4ZMVA

Crystal structure of human p-cadherin (ss-x-dimer pocket i)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
MDWVIPPISVPENGKGPFPQRLVQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 45
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmvA01
4XXWC 5CZRA 2OMYB 3K5SA 2A4EA 3Q2WA 4AQAA 1O6SB 4APXA 3FF7A 2QVIA 4AXWA 4NUPA 3MVSA 4ZMXA 4ZMOA 2OMZB 4ZMQA 5JYLA 1Q1PA 2YSTA 1NCGA 3QRBA 5DZVA 2OMVB 3UBGA 4ZMPA 5KJ4A 4AQ8A 2WBXA 2OMUB 3PPEA 4NUQA 2A4CA 4ZTEA 3K6IA 3Q2VA 3K5RA 2WD0A 4AQAB 2X2UA 1SUHA 1EDHA 4XXWA 4APXB 4ZMVA 4ZMNA 2OMWB 3LNHA 4OY9A 5CO1A 2QVFB 3LNIA 1NCHA 2V37A 3K6FA 2OMXB 1L3WA 5JYMA 2OMTB 2EE0A 2WCPA 4ZMYA 3UBHA 3LNGA 2YQGA 4AXWB 4AQ8C 4ZMWA 4ZMZA 2WHVA 4AQEA 3LNDA 3FF8A 1WYJA 3LNFA 4QD2E 3LNEA 1WUZA 1ZXKA 4NQQA 1OP4A 4ZMLA 1ZVNA 4ZI8A 4ZT1A 3Q2NA 1NCJA 1NCIA 1FF5A 2O72A 3K6DA 4AK1A 3Q2LA 4NUMA 4ZMTA 3UBFA 4AQEB
chains in the Genus database with same CATH superfamily
3KJ6L 4XVJL 3EGDB 3UEZA 3BPCB 2GBUA 1FNAA 5HHVH 3FBKA 1G9NH 1FFOB 2VR8A 3FO0H 1U3HC 3AJ7A 5AW0B 1YSOA 5SWZB 1V27A 4KUZH 1FGVH 5B8CC 4X5XB 4N2KA 2DBJA 2B1HH 3ARUA 5KSAD 2DQJH 5LXGH 1T6WA 1FN4B 2A77H 4V33A 4QTIH 4RH4A 1W8EA 5HSFA 3TCLA 3QDME 3VUAA 4LOEA 4XPHH 3G5VA 3QI9C 3LKOA 4LCUB 2XPYA 2Z7ZA 4QRTA 5CINH 3LZFH 1IAIL 3O3AB 4XNZC 5BNXD 3QIBD 1V05A 5K9JL 3FU6A 4KK8C 1S5HA 3SGKC 2PLTA 1H3UA 3EJZD 3EHBD 3TO4C 3DIFB 1U95B 1ZS8A 2VQ1B 4HS3B 1KLGA 2ZX9A 1LO3H 2G0KA 5CZVL 3T0XA 5FC9A 4KJPC 4Z6AT 1HWHB 4G7QB 3ZQWA 1ET7A 1JVKA 3JBG7 3NIFE 1XCQB 2EO9A 3K72A 4NSKB 5T1LB 4HWEL 5F1NB 4NOBA 3UC2A 2AF2A 2XZAH 4A6YA 3R4DA 1YEDB 2CLZA 4WNQB 3QJXA 1JF1A 2CKNA 2VO8A 2X4TA 2VDPB 4N0UE 4N2AA 4O51A 4MQSB 1QFHA 2H6PB 4OF3A 5L2JB 4NFCA 1PG7L 4G83A 1UQSB 4UM8B 4J3SA 3Q01A 5DC9B 3NSCA 2XACC 1PBYA 4H8PA 3TESA 2VDKL 4Q6IC 1JGDB 4U0RC 5IV2B 4OCXH 1YN7A 2FX8H 1NLDL 3BN3B 3L4UA 3GMQB 1JCVA 1N70A 4JJ5B 1NC4A 4XI5D 3H1ZA 2QELA 3IRCA 2CK0H 1FA4A 2BP0B 4P5MB 3E1F1 3STLB 5BZWA 2ATKA 4HC1L 5GZOC 2KBGA 3CDGB 1ZA3A 3CLWA 4Z7NF 1SYVB 1BJMA 4JO5A 5DZJA 3WLWD 2X1XR 1PEZA 1RHHA 2Z1KA 3QIWC 1E0OB 2XSKA 3RAJH 3VGDA 4AGMA 2VLKE 1YY9D 3TV8A 4M48H 3SKOA 1HINH 4R7NB 5LB1A 3ZZSA 5I5IA 3MXWL 4G3YL 1DJSA 1SHXA 4N86A 3SKJH 4TTDC 1CN4A 2WIMA 1BZ9A 4Y5YB 4P9MH 3FK3A 5FHBL 4XNYH 4YXKH 3RWCB 3ECUA 4JY6A 4DP1X 1ZA6A 2CR3A 1PYWB 3M17A 1JGLH 2OK0H 4MJ6A 1MRDL 4YDVB 5IBLD 1KIPB 2QZ5A 2AABL 1IGTB 1P7BA 3LN9A 4LSUH 4S1DC 1WDAA 4I2XB 4WWKA 4QLWA 3F7PC 3MRHB 4PR5A 3DXAD 1HKLH 1JP5A 1UCBH 3WG7B 2WAHA 3QNZA 1I1FB 1VADB 3QO1A 2A9BA 1DSFH 1QFPA 2A9NH 2KHAA 1IRAY 1YPZE 1Z2KA 1P7KB 2FGZA 3FCGA 4JFDE 4NKDA 4P04A 2FEEL 4YHYB 1G9EA 3PWPA 5HDOA 2A6KA 3M88A 4GO8A 3VXUE 2OL3L 5ITFB 3MNWA 4R4FL 2PR4H 1EAQA 1GZHC 1PZ5A 1RU9H 3FYIB 4U0QB 4XPGL 3ZKQD 2XQBL 4BSVA 5AVZB 2YGQA 2OM5A 3EH5B 3HTLX 5J6GA 3CG8A 3KPQB 4TQHA 2O93L 1JTPA 1KLFA 1WP6A 3O2DA 2CBOA 3TF4A 5E9AA 3CVHH 2CUHA 3QEGH 5M7QA 3QR1A 3E2HC 1BSIA 1D5RA 4Q2ZB 2UX7A 3GTTA 2VXSL 1KGWA 5TE7L 1DZBA 3WEXB 4L3AA 1KG0B 2Z92A 4GIAA 3UABA 4P3DA 4I5BB 1E5YA 1HHIB 2X89D 3UC0H 4WI8A 2BIOA 4NGHL 1AS7A 3S34H 4M8QB 5T5FH 2DZEA 2ZYHA 2QVKA 2VDNL 4KOBA 4ETQB 1EHLH 4K9JA 3MJWA 2QSQA 3S9DB 2J73A 2A6DB 2FX9L 2BWQA 4KDWA 4P5TA 2QGBA 3JVGA 1WAPA 2PKDA 5BZZA 1OCZB 1N12A 3KDMA 3A22A 4MDJA 4PJ5D 3U6XA 5KSAB 3EYQC 4Z3FA 1RULH 2BMKA 2OW6A 4H1LG 2QT6A 4YDIL 2Y7SA 4Y5VC 4ZXBC 5F1KC 1NMBH 4F5CA 2BP3A 2JH2A 1DEEA 3EDKA 2EIZB 3OZKA 4AYFA 4KRPC 3OKLB 1WYJA 1FUNA 3CSFA 3FQ2A 4M7JL 1L5GB 3FAXA 4XBGB 1B2YA 4U1HB 2Z1PA 1B0GA 1PY4A 2FJFB 1H8NA 1MRCH 1BREA 1OP4A 4HJ1A 3MUGB 3PWLA 3EHBB 1QHOA 2OMZA 5FUZH 3O3UN 1CK0H 1MEXH 3JV0A 2JKXA 1KCRL 2ZAHA 4U7MA 1FJ1B 5E6IB 3VFNA 1JYWA 1TFHA 1JDCA 2VDRH 2B0SL 5F96H 3TH3T 4CU6A 2P4AB 1CL7H 3PDOB 5DRWB 5CP7A 5K93A 3W0WA 5JW3H 4PGDA 2EUVA 4YIQA 3EBAA 4UINH 4XMZA 4TUJA 1TMQA 4G8EB 4JFQB 5IFJA 2OMUA 4L9LA 3EOAA 1MHCA 4KI5E 1ZJBA 5C2UB 3DSFH 1OQOA 2NXYD 3MO1B 2YBGA 5IMOA 2G2RB 2ZKMX 5EDSA 2VXUL 4ZS7L 2JXMB 4N2BA 4G72B 1UHVA 4EDXB 1KN2L 5AW8B 2CALA 2WGXA 4OCWL 5D2LF 1UH4A 2EYRB 1CFQA 1TZ8A 4CBZA 2VR9A 2NY7H 2WXIA 2BHYA 2V5MA 5CFAA 2VOTA 4JM2B 2DPKA 4XVTL 3KM1A 1MJ8L 2G9KA 4R5VA 5AEAA 4FA7B 3SY6A 1FPTL 4L29A 4ZDHB 5KS9F 1YUHB 1U8PB 4XXDB 4MHHI 4F2ME 3GBDA 5A7EA 2HG5B 1U8IB 5AVTB 2VTFA 4XMPL 3RWEB 2Y1ZA 3EDDA 3SQBA 1RUKL 1U3YA 4JKLA 3GSNL 3T4YA 3WFHA 3MFGB 1SJVA 2CRYA 1ZDSA 5E5LA 4RDBA 1HTYA 3VFTB 1DN0B 1NAMB 4MCMA 1GVIA 3JUZA 3LSOA 3PPSA 4WHCA 5KJRL 1OK0A 4K94H 1NFKA 4J5VA 1NCOA 1SHMA 1BVOA 5E9DE 4WJ5B 1F13A 3HUJA 4QHKJ 4Q9BA 5BOJA 3WS6A 5IW1B 3M8OH 3GXUB 3IJHA 2HXAA 4PPTA 4X6DA 1MCHA 3DXAB 3GSQA 1JHKH 1T89A 1YYLL 1NM9A 1U91A 3DX8B 3H3PL 3VI3A 3SQRA 5HHME 3K8KA 2MNWA 1SXNA 1ZLEA 4RMVA 1MZZA 5I66A 2KUTA 3BDBA 4APQB 3MJ9L 5KYUA 2OYKA 3QUMH 2APXA 4AIEA 5EF0A 3VE0B 4LKXB 5IF0B 1MLBA 3ZKNC 3LS5H 1S9VA 2AJZB 2WXLA 5E00B 3TN0A 3QORA 3V6BR 4YSUA 1J8HE 2QTVA 1QBAA 4QWWC 1J05B 2G9HA 4DP9X 1CD9B 2VDPL 4Y9GA 5HHNB 2BNQA 3O4LA 3DO4A 3RDTC 4EF3A 4F7PB 5I1JH 1OARH 4OFIA 3H2PA 3JT2A 2QPDB 4GRMA 3QHFH 3LD8C 3QULA 2IG2H 3S7GA 3T3MB 1UC6A 3M7OA 3GHPA 4XO5A 