 3WUWA 1HHKA 4WVRA 3MLWH 4OLEA 1RZIA 5IHBA 1MIML 2ERJB 1DVFA 5ESQA 3VD7A 1HH6A 4X80L 2P5WA 4MA8H 5FM5O 3MRDB 4J4PA 2A6DA 3L3JA 4KJYA 4Y4HC 3MODH 5BO1H 2IPTH 4KUCF 3WIFB 2A73B 3SPVA 4S1QL 3VXNA 1VPOH 1GGCL 1RFDL 4NQEA 1PDKA 3OXSB 3ULVH 1XAUA 2XZCL 3GB7A 4QT5B 1T3FA 4OFYD 4PJIB 2Z91B 3JUYA 4EN3C 4NKOB 4P5TA 4V1DA 1TVBB 3B8SA 2H6PA 1UB6A 4M48H 2D31B 3L5IA 3MLSL 3EJYD 4MDJB 4APQA 4Q0XL 4UT6L 4ZODA 1PYWA 4X7DC 4HXAH 5FKAB 1I1YB 1BWWA 3RY4A 5C70A 3MRLB 4MAYD 4ZYKA 1LP9E 1YA5A 4HKBB 2Z8VC 5FOBA 3PL6B 3MRRA 1N0XL 2BZDA 5JHDE 1XEDA 3U1SL 4KTDL 4EVNA 1CXHA 1E4XH 4KRNA 5JIPA 4WGVB 2IAMD 3VFGL 1B6UA 5D7JA 5ICZB 1HWGB 3GMNB 1KSRA 4IOIA 2VQUA 1KEMH 5EOQH 3MLYL 1WITA 3WFDL 3IFNL 4ZAKC 3D69B 4RIRB 4LSPH 2XWJA 3CFIC 2AV1A 3MFGB 4WIQA 4HGWB 1GZPB 4ELMF 5B3JE 2K7QA 3D9AL 2ADJA 2GSGA 1FNAA 3LMJH 4X6CE 5CGMA 5CLWA 5D72L 2GTWA 3G5XA 4NO3B 5ADOL 1IGJA 1ZTXH 3PGCA 5AZEH 4KVNH 3IDUA 3E2HC 2Z31D 4K8RH 5I19H 5DJZA 5E8DH 4XNZC 2MMXA 4FQ1H 1KCVL 3LVEA 2BVPB 3FQXA 3QXUA 5DZOA 2V2XA 5FA4B 5B22A 3QBTB 1S78D 3Q2CA 3GMRA 1T21A 3N1GC 2AABH 4XI5C 5DUPH 3OPZL 4MA1C 4PV8B 5L0QC 4XBGA 1MWAA 1S3KH 2FDBP 4Y5VB 1D9KB 3VI4F 2FHBA 4OIBA 5HJ3A 3DSFH 1EXUB 5DSCB 5F6IC 3RHWK 2EEBA 1JI1A 4JY6A 1IJ9A 1U8NB 3TCLA 3ULSA 4UTBL 3V4PH 1N2RB 4I3SL 3D39B 5HHVH 2OJZL 4FNLH 5CSZB 1QKZH 4Y4HA 4X5WA 1XT5A 4Y2DD 4YAQB 1NAKL 2VWEC 4YQXL 1YEGH 3BKJL 4GKSA 3MBEB 5SV4A 4KKCC 3CLEH 5IMKB 3VXME 1AGCB 2XZAL 1JK8B 1IZKA 1JP5A 2VZOA 3CZFA 2VLJB 1JGVL 2E7BA 1U2HA 5F7WC 4EI5C 4I0PD 3O6FD 4M03A 4EN3A 2VE6A 5SWZD 2JKXA 5FKPA 1ES0A 1MF2H 4LLVB 4M7LT 3ZT7A 4XCNB 5IVOA 1WV7T 5C0ND 1FORH 1I1AB 2VC2H 2I9LA 5IB2A 3CX5K 3RA7L 3B9DA 5I8CA 1YQ2A 4G7YL 4R2GB 4GG6F 4POZD 3C08L 5KVFL 1U3YA 1KCSL 4LHUD 4NPYA 2DLTA 3QIUB 3WLBB 3EO9H 3C6LD 1IGMH 1P7QD 1NUDA 3OAUH 5HYQB 5SV3A 1CDGA 5M95B 4RNRB 1F6LL 2O5YH 2JJTC 3BHBB 4LDEB 2QSVA 3UO1H 2X4TB 2J5LC 2ICWJ 4WI4A 4Q74A 2XTJB 5TF1L 3O0RL 2FZ3A 4AM0A 3D2UA 1SMOA 2H1PL 1UM5L 4NZDA 4QRRE 3DX9B 3L3GA 1CFQB 1CLZH 1RZKL 4ZAKA 1SYVA 1FVDA 5E8EB 4Y4KD 3RWHB 5I8OL 4FQXD 1FZOB 3CVIL 3VCLB 1QBLL 1R6VA 4OGYH 1Q9OA 1DANU 2P8MB 2D0FA 4R3SB 5DFWH 3I3BA 4NQSA 5KVEL 4NQCD 4M1GL 4PGEB 1G6RL 1XF3B 2DD8L 3O9WC 43CAA 4FZEH 5B3NA 1MLBA 4W6YB 3WUWB 1HHKB 4P5KA 2DQHH 1UVQA 3PDGA 5FYJH 5C09A 1LNUA 1EFXA 5ESQB 2EYSB 4OCYH 4RMQA 3QWOA 2KPNA 2WWMC 4IM8A 5CP3H 5HHOE 4PJ5E 3T1FA 2YD9A 5J1AA 5EBGA 4YDIL 2A6DB 2X41A 1RVFL 2VXVH 4BSWA 4KJYB 3AVEA 4L3EE 3RTQD 4UT7L 5C7XH 1KTKE 4D94A 4TNWK 1KYOK 1N6UA 1EGJL 1QEWA 2GJ6D 4LHQB 3SPVB 5JA8B 3B9KC 1CG9B 3WNOA 4NQEB 3DX6A 3GB7B 4R4ND 4M1DL 3DTXB 3G5YA 4JPVH 4P5TB 4V1DB 2H6PB 4MXQD 2NQCA 5I30L 2BNRE 1H9VA 5J11C 4HF5H 5FGBC 3WDIA 1IT9H 1QA9A 4K3GA 5BV7H 2YUVA 3M45A 4EI5A 1DBJL 1R24A 4C56E 1S5HA 1ZVHA 1A1NB 2OXGA 4YC2C 3KS0J 4OCRH 3UAJD 5CP3A 3ZE0F 2I60L 4LVNC 2AJXH 4GBXC 5IGXL 1J8HB 4IS6A 5IWLA 2IMMA 3KPOA 4L4VE 4ODUA 1NEZG 5BQ7A 4GW4A 4LCYB 1OARL 3P4LA 2W9DL 1VEOA 4IMKC 3MNWB 4M6AA 4NYLA 4ERSL 2JJTA 2Q8BL 5ITBL 4XNQB 2AV1B 3ARVA 1FFNB 3E6FA 3HNTL 3RZWA 2ADJB 5JXAH 1VFBA 5K9KB 3DRQB 4KTYA 1IGJB 5EB9A 5K59F 3ULUC 1GHFH 3ALPA 2WAHA 2IMNA 5J7CC 4BSJA 3LN5A 3UTSE 5A43C 3N85L 1KNOA 2V2XB 3QG6A 4L8SC 3PP4L 3WNLA 3GMRB 1RZGA 1T21B 3O9WA 4Z7UF 2V5SA 3VXUB 1MWAB 1XGPA 3U0TB 3L5JA 4MQTB 3CDFA 2IANB 5HJ3B 3VXTA 1LWRA 2BFVL 5JDSA 2ZG3A 2RCSH 4U6XA 3RFZC 1M7DB 2Y5TA 4F9LA 4U6YA 1WBYB 4JY6B 3HI1B 1KELL 3TT3H 3ULSB 3NZ8A 5IKCB 2W0LA 5E2UL 3FT4A 1VFMA 1FC1A 4X5WB 2JTDA 4NUGL 4WUUE 1CFTA 4ZXBC 5KN5B 1MY5A 4G9FA 4L29A 4JN1L 3KLDA 4F9PA 3QUXD 4GKSB 1LO4L 4MNGA 3B9KA 1Y6MR 2WWKO 5DDHB 3CZFB 3GUTA 1MJ8H 1PSKH 4F58L 1RIUL 4LPVA 1FL5A 1O7SA 3MACL 5FKPB 4FZ8H 3P9WB 1SEBB 4MAUL 4L3CB 3BPNC 3LS5L 3MV9D 5FGBA 3ULUH 5C0GA 5HDBF 5IB2B 