1XMWA

Cd3 epsilon and delta ectodomain fragment complex in single-chain construct
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
178
structure length
178
Chain Sequence
DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVGSADDAKKDAAKKDDAKKDDAKKDGSQTNKAKRALEVLEAEDKVILKCNSSITLLQGTAGQEVSDNKTLNLGKRIEDPRGMYQCGENAKSFTLQVYYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimeric CD3 mouse Epsilon and sheep Delta Ectodomain Fragme
publication title Solution structure of the CD3epsilondelta ectodomain and comparison with CD3epsilongamma as a basis for modeling T cell receptor topology and signaling.
pubmed doi rcsb
source organism Mus musculus, ovis aries
molecule tags Signaling protein
total genus 21
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2004-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xmwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xmwA01
4P9HC 4Z78B 3WUWG 4D8PB 2V7HA 4NO0D 1I4FB 2B39A 5FO9A 5JW3L 2MCPH 3IFLH 3GB7B 4X5WA 3S8WA 3T3PF 3Q48A 3CSBA 3F12A 3Q2CA 2B4CC 5CMAB 5CD5C 5JNYB 3MLRH 5JDSA 1P53A 2CK0L 3U2SB 5DUML 5D71L 5JR1H 3DNKA 2DQIH 2F54D 4P9HH 5I1KH 4YIQA 3CZFA 4XCCL 1N64L 1M71B 3MRLA 1INDL 4K07A 1UXWB 3S3JA 4RCAA 1RURH 1E27B 4Z7UE 3MRCB 2BCKA 4NPYB 4NQCD 1JF1B 2D3VA 3ECBB 1EK3A 1FJ1A 4PJ8C 2X4RB 1BVZA 2HTLD 5GJSL 3QXVA 3EYUH 1M05A 1S7WA 1YJDL 2V5TA 4JKKA 2XN9D 5HGGS 4QRQA 1XF1A 4ZTPH 4JANB 4NKDA 2DKMA 3DROA 3ILQC 4NKMB 4LQFL 1JWSA 5M94B 1IAOA 3JWDL 3O4LB 4FXKA 3MCG1 3S35H 4F9LC 1FORH 3DYMA 2MCG1 1VADB 5AWNH 1RUKH 3PXJA 1A6VL 4QXUH 1MCHA 3LD8B 1MWAH 1KELL 3IXTA 1J12A 3MRHA 1CFSB 1N8ZA 2JJTC 4Q9BA 4J23A 1QRNB 4LCUB 5JZ7C 1ES0B 4XVUD 1QBLL 3MV9D 4MD5A 1MHPH 2YA2A 4LF3B 5C0AE 4GRLD 5C0EA 1MFCL 3F7RA 4Y5YB 4FQXC 3VXQA 3Q6FA 3UXFA 1AD9B 3S4SB 4WY7H 3QXTA 4OM1H 4X6DB 2VDQH 2YPVL 4M62L 3MNWB 2DIJA 2P5EB 2J8UA 4M5ZH 1JGEB 1WFUA 4LRNH 4X6DF 1XEDA 4G9FA 2F5AH 2CD0A 4BJLA 2KPNA 1YEGH 1UXSA 1G0DA 3U9UB 1ZSDA 4YFEA 1R3HA 1FG9C 3HMXA 4YHZL 1YEHL 3LZFL 1WICA 3MRKB 1RK1B 4XRCA 3RGVC 1DQMH 1MI5D 2DQGH 4ODUB 1TZGL 3JTTB 4MNHA 3KLAB 4P2OC 1EZVX 1Q9WA 4XWGL 5DC0A 1CYGA 2BRRH 1KENL 2VXUH 2QADD 4S1QL 1PY4A 4PJFE 1W8NA 2X89A 3T3MF 2FX8H 2N7BA 1C16A 4HMEA 3UTSA 2FNBA 4NCDA 5E4EC 2PTUA 4JM4L 2JE8A 1VKXA 2WUBH 1VEMA 3KPSA 1PSKL 5C07A 3U4EA 2OK0L 5DR5H 1LE5A 3QPQD 3V7AE 3HNSH 4FABL 1N0XL 3MGOB 4YZFE 3OKNA 5FKPB 5K9KB 3HZMA 2H1PL 4BZ2L 3WXVL 4EQ3A 4CUCA 1LEGB 2P43B 4IRSB 3NACH 3A6BH 4PYHA 2V5YA 1HI6B 2Z4QA 4YDKL 1PVHA 2W38A 1F2QA 1D5MB 4EZMA 1OPGL 4JDTH 4LP4A 4OZHE 5DA4A 3CUPB 4H20L 2W07A 1UKSA 4GAJL 4HS8L 4ZOBA 3S3SA 5CD5D 5IVXE 5J13C 5JA8B 1GPOL 3NAAL 4RIRA 5DRNA 4PJBB 3S5LB 6CGTA 3D18B 4XB7A 3CZJA 4PRPB 4PJBF 4AENA 2CKBA 3A6CL 4FQHA 2Z93A 3MO1B 4XPBL 1XF3A 2ICWI 3ES6B 4ERSL 5IB4B 3I6LD 4XNMA 4M7ZB 3CCHA 5I8OH 1FVDB 1LHZA 4XP1H 4NKIH 3WUWB 4BH7A 2C3HA 2KZ1B 3TCXA 4AIXA 4Z77A 2EDKA 3NZHL 4JZJC 2BSRA 4PS4L 4XCYA 3QFJA 1FZOA 1G7PB 3HC4L 2HFGH 3TVMA 1RHFA 4FZEH 4P4KD 3CVHA 4K7FB 3PV6B 4BZ1H 1MF2H 2YEZA 3BVNA 1FLRL 2HT2D 3AGVA 1NGYA 4O58L 3P0VL 3B2VL 1NAKL 4OV5A 3VI3F 3D0LA 3KYNA 5HI4C 5B3JF 3SDDD 4JZNA 5CSBA 4ZNEE 4WI7A 1V7MH 1VFBA 1SJEB 3PWJB 2NY5C 4G80B 4DWHA 1JHKL 2C1OA 1AQKL 4AEIH 3L6FA 4XC1H 2VABB 1IRAY 4OLYH 3IAQA 2OZ4A 4JFOB 1ZVSA 4FQXD 2ZCLH 4LFHD 2ZG1A 3IFLL 2ZPKH 4I1NB 2BC4A 4HS6A 2HN7B 1DQQA 4OKDA 1M7DB 1I7TA 3MLRL 1ZS8B 2NY5H 4XWOC 1T03H 1DVFC 1OGAB 2X4QA 5ACMA 5GISH 4JRXE 4LPVA 4D0DB 1KFAL 5JR1L 5D8JH 2GK2A 2DQIL 1IMHC 4LLAA 4P9HL 4FFVD 1N3NA 3MGAA 1JPGA 2CMRH 1LEIA 1AGCA 4LEXH 3RGVD 1RURL 3ZSSA 4D9RD 3V6FA 1DANU 1JGVH 2V5MA 2VZOA 2QV2A 3FT4A 5ID0A 4HKJA 1J0IA 1BFOB 2WBJC 4JG0H 4MNQA 1W0WB 3EYUL 2XTJC 2B20A 1O7SA 4PGDB 4KI5C 2ERJC 2H2PD 4D0CB 4ZTPL 3QXAA 2QHRH 1ZKAA 2P5WB 4PRHB 1JNJA 1FORL 1F6AB 2DOCA 2EE2A 3QI9B 4N0UB 4OCMC 5AWNL 4P2QA 5JOFB 1RUKL 4QXUL 3D48R 1BD2E 1MWAL 1H8OA 3BZ4B 3QJFB 1CIUA 1S7TB 1TENA 4MWFA 5F8QC 3M8OH 4BFIB 1P7KA 1GRWA 5CEXA 4IBLT 5L7XH 4I18C 3O3EA 1MHPL 2ESVD 4U1LB 5I1GH 5DO2C 5IEHA 2KZWA 3O2VH 4HUXA 5MENE 1OAQH 3HZVA 3H3KA 2PYFB 2Q20A 3TWCL 1UJ3B 2VQ1B 2WWKO 4WY7L 1PYWB 1DQDH 4UMGA 5EC2B 3RY6A 4XNYL 3SJVB 3O6FC 4M5ZL 3KLHC 5KS9A 2BJML 3PJSA 5INCA 1KJ2H 4LRNL 3NFNB 3PWVB 4Y4HB 1V3MA 1ZGLM 2F5AL 5IHLB 1X4YA 5D6CA 1YEGL 1K6QH 5E8EA 1FYTA 1B6DA 3QBTB 1UKTA 4QEGA 2A6JB 2D31A 3NTCL 3R0NA 1FL3B 3GSNB 3VE0A 5ABDE 2FEEL 4K7PY 5TH2B 3L9RB 2P8PA 2DQGL 2E6QA 3PIQA 1HZHH 1T04B 3MLPA 3TJHD 4ZTOL 4OCLC 3BJ91 5HHME 3FQTA 2AJUH 3QA3B 2BRRL 2VXUL 3B8SA 4XPGL 4R2GB 3TEUA 5I19H 2FX8L 4FZ8H 3EZJB 3O6MH 4KU1A 3FB7A 3SCMA 2G5RA 3IDNA 1H0DA 5DZNA 3SPVB 4F33A 2WUBL 4U2YA 2DQFA 4FOMA 4MDIA 3GM8A 15C8H 4GBXC 2DI9A 4YPGB 4KDTA 3TBSA 3NIFF 1VSCA 2R2HB 3G08A 7CGTA 1LNUA 1T7WA 4OCNC 1RZGB 4MXVF 4PLNC 3NACL 2FGZA 3A6BL 3ZE1E 1LEKA 5C1MB 3IT8D 1I3RB 5H2BB 5E2VL 1WZLA 4J6RH 4JDTL 5KSVA 2MOVA 1OHQA 2X2YA 4WV1A 3TLRA 1LE9B 3BEVA 3ZYOA 2WAHA 3I3EA 5D7IE 3X12B 3LKOB 1KB5H 2FZ3A 1UEMA 5MP6H 4UQ3A 1KPVB 4Z5RA 1FN4A 1EEQA 3RL2B 1HEZB 3AROA 3P0GB 3HI5H 4NRZA 4F3FA 3TIEA 5A2LH 2VKWA 5GZNC 5HJ3A 1L9NA 3DO7B 4EN3C 4YXLH 1I75A 1FH5H 4E5XA 5I8OL 2MKWA 3QEHB 