3CHOA 2E0PA 1NJ9B 1KBVA 3N06B 4Q89A 4OKVA 4UANA 4KKQA 3S48A 4AW4A 4UT9A 4IBVA 5IVXF 1BAFH 5JW4M 5AG9A 2PP7A 5FYJL 5GS0L 3R1GH 2RQEA 5INCA 3OPUA 4XAKE 3ZSSA 4U1GC 3PAVA 4PJHB 1T7WA 4KJYB 2X2IA 2ZQKA 1RUML 3OQ3B 4I0KA 3CMOH 2VISA 5LO7A 2HLFD 1GC1L 1SYSB 4PLOB 3FOLB 1U6AL 4WUUA 3T08A 1JK8B 5LBVA 3Q2WA 3QUXB 5HD8C 3NABH 3DX7A 4NZFA 4XMTA 2W9LA 3LEYH 3MLSH 1J7VR 1B4JH 4ERSL 3ASOB 1G0XA 2B4CH 4PYGA 1XR8B 4WI4A 4C57C 3LX9A 5F72S 9PCYA 3B3BA 1RUAH 5I6XC 4PJ5B 5GGTL 1Y6MR 1A0QL 4MQ7B 3VXOB 3HI5H 2ITDA 2J8OA 1MQKL 4L4VE 4YHMH 2L7QA 4QTFA 3GRGA 3BGAA 4R8WL 4JRXE 5F7AA 4EUPA 3P11H 4FQHB 4XP6L 1LD9B 4GQPH 4Y16D 4AVKA 4O58H 1YEGL 4F57H 1K4CB 2OMXA 4GSQA 3U1QA 5DWUH 1EMTH 1KB5L 2JQAA 3FT1A 1T03L 4YVNA 2AK1H 4WSJA 2CA4A 1INQA 1AH1A 4XNQA 1CLOL 2CR0A 2R29A 3KPPA 1K85A 3SGDI 4U1MA 1EZUA 1PKQE 3C5ZD 4X9IA 4FXKA 4PJXA 4WWKC 1MF2L 4M1CD 5D5MF 4B0MM 5B38B 3CE1A 2AKRB 4X83A 4D9QE 3D7PA 5ISZD 3BWAA 3FQ4A 1ZTXL 3VFOB 5E8DH 2AXGA 5IB1B 5IUCA 1YQ2A 1AHWB 5FYKL 2I24N 1DVYA 3ARWA 3DHPA 2H6OA 2ADGB 1NL0H 4HCRL 4LLUA 5CSZA 1X5FA 3RUGB 2NXYB 5AL8A 4PJAE 5HP5A 4MXVE 4LCIH 1MCEA 4OV5B 2O6PA 1KPUA 3Q48A 3B37A 5E4EC 4FQLL 4HV8B 3A4DA 3QXTA 5MEPB 5IW6B 4ZW6A 5D1XE 3MV9D 1GGCL 4OH2A 4L8DB 4WNSA 1I3GH 2MCAA 3LQAH 3KYKH 5FDWA 4MA3A 2CDFA 3AGVA 4LKCB 3SD2A 3ZDZB 4I0PD 5K9QI 4LOUD 4IW4C 4XP1L 4G2AA 1WFTA 3MLWL 4WEMB 1K5NA 4ALAL 5LWYH 3T8MA 4D9RE 5H37H 2MCPH 1FL5A 2HYMA 1JNNH 2Q76A 1XIWD 2LHAA 1QFWH 1O6SA 1A7PL 4LHUB 4M6NH 5C0EB 5I8OL 1SOXA 3PGFL 4OBRA 4QRRE 3FUJA 4HWBL 1J0KA 1IE5A 5IREA 5AVRB 3MRJA 4JRYE 4ICXA 3TJEH 3MC0A 3PQYB 5E2TL 5T1DL 3SDXF 2WXPA 4IU3B 5DJZB 4E9VA 3L5HA 3QWOB 2FECI 2VZTA 4FNLL 1RZ8A 2D31A 3MREB 2ROXA 4P5TC 3JVGC 3HPJA 1T0OA 3RY4A 5C0JA 5I0VA 5AZ2L 1X5KA 4JKMA 1J0ZA 1IBBA 2JCCB 1CVSC 3U0PA 2CKBA 3X14A 3BGFB 4IBSA 3L7FA 4BJLA 2AXJA 2Y72A 1P1ZA 3VMNA 1N59A 4N2OA 2ZICA 4GKSB 4CN4A 5IJKC 3KPOA 4J28A 3GRWA 1HHHB 4YSSA 4X2UA 3DKHA 1OB1B 2KKQA 4RFOL 5AKVA 1AXIB 5F89B 5IB4B 3D18A 3IVKB 2DQGL 2ZF9A 3HMWH 2CJUH 2ODHA 3JWNE 4KKBC 4MFHA 5IB5B 3GSUA 5J56B 4NM4H 4YO0A 1KIRA 5DZNA 3GGWA 1NC2A 1KGUA 2DKSA 2HCZX 3NJLA 4DEPC 5JZ7C 3AU1B 3IFLL 1EDHA 2AEIT 1N26A 3AG1B 3DYPA 1ED3A 4PGEB 2F2HA 4XOCA 1JHLH 2HTLD 1A6WH 4L9LC 2XPZA 4JDVB 5IROD 5B1KA 3UOAB 2FR4A 43CAA 1EZVY 4JFFA 1JNLL 3E8VA 3NA9L 3LRHA 3EJUA 3GS7A 2Z4TA 4R96B 1ONQB 1NCHA 3EFDH 2J57A 3M1OA 1MZYA 3U83A 4ZFFA 2AFNA 4U1SB 4IOSD 4B96A 4E36A 3VA2C 1JGIA 3APCA 1QRNA 1COBA 3ZDYF 1IEBA 2X40A 4DK6A 2YD7A 5TQ0L 2R23B 4O02L 2X9XA 1OKEA 2XFXB 3LRGA 3LS4L 5CP3A 5TK2A 5JOFA 5E94A 3IBOA 1ZVSA 3MCLH 2BNRD 2HX9A 2GI7A 1AZNA 3IDNA 4L1LA 4ZW7A 3UTQA 5T3ZH 4WW2B 1LILA 1UM6L 2J5LC 3BH9B 3CJJA 4P2OD 1UXMA 4ANVA 5EZJB 3PFUA 4WGWB 1V10A 3PGCB 1UVQA 2L04A 3MRFB 4OSUL 4Y16B 1I9RL 5DVOA 3TFKD 4I85A 4PRHB 3N40P 4Z0XB 2WVVA 1IFGA 1ZOXA 4KBPA 3JUYA 5GPRA 3RNKA 3UZEA 4F7KA 1M3JA 3KPRE 4CMMB 5L8LB 2CA3A 2Y7QA 1OTSD 4HKXA 3BC9A 3L3KB 2L0DA 1C5BH 3B9DA 3HR5A 4P05A 5FKAB 2XDHA 2ZIDA 5DJ0B 4HIIA 2OXHB 4XCNB 4N1EA 4X0KA 3H3KA 3WS6C 1BQHB 4JPVL 3F84A 5GGQL 3NFSH 3CFCH 5TDOA 3MLUH 3Q6FB 4X98A 1T89C 1S7VB 1UD6A 5DA0B 5E5MA 1SXBA 5ESVB 3POHA 2KERA 4FFTA 3T1WA 2WYHA 1EHXA 3FFCD 3RWGB 4YJZL 3D33A 4PMEA 4OCLC 2I5YL 4UMGA 1FYTB 1U0QA 1DLHB 3WFCL 2AJUL 3D39D 2DLHA 2P46B 1UM5L 3QORC 1UJ3A 1X44A 3GLEA 4G5AA 4PJDE 1E7UA 3PNWA 4Q74A 3U30B 3WD5H 3EO1A 3FJTA 4DO6A 1O0VA 1RIHH 3QHTC 5J1AB 1JYVA 3DX3A 4JKPH 2X09A 4EUPG 1U8QB 3MV9B 3VB8A 1B9ZA 5DJYB 4D9LL 4JG1L 5CEZE 4I0PB 3SO5A 2FEDD 3SY0B 3CFJB 5E8NB 1B3JA 1I82A 4D8PA 1GY2A 1ODAA 1WRFA 2WXRA 1G6RA 2YFNA 2BVQA 4GMSL 3EO9L 1A9BA 4MMXA 2JVUA 4HW6A 5DUMH 1DQTA 1I1YA 4IEFB 1AZVA 3EOTL 2BVOB 2CJ3A 4UNIA 4HOWA 4KKLD 2JIXD 2WTPA 5DYFA 3LRMA 2NY2D 5DTFA 3HCVA 1SBBA 3IAPA 1NCTA 2P26A 1AR2A 4LNRB 2EDNA 2IQAA 4XOBA 1MWAB 5EMYA 1ODUA 4W9FC 2AEWA 3P0YL 5LCVA 1FNGB 2VC2H 1FG2A 4R3SB 1M56B 5IQNA 3W9DB 3SBQA 5EBGA 4AVIA 4TOYH 4G7YH 1JGEB 3QDGA 4AMKH 5IJVB 2XZCL 4MQTB 2XTJD 4UQDA 5B1CA 3ZZ1A 2BS8A 4PB0H 2D73A 4NKOA 5JXEC 1CFNB 1KF9B 3Q5OA 4EE2A 1RZGB 2Q8BH 4KKAD 3FCUB 4PP2B 3TH4T 3NIGB 3VXNB 1M05A 1PZAA 3JWOH 3B7RL 4V2BA 2CIIA 3FT0A 2C9PA 3KL0A 1A2YB 2ARWA 2BVPB 3LN4B 2YQGA 5A2KH 2NYYC 4JDZA 4AGPA 1UH2A 2YQ2A 5F3HA 4Y1AA 2WO4A 2Y07H 3LKSB 4WKZA 3Q6GH 2NZ1A 5CEXA 2BSED 1QKZL 5HI3D 4JCMA 5ALBL 5LNEA 4F20A 1QVOA 3LZRA 2DL2A 5H4YA 1YECH 3VD1A 4QD2E 1LE9B 5GGRB 3N55A 4HMDA 5F7EH 1M2OA 2KPWA 2AEOA 4NNYA 2PR9A 4AYBA 1EUTA 1PDKB 3WL9B 3VW3H 4YSEA 4LL1A 1VRSA 2BJMH 2P8MA 5FM4A 4Q9RH 4TRPL 1AD9A 2R7EB 1X5AA 2ZXEB 2X28A 3QXDA 1E27B 1RERA 3FQ1A 5DD5L 4OF5A 3FUMA 1HOCB 2UVEA 3OV6A 2IH1B 2WTOA 4MJID 3HNVH 4J3VA 3FRUB 1IFHL 2QPSA 1B0RB 2Q2LA 2R27A 4ABQA 1AANA 3L5JA 3NIFF 2OZ4H 2ICEB 1NLBH 4K15A 3ZHKA 2UZYB 2BOLA 2BNRB 2PUQT 2KDGA 5AKRA 1DUZA 1UD5A 1AC6A 3HZKB 4WFGD 3L8QA 1MXGA 3HNTL 1E4KA 4CMHB 2ZUXA 4J1UA 5IZ7A 3QCTH 2MCMA 3IU3A 1Q0XH 4YAQB 1G7IA 4LT7A 2QLVB 1HH6A 5KBLA 4CL7A 1AGBB 5IVOA 3JT0A 2J88L 4LSVL 2WZPD 4NERA 1GZQB 3BPOC 4AQ1C 3MNZA 1UATA 4U3CA 3C60D 1TOXA 3B7SA 4XP4H 1KULA 4Z7QB 3QFDB 3CDZA 4OGYL 3U2JA 