4ZMVA

Crystal structure of human p-cadherin (ss-x-dimer pocket i)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
214
Chain Sequence
MDWVIPPISVPENGKGPFPQRLVQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin-3
publication title Adhesive Dimerization of Human P-Cadherin Catalyzed by a Chaperone-like Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 214
sequence length 214
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zmvA01
4AQ8C 3LNIA 3UBGA 2WHVA 3QRBA 3PPEA 3Q2LA 4AQEA 4AXWB 1FF5A 3LNDA 1OP4A 4ZT1A 1L3WA 2X2UA 4ZMXA 2OMVB 4ZI8A 4ZMQA 4QD2E 4ZMWA 5JYLA 4NUMA 4NUPA 5DZVA 2A4EA 3LNEA 4ZMTA 2QVFB 1NCIA 5KJ4A 3UBHA 4AQAB 5CO1A 5JYMA 4ZMPA 4ZMNA 1O6SB 4AXWA 5CZRA 2OMZB 4ZTEA 2V37A 2WD0A 2EE0A 2WBXA 3LNGA 1WUZA 3K6DA 4ZMLA 4AQ8A 4APXA 2OMTB 3FF7A 4NQQA 2QVIA 1ZXKA 2WCPA 2OMWB 3FF8A 4AK1A 4AQEB 2YQGA 4ZMYA 3K5SA 3K6FA 1ZVNA 4AQAA 3MVSA 4OY9A 1NCHA 3LNFA 3UBFA 4ZMVA 2OMXB 1SUHA 4ZMZA 3Q2VA 1Q1PA 4NUQA 2O72A 1EDHA 3K5RA 1NCGA 2OMUB 4APXB 4XXWA 4XXWC 3Q2WA 4ZMOA 2OMYB 3LNHA 3K6IA 1WYJA 1NCJA 3Q2NA 2A4CA 2YSTA
chains in the Genus database with same CATH superfamily
5IM7A 2DBJA 5EWIH 1SY6H 4PRDB 4KFZC 5HJ3B 3MRLB 4L8SB 1T2JA 3NJNA 4LCYA 2P3YA 1TQWA 4JDZA 4OZ4B 4G8GE 1XGPA 2NSMA 4TMPA 1USQA 2ISDA 3S34L 3K1DA 3HI5H 3CG8A 4O2FB 4ZO7A 1L9MA 4XCFL 3SCMD 4BUGA 1PGRB 1BQRA 3TH4T 4D8PA 3LN4B 3VX0A 1P4UA 5H4YA 1NC4B 3JWDH 4YS4A 5T1KD 5MEOB 2R2EA 1EVUA 5CCJA 4PJ8A 5C07E 4I4WA 3OLIA 1KN2H 2Q6WA 4QMEA 1DVZA 5DC4B 3WMSA 4UIKL 4DPCX 3TFKC 3HRZA 3ZYOA 3VDBA 4Y5YA 5DHYA 1TZIA 4I9WE 5CCKH 3SDCB 1W9XA 4PS7A 2V7NB 1U93A 4CC0A 1H6FA 4N20A 3IDGB 1H9DA 1MIEL 3BKJL 3RU8H 1CTOA 4MNHB 2ICES 3L5XL 2BIHA 4KJYA 5H2BB 4AT6B 1XR9B 2H3KA 4DERA 3VG0H 3HC0A 2FT8A 1QKZH 4TNEA 1HSAB 2Z0UA 3FQUB 2BP0A 5B38G 3SCMC 3O0RH 3VSTA 2WQXA 3VGAC 1XGTA 5LGKA 1TCRA 3QQ4B 4HS6A 4JG1H 2YA1A 1FHNA 2FX7L 4WHYG 4H0GA 1OGAA 4QRQB 3CSBA 4G9DA 5E94B 2F53E 4OT1H 4JM2F 1UD2A 4M6AA 2F8XC 1MI5B 4E42B 4IM8A 3IGAA 4ORGB 3TJPA 3U48A 2E7LA 1UM4H 4OJYA 4HV8A 4NHUB 3CZEA 3MVSA 2Y3AA 4MAUL 4I8DA 4ANXA 5CZVH 3KPSD 4N9OB 3L81A 2OV0A 4UQIM 4Q9QL 4JK0D 3KEDA 1YN7A 3U6RB 4CMMA 2R8SH 1SOXA 1R5VA 3AWGA 1LO0L 1TR7A 2CLZB 2G0KA 2P5ED 4R7XA 4XT1C 1LE9B 4HIHB 5ESAB 5AOZA 4OV5B 1BM7A 3RIAF 5K9KB 4AJYV 5EU4A 3RDJA 2EYSA 2RJMA 3CBRA 2FNBA 4LEEA 3WUZA 3NCWA 2EE3A 2DWSA 4ZJ9A 3TBTB 1CGUA 2JKRM 2OL3B 2IF7A 3AS1A 3G6JB 1DDTA 2R7EB 3DIFB 2CLRB 4FQLH 4MCMA 1R3IH 3D69B 3KR3H 4G6JH 2DW5A 5EBLA 2IBZX 2A1WH 2JI3A 4NP4H 3WHXB 3BWAB 3DI2B 3B9KB 2PKDA 5D70H 2RTTA 3VI3F 1KGYE 3SPCA 1BFOA 1BM3L 3BUQA 5I6XC 2WP3O 3CD4A 4MMXC 1KEGL 2VLJB 4D94A 1AQDB 4HJTA 1ZK9A 4MA8H 3TGXA 3VB9A 2V7HB 3ISYA 1SBSL 5H94A 1JV5B 4I77L 2ZXAA 3A22A 1FQ9C 2CXKA 3TIDB 5EA0H 3GDCA 1DE4B 5IQMA 1C1EH 3WNIA 4OD1H 1X44A 3KJ6H 3RA7H 1IE4A 3KYMB 1KY7A 5T8IA 1XGRA 4IIQC 1PYWA 3M6DA 5J12B 4UYPA 4KGJA 5DA0B 1D9KB 3N1QC 1K9TA 5H35B 1YUHB 5ANMA 3SKOA 1ZLWK 4CW1B 5I1AA 4HALA 4Z7AA 4XMPL 3ARFA 3S4SG 4A66A 5D1ZB 5F7FA 3B2DC 3ZDXE 1J5CA 4F7TB 3T8VA 2GUOB 2P9RA 3RY4A 1VIWA 5DR5L 4L8BB 4Z7UA 1KXQA 1UJ3B 2OMYA 4ONGH 4XMVA 3OHMB 3TEXA 1EAQA 3DTUB 4FNRA 4HH8A 4WFGD 5I1CL 5BUAA 2RFXA 4S1QL 1FNGA 1CL7I 1DYZA 3K4ZA 1JHKH 5CO1A 4D9LH 4E41E 3OM3B 3L54A 4PWGA 2EE6A 3IMUA 5MP6H 5DUPH 3WY2A 3N2JA 4MCZB 1MFNA 1T7YA 2EDQA 2BVOB 2I85A 5L88H 1PVHA 3MV7E 5F44A 2YBRB 1VFMA 5FLUA 1KPVB 3NJLA 4PJFE 4YSAA 5ALCL 4AQ1A 4DN4H 5CSBA 3MRMA 3W2DH 2C9SA 4L1LA 5GPRA 4FEIA 3VFNA 3JWOC 4GG6B 1E42A 1EUUA 1I7RA 1XIWB 3VXME 3Q05A 2D9QB 2IWGA 5HYQB 1Q9WB 2COQA 3FU7A 5CM1A 1WC7A 1JZ7A 2QZ5A 1HNFA 2AQNA 2J25A 2ZPKL 4L9LB 4PWHA 4ZOAA 1X7QA 1C5CH 3ILQD 1EZVY 3RDTA 2VN6A 3BP6A 2W9DL 1KJ3L 3CPLB 3L3KB 1NOAA 4HJGB 5LGYA 2R69L 1RVFH 4KDTA 3ZOAA 1F90H 4Q6YA 3STLA 1LMIA 1V3LA 3NRFA 5IGXH 2Z91A 1GCYA 2EXWD 5D2LB 5D8JL 3L5WB 2AK4D 3SDYL 1C5BL 1A6ZA 5KOMC 5CU5A 4HS3A 3FCBA 1ZLWH 1GKOA 4LHQB 4MQ7B 1HH6B 4JY5H 4RFNB 5F7WC 2APFA 3P4LA 5C7ZA 2HX8A 3GMPB 2D03L 2YSTA 4QAWA 4IKLA 4MNGA 2CUAA 2EEAA 2NTFB 2Z35B 4FXLA 4NQDE 4UT7H 3IE4A 5T1MA 1OALA 4HPOH 4OR1A 2OK0L 3SE4C 4QRUA 4HUCA 15C8H 3ILQC 5KSUA 3MRJB 2EDRA 2GT9A 4CVXA 4EIUA 2A6IB 5CLTA 2VR7A 4KAQH 1RZKC 5HHOB 3CZJA 3OR7A 2JWYA 3PIQA 3QC5X 4JFUA 5F88A 1HWHB 5E1QA 4P59H 5FM4A 3OV6A 4CU8A 4MRCA 2PTVA 4PJGE 4MB1A 2FBJL 2DQTH 5DS8B 5T33L 2OP4H 4MAYB 4NZTL 3NBNA 4GAYA 2NY1B 1X5XA 2EXWC 2B14A 4WSKA 4B60A 2BZ7A 1DJGA 1R3LB 3T77A 3VFMB 1VCBC 5KVGL 2F9BT 3L95A 2WCSA 3TEWA 1UXMA 2R2HB 2W0FA 5F7KC 4U31A 1UCTA 2GKIA 1SHXA 1KLFA 3KPOB 3FQ4A 3ABKB 1ZV5A 3WYRA 5HI4D 3HZVA 4GO9A 1ECYA 4PREB 5KVGE 4MJID 1EEQA 3FU3A 4G8GB 3N43F 2N7SA 4XTRD 1I7ZA 4LSVL 3CFDA 1ZT1A 1XBDA 1RJZA 2FO8A 3U6XS 4DK3A 2APBA 4HCGA 5LDUA 2NYYD 1A9BA 4E9VA 5KVEL 4YX2H 3BKMH 1MXDA 4M7LH 5C07B 4NQXB 4PHXA 3QRGL 4FNPA 4HKXA 4LVEA 3RILA 2PO6B 3QXDA 1V27A 4A2GA 2IGFH 4B9YA 2RCSL 1JWMA 3FO0L 3KAAA 4I3RH 5A43C 5I0ZA 2Y07H 1AZCA 2IAMB 3F6IA 1OK0A 1FAKT 5F1NB 3DO7B 3MUZ1 3SSGA 3CHXA 2M8XA 4B9KC 3QXWA 1EJFA 1ZGLA 2BFVH 3KXFE 5J4MA 3H55A 3B5GA 5D7IF 3OAYK 3EG9A 1DSFL 4KKPA 5HI4C 4G8FB 1DBAH 1KT2B 2JKLA 