1XMWA

Cd3 epsilon and delta ectodomain fragment complex in single-chain construct
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
178
structure length
178
Chain Sequence
DDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVGSADDAKKDAAKKDDAKKDDAKKDGSQTNKAKRALEVLEAEDKVILKCNSSITLLQGTAGQEVSDNKTLNLGKRIEDPRGMYQCGENAKSFTLQVYYRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chimeric CD3 mouse Epsilon and sheep Delta Ectodomain Fragme
publication title Solution structure of the CD3epsilondelta ectodomain and comparison with CD3epsilongamma as a basis for modeling T cell receptor topology and signaling.
pubmed doi rcsb
source organism Mus musculus, ovis aries
total genus 21
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2004-10-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xmwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xmwA01
3T4YB 1FE8H 2VDOL 2DQUH 3OXRA 2P5EE 4EN3D 5KSBE 4OQ1A 3WJLC 4LMQI 4HUKB 4UOW1 3QHFH 4O58L 5FHAH 2FX8L 2FJHB 2JJWA 1AE6L 5DF0A 4U3HA 3LEXA 4NWTH 4XGZB 1DQQA 4RA3A 2EO9A 4EIGB 4ODSH 1I7ZA 4OM0H 4OCYH 5BOPA 2R1XB 3P4OB 3D6GA 4ZUVA 2DI8A 3TV3L 3WMSA 3QEUA 4OD2A 1OPGL 2AK4D 5BZWA 1JV5B 5DGQA 2Z9TA 3MA7B 3L3KA 1M6OA 4PRHE 2HG5B 2UWEE 5DS8B 4Y4KB 1ZT7B 4KDTA 25C8H 1R5WB 3VA2C 5KBNC 5SWSE 3MUGA 4J2XA 3DYPA 4M4RA 5F7YC 4WO4D 1JZ8A 3O3EB 4NUJA 1B6DA 4P2OB 3ZL4H 1S5HA 4JM2C 1EEYA 3I50L 4WI6A 2EYRB 5JW5B 3P9MA 2G2RA 3E0GA 1I9JH 5EFIA 4PJ5E 5HY9A 1NBYA 3TBVB 5TE7H 3KYKH 3G6JF 5IOPB 3C6LC 4DN3H 3MBED 5CZXD 1RV6X 1BZ7B 5J1AB 4A6YB 1YEHH 1PKQA 3BP5B 4KJWD 4KUZH 5EZOL 1U93A 4XCFH 2UVEA 5E1AA 5EOCJ 1BFVH 1NGXA 2OL3A 5AYUL 4QRRE 3VE0B 32C2A 1QQDB 3FB6A 1BX2B 4WY7L 4Y4FB 5IGXL 2Z8RA 1FIEA 4H26A 4QHNA 4ONFH 5C71A 3VXMD 5ITFB 1QEWA 2VR4A 4HKXA 5TFSL 3NFSH 5FF6A 3INUL 3SE8H 1YUHB 4WFGE 3DUSA 4RX4D 1G1YA 3KYNB 3O3DB 3T8XB 4R0LA 3AY4C 1EX0A 4I4WA 3VD3A 3L3JA 1FL3B 3G6JA 4YHPB 5C0CE 2EYTA 1CFBA 1ZLWH 5IWLA 3CPLA 1CT8A 1S9WB 3WS3A 1JBJA 4WUKH 3UTPE 1YN6B 4KPHL 4PREB 3L9RA 3G5YA 5DTFA 3L5HA 4BSWB 5DUMH 3JV0A 1QBBA 4UDUB 5HDBF 3FRUB 1ZT1B 3MRQB 3TGXA 3RIFF 1NANH 4MA1B 2XZAH 3GKWH 1NC4A 5D2LB 2OK0H 2W38A 4LL9A 4QTHB 4KKCC 3RGVB 3HPLB 1A6ZA 1C5CL 1TNMA 4PP1D 4WFFE 2XPGA 4HEPG 3HI5L 4JANA 5GGRB 1NPUA 1TLKA 5CSZA 3T1FB 4EN3A 1E28B 4N9GA 4NRYA 4NIKB 3TJEL 5CZVL 1INDL 5EC2A 3S5LA 5DMGC 3BKML 4DEPC 4M6MH 2NXYB 2X1QA 1W8OA 3U4EB 3K8KA 1PG7X 2JJSC 3U4BL 3EYOA 4XCYB 2R8SL 3QNYA 3EOAA 1IFHH 5JW4N 1T1YA 1K5NA 3HN3A 5C0RH 3TYGL 3ZKXC 4G9DB 5FCSH 4WW1B 3GHEH 1L0YA 4BKLB 1S7SA 5K59F 1KC5L 1DJSA 1UGNA 4HAFA 4TVPD 3VH8G 4HCRL 3FQUB 5BRZD 4D9QE 1DQJB 2OMBA 3QBTB 3RVUD 2DIJA 3WDIA 1U92A 1EO8L 4FA8A 4WO4A 3SGKA 5CUSL 3UXFA 3RNQB 5E8PB 4ISVB 3NCYS 2ZUSA 4AIZA 1GSMA 5HPOA 4UOJA 1T2QH 4XHQA 3RAJL 4HIXH 3MBEA 5HGAA 2BSRA 5FGCB 1KSRA 1PVHA 4O51A 5LQBL 1G9MC 1BREA 3MRPA 3QWRD 1OAYH 2OTUB 5E5MA 1X5ZA 3ARXA 4OKDA 3UTTB 5GSVB 3MRFB 4I0CC 3D0VA 4CMMA 1YEIL 4DGVL 2E7CA 3T3PE 2FWOB 4MLSA 1S7TB 1I85C 3WIHA 5F97E 3U0TA 5IMLB 1HH6B 5E08H 3STZB 3BUYA 5F89B 3GBMH 4U05A 3PUCA 1T3FA 1CD8A 1DUZB 4XNYH 4MNGA 2E9WA 4GMTL 4PS4H 2HN7B 3IJYB 1KEML 2QR0B 4PJDE 5DJDB 5BVJA 1FL6A 5KTEH 4PRNB 2FHFA 3WIFB 2J6EA 1AD0B 2ZPKL 2WP3T 3QIUD 2D2OA 1UWGL 2KL6A 4GG8A 3VFMB 3L3IB 2VIRA 2DWDB 1RU9H 2D03H 3RZWA 1N6VA 4QRPB 3SKNB 1KFAL 4PRAB 1IEBB 1E4WL 4BQ8A 3VRIA 4MHHI 4AEHH 4UU9B 3W11D 2DKMA 2IBZX 4GRWF 4ODWB 4LLDB 3TIDB 1CLZH 1A6PA 1C5BH 3FB8A 3RUGB 4ZSOE 1UM4L 2OR9L 1P1ZB 5K9OA 3FFCE 1QLEH 4HT1H 3NFPB 3ILQD 1CXEA 4N0UE 4M7KH 1N0LA 2BC4A 1DQMH 5K9QG 2BSTA 2VSDA 4PGCB 5EBWA 3MRBA 4FTVA 4PBVC 1WZMA 4AH2A 4P2QB 5T33L 1NEZG 3S88H 2ITCA 1G7IB 4WU5A 1D5IL 4JREB 1ZLUK 3OJ2C 4OQTA 3WLWD 2VLRB 3EFFB 2B1HL 3TESA 2SEBB 2YRPA 3QXDA 1PG7L 4QT5A 3QQ3A 1J1XL 2ZKHL 4OCWH 5J11C 3THML 6FABH 3MCLH 4XRCB 2VH5L 4JR9H 2YD6A 2IADB 2YD3A 2MSPA 1B3JA 3P0GB 4KDTC 4NKIH 2DN7A 3QCTH 1GGCH 2APWA 3JV5A 3LN5B 4RGNB 4S1DD 1N8ZA 2I26N 3ARGB 4Z95H 1D5BB 3MFGB 5E8NA 3C5SA 1YNLL 4LSUL 4QHLA 4WI7A 4L4JA 1PSKH 5CJXA 7FABL 5HYQA 1FO0H 1BIHA 5IB5A 4HXBL 1KJ2A 4TULH 2P45B 1CFNB 1B0GB 5GRZA 5J11B 5DFVD 5TQ0L 5HHXH 1UH4A 5HYJB 1HYRC 4H0GA 3OXSA 4X6CE 4NM8H 5EO0A 3QG6A 3EDKA 3S35H 2AEQL 5I8KL 3ISWA 5C0AB 4D9RD 5JPNB 4GQ9L 3UBXA 4W81A 3VDBA 5EUOF 3TP4A 4ZG1A 3V5DB 4O2CB 4EUPG 1OCWL 4TN9A 1L7IL 4MJIB 4NZRH 5T3XH 5SWQA 3VW3H 5HYEA 1MQKL 5DRZB 3MLUH 3MTRA 4PGDB 3NN8A 5A1AA 1I8KA 3LV3B 2NY2B 3QIUA 4M7JH 3I6LD 4CGTA 4QXTA 3QJFB 2X4SA 4V1DA 2YXMA 4WHYH 2FHCA 5KOMC 5IWLC 3VD4A 5FUOH 3LAFA 1T22B 1RULL 4ZFOL 3MRMA 1VGKB 2Q76A 5FYKL 1GZPA 1C08B 4E41B 5KANI 2P5EB 4HJJL 2LQRA 4UQ3B 3QFDA 3CXHK 5IG7B 2GTWB 2MJWA 4K7PH 4U33A 1F58H 3RWCB 1BHGA 1EFXB 3QUYA 4JFXB 3KPPA 5EUOA 2AXJA 1DTUA 1KLFA 2XFXA 4OAWB 2Q8BH 5IESL 4K8RH 3WFDL 2AJYL 4JDVB 4YX2L 4PJIE 3B9AA 1N5YH 1GXEA 3H0TB 3H3KA 4NM4H 1VEOA 3WXWH 4PFEA 3OF6A 5I1LA 5E8EB 4PRHB 2CUIA 3QCVH 3BIBX 2FZ3B 1GC1C 1OD7A 3MLSL 3QG7L 1WF5A 3MLYH 4HEME 2A9ML 5TE6L 1XZ0B 5SWSB 2BY2A 1FVDA 3DRQA 2IG2H 4GXUM 4FNLL 1K85A 4HKBA 2EKSB 5INDB 2XQBL 5L2KD 2V2XA 1G7QB 43CAB 4Y5XA 2Y5TA 1MI5A 1QBAA 4R96A 1BP3B 1MJ8H 4LPXA 4H1LG 3LHPL 