2CO6B

Salmonella enterica safa pilin in complex with the safb chaperone (type i)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
216
structure length
208
Chain Sequence
LNSATKLFSVKLGATRVIYHAGTGATLSVSNPQNYPILVQSSVKAADKSSPAPFLVMPPLFRLEANQQSQLRIVRTGGDMPTDRETLQWVCIKAVPPENEPGATLDLNLSINACDKLIFRPDAVKGTPEDVAGNLRWVETGNKLKVENPTPFYMNLASVTVGGKPITGLEYVPPFADKTLNMPGSHGDIEWRVITDFGGESHPFHYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
total genus 35
structure length 208
sequence length 216
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
B PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2co6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2co6B02
3QXTA 2DQHH 4NRZB 5HHXL 5ACZA 3BI9X 3RKDD 4LEOB 3ZYZA 3GMOA 2DKSA 5DUBA 1FPTL 5DHVB 4OFIA 4YUEL 4NDMA 2V7HA 4HS6B 4DVBA 5I6XB 5E4EB 4FZ8L 3EYSH 3MRNB 3PGFH 2FJHB 5KZCD 2ADIB 3KXFB 4Q9BA 1FNAA 2ZPKL 5E6IC 5DWUL 5JHDA 2EC8A 4RWHA 4XZUA 3DRTA 4OGYL 5FYKD 3HC0B 1NSNH 4XP5L 1V05A 3O81A 3DRQA 4NHCH 5DTFA 5KW9H 1CDUA 1C5BH 2DLFH 5C0ND 4RFOL 4NKMA 2CK0L 2HTLC 4HHAB 4GKZB 4GBXC 2DAVA 1WZLA 3P4OA 2Y07H 5EC1A 1I4FB 4UILL 5BZDA 2VXSL 5GGSA 2APTA 4TNWK 4WHDA 1LP9B 1I9RH 1M7XA 1FZOB 1BFTA 5ESQA 1TZGL 3VXPB 4BQ8A 3O9WC 4DGIH 5IM7A 5EN2B 4M8VA 3L1OL 1ZT4A 4KK8D 4PJAA 4AEEA 4JHBA 1KN4L 1FP5A 4U1NA 2OI9B 5CIPA 1JGVH 3MV7A 3RZCD 4L1DA 3VFVB 1FVEB 4RAVB 3MFFB 5HI3D 2E7LA 4QHLB 3D39E 4LRIC 1CLYH 3SJVD 5J89A 2EDJA 4U7KA 3LEVH 1P1ZA 3BP6A 2PR4L 1U8LB 5I71B 1T0PB 4MQTB 3FT4A 2L0DA 4FN0A 4HKXB 3G5YB 2ZSWB 4OKVA 1BVKB 3GMQB 4XWOC 3VWJA 2H2PC 4K3DH 1H9VA 5F9OH 4EDXA 3MRLB 5JA9A 2MCG1 5T1KD 4AM0B 3B6SA 5F6IB 4KRPD 4XCNA 1NMCB 5HGBB 1K5NA 5IQ7H 5FM4A 43CAA 3IFPA 3PL6B 4XVSL 4R4ND 1NC2A 4U6HB 4GW5B 1FO0H 4JRWA 3MO1B 1PG7X 3LQAH 4XP9L 4EN3A 4GG6A 1F4XL 1AGFB 1VFAB 4OLWH 4YEFA 2MFNA 1UZ6E 4OLVL 4QHKJ 3RUGB 2AV7A 4XPBH 2PN5A 4XP1H 3Q6FB 5EN2A 1JNNH 1MF2L 5F7MC 4PYHA 5GGUA 1E4KA 2MOVA 1JVKA 4PJAB 3A67L 1Z9MA 5CSZB 3ZE1E 5D7LE 3VCLB 5FYLH 1OTTC 5EZOL 1CFQA 4JY5L 1I9IH 1EFQA 1AXTL 2R0ZL 5FUCC 4KKBC 5EO1B 1NAKL 3FT4B 5GS3A 1YN6A 2LU7A 3QFJA 1FAIH 1A6UH 1HIML 4P3CH 3U30B 3BP6B 2D4DA 3FB6B 4ELMF 1MCHA 1UA6H 2H41A 4IOFC 1EGJA 1TTFA 2FJFA 5KSBA 1V7MH 4TTDC 4Y2DD 1KV3A 4KKAD 2E8YA 2I26N 3OHXB 4U1GC 2EXYD 3NOIA 2IFFH 2AJYL 4H1LA 1U58B 5L2KE 1GH7A 4Y4KC 1T03L 4JJ5B 5I1LB 1F90H 4LARL 4G6AD 4ZNEE 3UJJL 3MRQB 4TUJA 2EE6A 4LGSB 5KSAC 1AGBB 1NGZB 2UY7A 3QJHA 2ZUWA 5CP7A 2JIXB 5DJ2A 1WQVT 5IHZB 1UEMA 5T33L 4K9EC 3EOAA 4JM2B 3HLAB 4D9QD 4BH7B 5GGVH 3CX2A 2ESVE 1WIPA 4KTEH 4LHUG 4YX2H 2C3WA 2FO4B 5DRXA 4Z7UB 4S2SB 1FNHA 1RZKL 2JCCA 4O58L 5F9WB 3L3HA 1T1YA 5KSUA 4ACPA 4Y4KB 1IEAB 2J8UA 4YDIL 4L3CA 5B39A 1LMKA 3IAPA 3QEGH 4AH2B 1G9MH 1FBIH 4CGTA 1UKSA 3MACL 4KK5D 5ERWA 1XGTA 3MREB 1DBKL 5KS9A 5IW1B 3B8SA 3BGMA 4PJ9C 1JMZA 3G6AA 4JN2B 1L7TH 1OAZH 3ARBC 1PG7L 4Y2DC 5F71A 1P9MA 3PP4H 1MRDL 3HE6C 1GHFH 4XMKH 1TJGH 2OSLB 2XXCB 3U9PL 5EA0H 2DQFA 4X9FA 5A1AA 3SO5A 1D5IH 3TN0B 1S9WB 3ILPB 5FEBA 2DYPA 3EOAB 1QSFA 3BQUD 4M1DL 3NCEB 5CD5C 4UIKH 2R0KH 3MRHB 3WHE0 1S7RA 1HQ4A 4M6NH 2R2HA 4YHOH 4UTBH 5LGJB 4X6BA 3L7FB 3AM8A 4PJDF 2YPKB 4NC2B 4ODVH 1ZWIA 4N8PA 1NBYA 4Y5XC 1DEEA 3NZ8A 4LCWA 3ULVH 1Q1JL 4OQTH 1HHHB 3HE7B 4XAWH 2FHFA 1LP9F 4MZ3A 5CFHA 2J88H 5BO1H 3KJ6L 3QG6B 1N0LA 3HUJB 1A6TB 3ES6A 3DYMA 3ZE2E 5I1IH 1XCTA 3VI4F 3DSFL 2LVCA 5GGSY 3V95A 3TYGH 4MXQC 1W0WA 2F19H 5TE4L 3E1F1 3IDIB 1HHJA 3RGVC 2C3GA 1G6RB 3DVFA 3ZDYF 5C1MB 5DO2C 2C5DC 3UTQB 3X3FL 2Q8BH 4QNPF 5D1ZA 4P4KA 4Q7DA 3VCLA 3CZJA 5LVEA 1AHWA 4LIQH 4WI3A 5DSCA 2ADJA 1UXSA 4JO3L 2NY7H 3ARYA 1WWBX 2AP2A 2DOCA 3U9UA 4AT6B 3V52H 5L0QB 1J8KA 4LDOB 4P57A 1XT5A 4OCSL 4XNMB 1U91A 3P0VL 4OV5B 2PYEA 4GBXB 3WD5H 5ANME 5GGQL 2HVJA 4NNPL 4JQIH 2ADGA 3IAGC 5JPNA 1OF2A 4GRMB 4KH2A 3V6OA 3VXMA 2VABA 2VERN 4PB9L 5TE7L 1U6AH 1P84J 2SEBA 1PAMA 4PRPD 4I3GA 3VI3E 1UWGH 4ZUWB 3PHSA 5D1ZC 5DYOA 5SV3A 3SN6N 4ZAKD 3NH7L 3EYUH 1Q9OB 3FT2A 4P49A 1JYWA 1WFTA 3BW9A 4MCYB 3VXPA 1OCWH 4GS7C 4UTAH 3ROLA 1M05A 5F7WC 1OD7A 1G6RA 5EWIL 5DLML 5D71L 1OTSC 3K2MC 2B4CL 3H0TB 2NY5L 3MV7B 4QHUA 2X41A 4FQIL 4ELKA 4L4VE 4WUUD 3T0VA 1RUAH 4BKLA 3CLFL 2YPVL 1X4ZA 4IOIB 3RIFK 3MLZH 4YDLC 1MCRA 1L7IL 4NPYA 1KJ2B 4P23C 5DJDB 1T22B 1XEDA 3OJ2C 1IQDA 1U3HB 4K7PY 4NRYB 3GHEL 2R2HB 1PZ5A 5I1DA 3W9DB 2CO6B 4XVTL 1F11B 1MJ7L 5CJQH 3RWFB 1EBPA 4YDLB 3TJHD 2C4FU 3WJLC 2YPKA 1I8LA 1R3LB 1U8PA 3BZ4A 4JANB 4U6VH 1MHEA 2L7JA 2H9GA 2KZ1B 1WJ3A 3NCCB 5A2JH 4X99B 5JMOC 3BVNA 3RRQA 3UPRA 1REIA 4F7MA 1KIUA 3E3QC 5DHXB 3C6LA 1SVCP 1CD0A 5CILH 3W11D 1XH3B 4LL9A 4RGND 2OI9C 2J4WH 2X4NA 3MLYL 3RVTD 1SEQL 4W6WB 3WKNA 1JV5B 4JY4A 2IJ0C 4OKDA 1YNLH 4EVNB 1F58H 1VADA 4OZGE 3VMOA 4HPOH 1DQDH 3VI4E 1INEL 1IBGH 1VENA 4FZEH 2A9MH 3O45B 4KHXH 4L3EE 2H45A 3ZKQD 4G43B 3QZWG 1IL1B 1NC4D 1HH9B 3MJ7B 1OT1A 1G0DA 5C0AA 5FUZH 2FLBT 4QNPE 2V6HA 3RAJH 3Q6GL 1ZVHA 4U1SA 2DQCH 4HJ0C 1J10A 4Z76B 4JO4L 4QTHA 2FB4L 5D6DA 2XKUA 3L3HB 2IPKB 3IDYB 2B5IC 4XPTL 3TH4T 2AKRB 1F4HA 3RHWK 1M71A 1OD9A 2M1KA 4J3VA 4B0MM 1N6QH 4AEFA 1VA9A 3H8NA 5D6CB 3MRQA 4EI6B 3DNKA 1CFSA 4E41E 2LABA 