1SUHA 1G6RH 4XTRC 1G43A 2YLKA 1NEUA 3NUKA 4YSPA 2VJXA 2ZUTA 2CH8A 3W81A 4G7VH 2NXZB 2RMNA 2YOAA 4IMLA 1QSFD 3HPJB 2PCFA 2BVEA 3FUDA 3VWKB 5AW5B 3TO4C 5F8RC 5JTWA 1UURA 2OMUB 3EYUL 2NYYC 2XC8A 3WLBB 3FOMB 5HHNA 1EEYB 1H5BC 1QO3B 4P4RA 2F53B 1QFHA 2O6DA 4NNYA 4BWWA 1XF2B 1V55B 1YCSA 3MCYA 4J3WA 4OUOA 1HI6B 2CSPA 1IM3B 3BEWA 1A7QL 5DU7A 3ZPDA 5DK0A 4AGNA 5I15L 3QQ3B 1F5WA 4A55A 3OLGA 3FKUS 4PRNB 3WDJA 4JFTA 2PYEA 3OKLA 1KTCA 3QS3A 4LSTH 3GKZA 4KDVA 5SWZD 4CADB 3ABGA 1ZS8B 3PHQA 5AVZB 2HLAB 3I9IA 5IB3B 2JJSC 3HUJE 1Q72H 4ZW3A 3D9AH 2VMFA 2Y6SD 4N1HB 1H15B 5M7QA 4AQOA 4PEEA 4K2UL 3VXSB 4EJ1C 4GIAA 2ITCA 4N2IA 2ETWA 3K71A 1VEMA 3ULUF 4UMGA 4XO9A 1WFOA 2CDGA 5T1DH 1DFBL 2HRPH 4ECNA 3CWGA 4P2RD 4ZUUB 3DV6A 1QRND 1SXCA 1WT5C 3GMLA 3T0XA 1OGSA 3UABA 1G9NC 3OVUB 3NZHH 2L3BA 4U1SA 4DKAA 4ZXBA 4KDWA 3OAYH 2TAAA 4HBCL 1HAWA 3GC3A 4KFMA 5LCVL 4N2DA 3H0TA 1IBYA 4M29A 1S9KC 1QLRB 2HLFD 4S1RH 4LSPH 3WG7B 4XGZB 4Y9FA 3EJYD 1UKSA 2X9XA 1XF1A 5GXBB 5IMLB 2X4QB 1BQSA 4AH2A 3DTXA 3ZDXB 3NCEB 3FTUA 5KVDH 3JTTA 2E9IA 1QYGL 5JMRA 3IM1A 2Y6SC 4P49A 3RZCA 2FR4A 4XMKH 5TE4L 2W9EL 2CO6B 4WCYH 3UH8A 1X7TA 4DP4X 2VLRE 2AFNA 3QEHA 4K94L 2UX6A 4M8QA 3TBWB 4Z7VA 1G7JB 4F7KA 3QQ9D 4MJ2A 5GJSH 4E41B 5JIDA 5FOJA 3U0TB 1ZDQA 3REVB 3STZB 5FLVA 1U8OA 3UTSE 4HUVB 2WSKA 4DP1X 3MA9H 4G1MB 3MV7B 4QO1B 4AL8H 1QI5A 5BVJB 3WUWB 4PJFB 3KCWA 7FABL 2X2HA 3KZ8A 1S9WB 1T0MA 4H8PA 4P2QA 2AI0L 3MRCB 3BVNA 1II4E 3BX7C 1U91B 1NGYB 1NAMH 4AKOA 2BY3A 1T4KA 2XWZA 2HLFC 3SPHA 1HE7A 5I74C 1P7QA 1FO0A 4MB3A 4TNVF 3VXMB 4ODTH 3WN5C 3EJYC 1ZVSB 4WENB 3JWNH 3O6ML 1P5UB 2WLJA 3MV01 2RBLA 1EJ6A 2BNQE 4JVUA 1T89C 3GD1C 4KY1H 5I0VA 1KEML 2XVBA 2NT1A 3D12B 1YUKB 4LCCC 3CFJB 4F7MB 1BFVH 4QRTB 5G4NA 4UQBA 4UNIA 3TYGH 4FLOA 1BVNT 3FJTA 5HHVL 5D1XA 4HXAH 4OD3L 2VSDA 2O5XL 1UGKA 3WKML 4Y2DD 2XICA 3PJLA 2GSGB 3QQ9C 3NEXA 2DQGL 2LAAA 4BH7B 3LRSB 3LHPL 4ZMXA 5LNDA 3WFZA 3CMOL 3ECQA 3TVMC 1WWWX 4LVHB 5DURD 1QI3A 5GGRA 4PHZA 3ECBA 3D7PA 4KTEH 5L9DL 1CLYL 1MJ8L 1A7NL 3FT0A 4PP2A 1XBRA 2UXTA 3FH7A 3GBDA 3FUKA 5D6CB 1ET5A 3BPNC 4TNVK 3TN0B 3ULUH 5CJXA 5FFGA 4TKWA 4GXVL 2DBLL 4M6MH 2JJUA 4YDNA 1U6AH 3GTNA 2GUYA 2UV3A 1B4LA 2DIBA 3AUVA 1KBKA 3QJSB 5B3JF 2D4DA 2H26B 3AU0A 5F0JB 4NQDB 3SE8H 4P9ML 1JL8A 3UAJA 1KGWA 3HZMB 4YZWA 2BERA 5ABAA 2PETA 2CIKA 2A6KA 5FKPA 2QVMA 4MDRA 5DJCB 4ZZKA 2XXGA 2XZAL 4PG2A 5TDPA 5KZCD 3CVHH 2G5UA 4GFXA 1JN6A 4JAMB 4Y2DC 5DO8A 1JYVA 4E36A 4UQAA 2DKUA 4MGXA 4PJGB 4ZW7A 3IFOB 4AY0A 1DQQB 5A16B 2WQVA 3FRUA 2VISA 4OBSA 3ME0B 2OSXA 5DJAB 5EIVA 4AJWA 2LE9A 4QHNA 1BIIB 1PLGH 5HJDA 5I9QB 3WS3B 4XMZA 1NUGA 4P5TB 4IJ3C 7CGTA 4FI7A 5C0IB 3MLYL 1J48A 3QNYA 4D9RD 5B3NA 4MYWB 1KXVA 5KSAD 2YQ3A 2WCPA 2Z64C 3N40P 4FXKA 4JPKH 5E2WL 5SV3A 4AI7A 5HYEA 4YN3A 4OU3A 5IV2A 5CFAA 3P0YH 3PRZA 1RL1A 4QRSA 2IEPA 4RDBA 4LDCA 4P2AA 5LG1A 4Y5VC 3W39B 2HUHA 4X6FA 2IALB 4R2GD 5KAQG 4ABWA 1OSZB 2MQ3A 4DVRL 4ETQA 1C12B 1Q9OA 2G9KA 3MJ9A 5FYKH 4JN1H 1QFUL 3ZKQD 1MHCA 3WNKA 3CFEB 1MHEB 3VCLA 4JZJC 4ZO9A 1PIFA 2VLMD 4JRXD 2J8UF 2X5PA 3N44F 5TH2A 4BFEA 5JIQA 4MJ6B 2C1OB 4PQXA 2AJUL 2GC4C 4R9HA 3MC0A 4RH4A 2AABH 4EZMA 1N12A 1A0QH 1KELH 4JR9H 4LKXB 4MXWL 3FUMA 4GRWE 4B0MB 2R0WL 3NOIA 1UOWA 3HZYB 3T2NH 1DN0B 5A2FA 4PVNA 1ZK5A 1ZT4A 2XTJD 4XB7A 4CC1A 1P4IH 1LP9F 1GC1H 3K1KC 1DVYA 1UXLA 1WA1X 3KXFB 2O6PA 3PU7A 4JDVB 1G7MA 4GYBA 4ZX3A 5ISZE 4U6HB 2VN5A 4PGBA 2AC0A 4ANUA 2CKNA 1XO8A 4YXKL 3SQBA 4U3SB 2KPNA 1PDKB 5I26A 3F6LA 4BQ9A 1O6VA 5AG8A 2VDOL 5ILTL 5F1OB 4K7PH 2Y22A 2ED6A 3HAEH 3CLFH 1A4AA 2Z65C 3VFSB 4YHML 5EN2B 4KK5D 4KRPD 1R6VA 4NN7B 4NJ9L 2QSCL 3BSZH 4N90E 5BRZE 4OSUH 3I2CH 1S9XA 1SRDA 3ARRA 4Y5XB 2FX9H 4XP5L 1MCRA 4X6DE 3RE0A 5LAXB 5TDNB 3CFIC 1F4YH 1XR8A 2ARJA 4G80B 5AZEL 5EIIA 5C09A 4U6YB 1OARH 2W95A 1CLOL 1JRHI 1KYOJ 1ZDSA 3HUJB 3RJDA 5IBTL 1KGCD 4AYBA 5KOVC 1E9QB 3QDME 3OTTA 5I1EH 2Q8BH 2MIZA 3QUYC 3F04A 4J8RB 2XPGA 5F6HI 3ILPA 1IKNA 4HISA 1IC4L 2IVFC 5I5RA 3PNWB 3PUCA 1K5NA 3MZTA 5DFVD 2HUEA 4XX1G 1GZHA 2D31B 2VXUH 4N8UA 5KS9A 2CWRA 2MCPL 4PJBF 4KK5C 5H8DA 3UTTA 4KRPC 1NBZB 3VD0A 4LLDA 1A9EB 3NSJA 1UATA 1I4FA 2VO5A 2AXGB 5D96B 4U1KA 3RX7A 3S4SB 4H25A 2E74C 4OM1H 1NCBL 4AYFA 3BVUA 2W5PA 1MFDL 1FJ1A 3MUJA 3AW5A 4X4XA 3GSQB 5HHPA 5E5MA 3LB6D 3SIKA 1MVFA 2KMWA 2Z4QB 5DJ0A 5I73C 5C92A 1F45A 4AKQA 1EDHA 2XBZA 5IMKA 3TZVB 3IMSA 3QI9C 4HIEB 3WIAA 5F1KC 3HI6H 2SEBB 5SWQA 1UB6A 2YBGA 3DHMA 1CR9H 1WF5A 1KPRB 4HWUA 2Y5EA 3D18A 4NNXA 1V7MH 2VLRB 2XG5B 4XCEA 4ZTPL 5K9JH 4Z7OF 1HN1A 3WEAA 1JVKA 2EDHA 2X2IA 1OT4A 4YZFE 1MAMH 4F9LA 3UTSB 3C6LA 4P3CL 1M1XB 5HDOA 5IBUG 4XZUB 5DF0A 1GW0A 4JPVH 5TGBA 1HQ4A 2GC7C 1HZLA 4Q2ZA 5D4IA 1JE6A 1RIUL 3DJTA 5ERWB 1ID2A 3M7FB 1S7RB 3FT3B 3ESUF 3D39D 4JG9A 2EP6A 5DD6A 2DDQL 4ES8A 3BZFA 3FB5A 2BVPB 2R1YB 3RTQB 2XWEA 3QIBB 5CP7A 3S96B 2FWOB 4HKBB 1NGQH 5FPIA 2BNQB 3VUAA 4L3CA 1G5GA 5DZVA 3X3GL 3MLZL 3OHXB 3EGSB 4OLWL 3SBPA 3NGBB 4UM9B 4D3CL 3TEYA 3MN8A 1JIBA 2QQKL 5TF1L 3US1A 1BF8A 2CG9X 4OM0H 2L0DA 5GHWH 2OW7A 2WO4A 1FZMA 4JY6A 4P46B 3UJIL 1NBVL 3SKMA 3FSAA 2NR6A 3QCUH 5BO1L 3LPGA 4HUWB 