4ZMVA

Crystal structure of human p-cadherin (ss-x-dimer pocket i)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
b'MDWVIPPISVPENGKGPFPQRLVQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 45
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmvA01
4NUPA 3K6FA 5JYLA 1NCGA 4XXWC 4AXWB 3PPEA 3FF8A 4NUQA 4AXWA 4ZMLA 4ZMYA 3LNDA 4AQEB 1NCHA 2A4CA 2WCPA 2WBXA 4ZTEA 3LNEA 4ZMOA 2OMYB 2QVIA 4ZMQA 2OMTB 1NCJA 1ZXKA 4ZI8A 3Q2LA 4AK1A 4ZMWA 3K6IA 4ZMZA 3MVSA 2WHVA 3K6DA 5JYMA 2X2UA 3Q2WA 3Q2NA 2A4EA 3UBFA 2YSTA 2OMXB 3UBHA 4NUMA 1WUZA 4ZMNA 4ZT1A 4AQEA 1WYJA 4APXB 1FF5A 4ZMXA 2EE0A 1O6SB 4ZMPA 2V37A 2QVFB 3K5RA 3LNHA 1L3WA 5DZVA 4ZMTA 3FF7A 3QRBA 2OMWB 1NCIA 2OMZB 2OMUB 1SUHA 1Q1PA 2YQGA 4AQAB 3Q2VA 4NQQA 3K5SA 1OP4A 5CZRA 2WD0A 4AQ8A 3LNFA 5CO1A 4AQAA 4ZMVA 4OY9A 5KJ4A 3LNGA 3LNIA 2OMVB 4QD2E 1ZVNA 4APXA 4AQ8C 3UBGA 1EDHA 4XXWA 2O72A
chains in the Genus database with same CATH superfamily
1I4FB 4LPCA 3AT8A 5HGBA 1VFMA 3NCMA 4HC1A 4WK0B 4NIYE 1NKOA 1T1XA 3MROA 4WV1A 4H0IA 5FA4B 1FO0H 3OB0K 3ULVF 3IEAA 2GEEA 3BJ91 3EJCA 4JFTA 1GS7A 4OCYL 4QT5B 5DCCA 1RIVL 1PZAA 1FFRA 2JELH 4UI2A 2OTUB 2RFXB 3QJHB 1KIQB 4QRRE 4LCYA 2XWBA 4YR6A 3ULVC 2PO6C 5LGYA 3O4OC 4ELKA 3DX8A 2XG5B 1PZSA 2IH3B 3WL9A 1CQKA 2Z1KA 4UYQA 1MG2C 1YDPB 2XBTA 1BVKA 1AGEA 4L8BA 4Y4HB 3M86A 4PCKA 1G0YR 5CSZA 1U4EA 2WXNA 3CDGA 2GFBA 2G0KA 2H3NA 4OLYH 1AFVH 3FXIC 1WH0A 2FEEI 1YUHA 5AVQB 3DUSA 3P4OA 2FX9H 3V7AE 3GSRA 4LLUB 2CK2A 5C08B 4M00A 2VR6A 3T3ME 2AERT 2NTFA 1BQLL 1A4KA 1CF8H 2NR6C 4WI9A 3TO2A 4IRZA 2Q8BH 2CUIA 3QK0A 1XBDA 2HH0L 4FLQA 2O6PA 4WFGE 3RKDC 5KYWB 2A74B 2AV1A 1IJ9A 2B20A 2NY6B 4D0DA 4CUCA 4I18B 3DSFL 1NM9A 3ATEA 2YD0A 3RG1C 4FABL 3JBG7 1FVEB 1IO4C 3FT0A 3BWZA 3FN0H 1XCQA 1K85A 4RSVA 4F93B 3HLAA 4L3CA 3QEHA 3NA9H 4HIHA 1E50A 4JY5H 5E2WL 3LDBB 4QIRA 1Q90A 2XY1A 2PXYD 4ALAH 5FO9A 4AEHL 4JJ5A 3IDGB 3EJYD 4FQ2L 3VH8A 4ZFOL 1RZJL 2WK2A 3MACH 1UENA 5HSFA 4OF0A 3RRQA 4DW2H 2AITA 1JPGA 1F5WA 2EVGA 3I3BA 3TP4A 4GAJL 3GHEH 2WXFA 3IDNA 4OFQA 1IRAY 3WJJC 2FHBA 2YPVH 4C4KO 1JUFB 4AWJC 2F7PA 2VE6A 3EOBA 3PLYA 4JB9H 4Y89A 3ZE0B 1RK0A 1ZHLB 2NSMA 1XB6A 4F5CA 3CQQA 4DZ8B 1AYOA 1WA0X 1DEEB 2X88A 1P4BH 2C34A 3O4LE 4N8CL 4X7TA 4I9WE 2QVKA 3WTUA 3S7GA 4GKZA 1DQLH 2J1ZA 2XTSA 4NHCH 2LTQC 4QPEA 4XVUD 2WINB 1H3UA 2ZWNA 5BMFL 1PY4A 4DO5A 3VWJD 1MVUA 2VGLM 4JFPA 2EDWA 2VXSH 4L29A 4JG1L 3W2DL 4X7DC 2IH1B 4PV1C 2J8UE 2P26A 3FFCA 4JFWA 1RZQA 5LBSL 4J4PC 5FDWB 1R3IL 1GCYA 1XSJA 4HHAB 4TUOB 2DOCA 3L5IA 5A2LH 1NDMB 2KZWA 1AS6A 3DPBA 3NZ8B 3APDA 1TR7A 3VWKC 2WXRA 1W0VA 3CZSA 3KLAA 2R1XA 5FW6A 1FNAA 4A2HA 3TA4D 2VB5A 4G43B 1Y6MR 3RUGF 2VDNL 3UH8A 1A3RL 5IEKB 2FJHB 1IGIL 1A0QH 2HKHH 2IPTL 1WFUA 1J10A 2LT9A 4BELD 5BS0D 3CUPA 4M7LT 1ZGLM 5E9NA 4YBQD 4QHLA 2VCOA 1BMGA 1X5MA 4CC4A 5C07E 2X6BA 3GJFB 3QG7H 3MTXA 3AG3B 1D6VL 2H5UA 5KOVC 2P9RA 3RWJB 3D0VA 2WXPA 4B7IA 2XV6B 3OAUL 3SE9L 3F65A 1AIZA 1H3PH 2E9BA 1UXLA 5KVDH 3SY0B 1OPGL 4KKQA 3N1FC 2J8UF 3QFDA 1XH2A 5JPMB 2E7MA 5ITFA 3GRWA 1IM9B 1XZ0B 1ZIAA 4JRXB 3ATFA 4LKCA 5I6MA 4R5XA 1I85C 4M02A 1G7HA 3IGLA 5D7LA 4G82A 2G2RA 1OWWA 1TZIA 3MAWA 2WTOA 3SDYL 1XL6A 3GXIA 1HILB 3KXFA 3PPSA 3WBDA 5FECA 3QUXD 1G43A 4PRDB 4WHCA 3ZDYE 1N2RA 2X9XA 4FNTA 5TQ2H 3GC3A 2ENYA 2EE3A 2Q8AH 1N7ML 3X12B 1TENA 4GB9A 1T0MA 2VITA 4M5TA 1YNTB 4JFYB 1IGJB 1OSEA 4DEUA 2XZAL 1AXTL 4XB8A 4LESA 4JQIL 4PJGE 5DMGC 2EILB 4X8XA 4ANWA 2NY1B 4PLOB 1ZVSB 2WZ5A 3BPCA 3QDMA 3V5KB 3K8KA 2VJ8A 4PM1A 4ZMVA 1CXEA 1JV5A 3S5LG 1GW0A 3EOAB 1AJ7L 1GPOH 4U3SB 2X0WA 4KV5F 4LF3A 25C8H 4MA7H 1YO4A 3R4RA 4LBEA 4ANXA 3MBEB 1WLHA 1JCKA 2NY2D 3ECBA 3O9WB 4GKSA 4KGJA 3VFRB 2BP3A 3RILA 2DWTA 2P5EA 3OXSA 5JW4N 2VZVA 4ODUB 4NI3A 1F3JB 4MMZB 4QGYA 5C0AA 1JZ5A 2DQUH 1AI1H 1CK0L 5B4MC 3BDYL 2XTJD 2C7UA 5EU4A 3O2WL 4FXGB 2BNRE 3S34L 4IU2A 4N3TA 5TGBB 2YXMA 3MJ7A 4OF5A 1IILE 3IDJB 4QRPA 2CKBB 1ZLVH 3T71A 3BO8B 3FQTB 2O61B 5DEGA 5C09E 3EADA 3E3QE 2G75A 2X6VA 5CCHE 4X6CF 4C4UA 3DRTA 3RWDA 2R51A 1HYSC 1U93B 2VN4A 2OAAA 2YA1A 3AY2A 4C56A 4C4BA 4XVSL 2DYPA 4WEEA 5KVGL 4P8QA 5LCVH 1QLRB 5EZPA 4HT1H 5FGCE 3E8VA 3VA2C 4D9LL 1ZLSH 4JPVH 2O6FA 4NHUA 1FV1B 5ANMB 2WKOF 1Z6JT 3SBWA 1HHJA 4PJGF 3IS1X 3QISA 2R0KH 3WUZA 1UOLA 1BREA 4JGUA 1NUFA 5D72H 1HQ4B 5AG8A 2DLFL 3L3OB 3RVVC 1N59A 4YNYA 3DGGA 1I82A 4R96B 3T65A 5I17A 2V9QA 1EZUA 5I1DB 2ZCHL 3ISWA 4GY4A 1T21B 4PWIA 3QZWB 1UURA 3IDIB 4PWKA 4S1SH 1QOKA 5EC2B 1BD2B 4CSPA 5J12B 1B9ZA 3MOAL 4NQSA 4PYGA 1KN2L 1GSKA 2VDRH 3C5ZA 5GS1A 1AC6A 3PV6B 4GO8A 4R97C 3MNWA 4K73A 5I66B 1NSNL 1ZHNA 5GZNA 3MN8A 4UDTA 5HHOA 1RUKL 2VLLA 4GMTH 3N1PC 4BH8A 2W8CA 5I1LB 5ABZA 4YN3A 4FHBD 3P0VL 4LPYA 2YQ3A 4OCRH 3WNOA 4Y2DC 1PD1A 1XGPB 3T6XA 3PDOB 3O3UN 4QHUA 1JJUA 2PKDA 3HNSL 2EADA 1LDSA 4APQD 1Z7JA 3KEDA 3QIWC 4L05A 1OP4A 1WD9A 1YC8A 4R7XA 1L9TA 4LL4A 5B1AB 4Z3IA 1AD0A 3SE4A 5IB3A 3ZKMD 1AQKH 4TSAH 1DVXA 4QLWA 3VGBA 2HB0A 1DSWA 7PAZA 1ACXA 2DQIL 3A4DA 3UTZA 1C16B 3MO1B 1J9TA 1MFMA 3MGTA 3NIFE 5E8NB 4P23A 4FNLH 2Y3AA 5C0EB 4JKPL 3I6KB 4OGXL 3ASWA 4OF6A 2YBRB 5SWZB 