2X4NB 4W4OA 3UPCA 4OUUB 5C0EB 2R69L 2XNAA 4XCCH 4P2QD 4MAYC 1NJ9B 3C2SA 4KJQC 4PJDB 3TBSA 1V7NH 4JFOA 1HHKA 5T3ZH 4NKOB 2ZUSA 3VFMB 4WEMB 4N0RA 4KQ3H 1JPTL 5I30L 2ORBH 3OKNA 4ZAKB 3WS3A 1NANH 4QCIA 3SKJL 2A73A 4F37F 3WE6A 4L4TA 1S9YB 1RZ7L 2FBJL 4WO4D 1MAML 3MRDB 2BJMH 4PRPB 4Z8FH 1OAYH 1QEWB 4ZOAA 5KANG 1YQVL 3FTGA 3O6FD 3HNSH 4EUPA 5F3BB 4U7SA 5D1QB 5IV2A 3B9AA 3TH3T 4RGNE 1HOCA 1KULA 3BKCL 1B0WA 3N0PB 2OXGA 3TN0C 2NXZB 1ORQA 4OQ1A 3ECBB 3JBG7 5JXEC 2DQJH 2EXYC 4YBLB 5I73B 1A1MA 3BH9A 4NKIL 3Q6FA 2FHBA 1YEFL 2XYCA 4I3SH 2GTWA 4UI2A 2APWA 1MJJB 3CVIH 4JHAL 4QGYA 4K7PX 2AXJA 5TFSH 2A77L 1JV5A 3PP3H 3THML 5IHLB 4XBEL 4UT6L 2Z8WC 3T1FA 2JIXA 1FL3A 4WNQA 1IQWL 4DTGL 2P46B 2XFXB 1W8NA 3O8XD 1ZA6A 1IEBA 2DICA 4Z5RA 4JFDB 1CBVL 1I8LC 3O4LB 4Q2ZB 4ZFFB 3GI9H 4G8GE 4QXTB 5IB5B 1A14H 1BD2E 5ICYA 1ZEAL 1C7TA 4E5XB 5C0NC 1MWAL 3KPRD 3WUWA 4EEEA 2ERJB 4OI8A 2BNQD 3C5JA 2WBJA 3OR7B 2F58H 1QBLL 3NMEA 4BUGA 3G5XB 3RJQB 3UC0H 4Y16A 5D5ME 4RX4A 5MEOB 5MERA 1MH5A 5C92A 2X7LB 2XZZA 3ARGA 5JPNB 1MFNA 3RWIB 1N0XL 5E00B 3OF6D 1LO2L 2P8MA 3ARXA 2MJWA 4P4KC 4YHLL 1I9JH 2CPCA 1I8MA 1D5XB 2NX5A 4R0LA 3VFSB 4RAUB 4RRPA 5E2WL 3OV6A 1H5BC 2EC9T 4UOW0 3TWCH 3TN0D 4DFHA 4N68A 4AZ8A 4POZC 5E5UB 3U9UB 1IC5L 2VB5A 3OZ9L 5BS0E 4Q0XH 5F7KC 3REVA 3WMSA 1A6ZB 1F6LL 3T09A 2AV7B 1IILE 4PV8B 3O2VH 4WHYG 2F53D 4U6TA 4NCDA 3SDCA 1CGSH 4PRHA 1TQCB 1B2WL 2QSTA 4HUKB 4HCRL 1CXFA 3ZDZE 4Z7VF 4PJ9B 2P44B 3HZYB 5DUMH 2D2OA 5E9DD 5BV7B 2NY4D 4NZUL 4RRPG 2R8SH 3VXRD 4RGOH 4F7EA 1PX3A 1J12A 3DXAB 4LSVL 1DQQA 2EDQA 3X12A 1OP9A 1QFPA 1R5WB 1TIUA 1WGOA 1YYLH 3NGBC 1JRHH 1PBYA 4KMTH 5HYEA 1KJ2L 5IGXH 3LHPL 3VXSA 4XNUL 1GZPA 3KYNB 5DRNB 4NN7B 3PIQB 3GSNL 2X4UA 1RU9L 2JIXD 3CFIC 3QI9C 5HI3C 3QR2A 4LSSL 4L8CA 5KAQF 3R4DA 3SQBA 4HIXH 4H26B 2Z8SA 3Q0HA 3WFDH 2V2TB 1F8TH 1FCGA 4N5EC 3QCVL 3HMXL 4JFED 4OF5A 3MRDA 3O0RL 3ULSB 1EEUA 4LCYA 4YPGB 5DMGC 4N0YL 3RA7L 1LHZA 5ADPL 1OGAB 3LQMA 1DQML 3MRJB 3KPSA 3S7GA 1YPZA 1ZHBA 4O5LH 3DLQR 3ZT6A 3GO1L 5LBSL 2QJDA 4GAFB 4JRXE 4U1HB 3UAJC 3QZWA 4WGVB 2LU4A 3TNNA 3MRBB 1I7TB 1FNSL 4IDLA 2HN7B 1RK0A 4U1LA 2DQHL 2VDQL 5CSGA 3BIKA 1WCQA 3G6JF 3L3IA 5J1TC 5DRNA 5C09D 3EBAA 1CGTA 4X80L 1YPZF 3V2AR 3QB7C 5TGBB 1OQXA 4QRUB 2YA1A 4NRZA 1KBGL 1S8DB 2MCPH 2AK1L 4HXBL 5KW9L 4LPWA 3UZQA 3VRJA 3MRRB 3WL9A 2H8PB 5EC2B 3BP7A 2F74A 1OGAA 3MRPA 3MRJA 5GGVY 3MV9D 2R0WH 1QYGL 4GAYB 4B53A 4RX4D 5HI5C 3SKNB 3TBTA 2XG5A 4OSUL 1J5OL 2D7MA 1C16A 5C0JB 4X6EA 2JB5L 4YHPB 4Y2OA 1H15B 5BOZG 5DMJB 1M1SA 3O3UN 3QQ4B 2ITCB 1EDQA 1HSBA 3R8QA 3L1OH 1NMAH 1MHEB 3O2DL 5GISH 4DOHE 3BWAA 3VRLF 2EH7H 1DVFB 1XGRB 3I6KB 4I5BB 4RAUA 1U8MA 3U4BL 4NN5C 4I48B 3DI2B 3EJZC 5C6TH 3F62A 1I1AC 1FG2B 5C7XL 1N5AB 3QPQC 2XN9B 1X5ZA 2ZCHL 4KZDH 2QADB 3AY4C 2VO5A 1CT8A 4JFFA 4PLOB 5FGCB 4NO3B 5IK3A 3O9WB 3D9AL 4JRYD 2P7TA 4OV6F 1JZ8A 4L4JA 2UYLB 2HH0H 3H9SB 4HQQH 3DV4A 4P4RA 2WP3T 3D0VA 1NGWB 3LAFA 3OKOB 3BXNA 4MNGE 5AWNH 2DRUA 5KVFL 1X7QA 1R3HB 4JFDD 4OM0H 2GI7A 4C54A 4WO4A 1TETH 1OAUL 2HFGH 1WBZB 5DMKB 3TO2B 4DWHA 3CNKA 1U58A 2J3SA 1QR1B 5FCUL 3FQXB 2HT3C 5C0FA 3HFMH 3DURB 4OZIA 4P9HL 5BXFA 3LEXB 2OJEB 1TZHA 2E7LC 3HA0A 3ZKND 4XPBL 4JPIB 3CMGA 4G80A 3TFKD 2VABB 1XGRA 1AE6L 3P9MB 1Q38A 1XIWB 3C6SB 1JZ2A 3H3PH 3CXHK 1R0AL 1CVRA 5DYOB 3TNMB 3LPFA 3JV4B 2A38A 1Q9OA 2FGZA 4EOWH 3LV3B 1M05B 2VDMH 4NKDB 4WHTA 5ICZB 3RGVB 1CICA 4KVCH 2UWEA 4CN4A 2UYLA 1X5LA 3OAUH 4WFFD 3T3PE 4LSPH 1P53A 3WXWH 4JRXA 1V7ML 5CD3B 1MPAL 2VDLL 4HW6A 2YA2A 5SV4A 3G08B 2WBJC 4KTDL 2HTLD 1NDGB 4WHYH 3VFTA 3BUYB 3QDGD 1HE7A 1AKJA 1FFRA 1RURL 1T1XA 3JWOL 2SEBB 3LS4L 4X7SH 1GL4B 2HT4C 4L4TB 5AEAA 1M6OA 1BMGA 1E4XH 3OSKA 5D6DC 1BF2A 1CIDA 2FR4B 1KIQA 2DJUA 1QFHA 2K7PA 4OLYL 2ARJA 1QTYT 4GKZA 2VE6A 1I1CA 4YHKL 4KI5E 4APQC 3ALPA 1DLHB 2OZ4L 1QSEB 5J3HC 2DI8A 4NQDA 3HNTL 3NIDE 4JM4H 3CZFA 1CU4L 4ODHL 2QADD 4OD2B 2WSKA 3RKDC 4DJMA 4J8RB 1LEIA 4GRLC 2ZSVB 4LEXH 3SDYH 4W6XB 3RHWF 1S3KL 5KSVB 5ISZB 1AJ7L 1S7SA 4YWGL 3VFOA 1PVHA 4PGCB 4QT5B 2XWBB 5F1KC 1CFTA 5FYKE 1CGVA 1B88A 3N1GC 2AEPH 1MCBA 4FQXB 3JVGA 4LSUL 5I1KL 5J06A 4Z0BH 3WO4B 3UEZA 4J4PC 1IKFH 3MV9A 1TLKA 1DR9A 3FO2B 2WBKA 4JB9H 2C3HA 4DKFH 5E8NB 4JVPA 3I85A 5J1AA 1EO8L 4TRPH 1J05B 5KSBE 4JKLA 4Y5VB 1NUNB 3R0NA 2VR5A 5IJKC 4Q9CA 3V7AG 5HHVH 3B2UD 3V0WL 3QO0B 4XGZA 1G7JA 3T65B 3QNXA 3L3OA 6FABL 4UINH 4Z7WB 4R4NC 3TIEA 1KEGL 3M17B 1N6VA 1KLGA 4YC2B 4XPGH 1M7IA 4JLRB 4Z76A 4JDVA 5B8CC 3GDBA 1FHGA 3VFUA 3BPLC 1EO5A 5F97E 1NGPL 1MCWM 4NN5B 5JHDD 3D25B 1SJXA 4P2RE 3EOTH 2YK1L 2NPLX 3LD8B 4G6JL 4PJIB 4UMGA 3ILPA 1HZHH 4BH8B 3NA4A 3LMJL 1DDHA 3GRWL 2WBWB 2XXMB 5DS8A 2F54E 2NY2C 5D93B 1D5MB 3T2QA 1DEDA 2H2PD 4GAJL 2FL5B 3ULSA 5L6YH 4JQXA 1WC7A 2PYED 5GS1C 3ZO0A 4PJ5E 1NCWH 4YBQD 1O7SA 1F13A 3EJYD 3UTSD 5CD3A 3C9NA 1IM9D 4Y5VC 4KGLA 1HNGA 4ZOBA 4X4ME 4WUUB 15C8L 1AC6A 2WNGA 3MOQA 1OLLA 4HIJA 2FGWL 2IQ9L 4JM2F 1MREL 2V2XA 5L2KD 4KY1L 4XC3L 5KVEL 5C0IB 1MJUL 1I8MB 3CVHH 4M43L 4QHMB 2VZ3A 2EH8H 4Z7UF 1BJMA 1BBJA 2WWMD 4P5MB 4LIQL 1CL7L 2H3NA 3P11L 5FYJE 4NZRH 5J9PB 1K2DB 3S9DB 5J13B 5E2TH 5CP7B 5DJ2B 5AD0B 