3MRNA 1XL6A 4IOIA 1HZHL 3DLQR 3OKDA 1IGIL 2FK9A 4XPFL 4L8CB 3DXAA 3D50A 1XF4A 2APXA 4OIFA 1MFAL 5INDA 5TFSL 4AZ8A 4FYSA 3BLPX 3IKCA 4X5LA 3BGFB 1IC7H 1GVIA 2DWYA 2H1LM 4FNSA 4AIEA 1JGIA 5HVWA 5GGSY 4RNRB 2DQEH 1DUYB 1N0LA 1PSKH 1GAFL 5HYSG 3GO1L 5HDQL 3KVQA 5JHDE 3KPMA 1B4JL 1D6EB 4N24A 4OLZH 1SVBA 4PJ7F 4Z3EA 4UDUB 2DQFA 1HFUA 2GTWA 2NNRA 1F86A 2CJ3A 3CVIL 3KW8A 3PAZA 4K9EL 2N56A 2VXSH 3TNNB 3DURB 5T5FL 2AZAA 2DQJL 4I89A 1E4KA 4QRPE 4XPHH 5FIEA 3WGUB 2CQVA 2UVFA 3IPEA 1O5DT 2FATH 3O8XC 5DUML 5ABZA 1NMBL 4H20H 2R2CA 3SHSA 5DMIH 2Q76B 1IFHL 5FA4A 5CINH 5FWRA 3B2VH 4GRMA 3H42L 1UENA 4I0PC 1JRHH 1T80A 2UUDH 3NP3A 5E5LA 2IV8A 3RB5A 4R3SB 1DCEA 2W92A 2ZOOA 4JS7A 4L1TA 5JPNB 1HHJB 1WV7T 1CICD 1KV7A 1J5OH 2HH0H 5IEHB 4EN3B 2DQMA 1T20A 2I7OA 1OL0A 1CFNB 1ES0A 1WD9A 3ZRFC 4K0OA 1M53A 4FNLL 1W72A 4AYSA 4DGWC 1WAAE 1RHHA 2OJZH 3IGKA 3D48R 5ALBL 4DIXA 4M93B 3QEGH 3NEOA 4OGYL 3AM8C 5B1JC 1NGPL 1QLEB 4IEFA 2ZUVA 3DUSB 3SE3C 2WQ8A 1QSED 2UWEA 4JO3H 4PB9L 4R8WL 1FFPA 4CKVX 2GJZB 3L3DB 1BIHA 1W8NA 4YK4B 3BUYA 3C9NB 2G3NA 3LV3A 2YKLH 2NY4B 1LL1A 4JG0H 1UH4A 3V9CA 1T7XA 4IRSB 3PWNA 1A7PL 1X5GA 4GSUA 4WV1B 2VR3A 3MV8A 1ITBB 5MEPA 5DJ6A 1JDAA 4GRWB 2Y5TB 5JOEA 3FN3A 1AACA 3VXOA 4O51A 1CICC 2X89A 3TCXA 5E8PB 1KJ2H 3LDBB 1ZXQA 2YQ2A 2DH2A 4RDQF 5DMGD 5ISZB 3GXFA 4FI6A 5E6YA 3ARPA 2WGNB 3RWCA 1B88A 2LOEA 4ZTEA 5GJTL 1JWSA 1D2PA 3KPNB 3NA9H 4OVVA 3LNGA 2BVTA 1A22B 2DEWX 4KO7A 2ADJA 3E9UA 2VR9A 5FK9A 3FF7A 3L9YA 4JQIH 2MNJB 5DJ2B 4AYMC 4KH2A 5I0WA 3RUGF 3NRPA 4O02H 4HBQA 3DMMB 5BRZB 2NQDA 1KIPB 2VDOB 1MW2A 2XQYA 4YOKA 2FAUA 4PB0H 2NZ9C 4A7VA 1UM5L 2ZWYA 2PTUA 1B2WH 1SJEB 4J6RL 3DARA 4X8GA 4X6DB 1VZHA 1AY1H 4CGUB 4OF5A 2ZOTA 2EYTA 1UFUA 2HFFA 5AAWA 1CD8A 1U8JA 3PPSA 2X4RB 3DX1A 3HZKA 3JV6A 2B2XH 2A99A 2XLLA 2E3VA 3OAUL 3CC5B 5DMGC 1T03H 1GGBL 4BBWA 3BW9A 1XGYH 3UJJH 1KB3A 3QDMB 3MXWL 4N0UE 2VITA 3E38A 4XX1E 3FAWA 2XOTA 4FXGB 4PBWD 3ULVH 5I76B 3GBNL 2HN7A 1TXKA 3MRQB 5DQDL 1I8UA 2H4EA 3EOTL 1SDDA 3S98A 2Z7UA 3RY6A 1QBMH 4K4KA 3S9DB 3VDCA 3MA7A 3V7MA 1RULL 1BPVA 3QIWA 4QTIH 1SQMA 4GO6B 3U36B 3FS9A 1NTDA 2DOCA 4XH2A 4X6CE 3ZQXA 4HIIA 2IQ9H 1CFSB 3IU4L 2HKHH 3IF1B 4GW4A 2H0EA 1H3PH 2LU5A 5AW0B 3GI9H 5B1BB 3UDWC 5J56B 2B08A 5I1LA 2NNFA 4BXVA 4W6WB 3VXRA 3L4CA 3BLBA 2NY0D 4KI1A 3DROB 2UY7A 3F7YA 4IHOA 1TITA 3DECA 4NSKA 3MACL 4KPHL 1AP2A 4JLRA 1X4XA 4C55A 1OAZL 2EVGA 3EBIA 2A4EA 3RGBA 5IG7B 6TAAA 1DEEA 1L9PA 2R23B 2YRZA 4EOWL 4JFFE 4AQZA 2UXFA 3ZTEA 1HHHB 5D7JD 3RPIA 1ZHNA 2J5LC 1T3FB 3C87A 3E1F1 4JO4L 1N10A 5D7LD 4JRWA 4DZ8B 4MQXD 5A6IA 2VYRE 4MA1C 2ED7A 2EE9A 4G9FE 4N2HA 4Q0XH 2NMSA 3EJUA 3ECVA 3D07A 3R1GH 1SN2A 5IQ9B 4IRJB 3OAZH 1S7QA 1A7OL 4MHHI 4N8VA 3ZTNL 1FFOA 2D3NA 1YPZF 3AT9A 3GKWL 4NZRL 5HYIA 4RLDA 1MHPL 4FZEH 1YQVL 2A6JA 3U2SA 3W11D 4YLCA 3CCHA 1DQVA 3C2SA 3MYJA 4LL9A 1UXWB 4ELME 1KJVA 2XN9A 3OD3A 4PJDF 4DO4A 4JFED 2DJMA 3IDXL 2NW3A 4ANWA 1G1CA 1ADQL 2NY0C 1AR1D 1BBDH 2WKLA 3FQXA 4XOEA 3WTUA 4KX8A 5JHAA 3R7RA 4HZLA 4OCNC 5IW1B 2FLMA 4X7TA 5GSRA 3K2UH 1JPST 3HE6C 4RGMB 4DP7X 5EC2A 3QWRD 2W59A 1NEPA 4YSEA 2P44B 3FRPA 5D7JC 4F3FB 1NCWH 1T6BX 4J4PD 1KCSH 1OAQL 3RVVD 2JJVA 4MSWA 4QHUB 3QFJD 3R8BB 1MWAA 1U4EA 1F6AA 5AOLA 4H8QA 4YHOL 4EI6B 3W0WD 1XB3A 5IQ7L 1MCJA 2ZNXA 2G9HA 1F3JB 3MLXH 2KUTA 2WLZA 2Q2LA 4PJ5A 4BFIB 2VZOA 5JW5A 1J88A 1RURL 2Z1PA 4I3SL 3W11C 5JHDB 4QXTA 1PKQE 1RUKH 4H2AA 5EPMB 4Y4HB 1MHHA 4RQQA 32C2B 1PF3A 4ZS7L 4JZNA 1E4WL 1AO7E 1A4KB 5AB2A 5CD3B 3KL5A 3Q2NA 4PW9A 2WXFA 4K9JA 4QRRE 3Q9QA 1E65A 4QRPB 3ZYJA 1KWKA 4KZDL 1AR1C 4HWBA 4ZS6D 5JW4R 5E24E 3C8KA 1XX9C 4KBPA 1WFMA 2CUHA 3SDDD 1A65A 3HW7A 1A6AB 1PLAA 4PRAB 3Q6FB 2X3AA 3RPKA 2MQGA 1IC0A 5IY5B 4LLVA 5DUBB 4JKPH 4YR6A 3ZX1A 4J4PC 5E0QA 3RVVC 3T8MA 4WI0B 1IAIL 4YQXL 1MJ7L 5D4QA 5JMOC 3QWOA 2DLFL 1OSPH 4ZDHB 3OC5A 4EI5B 1TYRA 1OW0A 2OMBA 4NO0A 1D7BA 2B9AA 1SY6L 4YSTA 3LSOB 4WUUA 3VD7A 5DCCA 3FQRA 3HR6A 5A2BA 2BVYA 2FQGA 3QFDB 4X5WB 5BVPH 3WL9B 3LEXB 4WEEA 4BFBD 3HI5L 1B9KA 2ZIDA 4HXBL 4ZS6C 1OANA 4BSVA 5IF0A 3NH7L 1U8IB 3JWOH 3SDDC 2WZ6A 4F2FA 2ZCHH 3I74A 4UNTA 2LTQC 3VTMA 3D3VE 1Y1UA 2AANA 3DO4A 2E9WA 3M17A 4M4RA 1DCLA 3L3IB 2DI9A 5GS1A 4XN1A 3CXDL 5DVKA 5I8CA 4LAQH 4G2AA 3MHZA 4NO5A 4AEHH 2XQYK 5JLZB 2V2XA 5CCKL 4JEGB 4IBTA 4FQ2L 3WNNA 4NC2B 3IETB 3PV6A 2IPKB 3UYRH 4KKRA 4JFZL 4JX0A 1EJ8A 3RU8L 3TEUA 4H1LH 4M7LT 4NXKA 4OCLC 1MNNA 3H9SD 3DSFH 1JXGA 2VZVA 5SWSE 1PNCA 3RP1A 2IQAA 4R0LA 3VRJB 5EC1B 1OGTB 5ADOL 5LAPA 3MRIB 2WIMA 1GGUA 1QKZL 2HTKD 1KGXA 2NY2D 1G6VK 1OT2A 1PZUB 2WNXA 4WI5A 4AC4A 5CLWA 2XWJB 5FS5A 6PAZA 4HETA 2O30A 2QR0A 3O0RL 3ARGA 5DZAA 1LEIA 1HOCB 5C0CA 1MG2C 1JXFA 4NKDB 4BK5A 5C86A 2G4GA 4AUUA 4OT1L 4ZMOA 1Y0LA 4FQ1H 3WLWC 4B9PA 2WTOA 3PLYA 1G7LA 3ZTDC 3L17A 4TXVB 1UM4L 5DRZA 2E9BA 4P04A 5DVNA 1CDGA 2B1HH 3RVTD 2L7EA 1K6QH 1COBA 1D7FA 2JQZA 3PGCA 1RZKH 1NDMB 4B7IA 2R4SH 1NEZA 3RI5K 1GYWA 2R8SL 3P9MA 3D85A 5I16B 2EIKB 3MKKA 4ZBJA 1N0XH 1X9RA 3ASNB 4M7JH 4ANVA 1BMWA 3WJJA 1KCRL 2AJVL 1MCHA 3OXRA 4N0UB 3O9WD 4DGVL 5A40E 2F54E 2GFBA 3ZDZE 4LASH 5JPMA 2DH3A 1T1XA 4W9GC 