1XMWA

Cd3 epsilon and delta ectodomain fragment complex in single-chain construct
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
178
structure length
178
Chain Sequence
b'DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVGSADDAKKDAAKKDDAKKDDAKKDGSQTNKAKRALEVLEAEDKVILKCNSSITLLQGTAGQEVSDNKTLNLGKRIEDPRGMYQCGENAKSFTLQVYYRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimeric CD3 mouse Epsilon and sheep Delta Ectodomain Fragme
publication title Solution structure of the CD3epsilondelta ectodomain and comparison with CD3epsilongamma as a basis for modeling T cell receptor topology and signaling.
pubmed doi rcsb
source organism Mus musculus, ovis aries
molecule tags Signaling protein
total genus 21
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2004-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xmwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xmwA01
3DBXB 1FNLA 2QQKL 2J8UE 1F8TH 4K94L 2VZ1A 2X1OA 5D70L 4EEEA 4WIQA 1K85A 4HKXB 2A6KA 4PIRF 3IVKA 2VXSL 3QRGH 4ZAKC 2LFGA 5JPNA 1GXEA 3TCXA 1RZFH 4PRDB 2X4UB 3KHOA 1RJYB 4JDTH 4LVHB 3RPKA 2K9UA 1XGTA 2IBZX 3IDIA 3VWKC 2BVQA 3EOAA 3LQAH 1PZ5B 3CMGA 2DN7A 5TE4H 2E9WA 2A0LD 2DI7A 4H1LA 1IBGH 3IFOA 2BX5A 1F6AB 1IL1B 3RUGA 2V6HA 4Z78A 4G80B 5I76B 3DIFA 4L3EA 1NCBL 3BYTA 5IG7A 4NKOA 2H6PB 3VXMD 5ALBH 4GAJH 4XNUL 3B2VL 3JBG7 2ZG3A 8FABA 2ZCKL 1U8NB 4XCCL 5BZDB 4XP9H 1W0YT 2IG2H 4Y7MA 2EYTA 5FO8A 3N1FC 2WLZA 1R3LB 1LVEA 4GRWB 2BOCA 3V6OE 1YEJH 4N1EA 4JFDE 5C0CD 5SWQA 3U4BL 1WCBA 1QBAA 5KOMC 4JY4B 5D7LD 1T6VN 1IQDA 4UB0L 2G9HA 1EIBA 3GSUB 4PJ8D 4YFLF 1NQBA 5EU5A 1YNLH 4XP4H 3UYRH 5CKGA 4KROC 2XYCA 5IMOB 2P4AB 4X98A 4GMTL 4LAQL 2R23A 5GS0H 4U4BA 4OLEA 3SDXA 5IW6A 4WI7A 3OAYH 3F62A 5IP4A 3VGGA 1D9KB 3AREC 5LBSH 3SEPA 3UBXG 5JW4M 5FYJE 3RZCC 4UT9H 2PR4L 5C9JB 5TDPB 1FSKB 1T83A 3CX5J 4XI5C 2DKUA 3FQTB 2FHBA 1U42A 5DMJB 2PYFA 1KPRA 1PJ9A 1MAMH 1DLFL 2FYYA 3BPNC 4PLJC 4W6YB 5EZJB 5ANME 4KK9C 1MPAL 2V2XA 2X4PA 2NY3B 3P9LB 3JSSA 4Z6AT 3L9RB 3DUUB 1YJDC 2JF1A 1U8JA 2XIDA 3DV4B 1LO0L 4HG4K 2AAVA 5HSFA 1KT2B 1J87A 1HZHH 5ILTH 4YPGA 3FJTA 4OFYA 4PJ5D 1G7IA 2FX9L 1X5KA 4L4TD 4KDTA 1M71B 3JTTA 3AUVA 3ARXA 3O11B 2H2SC 1KF9B 1TJIL 1ED3A 5JZ7D 5F1IA 3O0RH 4XCYB 4YDIL 1QA9A 4QRPE 3ARBA 1QHPA 4F8TA 3NFSH 2YEZA 4M6OH 3VJ6B 4FTVA 3CXDH 1J0YA 3M17B 3PHQB 3GK8H 4LCCB 2DYPA 5IHZA 3NCYS 5I6XC 2HKFH 4NN5C 2FD6L 1S9KC 4C83B 4GMSL 3CSYA 5E5MA 1T1ZB 1KIRA 4M9PA 1KENL 5B3JF 3WIHA 5GGSY 5J1AB 1GJIA 3VMPA 4QWWC 1VKXA 4OD3L 2IAMA 2FGWL 4I3RH 4KHTL 3SHSA 3VDAA 2V5MA 4WTZG 5H8DA 4YZFF 4KI1A 1C5DA 1M7IB 2O5ZH 1FJ1B 1WZ1L 4WUUA 3BP6A 3T65B 3C60D 3MGOB 4XBEH 4K7FA 4PRIA 2EDYA 1KLGA 1XGRA 2QL1A 1NSNL 2AJUL 3ES6A 4JZJB 5IFJB 1MCOH 4NO0A 3QCVH 4HMEA 5IB2A 1FLRL 1YNKL 5KANI 3QIWB 3VG0L 2W60A 4MCYA 1OGAE 5C0ND 2M1KA 4DZBB 1FNEB 5IB1A 3RHWF 1ACZA 1P84K 5DVKA 1BJMA 3LKRA 5D1ZD 4DZ8B 3SE3A 4WW2C 3EO0B 4XBGA 1J1PH 4W6WB 4DGIL 5IKCA 5E08H 4OGZA 4YUEL 1Q72H 1W0VA 4HEME 3MV7E 2R0ZL 2PO6C 3I02B 1HSAA 2APXA 3GKWH 3FOLA 5F21B 4HWUA 1B4JH 2VLJA 3D39B 1QRNA 5F8RC 1YEHL 3QBTB 2B0SL 1A2YB 1KUMA 1NCDL 1UADC 4GG8A 4EIZC 4IRSC 4HPOL 2NW3A 4ZTOL 2XWTB 5KSAD 2VTFA 1O0VA 3FQNB 4K3JH 1J8KA 3FB5B 1EJ6A 2VE6A 3O9WB 3I3DA 2E5EA 1B3JA 1D5BA 3GSRA 3WFBH 3FRPG 1OSPH 5IJKA 3KPSE 1PG7H 3SGJC 2KZ1B 5IVXB 4Z7WE 2GSGA 2UWEF 2J2ZA 3O6FC 4HZLB 2HRPL 5KS9B 5L2JB 5T3XD 4CNIA 4NOFA 1BM3L 1T0NA 3MJ9A 1KC5H 1T0MB 1LP9B 3FFCA 3QHTC 1JNNL 2SEBB 1CICB 4OLZL 1M05A 3HG1A 3W5MA 1NC4B 3OKNB 1XCQA 3TLRA 4MNHA 2AK1H 4M7LT 4F2MB 1WT5C 4AT6B 4Y2OA 4U3XA 1KN4L 32C2A 3QO1A 1V3LA 1CFBA 1DQMH 1I9EA 3MGTA 4XC3L 5T3ZD 1EJOH 3PDGA 1XGUA 1ZLSL 4GKSA 1FIGL 3EOBB 2BNUA 1I9RL 2EEBA 3QFDA 5C1MB 1JWSA 3RBGA 4IOFC 4CVWA 2W9EL 3RTQD 4NWUH 3C2SA 3QAZC 5ITFB 4RA0C 1HXMB 5T3XH 4XVUD 4V2CB 4MA8L 4PRBA 3PWUA 4MZ2A 3WUWA 3TA3D 4AMKL 4ZOBA 3GJFK 1TZIB 2XY2A 5K59F 4JQIH 3ROOA 5FM5M 5CCKL 2XQYK 3BRFA 3NCYP 1ES0A 3LPGA 4OLXL 4TNWK 1JGUH 3UTQA 2Z91B 4XXDA 3TJEL 3VXUA 3A6OA 3BEVA 2KL6A 2QQQA 4KTEH 4XNQB 1CLZL 2ID5A 4PRAB 3KPQB 4X4ZA 5FV1L 1NUGA 1JF1B 1ZANH 3R0NA 4RDQG 2QQNH 3EAKA 1ZLVK 3ARSA 4MAYB 1C1EH 5T3ZH 2EDOA 3FO9B 4JZOB 3EIFA 5EUOB 1E4XL 4JDZA 5E2TL 3GSVB 3GB7B 1UXSB 2A77H 4GBXD 1FZKA 3DSNA 3QCUH 5HHXH 4RFEB 3MRQB 4X4MA 3P4OB 3U36A 3ZL4H 1FL5A 3L5XL 5ESVB 1FH5H 3JWOH 1OGAB 4ONHB 4N68A 5A16B 5C0FA 3D85B 3ZHDA 2C3HA 4EDXA 1MUJB 4L3EE 3CSBA 1LEKA 2Y25A 2PETA 4OZGA 1W8OA 3SDAA 2FJFB 4PJFA 4LQFH 1BD2B 2WBJB 4J3WA 3GMRB 5T5FL 4J3XA 5ECJE 3QNXA 1EX0A 1QFHA 2W0PA 4MJ5A 2OI9B 5E2UL 3BD3A 1X5GA 4PJEB 4YHMH 3KHQA 5CSZB 2APVA 3TYFA 2JJSC 1XF5B 3DMMA 1I7UB 4UIMA 3ARDA 2WWKT 3SKJH 3ESUF 1QNZL 1FZJB 2E9JA 2PCPA 4Y4HD 4CW1B 2IADB 1T66D 5I73B 3T4AA 4LAJH 4G6AC 1N4XH 2ATKA 3WXWH 1INEL 4Y16D 1K4CB 3OXSB 4JFFA 2GITA 4G6FB 4U1SA 1A6TB 4P5TA 4KRNA 1I9IH 5L2KA 1PBYA 2FJGA 4NNXB 4LLYB 3SDXE 3IU3A 5BV7L 4X8JB 3U6RB 5JW5B 4YWGL 5A40E 1RJCA 1N8ZB 4Y2DA 3TH3T 2NXYC 3AROA 3VFMB 3S5LB 1ZE3C 5E6YA 1OWRM 3EO9H 4HJGA 2LAAA 3EDFA 1Q9WA 2QSCL 4KXZI 2YKLH 3MUJA 4LASL 3Q2CA 4C55A 3W11C 4IM8A 5IVZB 4P2OB 2OYPA 1AQKL 4M1GL 5EPMB 2ESVD 3WXVH 1QPPA 4G6ML 