4ZMVA

Crystal structure of human p-cadherin (ss-x-dimer pocket i)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
MDWVIPPISVPENGKGPFPQRLVQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Cadherin-3
total genus 45
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmvA01
3LNFA 4AQ8C 4APXB 4AQAA 2WCPA 2YSTA 4ZMPA 4AQAB 3K6FA 3UBGA 4ZMZA 4AXWB 2A4EA 4NUPA 2WD0A 5KJ4A 2OMXB 4ZMYA 4ZMVA 1WUZA 2YQGA 3Q2NA 3MVSA 3PPEA 4ZMXA 1FF5A 4AK1A 4ZT1A 1NCHA 3LNEA 3K6IA 2V37A 4NQQA 2OMWB 4ZMOA 1L3WA 4ZMTA 4ZMQA 5JYMA 2X2UA 2OMVB 1NCJA 4ZMWA 1EDHA 4AXWA 1NCGA 2WBXA 3LNIA 2QVFB 4AQEA 3Q2WA 4QD2E 5DZVA 4ZI8A 2QVIA 4ZMLA 3FF7A 3FF8A 3K5SA 4ZTEA 3LNGA 3Q2VA 2EE0A 2OMYB 4OY9A 3UBFA 3LNHA 2OMZB 4AQEB 1NCIA 3LNDA 1OP4A 5CO1A 1ZVNA 2O72A 4XXWA 5CZRA 2WHVA 2OMTB 4XXWC 3UBHA 4APXA 3K5RA 5JYLA 4AQ8A 1Q1PA 2A4CA 1ZXKA 4NUQA 1O6SB 3K6DA 4NUMA 1SUHA 2OMUB 4ZMNA 3QRBA 1WYJA 3Q2LA
chains in the Genus database with same CATH superfamily
4NQDE 3OF6D 3V0GA 1E4KA 1CBVL 35C8H 1FGVH 3O6FC 2RCSL 4RAVA 3P30L 1ET5A 4I9WD 1JK9B 4PBDA 4ZODA 1NMAH 4QTFA 1TCMA 1WP6A 4PJ8B 1UT9A 4NQCD 4G70B 4CDGC 1DEDA 3BIBX 4R4ND 5C0DA 5ESAB 2YMTA 4NGHL 1JV2A 1U92B 3TPUA 3H7BA 5CJXA 1IUZA 4CRPA 2YQGA 4QTHB 5JW4M 3QWRD 3KPRE 3L3IB 3O6LL 4UQBA 4MXWH 3VACA 3CQFA 2EYSB 4CL7A 4X7SL 3UZEA 2BS9A 4MB4A 1WISA 4MKMA 3W39A 2D3LA 3MRGB 1BEXA 3EJYD 4MD4B 4G5AA 2R8SL 1G1KA 5IB5B 43C9A 1AO7B 1M7UA 3BN3B 3OAWA 4UM9A 5FIEA 3V0DA 4H4NA 4MJ4A 1E2WA 5D7SH 2YXFA 3ABGA 1LO2H 5J7CC 4LPTA 2HUHA 1T1YB 2PR9A 1PZ5B 2HJKA 4S2SB 1MOEA 2W59A 4I1RA 3E6HB 2VC2H 3MGOB 4UIKL 5A2IH 4FD0A 4O9HL 1P7QB 4P2AA 3DMMB 1L7IH 3RIFK 4RWYL 2JH2A 4XHJD 5E8EA 5GISL 5C8JB 1CDCA 4OLWH 2V9QA 5HHOB 2VR4A 1WE5A 1GIGL 4IBWA 2V4LA 2X3BA 2PYFA 3BO8B 4M1GL 3W0WB 4MGXA 1FO0B 5C0FB 2EE0A 2GTZA 3E1ZA 5KYYA 4AOFA 2ZOTA 3WEXA 5E9AA 2PW1A 2R2HA 1OZUA 1JTOA 1DBMH 3K91A 2H41A 1GGIH 1KCSH 1RZKC 1XCTA 2ESVB 2FUQA 4PJ5D 4K7PX 5IEHB 4M56A 3OR7B 3I6KA 4NQXB 4MA3B 3TTSA 1EJOH 1ZVNA 2WTPA 4GG8A 1NANI 2UXFA 5D2LF 1XGRA 4WKZA 4ZJ9A 4TLSA 3GWJA 3WJMB 3GI8L 5KSBB 3F6LA 4M62H 1AE6H 3AS0A 4P23B 5C0RL 3NJGA 5F93C 2IH8A 3AWGA 3QNFA 4PH8A 4ZFGH 5EF2A 3AAZA 1BZ8A 4L3CB 4A2FA 4B5EA 1T2QH 3UABA 4RZKA 4I9WE 2AABH 5H2BA 4AEIH 1NOAA 4NAJA 2AEQH 4KQ4L 3WS6C 4DTGH 5IQ9B 4Q4EA 1PMYA 4XPBL 5ANMB 5K33A 4LPUA 4JK0D 4NQEE 3HZKB 4YHKH 1TQSA 4N6QA 5CNHA 4X6CE 2EUZA 2YPLE 1UUNA 4N6RA 3LNFA 1F4XH 4R96B 5D4IA 1EHNA 3O9WC 4PGEA 3B9KB 5F7MC 4ZXBB 5JO5A 2CO2A 3CXDL 3HI1B 3U6XS 4L0YA 2VRQA 4LSDA 1RZJC 3VFVB 4YSDA 4U1GB 1ERNA 3LZRA 4PJ7A 4GXUN 4XN1A 1OANA 4HUCA 4JFYB 4LBAA 1T0PB 3L1OH 4BCYA 2Y22A 5F3BA 3MV8E 1JPGB 1KB5L 4MD5A 1NAML 2R0LH 3TA4D 3ZL1A 4IRSD 4YHYC 4DUWA 3A5VA 4GIPD 1VRSA 4TUKH 4UUJA 4JG1H 2BVPB 2ICEC 1ZANL 5FUOL 4JR9H 3BVXA 3IBEA 1CFMA 2KPWA 3DK0A 4NZ8A 5F7LB 4OZHA 1S7SA 1R5WA 3RDTA 3QAZC 4TRPL 5TPWH 4NJAH 1SPDA 1U95B 4Y5VB 1ZE3C 1S9VA 4ZUTB 3VFPA 1UT2A 3ULVF 3L1OL 4KQ3L 3KR3H 2J72A 3NJNA 2AGJH 2WVVB 1BXVA 3HG1D 5IV2A 5J1TC 4KUCF 3QXUA 1YYLH 2X7LB 2Z31A 2JCCB 4A04A 1S9WB 4U6HA 4M61B 5AEAA 4J4PD 5T33H 4WFED 2MFNA 5DHVH 1PNDA 3F83A 5MHSD 4IOSA 4WENB 4X6DF 4ADIA 1XGYL 2G2RB 2EDDA 3OJDA 1FORH 4URKA 2Z91A 2VLRB 3Q9PA 5I1IL 4LHQB 4NQED 2DQHH 2K3TA 4LCVA 4Y5XB 3EYQC 3G04A 4KRLB 4C4KO 3QORC 2H6UA 2UXTA 4Y16C 3LMJH 4ZMWA 2Q86A 5JA8B 2CM6A 1FNEA 4QXWA 1MVUB 2KS0A 2AW2A 4S1DD 4XO3A 1DFBL 1R75A 2ADGB 4LAQL 4PLJD 2CRMA 4DZBB 1HJBC 1CDBA 3MRPA 2XXCB 3QYNA 3GSNA 2P43B 5EO9B 3CFJB 3DX8A 1NQBA 3CXFA 4LFHG 2EICA 3QRGL 3V55A 3EXLA 5ITFA 1M56B 4PWGA 4K55A 3OF6A 3BEWA 3DJSA 1BGXH 2VAAB 1U6AH 32C2A 2DD8H 5I82A 1TENA 3GLDA 5GGTA 1XD1A 4KI5F 1KLUA 3FTWA 4FMFA 4F7MA 4QOKA 4QXTB 3WY1A 3RG1C 1C8QA 3H9SB 1AQKL 5DWPA 4PJEF 4FQQA 5BS0D 4JM2C 2QVKA 1ZS8A 4EDWH 1PFOA 4KNSA 1TQCC 5IQ7H 4NUGH 1YG9A 3L4XA 3I50H 3CVHA 5I1KH 2YAQA 1SNRA 4FXGB 4D9RD 1E43A 3BZDA 3VD0A 4ELMA 3DV4B 5J6HA 1WRFA 2YSTA 4I0PC 2ZOUA 3QJXA 5LBSA 4PIBA 4FP8H 3TFKC 5ACZB 2FQGA 4XAWH 1MW1A 4IKIA 4AKOA 1F4YL 2ZX7A 3O8XA 2UYLB 1EO8H 1KTDB 2FEDC 2W07B 2X5PA 4P3CH 4U1JB 3NUKA 4NPKA 4O00A 3O4OC 2EE9A 3UO8B 1LK2A 3VXSA 1HJCA 1TT6A 4DGVH 2CXGA 3EGDA 4GRMA 3VI4E 5F7AA 1P84K 4DF9A 2FEDD 2GI7A 1DSWA 3P4OB 1OY3B 3MRQB 3VD5A 1F4YH 2Z9TA 4HK0A 4JN2A 1TZIA 1J05B 2P5WD 3E9TA 1TYRA 3C8DA 1YC7A 1ZLSL 4HPHA 4U1MB 4F7CB 1SXBA 5JIQA 5BPPA 3QE5A 3FRPB 2M26A 3POHA 3VRIA 4FEMA 1E2VA 3BEVA 3PHSA 5GRJL 3G08A 3KYOB 2PXYA 2QQQA 4M7LH 3FRPA 5C2BH 3BZEB 1UD3A 1IFHL 3VO0A 5I0XA 2OR8A 3ZQ9A 2DL2A 4ELKA 4P23C 1UWXK 1CTNA 3DARA 4ECNA 2XN0A 3VRLF 3PDOA 3ZDXE 1J8HE 3EOAB 1QSZA 2X44D 3OXSA 1DVZA 3EAKA 3BKML 3ZDZB 1YN7B 3L9RA 1C5BH 2EDHA 3AADB 5GZOC 1U6AL 1UWFA 3WJJA 1TQTA 4G6MH 2OMWA 3B37A 4LDLB 4MNGB 1KCVL 5FYJD 3CC5A 3W3BA 3AXIA 4PJFF 1PLGH 4Y9CA 1HHGB 3UDWA 3QRLA 3QEQE 1H3XA 3HKZA 5SWSD 6PCYA 5AVUB 2A2QT 1J8HA 5LO7A 4M6ML 2W65B 5H2BB 3B2UC 3TYFA 3EJZC 4QR7A 1SVBA 5B1AB 1D6VL 1NMBH 4G8IA 5A7BA 3OL2A 4P2YA 1JFHA 2VXTH 2AVGA 2DM3A 1E5UI 2ENJA 3FQUA 3QORD 3PWJB 1YC8A 3C6SA 2AXFB 1RZGB 1BAFH 4GQ9L 4MAUL 3O11A 3W38A 3RWJB 2P5EB 4CSSA 2IGLA 