3QUZA 5I6PA 3IJEA 3MNDA 5CU5A 1TZGL 3TN0D 3UYOD 2WIMA 3W0WD 3OVUB 2YD2A 5DJCA 1B4JL 2LU7A 5MI0B 4LSVL 1S7WA 4FCAA 3R1GH 4N2OA 2XN9B 1PLBA 5GSRB 4K5LA 3SYOA 1FE8H 3FZUC 5A6LA 5EF0A 2JTDA 2WLJA 5C0BA 2MTPA 2PUQT 2OR7A 3E2HB 3IFOB 1Z9OA 3UTTB 3RL2A 3NCFB 3QCVH 5IMOA 1A6ZB 5C9KA 4JO2L 3MRGB 4LGPB 5IROC 4QXVA 1L9MA 5CINH 4EUPA 2V2XB 1GJIA 3AM8A 3ARSA 3QQXA 4ZW6A 1Q9WA 2BK8A 1KACB 1U8LB 4Z8FH 1NCJA 4NM8L 1M2OA 1DVFA 3P2TA 4RFEB 5HGHA 2BY3A 5T8IA 4XP4L 1Q1JL 2B4CL 1VSCA 3B3IA 3FOMA 1CLZL 5DYFA 1JCVA 3EO9H 4PWHA 4L8CA 3TZVA 1NBVL 3GBEA 1NCBL 3I2CH 4P4KA 3NFSL 3S3BB 1CI5A 4RX4A 3ZQWA 2XWRA 3L13A 1YECL 1ZPUA 3HC4L 2D9QB 3CFCH 4MQXC 4XI5D 5F0JB 4LPUA 3CZLA 4YHKH 3WN6A 2I5YH 2HX9A 4MQTB 2IWGA 2AEQH 2NY0B 2YMOA 2XKNA 3BD3A 4B9PA 5ICZB 4F9PC 4NSKB 4LOUC 1NPNA 4HSQA 3L7EB 4UNTA 3DTXB 4OZGB 1BVOA 4HQQL 2IAMB 4GW1A 4L3EA 1P53A 5FKAA 1PF3A 4RAUB 5CLZA 4UM9B 5FW7A 3QEQA 1VKXB 4GRWB 3LIZL 2PYFB 2K4WA 1XTLA 2WXIA 2YAQA 3RL1B 4YIQA 2FQDA 4PP1D 2C9AA 4PRPA 1DUYA 2BWDA 6FABH 3EG9B 2YPKA 2PPAA 3DX9A 4FDWA 1ILSA 4YK4C 3CFBB 4AG4H 3HHRB 1P6WA 3RX8A 1EJOH 2DQFA 2J5LB 4N2GA 4D9QE 1LK3L 2MCG1 3QXAB 4CGTA 1MFCH 3G6JE 4D7PA 1CD1A 2VC2B 2AXGB 3KJ4B 4HEME 2KS0A 3N1QC 4P04A 2X6AA 4QXGH 4EDXA 3MSPA 5FHBL 5IW3A 3IVKB 4NQCB 2V3EA 4XPGL 2W07A 1F6LL 1LMKA 4QJ4B 2F7QA 3SDXE 3PREA 1PYWB 2UWEB 5FKPA 4DWHA 4N8VG 5IR1A 2A99A 1BJ1J 2JH2A 5F21B 4LLYA 5KSVA 1XV8A 4LFHD 1E5AA 3V7MA 4PJAE 4QF1A 5IHLB 4XCEA 3UROR 5JQ6H 1T7YA 1KELL 5D4JA 4NUQA 2IADB 5TF0A 4H20L 2QZQA 1VGEL 5CSGA 4KZ0A 1QSVA 1JK9A 5CZXC 4Z0BH 2KQNA 4HKXB 3E6HA 3Q8FA 4R0LA 1X4XA 3QUHA 1BWMA 5GGSB 5C0CE 3QIUA 3ZE0E 3ULVD 1OARL 2D2OA 4WCYL 4N1EA 3BVNB 4PTUB 2FWLB 5FUOH 1AQ8A 4OGAC 2DW5A 4JLRB 4W9KC 4ODHL 1DUZA 2ZD0A 4LL9A 4XMUA 5C2BH 5B39G 3ROOB 2O5ZL 1A14L 4YS4A 4NFCA 2QVIA 3BAXA 3KPOB 4YOKA 1ZDQA 4UQ3A 4JFXA 2RMNA 2F7OA 1KZQA 3M17A 5D1XD 4B60A 2L4OA 3PNWA 1JZ8A 2XQYA 3DKHA 4WI8A 1ZHBA 1RUPH 1T89A 1P5UB 2JCWA 3HRPA 1UUNA 5HI3D 4JFQB 2NR6D 4ZW3A 1J9SA 5LB1A 2P42B 3LSOB 4FS0A 2WLMA 4RISL 4AENB 1OE2A 2ZSWB 1Q38A 1I1AC 3IETA 1O9VA 3KVPA 4G6AD 4HIIB 2I32A 3O45B 4I48A 4NWTH 3SDXF 4HLEA 3F85A 4ZAKB 1WAAA 3T0BA 2IXQB 3VSTA 4PJEA 3VTAA 2GSGA 3L4TA 1NGPH 2VDOB 4FI8A 3AMLA 5F3BB 1T20A 3LKRB 2OZ4H 1C8PA 4R83A 1XEDA 1USQA 2G60H 4L37A 4NZFA 1K8DA 3T0EB 3HUJB 2ZOLA 2A5UA 4F7EA 15C8H 3MCKB 4E42A 5E00A 3VD2A 1UG9A 4KKPA 5EU5A 1KB5A 3S37L 1UGKA 2BZDA 1B9KA 2LFEA 2ZUXA 5I8KH 3PV7A 3PWNB 1FGVL 1QBAA 2VDKH 3LY6A 3QWQB 4K9EC 5C7XH 1LD9B 3GLEA 3UTOA 2N0KA 4EEEA 1WFMA 3VD0A 4TLUA 1Q4NX 3P40A 3WIFA 4DN4L 3O41B 1MCHA 5HYSG 4XMPL 5F7YC 2PABA 2FO4B 1JGDA 5TPWL 1DE4A 1ETJA 2NNAB 2Q2EB 5C7ZA 1BOGB 3QWOA 3D6GA 4JFDA 5MEPB 5IIEB 3VFWA 1DVZA 4NT6B 4MX7A 2CUMA 4LE8A 4M6OH 4RFNB 3V0IA 4AEIL 1NBZA 4HH9B 3TNMA 2CCLA 1TZ8A 1UWXK 1RMFL 5BZZA 4KZEH 5AYUL 4X6DA 3BGFB 3GINA 4LCVA 4J8RB 4OLVH 5IB5B 2ZXAA 1TJIH 4G8AC 3UTSB 4WFGD 2CD0A 2ZX9A 3NJKA 4YHML 4H8WH 2W0FB 4TVSa 1Q9KA 2VLJB 5D5ME 3VXME 4G1MA 5KVFL 4IRSC 1R33A 4FTVA 4XAKE 4NNXB 2HFGH 1CG9B 3FQUA 4BSWB 1FBIH 2XWZA 4ESKA 1NBCA 4JHAL 4N68A 2WIIB 5INCB 4EPSA 3P4NB 1JNLL 2XYCA 5D1ZC 4QYAA 2HVBA 4FFVC 3VXUE 4QAMB 3BAWA 3L5WA 3GSNB 1KJ3L 1O7DE 4KMQA 1KXQE 3AY4A 4UZSA 3DXAB 5I8EB 4UQIM 2V9UA 2OSLA 1S7TA 1GTNA 3CFDB 5TE4L 3ZKSD 5L4MA 1DLHA 2FK9A 1S5IH 4ZMZA 2EE6A 4MCYA 2BRQA 2F53E 3VQMA 3P3TA 1QSFE 2BVUA 4HKJA 4D2NA 2Z7YA 3QQ3B 4TQEL 1XIWB 5CEXA 4LARH 4LBAA 2NDFA 5AZ2L 2A77L 2F54A 1YEIL 3CVCA 3L3IA 1M3JA 3NG5A 3PAUA 3K74B 4I9WD 3SKUD 4YHIB 5F7EH 1IQDB 3P11L 5LBVA 1WFJA 2G4EA 4AQ1C 3PHQB 4WTQA 4I89A 3LAFA 1T6VN 1R17A 5LGJB 1Z9NA 5ISZA 4XMWA 1KCKA 3VD1A 3ATDA 3DJSA 3BQUC 5ECJE 1B0RB 1NCTA 4J3OH 5HDOA 5LDUA 1FP5A 2N7BA 1D9KD 2MCAA 1KBPA 2XPZA 2YOAA 4PMFA 3MLWL 1BQHG 1Q9LB 2JJTC 1IAIL 3P9LB 1SUHA 4LLAA 4PREB 2OYMA 4H13C 4CA4A 1HINH 3BEVB 2X38A 1ACZA 1BD2E 1DQQA 3ECUA 1CICA 2R0LH 3ARBA 1JYVA 3RNKB 5JHAA 3HE6A 2XJKA 4PUBL 3VSQA 4S1RL 1ACCA 2J7LA 1VZHA 1YN7A 2CAKA 2JJUA 3TA3B 4BSVA 3KVQA 7TAAA 4GXUM 4WTZA 3SGKA 4ODBD 2ZXGA 2WLYA 4F9LA 2G5BA 1JAEA 2AVFA 2OM5A 1M6OB 2JKSA 3MRHB 4DGIH 4H25B 5C07D 5HYIA 3TH3T 1UA6L 2X1QA 1NAKL 3B8YA 4GSQA 5IB2B 5FUZH 4GAGL 1ID5I 4GBXA 4NKMB 2I26N 1DO6A 2BO0A 2B5IB 1XCTA 1QTPA 4AJYV 4KROD 4PI2A 3EFFB 4Z23A 4V2BA 4XP9H 1NBYA 2I60L 3VXRA 4XNQB 1HCFX 1KEMH 2YFNA 2OKMA 5ESAB 3C6LA 1G84A 3E7JA 3IAPA 2DTML 2IDSA 3DURA 4XR8C 2UV3A 4LSUH 1OQXA 1V10A 1C5BL 2EXWD 2VN6A 5DUJA 1FH5L 4KXBA 3WJLA 2LU3A 5FUCE 3TWYA 2WBXA 4CMMA 2YS4A 2YWYA 2ARJB 3B7UX 2GJJA 1S9XB 1K2DB 1E9QA 1NANH 3QO0B 3UJJH 1JGVH 1PX3A 4XBEL 5TF1L 3KAAA 3EXLA 1OGTA 2QTEA 1VCAA 1XWVA 3KS0J 2FRGP 5I1AB 3L7FB 3RVVD 2YD1A 4X5RA 4X7SL 4X9FA 3C08H 2E7BA 3IKCB 4IYKA 4NLHA 5ESQB 1SXAA 4DHLA 1TQSA 2EC9T 3U9WA 4Q9RH 3QNZA 2FJFB 3DHUA 2R4RL 1NDGB 1UM4H 2YPLE 3NZUA 2FGWL 4IRJC 4K0OA 2QBWA 3MRJA 2PP8A 2IPKA 5L88L 2OYPA 3QDHA 3WU1A 2HRPH 5AW0B 2N1KA 3MA7B 4RRPA 3ABZA 4XO8A 3MV9B 2GK2A 4AMWA 4WWKB 1OALA 3L3HB 4NYLA 2O6DA 2ICEC 2ESVB 3FB8A 5BV7B 5KZCD 3LRGA 5FYLE 1R5WA 4FGMA 4GQ9H 3V0EA 3TBCA 1JFQH 2BNRD 1GYCA 3ISRA 