2A0LD 4N90D 3EJYD 1OSZB 2VLKE 4LARH 4FQLL 1Q9OA 2IWGA 1U42A 4GO6B 3CX5J 4XMKL 1MCDA 4UINH 3MJ6A 1IC5L 4MDJB 1A9BA 4JG1L 1D6VL 1HK6A 4UNTA 3VFNA 5BO1H 4QRRB 5CGYD 1OAKL 3X12A 3BE1L 2CXGA 4WO4C 4WRLA 1CLYH 4NKDA 1CFQA 3L3HA 1DBML 2BHYA 2CDGA 3SGKC 4ZS7L 5KZCB 5BXFA 1PEZA 3AUVA 1N64L 1FSKC 2A6IA 2ADGA 5CD3B 1U3HD 2YKLH 3PWUB 3D2UB 2X4UA 2BJMH 3CXDH 5HHNA 5C3TA 3O4LA 3K1KC 1R0AL 1CFSA 4MQ7B 2XYCA 1L4IA 4OT1L 5FIEA 2BNRE 4LVNB 3WFEL 2H2SD 3RVXD 3KLDA 3ROLB 1WITA 3QZWB 4YXHH 4XNQA 5C0IB 4B41A 1IAMA 1FZJB 5E8DH 1FVCA 1RZ8A 4LLWB 4MS8C 1HILA 2WWMD 3P40A 3MMEA 3KPLB 3O9WD 1EEQA 2VDQL 1DFBH 5DJXB 5SX5H 3W39B 3PP3H 4GJTB 4WIQA 4Y5YA 2E8ZA 4TYUA 1C16B 1WFNA 4NCC1 4OZGE 2I60L 1D5ZA 5A2LH 4EVNB 2DQJH 5FUCC 2B2XH 3P9LA 3RDTB 4HPYL 1A21A 1KEGH 4F33A 4DKAA 3Q6FA 1A7PH 1NCDL 5E4EB 1QP1A 3KR3H 2J8HA 3WXVL 1KLUB 4L1HA 3K80A 4K94H 3UYPA 2CLVA 4ALAL 2EYSA 4JFPA 3GI9H 1F4XH 4NJ9L 1VFAB 5IM7A 2H2PD 3O11A 1OM3L 3SDXF 2DB8A 3KLHD 1KNOA 1IGYB 2OJZH 3B2VL 2QQQA 2C7UB 3F7PC 3VMOA 2VN7A 2ADJA 2IC2A 2P8PA 5BV7L 3O2DL 4H0HB 2PO6D 1AR1C 1DLHB 2YS4A 1ZS8B 4D9LH 2MQ3A 3EDEA 4DFIA 1YA5A 4HWNA 2FO1A 1FYHB 1Z6JT 5IV2B 1DR9A 1SEQH 4CVZA 3NCBB 4GUPA 4ZAKC 2VDKH 5H8DA 2Q8AL 5JDSB 1AR2A 2WP3O 4LSQH 2ARJA 4J3UA 1G7HB 4X6DF 4IDJL 4HUWA 4Z5RB 3UTSB 5ESAB 1DQLL 3SGEI 2F74B 3DLQR 4XZUA 5BVPL 1JCKA 3ARBD 4EZMA 3MNZA 2XZQH 1Q94B 2YPLE 3OR6B 4PLNC 3TH2T 2R0WL 4DOHB 1BVKB 4QRQB 5EZLA 4OFYA 4L8CB 3VFTA 2DI9A 4AMKH 1MVUB 3RVUC 3ZMRA 4TSAL 3FQNA 2O5YH 2PR4L 1CF8H 3ZZ1A 4ZAKB 1HHJB 3QUMH 4GBXA 3DX9B 1JFQH 3AFLA 1XFPA 3BD3A 1KIPB 5EN2B 4G6AD 2V7HB 4LLQA 3A6OA 1U3HA 3MCKA 4JKPH 3NACL 5D7KE 3F12A 4GXUN 5D71H 4ZPTB 4CMHC 2PN5A 3O3AA 1HCFX 2IF7A 2YPKA 4H88L 4PG2A 4X6DA 4U7SA 4HUUA 3OKDB 1NC2A 4JRWA 4YXKL 3TNNB 1W2KT 2BVOB 3DGGB 4F15C 3FB7B 1CI5A 4HG4K 1XR9A 4YIQB 3V0VB 2EIEA 4GKZA 3ES6A 4HGWB 3DNKA 1RSFA 1A6AB 4XCEA 4A6YL 3PWNA 4JPVH 4BFBD 4YHNB 1XGQA 3B83A 3VXUE 1MHEA 3SBWA 1T83A 3VGEA 1NCUA 4ZSOB 1UB6B 1ETZB 5FYLL 4HKZB 5GGSY 3FFCB 3GMRB 3ZDZE 2R0ZL 3IDIB 4N0UB 1H9VA 4ZUSA 4JY4A 3D69B 3T0WA 1ULVA 1BIIA 1WQVT 4G8EB 3VU2A 3H9HA 1UT9A 5E4IA 1IQDA 4L4VB 3NH7L 2W9EL 2VDNH 3A67H 1E4XI 3GRWH 2XV6B 1CGVA 2G75A 3IU3A 3GI8H 4Z7WF 3B8SA 4X98B 3U82B 3W11C 5DMIL 1LK3H 8FABB 3L5WB 3GSQB 2R0LL 3BH9A 3O81A 3QYCA 5DQ9A 5JZ7D 4LASL 2EO1A 3QUYC 3V6BR 1QLFB 3UYRL 4NT6A 2IPKA 1YY9D 5TQ2L 1MCWM 4RFNB 3ILQC 4K9EH 4L5FH 4CKVX 5MEQB 2ZCKH 1RD6A 5FUZH 1TCRB 3G08A 4JDZB 4EDWH 4JO2L 4X80L 5GRUL 1A7QH 4U1JA 5JIHA 4JY5H 4JFOA 5E9DD 4EOWL 2GK0B 4W6XB 4PBXA 5DHVA 1WVZA 2X6MA 4F57L 2Z8VC 4JB9L 4O4YL 1JHTA 3CDGA 3FOMB 1R3HB 3VFVA 4QHMB 4Y5XC 2DQFA 1XF1A 4KC3B 1S3KL 3WLWC 4Z7WA 3L3OB 1UYWH 4WEUD 4KJQD 4HBCH 4NQCD 5E2TH 3PGCA 1GAFH 3PDOB 3BRDA 5IB1A 4P9HL 2EEBA 1JNJA 1AXTH 3UPCA 3H9SA 4X6CB 2OCFD 4WW2B 4GS7C 5IB2A 3MRIA 4Q7DA 3KPRB 2YD5A 1P4BH 4HUXA 1ZLVH 4G9FD 4UB0H 3C2AL 4DVBA 2ORBH 5H2BB 3I3BA 4L3ED 3MLTA 4NKMA 4M48L 2AXHA 3TF7C 3K2UL 5SWZA 4ODUB 1IT9L 5CHNB 3R4DA 1U8MB 4OZHE 4EUPA 3LKOB 4S10A 4PUBH 1MCSA 4JG0H 3DROB 4UMGA 2Z4QA 5DFVC 1SY6H 4ZNEA 4X7TA 4LIQH 3VGHA 1A4JB 3VJ6A 5JHDD 4U6YB 3CH1A 2Q7NA 3QO1B 2H1PL 3QDGA 2WBJA 3TWCL 1Q72L 3S37X 1Q9KA 1LHZA 1ORQB 3BSZH 1Z5LB 4NOFA 3N50A 1IRAY 4OFVA 4E42B 5C07E 1NFDF 2NLJA 3RIAK 3JWNC 4U0QB 4JRYE 2YXFA 3AB0C 3SJVE 3BPNB 4ZPVA 5ID1B 1EA9C 1C12A 1HSAA 4K71C 4NNXB 4Y5YC 3CFEB 1QRKA 2E9BA 1J10A 4MA8H 3T04D 1LE5B 3TJHD 1NKOA 2X4PA 4M3JA 4BZ1H 4CDHA 1GOFA 5DJ8A 5E2JA 4AENB 3EOYG 4H5SB 5CBAA 4CNIA 1XH3A 1DN0A 4Z0BH 4Z8FH 2QSQA 4MNHB 3PV7A 3ULUD 3SKMA 4BJLA 3MLZH 1IM9A 1K8DB 4ZUWB 3QNXA 4UQ2B 5AG9A 2G5BB 1ND0B 3KJ4C 3TN0A 2BHZA 1FPTH 4HF5L 1UCBL 5KVGH 1JGDB 1Z9OA 5KS9F 5C86A 1NFDA 3BPLC 2B5IC 4HS8L 3UTQB 1VPOL 3FQTB 5JNYB 4NZJA 2XZCL 1WCBA 4H1LA 2ZWLT 1HQRB 2VMFA 5E9DA 5CINH 5I17A 2APTA 1LEGA 1Q0XH 3MO1A 5D6CA 2A73B 5GIRB 4MNQE 5CP3H 2VOTA 4WEBH 4QGTA 4FFVC 2QKIB 3TZVA 5KVMC 2OZ4A 4PLOB 4NRXB 1FNGB 4WGWB 4IS6B 1KCRL 3EJYC 5L0QC 4G7VL 4NQCA 1UM6L 5I16A 3TIEB 4FOMA 3QUXD 4L29A 4XCCL 5D1QC 4FMKA 3FT3B 5D1XD 4Q97A 5KS9A 3FAWA 1IGFH 5KJRH 3PWPD 5LJYH 3MRKB 5JOPE 5D5ME 3O6KL 1HHGA 2AW2A 4WNQA 2VZOA 4HIJA 3RZCC 2FR4A 4MVBD 3BH8B 1UH2A 4GBXC 2XZZA 3VH8B 4X99B 4L3EA 1GPOL 4JFZH 2B4CH 4IHOB 3MUJA 4XPFL 3RKDD 3ZYJA 5L0QB 2H8PB 4I3GA 5D1QB 1M1SA 1DANT 1HZHL 1E27A 4JKLA 4YBHA 4PG2C 1VGEH 4OZGB 3V0WL 4Q9QH 1MJUL 2W0FA 2XN9E 3ULUF 3BQUB 3HE6B 2LVEA 3KPMA 3Q3GB 2OSLB 1KIQA 1ZWIB 3V5KB 2NX5A 1UG9A 4ZODA 5F9OH 3RZCB 2JCCE 5HD8C 4K7PY 3S37L 3RIFK 1QVOB 1I1YB 3PQYB 5CJOH 5IJVA 5DA0B 4NQEA 5T3XD 3LQZA 3SBWC 3T09A 2APVA 3OKKB 1CE1L 4HDIA 1F3JB 1PYWB 3F7VA 2BXZA 4MXQC 4KI5E 5DD1L 4Y19D 1OAZL 1MSPA 4QOKD 3H3PH 4YHLH 1EK3A 1SJHA 2DM3A 2GY5A 4R4NC 1OF2B 1B9ZA 4PP2A 4ZD3H 4R4FH 2FIRT 4ZYKB 4PJFE 2W9DH 2ZUWA 4UUJA 5HI3D 3RFZC 3UAJD 4LK4A 4POYA 4OGYL 5IVXF 4ODTL 2IBZY 2Z35A 1JPGA 4K8RD 1QPPA 5CEXA 1I7UA 4N8CL 4K3GA 4FQ1L 5HHVH 3IGAB 3IAPA 1ACZA 3IAGC 3HAEB 5DLML 3KLHC 3DHJA 4XVUD 4GMSL 4JO4L 3PGFH 3VI4E 4HK0B 2YPLB 1T0MA 3VXPB 1QBMH 1J88A 3ARDB 4FQQB 5D7LE 5EDXA 4UTAL 4YHML 2VABA 2GTZB 2DWEB 2HFEB 2NTFB 4ELKA 4R2GC 4YO0A 1UJTA 4OUOA 4P23B 1DLFH 