5I8CB 3BKCH 1NEZA 3QEGL 1M71A 4HIXL 1PLGL 2VLKD 1SBBA 3HNSL 4DOHB 4XVTL 1YQVL 4XMLH 4GBXA 4ZS6D 3H3BC 4TQEH 1G7HB 2H32A 1D5XB 1RMFL 4KJWC 1QD0A 4UOW1 5TPWH 3MCKA 3OGOE 5FM4A 1B6DA 3BIKA 4CJ1A 2J6EH 1K3ZA 3L3GB 2X5PA 2GTZA 4IMKA 1JRHH 4ORGA 2CRYA 4BZ1H 1P7HL 4N8VG 1YYLL 5I66A 2XRAH 4PJHA 1YEEH 1IC4L 4GG6E 2CLVB 3VFWB 4AIZB 3TIDB 4NQSB 3TH2T 3OKDB 4YHML 3E2HB 1U92A 4PJ7F 5CKGA 4AG4L 25C8L 1MJUH 4G6MH 2DQUH 4JFFD 3X14A 4HKZB 5F9DC 1DZBA 3BZ4B 5INDA 2FX7H 1TTUA 1JF5A 2WIIA 1BVKA 3ZKNC 3P3YA 1DBAH 5C09B 1EFXB 4X6BB 3QWOB 4LCWA 4B53A 1CFVH 1T1YA 4NZRL 4MWFA 1OAYH 3MJ7A 3RGVB 3T2PA 1F4YH 3W9DB 2J6EA 5HI3C 4BSWB 3CPLA 1OSZB 2X05A 3E8UL 5D7IB 1H3GA 1NLDL 5HGGS 2R56H 4K71C 3HC3H 3MOQA 4MB4A 1DTUA 3DX6B 4JFEB 3KPRB 3ZYIA 4MX7B 2NXYD 5HPMA 1WFUA 3GHEL 4ZXBA 4OGAC 1PVHA 3P4NA 3QDME 4DGYL 1FFRA 3L95B 5E95B 2DDQH 2HH0H 4HK3N 1QA9B 4L9LC 2R9HC 3HMWL 2UV3A 4ODWB 1KEGH 3TJEL 4LASH 1L0YA 3KYKL 2X4QB 5IQ7L 3I6KB 1VFOA 3BP7A 3ZTJH 2QQKH 1DLHB 1IQWL 1PKQB 4LQFL 1GZQA 5KS9E 5I0DA 2HT3D 5C6WH 4YPJA 4NNPL 3SGEH 2R39A 5KG9A 1P69B 4KKNA 1Z5LA 3KPOB 5HI5D 3FO9A 4YHPB 5BQ7B 1RI8A 4DEPB 1KN2L 1HH9A 1XGTB 1I7ZB 1LO0L 5TGBB 5FGRA 4MDIA 1FL3A 1F58H 1AR1D 3A67H 4NYLB 4HWBL 4N8VA 4ZDHA 3Q48A 5GGVL 5IOPA 3D6GA 4MJIA 3RWJA 3LSOA 1VFBB 4UV4L 2F74A 1NBVH 4XPTH 3ZE0E 5F71A 5CZVL 2F5AL 3V5KB 3MRNA 1NMBL 3RDTD 1NSNH 4HC1L 3KPSD 4D8PA 2HAZA 3PWVA 2P24A 2R0ZH 5JW4N 5F96H 2YXMA 4G3YL 2V7HA 4EI6B 2A9ML 3MLXL 3I84A 3DX7A 3DVGA 5I1GH 2A77L 5CJ8A 1T7WA 2Z8SA 1EBAA 5C0JA 2E9WA 1XGPB 5JW3L 2BRQA 1QSFE 1BQSA 3IAGC 4PRIE 4W70A 5MEPB 1FNHA 2VH5L 1AI1L 4OQTL 5ELIA 5EH1A 5HHXL 3FN0H 2O5XH 3M8OH 3OGCA 4LRNL 2Y5TB 2PYEA 3SO3C 4PJGE 3P73B 2M8XA 3CGTA 3JTTA 2DQTH 4HCRL 4BM7A 5T5FL 2DQJL 4PJCA 5EZOH 5E2JA 4CVXB 4HJ0C 3KGRA 1LQSR 1CFTB 5E7BA 4CVZA 2ZZUT 1KJ2B 4Y5YB 2X89D 2VAAA 3CH1A 3RP1A 4Y19E 5MEND 2NY6C 1N7ML 3O6LL 3B9KB 1J5OH 1FO0A 5HI4C 5A2IH 1CL7I 1BOGA 5DC9B 4MA7H 1SJXA 3SCMB 1MREL 1FL5B 1DUYA 4XAWL 1UENA 5KSBA 4S10A 3RVWD 3WSQH 2WBWB 5J3HD 4DFIA 3SQOL 4L9LA 4ODHH 5C0GB 4WI7A 1YECH 3TT1L 3O11A 1OM3H 3NA9H 1NCBH 2Q6WB 1UKTA 4M7ZC 4YC2B 2IGFL 1M71B 4Z18A 3W2DL 5CEYA 1N4XL 5C07A 5KBNC 3O4OC 4R7DB 2VDKH 3LAFA 1GIGL 2J8UA 1H8NA 4GBXB 5ITFA 3HG1B 4OFKA 2F58H 5D96B 4PJIF 1S7SB 5JHLL 1BQHG 3WIHL 3RNKA 4Z78A 2GTZB 6FABH 4MQSB 3QDHA 2CIKA 2DLGA 5L8LB 2XZQH 3MMEB 3FMGH 1T83C 1UACH 5BMFH 4C59B 1SJEB 4EDWL 3TVMB 1C5BH 3B6SA 2NX5A 4M7JH 1U92B 4IRSC 5CZKA 2PN5A 1KCUH 3GK8H 5F1IA 2DQDL 1IM3A 3OJDB 4NZTH 3O3UN 3WKML 2V17H 5INDB 4MHHG 3GJEA 5DTFA 3THMH 4Q9QH 2JELH 3CU7A 3GFUA 1KCRL 3BXNA 3ZZ1A 1BVKB 2C3XA 4HHAB 2QADC 5GHWH 2FX8H 1ZLWK 1BBDL 1HI6A 1NGQL 4Q6IC 4HAFA 4Z7OE 3UTPE 3UTTE 3CX2A 5C0CE 3MJ7B 4B7LA 3ZL4H 5E8OA 1IGCH 4C54A 1EIBA 5HHMB 4PTUA 4NO5A 4YWGL 1AXTH 1F97A 1ZA3A 4JG1L 2E7LC 3ET9F 4PJ7E 5KW9H 3ARBC 1T03L 2XN9E 3C6SB 3KDMB 4R96A 4ZUWA 4PJFA 4WV1B 5JOPE 4LL9A 1YEIH 4WY7L 5HPMB 5IESH 2BSSB 4JE4B 4ZXBB 5EIQA 5FYJU 1FZKB 3NIDF 5IEHA 3HRPA 4WFFE 2R4SL 1ORQB 2B4CH 2V5RA 4NRXB 3VXRA 4JN2B 3H7BB 3EYFA 3S37L 4PUBL 4RFOL 3RIAK 1U41A 2B1HH 5ABDE 3JWOC 5FGCB 3RWGA 2G5BA 2IC2A 3KJ6H 3BPNB 4MQ7B 1JGLH 2GEEA 1X5LA 3O2DL 4RX4A 5KG9B 1J0KA 4U0RC 4UINL 1Z5LB 1BQHA 4NGHL 3V5HA 1A7NL 1L7IL 4HWZA 2OZ4H 5IBTL 3U4AA 4Y16D 2AK4A 3KLSA 4MDIB 2HFGL 2NY7L 1FL3B 3SDCB 1WBZA 3HE7D 2OYPA 4N8VB 1DQML 3NPZB 4X98A 4IRZL 5CJBA 1ND0B 4M9PA 4IRJB 4TUKL 4WU5B 5FXCH 3LSOB 3SJVA 5LWYH 3SE9H 2Q76A 3UJJH 3QO1B 3TLRA 1WCBA 5L2KD 5IMLB 1JZ8A 4OLZL 3MRNB 3GIVB 3BQUB 1F3DJ 4C83B 3O41A 35C8L 4D8PB 1F11A 4MNHA 1GVIA 2P24B 3PWVB 1T83A 4PRNA 2EDLA 2YMXH 3P0VH 4XP4H 4M61A 3CCHA 4F7TB 5I1KH 3VG9B 5L7XL 1JNLL 3BESR 4XCFL 1INQA 4K3HA 3B5HA 4Z76A 4ESKA 4IRSA 2AI0L 2VLRA 2EC8A 1A7OH 1T5WA 