2NX5A 1AXSA 3JV6B 3QUMB 1JHTB 5C09D 1J1OL 2ADJB 1PX4A 4FG2A 3B4NA 3SDCD 3WLWC 1QZNA 4Y9EA 5ICUA 2HT2D 3PDGA 4U1JA 3MV8E 4DOHE 1TO5A 5TD4A 2EKSB 2CKNA 5ICXA 2D7OA 2X4RA 2XBDA 3FQ4A 3EH3B 5F7HA 3FT3B 5LBGA 3MRNA 3P0YH 1X9UA 4KJPC 2DI8A 4U1KA 2DM3A 2OP4H 2JKIS 2Y72A 1UACL 2D31A 5DC9B 5FO7B 4AIZA 5I75B 3R19A 2JIXA 2CIIB 1JZ3A 1MELA 4LHUD 3P9WB 5DVPA 5HHXH 1C1EH 2X4OB 4OZGE 1FN4A 2UXFA 5KJRL 2W0KA 3ORJA 4AGNA 1VJSA 3U0PA 4H8HA 5AVXB 5GRUL 3MNZA 5J3HD 3HHSB 1L3NA 4WNQA 4FG6D 1F6AA 4G7VH 2Z4QB 4UU9A 1MCJA 2IALA 1GY1A 2EVFA 1FCGA 3M7FB 3P3SA 1AZBA 4NUJB 5JDSA 1ULVA 4XVTL 3FB5A 4TOYH 1JVOA 1TMCB 3EYVB 4BRJA 3V4PH 4GOSA 2K45A 1QABA 2XG4B 1BV8A 1P2CB 3QJQB 5K5YA 3J8F7 4UTBA 1FFOA 4AQEB 2AANA 2FUTA 3DBSA 5FW8A 3MFFB 1L7TH 1RJLB 2CO2A 8FABA 5IROD 1ZTXL 5JIPA 1R0AL 4AIOA 5ECGA 2K3HA 3OV6A 3W9DB 3VFUA 3O6LH 4PJHE 2EDBA 4FFYH 5IKCB 1OIOA 5FGBC 4LFHG 1UZ8A 1NFDE 1XF2B 4P46B 2H1PL 5E1HB 4GO9A 5F96H 4NO0B 3QC5X 3O2DA 2LR4A 4OJYA 5HPMA 2VW7A 1OANA 2EYTB 3MLUH 4H44C 4NRYA 3Q2WA 2FR4A 4TVPH 2BLFA 5KYUB 4N26A 2ZCLL 3QHFL 4IKNA 1BVNT 5E2UH 3BCDA 4KO5A 3QA3A 1LVEA 2H7WA 3GSVB 3ZK0A 4F8OA 2I07B 5C0JB 4Q2ZB 5E2VL 4PJBE 1FWXA 4EI0A 3SBPA 3IFLL 3QDGE 4JVUA 3VI3F 2OJZL 4ZUVA 4KDTA 4LOUD 3IB4A 1NIFA 3QZBA 4FFWC 5H2BB 5DQJB 2Y3NA 4OLEA 3L6FB 3UMTA 5A2BA 1KZYA 4GI8A 3REWA 3CFTA 2ENSA 1TETH 3KPSB 1YAZA 1BPLB 1CFQA 3HE7A 3GT6A 3QXDA 4N2DA 4OCWL 1SJHB 3Q01A 1RIUL 1S9WB 3AREA 3AXLB 1IC4L 2WXLA 3HIZA 2ADFH 3EYOA 2IDFA 5DJ0B 5KWYC 1QHPA 5DHYB 4MA1B 4PJ8B 4H2AA 3VM7A 1YNKH 2PWGA 2LU5A 1IZJA 1S9YA 1E6JH 1DQVA 3C2AL 2YSSB 4NKQB 4PJHF 2E46A 1CGSL 1W8EA 4A2LA 5IEHA 1E43A 1NFDF 1OGPA 3DMMA 4NQEE 1OM3L 5KN5A 1T1YB 3EYUL 3I3DA 3QPXL 1XGRB 4ZDHB 3NJNA 2VLRB 4QXUH 4X6BA 4YGVA 3DI3B 1KCSL 1MVYA 3WFZA 1E4WH 3FUMA 1MG3C 3VSVA 1E4HA 2VDLL 1NEZB 1TTCA 4PJBF 2H8PB 4MNGA 4URKA 3RVTC 3NJVA 4PJXB 1GGTA 5DR5H 3SO3B 2GTZB 3OC8A 3JV0A 1E8ZA 3TPKA 4ZFOB 2NLJA 1K6QH 1GA2A 2Y1VA 2C7FA 4NQUA 1OLLA 1WIUA 1UD3A 1FORL 1B3IA 1BLNB 2ENJA 3IXTA 4XO3A 1UWFA 3U9UA 5L7XL 3VB9A 1RZ8A 3CC5A 3RNQA 2AF2A 2DQDL 1JPTH 2HP4A 5JW3L 4OGAD 4YSQA 1AO7B 5D2LA 1R3KA 4Z78B 4PW4A 5MERA 4RCAA 1E3ZA 3HG1B 4NRZB 4NZRL 5EHFA 3AQZA 3A5VA 5C08D 4E0RB 4J28A 4G8EB 4Z77B 4M7LH 2ARWA 2Z31A 3DOSB 4M48L 4XBMA 1MOEA 5FYJE 3FK3A 1IX2A 2IPUK 1FIGH 4MD5A 3OZ9L 4GSXA 2GUOB 1GGCH 1M7IB 3T3PE 3PS6A 3TVMA 3U4KA 1ZT1A 5FO2A 3M1OA 1CLOL 4N0FA 3GDBA 3CN1A 4UTBL 3ZTNH 4D9QD 2X3BA 3H6JA 3KH3A 2C9XA 4K2UL 1QUNA 3EO0A 4RGNC 5DT1H 2YAOA 3WNJA 2H45A 3NCYP 1CGXA 1YEDB 2BERA 3W1ZA 1D5IH 1NJ9B 1W16A 1S46A 3KE0A 1R19A 1FSKB 5EA0L 1BWWA 1AHMA 3OZKA 1VADA 3ABGA 2R56H 4EMZA 3FTUA 5A1AA 3FSWA 3QCTL 2X4TB 3KWWB 1IBZA 3V6OA 1DZBA 3O2DL 5HGBB 4XNZB 4XNYL 4V1DA 4WV1B 4GRLC 2JKTM 1FYTE 3LEXB 2VDNB 2X89A 1AIFA 1UXSB 2Y5TB 3BGMA 3NIDF 4GMSL 4LSRL 5C0CD 1CDBA 4JAMA 2QKIC 2J4WH 4AQAB 5C8JA 2VOTA 2VUYA 3CIQA 5DSCB 1A4CA 4A67A 1DVQA 2ID5A 1T7VA 2HZHA 2Y2YA 2XWBB 3HKZA 4GUPB 4LCCC 3OAWA 4IIQC 2DTSA 1OAQH 4ELKB 2GSMB 3VFVA 3ZE2E 2K9FB 4LOEA 4M5ZL 5D7HA 5AQ0A 3PUUA 4FN0A 3BP7A 5DUMH 4EOWH 3WL9B 3T3PF 1FZJA 3GJFH 4ETQA 1RJCA 1FC1A 4LCWA 1OAZL 1BVKB 1AGEB 5CR8A 4QTIH 4B9GA 3CDGB 2GFBB 2GSIA 3OPZL 2NYYC 4X98A 4GJTB 2JCCA 3BUYB 1LLAA 1YUHB 4K3DH 4M6AA 4GP8B 2O4EA 3D4ZA 3DUSB 3OX8A 5EN2A 3P4OB 3WS3A 2EH8L 3WD5H 2WZPA 3S8GB 3CE1A 5I1EH 1PZ3A 3UJIH 5IBTL 2DDQH 3KL3A 3TO2B 2YAMA 2FD6H 1QI5A 3FF8A 4GG8A 4U33A 3ARFB 3MCG1 1IGYA 1QA9B 1SHMA 3GD1C 4HBCL 4W9FC 1XGTA 1AACA 3L1EA 5GGUA 3OGOE 4OZHE 1HL5A 2VO5A 1ZLWK 3BN3B 1F4WL 3QI9A 3BKML 4LLMA 2AQRA 3OAZH 1F1DA 4JDTL 3QPKA 3MRMB 2XFXA 4Y5XA 3QR1A 4FNRA 5IJKC 4L3CB 3QEHB 2IFFH 3FUEA 3QAZC 2B1OA 3HS9A 3UYPA 4XCYB 4HIHB 1FG2B 2F5BL 3L9BA 5JHLH 35C8H 4XX5A 2NUTA 3QORA 5HDQL 4X7FC 3ZU8A 4JJ5B 2VDML 3ZE2F 3VH8B 1OTTC 3VYNA 3A6CH 4LVOC 4BRVA 1ZIBA 3QSKB 4TUUA 4CU6A 2MCPH 1W6WA 1KTLB 5A2KH 3GMNA 1G7JA 4M1GL 1JI2A 2P7TA 5D2NC 2LU4A 3CDCA 3IDNB 1J48A 4J3OG 5D7JB 3WDHA 5FYJU 5E2JA 4UT6H 2J25A 5F1NA 4LDEB 2VE6B 3ZE1E 3MR9A 1RK0B 1BJ8A 4YSDA 4YHOH 4NJ9L 3U9PH 1MI5B 2PCXA 5E51A 4YSOA 1PCSA 4X7TB 5AALA 4GKZB 4JY4A 3F05A 4ZMAT 5LXGL 4N2KA 1T66D 1NL0H 3BZ4A 3FUFA 3FTGA 4FP8L 2OTWB 3PGDA 4OZHF 5GIRA 3ZMNA 4F2ME 2PCFA 2BIPA 4U1HB 2ZAHA 3Q6GH 1MVUB 3BVXA 5FF6B 4XN4A 3CVHH 4L29B 4N1CA 1TVHA 1XGUA 4M4PA 4XPTL 3VXMD 2KH2B 4EDWH 5LNDA 5KS9F 1F4XL 4UAOC 1EGJA 3ECVA 3FFCB 3D48R 1RIHH 1A7QL 3CDYA 4GUCA 3EHBC 1XAUA 1ADWA 4XAKD 4P2OA 5DD3H 5JHDA 1NC2D 3SE3A 3C6EA 5KANG 4ZTOL 3G5VA 3LNFA 4F57H 4AGLA 1W91A 4GG6B 1E67A 4L4VA 3VXUD 4LSPH 1X5YA 3GPSA 4EI5C 1TITA 4QKTA 4Y16A 5AOMA 2R1XB 3SE6A 4TSBL 1CFVL 4YXHL 2ESVE 5EBLA 2FX7H 5BRQA 3CLEH 3EOTH 5ADOL 3GI8L 3MRFB 3DWTA 2GIYA 2F53D 2WB7A 4IBZA 4BQBA 1AS7A 5D93C 1QSFD 3RDTA 1F8TL 3HMWH 3IMTA 5L9DH 2VZUA 3EYFA 4QHLB 3VGHA 3T2QA 2BS8A 3ZYOA 5I5RA 3QIBA 2YKLL 3AU1B 5EBGA 1H8OA 3RZCA 2MPAH 3LZPA 4PJIA 2IQAB 5T3XL 2ADIA 3ZR6A 1VEMA 1GC1H 4U6HA 3D0VB 4AXWA 4FL4B 4PJDE 5KSAA 1YA5A 2NXZC 3ULUL 4LRNH 5B1JA 3US0A 2WLZA 4J39A 2XZCL 4PI0A 1OL0A 5IJCC 2FL5B 2GT9A 5LN4A 4O51A 5ITFB 4XNAA 4LKCB 