3HOGA 5C86A 3P3UA 4N5ED 3SCMB 1FE8L 4ONFL 1Q9WA 3CQPA 1NBQA 1K4DB 2XTJE 1SF5A 2B1OA 2CBTA 1NFDB 1BIIB 3QP3A 4BH7A 1TCRB 1WQVT 3D18A 4LP5A 4HUMB 5C09E 4EUPB 4XTRD 3KM2A 1R0AH 4MA8H 4JKKA 4YSPA 4JG9A 3IGFA 5IB2B 2ARJA 1XD0A 3SQRA 1OE3A 2AXGA 2JB5H 3KXFE 3U25A 5EFIA 5HYSA 3QS2A 1R33A 1W0WA 3DYPA 1E0OB 3RWCA 3P2BA 4JUTA 1PZAA 4PRPB 3DV6A 4K9EL 5HHQB 3N42B 1A14H 1QI4A 2IWKA 4N3UA 1JFQL 5EN2A 4C4KT 3S96B 1JD7A 4P4KB 4Z7VF 5LQBH 1G1YA 3H3PL 5D1ZD 3LZFH 2PCXA 1HXMA 1E27A 1L6XA 3VXNA 1JMXA 2FWLB 4PY8I 3T1WA 2KZ1B 3OKNA 3ETTA 4DP1X 2FX8L 4WI8A 2AHIA 4XX1G 1UASA 1GZQB 4LGSB 4JMXA 5L2JB 2ITCB 2NY7L 4JQIA 4P2OA 3ROOB 2DY2A 4M8UA 4K5PA 1ULVA 25C8L 5I5RA 2EYSA 1DQTA 3FU0A 3PFUA 5T3ZE 4FKHA 4PJHF 4XP4H 1U42A 4OBRA 3MU3A 5HJ3B 4PJBB 5DD6A 4X50A 5SV4A 1JPST 5DJ2B 4F7TB 1KELL 1AXSA 2WBWB 1ORSA 5JW5B 4QHPA 4W93A 1T6BX 5JR1L 1T83A 3J8F7 2WSKA 3LHAA 1H3UA 1QRNA 2BS8A 2J8UE 3GUTB 1GZPB 4U1MA 4F7CA 2QLYA 3SY0A 1KEMH 2GK2A 2RQEA 3NABH 4G11A 2GBVA 1BOYA 3HUJB 2Z8RA 5CZRA 4QHMA 5DGRA 3RVUD 2BC4B 3DSNA 2HLAA 3GSXA 5D7LB 4F2FA 4WJ5A 4XCCL 3R1GH 4LEOB 3STZA 3BCFA 2ESVD 5E8DH 3ZZSA 1JRHH 3AG4B 2AJVH 5JPNC 4MXVF 4MYWB 4A6YB 3VJ6B 5IQMA 5F3HB 2QQLH 3BIKA 4ZUVA 4DP2X 1CLCA 2G3XA 4IHBA 1JV2B 1QBLL 3T2QA 1BFSA 3WNNA 1HHKB 4IM8A 1F1AA 1TXKA 2DZEA 2WQAA 3JWDH 3OKNB 1GGIL 1KCSL 4H8WH 4ZMNA 3O4OB 3SO3C 3LQAC 1WYJA 3PJSB 3BEWB 3KXFB 7TAAA 2WYHA 3VWKA 3MBEC 3BUDA 4O02H 3BWSA 4RAUB 3VG9C 5I0VA 2LFGA 3MX0A 1DJYA 4HPYL 1NGYA 5ERWA 5FGBA 4XMXA 1YEIL 5L7XL 3FT3A 2BNQA 1DE4A 2XKNB 4Y4FD 3WNJA 1PKQB 2O6EA 3CCHA 3EJTA 1QUNA 3RBSA 2YZ8A 3W0WE 5SX4I 4AMKL 5DT1L 2FZ3A 2KYIA 4WUUA 2WN2A 4MJJA 4W9CC 3K2UH 3ME0B 2OMTA 4OUUA 3G6DL 1J1OL 4HG4J 3S3CB 2RFXB 4HK3N 4YBLB 3LRGA 1EA9C 5HHVL 1ODUA 4LU5H 2O61B 1CXEA 1XL4A 2BIHA 4O2FB 3NQIA 3LEVH 3L95B 2QPFA 3RY5A 1CICB 5I6MA 2GJ6B 2Q2LA 1RHHB 5D1ZC 4M3KB 2R15A 4KFMA 4U1IA 3T0BA 4KY2A 1J5IA 2VDNL 1FSKB 3LKOA 3WOVA 3J2PA 4EN2A 3I3BA 3BP6B 1EZLA 4KXCA 5DJCB 4TQIA 1IT9L 5CJBA 3NZHH 1D5MA 5KBPA 2QPEB 2Y3NA 2F08A 1T1XA 3H8NA 3LS4L 4XH2B 2QQKH 1T22B 1NGXA 5I1CL 1AANA 1R6VA 4ODHL 4OVUA 2P1YA 1FGNL 3GT6A 3P2DA 3MYJB 4OZHB 2MQ3A 4DEWA 5LDSA 2LQRA 3TYGL 4UDTA 4RZCA 4LSPH 3SYPA 5C0CD 1LE9A 1A6ZB 1IC5L 5HDOA 2E59A 5JMOC 4HS3A 4GBXA 2H7WA 5A43C 1RUPH 3PWLA 1O75A 3I2CH 4GAJL 4IDJH 4N0FA 3W11C 2WTRA 5AB1A 5FGCB 3FUEA 3O81A 3V4PA 5D70H 3MXVL 4Q9QL 4JFDD 5F0MB 1Z6JT 3BGFB 1QI3A 1VADA 3H56A 3TNMB 4JVPA 1UEMA 4JRWA 5JHDB 2CE6A 5EO1A 3M8OH 4HJTA 2Y2YA 3BAWA 4BZYA 3EDKA 3V6FB 2OI9C 3MROB 3GBNH 3ZDYF 3BIAX 4EI6A 1GR7A 4PP1C 4NCDA 3X12A 3BXNA 3FU6A 4LNRA 5KYUA 4H1LG 1PG7W 1RD6A 3S7GA 3WHXA 5CP7A 1HQ4A 4XNMB 2YD3A 1BAWA 1P0SE 2IXQA 4MD5B 2ITEA 3CSYB 3KNBA 5EIQA 2NX5A 5D5ME 3C60D 4JBSA 1RK1B 1S5IL 3BN9D 1S7TB 4J4PC 2IEPA 1TZAA 3ILDA 1BD2A 3II2A 3PAZA 3LSOA 2ILLA 4M7LT 4PRHB 2VDMH 3ZLQC 5IM7A 3DI2B 1E9QA 2WUBH 1BQLL 4YSRA 4UQ2A 4S0HA 5FGBC 2EH8H 2FWUA 3C08H 4NM4L 1UXWA 1KTRL 2NR6A 1RUQL 4UT9A 4ZBJA 5AW2B 3ZKMD 2Y0SA 3ARSA 1KDJA 3ARGB 5DK0A 4FFYL 3U9UB 4F3FB 2F54A 1IC7H 3M1OA 4KJWC 1PQZA 1XR8B 5E7BA 3WV0A 4HFWA 2ZSVB 3N1QC 4PY8J 4W9KC 4FZ8L 1XR8A 3VDCA 4MJ6A 1R34A 5SWSE 3MODL 2OP4L 2YD1A 4NFBA 3JWNG 2RCSH 5DS2A 5DVPA 5E0QA 5EPMB 4WI0A 5DK2B 1MVYA 1MJ8H 3Q44A 5C0GA 1G7HB 3TBVA 1CVRA 4CBZA 2VLKD 1HILA 3OVUB 1LWRA 4ELMB 1EGJH 3BUPA 3BP5B 2A83B 4I77L 1J5DA 3X17A 3FQ4A 3OJ2C 2VZVA 4L9DA 1A2YB 4R97C 2B77A 3K2KA 5F72S 2EILB 5C0BB 3JT2A 2KLSA 3QUMA 4N9GB 3EFOB 1GGUA 2DLHA 1JOIA 3JWOL 5I1JL 4YFLF 1CR9L 4IK6A 3FB8A 1A3RL 3UAFA 1IEBB 1OAKH 4CC1A 3L3OB 4NC2B 4HULB 2AI0L 1JPFB 4Y5VC 2XVGA 3KJ6H 4KTGA 1Z3RA 1HQRA 2K9UA 4PYGA 3TASA 2HRLA 5K9QG 2A6IA 3INOA 2IDTA 2XWBA 3QRFM 5DZNA 1BAGA 4NN7B 4UZSA 3RIFF 3TBTA 1TZIB 1CU4L 2NMSA 1IM9D 4R2GC 1MNUL 4KMLB 1ZOXA 4R5TA 1CXFA 3WY3A 2GHWB 1F56A 3NBNA 3C60C 4BZ2H 5HI5D 4HF5L 3ETBJ 1P5UA 3F5WA 4N2MA 3FU9A 1WVZA 1IRAY 3M8OL 3VQLA 1CL7H 3ZE1B 4ZW3A 1Z0MA 5I19L 1SY6L 3RAJL 4HKBB 4B9ZA 3QQXA 3ULUF 3ARPA 1L9SA 3EUDA 5F1NA 1HT6A 1DSFH 3OAYK 1R19A 4UM9B 1EAQA 4APQA 2NY1C 3VRJA 5IMOA 3MZGB 4UDTB 4Y4KC 4S1SH 4ELME 4UOZA 4J3XA 2Q3ZA 4WTZA 2IJ0C 4GUOA 5CU9A 3BP5A 1W8NA 2AEPH 3QWOB 5FM4A 3V4PH 3EOAA 5F6HI 1UM4L 2VR3A 5I1LB 1B9ZA 4H0HB 1WFTA 5SWZA 1ZCRA 1QATA 1ADQA 3GNMH 4JANB 4N8UA 4W9GC 2YGOA 3WN6A 5I5MA 4UNUA 4AIZA 2A5UA 5DD3L 4EDXA 3GI8H 3T77A 3W2DL 1VADB 3TCXA 3KLHC 2CCLA 4XRCA 4E9SA 3OD3A 4U7SA 1XBRA 4JY4A 3MV8B 5J6GA 4DAGH 4K7FB 4BQ8A 4E41B 3IPEA 3EH2A 4I13B 1WFJA 5BZWA 2V9UA 5I16A 2OZNA 4PPTA 1ZLDA 2GJPA 3GKZA 1C7TA 2R2BA 4NDMA 3F64A 4A7SA 2J21A 5EN3A 2Z6FA 5FR3A 3FQWB 4NRYA 4YX2H 3VXUA 1BVLB 4P9HH 3LRLA 1BAFL 1E4JA 3UX9B 2WWOA 4JO2L 5I8EB 5IFJB 5IWLA 4JQIL 4L2LA 2P47B 2APTA 2R69L 4IQHA 1JNHB 3MX0B 3V5KB 3SKMA 4N2FA 1CK0H 2HUEA 5DJZB 2J4WL 5JHLH 4EBQH 4XCYA 4F7EB 4HUVA 2GQHA 2AK4B 2WZ5A 3PHQB 3T71A 1NTDA 2VUYA 4MNHA 3CSPA 3BD5A 4KGJA 5JNYA 4XO5A 1ZV5A 2Y25A 5EU4A 4M7KH 7CGTA 2V2XA 1LO3L 3B8SA 1RVFH 3N06B 4N3TA 4CN6A 4GG6E 3VNYA 3JVFC 3APCA 2E6QA 4HUNB 1M1XB 3BHBA 2VE6B 3VD4A 4OSUL 5C7XH 2G9KA 3US1A 2H2PD 3V7MA 1MCPL 1QLEB 