4P46D 4YHLL 2BJML 4TUOA 3LRGA 4WO4B 5T3ZD 5IFJB 3LKNA 3DV4A 3HI6L 5FYKE 4Y5XC 3OG6B 2FX9L 3ECBA 1O7VA 5D8JL 1NCCL 1VGEH 3RVUD 4Q6IA 3BIBX 1MFNA 3JWOH 1KIUA 4MAYC 1T7VA 2OP4H 5KTEH 5CUSH 4PJCB 4OGXL 1HZHH 5I2IB 2ED9A 4CVZB 3PABA 2Y23A 4LSUL 4Z7NF 2VAAB 2Y36H 5TE7L 1IEBB 3T0AA 4XT1C 1FN4A 3ARBA 4ZD3H 1FO0B 2IAMC 3OKLA 1FLRH 1QFUH 1NJ9B 2VISA 1BOGB 3IXTA 4L4TE 3DV6B 4JFPA 1LMKA 1UEMA 3EOYG 1IM9D 2Q7YA 2FIKA 3VXMD 1NCUA 4R8WH 4L9LB 2EDWA 4NHUA 4L8DA 5KVMC 1N64H 3GM8A 5CD5D 2V9RA 4JVWA 2EEAA 4EUPH 1PBYA 1OGAA 3TA3B 2Z31C 2A6KA 2A74A 4Z0BH 1VDGA 3CFEA 5C07B 4RMTA 4PJAA 4JKMA 4JFOA 5E8NA 5ITFB 1CDHA 4K9EL 4ZPVB 2OK0H 4BQCA 4EXPX 4YHNA 3H9YA 5EG6C 1CXFA 4NM8L 1AY1L 1S78C 3NBNA 1BAFL 4HIJA 2KQNA 1F00I 1UWEL 2BHYA 4LK4A 4RAUB 2CDFA 3U9PL 2CIKB 4RMUA 3CDGA 4GW1A 2E6JA 2GCYA 3G6JB 4AIXA 3VMNA 3BD5A 2DQCL 3CFCH 1INDL 1ZVYA 4JR9H 5LBSL 4S1SH 3DJ9A 1RJYA 4MXWL 1DBMH 1GJIA 4JZOB 4KROD 5F1IB 5FHAH 2J8HA 5I73C 3HZYA 1TXKA 3CK0L 5KVDH 2EH8H 4Y2DC 2G75A 1CIUA 4PJIE 3GJEB 3LD8B 5DTFB 5E94A 1NCDH 3SOBH 2AK1L 3C9NB 2R4RH 4YUEL 3S98A 4U49A 4OFYA 4A2LA 4I0PC 1QPPA 3O6FC 4HUUB 3SDDD 3TESA 3TWCH 3KYNB 2I25N 4H0GA 5IFAL 1K5NA 2H2SC 1CBVH 2HP4A 2C3HA 4PTUB 5C0NC 2DQEL 1ZA3B 5EO1B 5I1AB 3SO3B 1AGDA 4LLYA 4OD1L 4MAYA 4POZC 3DO3A 1UJTA 1QP1A 4R96B 4ZUWB 4ZQKA 3C6LC 3CVHH 4GAJL 2F54D 4HV8A 4EQ3A 5HYJD 3VWKC 4KI5F 1QSEE 3OKYA 2IAMA 1D3CA 12E8L 4WW2F 4LHUG 3S37X 3SE4C 2PYFA 4LQ1A 3I85A 4OZFG 2F19H 4OM1H 3TZVD 4LEXH 5F9OL 4YPGB 1E4XI 2ZWLT 4O2FB 1H3TA 1BBJA 2AGJH 4FQXC 2G5BB 2BC4B 3PWUA 2ZP0T 1GGTA 3LRHA 4P0DA 2IF7A 4P2YA 1TCRB 1TJHH 2I9TA 3V5HB 2FIRT 2Z31A 2WANA 1A21A 3OXRB 4N5ED 2LTQC 4YZFF 1RIVL 1T2QH 4LSVH 2AK4B 4KUCD 4AMKL 2GI7A 3CVHA 4MSWB 5CS7A 1WBZB 3MBXL 5IW6B 5ERWA 4X98B 1EMTL 3C2SA 2X4NA 2AJUL 5IMOA 3QUKB 4J3SA 4LMQE 1BJMA 4L4VD 4CNIA 1MCKA 2E7MA 2Q76B 1X7QA 3DUSA 1C5CL 3HC4L 4ZFZA 1G9EA 1ZANH 1KCKA 4N0RA 3VXSB 4OF8A 1I3UA 5GRUH 1UWXK 3O41B 3D39E 1F11B 3I9GL 4MNHB 1AIFA 5TDPB 3T2NH 2HJFA 2OSLB 4NM4H 4PRNB 2XKNA 3ARSA 4ONHA 3P4OA 1FRGL 4J12A 3MRIB 2YSSA 1INQB 1TQCB 5ANMB 4ZSOA 2VLRB 4LLQB 3ZE1F 1HQRB 4JDTL 1IFHL 4R4NC 3MXWL 4TUOB 1J0JA 2VLJE 4Y2DA 3LKNB 1QLEL 1X5JA 4UDUA 2GK0B 4MXQC 7FABH 4YBHA 1FH5H 5BS0D 3AC0A 2UVFA 4FG6D 3ECBB 2QADB 1KIRB 1RK0A 3GSXA 2QSCL 3NIFF 4NC1C 4LSTL 4WFGE 5TH2A 1OL0A 2AJSL 4I0PA 3O6FA 3DUUA 4M93B 2ZCLH 3NCEB 5SWZA 4FQCH 2P8LA 4I9WE 3UAJC 3IDJA 2KH2B 3RIFF 4P3DB 3MR9B 1SBSL 3MUZ1 3MA7B 4LSRL 2VDNH 1A6UL 3NPSC 1UZ6E 1MAMH 2R2HA 3FO1A 4LHUA 1HWHB 4RWHA 3OKLB 3ZTNH 2DIAA 1RZJC 3C6LA 1ZA6B 3CFKA 3C2AL 3IXTB 3NZHL 1P7QA 4OZFA 2DKMA 2XTJE 2DTMH 1MAJA 1S9XA 5HHNB 4QXTA 3U7YH 4AZ8A 2MWCA 5FV2A 3N0PB 2Q7YB 2FIKB 4I1NB 2FYYA 1ZLUK 4NHUB 4L8DB 4XVUD 4DGVL 3RWCA 3SE4A 2DLFL 3KHOA 2YRLA 5DK0A 2PW1A 2P43B 2A6KB 2A74B 5D7IF 5CJQL 2R1XB 3HI5L 4FQXA 5JW5A 5E8NB 4JFXB 4P4RB 5BOZG 2DB8A 1HNGA 4YHNB 4U0RB 4NQCA 3KPMA 3NCCB 5GRWA 1D6VH 4EKXA 4HIJB 1FSKB 2CDFB 1HILB 1ZEAL 1AGFA 1U8OA 4OD3L 2NY0D 2P5WE 4BH7B 1CK0H 4GW1B 3QUZD 4XNMA 1IAIH 2DM2A 3V52L 5DT1L 2XA8L 3BPOB 5IB4B 2EDRA 1BLNA 3PUCA 1MH5A 1BREA 5TQ0L 1H3XA 4OCSL 3GBMH 4NQEE 3RTQA 3HZYB 1EZVX 2G2RA 2QR0A 2G75B 5E94B 1I7UB 3QUXC 1MHEA 4KH2A 3MRMA 2GJ6A 3GSVB 3QPXL 4V1DE 4H8WL 1NUFA 5K9OA 4GKOA 1HDMA 4U6HA 1DFBL 1EA9C 3RI5K 4PV9B 4LSQL 2VSDA 1MIMH 5CHNA 2DBLL 1MHPL 1W2KT 1K5NB 1Z9OA 3DETD 3EGSB 4X9GA 4P5MA 4X80H 4D9LL 4J1UB 4AY0A 3WFCL 1CD9B 4MCZA 4NQUA 1XGUA 4YXLL 4H1LG 4LLYB 4M8QA 1KGCE 1J8HE 4MAYB 4XCYA 3U36A 4ZQKB 4OBSA 3LPWA 5DK3A 4S1QH 5FO8B 3H42L 1MRCL 4ZS6C 1GGCH 1RFDH 2W9LA 1OSPL 2XZCH 1UGNA 1IC5L 4NKMA 2IAMB 4R4BA 3HTLX 2CMRL 3V7AE 4KGJA 4TSBL 1FYTD 1JUFB 3MLSH 1EV2E 1V7ML 1EK3A 4Q0XH 4F3FB 4UT6H 1CGUA 1WWAX 5FYKL 3B4NA 4I3GA 