1TQCC 2GIYA 4FN0A 3TO4C 5I74C 3EYQC 4NN6C 4V1DE 3SO3B 5C92A 1ORQB 4OZIA 2P4AB 3LRHA 4PBWD 1IKNC 1ZA6A 1FG2A 5C07E 5EC1A 2AP2A 3X11A 2XTJD 5GGTH 2BY0A 1HSAA 4KI5D 5CWSA 5CFHA 2BDNH 4Y4KB 4HWUA 1KNOA 2Q8AH 5CEYA 3PP3K 3WCYA 2HFGL 4FZEL 4L8DA 2OJEB 2VQUA 4BZ1L 1AO7A 1FZMA 3GMPB 4JQVC 5D7SH 4R4ND 4KKCC 4OCYH 4MHHG 3RWDB 4L1HA 1A14H 2R69H 2EKJA 4HIIA 4H25A 1C12A 3I6GA 1CFQA 4DKEH 4EI6A 1V7ML 1CCZA 4Y16C 4JFZH 4FNLH 3RBGA 3G6AB 4WJ5B 4I9WE 4AEIL 4XC1L 5DO2D 3K4DA 4OLYL 3GZKA 4Y2DB 1TFHA 1S7UA 1XZ0A 1P2CA 2ZCLL 4U1GC 3UBXA 3ORJA 2ZPKL 1T21A 5GGVH 4HJGB 1EHAA 2WBWB 3WD5H 3O6FD 3EO9H 3DV6A 2C7UA 3S35X 2MSPA 4C56B 1T03L 1YEJH 4PG2A 5CEZH 1T22B 2VLLB 3BZFA 5EBWA 5GISL 1ZWIA 1XT5A 4EI5C 5D8JL 4X4MA 1Y0LB 3V6ZB 1YQVH 3RWGA 3QUZD 2WWMC 1RAMA 4OZGA 2DQJL 3SE9H 4IRJD 3SKNB 2CMRL 2WINB 5FYLH 3ZHDA 3R06A 4LEXL 2XYCA 5CJ8A 4JN1L 1Q9LA 3W5NA 3L3DB 1NGWA 3KAAA 4HIHB 3PHQB 4F57H 1JPFA 1JGVL 1SBBA 1JZ8A 1G7JA 4YNYB 4JG0L 4QLRA 4WO4C 3ELAT 5L8JB 3KPMB 3ULSA 3GJFA 3OR7A 3JBG7 1S9KC 4L8CB 2QHRL 4RA0C 2FJFB 3LPWA 4PRNA 1G84A 2NY3C 2J8OA 4RGOL 1UWXH 4M02A 4UUJA 4D9QD 4R7DA 5FGSA 3EGSA 1XGTB 4NQDA 5FOJA 5IMLA 5E9DD 5CKGA 3ULVE 5F1IA 1YDPB 1IGJA 3K7UA 1OAKL 4MJIA 1BEYH 4GBXD 3M8OL 4O00A 3ZYJA 4IJ3B 4PTUA 1OL0A 3UZQA 5L7XL 4JPKH 3ULUH 2X4OB 4PGEB 3CDFA 1BOGA 2D7OA 3NIDF 5LGJB 3O2VL 3C6LB 1OAQL 1BF8A 5L0QB 3VXOB 4Z6AT 4P5KA 3TNMA 1NC4D 3QQNA 4JB9H 3KVQA 2YOCA 3TZVD 2DLFH 2AKRA 3WLWC 4WW2B 2DIAA 1JGUH 2EO9A 2ITDB 1CT8B 1U3YA 2IMNA 4HJ0D 4WFHD 1S7VB 1KJ2L 3T0EA 1CLYH 1CDJA 2VTFA 3SE3C 2V7NB 5GGUA 4ODVH 4WW2F 5T1MB 5IQ7H 4PRBA 5HD8C 4AZ8A 3ARDA 1K6QL 1VENA 3WS3B 4B53A 1JNHB 5GZND 2G2RA 5C0BB 4EN3D 1UWEL 5IMOB 2ZKHH 5ESQB 5IHZA 1CE6B 2R2CA 4O4YL 1HZHL 3EYQD 1TZIA 3MODH 5DJXB 4JY4B 4WNQA 1ND0A 3PHOB 4PP2A 1BFTA 4Y8AA 1GGBH 1T1ZB 2GW5A 2AJUL 3HR5B 5SX5K 3FMGH 1KEGL 3ZT5A 4KI1A 2UWEA 3QUKA 2F8XC 3FQNA 3QIUB 5I19L 5GXBB 2VXSH 5L2KB 3T8XB 4FZ8L 4BQCA 3O9WC 3ZMRA 2Q8BH 3G6JA 2GJ6B 2OTWA 1AXSA 2BY2A 3MBED 4WHYH 4KKCD 4W68A 4UOJA 3X14A 4Z7VA 5C0DA 1F00I 1S3KH 3DVGB 2ZSWA 3EHBC 4RBPH 3JV4A 3DMMD 2H26A 4F9PC 3C5ZB 4LMQI 1TETH 3G5XB 1I7RB 4NZUH 3UZEA 4QRUA 1AY1H 1JMXA 5FUZL 5CEZD 1CICB 1QLFA 4HCRA 3N1PC 3I85A 3MV8E 4P23B 1KTKE 2JJVA 3TYFB 3KPRA 1G7IA 4J6RL 3ARVA 3KPTA 4RDQG 1ZT1A 4XP5L 1JV5A 4WDIA 5A16B 4PJIB 3BDXA 4WI2A 5I1LB 4ZPTB 5D1QA 3RNKB 5F9JA 2I9TA 1KB5L 4PJIF 5MP6L 1LO0L 5C0CA 1JIBA 1GL4B 2PYEB 4XB8A 3ARGA 2Y25A 4PD4K 2AXHA 1BZQK 3HI5L 5DJ0B 3FT2B 1X5LA 4YXLL 4DUXA 1S7QB 4QGYA 3WIFA 3WKNA 2QSVA 5CHNA 3DX6B 4CVXA 1ZLUK 2KUTA 1F4XH 3D5OF 3O3DA 2IAND 3PWNA 3KYMB 2X1PA 4WO4D 5FOBA 1YEDB 5HGBA 5GGTL 2B1HL 3LRGA 2BDNL 1B3JA 5FK9B 5JA9A 4KHXH 2SEBB 4U05A 5JMRA 3H7BA 4N1EA 4RX4A 2VAAA 4CU8A 2NY3D 1ZHKA 4QRPB 5C0FB 2FB4H 3GSWB 3Q5TA 2IPUK 4LIQE 3V5KB 4OLUH 4Y89A 2MQ0A 1JWUB 1WAAF 4H26B 3H8NA 4NUJB 4CJ1A 1A14L 2R69L 4HLJA 2IFGA 2GTWA 4DKEL 3QXWA 1HOCB 4TVPE 1OM3H 4DK3A 3GIVB 4LBEB 4JFZL 4FNLL 4R0LB 5C6PB 5TGBA 1HKLH 1KJVA 2YA1A 3NGBC 3GNMH 4G42A 5T5NG 3T1WA 3WL9B 1DUYB 2W9EH 3W11C 4DN4H 2Q76A 3VDAA 4FQQA 4LQ1A 4Y7MA 4OAWB 4P5MA 5GGVL 5DC4B 3S6CA 3WLWD 2EXWC 2HWZL 2QSCL 4PJ7A 3WD5L 4M93B 4NFDA 3EO9L 4JLRA 5ALCH 3B9KC 2CUMA 4LVEA 1LK2B 5IW1B 2ADIB 5CLWA 1YEJL 4X5LA 4PFEA 5DD6B 5HD8D 2ZCHH 3VI4F 1MJUH 3UTTD 3RUGB 2Z31B 1YQ2A 3AMKA 1YQVL 2NY6B 1IGFH 3QIBB 4P2RA 4XT1C 3L5IA 3LSOA 4MAYC 4JO1L 3SE9L 4OQ1A 3RUGF 2P8MA 4PGJA 5FYLL 3BUYB 1EHNA 3FL7A 4ZQKB 5GRJH 3SY0B 2R23A 2GAZA 3C5JA 3I2CH 4B7LA 1XGPA 5HDOA 4F57L 1AO7E 2YPLD 2PR4H 3BESR 3NCMA 4NJ9H 4W4OA 3TN0A 5T3ZD 3AS2A 3FO1A 3GSOA 5L88H 5JQ6H 2VL4A 1B0RA 1OTTD 2OTUB 4FMKA 5HHPA 3FFCD 3O9WD 2XKUA 2ICEA 4WFFE 1VFAB 4IOFC 1QSFE 2NY4B 5EUOB 1BEYL 3OR6A 1CN4A 1UCTA 3O8XD 1FVCB 4KUZH 5EU5A 1JK8A 5EUOF 3ZYIA 3OB0K 1J88A 1HH6A 1T1WA 5K9OB 3ULUL 4DGIH 1NEZA 5D1XA 1UENA 2WIIB 4JFHE 3UTOA 5IESH 3E6FB 2WK2A 4GKSA 1WFTA 2P44B 2VL5B 2Y9RT 1X5GA 2PO6B 5FO7B 1AHWA 3PQYB 4Y19A 5B38G 5BV7B 2E7LC 1KCSH 4JB9L 4OZGE 1RJZB 4P5TC 1KGCD 1A2YB 5HYJB 3UTPE 2VLRB 4YQXH 5TF1L 3L3GA 3C09C 1JGUL 4QOKA 1CLYL 4K2UH 2FJHB 4LVOB 4ODVL 2NY1B 2DF3A 1I7ZB 5F1NB 2W0KA 4QRRB 4CW1B 1H15B 4M7ZC 4R4BB 4IOIB 3HNVH 4L1DA 1I1YB 4L5FH 4HGMA 1WCBA 2VXVH 3UO1H 2FX9L 5I8CB 5JW5A 3VGEA 1FFNA 5CGYD 3MODL 3F5WB 2XV6B 3EYOB 5D2NE 2DB8A 4RDQF 1YN7A 1QHPA 3O4LD 4MJIE 1GGBL 3FMGL 4C57C 3OPZH 4Q58C 5DHVA 4QXGH 1FL6A 2VXSL 5D2LA 2ARJA 1S7RB 2D9QB 5FCUH 1QRND 4CADA 4ODHH 5I1IH 1KXVC 3WHE1 1OD7A 1MQKL 2UYLB 1U58A 1IVLA 4NZUL 3RBSA 3D85A 4FQCH 1AY1L 3QRGH 4JKLA 1U8MA 5BVJB 2GSIA 3JV6A 3VFVA 3C8DA 5BRZB 1R5IB 5IJKC 3ARBB 3W11D 4MD0A 4M1CC 1J05A 2GUOA 5F9AC 2R56H 2EXWD 3QQ4A 4H1LG 1XF4B 2XOTA 2A9MH 4FP8H 1A6WL 2X42A 3RZWA 3QG6A 4Q7DA 4JFEE 4X9IA 3VMPA 2QL1A 1TNNA 4HXBH 4WWKC 5KSAB 2X4UB 1U41A 2PCPB 5F6HI 2MFNA 1P6AB 4I5BA 3LN5B 4KFZC 3MMEB 1OAXH 4NM4H 3HC3H 5I1AB 5T5NF 4I0KA 1F4XL 3B3IA 5IWLA 1K4CB 4UT9H 2R8SH 2AK4B 2IQAA 2NXYC 4K23H 5IV2A 4PJ5E 1NBZA 2NMSA 4ISVB 1K8DB 4KHXL 4HUUB 4AQOA 2IGFH 3KS0H 3WEXA 4G6AC 3ULUF 2FB4L 2Q7NA 2VR5A 3PDOB 2YHGA 1E6JH 3O41B 1UACH 4N8VA 4R3SB 3OGOE 1MNUH 1NLDH 4U0QB 5LVEA 5D5ME 4IOFD 2QEJA 4YFDB 1F11A 