3CFEA 3DX8A 4NNPL 2BHZA 1XF2B 2BC4A 3ZTNL 1UJ3C 3TP4A 5CKAA 3WIHL 5TFSL 3BGMB 3S96A 4TRPL 1OL0A 1NGYB 4YXKL 2ZSVA 3RL1A 3GMQA 3Q5OA 2A73B 4YK4B 5J56B 4JM2A 2J6EH 2EDWA 4C56A 4JQVA 3QDMA 4OF7A 1DJSA 3RVXD 3HNVL 4QOKB 2MNUA 3QG7H 1JPTL 2EXYD 4P48A 2CIKA 1HYSD 4HUMB 2P8PB 3D2UD 2Z35B 4P59L 1K5NA 1GSMA 2HRLA 2X4RB 3WLWD 1D5XB 2R69H 4EUPA 4QT5B 1UCBL 1KIUA 3MNVB 4X6EB 4YDJA 5E5UB 3EZ8A 1E4WL 4M5YL 1OAQH 1H5BA 2I25N 4AIOA 4WDIA 3P73B 4HWEL 4RA3A 3V9FA 3ZZ1A 3IVKB 2NNAA 3L3DA 4R97B 2BMKA 3KLSA 4N90E 1YY9D 5JPNB 1VFAA 1J9CT 2EXWD 4DOHB 1VSCA 3AM8A 2BVQB 4UDUB 3QCTL 1GIGH 3VFRA 4HH8A 4MMZC 2EICA 4X6FA 4P23D 4H1LB 5IW3A 3OGCA 3IFOB 4TUKH 4ZS7H 2VLRD 4U7SA 3ZYZA 5FHBH 3RUGB 4Z78B 3ULVC 2EC8A 1L7TH 2PXYB 5E99H 3DIFB 1HHIB 4HC1H 4ZFOA 4K23L 5IG7B 4KQ4L 4NKOB 3DYMA 3P4MB 2G2RA 4D8PA 1MJ8L 5BW7C 3PWPA 5DFVC 1OTSD 4J3VA 2X44D 3HUJE 1S3KL 4NCC1 1TFHA 3UPRA 5F7FA 2EYTB 5K9KA 1GGBL 2AV1A 3VWJD 2XZCH 1A14L 3BQUC 1FAIL 2DQGH 3MJ9L 2BOCB 4R2GB 1CGWA 4P5KA 5JIHA 5E56A 4UOJA 1CGYA 5SWQB 1W72B 1WCBB 3LZFL 1IQDB 4HGWA 2ZKHL 2EDTA 4ODVH 5J7CC 2H8PB 4Y5XA 4P4KD 5F7DB 4RRPG 5EU5B 1EHXA 1RUKH 4ZUSA 3LEYH 3LSOA 4D9RE 1OP3K 2EDEA 2VDQL 4ODUB 4Q0XL 4Y19A 3SDXB 3A6BL 4C57C 1HDMA 5IW6B 2EE9A 3PV7A 4P2QA 5DD5L 4UUJA 5I16A 2DQEL 4L3AA 2CIIB 1G9ML 4RGMB 4PJ7E 3V4UH 4OCLC 5HHMB 4RMUA 2BJML 5HI4D 1CQYA 2PYFB 4XAKE 2YRLA 5TDOA 2NY7H 1KPRB 3O3DA 4PJDF 3KYNA 5I8OL 2VDPH 3ZDYF 5DHXB 2FYYB 1S7VA 3A67L 3VWKA 1WC7A 1N2RA 2CUHA 3RJDA 2X4PB 3FFCE 4NRXA 3MLUL 3TFKC 3EYOB 1JK8A 3P0VH 5EZLB 4GT7A 4UV7H 1OP9A 4Z7NF 3HG1E 2EDHA 2AJZA 4NKMB 4P9HH 4A2MA 5IBTL 1HWHB 1CU4H 1UKSA 1KCSH 3GBMH 2JB6A 2VERN 2CPCA 4M6AA 1J0HA 1MY7A 3JTTB 1KEGH 3K8MA 3WFCH 3VW3H 1ED3B 5C0AA 5BV7B 4HLZH 2BSED 2YUXA 5F1IB 4YHLL 2IQAA 4KKNA 1RMFL 4NUGL 4CDHA 4HIEA 1CE1L 4Z7VF 2CK2A 3TO4C 3GHBL 2YEZB 4EDWH 2ENSA 3TPUB 4FNLH 4FTVB 5EU4A 3U9UA 1YC7A 3V8CA 1IARB 5IHZB 2DYPB 1MY5A 3NIGF 2E8YA 5I1IL 3T0AA 1JHLH 2W1NA 3DUSA 2KBGA 3MLZH 5I1CL 3ARWA 5I71B 1FHGA 3CSYB 5E5MB 1JI2A 5TQ0L 1KIRB 4KHXL 2CLRA 3DSFL 2FIRT 4MYWB 3WYRA 5EA0H 3DLQR 5KVEH 1A3LL 1F4XL 1ONQA 2HVKA 3M1BA 3S36H 1TVDA 5CLTA 1VKXB 2Q6WA 2IAMB 3VXUE 3QDGD 2CKNA 3AREA 1K3ZA 2PKDA 2YK1H 1T4KA 4WUUB 4RMTA 3BP6B 4TNWF 3NTCL 3QEGH 4Q7DA 5E9DD 3FN9A 3VDBA 3PABB 3U82B 4ODWA 3FOMB 2X40A 1KLGB 1XGRB 1NLDH 4LIQH 4PRIB 2DD8L 4QHKJ 1U8IA 2XTJE 2IAND 3ES6B 4Z7QE 4AEHL 1UH4A 3MLVH 3UDWA 3V6BR 4MJID 1IGIH 4NO0B 1A6ZA 1JGLH 3UJIL 2Z8RA 4X4ME 5ESAB 4TPRL 5IB2B 1TXKA 1Y18A 2R0WH 3S9DB 4MCYB 2OL3B 4M5ZL 2AJYH 4K7PH 2W0FA 1NANI 3ARYA 3TT1H 4C59B 1JNLL 4XBGB 4HT1L 1NFIA 4MNGB 4PJFE 3PV6A 4KH2A 3W39A 2RB8A 1W0VB 3RQ3A 2AEIT 1AD9B 1UM4L 1OHQA 5TH2A 4N5ED 1EDQA 2VLJB 4BQ9A 4G5ZH 1QRNB 1QFUH 4LSQH 4JQXC 4KGJA 1OW0C 4GG8B 4X7TA 2QADD 2VR9A 4YLQT 3WS3A 4G43A 3FFDB 3BPCA 2VOTA 3GJFH 2NW3B 2VWEE 3LN5A 4YFEA 3LN4B 1LNUB 5DRXA 2VE6B 4Q58C 4OLUH 1V3MA 4YDLC 5FA4A 1MREH 1D5BB 2DQFB 3RX5A 1WITA 3GRWA 4JFFE 3KS0J 2R1YA 1IGYA 2AJVH 5E8DL 4G9FD 4S11A 1AFVH 3RWEB 3FAWA 4DUWA 2GSGB 3O6MH 3GI9H 4H88H 4JM4L 1ZLVH 3S98A 5D96C 1RZKH 3CJJA 5HD8C 3V5KA 4N0RA 1T0NB 3KR3H 3LD8C 1J05B 2BRRL 3IXAA 1RIHH 3NN8A 1PLGH 5E94A 4R26H 4QHMA 4XPHL 3G08B 1M05B 5B38G 1U58A 2YPVL 4X5WA 2E6PA 1VACA 3QIBD 1CDIA 3C6SA 3TGXA 2E7MA 1FRGH 3MACL 1J86A 5TF1L 3IU4L 3QUZC 2NY1D 4HQQL 4OM1L 3TBSA 2YC1B 2DLFH 1NDGB 4AJ0A 4OGYH 1C5CL 3MRLB 3VXRA 3QO1B 3QZWB 3RX7A 4RGOH 2WM0A 5C0BE 4DTGL 2LV4A 1XF4A 1UQSA 5KOVC 4J1UA 4O02H 2A1WH 4GKSB 4A6YH 3QFDB 2BNUB 1R3IH 4WW2A 4C56E 1JWSB 4DEPC 5GRUL 4XWOC 2ZUQB 4CMHB 4MDJB 4KXZH 4DFHA 5HGDA 2VB5A 4MB5A 4PGEA 5IFHH 2A9MH 1T04A 3OGOE 3MXVL 3DO7A 2VDRH 1QBLL 3QRFM 3WUWB 3ULUE 1KBGL 3CC5A 3MOBL 4PBXA 3EFFA 4PJBA 1ZV5A 2D9CA 1FPTL 3KXFD 4FFZH 5CBAB 3IFLH 4FQ2L 3C5SB 4IRSA 1ES0B 3BZEA 5GGRA 4GKOA 1CZ8H 4MD4A 4XXDB 2NY4D 4UILH 3BEVB 4MAUH 4N0UB 4JZNA 3ARGB 4GO6B 3D6GA 3RA7L 5FHAH 2BSTB 3L3HB 2X4QA 5KJRL 2EDLA 3I9GH 5LG1A 5JQ6H 4WU5A 3BFOA 3SGJA 1JPSH 4LHUB 5E2WH 1S9XA 3O6FA 1CK0H 1YQVH 2HJLA 4U1JB 5BJTA 4QCIA 4IDJH 4TTGA 1N6VA 1FL5B 1LEIA 3RGVB 2A0LC 3BI9X 2WP3T 1KCRH 3RP1A 1KJVA 1JZ6A 3QUXD 4KJWD 1LEKB 4OBSA 1RZGA 4DCQB 1BECA 2QHRL 3BJ91 4OZGB 3SDAB 5GS0C 3PWPE 1AKJA 4YHNB 2D7PA 1QVOA 3GDBA 1CBVL 4LF3B 4KAQL 5D1XD 4Z7UB 1WT5A 3QNXB 3PXJA 4FQIL 3QPXH 4MJ5B 5D7IA 1F02I 1F90L 4ORZC 5CJOL 4RMQA 2HLFD 4O2FB 3OF6D 3DMMB 3FB8A 1MFDL 1UB6B 2B1HH 4JRYA 5F9WB 5IEHA 4QYOA 1F11A 3T8XB 1SYSA 5D7SL 3ARDB 3GMOB 2ILLA 4X9IA 2PCPB 1UA6L 2EIZB 4KK5C 1D5IH 1FVDB 4LPTA 2ATKB 1Q9KA 4PJCE 5ISZB 1MWAB 2I9TA 3UBXA 2V17L 4FXKA 4P5TB 1A1MB 5J6GA 3MRDB 5L2KB 4J23A 2FJGB 4MLIA 3IU3B 2NY2D 5FYJU 3ZHLA 2GJ6A 6FABH 4P2QE 2J1KA 1W0WA 4FQJH 4Y2DB 5HYJA 5DTFA 1CQKA 1F42A 2V9TA 3A6CL 5GHWL 1Q9WB 1ZLWK 1JV5A 1KCLA 4G7VL 3VU2A 1P7HL 2XICA 2Q8BL 2D4FA 1KSRA 3MRIA 1S7TA 4NHCH 3I50H 3P4LA 3DX8B 1F4YL 2EO9A 1X5YA 2MQ0A 5SV4A 1L9NA 2X4SA 3OTTA 2BC4B 1BEYH 3RGHA 3ALWA 3LIZL 2K7QA 3S96B 2V9RA 4GRWF 1OPGL 3GMQB 4HIJA 4BQ8A 1JN6A 4XVTL 5HHVH 5F1KC 2V7HA 1X5FA 5GRWA 3QDMB 2CO6B 1E27A 4PBWD 1A7QL 2GFBA 3EHBD 3F5WA 4LEXH 4CGTA 3UX9B 2EKJA 2A6DA 3QUMA 1H15B 4FOMA 5DRWB 3IJSB 1J5OL 3F7YA 