4TN9A 4QXGH 2Y5TA 5KSBF 4G3YL 4BQ9A 2ZJSL 4BSWA 2A2QT 3CC5A 3U2SB 3HMXA 4NQXA 3L95B 4M6MH 4FA8A 1BEYH 3QH3A 2Y4SA 3NCMA 1N7ML 4WI8A 1U8JB 4JFFB 5JIHA 1JZ3A 4U31A 1XR8B 1VFMA 1EHAA 1R5VB 3AMKA 1OSPH 1XZ0A 3WIFB 5KJRH 5F9WC 1BF8A 2ITDA 2NY4B 4CADA 4OV5A 2UVEA 2HG5B 1BVLB 3LQAC 4JJHA 4KU1A 4MQXD 4ZO7A 5A40E 3HE7C 2QKIA 5CLWA 3HAEB 4OFKA 3K0WA 4S1SH 2AEIT 4KV5E 5D7JB 1FYTD 1HKLH 2PKDA 5DMYA 3EHBC 4FXGB 5D71H 3BKYH 2CQVA 4LOUD 3GRWA 4FQ1H 3DX6A 3DURA 1KPVA 4EN3B 4GG6B 3ARGB 4MZ2A 1J8HD 1SJEB 3WFBL 4NO0B 5MERB 4UUJA 3BQUC 1AXSB 1JWSB 1UJ3B 5SWSD 12E8L 1AO7B 1DP0A 4HS8L 1V3JA 4XMPH 4QRRB 4YNYB 3LKRA 3QXVA 4K8RC 5I17A 3ZMRA 5D2NA 1I8KA 4RQQB 3MV9E 1A7BA 1QFWL 2NY5C 2Y36H 3SKMA 1EJOH 3HUJF 3O8XC 2P49B 3BN3B 5ALBH 5D7SH 2DMCA 2O61B 3MXWL 1RIVL 5DVMA 3SGDH 5IB5A 4PBVC 4P2RA 1GPOH 3RWJB 3D18B 3CFCL 4HC1L 5INCB 4FXKA 2WK2A 4JPVL 2R9HD 4KMLB 2WWKO 4TQEL 3F6IA 3KPPA 5CJOL 4MD4A 4ONFH 2QQNL 5E08H 1PKQB 4FP8H 1MHPL 4HHAA 1P4LB 3RZCA 4XPHH 1L0QA 4CADB 2AVGA 3O6LH 3EDJA 1EZVX 4WHCA 5MI0B 4X4MA 1RHFA 3FCTA 3SCMB 4XB8A 5ICXA 4M3JA 5BZDB 5E5MB 5F9AC 4F15B 3FQUA 2AK4D 2AGJL 4XXDA 3RBGA 5HDOA 5IG7B 3S34L 3G5ZA 1NLDL 2KBGA 3HC3L 3PHOB 3QDJD 5DUPL 1D5ZA 3T3ME 4N0FB 3TT1H 1RUKL 4PJDA 3DMMC 4OZFB 4WTZA 1EHLL 3GIZH 1SJEA 5E8PB 3MLUL 4G9FB 5ALCH 3MJ8B 3TBVB 4LOUC 2QQKL 5I1EL 3K2UL 5IHUL 1Z0MA 4P5TA 4Z7NE 5FB8A 1Z9OA 1C5DB 4YZFE 4BELD 1UGNA 2FATH 3GMRA 8CGTA 1DLFH 1S78D 3LN4A 1LO3H 5FHAH 3MOAL 1IKNC 1A3QA 3CSBA 3E8UL 4PRNB 2AJSL 4P48A 3VU2A 1YUHA 3P4MB 1QVOA 1JF5A 4EUPG 1T1ZB 4RMWA 3QCTL 3D48R 2GT9B 1CDBA 4FZ8H 3T4AB 3ME0A 3RUGE 4DGYL 1AP2B 1LO5A 2RBLA 1AI1H 4OAWB 1T83A 4U1IA 1KB5A 1BD2B 2ZPKH 3DOSA 1LK3H 3SHSA 5AZ2L 1F6FB 4PJIF 5FGRA 4TVPL 1LO0L 4Y4FA 5DO2D 2XPGA 2Y6SC 4HJJL 4K7PH 2EEBA 4RDQF 2CUMA 4GRWE 1RIHL 1KTDA 5J9PA 3QUXC 2Q6WB 1KEML 3KPLB 4JRXD 4LSRH 3OKDA 3BX7C 1VEMA 4PJFB 2VXSH 1PY4A 1CE6A 2P48B 2D7OA 2X44D 3DJ9A 4Y2DB 3L3IB 1EA9C 4PLJC 2WM0A 2Q7YA 5GRWA 1NGYA 2OCFD 4LSQH 1ETZA 5A16B 2FZ3B 1OAKH 4FHBD 1BBDL 5E0QA 3HNSL 1YYML 2FJFB 5HDQH 4KQ4L 1F00I 4PG2C 3UTZB 1TXKA 1IGCL 4YQXH 3LZFH 5HYIA 2P5EA 4BFEA 4X6DA 1I7RB 1GYAA 1IT9L 5CUSH 3CAFA 4OGXL 1T0MA 4DOHB 1Z0NA 1GOGA 1A7QL 2I27N 1KC5L 2P8MB 5FA4A 4K71B 1OHQA 4J3SA 1JGUH 2IADB 1NCCH 3U46B 1ROWA 4GW1B 4JG1H 3MRGB 1DCLA 4ZXBB 4ONOA 3S36H 1XAUA 2A77H 1WICA 5ICXB 4JKPL 1AGBA 3O8XA 1FG9C 4UT6H 1AO7A 1HWHB 2FSEB 4TOYL 5EG6C 4XBPB 2HVKB 4U6XA 4URTB 5KVMC 1T6VN 4K94L 3PL6A 4X6DF 4IRZL 5F7UA 3MO1A 1RJYB 2DQIL 3REWB 3QEUA 5DJAA 1LEKA 4MHHI 3CFJB 1MOEA 5GS0L 1KG0B 3T3MF 1UWXK 1ONQB 2XFXA 3VGAC 5INCA 3KLSA 4Q6YA 4S10A 3B2VH 1CVSC 3GB7A 2FJGA 1GJIA 2CDFB 1R3JA 1ZOXA 4C83B 1JMXA 4ZFFA 3V0VB 5B4MD 2WANA 4MYWB 2W0LA 5EIQA 2XQYG 3EFDH 4O4YL 4APQA 5CEZD 4A6YA 4LCUA 5IB4A 3I2CL 2DJSA 4NP4H 3BD3A 3T4YB 1QA9A 4GG6F 1BREA 2W60B 1YN6B 1FL6B 3PWUA 3GMPB 2Z4QB 1A6UL 1BLNB 1HIMH 3RVUC 4PJXB 5C09E 4U6HA 1KUMA 3DTXB 4N0FA 3EYOA 1JI1A 1UM5H 1CXIA 3QWQB 3M45A 5EFIA 5D7JA 1JZ6A 3P9LA 3EYQC 5A2LH 1BIHA 3WDHA 2X4RA 4JR9H 5IVXE 1FZOA 2EYSB 1W0WB 3EO9H 1F2XK 3IRPX 3JV4A 3D2UD 2BNUA 4WWKD 3O3AB 5FK9A 4NQCA 3P9WB 2BNQA 3ZKXB 2YBRA 1S7TA 4H0HB 5CWSA 4EQ3A 3NCJH 4QRUA 5LAXA 4TVPE 1ZWIB 5F6IC 3KHQA 3KXFD 5KZCB 2Q8AL 2DD8L 3GSXB 1HHHA 3HE7A 1MCEA 3AC0A 3DX8A 2CMRL 4PJHF 4NIKB 4R4BA 3WE6B 1IGTA 4IMLB 4OZIB 4DKEL 1J1PH 3T2NL 3OJVC 3EW3B 2HT3D 4OF8A 5T1LD 4HUUA 3HR6A 4N0UE 1ZGLA 4M8QB 1RMFH 3NCYP 4GO6B 1LVEA 5E2JA 2YD7A 4PY8I 1B4JH 3D2UA 1J9CT 1N3NB 2H6PB 3MRIA 4WWKA 3CH1A 3ARPA 4WCYL 2F8XC 3BYTA 5T1MB 5FDWB 3UTPE 5CZXD 4LSSH 5TF0A 4OGAD 2DMKA 4Y19D 1ZVYA 3WFDL 5HD8C 3CFEA 1F8TL 3U36B 3I6KA 4XP4H 3BN9D 4WIQA 4ZYKA 4I0CC 4RIRB 3BAEH 5T3XL 3VXUE 4X83A 1PG7H 4GT7A 5SWZA 4WWID 1DE4B 3KXFE 2OL3A 3K4DA 3L5WB 4PTTA 4QTIH 3IDJB 1BZ9A 2VLRE 3GK8H 4UDTA 3CD4A 4TSAH 3D39B 2I9LB 3VXTB 2O26U 4NFDA 5C0AB 2Z92A 4HSQA 4MB4A 3UCRA 1MFAL 3WNPA 4OZ4B 2VLJD 2ADIA 3QUYC 5EBMB 1KCRL 1ZVSB 2VXUH 4E42A 3S96A 3TEUA 5I19L 4Y5VA 2ZP0T 1KJMB 3RZCC 5C0RH 5JORA 4MQ7A 1SQ2N 4EKXA 2B0SH 4CU8A 2Z31B 2V5TA 2IAMA 4R4FL 3TO4C 5T1MA 3WIHL 1CG9B 4WENB 3HZKA 1MNUH 4X80H 3MLXL 4G9DB 3BPOB 5EZJA 4DGVL 4YH6A 1M7IB 4JLRA 4Z7VB 5TE6L 5LGHL 5I1LA 4JM2C 3H9ZA 5ACMA 4CN1A 3STLB 4KHTH 4PUBH 4YXHL 5HYSG 1CN4A 3IVKA 5TGBA 3ZTJG 4DAGH 4JDTL 1I3GL 3DROB 1ED3B 2RIKA 3TYGL 2ICWB 1TPXB 2AXGB 3KPMB 4OGAC 4P2OA 3EDKA 3T0EC 4IOIA 5CAYB 1IARB 2X4OB 4M4PA 1K9TA 1HI6A 2ZUVA 3U0WL 1OM3H 2CUHA 3LB6C 4M7LH 5HHOD 2VR4A 1QNZH 3CX5K 2GAZB 4Y1AE 2DI9A 2IAMC 4P2YA 3FQTA 3JSSA 3QNXB 1T83C 3ZSTA 4JZOA 5DS8B 5GPRA 3H9YA 4XVJL 2K1MA 4GUPB 3VW3H 1F6AB 1WZ1L 4JRYB 4X8JB 2IBZX 3MZGB 3QA3A 3VRLE 2BVUA 3PWJB 3NACH 4YBHA 4HKBA 1QACA 1W0YT 4TULH 3K74B 5GGTA 3ARDC 5ESAB 4EDWL 3VWKD 2NQCA 2P8LB 2F54B 4OIIL 4Z7VE 3WD5L 4TUJB 3C8KB 1PQZA 2YD1A 5C7XH 1K3IA 2HJLB 5JIPA 4QWWD 3HPJA 1A7PL 3SE8L 4IJ3C 1TVBB 1MQKH 4KFZC 4BFGA 2MQ0A 3B5HA 3W0WD 4HBCH 3NN8A 1KCUH 4L9DA 2APVA 5F44A 2YD8A 5FK9B 4HC1A 3NH7H 4BJLA 1ITCA 5DZOA 4NYLA 3GSVA 1Y0LA 1X5IA 4J12A 3G08A 4G6AC 4N1HB 5JQ6H 3IAQA 3LKOA 1VKXB 1OAUH 2GK0A 3MXVL 4MD4B 1SJVA 3EIFA 2YRLA 1RZ8A 