3TF7C 5KW9H 1U8IA 4JFDE 1AGEA 5D1ZB 4JDVA 5GGSA 2QJDA 3CX2A 1VFUA 3RTQB 1OM3L 2HLFC 4QF1B 5F88B 4F80A 1VESA 4KV5E 1HKLL 5E94B 3LQZA 4KVCL 3V6OC 4S2SB 2I27N 3GNML 1NBVL 1TJIL 3V4UH 1BX2B 2GT9A 4WHCA 2W9EL 2YC1B 1I1FA 4DN4L 4NBXB 3NBNA 4QT5A 2CO6B 1IILE 1K2DB 1ZHBA 1N6UA 3SKMA 5ALCL 3RNQB 2IFFL 4PRPD 1ZV5A 4BQ9A 5LGKA 2L7UA 3TCLA 4O2FA 1IGIH 2ZCHL 1MJUL 5LWYH 2HKHH 5F89A 1CXLA 1S9YA 5F7LB 4BSWA 5ALBH 2NPLX 5HYQA 1K9TA 1N5AB 2KBGA 5HDBF 3DBXA 1CG9A 5GRJL 5F7DB 3OXSB 4YBQD 5B38B 4OFDA 3I2CL 3T0VA 3B8YA 1KIRB 4M6MH 3PGDA 3MLTA 1MEXH 5I16B 2A0LC 4M1GH 2A6KA 4ZO8A 2BXZA 4NJ9L 5IFJB 1J11A 4E0RB 5F93C 3F7YA 5HDQH 5IFAH 2GCYB 3A67H 3KXFA 5DQJB 3BW9B 4ZDHA 5L88L 5JQ6L 3U7WH 3W0WA 1S8DB 2J6EH 3DXAA 2JB5L 4X99A 4X6CB 5TFSH 1ERNA 2B2XH 1OCWL 3WLBA 3VXUB 2A6DB 4DW2H 4NO5A 1I8KA 1XH3A 5J6GB 3OKMA 2D2OA 4GSDH 3FFDA 2ZP0T 4X6CF 2VISA 1YMMA 2EC9T 4KUZL 2O61B 3WJLC 2FH8A 5IB5A 2OQJA 2R1YA 4PJAA 4DGIL 4PV8B 4DFIA 1BP3B 2D4FA 3CDGB 3O3UN 4JN2A 4P57A 3NH7L 4Y4FB 4ZFOB 4JAMA 3RWFA 5IESL 2JK5A 5DRZA 2CDEB 1EPFA 1NGQH 4AIOA 4WRLA 1MELA 3LN9A 3QFDB 4HKBA 4FQ1H 1HNGA 4HW6A 1KCSL 1LDPH 1OGAD 3QDJB 1ZT4B 2NXZC 5EOQH 4ONFH 5EU3B 1B6UA 2VKXA 3WN5A 4M8QB 3G5YA 3AC0A 1IE5A 3VWJA 1OSZA 3IETB 3V7AG 2NY0C 3FOMA 3PHSA 5JPNB 3QWRD 1DE4B 1PKQE 3BKYL 2EICA 4PJ9B 3HNVL 3DARA 1DEEA 1EFXB 5F7KC 4GUPA 1S7SA 4L5FL 5KSBB 1Y18A 4Z76A 3CX5J 4KROC 3AB0B 2VITA 3UO1L 1J8HA 1OAZL 5EU7E 1RI8A 2J88H 5FUCC 5KSBF 1CD1B 1QR1A 1X4ZA 4YGAB 4E41E 2JTDA 2NXYD 4HKZB 2HJKB 3ALXA 2P48B 2Z91A 4ZUSA 1FO0B 1ETZB 3OPZL 5CP7B 5SWZB 1D9KB 4RGMB 2ARJQ 4QXGL 4BSVB 5MEPA 2DJ4A 5C09E 3QUXB 3MOQA 3P40A 1UM6H 4ZODA 4PJXE 4ODHL 3GMNB 2BNRA 3VFMA 5C0GB 5I1IL 5JPMA 1X5ZA 4XPAL 3BHBB 5FYKU 2NX5E 4X6BB 4LHUA 1K5NA 1QEWB 1XGUB 5TDOB 1MFDH 2HLFD 3RI5F 4TUJA 3FRPG 3DV4A 4M4PA 4GW5B 4QOKE 4X0KA 1QRKA 4J4PA 3QRGL 1HYSD 1T7XA 5TF0A 3VG9C 3GSVA 2ICWA 2JCCF 2LE9A 5GIRA 3SJVD 2XQYK 1CGSL 3BZEA 2NW2A 1NC2B 3QWQB 3TO2A 2Y6SC 4Y4HD 4RMWA 3MROB 1AGFB 1KT2A 4PY7B 5F96L 2R56L 3VXPB 3EYSH 3BX7C 2RFXA 3SE4C 3UAJD 4FP8L 4XP4H 5J1SC 3OAZH 4IMKC 3QCVH 1JF6A 3QXDA 1EXUA 3MUGA 4GG6E 4HXBL 3DETC 4WIQA 5GQBA 3GMRA 4G8GD 3MZGB 2F53E 4RFNC 2XWBB 1OAXL 4NM4L 4WFGD 3GSRB 4R2GD 4UT9L 3ARSA 4HMDA 1U3HA 3OF6A 3ILPB 3OMZA 5IF0A 1X6NA 3U0PA 3D87B 4K3HA 5DDHB 1D6EB 1CFNB 1DUZB 2JELH 4NNPH 4TULH 3CFKB 2IGFL 4PG9A 1AR2A 1HHJB 2YUXA 1DJSA 5C0AB 1UACL 2RAMA 1MNUL 4ZO6A 3IDYB 3Q5YA 2AW2A 2Z8RA 3UDWC 4QRTB 3MRNB 3HAEA 4WW1B 5FYJH 1V8HA 4PR5B 1RK0A 4PJEB 3MJ7A 4XXCA 4LCWB 3F7PC 4MQXC 5KW9L 2OR7A 4U0RC 4LKXB 4KZEH 2MQ3A 4BM7A 1U91A 4IMLB 4U31A 4PJEF 3C6LC 1PG7W 5L0QC 2VLJA 3LH2H 4JHZA 3HTLX 1QA9A 4NBZB 1JZ4A 4PRIE 1J0KA 3V4UL 4U4BA 3ARPA 5D6DA 5BW7A 3CFDB 1INQB 2HAZA 3H2WA 1M7XA 3FB5B 4KRPC 3SE8L 2CKBH 2X40A 3OKEA 5GGQH 1TVDA 4MDJA 2K3TA 3MGTA 2NY0D 4L4TA 3JXAA 2XG4A 5FIEA 3RJQB 3B9EA 3RWIB 1IGIL 2VDMH 5LWYL 2HKHL 4H5SA 4FMFA 4OFVA 2EIBA 3ZTJH 1E4KA 5ALBL 4NGHH 4FTVD 2NTSP 4Q6IA 4PJFB 1V3KA 2X41A 4KJWC 1N6QH 2DJUA 4NNYB 4WU5A 3ZKXB 4HX1A 4Y4KD 4M5YH 4M6ML 5DQ9B 4PJFF 1MEXL 2H8PB 4M1GL 1F3RB 1TITA 2C4FT 5HDQL 5IFAL 3A67L 4N0CC 1OB1B 5ILTH 4NKOB 3U7WL 5EORH 2PUQT 2ITCB 4DJMA 1ODAA 1XCQB 1VB9A 3GRWL 4GLRI 3MUHL 5T5FH 3EO1A 5DD1H 3VD4A 5BO1H 5D7JB 1M1SA 4DW2L 5BS0A 4MZ3A 1Q1JH 2YUWA 1MREH 4MS8D 1CLZL 1XFPA 3KPNB 4OI9A 4OZHB 5C0RL 3RY5A 2BVOB 5DGRA 1JPTL 2VYRE 2Y07L 4WVRA 5A1AA 3I3BA 5IVXB 4U1KA 1DLHA 1DBMH 1C08B 5DI8B 2DRUA 2NY2B 2OX5A 2I5YH 1NGQL 3BEWB 1GXEA 1CGTA 3TBWA 1QFWI 4C56D 1LDPL 3DRTA 3B9DA 5MEOA 5EOQL 2IG2H 4YFLF 4ONFL 3LQAC 4U6TA 1DQTA 1IQDA 3KYOA 5KG9A 4B50A 3CFEA 1CFTA 1GZPB 2MHAA 1UZ6E 2J1KA 1AXIB 3DETD 1FAIH 2CLZB 3TC9A 3FAXA 5EN2A 4Y1AA 1U8OB 1A47A 1LD9A 3LQAH 3NCEB 2Y7QB 3FKUS 1J8KA 3QEQA 5DRWA 5GS2H 3DRQA 4XX1G 4WUUA 1ZGLP 3N50A 5DJDB 1PLGH 1FVEB 2XWTA 4G8IB 1T0NB 3VWKB 3QNZA 3QP3A 1WF5A 2YA0A 1FFPB 1CLOH 4LCCB 5T3XD 1IM3A 1QPPA 3JWNC 4ORZC 4RQQB 1MIEH 3IDMB 2XZAL 1WTLA 1UM6L 3HRZB 3E2HC 5C0NC 1G6VK 3DX7A 1A7RH 2AXGB 4PJDE 5D7LA 4F2MA 1MFDL 5ISZE 4CRPA 1P4LA 2XA3A 12E8H 3C6LD 4OFPA 3R4DA 3OB8A 4GRWH 4LKCA 5T33L 4WENB 3BUTA 5EO1B 3C87A 2HFTA 4JRXB 3KPPA 3NPZB 5F6IC 3FO0H 4YDLB 1U8NA 1F4WH 3ARFB 2XFXB 1OP5K 3FTGB 2FEDC 1ITBB 3HMXL 1J8HE 1Q72H 1QACA 1I1AA 4URTB 4XP4L 3CVIH 4AM0A 1EUUA 1J0YA 3QCVL 1HKFA 5C0BD 2IBGA 4U7KA 5JMOC 4CDHA 3V5DB 4HV8B 2VDRH 1JPST 5CZXC 1FZJA 3C6SA 1J0JA 1XIWC 4IHOB 4PB9H 2A83A 4DZBA 2E9BA 5F1SA 1I8MB 5AYUH 4WTXA 1ZHNA 2C3VA 5DEGA 1N2RA 5L2KD 3GI8H 5EH1A 3S34H 4KKBC 1NANH 4NCC1 3QHFH 4N0CD 3DSNA 3VXRA 1BD2B 2HT3C 5FO9B 1GZQB 2GJ6D 1CK0H 2NZ9C 4X5WB 1H8NA 2JELL 4NNPL 4TULL 3F12B 3BIKA 2QQNL 3DX8A 4ZFZB 4TVSa 5JDSB 1I85A 3H9YA 5J11C 2VNCA 3C5ZD 4UINH 1NGZB 3UC0H 3RIAF 5HDLA 4ZYKA 5FYJL 4HWBA 4HIEA 5MENB 4JZOB 4QO1A 1CICD 3FQWA 3ZL4H 1YN6A 1U8LA 4YIQB 3VXSA 3CZFB 4NNXA 4F7EA 3BISA 4KZEL 3QIWA 3MRLB 4I0PB 2DD8H 3ARRA 1TTUA 1EVTC 2BSSB 4LEOA 4QHLB 5BV7C 1HWGB 2UUDH 3VFGH 3IU3A 2VRAA 2DMBA 1S9XA 3BKCL 1FJ1B 2FX7H 1M05B 1S7WB 2K9UA 4PRAB 4QRQB 3VMOA 4NO0A 4H8WC 4NKDB 2CKBL 4NN5B 1JWSB 1IAOB 3VRLE 2AJ3A 1BLNA 4LDOB 5CBAA 3TESA 1JVKA 3G5VA 3Q1SH 2R0LH 2VDML 4U1MA 