1QP1A 1B0GB 4FQLL 4KH9A 3NSDA 2HTKC 1R3IL 1TZAA 1XSIA 4NS0A 3AQYA 2NY2C 4OFVA 3KR3L 4G6JL 2XXCB 4UTCA 5LWYH 4NP4L 2A1WL 2ITEA 2X1QA 2GPZA 1ETZB 3AZUA 4WJ5A 2YUZA 5C09D 4NKQB 1UJTA 2WAHA 1LK3H 2LW3A 1CDYA 4IGBC 1SYSA 2E7BA 1DLHA 4FKHA 4MA8L 3QISA 4X6CB 2QKIC 5IZ7A 2HX7A 2ZXGA 1HQRA 3QPQC 4DVBB 3FCUB 1H19A 2EINB 3QUMA 2IANA 4OZGF 1C1EL 3ARQA 1FCGA 2QQQA 4WKXA 3KJ6L 2P47B 1JGUH 2YAQA 2CBTA 2QBWA 4DHLA 3W9DB 3WFHB 1FFNA 1A25A 4LOEA 1W8EA 2EDFA 1Z9PA 3UTTD 3CXHJ 4UDTB 2X70B 3O9WC 3GYRA 2X28A 1GGIH 5A7EA 5IBUB 2BOBA 5FM8A 3EHBC 1AQHA 4ONGL 3IS0X 3K8KA 2GJ6A 3AT0A 1KBPA 5EU5B 4JFFB 1K4CA 2BNRE 4BHUI 1KGJA 4C54A 1O7SA 3ZGIA 4NRXB 4WW2B 1JHKL 4D9LL 3GS7A 4ODHH 4G9FB 4KHTH 4D8OA 5GZNA 1TMCB 4Y4FB 4AQAA 1FL3B 1EEZA 5JHLA 1ROWA 2OI9C 4M7ZB 3H1ZA 4XNQA 4OJFH 4F7PA 4I5BB 2EYRA 1BEXA 1S8DB 1BVKB 3OSKA 4DN4L 4R7DB 2VDPH 3MR9A 1ZIAA 4YWGH 3W2DL 4DK6A 4F37F 1JPSL 2N0KA 5AL0A 4ELMB 5GRYA 1JSYA 4APQC 4UQ9A 4E9SA 5DFAA 1E4XL 4GH7B 2XN1A 1DBBL 3C6LD 1IBGH 3L4ZA 4KMTH 2XQBL 4LESA 3SYQA 5KYYB 1R3JA 1C5CL 2ICWB 3QH3B 4DF9A 4YSCA 4HEMA 4FI8A 5K69A 1J8RA 4NPYA 4QY8A 5AKRA 2ALAA 4J5VA 2VR5A 4OF7A 1PY4A 5CJ5A 4MXQD 3V7AG 5HYSB 3AITA 2AV7B 3V52H 4JCMA 4XCCH 2ZSVB 5IMOA 5IGXL 1CQYA 3JWNG 1FORH 3D25A 4N87A 2PWDA 3H3PL 1KLGB 5L0QC 1PKQB 5C08E 4JY5L 1EERB 2FO4A 3ARDA 2ZX8A 5J0BA 4LXFA 4BKSC 4PBVC 3GHBL 4MCYB 2X1WL 3ZKXB 4A6YA 5GS0L 5EF2A 2NR6D 3X12A 1IVLA 1AO7B 3NRQA 1MCDA 1MZZA 4D0DB 4QRRB 4N0FA 1IGJB 4GSQA 3DXAD 4UT7L 1H8LA 2QPUA 4QLRA 4GQRA 3V9FA 4HPOL 1GS8A 4FTVE 2XRAH 1BWWA 2NXYB 4YO0A 5DSCA 15C8L 4OCWH 3HJEA 4LB8A 4AIZB 3ZIMA 2V9UA 1N67A 4KAQL 4P2OA 1J9TA 2Z3FA 1MLCA 2F1EA 3VI3E 5F3HA 4Z8FH 4MXQC 3QO0A 1TZHB 4KROB 5TJWK 5EU6D 3PL6B 2AERT 5IEKA 2I5YL 5EORH 3PF2A 5JZ7C 3TBSA 2OP4L 3E8UH 1DQMH 3CH1B 4JO1H 2EEXA 4KV5F 3VXUD 3SQOL 2VUYA 1CXKA 3Q2CA 1OSYA 4JVPA 4XVJH 2WINB 5L8KB 4DAGL 2G2NA 2IFFH 2ZG1A 2BY2A 3IJ9A 2VXQH 2GABA 3NFPB 4OF6A 4D2NA 5I2IB 2N1KA 2ZSWA 3P9LA 5F1IB 1FC1A 4YAQA 2V2WA 3QZWG 1HYRC 4JZOA 3V0EA 1Z5LB 1U8NA 4YPJA 2WJ7A 2VLKE 4MCNA 2YZ8A 1EGJH 4Q56A 4NQEA 3EGXB 3SPIA 1EX0A 1UG9A 3C5JA 3C6SB 3F6JA 3I6GB 3PWLB 4XAWL 4ZPVA 1GJIA 2EUVA 1JZ5A 4GI8A 1OKEA 1PD1A 2CJUH 3F7PC 3C5SB 3D3VB 4WO4C 4ZFZB 2I32A 3O3AA 3ZW3A 3P11H 2WM0A 3BKML 4FKKA 4M7LL 4CUCA 2QTEA 2VQ1B 2YC1B 5H37G 1BD2E 3ZK0A 2WO3B 5C9JA 3IYLW 1KYUA 4TPRH 3I3BA 2FJUB 3HE7C 3MAWA 1DEDA 2IGFL 5DHVA 4I3RL 1KENH 4PPTA 3V4PH 1GTFA 1AZBA 1QAWA 3LZFH 1ZLSH 4R97B 4U1MA 4WGWB 2V9TA 5GGTH 3KBEA 5CJ8A 3ARTA 4U1HB 1NLBL 1OP3K 3IGFA 1NICA 1CDUA 4Y16A 1BZ9A 5HP5A 1DLFH 3MQIA 4M3JA 5IQNA 2BFVL 5SWSB 4PJXF 5G4MA 2CKBH 1JPFA 4I18C 3V4VA 4UOZA 4G59C 3RKPA 3DJRA 5ID1B 3PDOA 1IFRA 1GZPA 1I1FA 1A9VA 1AIFB 3WJLC 3QIUA 4Y1AE 3M07A 4S1DC 2G2RB 4G7VL 5HGBB 1BBJB 1FZJB 1AYOA 2X9YA 3OBAA 2XQ0A 1MEXH 1AQMA 2X89D 3CN4A 4GBXD 2J57A 3H2QA 2R83A 5C0RH 4WKZA 4K3EH 3NCCB 2RA1A 4RWYH 2CCVA 2R2BB 1QR1A 1C7TA 1TKWB 1YMMA 4PGCB 5BQ7A 1QR4A 1HILA 3NP4A 1YC7A 5AEAA 5GSVB 4X8JB 1J0YA 2A4ZA 5DJ8A 2HCZX 1AGFA 2OYMA 4K71B 4UTBA 1NCOA 1X5KA 2X09A 1WFIA 5TE6H 2DMGA 5BZWB 5I71C 3RWEA 3L3GA 1VZIA 2MHAB 4FEMA 1FC2D 3QRLA 4PRDA 4LSTL 5HJ3A 2Y06L 3MRLA 4L8SA 4NQSB 4YBHA 3QUKB 3UTQB 3AG4B 4GO8A 1IKFH 3HAEG 4LLMB 3LKNB 3P1VA 3MTRA 4H0HB 2F54B 3ET9F 3M88A 4OZ4A 3ZDZB 1N6QH 1E0OB 2F5BH 1S7SB 4A7TA 2JJTC 2CJTA 4HP5A 1ZPUA 4O2FA 1PG7W 1OAYH 4UV4H 3C60C 2BP5M 1BMZA 3US0A 1EUTA 5I1GH 3LN4A 1KJMB 1NC4A 4WI4A 3TJHD 2B9BA 2FX8H 5T1DL 2X6UA 3GSXB 4P5KB 5IHHA 5MEOA 2E7MA 4GBXC 2DWDB 3FU0A 3H7BB 1T7ZA 5JA9A 1OP3H 2R56H 5BW7C 2JKTM 4LVOC 3CBKB 3NZHL 1FGNL 1OGAE 2CAKA 4OD2B 5D6DA 1IV8A 1K4DB 2LGNA 3AY4C 3PGDB 4L4TD 4WHTB 3SDCA 1IBDA 2V7NA 2P80A 4ENED 3IDGA 3S2CA 1NFDE 1T5XB 2D0GA 4MFHA 1GS7A 4MNHA 5CIPH 5FW7A 1BXUA 1KG0B 3T4AC 5H2BA 1YEHL 3F00A 4GB9A 3TCLB 1XR9A 2F7PA 5KVDL 2XU9A 4AT6A 4X98B 2VMJA 4OQTH 4W9IC 2P48B 3HN5A 3QIWD 4XMKL 2FJGB 3FQUA 4WCYL 1UASA 1RZPA 2XG4B 3BC9A 4AGPA 3MX0B 2BNRB 4RIRB 3U30C 5E9AA 1SYVB 4DZBB 3IS1X 4F57H 5I1DB 3QQ4A 1ZHKB 3K7UA 3GINA 3TJHC 1AHWC 5KVDE 5AKTA 1S7VB 3S7GA 1GTNA 5EEUA 1YY8B 2HFGH 4QRQA 4OF8A 5E94A 1U95B 3MA9L 2P1YA 1XD1A 4E42A 1SUJA 4BCXA 2IOIA 4ORGA 4NHUA 2LABA 2MPAH 1GZQB 2NQ3A 3MBEB 5E6SB 3TEZA 2G60H 5B8CC 3U46B 3OZKA 4N9GA 3U6RA 2WXNA 5FUOH 1JCKA 3JTBA 2QQLH 3QJHB 4XC1H 2X10A 4ENEC 2OCCB 2CLZA 2NX5E 1P6AB 5GRJL 3GRGA 1Y18B 4BH8B 1LE9A 3ARBC 4HIHA 1B2YA 5ESAA 4OV5A 4KY1L 2H45A 2ADYA 4O2CB 3SOTA 4X0KB 5FO8B 3OJ2C 5DA4A 3WFEH 3V7AE 3ES6B 4IU3B 1BFVL 3TBTA 4FFZA 2OL3A 4NQXA 3G6JA 3K2IA 1THAA 1YEGH 2C4FU 2CLRA 2R7EA 3DIFA 2Y2TA 3LNEA 3MO1B 4HXAL 4KNSA 1KN4H 4XMLH 4Z5RB 1ANUA 2XVGA 3L4WA 1BMGA 3T1FA 2HT4D 5KJ4A 3WHXA 3GLDA 3BWAA 5JHMA 4I1PA 3B9KA 4NC1E 3LKSB 5BXFB 3X1FA 1T5KA 2A0LD 2XN9D 2VLJA 4YL9A 1AQDA 2H2PD 1SNRA 5HDBF 4K15A 2V7HA 1JV5A 4JFXB 4FQHB 3TIDA 2WXIA 3F64A 3IDJB 4HPYH 4HUUB 3MREA 4KTEL 1TTFA 1DE4A 3QNXB 5C08B 2ERJB 1JD7A 3KYMA 2BS9A 1D9KA 4M6ML 5H35A 4OKVB 5IJVB 3ZTJG 1YUHA 2BIMA 4R6UA 5D1ZA 4ELKA 1UWYA 2VSMB 3SE8L 2GUOA 2PXYC 2OXHB 4L8BA 1O0VA 4ZW8A 5FM5O 2H1PH 2YEVB 1UJ3A 4FTVB 2FE0A 5IHUL 