3TT1H 3WEAA 5D7SL 4ERSL 5IOKA 4LHUG 3NDYE 4AH2A 1G7HB 3ARXA 4XCFH 5D7LB 4F15C 2DWYA 2G2RB 3VXOA 1TZIB 1QO3A 5C0DB 2WGXA 3QHZL 3ZQ9A 3KXFB 1BFOB 1ZCRA 4LNRA 2JKXA 1N2RB 3HI6L 4HS3A 5EN3A 4KO7A 1BD2D 3AADB 2W5PA 2F8VA 4LSSH 4NP4H 5BRZE 1VDGA 3OQ3B 1QBBA 2FWUA 4FJZA 1SN0A 1AE6H 3DARA 3CX5K 2VITB 1C8QA 1NWOA 3NEXA 4PGCA 4XMLH 5BCAA 1PMYA 3BPCB 3BKJL 2EDHA 1RURH 2EO9A 2CHXA 4JKLA 4KKAC 4XOAA 3CSYA 4PY8J 3LS5H 4WFHE 2HVKA 3O81A 1JOIA 3QJOA 4LF3B 2WQ8A 4LBEB 4U31A 4WUUE 1VLXA 5I9QB 3ECBB 3HB3B 4A7GA 1ZLDA 4GKSB 5CZVL 1YEEH 2PTVA 3TEYA 1YYLH 3MNVB 4PJDF 1FFTB 4YUEL 1RVFH 3BSHA 4YXLH 1SQ2N 4E9WA 3VRLF 4LB8A 5JW4M 3RY4A 4DVRH 1FO0A 4G8GE 5AL0A 5T1DH 1I8LC 2EIJB 2BVPB 3I84A 1P7BA 4PVNA 5LAXB 3SCMD 2C7UB 2IV9A 3NSYA 3WFDH 1DQIA 1RJYB 1RKRA 4ZSOE 4IU2B 3ASNB 1DFBH 3MJ7B 3FHEA 4GS7B 3L1FA 1QFWL 4QRPB 2JKJA 2YQ2A 1A6WL 2CHNA 4WJG3 5IMKA 1MIEL 3ZT7A 1YZZA 1N6UA 2PXYA 2Z34A 3DRTB 3RWDB 5ITBL 1HIMH 1ASQA 5KYNA 1AXIB 4G3YL 3S6CA 1E28A 4C56B 2DYPB 4K5OA 1IGTA 3KLDA 2F74A 4R7NA 1I7RA 2UX6A 1F86A 2I9LA 3BAEL 3QXVA 1DR9A 1KBWA 3A47A 5JO5A 4NHUB 4LHQB 4JCLA 4K8RL 1MEXL 1HHJB 1BVNP 2VWEC 3O0LA 5DVKA 4K94H 1LO2H 1N59B 1KCRL 2DV6A 4YNYB 3D51A 5I17B 1TQBB 4PGDA 3FCTA 1MREH 4OCXL 4YJZL 3MXVL 2OQJA 5TDPA 2VXUL 2WBWB 5F44A 4PIRF 3GZKA 1M42A 3SKOA 3S0PA 1TVBB 4XP5L 3SPHA 5B39A 3BUDA 4NNPH 3IGKA 2Z92A 3BW9A 3UTTD 1BIHA 2BWQA 2QHRH 3UJTH 4JL1A 4NQSB 5DD1H 4GRWH 4JRLA 3VWJA 4N2EA 3G6DH 4PJCB 5E4AA 3BZFA 3LTVA 1INQA 4FKKA 1JRHL 2XN2A 3OG4B 3A67L 5AD0A 1ZHNB 4UTAH 1U41A 4UDTB 1BBJB 1ZGLA 4BH8B 5CBEB 3CSGA 4LO9A 5TDOB 3FO0L 1NKRA 1MCPL 3T8XA 5IT2H 5LGHL 3HPJA 2B59A 1A1OA 3F12B 4BE6A 2VC2H 5LN8A 1MAMH 3G5YA 3MV8D 4AKOA 2B1AH 4W81A 4QHMA 2N3JA 4L8DA 5DRXB 1WCBB 3VXNA 2YPVA 3BT2L 1JNHB 3R06A 1QWNA 4MLSA 2NZIA 3MRIA 4HCRA 4UB0H 5ALBL 4YSUA 2JK5B 3RWEA 4P9HH 3X11A 4W9LC 1MW1A 3U25A 2XNAB 3NZHL 4XN7A 5BS0A 3NQKA 4ODVL 5IREA 3ZL4H 2VKWA 4WI3A 2IAMD 3UTZB 4QRSB 4NQDE 4Z7OF 3MGTB 3ARGD 4UM9D 3ZUCA 4E9SA 3OHXC 4P23B 1OXYA 2CBPA 1DANT 5J9PA 1IAOA 4MWFB 3N42F 3N9GH 1XGQA 3IJEB 1JRHI 5IVZA 2Q6WB 1N9PA 1MW3A 4MS8D 1GAFH 2X4SA 5DQDL 1QFUH 2EO7A 5E4IA 3UOAB 2DQGH 1QKZH 5IHHA 2ADYA 1S7WB 3EJRA 4WEBH 5GJSH 1H5BC 5I28A 1RD6A 3K72A 4E9XA 4W68A 1XSOA 4MJIB 4OW6A 4YL4A 2P24A 3NH7H 2NXYC 3IE9A 3C5SB 5FCSH 2QR0A 3FPYA 4OU3A 3UC2A 2OR8A 4G6ML 4H0GA 5J56B 3LKPA 4DQOH 3NCWA 4B96A 4LSDA 4WW2F 1UQSA 1W8NA 1FO0L 2EJ1A 4PGZA 5JOFB 1MFEL 2FYYB 5CP7B 5B1KA 4OGYL 4EUPB 4JRYE 2OL3H 4WW2C 2JELL 1Q9WB 3CH1A 3OTTA 4R2GC 2Y6TE 1DVFB 3IGFA 5HGHB 1NGXA 2E3VA 4N3UA 4NBZB 1RU9H 1O7VA 1GJUA 1KB3A 3B3IB 3FOMB 4LK4A 3T2LA 4PB0H 2YHGA 1FZKA 2WLKA 2ZUQB 3ALXA 1OAJA 2CRIA 3FYIB 1ILUA 3NT0A 3P2DA 3RVTD 1JBJA 1IIKA 3TZVB 1K3IA 4P4KB 3V0DA 3DX7B 3SGDI 5D1QC 4RA3A 4F1ZA 4OLYL 1QMUA 4ZFFA 3HNTH 4WI0A 4J6RL 1KYOK 3P4MA 1CLYH 4MNQE 5E24E 5BW7C 2DF3A 2CA3A 2FX9L 2XKNB 5EOCJ 2NY4C 3MLRH 4KVCH 3VM5A 5J4MA 2RCSH 2EYRA 2ARJQ 4ZTEA 1J9RA 5D7IE 2Q8BL 1M05A 5T5FL 3H3KA 3JUYA 3BIKA 5FKAB 1JGEA 4MYPA 5AW5B 5BRPA 5FPIA 3FDWA 3ZT6A 3FN0L 2XWJA 1BECA 2QADC 4KY2A 3SQOL 1OCOB 2A7BA 1DUYB 2IBGA 4A2DA 4GSUA 2X70B 4YDVA 4JY5L 2X1OA 3CLFH 5ID0A 5FYJH 2E74C 4IGBB 1MF2H 1L9PA 2DQFB 3LN9A 1JPSL 2D0FA 4HGMA 1BQRA 5FYKE 2IQ9H 1BQHA 1CD1B 4EDXB 2WJ7A 3MACL 4CBPA 4WY7L 1A4JA 2W07B 3O3DA 1D5ZB 1GS6X 1SDYA 1U58A 2KI6A 3GHEL 5FKPB 3SIKA 3HZ3A 1MLBB 3SDDC 3NJJA 2FDBP 3GMQB 4AYFA 4QF1B 5I8CA 4HCRL 4XCEB 4GRLD 3DK2A 3LMJH 3K0WA 1P4BL 2ZXCA 4AV4A 2VTFA 5D7IF 5B3NA 3Q3GA 3E6HB 4HAGA 4R0LB 4OJFH 3VI4A 4Z5RB 5BJTA 3PWJB 1HHGA 3QIUB 3Q43A 4XVJH 3C8HA 5LCVA 1MI5E 1E90A 3GI9H 4OD3L 3Q5TA 1AGCB 2Y1YA 2ZUWA 4TVUA 2PPDA 3FTSA 5AW1B 5CEZE 1XMEB 3SY6A 3FH7A 3FSZA 2IEPA 3I9IA 2CM5A 1TZOA 2ZP9A 3K6SA 1DUZB 3LQZB 2EACA 5ALCL 5FYJD 3UTSD 3F7RA 3EJUA 1XF3A 5FXCH 2MNUA 1MPAH 4EJ1C 1VZGA 4RMTA 4X0KA 4JO3L 1PNCA 4XPHH 1N6QH 2VUOA 3C75A 4UQ3B 4JFXB 1SXBA 2VLJD 3L1OH 3HLKA 3B2PA 4QEGA 4PHZA 4AT6B 3TBYB 1ZHBB 5ICYA 5EC1A 4BXVA 4U4BA 4HJ1A 1U8QA 4HPOH 2BIOA 5FO8B 1SQMA 3U7WH 5CD3A 5JQIB 2JQAA 5IVXB 1LDPL 2GSGB 2J2ZA 3KCPA 3OJMB 4HDIA 4MDIB 3RFRA 1T20B 4Y2NA 2W91A 1A0QL 1IKNA 2HKHL 1I3UA 1OB1A 3HEIB 4HCGA 2IIJA 4PRHA 4QWWD 5EIVA 3TN0A 4BSJA 4N5ED 1K8DB 1O5PA 2WBJD 3W0WA 5A7BA 4F7EB 1SLXA 2UUDK 4NZJA 5JIMA 4E42B 1I3RA 5E00B 5JXAL 3KYAA 3RX9A 1N3NA 3QG7L 5EU5B 1FYTD 4UZGA 1I8MA 4Y1TA 3SYPA 4JN1H 2IGFL 2CIKA 1NA8A 3RBGA 1WS7A 3B83A 5AWNL 1A1NA 2ZG2A 4KVNH 3JTTA 4KZCA 5KVDL 1KXVA 1HK6A 4CMHC 3WCYA 4GT7A 2Y22A 4ZUTB 4OR1A 3WIFB 5EEXA 3MUHL 5I73C 1WISA 3PXJA 1AOHA 2A1WH 3APNA 5T5NG 1JGDB 1DE4B 1S8DA 2FECI 1RZKH 3G5XA 3QWOB 2BINA 2YN5A 1LP9B 3CMGA 5A40E 3D33A 4JFDB 1ZVHA 3FN3A 4GFTB 3A4AA 3BSGA 4H8UA 3TNMB 4G9FB 2GITA 4ELMA 2WXKA 3QDJE 4D0CB 5FWQA 2Q8AL 1E3FA 4OBSA 4R4NC 3MZTA 2CRMA 4X6DB 4W6WB 5FYKU 4JKKA 3QZWG 4R90H 4WI7A 3W3BA 1I7ZA 2OSXA 1HL8A 4P2QB 5EUKA 4RBPH 2F58L 3NJGA 4P5TB 4HS6A 3GO1H 4QDGA 4K4KA 1GPOL 4L9LA 4MA7L 25C8L 3UIYA 3EHBD 4G1MB 2OMWA 3OKEB 4LU5H 1WWBX 5EZIL 3IFPA 1HEJC 4XB3A 4AMKL 3H42L 4YHZH 4LVNC 5FLUA 5I5MA 3GK8H 1MRFL 3D25A 