4PRPD 1PY9A 2NY0D 1ZA3A 1QLRA 3O45B 5KSVA 2ADIA 2BRRH 3IFOB 1Q9WA 3QH3A 3U46A 4JFFB 1GHFL 5EPMB 1NEZB 1VFOA 3VGBA 4D0CA 5CKGA 2R29H 3NZHL 2Q3AA 4XAKD 2DQDL 2JK5A 3C5JB 4LGPB 3EHBC 3SDAB 1KPRB 3B3IA 3GNMH 3SDYL 3FQWA 4YFLF 1AGEA 4JPIB 3CK0L 3ZE2F 2UVFA 5C09D 4CVUA 2Y07L 5C2UB 1J0KA 4L9LA 4L8SB 1RIHL 2F8VA 3HZKA 1ZKAA 1NMAH 4MB3A 5DD5L 3KPNB 1CGXA 4NQDA 4UV7H 1F5WA 3VXUB 5CEZH 2VYRE 4TRPH 3DECA 2BVQB 1FO0A 4OFPA 3FZUC 4OGAC 3BAEH 3EYVA 1FZOA 2VXUH 3RWHB 1XF4B 5FYJH 4G6FB 2E6QA 1XCQB 2X9YA 2NNAA 2EDKA 3D1MC 3MREA 2FEDC 3MRDA 1JRHI 3DIFA 1PKQE 3TT1H 1MPAL 3RWGA 5INCA 2A6DA 2WBJC 5HGDA 5DYOA 4KV5F 4NSKA 2FRGP 2ZOLB 4YDJB 5D93B 1SBBA 3GSRB 3I75B 4Y2DD 3GBNH 2J5LC 1DVFD 2DJ4A 2BVYA 2CMRH 3GSWA 1ZA6B 5F9WB 2XY2A 3ZDYF 4Q2ZB 1MF2L 1M7XA 5TF0A 3VGDA 3WKML 5GGUA 1C5DB 1YN7B 4Y16B 1C8PA 4LU5H 3KWWA 2FATH 4LKCB 4ZFGH 2Q7YB 1LP9B 3MCG1 1UFUA 4P4RA 1I9RH 1GIGH 2I5YL 3WE6B 4OV5B 3BGFC 1I1FA 1RJLB 3ARTA 2VXQH 3LQAC 4W70A 3N0PB 4KMQA 4PJEF 1LO3H 5C2BH 3R1GH 3Q5OA 2VDOH 3ULVD 1QFWI 4LPVA 3ARRA 3TN0C 1OGAD 5CCKL 1FIGL 4IRJA 3PWVA 1VHPA 5A2FA 3IDJB 2ZUTA 1T20A 2FX8H 3WNLA 5IVZA 3EKCA 4GRMA 4O2EA 4G6ML 1EGJL 4F7CA 4WI8A 1D5XB 3O4OB 2ICEB 1RZGA 3VWJA 4IRZH 5DEGB 3LH2L 2E5EA 3VI3F 3L7FA 5ISZB 3JZ7A 3DUUA 1YJDC 3MQIA 2QSCL 3C8KB 4LPYA 2AJZB 2DI7A 3ARQA 3E3QE 1DEEB 1RZKL 1X7QB 2Y72A 4QRTB 4OJFL 3V4VH 3TZVC 4PJEA 2YD2A 3NGBB 2FD6L 5BW7A 1MHPL 4OZHB 4OM1L 3I50H 4QWWD 5HGGS 5DDHB 2C3VA 4ETYA 4OD3L 1MRFH 5C0JB 5HDBE 4YPJA 5C09A 2AK4E 3SKJL 1JNNL 1IC7L 5B8CB 3WHE0 5J6HB 2AKRB 5FGRA 3UJIL 4X6EA 1AQDA 2O93L 1KBGH 4LLYB 4GRLB 5DMKB 3CZFB 3OKLA 3WO4B 4ZFZA 1QFOA 5C07B 5AYUH 1K4CB 5FDWB 3NCCB 1I8MA 2DD8L 2ZUYA 4R4BB 4UAOC 3N9GL 3OKOB 4GAGH 4JRYB 2CK0H 3SJVB 3FOLA 1E4XH 4PJHE 5IGXH 4YDIL 1A9EA 1T0NB 2CH8A 4JKWA 3FONB 4I0PA 4NNYB 1CLCA 1G9NC 3TBYA 2WNGA 5TFSH 1MIMH 3U30B 5D72L 5AWNH 2J7LA 1LO4L 1MJ7L 2WV3A 1WIPA 3HNVL 2FBJH 1OGTB 3FRPA 3ULVF 2OX5A 4FZ8H 2Y7QA 3LY6A 5I73C 5K9JL 4KKLC 3GMMA 3VWKD 4I5BA 3CFKA 1RFDL 4LF3B 4Y2DA 4AEEA 3NCMA 1J0YA 1BZ9A 3OB0H 4QXWA 4U1KA 5K59E 4G7YH 3F7YA 4UAOB 5BJTB 3WIIL 5B3JE 5IBUB 2X1OA 2GI7A 1MREH 2OP4L 5C0GA 1A8JH 3WFZA 2AJ3A 3VXME 4X9IA 1AGBA 1UXSB 4UT9L 2AQ1A 3B6SB 2IH3B 4R97B 5I9QC 5ADPL 4YHZL 2A83B 3G6AB 3UEZA 3VFSA 1JHKL 1TTGA 1HEZB 1K9TA 3UTZB 1OAUL 2NW2A 3W2DH 4WV1A 3LKPB 2B1AL 3LSOB 3C5ZD 5I73B 1C5CH 5I1AB 1AI1L 3C6SA 3HC3L 3O0RH 3BYYA 2CKBH 5FECA 4HH9A 3ULUC 5F21B 3C60B 3CVHB 4MNQB 1TZHA 1OGAA 2VDMH 1U95B 2X70A 1FNHA 5A3IC 1CE6B 2VZUA 5CZVH 4Z78B 3OX8B 3BXNB 4UBDC 4FXKA 4YQXH 4M62L 3SKOA 3U4BH 4OZ4B 2R8SH 3G6DL 3S6CA 2BNQD 3L3GB 3TYGH 5EU5A 3P9WB 4LCUA 5D5MB 4ELMA 5JMRA 2EIDA 3MV7B 4JPWL 4Z6AT 1KC5H 1ONQA 3M1BA 4KK5C 1OTUC 3QQ4B 4AEIL 4HCRH 2QADB 1C7SA 2L7UA 1N3NB 3F7RA 1R5VB 1QHPA 4UILL 1NL0L 3JBG7 1X4XA 3GSOB 5GGRY 3DWTA 1X9QA 3JWDC 5TDOB 4P2RD 1MJJA 2HJLA 4N9OB 3NFNB 4P57A 1FBIL 3OG4B 5EA0L 3U36A 5L88L 4TPRL 3NVQA 1LEKA 4GRWE 3NIGE 4B50A 3GMNA 3PL6D 1IGTA 2XN9B 4U6HA 5JXAL 3WCYA 1H3PL 4OCNC 4P4KD 3S97C 1JZ5A 2R9HC 4JDTH 3LEYL 3LRSB 3QUMA 4TVPE 5LQBH 5ACLA 2F19L 1B0RA 2OQJA 5BRZE 2P47B 2JCCB 3I3EA 1MFDH 1S9XB 2Y1VA 1KJVB 4MVBC 4U6XB 1RJYB 5EU6D 3KDMA 1NCBH 2IQ9H 3P11L 3QI9B 4G8IB 2ZUQB 1UZ8A 1UC6A 2XWBA 2PYFA 1WIUA 2VAJA 3RKDC 3HLAA 1CK0H 4N0FA 4OF7A 5DJYA 5DJAB 2YC1A 3KPSA 4U1LB 1ZGLP 1X5GA 3L6FA 5D70L 1NLDL 1BM3H 3AXLB 2YA1A 5I1CL 2UUDK 4V2BA 1KEMH 5H94A 1HOCA 3QR2A 3BKJH 3VWKA 2ZPKH 5IQ9A 4JZOA 4PJFB 5TPWL 1I8IB 4J3SA 2R0KH 1Y18B 2MQ0A 1JTTA 1CL7L 2PW1B 1NGQL 1T7YA 4OKVB 1KTKE 4XBPB 3HG1B 4LCIL 4P5TD 4YXLH 3UC0L 5ICYA 1T5WA 1NJ9A 4M6NH 4N0CD 5D7JD 5DZOA 1T2XA 1BQHG 1UM4H 4LPCA 4B0MM 3RKPA 2GITB 4G43B 4F3FB 1A0QH 2BP3A 5E99H 5IHLB 5I1IL 3M17A 3VFWB 4HS3B 1TFHA 2F5AL 2P7TA 3QQNA 5D9SB 1CGSH 5HI3C 2EDRA 1YQ2A 3RNKA 1DE4B 3UAJC 4RFOL 4N8VG 4S1QH 4TQEH 1T1ZB 2VL4A 5D7IF 1U36A 4YNYA 5T33H 4IRJC 5D7SL 4X8JB 4ODXB 1EAPA 1DQQB 4K7FA 1MWAB 1EBAA 4XBGA 4GOSA 3EBAA 2OJEA 4F7MA 3BYTA 1V7NL 2HT4D 4AM0B 1JYXA 3CX5K 3VFUB 3JUYA 3VWJC 3KAAA 3CU7A 1JYNA 4PV9A 4O9HH 1K8IB 1RUML 4D8PA 1B90A 4XXDA 3GSNH 4YGVB 5MEOB 1RZJH 2ED9A 3D48R 4XCNA 1U8NA 2O5ZH 3ECBB 4R26H 3MUGB 1A4KB 2NY0C 3MLXL 5CP7A 5LCVH 5D1ZA 4Q9CA 1QZ1A 4CUCA 1YPZE 4I0KA 4P2RA 2M1KA 1HYSD 1EEYB 2ZG1A 4I3SL 5BW7C 2HKFL 4R7DB 2X1XR 4ZOCA 3T2QA 4YPGA 1U8JB 5D7IA 5EU4B 1YNLH 3PL6A 2UZYB 3JXAA 4P4KA 4JFQB 4HXBH 1UKTA 3KVQA 1FFRA 1EJOL 5MERA 5E1AB 4PTTB 5TQ0H 3U83A 4XP1L 2ZSVA 4TSCL 1FFNB 3TBWB 3V4PL 2Y06H 4N0YL 2OR8A 1YMMD 5DT1L 3F65A 2WBWB 2JF1A 1CQYA 5SX4I 5FK9B 2WINA 3NABL 4OFDA 4OIIH 2WANA 4H25B 5B21A 3P77A 3SPVB 1J1PL 3T3ME 3PE9A 4PGBA 2VAAB 4I0PC 3GEWB 4HMEA 4F37K 3QAZC 1MQKH 3E2HC 3HRZA 3L3DB 4PB0L 4L8BA 4F2MA 1A14H 4I4WB 2QJDA 4JN1H 2IAMD 3BP4A 3RA7H 4MLIA 4OFIA 1URLA 4YZFF 2HFGL 1CD1A 2YMXH 3KPOB 2MPAH 3IDYB 4D9RE 4QTIL 1RMFL 4AJ0A 4KUCD 4QGYA 3CC5B 4WEMB 1A6UH 3ZE0F 4HJJH 4I2XE 1D6EB 4P5TA 3PWJA 4G8GD 1L6ZA 3O2VH 2X42A 5E70A 4HJGA 1HXMA 5EORL 5FKAB 3VGFA 2VERN 5HI5D 3V79C 3QAZB 3WFDH 1WBYA 3E2HB 2EH7L 2AJYH 4YX2H 3I6LE 4OSUH 4JPKL 4WV1C 2R2EA 1GGTA 4HD9A 4DWHA 2ZZUT 2DQHH 5DK2B 1OTTD 3V5HB 4JN2A 3VRLF 1U8HA 