1KXTB 3LIZL 5EO9B 3PWUB 1IGFL 1S7VA 4R97C 4NOBA 5IB1B 4UV7L 4HGKC 5F7DA 3ZDZF 1N0XH 1PX4A 3IU3A 3U1SH 4KTDH 4U1IB 1ETZA 1XIWD 5JNYA 4XWOD 3ETBF 4RZCB 4I13B 3VFGH 5IFHL 5LKNA 5H94A 3FB5A 4GMSL 2X4NB 5IMOB 2HLAB 4JY4A 3MLYH 4LPCA 4CNIB 2VMFA 1B4RA 2IANE 3QUYB 3IFNH 1G7IB 3WFDH 1X7QB 4CVUA 3DUSB 2VXTL 4LPUA 1L0XA 4ZFZB 1U8QB 3IDIB 3D9AH 4QRQA 3W11C 4BK5A 4NUJA 5D72H 3QEHB 4PRPD 5ADOH 1AIFB 3BGMB 2FBOJ 2XKNB 1IVLA 4ONHB 3P4OB 1S7WA 5I74B 4YEFA 3C09B 4YZFE 2YSSB 1TZHB 4YDVA 4DVBA 1BM3L 3PDDA 4U1JB 5A2JH 1EVUA 1VEPA 4LVHB 5ENWA 1RUML 2AKRA 3QUXA 5AD0A 1H3WM 1H5BC 1A3RL 1TDQA 3OPZH 1HXYA 5DMIL 3GSXB 2MPAL 4H1LA 4NBXB 4MS8D 2V2WB 1QSFD 1RZKC 3TBTA 2HFEA 3ZKSD 3NVQA 5EIIA 1LK2A 2B1AL 1S5IL 3MV9A 1JV5A 2IQAA 4URTB 2HT3C 4UTBH 4P9HL 4DOHE 4I3SH 2OJZH 2VKWA 4XBEL 3ZE1E 3S97C 3STZA 4UNTA 2OM5A 1NAKH 4P2OD 4WHTB 4HIEB 3ROLA 3VJ6B 5HI5C 2VLKA 3BKJH 4D0CB 4OZFB 1R3HB 4G6JL 1IE5A 1S9XB 2XZAH 5JQ6L 4X8JA 4JGMA 4X9HA 4MMXC 4QXTB 2FR4B 1AR1C 3TNNB 1JGVH 1QSZA 4UQ3B 4R26L 5HVHC 1S7XA 2VIRB 4GS7B 1J1OL 2FYYB 4PP1D 2FL5A 1EVTC 2YK1L 2NLJA 3RWCB 1IMHC 1B4JL 4U1SB 5D7KD 3ZKQD 3I6LE 2PW1B 4YHIA 1A2YA 3ZE2E 3LHPL 3DLQR 4Y4KB 4Z5RA 1G84A 3CDCA 3RA7H 5JW5B 3DROA 1DQQA 4G7YH 5FFLA 4BFIA 5DJXA 1X4YA 5KVFH 2R8SL 1KCSH 1ZS8B 3MUY1 5T1DL 4MA3A 3LKOA 4L8CB 2NW2A 4XP6L 4DKFH 4NQCB 1JRHI 1YDPB 3KPMB 4PRBA 1KXVC 2LTQB 3CZJA 3U82B 1RURL 5C09E 1B0GA 3PF2A 4QHUB 1AGFB 1R5WB 2CKBA 1U8OB 4GMTL 3T77B 3PJSB 3PNWA 5ICXA 1G6VK 5IVXB 4WJ5A 3GMLB 3BGFC 3O0RH 2H1PH 1UM5H 2D03L 1NGXA 1RZKH 5H35A 3MV7D 5I8OH 2KBGA 2MKWA 3CVIH 1QBLH 4C4KO 1MH5B 3QXAA 9CGTA 1FNGA 3RTQB 2X4UA 5KVEH 2G2RB 3P9LA 4M1GH 2VWEE 4OCWL 1G6RH 2GJ6B 2DD8H 4LGPB 5CAYB 3AAZA 4KTEH 3BO8A 1HDMB 5EWIL 4ODSH 1CGVA 4UAOC 1KV3A 1F4XL 2YRPA 2CGRL 4XPBH 4UQ2A 3WHE0 5FYJE 1HSBA 5E2WL 1H5BA 4ODTL 4P5MB 3WMSA 1FGVL 5J3HC 4YDIH 2EE9A 4FQQB 2DM3A 1RVFH 1RHFA 4LP5A 4M8QB 3UYRL 4UT7H 5EBWA 4K23L 2Y5EA 1HHGA 4JQXC 5E2VL 1EGJH 1KJMA 1IAIM 3RX5A 4TNVF 3NPSB 1J7VR 1DQJB 3IETA 4FXKA 4M1DH 1L4IA 4NKMB 2Z4QA 5MEQA 5I9QC 5D1XB 3IAPA 5DVNA 5I30H 3UXFA 1QFPA 2NY3D 3SGEI 4GUPB 1ZWIA 1DBJH 1C7SA 1YPZA 4F7PA 5HHPA 3NFNA 1FFOA 2HLFD 2W38A 4FQ2L 4L3AA 4PJCF 4OV6F 1NCNA 5JLZA 2I60H 3IU3B 1MNUL 1FFPA 1ETZB 5IGXH 3RDTA 2ATKA 1MCPL 1VFUA 3KPSA 2X4PA 1F42A 2WLZA 3CJJA 2RR3A 4CDGC 3P30L 1OARH 2W9DH 4JY4B 3P77A 4ERSH 2Q8BH 3SDYL 5ITBH 4X7TA 2VO5A 1ZLWH 3HNTH 1Q9LA 3P11L 4QRQB 2C4XA 3BP4A 1MELA 2JJSC 1OGTA 2DJSA 3N1PC 1YN7B 5DFVD 2CDGA 3ZDZE 5FIEA 3BD3A 1S7WB 2Z9TA 4YDVB 2UUDK 5BJTB 4DVBB 4MNGE 3AMLA 5DWUL 3PP4H 4N8PA 2AXGA 5AD0B 2X89A 1X5KA 5MENA 1HXYB 2CK0L 1P4LA 1IL1A 2FNBA 4NCC1 5E70A 1D5MA 3G6JF 4EDXA 2BFVH 3TBTB 2HFEB 5FYKD 5C0AD 2IPKA 4WI9A 5DS8B 3A6OA 2YD4A 3BIAX 3TEUA 1KELH 3MV9B 3IDXL 1KPVA 1P2CA 2P8PA 4EIZC 4GXUM 5E2UH 2VUOA 3STZB 4HZLA 4NUGH 2APTA 1T5XA 2VLKB 4JN1H 1QNZL 3NOIA 4UIKL 4Y16C 1SJHB 1LO4H 4O2CB 1ZGLA 4TOYL 4X8JB 4XMKL 5CD3A 5GS0L 3T8XA 3HE7C 1F6FB 1UXSA 4F58H 1GGYA 1RIUH 5JOFA 1BF8A 3F7YA 4X6DB 5D5MA 1S7XB 1AGEA 3QNYA 4OQ1A 4JDVA 3MACH 4P9ML 3SGKC 4PFEA 4PJHE 3DYOA 2IADB 4MAUH 3LS5H 4Z5RB 1KPRB 3ULUE 4HUMB 3GSUB 1DQQB 1H0DA 3QEGH 4G8IA 5K93A 3EOBA 4MA3B 1AGBA 3LKOB 1PLGH 4HIXH 3RL1A 1X5YA 2D7NA 5DRWB 3HNSH 2NW2B 4XVTH 1YQVH 4P4KC 4Q2ZB 1YYMH 2HKFL 4JFFB 1RY7B 4P46C 5HYIA 1N5YL 3NH7L 3U7WL 4B50A 4ALAL 4LCWE 1RMFH 1C5DA 3PNWB 2X42A 3EYSL 4WJ5B 3RKDD 1WZLA 1CICD 4ZOBA 2BOCB 3TBVA 5HHQB 2X9XA 4AEHL 4X6EA 3MV8D 1AD9A 1NGXB 5DRZA 3RVUC 3R1GH 5H35B 5IMMB 4O2EA 5H2BA 1SM3L 1WAAF 3RWEA 4U7MA 1GOFA 1D5BA 1U8LA 1MQ8A 2HJKB 5CJ5A 5CBEA 1DE4A 1IC4H 5JIKA 4MVBC 2ICEB 3QR2A 1FNGB 1DBKL 5CKAA 3UBXG 4PTTB 3R4DA 3P9LB 4YHMH 2IALB 3QQ3A 4AG4H 25C8H 2GY7B 5BVPL 2BVTA 3FCTA 3FOLA 4OBRA 