3K6OA 1XQ4A 4HKJB 5BO0D 4QRQA 4HK0A 3V0GA 4EQ3A 1HIML 4NCC2 1UEYA 3REVB 3GT6A 3NZ8B 4MNQA 1F8TL 3ILPB 3O45B 4Z7IA 4AJWA 4X6CE 2GK0B 5DJ8A 1BG9A 3CN3A 3SYCA 5DLML 4TL4A 3FFCB 1KTJA 3VSUA 4ATWA 3OLEA 3FQNA 3SO3B 4ZZKA 6CGTA 1II4E 4XC3L 2F19L 5I6MA 3KLHC 2D03H 2BY3A 4Q52A 2C8NA 2VUYA 3WJLA 4OLZL 2X2YA 1HZHH 3QXAB 2AAVA 3R0NA 5D1QC 4HPOH 3B43A 1JZEA 2X4OA 2M8XA 3TIDA 1KEGL 5L88H 2BW4A 3FUDA 4PSRA 3FRPG 4I18A 35C8H 4OZHB 2YC1A 2Z3FA 1MHPH 2VLJD 2YGOA 3GJFK 3DV4A 5CJOH 4F7MA 3EJTA 1ANUA 3VYPA 4LF3A 3F8UB 1GJWA 4JFUA 1YPZF 3LNDA 4RVBA 3SKMB 2KL6A 3NACL 3GBLA 2K3HA 4ELMB 2IOOA 3ZTJG 3QNFA 1QBML 4F92B 5KVEE 2VMCA 3G5VB 2JIXB 5JIDA 2WINB 4IHOA 2NY2B 3U0WH 3DUSA 1A9VA 2Y24A 4L4TD 1J9RA 3C6EA 3BZ4B 3KYMB 3PRZA 2WQVA 4PG9B 8FABA 5DMGC 1S5HB 4EN2A 2CRZA 3D0VA 3EGSA 3TBWA 1CDBA 1KLGB 4JG5A 2R0LL 4HALA 4Y4FD 3QYCA 4WHYH 5EU6D 3OZ9L 1MH5B 1T7YA 3CZKA 2XTJB 3LKRA 3K72B 1VERA 2WXJA 4LARL 3V0VA 5DK0A 3L2NA 2WZ5A 1HK6A 4X99A 5KBMA 1P7QA 5I18L 3S36L 2NY0D 3MLYH 2WIIB 3CZFA 3ZTDC 4WRLA 4CW1A 1E6JL 3CZGA 3S37L 4EZJA 5JHDD 4K7FB 5FO9A 3HRZB 3UZEC 5C2BL 1SDYA 4NQXA 5BQ7B 1DDTA 4CVZA 1GGTA 5A16A 5ICYA 1DZ0A 1XTLA 3H9SE 4DQOL 4G9FD 1LO2L 4UDTA 4RIRB 5LBSH 2BSCA 3S96B 5C3LD 1YCSA 2F6AA 1IILE 3HZYA 4CVWA 2ATKB 1I31A 1OP9A 1K8DB 4KZCA 5LBGA 3F3HA 4ONFL 4YLQT 3ME0B 2Y0SA 2VH5L 3F01A 4XMUA 3J27A 2FEEI 1ITBB 3SKOB 3COOA 4LCWE 5ADOL 4AGNA 2VYRE 1VB9A 1QSFE 2IQ9H 4FTVE 4NWUH 1UJ3C 2IIJA 1G7QA 1FH2A 5CM1A 1AO7E 4IDJL 4KKRA 3CSPA 4UQAA 4XMKL 1ZA6B 4MJIB 4DN4H 1OAXL 5CNHA 4MJ6B 1FVCA 1JYNA 5FCSH 1NBVL 1ZHLA 3ZUNC 2A4ZA 5I19L 3FT2B 1MFCL 4WO4C 5DZLA 1JNJA 2F8OA 3WIIL 1USQA 4HIXH 4PR5B 3TEXA 4OCYL 2YEZB 1S78D 3P30H 2OMTB 1SF5A 3O3EB 2B8OT 4MMXC 4P2QD 1QLEH 4GP4B 4IK7A 2X4NB 4OGAC 3SQOH 4L8BB 3NZHH 4P2CG 4Q8BA 5DD1H 4K5PA 5D2LA 4KKNA 2QHRL 4UYPA 1PX3A 5MHSD 3PWPB 3F7RA 1BQLL 1A3RH 3VTMA 4JFEE 4TSAL 3T8VA 4Z8FH 1UEMA 5DMIH 5GSRA 4QXTA 2E9WA 1IAIM 1KDJA 4FZEL 4ODSL 1G7LA 5DVNA 4BSVB 3C60B 5J6GB 3O9WD 3BJ91 4WW1A 1ZANH 3D87B 4QRUA 5ENWA 4U6VL 1KIQB 3CX5K 3JV4A 3CC5A 1UKQA 3OHXA 5FFLA 3V7MA 1QUNA 2ZJSL 5AW5B 1DLFL 1URIA 2VZ3A 2VLME 3IFPA 4PJGB 1PY0A 3G6JB 5E8EA 1XF2B 4ZTPL 3EXJA 3VXSE 2ESVB 4HAGA 4RETB 6FABH 5IHZB 3QUYD 3DX1A 4ZOAA 2E9GA 5DC4B 3VG0L 5F9WB 2JB6B 2XVKA 5I1CH 1N0LB 1N4XH 1OGSA 4N6QA 5HJ3B 5B7EA 4AG4L 4U05A 3DHJA 1I7UA 1RZQA 4PWFA 3QIBC 4N6RB 1SLXA 4ZOCA 4J6RH 3V6FA 5E2WH 1UXSB 4FCAA 5TE6H 2VLJB 1LMIA 3L3IA 3LN5A 4FQ1L 3EHBC 3RA7L 5LHDA 1UXWA 2EYTB 1AXSA 1MIEL 4LSPH 3OPZH 2BMKB 1JTTA 2RGSA 3SCMA 3MBXH 2DMGA 2OMVB 2FWSA 3ARDD 5CILH 3G04A 15C8L 1OSEA 3IMVA 1DEEB 1FFQA 3V0IA 4K5NA 4KRMB 4AYFB 2WWMD 3HR6A 4U31A 4DTGH 4LVOB 4UOW1 4I3RH 5EEVA 3O41B 3FSOA 2VLLA 1JPTL 5CD5D 1MFDL 4UBDC 1WHPA 1X5JA 3HE7D 2PP8A 1F2XK 4XNAA 3UYRL 4M56A 4PY8J 5EU3A 4AEHL 2QMJA 3L6FA 1BLIA 4Y4FB 1TLKA 2QSCL 2QKSA 1CR9H 5EU6B 3V4VB 5ACZB 3OX8A 4PAZA 5CP7B 2HT2C 1L6XA 2Y6SC 3JTTA 4JK0D 5D1ZD 3KEDA 4XI5C 2NUPB 1E4KC 3MODL 4KX8A 1HCFX 4KXAA 4TUJB 5I74B 3WNJA 5IMLB 4HFWA 2NY0B 4NZRL 3EOAB 3WEOA 2XU9A 1T83A 2ADIA 3GLDA 3ULVH 3TBTB 2DICA 2O5YH 2CGRL 4TQPA 3AMLA 3OKEB 4WI3A 4GNKB 2GJ6A 4WGVB 3UTOA 3OBAA 1GIGL 3WLWC 2RCSH 1JCKA 1JPFA 1DBKL 1FLTX 4F3FA 3WE6A 5F3BB 3KJ4B 1URZA 1YY9C 1KPVB 5CD3B 5HBBA 1DE4B 1AI1L 1CICA 3RFZA 1DQDH 3NCMA 1UWXK 3B9KD 3GDCA 4G7SB 3RPIB 2YMTA 2TSAA 4K7PH 5AVWB 2HJKA 4ZFGH 5JPMC 2E27H 4X4XB 3ZHDA 4PIRF 4G7VH 2X6BA 1SDAB 4PV9A 3K80A 2C1PB 5IBLC 1S8DB 3HAEH 2X1OA 1AP2A 3WFHB 4GS7B 4IMKC 2HT3D 2BY2A 2G2NA 1RIUH 3T0WA 3OKKA 4B5EA 1R75A 1IVTA 1AXTL 1C8QA 2KZWA 2X6UA 5J12B 3O11B 4NRXB 2MQ0A 3ZT5A 1D5MB 4I18C 2AEPH 2DWYA 5D4HA 4ZUVA 4OCSL 4KDTA 3NFPA 1N19A 3IJHB 3MGTB 4P49A 1OF2B 2XTSA 1MFUA 1OAYH 2IGFH 4YK4B 5L0QC 3FQTA 1EO8H 3O6MH 4DNLA 5F0PB 4EI0A 2AI0H 4P2QB 4FP8L 3X11A 1F4WH 1K3ZA 3H0TB 5JMRA 1B88A 3V0JA 2ROYA 4PJAF 4IJ3C 2EH8L 4MXVF 3DJSA 4GP8B 5ACMA 1TJGH 3GTNA 1RK1A 2H2SD 4ACTA 1MLBB 1S9VB 4A6YL 2D0HA 3QQ9D 4UTAA 5FF6A 3WNNA 5CFHA 2G9HB 1T22B 5JTWA 3EZ8A 4C8XA 4QT5B 4UCFA 2E86A 4KROC 2MOQA 2XWCA 2BNQB 4NC2B 3TBBA 1Z5HA 3D6GA 1RKRA 4OFQA 3K6IA 1N6QL 3H3BC 1NAKL 3MRDA 3QULB 5CJQH 1UA3A 2Y7NA 4KO9A 5FOBA 5JIKA 4J3TA 5HVHB 1I7TA 4BWTA 2R1YB 1OSPH 2DMKA 2HWZL 3VDBA 1HX0A 5EA0L 1KJ3H 4KZEL 1KLUA 1XFPA 3TIEB 1VFBA 4PUBL 3SYAA 4P9HH 5JUEH 4N2NA 2GUOA 3SDXA 1CIDA 1DBML 4JB9H 3V8CA 1L7TL 4OUOA 3RILA 4N2HA 5LAXB 2PW1A 3QUYB 4FABH 1V3JA 1PZUB 4OM1L 1HL8A 4L5FL 4NP4H 4JGNA 4FKKA 1F42A 2GJZB 4R4ND 4LCCC 4XCEA 3SDYL 4C54A 5LG6A 3CMGA 1ZGLM 2DAVA 3CZLA 2IANA 3DX7B 4K71B 6PAZA 3DV6A 4PJFB 3DOSA 5EN3A 2AVFA 3DETD 3UBXI 5JMOC 4FYTA 5SX5K 1NEZB 2E7BA 3W9EB 2H2PD 5D7KE 2GVYA 1UKTA 4YFDB 1DVXA 5FYJE 3ARDB 2Y1AA 3FH8A 1T5WA 4KO6A 4X5QA 3FW6A 3U7AA 3WBDA 1G1YA 3S35H 3U4EA 3BZFA 5B3NA 1JN6A 3FKUS 4MNGE 3PWJB 3UTSE 3VH8B 2B5IC 3N44F 1ETB1 2L7JA 3D08A 2IDTA 7TAAA 1WIUA 4H8WC 3TBVB 1KTDB 1INQB 3F00A 3LKQA 1NCJA 2DKMA 1AY1L 1D5IL 3HE7B 2APBA 3DTXB 4CU7A 4JL1A 4U1MB 1XF4A 2NY4C 2WNWA 1HEZA 2PWGA 4DP0X 4MBOA 1F4AA 1HAWA 2BRRH 3TWCH 1E50A 3O2DL 4Z7VE 2XWJB 5D1ZB 3IKCB 