2DTML

Thermodynamic and structural analyses of hydrolytic mechanism by catalytic antibodies
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
218
structure length
218
Chain Sequence
b'DVLMTQTPLSLPVSLGDQASISCRSSQTIVHSNGDTYLDWFLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN 6D9
molecule tags Immune system
publication title Thermodynamic and structural basis for transition-state stabilization in antibody-catalyzed hydrolysis
pubmed doi rcsb
total genus 48
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2006-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dtmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2dtmL01
1PKQA 3VXME 1RIHH 1H3GA 1XGPB 2XN9A 5GSRA 1JZ5A 2DLGA 4E42B 1NFDB 3NCCB 1DQQA 1K9TA 5E08L 4HQQL 3VI3F 3MLZH 4X6FB 3CU1A 4KUZL 4A2LA 5DJCA 5M94B 3PNWB 1JF1B 3STLB 4WVRA 2WIIB 1RJCA 1CF8L 2X1OA 3BN9D 1IGMH 2DQGH 4L4VA 3CU7A 5C0BD 4IIQC 2E7HA 4UNVA 2A9NH 4M5ZH 3BMVA 4EOWL 4P23D 1ZGLB 1NBQA 1OGTA 2VO5A 1MIEL 3BP7A 5ACLA 1U3YA 3TA3D 4PB9L 5MEQB 2DD8H 3DXAA 4OFYD 1DDHB 3HNTH 3VXUD 4QT5A 5D9SA 1AD9B 2WWKT 4WUUD 3MFFA 4ZTOH 2VSDA 2BSSB 4XCFL 4WI6A 3CVHL 1WWBX 3EOTH 2KH2B 3ZHKA 5A16B 5I71C 4OI8A 2ID5A 2JCCA 1EAPA 3BP6A 5IB3B 5ABDE 4LKXA 1FDLL 4G43B 4GXUM 4WHCA 2D4DA 4QHUB 4KV5F 2E7LA 4G6ML 4ZG1A 1X6LA 4Z7UE 4TVPL 4I77L 5DA0B 3QB7C 1RUML 4XPHL 3CDGA 1OP5H 2WBJA 5CD3A 2G60H 2V5TA 1OT2A 1RZGA 4WGWB 1BIIA 1I1YB 1P84K 2Y4SA 3JZ7A 1INQB 4LP4A 1VGKA 4U6YB 2AJYL 4XXDA 2OR8A 4PRDB 2B0SL 1M7DA 2DM3A 1LQSR 2X9YA 4OZ4A 3C6SA 4X5XA 3BQUA 2HH0H 4Z18A 4FFWD 4JGUA 1A2YA 4KI5E 1GHFL 1JPTL 1K6QL 4OBSA 3RAJH 1VGKB 4JFHE 4U6VH 1ZTXL 4KDTA 5DRWB 5ERWB 3I85A 5DVNA 4FZEL 4I13B 3RDTC 2FD6L 1F4YH 1O5DT 2FR4B 3IFPB 2UZIL 3WD5L 1A0QL 5HPMB 4PFEA 3T3MF 3D39A 4CRPA 5MERA 3C8KA 3UTTE 4FABL 3MOBL 4YZFF 5CBAB 1JFQH 3ARBA 3SE3C 2WBJC 3JV4B 2Q86A 4EI6A 3DUSB 3PQYD 1WC7A 3MLPA 2QR0A 1FFNB 5FA3A 1VFMA 3MJ8B 1T66C 3FQWA 4PTTB 2H26A 2CGRH 4ZPTA 3T2PA 1MHCB 4LK4A 3FFDB 1TIUA 2OTPA 1ORQA 25C8L 2JJVA 3V6BR 3MO1B 3MRMA 4MNGB 4D8PB 2BVQA 4RNRA 4GS7C 4U6XB 2B8OT 1T83C 1QEWB 1WWAX 4S1SL 4BFIA 2X10A 5EA0H 3V4UL 4OZIA 2ZUTA 2R0ZL 3Q3GB 2WQ8A 5E03A 3QSKB 3F6IA 2DQIH 5E6ID 2XY1A 3BZFA 4OGYL 3GGWB 1MFCL 3QDJB 5D2LB 4PJHE 4QXGL 5ENWA 4K3DH 4PJCE 3HS0A 4G7YH 5D72L 1NBVH 3Q6FA 1W8OA 5LWYH 1I9EA 4G43A 1ZT7A 4GMSL 5DMGD 3HMXA 3I50L 4W6XB 2P5WD 4MMXC 2VN4A 3JV5A 1YMME 1P9MA 3Q5YA 4P57B 2O61A 5I15L 5E94A 5I75C 1HH9B 4HUWA 4JFZH 4KXZI 5FYLD 2UY7A 4OLXH 2H6PB 1BLNB 4LIQH 3U2SB 5LKNA 4ZUWA 3BPCB 3PGCA 4OIBA 5DMIH 4YHML 4KRNA 2R2HA 5I71B 4TNWK 3HUJB 2G60L 4OLZH 1XF2A 2F74A 2XI9A 4X4XB 4APQA 4EIZC 4JPWL 4O51B 4NQEE 1DBMH 5DD6B 4P4RB 5T33L 1NGYA 3IDMB 3OL2A 2APXA 1FAKT 1MH5A 5JUEL 5DRNA 4J3OC 4HWBL 4F80A 1A6UH 4OQTH 4JFED 1A1NA 4M5YH 3OGCA 4EZMA 1IBGH 3C9NA 3PHOB 3EFDL 3TPKA 3MBED 4NC0B 4WW2F 1KEML 4POUB 1K2DB 2H3NB 3RAJL 3SOBH 4ACPA 2EKJA 3SKNB 3RU8L 5C70A 4FZ8H 1TETH 2WINB 3MV8A 5F89A 1VSCA 4RAUA 5KSBE 4YDKL 3NN8A 5DZNA 4U1NB 4KY1L 4IDJH 4B41A 4JB9L 3O41B 5AZ2L 1GIGH 1J8KA 2BERA 4Z8FH 4JFDB 4WWKA 4N0FA 4POYA 4HULB 3MCKB 2PXYB 2EDFA 3F58L 1UENA 5HHXL 3OBAA 3B2VL 5IHUL 3V52L 2VZ3A 1WFUA 5LGJA 4OCLC 3AVEA 3GM0A 3HE6B 2OJZL 3OTTA 5KZCB 4O4YL 4M6ML 4GRWF 3BOVA 4WGVB 4UU9B 2FO4A 2X42A 2GJZB 4KJQD 5KSBB 4ZNEA 1T20A 1ZHNB 2X4UA 3RDTB 4M7ZB 3KJ4B 3SE9H 4XWGH 3SJVE 3TZVB 2QL1A 1X6NA 1KCVL 2C1PA 3FQRB 3CDYA 1J1OH 2YPKB 3C2SA 3RA7H 4ZUUA 3HE6A 4GAJL 4ZNCD 4WFGD 1I1AA 4HXBH 1C16B 43CAA 4AIXA 1KLFA 5FUCC 4KFZC 1K5NB 3MNZB 1GZQB 2YN3A 3MTRA 4AEIH 3KYOA 2I25N 3ESUF 1JRHL 3N85L 4OUUA 3AS2A 3D39D 4GS7B 2XN9D 2RJMA 3SJVA 1CICC 3MR9B 4JDZB 2I9TB 1AGDA 4Z0XA 4DUXA 4LASL 4KK9D 5ADOL 3QI9D 2VITA 5BS0A 5JOPD 3DO7B 1GOFA 1U0QA 35C8H 3W39A 3AU1A 4YDJB 5EBWA 3TNNA 4OLWH 5AWNH 4WFEE 2JK5B 1LMKA 4XPBL 4Y8DC 2IEPA 1EFQA 4KHTL 1WSST 2B7DT 4JRXA 4LLVB 5F96H 1I1FB 3MOQA 3WHE1 1RULH 3S88H 4KJQC 1T2QH 1LNUB 2VLKB 2VUOA 3MRPB 3CLFL 4M1CC 4X8XA 5I1CL 4JM2D 4AIOA 1EAPB 5TGBB 1MFDL 2VLMD 4P23B 4FXKB 2GTWB 4PRPE 4OUUB 4RMWA 3S34L 1EBAA 3DNKA 1L7IL 4D0CB 2IAMD 4W4NA 2P5EB 3BISA 1I8LA 3NABL 2ZCLH 5DRZA 4N8VB 4QTIH 4M7KH 1QUNA 4MLSA 5GJTH 4LNRA 4GSDL 5K59E 4PJXE 4KTDL 3BEWA 3RX5A 4DVBB 3H42H 3DMMC 1L6XA 1DQML 4HCRH 3VG0H 5T5FL 1XCTA 1MHPH 3WXVL 1BVLA 4Z7OF 4HEPG 2OZ4L 2WSKA 3TNNB 4JM2C 4MAYB 4ZOAA 3PQYA 4QWWD 5KJRL 5L6YL 3DUSA 4I0PB 4WCYL 4JKWA 4PJAA 1P1ZB 1NLDL 1HXYA 2DWEA 4HGWA 4MB3A 3LCYA 4NIKB 4ONHB 3Q1SL 3A67L 1D5XA 4KDWA 3O6LL 3ARGB 3LQAC 1YNKL 4F58L 2E3VA 3BQUD 3IDNA 3DVNB 1W0VA 1QACA 3HTLX 4ZFGL 1Q8MA 1F6FB 2ERJC 5EZOH 5TH2B 2DBLL 5E9DA 4PJGA 2D03H 4KKBD 2VLKD 1UZ6E 4XCEB 3PWPB 1AP2B 5HGBA 4HLZG 3BGMA 4QHKJ 1XH3B 3TN0A 4AM0B 3BPNB 1MY7A 4Z7OE 2VQUA 3V79C 3QIUA 4G8GB 1FN4B 4LRNL 3TBTB 3ZYIA 4OTXL 2V6HA 4X5WB 2VZSA 5EBMA 4Z7WF 5EU4A 5E9DB 3PDGA 3JWDC 2EKSB 1WZLA 1V3MA 3QULA 4XMPL 4KKBC 5KSBA 1UKQA 3KWWA 5GPRA 3FTGB 1E27A 2F58H 4MXWL 5CD3B 4JJHA 3BQUC 3ROLB 1CGTA 4U7SA 3MLWH 5HYSB 1R3KA 4XXDB 1Q0XL 2QLVB 4Y19D 5GGTL 8CGTA 4PJGE 2I26N 5JQ6H 4YR6A 3D0LB 1DBKH 4Z76B 3IAQA 3SGDI 3X3GH 1MWAA 4M62L 5L7XL 4PRNB 2FZ3A 