2BSEA 4IRSC 3I9IA 4GAGH 1F11A 3MBXL 3P0YH 4L4TE 4PTTA 2DQIL 3ARWA 1EAPB 1F11B 3QUXD 4PTTB 4WFHD 3C12A 5KBLA 5GGRA 3H3PH 2FR4A 4JE0A 1EQWA 3ZMNA 3CVBA 1XXDC 3F00A 1RFDH 1CFNB 4TF4A 4C54A 1HOCB 1JXFA 4YIQB 1OP5K 1CF8L 2Z35A 3NFPB 1IJNA 3PJSA 4JO3L 4N2HA 1AIFA 4YNYA 5LGHH 3V7AE 3PWPB 4ATTA 1PL3A 1QLFA 2PCFA 5DTFA 2VXQA 3S3DB 3QHZH 4KJYA 1P9MC 1CFVL 4L4VD 1JHLL 3FFOA 4N20A 1MDAA 2WJ5A 4X0KA 5CILH 4WCYH 4FL4C 2C9RA 3MN8A 5DD6B 3TURA 1TR7A 2VIRA 4HJUA 2W9DH 3V5KA 4X83A 4WVRA 1JF1B 3B1TA 1KLGB 3DYMA 3J7HA 4GUPA 4HC1A 3PL6C 4A2EA 3OJDB 3PG2A 1C8PA 2AXJA 2ICWI 3OHXC 1X9UA 1I3RA 2BCKB 5BV7H 5IB4B 1AKPA 2R1YB 2R7EB 4K7PL 3QFJD 1QASA 1T5KA 3UYPA 4PJ9C 2P8LA 2PTTA 3QUHA 4OIBA 4N4YB 3HZKA 3VXTA 3ZDYB 4BZ1A 2Y3AA 2ZXCA 3GQFA 3VXMD 3OPUA 1RIUH 3QDGD 4S1DC 1MJJA 4ZMZA 1N59B 1OPGL 1D5ZA 1QWNA 5I15L 1T21B 5B39A 1MHCB 5ESQB 3RNKA 4ODWA 3V4UH 1BVOA 4KNTA 4S1QH 4XVJH 2XWTA 2VM9A 1H3PL 5IQ7L 4JANA 2YPVL 1JPGA 1JZ5A 1R5VB 3DJRA 5BO0D 3R06B 3VD9A 3B7TA 3FT0A 3HE6D 2J25A 4B9KC 1FLTX 1MREL 4OT1L 3RWIA 3G5XA 3LKNA 2APSA 4PLNC 4YOKA 3ENEA 4U33A 5DJ0B 1Z5HA 5A2KH 4Z7NF 3EH1A 3N44B 1JNNL 4H0LC 4L3AA 4N0UE 5LB1A 4DN4L 5J12B 3EYVB 4BZ1L 1PD6A 1C5DA 4TL4A 4BSWA 5E95B 4YO0B 3HBQA 3HG1A 1G0XA 1F90L 4MX7B 3DUUA 4H8WC 4XNQB 5BS0E 5BRZE 1KENH 3LDBC 1GHFL 2J8HA 3QB7C 3TLRA 4OLXL 1KGCE 4HIIA 3DSFH 3WIIH 2E74C 2X1PA 5E94A 2FX8H 4P2RE 1HQ4B 2FBRA 4FG6D 1YNTA 2WXGA 4XTRC 4IRSA 4JJHA 3VFWB 3QIWD 5E5MB 4QCIA 3KPOB 3VGFA 2NY2D 1EUTA 1TO4A 3BAEH 3WIFA 1RHHA 3U7YH 4XCNB 3VH8B 3B9DA 2FVNA 4NQCA 5DUBA 4HMEA 5GSVA 5T1KA 1F6FB 4YVNA 4HU2A 4AQEB 1YO4A 3WFBH 5KS9B 1X5GA 3DPDA 3OTTA 2HJLB 4LLQA 3CVHL 4OLZH 4HZLA 1DVYA 4TVUA 5F21B 3RB5A 4KXZI 5HDBB 2QDWA 4LLQB 3FOLA 1A4CA 3B83A 4HWNA 4WI9A 4ODHH 5I2IA 1SHSA 4QJ4B 1S9XA 2PP7A 3HB3D 5BQDA 4AT6A 1KJMA 1S7XB 3D4ZA 1EEUA 2J55A 3HG0A 2JIXD 4ZS7L 4DP5X 1SN0A 1J86A 5INCB 3U46A 1FL3A 3LZOA 3P9LB 5GSRB 1N70A 2D7OA 1MHEA 3GBLA 3OHXA 4OD1H 4R90L 5EV7A 5DJDA 1KEGL 3FQYA 1Z9SB 1GGYA 3OG4B 2LU3A 3DUSB 3ZT7A 3SPVA 4DO5A 2IAMD 3CFEB 3RKDD 4PVLA 3UL4A 4LPCA 1O7DC 1OM3H 4F7KA 1UB6A 5B39G 2YEQA 4YAQA 4NKOA 2GITB 3SZKC 2NY2C 4C56E 1T1ZA 4UT7L 4L9LC 1L6ZA 3S5YA 3AS2A 1HOEA 3V7AG 3CFCH 3TA3C 4BZ2A 4KKCD 4HPYH 3HUJF 5EOQH 5C0EA 4X4YA 3NCWA 2I07A 4HIHB 4PJIE 2H0JA 1BVKB 1LE5A 4N0YL 4HFUL 3VWJB 2VDRB 1F41A 3T65B 5TGBA 3FQNA 3CSYA 4Y19D 1AHKA 3TN0C 4DSYA 3SO3B 4HG4K 1PZ2A 1HKLL 3DX3A 2PYED 1JNNH 3ML9A 1X5JA 3RWFB 1M71B 4HGWB 2H1LM 1IKFH 4P5KA 3UTQA 1ILSA 2X4PB 3KR3L 3OB8A 4HDIB 4PJBF 4ZRGA 1G9EA 2RQ8A 4FI6A 4V2BA 3SE6A 1NZRA 4HDIA 3FT9A 2DEWX 4MA7H 3EGSA 1EVTC 1N59A 4X8XA 3P4OA 1UOWA 2VDOH 3HJEA 1CFSB 1QWHA 2V2XB 3MXWL 5JW4N 4GSDL 4EZLA 3MV9B 4JFPA 1FYTA 3TBYA 4CJ1A 1FC2D 2CRZA 3UTTE 2DI8A 1L7TL 3SJVE 3V4PB 5DEJA 4N8CH 1IT9H 4O2EA 5FDWA 1QQDA 1ZSDB 4N5UA 3K4AA 1II4E 4OV5A 4O2EB 1RPKA 1X5XA 4KKCC 4L1BA 3SDXB 3H54A 4FL4B 3QR0A 1G5AA 2Q20A 2D7PA 3B2MA 3OV6A 3TA3D 3L9YA 4N85A 4J3VA 5SWQA 1NBZB 2HB0A 3KBFA 2KDYA 4FJ6A 5HVHB 5FYLD 4KNUA 5B1BB 4ZO6A 2JSFA 3MRLA 1SYSA 3IBOA 5D6DA 4KV5F 4H26B 3GMLB 3VGAC 1NWOA 4BKSC 2F0CA 2XA3A 3DIFA 3VA6A 2JE8A 2PO6D 2C3VB 3KBEA 4WFGD 4YXKH 4GSXA 1NFDF 1QTPA 2QSTA 1MAMH 5SWZD 4F8OA 2DMGA 3AU1A 2VYRE 1OAKL 4HH8A 4UINH 2CJ3A 4HS8L 3VB9A 4MFHA 4QLRA 1D5IH 3UAEA 3LEYH 3EKCA 2YPLD 5E24E 4ORGB 1LXMA 5KSAC 1Q1PA 2F1BA 1JHKH 5DO8A 4ORGA 4OF5A 4QLWA 4E9WA 5JXEA 3EFFA 4L29A 2YAEA 5BVPL 1MIML 3ATFA 5DHDA 1IGJB 4QT5B 3TJPA 1OM3L 2Q1EA 3NZ8A 4EO5A 3WENA 1WH0A 3LN4B 1AQ8A 4ZNCD 3BGAA 3IE4A 1URZA 1JL8A 4F1ZA 1GYWA 2K7PA 4JFDB 1WK0A 2W8CA 1ZA3A 4UOW1 3ZYZA 5IIEA 4WI0B 3FUMA 5KVEL 3A22A 1MRCL 1A64A 3H2QA 4AL8L 2Q76B 1CXKA 4NWUL 4GO9A 3WHE0 4P46A 5D7IF 4GUPB 5IB1B 1FL3B 2L4OA 4YBQD 3GXFA 2EDWA 4ISVA 3KEDA 3IFLL 4FG6C 1GS7A 4XOCA 3RWDB 4MCYA 4P2QA 5IVZA 1ACXA 5TH2B 3GI9L 4NC1E 3UZEC 3VYPA 4F8NA 3V0IA 4JN1L 3BUQA 3MLYH 4FZ8H 3VYNA 1FG2B 4DGYL 4OZFA 2IDCA 3KLDA 4LMQE 2X88A 2VTFA 3VFVA 4AV4A 1ANUA 2Z31B 4A39A 4DO4A 5LGJB 3QDHA 3MXWH 1GKOA 1FL6B 1EJ6A 5BZWB 4UTAL 2QKIA 5L4JA 2BZCA 1JUFA 1A7BA 4BSJA 3BMWA 4AVIA 3IB4A 4YHIA 2MCPH 2AVFA 3DX6B 5AW4B 2VLKB 4NKIH 4G8GB 3DX0A 4E42A 1JGLH 1O7DE 2Q7NA 5AW1B 1KN4L 5T3XH 1MFEH 2OCJA 4OD3L 3BAKA 1EAJA 1WA0X 1RUAL 4EI5A 4KTEH 5MEOA 2EDTA 1XTLA 3A0OA 4GKNB 1Q9WB 1MVUA 4IDLA 3C5ZD 1T89A 2EABA 2ZIDA 4NKIL 1XF5B 4FF9A 1W6LA 3MRKB 4FQHB 3TO2A 4AL8C 3T6XA 2G3ZA 2BS71 4ZFOB 1OLLA 4L0ZA 5CIPH 4Z78B 3J07A 2R7EA 5KSBF 1RUMH 3LN9A 5D7KD 2BW4A 4PIRF 5GGUB 3S4SB 3ZE0F 3L9EA 2PTTB 4JFQB 1IGIH 4XXWA 2VITB 1LK3L 3O41B 1ZVSB 3EH3B 5D72H 3ILQC 2R4RH 3FN3A 2YBRA 5IHWA 4XMKH 4MMXA 2EE2A 4OZFB 4HWBA 5HHQA 1AGFB 1BECA 5D71H 4UAOB 3IU3A 3R7QA 4FZEH 2JJTC 1JYNA 2ICES 3KS0H 4AVKA 3P4NB 4P2RD 1KC5L 1OLZA 2XTJD 1CE6A 1AHWB 1GPOH 2H32A 3QZNA 4CW1B 3C2AH 3MUZ1 1SLVA 1EHXA 3D51A 1PYWA 3FTYA 4CADA 2FQDA 2HKHH 4H2CA 1KGYE 3RU8L 5H94A 1HDMA 5IVOA 4HJJH 4NXKA 3KW7A 4P3CL 4XPBH 4QRBA 1MRCH 2DQGH 2XWZA 3BISA 3BSZH 4A7VA 5J89A 3QRGH 5LGHL 4HBCL 4K8RH 1A4JA 4IU2B 5AD0B 2I9TB 4QUOA 4F24A 5CINL 3H3KA 1UEYA 3SDAD 3KCWA 3QARA 1FZKB 