4LGPB 5D4QA 5J5EA 1JPEA 2ZYSA 3NAAL 2F5BL 2J2ZB 5C9KA 5DZPA 1RZKH 4E41E 4KNTA 1TQBC 5DHDA 5IEKB 1SM3L 4KJWD 4AXWA 5LDUA 1UWEH 4ELKB 4RGND 4HHAB 4XAWL 5D6CB 1BDYA 4WFFE 4UMSA 3NJHA 4M29A 2X6AA 3SBRA 2XG5A 4HS6A 5DO8A 1BVZA 1KGXA 4MA3B 1RCYA 2BHZA 2HKFH 1EO5A 2NYKA 3OHXC 3NJJA 3FB6A 3PUUA 3CPLA 1M53A 3B9KB 1AIFA 5DHVH 1W9XA 3P4OB 5DQDL 1NIAA 3RVWD 3D9AH 5D93B 2R0KL 5F6HI 5T3XH 4TQEH 3LH2H 3UIYA 4TUKH 3ZKXB 3MLZL 5DA4A 4PW9A 5KVFL 4FEMA 3D52A 4AVHA 4XHQA 3NJGA 2X7LA 4XB3A 5C0BD 1Q9OA 4KTYA 1G0DA 2Y06L 3WXVL 5CHNA 3QS2A 4JZNA 2OR9H 1CTMA 3RWHA 1LGVA 2EDOA 3B2XA 4U3SA 2Y2TA 4HKZA 1UYWH 5DYOB 2CO2A 3V0AC 1ROWA 5HYQA 3HC0A 4WFED 1P6AB 4NBYB 1HILB 3WMQA 3QUZA 5CCGE 2VDQB 1CBJA 2X3BA 2FJGB 1IQDA 5JNYA 4JO4H 4OZFH 4XX5A 3FQYA 2EZ0C 3D8MA 1F0LA 1E3ZA 4PU2A 3TYGH 1A7BA 1AMXA 2VZUA 2HX7A 3KPSD 3TBYB 2CWRA 4X9BA 2BCMA 2XXFA 3L7FB 4WCYH 1BZ7B 4PJDF 1CU4H 1N59B 2JKNA 3G08B 4PIBA 1FHGA 1QSEA 2R56L 2QQLH 4BZ1A 1RIVH 4X7TA 1WA1X 4LVHB 3GD1C 4A7GF 4S1RL 1F1AA 1RJLB 4YMPA 1WT5C 4NQEA 1VEOA 2WUBL 5FUCE 2F8VA 1IAOA 4PQXA 1ET8A 2Q8AH 2HRLA 2ZUQB 4QY8A 2Z91A 4HWZA 3GSUB 3R06A 3SDDD 2HJLB 3HNSH 4J39A 4OIIL 2VZVA 4PJEE 1KXTB 4JFOB 2QR0A 2VR4A 2DQEL 1G9MC 2XBZA 3MRKA 1HQRA 2NNCA 3NSFA 4YOKA 4NPJA 2GAZA 4YHPA 1R5VA 5ANME 4QR7A 1CE6B 4NUMA 4JFFB 2UZXA 1F18A 4TXVB 1KTLA 1YA5A 2XY2A 2DEXX 5DEFA 4KI1A 5J06A 3BP5B 3HI6L 4FULA 4YDMA 1FFPA 3TCTA 3WFEH 4BUHA 1TQSA 4BXVA 3Q05A 1WIPA 1UZ6E 3AT9A 2ZYRA 5BMFL 2ICWA 3ZOAA 5IG7A 1NFIA 4NN7B 3TX4A 3ZDXE 2FUTA 4HSAC 3SYOA 4NUPA 3IGAB 3HVDA 1IL1A 3BKYH 4LOFA 1FNFA 1T4KA 3BGMA 2FEJA 1YQVL 4YSRA 3QE5A 3QDJA 5MERA 1VENA 1VEMA 1F56A 2EADA 3NH7H 2PW2A 3OGCB 5KANG 4GBXD 1RZIA 4WJG3 3PL6A 2VDMB 4NM8L 1TDQA 4BFKA 1W2KT 3C5ZC 2VN3A 4E2OA 1G7PB 5CCKL 4M1CC 1OZTG 2CZNA 3FRPB 5I1HL 3T4AC 4HYTB 3GYRA 4A7TA 4ZZFA 1JDAA 5ADPL 2ZUUA 2NSMA 3DRQB 4YBHA 5AWNL 1HWWA 2JMRA 4HUWA 3V5HA 4HKXB 4R0LB 2DN7A 4OJAA 5EBWA 1ZHBA 3QDMA 3GBNL 4QHLB 4BZ2H 1QLRB 5DS1A 4KDTC 4Y4KD 2F53A 4U6YB 1C08B 1VFMA 2BINA 2WWKO 4HOZA 2BSSB 1BD2A 3SIKA 1WGVA 1XXDC 5BQDA 2XKSA 4HG4J 1LP9E 4HD9A 3VQ1C 2ZCLL 4LOUC 2YBRB 4X5PA 1FNEA 1OAJA 2QKIA 2X1QA 3FCSB 1P9MA 4UT9L 3U1SH 4AGOA 4BSJA 3LPWA 1O6TA 1PJWA 3B9AA 3V5DA 4ISVB 2EDTA 1XIWC 1EJOH 3PNWB 4IGBA 1EDQA 4F7TA 3H85A 5HI5C 4AV4A 4RGNB 1WO2A 4WV1A 3Q1SL 5L2KA 3Q3GB 1FFRA 2LGNA 5C0GB 3AACA 2FH8A 2ZXCA 1WSST 3TA3A 5D72L 2IMNA 3PP3H 1UWFA 1YNTB 4PJ9D 3WFBL 2GEEA 2M1KA 3KXFD 3TT1H 2VR3A 4AY0A 5J13C 1W72A 5D96C 1A9BB 2KDYA 2WTRA 5C0BB 5K1VA 4W9DC 4JUSA 2ZCKL 5AOIA 2C7UA 3ES6B 5F7UA 2CO4A 3VD9A 1SMAA 2PPCA 4NYLA 1SY6H 5C3TA 3KWWB 4X8JA 4BWWA 5JW4R 1A1OA 2EE9A 1BX2B 3VXRE 1IGJA 4O4YH 3BP7B 1NOFA 3APFA 1SN5A 2OTPA 1FIGL 4POYA 3ZHFA 1S4IA 5DD0H 2O30A 4XN8A 5BO1L 1RUPL 4PY7B 5EFIB 1KCVH 3DO7B 2R29L 1JSYA 4B60A 5E9NA 3E6FA 3DJTA 5HGBB 2EUXA 3AY4C 1EZSA 1UKSA 2VT0A 3ARED 3L7EA 3ILQD 4PRNA 4QUOA 4X6CF 3DX6B 3KLLA 4X5WA 4XC1H 2DH2A 3RYMA 1L0XA 1SQ2N 2DLFL 3GSXA 4NRYB 5SWSE 3LAFA 3LB6C 5F6IB 3C5JA 3T3PE 1VEPA 5C0AB 5JPNC 2CIIB 1UB5A 4BZYA 5KSVB 3RKDD 1IX2A 3TPUB 4BK5A 5HVFB 3LHPH 5E0FA 4JDZB 3S2CA 4Z76B 5IROC 1WG3A 3T65B 2W88A 1BYPA 4UT7H 1EH9A 2FBRA 1J1PH 2OI9B 3E3QE 2DQMA 3GSRB 4R4BA 4JFDA 3PY9A 4OF0A 1OAZH 4WK0B 1WBZB 2E9JA 3OR7A 1KCSH 3DURA 4LP4A 3HG0A 4OD3H 3QISA 2J1WA 2I7SA 3GMRA 5AVUB 3VXUA 2VDOB 1ICTA 5AVXB 4ZMAT 1HNFA 1TCMA 4PS4L 2ICEC 1CQKA 5KYYA 5IMMB 2P8MB 5EEZA 2QQKL 1HT6A 1IKFH 2NLJA 4JRFA 2K78A 4FQJL 2R8SH 1OTTD 4JREB 4P2OC 4K07A 3EDFA 3VFGL 1TYRA 3SOBH 2YR3A 4MA7L 1FDLL 3AT0A 4K9EL 4BH8A 4UQ3B 4UM9D 5T3XE 2BSRA 2ZOTA 1MAKA 2FGWL 3FN9A 3TFKC 5LNDA 4DK3A 3S8FB 4IRZH 3NSXA 4JHVA 4YHKH 5BV7H 5T3ZD 2B1AH 3SZKC 2FYYA 1HQ4A 3RDJA 2AJSL 4PRPA 4YHZL 1OTSC 5IWLA 3SGJA 2W0KA 1U8CA 2VDQL 4GBXB 3TA4D 3NJKA 4LEBA 2VAAA 4E9YA 4MQXD 3WKPA 1RQ5A 2XG4B 5D7IE 3A3YB 4QHMA 1CFSA 4YXLH 3EH3B 3O6FA 1Z0NA 2HJFB 1ZHKA 4DEWA 3MRMA 3KPMA 3ERXA 4KGLA 1YMME 5I1LA 2CKBL 2DD8L 3WTUA 5DRZA 3QC5X 4FNPA 3CZJA 5ESAA 5TE4H 2YD2A 1LQBC 2D4DA 1OOAA 2LFGA 3L95A 4GW1B 4M1GH 4A7SA 2NRDA 4R84A 3SO3C 1S7RA 4ZQKA 4Z7NB 1AHMA 2P5WE 1HAUA 3DVFA 1SN0A 1KPRB 3L1EA 4W9LC 2VR7A 4DZBB 4JQXC 3MRCA 4Y4KB 4OJFL 5AVVB 4AK1A 1MFEL 1N64H 4ZX4A 4AUJA 4P5KA 4MNQB 1E4WL 2HLEB 5GZNA 2FLRT 3B34A 3LXUX 3BSHA 1T20A 4TVPH 4OT1H 4NI6A 1T1YB 2RMNA 5E2UL 4AKQA 2Y22A 4BFJA 3BZ5A 4O2CA 4K3JL 3W2DH 3ZLQC 3EF7A 1T1ZA 5CN3A 1KYUA 3BDYH 1G7MA 2IDFA 3VFWA 2G75A 4KKLC 3ZTNH 4DGYL 1YMHA 2NY2C 1JERA 2G4EA 4FHKA 1MJ7H 1Y6NR 1Q38A 5IHLB 4KTGA 4QOKE 1A4KB 1E8XA 1MNNA 1R33A 4A1RA 1IUZA 2V2WA 2BWDA 4OFPA 4PJ9B 1FO0H 3UAAA 1SVBA 2R4SL 2X41A 3G5WA 4RNRB 4KNQA 4PJ7B 3LV3B 5K9KA 5INDB 3L5WA 3MLVL 2DH3A 2WD0A 3ASWA 4L48A 5AZEL 4IHOB 3MR9A 3UTTA 2VDML 1OGAE 3DUSB 2DQIH 1YNLL 2ZWSA 5D70H 5CZXD 3WJMB 3D0AA 2FCBA 4Q9QL 3OR6A 5HPMA 1CFVH 2YARA 43C9B 5CIPB 2R2HB 3L3HB 4A63A 2Y5TA 3SYQA 5FV2A 3APDA 1MCPL 1L3WA 2F68X 4FG6C 4JMNA 3V0VB 2X05A 2FB4L 3WUWG 1ORQB 4KY1L 4H8UA 1O7SA 2HZHA 1D6VH 3AREB 2OCCB 3U79A 1ADQH 1HKFA 2CUAA 3AQXA 4PEEA 1BF5A 4HZLB 4UB0L 5CMAB 2DF3A 5DSCA 3UJTL 4MWFB 