4QHNB 3IDYB 5F7NC 2NXYB 4QLRA 4RFNC 2GHWB 2A9NL 4UQ2B 3P2TA 2A6IA 2VQ1B 1P84J 4RGMB 4PB0L 3HMXH 1MWAL 3KJ4B 2XQBL 4NZRH 3FT3B 1P7KA 5FGCE 4OLVH 4KVCL 4F33A 4DJMA 1JZ6A 5EUKA 5CD5C 5EBWB 4I2XB 3E8UH 4NWTL 1NLDH 2FGZA 1DQTA 4XAKE 1EBPA 2BY1A 3MUJA 2ZKHL 3PL6D 1JIBA 2R29L 3IETB 2C1PB 4B5EA 5FHBL 3VFVA 2Z4QB 3GHEH 4NSKB 4OB5L 4DGYH 1A4JA 4Y16A 4MJIE 1B88A 1P9MC 3V0AC 3BH9A 3TO2A 3HE7A 4NQTA 2NY5L 3Q3GB 4QF1A 4OZIA 3HMWH 2K1MA 3TJEH 3FN9A 1YPZB 2I27N 3KYKH 1FHGA 4F7PB 1A3LL 1MEXL 1FFOB 3LS4L 3NFNB 5DK2A 5IQ7H 3SGKA 3DX8A 3FKUS 4F80A 1IQWH 3LKPA 1WFOA 4LQFH 5JLZB 5L2KA 3IFPB 3T0EB 4NNPH 3J7HA 5EFIA 3RDTB 2ATKB 4QHMA 1OAKH 2D7PA 4WRLA 4WTWA 4HPYL 3VW3L 2A1WH 1KN2H 1XGQB 2D7OA 4K3DL 1VEMA 1LO0H 1M7XA 4OCNC 2R23B 3ME0A 3P77B 1HEZA 3ZO0A 4M4PA 4P46A 1QR4A 4HD9A 4HWBH 3GI8L 2HVKA 4X7TB 5GGVH 3SDDC 3O6KL 4N90D 2PYEE 2QLVB 3FQUA 3O2WL 1Q9LB 3UBXA 4Q9RL 1OGTB 4UV4H 4ZPTB 4X4MA 4PJCE 2CDGB 2F5AH 3AREC 4BQBA 2WUBL 1NMBH 3VFMA 1EEYA 4HC1H 4KRPB 5FUOL 3O3AA 5CWSB 5MERA 2IH3A 4G3YH 1OWRM 2DS4A 2YUWA 4UU9B 1WVZA 4GAYA 2EEDA 2A9MH 3MLXH 3VD9A 1UM4L 4PJ8B 3IDGA 2Z0BA 1CT8A 2A77H 4P3CL 4TTDD 5DJ8B 1CR9L 3P9MB 1I7RB 1FNFA 1MCRA 1XF5B 5AYQA 5MENB 2ICES 5KSBE 4YIQB 4LAJH 5JW3H 5A2FA 5MP6L 3MBED 1NFDF 2A83A 1OT2A 1X6LA 2VH5H 1UZ8B 1AI1H 4OQTH 5HHXH 4HFWB 3TZVC 4LRNH 1Y18B 1IM9A 4AH2A 3VXMA 1KPVB 2ADGA 4J3TA 5C07E 2DLEA 4DAGH 1FG2A 4HCRH 1YUHA 4PJEF 5T5FH 2DQJH 3SDAB 1QPXA 2OTUA 3RAJL 1EHNA 4N5EC 5FYLE 5DHVB 1ZGLB 3MGTA 1QLRA 1G7LA 3O6LH 1N7MH 1R5IA 2W60A 3QIUD 5ETUA 2VUYA 5CD3B 4OLYL 3KLHD 5DEFA 3T8XB 1UA6L 1S9YA 1IAKA 2D9CA 3RUGF 3PDOA 3DIFA 5JOFB 4AYFA 3F7YB 5D5MB 2PCPA 2B2XL 5GRZA 3QNYB 4JDVB 1MREH 4NKIL 2WM0A 2ICWA 4XAWH 4NDMB 3FJTA 2QSTA 1J10A 1P9MA 4TPRL 1YMHA 3T09A 3SQOH 1FAKT 1HQ4A 3TT1H 4YGVA 2EE3A 4G8IB 4DK3A 2IGFH 2JE8A 4NKDA 5FECA 3W2DH 3EOBB 1F5WA 1N4XH 3E1F1 3RL1B 1UWXH 1Z9MA 3H0TA 4LLWB 2B39A 2JCCF 1GIGH 1DEDA 1ZMYA 4O58H 1QBML 5FDWB 1JE6A 32C2B 3IFLL 5JHLH 3WIHH 4YK4C 4Z7QE 5FAAA 3TBVB 4KQ4L 3WLWD 1AP2A 4X6EB 1AD9B 3WXWL 5DRZB 2KQMA 3VGFA 3J8F7 4O2EB 2YEZB 3SDDA 3L3IA 1UQSB 1D5BB 1U8LB 4B0MM 3TPKA 5CBEB 4BQ8A 3SKJL 5CCKL 4M1CD 4EDWH 3NFPB 1OAXL 2BMKB 3QQ3B 3RQ3A 1T20A 5BZDB 4U1LA 4PJBA 2DQDH 4TN9A 3ZDXF 1P1ZB 3WKMH 3FCTB 4MMZC 3FOLB 3VGGA 3S3PA 2F54A 5J0BA 5GRJL 3LRSA 1F2QA 5DD3L 3QB7C 3UZQA 1OTUC 3CXHJ 1BBDH 2A6IB 5HYJA 1NGQH 4O02L 3BWAA 3WIHA 1P7KB 1KJVB 1MCHA 2H3NA 3KG5A 4CU6A 4XVUC 4G43B 1JI2A 1KJ3L 5EUKB 4OZ4B 1Q1JL 2CKNA 1G7QA 3CDYA 1ZVSB 3WJLC 2FLRT 1ZLUH 3C8DA 4CDHA 3TZVA 4RISL 4YWGH 4JG1H 5I76A 2F5BL 4DZ8A 3V0WL 1T03H 2AK4E 1NGYB 3L3HA 2DJ4A 3RPIB 4M6NL 4WY7H 1J8HD 3VFVB 1KJ2L 1KTLB 3WO4C 2OBGA 3VMPA 2C26A 2VXQL 4Y16B 5CFHA 2PR4L 3SJVE 3K3QA 4N8CL 1BIIB 4PGBA 2R4SH 2NY0C 3TO2B 2G9HB 2DJUA 3S37H 3VXSE 4PUBH 4RFOH 4L4VA 5T3XD 1FG9C 5DK2B 4M8VA 1EDQA 5DHYB 3LKPB 5F6HI 1IEAA 1KC5L 3QPQD 2EYTA 1LE5A 4XCCL 1QFWL 3EYQD 3PG2A 4PG9B 5EFIB 5SWQA 4QHMB 3O2DH 3WL9A 2VLRE 1DLFL 4KV5E 4UINH 4NGHH 4XHJD 1NGPL 3K1KC 1A7NH 5I6XC 1L7IH 5IBTH 4PGDA 2HFGH 2NY7H 1HEZB 2X6MA 1CQYA 1DQMH 1HK6A 4GRLB 4IRZH 1CFSA 3L5WA 4KI5D 3FQUB 4TUKH 5HY9A 3VXUD 4S1DD 2ZNWA 3DETC 5BS0A 1FCCA 3PV6B 4IDJL 1UJ3B 1OAZL 5IV2B 2IAND 5LCVL 3DECA 4OLZH 4HWEL 4ONOA 1SEQL 5IQ9B 1EEYB 1AHWC 35C8H 2VOTA 4NFCA 4MLIA 3O3AB 2EDFA 5MERB 3ILPB 4ELMA 4XGZB 5SX5K 4GAYB 3B3IB 1RUAL 1JNLH 5L7XH 4QYOA 4ZUSB 3IDGB 4HAGA 1CT8B 3GJFB 4YHLH 2BJMH 2CSPA 1LDPL 3L5XL 5IVXF 3HI6H 2A83B 4C55A 5JR1L 4RFNB 4PREA 1BFTA 3H9SB 4FQJL 3UMTA 5C3LD 5D8JH 1NCCH 5L6YH 1OGAE 4AH2B 1IQDB 3MYJB 1WZKA 1QBAA 4X0KA 4JHZA 3U30B 1YUHB 3U4EA 2D4DA 1KB5B 2ZUUA 4OGXH 3WJLA 2OMBA 5GQBA 4PGZA 4ZOCA 4AL8H 1XIWC 1Z0NA 1U8MB 4LSUH 5TE7H 5FO9A 3MGTB 3AFLA 1QLRB 1G7LB 1M05A 