1FL5B 2RR3A 3MLSH 1JWUB 2E9IA 1MEXL 5D2NC 3ULVC 4N9GB 4NRYB 3T77B 1BBJB 3IDMB 2A9MH 5TE6H 2X1PA 4ZUTA 3B8YA 4H8WH 3BN9D 3MRGB 4L4TD 4MWFA 1X4YA 3MNVB 4CJ0A 1FH5H 3NTCH 1ZLUH 2JTDA 1BFOB 4PBWD 5GSRB 3CH8A 4TNWF 5FM5O 2HFFB 2XWJB 2AK4B 4O5LH 3RY6C 3CFDA 2VR5A 1J7VR 1ODAA 3ZTNH 4G8FA 1IC5H 4JRXD 5H35B 4MYWB 1CR9L 1P7QA 3MYJA 5CP3A 4MJ6A 1XR8A 4OLWL 1BGXH 3FO1B 3QXVA 4AT6B 5D2NB 4XH2A 1ZHLA 2E9JA 1VFMA 4HKJA 5L2KE 4P2YA 1IGIL 2ZNWA 3DVNA 1AD9B 3D5OF 1DBMH 1WUNT 4NO5A 4PJHB 4W4OA 4YHKL 4JY6B 3BT2L 4KHTH 1R3IL 4PGEB 4N90E 1BLNB 1FLRL 2H3NA 5HYSG 4AQOA 1I4FA 3S36H 2PNDA 1BQLL 3DO7B 1MVFA 5FB8A 1NUNB 1KJMA 5IFAL 3WHXA 3SDXE 4KUCF 5LBSL 4LCYA 5DVMA 1OOAA 3GSVB 2O61A 4OT1H 3X14B 2CR3A 4CMMB 5GS0C 5KW9L 5CEZD 3WFEH 3TO4D 1M05B 2HVJB 5B4MD 1YMMA 4P0DA 2NY4D 5I1GH 2P49B 5I19L 3U7WL 3DOSA 4R90H 1YZZA 3OMZA 3VXMB 5FYJD 3OAYK 5ABDE 1MY7A 1Y0LB 1QHOA 4ODBD 3W0WA 2Z31D 3VFGL 5TH2A 3PHOA 2R4RL 4X7DC 4X4MA 5T1LA 3P4MA 1TVHA 1KG0A 5J7CC 4R7NB 2I60H 1I8LA 1DDHA 1E4KC 3RP1A 1UACH 3ROOB 2R4SH 3EO9L 3VFRB 1AY1L 4I77L 2FLBT 5DQJA 2KZ1B 3SCMC 3HFML 4ZFFA 3BP7B 4K3JH 4G8GA 2BK8A 4JJ5A 2AJSL 2N56A 5K93A 3O3BA 1SM3L 2DQGH 1O0VA 4NJ9H 4K3EL 1IZKA 5K33A 1OM3H 3QSKB 1RK0B 4JLRA 4DZ8A 5I15L 4P46D 4HUNB 4Q0XL 3MODH 2KQNA 4WHTB 3WV0A 5JQ6H 3BZ4A 5JUEH 1BMGA 5BV7H 3ILPB 4U1SA 3GZKA 2DLGA 3HS0A 1HSBB 4AIXA 1MRDL 3SCMB 1AO7B 1BQSA 2V6HA 4X5XA 4I13B 1IBGL 1FNFA 1M4KA 2Q8AH 3FTGB 2CGRL 5IBTH 2VSCA 3QUZD 3VFOA 1A1OA 4JJHA 3STLA 5C0ND 3LKNA 2PTTB 2V2TA 5FCUH 4DZBA 4KVNH 2DBLL 1NLBH 3LB6C 4CVXA 2VC2L 4NBXB 4O02H 1U91B 3VD9A 4FP8H 5EIIB 2ZSWA 2R0WH 1MLBA 5BRZB 1KN4H 1MFAH 2HKHL 4AYFA 4LVEA 4GAFB 4HHAB 1WBZA 2BOBA 1RZFL 4KGLA 1IAKB 2PR4H 3MRLA 5I75C 1YEKH 4AZ8A 1GGUA 2IALB 2HJKB 1D3CA 5D1ZC 1FJ1B 3GUTA 4DFHA 3LQAL 1R3JB 3EW3B 1I3UA 2VITA 4QHLB 5I1KH 4Q6IA 3L5JA 3HKFA 2NZ9C 2ZCLL 1FORL 3KNBA 2AI0L 5IMOB 3IETA 1EHLL 4DUXA 3LIZL 4EQ3A 4P4KC 4ONHA 3V7AE 1D9KA 3FFDB 4YXKH 4LPUA 4PY7A 1A3RL 1H0DB 5IKCB 4MGXA 2BHUA 3SOBL 1QRNB 4A2LA 4RIRA 5I75B 5I1DA 3RVTD 4M7LT 3W9EB 5CIPA 4IMLA 4N8PA 4A6YH 2ZUXA 1KB5A 3ZE1F 4BZ2L 3ZT6A 1FYTB 1YJDL 4EXPX 1KTDB 5T1MA 4KKBD 5I2IA 4QNPF 1MHCB 1Z3GL 3ZHLA 2LABA 4Y8AA 2NY1C 1KF9B 5I1EL 2D0FA 3DGCR 1IGJB 1P6AB 2Z31A 1LILA 3BGMA 3VXTB 3BP6B 5FYLH 5EBMB 3Q2CA 4KJPC 2GJZA 4PLKD 4LCCA 3OZ9H 1FV1A 3V52L 3GIVA 5KSUB 2RCSL 4NHUB 4ZNEE 3DVGB 4NZDA 3MBXL 4X7EC 1FG9C 1R24B 3S9DB 2YUVA 3IFLL 1BQHA 1U6AL 1UEYA 3MZTA 1NSNH 1MHHB 1N5AA 5HPMA 4PRBA 2YD8A 1OAQL 5DMIH 2F8XC 4P5TC 3D25B 4RMWA 1YNTA 4OF3A 4LASH 4N8VA 3RL1A 1AGFB 3F6IA 3UYRH 3AC0A 1FZMA 1ZHNA 4P46A 2Q6WA 5TQ2H 1KPVA 1A1MB 1OTSC 5KSAB 2AV1B 4WWKA 3U9UB 5JORB 1H5BA 3PF2A 2XACC 5DJ0A 1HKLL 4ZS6C 1OVZA 1HHIB 2D9QB 1XF2B 3BD5A 3CJJA 3MX0A 4F9PA 5ITBH 1T66C 2AXFA 2LTQC 4JO2H 4X80H 5GGTH 5FA4A 2FGWH 5E94A 4XPBH 4CDGC 5ELIA 4C55A 3OKNB 4ZXBC 3QFJD 1UWEL 2AJVH 2GKIA 4YFDB 5T5NG 1YPZB 2V2XB 2RBLA 3O6FD 2UZIH 4F57H 1SBSL 4JB9H 1T4KA 3QUZA 1N59B 4HC1H 1HIMH 3VMNA 4UNUA 1S3KH 2IFFH 3ARSA 1NFDE 1XGUA 2DM2A 4N1EA 4BUGA 1M7IB 5BMFL 1LO0L 1V7ML 3WN5A 2HT4C 4NC0B 4PV8B 2EECA 5IJKA 1IGCH 4LQ1A 4LNRA 1CFVH 1JI1A 3V6OE 2XI9A 3LKQA 3FB5B 5CWSA 3F5WB 5IUSA 2D31B 1A3QA 1J1OL 2FIKB 3X12B 2FL5A 3ZKQD 2WBKA 2X4OA 4F58H 1TVBB 4ZXBB 2IH1B 3UBXI 4U1NA 5ANME 5I76A 3FKUS 3QIWC 5A16B 4E5XA 4BZYA 5C08D 2CIIA 3C2AH 4W4OC 3NA4A 1KXVC 1KTLB 4NQCE 4M48H 3K2UH 2VJXA 4R6UA 5FA3B 4CADA 5TGBA 5MI0C 1R3LB 4NQVB 2V7NA 1U9KA 2NQCA 5KS9E 1WTGT 5DHXB 1ZHKB 4YHIA 5TDNA 4I9WD 3V8OA 2I9TB 1QYGH 2GT9B 1U8KB 1OHQA 1ADQL 2UYLB 3CFIC 43C9B 1UENA 2H1PH 1QSVA 1Q72H 3AMKA 2HH0L 4G9FE 2WK2A 2CJUL 4I2XB 4OLXL 4PJAE 4RA0C 1X5FA 2VLLA 3U2SB 4F7EB 4FFYH 4Y7MA 2YD9A 1AGDA 3WUWG 2AJUL 4JM4H 2Z8SA 2A77L 4HFWB 4XP4H 4PY8J 4Z7UF 5MI0B 2FX9L 2G9HB 3WEXA 2FEEI 3IAQA 4HK3J 4NC1E 1D5ZB 2BY0A 3HPJA 4KY1L 5E6ID 3DSNA 5JHDE 3D9AH 3NAAL 1I8LC 4ORGB 3KXFD 4LQFH 5C0FA 4YAQA 2VLJB 1OQXA 1FVEA 4IOSD 2NMSA 2FCBA 3OKMA 5HYFA 3L1OL 3HNTH 3HE7A 5C8JA 2R2BA 4UIMB 1G9MH 2AERT 1F90H 5FDYA 3ARVA 4NHCH 2F53D 2XRAH 4L8DB 4PJ7E 4LFHG 1CVSC 3VDCA 1MRCL 4GW4A 5IW1A 4NYLA 3H8NA 2XTJC 4J3VA 3T4AA 4JFYB 3B9KA 3EJZD 4HS8H 2XNAB 5I6XC 3QPXH 1UJ3A 1LNUB 5BOZG 4GXVL 2M8XA 2V17H 1HQ4A 5FM8A 3RGHA 4PJXE 2XZCH 3OWEA 4OZFB 4XMLH 5JHLL 1FFPB 4Y8DC 3VXNB 4OLZL 2D7OA 3QFJA 1AIFB 5L2KB 2OXHA 3K4DA 3O6FA 1JGEA 5GXBB 2IFGA 1JPFA 2NY3D 2E27L 5CBEA 1I9IL 1AHWA 4OZIE 1N2RB 3HUJB 4NQXA 2UY6A 4G7VH 1UM6H 4X6BB 5EO1A 4KQ4L 1QPXA 4NRZB 5SX4H 3SDXB 1YMHB 4K07A 3LCYA 4JFDA 2DTSA 5F1IA 5KAQF 5C92A 4HCRA 1MWAL 3GSXA 1VDGA 3Q1SL 4FQPA 2GSIB 2IGFH 3DURB 1JNHB 4KHXL 4ZDHA 2QL1A 3PIQA 1KLGA 4LOUD 4OLVH 1W72L 3PGDA 1AJ7L 1WV7T 4NO3A 3EYFA 4JEGB 4Q6IC 1JGLH 1GPOH 5LGHL 1HINL 2DQTL 3LN4B 5IVXE 4KFZC 4XPFH 5HHQB 5T1KD 3QWOA 2G5RA 4M6AA 3RWDA 4U1IB 3S4SB 5FKPB 4LGRB 5F7FA 3HZMB 3REVA 1MCJA 1D9KC 3V0WH 1VADA 1A7RL 4LSVH 3PWPE 4LVOB 5I8CB 3UO1L 4PTUB 3WL9B 3T0DA 2PXYC 1X5IA 4DKFH 4GLRH 5CKAA 3HMWL 1TQCB 4FFWC 4QXUH 4XCEB 5EO9B 3TM6A 5BS0D 1BBDH 1QSED 5HJ3A 1G6RB 4RAHA 1MFCL 2FYYB 3O9WB 2YD4A 3N1FC 3TFKD 3CCHA 4CRPA 4POZD 5DD6A 4HWZA 5KVEL 4OV6F 2MCPL 4PJ9D 2ICWB 1V3KA 