3O3DA 1YN6A 2ZOKB 3VDAA 5C1MB 4GXVH 3FO9A 2W60A 3HZMB 5F7LB 1RK1A 2L0DA 1YPZF 3ARFA 2UZYB 5IVXA 3OJDA 4PJFE 3OKOB 2QADD 4NOFA 2DTML 3O11B 5DR5L 5C3LD 1ZT4A 2H41A 4L3EA 1CFVH 1C5CH 1F4WH 4Y5XB 1HHIB 1H3VA 2DWDA 2KZ1B 5ID1A 4NQVA 4UV4H 4Y4KB 4MJIB 3G5ZB 4HMDA 4RISH 1FO0B 1SYVA 1SJEA 2CIKB 2HWZH 4X99A 3VDCA 4DAGL 5K9QG 4XC3H 4LCCC 3Q3GA 3JUYA 2AJXL 3C08L 4ORZC 4DZ8B 5F7UA 1ITBB 5D7LD 3NACH 4HS3B 3CNKA 2ICES 3O9WD 3LB6D 2DMKA 2DI7A 3MRHB 1RIHL 1OGTB 5FIEA 1MFEH 2BVOA 3J8F7 2X2YA 3KPRA 2ICWJ 4H1LB 1PD6A 1SJEB 1FZMB 1RFDH 4UQ3B 1SM3L 5CLTA 1F4XL 1IMHC 2FZ3B 4CU8A 3ARED 4L3EE 5K9KA 2KPNA 4CJ0A 4LLMA 3TGXA 4JY4A 5CZVL 1INDL 1J0HA 2B5IC 3MMEB 3OQ3B 1UA6H 5I74B 4LLAA 1E28A 4NRYA 5E8OB 3CSYB 1MF2L 4FQIH 1TMCB 3VCLA 4NN7B 3QULB 3ALPA 1JI1A 3K1KC 5FUCE 3GSQA 1HSBB 1YNLL 3U9UA 4NT6B 5I1KL 1XGTA 2ZJSH 2QJDA 1E6OH 4QHNA 3LEYL 1F13A 4ZTOL 1FN4A 1X5ZA 5GZND 1ACYH 4G3YL 3SGKA 4XP9H 2ZSWB 3LY6A 5KSBF 2I60H 2P24B 4QRTA 3H3BC 1IAIM 4AT6A 5DMJB 5EUOA 1TZGL 4KJYB 3PL6A 2OMNA 4PJFF 2BSRA 1LHZA 2A83A 1AIFA 1IGML 1XGYL 2DQGL 4Y16C 1DL7L 1QFUH 3QFJD 4C4KT 3MGTB 5GGTH 5HJ3A 5C08B 4Q58C 2NTSP 5ISZB 3G5XB 4LSUH 3MRFA 1Y6MR 2WBJB 2DQDL 1D5BB 1GAFL 3GB7A 1D3CA 4RGNC 4ZSOE 1P7KB 2Q1EA 2QQLH 4HMEA 5T1DL 1LILA 32C2B 4ZAKC 1KTRL 3SDDB 4JM2A 2Y6SD 1WZMA 1J5OH 5C0BE 3A6OA 4RZCB 4TNVF 1N3NA 1D5ZA 3RHWK 1AHWB 2YEZB 2DQJH 4LSQH 3O41A 5BQ7B 3L7FB 2F5BL 3B6SB 5F89B 3CGTA 1D5XB 1ZHBB 3JWOC 3C6SB 4FQLL 3ZO0A 2ORBL 5FUZL 5DEZA 4HH9A 3MPCA 3QUMH 2OBGA 5L6YH 3KPTA 3T2OA 5C86A 1A6VH 5HHXH 1JWMA 2QQNH 3HAEG 5C0BB 2QQQA 3U48A 2EXYD 3RZCC 4TUJA 3O6FD 3PGDA 5DYOA 4L4TE 3L95B 5H94A 4J3SA 2NY3B 4I2XB 2CK0H 4FQ2H 4DW2L 3SKUD 4Y4KC 3VG9B 4RAHA 3VWKB 4QRRA 2VL5A 1BQHB 1A7OL 2AXGA 2ATPA 1Y18A 4HWEL 5EA0L 3V4UH 2J88L 4FTVA 5I15H 5IB5B 4LIQL 2W65B 3MROB 5DFVC 1QQDB 1KJ3L 3I6KB 5EZLA 3EFFA 1OARH 3K0WA 4UOJA 1KJ2A 3QJFA 4I5BA 1N59B 3IRZA 1Y6KR 4J3UA 5JHDB 1JGVL 1VENA 4HIHA 4OCRH 2YA0A 4GQPH 4Z76A 2I27N 3REWA 4YBLB 1LEKA 5E1AB 1A6PA 1ZA6B 2BFVL 3CDFA 5EN2B 3RVUD 3DX8B 4NN6B 1EJOL 4PD4J 4PY7A 5INCB 2HRPL 5T3ZE 1OAKH 3OGOE 4PJXF 3BZ4A 1IGTB 3EZ8A 4N9GA 5I1AA 3ME0A 3G5YB 5JPMB 3GSVB 5DWUL 4FQ1L 1IGIL 3HI6L 4JVWA 2CRMA 4AIZB 1IAIL 3HE7D 4FQQA 4LCYB 3S6CA 1AXSA 5SWQA 1TCMA 4GBXB 5FF6A 5JORA 2YOCA 3PWJA 4PJ5D 5JW4N 2HFGL 5D1ZD 2X1XR 1IEAA 2XN9B 3DHMA 1W0WA 5TPWL 2HG5B 2AJ3B 1T1ZB 3MV7D 5L88L 1FV1B 3TWCL 3FO0L 1X5JA 4YHZH 3HC0A 3VFMA 2VR5A 1U8IA 5F96L 1K3ZA 3WE6B 2AP2A 3TYFA 1N64L 32C2A 4YK4B 1T2QL 3E6HB 5FHAH 3BRDA 3KJ4C 1IC5H 3SDXE 1J86A 1KB5A 3TZVC 4MA7H 4O2FB 4OB5L 2CKBH 2MSPA 3C6LD 5JIPA 3F7QA 1PZUB 5HGDA 1LE9A 1VACB 5J1AA 5B39A 5EC2A 3NIGF 1DSFH 3IJSA 3QP3A 5A2JH 1QYGH 1ZVHA 4FQPA 4JR9L 5E1HB 3PQYB 1W2KT 2LVEA 4U1KB 3DPBA 3LH2L 1UXSA 5DVMA 1XIWD 3SE8L 3PWJB 1JZ6A 3MGAA 5KOMC 3GMQA 3GSNB 2P8PB 3ARUA 5SWQB 2A6KB 4PJBE 5FECB 1WISA 4OD1L 4O9HH 4OZFH 4QOKE 1NCWH 4JFEE 1S9YA 4K2UH 4Y2OA 3VA2C 5BJTB 3MLRH 4ZOBA 1KJMA 3V7AG 2EDRA 2R0WL 3TC9A 2I5YL 4RFEB 3FQTB 4YEFA 2LAAA 1PZ5A 4JO2H 1BOGB 5I8CA 1UM6H 3MZTA 4PJCA 3ZTJG 2MPAL 3P0YH 1CGVA 1DN2A 4QOKB 5BS0D 4LSSL 4DFHA 5D8JH 4JHAL 2E5EA 2F15A 5C0AE 5TF1L 1UYWL 4YHKL 4EDXA 1VADA 4L5FL 1JGDB 3QCTL 3ORJA 4FHBD 1AGEB 3X12B 4P57A 4V1DB 4HXBL 1YY9D 1NMCC 2CLVA 1IAOA 2RFXB 1F6LL 5SWSE 2XNAA 2JB5H 1XF2B 4HLJA 4QOKA 4XPFL 5IROC 4D9LH 1Z0MA 2C4FT 5LGHL 5E7BA 1NUFA 4XI5C 4ZOEA 1EFXB 4GG6E 3VWKA 1NCAL 4BZYA 1H15A 5LBSL 1DBAH 1I8KB 1Z9OA 3IXTB 4RRPG 4J3XA 2IJ0C 4RX4A 1NCBH 1HXMA 1MAMH 4FFZL 4HKJB 5A2FA 1BJMA 5T1KA 1KSRA 3MA9L 1A6TA 2COQA 5IGXL 4PG9A 1BBJA 4WUUB 4JFQA 3QCVH 1ORQB 4RCAA 5C0AA 5KW9L 1FPTL 5L7XH 1AQKL 1BHGA 3LQZA 3O6KL 4MJ5B 4N0UA 1WAAF 1EHNA 1DBJH 2A0LC 1UM4L 4ISVB 3IDXL 2I9LA 3D18B 5FA3B 4R4BA 5HY9B 5DRXB 1YEEH 5KAQF 4OCMC 2C7UA 1I9JL 3CDCA 2BMKA 1U8NA 3VXSB 1TNNA 1IAKA 5B39B 1I3UA 1IAII 4A6YH 2EIZB 4UV4L 3GSOA 4OAWB 2IADB 3MV9E 3U7YL 3LMJH 1YJDL 2VJXA 4NQEB 1M71B 4OM0L 1NDGB 4PRHE 3O6LH 1FNGA 3D2UB 3VXOB 1PG7W 3QUZB 5JLZA 1OAQL 3QDMB 4ONFL 4Y5YA 1KJ2L 2A0LD 5E8EA 4Y0GA 2DIAA 3FOMA 3OJ2C 3C5ZD 1IQWL 4O02L 4PJ7E 5FGCE 5C0IB 1KG0B 1U8PB 2RQ8A 3IXAA 1RZFH 2P5ED 3MJ9L 1UCTA 5AYUH 4PJBF 1JMZA 5DRWA 3SKOA 1A1NB 5DDHB 4TVPD 1TVHA 5T1MB 2OX5A 4HXAL 2QHRH 1INEH 1T66D 4YGAB 3TH3T 5J1SC 3D69B 3MBEB 1UXWB 4G6AC 4IRSD 1KIRB 1EERB 2CO6B 1YEKH 2HRPH 2C3HA 3PABB 2XKNB 3LQAH 4ZO8A 3VWJD 1P2CA 3NABH 1ED3B 4HKZB 4NZJA 5F3BA 1XF1A 5KS9F 1JGUH 1IGIH 1YNTB 2X70B 4OZFG 3WKML 3BD5A 4L4VD 2BCKB 1KULA 4IOFD 5E00B 4N1EA 5DSCA 2FH8A 1ZEAH 3QBTB 4H88L 5LGKA 2EXWC 5F88B 3U0TA 4WU5A 3DX6A 4WO4D 1BFVL 4HIIA 1CGUA 4NDMA 5ACZB 4ZPVA 3WN5A 3OX8B 3HA0A 1NLDH 2RB8A 4HS3A 1YYLL 4IMLB 5FGBC 4LOUD 2R69H 4QXTA 1AGCA 3FN3A 3NTCL 3C5JA 1OQOA 3P2TA 3JWOH 5D71L 3KYAA 3N9GL 5CMAB 1MCLA 2GTWA 4OM1H 1AR1C 1M6OB 1MHEA 3QEHA 3UTZA 3D5OF 1AQKH 1DVFD 2J8OA 2C3XA 1QOKA 3HCVB 3HC3H 2D7TL 1MQ8A 5E2UL 4B7LA 4EUPA 2DYPB 3WIHA 1CE6B 1IAOB 2RFXA 3PP4L 4UUJB 1YPZB 1L4IA 4GRLD 5IMLA 5E94B 3L3HA 2W60B 3HZMA 5GS1C 4RRPA 1EZVY 2YBRA 4HK0A 1XGPA 3QWQB 5BZWA 3U1SL 4NFBA 4N0CD 2DL9A 2XRAH 3U7YH 1D9KC 4ODUA 3KXFA 4X6FA 3RKPA 