4CU7A 4ZO7A 4FP8H 5JZ7C 1FYHB 1CVRA 2GYSA 1T22B 1D3CA 4RFOL 2JJSA 4OCWH 1Z2KA 1BOYA 1H5BB 3QQ9C 1X44A 3H9HB 5I8EA 4PY8J 1OP3H 1I1AC 1YJDL 1JWMA 5CP7B 3BP5B 4HS8L 5J06A 1JGVL 1MHEA 2IPUG 5ENWA 2NNAB 1HNFA 4P9MH 1PX4A 2BMKB 3BIAX 4FG6C 1IAII 1L7IL 1UVQB 4MQSB 1VFAB 1ND0A 4WTZA 5AAMA 1QKZH 2R2EB 2YZ1A 2CR3A 1JGDA 4FABL 5JLZA 1E6OL 3MLSH 4L9DA 3UCRA 4LRNH 4Q9QH 1EVUA 1ORSA 1AIFA 1WBYA 3OWEA 1GC1C 4X6FB 3OGCB 4GRWH 3S34H 1NCWH 4WRLA 2NY3D 4L4JA 1KB9J 3GBNL 1AR1D 5C6TH 1UENA 5E00A 3C60C 1IGML 2ICWJ 3QEHB 1R5VA 4ZFOB 5FK9A 4JO2L 3PWLA 4MJ6A 4MXWH 3X3FL 1G0XA 4Z8FL 2G2RB 4D8PB 3DGGA 2Z8WC 3GRWL 1WFTA 2JJWA 3VD3A 1ZHLA 4KWUA 3RWCB 2GJZB 4ZXBC 4XXCC 5K9KB 5C0NC 2AV1B 1PW3A 5GGVH 2BNQA 1DQDH 1FFOA 4P5KB 1NBZA 3CDGA 4NZUL 4PJ9A 3VGAC 3MRCA 2Y23A 4O4YL 1DDHA 3O6KL 5JHDA 4HGWB 3SDDB 2LAGB 4XGZA 4GXVH 3MRJB 3S37X 1CDJA 3WV0A 1EMTH 2D7TH 2B20A 3EOTH 1K8DB 2VJXA 3LSOB 4GJTB 4JGMA 3FRPA 1HH9A 2GUOA 5IFAL 4Y19B 1HDMB 3UROR 1X5IA 3SJVA 4KVCH 4UUJB 1CXHA 2IPTL 5SX5H 5DT1H 1A6AA 3K2MC 3BP7B 4PG2C 4I77H 4I4WA 4FQ1H 4PJGA 3T2NH 2B2XH 1CCZA 4WI5A 1U36A 2ITDA 3CFKB 2H32A 2ZG2A 3O3DB 5D72H 1N5YL 1V7MH 5HY9A 3NIFF 3HC0B 3LHPH 1N2RB 4M1DL 1B9ZA 1X4ZA 4BFEA 3ALXA 1OLZA 1N0XL 3AXLA 1RFDL 3VI3E 4APQA 4M4PA 5DEZA 3L3GA 3Q6GL 1WEJH 1Y6NR 3RJQB 1Z6JT 3EDJA 1S5IL 2JB6B 4F3FB 2BCKA 5E1HB 2DRUA 3DV6B 5BW7A 1M7DB 4XH2A 3VXRE 3KDMB 5DD1H 5C0AB 3D25A 3KG5A 2LU3A 3D39D 4LARH 1OP5K 3HAEG 1OCWL 5KANG 5CMAB 2VAJA 1IT9L 3NZ8B 3KPPA 4LCWA 1C7TA 1S9VA 4O5LL 3BQUA 2BOBA 3PL6C 3STLA 1KFAL 4ODTH 5EU4B 1E6JH 3U9UB 4F9LC 3IDXL 3NZHH 5IV2B 1EXUB 1SEQH 3O9WD 3RIAF 1A7OL 3DUSB 3DTXA 3MRNB 5MEOB 5LGHH 5IVXF 1OGTA 4XVUC 5T1LA 4WEUD 5KS9F 5CEZE 2ADFH 5D70H 3EYUL 2YPLE 3UJJL 4LKXA 2HVKB 15C8H 1LP9F 3M1BB 2DQUL 2Q6WB 4EI6A 1RVFL 2VXSH 3HFML 3AREB 3GHEL 1IAKA 5I1LA 1T4KB 1A5FL 4JKWA 1AXIB 4JRXE 1KG0B 5I19H 1IZKA 1N6QH 1J0KA 1CICD 1U8IB 4WWKC 5LXGL 3OKDB 1CDGA 5D9SB 1CL7I 3BPNB 5IMLB 3BRDA 1CWVA 1CLOH 1HKLL 4GBXC 3RKDC 2D7QA 3GSXA 5SWSA 1A1OA 1NCBH 2XA3A 1IGCH 4Q2ZB 2GAZA 5TPWL 3PV6B 4XNUH 3B2VH 1MFEH 4FFYL 3P4NA 3WKML 3VXSE 4PGZA 4Y5YC 5TH2B 4Z7OE 2MHAB 5D7IE 3U2SA 1U3JA 2OBGA 4J8RA 1MHHA 2A74A 1KTKE 1NCAL 2O93L 4JRYE 4X7TB 1Z0MA 3BPCB 3U4BH 3TO4A 4U6HA 3LN5B 5F1OB 3MLXL 5HXMA 4H0HB 5DRXB 5IMMA 4FQCL 2Q7YB 1UGNA 5FA4B 5J57B 5I6XB 5I1HH 2BZDA 2IGFL 5EUOF 1WZMA 3GSNA 1MCIA 1IGYB 1QOKA 4GMTH 4LAQH 5D2LA 4Q97A 3RWGA 4PJHE 1DE4A 3QUML 4NM8L 4ZSOA 3SY0A 2PR4H 1MI5B 2WWKO 4HIXH 4LSTL 2FX7L 4LMQI 1AXSA 3NN8B 5E94B 4OF3A 4QHMB 1O7SA 1WBXB 2DBJA 1OGAD 4X5WB 1IC7L 3D85D 3X12A 1A7PL 4OTXH 4CAGA 1RI8A 3DI2B 4IIQC 3TBSB 1J18A 4N1CA 3MRKB 1ORQB 1IGTB 4LK4A 4PJEF 3MRFB 3EYQD 2P48B 4Q9RL 1LO0H 2WBJD 3I3BA 3QWOB 2QR0B 2XFXA 2E7LC 1XF4B 2FX9H 4PV8A 4Y1AE 3CK0H 4J1UB 1MJUL 3B9DA 4JB9H 1NEZG 4AENA 3VI4E 4D0DB 1TJIH 3QNZA 3U7YH 5DZOA 5EWIH 5HGDB 1JNJA 4R9HA 4YDIH 1T04B 2ZZUT 2VZOA 3DO7B 2EXYC 1PKQA 1HYSC 4X83A 4PB0L 5L6YH 4FQXC 1FYTB 3CC5B 4HIHA 5HHQA 1AO7B 5JPMA 3EFFB 4LP4A 4L1DA 4PJBB 4G6FD 2Q3ZA 4JQXA 3WLWC 2LABA 3LVEA 2XWJB 1MFBH 3SKUD 3Q1SH 1KTRL 4YO0B 5FYLE 2FD6H 4MD4B 4LL9A 5DUML 4EXPX 2FIKB 1VERA 1SJXA 1XCTA 1I75A 4G8FB 4JZNB 1OARL 5CGTA 3WIFA 3GNML 1S9WA 3WCYA 3BMWA 3MRBA 3BN3B 4NO3A 3ALPA 3KYAA 1YEGL 4OD3H 4AEFA 2VITA 2FGWH 4P2OD 1YY9C 1BVLA 4Y89A 3CFJA 2EXWC 2IH1B 5FDWB 1S9XB 3O6FB 3TC9A 2HJLB 5BJTB 4QCIB 1FL3B 2VAAA 1T1XA 1MRCH 4NCDA 1LEIB 4ODSL 4P23C 3RY5A 3T08A 3WNOA 3MCLL 2AJUH 4WFFD 4F57L 1KJVB 1SBSL 1BWMA 1RZGB 5J12C 1FLRH 3R4DA 5F9AC 1YNKH 2FCBA 3VG0H 1WLHA 1HQ4B 3MFGB 1QVOB 3QUZA 2D9QB 4HS3B 4QOKD 1MFNA 4PJAA 4XMKH 1NGWA 1Y0LA 4DGIH 4AEIL 1KACB 4U1GB 1RIVH 1NFKA 5IEHB 4QYOB 2Y6SD 3VWJC 3HRZA 4RRPA 3NACL 3BKYL 4E5XB 5HGHB 3CLEH 4NWTL 1YEHH 5JHDE 3QAZB 3L7FB 1NCDH 4LHQB 3MRHA 1Q9KB 3ULVL 5FYKL 1I8MA 4HPOH 1L6ZA 4P9HC 4ZTOH 2XA8L 5EO9A 1QBML 1MVUA 5DS8A 4XAWH 5J6HA 2GJ6B 3L1OL 3SJVE 4KUZH 1B2WH 1W0WB 5HYJB 3RUGF 5DTFB 1CN4A 1IEBA 1YEKH 4PJGE 2FB4L 2HRPH 2Y1VA 4JKPH 1IQWH 2QEJA 2X4NA 1H3TA 3OMZA 2PXYD 2X09A 4HUUA 3MRIB 4L3ED 3ELAT 3HN3A 5I9QC 1D6EA 1JNNH 2CLZA 1SY6A 4OLZH 1FBIL 4HJ0D 4TUOA 3K4AA 3W0WE 5T1MA 2WQRA 3HE7C 3VFWA 5I1DA 1BJ1J 4Q9BA 2ZSWB 4WNQB 1DN0A 4HIJB 3ULVE 1JN6B 5FYKE 4MJ4A 4LLVB 1QD0A 3K46A 2V7HB 2VH5L 2NX5E 1N3NB 4TN9A 3F5WB 4HF5L 4J2XA 4XC3H 1S5HA 2UZYB 4UT7L 1C12B 4OCMC 4GG6B 1FIGH 1I9RH 4TULL 4YHZL 1BFVL 5DGRA 4H1LH 2XPGB 2GT9B 1F13A 3SDXF 5FECB 4LCWE 3OHXB 1A9EA 4U3CA 5IHBA 4D9LL 3MZGB 3ZDZF 2DI8A 5I8EB 4JFEE 4MA8H 5DHYA 2Z31B 2E27L 5IM7A 5I8KL 5I74C 5JTWA 4Z18A 1NBVH 1G7MA 5F7EL 4OLXH 4S2SA 4HBCL 5HHMD 4L3CB 1TTUA 3E1F1 3NAAL 3TJEH 4QGYA 3T3PF 1F3DH 1CLZH 4KMTL 3RNKA 2C3VA 3VA6A 1VEMA 1VFMA 2HFFA 5FGCB 2NXYB 2I9LA 1BX2A 2VZUA 1YMMA 1W72H 2G75B 1E4XH 2YA2A 5E00B 2VSCA 5E2TH 4AH2A 1HCVA 1F3JA 4ZTPL 3PHOA 1R5VB 5DQJB 5FK9B 3BXNA 3PWLB 4IRZH 1NCNA 5FM8A 4NP4L 4OFYD 3DGGB 3L5XH 2AI0L 2GY5A 5DDHA 3GSNL 4ETQA 4X9GA 4NQUA 4GKNA 5DO2C 5SWSE 4JFZL 2DM4A 2XRAH 4LSVH 2UYLB 1OP5H 2WWMC 4RGNC 2BNQB 3T0VA 1RZKC 5T5FH 1FFOB 5MEQB 3MUHL 1NBZB 3O3UN 4PJ9B 3MRCB 1KLUB 4FTVD 1N6UA 1DDHB 5E2UH 2EECA 5JHDB 4L4TA 1BFSA 2DYPD 3O3BA 