4LLYA 4IEFA 3GJEA 5DJ2A 1G7LA 5GGTL 3MRDA 2CBMA 5KYXA 1UA6H 3T8XA 3L4ZA 1GOHA 4HX1A 4MTMA 4YDLB 4YWGL 4BBWA 4HYTB 3VXMB 2LTQC 3DPBB 3PJLA 3S35H 1J8KA 1AQKH 1OSYA 4G8GE 3C6SB 3HMXA 2AEWA 4HBCH 1MCRA 2KERA 5DF0A 4ZT1A 3HS9A 3RDTC 1KGIA 2XNAB 4ODXA 4OF8A 3CLEH 3HN5A 3V5HB 3ARDA 5I5IA 2C3HA 3ZT6A 4ODTH 2ZUVA 1I7TA 4XP9L 2VLJA 1UVQA 3PS6A 4GAYB 1M4KA 5B7MA 4HKXA 3HNSH 5E8PB 5AUMA 5C0JA 1DVXA 2BPBA 5I5JA 3ARFD 2C9AA 3DURA 1N0XL 4X6DB 3RX8A 5DRZB 3NN8A 2CLRA 1JVOA 2WP3O 1PZDA 4TULL 1LM8V 3BKMH 5L0QB 3PWVA 2ATPB 4Z7OE 3IE9A 1UURA 1L7IL 3TF4A 2Q5BA 2V5MA 3S5LG 2DEXX 4MD0A 2WZPA 1SQ2N 2EH7H 1KNOB 4FG2A 1BZOA 4FXGA 1ZJBA 3B9VA 3EYVA 3TTYA 3L9BA 3FO0H 3SE8H 2BY3A 5CN3A 4NO3B 3KPPA 2YA2A 2COVD 2ZSVA 3QR1A 1CZ8L 5GHWH 3MNWA 3GUFA 1WBXB 3MFFA 3OKEA 1ZLSH 3VRIB 4CVUA 1BM7A 2X4QB 2A3TA 1QUNB 4M9OA 5MERB 1PLAA 3P3RA 2WQVA 1DBML 3RPIA 1OGSA 4XRCB 1M2VA 2MHAB 1U2YA 1NAMA 5D7JB 3WFEH 4HLZH 3FSAA 4FOMA 1ZK5A 1NEUA 5IHUL 4WW2F 5L9DH 5F6IB 3C2AL 3VFUB 4MNQA 1MFAH 2R2BB 4L1LA 4NDMB 5FA4A 1UFUA 1PZ3A 1FVCA 4DESA 1EDQA 4IKLA 4XAKE 3VFUA 4H88L 4W9ZA 4N2DA 4GUCA 3GSWA 3MZTA 4W9IC 4FQXC 1XB3A 4JPIA 2GCYB 4XXCC 2QADC 3FBQA 2EAEA 4PRHA 4HSAC 2P24B 5GZNC 4XH2A 1JV5A 3GKWL 3HFML 3LKNB 4CC0A 1ZLWH 4S1SL 4AQ8C 3HKFA 1P7BA 1IQWL 1QRNE 2J8UA 1AO7D 3HG1E 4ZUTA 2VSKB 3PWUA 2NDGA 3AG2B 4YDMA 3VFPB 3EGSB 1N4XH 1IQDA 2CHDA 5IG7A 3AMKA 5E00A 1GOFA 2DEYX 4IRJD 1DANU 3REWB 4F9PA 3VQ2C 1FN4A 3GMNB 3QFDB 1SMDA 3NJHA 3CHXA 2D0FA 5EC2A 3OHXB 2HFGH 4GKLA 1NBVL 1XSOA 2AAVA 2XBZA 3MV8D 2AJZB 3AU0A 1GJIA 2AXWA 3FCUB 1UXLA 2PWHA 3NG5A 3OLGA 5CKGA 4HJEA 5F1NB 2MPAL 3ZKND 3K6IA 4ZTOH 1BJMA 5E5RB 2HMIC 1EZUA 4CGUB 1A4BA 1QPXA 1RK7A 4XBEL 3NESA 2ZOKA 1MWAH 3GC3A 4WTWA 3P02A 4XPGL 2X4SB 1QW8A 1TJIL 1JCKA 3WELA 2GJ6E 1E40A 1SOQA 3X1GA 1K4CB 2DJSA 2G5UA 4H26A 4YHYB 3S9DB 1E65A 1BLNB 2DQCH 4UT9H 3TV3H 4GW4B 1KXTB 3EYUL 4ZS6C 3MO1B 3L3OA 4Z23A 4NN6C 4JG5A 4PJIB 4PSRA 2IADB 3LPFA 1PY0A 3IDNA 5EULV 1J1XH 2V17L 1T3FA 2BRRH 3Q6GL 3VSQA 5CCGE 1S3KH 3KH4A 3DJZA 1UYWL 3V6BR 1V3JA 4L8CB 1T7ZA 3SDCB 1IM9B 4RMWA 3HW7A 5IBUB 3KGTA 2ADFH 1NLBH 3SKJL 3ZTJH 1QP1A 2GSMB 1MCOL 1A6PA 1QBLH 2EYTB 3G5ZB 1J8RA 3AT8A 3W39B 3W57A 3C5JA 3CFTA 5DJAA 3U79A 1C5BL 3TO4B 2ZPKH 4B97A 5F88B 2YQ2A 1OTUC 3HHRB 4ES9A 5BS0B 3NJIA 1ASOA 2YZ1A 3QORB 5FCUL 1VLXA 3C6LA 3C5SA 3V4PL 1SXCA 1ZEAL 1M2OA 4M7JL 4CW1A 1XCQB 3HG2A 4QHNB 1I31A 1HNGA 1USQA 1X4XA 3WXVH 2VXSH 4Z7WF 5F1OB 4HWBL 4QIRA 3O6FD 1C16A 1X7SA 2R56L 5SWSB 3RL2A 3T77B 2LTQB 2WYTA 4W4OC 3CFJA 4B3EA 5K9KB 1BLNA 3U4AA 2OCCB 4G72B 4QYOA 3IRZA 4NQTA 2BFVL 1FG2A 3CX5J 4WEUD 1SXAA 3DVGA 3EJUA 3ROOA 3C5ZA 4QRRA 1U8KA 4AYEC 1V7ML 2VSDA 1IBHA 3KJ4C 4GW5B 4JRYD 4ZFOL 1A7NH 3MRRB 4KTDL 2ID5A 1QABA 2VO5A 4OGXL 5C08A 2ODIA 4MAZA 4LSSH 43C9B 5IB5A 1G9NH 1CT8A 4TLTA 4YO0A 2Q0ZX 4AG4L 1XBDA 1X9RA 1KTLA 1ADWA 3IMWA 2XWBB 4LNRB 2WKOA 1HHJB 2BVYA 1KG0B 1XGZA 2FRGP 3MCG1 3LX9A 4JDEA 2RA1A 3AS1A 4BDVB 1AIFB 1H8LA 3E6HA 3MGOA 2RMNA 2XN9D 2YFOA 3CH8A 1FF5A 1LO4H 2NXYC 4YXLL 4OIFA 3LNEA 4UYQA 4EI5B 1C12B 1WBYA 5BRZB 1JPTL 2EEDA 2QFPA 2DAVA 2GK0B 3U0TB 5ADPH 1E5BA 2BX5A 3DJTA 4ZMAT 2FL5B 1C12A 4QHKJ 2COQA 1QKZL 3ZVVA 5B38A 3JWOC 5HJBA 5ISZE 4GRLA 2XPYA 3BSHA 4G7QB 3OHMB 1PJWA 4DPRA 1NFDA 5JDJA 1H3VA 4QRSA 5DJXA 1U3HD 2WXPA 4F2ME 3RIKA 3UBXI 3LIZH 4OLWL 4XNZB 1F00I 2O6CA 3TN0B 3ZTCC 2NSQA 2X42A 3FT2A 4DN4H 3P0YL 4F37F 3GBMH 3BPNB 4BFNA 3G5WA 4Y4FC 3OSVA 2ESVE 2HSIA 2VR8A 2KT6A 4HD9A 1E6JL 2DBLH 4U4BA 5AYUH 4UZGA 3DVNB 2BY2A 2PYEA 5E1IA 2PPDA 3MRBB 2WLHA 1JZFA 3N41F 4EN3D 2YLHA 5LDUA 3QDMD 3L3JA 4LHUD 3MREB 3CVDA 4PM1A 3KCPA 1F4AA 4XWGH 3DUSA 4YEFA 3LXUX 3O2WL 1P2CA 4X8JB 4DEPC 3MUJA 4TOYH 5ICZA 4MXQD 3KPLB 5HI4C 4PBVC 2ZD0A 4K2UL 2XI9A 4GQPH 3QPXL 4TNVK 4JVWA 4O4YH 2OMTB 1S5IH 5FYJE 2QTVA 1BLIA 1E4XI 1ZEAH 2AJ3A 3OMZA 5CJ5A 1C5CH 5H37H 4RAHA 5HHNA 5IW3A 2AK4E 3BLPX 5IB3A 5DFAA 4HQQL 2XACC 4U3HA 1HE8A 1UWGH 1KCWA 1DN0B 3IDGB 1YLBB 3RVUC 3VFNB 3QDJD 1XF5A 4LLMA 4ADGA 4MDJB 4P2QE 1FAIH 2OMXA 4W4OA 3PWPE 4KKBD 1M05A 2P8PA 2XV6B 1OF0A 3VGGA 1ETZA 2P26A 3BQUA 1IC7L 1M9WA 3O8XC 5D7IA 1NIDA 2WUCL 4Q7DA 1KCBA 2BWQA 4IRJB 4XGZB 3BJLA 3HUJA 2AQ3A 1ZTXL 4PRNA 4Z5RA 2J12B 1NCBH 1NFIA 5IF0B 3SZ6A 4XMKL 5KVGH 2ED7A 3IVKB 3V10A 3JV4B 4TVPH 1PQZB 2WLZA 2XHNA 4A6YA 2TRHA 3RUGA 5IESH 4QWWC 4KKNA 3DRTB 2BIIA 3ZYIA 3K6SA 1TQBB 4H2AA 5I1LA 4I5BB 4B9PA 3FO9B 3LPOA 5DK3A 6FABH 5EZOH 2HH0H 3B3BA 3WUWG 4UWQB 2CKBH 3K71B 1KBWA 5BJTA 4KQ3H 2EEXA 2ZP0T 5BW7A 4KXAA 3O0RH 3LH2L 5D1ZA 5E2WH 3U48A 2EIEA 4NBXB 1IGYA 2XZQH 1CDGA 2EUXA 4PB0H 5CD5C 3EIFA 2OMVA 4FABL 3SOTA 4OJDH 1P6AB 5EZOL 1U8MB 1Q90A 4PGCB 4XPTH 4OCYH 5DZVA 1N18A 1T20B 5ALCH 4MLIA 3FHEA 4Y9GA 3U4EA 4M00A 1TSHA 3RWCB 2ZKHH 3HPJA 4N0RA 3BAJA 1GKEA 2YKLH 1YUHA 1OP5H 1P1ZA 3FUDA 3QULB 3LMJL 3FB5B 3ARFB 3OWRA 3UCQA 2BJML 5EC1A 4NQCB 5DUBB 2IPTH 1GZHC 2Z1KA 4GRWE 1HXMB 1Q9LB 2WLIA 5A40E 4W9EC 1KTDA 2W07A 3QJSB 2I69A 3AXLB 3ABLB 2L04A 3BH8A 4M8RA 1VZHA 5KS9A 2UZYA 3VXPB 1PD0A 1FO0H 1KPVA 1UXMA 2ZX8A 4XE5B 3IJHB 4JFHD 1KJ2A 4Y4HC 5JIHA 