2CALA 2Y1AA 5E9DE 3WNPA 3ULUE 2IDQA 4F5CA 3DUHA 3SGDI 5GGUB 2JB5H 4QRFA 2P5WE 2VUOA 4IKKA 4HQQL 4PJ5D 2TSBA 1JWUB 2HT4C 4P4KB 4WGKA 3VI3B 1DO6A 35C8L 3QJVB 4MCZA 3KH3A 2JLPA 4HSQA 2A0LC 5EOTB 2R29A 3THMH 3UO8B 2H2PC 2YBRA 3FYEB 1NMCB 5HHXH 5K59F 1PLGL 2WVVB 1KPVA 1DQJB 1XGUB 2OXGA 2VXTL 3MOBH 4XAKD 3SGJA 4UV7H 4YDIH 1RLBA 5IVZB 2XA8L 4JQVC 4JBSA 4DN3H 3H2PA 4KKBD 1HEHC 5G5DA 2WWMD 3CFKB 4I1NB 4JPKL 1C8QA 1BXXA 1XIWA 1K8DB 5DHDA 3SPGA 3WJMB 1FBIH 2GBVA 1Q9WA 1MSPA 4JKMA 1ZE3C 3EDEA 3ZDYE 1IFGA 1A6VL 3D08A 1QACA 4FG6D 4L9LA 2FJSA 5I6PA 2VLKB 2W0PA 4N68A 3LNDA 4UANA 4Y4KC 5FYKL 4NRYB 2AHIA 1CLCA 2Y69B 4NENB 4NAQA 2P43B 3UMTA 3CPLA 3L3KA 3WSQH 4HJGA 1JXJA 4BK4A 2M2DA 3P2BA 1A6UH 3BIKB 1L0PA 1BD2B 4WUUD 2I9TA 1JMZA 1J5IA 1N3NB 1L0XA 2A9DA 3HS0C 5D2LA 5TDOB 4QXUL 3L5WA 1NOLA 5FYKE 4IBLT 2H2SD 2GJPA 1A0QL 5AVRB 1F97A 1KELL 2JB6B 4GP5B 3WEXB 4JR9L 3VFUB 4XNYH 2DIAA 2ENSA 4MQ7A 2BS71 3GZQA 1OWWA 2H6PB 3KLAA 2YD1A 3NIGE 3BAIA 5HI5D 3T2NL 4OZHE 5CAYB 5E7BA 4KKBC 5KBPA 4WJG3 2WWMC 1P4IL 1Z6JT 1GC1L 2VDMH 3GMPA 5AOKA 1VGKB 4I3GA 1SEQH 3BPCB 4D7PA 3WXVH 3G5YB 3Q01A 4Q6IB 3HA0A 5DJXB 2NTFA 2Z35A 3TNMB 5IVXF 1AOHA 2YAPA 1MXGA 3OXSB 4Y1AB 4S0SD 4LHUG 3H9HB 3MNVB 4BK8A 2O61B 1NPJA 2FD6L 2OFQA 3HS9A 3MRJA 2A6IA 2JNZA 4FGMA 1CMOA 4K7PL 1UTDA 3BPOC 5FO9B 4FFVD 3CLFL 3ZHLA 1A4JB 5CMAB 3KYAA 4QHMB 1DQLH 1G6RB 4PGZA 4NPKA 2PR4H 2HWZL 5DS8A 1GA2A 4MAYA 4OSUL 1MPAH 4PJ8B 3I2CL 3ALPA 1O7DC 3I6SA 1R3LA 1MRCL 2H2SC 4XB8A 3VFMA 5FR3A 1OOAA 1VFAB 2R2HA 2FSEB 2W8CA 1F4YL 2V0AA 5HI5C 3LN5B 4Y5YB 3ARGD 3KPOA 5B3JE 5C0CD 3BAWA 3ZZLA 4GQZA 4PREA 1I1AD 3SJVD 4G8GA 3RZWA 4AW4A 1BW8A 4A67A 5CP3A 1YEWA 2XSKA 4RFEA 4BRVA 4MZ2A 5I1EL 3ZRCC 1I85C 2Q8BL 3O6FC 4JGNA 4QGTA 5FCUH 4L48A 2DEYX 3MRDB 1BHGA 2BP0B 2P4AB 1WK0A 3EH5B 2VXUL 4FFVC 4OFKA 5C07A 1TFPA 4NQCE 5CU9A 3MI6A 2PO6A 4K8RC 2HKAA 4POZD 3C5ZB 4MAZA 4U3CA 1YYLH 3RIFF 1TEYA 3NAAH 2O5YH 2FLBT 3M45A 1URIA 3AREB 5KYNA 2IAMA 4OM1L 3SGDH 3CFQA 1NFDB 4MZ3A 1AGCB 5CGTA 4K07A 3IDYC 3R7QA 1MJUL 3P3UA 3OLDA 4HC1H 1J5HA 3N43B 5EO1B 1QHPA 1EFXB 1ODUA 4G8FA 1I1AC 4G8EB 5AVQB 2V2TB 1NBCA 3FUHA 1ACXA 2H41A 3HI6L 4FJYA 3SDXF 3SYOA 3HI1B 1V7ML 3R06B 4OB5H 5D4JA 2R4RL 3E80A 5K9JL 4JDTL 2ZOLB 1EZLA 3HPJA 2NTSP 4FQXC 2EDBA 4X5RA 3VWKA 3P4MB 1L9RA 2OMUA 4B6ZA 3QG7L 2AGJL 3WLBA 3FOMA 1EEYA 1MAML 4YE0A 1CYGA 2F53A 3RVXD 1XF2A 4XP6L 4X8CA 3GZKA 4JPVL 1JTTA 3EO1B 4Y9EA 1HI6A 3WMQA 5C0BD 1IM3A 5C6WH 5CILH 4J2XA 4POZC 1RI8A 2JKXA 3CZUB 3N1PC 5FAAA 5G55A 3EADA 3SKNB 3QQ3A 3WMPA 1KC5L 3HC4L 3CFTA 2HX9A 4PRNA 1TUPA 3RNQB 4F15B 1E3XA 2NX5B 2Q1EA 2NY3C 4CADA 2ZCKH 1OSEA 1FLTX 1ZS8A 2HLAA 4NKOB 4XNUH 5IB3A 1ILUA 1H3GA 2JKWA 5GZND 4PTTB 2WQUA 2FLRT 5IKCB 3UZQB 1H15A 3U4BH 4RDQG 3EYOA 1NAMB 3VXSA 3APDA 4WWNA 4YXLL 5GHWL 1P53A 1E9OB 1CT8A 1VRSA 3MUGB 2F8VA 1AQKH 1MNUL 2AEPH 3QCUL 1F4HA 2ENQA 4A2HA 1JGDB 25C8L 2VJ8A 3RVXC 4KRNA 5DRWB 3WTSA 3B2UD 1OVZA 4P0DA 4V33A 4NZUH 3BKCH 4WU7B 2X6MA 4J2QA 1PSKL 1UKQA 1QLRA 2BJMH 3AG1B 4FQCH 1RH8A 3K91A 1JDCA 1QNZL 3RJOA 3UP6A 4P2QE 4PV9B 4XGZA 3EJCA 3MRMB 4K3JH 3T9WA 5GZOA 5IMLA 2X4QA 4NEHB 4XP4L 1SGKA 3WS6C 4ERSL 5ICZB 1FNSH 1A66A 1S7UB 1OAXH 2A74C 5JDJA 5I1JH 5LVEA 4XBGB 2VXSL 3NFNB 2ZE0A 2NPLX 4I2XB 2CO6A 4XPHL 5E9DB 3LMJH 4BZ1H 4F8LA 4XN8A 1A7RH 4ZQTA 4BJLA 3TBWA 2P5WB 3KLSA 2FATL 1G7JA 4CBPA 2E75C 4H20L 4KZEL 1HT6A 1X7QB 2EH8L 4PU2A 5DMIL 4E41A 1LTXA 2ZX5A 3U0TA 3REVA 2IWEA 5CINL 1J7VR 1FVDB 4HUVA 3B2VL 3RDTB 4WEMB 4G1MA 1FCCA 1ZTXL 5IBLD 1T66D 3NK3A 5CN2A 3MV7A 3L5IA 3NJJA 4OIAA 4QO1A 5BVJA 3WUWA 4PJFA 4HEPA 1QFWI 3B2UC 4UT6H 1S9WA 1YQ2A 4YDMA 4HK3J 3CVHB 4AYEC 4U7KA 1U91A 3WEBA 3BAEH 1J5OL 1IO4C 1I75A 1JD9A 4LEXH 1NGYA 1MVUB 1IIIA 1I1YB 2FECL 1ZTXE 1Z9OA 4LDLB 1RUMH 3VXMA 5DD0H 1ZVSA 5DLLA 2QVFB 1P5UA 1GPOL 3ZN6A 2OJZL 3ZDYB 3AAZB 3V55A 3WKNA 4F7MA 3CFJA 4QRTA 4F1SA 1M4KA 1KYOK 4UINH 5E4EB 3TTYA 4NAMA 3QEGL 1BCIA 5ANHA 1J1PH 4Z7OE 3VAEA 4G6FB 4KJQD 4EAEA 1JVOA 2JTYA 2OMZB 4PJ9B 2GSGA 5FGRA 1HINH 4PV8B 4F7CB 5C6PB 1J87A 4BH7A 4R4FL 2R51A 3LRSA 2YKLL 4KVPA 4GRLD 5CCHE 5E8OB 1NLDL 4FG4A 1CGVA 1IEAA 3AXHA 3V79C 1JZFA 4TV3A 2MTPA 5HGAB 2B0SL 1HH9B 1HEZB 3ISWA 3QAZB 3NIGB 3VXNB 5E2UL 4OZHB 4G3YH 3QR0A 4FNQA 5D6CA 1KJ2L 3DJZA 5D5MF 2VSKB 3LZOA 3TN0A 4HW6A 3UYPB 4DEPB 5LJYH 5AW1B 3INUH 2NZ1A 1TDQA 3T8XB 4DTGH 2XJKA 1IGCH 2H26A 3QC6X 3OG6B 3K5SA 1T1WB 1UGNA 3KPTA 4NQDA 1XL4A 3LIUA 3L48A 2EDLA 4MA3B 4YSDA 3HZMA 1TJIL 3LH2H 4HKZB 1QEXA 5EZPA 3NA9L 3O4LE 5HHMD 4FADA 3C12A 4XPAH 1VB9A 4JAMA 2AQPA 3QHZL 4PJGA 3IFOA 1DQQA 1NFIB 3BPLC 2Z31D 1J8HE 5A16A 5JIIA 3LS5H 3ME0A 4GRLC 5DJAA 5CGBA 2YXFA 4H1LG 1BIIA 3WS3A 4PB0L 3HAEB 4ZOCA 3LNHA 1B2WL 4P5TA 3ZE1E 1E2ZA 2WNKA 1FHGA 3H9YA 1AY1L 5C0IA 1ZCRA 1SXAA 5AUMA 4B9ZA 2UZXB 5F9OH 1I8IB 4MHHG 1P6FA 3PPEA 1F8TL 5EZOL 2B2XL 1ET7A 3T0EE 1F1AA 1AZZC 1N4XH 2MNWA 4LP4A 2CM6A 2Y1VA 2EEFA 3W39A 4U49A 5MI0B 3UAEA 4PRHD 1C12A 4EO5A 3ULVL 1RK1B 2X2JA 4ZO6A 3CFEA 3SO3B 2VH5H 2JVUA 1A7BA 5JYLA 3FO1B 5JW4M 4NQCB 1QBML 1OD9A 3NA4A 1B0RB 2C1OA 4MJ6A 2VERN 5IFAH 2GW5A 2A9NL 2Z31C 3Q44A 