4XGZB 4OV6F 1RHHA 4NFBA 4MNQA 3HI6L 4N5EC 3GIZH 1GVIA 4N90D 1QNZH 2R1WA 1HH9B 4NQXA 3LKSA 4AIZA 1INEH 2IAMD 3RVUD 1NUFA 1I1AA 1K9TA 3MV8A 4I4WB 3KLDA 4WUUD 1Q0XL 3G04B 3H7BA 3DO3A 2VMFA 4M4RA 3D3VB 3H0TA 5BV7H 3QEUA 5L88L 2ITDB 3HB3D 5IHLB 1XF3A 4PRID 4YWGH 4ZSOE 4F7EB 5B38A 4NO0D 2F5AL 1UEYA 1NCUA 4LGPB 4OZHA 5C07E 2RHEA 4LBEA 5ETUB 4M1GH 2VDML 3O81A 4WI9A 1AGDA 3AXLB 4HDIA 3EGSA 1SM3L 4G6MH 4APQB 2NTSP 3QXDA 3QIBC 1V5JA 1Q1JH 2BCKB 4J4PC 5J89A 3ZTNH 4N0YL 4NSKA 1HEZA 5TFSH 5EC1B 4YHOL 2NY1C 4XH2B 4YXKH 1KB5A 2B39A 3WNNA 2G5RA 2HTKC 4KJPD 1XH3A 2VLJD 4JHWL 3FO0L 1QRND 1UB5A 5ERWB 35C8H 3NGBB 1YEFH 4M8QA 3QFJB 4ZXBA 2DQTL 3HNVH 4XXCA 4OD1L 5DXWA 1S9VB 4WI4A 3STLB 2BOBB 4LSSL 2EKSA 3IS0X 4P59H 4BUGA 2EE3A 1PKQE 3BKMH 3LS4H 1OGTB 1Y6KR 2HAZA 4RIRB 1NJ9A 2AVGA 1UCBH 1KYOK 1G9NH 1MCJA 4YE4L 3N85L 1BOGA 4FZ8L 5DURB 3WS6C 3MOAH 2DDQL 5EBLA 2GSIA 2Q86B 5IF0B 4YFDB 1NMCC 5T1KB 3U30B 4P3WA 4PREA 5I1LB 1RUQL 2NY4C 1RZFL 3FFCD 3RDTC 4E41E 4JDTL 4PG2A 2R9HC 5H2BA 1CS6A 3QCTH 1BWWA 3HG1D 1YN6A 5TE4L 4ZUVA 5E2JA 3HPLA 3MCKA 2HG5B 1IBGL 1KIQA 4JFXA 5HVGB 1JWUA 3BDYL 1B0RA 4NFDA 3FQUA 3SKMA 4PRHB 1A1OB 3PQYA 4K23H 4DVRL 2GAZB 1MJ8H 3RI5F 3QDJA 5FM4A 2Y7QA 4GAJL 3LEXA 4KJWC 2B8OT 2IBGA 2YUZA 4PJAE 4XP9L 5A1AA 3U2SB 2IG2L 4ZO9A 4LFHD 5D1XC 1AHWC 1GGBH 4J8RB 2KZWA 1MHHB 1A14H 2A74B 2Z8SA 3GSWA 5JA8B 3IKCA 1FAIH 1SYVA 3MJ9H 2WP3O 2DJUA 1RSFA 2F58L 1A3RL 2HLFC 1SY6L 3WNMA 1RZIA 2VLMD 3LZFH 5DD3L 3PL6A 2DTML 4GKZA 4LRIC 2ZKHH 4R4ND 4G9DA 3VXUD 4XP4L 4HWNA 5BO1L 1MCNA 1U6AL 5JXEC 3GSNB 1EV2E 3ARGD 4CVZB 5DK2A 2YN5A 3MV01 3SE9L 5GS0L 1LD9B 4Q0XH 5D2LB 4XPTH 3RY4A 1DE4B 5LBSL 3PWJB 5D7KD 5FUZL 3SY0B 3B3IA 2DQEH 1DQTA 3QXWA 2ICWA 4JFYB 2V2WA 1ZA3A 4LVHC 3RNQA 4NO2B 5I1KL 4CN4A 1AXSB 2BJMH 3IDUA 1E4KC 4LOUD 4OZGF 3RGVD 1CLCA 2E6JA 5JO5A 2YRPA 3REWA 3DGCR 4Z7UF 4WWKA 4DQOL 3SDAD 3MLUH 5DF0A 3LOWA 4GBXA 1HSBA 1NGQH 3KVQA 1HZHL 1G7QA 5I66A 2XFXB 4PV8B 4F15B 1RZ8B 4HUXA 5HDLA 3BH9A 3DMMD 4YQXL 5SX4I 5FB8A 4AENB 3V2AR 2HJFB 3QNZB 3OKKA 4Z0XA 3ARDD 3BHBA 3O0RL 1NGPH 4Y5YA 3SGEI 4NUGH 4U1IA 1C7SA 3VXME 3M07A 5C09A 3V4PL 1CE1H 2XACC 4JFHD 1JHTA 3GHBH 3NFSL 4HIHB 3VFPA 4DVBA 2OXGA 5HHQB 5JPMB 5ISZD 1JPFA 3CUPB 4RX4A 3KPOA 1X5HA 4P5TD 1QFOA 1UT9A 5I1IH 4U2YA 5L2KD 5ELIA 4Y4FC 2FH8A 1CI5A 2AXFA 4OGAD 1XCTB 2PF6A 4K55A 4RQQA 3KYMB 4KRPD 5TQ0H 2BRQA 3G9VA 4Y2DD 4OUUB 5D7LE 1D9KC 1BZ7A 1TZHB 4D0BA 4OIBA 1S9WB 3FB6A 3MRBB 1MCFA 4YX2H 1A3LH 1F4XH 2AEPL 1FSKC 5CWSA 1I3RA 2C3GA 4Z9KB 5I15L 2J6EA 3H3PL 1EHNA 2MQ3A 2O5ZL 3ARUA 2VAAB 1T1XB 1WV7T 4XBEL 3OAUH 5BVPL 1YMME 1OAKH 3QHZL 1XGPB 4JM2F 2DD8H 4M6NL 5HVHB 4QHLA 3LB6D 1MCOL 2JTDA 1HCFX 1AR1C 5DGQA 1FFPA 4DN3L 4S1DD 2AJXL 4TPRH 4LNRA 3QPQC 4JM2D 5KN5A 1MWAH 2H45A 4C56D 3CX5K 3QDMD 3QUZB 3TH4T 4IIQA 4EKXA 5IR1B 4JVPA 2X05A 5ACLA 2PW2B 1I7TB 1NGWB 1Y0LB 2FO4A 1JNLH 4HT1H 5E08L 1I3VA 5D6CA 1Q72L 2E7LA 4H5SA 1UM4H 1MCPH 4NPYB 4IMLA 1GC1L 1RURH 3GKWL 3HRZB 3KLAA 1EBAA 4GRMA 1B4JL 4F33B 1A4JA 3OBAA 4PJ5E 4L4TE 3ECBA 3OAZH 4HKZB 2R1XA 4K3HA 4K7PY 4O00A 1AGCB 3MRHB 1I8MB 1NGZB 4LCCC 4FQXA 1TITA 1CXLA 3STZA 3SQOH 5EO9B 2J4WL 4YR6A 3WD5L 3GIVA 5J6HB 5H37G 1KB5L 1A6UL 4HGKC 5HHOA 3AAZA 5C71A 3WFBL 4EN3A 1X5ZA 2HYMA 1S8DB 1B88A 2HH0L 2IJ0C 4BM7A 4YBQD 3O3AA 4M93B 4JM4H 4IHOA 1MCBA 4PP2A 2OJEA 3M8OH 2X4NB 1U8LB 2EYSB 4HUUB 2GEEA 4EUPH 1D6EB 5GS1A 4OZHE 3Q5TA 1OAZL 2CLZB 2FEDD 4TUOB 3PWPD 4XPHH 5FGRA 3S6CA 1WISA 5AZ2L 5T1MB 3HNTL 4EZMA 2YPVH 5I1DB 4P23A 3IDNA 4PJXB 3QP3A 3QIWC 5J3HC 4AL8H 3KJ6H 5TF1H 3IU4H 2AK1L 4HQQH 4OM1H 3BPLB 1C5CH 4KVNH 5L9DH 4NQEA 1AQDA 2HFEA 4CKVX 2AXJA 3BO8B 1S5HB 1QFPA 4HS6A 4DTGH 2ZPKL 2VDLH 1CF8H 5DVMA 3CDYA 5GGSB 2FECI 1T2JA 1AXTH 4ZODA 5EB9A 5GRUH 1CD8A 5C0JA 1A8JH 4FZEL 3RVWD 5F88A 4NWUL 1PGRB 2CMRL 2CUIA 5C8JA 3MXVH 5KSUB 5T3XL 2RFXA 2FHFA 4Y19D 5DHYB 5CEXA 1ZT7A 3H3KA 1KBGH 3MOBH 2X1PA 1T20A 4OI7A 1FPTH 4PGBA 3O9WC 1G7MB 4S2SB 3PF2A 4QRTB 2BSRA 3MROA 3FN0H 2FL5A 2HVJA 5CINL 4KTEL 5DD0L 4MDIA 3VWKD 1CFNA 1ZANL 2HFFB 4YPJA 2QQNL 1YUHB 5KJRH 2DKMA 1XR8A 2VQ1B 2EIDA 2I9LB 5F7KC 5T3ZL 5B3NA 1MCHA 4AH2B 1WIPA 4MCZA 2A77L 1F3JB 4ZD3H 5HHXL 1CICC 1UWEL 3BXNB 2D3VA 5FOBB 4ZPTB 1GGCH 5JW4N 4KKLD 1BQSA 1JZ4A 5DDHB 1FH5L 4ETQB 4GW4B 1I3GH 3QQ3B 5T3XE 3PP3K 4GKNB 5C0AD 5DJ6A 3VA2C 3HE7A 4CADA 2QHRH 2UWEE 5IBUG 1IM3A 3QDJE 5E0QA 1P4LA 5DEGA 1CBVH 4KAQH 4HULB 1GOHA 4FQIH 1YECL 3P40A 5C0GA 1F90H 1PQZB 3O3BB 5IB3A 1MFDH 1RHHB 4XP5L 2IC2A 4MNQB 2UV3A 4JE4B 4PGJA 5D7SH 5E8PA 4WEBL 5T3ZE 3SKJL 2R1WB 4W4OA 4QRRB 4NQXB 3LKSB 3WXWL 1N0LA 1I8IB 2RQ8A 3HC4H 4B41A 3MV8B 3OKOB 1F97A 3ARED 4Y5VC 4YHKH 2V17H 2ZCLH 1I9IL 4Z7VA 3H7BB 3VCLA 3QEUB 2PTTA 3UTSB 3BZFB 1XF3B 3R8QA 1T2QL 4MAYC 5DMKB 5GHWH 3A6CH 5B38B 2E9BA 2VN7A 3EO9L 5HYQB 2YKLL 4OZHB 4PLJD 1BBJB 1JRHI 4DKFH 1FVCB 3L5WA 1FV1A 4G7VH 3BDXA 1YNTB 5DYOB 3QDGA 2Q8BH 4BK4A 4OF8A 1AGDB 5ABDE 3H2WA 4HDIB 3WXVL 4RISH 5I8CA 1LILA 1A9BA 3EJZC 3UEZA 4BSVA 1JZ2A 1F4YH 3IAQA 4ODHL 3LIZH 3S3SA 4NSKB 1HEZB 5T1DH 1KB5B 3OL2A 4X99A 2E8ZA 2F53A 3E6HA 2H2SD 4XVTH 4M8QB 2J6EL 2HA1A 5KZCD 1BGXL 4TNVF 5DJYB 1A7QH 2AV7A 4P5MA 2EKSB 4JANB 