3U0TA 1MRCH 3SGJC 3IXTB 3BE1H 4NGHL 3TV3H 3ZTNH 2F54A 1N8ZB 5C0JA 3ROOA 4XH2A 5A2KH 2RCSH 4H8WH 2BZDA 3ESVF 3WV0A 5EDXA 1N6QL 3KPLB 3QH3B 4M5YL 1MHHA 3CVHL 2X7LB 4NQCA 4OCWH 3TA3B 5LKNA 4P49A 3EJYC 1SBSH 4QRPD 5EO0A 1GYAA 5ILTL 5E5UB 3Q6FB 1WV7T 5HPMA 3T77A 5EORL 3VGAB 2XN9A 1FLTX 1KEMH 1I9JH 4JDZB 3KHOA 5T5FL 4RWYH 1JFQL 1MJJA 5B4MC 5DD1L 4J3SA 3LEVH 4PG2C 1Q1JL 1UXSB 1MREL 5TQ0H 5C0ND 2QQQA 1NFDA 3EJZC 1ZSDB 4O2CA 3ZE1F 5FA3A 2DQEH 1SYVB 1T5WB 4J3UA 3T3PE 4N0YL 4U1HA 3ARBC 2EE3A 4LVNB 5FV1L 4XRCB 1XR9B 3MV9A 1PKOA 3O2DA 4U6HA 1HK6A 5I1CH 4HFUH 1SHMA 2APTA 1A3LH 1FPTH 1Q9WB 2I5YL 5FDWA 4YHPA 1N5YH 4U1IA 5CJBA 2Q7YA 2YRZA 4ELME 3U7YH 2IG2L 5ICYA 1OGTB 2Z31D 1C16B 2NY6D 1I8IA 1RZKL 3QO1A 3QIBD 1O5DT 1C5BL 5ESVA 4V1DB 5ANMA 3KPSB 2WANA 3CDYA 4YBHA 3AU1A 5C07B 3U4EB 1FAIL 2W1NA 3SGKA 1UC6A 5CZXD 1HDMA 5L2JA 1PGRB 4C58B 1PDKA 5ICXA 1UQSA 1JI1A 1YEKH 4KDVA 3HZMB 3ZHLA 3GJFH 4JO4H 3LQAL 2LU3A 5EUKA 3D3VE 2DM4A 3O3BA 2A77H 2WQ8A 5KANG 3FO9A 2VUYA 1MI5A 2YD5A 1W0VB 4FFZH 2Z4QB 1YECH 5BS0E 3V7MA 1PLGL 3TJEL 3HHRB 1RU9H 3P9MA 4R8WH 4DEPB 4PIRF 5SWSE 1BZ7A 1MFBH 2NZ9D 4NQVA 2NY4D 1J86A 1MIEL 3IGAB 2AXFB 3T0EC 5DRNB 1ORSB 3SEPA 5I6XB 1GVIA 5FHBH 4WI4A 4JFFD 1A7RL 3P9WB 3DGGA 1E6OL 4FQHB 2Z93B 3WDIA 4R26H 5GSRB 2EIDA 4XNMB 5T1KB 5DJ8A 5FM5M 12E8L 2FD6H 4JVPA 4X6DE 2P5EE 1QSED 4RNRA 5HVFB 5HYJD 2VLRD 2B0SH 5JXAH 4EUPA 1A9BA 3TT1H 2BSRB 1F4WL 3UTQB 4XCYB 4QRRD 1FZOB 2APBA 4HFWA 4YDVB 1A1MA 1Q72L 3CVHB 3QXUA 3H9SE 1IGYA 4GT7A 3CVIL 1XF2A 3LOWA 3GSQB 3BVNB 4RBPK 1NGYB 3D69B 1NQBA 4OV5B 3BO8A 3D0LB 4QTIL 2VDRL 4JZNB 4L8SB 3P4OA 1GSMA 4PGBA 4Q2ZA 5BCAA 3T3ME 3TPKA 2NR6C 2NW3B 1KLUB 1CF8H 1XF5B 5F9WC 1DSFH 1V05A 2C1OB 5HHOE 5ICZA 3L6FB 2D4DA 1KYOJ 3L5XH 5C0IA 3DPBA 4TNVK 1YNKH 3F8UB 3OWEA 2FYYA 3GI8L 5BJTA 1EBPA 1MH5B 3EJYD 4ZAKB 3IKKA 4POZC 2EC9U 3NCCB 3L95B 1D5BA 2BC4B 1BAFL 3MACH 1CK0L 4HS6B 2DM2A 5J3HC 5IOPB 3PGCA 2RR3A 5I76A 2DWDA 3RA7H 5FB8B 5D1QC 5B4MD 4F9LA 2X4QB 3UC0L 1RZ8A 4R9HA 5CP3H 3HI6H 2VZTA 5LGHH 5GPRA 1T20A 1EGJH 4DUWA 3W9EB 4QXWA 3SDDA 2VIRA 5ESAA 1MCFA 1MVFA 1N3NB 3ZL4L 4O51B 1SJVA 2VZ1A 4ZFFB 3ARBD 2DD8L 3MZTA 1LEIB 1IFHH 4TVPL 3OBAA 1QUNA 2PXYC 6FABH 2V9RA 1NBQA 4U1SA 3QDGE 5IVZB 5E70A 4PJBE 1EUTA 4UT7H 4JFPA 2MNUA 2L4OA 4FQXA 1HYRC 5DQDL 3QXAB 4I0CC 2FJGB 2X44D 4UI2A 1T0MA 2FLRT 3VFSB 43CAA 4EQ2A 4PJ9C 1Q0XL 5FFLA 3L3IB 2EIEA 3UBXG 1FRGH 4K8RC 2R0LL 2YWYA 3S36H 4OI8A 3QO0B 1MRCL 1OP9A 4POYA 3BE1L 3TV3L 3ZTNL 3EOTH 4MWFB 2VZUA 1P7KB 4H8WL 5CEXB 2AK4D 3O3EB 4POUB 2L0DA 2B7DT 4N68A 3RGVA 5I18H 2AJVL 1A7QH 4DVBB 4K8RH 1CGWA 4HUXB 4P2OA 4PGCA 1SBSL 1E4WL 3I84A 4LLYB 1ROWA 4AK1A 1CDBA 3J8F7 4M7LL 1KPRA 5GGVY 1KEML 5KS9B 1I9JL 3PJSB 3VU2A 5INCB 3N1FC 5BVPL 4RWYL 3L1OH 5D1ZD 5AZ2H 3LEVL 1A7BA 4NT6A 5E7BA 4CMHB 5KS9F 3IFOA 3MV8B 5D6CB 1P4IH 1NMCB 2DS4A 5DYOB 1AGDA 2DQEL 2D31B 4JO2H 5CZKA 3DJ9A 4MZ2A 4LAJH 3VE0B 1C5CL 5E99H 3Q0HA 2ESVA 1I8LC 4R97C 3PIQB 5I1CL 3V95A 4HFUL 4I2XA 2PTTA 1JTTA 5BZWA 1A3LL 3K46A 1FPTL 1S9WA 1N5YL 3VDCA 3FQTB 4W4OC 5IMKB 1XR8A 3MQIA 3EYVB 5IB3A 3U7YL 1WWBX 3MRBA 3PL6B 2RGSA 5ACZB 2CDGA 4X5XA 3FB7B 3SCMB 4IDJH 4OFYD 3IS0X 2AJSH 4F33B 2NNAA 4OJFL 2DQFB 3JWOC 4MDIB 4UU9A 1VFMA 1OT2A 2XRAH 1CXKA 4JVUA 4LLUA 5FA4B 3BP5A 5DJAA 2XN9E 3TBSB 3U6RA 3OJVC 4TYUA 5BQ7A 1U95A 1YEKL 4JO4L 1LNUB 2NR6D 1CGYA 1EEZA 1UEYA 2A77L 2C3GA 5E00A 4JPIB 2P5WE 3MCKB 4FFZL 3WNPA 5CINH 2ENSA 4PRHE 3ZYZA 1YECL 3JWOH 4Y2OA 2VDLH 4POZD 4KJQC 1RU9L 4JZJA 1AHWC 3GFUA 3VXUD 1ZTXH 4XCEA 4F8QA 4WV1B 4AQ1B 3M45A 3NIGF 3BEVB 2FZ3B 3HPJA 4G3YH 4L4VD 4Q9CA 5FHBL 3QUMB 5DURB 4Z5RB 2E9JA 2GSGA 1KJ3H 4NRZB 1LK3H 4F3FB 1HXYA 3TIEB 4R26L 5TDPA 5HJ3B 2IH1A 2NLJB 1FV1A 4QHMA 2FD6L 1P84K 2DQCH 1DZBA 3CLEH 4BSJA 3BGAA 3QDJD 3TPUA 5H94A 5JXAL 1NKRA 3PDDA 2A73A 1FG2B 3TT1L 3X11B 1S9VA 2HJFA 1HSAB 2Q86A 3NFPA 3BWAB 5EBLB 5CEYB 2PF6A 1XMWA 4PJ9D 3JTSA 2E8ZA 3FZUD 4ZUWB 3REWA 1EFXD 1AO7B 1FZMB 3W39A 1RZ7L 2Z9TA 3BQUC 1IT9H 2R4RH 2V2TB 1IJ9A 4QHNA 2C4FU 5DK0A 1OAYH 4HEPG 2DIBA 5K9JH 4HIIB 4H25B 3EFFA 4GKNB 4JQXC 3U46A 4EI6B 1F8TL 3RDTC 1AIFA 4MNGE 4MA3A 2XXMB 4XVJH 1R3LB 2JIXB 3NN8B 5DMGC 4TTDC 1HNFA 3EO0A 5DHVH 4U6YB 5IVOA 3PNWA 1UADC 1TQBB 5SWZD 1DSFL 3L5XL 5C9KA 2YD2A 4M6NH 1S7UB 3L5JA 3IDGB 1P2CB 3WNNA 2WBJA 5DK2A 1G7MA 2D7PA 3UBXB 5D7JC 1NGXB 4G6FB 1EMTH 3DVIA 3DV6B 2C7UB 3EIFA 3RA7L 1CVSC 4L9DA 3BZFB 5EBWB 1ZWIB 3HI6L 3TFKC 5LGHL 3UYPA 3LS4H 5FKAA 1FIGL 4CJ0A 3GMOA 4OZGB 4JG1H 4X80H 1NAMB 4YO0A 3U30B 1N0LA 1IFHL 1MHEA 2KKQA 3R06B 4DKDC 5IW3A 4OZGF 4I18A 1Q9LB 2HMIC 1U9KA 2VDNL 6FABL 1T1YA 1FNSH 4OGXH 1ZLVK 1JPFB 2V5RA 3G5ZB 5J57B 1QR4A 5E1AA 1GAFH 1KLFA 4UT7L 4AY0A 3VRJB 3GJFB 4O9HH 2EDQA 4HIJA 5E8PA 4Z7OE 3T2QA 3MRDA 4PRNB 1NBYB 3O6FA 4M1DH 3IDJB 2AQ2A 1FRGL 2D7QA 5AUMA 4JHWH 5HY9B 5IMLB 5B8CB 3K4ZA 3QEGH 3S36L 4CVZA 4MJIB 1WBZA 2ZCKH 3TIDB 4N9GA 5CJXC 3QUZA 3EOTL 4OGZA 3TBYA 2V5SA 2FECI 3LKRA 2DLTA 4IRJA 4PTUB 3NZ8B 4MHHI 2BY3A 2DLIA 2W65B 4KK8D 4Y5VB 3VWKC 3CSPA 1EERB 1UVQA 4P9MH 4DKFH 5I18L 2BNUB 1A7QL 3RVUC 1YEEH 1BOGB 4K8RL 5IJVA 4OFIA 1FNFA 2D03H 5I73C 1JCKA 2AGJL 3MRRB 4P5KB 5C0AD 1EEYA 