1MCCA 3RIFK 4U1NA 2YD6A 3N1QC 1V7NH 4E9RA 5FO9B 1R5WA 3ULUH 4NQXB 1NDGA 4CVZB 1DL7L 2ZZUT 4QHNB 5IFHH 3AY2A 3ILDA 2UYLB 1JNHA 4JFYA 5F7LB 1PZSA 4NJAH 3HHRB 4LSTH 2HH0L 2AJYH 2V3DA 4YFLI 3UADA 3CK0L 4G42A 2UWEB 4ZMLA 3VFMA 3BPNB 3C5SA 3FQWA 3AC0A 2DWDA 3B2UD 2NX5D 1HYRC 1R3HB 1CXHA 2COVD 2MWCA 3QZNA 2Q20A 4UF7C 3ZGIA 2B3RA 2NNRA 2WZ0A 3IS1X 2H45A 1YEKL 1EVTC 1FE8L 3RIAK 3UTPE 3B2PA 2QKIC 4RZCA 5M94B 4X8CA 3KDPB 4JY4B 3X12A 2AANA 2GK2A 2NXZD 3TEYA 4IGBC 3UCQA 2OMYB 1NICA 1R3IH 1BG1A 1KBWA 1T2XA 2OJZL 1KELH 3PLYA 4UM9B 2WUCH 2XRAL 2Z31D 4WV1C 4XCCH 2J8UB 4QRBA 4HOXA 2NW2B 4YBQC 2EVGA 4LIQL 1AMYA 4I77H 4XO9A 5H2BA 2PWHA 3IDGB 2ZP8A 3MVSA 4XZUA 2M26A 3C60C 2NY6C 1JVOA 1YZZA 1E4XH 4M6OH 3ABMB 5JDSA 4I48B 3CXHJ 3CDYA 3ZIYA 5JQ6L 1H6EA 4PYHA 4A04A 1EFQA 4PGZA 2CLVA 1JRHH 2ZG2A 3IMRA 5D7LD 4HQQH 1SVCP 2I9TB 3SE8H 1YAZA 4QXTB 1DEDA 2OXGB 1PZ2A 4KOCA 4XNUL 5TDPA 3V9EA 5KS9B 2V7HA 2Z8RA 3MFFB 12E8L 3VA6A 3IPBA 5ENWB 3VXTA 5AB1A 2KPNA 4GIPD 3CC5B 5IVNA 5A2BA 2PTUA 5EF2A 1CDGA 1XMEB 5F9WC 4TYUA 2N1TE 1I8MB 4RMTA 4M02A 5F9JA 5EUOE 2ZWKA 4EN3D 1R6VA 5IBUG 4WWOA 3E38A 2VDOL 1VIWA 4KVNL 5E0QA 4X9HA 3OMIB 4ZSOE 4BK5C 3PJSA 4LE8A 4IIQB 1CD1B 1BYNA 5TGBA 4RGOL 3HA0A 1LL1A 1KUMA 1RFDL 2ZUVA 3KM2A 8PAZA 1E40A 2GT9A 4KQ4H 5TF1L 4RGMC 2BNUA 2ZUTA 4J3OH 2FATL 5IBTL 5IJDC 1VCAA 3V6FB 3X17A 4I9WE 4K4KA 4AQEA 3LZPA 3QA3B 2D7TH 4UIKL 3MTRA 3QFJE 1AG6A 4PJAA 1U8HA 1F6AB 2CLRA 2DQFB 1EHKB 1KIUA 2AJ3B 3L1OL 3L45A 4U6HB 5LNGA 1U3ZA 5SV4A 1LDSA 3CVHA 5D1XA 1N7ML 2WN2A 1LO0L 1MCOH 3IJEA 4M7LL 5T1JA 1VPOL 4XN1A 4DN3H 1ZLUH 3H55A 1PX4A 3RBSA 1PSKH 1Q9KA 2A73A 2NY0C 4HKBB 4J4PA 4NKQB 2C3XA 5AG8A 1YEFH 4KK9C 4L1DA 2CO7B 3WKML 5KSBB 1TQUA 2W9DL 5GGVH 1EIBA 3QBTB 3Q13A 5EU3B 5T5FA 4NRZA 1RH8A 4P2RE 5IVXB 4O00A 3KJ4C 1VKXA 4EVNA 2PCPA 3CSTA 4MA8H 1CF8H 4GIOA 1RJCA 1MRFL 3EJJX 5E1QA 3SGJC 1Z6JT 4N1HB 4HETA 2WNGA 1TEGA 3L3DB 4YWGH 3RZCA 3F6IA 3QH3B 3NCJL 3KJ6H 4JZOB 4WDIB 3FU9A 4D0DA 4F8TA 1I1AA 4XVJH 4YXHH 2I9LA 1VJSA 2ADIB 3FPXA 4OI8A 3O6FC 5EWIL 2EABA 1AAJA 3DGCR 2V3FA 5EOTA 4FNUA 3UAEA 1TSRA 2GJ6B 2I7OA 1J8KA 1S3RA 3QQXA 3IJ7A 1U8MA 5KYNA 4GQQA 1URLA 5EB9A 4ES8A 3OJVC 4WVRA 1BYOA 4M43L 2Y3AA 1T0MB 1CICB 2W07A 2OQJB 1U41A 4OQ1A 5I1IL 3RFZB 5H8DA 5JA8B 2ZWYA 2XN9D 2BSBA 3N85L 4IM8A 1A4CA 2WXMA 4LDOB 4TVPE 1BCIA 5EIIA 5KSUB 2QADB 3GRBA 4HIQA 4W9HC 1ILSA 2YD0A 4MRCA 3ZE1E 4HT1L 3ILEA 1LO4L 1IAIH 1JWMA 2NX5B 3WIAA 5K9JH 4DT2A 4KVCH 1T5XA 3U4BL 1NKRA 6PCYA 5DJXA 1S78C 5BRZD 4ADGA 3QNYA 5CZVH 3OKKB 4AC2A 4EKXA 2NXZB 2XOTA 1G6VK 4E68A 1HVXA 2XA8H 4HGKC 2H9GA 4HAFA 5D5MB 2HKHL 1CZ8L 3KLSA 4LXFA 4PGJA 1FV1B 4J6IA 2Q6WB 4ZUWB 3EKCA 2Z31B 2XVBA 4HWEH 2BK8A 4FXGA 4YSAA 3P3UA 1ETJA 1U36A 1KCUH 2DJMA 3CX2A 2J21A 4XPFL 5F1IA 4RWYL 4A66A 1EFXD 3T0VA 2DYPD 2SODB 3O9WC 1QFUL 3ZW3A 4YSDA 5CGMA 2V6HA 1AG0A 1CBVL 4G8GD 5GIRA 1TO4A 1QYGL 2WGNB 1ZSHA 2ED9A 3GJEA 3VXQB 1U9KA 2VDKH 3QARA 4EXPX 3ARFA 5F3FA 3FSWA 3P73A 2BRQA 1NLDH 4ANKA 3W38A 4UI2A 4YHIB 4XN2A 3PU7A 3A4AA 2K70A 5FF6B 4PVLA 2XETA 1Q1JH 1R3LB 5D7LB 3ULSA 2G30A 3EYFA 4XN4A 3ZL4L 3ZIMA 4HC1H 3NCYS 3IE9A 2NUTA 3T9WA 1FNHA 4MZIA 3DHUA 3VXPA 1H3TA 3FU5A 3QUYC 1G9NC 1J48A 1YDPB 4P23D 2YAOA 2P7TA 2B3IA 3MLRL 3ESOA 2VLRE 4G3YH 4K7PX 5ID0A 4JFZL 2WQ8A 4EN3B 1T0NB 3KPRA 3AROA 5FHBH 2HMID 4B5ZA 2GUOB 3KLQA 3V5KA 4ODVH 2WBJA 2A74A 3T2NL 1Q0YL 4GPVA 1ZKAA 4AQAA 1MRDH 4OFDA 4G1MB 4NN6B 2AABH 3QUMA 2Y1YA 4GJTB 3ARDC 3EAKA 4UQ2B 3PUCA 1O5PA 2EC8A 3TU6A 2D9CA 3ARZA 1JPGA 4ZD3L 1OE1A 4JFPB 1S7SA 4Y9CA 3IAGC 3HS0A 3ZY7A 3UG4A 3REWB 5I5JA 3FXIC 1S5IL 3ATEA 3MV8E 4RX4D 1U42A 1A5FL 5CWSA 3WO4C 5CD5C 5HYJD 4FNRA 3QIUD 4F7CA 5KJ4A 2JF1A 2OL3H 1PX8A 2VXVH 1EJFA 4R4FH 4XPGH 4BRJA 1P6FA 1S3KH 1T5WB 1AKJD 4AJVA 3BAYA 5EBLB 3ZX1A 4UQEA 5C86A 4PRAA 2AXFB 3T1FB 1AQDB 4XBPA 2YAEA 4FNSA 4PV8A 1I3UA 1Q94A 2W1NA 4L5FE 4F91B 2K45A 4K8RH 3HKFA 1A1NA 4LBEA 1ZLWK 5BXFB 1ZTMA 3ARGA 1WFOA 2B59A 4L1SA 4MJ2A 3PV6B 4QF1A 2J71A 2P8LA 3HG5A 1MFBL 4PJEF 3VWKD 2VXSH 3QJZA 1DQVA 5TE7H 1ZHNA 2N01B 4B27A 2H32H 5C8JA 4C56A 4NGHH 4NQSA 2EIMB 3QUHA 4ZTOL 3EGXA 3BRFA 3QCUL 1YEJH 3ZDYB 4MVBC 3TZVD 3I2CL 4Q4IA 5E6ZA 2VDNH 3ZHNA 4AXWB 1SDDB 1Q9WB 1ZV5A 2R39A 1UZ6F 4D0CA 2W8CA 2FX9H 1DQML 3ZDXF 1VZIA 1YC8A 4PW4A 4W4OA 4HS6B 5IIEA 2HT3C 4GKZB 1J1OH 1WD9A 3WLBA 1XAKA 1NANI 4U1IA 2J4WH 4YDIH 5MENE 2XN9B 2YUZA 1JE6A 1ACYL 2HP4A 4ZUTA 5AZUA 2H47C 2LR4A 5IOPA 1IAKA 3I9GL 4TV3A 5A2IH 5FYLL 2V9UA 1S7TA 4M7JH 2ICCA 2IFGA 4QRPB 1UG9A 2R15A 5I76A 5IP4A 1QQDA 5EZOL 2X7LB 3H2WA 5IHUH 4HF5L 4B9KC 2WPGA 1PF3A 2NDGA 4GSRA 1RK7A 2QGDA 3RX7A 5BRZB 3IMBA 1RP8A 3HPLB 1C12B 3SBWA 3S35X 3C2SA 4LPWA 1X9RA 1KCRH 5D4IA 3I75A 4U3SB 2B0SH 2JKSA 5IMKA 3HZVA 5KOVC 5DR5L 5CGBA 2W92A 2AERT 2BSTA 1AGCB 2VXQA 2H2SC 1QATA 2DJSA 4UT6L 5TDNA 2VLKD 3WMPA 5KUKA 5ICZB 2D3JA 1BM3L 25C8L 3C5XA 4RMUA 4WTZG 5B7MA 1QSZA 2WOBA 4E42A 3GMNB 3KLDA 5E24E 1E8YA 4UU9B 2FLBT 4BH7A 2D2CC 2DL9A 3U46B 1MJUL 2YIHA 2VXUH 3KS0J 4G8GB 5DFVD 4ZFOA 1KN2H 2VCOA 5EIIG 4A68A 2LE9A 4WI2A 1BZDA 1QSEB 1T3FA 4JJOA 1MW0A 