4QRQA 3VGAB 1DQQA 4FFWC 3UZVB 4RFOH 1NJ9B 1QSVA 3BUYA 3O2VL 1BOGB 3PDOB 1OAQL 5I73C 1R5WA 4HEPG 5A2LH 5EBLB 2GSIB 4HS8H 4KJYB 1IRAY 5KAQG 1JGVH 4FQLL 4QWWD 1L7IH 1N7ML 3VI3F 1QZ1A 4FABH 3T0EA 5H2BB 1Z3GH 4A6YA 1KLFA 1YN6B 3MUGA 3V0VA 4ZUVB 3CFIC 3MCKB 4OZ4A 1RZ7H 1KIQB 3GBNH 4ZS7L 4JFXB 3EKCA 1JWUB 4JPVH 5FHBL 1EA9C 2FX8H 1B0RB 1IGMH 5D2NC 4WW2F 3VXRD 3SKMB 2MCG1 3PQYB 3BD4A 4JO2H 3CZJA 4Z8FH 3QDJB 3GRWH 2Y7QB 4MD0B 3LEXB 5C0DA 2APBA 1V3KA 3ZYIA 4J4PA 4YK4C 3WO3B 5DUPL 3LMJL 4PJBF 2G5BB 1XGYL 3UYOD 3OJMB 1FVEB 3I3EA 5BXFB 1P5UA 3GSWB 4AG4H 2VUYA 1SYVB 2X7LA 1AC0A 3VMNA 2W92A 1AO7D 1RZIB 4O4YH 4JPWL 4GKZB 4IRSD 4MA1B 1CT8B 4S1RH 4ODVL 3CMOH 3ET9F 4QXGL 1MFCL 3S3PA 1RUKL 2QV2A 2GQHA 4C54A 4PRNA 5BZWA 5GGVY 5IFAH 4QHNA 2XZAL 3WS6A 4PUBL 4R97C 5EH1A 3B3IB 2IPTH 1CDHA 4P49A 2ICWB 4XMPL 3F6IA 3O6FD 1ZA3B 1ZT1A 3RNQB 3V4UL 2OTPA 2R2CA 1A64A 3D18A 2CRIA 2F5BH 1WJ3A 3QH3A 3RDTA 2VDPL 5JO5B 5L8LB 3ESVF 5EUKA 5AG9A 1N5YH 3REWB 4WWKB 3P9MA 5EDXA 5EOTA 4GS7C 4K2UL 2X41A 4O2EA 1BMGA 2PXYC 1N0XH 4UV7L 1HSBB 5DMIH 4P9HL 1IFHH 2DB8A 1QLFA 4HJ0C 3SO3B 5I66B 5FYKU 1JZ5A 3OKLA 2PUQT 3GBML 5DJAA 4HUXB 1RQ5A 3F7VB 3S35X 2VLRE 5A2IH 3BH9B 3MXWH 1KEGL 1T3FA 5FB8B 4NQEE 3VW3L 4XX1E 3OKKB 4IOFD 3HS0A 1IAIM 4Y5YB 2DJ4A 3OB8A 4OQ1A 4R2GC 3QZWG 5C09B 1JHTB 3VFPB 4O5LH 4DVBB 1KFAH 1JPFB 3E3QC 4FQQA 3IDXH 3KPOB 5GGQL 4LP5A 3JVGC 3OF6A 2BHUA 1IKFL 4QEGA 4H25A 2E3VA 1JHLL 2VRAA 1A7OH 1AP2A 4AQOA 4LRIA 2GJ6D 5LAXA 4HKJA 1H8OA 4Z5RA 4NFCA 1KCVL 5DA0B 2OK0L 3DBXA 5HYJD 5FOJA 4D0BB 5ICYB 1BZ7B 3VRIA 4NKIH 3RRQA 3FB6B 5JXEA 3UMTA 4U7KA 3UJJH 4HKXA 2DQUH 4MGXA 2P5WA 3M45A 1RVFH 4RGMC 1I3RB 3GHEH 5D5MB 1A5FH 1INDL 4YJZL 4LDLB 2OR8A 4ZYKA 1RJYA 1UZ6F 3MNWA 1U8OA 1UM6L 3OG4B 1NLDL 3QDHA 43C9A 1FGVL 2UVEA 1V05A 2CDGA 1EGJA 1CIDA 1JGLL 5C9KA 5DQ9B 4LNRB 1HKLH 4LHUG 5C2BL 1IL1A 5H35A 3MRGA 3O2WH 5EBMA 4G8GA 3L5IA 5DMGC 4HK3J 1NBYB 3MQIA 1EO8H 1OT2A 1T1WA 1C08A 4ZNEE 2FO4B 4GAYA 2H6PA 3QXAB 3T2QA 4PJDE 5D6CB 5BV7C 3LRSB 2WIIB 2CDFA 2QQLL 1D6VL 4YNYB 2C26A 1AGFA 3KPTA 4GRMB 3ECBB 2FATL 1NCAH 4Z7NE 1R3LA 4LSQL 4BK5A 2CRYA 3UXFA 4G6AD 3STZB 4JY4A 5MP6L 4YR6B 2CRMA 5DK0B 2CD0A 5I71C 3GSUA 2NMSA 4FQCH 3V5DB 4OLUL 4FQPA 5HHOB 3AAZB 1VEPA 4Y4FA 4PLKC 5IK3A 4EN3B 3WL9B 4LSRL 2P8LA 1U8KB 3CVHA 3C09B 1EPFA 2AJVL 3RVUC 1AFVL 4Z7VE 2XI9A 4LCUA 3DETC 1D9KA 2NXYD 4IHOB 5BOZG 1HILA 1RZKL 2RAMA 3W11D 1GRWA 3NIGE 4LSTH 5H94A 3KR3L 4XMLL 2ZJSH 3FQTA 5HTSA 2FX7H 5GS1B 1RIHL 3ZMRA 1CDCA 3SKOA 2C4XA 4OF6A 2QTEA 1FNGA 5DJCB 3QDGE 1IC7H 1G9NC 5EZJA 3IDNB 3PP3H 4BYHA 1FRGL 4Y88A 1A7PH 4XTRC 3AMKA 4XWGL 1GHFH 5J12B 1BF2A 2BNQD 3DV4A 4OGYL 3HAEB 3SE3C 1LO4L 2IANE 4KKCC 1PDKA 3T3MF 4PJ9D 4RGOL 2HFEB 4MJIE 2F53E 2OQJB 4OCYH 4K8RL 5JHDD 1MJUH 3CGTA 4ERSL 4A6YL 3WKNA 5DUBB 1YQ2A 4UTBH 5C0JB 5A2KH 5DFWH 4RGNE 4WGVB 5F88B 5C8JB 4PB0H 5CEXB 1ZT7B 2EO1A 4X0KA 1X4XA 4PJGF 3LKNA 5I30L 1T20B 1TZGH 4PGBB 5MERB 3M17A 5IT2L 4OM0L 5IUSA 2KUTA 5FCUH 1CZ8L 5DUMH 3D3VD 3MROB 3KYOA 4UILL 4C83A 4JCLA 1R6VA 1I8KA 1OARH 2Z8VC 1T1ZA 5EZOL 3ARQA 4NUJA 4M7LH 1ZTXL 3GNMH 5J1AA 3SCMA 1G6RA 1YEGH 2DAVA 3ULVF 5JQ6L 3B9EA 3C5JA 3SPVB 4YEEA 4MCZB 5FDYA 5EU6B 1CK0L 3F7QA 2OZ4A 4APQD 5ITBH 4G9FE 3ULVD 2APTA 3IDGA 1RD6A 4XC1L 1KELL 5I9QB 1A21A 4D3CL 5F8QC 3HZKB 5IFJA 4F57H 3PDDA 5DFVD 1KCRL 1SBSH 1XMWA 1QFWI 4CADB 4NC2B 4DGVL 3QIWA 4Y0GA 5DEGB 2HMIC 1DBAL 4DZBA 1FNEA 2WUBL 3BQUD 4IEFB 3B9AA 4U0RB 5IEKB 5C0GB 1OM3H 4AEIH 1NFDA 4ZFGH 5IB3B 2B1HL 3I02A 1CYGA 3FQWB 3JXAA 4ODXB 4WHYG 2JCCB 1TQCB 5E8PB 4Q74A 5HHPA 4RDQF 3NACH 5T1LD 1H8SA 4PB9L 5HDBF 4NWTH 3NMEA 4NQCB 4R7NB 1T6WA 3ULVH 1A47A 4N1HB 3TN0A 3B8YA 4PJIA 2XA8H 4R4NC 1QBMH 2NY6B 4U1HA 2XWTA 4HH9A 1CVSC 4WEMB 1JPST 1KJ2A 3VCLB 3ARGC 3L1OH 4ELMB 4WU7A 5GZND 3KXFE 2V5TA 3H3BC 3B2UD 5IVXA 3O2DA 4KK8D 3KJ4B 4HZLA 4X6CB 4ZDHB 3L5WB 3ZKSD 1FV1B 1G0YR 5KS9A 5L2JA 2VZTA 3TBYB 4HUVA 5SWSD 5I8CB 1A9BB 1T0MA 2VABA 3RGVC 1WVZA 4BSVB 1FZOB 2SEBA 3MR9A 2D7OA 1FBIH 3FT4A 3NPZB 2ZUTA 5AZEL 4NM4L 4XT1C 5GISL 1NC4A 3H9SA 5CBEA 3SDAC 1UC6A 4X99B 1PD6A 4PGCB 1NEZB 4YBHA 5HHVL 5SWZA 4NKDA 4G6JL 3ROLA 4K3EL 3LAFA 4LEXL 2AV7B 5IQ9A 2XKSA 3DMMC 4P5MB 4KI5C 1JUFB 1IAOA 2ZUSA 5F9WC 1MCSA 1XAUA 2D2OA 4OCRL 1QR1B 4YHZH 5D1QB 1BFVH 3ARDC 4NQVB 5D2LF 1EGJL 2H1PL 3CXHJ 3DHMA 5JUEL 2WNGA 4OCWL 2DIJA 3BUYB 4KTDL 2ZUWA 4JJHA 1CGUA 2ZNWA 1R5WB 4UAOC 4Y8AA 5HHNA 5FO7B 4HXBL 2E27H 4FA8A 5I8KH 2X70A 1TZIA 3BZDA 5F7EH 4OGAC 4HBCH 1IC4H 4Y5VA 3NAAH 1QKZL 1HI6B 4Y2DC 3T0EB 5EIVA 5F96L 4JG0H 5MI0B 3MYZA 4Q9QL 2E7CA 4XNQA 2YPKB 2Q7NA 3V0VB 1JF1A 2EEAA 3S34L 4MAYA 1ZVSA 1JYXA 4HXAL 4JZOA 5C6TL 1INQA 3MMEA 1MRFH 3GB7A 3GSVA 5D7JB 1D5MA 4ZTPH 4RFEA 3MRQA 4OZIB 3V52H 2JE8A 2OR9H 3I85A 3LB6C 5ESVA 2AI0H 2FBJL 4JGUA 3GSNH 2P5EA 3CVHL 4ONHA 4S1DC 2EDDA 5A16A 1T21A 5TGBA 4JFZH 4K71B 3SGDI 2FJFA 5IOPB 2OJZL 3B5TA 4ORGB 5CD3A 4HWBH 1BD2A 2WUCL 1FDLH 5DLML 2X7LB 3G6AA 5GIRB 1JTPA 3B5GA 3WJLC 1VA9A 4POZD 2VN4A 3FRUA 3CSPA 3RY6C 4WFHD 2NLJA 3BE1H 3UTTB 4PJEA 5CSZA 4XPFL 3HI6H 5F93C 5LKNA 1I7UA 3O4LA 4XNXL 4GRWE 1EMTL 1H5BC 4QHUA 2D7TL 3MLYL 3WFHA 4CW1A 4QHNB 2GIYA 5DJZA 3FKUS 