2XBTA 43C9B 3ULVE 1MCCA 3S3SA 1HYSD 4B3VA 4NCC2 4LKXA 4JPQA 4N4YB 4U0RC 4X7DC 3OG4B 4KK6D 3T3PF 1IJ9A 3HZYA 1DN0A 2BWQA 3U2JA 4ZMPA 5D9SB 1R33A 5FGCE 4NXSA 4NFCA 3GI9L 3UGUA 2BM3A 5E2VH 3KXFA 1NC4D 4JDVA 1YECH 2DTML 4OCYH 4U6HA 4QI3A 4DGIH 4IKIA 3WD5H 1I3GH 3O4OC 4U3SA 1OTTD 1PDKA 2FEEI 3MGOB 4YBLB 1DJXA 4KXDA 1BVLB 4N22A 4LSSH 2ZYRA 2J8UB 4YJZL 1N68A 3N44B 3J7HA 3SDCD 3VFSA 1CZ8H 5EN2A 2P80D 3DK0A 4X0NA 5C3TA 4W6XB 3S5LG 4KITB 3B9EA 4Q0XL 1LNUB 4H44C 2CDGB 3V5DB 3TONA 1KULA 3FTGB 4NZFA 3VD2A 4YHZH 3R1GL 2HT2D 1YMHB 2E8ZA 4Y5XA 1HHGB 3DVIA 1HYSC 1TO5A 2ENYA 2IAAC 3IJ7A 5LAXA 3ENEA 3KCPB 4G80A 3DOIA 4X7EC 4QHLB 4PJCF 1T6VN 3FONB 3TJEL 5KS9F 2Z8WC 3R8QA 3FK3A 5D2NC 3HUJA 5D4HA 1BXAA 3LRMA 4Q4IA 5IQLA 3KVDD 1E9QA 3DV4B 5IFJA 1S7XB 1TTCA 1MI5D 2FVNA 1YJDC 1KCKA 1OTTC 1GJWA 5DZ9A 1DANU 1OHZA 4J8RA 3U25A 2B5IB 3KG5A 2XZCL 1O9WA 3K2UL 1EAPB 3QCVH 3PNWA 4MJ4A 3AUWB 1JNLH 2ZUSA 4NUGH 4AQ8A 3MJ7B 4OLXH 4TNWK 2D31A 3N41F 2C9XA 1NCWL 1PPIA 1KCSL 3Q0HA 1RQ5A 1NBZA 4FZ8L 3ETTA 1A9EA 5CR8A 3NSXA 1U8OB 1JNHB 2AXGA 2BIPA 3JV5A 3EYQC 3P3TA 4D9QE 1BZQK 3S4SA 3BZ5A 3WO4B 2G2PA 1GGYA 1OCCB 3CIAA 1DVFD 3AXIA 4W4NA 1RUKL 4JB9H 3B34A 1LGVA 1NPUA 3GSQA 2V9RA 3TBYB 4XO8A 4NFBA 2CGZA 3B9KD 2AAAA 2Z4QA 5LCVA 4O2EB 3TZVA 1AR2A 4HIEA 4DSYA 2SEBA 3WO3B 5DMKB 1KPRA 2X4NB 2FZ3B 2VLRA 2XG5A 2WXJA 3ZTCC 2AQ3A 2F19L 3AS2A 3PREA 3U9PH 1A5FH 5FYKU 4JHAH 2NSQA 4JGJA 1D5BB 3BYTA 4NP9A 1I3RB 3UTSA 1UFGA 3BH8B 2N7BA 1M1XA 3EJPA 5CJOH 4XZUA 4K7FB 1D9KD 4LCVA 3NCMA 3PP3K 1DTUA 2EE0A 3FT4B 3G6AB 3KPSE 4N2LA 3ZUNC 1S9YB 5D1ZD 5ERWA 3GXDA 2E0PA 2GB2A 1S7RA 3FT3A 1OSPL 2DICA 2DL9A 3GNMH 2P5EE 1YEDB 4Y89A 3G7TA 1AZUA 2BVPA 2R1YA 3RTQA 1DVFC 4I85A 3S3PA 3QIBA 4OF0A 1HKFA 3S96A 2FWOA 4HKBA 4RRPM 2BNQA 3Q1EA 2W0LA 4CSTA 3AACA 3OHXA 3EGSA 5I8KL 4BYHA 5BVPL 4UM9A 2OMWB 5KBDA 4Z7OB 2EH7L 3O45B 4P46A 4AK2A 3SPVB 2XA3A 5GIRB 3VG9C 3IDIB 3JWOL 4X7FC 5IB2B 4Y8AA 3CGTA 4HUWA 2ZCHL 3AROA 2QADB 5E1HB 4L8CA 5HHQB 4NN5C 4LBEB 3BT2H 1JN6B 3CX5J 5JUEL 4XC3L 2CHXA 4Z3GA 1EZSA 3G9VA 5HI3D 3F7RA 2E47A 4J23A 4RNRA 4FF9A 4H4NA 1DUYA 1G9HA 2KKQA 4AEHL 3ZQ9A 5EEXA 2TRHA 2ZXWB 3QJXA 2A73B 3QZNA 5B7MA 3UYRL 1D6EA 5FV1L 5B21A 4C4KT 1IEBB 4UDUA 1HL8A 3ZT7A 3DSFL 2P7TB 3FO9B 3HFFA 3TNNA 3DURA 4GPVA 5DWUL 2YXWA 1KJ2B 3O4LB 5IV2B 2MTAA 1PS3A 2CMRL 1JF1B 1OB0A 1GMEA 3PP3H 4NJAH 5EFIB 3BHBB 5DWPA 4A63A 3GF8A 1YVLA 2Q76A 1L0YA 5LKNA 2BOLA 4PGEB 3MLVH 1U8HB 3A6CH 1J8HB 2MCMA 3JQOB 1YA5A 3P0GB 1PZ3A 1UZ6F 4FQ1L 4LL1A 4N3UA 4IJTA 5TH2B 2KL6A 2DYPD 1I82A 4LPVA 3ZE1B 3ZHDA 4A7UA 2LVCA 5JPNA 1WIPA 1HHJA 2BH0A 4HULB 2Y2YA 5IEHA 1UH3A 4EN3A 3GK8H 2B1HL 1CFNA 1WO2A 2UWEF 4O02B 4ZO8A 1RZKL 4PJHE 2R4SL 4HA1A 3TF4A 5BV7H 3NCBB 1LMKA 5HHOD 3T0EB 4M7JL 3K46A 5DMYA 3RX5A 1CBVH 4N3TA 5E9NA 3ZU8A 3A67H 1IAKB 3GJFH 1XZ0B 1H6EA 4LASL 3MLTB 2NY1D 5JIMA 3GRBA 1RUPL 2YFNA 4B5EA 3NJIA 3DUSA 3HR5B 4H13C 5A2CA 5LWYL 3SKUD 1RV6X 2Z7ZA 4ZMLA 2GJZA 3DBSA 3L3DA 1T7WA 2BRRL 1ZPLA 1ILSA 3C9NA 4CN4A 4QGYA 3VYNA 1R9FA 1UVQA 4IRSA 5KSBB 2DQUH 1LK3L 4LCUB 3V5KB 1OEZW 4WV1A 4L05A 3ZSSA 4G8GD 3ZL1A 2Y5TA 5LBGA 1TETL 4J3OD 4DKTA 1IJNA 2Q7NA 1KZYA 5E8PA 3BEVB 5FGCB 2FHFA 4LRNH 3Q5OA 4OLUH 5ISZA 1RZFH 1S6NA 1N59B 2VDNL 1JGUL 1AMYA 2OYKA 3E0GA 4HJ1A 4H88H 3PDDA 2A9CA 1XCXA 4NNPH 1J5DA 2F08A 5C07D 2NY6B 5A2KH 4HWNA 2HJKB 1LEKB 5EO0B 2ED9A 1FH2A 3KPNA 3WNOA 3LJ3A 1V10A 4KKAD 2NY1C 4WUKH 1NC2B 2WPGA 1TYEB 4I48B 3IMTA 1JK9B 2AVGA 3K0YA 5F89B 5DJ2A 4PMFA 1WS8A 4KHTL 3K6IA 5F9AC 3T2PA 3VD3A 3DMMA 2UXVA 5BRZA 3WY4A 4M7KH 3L9RA 1KIPA 2AEQL 3A4AA 4FCAA 3IDMA 1SJEA 4X6DA 2J71A 4J3OC 2GY7B 4WRLA 1ECZA 4JM2D 4P8QA 43CAA 4O58H 5GGRY 2X4RA 2X2UA 4MRBA 3VWKD 3TO2B 1BZEA 3KL0A 3CC5A 3L7FB 4E5XG 1CO1A 3S5ZA 4GKLA 1ITCA 1SF5A 4XBEH 4KHXH 1W72H 1W91A 2COVD 3UG4A 1IBGL 2F53D 4JGMA 4LARH 4M43L 2AXFA 3SCMB 4GUQA 4BDVA 4EMZA 3VGAB 3WAJA 5IMMB 4FXGA 1IM3D 4KKAC 5I76A 3ELAT 3L3OC 3MRQA 1VJSA 4UQ2B 3TESA 2WOYA 4JFPB 2QKSA 1T0NB 3L4UA 1WTLA 3VRLF 4TSBH 1OAKL 3B7RL 1ZLEA 5EO9B 5MENE 1CS6A 4KVCL 4ALAC 3V52L 3DTDA 4XCCL 3FUIA 3I6LE 1YEKH 3S3BB 1AKPA 3U36A 4M61B 4MJ5B 4HAGA 2FB4H 3KGUA 5DC2A 3FXIC 1CFSA 4U1LB 2W94A 1KB5L 2RHEA 2CPCA 1MRDH 1NOFA 3IF1A 5E4IA 4JM2C 3KE0A 5KBKA 4AWJC 1SXNA 3UZEA 1DJWA 4DP0X 2E5EA 2ZYHA 3MTXA 4XE5B 4ZFQA 1UOKA 3DROA 1EHLH 1PZSA 2GK2A 1G9NL 2ED8A 5ID0B 3APMA 5DT1H 2VC2H 2XRAL 5IG7A 3TA3D 5LXVA 2R23A 4RAVB 5I6XB 3FF8A 4MMXB 4OCWL 2FIKB 4ESKA 1HHHA 1XF5B 2IWKA 4PS3A 1OM3L 4DZ8A 4PCTA 3V4LA 3O0LA 3IFLH 5LBSA 5GZOD 3OKYA 1SJVA 3KPSB 3RWHB 1G9MC 5EORL 5IQ9A 3QUXC 4IRJA 1DQML 4CU6A 3VX1A 4JO1L 1RUQH 2ODIA 4IIQB 2WZ5A 4Z95H 2PWHA 2P5EB 3N50A 4OZGE 3UEQA 4B95C 4WFED 4XVJL 2FEJA 1UXWA 3ESVF 4M6OH 4FG0A 2IFFL 3UADA 1N0LB 1L9OA 4E41D 2VXQL 1LO2L 2C1PB 5AAMC 4D7BA 3KDMB 2WZPA 3D51A 3KPQB 3W9EB 2JCCA 3DX0A 4NBXB 3SE6A 4ODBD 5KUMA 3MV7D 3DC0A 1NANI 1OQOA 2HFEB 4C4BA 1QVOA 1R3HB 4QKTA 1EGJL 1RSFA 3Q9PA 3TA3C 2E46A 3DHJA 2XFGB 3PWVA 4OIIL 3QJQB 3ZJAA 3K2KA 5EU7C 2Z8RA 2OS7A 2QQNH 1K3ZA 4JE0A 2B3RA 5E6ID 4F3FA 4LK4A 5L8JB 2VZ3A 4TVSa 4QHUA 4XHQA 3VXMD 3MLUH 