3WKNA 3H9HA 1G7MA 4IBLT 5DJ6B 5E4IA 1NEZB 2QADC 5I1KH 1A4KB 1BM3H 3VGAB 4PBWD 1E6OL 2XWTA 3GIVA 2XG5A 4U1MB 1KIRA 1VHPA 4JY6A 1QSFB 1T2XA 4OZGF 1F3RB 4U6XA 1KB9K 1MF2H 4FQIL 5J56B 1MI5A 3OAZK 4LF3A 4NQUA 5DJ0A 4PJ8C 4RBPK 3RBGA 5DHYA 4LLQA 1A7RH 2NXZD 3KHQA 4M43H 1JNLL 3PL6C 3LKOA 4NHUB 5C0FB 3RTQD 4X5XB 3BGMB 1CFQB 4P2QD 4NSKA 4PRDA 2NZ9D 4MD5B 4WDIB 4XCCL 2P48B 4FQJL 4OGXH 4F33B 3KR3H 1NJ9B 1D9KD 2OTWB 4JHZA 3KDMA 4RGNB 3UO1L 3RDTA 4J12A 4KK8C 1YEFH 2W0LA 1H5BB 2VLKE 3SDDC 3FB7B 4TOYL 1BD2B 3QXWA 3LS4L 1HCVA 3O2DH 1A7QL 4Q0XL 1T6WA 2ZJSL 3V5HB 3DX7B 1J8HE 1HHKA 4PS4L 1CQYA 3FB8B 4PV9B 2DM4A 1ONQA 2GHWB 3VH8A 4PY8I 1YEIH 5IFJA 4V2CB 3ARQA 1FH5L 2HG5A 3M45A 2WUBL 3VGDA 1GH7A 3U7WL 5IESL 2IPUG 3S3SA 1IVLA 1CF8H 4UIMB 3OAYK 1CQKA 1BX2A 2Z91A 5IW1A 3L7EA 4ZODA 4DN4L 4OZFA 5CZVH 4L9LA 1GYAA 3BP7B 3ULVE 5FAAA 5I17A 3QUMB 1KIPB 4KKAC 1A1OB 1KB5L 1FJ1B 5AEAA 3ZDZE 2BVPB 3BXNB 4NQDA 3PP4H 3KLAB 3UJTL 1MCJA 2CQVA 3H8NA 2R1YB 4UNTA 3TH2T 2WIIA 2GAZA 3QIUD 4P5MA 4QRQB 2EC8A 3NIDF 2YXFA 5KVGL 3BH9B 3D87B 3HMWL 4UT7L 4D0DA 2O61B 3BX7C 5D6CB 1T04A 3BI9X 4J8RB 4V1DE 4HJJH 3MRRA 5I1LB 2A73B 4LMQI 1GGYA 5ICZB 1EJOH 4R0LA 4NN6C 2B1HL 3FQUB 4YHNA 3VRJA 4HZLB 1VKXB 1SVCP 1CGSH 3TF7C 2ZSVB 1PZ5B 5IR1B 5CEYA 3G5VA 2XWJA 4AENB 5JOPE 3DLQR 4NZTH 1FVEB 2D31A 3N1MC 1QZ1A 3FRPA 3O8XC 4WEUD 4JFXA 1WK0A 3NH7L 2QADB 1JIBA 1IFHL 5DJZA 4D9RE 2W9EL 4NUGH 1J9CT 3MLVH 4PJBB 1OAKL 5E2JA 3S37H 2GTZA 4Q7DA 2GT9B 2VNCA 1TZIB 1EEZB 5D5ME 3RWFB 1PYWB 4QTIL 4Q74A 3TIDA 2UY6A 3ZKQD 4N0YH 2UZXB 2YUWA 1XIWC 3ET9F 3SOBL 3B8SA 1XF3B 1XF4B 3S5LB 4I18C 2R56L 4G8FA 5HYEA 5JLZB 3WUWG 5HHQB 3RVXC 3U0PB 3QI9B 2BVYA 4X6CB 5EPMB 1LEIA 4LCWD 2W9DL 4NKDA 2VIRA 4PV8A 2YWZA 2HP4A 4MHHI 4YHZL 1TVBB 2FATH 3VXNA 1KN4H 2GKIA 3WFHA 2H2PC 5A43C 4P4KD 5EBLA 4YLQT 3TP4A 4NQCA 4JDVA 4K3HA 2J88H 3QISA 1IC7H 4X6EB 4PTUA 2CPCA 1JYXA 2EDYA 3S36X 3J7HA 4F58H 3OZ9L 1N8ZB 3L5JA 2MWCA 1JI2A 2ZUQB 4BSWB 4HPOH 3BRGC 2VWEE 3TV3L 4QRPA 2GUOA 2ICEA 4KRPB 4WEBH 4Z7WE 1KB9J 2XQYK 1DR9A 1Q0YL 3CMOH 1FNLA 3FT2B 4PJ7F 3N06B 1F00I 3BEWB 4OF8A 5HI3D 1LD9A 1U8KB 4R7NA 3WDIA 3OKKA 3GSQB 1PQZA 3PGFH 4KHXH 3S35L 1MPAH 1V05A 1DANU 3PIQA 4DCQB 4PYHA 1SJVA 5DUBA 1AO7B 4EKXA 3B9EA 1MJUH 2D7OA 5IR1A 2HA1A 5DD5L 4WHTA 5E70A 1I1FA 1GPOL 1IGFL 1X3DA 1XEDA 3AXLB 3L3KB 1MCRA 1RMFH 2CRIA 3MRDB 1A7NL 4JO1L 35C8L 3H0TA 2NTFA 2LFGA 2GSGB 3UXFA 4ZFOL 2YR3A 1JMXA 4YXLL 4XCCH 5IG7A 4FQJH 4IIQA 5CCKH 1R3JB 3L3KA 1IAMA 4O2EA 5FYKU 2VDQH 5EZIH 4YWGL 3QUYB 2V9TA 1MRDL 3B5TA 3OF6D 1AE6H 3IFOB 4L3CB 4Z7QF 3QDJA 3KPPA 5D2LA 4ENEC 1MJ7H 3VXSD 5CHNB 3QDGD 4LCIL 4U1JB 4PJEE 2JB5L 2MJWA 2X40A 4AQ1B 3O9WC 4R2GC 4WJ5A 4F8TA 2XACC 5KSAD 5C0DB 3ULUL 1JL8A 3KYKH 1KJVA 3NFNB 2ESVE 2PYFB 2IQAB 4L4TB 5FYLL 1XFPA 3VGFA 4WI5A 4S0TD 1JF1A 2DKMA 4X8JB 1I4FA 3DVFA 1FL6A 1I3GL 4GKSB 4LNVA 1RVFH 1KPUB 3EDJA 1EA9C 2JJSC 2J8UE 1N8ZA 4FP8L 1ZLWK 1F6AA 4R8WH 4G6FB 4R2GD 5DK2B 1PG7H 4HX1B 2WUCL 4Y19B 1GGBH 4I1NB 1QRKA 4MNQE 4G8GD 4X80L 1C5BH 3QA3B 1J1PH 2P7TB 3T0EC 1V7ML 4MZ2A 5L2KE 1T20B 2X4UB 1OF2B 1KFAL 3EYUH 4U1SB 3R06A 4F7CA 3GRWA 5D7LE 5IF0B 4HH8A 1B9ZA 2YPLB 5MENE 3QT2A 3NFPB 4HUVB 3MX0A 4Q9RH 5FKAA 4XP5L 4OQTL 5JHDD 4XZUA 3HN3A 1TENA 1A64A 1B0RB 5ETUA 5SWZD 4R26L 5E8DL 4GMSH 4FQHA 4ZYKA 1CT8B 4JFDA 4N0RA 5TJWK 5I6XC 1XF4A 1B3JA 4DGVH 2BNQD 4KQ3H 4U49A 3BPLB 2YPLE 5C0FA 4L8DA 1SQ2N 5C6PB 2FL5A 5KZCD 1KENL 4K8RD 4MNQA 3B2VH 4Z77B 2P5WA 4OIIH 5DZOA 4NPYB 5I0DA 1S78C 5EIQA 3SBWC 2PUQT 1J18A 1J7VR 4K3JH 5MENA 1A5FL 2AV7A 4NZTL 5IKCB 3V2AR 2HAZA 1D5IH 4R4NC 1KCLA 3T0WA 3VXUA 2Z4QB 2EC9T 3QDMD 1JGLL 2E9WA 2YK1L 1BGXL 4Z7QE 4FFYL 2J4WH 3VRJB 1AD0B 2QHLA 4YHNB 5B21A 2GCYA 1XGQA 2KQMA 1ZA3A 4PRIE 3WHXA 3QWOB 3MYZA 3MLZL 1OP3K 3P4MB 1H8SA 5IFAH 3F62A 5AD0B 3SCMB 3EFFB 4ZS7L 5H8DA 2FHFA 3O6FC 4ZUVB 4BZ1H 4CVXB 5JR1L 1JNNL 3V4VL 1DUYA 1S7WA 1CE6A 1DUZA 3IGAA 3VXRD 2XZCL 1B88A 1P4LB 4X5LA 3CFEA 5CD5D 1S9KC 3BYTA 3JVGC 4LCCA 3IDGA 5JXAH 3BHBB 3N1QC 3ZL4L 4CU7A 1N6UA 3GSUA 4Y5VA 5T5FH 2BNRE 3W0WD 1TTUA 2VDLL 1ZLUH 3GMPA 3IVKB 1RUKH 5B8CB 2Q3ZA 5GS1B 2AJSH 4AMKH 1RIVH 4LSRH 1NGWA 2RIKA 5JHLH 3IAGC 3I9GH 3DYPA 4MQSB 3KPNA 1A6WL 1B0WA 4OLWL 5EIIB 3FAXA 5GGRB 4HWEH 1A6ZA 4TVPE 2HLFC 2XKSA 3CLEL 3F12B 5CIPB 2VE6B 2VLME 1QP1A 4OLUL 1N3NB 3LAFA 1U6AH 4R4ND 3VGAC 4RGMB 2Y5TB 2X4NA 3GMNB 5GRVL 3N85H 2PCPB 5GISL 2WAHA 1CK0L 5IMKB 5GRUH 4PJ8B 4P46B 4LLWA 5HYQB 1TDQA 5E8NB 1K5NA 3MNZA 4EXKA 4NZRL 4DZBB 4EUPH 3H9SB 3K80A 3DWTA 3RVTD 2HJLB 4E41D 2XXMB 1GHFH 1JPTH 1K6QH 4JFHD 2GK2A 4GRLC 3MNWB 3QG7H 3QNXB 3DGGA 4LVNB 4QRTB 3FOMB 1ZLSH 4CADA 3IDIA 3HI1B 5ITBL 5J12C 2I60L 4XNXL 4ZUSB 4LLQB 1PW3A 1D6VL 2DLFH 1NGZB 3LN4A 2GK0B 2R1XA 4M1DL 5DZLA 3T0AA 2OK0H 1NBZB 4YJZL 4CNIA 1NDGA 2YZ1A 1R3LB 3LRSA 3QO0A 3MUJA 4H5SB 3QUZA 1MCOH 2CLZB 3DTXA 1R24A 4LPUA 4DKEH 2PYEA 3SE4A 1C5DB 5JDSA 1HE7A 5DJAB 4N8VG 3V6FA 3PWNA 3SO5A 4J4PC 2Y06H 4GAYB 4MNQD 2OR9H 4XVTH 1OLLA 4BZ2H 3L9RA 1H8OA 3FQNA 2IANA 1IKNA 5EU7E 4TQEL 4XCNA 3VXSA 4XH2A 3IAPA 3R06B 4F7CB 2P47B 1WZ1L 2BJML 5H35B 3ZE1E 5B38G 3KYNB 2VDRH 5ID0A 4WI9A 