3MJGX 1K4CA 4HUWB 4FMFA 4OFIA 1A6TA 1ZT1B 3AM8C 2J3SA 1MCLA 4I77L 4FQ1L 3KNBB 4DUXA 3N1QC 3D18B 4XP6L 4NNXA 4LLYA 2M8XA 2VKXA 3T2NL 5L88H 3QH3B 1WIOA 4X8JA 5FAAA 5JW5A 3ARVA 3TH2T 1N8ZA 1FORL 2CXGA 5EUKB 3VD4A 1DUZA 3VFMA 2R56H 1RHFA 5E6IA 3ZE2F 2R8SL 3P9MB 5EOTB 1U8QA 4J6RL 1QBBA 5LQBL 3QUZD 5EPMA 5GGTA 4G3YH 5I1EH 1SM3H 1XF1A 5D2NA 3OKLB 3O8XB 4XNZB 4BSWB 3R06B 4KC3B 4IMKC 5K93A 2YD1A 3FHQA 4N0YH 2Q8AL 3U83A 1T3FB 4RAVB 2DQIH 4YHOH 1KB9K 3LRHA 4MQXC 3W5NA 1G6RL 5HGBB 2A73A 2D03L 3FO0H 4PY8I 4XWOD 4LARL 4NZRL 2DQTH 4OD1H 2OZ4L 4NYLB 4EQ3A 1GGUA 3Q5YA 3IETB 1YY8B 5F3HB 3SDDC 4FQQB 1YEEL 4LSSH 4MSWA 4I13B 3NZHL 2Z35A 3U1SL 5AYUL 5JNYA 1DANU 3HI5L 5JHLH 4H25B 3RVWC 2X4RA 1AP2B 1G7LB 5LAXB 3MNVA 4HKJB 4Z5RB 4NBYB 3N85H 4PRPA 4TSAH 3BPOC 4F9PA 4FZ8H 1DL7L 3JV0A 3VRIB 2ADFL 2DDQH 1OLLA 3BAEL 3DVGA 1TPXC 3G6DL 2ZUYA 3P73A 2IH3A 4R6UA 15C8L 2P5WB 2ICWI 1ETZA 2ZWLT 2OCFD 3UP1A 4Z76A 1RUQH 1RULL 1C5BH 4ZYKB 3FB7B 1UJTA 1J1XL 5I19L 1EK3A 1N6QL 4Y8DC 2ERJB 3MNWB 1EERB 1U8OB 4IRJC 5F7HA 3CLFL 4G42A 1LMKA 4UDUA 2ENYA 5MENA 1SVZA 5KVFH 43C9B 3MLRL 2CDGB 4BA8A 1F6LL 5DHVA 3H42L 4NJ9L 1CLOL 5GZOC 2DKSA 2NZ9C 3BDYH 5H35B 1G7PA 3MRGB 4I18B 1QSFB 2BVTA 2IPUK 4G8GB 5EBMB 5GS0D 4W81A 5HDQL 2PXYA 4JKKA 2Q76A 4KKLC 1HHIA 5BS0A 1KJ2L 3GMNB 1T1WB 1C08B 1IGCL 4GAYB 3P4MA 3T1FB 4DVRH 1FGNH 3O3EA 3HR6A 4OCXL 4TUJA 1MFEL 2CDFB 1C16A 3NIFE 3VRLF 7FABL 1OAYL 3O2DL 1BQLH 1AGFB 5IGXH 1EFQA 3GUTA 5CJBA 4PP1C 4Q9CA 1WICA 4KMQA 3AGVA 3I6GA 4P2RB 5JIPA 2F58H 1A3RH 4J3TA 2X1WL 4U6TA 2FSEB 1KPVB 2W91A 3UPAA 1SY6H 5CLWA 1VB9A 1W72A 4KK5D 5DD3H 2DTMH 3D39E 3RWDA 5LCVL 4LDOB 2DM2A 5DVNA 5DJ2B 2H8PA 3JVGA 2BERA 4OCSH 5F7DA 5CAYB 4DGYH 5BO1H 4Y4FB 1U6AH 5I1HL 5IK3B 4JDVB 3IDMA 2P8LB 1QFWH 3CVHB 3BZ4A 1I85A 4F7PB 5FV2A 3SE9H 3B4NA 4ODUA 2FGZA 1ZLUH 4LCUB 5FUZH 1YMMD 1S7SA 1HILB 3HZMA 4L9LB 2CIIA 3CSGA 4B0MM 3B83A 4I3GA 1KN2L 5H94B 1UACH 4HIXL 5I1KH 1JMXA 1Z0NA 2XQBL 1KTDA 5IVXE 1IMHC 2P24B 3TNMA 2YHGA 5GRXG 3SKOB 3UDWC 3KS0H 1GCFA 1FNGB 2Y06H 5KS9E 1XIWB 2YBRB 3T0WA 3WJJC 4I5BA 1T1YA 3D9AH 1LP9E 1QLEH 1Z9LA 4OTXL 4DQOH 3K1DA 3T1WA 1WFNA 2VKWA 1F2QA 2WANA 3EYOA 2HFGL 5EZLA 3IAPA 3ARFB 4KV5E 4NKMA 3H9SE 3VFVB 5IMKA 1IAMA 4L8DA 4MXVF 1KJMB 3CK0L 3LN9A 4YQXH 1BVZA 3D5OF 4MNQD 4JB9L 5GRYA 1V8HA 3DWTA 3U7YL 1W2KT 1UXWA 5EWIL 1ZT4A 1AY1L 4N5UA 3TPKA 2D0HA 1CIUA 4L4VB 3V4PH 2EDXA 5L6YL 3QQ9D 2FHCA 4X0KB 4BZ2H 1Z9MA 3LKNB 4YBLB 3TPUA 1I1AD 3HE6A 3MV8D 3QI9A 1MFBL 1I1FB 4M00A 3HMXA 1TCRA 3Q1SL 4RZCA 2BY0A 2ARWA 4FG6D 3KYOB 4OZHF 5F1NA 4GLRI 1BFTA 1I8KB 5KVDL 4NUJB 1M4KA 5SV3A 4PV9A 3SCMB 2AEPH 1G6RB 4X7SL 5DRZB 4CDGC 4Z77A 1WAAA 3C5JB 1U95A 3ZE1F 4XVSL 4UT6L 5I15H 2Y07L 3H3PH 4UIKH 4QRUA 4WFED 2HTLC 5F7WC 4LLQA 4S10A 1X3DA 3VXNA 3IDGB 1MRCL 3PABA 1J1OH 5BVPH 1L4IA 3FOMA 3QHZH 4XPBL 5EUOE 4U1NA 4M6NH 1JYNA 3X17A 4JPKH 4LQ1A 3QWQB 3DUHA 4DN3H 2AJXH 5ESAA 4EI5C 1Z9SA 1OWWA 4UI2A 3ILQC 4ZXBD 2OL3A 2JJUA 1QYGH 3IFNL 2P46B 4NQDA 4J3UA 4ALAH 3ZYJA 2UY6A 4XMKL 5A43C 3TJHC 4MNGA 3HC3L 1NFDB 1FNSH 1RIVL 2FH6A 1BD2E 3IFPB 5JIKA 5K9OB 3DURA 1AD9A 2AXHA 2L7UA 3F6LA 1GC1H 2HP4A 5HHPB 1EEYB 2Y9RT 3CLEL 4PJEE 3TN0B 4NT6A 3FFDA 5AD0A 4PJIB 2J4WH 4U1HB 1PAMA 3LN4A 1JJUA 3WD5H 2DQDL 2HN7A 4HH9B 1LNUA 5EG6C 4XAWL 1KJ2B 2R2HA 1KB5H 5C0IB 1A6UH 3AVEA 5EIQA 2KDGA 3FZUD 2DQFA 4GQ9L 4KUZL 1B2WL 4WU7B 1DBKL 3QEQA 1S7XB 3SGDH 1T2XA 2HH0H 4FQHA 3G5XB 2A6JA 3RWEA 4OFDA 3X3GL 3ZHKA 1YEKL 3QDAA 5TQ2L 4AIXA 3FCTB 5CJXC 4JKPL 1IQWL 3S4SG 4HUVB 3PQYD 2VABB 4TOYH 2MKWA 1J05A 1OAZH 2YD9A 3MR9B 3QDJD 3FT4B 3CFCL 5AZ2H 3DRTB 3HNTH 3C9NB 3G08A 2F9BT 5T33L 3H9SB 4Q6YA 2NW2B 5CBEB 3QYCA 3S7GA 4LEOA 1M7XA 3N9GH 4DUVA 5SWZB 2YC1A 4K3GA 1NDGA 4NKDB 1EZVX 5BRZA 3ROLB 3JZ7A 3MRLA 4V1DB 3QZWA 4WFFE 3VGBA 5IQ9B 4U1GC 3VFNA 2ZPKH 5MHSD 1IAOB 3PL6D 3KPRA 4PPTA 2O26U 3AB0B 4QOKE 4FZEH 4MDJA 2CMRH 3DXAA 2YA0A 5HHNB 1J0JA 5DR5L 3ZKMC 2X70B 3K8LA 3L3OA 5CBAA 1NBVL 3C5SA 2X9YA 4F8QA 2EZ0C 4NHUA 3PGFH 4Y5VB 5TJWK 5CINH 4N0UA 4IDLA 4X6DA 1VGKA 4EOWH 5DD0H 3ARGA 1CFVH 1TTGA 4WHTA 1LO3H 4RNRB 3EYFA 1ULVA 2BSTA 3GSOA 4M3JA 3DX9A 4WWKD 3L3HA 4O2CB 2FJHA 3MV9A 4DOHE 1ZVSB 2YD3A 1QR4A 2HT4D 1ZGLM 1W72L 1O7VA 3V8OA 1INQB 3MMEB 4LHUA 2IWGA 2WK2A 3RKDD 1D5MB 5MENE 4L1HA 1UWEH 2F15A 4U1JA 2R15A 4ZMAT 4IRZL 1WK0A 1LDPH 1YEDB 3RGVA 2P5EB 3CD4A 1T21B 3RUGE 4NRYB 5TGBB 1MF2L 1FFNA 5BS0E 5E24E 1JP5A 4DCQA 2XRAL 3MTRA 4LSVL 4GXUM 4PLNC 1YDPA 5CD3B 5CSGA 4YHNA 5C09D 4LF3A 3G6AB 4Z7UA 5ID0B 1YECH 3FRUB 2RCSH 2NLJB 2P43B 4P46C 4RX4D 3BJLA 4O2FA 3UZQA 4XP5H 1UB6A 3O4LB 3GIZL 4BH8B 2HLAA 3GBLA 4QHUB 1DSFH 3T8XA 3GMOA 3FAXA 3LKPB 4TYUA 1CL7L 4S0SD 4WEBH 4KK6D 2Z31C 1I4FA 2HT3C 3WFHB 1TLKA 3I6KA 4WV1C 5DJZB 3E3QE 2EIZA 2M26A 2BDNH 1FVDA 2D31A 1RPQA 5ISZA 3BD5A 3TCLB 1MWAA 4W4NA 1J8HB 1A1MA 4XP1L 25C8L 3MRDA 1NAMB 3AU1A 2C3XA 3I75A 1KNOB 1T2QH 4WJ5A 3ZDZE 1KIPB 3CVIL 1DUZB 1MJJA 5CIPA 4MA7H 4XNMB 4N8VG 5E6IB 4LPVA 1EUUA 1U8QB 1DN2A 2W07A 5HHME 3T2PA 4BELD 3RIFK 5C08B 2X9XA 3K74B 5D93C 4FFVD 5DZLA 5D2NB 4TVPL 4ODHH 5KSAB 1VCAA 3GMPB 1Q1JL 3T3PE 1UFUA 3EFDL 2GCYB 5JORA 2FNBA 5FXCH 2F54A 1IGJB 4GW5B 