1SHMA 1QFUL 2G60L 1CE1H 1IARB 3ZLQC 3UPRB 4FQHA 4NZTL 5GZOD 2Y6SD 4LCCC 4U1HB 3A6CL 2ATKB 1B88A 4ZUSB 1FGNL 1T2JA 5E6IA 1KN2L 3LS5H 5IMKB 1Q1JH 1OAZH 1YY8A 1UB5A 2PXYB 2EDHA 3BZFA 4HS6A 5C0BD 1PKOA 2YOCA 4FABL 2EE3A 3JV4A 3MV8A 4M61B 3ZE2E 3OGOE 2RQ8A 3GM0A 1E6JL 5T3XE 1G0DA 1S7RA 2F53A 3IF1A 3EOBB 2K9UA 4PRID 1F4WH 4GW5A 1PZ5B 2OL3H 5LWYL 4N8CH 2HT2C 4IDLA 3BW9A 1T03L 3N85H 2WIIB 4Y19E 1P4LB 4QOKE 3JTTA 5T3ZH 2PO6B 5J6GA 3E8UL 1IGML 1XCTB 4GMSH 4WWKC 1LDPL 1H5BC 3QPQC 3DMMD 2YBRA 2X4RB 5LXGH 4YBLC 4ENEC 4RGOL 4F9PC 3T0ED 3TO2B 5F3BB 3CVIH 2X4QB 3EOTL 4YHMH 1A6VL 4U6TA 1QA9B 3MV9B 3VFVB 1CU4L 1Y6NR 4RDQG 4NOBA 3S3SA 3NCJH 4M93C 3MGTB 1U3ZA 2IAND 3QDHA 3ARBB 1VFBB 3WN5C 5F6IC 1X5LA 2X10A 3NZHH 1ZLSH 2OXGA 1GOGA 4RFEA 2DQDH 1CICC 4U0RC 3ZDYE 4C56D 4RZCB 5IJKC 1ITCA 5IEHB 3KLAA 2MCG1 1YEEH 3LKSB 4MHHG 2VDRH 1HDMB 2EC9T 1A6TA 4WDIB 1TETL 1RIHH 4PRPE 3RWJA 1N0XL 3K4AA 2BVPB 3MLTB 5CS7A 2BFVL 4PJEE 4GG6F 4YJZL 4XVJL 1GC1H 3M45A 1MAML 3DX6B 4XAKE 2ICWI 3QCUL 3TC9A 1FHGA 3K74B 2DMKA 4M02A 4LLUB 1EZVX 4IOIA 3D3VA 5C09E 1TDQA 4LNVA 1TMCB 4G80A 3D85B 5DEFA 1DBBL 1S9YA 2FJGA 5DR5H 3UZQA 1IKNC 1MPAH 4ZNCD 5BS0A 3NIFF 5LGKA 1ZVHA 1QSEA 4HJ0D 1EEZB 2Q1EA 3RVTC 5C7XH 3S96A 4XXCC 1FZKB 3AU1A 3VI3E 5E2VL 1S7WA 2MKLC 3GGWB 3FO9B 2QLVB 4KKBC 4OUUA 1OP9A 1TCMA 3MV01 2H32A 3MR9A 3X3FH 2NW3A 1NGZB 2NYYD 1VACA 3CUPA 3V6ZA 3RTQD 4PLKC 3SGJA 1F6LL 4KROC 1JN6B 1NGWB 4GG6A 1A47A 3TVMA 4JHBA 3DXAA 1RURL 3VG0H 2L7JA 2LAGB 4TSBL 4LHUD 2ZCHH 4HGKC 3FN9A 3ARFD 5C0BA 4MQXD 3QULA 3REWA 4ZFOA 1XGTB 3ZHKA 2I5YH 4G42A 5F7KC 3C87A 4J3OC 4FFZL 1QSZA 4KJYA 4YDLC 3HE7C 3O41B 4BQBA 3F6LA 5GS0L 4FS0A 4MD5B 1J8HD 4LCWD 4OLUL 2VXVL 1Q9LB 1XIWD 3RU8L 5GGSB 4EI5C 5CCKH 2P5WA 4XPTL 4YHYB 1X5YA 5J4MA 4MAYD 2DKSA 2VLMD 4Z0XB 3B9KC 1BOGB 3PJSA 3DMMA 1I3VA 4G6MH 1EGJH 1UJ3C 3VD5A 1WZ1H 4G3YL 2Y4SA 4X4YA 5LVEA 3X17A 4ERSH 3DI2B 1DQDH 5ANMB 1PX3A 3O6FC 4JZNB 3WLBB 2DJSA 2J6EH 2IBGA 1OGAE 4OJFH 2IANA 4JHAL 5L7XL 3VXOA 3BGAA 4EI5B 1AHWC 4HIEA 4XC1H 1S7VB 3BHBA 2XOTA 2CPCA 2R69L 3X11B 3BIKB 1MHPH 4N0RA 1KXQE 3NPZB 4C56A 1AFVL 4S1SL 1RHHB 5DVKA 3WD5H 2CO7B 5IB4A 1L7TL 3HC4H 1JZ4A 1JNNH 3CNKA 2WWKT 3OR7A 1I1AA 4KRPC 5HHOA 5KANG 3ABZA 3JVGA 4J4PA 4NC2B 4OCSH 2EKJA 4MA7H 3TA3A 4G9FB 1EO5A 1KJ3H 4PJAB 2EIZA 2DL9A 4TVPL 4U1MB 1ZK9A 3NZ8B 5EOCH 1OARH 2CDFB 1QSFD 3BEVA 4Z18A 1QKZL 3TCLA 3N9GH 3MNWB 2W65A 1E0OB 5KVDH 1TZIB 3U7YH 1I3RB 1MCOL 4FRWA 1OB1A 2ZOKB 3U48A 4P5MB 2X09A 4KMTH 5KG9A 2YWYA 1OAXL 5JHDB 4LSTL 4NFDA 5DRWB 5FO8A 2X4NB 4OQTH 5HYSB 2R2HA 1IAIM 5BZDA 1UA6L 2V2WA 1HH9A 1MUJB 1NBVL 4D0BB 3ZTJH 3SQOL 3HA0A 1VENA 2BNUA 5MEND 5DD3L 5IP4A 1RFDH 5D6DA 2VN4A 4WCYH 5IJVB 2R1YB 3O6LL 1KCLA 3O2WL 4RISH 2NXZC 3PXHA 4LRNH 4XPGL 3G5ZA 1FNEB 1X5JA 4PJCA 4PJ7B 5FYLD 1IC4L 3ULSA 2OP4H 2VZ1A 1GZQA 4LBEA 3QEQB 4M9PA 4UT9H 1IL1B 2X05A 2H26B 5A43C 4JM2D 5ADPH 2FO4A 2JB6A 1SJHB 5E6IC 4LP4A 4LHUA 4YBQC 3ARFA 4PJXB 1JPTL 1YYLL 2OTWA 1PX4A 3C6LD 4HPOH 3PABA 5EU7E 1NMBL 2WUCL 4UUJB 2C1PB 2X7LA 3HC3H 4HUMB 4DVRH 1KJ2H 3AREB 3B2UC 4I48A 3OPZL 5IW6B 5JPMA 4TNWK 4KDVA 1J8HA 4LCWA 4LSRL 1XIWA 4OZIB 2FGZA 2DQIH 4JZJA 3VXSB 3GMPB 3BESR 3ZSSA 2AAVA 3CU1A 5DRXA 1T0MB 5ENWA 5EIQA 4NKOA 3P2TA 4CAGA 3O2DA 3EO1A 3E6FA 4M62H 2GJ6D 5IEKA 3MJ9L 3BFOA 2XWTA 3O6MH 3G6DH 3BMVA 2VZSA 2JIXA 1JYVA 4PJBE 2ATPA 1U58B 4P3DB 4RQQA 5H37H 4U1GC 2VKXA 3G5XA 3UROR 1MCQA 3MROB 4UI2A 4YO0B 1IM3A 1J05B 4KK9D 4L3CB 4FQXC 1SVCP 3H7BB 2HJFA 2QSTA 3D18B 5C0DA 3T4YA 2HMIC 3VXRD 3TBSB 1KIRB 5C6TH 3V8CA 3QH3B 5IVXB 3QUXB 4AQ1B 4IEFB 4YHOL 5DD0L 4M6OH 5E00B 5D1XB 2HTLD 1EVUA 3QUKB 3U1SH 5ICXB 1CQKA 3B3IB 3MACL 3TH4T 3A6BH 2BNQE 2FJHA 3PWPB 4XGZA 1MCBA 4U6VH 1H8NA 4L9LB 4MDIB 3OKEB 1JGVL 2R1XA 3P4OA 5L9DL 3GO1H 3LEYH 3I2CH 4KKCD 2C1OB 3W82A 4ZTPL 4FQXB 1JV5A 4A2MA 3MA7A 1G7PB 3P11H 2HG5A 4Y4KA 1ZT7A 4JM2F 3QDMB 4P2RE 1R5WA 5TF1H 2YR3A 1DBKH 1NMCC 3WJLA 5D7IE 4YWGH 5KOVC 4C83B 4P2OA 5DMGD 2I9LB 5HHMD 2VXSL 2CIKB 1RIVL 2P1YA 2EYRA 4LPTA 2WQ8A 5JW5A 5K9KB 3TBVA 2FJFB 5IOPA 5HGDB 1IQWH 1BZ7A 4KMLB 4LDEB 5J1AA 3RWIB 5EU6E 4A6YA 5MENA 2AJXH 3BP5A 1UWXK 1E4JA 3O8XB 4XP6H 1LVEA 5GISH 1NEUA 1K6QL 2I25N 1H3TA 1NAML 3VE0A 1NGQH 1QQDA 2C4FU 4QYOB 3ET9F 1BX2A 1I3GH 4LCIH 4Y19B 3SGJC 4BFGA 3ORJA 1DEDA 1T21B 4JM2A 4QOKB 5D2LF 3CGTA 5I71C 4LIQE 2IQAB 2P42B 3TVMC 3FQRB 2VWEC 1R6VA 1FRGL 3EFDH 5ITFA 1PEWA 1YUHA 2E7HA 4GW1A 2DDQH 4N5UA 4XPHH 1M7DA 3NIDE 3O3DA 3KYNA 4XNXL 3T8XA 4X4XB 5HDLA 1FL3A 4YHPA 3BOVA 4TNVF 1S9WA 5FV1L 2D4DA 2LU3A 3G04B 3QDJD 5JO5B 2F8OA 4BSWA 3BKYL 3V4UL 3IKCB 4UDUA 3FRUA 1ZT1A 3FMGL 1RZGB 1N4XL 3MRQA 1D5MB 4XNUL 1NFIB 2GUOB 5D2LA 1ZT4B 3WSQL 2DICA 4QTHA 4Q9RL 4NGHL 3RGVA 3LPWA 1J11A 4LSPL 4S1RH 4HWUA 5I66B 4PRPB 2J88L 5EBLB 5KVFL 1FP5A 1GGIH 4YZFE 2Y36L 4FG6C 1BD2D 2EZ0C 5GGRA 3BUTA 4ODVH 3P30L 3T1FA 1E28A 4BYHA 4OCMC 4I3SH 3ZE0E 2HKFH 2EE9A 3OGCB 2HVKB 1MCWW 5D96B 5DURD 2J8OA 5C09B 3VXQB 4LAQL 2PYED 4N1CA 3U4EA 4XCYA 2CRYA 2XG4A 1I1AC 5CEYB 1S78C 1ROWA 1EJOH 4G9DA 4J4PC 3OHXB 5GRJL 4NO0D 3TA3C 4WW1A 5HYIA 4YFLI 4NPYB 5IHZB 4BKLA 5DSCB 4XP1H 4HWEL 3BVNB 3MRJB 1ACYH 2ERJB 3V4PH 