1MRFH 3TNMB 5CUSH 3N06B 4LHJB 4OB5H 2AKRB 4MXWH 1WLHA 1ZK9A 5ADPH 2VE6A 2K1MA 3QDME 2YBRA 3FQRA 3BP6A 3L1OL 3MLWH 1DQJA 4RMVA 5AZ2L 3QCUH 4PRBB 5EU6E 3QHZH 4MVBC 1P4IL 4PUBL 4GXVH 3CPLB 5I66A 3B2UC 1TIUA 2F58H 3X3GL 3HE7C 4GBXA 2ENYA 2J7LA 2G2RB 3DUSB 5F71A 4JO2L 4RFOH 1SVZA 3B6SB 5E99L 2BOBB 5JIIA 5D7KE 3KHQA 2ILLA 3EDKA 1SMAA 4JFEB 4WNQB 4KAQH 2GY5A 4LP5A 1ND0B 1JTOA 1KTDB 2XNAA 1Z0NA 4JPWL 5GGRA 3HI1A 1NEZG 2N56A 3MV7A 4OD1H 2V9QA 5JIPA 4JVWA 4YHNA 3LHPH 2UWEB 1NC4A 3PWLB 3QUKB 1FCCA 3D1MC 1F4YH 3D39E 5IR1A 3R8BB 4LCYA 2UWEF 4IDJL 3PXHA 2AJSL 1AFVL 3G6JB 2OTWB 2M8XA 1AXSB 3MTRA 3BQUD 3P77A 1I9EA 2EDTA 4KXZH 5C0DB 3U48A 2ZSWB 3LKSA 4PJ5B 2XRAL 2HG5B 3G6JF 3JV4B 5ITBH 1VGKA 4Z7VF 2H26B 3RX5A 3MRIB 3RDTD 3K2MC 1T3FA 4I3SH 3MX0A 4HK0B 4IS6A 5DMGD 2AS5M 2GJZA 2F15A 4EN3A 2DICA 4D3CH 3F58L 5MEQA 3TO4A 1QLFB 4N8PA 4DVRH 5CINL 3JWOL 1IKNA 3SN6N 1G7IB 5C8JB 2J2ZA 4PGZA 1ZT1B 1PY9A 4JFDB 5D7JD 2B5IB 3BGFC 3SDAB 1ZTXL 5DD3H 3SOBH 4WDIB 3DI2B 4LSSH 1NANI 2QR0B 4G43A 3WN5C 5HYSA 3NIDE 4G3YL 1FYHB 4XP6H 1YNTA 4KJPD 4KV5F 5C0CB 5CCKH 4KKLC 3HG1E 4JQVA 3MBXH 3ARGB 4KTYA 4HDIA 4HF5H 1S78D 5EZOH 1KJ3L 1LK3L 2HH0L 4HH9A 3SQBA 3DMMA 3EDEA 3HZYA 3WIFB 2DQCL 3CLEL 5CHNB 4MB3A 4CVXB 4HLZG 3DHJA 3PWNB 2LTQB 4JY6A 1PEZA 4TUKL 3AXLB 3VFPB 1OP3K 4WCYH 3QULB 3H7BB 1Z3GH 3SKOA 4KMTH 3U36A 1G6RB 2W0FB 2GITA 4PTTB 1KN4H 2YRLA 3BD4A 5I15H 1BIIB 4XZUA 5DJ2A 4OT1H 1IT9L 2R4RL 4CBPA 5E03A 1WBYB 2FCBA 3RVTC 1QG3A 5K9JL 1FL5B 5T1LD 3X3FH 2GTWB 4P46B 5GS1B 1TVHA 3TA3C 4XVJL 2VZSA 4J1UA 2C3WA 5TGBB 1IGCH 3LRSA 1KJVB 3VWKD 2ICES 2ED8A 2MWCA 3GIZH 1UFUA 2NYYD 4J4PC 5J89A 3RVUD 1ZE3C 5IK3A 1MCNA 4M6NL 2VXTH 5ADOH 2IANA 4JY5H 2XZCH 3C8KA 4UNUA 3OJDB 3W2DH 4WO4A 4UQ2A 3IB4A 4P5MB 2EYRA 4RGNC 3VXTA 4PJ7B 1EMTL 5FGBC 3EDDA 1F3DJ 3TBVA 3FQUA 2D7TH 4JLRB 3OAZK 3RVXC 5E7FA 3GUTB 5GJTH 2UVEA 4PJ7F 1KN2H 4QHUA 3RHWK 3SKJH 1KIQB 2ATPB 1F97A 4LVNC 2O5YH 3WNOA 3C5SB 5A2IH 3B2UD 3LS4L 2EDXA 2OBGA 4JRYA 3BPNB 2XKSA 4QWWD 4P2RB 3LSOB 3HE7D 4JG1L 5DJYA 4G8FB 4X80L 4RWHA 4ESKA 2R23B 4YBLB 2GAZB 3C5JB 4NQTA 3R1GH 1AXTH 4NZDA 4OGXL 1BBDH 3WE6A 3BXNA 1PKQB 3TN0B 3U82B 3HC0B 4ZSOE 4DAGH 5CJOH 2HT4C 3LKNA 3MRPB 3KYKH 4UB0H 3TBTB 4YHKL 5EWIH 3Q5OA 1N59A 3GSOB 1JHTA 2PYEE 3RQ3A 1MAMH 1B0RB 5B39G 5HHPB 3L3KA 3V0VB 4M1DL 3DGCR 4XMKL 3GEWB 3SE3A 4XVTH 3QEUB 4JHWL 4UZGA 2ICEB 1G7QA 4PREA 3QEGL 4E41B 3MYZA 2ZCKL 3OR6B 3WJJC 5EU5B 3OV6A 3BP7A 5DD5L 4M6AA 5EA0H 4N0RA 1HH6B 1T1WB 3LPFA 1ZGLA 2EE9A 4UDUB 1QO3B 1BD2D 1NEZB 1X5YA 2ZUQB 4DEPC 4ODBD 4DKFL 5D1XB 1YEEL 4PJXB 2YPLA 3FN0H 2NX5B 4NRXA 2Z8WC 3JVGA 5D6DC 5IMMA 4PJXF 1MRFL 2HLAA 3CH1A 4K9EH 1AKJB 4OB5L 4MXWL 3N85H 5ADPL 2YR3A 5DVKA 4OD2A 4QOKB 1CXIA 5MEND 4HUVB 3FHAA 1IGMH 1QFHA 5SX5H 5H35A 3MLWL 2AABH 3O9WA 4YHML 4I77L 2I60L 4I0PD 4EXPX 3QCUL 3QHZL 4KKLD 1QBMH 4YHIB 4Z9KB 4GXVL 4YPJA 4MB5A 4MMZC 3CLFH 2F58L 3VGGA 4I4WA 1E4KC 3O8XA 4PPTA 5DZOA 4RFOL 4AG4H 4WU7A 4Z7WA 5KSUA 4YDIH 3QJHB 1FC2D 4QYOB 4S1RL 3WFDH 5JW5B 1AC0A 4D8PA 2F19H 2GJJA 1FFNB 3VI4E 5LBSH 4KAQL 4MJ2A 4GS7C 3P9LA 4GG6B 1S7XA 5CMAA 2CLRA 1WVZA 4OD1L 4X7DC 3WO4B 1IZJA 3RUGE 5ENWB 3KLSA 4G9DA 1OARH 1IC1A 1FL6B 2F53B 5KJRH 3SGDH 3DURB 1F4YL 5D2LB 5HHMD 2ARJB 4NO2A 2XTLA 3DWTA 4G7VL 1WZKA 4CADB 4JFYB 3FRUA 5D2LF 1M71A 1UM5H 4GAGH 3RVTD 1RHHB 5ITBL 1U58B 1G0YR 2JB6B 3MRCA 4NPYA 1CTNA 1JF1A 3TA3D 2CJUH 3ULVC 3LDBC 5IBUG 4Z8FH 4D3CL 3D85B 43C9B 5DUPH 1U8MB 2GSIB 2DL9A 4MGXA 4N8CH 3VFVB 1A0QH 4JANA 5EFIB 4MD0B 1JGLH 1JNLH 1AH1A 4NRYA 1ZLUH 3O4LA 1J05B 1BHGA 2GUOB 2N4IA 2LU7A 4LLMB 5DD3L 3QQ4B 5JW4N 3O6KH 3ULVH 4ZS7H 4HIXH 3U0WL 3KJ4B 4LSQH 4ETYA 2DJSA 2A1WH 1T1XA 3QG6B 1W8OA 4PRIB 4XP6L 1QRNA 3OKKB 4LCUA 5CCKL 3UYRH 3IF1A 4PYGA 5EZOL 3EOAA 4GXUN 3MV7E 2FR4A 3C2SA 4LNVA 3PQYE 5TJWK 3WSQH 4LHUG 4P2CG 4Y5YA 5ACLA 2LABA 1JMZA 3B3IB 1AD9A 1QPXA 4NYLA 3S4SA 1HHGA 4XP9H 3MNWA 2IQAB 2HT4D 5IV2B 5FECA 1F45A 3QAZB 1GHFH 1NBZB 1F02I 4V1DD 1HCVA 2WQRA 4WCYL 3O3AB 1Z3GL 4LSVH 1HILA 5C07D 3O2WH 1RV6X 3VD9A 1U8HA 4KMTL 4DQOH 2GHWB 3B9KA 4F15C 1KN4L 3U9UA 4ZXBB 5I15L 4DZ8A 3UPRB 4XNZB 3FB8A 1U6AH 4UIMB 4LPWA 3MRKA 1RK1A 3X3FL 1U8IB 3CH8A 4ODUA 4JDVB 5GGSB 4MAYA 1BWMA 3JTTA 1H5BB 4AT6A 1IGCL 1LO5B 4ONGH 3LQZB 2IAMC 5B39B 1D5IH 3IJHB 2GT9B 5ADOL 2AEQH 1I1FB 2XZCL 1OD9A 2P8LA 3L5WA 2Y4SA 3W2DL 4I9WD 3O6LL 4DCQA 3PE9A 4QT5B 3DYPA 5BMFH 4L3CB 1ZHBB 2D7TL 1EAJA 1YPZE 2W9DH 4B7IA 4JM2B 4LLQA 1KN2L 3SKJL 4HHAB 5T1KD 5FKPA 2O5YL 5F89B 5F3BB 4HKXB 2H9GA 1A7PH 1Q9OB 1S9YB 5BRZE 4KQ4H 4BSWB 3HPLB 3WFCH 3HN3A 2XQBH 3L3HB 3GBMH 3RWHA 1A6UH 3S37X 1CG9B 2Q6WA 1HI6A 5FYLE 3OX8A 3ARUA 3HAEG 1RZJC 1BPVA 1D5MA 3QR2A 4P0DA 3R1GL 3QCTL 1AXTL 2C4XA 1BBDL 1TPXC 2XPGB 3OB0H 4UV7H 4DAGL 5CJOL 3ETBF 5F9DC 3KXFB 1FQ9C 2FGWL 3KYKL 4UB0L 5E6IB 5EWIL 4ZDHB 2R9HC 4M7KH 1T0PB 4OZFG 1MAML 3W0WB 3VJ6A 4MQ7A 4P5TA 4ZPVB 1OAUH 4KGLA 4L29A 2IBZX 5FYKH 1V5JA 1OW0C 1RZJH 3D18A 4RAHA 4X99B 4PRPA 1HIMH 4GMSH 3WLBB 5CIPB 4NO5B 1I8KB 5IB4A 2V9TA 3FFDB 1T66D 4F37K 1P5UA 3NA9H 2VISB 1FVDA 4Y8DC 3WUWA 4ZS6C 1B0GA 3PV7A 4ALAH 1SJHA 1YEFH 5IB5B 3ULVD 5EA0L 4PRDB 2OQJB 4ZAKD 3QIWC 3ULUE 3ZE2E 