2ZSWA 5FCUH 5TJWK 4P9HH 5FO8B 1U8JA 3EYFA 3DARA 4OCLC 4HJGB 1CK0H 5ANMB 4NBYB 5I66A 4OBRA 1Y6NR 3HAEH 4EXKA 2IG2H 4S0TD 5D7KE 4ODUA 1BJ1H 5D4QA 3FO9A 4YHNA 4PD4J 5IBUB 1UZ6F 1YEIH 3IYLW 5BQ7B 4OCXH 2VZUA 4YE4H 4G80B 5TQ0L 3QI9D 3VXSD 3CDYA 3X11B 2DQUL 4F2MB 4K3EH 3TYFA 3VFSA 2GFBB 5ISZE 4FXGA 5BRZE 5ITBH 3BP4A 5J11C 1LEKB 4LHQB 1EMTH 3QDGE 5DMGD 1BJ1J 1N4XL 5DQJB 1SY6L 5LQBL 1SEQH 4OZIF 1QRND 4NUJA 5D7IA 3U6RB 4PJ8C 3GB7B 4J3OC 4MWFB 1F58L 1UXSB 4GRWB 1NBYB 2IPTH 2VIRA 3BEVA 3EJYC 4JFPA 5J6GB 1JFQL 2EDYA 3V6ZA 4ORZC 2R23A 4FQJL 3IU4L 3KPTA 5F88B 5HYQA 5EBWB 1VACA 2OZ4H 2NR6C 2PW2A 4H5SB 4MB5A 2OL3H 3BP7B 3MRPB 4IDJH 3BKJH 1KJVA 1CFNA 2NZ9C 3QWOB 2Z91A 5B38G 3WNNA 1U91B 5AYUL 1UH4A 5IF0B 3ZT7A 5D1XC 3LH2L 5MENE 4Z7QF 2V2XB 1F45A 1AD0A 3BP5B 3UBXA 1NCAL 4QEGA 4XC1H 4OFYA 1UCBH 1S7VA 4TTGA 1OW0C 3BSZL 4ZFOB 4DKAA 1XF3A 3RKPA 3TYFB 4P4KB 1CS6A 4F57H 2MWCA 1MAJA 4IRJD 3QIWA 2VLKE 3ZHDA 2Q87A 5EPMA 2BOBB 4FFWC 4MS8D 2C4XA 3V8OA 5DRXB 5CIPH 3L5HA 4V1DE 3UZVB 1AQKH 3TC9A 1GGTA 2G60H 4XP6L 2YMXH 1VFUA 5J8OA 2C3VA 3MMEB 4M93B 2F53B 4TTDD 5E8NA 1F4WL 4WU5B 3ZDXE 2EDHA 1Q0XL 1A0QH 5DD6B 4PGBB 1A1OA 1GGCL 3CSGA 4NUGH 3PABA 4YHML 3BPCA 4MJIE 5C0IA 3CH1B 1LEGA 3G5ZB 3MODL 5HGHB 1PFCA 2V7NA 2A6IB 2COQA 1R3LA 2CDGA 3SDAA 2WUBH 1ERNA 5C9JA 2W9DL 4PRDB 1WFUA 4JPKL 1JL8A 2BP3A 3VXME 4CBPA 5GRVK 4IRSB 3D25A 3A6BL 3ETBF 3SOBL 2DQEL 4G5ZH 4XWGL 1JHLH 1KB9J 1H15A 2HJKB 1PKOA 4PV9A 4OBSA 5FM5O 3CX5J 4K55A 3U0TA 1ORQB 3WXVH 1MCKA 4PRIB 4OCRH 2MHAB 1MCIA 5BV7H 3P40A 1LE9B 4LP4A 1XGUA 2A0LD 1N6UA 1YEFH 3F7YA 5IW6B 3E0GA 1UYWL 3HE6A 1D5BA 4CVZA 5DD3H 1H3TA 5DDHA 5BVPL 2R1XA 4F7PA 1E6OL 4HMCA 3VRJB 5HHMD 4A6YL 5SWSA 1J1XH 1UKTA 4Z7QE 1EFXB 4LHJB 4MDJB 4PJ7F 2RQ8A 1EH9A 3BE1L 4H26A 4GLRH 5D70H 5ESVA 4K3JL 2IQAA 1QSZA 3KVQA 1WCBA 3JV6B 4ODBD 4DN4L 3V4UL 3QUYA 3I50L 4WI7A 2IF7A 5GRXG 3F58H 4G7VL 2HWZL 3AB0C 4ZXBD 2Z35A 4LAJH 4XNYL 3IKCA 1P4LA 4GRLD 4OFPA 4WFGE 3DX6B 4F58H 2GCYB 1L9MA 5GS0C 4IHOA 4PR5B 2P24B 4WW1A 2X1PA 1HNFA 3VH8A 3FN9A 4IRSA 2X9WA 1V5JA 4QRTA 2NXYB 2ZSVA 4HT1H 4NQDB 3O3DA 3FL7A 2L7UA 1Q72H 1C8PA 3HG1E 4UQ3A 3KS0H 5CZXC 4YDKH 3OB0H 5E95B 3PDOB 4MJID 4ZSOB 1VGKA 4TNWF 1AC0A 1QOKA 4C55A 3C5ZA 1NCDH 2CRIA 1G0YR 4JREC 3SKOB 4ONGL 2D9QB 2FECI 1FFNA 1CFVH 1PLGL 5BOPA 3HRPA 4U1SB 1FH5L 1CICB 2G2RB 2YPLB 5CIPB 2IANB 4KV5F 4HWZB 3VI3F 2YD6A 1A8JH 4JRXB 1EGJH 1T22A 3FCTB 3QRFM 5CZKA 3TCLA 1QFWI 4CUCA 1VSCA 3B83A 4HIIB 4KKBD 3ZYJA 3OAZH 1B2WH 3QISA 3VGGA 1NBZA 2A1WL 3QXAA 5I1HH 4AMKL 4LLAA 1FZMB 4HH8A 1VPOL 3EO0B 1NBVH 3BIBX 4J1UB 3R0MA 4IBLT 4PRBA 4LNRB 4WVRA 1RIVH 1HSBB 2CJUH 1X5JA 2NY2D 3LPWA 3BHBA 3IDXH 1BFOA 4HC1H 2F5AH 5K9KA 1HYSC 1K4CB 1JYNA 2G75A 3BRGC 3PL6C 2OP4L 2G5RA 5GS2D 2BMKA 5KSAD 5JUEH 3KJ4B 1F02I 4Y2DA 3C08H 1MLCB 5L9DL 1BZ7A 4P2CG 3DV6A 1KTKE 4NJ9H 4XVUD 3RY4A 3CFBA 2HMID 2H26B 1G84A 1P4IH 1UM4H 3OKKA 5HDBF 1CT8B 5EC2A 4MAYD 1OB1B 2NY1B 4L5FH 3KAAA 4ODWB 1AXIB 2PXYA 4PRHD 4XPAL 5I74B 3EKCA 1HQRB 4NO2A 4P23B 5C6WH 1A3LH 3ARDB 5I71C 5D72H 1GAFL 3G6DL 4QXUH 4U3HA 3DYOA 4K9EL 3ZTNH 3B3IA 4WI2A 5IOPB 1G7MA 4GOSA 2R2CA 4NOBA 5T1DL 2J8UE 3DVNB 4HS3A 1QSFD 3L3JA 2ITCA 1WIUA 4PTUA 3WIIH 3CUPB 3PF2A 4ALAL 3K4ZA 4F2MA 1DQMH 5GRJH 1INQB 4B7LA 1EFXD 1DJSA 4KXZH 3BGFB 1MCWW 2X7LA 4C4KO 1RVFL 2EE2A 1QD0A 2DQTH 5IB1B 3L5XL 4JO1L 3UDWA 1ZV5A 3C2AH 1JE6A 2XI9A 1IMHC 3GKWL 5F3HB 3SDDB 3KYOA 1WEJL 3PWPA 2VDQH 3DX7A 1WTGT 4NWUH 2Y5TB 5T5FH 4KPHH 5MEPA 1LP9A 5KTEH 4P2OD 3CXDL 5JXED 1IRAY 2NZIA 2R1XB 2F5BH 4R8WL 5FYJL 5IJVA 4HPYH 4J6RL 1MWAA 4YK4B 4QRPD 3RX7A 5LG1A 1RPQA 5SX5K 4JFZL 4R3SA 4XH2B 4JN1H 3TO4B 1OGAE 4RWYH 2BRRH 1W0VA 2FX7H 4PRNA 3QNYB 4YDVB 4BM7A 5J12B 2AK1H 3HCVA 3TIEB 4P59H 2C1OB 3MNVB 1T5WB 3MV7D 4DEPC 3NAAL 3SCMC 3OKYA 5I6XC 1AP2A 4CMHB 4FTVD 4YFEA 4RGNC 5GXBB 5C08D 3EYQD 3JVGC 1CLOL 3MC0A 3S98A 1AR2A 4LLDA 1EUUA 1A9BB 2HVKA 3FB7A 4LAQH 5D7LB 2X4QA 4OLZL 4M62L 4MJIA 2V17H 3FB8A 4JVUA 2XZCL 1S5HB 2CRZA 2OL3B 3L5WA 2JJTC 1PGRB 4UT9H 4NN6B 4X5XA 5TH2B 4UILH 4Y89A 5I1JL 4PJ7B 5DRZB 4ETQB 1H8OA 3PWPB 4LSTL 2EH7L 1JHKL 2XA8H 3DX7B 5DD1H 2OSLA 1I8KB 4RQQA 4D0CB 4P4KD 2E7BA 4L8CB 3CU1A 5C9KA 5BS0D 5FGBC 2VDKH 3HMWL 1X5KA 5E2UL 5CCKL 3QPXL 4YJZL 1SMAA 3Q5YA 4QRQA 4YAQA 5IQ9A 4ZDHB 3VG9B 1GGIL 1TCMA 1UWEL 1JGUL 3MA7B 4RNRA 1J8HE 2E6QA 2QBWA 2VE6B 5B39B 4MA8L 1BQLL 4PJGF 5F70A 5EH1A 1WLHA 4MA7H 1T5WA 4P3DA 1FN4B 1T3FA 5TPWH 4P23A 1RULL 2ZOKA 5BMFH 4ZTOL 4OD2A 4KJPC 4ODXA 3NPSB 5C86A 4JFXA 7FABL 4AENB 3ULUD 5DA4A 1S9VA 5T1LA 2H1PL 1AHWC 4KKCD 1XGQB 1YC8A 3WNLA 3D3VD 3QUZD 4JFYA 3STZB 2AI0H 4Z78A 3GUTA 1CFTB 3TZVB 1C5CH 3IDNA 4E41B 4OM1H 2V2WA 3GM8A 4KROD 2XIDA 3BEVB 1Q9WB 1NGWA 3MJ9H 2WP3O 2VAAA 4QOKD 1R0AH 3L3KB 2BOBA 4HWUA 4Z7NF 2K3TA 5ICZA 1YEDA 1KCSH 4L1HA 2O5ZH 3FB6A 3QIUA 1T04A 3O6FC 4PJFF 5I1DB 1IVLA 5F7DB 1FFOB 3RPIB 1IQDB 1U3HA 1J0YA 1MAKA 4M5YL 5I8CA 3MUZ1 3X3GH 4RGMC 4H25B 1U2CA 3HS0A 4LHUB 4JPIA 3R06B 5E6IA 4QWWC 1QO3B 4S1QL 2ZCLH 3TBWB 4WUUA 2Y7QA 3QEHB 3FHQA 4R0LB 4L8BA 5C0JA 3HI6L 5DK0A 3C5ZC 4PGDB 4LU5L 4K07A 35C8L 4Z78B 1F3JB 3BZEA 3VFPA 2BCKB 