1GZPA 2E7MA 1CFBA 4F5CE 4J4PC 4XVTH 1MJ8H 1XZWA 3RKPA 4E9XA 3ELQA 1FPTH 4QRFA 1DCEA 5IB3A 1G1KA 2YQ3A 1F4HA 3CUPB 5EU4A 3WGVB 3JWNG 3FO2B 3I85A 2DBLL 4XMPH 4AENA 1IKNA 1RUKH 2JK5A 3GSNH 5K9QG 1JZ7A 2KZ1B 3R06B 2WVSA 3KNBA 4P23B 1A3QA 4R4NC 4Y9EA 2OR8A 4AIZB 5DDHB 4N20A 5KJRH 1R5VB 2IGLA 4NO3B 2W0FA 1DR9A 1CXLA 3WY1A 4LAQL 3DETC 1MCIA 1PZDA 2NY5H 1PZCA 4GKLA 2MEJB 2H2PC 4LLWB 4KMQA 1J1XH 4Z77B 5I2IB 1OD9A 5LGJA 1CPUA 1FVEA 3HFMH 4X6CA 4Y7MA 2O6CA 4HMCA 2IBZY 3BGMB 2JFCA 4GUCA 4PSPA 4XNMA 3HC3H 4QHPA 3ZE0B 5MERB 3B5HA 2XFGB 3N1MC 2YWZA 2PW2B 5HYJB 4CVXB 4ORGB 1RZIB 3VU1A 2ZONA 3G5ZA 4PD4K 1EBPA 3VFPA 1TTGA 3D30A 2LLLA 3L3JA 4LFHD 2TSBA 1REIA 2VDPH 1AKJB 3FSAA 4CSTA 3EJSA 3PDGA 3SBPA 1QSVA 2ENSA 4ZT1A 4HLZH 4ABVA 1XGTA 1LEIA 1J5IA 5T1KA 4LQFL 3BMWA 1X7QB 3EYOA 4HUWB 3V5HB 2CUIA 2TAAA 5AAWA 1WAEA 1VFUA 3EFOA 3RLSA 2Z4QB 4KJWC 4UTAL 1KBKA 3WY2A 3D0LA 4L8CA 3W39B 3UBFA 3LXBA 5AOMA 2BERA 4QCIB 5GS0H 4XHJD 3HUJE 5F7HA 4NKIL 5AUMB 2X4PB 3VWKB 1LO5A 2Q7NA 5B4MD 5LLIC 2GSIB 4X6DE 2X44D 2OMWA 2QVIA 3RVWC 2EVFA 3ARFC 3VI3E 3TEWA 1U6AH 3FT4B 1E4HA 4PJCB 2BHFA 3IJYB 3PIQB 3TZVB 3DVGA 3V5DB 3I9AA 4ERSH 1HJCA 3WUWB 1D5BB 4A2DA 2HN7B 3MNDA 1QR1A 1OW0C 5CGYD 5GGTH 4MSWB 4BDVA 1TETL 1A0QH 3NCXA 1YEEL 4XBEL 4K94C 1Y1DA 1MQKH 3US9A 2ZCHH 4MD5B 4KI5D 1UACL 3BN9C 4JO3L 5FFOA 3O4LE 4N0CD 4XP6H 4BCZA 1HCYA 5IEHA 1T7ZA 1EAJA 1YEGH 3V52L 4N0UB 3OG4B 3UAJD 3O81A 5C9JA 3CVCA 1KB5H 2DIAA 2YAPA 3BD5A 5D7IF 4GRLD 4XXWA 4XPTL 1BLNA 1UB6A 2FLMA 1IM3A 1T03H 3H9SA 5ABZA 2WBJC 2A74C 2C7UB 2GUYA 1CLOH 2F18A 3O2WH 1S7QB 1XSOA 3KPTA 2DI9A 3L4TA 4MAUL 5EOCJ 4NYLB 2QSVA 1TPXB 1MF2H 2X2HA 4DUXA 5F6IC 1IGJB 3K6FA 2H0PA 4GINA 3DTUB 3PWUB 5I15L 3MLTA 1U8KB 4GW5B 1WCBA 4ADJA 4F7EA 1ZTXH 1UM4L 3GMPA 3HS0C 3TP4A 2VLKB 5HHQB 1HE8A 4WUUE 4LCWA 5F1OB 5FYKH 3PWNB 4FTVA 2ZOKA 4ODTL 1PW3A 3EDEA 1Z9PA 2OI9C 1FORH 5DI8B 5I1GH 1FZMB 1GSMA 2F58L 3L9RA 5D7JA 1Q72L 1TZHB 3GSXB 2PXYA 3VGEA 4FQLH 1J86A 4JW3A 4KKZA 2IAMA 3C6LB 3SDDC 2YQBA 4UZUA 3BAKA 3NIDE 2DIEA 4JHAH 1BQUA 4IS6B 1M3IA 2A99A 3RX5A 4XP1H 3TVMD 4LASL 3D2UD 3MJ7A 3MLWH 4ALAH 5D6DA 5AW6B 5HHMD 3NCEB 2X9YA 1YPZB 1YY8A 4KUCF 3ARGC 4JFDB 1JF6A 2XPGB 1E5UI 4PREA 2OP4L 2BOCB 3GZKA 3BHBB 3DURB 1WPCA 4LSSL 5I8OH 3PGFH 4ORZC 4HWBH 2PO6A 1IVLA 1JXJA 3VXUB 1QOKA 1BVLB 4PJXE 4FLHA 2PYEA 2B4CC 1IIIA 5B7FA 1M71A 5E2TH 2ZUSA 2OTWB 3Q2LA 5I8EA 5KYYB 4I4WB 1XGRA 4YE4L 1OTUC 5T1DH 4AUYA 4CDGC 1P4IH 1FZKB 3U9WA 5KTEL 5DZAA 1I9IL 1CB4A 2ENPA 3NRQA 3GSVA 3O2VH 3NPSB 3KEHA 1WD8A 2EQDA 5KVDE 2WXNA 3D85D 4XN7A 2DWEA 1SPDA 3CCHB 4PLKD 1ZGLP 4W4OC 4LAJH 5IBUB 2HPTA 2BSRB 4FMKA 1BF2A 2VNCA 1XZ0B 4XWOD 5CSGA 3OWRA 4N90E 1S7WA 1I8LC 2Z9TA 5HYIA 1F3JA 2QGCA 4XAKD 3PWVA 4IBTA 4MA1C 4GAYA 1KBBA 5ELIA 3AXIA 3SJVA 3B8YA 5AYUL 3AAZB 1S7XA 1XCTB 3EG9A 1PD6A 1VACA 4AITA 4JO1L 5T33L 4HX1B 5KUMA 3GXNA 1TCRA 4JN2A 5EORL 4RFOH 4YDLC 3F6LA 1M7DB 2YAMA 3NCFB 2DQGH 3HFFA 5A7BA 4BKSC 3UH8A 1FVDA 2EDMA 2NNXA 3UEQA 3BAIA 3GMLB 3LQZA 4MD4A 4R5XA 3T2PA 5J57B 3UAFA 4YHOH 6TAAA 1TXKA 3AS2A 3L95B 1TQCB 4L4VD 4EEEA 4BZ1L 1NDMA 4B7LA 3KLAB 2H6UA 3H9HB 4JRXD 4ZUSA 3BEVA 3IFLH 3WY3A 2A83B 3KPNB 2IPKB 1CGSH 3LQAC 4ODWA 5I8CB 3TWYA 3IN0A 1LEGA 1JNLH 2OZ4A 4P5KB 3FQXB 3A0OA 1CIUA 4FA8A 2HVJA 3BKCL 1G1OA 3VCLB 4JDEA 3K91A 1U2HA 4PJ9C 2HFGH 2OKMA 1HHJA 1NAMH 4ZQTA 1B4TA 3WNKA 1TU2B 3HI1A 4E0RA 1M1XA 5TQ0H 4H0IA 3QHZL 4O02H 3X3GH 3LS4H 2BO0A 4RFEB 1NGXB 3ZK0A 5C6TL 4XH2B 4Z3TA 3RIFF 2G75B 2F0CA 5ETUA 2JE8A 1YMHB 2VB5A 4OFYA 2MOVA 1UM6H 3MUHL 3VSTA 5F7MC 2N4IA 4HIHB 4Y2LA 1E28A 4R5TA 3KR3L 5D1QE 5BOPA 3QJRB 3WJJA 4GI6A 4OSUH 4JZJA 2EDYA 2X1PA 5JORA 1QW9A 4RMBA 5EO9A 4V1DD 4EI5D 4XPAL 3R18A 3UYPB 4GRLB 1Q90A 1L0YA 5K9KB 3SZ6A 1K2DB 4JLRA 4JO2L 4Q9CA 4AQZA 3G5YA 1TNMA 3ILQC 3RIAF 3CH1A 5J11B 4JPVH 4OCRH 4Z7UF 4OZIA 5GGQH 4LLVB 3U4AA 2IJ0C 2YMOA 1OLLA 4DP2X 4F2MB 4IBZA 4YFLF 5E4OA 1AZUA 1MCFA 1NGWA 4QRRD 2EYSA 2MOGA 3V4PB 1QRNE 4L0YA 1BECA 2JWYA 3MRLB 3KL3A 4JRYD 3VXMD 5EUOF 3QG7L 2X70A 3VD3A 2I5YH 4QTHB 5HVGB 3WFCH 2AJUH 4PFEA 5EA0H 1UM5H 2A0LC 4P48A 5BRQA 3VI4A 4LGSB 2VL5B 4OGXL 5GS2H 4MMZA 4H8VA 4BFOA 3BPNC 4OJCA 3VRLE 4NC0B 5DFAA 5E9DB 1IIKA 1NKGA 1ITCA 4YN3A 3TNMB 2RQ8A 3WUZA 1J0JA 4N0FA 4S2SB 1H9VA 4JG1H 2ZPKL 1C5DB 2IF7A 5AB9A 3TVMB 5JW4N 5AAWC 3D2UB 3WTVA 2JV6A 1Q9LB 3ARVA 1EA9C 1CG9A 2VKXA 3T77A 5HHMB 5KAQG 3HG1D 1TO5A 4GMSH 3EO9H 4TM9A 2GCYA 4G42B 5JR1L 3EOTH 2G60H 4WU5B 3O0LA 3FQWB 1K4DA 4M3KB 3IDJB 4OF7A 1N67A 4P57B 1N8OE 4HXBL 4JGUA 1J8HB 4CADA 1PCSA 3V55A 3L3GB 4LCYB 1NKOA 4O2EB 3RWIB 4CSSA 5HDQH 1OD7A 1DQQA 4PI0A 5HPOA 4WTQA 4NKMA 4ZYKA 4H88L 4RAVA 1BBDL 2NCEA 2G2PA 1NMCB 2Q86B 4AJ0A 4M62L 1Z9OA 1XMWA 3LIZA 1D6EA 4MQXC 2YD5A 1UADC 5EG6C 1RURL 3D85B 3S5LA 5C0FA 1WTLA 2CHNA 1I9EA 1KJ2A 4YLCA 1J18A 4KK5D 4BM7A 5E1IA 4NQDE 2HX8A 2FIKA 4GXUN 2GFBB 3LRSA 4XGZB 5H2BB 5MEQA 3V0DA 4NO5B 1N5AA 4W93A 1QRKA 3H56A 1ASOA 1H5BB 2CO1A 1NUGA 1IC5L 1SOQA 4TL5A 4HUUB 2DMBA 4OAWA 1DJWA 1LJMA 3Q9QA 2YHGA 4LPTA 5GS0D 2R1XB 2H3NB 2QL1A 4LSRL 3QJOA 3PF2A 2ZNXA 5T1MB 