1U8NB 2PW1A 5T1KD 3AM8A 5IB2B 2FSEB 1C5CL 1F4WL 5A16A 4LFHG 1JF5A 4N0UB 2FX7H 1ZOXA 4NRXA 2OTUB 5F9OH 1S9VB 3LHPL 2E7BA 2ZKHH 4FNLL 2APFA 1MCHA 1Q72L 5CS7A 2MMXA 4I4WA 2AI0H 3ETBF 5E2VH 1QSEB 3NGBB 2H1PL 6FABH 4TSBL 4I9WD 1KCSH 1AJ7H 4GG8A 3BGAA 4TPRH 1ZS8A 1JPFA 5IJKC 2CJUH 3VWJA 3BWAA 1E4KC 3CFBA 5I1JH 1MFEL 4W4OC 2DL2A 3V6ZA 5KG9B 1QSZA 5HVGB 1MCSA 2MHAB 1WBXA 2BHUA 4BQ8A 2Q76A 3LDBC 4BQ9A 4JGMA 4PR5A 4X6CE 3QDME 5CINH 4Q97A 4RWYL 4GRWH 3O2WL 4NFDA 2JJUA 2YMXH 4OKDA 4LRNH 2FLRT 1MCWW 2C4FU 4I48B 5TE7H 3O4LD 3L1OH 2FYYB 4XMLH 1AGDB 3W0WE 3CFDB 3QUXB 2XT1B 2GFBA 2NX5A 1BFTA 3WO3B 2ADJA 3QRGH 4LKCB 5BV7B 1P4BL 4RGMC 3MRIB 3O4LE 2X4PA 5C0EA 1BOGA 2XTLA 4R6UA 1T03L 1RZJL 1KT2A 3NFSH 1CLZH 2ESVB 2OLDA 4MCYA 5LWYL 5F8RC 3C60D 3GJFB 4M62H 2DI8A 4WW1A 1MNUL 1JVKA 3TCXA 1ZAGA 4P46C 3UDWA 3SY0B 2AK4A 4I18B 2P8MA 3FFDA 1Y0LB 1TQCC 1T1YA 5MEOA 3MXWL 2XXCB 2AAVA 1NCUA 2CXKA 3GSWA 1WBZA 2P8LB 4YUEH 4M5YL 3MQIA 3ZKND 1DE4B 4PJDA 1YPZE 1CD8A 1CT8A 2OJZH 3VI3E 4LPYA 1WT5C 1XCQB 2J12B 3FB5A 1OHQA 3G6AA 3PJSB 4U1IA 3DVNA 1DBML 4LBEB 3BP5B 3MXVH 1OM3L 4XBEH 1Q9KB 3EDEA 2WK2A 4TULH 4O2FA 2CDFA 1WV7T 3RX7A 3F7VB 3D9AH 1CXEA 4XI5D 3WNPA 2IBZX 5T3XE 1A9EB 3I02A 1N4XH 1IM3A 1UJ3A 4JPIA 3TBYB 1KN4L 1TVDA 2GITB 4OZIE 2APTA 3RGVC 3QQ9C 3MNVA 3LRGA 4DOHB 2W07A 3TO2B 4U1NA 1SJHA 2I9LB 4JFZL 4JFFD 1JPGA 2XFXB 4WV1B 4A6YA 4DTGH 1XF3A 5C0CD 4OV5B 3W9EB 1U8HA 1AXTL 1F8TH 5I16A 5F21B 1U3HD 3OR6A 3HB3C 2IH1B 4X80H 3G04B 4C56A 2IAMA 3QIBB 1UKTA 3LEVH 4LU5H 3WS3A 4APQC 1OAXH 2DRUA 1NFDE 1H9VA 3BZ4B 4M7LL 1INEL 2EDEA 1Z3GL 4Z6AT 1JTPA 2R8SH 1RZ7H 3MV11 4Q9RL 3FFCD 5M95B 4LHUD 4OQTA 2O5ZL 5AUMA 1U36A 3CFCH 3RIAF 3WFZA 4OKVB 4R0LC 3IFOA 4ODXA 3IDUA 3LS5L 5AAMA 4Q9CA 2VQ1B 5TE7L 2FYYA 7CGTA 1NAMA 4Y5VC 5IWLA 3I3EA 4RDQG 3P9LA 3MRRB 3RNKB 3V5DB 4KQ3L 3PWLB 1TZGH 5I2IA 3QAZC 3QCTH 5J1TC 1FG2B 4X6DE 4J23A 3Q6FB 3IU4H 5IROA 4OZHA 1J88A 3CCHB 4K23L 5IJVA 3OKNB 3D2UD 2F54A 3G6JF 2E8YA 5HDBE 4KHTH 4KU1A 3KLDA 5K59F 2EYSA 2DQDH 3TBSB 5C07E 3PWUB 1HEZB 1NGQL 3WNKA 1YN7B 3QUXC 3KYMA 3PIQB 1T0NB 3O3BB 4W70A 2Z92B 3GI8H 4RMTA 1XZ0A 3QEUB 4Z7UB 3UTSE 2Y25A 4P2OB 4LEXH 4OCNC 4I4WB 5JMOC 3U36A 3K81A 3IJYA 3ILQD 2XQYG 1I1AB 2A1WH 3QFJE 3GSNA 3KGRA 3TV3H 4MXQC 1F90H 5LCVH 5C0RH 4NO2B 1E4JA 1IC1A 4L8SA 4LVOB 5FYJH 5D1QA 4MVBC 5GGSY 5EU7C 4F37K 1TETL 3RGHA 3ULVL 1AI1L 4LHUB 2NXYB 3NAAH 2V7HB 1FFPB 5CEZE 5T1LD 5J89A 1OOAA 3EUUA 2F8XC 4BH8B 4S0SD 1UJTA 2XTJE 2DI9A 2QSCL 5SV4A 4R8WL 5HGDB 3RVUC 2Z9TA 1GGBL 2FBJH 3VXPA 2V17L 1SVZA 4R4FL 1YYMH 4OSUH 4NKMA 1L6ZA 5I8EB 2YPVL 2ADFH 3W0WA 3U83A 1U8IB 5HHQA 3WFCL 4WENB 4N0FB 4NM4H 3DBXA 5D2NA 5IHZA 2CUHA 3JWNC 2AK4D 2HFGH 3T1WA 3RWGB 1CI5A 1ZE3C 3IFNL 4XMPH 4GKNB 2DQEH 5KOVC 2EEBA 4O58L 1MRDH 3CZFB 2ADIB 4WV1C 5DEGB 2GYSA 4NP4L 2CK2A 5KSUB 4XNUL 4QHNB 3U4AA 4OZHF 5MHSD 2FB4H 4U7KA 3QQ4A 3I6GA 4FG6C 1TCRB 5FUOH 3HZVA 3M8OL 4EIGB 4LLWB 4MJ4A 1T4KB 4GG6F 5DQDL 4APQB 2VKWA 5FB8A 1LK2A 3WIHL 1I9RL 1KELL 3SCMC 4EI5D 1CDHA 2H32B 1IQDB 2FJGB 4DVRL 3D3VA 5BW7C 4BZ1L 2IGFL 1B90A 3JV6A 3QZWB 4W6YB 2NY1D 3QCUL 1ZEAL 3RTQA 4J1UA 2GJ6A 5L88H 3FMGL 4XVUD 4OTXH 5HGHB 3O9WA 2PR4L 1A3LH 1G7IA 4EXPX 1C08A 3GI9L 1JHTA 3UJIH 2Q6WB 1N2RA 4JANB 5GRWA 1I75A 43C9B 5KANI 2AXGB 1VFOA 3TA3C 2NR6C 1RZIB 4NKIL 4XBEL 5K9OA 2VB5A 3DROA 1PKOA 1EEQA 2CRZA 2PYED 2R1YA 5EO1B 1KTKE 3QXDB 5I66A 4OLVH 1T5XB 3I9GL 4XX1G 2ED7A 5EOTA 5KVDH 1T1WA 2QQKL 5F1IB 1ZS8B 5FO8A 3T77B 3EAKA 3BP4B 3CFEB 1PY9A 3L3IB 1GRWA 1PEWA 2MOVA 3HNSH 3RY5A 4NKQB 4XTRC 2WBJD 1JRHI 2LAGB 1OWRM 1N2RB 4JANA 3VGBA 4RMSA 1S9VA 4C56D 2AEPH 1CD1B 1ES0B 3U0WL 1QRNB 3GSXB 3ROOB 4NRXB 3P9MB 5DR5H 2M8XA 2FIKA 3TPUA 4KI5D 1W8NA 1AHWA 1YECH 2YEZA 3VH8B 3CFJA 3RUGA 2ZP0T 4IS6A 1FLRH 4JJ5A 2F8OA 3KXFD 4YX2H 4GOSA 4Z95H 2VOTA 3HPLB 2HLAA 2ICCA 3OG6B 2V7NA 3W9DB 1SEBB 1A9BB 5FHBL 5C0GB 1RJYB 4LEOA 5E6YA 5EH1A 4BQBA 1RUPL 1R5IA 3QG6A 3HNVH 1MI5D 3LEXB 1WCBA 1KN2H 3IKCB 5GS0H 1G7PB 1NGPH 4OUOA 1U8OA 3QDJD 1FL3B 4P99A 4ZS7H 4GKNA 3FO1B 2ITDB 2EIDA 4KAQH 2EEDA 3U46A 2P46B 1GGIH 4G8EB 1ACYL 3DUUA 4FXGB 3MBXL 2W0FA 3QNXA 2B2XL 1GC1L 1VEMA 3RY6C 3STZB 3L1OL 1QLEL 2EXWD 3L5XL 4XHJC 3E0GA 4UT6H 1VFBA 1WZ1H 2BJMH 2SEBB 5JPNA 4PLOB 4U0RB 4NHCH 4U31A 3ES6B 2IALB 3LPWA 5CJQH 3MOBH 1KCUH 3VWKD 2R2EB 3C87A 3AUVA 3VJ6B 4OFKA 2VLJD 3V6OA 3TM6A 5MEPB 4F3FB 4QXUH 4DOHE 1P53A 1C1EH 4ONGH 5GRJL 2ZUYA 2A74A 1FH5H 2WUBH 4P5TA 3TT1L 3LN5A 4NRZA 3BPCA 1S5HB 4KRLB 5JXED 2EYTA 4HAFA 4XPTL 3SN6N 4EI5A 1CD1A 4FRWA 3HB3D 2LABA 5D2NE 5DTFB 1LVEA 5AG8A 3FQXB 2X09A 4NCC1 2QKIA 4MJIE 3VD4A 3IJYB 1CU4L 5HHMB 3TYGL 5I76A 2E7CA 1DLFH 5GQBA 3MLSH 3NZ8A 4LSUL 4PB9H 3CXHK 1P4IL 3K46A 4NQXB 3DVGA 1UCBL 2AV1B 3GK8H 3JVGA 3PGFL 4KHXL 3BHBA 1KNOA 4XCFH 1IM9B 1QR1B 2WBWB 2ZPKH 3EGSB 4ZXBD 3FOLA 4ODWB 2XTJC 3T1FA 1MREH 1F11B 3WN5B 2FGZA 5KN5A 1FFQA 3QG7L 2D0FA 4WHDA 1U3HB 3SGJC 3MGOB 4NNXA 4C56E 1CFSB 2AKRB 4PGEA 2H32H 5I1HL 4F7EA 1M7IB 3RNQA 1NFDA 4MA3B 3FO9B 4NWUL 1KLUB 4PJ5B 5CJ5A 1NBYA 3O2VH 5J9PA 3ARZA 3INUL 1AQDB 4OZGA 2Y5EA 3AC0A 1VFAB 5EU6E 1TJIH 4Z0XB 1MCOL 5BVJA 3V5KB 