3T3PF 3U4BL 4B7LA 3MJWA 3GSNB 1YPZE 4X6EA 5EO9A 3WFDL 5JW3L 1CGWA 3QXVA 1KBGL 3CFUA 4NWTL 4RGOH 3UBHA 3B9KC 1PEWA 1NUNB 2E4FA 3K8MA 4R5VA 4ZXBC 1CYGA 1U21A 5MEPB 2GFBA 4OM1H 1BMWA 3D8MA 1NANH 1HKFA 3CSFA 1MRDL 2NLJA 5D2NB 4Y5YA 2LVCA 2OYPA 2YRPA 3LQMA 2WXKA 3SBQA 2P8MA 2XSKA 4YHNB 3SE8L 3VDAA 5K69A 2O4EA 4PW3A 5INCA 2E7HA 3D0LA 4JGNA 4OZGE 4LQFL 4P48A 2ZX5A 1FNAA 3MUUA 4LEXL 1ZGLA 2B14A 3DUUB 4URTB 4XNQA 1Z9LA 3MHZA 4N25A 2DM2A 2FQEA 4ONOA 3KWXA 4UINL 1XF3B 1AR1C 1MSPA 2VLRA 5JW4Q 1YEGH 2YGVA 2DWXA 4LGRB 4EIGB 1ITCA 2VXQH 4Z3IA 2X4TB 1H5BC 1I1AD 3CPLB 1U3HB 1B4JH 1BQLH 4C56A 2PW2A 1E8WA 1OTUD 5KANI 1MW0A 3OXSB 3WFZA 4X98B 3OR6B 2DQTH 5C0AE 2YWYA 3I75A 3OKYA 3W9DB 5CD5D 5CFHA 3AUVA 5I0WA 1HU8A 4K94L 3QEUB 1QWUA 1U8LA 1EBPA 5GGTH 5AUMB 5L7XH 1FFPA 2BERA 3VW3L 1EH9A 5DFWH 3AQYA 3AY4C 2DQJH 1DQVA 1N67A 3S35L 2EECA 5DEFB 5HSFA 4WWID 2CDGB 3SN6N 2GY7B 1OWWA 3ECUA 3VNZA 2WKLA 3X14A 4PREB 3MRQA 3RILA 4D94A 3B3IB 3OLIA 4RMTA 1TTFA 3O3UN 4KBPA 3LQAL 2P49B 3GRBA 4E9TA 1D5RA 4LSVH 5CCKL 5KJRH 2FBJH 3JYBA 5I8CA 3QZWA 3BVNB 4XVTL 5LBSL 1DVFB 5CF3A 2CLVB 3L7FA 3GMRB 1IBYA 4WWOA 1EFXA 3RBGA 3DC0A 3FZUD 1NOFA 2BC4A 3DSNB 4OQTA 4KKRA 2GSIB 4M5YH 3ZDXB 5LJYH 4R4BA 3TFKD 2K4WA 1PX8A 4UU9A 3CMGA 2ENSA 2K70A 3L95A 4QJ5B 4YDKH 5IB1A 1FJ1A 4MA1C 5FWRA 4Q6YA 1Z7JA 4UU9B 3TYGH 3RFZC 3AROA 3CXHK 3MNVA 4J6IA 4MWFB 5A6IA 4P49A 1MF2L 1IGYB 4GEJA 2YS4A 1NGPL 3QSKB 4GPVA 2A74C 1JGLL 3LH9A 1T0OA 1CU4H 1NCCH 2W80C 4WV1B 1N12A 1KYOJ 1SN5A 5JHAA 2WGNB 2WWKO 3WFDH 2VL5B 3O3BA 4Y1AE 1SYSB 5L0QC 4X6CB 5ILTH 3LRKA 1RJLB 5I73B 5FHBL 1LP9A 5D55A 1K9TA 3WUWB 4PS4H 1ICTA 1SHWA 4LCWA 3UP6A 1YCSA 3WE6B 1AD0A 4ZD3H 1L0QA 1QSEB 2ZICA 1CE1H 4ATWA 1QSFD 1KBVA 2FJSA 2P80A 5I76B 2Y9RT 3MLPA 1FDLL 1TYJA 1LHZA 1KTLB 2MOQA 3CE1A 3MJGX 3NFSL 4IS6A 4FQ2H 1KEGH 5EEUA 5IQ9A 4PJGE 4F7EA 4HUVB 4KRNA 4OF0A 5I6XB 2HFFA 1TQBC 4I87A 3EYFB 3I9PA 4X4XA 2IWFA 1V55B 3PWJA 5GIRA 5CSBA 2NY0B 2AXHA 5DUMH 3RZCC 3VXRE 3HHMA 1SJHB 4EOWH 2I32A 3O3AA 4AQAA 1YEFL 3TEXA 1I1FA 4PB9H 1S7RB 1LNUB 1T7WA 3WEOA 3U1QA 1BEYL 4HIPA 2JCCF 3BAXA 1U36A 2H1XA 2PF6A 2A4EA 3HMWL 4DKTA 2XBTA 4JFZL 4F9PC 4YHPA 1BVNT 4LL9A 1UXSB 3GIVB 3PV7A 4N2IA 4XNMA 1WUZA 4AC4A 2N3JA 2Y5TB 3GO1H 3S37L 4FCAA 1WITA 1ZGLB 4ODVL 1J87A 4GG6B 1QBMH 2I60H 1T4KA 2I26N 1CG9A 2B4CL 5AALA 3D69A 4NPJA 2VZOA 4LVNC 1EWHA 4BKLA 2I27N 3QNZB 5DDHA 3VXQB 4U6XA 3E6FA 5L6YL 3VD1A 3J27A 4AYMC 4LLDB 5B4MC 4WNQB 3FQXA 4ANWA 4HT1L 2VDKH 4GQQA 4TS6A 1IBFA 1NCGA 3ML8A 3RI5K 3SPCA 1X7TA 3HNTL 3LXCA 3VSTA 3Q05A 1A9VA 2PO6B 4ODVH 1GTFA 2R2EA 3L48A 1MFEL 1N6QH 3MLRH 2KLRA 4KHTH 3VGHA 3ARBA 3FQ2A 1R5WB 4AW4A 5JTWA 1G7QB 2ZTBA 4G3YH 4E9LA 4F7TA 4X99B 3CDYA 3RWHB 1E4XL 2BIQA 3MV9D 3VWKD 4KJQC 3TJHD 5DJYB 3X3GH 3NSJA 1NBYB 5E2UL 1QTYT 4U6HB 1IGTB 2WZ6A 2CNYA 2AFNA 4MQTB 1OAUL 3GTVA 4BEIA 1E3ZA 3THML 1I8UA 2K7QA 3V79C 2IPUK 3RUGB 1UXSA 1T20A 3K0WA 2VABA 4B60A 3NRPA 1CQKA 4Z78A 1VEOA 4LKCB 4ODSL 3NIGB 1MXGA 1IEBA 4G43A 2YEVB 1PD1A 2NOYA 3EFDH 3ROLB 3TVMB 2ZQKA 1BZ7A 4G42B 4R0LA 4DN3H 3RAJH 1VEPA 3ECWA 3WIHH 4YSTA 3IDJB 4BFKA 4JHUA 4RX4A 5IBLD 5F9OH 2DBLL 3QZWG 5FOBB 3UZVA 4XP5L 5ES4B 1L0YA 4KK6C 1KTJA 1P5UC 1VEMA 1YDPB 5HYJB 3LYRA 4WF7A 2N7AA 5GGSB 1W80A 1N5YH 1XWVA 5FGSA 4JQVC 4S10A 3RPKA 2Y7LA 2YGNA 4IOFD 1Z0NA 4DGWC 1JSYA 3FHAA 3VCLB 1AYOA 4FKEA 3MBEA 5ETUA 1YYML 4P9MH 2WQXA 5D4QA 2V33A 2WCPA 1P84J 2V5YA 3LB6D 2WLKA 4KXDA 1BPVA 3EBHA 1U4EA 3S5LB 3VVVA 3HMXL 3RLSA 4DK5A 4MNHB 4KITB 1D7FA 1HHHA 3MKKA 3WD5H 5BV7B 4HMCA 4AYID 3BP6A 5ANME 2PUQT 3GSVA 2EC8A 4Y2DB 4N8VA 4GSDH 4DZBA 1YNKL 2ZAIA 3KBPA 3MDJA 1RI8A 2XN2A 2X4PA 3EJJX 5AAPA 2AANA 3L3GA 3VI3A 4WI5A 3BDYH 5F3FA 3LEVL 2XPZA 3HRZC 3O4LE 2ZCHH 3VG0L 4QHMB 2CBPA 3QUZB 4AZ8B 2ITDB 3ERXA 4W9HC 1SYVA 2OJEA 3W37A 2V8LA 3CFCL 1XQ4A 1WC7A 2HFGL 2R9HD 3QDME 3Q5TA 3V4LA 5JHLL 2Q8BL 3SKOA 2NX5B 3UOAB 2Y72A 4IBLT 2KBGA 2AQ2A 1UOLA 4IBYA 3EYQD 2H9GB 1SXNA 4YSQA 3O3DA 2XUWA 3RVWC 3EF7A 3Q6FA 4OD2A 3WTXA 2R8SH 3T0ED 4HWEL 5FO8B 2OAAA 4PJXE 3M88A 2VJ0A 4PJ5B 2DPKA 4TVPE 4PJFE 3PGCA 4NQSA 4OKVB 3X13B 3QUYC 3STBA 5KVFL 4L4TB 4ACTA 4D8PB 5J57B 2F54B 1JYXA 1KCLA 2WAQA 3P9MB 5DD1L 5JDSB 1Z9NA 4UT9L 3TV3L 3VFMB 2K6ZA 4XE0A 2F1EA 1N6UA 2VW4A 3DETC 1UHVA 4KZDH 3NTCL 4F58H 5K59E 1ZHKB 4AH2B 3TBSB 2ZWNA 3P54A 2DQFA 4G2AA 1MXDA 5CJQH 1JPSL 1OWRM 4R0LC 1NOLA 2KH2B 4N0CD 4W1TA 4EN3B 2OK0H 3CFKA 3H9ZA 3S8FB 5I76A 4Z3HA 2WVTA 5B8CA 4AWJC 4HV8B 4TNFA 1MHPH 3QIBD 4APXA 3DETD 5D9SA 3D4YA 1F6LL 4JRXB 3WNOA 4G7YL 3IAQA 1GPOL 2DH2A 1JXKA 3QDGA 4KC3B 1H6TA 4JPVL 2GJ6A 1ZLUK 3X12B 4XCNA 5IW1A 4FQLH 2CAKA 3VI4B 3V8OA 4WU5B 4N2LA 3WSQL 4MAYC 4PP2B 1NGQH 1RURH 3MV9A 2CRYA 2VOTA 1MCWW 4JFPB 4X7TA 5DVMA 3TBYB 2CCVA 1SJHA 4EI5D 1NDGA 2WXLA 3DX2A 3MRJB 4G43B 2DDQH 1S7SB 4JE4B 4L9LA 2JKWA 1T5WA 2FJGA 3GGWB 4NNXA 4Z7UA 3AAZB 1XEUA 3TIDA 1P5VB 3H53A 2R9HC 4HISA 2NNXA 3ISYA 4NI6A 3UTZA 1F1GA 4Y2OA 5F0JB 3D39A 1A2YA 1OPGH 1B0IA 1OB0A 1W0VA 2RTTA 4N86A 5D5MA 4X4XB 4DGIL 4ZMYA 2NTFA 4OZHE 4WHDA 3FUNA 5T3XL 2DDQL 1RJCA 4FRWA 1EANA 1OAJA 2VKWA 