4J3BA 1QVOA 2DQUL 4EE2A 4HV8A 4TNEA 1KBVA 4ZUSB 1YEWA 5IHUH 1AD9A 4BK5C 1A66A 2EC8A 1IMHC 1K5WA 1GHFL 4E36A 2FVNA 3F8UB 2VISA 1JZ2A 2JTYA 3HRZA 3BZ5A 1NOFA 4NP9A 4KOCA 4EQ2A 4AC2A 1CDJA 4OLWH 2HPTA 2BH0A 3GZQA 5L4FA 1DLHB 2XWTA 4YEFA 1M71A 3TIDA 4KKCD 2CALA 1FNEA 5BV7H 5IUSA 4HKJB 5J7CC 1KTBA 5CEXB 2EO1A 3QJZA 4HVBA 2PN5A 1P7QA 3N1MC 5DD0H 3GSOA 4MAUL 4XMXA 5DZ9A 5HI4C 3CXHK 3L3IB 3WDIA 4Z7NF 5IQ9A 2GW5A 2Y25A 4ZMLA 3QUMH 1OGSA 3REVB 2D7MA 5C0NC 3GSWB 2R0KL 3N44F 2VXTH 5GGRA 2YD8A 1HS6A 5EZJA 5EFIA 5ISZB 1L0XA 2O5YH 4XMVA 2GB2A 4G59C 3NIGE 2XZQH 4JBSA 3LZOA 5DFAA 4HYTB 5E4EC 2ZXEB 5DEFA 5E5UB 1TTBA 4NN7B 1EAQA 2VDRL 3B9EA 5F71A 1HDMA 2K4AA 4PRNA 3UC0H 1LEGA 3ARWA 3DHMA 4RAVA 2Y6SD 1XF1A 1DQQB 3ZO0A 1MSPA 4GMTL 1E4KA 3ARUA 3MV9D 4AM0A 4KVPA 1OV8A 2CDEB 1GR7A 1U8IA 3ARBB 2ZX6A 3HE6B 4OCRL 2ESVD 4KKAD 5D1XA 1N5AA 4NGHL 4Q9BA 1J5IA 2V3DA 4BSVB 9CGTA 4YLQT 2O1AA 2ZKYA 3O11B 2NR6A 4YLBA 1A6UL 2OR9H 5GISH 2N01B 5BOZG 3B1TA 2C9QA 2CUAA 3IMBA 4NQTA 4XH2B 2PYEE 4G6JH 4Y4HC 1BVLA 1O6SA 4JL2A 1CD9B 4WHTB 2AK4B 1OZTG 1PLCA 1IGFH 3ROLB 2KPWA 4Z7VA 1XCTB 1AQKL 4TSAL 5IFJA 2HWZL 2PCPA 3DHPA 4KO6A 1CD0A 1TMQA 3K5SA 4FNLL 4ANKA 3T6ZA 1AR1B 4NZDA 4JN2A 4FZEL 3P73A 1J8HE 3EO1A 2A74C 3RLSA 3RIAF 4WI2A 2NY6C 1MFAH 2BRRH 4I18C 4IBQA 4K7FA 4X5PA 3O8XD 2VAAA 1HC1A 3ESUF 4BD4A 4OV5A 3O3BA 1JV2A 1UWGH 5IESH 4YE4L 4AVIA 2B8OT 4OCYH 5F6HI 1YAIA 1OGTB 3CZNA 5BRZD 2W1NA 2RACA 1V27A 1DBAH 1FE8L 2IBZY 3L17A 3LZFL 2D3JA 1ZEAH 4M8UA 3HC0A 4ZRGA 3KLHD 1Z1WA 5IG7A 3AUWB 1XF5A 3QNZB 4IMLB 5AW7B 5DWUL 3K46A 4WFHD 3ESOA 1X5GA 1R75A 5CINL 3U6XA 3CVBA 4WUUD 3TEUA 2WXGA 3PJNA 1BHGA 4K07A 3QZNA 5DRNA 4LP8A 3RY5A 4B0MB 3FUNA 4G8GD 4NYLB 2WTPA 4R7LA 1EVTC 1SJVA 3VGEA 1R5WB 1YNLL 3KGUA 4P2RE 4ZOEA 1RH8A 3FBKA 3NRQA 2WANA 1AXSB 2VR4A 1KWGA 4FABH 2WPGA 3QC6X 2VZOA 3NBNA 2GTWA 4I9XA 1E8XA 1YJDH 2H0EA 5CJXC 1KNOA 4YHKL 2I5YL 2V2TA 2QPSA 3SD5A 3BIBX 2AEQL 2DJ4A 1ECZA 2BP0A 2VDLB 4H5SA 4MAYD 2NQ3A 2YEZA 3BWUF 2WOBA 4ISVA 4Y2OA 1I7TA 5ICXB 5E2WH 1XZWA 3MRNB 4LLVA 3GXTA 2BW4A 3BWUC 2FIKA 4FQ2H 4AEHH 4N0UB 1QNZH 5F1IA 5ABAA 3TBWA 2WKGA 3UZQA 4HJSA 4AIZB 3WTWA 2LLNA 2WLIB 3KPSD 1ZLUH 3ULVL 3BP6A 4PG2C 1O9ZA 3B6SA 3TYGH 5DHVA 1ZA6A 1FN4B 5T1KD 4PBVC 2NY7L 5KJ7E 2XBZA 4JFZL 4GAJH 4BFRA 4M4RA 3WEOA 4XRCA 3U0PB 3JWNE 4AG4L 1EJOL 2B16A 4WNQB 1B2YA 4UU9B 2IALB 3QO1A 2VAJA 5B7FA 1CXHA 1MFCL 5HYJB 1UM5L 4QXGL 4W9IC 4Y5YC 3FB5B 3ECWA 5L4JA 3QFJE 4FLRA 4O58L 1E27A 4P05A 2Q0ZX 3IYLW 2YD9A 2IGLA 2FYVA 4ZFGH 1D9KA 1FFOB 1JD9A 3CPLB 5BMFH 3ZGHA 1CFBA 3SB3A 2CPUA 4A04A 2EIBA 3W2DH 5E6IB 5EZOL 5F3HB 5JQ6L 3GMLA 1Y1DA 4DP1X 3KL0A 4RETB 4Z0BL 3CXDH 1KGJA 3ARDB 3OLIA 4PJFE 4DZBB 2Q76A 1R3IH 3O3AA 2Y1AA 2HJLA 4R5VA 1JHLH 4WU7A 4B50A 2APFA 1UZ8B 3TBSA 1J8RA 3ZTJH 3WS6C 2YRZA 1CFNA 5E03A 4HEPG 5FUOL 4ADIA 5HPMB 3OKYA 4NRYB 2CRYA 5AOJA 1Y18A 4QUOA 3KDMA 3PP3K 2DBLL 2YC1A 4HWUA 5C07A 1MH5A 4NQDD 1QI4A 2R1WA 4P06A 2XXCB 1BIIA 3U2SA 1YC7A 2IPTH 1IAMA 2YD7A 4AGPA 4LAQL 4ZUVB 3JWNC 2NY1C 4XPFH 4B3VA 4MXVE 2BVQA 4Z7UE 1YPZE 3LKNB 2EEBA 2YMXH 4NWTL 3BIAX 3QXDB 1CFQB 3OAUH 4YSSA 2PETA 4PJ6A 2DM2A 2ALAA 2KLSA 1DCLA 3BFWA 3AREB 1OPGH 3SJVB 5EF1A 4RIRA 4ENEC 2QADD 4PHXA 3F6LA 2CMRL 3H7BA 5FK9A 4BFIA 15C8L 3BPLB 4P4RB 2Y2WA 1S9YB 3U7AA 2OSWA 3ZPDA 2NZ1A 3OKLA 5IEHB 2P45B 1EHAA 4TNVF 5I8KL 3TM6A 3DMMB 5H4YA 4RMUA 2BHFA 2C3HA 5KN5B 5C7XL 4XGZA 4UQ2A 4DGYH 2XLLA 1SDAB 1HXMA 1ZLEA 1MWOA 4K3GA 1E4JA 4JQXA 2C3GA 1UM6H 4KQ0A 1G9NC 5D9SB 1N7MH 4YGVB 2IDCA 2XZAH 4G1EA 3MRCB 3GMPA 4JG9A 1HHIA 2IOMA 4JQIH 5FYKH 3RIKA 4QYOA 3AITA 4MNGB 5DMYA 1MWAL 3HZMA 3ZDXB 2N7SA 2ZXQA 1OP5H 4MXVF 4Z7UF 4M6OL 1YPZF 4MNQD 2G3MA 2HUEA 2PPFA 4W4OA 2BNRA 7CGTA 3DJTA 5EUOB 3U9UB 3MV7E 1YYML 4NI6A 1L4IA 3TEWA 1TJIL 3CC5B 5C3LD 3KR3L 5J12C 4IBUA 3BDYH 5D2LB 2J72A 3FU9A 3SDCA 1P6FA 1R3KB 3S5ZA 1XGZA 2DLGA 1BJ1H 5MERB 4FRWA 5ID1A 2L0DA 4FFZL 3S34H 1ZT7A 1JVLA 1E5UI 3P30H 1D7CA 2Z31B 1I1YB 3WNIA 2JB6A 4WWPA 5JW4R 3ARFD 4JVPA 3U6RA 1J7VR 1P4LA 3L3KA 1HH9A 4NENB 2H6PA 32C2A 2D4DA 2HT4D 4HHWA 4G7YL 1GGUA 5EBWA 2HFGL 1RHHA 5I16A 4QXTB 4UQEA 4LHUA 1OHQA 2GI7A 3MUJA 5FYKD 4D9LH 1QUNB 3EO0B 3IGUA 5HY9B 1GS8A 2X3CA 2XV3A 2ZONA 5GPRA 5DJDB 4BBWA 3US1A 3D3VB 5DS8A 5H35B 5LQBH 1BZ9A 5E99H 4ATTA 4FXTA 1Y1UA 4QHKI 3VFGL 3FCUB 5E5LA 2YK1L 2QT6A 2VDPL 1OSZA 3KL5A 3I9AA 4TS6A 4XCNA 3CN3A 2ZAGA 4W9JC 1TKWA 5J06A 5F88B 4V1DB 5JOPE 3MOAH 2J5WA 1KN2H 1OTSD 4P9MH 5F7EL 1AIFB 3ZZQA 1RY7B 2EDFA 3ZTDC 1MI5D 4JAMB 1B6DA 1XSKA 3IJ9A 1NSNH 1MCRA 3ZLQC 2X2UA 4P5KA 3WHE0 4F7PB 5B7MA 3JZYA 5IROA 5I8OH 1MFDL 3UAJC 3UBFA 1BM7A 5CEZD 3NN8B 3VFVB 3P0VH 4YSTA 4HU2A 1HHHA 5G2NA 3BP7B 3AS0A 2CO4A 4NFDA 4E2OA 1FZJB 1FL3A 5DU7A 2OI9C 3TO4D 3WKML 4LCWB 2RQEA 3S35H 4ABWA 3E9TA 3BPNC 1BAFH 1FNSH 3HNSH 4M1CC 4DGWC 2L7UA 2ZX5A 2BP8A 3BSZH 2Z3FA 4ZX3A 2Y5EA 1HINL 1I9EA 1SDDA 1JMZA 1M56B 3PY9A 5EN2B 3WS3B 1UKSA 4JCMA 3VRIA 2OV0A 4N2MA 5F6IC 1PJ9A 1F97A 1YN6A 3SSGA 2ZYHA 3TEXA 1DJHA 2FSEA 1CDHA 2FNBA 1I9RL 3V4PA 2WQSA 4A2EA 2BIIA 1XGTB 2DQIH 3CNKA 4OQTL 1A2YB 5FOJA 5ANHA 