3TM6A 4P57B 1V3JA 4JAMB 2DQUH 3RWFB 2JK5B 5DRZB 5EU4A 1YMHA 2Z35A 4F7TA 2YK1H 1G7PA 4JRYE 1MLCB 1B9ZA 2W92A 4K7FA 3SDCC 4PJDB 4K9EL 3N85L 3RJDA 3T1FA 4U6XB 5FDYA 3HLAA 1IGML 3VWJB 3LVEA 1P5VA 2AABL 2EH8H 3FOMB 5GSVB 4U1JA 1CXFA 3M17B 1SJEA 5IBUB 3PWJA 4L3EE 1A3RH 1JN6B 3CLFL 4XCFH 2GEEA 5I9QB 1DEEB 1EBAA 4AEEA 3MYJB 4GUPB 1S7SB 4AG4L 4A2MA 5F21B 4Y5XC 4YDIL 3WFDL 1J8HB 1CDGA 2F19L 1M6OA 3VFUB 1CDHA 1L0YA 3DHMA 1QR1B 2LAAA 3NCYP 3S97C 2HN7A 1JUFA 1J0ZA 3BN9C 3OG6B 4ONHB 5IJKA 1L0QA 1M7DA 4KGJA 1ZS8A 1JYXA 2HTLC 5HDBE 1OGAA 3OAYK 1AR1C 4BKLA 1K3ZA 1KV3A 1A4KA 4C4KO 3PG2A 4LGRB 1T6WA 3VFMB 5DVLA 4LHUB 1K5NB 2M1KA 5JHLH 25C8L 4WWKA 5I75B 1UB5B 5CZVL 2DTML 4KRLB 2CJUL 4TUJB 5D4QA 4LGPB 1SJXA 3DV4B 4X0KB 3MNZA 5JQHC 1R3JA 3BPCA 1A1OA 5DUPL 4ZUUB 4QHKJ 4XVUC 2FIKA 2YN3A 2ICWB 3GSVB 4D0CA 1A0QL 4HWZB 1T80A 4X6CE 3BZEB 2NW2B 2VDPH 4GRLC 4GOSA 1R3IH 1JGLL 1JNLL 1C8PA 2BVQB 1KT2B 4N0UA 3MV8D 4Z7WE 2ZJSH 2FBJH 3O6KL 1C1EL 4ZS7L 2RFXB 5J9PB 4PY8J 4LSQL 2A1WL 3BZ4A 1S7TA 4HC1A 4JFXA 1UA6H 1WITA 5HVHB 3UYRL 4L8BA 1EXUB 2VSDA 3MUGB 1J1PH 2COQA 3FN9A 4YC2B 2P42B 4YK4B 1DBAH 1I9RH 1TVBA 3EOBB 3WSQL 5JTWA 3SQOH 5DF0A 1OLZA 1UJ3A 3PL6D 1UM4H 1PYWA 1U3HB 5EC2A 3VRLF 3SJVA 2HFEA 3WXWL 4S0SD 1GHFL 5DHYA 4LSTH 4OZ4A 5D2NC 4LSVL 4CKVX 4C59B 4ZO7A 1YUHA 2QADC 1KF9B 5KSBE 2J5LB 2QLVB 2A6JA 2WV3A 1FL3A 1OT1A 3GSNA 3WYRA 3HAEB 5E1HB 4YEFA 4Y5VC 5TH2A 1U6AL 1RK0B 1XGRB 3QUYB 3D6GA 2E3VA 2J6EA 1JHLL 2WMPA 5F8RC 4BELD 1U91B 4G8GA 3O4OC 2CRZA 3DUUA 4ONGL 5DMIL 3QA3A 5FF6A 5I1JH 4OZFB 4TVPD 3IJSB 1D5IL 3GBLA 4P3WA 3CX5K 2AEQL 1MVUA 4GJTB 1KCVH 1HHIB 1DR9A 2FWOB 5DURD 4WUKH 5BMFL 4DOHB 2H32B 4NIKB 1LWRA 4MDJB 3W82A 2W9DL 4XXDA 2JCCE 1IM9D 2R2HA 5M95B 4APQB 1KPUB 2JJWA 4H5SB 2AK1L 1A7PL 4BYHA 3KYAA 4KQ4L 3WFCL 4ACPA 1U0QA 1UJTA 1ZA3B 4EUPH 4P59L 3GBML 2E5EA 3OGCB 4LCIH 4ELMB 1EHLH 1A6UL 2G75A 4Q6IB 3WJLA 4QNPF 4ELMF 4HX1B 4XBPA 1OTUC 2B4CH 4UV7L 3GMQB 3QNYB 3BN9D 2I26N 1LE9A 4RZCB 4M7KL 3X12A 2NTFB 1KLGB 1OAUL 1HQRA 5FYKL 1KPVA 3D3VB 1AR1D 3RL2A 1HEZA 3EO1B 3LKPB 4GMSL 4P4KC 2YMXH 3LQMA 2JIXD 3DO7A 5BS0B 2J4WH 3NA9L 2HT2C 1F3DH 1NSNH 1CBVH 4ALAL 1FSKC 1GGCH 1YEFL 4WFFD 4FTVA 5SWSB 3SDDC 1QSFD 4KXZI 3UPAA 2EYTB 1MCBA 3BSZH 2WSKA 4U1KB 1DLHB 3B4NA 4EOWH 3IVKB 5HYFA 1EVUA 2DQUL 4G6FD 3SDAC 2H41A 1RULH 4ODTH 3VFRA 1IEHA 1U8KB 2YK1L 4N5ED 4JREB 3TBWB 2CIIA 4JFHD 1NCCL 2OJEA 4HWBL 5MEOB 1JYVA 3PWPE 4PJEE 2DI8A 4LCWE 3I9GL 5SWQA 1IQDB 3RWDA 2BMKB 5MI0B 2LU4A 1AP2A 2MHAB 3UTPD 2QQKH 1LO2H 2AJXH 4N0FB 4U3HA 1NGPH 3VG0L 1A3RL 4XCFL 3G6AA 4WJ5A 3M1BA 4PLKC 5DSCA 2UZXB 5JO5B 3D25B 4FFVC 4Y1AB 1LD9B 1W72H 5DUBA 3QEQB 1FC1A 1YNLH 3H9SB 3DX9B 4OSUH 4HJGA 1NFIA 3R0MA 2YS4A 3MSPA 5CGTA 4C56A 4LLDA 2EIZA 1ACZA 1T22A 4OIBA 1IM3B 2H2PC 4A6YB 3UTZA 4MJID 3MFFB 1SYSA 3V6ZA 5EIIB 2EYSA 3I6KA 3SE4A 4PJGE 5HHOB 4IMKA 1BVKA 1AGBA 4IRZH 3SKNA 4K7PH 2WINA 4RSVA 5JHLL 3GK8H 3T4AA 1QYGH 1UKQA 3DX7B 5FAAA 3KG5A 2EDEA 4F2MB 5D9SA 4M00A 3RI5K 3KPOA 1P4LB 4F7CA 2VDKH 3DECA 4TRPH 2R2EB 3PWUB 3D9AH 3KPMA 2VDOH 1KG0A 4GW4A 4C55A 4L8CA 1PW3A 2VDPL 5MERB 5GRVK 1R3IL 2ADGB 2CIKA 2FJFA 2VLME 4ORGA 5F3HB 1NCWH 1U8NB 3IDIA 4IDLA 2ZJSL 2FBJL 3AREB 3CSYB 5D93B 1YDPA 4X9HA 2H3NB 5KZCB 1I1AB 1BZ9A 4JKPL 4IIQB 5C2UB 4AM0B 2EO1A 4HGKC 4UOW0 4CAGA 1UA6L 3QDGB 2CRIA 3O2DL 3MRJB 4WTZG 1J1PL 4LVHC 3UDWA 2X4OA 1DBAL 1I9RL 3C6SB 1NLBH 3MJ8A 4JFED 2VO5A 1IL1B 1BFVH 2A83B 3C6LA 1FZKB 1Z2KA 3SQOL 4DZBB 5JOEA 2CKNA 3VXOA 5GS0D 1OTUD 1ZHNB 2P7TB 1SEQH 5C08E 5DEGB 1UM4L 1OOAA 2ED7A 3KGRA 4V2CB 5F7MC 4EDXB 5DVMA 4LASH 3TJHC 5EU7C 1S7VA 3QDHA 2V7NA 2I9LA 4NSKA 2KQMA 1J10A 3BIKB 4PJ5D 3DX8B 2PNDA 1JNHA 4OLEA 1EIBA 2F74A 4K71C 5EBGA 5F70A 5JOPE 5C0BA 4XNUH 5IMOA 3QPXH 3EUUA 4MAUL 1WZ1L 5ESQA 3RZCC 3IKCA 3OKYA 4LOUC 5HBBA 5DJXA 4YGVA 4CVWA 2ZG3A 5E8OB 3PHOA 3OZ9H 4LEOB 4LU5H 3HR5A 2P45B 1Z5LA 4JFDD 5I1JL 1I3UA 3IU3B 3SDAD 2OL3H 5I2IB 2MTPA 2EDOA 1S9XB 2LAGB 4TUOB 3SGEI 1F58H 3T8XA 2R15A 1IAIH 1WK0A 3ALWA 3HFMH 2OLDA 1XAUA 5FM4A 2MCPL 3T08A 4PB0H 4Z95H 2AJ3B 1BLNB 4QCIB 4WEBH 3G5VB 5D96B 3IYLW 3V6OE 3C5ZA 1SQ2N 3G5XA 2HVKB 4U1MB 4D0BA 2Y5TA 2F8OA 3NPSB 3LMJH 1G7LA 2F54B 1DP0A 4LCIL 1EHLL 4PLKD 1CICA 4XH2B 4F58H 5I1KL 2EZ0D 1EA9C 1WIOA 2ZNXA 3U7AA 5J12B 1MHHB 5LAXB 4M48H 2B4CL 1P69B 5DRXA 4NQCB 1J18A 5CLTA 5A16A 3HKFA 2PN5A 3GHBH 3BH8A 5HPMB 1OQOA 3T77B 4MCZA 2XN9B 4YX2H 5JUEH 4MD4B 3CFBA 4MMXC 4B0MM 3ABZA 4P46D 4LFHG 1RJLB 3ZZ1A 1P4BH 2BNQE 2YMXL 4QXTA 4R4FH 3S35L 3SGDI 3PP4H 2J4WL 4R4NC 1NSNL 2MJWA 1GGCL 5FA3B 4NDMA 1P84J 4MJ5A 1NFDF 1NUNB 2JJUA 3P4NA 3BSZL 5C6WH 3KYMA 3F65A 2XQYG 3MV9B 4EOWL 4NQUA 2QTEA 1RULL 4ODTL 2SEBA 4W6YB 5FDWB 4JE4B 4YHPB 4U1IB 2Q7YB 1WAAA 4QRPA 3GSWA 3H3PH 4WFED 5ICYB 4H26A 5B21A 4OM1L 1GGTA 4NUJA 2VDQL 3QO1B 1BVLB 1KTRL 5E2JA 3L3JB 2QQKL 2AJXL 5DEZA 3AU1B 3GIVA 1NGPL 4R0LA 2CR6A 1HDMB 3OHXB 5L2JB 3HS0A 3QUZC 2G9HB 3TN0D 4PP1D 1EHXA 1DUYA 3IXAB 3WDJA 3OAUH 3V0AC 5FUOH 2BK8A 4IRJC 4NBYB 5IB2A 2IWGA 4OSUL 4MXQD 4NHCH 1XCTB 3RKPA 1UYWH 1FNAA 4M03A 1DQML 3CNKA 2FHBA 1QFWM 2Y5EA 3P9MB 3BPOB 5IW1A 4ZXBC 2W9LA 2ADIA 2FDBP 3Q6GH 4MNGB 4E41D 1H3XA 5K93A 