1FO0A 1KT2A 4MA3B 3VG0H 2NY1D 2UUDH 3HNTH 3GSWB 3WJJA 1CU4H 2E7CA 1T7VA 3SKOA 4G9FE 4MCZA 4LARH 2VAAB 3FMGL 2FD6H 1Q9LB 3UJJH 3GGWA 1P2CA 4I48A 3RBSA 3W0WB 3WV0A 1E4JA 5GSRA 4JO2L 2AJZA 2B2XL 4ZQKB 4FXLA 4F7CB 2EDWA 4IS6B 4WW2F 3VGEA 4OKVB 2XQBL 2DJ4A 3BO8A 1INDH 3CVHB 3LRHA 4UOW1 5JLZB 4TUKH 5L8LB 1NBZB 3QXAB 3BPLB 4HK0B 4X6DB 4DW2H 2MNUA 1FZMA 2YD5A 4YX2L 4UBDD 1N59B 2YD2A 1JGLH 4NZTL 5CGTA 4BZ2L 1WBZA 2QHRL 3HI5L 1HDMA 1I85C 1I3RB 4YHZH 3DO7A 1I1YA 2D7TL 1HXMB 3L9RA 5GGTH 3WHXB 5EO0A 4ZUSB 1YJDC 5EBLB 3IXAA 3TNNB 5T3XH 4ZFGH 4LKCB 5KN5A 1N64L 3P30H 4L4TD 5EIIB 4B7IA 3HPJB 4L3EA 5TH2A 1A6TA 2CXKA 1HCVA 2DQFB 4ZOCA 4LQFL 4V2CB 5DRZA 1G1CA 4M02A 2R56L 5GSVA 3H7BA 1D5BB 1YMME 5CJXA 2DL9A 4IM8A 3K8LA 2IPUK 2W1NA 2VLRD 1U93A 4IJ3B 3L7FA 3MA9H 3H9HB 2DLIA 3IJHB 3RTQC 3C5SA 3EJZD 4F8QA 3NFPA 4N9GB 4UB0H 1QBAA 3O2WH 2BVQB 5LXGL 4NKMB 1NCTA 3MR9B 2VSCA 3AROA 3QZWB 2OJZH 5ILTH 4M6NL 4I9WE 3UMTA 3MGOB 3HB3C 3K7UA 3MYZA 3NFSH 4PJIE 3LKQB 5K59E 1YJDL 5JZ7C 1RK0B 3H42H 1H3VA 3IETB 1ZHKB 4KHTL 4PUBL 4R96A 4UU9B 5FIEA 1M6OB 5FDYA 4M93C 4Q6IA 1Q1JH 4OQTL 4P46C 4S1RH 3EDEA 2ZKHH 4RISH 2CDGB 3SDAB 3TP4A 3S5LB 3EJJX 2Y06L 5FA4B 4OCWH 4FQLH 4K2UH 5INDB 4AEHL 3EYVA 4UIMB 2EDTA 3KPNA 3TIDA 4R7NB 4LLYA 3DSFH 5FAAA 1GCFA 4PJ7E 4KK6D 2A74A 2GKIA 2ZUUA 2F19L 5TE4H 3SE3C 1CL7H 2MHAA 2X4OA 1FQ9C 3I6LE 5HHME 4PJEF 4Z7UA 4WJ5B 3HZMA 1T1YB 2ZWLT 1X6LA 4PJGB 2CKBH 2EXWC 4HZLB 4PJAE 3PUCA 3AB0B 4OD3H 4PRID 3QNYA 4YDVA 4XVUC 5BVJA 5F6HJ 3VGDA 1OAXH 3SDXF 2FJHA 3RZCB 5GIRA 4Q74A 3ABZA 4ZUTB 2WQ8A 25C8H 3LCYA 3WFCH 1ZHNA 3MV8E 3PHQB 2Z91B 4H8WH 5CLTA 2WBJD 4RDQG 3V6FA 4PREA 4Y16B 4GG8B 1D5ZB 4FQCH 3STBA 3VFRA 5DI8A 1NMBH 2BVPB 4KKNA 1TNMA 1D3CA 1K4CA 3GBNH 4JJ5A 5DJCB 2B7DT 2BMKB 2WUCL 2E27H 3GSWA 4CDGC 3VFUB 2FYYB 5KG9A 3NTCH 1DE4A 4FQ1L 3DV6B 1IAOA 1ACYL 4M61B 3ARVA 1ADQH 5DF0A 4UUJB 2J6EH 4NM4H 4NC1C 5HHNA 4XVSH 4PV8A 2VAJA 5J7CC 4NJAH 4BUHA 5AZEL 2BY1A 4NPYB 1OSZB 3B9KB 3TPUB 1D9KB 3QHFH 2I60L 4ZO8A 3GJEA 2NXYC 3P73B 4OCXL 4ZXBC 4Y16C 1A5FH 1T89C 1J8HA 2EE9A 3PDGA 3D69B 3MLZL 1KF9B 3ZKMC 3QIUB 2F8VA 3TBYB 2A6JB 2CD0A 2NY4C 3LN5B 4FFZL 4E5XA 1JPFA 2AEQL 3GBMH 1FSKB 4NO0A 3VFRB 1MI5D 3BH8B 3G04B 4X4YA 2ADGB 4DFIA 3D3VE 4JFYB 3STZA 5IFHH 4CW1A 3FRPA 1WZMA 1UQSA 3PNWA 3OB8A 5EU4A 3VE0B 4IRJA 2AV1A 2GJ6E 3SBWA 1MHHB 4G8EA 5DD0H 1UJTA 4PIRF 3HKFA 2I5YL 2BNUB 1L6ZA 3S34H 5GGRY 4NWTL 4FG6D 2MKLC 1U3ZA 2QSVA 5IT2L 1JK8A 3VDCA 1U0QA 1FL3B 5GJSH 1MCLA 2ZG3A 4TNVK 5KSAA 3AREA 5F21B 1IEBB 4RMQA 2J7LA 1F3DJ 1S5IL 4NKOA 4JY6A 3I84A 1BVKA 3GMQA 3VWJB 4KVNH 1CQYA 3A6CH 3QEQD 2IC2A 1IGFH 2I07B 3TA3D 2C9AA 4CJ1A 2R2BA 3T3PF 5IQ9B 4AIXA 3CFDA 4WU7B 2Z0BA 3BMVA 1JPFB 3E8UH 3ZLQC 1LGVA 3IKCB 1NUGA 1YEJH 1DBBL 2GUOB 5E6ID 2A9NL 3RAJL 1O0VA 4D8PB 4OIBA 1FFPB 3B4NA 2G9HB 4XX1E 4HH9B 4JO4H 1IC1A 5DFVD 1GGBH 4O2FA 4I2XE 5B39G 2VL5A 3ES6B 2WV3A 2JJSA 4XMLL 3AREC 5J11B 1MIMH 1P4BL 3PWVB 2F8OA 4XP6H 1ONQA 2N56A 4D3CL 1T20A 3PV6A 2AJXL 1UKQA 1NGQL 3WS3B 3D85A 4H88H 4PS4L 2RFXA 3GNML 3E6FB 3KYNA 1CDIA 4KROC 1NSNL 3CCHA 3QFJE 1WWAX 2GJZB 1AKJD 2VUOA 2FO1A 1JWMB 4O02H 4DN3H 3ZSSA 4S0SD 1U93B 2BNRA 5GJTL 2WUBL 3T8XB 2Q76A 3QUML 5DVNA 1RI8A 3IFOA 5F3BA 3BPCB 2R29H 3FTGB 4MNGA 4WFHD 4LLQB 1SHMA 3JTTA 3TV3H 3H2WA 5DEGA 4HZAA 3RWGB 2BJML 1JTOA 3O4OB 4JRYA 2CKBA 4LDLB 1IGCH 3D85D 3MBXH 2YRZA 4I0PC 5I1CH 3IXTB 2CDEA 2PTTB 3WFZA 1TVDA 2AKRA 2VITA 3NIGF 3STLA 1MCPH 1W72H 3DYPA 3FT3B 3BWAB 3LKPA 3D0LA 1T7YA 4L4VB 5DD3L 3GIVA 4PJCF 1FLRH 3BKCH 4PJ8B 3OL2A 4M5ZH 4XXCA 3FFDB 2BSED 2ICWA 5FKAB 3IJSA 3RY5A 1DN0A 3SDXB 3U36A 4AJ0A 4OUUA 1E6JH 4ELME 1EEZA 2Y5EA 2JCCB 3IU3B 2YUZA 3FO0H 4K94H 1A1NA 3CVIL 4Y4KA 4P5TB 1KJ3H 2ZG1A 1ZT1B 3IDJA 3GI8L 2AABH 4HS6A 3LY6A 2AK4B 1XFPA 2VDPL 4K8RD 3P77B 3VXUA 1SY6A 3D6GA 3IFOB 3GMRB 4LCWE 2CRYA 2BFVL 2X1QA 3ZZ1A 3LKQA 4PJDE 4NO2B 3INUL 4HT1L 1A4KA 3Q1SL 3GI9L 2GT9A 5IG7A 1P69B 1GOHA 3OHXA 1X5YA 3W9DA 3U7WL 5D1QD 1YEKL 1ZLSL 1S7WA 3JUYA 5JOPD 1TPXC 2CIKB 3BZ4B 4JANA 1KN2L 5JXAL 5GGQH 2FX8L 1JNNL 4H1LB 4FABL 2EIDA 4N8VA 5DEZA 2AXHA 4M1CC 4XCFH 4QOKB 3ARUA 5FYLL 4P2OC 3BEWA 5EOCH 2QEJA 3LV3A 4ELKB 4Y0GA 5JOFB 3N9GH 1WFOA 3D39D 3HLAA 1I9JL 3QCUL 2FBOJ 2PNDA 5D7LD 1EGJL 4JR9L 1NFIB 4CMHC 2W9LA 5IKCA 3VRIB 4UDUB 4MXWH 5KS9E 3CLEL 2ADJB 1BZQK 4M1GH 1AH1A 3UTSA 1T7XA 3QAZC 3RX5A 1SBBA 4P2QB 4F80A 2DKMA 5I1HL 2IH1A 1YMHB 2G2RA 5EORL 5CKGA 5D7IB 3U6RA 5F7EH 5D7JD 32C2B 3VXQB 3FOLA 5CSBA 3QFJD 2EKSB 2QLVB 4G8FB 2A6KB 4HWNA 5FKPB 4PJ5B 4LBEB 4QXTA 3DX9A 2DD8H 5SWSE 5E5RB 2CMRH 3W2DH 2GW5A 4MGXA 5HGBA 1BQHB 3RWEA 1T66C 3ZDXF 1PZUB 5EOQH 2DL2A 2J8OA 4OF6A 5C0CB 1K5NB 5SX4I 1QLRA 1X4YA 5JUEL 3S88H 5CEXB 2YZ1A 4NQCB 4MDIB 3MRFB 3S35H 3QYCA 4WTXA 5GGSB 5DSCB 1YYLL 3DBXA 4CAGA 1UM4L 5JXEA 3PGFL 1OPGH 1ES0A 3D18A 2BCKA 2R2EA 2FECL 3S8WA 4XBPA 4KMTL 2XKSA 2UY6A 1Q9LA 4H1LH 2OQJB 5D72L 2NW2B 5EULV 4FQ2H 5HYFA 1QSFB 2JB6A 2IH1B 1E4WH 3PGDB 5E2VL 4RFOH 4Y7MA 1KB5L 1A6WL 4JHWL 2YUXA 3GSRB 3LIZL 4BZYA 4Z77B 3RDTB 4ALAH 2CDFA 3IFNL 1QBMH 5FV2A 2XTJB 3ZE1F 2X4TB 1ZMYA 4D9RD 4PRPA 4FFVD 4EXPX 4QYOA 4XCEB 3VXUB 