2CIIA 4MMZC 1G7LB 5EOCL 4YAQA 5IOPA 1CICA 2UYLB 3OPZH 4GRWB 1ZKAA 4JRWA 3HG1B 3P3YA 5ANME 4DFIA 2JIXA 2LV4A 4CKVX 2VR4A 1E27B 3KPSE 3FQNB 4M9OA 3ZTNH 5D5MA 1EIBA 2EE6A 3ARRA 2XWBB 3EYQD 4QCIA 1ETZB 3D69A 1NEUA 2Q3AA 1S7TA 4WHYH 4XXCA 4Y16D 4LPXA 5DT1H 5D1ZC 4Y1AB 1IE5A 5BJTA 1AKJA 3VFUB 1I1AD 4YHPB 4G8GA 4UOW0 3L3OB 4HBQA 2ATKB 3DI2B 4L29B 4K55A 4ZFOA 4R9HA 1B6DA 1VEPA 3WL9B 3GMLA 3K74B 4YHOH 3KPMB 4Q2ZB 4ZS6D 1JCKA 2AXFB 4LHJB 1BMGA 4M48H 4TTDD 1G7JB 4XT1C 3GJEA 5D71H 4JPKL 3G6DL 3FO0H 3QDGA 1DQDH 2V2XB 4OLVL 5SV3A 3WIFB 5FK9A 3RIFF 3K3QA 4M4PA 4HUXA 1SMAA 1ZANL 2VXSL 2FATL 4NQCB 5ECJE 5D5MB 2KZWA 1Q9KA 4TULL 4JG1L 4LLUA 1QA9B 4WY7H 2YD5A 1H3UA 4IOSD 4JLRB 4X6CF 2BNQB 2IBBA 3P4LA 1FQ9C 1IEHA 3SDCA 1J05A 3LVEA 4PGDB 4QY8A 4G9FB 2PTTB 1XIWA 2YHGA 4EVNB 4LLDA 5F3HA 4LSPH 5INDA 3EYOA 2GSIA 5D7IE 4Y1AD 2O26U 1HHJA 5H2BA 3HFML 4MJ5A 4P9MH 1EXUB 2FD6H 3M1BB 4KGJA 1UACL 2VH5L 4HV8A 3VMPA 5LQBH 4WNQA 2CMRL 3VFTB 1ZSDA 1BWWA 2Y1VA 3UJTH 5E5UB 4Y4HA 1T89A 3MRLA 3G5YA 4MXVE 2D7NA 4NZDA 2UWEA 1RZJH 1UG9A 4PP1C 1NCCH 3BRFA 2F5AL 2NW3B 3TBVB 3BPOC 4ZFZB 4JFFB 4KDVA 1P4LA 3GMMA 1E4WH 5CJXC 1ZLUK 3QAZB 1ZLVK 3H9SE 2YK1H 1FNAA 3H7BB 4TRPL 1ND0A 3HUJA 2HFEA 3MXWH 5J3HD 1JUFB 5F6HJ 2P4AB 5FFLA 5F93C 3AU1B 1CGSL 3PWVB 3X12A 4AEHL 1FGVH 3NA9H 2X4RB 4O58H 3JTTB 3DHJA 3RWHA 1U93B 1EHLH 4NP4H 2V9QA 1T80A 1EHAA 3E2HC 4LAQL 2AJYH 5TDPA 5DEFB 5I8CB 2HFFB 5J3HC 5FUOL 1KGCE 3P73A 3EYFB 5EUKA 5DQDH 5DUBB 5IM7B 4UDUB 4TUJB 5C0CE 1LP9F 5BV7L 4JHAH 4OCYL 2XZAL 5FA4B 2EH7H 3AREB 1LD9B 1U8KA 2P8PA 5DURD 3ECBA 2NXYC 1UQSB 5GSVA 5DF0A 3UYOD 4RQQB 3IDJA 1EAJA 3FB6B 1WUNT 4P49A 5HI5D 1FPTH 3FO1A 3IFLH 4ZSOA 5HHOD 4DN4H 2C1PB 3BDBA 1U91B 3CAFA 3EYQC 1BVKB 3WEXA 3SHSA 5ALBL 1DBAL 5IEHB 3SE9L 1UH3A 5ESAB 5JXEA 3SDDA 3T8XB 4LSDA 3HLAA 1F97A 3QHFL 4JO3H 2AABL 4NJAH 4WFFE 4JO2L 5DLMH 4DWHA 2Z35A 3PV6A 4K9EH 5GHWL 5C9JA 2H9GA 2UUDH 2YPLA 5F9WB 3HR5B 2CD0A 3NA4A 3L3DB 5IEHA 4Z7VE 3AS0A 5JO5B 1NANH 1LDSA 3I6LD 1HQ4B 5ERWA 1BZ9B 3HC4L 1OW0A 1A3RL 3QWRD 4GRMB 1JV5A 4YQXH 1S5IL 3FJTA 2VTFA 3O2VL 2HVJA 4N1CA 3NAAL 4NM4L 3WLWC 1ZHLB 2VLRB 4MQTB 4FQQB 4LPCA 1SBSH 5TDOB 1T3FA 3V0VA 5KVMC 1LK3H 5HHVH 4MS8D 3T0EA 5DQJB 2IH3B 3DV4A 2HFTA 3SY0A 3RPKA 1BIIB 1JK8A 4M9PA 4Z7VF 4OZIF 1XR8A 1K4DA 3AY4C 3IDMA 3PXJA 1LO0L 4TUKL 4Y4FD 4ESKA 5GS0D 5E8NA 3ILPA 3MRIA 4RFNC 4ETQA 1QRNE 5FKPA 5CEYB 3MLVL 4L1HA 5DMIL 4AK1A 4UTBH 4YIQA 4X7SH 4YO0B 3WS6A 1BFVH 3KXFB 1U92A 1A6AA 1FL5B 3CVIH 1KN2L 5GS0L 2HKFL 4GAJH 1NGPL 4GW5A 4TTGA 3VFNB 4YWGH 1RJZB 4LCWA 5HTSA 5ITFB 3QPQD 4PD4K 4X6DA 4KMQA 4TUOA 4UAOB 1M7IA 3RNQB 5HYJE 5JUEH 5CP3H 4H20H 4HKBB 1U3HA 3LKPB 5JW5A 3IDYC 2B2XH 3S35H 4RA0C 4M1GH 1LP9E 2P43B 5DHVB 1F4AA 4MX7B 1BZ7A 4JG0L 4ZS6C 4G7VL 4E41A 2ATPB 3IETB 3C5SB 5D7IA 2GJJA 2OP4L 1AC6A 4K94H 5LVEA 2YC1B 1KTDA 2AJXH 2XTJD 3C08H 4JZOB 1GIGL 1CBVL 2BVQB 1EDQA 2MQ3A 5GRXG 3LOWA 3V6OC 2X4SA 3EOBA 2WZPD 1NDMA 2YRZA 5IVZA 5BZDA 5L9DH 1A6WH 5CZXC 4L8BA 1A3LL 4P5TD 5DJ8A 4YH6A 5K9JL 1FVDA 3AREC 5J6HA 1JV5B 4OT1H 1OTSC 3QNYB 1Z2KA 4Y16A 4NO5B 3KPOA 2EC9U 1UZ8B 4GH7B 1NC2D 3BSZH 2V5SA 4PP2B 3ULUC 3K4ZA 3L3DA 5ICXA 4U1HA 1AR2A 1RUPH 5C08D 3WFEH 5ESQB 4M7KL 3F7VA 1BZQK 3WIFA 1U8MA 3MRFB 3WKMH 4MDIB 5A2KH 1E4WL 2J8UF 3B9DA 1RI8A 4X9HA 3CXDH 4XGZA 2OL3B 3CUPB 4JZNA 5F9WC 1RJYA 1CDGA 1G6RA 2VLRA 2F19H 2VXQL 5DQ9A 4EN3A 4FQXB 5C09A 1RJLB 4F15C 4MQ7A 4ODHL 4RMUA 5ESQA 1FORL 4XVSH 3UTQA 1YYLH 2Q7YB 3BD3A 5F6IC 2OL3A 3DMMA 3I75A 3RPIB 2DLHA 1S7UA 1XGYH 4Z7UA 4HK3N 4QYOA 2FJFB 1SYSA 4JM4L 3FHQA 1IJ9A 4NRYB 3SGKC 3JTSA 3BUYB 3BH8A 2XWBA 4ZO7A 1QBMH 2VWEC 4KMTL 5EU6D 1XF5B 4JHBA 2HKFH 2ARJQ 3GJFK 4U1HB 1T0PB 5ESAA 4OAWA 1RHHB 1TLKA 5F7EL 1HKLL 1NC2B 2WWKO 4KJPD 4AZ8A 4ZDHA 3DMMD 3EOTL 2DMBA 3BW9A 1H0DA 4JFYA 5SX5H 4IRSB 1PG7L 4Z7WA 3D18A 5CD5C 1KPUA 4AEEA 4GUPA 5J0BA 4JZJB 1LO5B 4PJCF 2ZCKH 1OT1A 5SX4H 3WJJC 4EUPB 1A6VL 3ALXA 2YD4A 4ODBD 1FBIL 1M1SA 1A6TB 3IVKA 4JFDD 1MHPL 3WXVH 1GOHA 4JZJA 4M7LT 3MRCB 1DANT 1H3PL 2HFFA 3T2NH 2NY1B 2P44B 4JRYA 3UEZA 3C5JB 1A7BA 2HN7B 4H1LH 4PJ8D 4YHYB 1U6AL 3WLBA 3WSQL 4BH7A 3FT3A 1J1XL 2V2WA 1EO7A 1FGNL 1PKQB 3BKYH 4KRMB 3BVNB 5T3ZD 1NMBH 1V5JA 5TDNA 2R39A 3PHQB 1FNSL 4U6TA 2Q20A 3BEVB 4RISL 3K1DA 2DQFA 2X4OA 5AAWA 4ZFZA 4M7JH 4PJHF 1DLHA 2XA8L 1YEJH 5HHNB 4P5KA 2IALA 2OM5A 1K8IA 1Q9LA 4LSTH 1SY6H 2ADGA 3O4OB 1JGEA 1NL0L 1TCRA 3ARYA 3VFRA 5CEXB 3CPLA 1YQ2A 4BSJA 3X3GL 3DSFL 3GJEB 3LKQA 1JK8B 4XTRD 5HDLA 1WIUA 5I9QB 4MXQD 4NUJB 2C9AA 3SKOB 4UDTB 1RFDL 4JQXC 3OMZA 3Q2CA 3GDBA 2F58L 3PUCA 4MXWH 2E7MA 1QSVA 1S7XB 5DJDB 3TN0C 3DV6A 4DEPC 1AXIB 1NH6A 4OF3A 3D3VD 4ZXBB 2AEWA 4LVHB 5BXFB 1ZGLP 4E9LA 1WT5A 1JPSH 3T0ED 1G7QA 5E95B 3Q6GL 4JQVA 1QA9A 4JFEA 4LOUC 2R56H 1EMTL 3LN9A 1K4CA 2L7UA 1CD9B 1JNHB 4NQEA 2VAJA 2FHCA 2XY2A 2OXHA 4DKFH 4RX4D 1G0XA 4MA7L 3W2DH 1F58H 2XWTB 5BOPA 5BO1L 2JIXB 3QDGB 3C8DA 1U58B 2VIRB 5JHLL 2OQJA 3ZHDA 2PW2A 2G9HA 5GGSA 3QA3A 3D48R 4ZD3L 2A6DB 4QF1A 4I0PA 1REIA 4GLRI 2ICWA 3HE6D 4G8FB 1HH6A 3SKMA 4HWBA 3TJHD 1JTTA 3SEPA 1K8DB 3EBAA 5CIPA 1BF2A 3PWUA 1ES0A 3GSWB 4KI1A 1MUJB 