5DD6A 3MLUH 1CR9H 3BKMH 2DM7A 1GGIH 2AJZB 3QIBA 1OP5H 3GGWB 8FABA 5FUCE 5C09D 3BUYA 2HRLA 3IAPA 3SY0A 1QYGL 4U49A 3DGGB 3RZCD 2OR8A 1UZ8B 4LOUD 5DR5L 1WWCA 2NX5D 3H0TA 5DJ8B 1XIWA 2VDKL 3HNSL 3O45B 4ZUTB 4TRPL 3OJ2C 3CJJA 3D9AL 1RY7B 3BKJH 3OL2A 2J8UE 2VDOL 5C9JA 1AKJD 2GK0A 1EX0A 4QOKD 4G9FE 3L5HA 3V9FA 4MA1C 1NCWL 1QOKA 4JM2C 4XVSH 3RY4A 5A43C 5J4MA 4HFWB 5AAMA 4OF6A 3TZVC 4XX1E 4QY8A 5EUOA 4M6OH 1IGYB 4JCLA 4OLZH 5FV2A 5EZLA 1ONQB 1XF2B 1FVCA 4HJ0C 1CLCA 3CK0H 1PQZB 3IDXH 3BO8B 1UGNA 4I48A 5K9OA 4HXAH 4JFFA 3P4OB 4PGBB 4Q2ZB 2WLZA 4E42B 3E6FA 2QBWA 1MCPH 4Z7OF 2GQHA 5ICZB 1QSEA 4S10A 1A2YA 5C0IB 2F53D 4XP1L 2VLRA 4NKIL 3UTSE 2FYYB 1VEOA 5GRZA 4PJ8B 4LASL 1F90H 3NCBB 3B9AA 2AV7B 1MWAB 3KPSE 2FJHA 2XKNA 4OUUA 4L9LB 4WWID 5CBEB 1QKZH 4QRRA 5I76B 4CW1A 4F7MB 4IOIA 4XCNB 1MFAH 2Z0BA 1TLKA 4OD3H 3H9HA 1RZ8B 3RIAK 2ZSVA 4XNUL 3QPXL 4UIKH 3K8KA 1MF2L 5FYJE 3S96B 3EOYG 3MBEC 4TNWF 3SGJA 2VIRB 2KH2B 3F7VA 2LFGA 5F1KC 1L4IA 3F5WA 3DMMC 3EYOA 5KOMC 2AV1B 4HUMB 3QDMB 4LU5L 1CQKA 5IHUH 2GY7B 3NCFB 3VA6A 4U1SB 2WM0A 3L7FA 5EU6B 1T2XA 1F58L 5LJYH 4JFPB 4FQXB 1S7RA 4PRID 4C83B 1KCLA 1WBXA 1T0MB 3HFML 2R0ZH 3ZT6A 1YYLH 4Z95L 2OXHA 1B0WA 4HJJH 2UYLA 4WEBL 2OCFD 4HK3N 2WWKT 2NY5L 1VCAA 5T1DH 1FE8H 5JHDD 4LRIA 1RMFH 3QZWA 5BVJA 4F58L 1BJ1H 3QFJE 3ARBA 3D39B 1HHKA 3RGVB 4KKAD 4P2OB 3GHBL 4PGCB 1XF4A 5F97E 1ZLWK 1YC8A 4ZXBD 4QTHB 1KPRB 4YX2L 5JUEL 2CLVB 3G9AB 1MCRA 3MXWH 2H6PA 3BRGC 1ED3A 5I75C 2WP3O 3P4MA 3VDBA 1P4BL 2HFFB 4R4FL 5E4EB 4P99A 5SV3A 5ID1B 1L7IH 5IFHH 4NQXB 4PJHA 4CNIB 2NCMA 5I1AA 1AGDB 2GYSA 1B4JH 1R5WA 4NQEA 1BREA 1GGUA 2AK4A 4NHUA 3N9GH 3ZE0F 1VEPA 2ESVB 3X13B 4LSPH 2JJSA 4I2XB 3UZVB 4QRSA 3HG1B 3JZ7A 1S9WB 4G8EA 5I1GL 1CI5A 2DQHH 4JHBA 4JM2D 5L9DH 3PDOA 3MRBB 4R3SA 1KYOK 4Q74A 1EEUA 1TCRA 1WSST 1F4AA 2A74B 2O93L 1DQDL 4X5XB 3CC5A 1QBAA 5J13B 5H37H 3BPLC 4BK5A 5D1ZA 3BGMA 4K7PX 4NWTH 4QF1A 3P11H 1E28B 4LNRB 3CFCH 1T5XB 2E7BA 3U6RB 1A6ZB 4MNQE 4M7LT 5BQ7B 1U95B 3OXRB 1MCWM 1BX2A 2QKIB 4XPHH 2Y23A 3OAUL 5E6ID 1EEZB 1FGNH 5KVEH 5E00B 3VRIB 4NHCL 2MKLC 1AI1H 3K3QA 3H9ZA 3RNQA 4P2QE 3FONA 4JZJB 2VZVA 3JVGC 1YEIH 32C2B 1R5VA 4GLRH 3SBWA 3MLUL 1CR9L 3BKML 4KHTH 2R39A 2OI9C 3QNXB 3QUYC 5GGSY 1OTTC 2WLYA 2IPTH 3X17A 3HPJB 3O6ML 1N5AA 5L6YH 2Z92A 4RMSA 5F7DA 2GSGB 5B38A 3UMTA 3AAZA 3WBDA 2YD7A 5I16A 5TDPB 2IH1B 4ODXB 15C8L 5T3ZH 3O8XC 2ATKA 3BH9A 2CGRH 4BQ8A 3BKJL 2RB8A 5DQJA 3BW9A 5KS9E 5ISZD 1KULA 1S8DA 5CP3A 1QFWH 3PDGA 2A73B 3VXNA 1EGJA 3TYGH 5KAQG 1S9VB 2HJFB 3MRGB 2FO4A 3V8CA 2Q86B 4XVSL 3NFPB 1X44A 2EKSB 2A6DA 1FYTE 5F44A 5J6GA 1U8QB 5I1DB 3N0PB 4GO6B 4OLZL 4G6JH 2O61A 3W39B 3CK0L 3FOLB 1DVFB 2W60B 3IDXL 5EOTA 4L4VA 2IPKA 4ZSOB 5DK0B 1J8HD 2L7JA 2AAVA 4FXGB 5C86A 3AS1A 4HXAL 1NKOA 2EEDA 3U46B 3CDGA 2DLEA 3W9DA 4CMMA 5HYSG 4ZFOA 4MA3B 1MCPL 4OGAC 2EDNA 2CDEA 3EO0B 5EG6C 3DLQR 3QFDA 4U2ZA 2A2QT 3PNWB 1FH5L 2Q3ZA 2PXYA 5TPWH 3QDJA 2NZIA 1NUFA 1ZT4A 5EU3A 4M8QA 2BP3A 5CGYC 1F90L 2WBJB 2GKIA 3HE6B 4ZG1A 2XTJB 3RX7A 2YN5A 2ERJB 4RISH 4XHQA 1TJGH 3VFNB 1QKZL 2FL5B 2UZYB 1P7QD 4KI5F 5CILH 1LVEA 1MFAL 3O11A 4PJ9A 2Q8AL 4GH7B 4OD3L 3LD8C 1KIUA 1EFXA 1DCLA 5FKAB 3T0DA 5D7SL 3VXMA 4OCYL 3GMOB 3QISA 3NIGE 1KCRH 1MHEB 4H1LA 2HJKA 4HKZA 4I18B 4JREC 1KJ2B 5BZDA 5KVFH 1QQDA 1T1YB 1FO0A 1ETZA 4Y5YC 5CP7A 5SWZA 4TSCH 2WUCH 3KWWB 3WFEH 5E1AB 4K3EH 3UJTH 1WWAX 2YD3A 5DVNA 5E8PB 3DTXB 5FO8B 3H42H 5E6YA 3GMNA 5C0GA 2R0ZL 1YYLL 3BHBA 2ZUVA 1GOGA 4HJJL 1MUJB 3D2UD 7FABH 1JI2A 1HSBB 3F6LA 5T1DL 5E95B 5CEZL 4GW5A 1WBZB 4OZIE 4N9GB 3U4BH 1RMFL 1D5ZB 2BERA 1X7QA 1V7NH 1HHHA 2KDGA 3LKRB 1UVQB 1QFOA 1I8LA 3MROA 2WZPD 4MLSA 2DYPD 4PY7A 3VXPA 5IJVB 1RD6A 2IH3A 5DD0H 5EIVA 2HJLA 4Z7UA 1RVFH 4JCMA 2DQTH 2VE6B 3MXWL 5MHSD 1YZZA 3QUYD 1GOHA 2YBRB 3BP6B 1DQJB 1CL7I 3JV0A 1OF2B 5IFHL 1WFNA 4OBSA 4OF5A 5IGXH 2X1WL 1WJ3A 3GSRA 4GBXB 5K59E 1B4JL 1R6VA 3B9VA 4IRSC 3MRMB 3QWOA 3N9GL 4HK3J 5DDHA 4LSPL 4JPKL 3PF2A 1KB5B 1D6EA 5FM5O 5EPMA 1AQDA 3AREC 1DUZA 4HH8A 2XNAB 2DQHL 3MV7B 5L9DL 2ID5A 4X4ME 5C0AA 4YHNB 1A1NA 4WHYG 4APQD 2AI0H 1KCKA 3HUJA 4QRTA 3MRNA 5D71H 2DLFL 2KL6A 4WW1A 4EBQH 1YJDC 4LCYB 3FB6A 4PR5A 3MXVH 5SV4A 1NCUA 4BA8A 4NWTL 4HGWB 1INDH 3RKDD 3O0RH 1CS6A 3LKSB 2F8VA 3JWDC 5IQ7L 3CFCL 3B5GA 5IKCB 2R2BB 3KNBB 1T3FB 4EVNB 1A02N 3E3QE 4OGAD 3S3PA 4IS6B 4XPHL 2GJZB 5TE7H 4Z7QE 1CZ8H 4EN3B 4U1NB 3CFDA 5KVEL 1TQCB 3TO4B 3RL1B 4AL8H 2ZKHL 4YBQC 4S1SH 5I74B 4NN6B 1AI1L 3D3VD 4JGUA 2FATH 5KAQF 4X7TA 4LQFH 3ARTA 3E8UH 4KJYA 4NQDE 2FHFA 5A3ID 4NC1C 4NQEE 5BS0D 1NH6A 2APVA 3RWIA 5IG7A 4KHTL 1J7VR 2IEPA 4G43B 2APWA 5HYSB 5SWSD 1MFEH 4J2XA 1YNTB 5L6YL 2Q8BL 1P1ZB 1NL0H 3BQUA 2H45A 3AY4C 4WTWA 2YSSA 3CU1A 4JQXA 1S3KL 5DQ9A 1R24A 5T3ZL 3RDTA 1KB9J 4KMLB 3HZYB 4Y16B 2GFBA 1TETL 2CGRL 1YPZB 4MJ6A 3ZDZF 5A40E 5IB1B 3T0EE 1QFWL 2YPVH 1YPZF 3CMGA 5DMKB 1XCQA 4NWUH 4M43H 3DIFA 2JLLA 2P5ED 4U1GB 1LDSA 1W0YT 5D7JA 2CXKA 5EZJB 3NPSC 2DQDH 4X98A 3U36B 4G6JL 4J7RA 1DN0A 2C1PA 4OZHA 4XZUB 3BWUC 1A4JA 1IAII 1YEHH 2BVOA 2VLKA 5J1TC 5FYJU 4EI5B 3H9SD 1IEBB 2F5BH 5IVXA 2AVGA 3FO2A 3MUJA 5DI8A 3MRFA 2G5BA 4J1UB 4X4XB 4XWGH 4YAQB 2UWEE 2XWJA 