4H0GA 2APFA 1QA9B 1QFUL 1TJGL 1K3ZA 4LCUB 5IB4B 1I4FA 3KJ4C 2B1AH 2YKLL 3QG6A 5GZOD 1C7SA 4NWUL 1KN4H 4HFWB 5TF1H 5JQHC 2Q3AA 3U0PB 4QRTB 4WI6A 3SE3A 5C08E 2BVOA 2ZUQC 1CCZA 4R8WH 3OQ3B 3F7QA 4Y19A 5C6PB 4HPYL 2IBZY 4YIQB 5C0DB 2ZUYA 1WAAF 3PQYA 3X13B 2J2ZA 3WJJC 4Y4HC 2YXFA 5LGHH 1I7UB 3U48A 1MRFL 1R24A 1ZXQA 3I6GA 4W4OC 4YXHH 1MFCH 4OLXL 4HDIB 1Q9WA 3LDBC 3MRRA 5FA3A 2XOTA 5DWUH 4IMKC 3DGCR 4JKMA 5IJVB 5ACZB 4LCIL 3S37H 2VH5L 4MA1C 3QDMB 2NTFB 3KJ6H 4B50A 3O4LA 4Q2ZA 2CK0H 1FN4A 1BOYA 1QLFA 3PABB 1BD2A 4NDMB 1KXTB 4C4KT 3HAEG 2BOCB 2XWJB 5EDXA 5I1IL 3W5NA 1A4JA 2EKJA 2MCPL 3UPRB 3I3DA 1FYHB 5C3LD 1U41A 1IKNA 1F3DH 1FL5A 4HIJB 4WI9A 1RZ7H 1KPUB 3LQZA 3VW3L 3AMLA 3ULVE 4Z8FL 2YXMA 4LPXA 4OIAA 5E8OB 4XP1L 3U0PA 4X9HA 1JNLL 1GVIA 2BVOB 2CKBB 4WFED 1CXLA 2JCCF 5I1GH 2H2SD 1BIIA 1FVDB 2J5LB 1YNTB 3QDHA 2PTTA 1VFOA 2CDEB 4ETQA 1S9WA 1NMAL 3O2DH 4ENEC 1FNEB 5IW6A 1T7ZA 1MQKL 4LLYB 3MNWB 4K8RL 5FA3B 4LNVA 3EZ8A 2ICWJ 2BNRB 2BSRA 1K85A 4RSVA 3I6GB 4I3SL 1QP1A 4OJFL 4HX1A 1DUZB 5EBWA 3DETC 3MR9A 1FGNH 1RUML 4E0RB 4QO1A 1PSKL 1QSED 5TE7H 5BMFL 3W0WE 5ENWA 4APQD 1NCNA 3QWOA 4DUXA 4ODWA 4UNVA 3C60B 7FABH 3WFHA 4MNQE 1ZHKA 1UWGL 4YGVA 3ZYOA 2J1KA 3Q5OA 4GJTB 4HV8A 4Z7WA 4L4TE 3BRFA 1DQTA 4U1IB 3CIQA 4NC0B 1Q94A 3GKZA 5CEYA 4NQUA 4PRPE 4X7TA 4HF5L 1TETL 2PTUA 1PD6A 2YPLE 3QRGL 5MENA 3T0WA 2IAND 2YPLD 4U4BA 5FUOL 4ZO9A 5C0EA 3QIWD 1MWAH 2CK2A 3MRLA 5EZLA 4R7NA 4GAGH 1KGCE 3QDGA 2GUOA 2NNAB 3MROB 5EIIA 1IGIL 1QSEA 3QO1A 5L0QC 3CLFH 2EDXA 2YZ8A 2P45B 2KKQA 2AJUL 3AREB 1U3YA 3AU1B 3BKML 1OTUC 1MCCA 2PETA 3IDMA 3PGCA 2YRPA 2OQJA 1IJ9A 2EXWD 3O3AA 5DXWA 4P2RB 2HFFB 3TJEH 2VQ1B 1MFBH 1JIBA 4LCWD 5CJQL 2VYRE 1KIRA 3LEYL 1LDSA 3X3GL 1K4DB 4BSVA 3T4YA 3OKMB 2EECA 5DJ8A 2R2BB 4CVUA 3NIFF 4H8WC 4S1QH 5L88L 3RUGF 3DO7B 3DX8B 2ARJB 4R4BB 2Z9TA 3ORJA 1GZQB 1QBBA 3QDJB 2AJYH 1T03H 3MLVH 1YY8B 4GMTH 4YXKL 1ORSB 4KTDH 4ZS7L 3IU4H 4G7YH 1EAPA 4KJWC 1NLBH 2R4SL 2VDRL 4IDJL 3VD9A 2GFBA 5DQDL 5CBAB 3QUYD 4PGEA 5GZNC 2M8XA 3H7BB 2IBGA 1SBSL 3ESUF 2P24A 3H9SD 2C7UB 4CW1B 4JE4B 4ELMB 4Y4KD 5IBTH 1IBGL 1G9NL 4IRJB 2B2XH 2G75B 1XF4A 3ARBD 2EZ0C 3VWKA 4U6XB 3BSZH 2AV1B 3ULVF 5FOJA 1MQ8A 2XN9D 3CSPA 3CFJA 3D0VB 1MLCA 1NFDF 4YBQC 1JGEA 2VQ1A 1UJ3A 4JM2D 3BDYH 1B0RB 5FM8A 1HINH 2JCCE 1ES0B 3LHPH 5HI4D 1IM9A 3FOLB 4NZTH 1UB6B 1VEPA 1VDGA 2ZG2A 3NPSC 2QHRH 1GRWA 4WV1A 4OFYD 1RZ8B 5HHOE 1A1NB 5GGTL 1D6EB 5LCVH 5IVXB 5JLZA 1DUZA 4C83A 3GHBL 1XF1A 5C08A 1ZT7A 1QEWA 4P3DB 2YMXL 1MH5B 4NSKB 4R26L 3N50A 1YY9C 2QHLA 1BQHA 1FRGH 3B9KC 1IFHH 3QUZC 3V7AE 1EHXA 4PJHE 2CLZB 4HIEA 1Q94B 4MLIA 1V7NL 2HAZA 2DKUA 3WN5C 4HUVB 1XGQA 1R3KB 4NM8L 5DI8B 1UJ3C 2A74B 2Y72A 4M48H 3WKMH 1J0KA 3MZTA 4XRCB 3C5ZB 2C3XA 2GHWB 4HMDA 4ZUWA 9CGTA 2ORBL 2VLLA 2IPUG 4JG0H 1J1OL 1UCTA 4UIKL 1MHCB 5D2LE 3LKOB 1VKXA 5HVHB 1G7IA 1NGPH 1ZSDB 5DJ0B 3UJTH 3B9DA 2KL6A 3VD7A 3HG1B 5CGYD 3QHZH 3SQOH 1K8DB 5C0BB 5ILTL 3ARFC 3UTTD 4NNPH 4XPFL 3CGTA 5E9DA 4QY8A 5DUBB 4WNQB 1YQVH 5GRUH 1BM3H 2VN4A 4LEOA 5MHSD 1UM6L 3H42L 1J87A 1P5VA 5E6ZA 1IC7L 2HLAB 1AQDB 4Y5XA 1UFUA 3Q48A 3MPCA 3ULUC 4V1DD 1CI5A 3KR3L 3TGXA 3BZFA 4NZJA 4Z6AT 1UB5A 5HYJE 1UT9A 5HI4C 2XN9E 2JLLA 3QQ3A 3LS5L 2DDQH 5HHPB 1A6PA 2FIRT 3HC0A 5DVKA 2W0PA 3QUYB 2MSPA 1U8QA 1LD9B 3HPLA 1BAFH 4UV7H 4DN4H 4HKBB 3P4MA 3S3JA 4ZNCD 5GQBA 3H9SE 3T4AA 4JHAH 5IMOA 2QSCH 4BZ1H 3KPSD 4DZBB 4R97B 2JF1A 5TFSL 1NAML 4YHIB 5CBEB 2HJFB 3EYVB 1CD8A 2DLTA 2WIMA 1IGJB 5CJ8A 4I0KA 2OTUA 2NY7L 3CVHL 4M43H 3TVMB 3CFEB 3I3EA 1OGTB 5SWQB 1CGWA 5IFAL 1AY1H 5EOTA 5ADOH 4Q9QL 4TPRL 5I8EB 3NZHH 4W81A 4XTRC 1ZEAH 4FNLL 4XAKD 3VWKB 4XVTH 3NCBB 1RHHA 1K6QH 4Y4FC 5D8JL 2CLRA 2HTKD 1C08B 2DLHA 1ZA3B 5K9JL 3R8BB 1YC7A 4UOJA 5DT1H 3UC0L 1NL0H 1P6AB 3RWFA 1CFVL 4U0QB 4HS3B 3DVNA 3MNZA 4X7FC 2X70B 3E6HB 1CYGA 4JPWL 4TUOB 5T3ZE 3B3IB 5IOPA 1N7MH 5F9JB 3NCYS 1SM3H 1CIUA 3AGVA 5HDBE 3KLHD 1AKJB 5C0CA 4R7DB 3MLRL 1QSFE 5CS7A 1ZLUH 4Y1AB 3MLTB 3FB5B 1NCBL 5EBLA 1OP3H 1INEH 5C2BL 2VDOH 4GKSB 4XNXH 4J8RA 1FV1B 1U8HB 4WY7L 3MV8D 3CZFB 4GKOA 4POUB 3IFLL 5MEPB 2YPVH 2WIIB 2W9EH 4LHUD 1DSFH 4PGDA 5D9SB 3DECA 4H0IA 3N85H 3GMMB 4GS7B 5DUML 5DGRA 1KFAL 4NRXA 4LFHG 1QSEE 2F5AL 2I07A 1YDPB 3QXUA 5I66B 4RGOL 3KPOA 3W82A 1I1FA 4I13B 4XPTH 3TH2T 4EI5D 5IVXA 4LSVH 3TO4A 2F9BT 1HEZB 4YFLF 3G6JA 4ZQKA 4NT6B 1HHGA 2ATPB 1UC6A 1P84K 1XF5B 1BGXL 1MIEH 1XR8A 3WXWL 1A22B 5FYLD 4KROB 3H3BC 5GRZA 5DMKA 2VDLH 3KPRB 2IANE 4PJEB 3KPSE 4XPAH 3TZVD 3OJMB 1EVTC 4ONFL 3MRCA 5IF0A 5JOPE 3QSKB 5F1SA 1NFDB 3O8XB 5D5MF 5T3ZL 1MRCH 4HKJA 5K9KB 5CINH 1H3WM 3KLHC 4X99A 5HYJA 4FQPA 1TVBA 4KQ3L 1FORL 2CRMA 5M7QA 3L3GA 1KCVH 2P7TB 4MLSA 4BQ6A 2HFFA 4FQHB 4NQEA 5JHLL 2UZIH 5DEFA 3TNMA 5F7LB 2F53E 2PCPA 1VGKB 4KUZH 4M7ZC 3TZVA 5FUZL 5ADPH 3OG4B 2IGFH 3CMOL 4G8GD 2A83B 4O51B 1U95A 2BC4B 1EEZB 1OW0A 4EZMA 4K3HA 4O5LL 4RCAA 4OCYL 4KPHL 2ED9A 4JZJC 3GO1H 1YDPA 1G0XA 3L3KA 1EXUA 2E9IA 1HHGB 2YPLA 1MCOH 2A9NH 5C0FB 2FZ3A 1AO7E 4QHKI 4PJEE 1DLFL 4ODUB 1A21A 4LLVA 4ODXB 1LO3L 1VERA 4U1MB 43C9B 5MP6L 4X6EB 2AK4E 3I02A 5IMKB 4JFZH 1A4KB 4DCQB 1RZFH 1CDHA 2Q20A 