5KVFE 3FK3A 2JI1A 1C1EL 4PGEB 3QAQA 2AP2A 3PHOB 4JB9H 3RA7L 2RD0A 1ZPUA 2CKBL 2ZZUT 3QULA 1E6OH 3VD3A 1HSBB 1RMFH 2HTLD 4A2GA 3RVXD 5KSUB 4BFIB 4E36A 3UPRA 1RZKL 5IW6B 2R0KH 5EU7C 3V4VB 4LOFA 1YUKB 5D7SL 4MZ2A 2FLMA 4X5WA 1IAII 4ZX5A 2WIIA 2CR3A 5FUOH 2OCFD 4JX0A 1RZ7H 2TAAA 4BWWA 2E7MA 2NT0A 3IMTA 2J8UF 3ABKB 3CHSA 1QLFB 2PCFB 1UA3A 1CG9B 3ZR6A 1S9YB 2EDMA 2XJKA 1P1VA 1RUKH 2WB7A 3MRNA 3CZNA 5JORB 5E9DD 1Q9KA 4FQ1H 1SEQL 1YYLL 3PGFH 1JE6A 3L45A 4APQB 1XH2A 4PWJA 3FFCA 2ITDA 5ESAA 1A02N 3FQRA 4IBTA 5EU6D 4OFVA 3NGBB 1XGYH 2NY4D 4F8QA 1BZEA 1IGFL 1RZJL 1BF5A 3RGVB 3SY0B 4DP0X 3NCYS 1P5UB 2GUYA 3BAEL 2H3XC 5LN4A 1WCBA 4HKJA 5D96C 3BPCB 2H0EA 5C09D 3NSFA 5E8OA 4EDXB 1DQLH 4L4VA 4HKJB 5BUAA 2NX5E 5EU3B 5F7DB 2X9WA 4X6BB 4X99A 5F9AC 1LMIA 4UT6L 2B5IB 5HGBB 3N9GH 2CSPA 5E5MA 4M1DL 1K3IA 4Y16B 1J0KA 2IH1A 3WS3A 4FS0A 2AQSA 2V0AA 1FNEB 1MY5A 2C26A 2YBGA 3M46A 4FFZH 4JO8A 1UA6L 3IDYB 1E30A 4KV5E 3ARGC 2EO9A 15C8L 4YWGH 5I0DA 4NZRH 3RKDC 4FLQA 1JVKA 4LVHB 1O6TA 4MAYA 4XBPA 1DVUA 4GW5A 1OHQA 3QJQB 1XGUA 2UWEF 1BVLA 3GLEA 1AHMA 3OC5A 1RJLA 1F1DA 1ET7A 2Y36L 3FTGB 4L8BA 1HEZB 4FFWD 1CUOA 3GMMA 4GRWB 5BZDB 2HTLC 3ZMRA 4OZIA 1X5LA 2ZKXA 4WI4A 1I9IH 3QJFA 3QI9D 2VKXA 4U3SB 1B4JL 2N59A 4HC1H 1Y18A 1ZLWK 4FQQB 5CBEB 1U8MA 4IOSD 1G7JA 4OZFG 5LG1A 4NRZA 1OALA 1W0YT 2HAZA 3NCCB 5I1KL 3NIFF 4QAWA 5M7QA 1KIUB 1EFXB 5DGQA 3VM5A 4B95C 5I8EA 4DGYH 4OAWA 4Y16D 1PX4A 3TA3B 3QUYB 1FZOB 1T04B 4N0UB 4X4MA 5FKPA 1A1OA 3VGBA 2C9SA 4DKDC 3TIDB 2HWZL 3BESR 2V9RA 1PIFA 3G9VA 1RZPA 4N0UA 2G30A 5FKPB 1A1MB 5DMIH 3PYCA 2DIEA 2OMZA 1TFHA 3G6JE 5F7BA 3IJSA 5ID0A 1UJ3B 1ZJAA 3MCKB 3MGTB 3HE7A 1EZVX 4U1LB 1GTNA 3MJ6A 4LVEA 2P5WA 3UJJH 1BZ7B 2FECL 4G42A 4R0LB 4I89A 1W0WB 4JFSA 2OYKA 1UGNA 4DKFH 5IF0A 5EU7E 4BXVA 4I18C 4F7PA 2WN3A 2QHRH 4Z0XA 4HGMA 4M1GH 1ZT4B 4AJYV 1GXEA 2E9WA 1CD0A 1FL6A 2YXWA 2BVOB 1ZGLM 3ZDYE 2AF2A 5BRQA 1AGBA 5T1MB 3FHQA 4I0CC 4JW3A 5I71B 3NFPA 4YNYB 1ZS8B 1BVNP 3GMPA 2N01B 2CLRB 3SBWA 5T1MA 1IC1A 3F7YB 4PLKC 3RTQA 4H88H 1MFUA 1XR9A 4MS8D 1CFQA 3UG5A 4M1DH 4S1RL 2FGWL 2J6EH 4LFHD 2YQ3A 2KPNA 3AB0B 4RZCB 1GYAA 5KTEH 1QA9B 4XMTA 2VB5A 3VI3B 1Q9KB 2A6DA 2YO3A 5JYLA 1OK0A 1JYWA 4IBUA 4IJ3C 1DJWA 1E7UA 4MA8L 5DJYA 2WYIA 1CLOH 2MNJB 2YOAA 4P46B 5DI8A 5KSBE 4TUJA 4R83A 4J3UA 1L0PA 1KLFA 3HBPA 3WNPA 4XNYH 3CZFA 1KIPA 2HKAA 3QISA 1ORQA 2V2WB 4MJIE 5AENA 4NYLB 4WSGA 3MV7B 3TNMA 1BX2B 4PJ6A 2DS4A 3RU8H 3FZUC 3GK8H 2HT3D 5EIIA 4PREA 4TQEH 4TUOA 1XSJA 4YSSA 3O3EA 4ZAKB 2J56A 3TCLA 5IOKA 2A6KB 5HYSG 2E47A 2IQ9H 1WBZA 1G5GA 4UB0L 1WFNA 2XXMB 3TBCA 3MI6A 1RERA 5GS2H 3MA9H 4M6AA 3FQXB 4MLSA 3FUFA 3GRGA 4J8RA 3B7UX 2OKMA 1TJIH 3OGOE 4YGVA 3ULVL 1KYUA 2Q7YB 4WHYH 3SDAB 5CP3A 5KOMC 3U4KA 3VD7A 4L3EB 4CADB 1DANT 3GPSA 2XN9A 4FHBD 1N5YL 1MJUL 2HLFD 3R0MA 3UJIH 2CIIB 4M6NL 1I7RA 3UTTB 1X9LA 5EEXA 3MV9E 2GSGA 4LPYA 5MEOB 1ES0A 3MCLL 4XAKD 2G75A 1U95A 3K8KA 4Y5VA 4YPGB 5DMIL 2OMVB 1RZ8B 1U2CA 3C6EA 1S8DA 1DQQA 1YEJL 1BQHG 2AC0A 3VAEA 2F19H 3JWDC 1ZWIB 5DZAA 5T1LB 1SBSH 4QD2E 4RGNC 2OJ1A 4RCAA 4XNAA 5CCHE 1NH6A 1FAKT 1K6QL 3ME0A 1X5KA 3FF7A 3S34H 2MPVA 3ZHDA 5ITFB 3O2VL 2CKBA 2IAMC 4IYKA 2ZOKB 4XN4A 2QGCA 4MQXC 3AABA 3GRWL 2Z31C 5C09A 1OT2A 4O58H 1GVIA 2BIMA 1M9SA 3IDJA 5EBMA 3BWAB 3REVB 4POZD 5E2UH 3IVKA 2C7UB 3MLVH 1DEEA 4PJ5E 5BVJB 4L3FA 3AREC 3L4YA 4PJXB 2JELL 4N2KA 5DEFA 5AWNH 2FLRT 4K71B 4TVSa 4M7ZC 3ECBB 3JV0A 5C6TH 3UEZA 4R4NC 1KWKA 2VN6A 3I6SA 4OM1L 4P46D 5HVWA 3T4YA 3R06A 4OFPA 4YFEA 1QRND 3NFNB 3U0WH 1J48A 3KHQA 4HQQH 2BRRL 4XNYL 2HJFA 3MOAH 1OGAD 1TNNA 4OCWL 5AAWA 3MRDB 3WXWH 2IALB 4PW9A 2BVOA 2JKSA 5DJ8B 3IXAB 3BE1L 5TH2A 2WIIB 1YPZB 2DW5A 4J5VA 4WAFA 5KW9H 4MSWA 1B88A 2CDFB 3MC0A 3NCXA 2DQFB 4U0QB 8FABB 5ADOL 2WAHA 1UZ8A 3QAZB 2AS5M 3MRNB 3QR2A 4HHAA 4LDEB 5KVGL 1FCCA 4XN2A 2OW7A 1QYGH 2PWFA 4K8RL 2BDNL 3KYMB 1U58A 4P5TD 3TBWB 4ENZA 5JPNB 4HUXB 2E6PA 2Q9OA 1WEJH 3O6KL 3G3LA 4R7XA 5IQLA 1I4FB 3CFIC 5DJ6B 3I3EA 3T6WA 1G6RH 1UB5B 3W9DA 5C9KA 2XX0A 4YJZL 4WTQA 3KYNB 5GRYA 2CDGA 5C2UB 2AEOA 4LHUG 4XP6H 4EOWL 1NKOA 3H9HA 1FWXA 3PP4H 3W5NA 5I6OA 5DJAB 4DGUA 1FHGA 2YEZB 4K7FA 2Z93B 2FJGB 3GGWA 1TITA 5HVGB 1MIEH 5EBWB 4I1PA 3UTPE 3PV6B 1HTYA 3MRKA 4JS7A 4TNWK 4KQ0A 4QGTA 1E4WL 4XWGL 3UYRH 2HJFB 4Y1TA 3GXTA 4Y2OB 5IJDC 5DC4B 5FW8A 2BP8B 3HG5A 4U1NB 5CD3A 1WIOA 1SN2A 5C3TA 5SWZB 4Y2DC 3VXSE 3UERA 2WXRA 5LWYH 1HSAA 2L7UA 2FJHA 2GUOB 1H3GA 3VM7A 3U7WL 3VXRD 2W9LA 4GYBA 1YJDL 2DWEA 3O8XD 4RMRA 2OYLA 2P48B 5DZLA 4ZYKB 4OFDA 1NBZA 1DBBH 2EZ0C 2GSIA 4HV8A 2DYSB 1F2QA 2Y1YA 4ZOAA 4KXZH 3DOSB 3NJJA 3ECVA 1OTTC 5F3BB 3KCPB 3EO9L 1FQ9C 5KYYB 2OMZB 3MPCA 1TKWB 5BCAA 5T33L 1GC1C 2IG2H 3PL6A 2ZX6A 3A67L 4J3BA 1BF8A 3L3KB 3NZ8B 4KJWD 2WOYA 3GJFK 1CFTA 3FN0H 1CBVH 1GW6A 2WBJD 2WOBA 1SJXA 5ID1B 4DK6A 1YUHB 1IC5H 2ZXGA 3X14B 2WWMD 3CLWA 1A7OL 1MI5E 3S36L 2L3BA 5AVSB 2O26U 3SY6A 4KDTC 3ASOB 1RZIA 5E00B 4G7YH 3CDZB 4LCCB 5IMKA 4TUUA 4IBSA 3OAYH 4MMZB 5EC2B 2HJKB 4QRPD 3CAFA 4L3EE 4PJ7F 1JWSB 5SX5K 3RTLA 3K2IA 3O45B 5B21A 4ZFZA 4PJCA 3RHWF 5CJOH 2HN7A 3QUXA 3CXDH 