5ETUB 3ZSTA 4X99A 2ENSA 3MXVL 2GAZB 4FQLL 1QRND 3GBNL 1F45A 1UWGL 3DIFB 5GIRA 1DSFL 1QQDA 1ZE3C 2EIZB 3VA6A 1H3UA 2YXFA 3SGJC 3QULA 3QXWA 4GQ9L 1TETL 2EDOA 3DURA 3RWFB 2FWOB 2J88L 1YMHB 4NQVA 4AEEA 1JYWA 1HQ4B 2BRRH 3HC0B 3GSNB 4KI1A 4YGVB 3ARFD 5F7HA 2XG4A 5HYFA 3CAFA 5FO7B 4NNYA 4U3HA 3Q6GL 4HS8L 4NKDB 1JPSL 5CSGA 2JLLA 3BEWB 4KROB 2E9JA 4K9EH 4MD5A 4UTAL 1G9NC 4XPAL 4NM8H 1AY1H 1IAII 3T04D 2XFXA 5GPRA 3KLAA 1BAFH 1PX3A 1AO7B 1UWEH 3ES6B 1PAMA 4GKNB 5I71B 2BVQB 2BERA 1AP2B 5I1CL 2PW2A 3U9PH 4MS8C 3U46A 5DJ0B 3UJIL 1J05A 3EHBD 4LGSB 3O3DA 4KK9D 2OXHA 4J6RL 1U2CA 3TBSA 2DQCH 1INDH 4O5LL 5LBSH 2R15A 3QUMB 3RGVD 3L3KA 3U0WL 5MEOA 3MUHL 2IQ9L 4KHTL 4MXWH 5JPMA 3OG4B 1T20B 4PP2B 1M6OA 4U1LB 4PJBB 3TGXA 1REIA 1AHWA 1FVEA 3VMOA 4KDWA 3CK0H 4P2OC 1UH4A 1S9WB 1KT2A 4OFPA 1HYSD 2F54B 4JDZA 3LRSB 4JFED 2Z8RA 3KPRD 4YUEH 1JPTL 3K8LA 5HYJB 1A3QA 3MREB 5EZLA 3BWAB 5ISZD 1T6WA 4PP1C 4QHKJ 5IFAH 1FYTA 1G7QB 4N0YL 4A6YB 4YBQD 4FQHA 3TZVB 1M7IA 3RIFK 4GRMA 2DQEH 3WN5C 1UT9A 4YFEA 4DZ8B 4OD1H 5KZCD 4E9LA 4MQXD 3L3HB 3ZDXE 4F8TA 4GAJH 5DD5L 3VU2A 1U3JA 3GI9L 1XIWA 5IB3B 4FS0A 1NFIB 1FO0L 3D3VD 12E8H 2CO7B 4NN7B 1UKQA 4U1HB 5HDQH 4F8QA 5H37G 2UZIL 5F7FA 2AS5M 5F9OH 5EU4A 4QNPF 2O26U 4X8XA 2AXJA 5KSAC 2EYTB 2GT9A 1LE5B 1CWVA 4JQVC 1NL0L 3SBWC 1B2WL 5A1AA 4ZSOE 3TIEB 3JV6A 4PRPA 1S7TA 5SWSB 1WF5A 3HAEH 1RIVH 3DWTA 1T1XA 4MD0A 4LARL 4AMKH 1CE6A 4P57A 4PGDB 3BZDA 5GSVA 5GGQL 3V95A 5LGJA 3MBXH 5FYLL 5KANI 1EMTH 1ZLVH 4X6DF 1CFSB 3L5WB 3DRTA 2AJUH 4KXZH 2FATL 1GAFL 1NDMA 4YK4B 4W68A 1D6EA 5BS0B 5SWZE 1C5CH 3HC4H 5IJVA 2NTSP 4K3EL 3QFDA 1ERNA 1XCQA 4ETQA 1QSFA 3I9GH 3JV4B 3ZYOA 3VGAC 1A5FL 5I17A 4ELMB 5TFSL 3I3EA 4RGNB 3HPLA 3QCUL 1ACYL 1FRGH 5EC2A 3HS0A 5DXWA 4FQPA 4JDTH 1IFHH 5JW4R 3MXWH 2VZ3A 4JY5L 4OAWA 1YEDB 2EDDA 1CGYA 1KBGH 4P2OA 5MHSE 3UPAA 5J1TC 1QLEH 4PB9L 4I77L 4NCDA 5GGTA 4PREB 5LAXB 2NY3C 2VYRE 2QSCH 2UZYB 3SCMD 4LSTH 2YPVL 4HWUA 4EUPB 2AJSH 3VFPA 3WS3A 3DPBA 5DRXA 4QRSA 4Z7UA 2HLFC 3B43A 2EIEA 3PWPB 4P2RB 1SBSH 3B9VA 2HVJB 4LSRH 3SKMA 4NQCE 2DQIL 5FO9B 1JWSA 1JZ2A 1M05B 3K8MA 1F2XK 2XIDA 3LDBC 4X99B 4LF3A 2IG2L 1PD6A 5J57B 2F8OA 3IDNA 5IVXE 1QQDB 3C2AH 3NZHH 3HG1D 4YLQT 4PRDB 4DCQA 3WO4B 3QHTC 3MRKB 1JHTB 3DURB 5HYSA 2FBJL 5FDYA 3IAQA 1JMXA 1TVHA 5DURD 3QUZB 4DGVH 4KDVA 4HG4J 4N1CA 2ZUSA 2DLFH 4RSVA 4HWNA 3HUJB 4NNYB 2QSQA 5IBUG 5DFVC 3MV7A 5CJQH 3HI5H 3PQYD 5KSAA 2AEPL 4UUJB 1MCIA 5BVJA 2WBJC 3VFSA 5DD1L 4E42A 2GJ6E 4JQVA 4ZFFA 3SBWA 3CSPA 3TVMD 4Z0XB 3FRUB 3G5ZA 2H9GB 2UUDH 3DVFA 2XFXB 3CFDA 3RL2A 5I6XB 4MB5A 4HULB 3KLAB 1TITA 3U48A 1G7PA 3GNML 1ZEAH 5IHUL 1NKRA 5BZWA 3DGGA 2YD5A 4OD3H 2HTLD 2PW2B 4IOFD 4D0DA 4NC1E 5D7SL 3O3DB 1YEKL 4X83A 3WS6C 3TBSB 4QTHB 4ZTPL 1WC7B 3V52H 5K9QI 5IHZA 4JM4L 5I1EL 5DT1H 2BSRA 2XA8H 4KGLA 4DN4L 3HB3D 2R0WL 5JPMB 4D9RD 3SQBA 5TQ0H 1M6OB 5HHMD 3UTTA 4OCSH 5BRZD 1AHWB 4B7IA 4KMTL 3MO1B 5E6YA 2Y4SA 3FO2B 1DQLL 4QTIL 4AEIL 1ROWA 3N50A 3QPXH 4H8WH 4U31A 1DBBL 5EZLB 3CFJB 2APXA 4PJ7A 4XC1L 2W65B 2YBRB 4MNQB 4ZNCD 1DFBH 4MYWB 1OOAA 3BP5B 4LSQH 3AXLA 1UC6A 3HZKA 3N06B 2DBLH 1MHPH 1FYTB 2R2BB 3B8YA 4LNVA 1VADB 3HE6C 4D9LH 4FQHB 3WFCH 1M7IB 1XH3B 4GRMB 3C5JB 2BY0A 1XF4A 1XR8B 2IFFL 4YXLH 3RZCD 4HDIA 1HHHA 1NC2B 3H9ZA 5DHXB 2IH1B 3O2VL 2JB6B 4LDLB 4CGTA 3H42H 1MRCH 1W0WA 1OSPH 1I3RB 4W81A 4UIMA 1MHCA 1IC5H 3EFDL 2YPKA 3RKDC 2CMRH 5I15H 4TSBH 4CADA 3SDCD 1V7MH 3UTZA 1GSMA 5FYKH 1QLFA 2FO1A 4IEFB 2ERJC 4LEOA 4IRJD 3LIZH 2GT9B 2WP3O 1IGFH 4Z77A 1K8DB 5LGHL 3GO1L 4HS3A 4PRPB 4FFVD 4UV7H 3LKRA 1S7TB 1PFCA 3BQUD 4GSDL 3GMPA 5K9JH 3GMQB 3OR6A 1T1XB 3NFSL 1G9MC 1P84K 2E6PA 5GSVB 5IFHH 5LGJB 3MGOA 5ICYB 4KZDL 4GMSH 2H8PA 1WLHA 2I5YH 5F7KC 5D5MF 3DRTB 2UYLA 1U6AL 3HCVA 