4MNQA 1U3JA 4LPTA 2AQ3A 2AJSH 2D31A 5IJKA 2D7PA 4MXQD 4CVWA 2R15A 1F4YH 2R69H 5ETUB 3QUMB 4XBGA 2Q6WA 4ZG1A 5IB3B 1ZLUK 5L2JB 3MBEA 3UPAA 4LF3A 1EBAA 3TZVC 1VFBB 4Z7VA 3BESR 3GUTB 1DVFA 1ZANH 4GQ9H 3F7RA 5E1AB 5LWYH 4MAYA 3S5LA 3WDIA 5KVGL 5E99H 1FVCB 5JIKA 4KDTC 4P5MA 1E0OB 1RIHH 3S4SG 1S5HA 5HBBA 2EYRA 1DQLH 2UZYB 4NNYA 5HPOA 5IEKB 3AS0A 3T1FB 1P7KB 2FIKA 3IGAA 4Y16D 1UXWB 5HHNB 3SE9H 3GJFK 2PO6B 3E6FA 1ITBB 1KB9K 2NR6D 2B1HH 1HHKB 4LRNH 3O3BB 5IMMA 4GSDL 2RCSH 3C8DA 2JJSC 1S7RB 2N4IA 3LKSA 5KBNC 5BZWB 2NZ9D 1QBLH 1CTNA 1EFXA 4MDJA 2BRQA 4ZSOE 4J2XA 3DO3A 3FN0H 1FAKT 3RWHB 3VXTA 2V7NB 4W6YB 3PWJA 3HNVH 3HMWH 5I15H 3FFCB 1X5XA 1KXVC 3DGGB 1LO2H 1ND0A 1YYMH 3WLWD 2X9XA 3T65A 3FFCD 4KQ4H 4Q6IB 5FO9A 1GGIH 1UWEH 5ABDE 4HFUH 3V4PH 5EB9A 5F7FA 5E2WH 4KGJA 1I7TA 4JQXC 2NY0D 5EZIH 1UACH 5I1AB 1I1AB 4Q0XL 1E6JL 4HKZA 5IB3A 3D9AH 3V7MA 3DUSB 3FOMA 2HH0L 5KN5B 2H32H 4V2BA 4PBWD 5JOEA 1F90L 3WHE1 5IB1A 5J0BA 4Z95L 2ENYA 3EGSB 4EIZC 4ZPVA 3UROR 1IEHA 5HJ3A 1DBAL 1GZPB 4OCNC 2X4PA 3P11H 3UBXG 1ZTXL 3WEXB 1WBYB 2O5YL 2OTWB 3DVGA 4RGNB 1UXWA 2BSTA 5KVDL 4YXLH 3BO8B 4YC2C 5T33H 4R90H 5CWSB 3EDDA 3V4VH 4FMFA 3WLBB 1FGVL 4HXAH 3RU8L 5F7HA 4PGBA 2YD4A 3O45A 3TJHC 1CE1L 2F58L 4DZ8B 4MD0B 5L8JB 3OGCA 1BECA 3CK0H 1NFKA 5IMOB 3KNBB 3C6LB 5IESL 3KPQA 3ARED 3U7AA 1KIQB 2HKHH 3IS0X 1IZKA 4NGHH 5GGRA 1OSPL 3BUTA 3EYOB 4PPTA 5BW7A 3N9GL 2VLRB 3DIFB 1DBMH 4R2GC 3KYMA 5F3HA 3F12A 3O6ML 3RIAK 5IR1A 4MB3A 3QCUH 4L8SC 1IC5H 5B3JE 5M95B 4LSPL 3VGAB 4RA3A 1NAMB 2X9YA 5ID1B 3W9EB 3PWLA 3PP4L 3BGFC 1AGEA 4LPVA 1RZJL 1U95B 2BC4A 3LS4H 2HFEA 4POZD 2PYFB 2VXTL 5DJ0A 1KNOA 4MCZB 1BX2B 1BD2D 4QHUB 2P47B 1FFOA 5D2NE 3RPIA 3CFBB 1JPSL 4TVPD 4ORGA 1X5AA 1N8ZA 1S7XA 4NQEE 4YHKH 4JAMA 2OZ4A 3OPZH 1FNSH 3U82B 4L4VD 4WUUE 4RFEA 4IS6A 2R23B 1T5XB 5D2LB 3V5HA 4DUVA 5EOQL 1RUQL 4RBPK 1QR1A 2A6JA 5EO9A 3CFCH 3HZYA 5E00A 1UENA 2DQGH 3T2NH 3ULVL 1DFBL 3HZVA 1KJ2H 1P6FA 3BW9B 4MCYA 2QQNH 5I76B 4P0DA 1FV1A 1U8HA 1KT2B 2DF3A 1AD9A 1SYVA 5C0DA 1BFOB 3PHQA 1HSAA 5JW4Q 5I2IA 1PJ9A 3V79C 1RFDH 2XRAH 4LSUH 4F9PC 4AENA 4HWBL 3RX8A 4I8DA 4ELMA 1T2QL 3VD4A 3REVB 4HXBH 3PWLB 4N8CL 3BPNC 2IH3A 3CFKB 4NNXA 4PJCE 4F7CA 5ID1A 2R4RL 1U8MB 3HC3H 1HH6B 3BYYA 4HZLA 2WWMC 2HFEB 1QHPA 1RUKH 3NIGE 4NQED 5D2NB 1J0HA 1EHLH 4PJGA 2XY1A 2R56H 1N5AA 2X1WL 4FQHA 1XZ0B 4NQEB 3TVMC 3QUXB 2GSIB 1IGMH 2WLYA 3QDJA 5AUMB 1KEGH 1B0RA 1GIGL 4XPGL 5HHMB 4GKNB 5LBSH 5JO5A 4I0PD 4ZFOL 1HWGB 3O6KH 3UJIH 2Y25A 3WSQL 1ZHNB 3KWWA 3DTXA 3P2TA 3UXFA 3HHRB 2HVJB 4OCSH 1MFAH 3B6SB 2VXQL 4RMUA 3X14B 5HSFA 5LXGH 4KDVA 1F6AA 4X8JA 3HE6D 1Z3GH 1KCRH 4JKKA 5E6IB 4LVNB 4MNGB 3RVWD 5CZVL 5C71A 2BHYA 4Y8AA 1GGYA 5CEZE 4X4XA 4MQXC 3V5DB 3TA3B 3FB8B 5HHXH 4W70A 4QRRE 1KPRB 1XCQA 1K8IA 4WTWA 3L7EB 3F12B 5E70A 4NO0D 4I9WD 3ARGD 3BD4A 5AWNL 5KVFH 2Z93A 3DSNA 5TE6H 1WBXB 3UTTE 4OCWL 3ZE2F 4WDIA 3WEXA 4WTZG 3UDWC 3QEUB 4ZFZA 2NY3C 4L9LA 1YEHH 1QYGH 1I3GH 2VNCA 4XP5H 4F7PB 1J05A 2FGWH 1P7QA 1H8NA 3HFML 2V5YA 1QKZH 4HBQA 3KPSB 4KY1H 1J5OH 3KLAA 4BK5A 2MQ3A 4YR6A 4HG4J 3GZKA 4Y5YC 1S9YA 5FF6B 1YPZB 1MJUH 1C1EH 3IDYC 2VOTA 4KI5C 1VHPA 3NIFE 5I16B 1X44A 3X14A 2F53A 4MJ4A 1A9BA 5GISL 1BBDH 3FB5A 5D6CA 4EI6A 1MCQA 3HUJA 2JELH 3MROA 1T3FB 1BQSA 2K7QA 1MJ7H 2BVYA 2EO1A 4IOFD 4FMKA 5E8PA 4HD9A 3HPLB 2XNAB 4DGIL 3PWPD 5FO9B 1NKRA 3WO4C 2NYYD 3GIVB 3ZHKA 2CR6A 3NA9L 3CU7A 4LKCA 3SPVB 4FQCL 1JTPA 2ATKB 5HHQA 3VFMA 4KDTA 4DQOL 4HQQL 5CGYC 1NCCL 5I75B 2FIKB 3IGAB 2OX5A 1E4XI 3DUSA 3FOMB 2PO6A 2PYEE 4JKPH 1A7OH 3QPQD 3C5ZD 3QXDA 1LILA 1NPUA 3IJYB 3MUHL 4KUCF 3MOBL 1NFDE 2BHZA 2ZCKH 2C3VB 3MMEA 4M6OH 4I0PA 4HX1B 1FDLH 1A6AB 4R3SB 4RMVA 4XH2A 4K3DL 1YECL 2AXFA 3SJVA 2C1PB 2H9GB 5GRVL 2IAMB 1RUPL 1DQQB 4UT7L 1JWMA 1WAAA 3BVNB 1QRNB 2DIJA 2GTZA 2I60H 4D8PA 3ULUH 1T21B 1S78C 1JZ4A 3MREA 2VLKB 4DZBA 5D93C 4QTHB 3T0EB 4I2XB 4O2CB 2ERJC 2PXYC 1A7NL 3VXSE 1CL7I 1EHNA 1XGTB 2ED8A 2DQCL 2V5RA 5EUOA 3JTSB 3TBWA 3PWVA 4J1UA 1E4KC 4HIEB 4KK5C 4GXVL 3AUVA 3JXAA 4KVCL 2BY3A 5B3JF 3IXTA 1LNUB 3FAXA 5A2IH 5EZOH 2X2YA 4D0DB 4NUJB 3VFWA 5IBLD 3BPOC 3UO1L 5GRYA 3MCKA 3L5IA 1UB6A 5E1AA 1VGEL 4TSCL 2N1KA 5E94A 3KDMA 5ITBL 1IAIL 2FLRT 3HG1A 5J6GA 5CHNB 2WQRA 3W0WA 4AL8L 1UH3A 1OB1A 5IHZA 5DJZB 3IF1A 1EERB 3C5JB 3FONA 4DCQA 3G5VB 2H6PA 4MHHG 5HGAA 5DJXA 5DQDH 3IS1X 3K46A 4PRHB 4PP2B 2J8HA 4KKLC 1EAPB 1EEYB 1L0XA 1EUTA 4HUNB 4MNHA 5DMIH 4MMXC 1IGFL 1YEEL 1ULVA 1A7RH 3KPRA 4EDXB 2CIIA 2GEEA 5C0BE 1PDKA 2C7UA 2A0LC 3C60C 3UYRL 5IHUH 1CF8H 2RHEA 2RAMA 1X5FA 2HT2D 1LQSR 3Q3GA 3LSOA 3F8UB 2FATL 3VFWB 3GMMA 2QADC 4WCYH 4PRIE 1MCNA 2PYFA 4I5BA 2B8OT 4XMLH 4TSBL 3S6CA 1EO7A 4XHJD 4D9LL 2EICA 1FVEA 3SKMB 3QCTH 2JJTA 3MUJA 2F74B 3NABL 2ENSA 5JNYB 1XF5A 4GW4B 1CDYA 1FBIL 3PXJA 4P57B 3ZTJH 1LO0H 3GJEB 5B21A 4B5EA 1A9EA 5D1QA 3T0XA 4MSWB 5ID0A 1TNNA 3V6FB 3SGJA 1HOCB 1T0MB 5E56A 1I3VA 4TUOA 1I7RA 3WIFA 5CEYB 5E2TL 5C0GB 4G6ML 4LLDB 1GHFL 4XMKL 1BVLA 3DX9B 3TT3H 3UJTL 2KQNA 3TM6A 4MJIB 2ICES 1XGYL 3C8KA 5EU4B 2VSDA 3VE0A 2BNRD 4KZEH 4LVEA 4KI5F 3CJJA 4Z7WF 3RL2A 1U8NA 1U92B 4NQDD 4UTBL 2FX9H 1W72L 5IKCB 