3FQUA 5GHWL 1DQJA 1CG9B 3VRLE 1W0VB 5TE4L 3RWEB 5B38B 1F8TL 3O3UN 1HWHB 3MGOB 3NABH 4P59L 1LE9B 3ARGD 4ONGL 2GAZB 3RNQA 5E8PA 1PDKA 4ISVA 2JJTA 2YEZB 3WFCH 4DW2H 3ZHDA 3QJHB 1KCSL 3HCVB 1S5IL 2Y7QB 2UUDH 4D94A 3A0OA 4HJ0C 3RHWK 4UT7L 2DYPB 4GKNB 4CN1A 1DVFB 4U1KB 5D6DC 1CGYA 1MCEA 1ZTXL 2OTUA 3MLWH 4MA3B 4C4KT 4YFEA 1QFHA 2EC8A 5HYJD 4UT6H 3UTTA 1RMFH 5GSVA 5FO9B 3MRFA 5IQ7L 35C8H 2FWOA 1RIUH 1S7TA 4HZLB 3RUGF 3WHE1 1G6RL 5IMLA 4XB8A 5DWUL 3STZA 4QCIB 3VG9C 4JAMB 3J8F7 4MJID 1DUZA 1W0WB 4M1DL 4X4ME 3WUWB 2FECI 4MQXC 2HN7A 2GCYB 1A6WH 3F58L 3IJYA 2QR0A 4XTRC 5DJDA 5FECB 4K3DL 1KCVH 3U0WH 4Z7VE 4PRNA 3WIFA 1AD0A 1TZHB 4XWGL 4BFIB 3VFMA 2B0SH 2Z92B 3L3IA 1CLOL 4QRPA 3SKNA 4PRAA 1XIWC 1I85A 4PG9B 1IEBA 4E41D 4UU9A 3D39B 5T3ZD 1M71B 4ODWA 3NCYP 4Q74A 4LLDA 5HVHC 3VG9B 3TIDA 1NBZA 1HI6B 2GIYA 1CXHA 3MFFB 3RUGA 3TT3L 5HDQL 2X4TB 1J9CT 5T1DL 1P1ZA 5HHPA 3VFPB 4RRPG 4JHWH 4FQIL 3NFPA 4QEGA 4AK1A 5GS2D 4R9HA 4FHBD 3PNWB 5B39G 3BKCH 4L4TE 4HULB 3OAUH 2HJLB 4PGCA 1IGIH 2O5XH 2C3XA 5GRWA 4P2QA 5SWSD 3JUZA 3QHFL 5FHAL 2J12B 1G7IA 3BT2H 4LGSB 2P8MB 4PLJD 3I6GB 3QHZL 1MFEH 4MD4B 5E5RB 4NWTL 1FLRH 1WAAE 1IJ9A 2VLRA 3EFFA 4ODSL 2DM4A 5EOQH 1BQLH 4HX1B 2H6PB 4JRXE 3BI9X 4DJMA 2SEBA 4NNPL 3IU4H 5IFAH 3LD8C 1J0HA 3RIAF 4MJ5B 3V95A 5LBSH 4YK4B 1T7WA 4MCYA 4EI6B 4XRCA 3DUHA 2BOCB 25C8L 5IF0B 1MAKA 4Y4KC 1KT2B 2IADA 4ORZC 2EDFA 5IHUH 4KVCH 3L7EB 1NDMA 5DK0B 3LN5A 1FG2B 1A1NB 3ARGA 5I8OH 1D5BA 5DHVH 1UADC 4P2OC 3ARPA 1I9JL 5HDOA 5TE7L 3KYKL 4BSVA 1SQ2N 3SDDC 2EXYD 4DN3L 4Z77B 5F7UA 3I85A 3LD8B 1YEHL 3VWKB 2W0LA 2VISB 3D2UD 5CEZE 1CFNA 4XCFL 3FO2B 1U3JA 1N6UA 4X5WB 1AY1H 1TJHH 4QXGH 5C0EB 5HYJA 5L2JB 2M2DA 3HFMH 5C0AA 5JPNA 5IR1B 5FYJE 1YECL 3CSYB 3V5DA 4AG4H 2Q86A 3EYUL 4X0KB 3IS0X 4WU7B 1FFQA 4Y4FC 5F8QC 4KZDH 2FLRT 2YSSA 2J8UE 4WTZG 4MJIA 1U8PB 5JLZB 2K3TA 4M7LH 2WIMA 3SDDB 2HAZA 4HSQA 2A9NH 2DF3A 3C5ZB 3NFSL 5HVFB 4PJBB 5DRZA 5F9JB 3S8WA 2HFTA 4B53A 5CMAB 4PGDA 4WI5A 1F3DJ 1MLCB 4MQSB 3LV3A 4EUPH 3W9DB 3QJFA 5DUBB 5HGHB 4WUKL 3MYZA 4NUGH 1G7MB 1KACB 1MRDH 5E0QA 1I7RB 1T22A 3R06B 1YYMH 1CDJA 1VGKA 1C08A 5DUML 4E41A 4PYHA 2P5EA 4MS8D 2GTWA 5IG7A 3ZE1E 1F6AB 4QHUB 2D7TL 3RWCA 1U2HA 2BNQB 1EFXA 4JFXA 5DZLA 4QNPE 2XT1B 4OAWA 4URTB 1MCLA 2OK0L 1C1EH 4MA1C 4JDVA 3TLRA 2DL2A 2VC2H 3H0TA 5F7MC 4QRSB 4KK9C 3RGVC 2Z0BA 5MEPB 2HKHH 1CIUA 5E8EA 4OTXH 2M26A 5F88B 4PRHA 1BPVA 2FZ3A 1RZFH 5JXEA 4Q58C 3UZVB 4KK6C 4OLYH 1XZ0A 5SWSA 1P7KB 4YPGB 2LFGA 3LQAH 2HTLC 5D7IB 1U8OB 5INDA 2EDLA 4M6ML 1G7QA 3HC0B 4HLZG 43CAA 1XT5A 2ZCLH 4KQ3L 2NXYC 2VZTA 1IFHL 3UTSD 4P9HC 1EHLH 2C3WA 2GYSA 5C0RL 1OSZA 4P9MH 5HSFA 1BJ1J 2YD7A 5EU6B 1HNFA 3IDGB 4MDJA 1AR1D 1F11B 4BELD 2ARJQ 3WFBH 4H1LH 5FYJU 4QRRA 2KKQA 2BVEA 1SEBB 4FTVD 1YJDH 2VZ3A 3DBXB 4ZAKD 5MP6L 1Z3GH 5I1EH 3OAYH 1F00I 1EZVY 2JJTC 4HIXL 5CD3A 3MRCB 4ZUUB 2W9LA 2OZ4H 2FX7L 3PWUA 3D2UA 1ZEAH 2RCSH 4J3TA 5HVGB 4MQ7A 3S35X 5AEAA 3MV11 4LEOB 1U6AH 3OQ3B 1XGYH 1KTRL 1CDHA 3GHBL 3ROLA 3QZWA 1NUFA 5I30H 5C0IA 1FZJA 5E08L 2H9GB 4WUUB 5D7JB 4LLWA 3GBML 4XNYL 2W0PA 4XPAL 3KPLA 4XP9H 3IS1X 5E2WH 2Y25A 5DJXA 2CD0A 3W39A 2GY7B 5KTEL 1N26A 4G5ZH 4QY8B 5GRYA 4BH8B 1C16A 4HWBL 2N7AA 2XIDA 4NN7B 4DTGH 1RU9L 2D03L 4EVNA 1G9NH 4WTXA 4ZUTB 4L4VD 1T89C 3RDTA 3KPQB 3I9GH 3FO0H 4K7PX 4AEHL 1KYOJ 1CDBA 1SBSH 3EUUA 3VDAA 1KLUA 5GGVH 1CLZL 5DQDH 5I74C 1EGJA 4APQB 1C5BL 4NP4H 1NGPH 3KYOB 5F9DC 1XF3B 3UPAA 5BMFH 2WQRA 1VFAA 1QLEL 4HT1L 2KDGA 4ZQKB 3QXAB 4F7PB 3M07A 3W81A 4C57C 4KWUA 4M7KL 2X89A 1IGYA 3GSUB 4Z7UE 1LD9B 1DQML 2C7UA 3T3PF 5DJCB 3U79A 1DLHA 1WZKA 5D8JH 4V1DD 1ZS8A 2F58L 4BA8A 4NO5B 5IV2A 3HAEG 3P4NB 3L5IA 5JDSA 3ULUH 2NY6B 5I74B 4HMCA 3NA9H 4GKSB 1OT2A 3CLEH 3FQXB 4FMFA 4JREC 4Z5RA 3QUYD 3UTSA 2COQA 5ESAA 4CW1B 1WEJL 2F74A 3IDNB 3H42H 3DTXB 1A2YB 1NH6A 1RUQH 4OCWL 1F42A 2MHAB 3MCLL 5AG8A 3OR6A 4JR9L 3OF6D 2BMKB 2GJJA 1BVKA 4QRQA 4NKIL 3QCTL 1GGCL 4L8CA 4H20L 1FGVL 5GRVK 1T6WA 5C08E 4ZAKA 1HHJA 2OI9B 3KPRD 3DX9A 3MA9L 4RGNC 2PW2B 3ARGC 3DV6B 1KIPA 2AJUH 4BK5A 5EN2A 2A77H 1PSKL 2V7HA 1MI5D 1XEDA 2IAMB 1A22B 3JWDH 4TULL 4KY1H 3HZVB 2W0KA 3OKDA 4Z7VB 1W0YT 3X3GH 5D4QA 3NAAH 4HIIB 3TNNA 3SE4A 1JZ3A 2BVOA 1CTOA 2EDXA 3DGGA 3FB7A 3S35L 1N7MH 5DUPL 4YIQA 3V0VA 1LMKA 4HGWA 4G6JH 4JJ5B 1J18A 3L1OH 1A6AA 4X9FA 1YNKL 3BJ91 4YHNA 3NCEB 5DO2D 4K2UL 5T3XL 2YUWA 3VW3L 5E5UB 4PJ8B 2NY7L 1UKSA 3MLUL 1UB6A 1MRCH 1T04B 1ETZA 1RZIB 4HKZA 1EFQA 3AM8A 5GJSL 3RBSA 3FFCA 3JWOC 4P5KA 3KXFE 4M7JL 3GMRA 3QDAA 2RJMA 4YH6A 3P0YL 4GXVH 1NFKA 3IDIA 3O4LD 4N0UA 3D69A 2NY2C 4G8EA 3H6JA 5FUOL 4HIHB 4L4VA 5GS1B 4L4TB 2F53E 4P3WA 4K7PL 4X98A 1CVRA 1A1OB 4EQ2A 3SO3B 1FN4B 3LKNB 8FABA 3L5WA 3GSQA 1ZV5A 1XGPB 2Q8BL 2VR9A 4K8RL 3P73B 1QNZH 2F54B 1QLFA 1IAIL 2E6JA 3WNOA 1N5YL 4JRXB 4NM4L 1WIOA 5ALCH 2ZSWB 3C09B 3WXWL 1AQKH 1MH5B 3LMJH 4WW2F 2ICCA 3QCVL 4Z76B 4MXWH 4OF0A 2CDEB 4C54A 4IBLT 1TCRA 3GJFB 4JDZA 4KHXH 3QO0B 5JXEC 3QEGH 4XNZB 2DQCH 2GK0A 1MIEH 2IG2L 1W72H 1AJ7H 5KSBB 5ACZB 4N1HB 4J8RB 2RHEA 4PLJC 3E6HB 1MJ8L 2ENSA 3N1GC 3FOMA 1R3HA 4QHMA 2YK1H 5LGHH 2DQTH 3RX8A 1UVQB 2FBOJ 4LARL 3L3OA 4F8QA 2WM0A 3V9FA 4UINL 3FT4A 