2ITDA 4HKJA 4KQ3L 1OF2A 1T6VN 4WO4D 3DO7A 1D6EB 3QWQB 2VXTH 3MJ6A 3HZVA 3UPRA 3QA3A 5GJSL 1X44A 1K2DA 3MV9E 3WUZA 3FL7A 4ETQB 3WS6A 1A6AA 5C0AA 5I17B 5EOTA 3HPLB 3FTGB 5JXED 1NLBL 2D7MA 2VLKE 3HS0B 1TFHA 3X11A 1BM3H 1NGZB 3PL6C 5D6CA 3WNKA 5GS2H 2QHRL 2BNUB 3Q0HA 1MCFA 4OAWB 3EO0B 3BUYA 1RUMH 4DK6A 2EIDA 1K4CA 1A3RH 4XXDB 4X4YA 5T33L 4U6TA 1UCTA 2MPAH 1J18A 1DUZA 3IXAB 4LLUA 2OQJA 4X5LA 3FOMA 1KUMA 3VFPB 4HJGB 4OF3A 4QRSB 4Z7UB 4O9HL 1F8TL 4KJQD 4P3WA 1JWUA 2B1AH 1S5IH 3VRLF 4MJ5B 2WINA 4P9HH 3SKMB 3IKKA 1WISA 4XBEH 3TA3D 2X1XR 3DI2B 4JFFE 1I8MA 2VZVA 4TNVK 1LVEA 3IDNB 4JLRA 3OJ2C 4G6JH 3PWNA 4DCQB 1J0IA 1H3VA 3PP3H 2LU4A 5FYLD 1U42A 4R26H 2FJHA 2NTFA 1TVHB 1J1OH 1CICA 2YK1H 4Y5VC 1B4JH 4NRZA 2D7TL 3L3OB 4Y0GA 3QEUA 3MV8A 1HINL 3LHPH 3MV7B 3LCYA 1DDHA 3MNZB 5BVJB 2DN7A 4Y1AD 4E42B 4JAMA 4ZFFB 2R8SH 5C08B 3ZYZA 3MRDA 2APWA 5T1DH 3MJ8A 2MCPL 3G5ZB 4XP6H 1ZT4A 2VDOH 1R0AL 3CFDB 3RL2B 2R0LL 3O8XD 1EFQA 1RURH 3SE8L 1G7PB 3IJHB 4GMTH 3DGGB 3MBEC 2A73A 2X4RB 4D0DB 4X9BA 1BJ8A 1CE1L 4KJPD 2WUCL 4JRYB 2D03H 5ALCL 5IHZB 4MD4B 2BSRB 2D31A 4FMKA 5DMYA 2IBGA 3UYOD 3MUGB 2CUMA 4PR5B 5F21B 1AH1A 1HNFA 5FKAA 1I1YA 3VGAB 1J0YA 4OCWH 3QIUC 1QSVA 2DF3A 2XTLA 3KLHC 3PL6A 2QQNL 1MQKL 1CGTA 3MOAL 5EWIH 5GISL 2Z35B 5B38G 3MC0A 1F4XH 2CGRH 3NAAL 3AXLB 3HZKB 1WT5C 1YPZE 5E2WH 3BGAA 4H0HB 2NY3B 4IIQC 1FGVH 3K2MC 1XF4B 5EOCJ 5MI0C 1KLFA 2CLZA 3TH3T 3UYRH 4DKEL 4K23H 4EXKA 1HHHB 1Q38A 1VGKB 1FP5A 5E2VH 1J0HA 5JMRA 3DHMA 4NWUL 4R4FL 2Q8AL 3STBA 1W0WB 4NO3A 1F6AA 4UIMB 4DUWA 3EDJA 3TFKD 2MQ3A 1PG7W 1L9NA 2YPKB 2WQ8A 3V0VA 1B90A 1LK3L 4OV5B 4CADB 1ZOXA 4U6VH 5IBUB 5FA4A 1NC4B 3BDYL 3T4AB 1PZUB 4LEOB 5DEZA 5KAQF 2WV3A 4FQ2H 4M1CC 1IRAY 4KK8D 4Z77B 4Y5VA 1ZKAA 4KRMB 4HS3B 2W9EL 3VXSD 5F1SA 1MI5D 2HJLB 1MNUH 3MROA 4PIRF 1S7QB 5JPNA 3CXHK 1MCPH 5DJAA 3T2OA 5F8QC 5MENE 1L7TL 3A6CL 3U6RB 4JPKL 2H8PB 3P30H 5CEXB 4KKAD 2UYLB 5CSZA 4UB0L 2ITDB 4HKJB 3TN0B 3SDYH 3U7AA 2WLYA 5HD8D 4P5TC 3HZVB 3UPRB 3MBEA 1N8ZA 4S2SB 4LNRA 3P11H 5C6TL 1BVLA 2ADFL 1TMCB 1J12A 4JKPL 5C0AB 2ICWI 5GGRB 1OT1A 3TBWB 1YNKL 3X11B 1MFBL 3TNMA 5B38A 2IJ0C 5FA3A 5D5ME 2Y25A 1K4CB 4LBEA 3HZMA 2CK0H 3QIUA 3WLBA 4P2QB 3BT2L 1DUZB 4LLUB 5HYQA 2OQJB 1A6ZB 1S8DB 3FOMB 4XVSL 2ZCKL 5E99L 3VFUB 3T2QA 2JJWA 3MPCA 2X4TA 3H9HB 1WTGT 1JWUB 3L5HA 4IIQA 1A14L 3QPQC 3IDXH 3EYQC 2VL4A 3DX9A 3HFML 4HT1L 4U2ZA 1I8MB 5E8EA 4FXLA 1FZOA 4WEMB 3VCLA 2D4FA 1QNZH 3W0WD 4TOYH 3PWNB 4JO4L 3KXFB 4XMKH 5GS0H 4PJXF 1RJZA 1EHXA 1PQZB 3DYPA 3A6BH 1JYVA 2FJHB 3QJHA 3U2SA 3OMZA 4KI5C 1RZJL 2YUXA 3KYOB 4S1DC 1CICB 4P9MH 4NRZB 4WW2C 3QEUB 2CXKA 1FNEA 3S34L 4XRCB 1JFQL 1DDHB 4H0IA 2EYSA 5CZXD 4JAMB 1EHAA 1GH7A 1KN4L 1G6RB 1A9EB 4HMEA 3MJ8B 4CMMB 1ZT4B 4F57L 4N0CD 4KUZL 5SX5H 2HKFH 2C7UB 4TSCH 3OTTA 4X7EC 3GMOA 4NZJA 3NH7H 3RWIA 1N5YH 1FPTL 3U7WH 4ALAH 5FB8A 3CNKA 2OI9B 3FONA 3EYSH 3O4LD 2E7HA 2Y7QA 1CG9A 4YX2L 1FC2D 3TV3L 4JVPA 4OUUA 3DTXA 5AZ2L 4BFGA 4AEHH 4P59H 2NY5C 2FCBA 3BUTA 1IC1A 1EJ6A 1SM3H 3L1OL 3GGWB 1OY3B 4G7VL 3VI3F 2OS7A 1MAKA 1PZ5B 1DBKH 3QWRD 5K33A 1YC7A 1I3VA 1BZ7A 4G6AD 2BP3A 2BHZA 4LP4A 4NQDD 2ENYA 4LLDA 1A1NA 4WENB 4W4NA 5BVPH 4NCC2 4NC0B 4RWYL 3R8QA 5GGUB 3CLEL 5EN2B 4JKLA 1J8HA 4GG8A 4CN6A 4OZIE 2A9NH 4IHOB 4NQXB 2RQ8A 1MWAH 1XGRB 2XQBH 2DI9A 4LCYA 1PG7L 3SKNB 4KVCH 2X7LB 3F6LA 5L2KE 1YNLL 2CLZB 3ARFC 5HTSA 1W72A 3MNWA 5EZIL 5GRYA 5T1LB 1VB9A 4XNQA 4OCXH 1WJ3A 1OQXA 1FFNA 4NWTH 3Q1SL 5HVFB 2B20A 2EXWD 5K9KA 3DRQA 5EULV 1KFAL 3N1FC 1F6AB 2ZKHH 3OAUL 4CL7A 5FUCE 2R29H 3UJTL 2NMSA 5FHBH 1YZZA 1BGXL 3V0VB 3QDAA 5T3ZE 4L5FL 5GGRY 4OB5H 4MCYB 3WV0A 4X4ME 2NY5H 3SO5A 5FCUL 2YPLD 1OPGL 3EHBC 2HT4D 3QUYD 4HK0B 4KK9C 3WDHA 1A3LH 1FJ1A 1MEXH 3ARTA 3LS4H 3VXUA 3ZYJA 