5F6IC 1RU9H 35C8L 1YEFL 4PJ9C 1BGXH 4HUNB 2FZ3A 1H9VA 4NZJA 2JELL 2ICCA 3JV6A 3VGFA 4FQXD 1H15A 4LCYA 5DRWA 3IJSA 2BVOA 3LS5H 4MSWB 3WJLA 1FE8H 2FBOJ 2HWZL 3RWIA 5JNYB 3RY6A 3WN5B 3BKML 4JHZA 1AJ7H 1T22A 3LS4L 5TF0A 4BJLA 1MLCA 4P3DB 1G9NL 5HHOD 4EN3D 4PRPB 3O2VH 4FTVE 2VO5A 2V5SA 4CVXB 3HA0A 3WEXB 3MOAL 1P69B 3H9HA 4PD4J 2OL3L 2VDNH 3DVGB 2IH3B 5M7QA 3G6JB 3WHXA 5CP7A 1FLTX 3BP5A 1ETZB 4OFKA 4FQLH 1OOAA 2E9IA 4Z76B 1UVQA 1N7MH 1QSEA 2R2EA 3G5ZB 3KYKL 4ZQKB 5CHNB 1WAAE 4G42B 1IVLA 5MENB 1I7ZA 3RTQB 5KSBA 3NCJL 5DHVB 4WUUE 4NO5B 1U8PB 3MODL 1BJ8A 1G7PB 3BH8A 4LMQE 4GS7B 4APQC 4PRIE 5IBUB 4NQED 3QEHA 5EU7C 2Q76B 5BS0B 3ZT6A 5JW3L 1FCCA 2Y5TB 3O3EB 4UU9B 1PEZA 4TUJB 4FXGA 1C16B 4IMKA 3Q0HA 5DUPH 1ZHKA 4G8EB 4OFVA 3LMJH 3NGBC 4QXWA 3RWCA 2GJZA 3N50A 3GUTB 1XGYH 2ED7A 4MNGE 2N56A 3I6GB 2BVPB 4F58H 5B8CB 3TBWA 1P4IH 2VLJE 2X42A 4JPWH 1QRNE 4ZO8A 3RWDB 3KPMB 3SDDA 4WGWB 3MRJA 4PTTA 4QXGH 1MFAL 5E8NB 1MFCH 3IDMB 1OAUL 1J10A 1K8DA 3VXQA 3BZ4B 5GRJH 1NEUA 3HAEH 1VADB 1YN7A 2XZAH 3D69B 4XPTL 3U30C 4PUBH 5EO0B 2YXFA 3HNSL 1S7SB 3HZMB 4MS8D 1V7NH 3TNNA 4XMPH 5EU6D 4I0PA 3BP7A 2RR3A 3Q6FA 3C2AL 1KTDB 2BY2A 3D48R 5GZNC 3TNMB 1BLNB 3B9KC 3CFKA 2N4IA 3U0TB 3B2UC 2VLKA 1ZHNA 4IRJA 4KK8C 4I5BB 1OTUC 2XZZA 1PG7X 3HC0A 3VFGL 1LE5B 1LK3H 3HE7D 1T1YB 4I2XA 4K2UH 1P53A 2DMCA 2MJWA 3NCCB 4UBDC 3T0BA 1SJVA 1HK6A 1BZQK 5JMOC 1NGQL 4XHQA 1T5XA 3P2TA 5IMKB 4L8DB 2JCCF 1TIUA 3CU1A 3SBWA 3TM6A 3RVVD 1JCKA 4F3FA 5BRZE 3DV6A 3CNKA 1M7DA 3MBXH 1QO3A 3KDMA 1QP1A 1UKTA 1UXWB 4OI9A 1RK0A 1ZT4B 4NDMA 1NGPL 3QULB 4M43H 4WENB 3UAJD 5CMAA 2C1PA 5FKPA 4KRLB 4NQCD 4CL7A 4FXLA 5GGRY 3NZ8A 4JO4H 3W2DH 3HE6B 1P6FA 5GGQH 3QI9B 1EXUA 5IV2A 2NY6D 1TCRB 1TQBB 4HV8B 1IKFH 2QLVB 4RZCB 4JY5L 3MRNA 5MEOA 4H0IA 5F1NB 4KZDL 4X6CF 1ZK9A 1KCVH 3ARZA 2OK0H 3S37L 2VLME 2CXKA 5F89A 4PV9B 1NMBL 1GZPB 4JFQA 1IJ9A 4YX2L 1LGVA 4Z77B 4S0TD 4U7MA 3WIIL 5LJYH 2BSSB 3AMLA 1U95B 5FIEA 1D5ZA 5SX5K 4N0UE 1IM9A 1DQJA 1JHKL 5D6DC 1JNHA 2XKNB 4P99A 4QRUB 1INDH 3NABL 1KG0A 4LLQB 3D2UB 2WBWB 3VXNB 1BP3B 1UM6H 4UNTA 3OAUL 3OV6A 5D7KE 5HVFB 4XB8A 2FR4B 1OAKL 4U1NB 3MNZA 2D0GA 1FGVH 3OKDA 3BUTA 4OLWL 5D9SA 5E8OA 2F53D 3VXPA 4WTXA 5IMLA 5CJ8A 3WJJA 5DO2D 5C2BH 4LPCA 1MWAL 1PG7W 2WWMD 4KY1L 4NQDB 4RGND 4F15C 2F74A 4Q2ZA 5IW1B 3V79C 1QHOA 1DQLH 2MPAH 4OZGE 5DC9B 3W9DA 5A2JH 3E2HC 5B39G 1HHKA 3ZO0A 3WLBB 3DURB 2R0KL 2QQLH 2OTWA 1MCPL 1D6VH 4R0LB 5DVLA 3V6FB 1LEGB 1RURL 4Z7UE 3OJ2C 2MHAA 1TTFA 2K1MA 1VEOA 3EDEA 4HMDA 2FATH 1MCKA 4POZC 4KI5E 3MZTA 4X5LA 4NT6B 5AD0B 4JJ5A 5TE7L 3QJFA 3SQOL 5MP6H 1BAFH 2HN7B 4MB4A 5E95B 3CFDB 2R2HB 4M7JL 3FONA 2Q7YA 4N9GA 2NY0C 5FUCC 4JFHE 5M94B 3T0ED 4K8RD 5JDSB 5ISZE 3QEQB 4LSRH 2H3NA 1CR9H 4FQHB 4K9EH 2A6JB 5L2KE 2Q1EA 1U92A 1OAXH 4DKDC 1M1SA 2ZOLA 1LO5A 1MI5A 1YYML 3M8OL 3V7AE 4KKBC 4XMLH 5IVNA 3V6ZA 5HVHC 2J8UA 1GAFL 1WBXA 4L8BB 1I3UA 4J4PD 4LEOB 1TJHL 3QO0A 5E70A 4AL8L 1DR9A 3KJ6L 3MRKA 2HTKD 4XWGH 3RIFF 1ORQA 1IGTA 1BQUA 3MRFA 4EI5A 5BRZB 3ARTA 1LO4H 4KVNL 5L9DL 1Y6MR 3QWOA 1IZJA 2QR0A 3VFNB 2HT2D 2VDLL 1CF8L 1WCQA 2APFA 2EC9T 3L3JB 4K8RH 4TSBL 3UTTD 1YMHA 4ERSH 3KPRB 1BJ1H 2ZG1A 3RIAK 3QDME 1AXTL 2XXCB 4D0DA 1ZGLA 4QXUL 3DXAB 3GSQB 3BDBA 5D4QA 1IEAA 5F7NC 3BVNB 4LPUA 5HI5C 5F3BB 1OTTD 4HX1A 1G7JB 1GOFA 3FT2A 1FYTA 4ZFOL 1AO7A 1S7QB 5I30H 3EYVB 2I07B 3NA4A 5J13C 3TT3H 3L3OB 3OX8B 2XWJA 5IT2H 4OM0H 3UC0L 4YO0A 4NHUB 1F4WH 3SOBH 2FIKA 2ZUXA 3FN0L 4ESKA 2C4FU 1P2CA 4G8FA 4X6DB 1VGKB 4OF0A 3RDTD 5EZOH 3PJSB 2BVYA 2R9HD 4WTWA 4M93C 1ZTXH 4WHTB 3EYFB 2OSLA 3GSOB 3DX9B 2FJHB 3MV9B 4LLUA 5FDWA 2IH1A 2M2DA 2V7NA 4ZD3L 3P0YL 5KSBE 1Q8MA 5CJXA 1JZ3A 1FL3A 43CAB 4HZAA 3IS1X 1GGCL 5ADPH 4XC1H 1KELH 5HDOA 3TZVA 4D3CH 1I3GL 1QRKA 4OLVL 1FFNB 2X4TB 3BPLC 3QJHA 2NR6D 4DGVH 1YDPB 1HQ4A 2OP4H 3BT2L 1DBAH 2DLGA 4HS3A 1DVFC 4OF5A 2WUBH 4RBPK 4NN7C 4P57A 3NFPB 4N0FA 4EJ1C 2J5LB 5E9DB 2HLAB 4CU8A 5HYIA 1EHAA 3H8NA 2CR6A 1NL0H 4E5XA 5HGHA 1FO0A 2R4SH 4PB9H 1I4FB 1YPZB 4NZTH 3UO1L 4WI2A 3I6KB 5JXED 5CJQL 5EBWA 2L7JA 2QJDA 4UAOB 1RZJH 2ZOKB 3L7FA 2D31B 4QF1B 2P5WD 5L0QB 2CKBB 2XKUA 1NPUA 3HC4L 2NY5C 4YHKL 1C8PA 1KEMH 2ZCLL 3ZTJH 4Y19E 3AU1B 3EUUA 3I75B 1TVBA 5DMYA 4WJ5B 5DC0A 3HLAA 3MA9H 1MJJB 4LCIL 3GMMA 5CIPB 5BCAA 3QSKB 5I17B 4DKFL 3G5YA 3R0MA 5I75B 4WY7H 1E28B 4G8GD 4RISL 1FL6B 4I2XE 3VFOA 5AZEH 4NM4H 5GISH 5JORB 3INUL 3KPNA 2VQUA 4LGRB 5T1DL 3ZKND 1HYRC 4KJQD 2ZSWA 4WNQA 5AYQA 2F54B 4R90L 5F70A 1V3JA 4LLVA 4KU1A 3SE4A 4G6JH 3THML 1DBBH 2FZ3B 12E8L 4K3EH 1N3NA 3QA3B 4U2ZA 2J88H 3JV6B 5C0AE 4LCYB 3WFZA 3IDYC 1C12A 2BVOB 2H9GA 3RWIB 4GG6A 4OCRH 4IS6A 1P6AB 3ZKXB 4P46A 3PWNB 2XPGA 2GT9A 3LQZB 1EGJH 2H1PH 5JUEH 4U33A 1PEWA 5FECA 2VXQH 1MLCB 4NZDA 1BIHA 3OHXA 3U9PL 3ZSSA 3C6LA 4KTDH 4Y4FD 2VXTL 2ICEB 2XG4A 5D8JL 3P30L 4HXBH 2Z31A 1D9KD 3WHXB 1VPOH 3VFTB 4WV1A 2NTFA 3W81A 3MV7A 3C8HA 4MMXC 2AKRA 2XOTA 4DW2L 3R8BB 1QFWM 1A7NH 3U7WH 1CGXA 4L3CA 1QSEB 3MGAA 4LLDB 4XCNA 5J0BA 2AK4A 3ULUC 5F96H 1Z3GL 1I7ZB 5KSBB 1BQHG 4GSDH 5DJXA 1RZ7L 4HXAH 3S36X 2G75A 4JPVL 4KUCF 3BH8B 3NH7L 3V7MA 3TBTB 1G6VK 2K7PA 2FX8L 4WO4C 3QPQD 3PIQB 3ARFD 3TIEA 5DQJA 5INDB 