3JVGC 4MMZC 4HU2A 4EI6A 2CGYA 1HXYB 1SMOA 2AJZB 2WLNA 4CSSA 4TPRL 5AWNH 3MRFB 3V4PL 4HLZG 1F3JA 2NY5C 3LZFL 4XX5A 1ZLSL 4BFIA 3F12B 3ZT6A 3BKYL 4Y88A 5JHDA 4QJ4B 5EPMA 5KJRH 4Y4HA 3W3BA 4W4OC 5FGBA 4UI2A 1WRFA 2WQSA 32C2A 1IGTA 1U3HD 1AOZA 2CBMA 3BFQG 3BFWA 5CD3A 1A4KA 4IBVA 1WHPA 1IAOB 2VW6A 4AKPA 4QRPA 1U30A 4MYPA 1CE1H 1BX2B 1A3LH 1YEFH 2XI9A 4ODVL 3CXHK 4H1LB 4WAFA 3UP1A 1P5VB 4DNLA 1A6AA 4YFDB 1OCOB 4PRAA 2ZOWA 3FYIB 4K3EL 5DUBA 1F6FB 5E6IC 3TN0D 2GEEA 2DRUA 5TPWH 4EQ3A 3D5OF 2PP8A 1FI8C 1IC1A 3FTYA 4WI0A 1M3IA 2Y72A 2XPZA 3GZPA 4NQDD 5EULV 5EZLA 2GK0B 4ZDHA 4EI5A 4BM7A 2MQ0A 5I0DA 1TQCC 4LRIA 2BCMA 4NQUA 4PJHB 2W81C 4JKLA 3AC0A 2G30A 4DK5A 5IWLC 5B7EA 3LSOA 1WAAA 2C3XA 1U3HC 3JYBA 1IKFL 2VABB 4P5MB 4ZUWB 3QFDA 4X5WA 3WL9A 3LEXA 2PWFA 4EDWL 1OTUD 2F5BL 2R1WA 3LNFA 1ACYH 4U6XB 1OAYL 4UV4L 3TT1H 4XXCC 4LVHC 5MHSE 5CEYB 1ZY9A 1U8IA 1UXSB 1VACB 5A1AA 4JPWH 4Q8BA 4UNVA 5FB8B 2FX8L 3HZ3A 1WZ1H 2C9PA 1F4XH 1OO2A 3T65B 3CU1A 2CDEB 1XWVA 1ZE3H 2L8AA 3L3IA 4KKLC 2IDCA 3FT1A 3MLRH 2YHGA 3QS2A 3GMQB 3ATFA 4RESB 4F9PA 3RPBA 5C7XL 3ZR5A 3QUGA 5JLZA 1KIUB 2ZXCA 3OAWA 3IETA 2ROYA 1M6UA 2IPKA 1MLBB 3F2LA 3FW6A 2J73A 2WC7A 5KVFH 1Q9KB 2F61A 1TZGL 3VRJA 2IGTA 5EC1A 1OGTA 5F6HJ 2XWTB 4OQTL 3MRIA 2XZQH 1OTUC 3BW9B 1KZQA 1VLXA 4HT1L 4F8TA 2B15A 5IJDC 2ZP8A 4WNQB 2XWJA 5DHMC 4F57L 1TTGA 2ZQKA 5E1GA 4N0CD 3BDYL 2F7OA 1HOCA 3K6NA 4XP1H 5FHBH 2C3WA 4NKDA 2YZ1A 1I8LC 2ZTBA 3D06A 4Y9CA 3II1A 3KXFD 3O3UN 3MMEA 2BX5A 4JFYB 1TSHA 2PPDA 2YMXH 5E1AB 4BSWB 1M7IB 3VI4E 3QUML 2MPAL 3J8F7 3RGVC 4D9RE 2G60L 1W15A 1OQXA 2D4FA 3ZHNA 2VL4A 3GHPA 1NDMA 4L5FH 1YEJH 5JORB 5FUOL 1EAJA 4MJIB 2QQLL 3FCTB 2BSSB 4XC1L 4U33A 5EV7A 4UBDD 5I16A 3OZ9H 5GS2D 8FABB 2A9ML 4J3XA 4P23C 2X05A 3RWJB 5KANI 2XKUA 4LOUD 1CBJA 5EG6C 4N0UA 3IBOA 3TO4B 1N5AB 4N86A 4J3UA 2G3ZA 1IGYA 1B0GA 4GEIA 1YEGL 1PZCA 1H5BB 1RUAH 4XMLL 2VLME 4JRXE 4QNPE 1INEH 1KN4L 2NY7L 3TFBA 4TULL 2DMBA 1MCOL 2CPUA 4JLRB 1ETZA 4N0CC 1P0SE 5MENB 3CE1A 4WF7A 1FV1B 4CC4A 1N5YH 5DVLA 1YNTB 3CLWA 3MUHL 2HVJB 3X1BA 1HDMB 4X6CA 1DBKH 3JWNC 1L9NA 4M6NL 3PQYD 4HPYL 5E2TH 3IKKA 4DVBA 3T71A 2DLGA 2XIDA 1Q9LB 1T83A 2QVTA 4H26A 5SX5K 2Y0SA 5F3BB 4UBDC 3W9DA 1YEIH 3WFHA 2MRYA 2Q8AL 3LQMA 2CIIB 4PM1A 3DX2A 1A47A 1KB5B 4G6AD 1F02I 2BLFA 4K8RH 4UDTA 2IJ0C 2YPKB 1X4ZA 2OTWB 2X70A 3HHSB 4LZKA 4XWOD 5DK2B 4TVPD 5FXCH 5JXEA 2H1PL 4JKNA 2OR8A 5E4AA 5EU5A 4JFFA 2ATKB 4NT6B 2JB5L 4XPBL 1TEFA 5IJKA 4LCIH 3IJSB 1HHKB 4NRXA 4GY4A 1WSST 5DC0A 4PJEE 3C2AH 3ZDWA 4Y4FA 4OLVL 1FL3A 2WXOA 1AZRA 5D1QC 4C47A 3D4GA 4I5BA 2QGEA 1OM9A 2WTPA 5HHXL 3TZVD 1S8DA 2UZIH 1BVKA 4W9CC 2VKXA 4R7DA 4OZGB 3ZKND 4BKLB 2PCPB 2DIJA 4A6YL 2VLRD 4DN3L 4QRBA 4ELMA 2HA1A 2EKJA 4JY4B 2X4PB 3GIVB 4X6BB 1JTOA 2QT6A 1HL4A 3ARUA 3UFIA 3M46A 3UTSD 5T1LD 1J1XH 1FBIL 1AS6A 2XV0A 2Y36H 4G6AC 1MHHB 3V6OC 4MBRA 4AYGA 3MU3A 2EDWA 1R46A 3RWIB 5KYYA 1HK6A 5HVHC 1G7HB 4MZIA 4PD4J 2ICWA 5J6SA 2ZWLT 3QH3A 3PAYA 4Z3TA 4JMNA 1QRNB 4N2KA 1BVOA 1CGTA 1ADQA 4TUOB 2EDEA 1O6SB 4B97A 4LBAA 3WSQL 3HCVB 2Z93B 5GGVY 5HYSA 1N70A 2AV7A 1A6UL 3VA6A 2CBQA 5IHZB 3K6SB 3QIBD 5I82A 3WEOA 2IPTH 2WBJD 2ZSVA 2P24B 2BNQD 4KKCC 1KCUH 1KXTB 5JDSA 5SX5H 3VNZA 1JGEB 2AS5M 2XY2A 3QZOA 1BQHG 4EUPH 3UPCA 3FBQA 5I74B 1WUZA 3WN5B 3QXAB 3Q8CA 1KLGA 3ZKNC 1PKQA 3IK2A 4FD0A 2H3NA 1DVSA 5SV4A 4NKIH 1QLFB 4P46D 5HY9B 5JQIB 4A2FA 4LCCB 4MCYA 3S37H 1AGBB 3M1CA 1JPTH 1AO7A 3V4PB 1SEQL 2IH8A 1AANA 3WXVL 4D0DA 5F8QC 4QRRA 1EV2E 3NCXA 1IGJA 2X44D 4WZ9A 1CE6B 2WVSA 4U1NB 2DWTA 2DYSB 4FMFA 2BWDA 4Y9GA 4AIZA 3B5TA 3DGCR 1LVEA 5CBEB 3TVMB 1JG9A 4HJIA 3PYCA 1X5AA 1TZHA 1XZWA 3VFTB 3GSUB 4DKFL 3PL6A 2PR4L 5HDBE 3A0OA 2QHLA 2WBJC 1UOLA 3CH1A 3D39E 5DLMH 3MSPA 3QG6B 4D0CB 3SKJH 1IM9D 1MPAL 2R0KH 3BPNB 3K80A 4FFWD 2CR6A 3CZKA 1A1NB 4TSCH 2WINA 3K3QA 3X1EA 1NSNH 5IHLB 3BP7A 4WNSA 1JCVA 2ZWZA 3RTLA 1QI4A 3J2PA 3LNIA 5CD5D 4YMPA 3NFPA 4OIBA 5I2IA 3PG2A 3Q2LA 3EDFA 3S36L 5F1IA 3P3RA 2OTPA 3MRHB 1OV8A 4RGOH 5DS2A 1EAOA 4E9WA 1SY6A 3P40A 1WISA 3KYOB 4MMYB 4Y2DB 2RR3A 3TURA 3B2PA 3EGXA 4CVZB 3BGFC 3I6GA 3E3QC 3K72B 3PWLA 3ARSA 4LSQH 2OM5A 3SY0B 3MXVH 3CUPB 3C8DA 4HCFA 3D3VA 4ZFZA 3QUZD 2OR9H 4MX7B 3SBWA 2VQ1A 2YC1A 1YNKH 3AQDA 4IJ3B 2Y5QA 1IUZA 4UTBL 1AIZA 1HOEA 2FDBP 5K59E 1IARB 5FC9A 4NQVB 1MCWM 4ODUB 4C58B 1D5MB 1YYLL 3VSQA 4YVUA 2P8PB 3NAAL 1OPGH 2O5YL 4ODXB 4FFWC 5AW3B 4BRJA 2J6EH 3CFBB 2Y25A 4U1HA 1Z0NA 2OJ1A 5J3HD 2HVBA 2JCWA 4CSZA 4J39A 5SWSA 1O9VA 2XWXA 4KC3B 3EFFB 3HN8A 4HC1L 3E9TA 5ID1A 2NY4D 3ROLB 2BRQA 4LLYB 3AB0C 4X5PA 1AIFA 1GY1A 4DUXA 1H8OA 2O5ZH 5KZCB 4O5LL 2VT0A 2G2RA 5BZDB 4MBOA 1BBJA 1FZJA 4OB5L 3RL2B 5HGBA 3UGXA 4BEIA 4LGPB 5CIPB 4IBWA 4WY7H 3BQUD 3LPFA 2BIQA 2CJSA 3QUZC 2R2BA 2XPYA 1TKWA 4PGCA 3KLHD 4XR8C 2NLJA 1EMTH 1MREL 2BHZA 3CLEL 4H8UA 4YPGB 3MLWH 5GSVA 3MRBB 4X8JA 1IQDB 3VI4B 1HKLH 3GS0A 4HHGA 5CILL 1G84A 1IEHA 3EDJA 5BZWA 1LO5B 3LZPA 2MHAA 4QYOB 3VRIB 1RZQA 4L4VA 5K1JA 4R96B 1AXSB 1FYTE 3FHEA 1PW3A 4ABVA 4NQSA 1NPNA 3QUKA 3UTQA 5CJQL 3LKNA 3QXVA 2WSPA 1KBBA 2F54A 4KO5A 5IVXE 2NY4C 1S7SA 3BCFA 5ETUB 3U4BL 