4U3XA 3U0TA 3RGVC 4WW2A 5DJYA 3X3FL 4KK6C 2VDRL 3MROB 2IANA 4ZO8A 3QFJD 5JPNB 4JEGB 4L9DA 4U1NA 4JFHD 1M7DA 4GW5A 5DJAB 3QDGD 3NCBB 1WBYA 4HPYH 3HI1A 3VW3H 1HYSC 3QCTL 5IKCA 4NNXA 3V4UL 4K3DH 3PHSA 4JB9L 2CKBL 3QQNA 5FYKU 1ZXQA 3GI8H 5KN5A 4OCYL 3O6KH 3OAYH 5D2LA 1N8ZB 1MCBA 1U8HB 3O2WH 4Q9RH 5KOMC 4LNRB 5DDHA 2DBJA 4TSAL 5AEAA 1VKXA 1BVLB 3NA4A 4YBQC 3HUJF 4PGCA 3RHWF 2WUBH 4PPTA 2W59A 4OLXL 4JGUA 4K7FA 5FUOH 3TJHD 1SEBA 4MQXC 2WBKA 3QH3B 4HW6A 5D1QD 3TNMB 5B38B 4L3CA 4NN5B 4N68A 4X5XA 5FA3B 5F93C 2VB5A 1UM4H 4BELD 2L7JA 5IWLC 4P3CH 1N3NA 1CR9H 3E3QC 4LBEB 3HZMB 3WNMA 4PS4L 5MP6H 4DEPC 3VGDA 1QRNA 1YJDL 2DI8A 3HRZB 2V7NB 1G7HA 4NFBA 3WO3B 5MHSD 1D5ZB 1HOCB 1D5XA 5IW1A 5E24E 4IIQB 4GAGL 3NCJL 2Z8WC 5ID0A 5MI0B 3ARFA 2VXUL 3RAJH 1CFNB 2KZ1B 1LEGB 4XPGL 4H5SB 2CR6A 2CLVA 4KWUA 3VFWA 3FFDB 4AIZA 1E28A 2DTSA 3TIDA 1OTTD 3OKDA 4F7EB 1KIPA 1RJZB 1UA6H 4Z9KB 1BQLL 1JTTA 3QJHB 3U2SB 4FOMA 3VFTA 3T0WA 2B2XH 2EO9A 4HKZA 5KJRL 4NKIH 2J3SA 3OJVC 5IK3A 2FD6L 5EU5B 5GXBB 3BZ4A 5EOCL 5JXAL 4G6FD 5DEGA 4TPRH 1FNEB 1A4KA 3PGFL 4IJ3C 4X6BA 5F1NB 4PJBE 2HG5B 4F9LC 1LP9B 2VNCA 2AEIT 5IVNA 3RGVA 3W9DA 3C60B 4QY8B 2F54E 2B8OT 3QHZL 1OSZA 1RJCA 4WHDA 3JWDL 3ULVD 3GMOB 3PWLB 5D7IA 3RWIB 4F9PC 5HYJE 4Y5YC 5FB8B 1QBMH 3FONB 3IFLH 1TJGL 4OSUH 3OKMB 3NCMA 2Y7QB 4WI8A 2LAGB 4JFEA 4OUUB 4KQ4H 3AS3A 3KPRA 4YFLF 1SMAA 4MX7A 3WXWH 4YDKL 2Y9RT 3SCMC 5C0BB 1WWBX 4J3WA 5ISZA 5C0DA 3IU4L 3L95A 4KHXH 1EUUA 3SKJH 5CCKH 2L7UA 4X6CB 5EORL 1BZ7B 3UTQB 1OAXH 2WP3T 1A9BA 4ODWA 4FFYH 4NBYB 2Y6SD 4LLDB 1FZMB 2X4QA 4J8RA 3I6KA 2Z92A 4JGJA 2QQQA 1DLHA 2WK2A 1NMCB 1PKQA 4GFTB 3S7GA 1AC0A 3F58L 1B0WA 5ACZB 2SEBA 5GRJH 1BF2A 4GG8B 4M7KL 4F7CB 5DD3H 4HG4K 1WFTA 5D96C 1KIQB 3D85B 2UY6A 4O02H 1TZIA 4MXVF 5T1KD 4YHPA 1A0QL 4R7NA 1PG7X 3D3VA 3BPLC 5D1XD 1XGTA 1I7ZA 5TGBA 3VI3E 1KJ3H 1Q1JH 1W72B 3JZ7A 4RISH 1CD8A 3RVXD 3O3EA 4K8RD 5SWSE 2CJUL 5DRNA 1LEKB 5EO0B 2F5BH 3V0WH 3BMWA 2VSCA 5JW4M 4XMLL 3TVMC 1JVKA 1U93A 3L9RB 2FSEA 3V5KA 1TLKA 1IZJA 4M6NH 1KOAA 3T3MF 1IC7L 1KJ2H 4X4ZA 4UDTB 4OZGF 1I1CA 2CK2A 2VXQH 5HBBA 1EEZB 2FHFA 2PR4H 4EI6A 4N8CH 4FP8L 4NT6A 5BS0E 2HTLC 3HHRB 4IOFC 1YEFL 3RVVD 5C0FA 2FB4L 4HGMA 3IJSA 4HLZG 1HSAA 2ZUTA 1FJ1B 3WD5L 4ZNEA 3IKCA 3AY4C 4WW2B 5DJYB 5MEPA 1C16B 4CBPA 4ELME 3F5WA 3HB3C 4RGNE 4XCCH 1QFWH 1NH6A 1BIHA 4XCEB 1DLFH 2AJVL 4KXZI 4P23B 4U1NB 4GW5B 4N0FB 2LU7A 5IM7B 1N59B 2QKIA 1NGPH 4OT1L 3RY6C 4WWKB 3P73A 4D2NA 4NNXB 5JA9A 1F4HA 1JNHA 1MJ7L 4WV1C 4R0LC 5DD0L 4CVXA 2H32H 1FE8L 2IPUK 1DBAL 3W81A 5KSVB 4KMQA 1KJ2A 4Y5YA 3V6ZA 5D2LB 3S4SG 2ZCHL 5BXFB 4X6FB 1VKXB 4XP1H 1Q72L 4IDJH 2ZUQB 4QRRB 4CRPA 1OAZH 3PWPE 4U05A 4WTXA 1URLA 4P2RE 4PGCB 3VI4E 3SCMA 4QHLA 5LCVH 1FYHB 1CF8L 4HWEH 1SEQH 3EDFA 2COQA 5IG7A 4K7FB 4FHBD 3HNVH 5C8JA 4PJDB 1CVSC 4X5XB 1X5HA 1RUAH 2XG5A 4HLZH 2Q6WA 3FB6B 1DEEB 4J2XA 1N3NB 4YXHL 5I16B 2N7BA 2JK5B 1OHQA 4YHOL 3G08A 4QRTA 1LDPH 2Q20A 1JZ3A 3L5XH 3DBXB 4R7DA 1QRNB 5JR1H 1QYGL 1X6NA 3RY5A 3HG1A 3QRGL 3SDCC 3AB0B 1BP3B 1FCGA 4DKAA 4FQJH 5J6HB 3EJZD 1S7SA 5HHOB 5IW1B 4IRJC 2LVEA 5A2LH 1TZGL 5ID0B 2D0HA 3ARFB 1ZT1B 4JM2B 4FFVC 3SHSA 1JYNA 3BQUC 4JHBA 4U2YA 5AWNL 2CDEA 4XPHL 3FFCD 3MMEA 4I3RL 2OTWB 3NACL 3PQYA 2VLMD 4WEBL 4FQIL 1E28B 4DQOL 1E4KC 4O4YL 1SJEA 3MXVH 1KIPB 2FEEL 4R90L 3VG9C 3TVMA 4YO0B 4FQLH 1A1MB 3GBNH 1UWGH 1DSFH 3VFTB 1I7TB 3QDJD 5IK3B 3OJDA 3BP6A 4WO4C 4GQ9H 4DUXA 1TETH 5DEGB 2YS4A 2J88H 5IT2L 5IB5B 1FIEA 1A4KB 3VGEA 5IHLB 2WIMA 1DJSA 4HHAA 3U83A 1T89C 2JIXB 4C56B 1NANH 3Q6GH 4HS8H 3V9FA 3RPKA 1JPSH 3AY4A 4P2CG 1A64A 4XNXL 3LN9A 4ODXB 15C8L 5JXEC 3WJJC 4DKDC 4HPOL 4ODBD 5C2BL 4UTAH 5BRZA 3S4SA 3LZFL 4OI9A 1ULVA 4XPAH 3OJMB 4ZUUA 3W82A 3RY6A 4MNQE 3REWB 1BMGA 3LKQA 3SY0A