2BNRB 4KUCD 2FBJH 1MCCA 4QLRA 3CVHH 1F4AA 3P0GB 4UDTA 4FXGB 3MFFA 4AQ1B 4HK0A 3CCHA 1ZHKB 1YZZA 2AJSH 2KKQA 5JW4R 3VGDA 4XZUA 1KULA 2UYLA 3BIBX 2OJZH 4MX7B 2WUCH 2UZXB 4L4VD 1H0DA 4O51A 4AG4L 5DLMH 3HPJA 4K7PX 5MEQA 3MYJB 4HW6A 2C3WA 1KLUA 3K3QA 3TBWB 2F19L 5DJ8A 1T03L 4XPFH 2D7NA 4S1RL 3CMOL 4XNXH 4PTTB 4OB5H 2J8HA 2KPNA 5B21A 3VXOA 4F7CB 3MUZ1 3MLYH 2EDJA 3VXQB 5L8KB 4KQ3L 1JE6A 4RWHA 3MRPA 2FRGP 1YN7B 3BPOB 3L6FA 2NXZB 3SCMD 3RWHB 2RJMA 1H3XA 1CGVA 1TPXB 1MH5A 4B50A 3TNNB 1NANH 4BFGA 2NPLX 3AC0A 4I0PB 1EEUA 4LLWA 4NN6B 4QXTB 3FZUC 3Q6FB 4XP6H 3G04A 3S4SA 3WFDL 3D3VA 4O58L 2F5BL 4ZS6D 1EO5A 2R39A 4JPIB 3WNPA 1JTOA 2VLKB 1FORH 1MI5E 1ZHNB 2DQJH 4F7EA 4IRJB 2P7TB 2R8SH 4I2XB 4J6RH 3QUYC 3C8DA 3QIWD 4GQPH 5ETUA 5J3HD 3H6JA 5LQBH 3VGHA 1NFDF 3QIUC 5DMIL 3BWAA 5J8OA 2MTPA 1IFHL 2P49B 5E03A 1RUML 1T5XB 4LPYA 2C9AA 4MHHI 4H8WH 4NC1C 3MXWL 2Q8AH 4KKAD 2NY2B 5EC1A 1QO3B 4LSPH 3WO4C 1G6RH 1RK0B 5C7XH 4NDMB 2D03H 1U91B 4PJIF 1EZVY 3H9YA 5ERWA 3RL2A 3SGKC 4CRPA 3OPZL 2C1PB 5FKPB 4NZRH 3QFJA 2OZ4H 3NCMA 3OG6B 5DRNB 3T0XA 3TN0D 4MA1C 3JWDL 1YEEH 1K4DB 1MRDH 3U1SH 5AYUH 3HI5H 3TVMB 5F9JB 5EOQH 3SO5A 5HYSG 3F12A 5FYJL 4RIRA 1FYTE 3MA7B 1AO7E 4F37F 4XHJC 4PJBE 1KGCD 5F89B 1DL7H 3BAEH 1EUTA 4NKIL 3G6DH 4L8SC 1MJ7H 4JFQB 4JEGB 1UWXH 5A3IC 2Q86A 2MOVA 5IF0A 5T1KA 3PE9A 4IJ3C 4TSCH 2X5PA 1D5ZB 1IM9B 3S8WA 1DQJB 3EO1A 1JF6A 2JB5L 1RULH 1JNHB 4KV5F 3MUY1 4XRCA 4ISVA 2FECL 1J1XH 2DQHL 8CGTA 1DEEA 3CLFH 1FO0L 1UKQA 1JMZA 3S88L 4X7EC 4NQSA 3MNZB 3B9KA 1NC4D 3H9SD 3MLRH 5CEYB 5E8OB 2HT4C 2HG5A 3VXPB 3GO1L 3H42H 4NJ9H 1JPGB 5SWZD 3D0VA 3O2WL 3SO3C 5HDQH 4V1DD 4PRHA 1KJ2H 3HKFA 1EO8L 2F74B 1Q38A 3CZFA 4BKLA 4MQ7B 2DWDA 2CO7B 3W9DB 4OCXH 2YWZA 1HHKB 1LWRA 3ZDXF 5HPMA 2OTWB 7FABH 1OAYH 3O2DH 3HR5A 1PKOA 1QQDB 2H2PC 4WW1B 3CPLB 5CZVL 2MMXA 1ZGLP 4EIGB 1P7QA 1WFUA 4NRZA 1B6UA 5E7FA 4OZFG 3DPBA 5EZIH 2WINA 4JJ5B 4LPXA 3QJFB 2BP3A 3TV3L 5LCVH 4MVBD 4JREB 3K4ZA 4JO1H 3FONB 4N9GB 4KK6C 4I48B 1NUDA 2XN9B 1Q9LA 2H3NB 4CVZA 1MQKL 1LD9A 4LHJB 4MJ2A 1U92B 2JK5B 4MAYD 2HKHL 1SJEA 1TVHB 3PWJA 4N8VA 2GJ6E 2ZOLB 4YEFA 1P4BL 1LO5B 2Z4QA 5GQBA 2VDOL 4JFYA 4HWBA 5EBGA 3LPFA 5HYJE 1KN2H 4MZ3A 4NO2A 2ZJSL 3BGFB 4FMKA 2XQBH 3V6ZB 5D6DA 1XEDA 4R7DB 2J8UB 5J11C 3EJZD 2P5ED 3R1GH 2VL5A 1OB1B 3QO0B 1F58H 3VH8G 2I5YH 4JHAL 4I9WD 2XZQL 1GHFL 1BD2D 2HFGH 4EI5B 3L5JA 2GHWB 4FFVC 3I84A 5HGAB 1ZWIB 2GTZA 4ENED 2DJSA 4RMSA 2ZUUA 4RBPH 4NNYA 1UZ6E 1VHPA 1RZ8A 4OCYL 5JXAH 1YMHB 3HRPA 5IQ7L 1KTLA 5F6HJ 3O4LD 4UTBL 2HJFA 1ZGLB 1HOCA 3RVTC 2H26A 4FFWD 1AY1H 1JRHL 1IEAB 2P47B 4GG6E 4HX1B 3FT2B 4J7RA 5DEFA 3HMWH 4M48L 1TZGL 3CUPA 2YMXL 4Z0BH 2WV3A 1J8HD 3HUJA 1F00I 2MQCA 4KPHL 2PYEA 5FCUL 1CFSA 2YUWA 4EN3C 1B0GB 1KPUB 1RUPL 3C09C 1P2CB 3KYMA 5KVDH 3WNKA 4OUUA 1TZHA 4JFDB 4M7LL 1ZHBB 2OSLB 5E6ID 3QR2A 4XNYH 4X7SH 4DKEL 2CGRH 2Z9TA 4LLUB 2FEEI 1QTYT 2AK4E 5DD6A 1Q94A 3WFEL 4U1LA 4XVSH 5C08D 1HH6A 4UT6H 2MCPL 2Y07H 2V7NB 5GS1C 1SVCP 1T80A 4PLOB 1J12A 4PR5A 5ITBL 2R2BB 3RI5K 5FGCE 5H37H 3OJDA 4XPBH 3TZVB 1XGPA 1XGQA 1REIA 4F7MA 4ZOCA 5DC4B 3IF1A 4M03A 2VUOA 3QJHB 1R5IB 4PJ7A 3RX8A 5JQHC 3IFNH 5IR1A 2DTSA 5EOCJ 2PW2A 5BOPA 1IAIH 4OAWA 1NAMH 1I7TA 4ZFFA 1U2HA 4ZUWA 5LGJB 4P57B 1OM3L 2AABL 5ANMB 3HC3H 3TESA 3I6LD 4N0FB 4GUPB 4ZFGL 1MIEL 2BNQE 3T77B 3BEWA 2VYRE 3GJEA 4HKBA 4NPYA 3DX6B 3G6JF 1U3HA 5FA3A 4XCEA 4PRPD 1FO0B 4F33A 4EQ2A 3MREB 4HKZA 4M3KB 3EW3B 4ONFL 1TDQA 5EBWB 5GGTH 1AGCA 3KLHD 3T3ME 5HI3D 4NKQB 1NGZA 1S9YB 5CS7A 1TCMA 2DQDH 4RAUA 4K07A 5DQDL 5CP3A 4U3HA 2YD5A 1TVBB 4GQ9H 1DBKH 3DVIA 4QRPB 5MEND 2GW5A 5JA9A 3HLAB 5IROC 1S8DA 2VZVA 3GMMB 2XY1A 1I1YB 3X3GH 4MS8C 1AC6A 4H26A 1WUNT 4R96A 3D3VE 5TQ2H 3G5YB 1EAPB 9CGTA 1U8LA 2EYSA 5BS0D 5FF6A 1FC2D 1XZ0A 2VIRA 3VFOB 4X7DC 2QKIA 3EJYC 3CFCH 4PS4L 1DCLA 5T33H 3KPNB 4EVNB 2H41A 4PJXA 1HHJB 1ROWA 2LTQB 1WSST 1CTOA 5EU7E 3WHE1 4ONOA 3FQRB 4U0RC 3RVVC 4R2GD 1IEHA 5IWLA 4HJJH 3BO8A 1DVFA 2H9GB 3MLWL 3ZTJG 1JIBA 5GGSA 4IS6B 1PSKH 5EN2A 3BW9A 2OR7A 1TQCC 4P46B 4B7LA 3QFJE 5DHVH 5GJSH 1UWGL 1A7RL 4W4OC 4YHYC 3C6LB 3UAJC 1UM5L 2O5YH 1DEDA 2DWEB 5KSUA 1HHGB 5EO1A 2MFNA 3OAZK 2YD7A 2QBWA 5GXBB 2ARJQ 5DR5H 5HJ3B 4Q6IC 2NY6C 4WV1B 5F7LB 2NTFB 3ME0A 3MV7B 3X14A 2AKRB 2L0DA 1CXKA 1UCTA 4QRTA 1IC4L 2UZIH 4XCNB 1S7WA 1QLRA 2AK4B 5GJTL 7CGTA 3L5HA 4LVNB 4JG0L 5HDBE 1YEIL 3KJ4C 4NQTA 5DJXB 2VNCA 4YC2B 4WFGD 1YUHA 4UV4H 2VQ1A 5K9QI 4OUOA 2VISB 2DM3A 1P1ZA 3ZT5A 1MRFL 1UG9A 1SQ2N 2A6IA 3W82A 3TIEB 5BMFL 3WE6A 1WFOA 5DMGD 5FOBA 3V52L 5D93B 2OR9L 4ZPTA 3IJHA 3KPSB 3F8UB 1A0QL 4Z7WB 3W9EB 4GW4A 4Y4KC 3QQ3A 4UDTB 2CJUL 1MF2H 5B39A 3MFFB 4OQTA 4HK0B 3CCHB 4M9OA 4PRHE 3OQ3B 4XZUB 2W9DL 1ZMYA 3VFUB 4K9EC 4WHDA 1EEZA 5KAQF 4HWBL 4XCFH 4O51B 1H0DB 4GRLC 1FDLL 3VXTB 5F6IB 3HPJB 1KXTB 3L3IB 4AY0A 3IRZA 3HE6D 5D1QC 5DJ8B 3BE1L 3QI9D 3CAFA 1PQZA 3WDIA 1RK1A 4TVPD 3VXOB 1WAAF 3L7EA 1CL7H 1H3GA 4XBPB 3JWNC 4QRRA 3GMLA 3MRPB 4PLKD 1QACA 2CK0L 5C0BA 3L6FB 3SDCC 5J1TC 1ZA6A 4E0RA 1MH5B 4ZFZA 1I8IA 3DETD 3OKOA 4LLWB 2FWOA 4XP1H 25C8H 3T0EC 3CXHK 5MI0C 3S4SB 4K8RC 4PY7B 5DSCA 5D2LE 2B5IC 3UTSA 2AJ3B 5CGMA 3BZFA 2EYRA 1TENA 2WAHA