1JWUA 2CR6A 2CLVB 2QFPA 5ALBH 2FO1A 3F2LA 4XRCB 4YSTA 4WWNA 4FLQA 2WQAA 2WB1A 3OKYA 3WFDL 1MW3A 4O2FA 3P9LB 4L4VB 1JYXA 4EXKA 3LDBB 4JRXB 3U0TA 3VXTB 2EDWA 4F58L 3IJ9A 3QFGA 3ZE1F 3M07A 3DPBA 4TRPH 2YGVA 1IM9D 3I6GA 1OM9A 3UTSA 3OAZH 3QDGE 1JPSL 2E5EA 4GRWE 1MLCA 5D7JC 1HHGA 4R2GD 5GXBB 2PXYC 2ITCA 3IJ8A 2IAMC 2PTTA 3BKJL 4K3EL 5DF0A 4AYDC 3TF7C 4LK4A 4HWNA 1IFHH 1PKQB 5CU5A 3DSNB 1TJMA 1V54B 2JB5H 2ZXGA 3A6BL 3IFNH 2HT4D 1HXYA 1W0VA 4ONGL 2XN0A 4Y1SA 4B41A 2QFRA 4IOIA 2VN7A 3NCYP 2A9ML 3Q1EA 4Y1AE 4WI6A 5DT1L 3L4VA 4KXBA 4Y2OB 2PO6C 5CZXC 3II2A 1N3NA 1MCRA 4NUQA 1MDAA 1OSYA 1JAEA 1F45A 1FCCA 1QLFA 2J88H 2BIQA 4V1DB 4A55A 4EI5B 3BKML 2VITA 2WJ5A 4LSVH 3L9YA 1KT2A 2VRKA 2X42A 3DWTA 2D0GA 4OGYH 3RWDB 5CEZD 4PRBA 4EIUA 4L3EA 3NEXA 4J3UA 3JWOC 1KY6A 1NCUA 2EAEA 4JPIA 2A73B 2KH2B 3EYSL 2BW5A 4XNBA 1KXHA 2F74A 4BQCA 2F61A 2AITA 5J1SC 1F8TH 2NNAA 4QRRB 3QEQA 1ZLVK 1E5AA 1TJHL 3H42L 4OR1A 1OV8A 1F4XL 4KY2A 4YR6B 5DLMH 3B6SB 3O3DA 4E9WA 4JRYB 3FB8A 1BQSA 3KW7A 3BD3A 5HHXH 4XC3H 2F19H 2UUDK 4QHKI 4ANXA 2FUQA 5F7KC 2R2EB 3TO2A 3EZJB 1S9KC 1OALA 1I1AB 3MOAH 4PMFA 4OLZH 3PHQA 1C1EL 4LDCA 1UURA 3OB0K 1A6UH 1HZKA 1OWWA 2X3CA 1KEGH 3DVNA 3B2UC 3MX0B 3VFVA 4Z5RB 3VGAB 3NCWA 4YBLB 4OD1L 5F97E 3TTSA 3P9MB 2DQCL 4G6JH 5EZLA 4X8XA 2EECA 2Y7MA 3NACH 4MCZB 1EJ6A 1DO5A 1M1SA 3N1FC 4NHUA 3UPRA 2F08A 2VIRA 4UAOB 5GRZA 5I6NA 1QBMH 3WHXA 2PWDA 5E6UB 2H26A 1IC0A 1JWMB 1IGYB 4P46D 4AH2B 1ZJAA 1CDUA 3N44B 4QNPE 1MPAL 4DPRA 4BFBD 2Z93A 1T1XB 3U6XS 4ETYA 5G55A 1UD3A 2X4SA 1TEFA 3I02A 2MTAA 3I6KB 1DQJA 3LPGA 5DJDA 1BEYL 1P4LA 3DXAE 3OZ9H 4OIFA 3B5TA 4ZAKD 2ZG3A 4PJEA 4GOSA 4LARH 5I8KL 4NO0A 5JW5A 1HC1A 4TNVK 5FO8A 3EJRA 3MBWB 1WWCA 5I18H 5ANMA 3GMMB 5KVGE 5A6MA 2EUZA 1PU0A 1AQKL 1MCSA 3BQUD 4LLDA 5A3IC 3BSZL 5DJ6A 3KPLA 5F1IB 3FQRA 1FZJA 2R9HD 2DLTA 4X80L 1G9NL 3FO0L 3O6LL 5C2BH 4L2YA 1NCBH 4NENA 1CDJA 2C3VB 3HB3D 4DQOH 3HAEA 2JELL 1GS8A 1CMOA 1MI5A 1AGDA 3ML9A 4C4KO 4YHNA 4QTIL 1KCBA 2IADA 4N3UA 3ORJA 1GGBL 3A4FA 4PJ8A 5IESH 3WNIA 1IKOP 2X4QA 2MTPA 4NZTH 3VXPB 5CINL 1M2VA 1RJYB 2AJVL 4FQCL 1QTYT 2VH5H 5DQ9B 4J3BA 3H9YA 4H8HA 1WA2X 4G8FA 2WYZA 1D7FA 3MNMA 1IM9B 5ADOH 3HE6D 1XB3A 2DY2A 1IBGL 3S5LG 1ZD6A 1GW6A 3FAWA 1RXLA 3ZKMD 3KPRB 4R2GB 1LO3L 3CFBB 1JV5B 4IDJH 3SOTA 4M7ZC 3V5KB 1G7JB 4EO5A 4XMKH 3RGVD 1OAXH 1MWAH 4FE9A 2VWEC 4XO3A 5GJSL 3KGUA 1FFNB 5C09A 2GY7B 3SDAD 4XVUD 5I19H 1MFCH 2A6JA 1UZ8A 3WIIH 1A4AA 4J3OD 4OCYH 3SE9L 4E5XB 3FFDA 1N8ZB 3BP6B 4S0HA 4GMTL 1S7SB 1UZGA 2IDQA 3MRGB 1D5ZB 1ZMYA 1FO0B 3B2VL 4G80A 2GHZA 3IJSA 4JHUA 3V8OA 5CWSB 4N9GA 3IS0X 2QHRH 5IVZA 3KCPB 3FMGH 5DI8A 4PJDB 4OZGA 4OCXL 4U6XA 4HIPA 3GSWA 3S3SA 2JJUA 3TEUA 2EDDA 3LVTA 2VM9A 5ESQA 1C16A 1PG7X 2YEQA 3C09C 4FZEH 4LL9A 4ODSH 2CHXA 4TSCH 3U36A 3PGDA 5E99H 4M4RB 4U6VH 4XBPB 3VAEA 4PV8B 4QEGA 4YNYA 5D2NA 1LHZA 4CN1A 4ZMTA 2E7LC 4FQIH 1DLFH 4FI7A 1BPVA 4LBEB 1HINL 3SKJL 2V3EA 5FOJA 3SE6A 1U8LB 2B59B 1R24B 3O0RL 3P77A 5E8PB 2VE6A 1BV8A 4QF1B 3VWJA 2DIJA 4P4KD 1HXMB 2JSFA 1C8PA 2IDUA 3VXRA 2ZSWA 2R0WH 2YD4A 2X38A 3JTSB 3QJQB 4N2CA 3VG0H 3CFTA 2R2BA 2YN5A 2GITA 2APFA 4LSUL 4W1TA 3E80A 3ZDZE 2P8PB 1X3DA 3GEWB 2O61B 3DROB 5BJTB 1ZT1A 5D2LE 5DZVA 2R1WA 4R7LA 1I8KB 1GSKA 2X12A 4FQ1H 3RA7H 4EIGB 1KJMA 5KG9A 2GTWA 3JWDH 1MIEH 5EZIL 3WLBB 2JI2A 5GS1C 1ESOA 3RL1B 3STZA 2X4UA 4M6ML 1THCA 4K5LA 3QT2A 3TS8A 3T6ZA 1S7TB 4DVBA 3PABA 2XJKA 4DCQA 4P46B 1X9UA 3S98A 2YPLA 1LDPL 2VERA 1JPTH 1Z3GL 4Y19A 5K9OA 1MFDH 3ETBF 1RZ7L 1EAOA 2XKNB 4XMWA 3WEBA 3WN5B 2AZUA 2EJ1A 3UYRH 5KBPA 2J44A 4W81A 2YOCA 4BQ9A 1MG2C 4N8CH 3W37A 2CIKA 4MJ5A 3DUHA 5IB2B 1F00I 4ZAKB 5I71B 2Y5QA 4I3SL 3P02A 2JCCE 3U2SB 3S3CB 3MODH 3DMMA 3F85A 3AXLB 2VJ8A 3NCCB 4I1PA 4KTDL 5KYWA 1QSFD 4NZRH 2EKSA 4FL4B 1EXUB 2K8MA 5IT2L 3C08L 4S0SD 1UOWA 1HDMB 1H15A 2CGRH 5DHVA 1AO7D 1GIGH 1DBKH 3VI3F 4ZFOB 3I3BA 3UAJA 1CXIA 5C70A 1HYSC 3ECBB 4RMQA 2Y1VA 1AR1B 3ZYOA 3Q8CA 3EO0B 1CQYA 2ZUWA 4G8IA 3X1EA 5L4JA 2HMIC 5EPMA 1JZ8A 2HTKC 4NOFA 1WC7A 2HLAB 1MCJA 3MRRB 5D7IA 5EU4B 3GUTB 3MROB 2VO5A 5CN2A 2UXFA 2KQMA 2AEQH 4TPRH 3OAUL 3QRFM 1SUJA 1MRCL 3LKPA 4JFED 1QTSA 3HE6B 4RLDA 4ZFZA 4OZFA 2H0FA 3AS0A 4PWIA 2CQVA 2ADJB 4M5ZL 3VJ6A 1WBYA 1TKWA 2W0FB 4PTUB 1AXTH 4LOVA 3QQNA 3UFIA 4OLYL 2OZNA 2VDRL 2I60L 3RGVB 3K6NA 4NIKB 3PAZA 3QIUC 1U93A 1MN4A 5EUKA 3CLFL 2WLYA 2VLMD 1NIEA 4U1KA 3X13A 1Q1PA 4G9DA 4AT6B 2DQTL 2DI8A 3DSFL 1KNOA 1TZIA 3RG1C 5EF3A 4P8QA 4AIXA 3HAEG 4L0ZA 1GXEA 4R7DB 4HGWA 1H0DB 2EH8H 2BOBB 4J3XA 4DFIA 4M03A 5CF3A 4TUOA 1UT2A 5A2CA 4P59L 2IXQA 5F88A 4HUNB 4N0YL 3MV7D 1K5WA 3FOMB 2O26U 2UY7B 3NIDF 4URTB 1YG9A 4IHBA 3JYCA 1CYGA 1FLRL 2MPAL 3O8XA 1WZKA 1D9KA 5IQ7L 3ULVC 2FECL 5T1KB 1X4ZA 4N8VG 2F7RA 2Y6TE 2HWZH 5ISZE 1VESA 2D7NA 4KZEH 2YRBA 5IOKA 3UX9B 2AQ3A 4PUBH 5IQOA 3CN1A 1FL6B 5ECGA 5DMJB 4YDJA 5LQBL 3GXIA 3MA7B 1DBMH 2P52A 1L7TH 2VMDA 5C0DA 4IRSD 4DGIL 1PNCA 2FAUA 1MJJB 4L8SA 4H25A 3BIKA 1T5KA 4F24A 3LKNB 4H5SB 4OM1H 4DP4X 2NY1D 3IWUA 5JQHC 3IMTA 3N9GH 4Z95L 3SDYH 1TJIH 5FV1L 5C0CD 3TO4A 4X6EA 1A22B 3ROLB 1TUPA 