3UAAA 1DQLL 2OXGB 5HJDA 1MKFA 3F7QA 3O2DH 4AZ8A 1MCNA 3DKHA 4FYRA 3VWJD 2HH0L 2XIDA 4APQD 1MFNA 2DQTL 3JTSA 2DD8L 2XZQL 4LLUA 4J8RB 3UBGA 1T0MB 1G6RL 3FUJA 2ZUQB 5LCVL 3K6SB 3FFDB 3EW3B 4OB5L 1LP9F 1BQRA 1KYFA 2F74A 3CSTA 1OOWA 1QBML 1NPUA 2H47C 2D7QA 4NSKB 3V0WH 4RGNB 1CR9H 3OKDB 5DT1H 5GZNA 5L88L 3ZSTA 4CSTA 4NO2B 1ID5I 1XF4B 1MVFA 1OSEA 3UAJD 2HRGA 2YD7A 3U30B 2IAMB 5KVDH 3MJ8B 1JPTH 1Y6KR 1VCAA 2VDPB 5LCVH 4HIEA 4AJ0A 4PJGB 4KHXL 1BOGA 4JFXA 4A2LA 4HIXL 4IBVA 1YAZA 5DQ9B 4K9EH 3IGKA 2ZNWA 4FX5A 1OV8A 2QKIC 4PJGA 5HD8D 3V0WL 4HIIB 3PQYE 4Z76A 1G1CA 3QIUD 4M6OH 3RGVA 5MERA 2APFA 1A7RH 4CVXA 3U4BH 1N7MH 2DQHL 1AGCA 1ZSHA 2VGLM 3S37X 4IJTA 3HG4A 3IDXL 4M8VA 4X2UA 5F71A 5TK2A 3BQUB 3TBBA 4JFOA 5E23A 1D9KB 4OGAC 3IMSA 1PNCA 3GEFA 1RU9L 1FZKA 4X4ME 2HVKB 4ICXA 4G9FB 3OMIB 5FUCE 4NP4L 4FQ1L 1RL1A 2QSCL 1DQQB 1S8DB 2IDSA 4JUSA 5DMYA 4A37A 4RWYH 5CXPA 3L5XH 5AYUL 2E7LC 1KJVA 2ARJQ 5EUOF 4DKEL 4JDVB 1VENA 1CO1A 3QIBB 5JR1H 3HR5A 3OSKA 5ILTL 4EQ2A 1TZHA 1U33A 3M45A 4P59L 4PS4L 3ARED 3ARDB 3MNMA 1TMCB 2ROXA 4IRZL 5DWUL 5SWZE 3SCMC 2XPGB 3SPVB 2NDFA 2K6YA 2IBBA 1NIEA 4K8RD 5IJKC 2B39A 2QSCH 4Z9KB 2K1MA 1P4BL 4LNVA 3ZR5A 3QO0A 1HI6B 5JZ7D 4IIZA 4F7MB 1F4WH 3N1GC 1T4WA 2P80D 4KK6D 3LJ3A 4LVOC 3ARGA 2JF1A 1Y1UA 1SMAA 5DQDL 2DLTA 3HN8A 2PW1B 4R2GB 4R9HA 1R9FA 4GEIA 1M7DA 3OPZH 1E28A 1I82A 2X28A 1MFDH 5D2LE 1DVQA 3ZL2A 1UOKA 4NKOB 3QRBA 1N8ZB 1BFVH 5FYLH 5I18L 5AVRB 3EYSH 2BSRB 4GO8A 3F6JA 3WYRA 3C6LC 3TBWA 5JPNA 4M43H 4FLRA 1IKNC 1X6LA 5AD0A 1E3FA 1D2PA 4QHKI 5D93B 3TZVC 3P9LA 1Y6MR 4L5FE 2Q86B 2JJVA 1SXZA 1G9NL 5L8JB 4NT6B 1AZVA 4F9LC 2B9AA 4X6CF 4LSVL 5CCKH 2HG5A 3HZYA 3TGXA 4AM0Q 4PAZA 2W91A 4U7KA 3DK2A 3PAYA 2PMZA 1FE8H 2NYZA 1QFUL 1SJEA 3CSGA 2BO0A 2YRBA 4OIAA 3RL1A 4F80A 3SOBH 4N26A 1WZLA 1LDPL 2QTEA 2VISA 4NHUA 4EMZA 2EIBA 4Y9FA 3JXAA 3QEGL 3D0LB 3V0VA 4YIQA 1ASPA 2ISDA 4L4VB 2EP6A 1CFVH 2BVPA 5F7DA 4WI3A 4TSAL 3OB0K 1NGXB 2VQ1B 3FF8A 5L4IA 5LCVA 1NAMB 1VGKB 3Q48A 4EBQL 1IZJA 5KVFH 3M07A 4BQCA 1E5CA 3IETA 1BHGA 3EHBD 5I1EH 4JFEB 4OLYH 2E7DA 4QHNA 1H15B 1OAUH 2NZ9D 3C09C 1U8HA 1WBXA 2FO4B 2DQUL 3HG1B 1UWXH 1RVFL 1NGZB 3EYOB 2VL5A 3MLXH 4LCYB 4MMZC 4WSKA 5CO1A 1M05B 2P8PB 4LP8A 3PP3K 3NACL 5CGYC 2ADIA 5GZOA 3NVQA 4Z7VA 2ICWA 3WE6A 5IJKA 3D3VB 1YEFH 3QZLA 4ONHA 5TTRA 1UZGA 5DC9B 4Z7WA 4HOXA 3BVTA 3VVWA 5C9JB 3QPQD 5C07B 3VXOA 3B34A 3QPKA 2BNQE 4RX4D 1I1CA 5KVMC 2QMJA 5DHVB 4EZJA 2ZONA 3VSVA 2ZJSL 2VXUH 4XP5H 3BKYL 1IE4A 4XP1H 3WDHA 2VXTL 1QW9A 1B4RA 4MVBD 1NDMA 5GGVY 4P2OB 2YPLA 4IU3A 1BFVL 1JS4A 5E70A 1YPZF 3VQMA 1NCDH 2C9QA 5AB0A 1JRHI 3KVPA 4JM0A 3CU7A 1KJ2B 4M43L 1DLHA 1YYMH 4P9ML 1MAJA 3FB7B 4UBDD 4UV4L 4EXKA 1GOGA 3F62A 4PRBA 5CAYB 1PCXA 2X0WA 3CDGB 43CAB 1MEXH 3UTZB 1JZIA 3VX0A 1CICC 3D39B 1F90H 2CUHA 3JVGA 4N2CA 3RRQA 2WP3T 2XWRA 3X13A 2YOCA 3GXPA 4LSRL 5EZPA 2DTMH 4M61A 4MQXD 5C70A 2NXYD 3BUYA 1BW8A 1C1EH 1ZKAA 5FKAA 1QEWA 1WFOA 2ARJB 1HWHB 2YUWA 4Q0XH 5HHOA 4X6BA 4LRIC 2X4QA 1I8LA 2K8MA 3KPNB 3RDTD 5E2JA 4FQPA 3FCSA 1LWJA 3DGGB 2C9XA 4YEEA 1JZDC 2GEEA 2KL6A 3GS0A 4EIUA 1NFIB 4P23D 3LZFL 1ND0B 4FNQA 1T0NA 3B56A 3VD2A 5I66B 3DROB 3D5OF 4X5WB 1SEBA 5HGDB 4Q9RH 3CZUB 3BT2H 3GIVA 4KRMB 4QY8A 3LQAH 2VMCA 2BSED 2J1WA 1PLBA 1DP0A 5E03A 4QKTA 5KJRL 1MWAA 1DR9A 3SDAC 2JNZA 3D0VA 3OZLA 5EF0A 5AVTB 2VQ4A 3DVGB 4QRRB 2WCSA 3F7RA 2CUIA 2NY0D 3SPGA 4N8VB 5F97E 3WEAA 1SRDA 3A4EA 1RXLA 1GGBL 2WLLB 2R29L 1CT8B 3VTMA 4GSQA 3Q3GA 2ADFL 4JFEE 2NZ1A 1AD9B 1EXUA 3C5SB 2J6WA 1SJEB 3WKYA 1NC4D 1LLAA 3WY4A 1OD7A 3BPCA 3NH7L 2YA1A 2BSDA 4FA6A 5DJDB 1FYTB 4GRWH 3RL2B 1TTCA 3BPOB 4S0SD 1NAKL 4AIZB 4TM9A 2O72A 4NO0B 3TPKA 3LXBA 4OD2B 3NDZE 3SE4C 2R51A 3CHRA 5T1KD 4FFZL 3NT0A 5J4MA 2W9DL 5KVGE 4OR1A 3C6LB 4A7GF 1A47A 1FZMB 4LCUA 4XMVA 2B3IA 4QOKE 3S0PA 1IM3B 3CPLA 4RA0C 4X9FA 3OKMA 5HI3C 5BS0A 1XB8A 5IMOB 2C4XA 5LAXA 1TPXC 1P4LA 4H1LH 5H4ZA 2JB6B 3L6FA 1IE5A 3BH8B 4PGZA 3FO1B 3NFSH 4JDZB 3JV6A 4PJFA 1SEBB 2YJLA 5EWIL 5D7LE 4ZX3A 1BVKA 5E4EB 5J1AA 1V8HA 4LARL 3DXAB 3OGCA 4WI7A 4Y4HB 1KB9J 4DTGL 4F15B 4QNPE 2ATKB 4MDIA 4ANXA 2DV6A 5IVNA 4O02L 3OAZK 4TLUA 2BHZA 5JOFA 5E6ID 3MYZA 1OPOA 3O9WA 1M3IA 2YQBA 1G4RA 5JOFB 5HHXH 5B7FA 1IC0A 3EO1A 4C83A 3GBNL 3T2PA 4E41E 4NKDB 5K1VA 4ZUSA 3L2LA 2IC2A 3H0TB 3QPQC 2VM4A 3BFWA 4YXLH 4V11A 3KVQA 2JJUA 3ATEA 5EUKA 5HPMA 2J5WA 4CU8A 3FUKA 3DXAE 3LZQA 3QWNA 1QQDB 4DW2H 3VUAA 5HPOA 2NXZD 3LVEA 5IIEB 1I8AA 5HD8C 4GSUA 2DWEB 4A7QA 1HYSD 2B59A 2X2UA 4XHQA 2FL5A 4L8SB 5J3HC 3FSOA 1CXLA 1CQYA 1DBKH 3VH8A 4OLXH 2OSLB 3BUBA 1U8LB 3N43F 2PXYD 4JHBA 1C9SA 5GS1C 2WXMA 3LKOB 1AI1L 3C60B 5GGQL 3A47A 4I3SL 1MNUH 2OJZH 2Q8AL 3LXAA 3L3GB 1NIBA 1KCRH 1F3JB 4Z5RB 1FPTH 2ZOLA 4JPWH 3NDYE 4CGTA 4P5TC 1WFIA 1VGEH 4WW1B 2NY1B 3EOBA 4WNSA 5E7FA 3HC0A 2Z34A 4Y4KB 3SSGA 3EADA 7FABL 1XF2B 1DSYA 1RUPL 4GAJH 1R5IB 3V4VH 3X3GL 3UMTA 4Z0BL 4ZW5A 4K9EC 3EZJB 1XGPB 4X6DA 4P2OC 1NGQL 1QMUA 4A1RA 1ET8A 2G5BB 4PGBA 3CCHB 2ZYRA 1MWAB 3UPCA 5GRVL 1P6WA 3MREA 4YE0A 1ZTMA 3OJVC 2IVFC 4OZGA 2QFRA 4FQXA 4HHAB 4JM2F 1J5OH 1NKGA 2YPKB 