3QNZB 4XC3L 4TUKH 3PDOA 1A7RH 3TO4B 2J4WH 1WWAX 1JK8B 4FXGB 4LLAA 2UWEB 1AKJB 3N1MC 4P3CH 4WW2A 5GRVL 1MFCH 5DHYB 2VXTL 4J3WA 1YEFH 3KPRA 3QRGL 2I07A 3L5XH 2V5SA 1TENA 5KVEH 4FFVD 5H2BA 2MKWA 2J8UB 3GMOB 2GJZB 1S7QB 5JOEA 3QB7C 1QFUH 3BX7C 2VQUA 2YKLL 4RWHA 2QQNH 2EXYC 4IRSB 4PJ5B 4ODUA 2ED8A 2Z91B 2BJML 5CHNA 1U8MA 3A6CH 2C5DC 1FGNH 1KN2H 3V6FB 5D1QD 3LKOA 3DROA 4WTZA 5BS0E 1MCKA 2XA8H 1QSEE 1O7SA 1RJZB 4OGZA 2EE2A 3VCLB 2JLLA 1A4JA 4OFYD 4LVNC 4YXHL 5E8DL 3VGAC 3UJTH 1ORQA 3RZCD 1Z5LA 5BQ7B 5IMMB 4GBXD 4NDMB 3RL1B 4E42A 1DFBL 2RGSA 1FZMB 5GRXG 3PQYD 4EJ1C 4P46B 5LWYH 3I3DA 3G5VB 2CXKA 4JHZA 1T03H 4GG6E 1EXUB 5ID1A 4RNRB 4NNXA 1PLGH 1REIA 3CFEA 4GKOA 5C0BE 2NZIA 1LE5A 3AAZB 1NC2D 2ADFL 4KTDH 4M1GH 2DQJL 1I7TB 2B2XL 5C0CB 1P4IL 1ED3B 3PP4H 4AENA 3KG5A 4H5SA 4YE4L 1A6VH 5IBUG 1A7PL 3RDTC 3VGAB 1CBVL 3NIFE 3KR3L 2DRUA 5HD8D 4BH7B 1QD0A 1DP0A 4K94L 4NFCA 4PRIE 1S7XB 2H45A 2PF6A 1K8DA 5E4EC 4ZUWA 4XVSH 4UQ2A 2R1WB 5E8OB 2G5BA 1ND0A 3GI9L 1JJUA 1ZSDB 3QXUA 3Q48A 3BO8B 3MLRH 4KTYA 2AGJH 1JGDA 2OJZL 4MXQD 3LKQB 3UTQA 3FQTA 3T0EE 4NO2B 2VL5B 2W60B 4TVSa 5LKNA 4D9LL 4PD4J 1NDGB 1RZKC 1ZGLB 1GYAA 1LK2B 3BRFA 4R4ND 3BISA 2LAAA 1HQRA 4DGIL 1SEQL 3KYMB 4F7TB 2VDKL 3I6KA 1INQA 4D2NA 2XKSA 1N0XH 2A73A 1GGBH 1JUFB 3S3JA 4XVJH 2QKIA 1G7LB 2JKXA 3ULVH 2ICES 4OZGF 3X13B 1OL0A 1FNGA 4O2FA 4C56E 4IS6A 1AXSB 3KJ6L 3TIEA 4JFFD 1X3DA 5TDNB 5JA9A 1FAIH 3J7HA 3FT3A 1TJIH 4CU6A 3MOBH 5GQBA 1DBBH 1F4YH 5DI8B 4RWYH 4CN6A 2A74B 1OT1A 1CF8L 3IVKB 1JHLH 3IDUA 2VLLB 1YEJH 1TTUA 5FOBB 1R5IA 2AEPL 2A1WL 1QG3A 4KU1A 2BY3A 3BH8A 4R2GD 5ESQB 3U9PL 2D7PA 5JDJA 1HNGA 5ALBH 4ESKA 4GH7B 5CILL 4X99A 4X6FA 3VH8A 1CDCA 4JKPL 4U49A 4IHOA 1QOKA 2H8PA 3SQBA 1J87A 3DETC 3VRJB 5D1QA 1V5JA 1RURH 4TNVK 1UXWB 2AQ3A 3LEVH 4S2SA 4PJGE 1X4ZA 4OZGA 3EHBD 4YAQB 5FYKU 2FSEB 3SE4C 2LV4A 3HE6A 4AL8H 2P8LB 2OSLA 3Q3GA 3EDDA 3H9SD 5F70A 1ZWIA 3V5KA 4JPVL 4LLMA 3RZCA 5I18H 2HTKD 5GS0H 2BSSB 1BWWA 1QVOA 1I1YA 3PQYA 4OLUH 1SJXA 2P43B 1WFUA 3C9NB 3OKKA 3CDYA 4YR6B 4XPTH 4F9LC 1Y6KR 3FZUD 2CKBB 3UJJH 2QQKH 1F3JA 4OGAD 5SWZD 4MD0B 1PYWA 5EU3A 3AM8C 4PJDB 4XX1E 4Z7UB 3U6RB 1UQSB 1F6FB 2FEDD 1NCAL 2VDNL 3A67L 1CZ8L 4MB4A 1OF2A 3GRWL 3EJJX 3GI8L 3QDGD 2WBJD 1J8HE 4LCWE 4X9HA 4ZYKA 1LK3L 5CBEB 4XB7A 1ZMYA 5T5FL 3GK8H 5GGQH 2VLME 5EOTB 1UH3A 1HXYB 1Q8MA 1KPUB 2X41A 3HR5B 3IGAA 1UM5H 2JELH 3HAEA 2YPVL 2I24N 4K9EL 4W68A 5I0DA 4NZUH 5L8KB 2ZCKL 4PIRF 4S1SH 4RFNC 5CLWA 4HK0A 4TTDD 2YPLA 1WC7B 3VXPA 5FUZL 4EDWL 1P53A 4RBPK 1EPFA 5KN5B 1JWMB 3BPCB 4JY5L 1BVLB 5E56A 3IB4A 3MRNA 1JMXA 2DMBA 3ARDA 4FQQA 5IFJB 1IILE 5C08B 1ZXQA 3ZKNC 3RVVC 4F37F 2GTZA 5ISZD 2DWEA 2HFEA 2NTFA 1FFOB 2HT3C 4IIQB 1U8QB 2ZG2A 1IM9D 1II4E 3MUZ1 4P23A 1FDLH 3QWOB 1UYWL 4UTBL 5B39B 1I1RA 1CIDA 3GMQB 3O45A 3TN0D 1YEGH 3BDXA 3TEUA 5ESVB 5ICZB 12E8H 3IFOA 1PQZA 3REVB 1GAFL 4JFFA 4CU7A 1NEZA 3C5JA 3SDAA 1KPRA 1G7JB 1AXTL 3SDCB 4JPIA 2IPTH 5EG6C 3R0MA 4WW2C 1SYVB 4HFUH 3GMLB 5DD3H 3PHQB 1QSFE 4HWZB 4XWOC 3RY5A 4L8SA 4GRLD 3O6LH 4UB0L 5LGJB 4KRNA 1RY7B 4JGMA 3VXUA 2MFNA 1PJ9A 2GSGB 3TZVD 2BVQA 5ID0B 3TYFB 5ILTH 3MOQA 1AP2B 4RAUB 1HWGB 4PUBL 1LP9F 4JG0L 3RWHA 1UB5B 1FC2D 1BF8A 1XF4A 3KXFB 4EXKA 1IKFL 4RMQA 1RUKH 1SY6L 1XCQA 3JSSA 4PYGA 3JV4B 5ERWB 1TQBB 5MENE 1TPXB 1G0YR 2BXYA 4JO3L 7CGTA 2CRZA 1A5FH 4KZEH 3BSZL 3HZYB 3OPZH 2ZP0T 5GGVY 3T65A 1F45A 2EDYA 3IF1B 2ZOLA 4YDJA 5GZNC 1LO5B 5FYLE 4PRDB 3GSRA 3I75A 5DO2C 1WBXB 5J0BA 4S11A 5HVWA 1ZOXA 3NOIA 1ZA6A 4R3SB 3FHAA 2HRPH 4Q2ZA 3BPNC 4D3CH 4MA8L 3CMOH 1C5DA 4BZ1L 4DCQB 5L8JB 4Y16A 1AC0A 1JVKA 4LKCA 4LHJB 3RRQA 1LP9A 5F7EH 4Z8FL 1P7HL 1TZGL 3WE6A 4OV5A 4KKLD 3MLZL 2NX5D 1RJLA 1RAMA 1T5XB 5AZ2L 5DJ2B 3QA3B 1QUNA 2V9TA 4KK8D 1FPTL 4OZHF 4NN5C 4JFEE 5IK3B 5KVGL 4NQED 4YHOH 4RFEB 1NCNA 2GJ6E 3IDJA 4KXZI 4RAVB 3H2WA 3GSNB 4PJIB 1QFWM 2A6KB 1EMTH 1S7UB 2WLYA 2EICA 4XBEH 1D5XA 1JF1B 2ICEA 5CINL 1Q0XL 1SYSB 5DEGA 2GW5A 3FHQA 4BK4A 5F1NB 1EEUA 3S5LG 5ISZA 3CFBB 3MV7D 3VXRE 3OG6B 1S8DA 3LS4H 1P6FA 2UV3A 2AJZA 3BDYH 1DEEA 1RK1B 1X7QA 2D0GA 4QRTA 4YDVB 4NN5B 3GJFK 5T1KB 2OYPA 3MLVL 4LSSH 1NAKL 3BWAB 1K3IA 5A3ID 2VLKB 5AUMB 2NCMA 1S9KC 4CJ1A 4OZHA 4UBDD 5DDHA 1IGFL 5KJRL 2EXWD 5BS0B 1J5OH 5J9PB 5C0JA 5ETUB 1F02I 2DAVA 1DSFL 5B8CA 5J6HA 1QO3A 2AKRA 4YUEH 1UZ6E 4TUOB 4LLYA 4GRLA 4U4BA 4FQ2H 4PJ9B 2HP4A 4KK5D 4HV8B 5DMKA 5CJQL 3CZFA 1OTUD 4Y5VB 1K6QH 5C07A 1VACB 1K4CA 4JFZL 2B4CL 3QI9D 1NAMH 5FDWA 4R4BA 4Y4HB 3RWFB 5EWIH 1YDPA 3OKOA 4JRYA 3SJVA 1DBAH 3KHQA 5HHME 1OW0C 3ZKMD 1H15B 2JE8A 4HUVB 3LKRB 4NWUH 5DRNB 3NCFB 5F3HB 4Q9QL 3NMEA 1FRGH 1ZVYA 3FONA 3JV6B 3BEWB 3RY4A 3KS0J 2BY1A 4NNYA 5FGCE 2BNRB 3GM8A 3BQUC 1P2CB 3HE6C 1U8LB 1XGRB 5F9OL 2R9HD 5I1JH 1OGTA 2FH8A 2CLRB 4LF3A 1T1XB 4PRIB 5CJOL 2AK1L 4NQDD 5AD0B 5BJTA 3BZDA 3B5TA 3HR6A 3DMMB 1MELA 1UXSA 3B6SA 3HG1D 4GSDL 3V4UH 2IH3A 2B39A 1EHNA 4YHLL 5D5MF 3T0EB 2A83A 3G6AA 1HEZA 3UTZA 3U7AA 3T2NH 3NPSB 3WSQH 1BJMA 4ZD3L 3TBTB 3LKPA 3LSOA 4NGHH 5I1AA 5EZIH 5KVFH 3C60A 4MNQA 3QDJE 4UDTB 3TH3T 2PCPB 5HHVL 2CSPA 2Z93A 1U95A 3JTSB 4C56B 1CE6A 4Z78A 3GIZL 3MRRB 3OX8A 3RUGE 3BXNA 1IAOB 4LAQH 4IMKA 3QXTA 