4FQQA 4N22A 4RQQA 4HUKB 1V3MA 4HPYL 2DM7A 4C4UA 2UY6B 3RGBA 2G5BA 3MXVL 3QUML 4F33A 2CO6A 3GJFB 2P80A 4I89A 4HEMA 2FBOJ 4Q14A 3U6RA 3T0ED 4AE0A 1JZ2A 3MBED 2OTUA 1I7ZB 1ZE3H 4OF6A 1KB9K 4BZ2A 4UQBA 5DK2A 4Q6YA 4RDQF 4ZUUA 5IM7B 5C6WH 1BLNB 1B6DA 5C0RL 1TQTA 5E8OA 3H9SB 5DD3L 4Y2DD 2IG2L 3WHE0 2ITEA 2MNJB 5JHLL 1AY1H 1D5IH 4G5ZH 3BP4B 1WK0A 2XV0A 4LPUA 1A7OH 4EBQH 1TNNA 2K3TA 4PBDA 2LQRA 2OSLA 5DFVC 1MVUA 1BVKA 2DB8A 2EEAA 1BAFL 2DW5A 4E9SA 2AQNA 2AQSA 2OCFD 3EH1A 3NIGE 4F7EB 2J5WA 1SEQH 1ZAGA 2FL5A 3NAAH 2F5BH 2WLLA 3QZWB 5CKGA 4ZMQA 1QSFB 4FTVB 3KWUA 1HSBB 5J89A 2W65A 4XTRC 1SM3H 1CLYL 2CPUA 3ROOA 3QJVB 1F3RB 1AO7B 5BCAA 1WTGT 2EDHA 3RTQA 3NJIA 4DPCX 4EQ2A 4XAWH 1F2QA 1DJYA 2FK9A 3P0GB 5FXCH 2YA1A 3IDMA 4N4YB 4NQVB 4P9HC 3E8UH 3FTSA 4R7VA 2XBTA 1MG3C 1S6NA 3VFSA 4CC4A 2D0FA 3Q2VA 3E6HB 5D2NC 5DQDH 3EBHA 1XH1A 1YNKH 4GG8B 2R0KH 3HLAB 3P11L 2YZ8A 3LNHA 4ZPVA 2GSGB 3MLZH 5KVFH 1P5UB 4F57L 3MLXH 2HRHA 1E9OA 1YN6B 1ES0A 2CH8A 3BFQG 2Y06H 4CC0A 4W9ZA 5CBAB 3WXVH 3BZEA 2VDLB 4YEEA 2Z64C 3I50L 4JFEB 3BVTA 3GXFA 1U8NA 2OJ1A 4X4ZA 1RSYA 4Z7UA 3KHOA 3WCYA 1NZRA 1A47A 4EOWL 1H3XA 1GZHA 1GOGA 4JN1L 3FU7A 3MSPA 4J2QA 5AOJA 2BNRE 3CZSA 2J72A 4XVOA 4AL8L 3SKUD 2V2XA 3OAWA 5FDYA 5E8DL 2GI0A 4K3GA 2A6IA 3QQDB 4BUGA 1A6VL 3UL4A 5ID1A 1CS6A 5AL0A 5LJYH 1NL0L 1JUFA 3MNVA 3V4VH 3VXSB 1F3JB 3HZ3A 2WXGA 3TV3L 2VXQL 1Z9NA 5JXAL 4LLMB 1AFVL 3F58L 4GAYB 4MJJA 4XP5L 1WUZA 2GEQA 2OYLA 4NUJA 2R56H 5E03A 1QW8A 1S7XB 1FSKC 3II1A 1I3GL 4NQCA 3LQAL 1AYRA 1AGFA 5HDRA 4S1RH 5FWQA 3PCYA 4DOHB 3FDWA 3MV7B 1BQKA 5A40E 4XHJC 2WUBH 5DD6B 1AQHA 1UT9A 3H7LA 2WXQA 4MLSA 4CKQA 2ORBL 1RZKC 3BW9A 4PB9L 5LWYL 5B4MC 3CFKA 4ZFOL 3QJFB 4OLVL 3WS3A 4MD4B 1OPGH 3APMA 1JNNL 3H7BA 4OZFG 2VUKA 2EXWD 3GLAA 1MHEB 1ECZA 1A9EB 3FU0A 4ZUSB 4UOQA 3ZKSD 4GLRH 3BEVB 5FYJD 4AZ8B 2DQEH 3GSOA 2ICWI 5F0MB 4FMFA 5GQBA 4AYSA 3BCDA 4ODWB 2GG1A 1BOGA 1LEGB 3D39E 4IRZA 4Y5VA 1KYOK 4TULL 5MEOA 3DI3B 1EXHA 4AV5A 3HI6H 1JMXA 3SSGA 1MUJA 2CBMA 5C97A 3VU2A 4N0CC 2HAZA 4N2IA 4MXQD 4V11A 5BMFH 1NPJA 2OMBA 5AOZA 1UASA 2NY1B 3UAJC 7FABL 2EDLA 4P2RA 4E0RB 1RL1A 1U2CA 4GRLC 1YQVH 1JIBA 3QYNA 4PWEA 2MQ3A 4BFIB 3MZTA 1R5IA 2AJXL 1L9PA 4ELME 5DC2A 2E7CA 1GTNA 4E41D 4JQIL 5J11C 4FX5A 3MUJA 1AGEB 3T0EB 4OFKA 5CCKH 5TH2B 3MBEB 1MFAL 1M7XA 4X4YB 1J5OL 1U8JA 3SDCA 3FCTA 1BMZA 2P24A 4N8UA 4Y8AA 5E6RB 5ADPH 4WFFD 2FWOA 2VSCA 3HMWL 5AWNH 3WI9A 4W6YB 4LEOB 4Y2DB 2Q3ZA 5J8OA 2N0MA 5ABAA 5B39A 3QG6A 1SRDA 4FQXA 3OKOA 3G5YB 1J12A 3CH1B 4UOJA 4Y9BA 8CGTA 4QAWA 3TTYA 4UV7L 4WI7A 3QJUB 4WF7A 2F15A 1E5ZA 3TYFB 4AEIL 3WIFB 1A6WL 5EEYA 1VFAA 5FYKD 3QO0A 3EF4A 1K8IA 1VCBC 5EU5B 3NGBC 4YHLL 2WCPA 2JKWA 5M95B 5K39A 3EFDL 3TVMC 4KNSA 5EO0B 2X10A 2GIXA 4UT9H 4XZ4A 3EOBB 3VG9B 4FFVD 2EIEA 1OE2A 5ERWB 3QDJE 1VLXA 2QDWA 1O9ZA 5J6SA 1QA9B 1TVHA 4DZ8B 4HZ1A 1KXQA 2CGYA 1JJUA 3O8XC 3NESA 5JOEA 3Q1SH 3GIVA 4N0FB 1R46A 3HZMA 4JRWA 1D9KC 5IFAH 1LQSR 5D72H 3WFBH 4ZG1A 2IV8A 3DK2A 3JYBA 3T77B 5G4NA 1EZLA 3GSNB 3G3LA 1OM3L 5D55A 2BDNL 4GKNB 4PRIA 3BVNB 3BH8A 4PLKC 2ZCKH 5FK9A 1JZ4A 1S2EA 5JW4Q 2ATPB 4KMLB 4FFWD 2F53E 4XWOC 4L8SC 4EUPH 3MJ6A 1OP5H 1ZEAL 1IO4C 5CJXC 4P2YA 1BD2E 2GB2A 2YPVL 4QXVA 2P49B 2OAAA 1DQQB 2Z35B 4AW7A 4NKMB 3LHAA 1WBXA 1FIGH 1H5BC 1ADQA 3QAQA 5BRPA 3CZEA 5EU7C 4L3FA 1R3KB 3DDFA 3D1MC 2O5ZH 5BO1H 3RDTA 1WHOA 1RUPH 3S5LB 4HCGA 5E6ID 2VLRA 2OJEB 1KJ2B 4TNWK 4BKLA 2XX0A 4EPSA 4UDUA 1BFOB 1XEUA 1PAMA 2UV3A 2R2CA 2Y4SA 4P2AA 4Y4HA 2EH7H 3ELAT 2DLFH 3VX1A 1N5AB 5L2KE 2ZE0A 4NQUA 4RSVA 1NGYB 5KEZA 5HGAB 1RIHL 4F1ZA 4HH9B 1QG3A 2HFFA 4MJ4A 4CUCA 4HUVA 2VABA 1OQXA 4FZ8L 3WO3B 2W91A 3TNNB 4QHUA 4JG0H 4L1TA 1W80A 3NJVA 3QYMA 3QEHA 3BPLC 3ZL2A 4M9OA 2IALA 5E23A 1AZZC 1G7HA 3MV8A 5FCUL 2WLJA 4JM2D 4U1JA 2GABA 5EIVA 3WOVA 1TG8A 4FNTA 4KU1A 1D5XB 4PS4H 2D3NA 2QLYA 1LEKB 3QQ4A 5CN1A 4W70A 1ZXQA 3MRNA 3I6GB 3VD2A 4MNGB 4IBWA 2IFFL 3H6JA 4QNPF 2NW3B 2YZ1A 4A7QA 3RVVC 2CJSA 5C1MB 4PY8I 4ONHA 4LRNL 3RTQC 1UA6L 3VFGH 2EE0A 5FR3A 4MA7H 1FDLH 4K9EH 2VDLL 3BQUA 3HN8A 4AMKL 4KQ3H 5TJWK 5T5NF 2FGWH 2G0LA 1DUYB 2YUVA 4CC4C 5CBEB 5IJBC 2Q8BL 3QSKB 3OKMB 2FT6A 4XMVA 3MOBL 4Z7VB 1SJHA 2VDQH 4K3DL 2V4LA 2P5ED 4KTEL 1CLVA 5D71L 4E41B 3C9NA 2XCMC 5EC2A 1KB5B 1PQZA 4APQD 1N3NB 4PLJD 5I1KL 2AQ1A 4L4TE 1E9PA 3CQPA 4D0BA 5FECB 3MRPA 5BZDA 2MHAA 3Q6GL 3I74A 2CKBH 2DD8H 4LPYA 4OFVA 4DESA 2BP8B 4PTTA 4L3CA 3T3MF 1CXKA 4KWUA 2XV3A 3FTGA 3NK3A 5MENA 1TVBB 5EOQH 3D06A 4IBYA 1S9XA 1EEYB 4JPIB 4J7RA 2IH3A 4W6XB 3UBXB 5DJ2B 4BINA 2MFNA 3WNPA 4OJFH 2BJML 5AW2B 1UA7A 3CBKB 1FGNL 1E4WH 4RA0C 4APXA 5FX3A 1DJHA 3LJ3A 4U3XA 1XR9B 3OC5A 4F8OA 2FNWA 4NNXA 3ESVF 3QR2A 2R69A 2IVFC 3QZBA 4YBLC 4TNVF 3SDAA 2CPCA 4X6BA 2RALA 2W94A 3ARXA 2MQCA 1M9SA 3OKDA 5E2UH 5JHDE 5GS2D 1I8IB 4K3JH 4C4BA 2GBTA 2CDGA 1IE4A 1SBSH 1SJEA 4MRBA 4KPHL 4PRPE 1JBJA 1VA9A 2BC4A 4DGYH 5D9SA 4G9FE 5I1AA 5C07A 4DUVA 3MACL 2QBWA 2BZCA 3DVNB 1MVFA 1NBQA 4NI3A 3QUXD 3D3VA 5JLZB 3FONA 1UT1A 1GCYA 3KGSA 3IRPX 5A6IA 2QGEA 2GHWB 3QCTL 4LU5L 1L9MA 2VR6A 5SWSD 5CP3H 1LNUB 5GRWA 2DDQL 3SGE