1I9JL 4MJHA 4JKPH 2B3RA 4DGIL 3TH4T 4Y5XB 5E56A 4WSJA 5DD5H 3K2UH 4FNUA 2VM3A 5FUZL 4OF7A 3Q05A 1KJVA 1U33A 3MRLA 3TEZA 3UYPB 3ESMA 3VDCA 1U3NA 4OFDA 1SY6L 3LPFA 4Z7WB 4FFYA 2NY0C 1BM3H 5KUMA 1B4JH 3FPXA 2H41A 1KEML 1A5FL 3ABMB 3LOWA 1T04A 4NRXA 3KWTA 1K9TA 4KXAA 4MFHA 1HI6A 2OCFD 4MMXC 1U8PA 2VM4A 1G7JB 3GMNB 1J1PL 1I4FA 3PPEA 4BGDA 3MGOA 4YDIH 4U3HA 1ET5A 5F1NB 3TNNA 4HP5A 4BINA 3VQ1C 2KBGA 3MR9B 1IFRA 2DQEL 1NMCC 3RTQC 3UJJL 4L2YA 5F70A 4CC1A 2YAFA 2G2PA 3QDJD 3QJHA 2VSMB 4JO8A 5B3JE 2HTKD 1EMTH 1Q1JH 2B4CH 2HTLD 1CLZH 3BZ4B 2D73A 3FTGB 5GIRB 3PGDB 1PKQB 4YSAA 2PCFB 2ICWJ 1SLWA 4LCYB 4A39A 3KJ4C 1BYOA 2UWEF 2COQA 1UT1A 1TVHB 1XGUB 2MHAB 2PTTA 3H56A 1LQBC 3HC4H 5B1CA 1FL6B 2JQMA 2HRPL 3EOYG 3L3DB 5KANI 1GRWA 4Y4KB 5C0FB 2XX1A 4LLUA 4HD5A 5HTSA 4P2OB 5C08A 1E9OB 3CXFA 3DVIA 5I6XC 3BRGC 3UADA 4ZX4A 1UH4A 1OGAB 4BM7A 2H3XC 3QRFM 1JGIA 3CWGA 5KYWA 4HQQH 4UWQB 4L4VB 2ZYRA 1I31A 5MEQA 1IVTA 3OD3A 4Y16B 2FE0A 1MCQA 1FVEA 3LIZH 4QHPA 1F56A 2IBZX 5EBLB 5EDXA 3OQRA 3G6JA 4I4WB 4P49A 1NANI 2F5AL 3IDXH 4EIGB 1GZHA 2PMZA 2QPEB 1WCQA 1UD8A 3RDTB 1S78D 5CIPA 5A3IC 4GSDH 3EYFB 2AQNA 3P0YL 1CIDA 1NGWB 3SDXA 3QIBB 1SOQA 1Q1PA 2OP4L 3DSNA 3RZCB 4PJIB 3U30B 1MW2A 2ADIB 1WBXA 4U6HB 1PU0A 4IHBA 4PJAA 5FHBH 5KSAB 1QATA 1MW0A 5LVEA 1C1EL 4XPGH 4FQXB 1OZUA 4RMWA 2VDQL 1QRKA 1NFIA 4CSZA 2GT9B 2X1XR 3QPQD 4KI1A 3WIIH 4O51B 1JUFA 3OG6B 4FMKA 4ZAKC 3QXUA 4L4TE 1ZHLA 1IM3D 4CU7A 1H19A 3UZVB 2GJ6E 1KELH 4AH2B 4C4KT 3PFQA 1T2QH 4WWNA 3VXOB 2EEDA 4H20H 1QO3B 1VGEH 4TOYL 4LNRB 2HLEB 3DECA 3V4PL 1ODAA 2SEBB 4HS3B 3NUKA 4WCYH 1JTPA 1RUAL 1HNGA 3IPFA 1JI1A 1XR9B 3S37X 5TH2B 3C87A 4PLKD 2DEXX 1L7TL 1T0NA 2D03H 1W9XA 1LWHA 4ODHH 2IH1A 5AW6B 1CDYA 1M1XA 1A14H 1MHHA 5FDWA 4KJQC 2AAAA 4HIPA 2HVKB 1MKFA 4FFYL 5H94B 1LO3L 1MZZA 4TUOA 2PYED 1HU8A 4F2FA 5F96L 1NEZG 2WXQA 3KS0H 2X4UB 3WTVA 1NDMA 2KHAA 3MLUL 3R8QA 4RISH 1X5XA 3A23A 1FO0B 1NKGA 1DBKH 4ZW5A 4S2SA 3SYCA 1UB5A 4G43A 4LGSB 4Q97A 2CWRA 1JDCA 1J8HD 2APXA 1F4YH 5DVLA 5C71A 3ZRSA 3SYAA 2PXYB 2YSTA 1PTZA 4TQPA 1L0PA 1XXDC 3GJFA 4AL8H 1ML0A 1E28B 1DP0A 1WJ3A 1PD6A 1TETL 1IGTB 2EXTA 3GTTA 2F74B 3QHTC 4R7NB 1I7RB 1SM3H 1IGCH 2I9LB 1H6TA 4PV9B 2UYLA 2HJFB 1TQWA 2ZQKA 1H9VA 3ALPA 5AOIA 5JPMA 1AGBA 5E1GA 4W1TA 1YNKL 3L3GA 4KKNA 2DWEA 2VQ1A 4J2QA 4TQ8A 4XMPH 3DHJA 5FDYA 3Q7JA 4PGDB 5JIIA 1E6JL 1KG0B 1FG9C 1FAIL 3LRMA 3QBTB 1KGWA 2DLHA 4MJID 5TDPB 3SJVE 5BZWA 3GXDA 3L9RB 3EIFA 2GBVA 3SKOB 4PRDA 3GMOB 3VFNA 5E1AB 3C6SA 3BW9B 5AB0A 3WKPA 4HJ0D 3AG2B 4K3JH 2P3YA 2ZKXA 3K2MC 4O4YH 2EDEA 3UABA 4B9CA 1RMFH 2ZUSA 3NEOA 4QXUL 3VWJB 2OSYA 1V05A 3VACA 3X12A 3O6FB 2Y1ZA 3BZFB 1YNTA 2A9CA 3HZYB 1XIWC 4JFYA 4WTWA 5D5MA 5DJAA 2ZPKH 2D7QA 4P2RD 3LN5B 1N12A 2E27L 5JHLA 4OIIL 4ETYA 1ZGLB 4WEMB 4AQ8C 5DR5L 4E68A 2F08A 3T8XB 3SDAB 4U3SA 3HPJB 2B59B 5C3TA 1NC2A 1A1OB 3PHSA 4Y4FC 3LVTA 4RFOL 1NPUA 1PVHA 3VFRA 2VLKB 3KBFA 4ZTPH 5KVFH 3VXUA 1CI3M 4I0PD 4XXWC 1F3JA 4QHMB 4L8DB 3RFZA 3EJQA 3VXNB 3OJVC 1KXQA 4UT6A 1JPTL 3R06B 4Z18A 3MRIB 3VRJA 4JHAH 3JZ7A 1JNLH 3QQ9C 3QRLA 3RWEB 5TGBA 2F53A 5GXBB 4HZLA 1KJ3H 3BO8A 1W0YT 3FQTA 4E5XG 4WSKA 4N6QA 4IMKC 2J3SA 5EU6B 4MA3A 4U1LA 1NH6A 3DK0A 4MCNA 3CVHA 5J9PB 2JV6A 3ET9F 1IAOB 3ZTNL 3TA3C 3JXAA 3MCLL 2A77H 2YEQA 5KYYA 1KMGA 1L6ZA 1FV1A 5ANMA 5IVZB 3RPIA 5IF0B 1D5IL 3QFJD 2OW7A 4IGBD 5CLYA 3L3OA 1IQWL 4R96A 4Y1AE 2R56L 4KK5C 3DO4A 5I1DA 5JXED 2D2CC 1S7XA 3QUXB 3IDIA 3HBGA 1BF2A 1OM9A 3LKPB 1AQHA 1BD2A 1HOEA 4LKXB 5IBLC 4JEGB 1UQSB 3VH8G 4LOVA 2FSDA 1CYGA 1I3GL 1IAIH 3PV6A 3VJ6A 2HT3D 1EEZA 5I66A 3B2VL 3GS7A 3CH1B 5FHAL 5GRVL 1G1CA 1V7MH 4WI6A 4ENZA 4CSTA 1NGXB 1OAQL 5I1LA 4JO1L 5EBMA 1I8UA 2X0VA 4EOWL 2V3FA 1FZKB 3GLDA 2Y2TA 4PUBH 4YC2C 1XGPA 3SO5A 2NY2B 2DEYX 4S1RH 2QVTA 3PGFL 4S1DC 3PDOA 4A7VA 5DGQA 1CGTA 4M6MH 3ISYA 1OT4A 5T3XE 5AAMA 5FM4A 1JERA 3P4MB 4K3DL 4I2XE 3SCMA 4JFHE 2XTJB 1NAKH 2NY5C 1KBKA 5B8CA 4NCDA 1DJIA 4X80L 4GAGH 4OAWB 1KUMA 3FFOA 4XXCC 5AW2B 3VGGA 5I1EL 1WK0A 3UJIL 2EYRB 3GHBL 3VCLA 2N7AA 4JFVA 2FD6L 3EBIA 4UOJA 1M05B 3V95A 3BX7C 4U1NA 4E41E 3MJ9L 3KYNB 1YQVL 2EKJA 2I60H 3BIKB 4PYHA 3UAFA 1C16A 2YOCA 4I5BA 4WWKC 4HLZH 1JDAA 2DTMH 4HUKB 1SEQH 5E8NA 2ZUUA 5AVUB 3CZJA 3CX5J 2XWJB 5L2JB 2UXGA 1G87A 4C54A 5I1GL 1G7IA 1CE1H 3EYSL 5IQNA 2A6JA 4K7PL 5CD5C 1DJWA 2WNXA 2CJTA 5TF1H 1ONQA 4RDBA 1BQHB 3CVDA 2GTQA 4G7QB 2BCMA 5I15L 4OJCA 2EDKA 3F58L 4GI9A 5AB2A 5I1JH 1KLFA 3IU3A 1V5JA 3IFOA 1UXMA 3HTLX 3O3DB 3UTTA 5CGTA 1COBA 1A6ZA 1IAIM 1NGQL 4P2YA 4OFIA 4JFSA 2R4RH 1ZOXA 4AYFB 2WJ5A 4HIEB 5I8CB 2P80D 3MLSL 3WHXB 3A6BL 3LEYL 4BFBD 1EWHA 4FLHA 3EJZC 1J0IA 2LE9A 2AJ3A 3I6LD 3MV7D 5GRXG 5HYEA 3Q3GB 4EZLA 3VI4B 2IAAC 3KGSA 5BJTB 3UAJD 1CLCA 1FJ1B 1HHGB 1NL0L 4G9FD 5SWSE 2A6KB 4L4JA 3LZQA 4P59H 2KZBA 4U1GC 3MV8A 1PL3A 2A9MH 2VT0A 3CVHL 5HHMB 4AUJA 3K6SB 3TV8A 1FFQA 2P43B 2IWFA 2Y0SA 4GNKB 2P52A 1XF3B 4APQB 5F7MC 4P2QD 4X0KB 5IQLA 2R23A 4P5TD 2W9EH 4ZFZA 3X1FA 5ICZA 5DD3L 1KGIA 3L7EA 2AXWA 4HCIA 4Q6IC 2G0LA 2CE6A 3RIAK 4OZGA 1FLRL 2E59A 4AQOA 5ICYB 5EC1B 4N9GA 4WLCA 2IAMA 