1QSEE 3C75A 3I75B 4JRXB 4RA3A 1FPTL 4WV1C 1PIGA 1NCGA 1KJMA 4WVRA 1FIGH 1XTMA 3GSXA 1QOKA 1HWWA 1RJCA 4P5KA 4ZUVB 4IDJH 3BQUC 2DWDA 3H7BA 3LDBC 5E7FA 1RPQA 1UZGA 4W6YB 3KLHC 3WFCL 2I9LA 4ZZFA 3IEAA 4HWEH 2X3BA 4KKNA 2PWEA 3QDMD 3BN9D 2X4OB 4NZUL 4OD2A 1WD8A 3BKCL 3B4NA 1K4DA 3JUYA 3PGDA 3X2QB 4WHTA 3CJJA 4S10A 1XCTB 1BWMA 3AS0A 2BJML 2PN5A 4FQCL 1RU9L 4RGNC 3LZNA 1T5XA 3DVNB 5B1KA 3OPUA 3T2LA 4X9YA 3CC1A 4K3JL 4A39A 3QUYB 3WY3A 1KG0A 1FNSL 2BWIA 2OL3L 1OAXL 3TCLA 5I1JL 5F97E 1J0HA 4X98A 4V1DD 3V4VH 2F6AA 2FJGA 1NKGA 2XG4A 3GRWL 3LMJL 3Q6GH 3MX0A 2BNRA 4N0RA 1A7RL 4RIRA 1GSMA 1SYVA 4DZBA 5I1DA 5FF6B 2XWRA 5EBMB 1ZHKA 1NCTA 1UYWH 4Z3IA 1S7VA 2VDKL 4PJEB 1M6OB 4QT5B 3U4EB 2ICEC 1K3IA 1U95A 3OPZH 4KKZA 5C2BH 1G7QA 5AZ2L 3KWWB 5D1ZI 4GLRI 1REIA 1SM3H 1GZQA 2J72A 3G6JF 1ONQB 3HMWH 2NCMA 3MBEA 4UT6L 3CSFA 1NCDH 1TZOA 3BZ4B 3U46A 5IMOB 3BAEL 3WNLA 2ZYSA 4LEXL 5I73B 3GM0A 3QJHA 3EJZC 4R26H 4TM9A 3QI9B 1H6UA 3B3IB 1M3JA 3JV4B 1Y18A 4WSJA 4BH8A 4GKSB 5JIHA 5DD0L 3Q13A 4YHNB 3HMXH 3ARDB 4O2CA 4X0KA 5FO8A 3N9GL 3RVUD 3E1ZA 5G4OA 3ES6A 4IU3A 2WYTA 3SDXE 4UINL 4ZTOH 2DZEA 2AJSH 3IU3B 1A4CA 4IRJD 5FA3A 3MO1A 4L1HA 1WBXB 3RRQA 5JW4N 4Z5RA 1ASQA 4XNZC 1J1PL 4YXHL 2J88H 4M5YL 2QHRH 3EYSH 3HFMH 1FFTB 1HINL 3CZGA 1EFQA 1F2QA 3LKSA 1JFQH 2EDOA 2R29L 3GJEB 1KOAA 5BXFA 2JKSA 4CVUA 4HFWA 1P84J 5EMYA 4F58H 3W5MA 3DBXB 1JPGB 1YJDH 5FO2A 4JFXA 3VJ6B 4FQHA 1F1DA 3TH2T 3IDJA 4HUUA 2AMUA 1FE8L 3EJRA 2ODHA 3QNXA 5E70A 4LPWA 4PI0A 5C08A 3KGRA 1Z0MA 1PZAA 4RBPH 4G3YL 4E9RA 4U3HA 4MB5A 5E51A 4LFHD 5HGHB 3INUL 5IJVA 5E0FA 3O6LL 1IGCL 3FH8A 2J56A 3UAFA 3TTSA 1W6WA 3L2MA 3OR6B 1T2QH 2O6CA 2OXHA 3VWJC 4WWKD 2Q3XA 3LH2L 2BW4A 4FTVA 1EWHA 5CZKA 4XVTH 1XAKA 1EO8L 5GGUA 3V0VA 2MOVA 5D7LE 5LQBH 5HDLA 4XPAL 1JWUA 4RMSA 4GG6F 1XCWA 3VI3A 3VU1A 1PNDA 1BAWA 4RMWA 4NWTH 4NKMB 3GUTB 2FO1A 5HDBB 1D7DA 5EOTA 3LS5L 4AVHA 2C3HA 3D39B 1DDHB 4GG8B 4ICWA 2WVVA 3FUNA 1DQJA 1XGUA 4H8HA 3IGLA 3D8MA 1ZSHA 3SDAD 2P28B 5IVZA 5C9JB 4AYDC 1YYML 3CFKA 3CQFA 4JFEE 3RVWD 5F9OL 1FDLH 1RXLA 4Z3HA 4RGMC 4WI8A 4LSRH 1K8DA 3WJMA 1BLNB 5JXAH 2BSBA 1KCLA 1N4XL 2ZNWA 2N01B 4X99B 1TFHA 3O8XB 2GJRA 2XKNB 2VLKA 4WWKC 1MCFA 5T3ZD 1AJ7H 1H0DB 2YUVA 1OK8A 4NRYA 3HKZA 4I0PB 4NYLB 4NENA 1OT1A 4ZFFB 3LRLA 4N6RB 4CNIB 3QFJE 4PLJD 3BVDB 3BIKA 3W0WE 1BD2A 1E2WA 1CDBA 5GRZA 2AK1L 3KWXA 1N3NA 1ZIBA 3L5HA 5C0FA 5TDOA 3EFDH 5JQ6H 4L2YA 1DJSA 2IH9A 2JB6A 3WEXA 2WAQA 3LXAA 3VFUA 2ZCLH 4FLSA 2H6PA 2LAGB 2LFEA 2Z7WA 3NSYA 4JFHD 3SDAC 3LD8C 3BRFA 4CN6A 4Y1TA 4AM0B 4CJ1A 4ZAKD 4IK6A 1EVTC 4WK0B 2YGOA 1YEEH 5E2VL 3GBLA 1N7MH 4A37A 1VGKA 4QCIB 1F6LL 1XH2A 2DKMA 3BPCA 4L37B 3G5YA 4Q6IA 5DJXA 3RWEB 3EUDA 3EO9H 3F05A 1JOIA 4HS8L 1I3GL 3TNMA 4DEUA 3OXSA 5CZXC 1EA9C 1PJ9A 2J4WH 4Y1AA 1IBFA 2H47C 3H9HA 3MNVA 4XVUC 3B1UA 2XIBA 4XO5A 4AMWA 2O61A 4GP8B 4OJDH 3EBGA 3QCTL 1WIOA 1KTJA 4LSSL 3QWNA 4LLWB 1OB1B 2GBTA 1AHKA 5FO9A 3QDGE 3KL3A 1A4JA 5CMAA 1CZ8L 4QHMA 4M02A 4Q74A 2LU4A 1G6RA 3V0IA 1YNLH 4XXWC 3RKDD 3OF6A 4RRPG 3AWFA 4QXGH 1LXMA 4K5NA 4P99A 1J0ZA 1RK0B 4J3OF 4XN9A 4YHZL 1E3ZA 4PN6A 2UZPA 3UBGA 4EKXA 1VFAA 3DX4A 1AE6L 2FSEA 1CYWA 5F7EH 5J9PB 1DQDL 5D5ME 1WWAX 1BSIA 1FYTB 4IRZH 3UAAA 3GMOB 3LN5A 4KUCD 4ZAKC 3ZHFA 2BVQB 2XTSA 4ABUA 1CD1B 1TYJA 1KDIA 2Q7YB 5AALA 5AD0B 3LS4H 2CUMA 1TMQA 2F8OA 2EXYD 1EK3A 2PP7A 2ZG3A 4TOYH 3FPYA 5IVXB 1QSEB 3QQNA 1F13A 4I0CC 1UCBH 2J6WA 4XVSH 1S7WB 4QOKD 5IT2H 3DYPA 1SF3A 3QCVL 1SOSA 3MRDA 5ICXB 3PP4H 3QB7C 4U6VH 2LU7A 4NUGL 4OLXL 2AITA 6FABH 2V6HA 2KQMA 1FRGH 4X83A 3GSWB 2KHAA 1V8HA 3UCRA 1VESA 2PTTB 3B43A 4B9FA 1FUNA 2CHNA 3C5ZA 5F1SA 4NGHH 5A2IH 2CDFB 3AREA 1KUMA 4AX3A 3KGTA 2V37A 3B83A 1NFDA 3H9SE 4ONOA 1QBLH 1AGCA 3PXJA 3P4NB 4JB9L 4TRPL 1P69B 5D7KD 1NUNB 3ZUCA 4U6TA 5K9OB 5L7XL 3QYCA 2WYHA 4JE4B 4N9GB 5AW9B 2OKMA 5EO1A 2VIRB 3FAXA 3L1GA 1ZWIB 2YPLD 1EFXA 4G8EA 2OMTB 2X9WA 2V2TA 2EXYC 4LPYA 3U0WL 3HI1A 4S2SB 3R06A 1IC5H 5HJGA 1HHIB 2ZOLA 2YPVH 3VXTB 1Z3RA 3P4MA 4UT9H 1A5FL 1BXVA 4JHAL 3VXSE 4Q58C 2HFTA 4DKDC 4MQTB 3KPRE 5AVSB 1JBJA 3UBXB 4G43B 3T1FB 2VDQH 5DZPA 5CJOL 5F9WC 2CHWA 2EIZB 3EO1A 4OLYH 3TLRA 4G8IB 3SKNA 1J0IA 2VDKB 4NX0A 5FWQA 3GNML 2VZSA 4Y2OB 4G7YH 2WJ5A 3RNQA 1R34A 4K5PA 3I02B 2NX5A 3SGEI 1UQSB 1RIHH 1QMUA 1X5IA 3MREB 2K8QA 4HCRH 4J8QA 4NKOA 2DM3A 5CJBA 1TTUA 5HPMB 4G9FD 2B7DT 4OLEA 4ANKA 4PTTA 1JGVL 5IKCA 4Y4FD 4WI6A 3UZQA 3LPWA 3SDXB 1NAMA 2WLYA 3RIAK 1HSBB 4Z76B 3FQTA 4HFUH 3GMNB 1NCJA 2J5LB 3GI8L 4J3OH 3V8CA 4ELKB 4MA1B 1XMWA 1E9OA 1BQHB 3MUGA 1PAMA 5HVGB 4I7ZC 1AD0B 1UACL 2MCG1 3CNKA 1JGDA 4M5ZH 3S34H 4IS6A 3ZDXF 3S2AA 1E30A 1TQBC 2P5PA 5DRWA 3BT2L 4N28A 1TU2B 1N19A 4JW3A 1MW1A 1ZHLB 5DDHB 5CLZA 4O9HH 3VQMA 4WU7A 2OTUB 3G08B 2FEEL 1ZD6A 2VRQA 3FTSA 2DB8A 3IFNH 4PJCE 2OXGB 1VGEH 2NY0B 3FBKA 4PV9A 3FUJA 4PYGA 1TSRA 4ALAH 4UIKH 5DJDB 2LU3A 5ICZA 5E2JA 1R17A 1S7UA 3IRZA 3OGCA 4WW2C 4MNQD 5G5DB 3NIDE 4XBGA 3HE6B 5TK4A 5TF0A 3NFNA 2D7TH 2BINA 4I2XA 5E9DA 2J1YA 4R7LA 5D7JB 4NAJA 1AS8A 4YDZA 2P5WA 3DRTB 5D7LB 2PF6A 4E9XA 4PY8J 4NJAL 3BKJH 1TTRA 1HIMH 2C9AA 1J05A 3FC8A 4N5ED