4UDTA 4CDGC 4HT1L 4LLYB 4NZUH 4O9HL 3L3GA 4IRSC 2QTEA 4OD1H 4MAYD 3IRPX 5DD3H 4JRYB 1FCGA 4W4OA 5EUOE 3GSVA 1SHMA 3KNBA 1S9XB 3VFSB 4XNZB 3WFEL 4KMLB 1QR1A 4ERSH 5D1XB 3UTPE 2CDEA 5B39G 5CIPH 1A7PH 1DLHB 4OV6F 5CINL 2HT3D 2GW5A 5JIHA 5TGBA 2VERN 1HZHL 2UVFA 4LHUG 1I1CA 1KXTB 4HIXH 1TQBB 2DQCH 4OCRL 3KXFE 1MJJA 3WUWA 2NY1C 3S4SB 3X11A 1X5YA 1ZTXH 5HGHA 1KLUA 1Q1JL 1EJ6A 2MCG1 3VU2A 1H3TA 4P2CG 4UINH 5C2BL 4HWZA 1MLBA 5ID0B 3OF6A 2W9DH 4F3FA 4D9LL 3SGEH 1NC2A 2HT3C 4BK5A 5FGRA 4BSVA 3HRZB 4MNGE 2IH1A 2XZZA 2Z8SA 1CL7H 1CFTA 1FZKB 1JHLL 1NC4B 4QHLB 3MV9D 3T4YB 1DQJB 5I1JL 4BFEA 3MUGB 3FQTA 4L9LC 4GAGL 1DVFC 1FFOA 3OKMA 2B1AL 5DYOB 3HKFA 1C5DA 4FFWC 4LPWA 4H26A 4UTAH 2VQTA 4XNQB 5EDXA 5GIRB 3VFOA 3O4OC 5IFHH 5AG9A 4BELD 2X4QA 1JZ7A 2D7QA 1ADQA 4KROD 1WVZA 1PLGL 5I9QC 5F9OL 1QO3B 2YWYA 2BDNH 3CUPA 2R29H 1JPST 1HINH 4X9FA 5D2NB 4ZAKA 3FQRA 1AJ7L 5J6GA 2VDMH 2X44D 4WWKC 2MQ0A 5DMGC 5HHME 1MCCA 3ARBB 1T03H 4ELMB 1RZKH 1VFBB 2VXTH 3FAWA 4S1QH 5DS8B 1V8HA 1KFAH 2HVKB 4KTDH 2FJHB 1P5UA 3FZUC 2FIRT 3JWDH 2OS7A 1WEJH 3QQNA 4NKDB 1NGXB 4L3AA 4PJHB 5FA4A 4I0KA 4ODTL 3UBXA 1NBZA 4NC2B 1UB6A 4WTZG 4UQ2A 4L8CA 4KKNA 1BD2E 3T04D 3S4SG 3DRQB 5CKGA 1ETZA 5HY9A 5KSVA 2FEEL 3BKML 4L8SB 4N5EC 1WTLA 3IDJB 3ZYJA 2VDQL 5EZIL 2P8MB 1S7QB 3SDAD 3DVIA 2YN5A 4LF3B 2B20A 4RFNB 1MRCL 4KUCF 4X0KB 3B8YA 2GIYA 5SWSD 1U3ZA 3P73B 4MWFA 4OIAA 2FWOA 1V3KA 2I07A 2YUZA 2ZG2A 2DOCA 4G8IB 1YMMD 2NY2C 1KEMH 3TJHC 1XGUA 4L5FH 1F3DJ 1KV3A 4UNUA 3QXVA 3V0WH 5D7JB 4YBHA 3H2WA 3RU8H 1JUFA 1L0YA 5E0QA 3H3PL 4KVNH 3QH3B 4TSAL 3H9HB 4KTEH 3LH2H 2X9WA 4PB0H 2Z31A 4Y1AE 1PAMA 5DMKB 1KCUL 3PXHA 2G75A 2E9BA 4K23H 1RUMH 4XPHH 5TPWH 3SKJL 4R90H 5CBEA 1OAYL 4MA3A 1ZT7B 5BMFH 4YC2C 1NCWL 4FMFA 3BYYA 2Z31B 3A0OA 5HGAA 3TT1H 1KYOJ 1CN4A 3NCBB 5E6IB 5FOJA 3QH3A 3BKJH 4X98B 2J8UA 4PRAB 4OB5H 3MLWL 1Z3GH 3X14A 2R8SL 2YXMA 5JA9A 2ZUSA 3CFBB 4Q6IA 3E3QC 4JQIH 4OM1L 1HN1A 4HUUA 1XR9A 1E4XL 4RNRB 2GY7B 3LB6C 1C7SA 4L9LB 5D7SH 2X41A 1P7QD 4JFFE 4LLUB 1T7WA 3HAEA 3QIWB 4ZUVA 4RA3A 1FRGL 1HINL 2AJSL 2DTMH 3F5WA 3BSZL 1DCLA 1ZHKA 2DLTA 3T4AA 3MRJA 2VLJB 5IVXE 3QZWA 1WC7B 4GW5B 5EIVA 3GKWH 4K7FA 1CE1H 5T3XD 5J6GB 4PRNA 2E27L 4JREC 1AC0A 2X1QA 2BSTA 4ZO9A 3VXTB 4CNIB 4HFWA 4N1HB 2AXFA 4YFDB 3SPVA 1VESA 4NN5B 1UKSA 2V5RA 5D2NC 3O3AB 3AB0B 1KJ2H 1JNHA 2OMBA 3MRNA 3SE4C 3FB7A 4HIEA 5DJAA 5GISH 3QUZD 1FE8H 3ARBC 1ZLSL 3R0MA 2E6JA 5CEZD 1A2YB 3VDBA 2R9HD 4JQXA 4S1SH 4FQCL 1QO3A 5IIEA 3MRNB 5DO2C 4PJDB 3U46B 1RZ8B 4PRIA 3VXMB 4JZNB 2YKLL 4CN1A 4YPGA 2Y23A 1NPUA 1D9KA 1DP0A 1UZ8A 2JJSA 1FP5A 4WW1B 1YY9C 4L8SC 3QNYA 1HSBA 3QEQA 3U9UB 4D9QD 3D0VB 1QFWI 4S2SB 4XC1L 1S8DA 1AQDA 4OZGB 3ALWA 5IBTH 4HUVA 1QPPA 4PY7B 1T7VA 3BE1L 5FYJD 5IVZB 4QHUA 5SWZA 4FFYH 3ARVA 3C60A 3DURB 4YDLC 5JZ7D 4WTWA 3L5IA 2W59A 3WEXB 3BDXA 5DK3A 4NO0D 5D7JC 1D6EA 4PJEA 1MVUB 1O7SA 5IG7B 2OJEA 3RWIA 1YEEL 1J87A 3CC5B 1IGCH 4DUVA 3VI4E 1FL6B 5A2IH 3MFGB 1BD2D 25C8H 2IAND 5GIRA 4M6OL 2QQKH 3TH4T 3QCVL 1UWXK 1QVOB 4PGCA 2V17H 1I8IB 4G6JH 3LMJL 3R1GL 5DJXA 1S78D 1HDMB 2BNRB 1ZGLA 5I75B 2EO1A 5F7DB 2OJEB 3NCJH 3VXMD 6FABL 3CJJA 5GGVL 4X99B 4WUKL 1WZKA 1N0XH 3G08B 3U82B 3VH8G 1PX3A 1QSFD 3C60B 2WIMA 1V7NL 2EYRB 2R2EA 1MWAH 3GKWL 2Z91B 5IW1B 1EBPA 3HMWH 4U6HA 5D7LA 5FB8B 2FCBA 1K8DA 3LSOA 2I07B 3RX8A 3RWIB 3AY4A 1ZWIA 4WO4A 4P5TB 3RZCA 3U79A 5DMKA 3ULUF 3LV3B 2MTPA 2WWMD 3HMXL 3REVB 4ODVH 2E6QA 3F65A 4F7TB 4HF5H 3OAZH 3MRGB 4GJTB 5EWIH 3U9PL 3ZKXB 5IMOA 2B4CH 1NMBL 3W5NA 5JQHC 3PDDA 1CG9B 1UA6L 3ZHLA 5EUOF 3L9RB 4XNMA 3GO1L 3HZVB 1NCTA 4G5ZL 3QIWD 4Y4KD 5F7KC 1U2HA 5CSBA 4NWTL 1J11A 4KVNL 4UILL 1ZT1A 4FTVE 1J0KA 4KK9C 5D6DC 3BIKA 4DEPB 3T3PF 1KPVA 5JO5A 1TVHB 4PUBH 4LVHC 4AEIL 1M05B 3HE6C 5FOBA 3GMLB 5DC0A 4KRPD 4QRPB 1WBZB 5ANMB 3LIZL 4L29A 4LARL 4YDVA 2N7BA 4M7ZC 2VZ1A 3UBXB 4MNHB 2UV3A 2BSTB 2P49B 4XC3L 1M7XA 4XRCB 2F8VA 5BOZG 2ZUUA 3VXOA 1ZT1B 3REVA 3LPFA 4YHLH 4M03A 3PHQA 5HDQH 1JHLH 4JN2B 4M6MH 2KBGA 1BFOA 3WFHB 2FLBT 1XGRB 1OF2A 1JN6B 1D5MA 2F53B 3OAUH 5LJYH 2P7TA 4AH2A 4NCDA 4EBQL 4HW6A 3VFMB 3I3BA 4LQ1A 1MCFA 3OZ9H 1A3QA 1OSPH 3BP4A 2DJSA 2Z92A 3JWOL 5EUKB 4HPOL 1CWVA 5D6DA 3RA7L 4P3DB 5C09D 1GVIA 4YDLB 4Y4FA 3IF1A 1P7QA 1A6ZB 3CK0L 2UWEE 3R1GH 5GGUA 4TTDC 4HG4K 2Y36H 2BFVH 4P2OA 4HKXA 3HFMH 3GKZA 3LZFL 5HGAB 2D7PA 4OZHB 1KT2B 5I1DA 4JRXD 2VUYA 1F02I 3UC0H 3WFBL 1YEGH 5C0DA 2R1WB 2DJUA 5JOFA 5K93A 4P59H 5L2JB 3VFWB 1FFRA 5DD3L 4M8VA 1B0GB 3JV6B 1VFUA 3SO3C 1BZ7B 4JCLA 1T83A 1ZA6A 4YHIA 2ZSVA 4MA8H 3QUXA 4QNPF 3TJEH 4NOBA 4IMLA 1HYSD 3GHEH 4YUEL 1XGRA 1QHPA 2ZOLA 3EDKA 3VFWA 4MJ6B 2JK5A 3PWVA 1Q94B 3THML 1X5KA 3P9LB 3V5DA 1VGEH 1KYOK 1F2QA 1T22A 3QXUA 2NW2B 1BP3B 3WMSA 3DURA 1DVFB 4F7PA 1BQLH 4ODWA 4P5TC 3DMMB 3N1PC 3T1FB 4YZFE 1N6QH 4MNHA 4UT6L 4DKFL 5BRZD 3B5HA 3WJJA 4ORGB 2IMMA 4NNYB 3N0PB 5JPNB 3JTSB 3SDYL 2X05A 3CFCL 2BP3A 5B38A 2C1OA 4XMKL 3JV0A 2DS4A 2UWEF 3MJ6A 3NFSL 3SDDD 5KVFH 3KVQA 2HT4C 1CLCA 1CTNA 1NLBH 2H45A 1DQMH 3W9EA 3ZKMD 2VAAA 2GSIB 4M48L 3IU3B 4HIEB 5DS8A 1KIQA 4JY5H 4S1RH 2G5BB 3ULUD 2CUMA 3ARGC 3K2UH 5IIEB 4NCC2 2EDJA 4OLZL 