1EAJA 2JCCF 3BRGC 4OZ4A 1QACA 3SGDI 4OB5H 4WTWA 3L3GA 5D5MA 3ARDC 3IJSB 3CFCL 3JWOL 3MV7A 4DKEH 1B4RA 3RPIB 1BD2E 3IJHB 4HWEH 1VEMA 1T1WB 4HH8A 3QQ4A 1DLFL 2FB4H 1U8IB 4PB9H 4D0DB 1N3NA 5F8RC 1MAJA 1R5VA 3ZTJG 4ETQB 4P23C 1WJ3A 1Y6MR 4QO1A 1JWSB 5TDOA 2R29L 4IRJD 4R8WL 4P59H 4MAUH 3NFNA 2PYEE 1YQVL 4U31A 5B22A 3GNML 4PJGB 5HI4C 1KCSH 2BSED 2Z8WC 1ADQA 5GPRA 3SDAC 4PJFF 4HXAH 1S5IH 1UKQA 1KXTB 5F6HI 1QR4A 3VWJD 3LRSA 4UT7H 2ESVE 3D0LB 4X83A 1UWXH 2JCCA 3MOAH 1NMAL 3DO3A 5CEZL 1S9XA 4L8SC 1KJVA 1ZTXH 4U6XA 1MFBH 1RJYA 4TRPL 2MQCA 4FQJH 3QI9A 1QBLH 4FZEH 2W92A 4G8IA 3RTQB 3PWLA 4MX7A 3U4AA 4LKXB 1ZE3C 3BAEL 5C6WH 2FO4B 3FCTB 2X9WA 3ARFB 5DJAA 1DANU 4TUJB 5FXCH 2C4XA 4U1LA 4XNMB 4W6YB 3PABB 2HA1A 2CLZB 1NCTA 3TT1L 3UBXG 5IFHH 3AXLA 1QR1B 4MMXC 1DUYB 1UEMA 1BJ8A 5HYJE 4PJFA 5J1SC 3GBNL 3MJ8B 1I8IA 4ZOAA 2HTKC 2DLHA 5D93C 2CMRL 1Y18A 2APXA 3WBDA 4Y89A 2PW1A 4MAYB 1WICA 5BV7B 4OKVA 4XBPA 4Y1AD 5F9WC 2APBA 1CFTB 5CIPH 4MJIE 1KB5H 3HG1A 5EZJB 2BVTA 3IXAB 3H9YA 5F44A 2XWTB 1MNUH 4NN6C 3Q5YA 2QHRH 2IPUG 4ZFGL 5HDQH 4DN4H 3L95B 4I0PD 3KLSA 4Y16C 5J8OA 2GITA 4G43A 5T1DH 1I9RL 1GIGL 3G9VA 2F15A 3VFWA 4HS3A 4XMPL 1LEIB 1OP5K 4NBYB 1ITBB 1LO3L 2IMNA 4RMVA 5D9SA 3R1GL 3DRTB 3WUZA 1NKRA 2R23B 1DE4A 5FO7B 4E41E 1T1ZA 5T3ZE 3B9DA 4I8DA 4PR5B 4LEXH 5HTSA 4X8JA 3B9EA 1ORSB 4ODXA 3QHZH 4NN6B 1ES0B 1MWAA 4TTDC 1MFNA 4IRZL 3IDXL 4NNPH 3O4OC 4AM0A 5M7QA 1VKXB 3VFUA 2MOVA 3HB3C 4OBSA 3G6JE 1H8OA 4I18B 4WJ5B 1W72A 3RL2B 1QSFB 4OD1L 1SJEA 1K8IA 4JO1L 3HNSL 2ZJSL 4CN4A 5MEOA 4YGVA 3V4VL 3ESUF 3ECBA 1A4KA 2KH2B 3NGBC 3ZT5A 4WHDA 4R7DA 4O58H 3CFJB 5A2KH 1AE6H 3TNMB 1U8JA 1MRFL 5EU4A 3BZEB 3UYOD 4MSWB 5MENB 3GFUA 4JFQA 2X40A 5DJZB 3TV3H 1KBGL 3OTTA 5B8CC 1OPGH 3DV4B 2VQ1B 4PTTA 2P24B 2EDBA 4GRLC 5ACMA 1E6OL 3WO4C 1FFNA 3TBWA 5TDPB 4GAGL 2CK0L 1E4XL 1YECH 4JM2B 3EYUH 5F1OB 5FK9A 4WFED 4H25A 1S9VB 3SPVA 2B7DT 1HHKB 3C6LB 1MIML 2CKNA 2VAAA 5AWNL 4GW1B 4EDXA 2FBJL 5EUKB 1M7DB 3U30C 3L3DA 4FZ8L 1IEAA 5HGBB 1FAKT 1X6LA 3KPOA 4I1NB 5GS0D 5EZOH 5DJ6B 3U0PB 4M43L 4G7YL 3HMXL 5C9JB 1KYOK 1MREL 4JFEB 3CC5A 2NTSP 3ARZA 4Y1AA 1D6EA 3IRZA 1MCPL 2GJ6B 2WSKA 4WY7H 2D7TH 2ITDA 4R97C 5FKAA 3QQ9C 3KPSD 3W2DL 2XKNB 1NGYB 3INUH 3O0RL 1SVZA 3SY0B 2CKBL 3AMLA 3LN9A 5DK2A 1HHHB 3V5HA 3VXRB 4ZOEA 5A2IH 1KELL 1CDIA 2DIAA 1WGOA 1FL5A 3MXVL 3C60C 4PJHF 2VDML 1KCKA 4KK8C 1JWUA 2AEWA 3SCMD 1AO7D 4KPHH 3MJGX 1BBJA 3IDMA 3T77A 1WWCA 3EGSB 4KAQL 3MRGA 3MNVA 3KPTA 4YQXL 4M03A 4MNGE 4KQ3H 1BFOA 4ELMF 1INEL 2GFBB 4IMKC 4M5ZL 2EDJA 1MQ8A 5GSRA 5JIIA 3R0NA 4Z7QF 4KDWA 2HFFA 2NR6D 2XWJA 4OZFG 3SE3C 2AK4A 2X5PA 2HLAB 1GJIA 5FUCE 5H35A 5B3JF 1L6XA 3EO0B 3ZSTA 3AROA 3FO1A 5EH1A 2ZUUA 3WFHB 4AT6A 3SN6N 3HI5H 2QADC 5D2NA 5I8EB 5MP6H 1B4JL 5HHMB 3TJEH 4DEPB 1AD9A 1INDH 4J23A 4QF1B 2EIBA 4PJHA 3UTSE 4JY6A 3BKMH 4PGEA 2PTUA 1P84J 5F7DB 1BLNA 3DX8B 2EXWC 3ZKXB 5IB3B 2AXGB 3RY6A 2FX7H 4JDTL 3DO7A 3LB6D 4NQSB 4DOHE 1MFDL 1V3JA 2VE6B 2E6PA 2QSVA 3GSVA 1NCBL 2IQ9L 4F8TA 5CLTA 3OJDB 3X14A 3FT2B 1M05A 1QRND 2HVJA 4FTVE 3QI9C 3W5MA 3GHBH 3MRHA 2ZUQC 3KHOA 3IFPB 1EO8H 3QIBC 1CK0L 3OKYA 5D1ZD 3ZKMC 2BCKB 3S4SG 1FYTD 5CUSH 3M8OL 3VXMA 4MMZC 5JOFB 4XPAH 5CD5D 4KI5C 1Y0LA 2NZ9D 1BM3L 4RCAA 4EBQL 3EIFA 3RAJH 1VESA 4RX4A 1R3KB 3BKJL 4KXZH 2O26U 4R7NA 4HWBH 3HI1A 2R0KL 3ROOA 3VFRA 1AGCB 3QDJB 1ZHBB 4ZMAT 1YEDB 1YEIH 2QQLL 4DGVH 1BFSA 3QIBB 4OCLC 1GOHA 3BP7A 3NIGF 4YXLL 2EDTA 1JPSL 2A6JB 4M6NL 1NBZB 4M1CD 3GJEB 1XF5B 2NY1D 1IC1A 5HHPB 2D7QA 1A0QL 5E99L 4GMTH 1K2DB 1RK0A 4KJPD 4LLVB 4WHTA 5KSAD 5F96L 1CGSL 1E4KA 3ILPA 1BD2B 4L4VE 1UWGH 4S1QL 4TQEL 5EC1B 2F58H 1HSBA 4MJ2A 3SCMA 1AO7A 1KFAH 2BZDA 4JQXA 3TPUB 1E4WH 3IXTB 3AGVA 3FTGA 5DURB 2CO6B 2PYEB 4M8QB 1JTOA 3RX7A 1WEJH 4WI3A 2PTTA 2RFXB 3SE9L 2OR9H 1CXLA 4NO0B 4MCZB 1OTSD 4MCYB 3CSGA 4ZTOL 1KIUA 1PG7W 1K4DB 4O9HL 4V1DE 5D7LB 4ZS6D 2ESVB 3GSNL 1U91A 1XMWA 5BRZA 5EIIA 3PV6B 1RZJL 1O7VA 1T66D 2O5ZL 4R26L 4H20H 1FGVH 5LCVL 4HHAA 1NDMB 3OXRB 1JE6A 1IAKA 2IALA 2HJKA 4ZXBD 1FJ1A 1J0ZA 1ZVSA 3MA9H 1CTNA 1R3JA 3V7AG 5EUOE 1D5IH 3LEXB 3RX5A 3S36X 5DC4B 1VFUA 4BSVB 2W91A 1I7ZB 2B1HH 1JTPA 4ZUVB 5IMOA 3QEUB 5FM5M 4OD2B 1PG7H 3H9ZA 5BZWB 1T7XA 3K81A 4DKDC 4KKAC 3L3KB 3QWRA 1J1XH 3FFDA 1M6OB 2ZKHH 4UIKL 3THMH 5JW3L 1H0DA 1JPST 1P7QD 5IKCA 2VH5H 2Y06L 1CN4A 5DUPH 5A40E 1CGTA 1QRNA 3KPRE 3K46A 3BWUC 4NUJB 2Q86B 5DK3A 3W9EA 4HZAA 1XAUA 2HLFD 2J1KA 1FYTA 1JP5A 1S5HB 1YNKH 3OL2A 4OIIL 2YSSB 3QIWD 1MI5E 1KTDA 4K2UH 3P9MB 2G2RB 1MHCA 2P48B 3B43A 2B8OT 5EFIB 5HY9B 1NBYB 1IGJA 2NY7H 2IBBA 4LSUH 3VXTA 3BP6A 1ERNA 2ZUVA 7FABH 5EBMA 5F7WC 3AS3A 1A14L 5GJSH 4JN1L 3RA7L 1PKQB 4LSDA 5KSUA 4R0LC 3P0YH 4NHUA 2YMXL 2MPAL 1U93B 3DVGA 1N6QL 1NGXB 2OL3B 1R24A 1SMOA 1YPZF 3IDYC 32C2B 3ZYOA 1A6UL 1FNLA 1MHHA 2AEQH 2VLJD 3FB6B 3SGDH 5I8KH 4GQ9H 1TJGL 3O2VL 4H26B 1HCVA 4QHNB 1OCWH 2E7BA 3D25A 3CZJA 3MJ9A 2DQEL 1L7IH 1QEWB 5FHBL 2H32H 4HKXB 1AGFA 5FF6B 1IAIH 3W0WD 4OSUL 3DUSB 3BD4A 3O4LE 1A1MA 4R0LB 2XY1A 5KSAA 2DQHL 5T1LD 2AV1A 3U9UA 5JORA 3L3JB 3G6JB 2EYTB 4PD4K 2KQMA 3OAZK 3CPLB 1CT8B 1P9MA 1HHIA 4ODHL 3WS3B 1XF2A 4JQIL 3QHTC 5C70A 1RUAL 4JE4B