3BEWA 3LRSB 1NDMA 4HAFA 4MJ4A 1FIEA 4OLWH 1RUMH 1WEJH 4S1QH 2D0HA 4LLVB 4UT6H 5HSFA 4TPRH 3G6JE 3C8KB 2M2DA 4YHLH 3UEZA 4Z7VE 4WO4B 4UQ2B 5HHOD 5DJCA 2EYRB 1ZLVH 1A21A 1GZPA 4RISL 3VXTB 1EZVY 1TJGL 1PG7X 2DBLH 3QI9C 3TBVB 3FRPA 1G7HB 5CILL 1QSZA 2NY3B 3BOVA 3MNVB 4QHUB 5I8EA 3ZE2F 2H1PH 1U8OA 4WI9A 4OLUL 2X4TB 4JRYB 1RZIA 3MA7A 5CJXA 5T1LA 3KPRE 5LCVH 4XAKE 4IRSD 1NJ9B 4FQLH 1KCRL 2XA8H 4P48A 4G8IA 5DS8A 4PV9B 3KLDA 3VWKA 5A2FA 4ZNEA 4TSCL 3WE6B 3BXNB 4GAYA 2BOCA 3ARED 3WFEL 4LCCA 1HYSC 1UJ3C 3LKNB 5KZCD 4HC1H 1SEBA 4P3DB 4RQQA 4L3EB 5C0CE 1N59B 1T7ZA 1DDHA 3QDGD 3H42L 4Y4HC 1T7YA 2AXGA 3A6CH 3WFHB 7FABL 4PREB 3UAJC 4DKAA 3U4BL 1FNGB 3HE7A 1IGFL 1D7FA 4HQQH 4YDJA 3BJLA 3NZHH 1ZGLB 4YJZL 2B1AH 5DFVC 2YPLB 3FTGA 4M61B 3VXME 4R2GC 5DD0L 2PR4L 2HLAB 3GSNH 3CH1B 2R29H 4EIGB 1RVFL 2I25N 2FSEA 1FLRH 3IJYB 4O58H 5ITFA 1NAKH 4OD2B 1VERA 1JE6A 5AD0B 5HGAB 2A6IA 5H35B 1E4JA 1QVOA 3QG7H 5F7FA 4IHOA 3K80A 5IGXL 1KSRA 1NDGA 1AQKH 4GG8B 1T83C 4WU7B 3U1SH 4Z7WB 1NCDH 3LEXA 3F6IA 5F7WC 4RMTA 4PJ7E 4MCYA 1JZ5A 1BD2A 4EJ1C 4Z7WF 1GZQA 4HT1H 1FFRA 3P9LB 1S7XB 2CLRB 4ZFZA 4G9DB 4DTGH 1NGZA 2ZOKB 3L3OA 2AI0L 4P2RE 5F1OB 1KTLB 3ARZA 5A2JH 2V17H 1KFAH 4YQXL 4EBQL 3QSKB 5MENA 3MXVL 1TDQA 4HMCA 4JZOA 4NO2B 1I7UA 1O0VA 4K2UL 4KMQA 3FJTA 3FRUB 2CK2A 1IEAB 4I0PA 5C71A 3O0RL 1SVCP 4O02H 4G7YH 2AJYH 1FFOA 2BSSA 3HNTH 3KJ6H 4QHLA 1JZ3A 5H8DA 5TE7L 1CZ8L 3SO3C 2LQRA 4BUHA 4PRAA 4AL8L 4L9LC 2VXVL 4S1SL 5JXEC 2FATL 4Y4KC 3E8UL 4UBDD 2X9YA 3GKWH 4NRYB 3RPIA 2P5WD 4PRHD 3HCVB 3QI9D 3K74B 1C5DA 1T1XB 1MFEL 1MAKA 1OP3H 4QHKI 1N6VA 1NL0L 3IF1B 5FCUL 2V2XA 3EOAB 2FR4B 3KPLA 1VHPA 1GH7A 3QH3A 4Y19E 1IAKB 4MS8C 5FGCB 2X7LA 3TA3A 3IU4H 3HUJE 4Y2DC 3MREB 3RIFK 2DAVA 1QD0A 2JCCB 3NGBB 3TWCH 5HPOA 4NYLB 4FQCL 4PY8I 4GW1A 1HHGB 1K4DA 3BDYH 4NWUL 4XNYH 4M43L 5FECB 1BBJA 1J1XH 2BJMH 2YD9A 4JDZA 1S5IH 1FHGA 2EDFA 1G0XA 1HILB 2RBLA 5FGBA 5JIHA 2DQDL 3LV3A 4MLIA 1U8HB 1WQVT 1NPUA 4N1CA 3B9KB 3ROLB 2ZUSA 4DZ8B 1SYVA 1T5WA 3NTCH 3HB3C 2A9ML 2C3XA 2E7CA 3CD4A 3FB8B 3MJ6A 2F5BL 1XR9A 1A6PA 3FCTB 2ICCA 1BQHG 4MAYB 5D7IA 4AT6B 4ZTOH 3CFJB 1QLRB 1T89A 3U9PH 5DFVD 4OLWL 1RUML 4LAQH 5D2LE 1WEJL 2W0PA 4XPGH 5E5MA 4JJ5B 3HC3L 4UT6L 4TPRL 4LHQB 4HD9A 1OGTA 2YPKB 2P8LB 3L5WB 4YHLL 2OTPA 2R8SL 4DCQB 4GKZA 2UV3A 4K23L 3C60B 3STLB 4F7PA 4V1DA 1XGQA 2DBLL 3T2PA 4KVNH 3WS6C 4LLQB 1B2WH 1E6JL 2H9GB 1NLDL 4IJ3C 4LDLB 3WJJA 3RWHB 5C70A 1W0VA 5LCVL 3PWPB 4FQLL 2Q6WB 4YXHH 3OX8B 2ZZUT 2XA8L 2A38A 4XBGB 1HH9B 5E2VH 5T3XH 1RIVH 2VLKE 1E4XI 4OF3A 4HC1L 2VR4A 3MR9B 4WW2C 5HHXH 3IGAA 1JZ7A 4NQSB 2AXFA 2ZUXA 3B5TA 1ORSA 4MQ7B 4P5TB 4L29B 3VJ6B 4Q9QH 2R1WA 3C09B 5F7YC 3MJ9A 1MLBB 4FHBD 3BP4A 1IKFH 1HE7A 4J8RA 4MX7B 5GSRA 5T1KA 2OSLA 5KOVC 1PBYA 1B0GB 1SJHB 4PJ8D 4HQQL 2B1AL 4HS3A 4PJGB 1RQ5A 3UTQA 1D6VH 5EU4B 5JXED 3ILQD 1YMHB 4BH8B 2Z35B 2ZOLA 4F7TB 4PJGF 4YDVA 1TCMA 3QIUC 3BMWA 3GSNL 4KDWA 2V6HA 2R29L 5E2TH 5E6ZA 1KIPA 2Y1VA 3T1FB 1QFPA 3MV01 3GSQA 3Q3GA 1DL7H 5JLZB 3D69A 3W81A 2J6EL 3HLAB 4L8SA 3QG7L 4U1JB 4Z7NE 5JZ7D 1T4KB 2FIRT 3V4PH 1WUNT 2X4SA 5TFSL 2B2XL 3QDMD 3ZKMC 3C5ZC 3T2NH 3RWJB 1U2CA 2NW3A 2P24A 1KLUA 4ZOAA 1XF5A 1YY8A 4GSDL 3REVA 2EDYA 5EU6D 3LS5H 3U1SL 1CICC 1NFKA 4NC0B 1NCDL 1MH5A 4Y2DD 4ZAKA 1F6FB 1M6OB 4P23C 3BD5A 3L95A 4HT1L 1JUFB 3I75A 3I3DA 4RAUB 5IOPA 5D7KD 2FBOJ 5FB8A 4DTGL 4FQ1L 2V17L 4BKLB 4FA8A 3W9EA 4CN6A 4OV6F 1A4KB 4N90E 4MQSB 3SDXA 5C08B 2DQJH 1A7OH 2VN4A 4O51A 3HB3D 3GDBA 3KPQA 4ODWB 3T4YA 4ZFFA 2BVYA 3D39D 4O02L 4G7YL 4BFBD 2AJYL 4JN1H 5AAWA 4WWKB 3HNTL 4XNQB 3KJ6L 4UV4H 3KXFE 3AFLA 1UT9A 1JL8A 5IVZA 4P2OD 3W0WE 3MNZB 5JORB 4Q97A 1R3JB 3DXAE 3BPCB 2EDHA 1A1OB 3ARWA 3HE6C 4NFCA 2FIKB 3LAFA 4MSWA 2XXCB 2FJGA 5BXFA 2J88L 5K9QI 2NXYB 3GKWL 3UJIH 3VFSA 5TDNB 2EECA 3L3IA 4RGOH 5TQ2H 5KVDH 4YR6B 3AM8A 1EFQA 2APXA 3HZKB 1YMME 2IALB 2DKSA 3QO0A 1OAKH 2R1XA 4PJAE 1BQHB 4JFXB 4L8BB 3P0YH 2DWEA 3F7QA 4MA8H 2W0LA 1JWMA 4R0LC 3ZSTA 1RJYA 1TVBB 4DVBA 5CSZA 3HG1D 1RUPH 3PABA 1JYNA 3IU4L 1MHCA 2D7MA 1SM3H 2HVJA 4ONOA 3VD7A 5KVGH 4LLYA 1JP5A 1VGEH 2IAMA 4GMTH 4FFWC 1H3WM 3BDYL 2HFEB 1J1XL 5DHYB 4M93C 1S5IL 4OZ4B 4P4RA 2I07A 4R96B 5FHAH 3CXHJ 3VFOA 3MV8A 1IBGH 1YUHB 4N9OB 4HAGA 4HG4J 3EYSL 5DYOA 2Z31C 2NY6C 5ERWB 5CAYB 5TE6H 1R3KA 4UDTA 3QIBC 3GSXA 1UWEH 5IW6A 1TNMA 5ETUA 1KJMA 2IMMA 4O4YH 5HGDA 5EZIH 1KC5H 4X6EB 1AE6H 4G8GB 4G5ZH 1UB6B 3WHXB 3UYOD 3DUUB 3DVNA 3OKLB 3U9PL 1MCIA 2K7QA 4M4RA 5FF6B 3S98A 2NY7H 4LAQL 5IMKA 1KEGH 3EYVA 4FQIH 1BF2A 1MCJA 1U8JB 2BNQB 3PL6A 5ACZA 1M7IA 1MVUB 3QIUD 2BNRE 3NABH 5HHQB 4G6KH 3T65A 2V7HB 3PUCA 5AZEH 2VB5A 5HI4D 4KVNL 1GOFA 3ZTJG 1CQYA 1OW0A 4XXDB 5FA4A 3THMH 2NY4C 1B2WL 4K3GA 4MA7H 1A9EA 3ZKMD 1WC7A 4YUEH 5FUZH 4JPIA 2AXJA 3KS0J 3MCKA 2G75B 4RGNE 2HTKC 4H88H 4YXHL 3V52H 4XC3H 4F8TA 2IADA 3AS3A 2O5ZH 4P23D 4XBPB 5T3XL 2XZZA 2PO6C 4WEUD 1MY7A 1RIVL 4XP5H 4HULB 3LH2L 2OMNA 2BCKB 5HHXL 4E9LA 2AQ1A 4XWOD 3SDCA 4BQ6A 1DVFD 3FT3A 4Q9QL 4LVOC 3EDFA 1HQRB 1LO0H 3QUMA 2NXZB 2NY1C 3BRFA 3DROB 1IKFL 3ZDYF 2PYED 5GGQL 2NY0B 1ADQA 1IM9A 4FXKB 2NLJA 3TT3H 5BV7H 2BSTA 1MAJA 2VWEE 1X4XA 3STZA 3RU8H 4EDWH 4WI5A 1C