2V2XA 5E8EB 5HYSG 5JHDE 5KJRH 3E8UH 1ZANH 3SE3A 1HHKB 3U4BL 1NCBL 4LEOB 5DGQA 5IK3B 1OB1A 3VFPB 3WFCH 4PG2A 5HVWA 4YE4H 1O7VA 4XVJL 2ZUXA 3MXVL 4NM8L 2X7LB 2FJFA 5KW9H 4FFVC 3U4EB 3BP5A 2VXVH 3KJ6H 3W82A 4KGLA 5KVGH 1G7MB 5ELIA 3KDMB 4HUKB 4Y2DD 1EPFA 2C1OB 2QEJA 4WEMB 1CICD 1RJLA 4XNMB 2G5BA 3BQUB 5CWSA 3V52H 1R5WB 1RU9L 2ESVD 3MLUL 3UC0L 3WFBH 4BSVB 1G6RH 3WCYA 2NY2B 1BBJB 4UB0H 1MI5E 1YYML 1S3KH 4WI8A 1ADQL 3D39E 4OLYL 3MLRL 2BXZA 1YN7A 1RSFA 2Z8VC 3SDXB 5EO1A 4PR5B 2FB4L 5FYLE 3VFGL 3MMEA 1GC1C 4MJ2A 3WUWB 1IGYA 1SMOA 2F54B 2Y5TA 1I8MA 5T3XH 3LKNA 2BOCB 3MJ7B 1DBJL 1T22B 1I8LC 3FRUB 4BKLB 1AH1A 1FZOB 4LGRB 5D7JA 4K8RL 5GJSL 4X4YB 2UUDK 5IV2B 3CVIL 3BP6B 3UX9B 1JWSA 3GBLA 1T2JA 3FN9A 2YSSB 1HHGB 5EFIB 4PJ9D 3B4NA 1YNLH 3NZ8B 2X4SB 4GW4A 1IGYB 1IBGL 5FYLH 3C8HA 3M8OH 1CFNB 2JE8A 1R5WA 2DM2A 1N5YL 2OTUA 4OSUL 3EYVA 2FWOB 3KPRE 4FQXD 4P3DA 4XP4L 5DJXB 2IAMC 3LN5B 3PDOB 2AQ2A 5FYKD 3SKMB 3DO3A 2VC2H 1KCVH 1BJ8A 3QIWC 1I7RA 1OLZA 3VMOA 1J1OL 2R4RH 3MBEA 3VI4F 5F44A 3UTPD 3MNVB 2AJVH 4DQOL 3FB8A 4PV9A 3I02B 2ZNXA 2ARJA 4L4JA 5I74C 2M26A 1XF5A 3RIFK 3WJLA 4JREB 4IMKC 3GIZL 1S7SA 1U41A 1HH6B 5FM5O 3VFNA 2FDBP 1J05B 4Y5YC 4YDIH 2JJTA 3L7FA 2AABH 4ZDHB 1YN6B 2ZOKA 5EO0A 2OCFD 5IHZB 4F2MA 3RL1A 5IEKB 5IHLB 4J7RA 3D2UA 2ED8A 2OTWA 5E5MB 4GT7A 1LK2B 5L8KB 5EC2B 5ANMA 1FAIH 2VDPH 3LKRB 2NZIA 1ROWA 5D72H 2A6IB 4JFPB 3QUYD 3HNSL 3FB6A 1IGFH 4KZDL 2EH8H 5GS2H 1Y0LA 1NQBA 1FO0L 4Z0BL 3RPIA 3HI5H 1BVKA 5E4EB 1YEHL 4WTZA 4RMQA 3QCUH 1NSNH 3OXRA 4PJ9C 2XV6B 3DV6B 3HNVL 4EN3B 2KL6A 1FGVL 3NA9L 5D1QB 2E6PA 1MHHB 3ZT6A 4XP1H 1UC6A 1A4KA 5IMOB 1HOCB 5D7KE 1D6VH 2DLFL 4X98A 3NTCH 3VFOB 4LCYA 4E0RA 4F7TA 1MLBB 3GJFH 3CPLB 5DJZB 5B3JF 1RMFL 2VABA 2YKLH 1VERA 2JJTC 3RVWC 4B50A 2FGWH 5EZOL 4PJ8A 2JF1A 4H0IA 1GAFH 1FZKA 1NC4A 4KQ4L 4N90E 1K3IA 4O51A 4D2NA 2BY0A 1CICB 1G9NL 2OSLA 3BWUC 3DGCR 4WO4C 3MJ7A 1A1MB 5DJ6A 4D9QE 1U8QA 2DDQH 3OKLB 3MRQA 5IVXF 3BEVA 3W2DL 1SEQL 4QRRD 1X44A 1I7RB 4PJDF 3FOLB 4NO0A 5J6HB 2R0KL 3MRJB 4IIQB 3P9MA 4K9EC 1HSAB 1QNZH 2NY3C 5CJBA 4HMCA 4O2CA 2IPUK 4TVSa 1UQSA 1S9XA 1E6JL 4Z7NE 3KPNB 1DN0A 3GRWL 1A0QH 1HWGB 3AXLA 1YJDC 1N7MH 5GS1A 5CSZB 3FQXA 1XZ0B 2J5LB 1Z5LA 4G6AD 5IW6B 1KTDB 4JZOA 4FFVD 4NKIH 3NPSB 4HT1H 4JPVL 4P23C 4X6DB 4DZ8A 1PY4A 1QBAA 3Q5TA 1E0OB 4J1UB 3KAAA 4NQXA 2NY0D 4LCWB 3DRQA 4WFGE 1J0ZA 4WW2B 1RIUL 3QEGH 1NUNB 3RVVD 2DD8L 1PQZB 2DB8A 5IFAL 4UZGA 5H35A 4C56B 1U8QB 1EXUA 2Q6WA 3STLA 4HKBA 1EO8L 5I1IL 2X4RA 1QRND 3AM8C 4PLKC 4PJ5E 4LPVA 2QBWA 4KKLD 3U30C 3DUHA 4XPAH 3RTQB 3BUYA 4IRJC 3V4VH 1LK3L 4N0CC 1IKFL 4QYOB 5C0NC 4G9FD 2NX5D 1QLRA 1BVZA 5CSGA 3BZEA 1A5FH 5HDOA 3MLXL 4RZCA 2VLLA 5DQJA 1S3KL 5DT1L 1HOCA 5IBLD 4PRBB 3GK8L 3WLWD 1WIPA 3CZFA 4TVPH 4S1DD 4HKZA 2D4FA 1A7QH 4Q0XH 3EYSL 3VE0B 1S7XA 4KKAD 2MQCA 5FOBB 1CXIA 2OYPA 2VDOH 1YEHH 2VABB 4PS4H 4LSTL 4PV8B 1G6VK 4DKAA 1CYGA 5LG1A 3QIBA 4M6NL 4N8PA 3U4EA 3OHXB 1CTOA 3WUZA 1AKJB 2EECA 3NPZB 3VFUA 2C3WA 3GMRA 4BK4A 2BY1A 2NY6D 2XOTA 4X9IA 1W0WB 3OKDA 2EDQA 3P30H 5JXEC 4WV1A 4ZFOB 4PGDA 4QY8B 3HLAB 1AFVL 4MCZA 1EVTC 2ILLA 1INDH 2UYLA 1DLFL 2MPAH 3P0YL 1DVFA 4F7PB 3MA7B 4OGZA 1JPSL 4EQ3A 3SJVD 4JJ5B 2BRQA 3TZVA 3IJSB 4HWBH 4PJGF 5I8EA 5CEZH 4XBPB 4ELMA 1WF5A 1ZHKB 4NZRH 4EQ2A 3NCJL 2ZPKL 3ARGA 2V2WB 4PRBA 2R2BA 4GW1B 5E5MA 4XXCC 5ESVA 1CFSA 5HDQL 4JDTL 4PP2A 4IMKA 4F2MB 4PUBL 5EZJA 1MLCA 3FQUA 3DYOA 3LHPH 3P4NA 2NY0B 3KS0J 4LCUB 1ZWIB 2E9JA 1NC4D 1Q72H 4WO4B 5D70H 4KJWC 3GRWH 3KYMB 4UQ3A 1JWUB 1GCFA 3EOYG 1R5VA 1U8JA 1MAJA 4FG6D 2AXJA 3QXDA 3PL6D 5EZLB 3ILQC 2XIDA 1ZK9A 3EJZD 4PGCB 3SDAC 1RZIA 4CGTA 5K9OB 4JO4L 5EWIL 4P5MB 4Y5XC 3Q48A 1CK0H 2VL4A 4HGKC 3SO3B 2ITCB 4MDJA 5M7QA 4NNPH 1U8JB 2D0GA 5F1IA 5FO8B 4PJIE 5I0ZA 4QRRB 3CC5A 4LGPB 1A1OA 2EDWA 2IQ9L 2R0WH 1IFHH 4QRPD 2QSQA 1L9MA 3HZYA 3DX8A 4LL9A 4M00A 4XVUC 1A6AB 3RUGE 1GZPA 5D96B 3TFKD 5FV1L 4GW1A 4NKOB 3LS5H 1Z6JT 5IMMA 4K3EH 4H0GA 5CBEB 3KR3L 3LQMA 5IV2A 1BQLL 2YA1A 2OK0L 4LAQH 5GZOC 4OLXL 4S2SA 3PG2A 4POZC 3B5GA 5GSRB 1ND0B 3EO9H 5TE4L 3ULSB 4UINL 1FBIH 1S7VB 2H32A 1CXLA 3HS0B 1RV6X 1AD0A 4NPYA 4PJIA 4K3DL 2VL5B 2HMID 2DAVA 4O02H 5BRZA 1CVSC 3GB7B 1NEZG 3K4AA 3V4PL 4DN3L 2LQRA 1G9MC 1SYSB 4GAGH 3TN0D 1XR8B 1IGJB 3TVMC 1HKLH 3WV0A 3OHXA 2DLIA 2IH3A 3DV4B 1OARL 1KPRA 1GXEA 1T1XB 2FX9L 5ESVB 4NC1C 4KK5C 1LE5B 3OJVC 1LO4L 5TQ2H 2DQUL 1NCDH 3QIUB 1JNJA 2GJ6D 1U8PA 4HK3J 2HMIC 3RY6A 1J0JA 5HHNA 1FNEB 2DLEA 1J0IA 1UACH 1B4JH 1NGXA 1GOGA 3WXWL 4R96B 5BO1H 1I7TB 3V7AE 5TQ0H 4R3SB 4PJGB 2UVEA 4HPYL 4JPVH 3MREB 4NQCE 3GNMH 1EK3A 4AL8H 1AGFA 2Z31D 5EO9A 3ARTA 1CIUA 3LKRA 4IOIA 3I50H 1OD7A 1WJ3A 1KB5B 3QUML 4HCRL 3VG0L 4F57L 3U6RA 3KHOA 5CUSL 1P6FA 5F1OB 2EZ0C 1A02N 3U36B 4HFUL 4QGTA 2FO1A 3G08A 1AHWC 4GQ9L 4H26B 5F72S 4CL7A 1J12A 2YMXL 2LU7A 3O45A 5D1ZA 3T4AB 3ZKNC 1JGEB 2VLRE 3ZE2E 4N5UA 1EVUA 3CFKA 3C5SA 4UOW1 1YDPB 5E2TL 2BRRL 5DUPL 5K33A 4CW1A 3TBSA 3L3OA 3WDJA 3KPRB 4EDWH 1G7PA 3RWCA 4YDIL 4ODSH 4F9LA 4PGZA 4DVBA 2F9BT 3H3KA 5SWSB 3EO1A 5IM7A 3S3JA 3QPXL 5ADPL 4UTBL 3BDYH 4JFXB 3QFDB 1F58L 3ZTJH 5DXWA 5T3XL 1L0XA 2V2TB 