3G6AA 4UIMA 4RAUA 1YQ2A 3ARGA 4UM9A 3H9SB 3BJLA 2TSBA 2VDRB 2VKXA 5F89A 2ZICA 4U1MB 4IBWA 2JLPA 2NNFA 2J2ZB 3CLEL 3KCPB 3U83A 5KJRH 4HDIB 1E3XA 3FAXA 4UTAA 4KKLD 4TUJB 3E38A 3HS0B 4FA7B 5IK3B 1OP9A 5L9DL 4DEPC 2X2JA 3W0WB 3DPDA 1VZIA 5E1QA 5JOPD 1I3RB 1ETZA 1DSFH 2R1YB 1N3NB 3TFKC 2OYKA 1J0JA 2AXGA 3SHSA 3ZTCC 1GC1L 1X5IA 2B0SL 2CIKB 1OSPL 3UO8B 3IVKA 4ZXBD 1OT1A 3V4UL 4WI5A 1A1NB 3O6ML 2FX8L 3MRKB 1OF0A 2Y7NA 3U79A 3MLPA 1D6EA 3LPOA 3FUKA 4P57B 3GYRA 1JYNA 2ATAA 4PSPA 5K39A 2Y7LA 4MGXA 5D71H 1NFDA 4GIAA 1AZCA 4XPBL 3D69A 1TPXB 2AW2A 3T0XA 3B9DA 4G42B 3V0JA 1C5CL 4HKXA 5SV3A 4PJ8C 3BAYA 1P7HL 3KPQB 5GGSA 1AYRA 2ZXDA 2GITB 3HW7A 4PTUA 4LSSL 3LN4B 4PJ9C 3KPRE 4AJVA 2HMIC 1AE6L 2HN7A 1TEYA 3IXAA 4JLRA 4MBOA 4YXKH 1UCBL 4YSEA 2OMTB 2ZCLH 3QHFH 4BEIA 4NJAH 3K4AA 3RVWC 1PIGA 4MVBD 3M8OL 3JUZA 1U8HB 3QARA 5DLLA 4HS6B 2J1KA 3I02B 1QPXA 5IW6B 3IFLH 4L9LB 4G7RB 1JTTA 2QHLA 3IFPB 2VZ3A 1YEEL 1P5UA 4QMEA 3CX2A 3OC5A 4OCMC 2C5DC 1EX0A 4JFQA 1RVFL 3LSOA 1EZSA 1OHZA 4AENA 3D25B 4DVRL 3P2BA 4JZOA 1RZJC 1NTDA 3O45A 4HV8B 1YEGL 1T83A 4M43L 1SMAA 1RIUH 3WFDL 2OL3A 4I1NB 3K81A 5F3BA 5EG6C 3LKRA 3N43F 2D0GA 2AK4D 3V55A 2MKLC 2YD3A 5FYLL 2F7RA 2Z6FA 2CZNA 2A83B 3TF7C 2C9SA 3HUJA 4G11A 2BSSB 4GLRH 1LMIA 3MCKA 1HIML 5AAWA 1M6UA 2Q7NA 5A3ID 3KLSA 2XWTB 3TIDB 2PNDA 4S0HA 1S9VA 1FNEB 3PWNA 3RX5A 1OM3H 3T6WA 5EIQA 3VGAB 3GSOB 3QPXH 1LD9A 4PU2A 1KYOJ 5IMMA 2LAAA 3N85H 3BT0A 3HI1A 5GGVL 1LO4H 1DBBL 1UT9A 2W9LA 1AZUA 3O41A 5GGRB 5T3ZE 1A3LL 2W60B 1ID2A 2FO4A 2HLFC 2PWEA 3G9VA 3GSUB 1Z5YD 3LXUX 3QFGA 4HEPA 5DHMC 5EFIB 2UX7A 1G1KA 4R6UA 1QW8A 2E76C 2JKWA 5MEPA 4NQVA 12E8L 2VQUA 2YXVA 4L2LA 3KBEA 5CJOH 3QR0A 4NNPL 4IIQA 3O4OB 3OMIB 4L1TA 3U1SL 1HL9A 3W5MA 3UJTL 4X5XA 5AKTA 5EIIA 8CGTA 5DD1L 1LE9A 1FORH 1HDMB 3G6DL 4PRNB 1BFSA 4AKPA 2Q1EA 1HNYA 4HJIA 4M8RA 3SKMB 4GINA 1TTRA 4YSCA 3UTSA 3E1F1 4UTAL 1FGNH 4NXSA 1NCUA 2FZ3A 2RAMA 4AM0B 3CIAA 5EWIH 4HHGA 4NZRH 1X7SA 1IC5H 5EOQH 4HJGB 1U8IB 2LABA 3T2PA 5IT2L 2VLJA 4EUPG 4M48H 1N5AB 3ZDZB 4KJQD 3WFEH 4XPAH 3WIHH 3QAQA 4HK3J 3NQIA 1PY9A 4IHOA 4WK2B 4Z7QE 3VXTB 1E2ZA 3GZOA 1CLOH 3UGUA 1CG9A 4BSWA 4XNXL 4I1PA 4UB0L 5INCA 1BVLB 1SFDA 2VLKE 1PEWA 3P4NA 1RSYA 1S4IA 4L1HA 1J18A 1AQMA 5IFJB 3JYBA 5IJKA 4IS6A 5HDLA 4PLNC 4JDEB 2WBJA 5E8EA 5ILTH 4L1LA 3II3A 3PRZA 1X7QA 5DQ9A 3V8CA 2UZYB 4QOKE 1FYTA 3KW7A 3QCTH 4JN2B 3HOGA 3KG5A 4JMXA 3EO1B 3GXFA 3QQ3A 5K9OA 2GJ6D 3FO9A 4JUSA 1PPIA 3S2CA 3AS2A 4QRRB 4XNYH 4K7FB 1H6UA 4U0QB 2VAAB 4UTCA 4XZ4A 4JO4L 2D3LA 2LGNA 1IBBA 1QFUL 3LH8A 4GMSH 5CWSA 1JV2B 5DZOA 3OB0H 1QKZL 3ZO9A 5T1JA 3MV11 5HYJD 5LGJA 3EDJA 1Q9OA 2OMNA 1HYRC 5E08L 2C9VA 1KCBA 3NH7L 3CZFA 3RGVD 4RGOH 3ES6A 1WHPA 4ZZFA 5SWQB 1PZ2A 3HC0B 1JVKA 1B0RA 1RZGB 4H88H 2YQGA 1XF5B 1OAZH 1Q9LA 3T3MB 3OPZH 1AANA 2Z4TA 2DJMA 2OL3L 3H9ZA 4HUWB 3WGVB 3AMKA 3BEVA 2YQBA 2CGRH 4UOZA 1J5OL 1JF1A 2BDNL 2X7LA 4P07A 1MRDH 2UZPA 3ARDD 4JZNA 4DUVA 1RU9L 3VE0A 3LS4H 2Y23A 4X83A 5L2KE 5GHWL 4ONOA 5IBTH 1ZGLP 4BKSC 1YEKL 1EHLL 2GHZA 5DJZA 1O7SA 2AJUL 4GXUN 1T1WA 2O72A 4HBCH 4WHDA 2Q20A 2YRBA 3WFBL 4FNQA 1F4WH 4JREC 3BKMH 3FO2B 3HNTL 1KNOB 4JDTH 1YMME 2V2TB 1M6OA 3NJMA 3U4BL 1KXHA 2B9AA 5J5EA 4H5SB 5IB2A 1MWAB 3MLRL 2NT0A 3FB6A 4Y2OB 1ERNA 1I7TB 1M9WA 4W9CC 3JTBA 3QJFB 4ZBJA 2BNQE 3EFFA 3OF6A 4W4NA 3S4SG 3W5NA 4TYUA 3H53A 4XNQA 2FIKB 5ESAA 5F1IB 1B6UA 3UZQB 4UILH 2A4CA 4IOIB 1F58L 2CBOA 3RUGB 1QRNE 2VM9A 3BP6B 4P5MB 1MCOH 4Y0GA 3B6SB 2RBLA 2O30A 3H9YA 5DHVB 1YCSA 4M1GH 4WWOA 1MFNA 1DHKA 1OKEA 2DQTL 2VN7A 3O4LB 3PHAA 4N0YH 3RWHA 3SJVD 1N8ZA 1MQKL 2DQCL 2ARJA 5FYJL 1JNJA 5FGSA 3QDME 5CN3A 1S9XA 3QO0A 1BF8A 4F2MA 4NJ9H 4UIKL 5B22A 2R9HD 5BO0D 2WYTA 2IQ9L 4N4YB 1MRCH 4N87A 3KJ6H 4PJ5E 3L7FA 5EU3A 4B5EA 2AGJH 2APVA 3WMSA 1NCNA 2A9DA 2ADGB 2J8UB 2X4QA 2P44B 2P4AB 2P5EE 3IKCA 1E27B 5F7DA 4CC4C 4TL5A 5LXGH 3EZJB 2HFFA 5C0AE 1EJ6A 2XZZA 4POZD 1WITA 4Q56A 3NAAH 4XX1G 1BMZA 1CDCA 4EVNA 5GS0H 2RB8A 2YWZA 1NDGA 4XPTH 4A38A 3TCLB 4A7QA 3GMLB 2ZJSH 3LMJL 3MA7A 2V6HA 1ORSB 1DO5A 3MV9A 1KEGL 3QB7C 2Q76B 3O3AB 3AAZA 4OM1L 4ZFQA 1U3JA 1SMOA 3NCYS 4RMBA 4UQDA 4WU7B 2AJSH 4XVJL 3TBSB 1R6VA 2ESVA 2VDPB 4DJMA 2ZWZA 4ZTOH 1ZE3C 5GZOD 4K3EH 4IU3B 3WXWL 4U6TA 5CJBA 3CXHJ 3QUMA 1MCCA 4DEWA 2ORBL 4N86A 1CFVH 3S97C 2FIRT 2YC1B 1CR9L 5C07B 3WNLA 5IY5B 2R1WB 5ADOH 1N6QL 4XE0A 4XP6H 2WM0A 3U2SB 1I8LA 1WBYA 3FMGH 2QKSA 1P7KB 4Z3GA 4PJDA 2QELA 4KNTA 4KROB 5GS3A 3HFMH 3OKDA 2BVQB 4FQCH 1SJEA 5E9DE 4H8QA 4HW6A 5T3XH 3O2VL 5GS0D 4CVZA 4Y1SA 4Y9BA 1K4DA 2QSTA 5I9QC 2HJKB 3HB3C 5FV1L 1A3QA 4Y1AD 5LKNA 2PWHA 3V0HA 2XZCH 4XAWL 3OMAB 4X6CB 1UA3A 1QWUA 2DIBA 3O8XA 3FU3A 3H9SE 4FMVA 3HHSA 5HHOE 4WGVB 4DK3A 1UWYA 3FULA 6CGTA 2VMDA 4ERSH 2CDGB 3D3VD 1M7XA 1SJMA 3NCJL 4FQHB 4U49A 5D7SH 2ZUTA 2Z4QA 1EPFA 4BFIB 4BWTA 3DO7B 3FO1A 5EOCH 5BRZA 2IO5A 2ZAIA 3EZ8A 2XVLA 1P1ZB 3B34A 3OKLB 4GS7C 1N5YL 4KUCF 2A38A 2BSRB 2EIEA 1SHSA 3L1GA 4JN1L 2WCGA 5CF3A 3R18A 4PJGB 1QHQA 2XG4A 3HI6H 1WFTA 4BCZA 5JA8B 4KVNL 1HXMB 4FQ1H 3LPWA 5EORL 2AZAA 1UJ3A 1J8SA 4DN3L 3Q6FA 2CO6B 5A7EA 