4L8SB 3PGCB 3CPLA 1H3PH 3U7YH 1YMHA 3MRMA 3LZFL 5D96C 1FNEA 4P2QA 3ARSA 4HLZH 4X98A 5EUKA 1IT9H 3LS5H 2P4AB 1A2YB 1OTSD 3MNWA 4GRLB 2X70A 4JGJA 1WCBB 3JV6A 1OARH 4NFCA 3OXRB 4S1SL 1P7QD 5KVEH 4HUXB 4JG1L 4M7KH 4EIGB 2UWEF 3U0WH 1J1XL 3GI8H 4PJCA 4YDJA 1XF2B 1E28A 4CMMA 3DGGA 5HY9A 2UVFA 4YGAB 5JHDE 5J57B 4HS8H 1ND0B 3DI3B 4H20L 3INUH 1LEGB 3F7VA 1KPRA 2DQIH 1UH2A 3TA3A 4PY8J 1EVUA 2Q8BL 2NY3B 5SWZB 5GS0H 3NZHL 5C9JB 2Z93B 2EDNA 3OXSA 1KLFA 1NANI 4GRWF 3KPLA 2LTQC 4DUWA 1DVFC 5CEZL 1YEGH 3B2VL 4BH8A 1I1AA 1MI5A 5FM5M 2XACC 1D5MA 1CE6B 1I3UA 4ERSH 4GLRI 1W2KT 5HVGB 3MRMB 4U3XA 3DMMB 4HMEA 3VD5A 3S97C 5BRZA 1N2RA 5DHYB 4JPWH 5C0AE 4HBCL 1LE9A 2ZUXA 1OQOA 1RU9H 1ZHLB 2EDFA 5DD6A 3BJ91 2R0LH 4Z77A 1I85A 2VLKD 2BVQA 2IMMA 3B9KD 4Y5YA 4G8IB 4HUUB 3LN4B 1A3RH 1LO4L 3ULVC 3QCVH 3D1MC 1XF2A 2QQLH 3MXVH 4G8GA 5IHBA 3O0RH 3D2UB 4FFYH 4GKNA 1J0JA 4WWKB 1WV7T 2XQYK 4LHUA 5DFTA 3WFEH 5FXCH 2FEDD 2QQKH 4QKXB 2OM5A 1KACB 3MCLL 3K81A 5INDA 5DEFB 2B4CH 4PB0L 3UBXB 2Z8VC 1QFWH 1SEBB 3GM0A 4V1DB 4ZYKB 3N1MC 1T7WA 1QFOA 3OKEB 1VFBA 1RUAL 2BDNL 2V2TA 4O51A 1GPOL 2CGRH 3MGTA 3R1GL 4M7JH 3UBXI 1U42A 2H26A 3QJHB 1S9XB 4E41A 1DVFD 2LE9A 1BGXH 1MIEL 2KUTA 2QSQA 1KJ2A 3RL2B 1VACB 1J86A 2ZOLB 1EMTL 3I6LD 4S11A 1F5WA 1B4JL 1MVUB 1JI2A 3O6LL 1T4KB 2VDNH 4DKDC 3PE9A 4TVPH 2JKXA 4YUEH 4LLUB 4ISVB 2R9HC 3HRZA 5E8DH 4RFEB 3RFZC 5FV1L 2E9JA 3VFTB 1WTLA 1RZJC 1RJLA 4OFVA 3IFNH 4PJEA 3RWDA 3ULVD 5H2BA 1FCCA 5EU7C 1TMCB 3MLUH 2OL3L 1LNUA 1CGUA 5DC9B 5I1EH 3VXNA 4KUZL 3ECBA 4HPOL 1KELH 1B6UA 3TO4D 3OAZK 3RGVA 2IGFL 3CMOH 4ZO6A 4J3WA 2NYYC 2XICA 3VWKC 2A9ML 3PHOA 2GTWB 1SYSA 2VISB 2NW2A 1TJHL 2DM4A 4QRPB 5FHAL 5TDOA 4UV4H 3NBNA 1I9RL 1M7DB 4PD4K 4LIQE 4XNMA 4C59B 2NXZC 1PX4A 3HE6B 3IDMB 3Q6GH 3FQTB 2ARWA 5GHWH 4OZHA 4DGYH 2FB4H 1RZFL 4JFDA 1KG0A 2E7HA 3SDDD 4ISVA 3BFOA 4X7TB 2IWGA 2XY2A 4I0PB 4J6RH 5AYQA 4MD0A 4NFBA 3SY0B 1R3JB 4HJJH 3LEVL 3EYSL 4OM0L 1CR9L 2F54A 3QP3A 2DIAA 4KRPB 1DEEB 2NW3A 3FQXA 4Y19E 2JTDA 5E99L 2HFGL 4LSRL 1Q0XH 2XWTB 4WW1B 5FOBA 2FRGP 4XCCL 4JFEB 1Q9KB 1H5BB 2ATKA 1A6VH 1RZIB 2FSEA 4XTRD 1MI5E 4QLRA 2X6MA 5EUOE 2GSGB 4EN3C 2JJVA 5IQ7L 3GMOB 2WAHA 2W9DH 5C70A 3GSQB 1T2JA 4UDUA 3DV4B 4P4RB 5ESQB 3T2PA 2MPAH 4YHYB 3T77B 3H3PL 3A6BH 1RK1B 3LQAL 3MRNA 2EEDA 4OLWL 2DQEH 3OKEA 4G5ZL 4WI5A 2YD9A 1DN0B 2F54D 2DBJA 3GSUB 3MCKB 4OD1H 5D5MB 5EU6D 1L0YA 2VQTA 5KOMC 2Z92B 3DRTB 5AG8A 3GJFH 2GK2A 5CUSL 3WJLA 4G8IA 3ARRA 5TQ2L 4LLWA 3NGBB 3LKSB 3JWDC 1JCKA 3E3QE 4RA0C 1U8IA 1KLGB 2Q7NA 5E7FA 1FGNL 1RUMH 5JDSA 4S2SA 1LD9A 5E1HB 4X4ZA 5A2KH 5GS1A 4ZFOA 3FQWB 3C9NB 3MQIA 5D70L 5IFJA 2W07A 3HCVB 3LN9A 3I50H 4L4VA 2A6IA 5I18L 1TQCC 4CMMB 3RVUD 4ODSH 5DR5L 3BGMB 3NCJL 1DBAH 1RJCA 5K59F 1VB9A 2PF6A 2O5YH 3HC4L 3QRGH 4YLQT 3THMH 3W5MA 4XNQA 3CPLB 4PJBA 4KTYA 1IQWH 4ODHH 1CICD 1JGEB 3MJ6A 2XV6B 1T1WB 2BHUA 1A2YA 4GRLA 1FO0L 4X98B 2VLLB 2AI0L 3CCHB 5IIEB 1ZAGA 1NJ9A 1MUJA 1ZSDA 2RFXB 3GSXA 3DVGB 1KLUA 1QSVA 3FRPG 1CWVA 3OAYH 1U8IB 2O5XH 3T08A 3QDMA 2YSSA 2UV3A 4KTEL 3LEYH 4JY5H 4JB9L 1FSKC 1AXTH 2O5ZL 5B22A 1A4JB 1G7JB 1FFQA 4E41D 4QRRD 1DANU 4OGZA 4F8TA 3BT2L 5ID0B 1GZQA 2ED7A 4P3CL 3RWIA 3O4LD 4X5XB 1G6RL 1N4XH 1G9ML 4FFVC 4QTIL 4DVRL 1SY6H 4LPYA 3EO9L 1LK2B 2PW1B 4NN7C 2ESVA 4QF1A 1G7HA 4OFDA 1MLBA 3VMPA 5DK2A 1RZIA 4FTVE 5CJBA 3VDAA 4WHTB 1YMMB 1EZVY 3VFGL 3L7EA 3QUXA 2MQCA 2B39A 1MRDH 1XF4B 4QRRA 1DQJA 3HB3D 4WDIB 5EA0L 5JW3H 1RUQH 1CLZL 2HRPL 4NRYA 4M9OA 1X5HA 1QUNA 2AJ3A 1UADC 5IMLB 3HR5B 4N1CA 1A9EB 1UZ8A 5I73C 3CSYA 4MX7B 2FWOB 4QRPE 4Y4HD 1T1XB 3G5YA 5BS0B 3C8HA 2R0KL 1NCAH 3B9KA 1MNUL 1ZA6B 4YHOL 5IUSA 5D1QC 1JPGB 3C6LD 2FR4A 3VA2C 2UUDK 4IRSD 2XQBH 3IXAB 5DGQA 1YQ2A 1FC2D 4L5FL 4D94A 1QLRB 4I1NB 2G9HA 4WU7A 1RZKH 3RVXC 3GHBH 2WLZA 1T2QH 4L3EB 4MJ5B 4NCC1 5K9QI 3MYJA 2BXYA 4JFFE 15C8H 4DAGL 4M8QA 1A3LL 1JRHI 4OGYH 2X4RB 1EEYA 1V3MA 3ARZA 4YDIH 2WW8A 2Y7QB 4U0RB 4X4YB 4OLEA 4XNZC 2CIIB 4PLJD 1BVZA 4NHUB 3Q3GB 3HI1A 1OM3L 1MLBB 2BZDA 3QO1B 2G60L 5KOVC 4NNXB 2BSRB 4J3XA 5GRJL 1QLEL 1N64H 4O9HL 4HULB 5CD5D 2GY5A 4UAOB 5CMAA 1ZGLP 3Q5TA 5HVWA 1L7TL 2XN9A 4NZRL 3U83A 3VRIA 5F1OB 5T3ZD 2EIZA 3UTSB 3N1QC 4QXGL 4JG0L 3JUZA 3UTZA 3B2UC 3U9PH 1XR9B 4OZFH 3P0GB 3X3FH 5BJTA 5DJXB 5JR1L 3P73A 3GSVB 1FNGA 2NY0B 1T80A 4U2YA 5GSRB 32C2A 3VXQA 3BXNB 4XZUB 1BEYL 3WLBA 3IDGA 2WBJB 1Q0YH 4QCIB 1PKQE 1KLUB 4LVOB 1GSMA 3OKMA 5DJ8B 5GRUL 2J6EA 2A6KA 3DETD 1CLYL 3GMNA 3DRQB 1IC7H 1SJHA 1YN7A 2YWZA 4O00A 3BH8A 2PR4H 2QL1A 5D1ZD 3UTPD 1T0NA 4ODVL 3SGEI 1MFDL 4G8GB 5HYSA 3PWUB 4ZUUA 2CLVA 2HKFL 3BHBB 2FX7L 1YJDH 5AD0A 5EU5A 4Q9RH 1CXKA 1S7QB 4JFXB 4GG8A 4OUOA 1EV2E 5T3XD 1KBGH 5F7NC 5BRZB 2NY6D 1NAMH 3B8YA 3B9EA 4OLZH 3V9FA 1OAQH 2V17L 5KS9F 4UTAL 3IVKB 2AW2A 1AGEB 4XP9H 2DBLH 4P23D 12E8H 5IW3A 4AEIH 5EWIH 4HWBA 4OLVH 4XWOD 1YUHB 2ZUQB 3PP3K 2H8PA 1IAIM 4ZPTA 2BY0A 5CP3A 3LB6D 4GBXD 1OT2A 3P77A 4EDWH 2Y1VA 3M8OL 3P0YH 4R9HA 2X42A 2Z31A 1L7IH 4PREB 2R0ZH 3VXMD 4OD3L 3QG7H 4ODTH 4OZHE 3SE4A 1HN1A 3UYOD 5K9JH 2ADFH 3SE8H 3BDBA 1FYTA 2P5WA 1NAKH 4PG2A 4DZ8A 4NQTA 3GHEH 3I9GL 5E4EC 1FAIL 2ICCA 3U4AA