1QBLH 4QTHA 5I66B 4NKOA 3HG1A 2L4OA 5A1AA 1QFPA 1O0VA 4TUKH 1WBXB 3C09B 4WI4A 3RVTC 3UCRA 2FHBA 1I3GH 1MCPH 5SX5K 2ZG1A 4L3EB 2F53E 2HJKA 4QTHB 5J9PB 2NY3D 1OVZA 2X1PA 3UZEA 1G1CA 1SBSL 4MJ6A 4JG0H 2NZ9C 2XQBH 3D0VA 5EIIA 2D9CA 4N8CL 5ALBH 3EHBD 1MEXL 4QRPE 2JJWA 5IP4A 2IAMB 1UFUA 1RUAL 2VXUL 4LASH 5ADOH 4EI5B 1JNLH 2YD3A 1J5OL 5JTWA 1UM6L 1OP3H 2EIBA 2AK1L 2JLLA 2HYMA 5EULV 5GHWH 4FQXA 4MAYC 5C09B 3EO1B 4JQIL 4Y4FC 3MRQB 1NKRA 4F7MA 1UWGL 2F53A 4KKCD 1DQTA 5TDOA 4Z9KB 2AS5M 4GBXC 4PRHB 5B3NA 1KCKA 2PNDA 2DICA 4LLDB 2K9UA 3V95A 3MREA 2CDFB 5I18H 3B6SA 5ISZA 2DTSA 3CVHB 3WYRA 3P11H 4DAGH 1G0DA 1R3LA 1IM3B 3QIBD 4K7FB 2HVKA 5IESH 3OXSB 1U8LA 4QRSB 3RVWD 3UTTA 3H9ZA 1DE4A 3PWNB 3QDJE 5D2LE 3V8OA 2BVUA 3FTGA 3C5ZC 2EDXA 2P24A 1UWXH 4D0BB 4PJ9B 1T1XA 1LE5A 5FHBH 4K9EL 2LE9A 1AXTH 1F8TL 4WI3A 1EV2E 4QLRA 4YXKL 3WFDH 4PIRF 5I1EH 1V3LA 1X4XA 1IM9D 3NVQA 3ZE0E 4UDUA 4Q2ZA 1S7TB 2IG2L 1U8MB 2VLRD 4ODSL 4M7LH 5DHXB 5BRZB 3OXSA 1IZJA 4NGHH 2R29L 2EZ0D 5JW3L 4GKSA 3GMOB 4P3WA 1NFKA 4FOMA 4GXUN 4P2OD 4BFBD 3LKQB 1QBLL 3FCTA 1T21B 4KI5C 4HZLA 5I8KH 3H9SA 1LO2H 5DWUH 5I1LA 1KJVB 4I0PD 2VE6A 1FIGH 1VCAA 4K94L 1P7HL 2RAMA 1IAIH 3T4YA 5D7LB 5T5NG 4X6DF 5IF0A 4OD2B 5TDPB 2C3VA 3FRUA 3JUZA 3MRGA 5F1NB 4HIJA 1R3HB 5JQ6L 3RKDC 2EE2A 4JY4B 2ZUWA 1I8MB 4U3HA 4BJLA 3CFJB 2YD2A 1B0GA 4JPWH 3C09C 3MLTB 1FORH 1Z9SA 1NBYB 5DJ8B 4G8IA 4MLIA 5HVFB 4N5ED 2DDQL 5D6CA 3IDGB 5IMMB 2L7JA 4JFDE 4PGEB 4PLNC 3TESA 2J5LC 2QHRL 3S8WA 2J8UB 4PRAA 2APWA 4GG8B 3MFFB 4X7CC 5EU6A 5KVDL 4LVEA 2J6EA 2JB6A 5CGYC 2EDDA 4XP5H 5CZXD 4LNRB 4AL8L 2Y72A 3O3BA 3RY4A 4TUOB 1HDMA 1JGUL 2BNRA 2Y36L 4XWOD 2YD7A 1P9MC 3MLTA 3WIHH 1G9NH 2X89D 1I8IA 5CMAA 4XBGB 3P4NB 4F57H 4ZUTA 4LSQL 4EI5C 3KPLB 4HFUH 2YUVA 2HJFA 5DJYB 4JN1H 4H88H 4LSVH 4AG4L 5CILL 5JW5B 4LDLB 4P3CH 1CZ8L 4L9DA 4C57C 3HR5A 2B5IB 2FJHA 2KDGA 3ARFD 4Y4FB 4ZFFA 2DM7A 4OFYA 1G9ML 4YFLF 1AGEA 2GUOB 2ICEB 4KWUA 3VD3A 4NN7C 1FL5A 1P6AB 2A6DA 4QF1B 4AH2B 1W72L 3KYNA 1DQLL 3FB5B 2PETA 4ONFH 2YRLA 1M4KA 2HTKD 1HCFX 1ZGLM 4DW2H 3RP1A 5F3BB 3SQBA 1LE9B 1I9IL 1IARB 2ITDA 3D39B 4XP6H 3K8LA 1K4CB 3G5XA 1K4DB 3H3PH 1EO5A 4U1GB 2XA8H 4G5ZH 3O6MH 1FYHB 1OW0C 4XRCA 5DHYB 2MFNA 5D1XD 3LRSB 3OG4B 4G42B 4HS8L 2NXYD 5DEGA 3C5ZB 1URLA 4K7PH 4PRIB 3GHBL 1NAKL 3VFRB 3ARGD 1OAYH 3IDNB 3HI1A 4HJGA 3GUTB 3GBML 5HPOA 1DQJA 5B4MD 1FNSH 4G6MH 3SPVB 2DQHH 3VMNA 1NCAH 5IK3A 4KZEH 4DUWA 4I77H 1G7HA 2A9ML 4XCEA 1NEZA 1TTGA 1FIGL 1CLOH 2NY7L 4NO5A 4PJAB 2JCCE 2Y6SC 4PREA 3TNMB 3MBEC 3RUGB 1AFVH 4NBZB 5CAYB 1ITCA 2FX8L 2VLJA 4J2XA 1PX4A 1F6AB 4JO1H 3T2NL 3W9DA 4QXUL 3VFVA 4MAUH 1F3JB 3FFCE 3DSFH 4U6HB 1RURH 2AKRA 2NY0C 3WLBB 4PJXB 4UUJA 2GFBB 2NX5B 4TQEH 4BH8A 2HN7A 1UWGH 3EOBB 3S88L 3LV3A 1OCWH 4ZUTB 4RWYH 1VFAA 3P4OB 3BVNA 5K9KB 3DXAD 3P30L 2FIKB 4C54A 3UTZB 1BECA 4U1LB 3NCEB 4CN6A 5CJXA 3GSNL 5I18L 5C07B 4OCWL 4YNYB 1UCBH 5CSZA 2MHAA 3L5XH 5KN5B 5DHVA 1R0AH 4MXVF 1BM3L 3M1BA 3IS1X 4LLYA 3ZYZA 2AI0L 2BZDA 2YSSA 3BAEL 4DGIL 1BQHG 3MLUH 4PRPA 3QHTC 4JFYB 5F88A 5I17B 3G5VB 4YFEA 1FZOA 2EO9A 4JR9H 1GGTA 3G5ZA 5C0CA 4QXTB 3LKNB 4JLRA 3QUYC 4KUZH 1JN6A 1S9WA 2VMFA 1TJIL 4OD2A 4TRPH 4ZUWB 3MR9A 1W72H 3VXRB 3VXSE 2R2CA 1X4YA 4CMMB 4NRZB 3ARFB 1X5HA 4GAFB 2A6JB 4D0DB 3I6GB 4E42A 4Y4HB 4M6OH 3FO2A 3OKLA 3QWOA 1VGEL 5C3TA 3WS3B 4HV8B 4J6RH 2VITB 5CZKA 5BS0B 12E8L 3DSNA 3DX9A 1D9KB 1JHKL 1OGAA 1T7ZA 5D4QA 3TBVA 2V9RA 4NQDB 5IUSA 2YA2A 3KPMA 4X7FC 3BH8B 1QFWM 3GMQB 1S8DB 4WUKH 5ILTL 4HWUA 5C09E 4K7PL 1BPVA 2ERJB 4G42A 1ZVYA 2DQCL 4UT9L 4XGZB 3CXHJ 3QIUC 5F7NC 1HQ4A 5TE6H 1II4E 4Z78A 4CU6A 3STZA 2A83B 4B0MM 3AS3A 1NGZA 3LN4B 4U1GC 2VISB 2N56A 1A9EA 5C71A 4MQ7B 5DMYA 2EDBA 2PTVA 4P46A 1P69B 1K8IB 5FK9B 4UQ2B 5L8LB 6CGTA 3GNML 2FX8H 4IM8A 2BNQA 2APVA 5IEKA 1DFBH 4D9RD 1R5IB 1X5LA 3G6AB 3PJSA 2HTKC 3JV4A 3NZHH 3H9SD 4L1DA 1FNEA 2VKXA 5F1SA 4LRIC 3L5WB 4ELME 2C7UB 2YD1A 4JM2F 3UPAA 1WBYB 2ARJB 3VGGA 1HIMH 1N0XL 2IFGA 3SKNA 4HPYH 4ZFGH 5FF6B 5JORB 1FSKB 3MGTA 2OL3H 3T09A 4OCSH 2LU4A 3UTSA 2P5WE 1HXYB 2DWEB 5ISZE 3QWRA 4WW2A 5F7HA 4N0YL 2CLRB 4ZSOB 3MYJA 2ENSA 3GMPB 2GI7A 1S7SB 3PDOA 2PYFA 5IB3A 2WW8A 3P9WB 1N64H 3INUH 1MCWM 5FYJE 5DK0A 3FN0H 3NIFF 2B1HH 3IS0X 3ZL4H 2ATKA 5IMLB 1CGXA 4GBXD 3OB0H 4YAQB 3UBXI 4FABH 1RAMA 4CVUA 2F5AH 4JRYE 1JFQL 1DN0B 2J1KA 4PBVC 1MFAH 3HCVA 3OKMB 5HSFA 3QO1B 4PYGA 4QCIB 1KBGL 1IT9L 4KTEL 5JIKA 3VW3H 1T04B 1S7RB 2YS4A 4LCCB 2NY5H 3T65A 3GHEL 5C92A 3QPQC 1I85A 1Q0XH 3GMNA 3OSKA 4X4XA 4R90L 1BFSA 1ORSA 5E1AA 5IBUB 2ZCHL 4OD3H 5SWZE 5IJVB 1R3HA 5C07D 4YIQB 3V0AC 2W0PA 4MD0A 3Q5OA 1HNGA 3U7AA 4CVXA 1NUGA 3SDAA 5I19L 3H6JA 5ACZA 3EJJX 1BQHA 4HEME 2BVPA 3BXNA 4YHOL 5JOFB 1CXKA 3VWJB 3PWLA 5I2IB 3BKJL 1HH9A 3LIZH 3O2DA 4FZEH 4HUWB 3BD4A 4P4KC 4KVCL 4MB4A 1Z5LB 5IW6A 3QQ4B 2NCMA 2FBOJ 4M8QA 2K1MA 2QSCH 3MROA 5I8OH 3O81A 5B8CC 4H20L 3T3ME 5E2WH 1UEYA 4WFHE 3ARFC 1QFWL 1DQDL 5ILTH 2GAZB 4OZFB 5BMFL 3LQAL 3V6OE 3OR6B 4XHJD 5J06A 1JYNA 4ETQB 5C07A 1MUJA 4Y4HC 1MHHA 3IF1B 4J3WA 5LBSH 1JWUA 3UYPA 5DC9B 1MVUA 4G6KL 5DVOA 4LCUA 2A74B 4XP4H 1UB6B 4BSWA 2RR3A 1FC1A 3GI8L