4G59C 4B7IA 5B22A 4B9IA 3BW9A 1HFUA 3QQ9C 4AQ8A 4Z7QF 2PP8A 1AG0A 4KDTA 4KX8A 3GMOB 4NO3A 4OD1L 3KJ6L 4ZS7H 4BQ9A 1TCRA 1XDTT 1FAIL 2J71A 1MHCA 2QPSA 6CGTA 2VZ1A 2Z91B 5FV2A 3RVWD 2IGFL 3DO4A 5H37A 3C87A 1CLZL 1K8IA 1ZHBA 4OFKA 1WCBB 2BNUA 4MCNA 5GS0H 1NBCA 3NSCA 5M95B 1V3LA 4JRYE 3NN8B 4GH7B 2DRUA 4QRFA 4C8XA 4TTDD 3UYPB 4H5SB 2AAAA 2AJVL 4NM4H 5JHLA 4MXVE 3MOAL 4HSQA 3CIQA 3PDDA 1MZYA 1VGKA 3ESOA 3RPBA 2QGDA 1X7QA 5T1KB 1WWBX 3LV3A 1YN6A 4ZSOA 1M57B 1AR2A 4FNLL 4N8VG 4JZNB 2EVHA 3RNQB 4H8WL 1O0VA 2AV1A 3S3JA 3MODH 2CUMA 2OX5A 3FH7A 1QLEH 3BOVA 2V9TA 5KYNA 1KYOK 2CG9X 4HEPG 2Z0UA 3NFNA 3NQKA 4XCEB 3WFHA 1WIUA 2GFBB 4Y4FB 1B2WL 3LKRB 5A3ID 2AQQA 1JXJA 3ZTEA 2XRAL 3CFDB 3QJZA 2JJWA 4PRDB 5FUZH 3RWEA 5KVDL 5ISZB 4GBXD 2R69A 1PG7H 4FNUA 3PDOB 4JQXA 2Y5EA 2BM3A 2JTYA 1JZJA 2KMWA 3C9NA 3I74A 3MUHL 4K7PY 4LOVA 4O9HH 4BSWB 3EFOA 3FOMB 5A6MA 3K2UL 4XOAA 3SGEI 4P05A 4Z6AT 3AXLA 4NN5C 4UQCA 1X4ZA 3Q1SH 5C0BA 3H0TA 3LS5H 2N0KA 4W6WB 1TVBB 2AJXL 2Y7OA 5D72L 2CKBB 1Y7VA 1D5BA 2ICCA 5KN5A 3I6LE 4UQEA 4YQXH 5FGCE 5IBLC 3QIUC 1L5GB 4GRLC 3QWRA 1JHTA 4FE9A 1NEZB 2X1QA 1AJ7L 3QDJB 5D1XC 3RA7H 5HVFB 4UT6H 1EO5A 1JK8B 1RULL 3QYMA 1J7VR 4NP4H 2A0LC 3LNHA 4H0GA 2CGRL 4XPFL 2P52A 4IKNA 3QI9C 1DJXA 3M86A 4Z77A 2CCWA 3SOBL 3Q1EA 2AERT 5AOKA 4BHUI 1I1AA 3EGXA 1ADQL 1KOAA 2H26B 4JHWL 1BXUA 1YJDH 2VMEA 4HAKA 3EGDB 3NZSA 3LIZA 4KZDL 3WDIA 4EZMA 4XPAL 4EUPH 1DBBL 2WLLA 2ZCLL 4FQJL 5EDSA 2X89A 1IM3A 2FSDA 4WFGE 5E9NA 1RJYA 1X5IA 3UDWC 4QDGA 4PLJC 1T2QL 1RSFA 4U1GC 3U82B 5T5NG 2OLDA 1V7NL 3ISWA 4NM8H 1P7KB 1ZXKA 4ESKA 3FT3B 1YECH 3CD4A 5EO0B 4CVZB 1U41A 3QIBC 3FCTA 3S4SA 4PRPD 3RJDA 1B0RA 3T3MF 1CF8H 1T6WA 4OF7A 3VGDA 1Q9OB 1GGTA 3NACH 5A2LH 3DUHA 5D8JL 4X7FC 4L37B 2C3XA 2GJJA 4PI2A 5TQ2H 1R3KA 2FCBA 1JF5A 1OEZW 1JPFA 4WW2B 3OX8A 4ONFH 4WTXA 1O6SA 4N2AA 3QWOA 5LXGL 4G1EA 4X5XB 4C56B 5TF0A 3FB6A 1N0XH 1EEQA 1JGUL 5D5MF 4FA7B 3R8BB 4OZIF 5E2VL 1FRGL 5CJOL 3PP4L 4ZO8A 2XBDA 5FW6A 5EZJA 2H9GA 4G6JH 8PAZA 4JRFA 3G5VB 2ATPA 3FQNB 4X8CA 1DLFH 1RKRA 1B0GB 1CK0L 3GSOA 3U83A 2YMXL 4ELKB 3I6GB 4KROD 1XH3B 1MI5D 4A63A 2R1WA 4LP4A 1SDDB 1XAKA 2ZCKL 3BZ4A 4JQXC 3VMOA 2NXZC 4UV7H 1LEIA 4B0MM 4YHMH 5CLYA 4AXWA 4Q2ZA 5E2TH 5DS8B 3IJSB 5D2NA 3S3SA 3REWA 1AIZA 4JFFA 5DD0H 5FM8A 4MZIA 2Q3AA 1KDIA 3MRLB 1HCZA 4K3EH 4R4FH 5BZXA 4BELD 5LKNA 3QXWA 3EH5B 3O9WD 2VDMB 1MUJA 4HJIA 4N87A 2BW5A 3E0GA 4ODXB 3A4AA 5FXCH 3KPSB 3T09A 4ODTL 1DQMH 5HYQB 4XCEA 3O0LA 4M4RA 5HDWA 2FEEI 4F8PA 2NNFA 1RK0A 1URIA 3TNNB 3SYCA 2Z8WC 1BP3B 3T4AC 2CGRH 2YGQA 4O2CA 5BOZG 1IBGL 1P4LB 3PHAA 1OAYL 1Z9MA 3FPXA 4WU7B 2IOMA 1ZV9A 1TKWA 2K78A 5LBVA 2APBA 3LB6C 4QHUB 3WGUB 1T83C 3WIAA 3OR6A 4YHZL 3MOBH 1SXSA 3DXAD 3RTQB 4X6CA 5CP7B 1GJUA 1R3IH 4NC1C 3W2DH 1YEDB 2APWA 5CN1A 4WV1A 5E4OA 1RZGA 1CC3A 2R4RL 2VXVL 4K3DL 3DWTA 5IJVB 4WCYL 1T66D 4KO6A 3NABL 2CA4A 5HI3D 3WTUA 1KNOA 1CLYL 2MJWA 2PCYA 4L9LB 3RB7A 3U0TA 1FHNA 3S88H 1H5BB 1ZMYA 3ATBA 3GHPA 3IDGA 3ZUCA 3R8QA 1I75A 5BXFB 3F84A 2F8OA 3AW5A 1I9RL 1ESOA 5BVPH 4FXTA 2XA8L 2JQZA 4FHKA 3F2LA 3TO4D 3EJQA 2WNWA 5EEWA 5TDOB 4E42B 2NQDA 2RBLA 2HX7A 1E67A 1SY6H 4FMKA 2IPKA 2ADYA 3GM8A 3NH7H 4N6RB 2CK2A 4H8VA 3O3EB 4M6NH 2YAMA 3UTSE 1G0YR 1VFAA 5ICYA 3ABMB 2JIXA 1TTRA 4A38A 4APXB 1I7TB 1B6UA 2UZPA 3UG4A 2EADA 1NBYA 3B6SB 1FG9C 3ZTNH 3QJTB 4AKPA 4WW1A 5AVZB 3TO2B 1X5AA 1E9PB 1MG2C 1J9QA 2W81C 1JGIA 1A14L 4TUJB 3BRGC 2FT6A 4I2XE 1TUPA 1PU0A 1KPUB 2PCPA 2PP9A 4KJQD 4KY1L 1NUDA 4EJ1C 5B39B 2OX5B 4NNYA 3KNBB 1VB9A 4GS7B 2RAMA 3HBGA 1O9VA 4H8UA 3LRHA 3G5XB 4HETA 4PG2A 1HOCA 1ML0A 2CR0A 3QFJE 2BHYA 1CWVA 4OU3A 4PHXA 4WWKD 3QZMA 3BC9A 3ELAT 1UCBL 4TQEL 1BCIA 3WTSA 5BZDA 4PV9A 3DHUA 4XO4A 3N85H 1YY9D 1O7SA 2WO3B 3G5YB 3DTUB 4JKPL 4ABWA 1ZHLB 5JQHC 5GXBB 1FN4B 4G6KL 2GC4C 5IB3B 2K6WA 2F53B 2XN1A 3FB6B 1HZHH 1DUZA 2B8OT 2LV4A 4UTAH 3NCJH 5C6TL 2VH5L 4LSTH 4RFEA 2CHWA 2JKXA 4WY7H 1ONQA 1IU1A 2LU4A 2YXVA 3ARBB 2JV6A 1ETJA 1HX0A 3N85L 1KXHA 3KYAA 3T3PE 3MA7A 1RUKL 5K9QI 1H6EA 4I2XA 1W72B 1XX9C 5DJZA 5IBUG 4BH8B 1AZZC 2IWGA 4HS8H 4J1UA 1G9MC 3GM0A 5EORL 1V3MA 2VDOB 2DQCL 3ALWA 4GBXC 1LO0L 5IUSA 3ZGHA 1DQDH 1CE6B 3CMOL 2MCMA 4Y4HD 3T0VA 4GG6F 1DL7H 4JZOA 1DCEA 1EERB 4IHOB 1AQHA 2CBOA 4BSVA 5D7JD 3S8GB 4DP6X 3GXUB 4KH2A 2JCWA 4NZTL 3TEUA 2GW5A 1BQHA 3MBXH 4MJIA 4H44C 2LU7A 2KZWA 1S2EA 2FIKA 2UZIH 5EF1A 4Z7UB 1J0JA 1AGEB 1FPTL 2WINB 5T8IA 5GRZA 3N0AA 1NKRA 1X7QB 3K3QA 4WW2C 1MI5B 4XVSH 3W1ZA 1S9VB 1ZLEA 3IFOA 2VZUA 4GMSL 4WJG3 1HK6A 3TWYA 4GFTB 2YPVH 1CDHA 3ZHLA 4JQVA 1CYWA 1Z9OA 3BP4B 3D3VE 4TTDC 4MJ5B 4YZFE 5FAAA 1G6VK 1AH1A 5T5FL 2XWJB 1PYWB 4O51B 1H9VA 4L8DA 3WE1A 1R3KB 4YDIL 2D9CA 2YD4A 1D5BB 3IMBA 3QEQD 3MLYL 4WNJA 5ANHA 4PRAA 4HJGB 1T5XA 1JDDA 2NSXA 5IVXA 4GINA 3PWLB 4ABVA 5I0YA 1A4KB 5E8PA 3EG9A 3IMVA 3GYRA 5TGBB 5IUCA 2APVA 4XCFL 3WXWL 1EMTL 3PPEA 1SVZA 1IGML 3NP3A 5E4EC 5ITBL 3E8VA 3KDPB 1V7MH 5LG6A 4FNSA 3CFKB 1CLZH 4GI6A 1U8KB 5AVVB 5G4MA 1LEKA 3FT2B 4LT7A 3ARQA 4X5QA 1QFUH 2B1HL 5FYKL 3F04A 5I1AB 4F5CA 3Q06A 2A73B 2CU9A 3UTQB 2EYRA 1CFSA 4B9GA 1O7VA