4OZIE 1F6FB 2IV8A 4ZUWA 5K59E 1RJLA 1S5HA 4G1EB 3GMPB 4WUUA 1HHIB 1IC7L 2WQWA 5BZDA 3FSAA 2X5PA 3HZMB 4R97B 3SBWC 1CB4A 2AXFA 2CH8A 3CMOL 3W9DA 4AEFA 4G8GA 4BUGA 5T3XD 3U46A 1TQBC 3PHOA 5KZCB 4P46A 3LVEA 1JPFB 3CSTA 4OUUA 1EJFA 2BNRB 4BA0A 4WO0A 2R7EA 1QX1A 4YUEH 4DO6A 3B2UC 3BAKA 4KPHH 4Y2DB 3AW5A 5C09B 4E41D 4R90L 4C57C 4NKDB 2KT6A 1MY5A 4B3EA 3SDCB 4NN6C 4KTGA 3GSVA 3C5ZC 5GS1C 2QSVA 2I07A 4MAYA 4Q2ZA 3QS3A 5C0JA 5IHWA 1ZT7B 3GO1L 3U0WH 3MLZL 1QFWH 3QIWB 1IC1A 3PQYE 1NOAA 2JB6B 5FGCB 3WLBA 1ESOA 3U6RB 1MCIA 4BXSV 1IU1A 5H2BA 2EDDA 4YEEA 3WY1A 5ITBH 5E6SB 5AVTB 3L6FA 3B43A 2H6PB 32C2B 3GK8L 2WMPA 5C0BE 4N2NA 4G3YH 1RHHB 3KPSA 3E8UH 3LKQA 4IJ3B 3X1GA 2YLHA 1BPVA 2E7CA 2A73A 2A9NH 5EO0B 4ANUA 3PL6C 5IHUL 5KVEL 1S9WA 5T1KA 5LWYL 1X4ZA 4OZIF 5K59F 1VERA 4C8XA 1MEXH 3APCA 3M1CA 5DJ0A 5DHYA 2QMJA 2J43A 5DS8B 2QGEA 1LEKA 1BZ9B 1KCRH 1A9VA 1AMYA 3UPRA 2YSSA 3SE4C 5LNGA 1ET8A 3WEBA 3BAIA 4TV3A 4XCNB 1OSZB 4ONGH 2OBGA 1MCDA 3TFKD 4XP5H 1OPOA 3BKYH 1TKWB 5DD0L 2PPCA 1XGRA 3GJEA 4ZDHA 2NDGA 2XACC 4MZRA 1NCGA 3B7TA 5HDWA 1SHWA 3BMVA 5BO1L 1NEZA 4P5KB 3QUZC 2DL2A 1IBGH 3D0LA 4NPJA 3HC3H 4O9HH 3FO0H 4GQZA 4FYSA 1V55B 1HHHB 4L3EE 2XZQL 2YRLA 5LGHH 5BVPL 2XRAL 3QEQE 1FL3B 4D8PA 2D8KA 3LB6C 1J5CA 1I8KB 2WYZA 2YGVA 3ZL2A 2VDQB 3FRPB 4OFYD 3UC0L 1DVSA 2EP6A 4PRPE 4PJ9D 1CFTA 2BP8B 1RL1A 2HMID 2M2DA 3BVVA 1SDDB 4N2LA 3DVFA 2F6AA 3I75A 2WYHA 4NQDA 4MHHG 4Y4KD 4BFFA 3VRIB 4Z78A 3NIFB 1N0XH 4JJOA 2ED8A 1NAMB 3LYRA 4PLJD 1YN6B 2WO3B 4G8EA 4Z77A 5C0IA 3AM8C 2FSEB 1J0KA 3NZHH 3V4PB 3B9AA 3WUWB 2XCMC 1CBJA 1I75A 1EHKB 4RRPG 1M7IA 2G5RA 3EH2A 1J0HA 5GISL 3T6VA 1VACA 1WG3A 5EZLB 3B9KC 4G6JL 3TZVC 5CUSH 4AYGA 3HVNA 3MRLB 1YEDA 1MXDA 3VFOB 1WIOA 1NJ9A 3OXRA 1WBZA 5DQDH 3UDWA 2EIDA 2P8PB 5CHNA 3VYPA 2JFCA 2H6UA 3GDCA 3QUYC 4BZYA 5EEVA 1T04B 4JFFE 3HG0A 4YK4B 4GSRA 4NRXB 5I18H 3EH4B 3EKCA 4N0CC 3SPCA 4E9VA 3RWFB 1RAMA 5HVFB 1U8PB 4G6MH 1FPTH 1DBMH 1LILA 4FQXD 3GNML 3MGOB 4R7VA 1JK8A 1U42A 1MFAL 4X0NA 2BRRL 4ZD3L 3T08A 4AC4A 4KTDH 1AHWA 4UOQA 2R69L 3GMMA 3OAYK 3TNNB 4KMLB 3LEXA 1TQTA 1KPUA 4HUCA 1MFEH 1UXSA 1JNNH 2Y5TA 1EO8L 1UWGL 4N6RA 4OGYH 3D4YA 4X5WB 5IESL 2XXMB 4AQAA 1M1SA 5DSCA 1K4CA 2ZE0A 3KPRD 3ZYIA 4BFEA 1NFAA 1DBAL 2HX7A 4GUPA 2WN3A 2HLFD 3Q13A 1ZEAL 4Z76B 1WZLA 5SX5K 4HIXL 5F7LB 4G8FA 4MNQA 3H2WA 1IKOP 3CHSA 3GEFA 2DIAA 1YEFH 5D6CB 2BSTB 4PJEE 2PTTB 1AQDA 5D7IA 2GK0B 1NPJA 2CHDA 4X9IA 4YBLC 4E5XA 2F68X 1AGFB 1NIDA 1PNDA 1B0GA 3BUYA 3EGSB 3STZB 2AC0A 2ROXA 2WVUA 4J6RH 3FBQA 1A6AA 2E56A 3IJYA 5CBAA 5HD8C 3CK0H 3ETTA 4U05A 1JZJA 1PBYA 1NFKA 5T5FH 3ARFA 3D9AL 4MXWL 3WNPA 1QTSA 2NT1A 5KBDA 3BVUA 3IE4A 4KRPC 1Q94B 1QA9A 4BZ2A 1XO8A 4R0LC 4FYRA 1HKLL 5MEQB 1YJDL 2XYBA 5FIEA 3QIUC 2P5WE 3L95A 4XC1H 3MRMA 3BWAB 2BIHA 5E95B 3TBBA 4JQIA 3G6JB 3SQOH 4F7MA 3RE0A 3BLBA 1JDDA 4XCYA 1PLAA 5CIPB 1FG2A 2Z7ZA 1KCUH 4AK1A 3L4VA 1JPSH 3SDXB 4I13B 4PCTA 3DSNB 1QNZL 2K7QA 1WBXB 3LRKA 1KTLA 4PJAB 4UMSA 1JYXA 4XOEA 4WY7H 3HMXL 1T89C 1ADQL 4UV4L 1HOCA 1SEBB 3TYGL 5K1NA 4P3CH 2GBUA 4PJEF 5IQOA 1EO5A 3ESPA 1NFIB 5D7JA 4JDVA 3M45A 2I69A 4Z7AA 3RUGE 5C0CB 4HCRH 4HS8H 1QBML 1MI5A 2QVFB 4BH7B 5JHBA 4QRBA 2MSPA 3B7YA 3JV4A 2MQ3A 2XV0A 2OTWA 4Y5VC 1DQDL 3TO4A 4OD3H 4ZFGL 1QW9A 2YA0A 4U1HA 4PN6A 4JPIB 5F9OL 3LPGA 5FF6A 3O6FD 5DO8A 1FAKT 1T0NB 4WRLA 3TONA 2CJ3A 5ALCH 1ZT4A 4Q4EA 1YY9D 3NEEA 1Z3GL 2P8LB 3BGAA 2K8MA 1M1XB 1MHHB 2EYSB 4JO3H 3CXDL 4HJEA 5CO1A 2XKSA 4EAEA 1SFHA 1CDGA 2HKFH 3U7YH 3SDAD 1CWVA 4OLZH 2WUBL 1JHLL 4BQ9A 5F9JB 2OMBA 1Y0LA 3RVUC 2VLKD 2YRPA 3G5WA 1KJ2H 5DGRA 4GG6A 3ZKND 4HGWB 4QY8A 1F1GA 2F54E 1KPVB 4I3RL 1OD9A 3GSXB 4S2SB 1WTLA 3EW3B 1UB5B 2JMRA 1LDPH 4UV7L 2WSDA 5IFAH 4QOKD 3MRFA 2E9WA 2DI7A 2PWFA 5HYQA 3VXPB 3GMRA 5JOEA 4KNUA 2KDYA 1ZHKB 3KPPB 4U1SB 3UXFA 5D1ZB 4XPFL 1U3HD 1NC4B 4ZODA 3RWGB 5K33A 3DO7A 3AU1A 4KV5E 4Y19E 5JXAH 3AC0A 5EU6D 2O5XH 3HAEH 2IQAA 2YMXL 2NZ9C 4HK3N 5JORA 2IGFH 2WWKO 1NCHA 1OCWH 3PDDA 5IM7A 3A6OA 5AWNH 2QSQA 4ODXA 3BSZA 2VIRA 3D06A 4AK2A 1UD5A 1MHPH 2UYLB 5ESVA 2FL5A 2FAUA 3JWOC 1AGBB 3ENEA 4U3XA 3L3GB 2FEDD 2DWEB 1DTUA 2VQ1B 3N3EA 4HWEL 3Q2LA 3QDJA 4TTDD 3RWIA 3F83A 5I74B 5C6WH 1PKOA 5C0DA 3T2NH 4AQ1B 4X6CE 5BZWB 1BFOA 3AY4C 3ZSTA 4BZ2L 4DGYL 2F8OA 3VFNB 3C6SB 4Z3JA 1UM6L 1GKOA 2FJGA 5I6KA 1UWXH 1TJHL 4U4IA 1BX2A 3RDJA 1YRKA 5L2KD 5D5MB 3VXMB 4FG0A 2FWSA 4MD0B 5DJAB 5FYKL 4PTTA 4V11A 4M62H 3WN5A 4GEJA 2AEOA 2F58H 2FT8A 4XNUH 4OT1L 1I9IH 4HAKA 1YMMD 2GY7B 4MRCA 4UT7H 1NC2B 3RB5A 4JRWA 3D08A 2O5NA 5EZIH 1DYZA 1A7NH 4AMKH 3UGXA 3H42H 3VXUB 3MNVA 1U95A 3MV01 3RFZB 3BPOC 1F0LA 4JANB 2BIMA 5KTEL 1MRFH 2DJUA 3V8OA 2WP3O 4HF5L 2BNQD 5LAXA 2BVPA 1A6TA 3VRJB 4PR5A 5HI5C 4NN7C 2WSKA 1RJYA 5LAPA 2F53B 1OK0A 3HPLB 4NNYA 4XNBA 3P30L 1GHFH 1QRND 3FN9A 1QSFB 4HZLB 1M7UA 1R47A 2V8MA 2V4LA 2OYLA 4RSYA 5SV4A 3LNGA 4F7KA 4EZJA 3ELQA 5CEZL 1CICC 3FCBA 3W11C 4X8JA 4MA3B 4U1LB 5IB4A 3ARBC 4LRIC 1OY3B 3HE6C 2ZZUT 3CVHB 3BVWA 3HNVL 3S8FB 4N85A 4NB7A 2E9JA 2VR7A 5KYYB 3STLA 1U8CA 4MAUH 4PJ5D 4R26H 3RPIB 4F9LC 1KULA 3NESA 3ZY7A