2CO6B

Salmonella enterica safa pilin in complex with the safb chaperone (type i)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
216
structure length
208
Chain Sequence
LNSATKLFSVKLGATRVIYHAGTGATLSVSNPQNYPILVQSSVKAADKSSPAPFLVMPPLFRLEANQQSQLRIVRTGGDMPTDRETLQWVCIKAVPPENEPGATLDLNLSINACDKLIFRPDAVKGTPEDVAGNLRWVETGNKLKVENPTPFYMNLASVTVGGKPITGLEYVPPFADKTLNMPGSHGDIEWRVITDFGGESHPFHYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fibril protein
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 35
structure length 208
sequence length 216
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
B PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2co6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2co6B02
4FXLA 5EU6A 4JPKH 1CFVH 2N7AA 2YN5A 3BDBA 1ZVSB 3FO1B 5HI5D 5FO7A 3EW3B 4N1EA 1R3JB 4EVNA 3TIDA 1HSAB 1F4WL 1BD2A 1X5XA 4JANA 3T0VA 4YHKL 3LKRB 1UB5B 5E7BA 1EEZA 5I2IB 3UTQA 1Z9MA 3QUKA 1XZ0B 1MRDH 3T0DA 3MNWB 1OTSD 1DQMH 5BV7C 4K71C 1YPZA 4K7FB 1NCTA 1DBAH 5HSFA 1MEXL 2OTWB 3WXVH 3UTSB 1ITCA 4PJXA 1FYTB 3UROR 3GB7B 1MNUL 5E2VH 1A6TB 5HYJE 3PNWB 5JDSB 3MRBB 5EUKB 4UB0L 3EO0B 2RJMA 5E2TL 4BZ1L 3GI8H 4QCIA 2OP4H 1NCCH 1ZTXL 4KK6D 4QRRA 4M7KH 4QRPD 3LZFL 5IB5B 4LF3A 2NX5A 3GSOB 4TVPE 5L2KD 5F89A 1DQLH 5EBGA 5CLTA 1OCWL 2B5IC 5KSAD 1QSFE 1C5DA 2ZUTA 3VXRD 1W0WA 4GW1B 1FLRH 5CMAA 3WIFA 3VW3H 5DUML 3TF7C 1YEDA 1L7TH 2F53E 2RCSL 4WI6A 4KKLC 4I0PD 3ARBB 3BGFC 4J7RA 4G9DA 3QFJA 3RHWF 3ECBB 4X5WB 4KKNA 4YDJA 5BRZA 3TM6A 1ZGLM 4QRSB 4KRLB 5TQ0H 1BQHG 3QUYB 5MEOA 2JLLA 2ZG2A 4MD0B 3FQTA 3OF6D 2A74A 2E7MA 1S8DB 5FXCH 5CFHA 4XHQA 4NC1C 3S97C 3MJ9L 4P4KD 5SWZD 5DJ8A 1X5HA 2C4FT 4JY5L 4Z7UB 5HYJD 4OFIA 4CMHB 3H3KA 3RDTB 4BM7A 4O51B 1HKFA 2AI0H 4OZGF 4BFEA 3P4NA 1OGAE 4GRWH 2F5BH 2Y36H 2YPLB 3D0LA 2HLFD 1SVZA 5IG7A 1U3HB 4LNRA 1YEEL 3MV9E 4TVPD 2WBWB 1KPRA 4EKXA 2ZPKH 4LVNC 5HPMB 4LQFL 1QSFD 5GS0H 4I18A 3X3FL 2I07A 3V6BR 1I9RH 3PV6B 4GXUM 5EO9A 2F53D 3G5XB 3DX9A 4S2SB 4OTXH 4AMKH 2FH8A 2I25N 4OD2B 1QSEA 5DUPL 1X4ZA 3W5NA 4DGIL 1FZOA 2WWKT 4HLZG 1EEUA 2X4PA 2VR4A 3QEQA 4YHOL 5FYKH 1G9ML 4MJIA 2NW3A 4EI5C 2BHYA 4XP4L 1YC7A 5C3LD 1JV5B 5GIRB 3VXPA 1KTDA 5E0QA 4UV4L 3SHSA 2HT2D 1JNLH 2CRZA 1EERB 4B7IA 2NY7H 4WY7H 4HK3N 3LPFA 3WMSA 4WO4B 2HTKC 1IZKA 1UJ3A 1HHKB 1MQKH 3OJMB 1PEZA 1NCBH 2Y06L 3QUMB 4KHTH 4Q0XH 5LKNA 1MCJA 3VWKA 4PJ5B 1OGAD 1CGWA 1FVCA 5DRXB 3K46A 2UYLA 3RWJA 8CGTA 3BZEB 1JF1B 4LK4A 1JWMA 1FAKT 2VMFA 4X6CA 1HSBA 3TA3D 3U9UB 4JGUA 5GQBA 1RIHL 4OGXL 5LVEA 3S6CA 3TJHD 5ACLA 3RHWK 3TBWB 3JV0A 3QUXA 1JWSB 3L3JB 3KR3H 3U30C 4ELMF 1O7SA 2QBWA 3JWOL 4FG6D 4HC1L 4JR9L 5F6HJ 4CNIB 2YUVA 3L5JA 4HPYL 5CWSB 1TIUA 4P3DA 3MO1B 3KPQA 4HXAL 3U4EA 4UIKL 1DLFL 5E6IA 2IBZY 5SWSB 4D8PA 4E5XA 3LKSA 1NGYB 4Z8FH 2C3GA 3QDJA 1QLEH 5JQ6L 4IOIA 4AIZA 3THMH 2IAMB 4ZO8A 3DX7A 4PRAA 3ZKXC 2VDPL 1Z5LA 4GBXD 4POZC 5F1IB 1XFPA 2H9GB 4JRYE 5EC2A 2NY4C 3ARZA 3QT2A 1G6RL 2QR0B 4K8RD 1P4BL 1KIQA 5IHZA 3NIFF 4Q9RL 8FABA 1FV1B 4PB9L 25C8L 2CLZB 3ILPB 1I7TA 4NO0A 3VXMB 4ZFGH 4NOFA 3VFWA 4WUUB 5IEHB 2VXUH 4I4WB 1CLOL 5F3BA 3KLAB 5TE6L 1MRCH 3ARDC 4NWUH 1S7TB 3BZ4A 2WUCL 4QTIL 3EYOA 1FL3A 1MJ8L 3BP7A 4M7LL 3V6ZB 5D2LE 3OKDA 4PJDE 1JPTL 2BVYA 4HHAA 3F6IA 1DZBA 1DCLA 1X7QA 3ZMRA 2X1WL 3EGSB 3GKZA 1FGVL 3MV8E 4LVEA 2XQBL 5I18L 1CBVL 3I2CH 1YEHH 3SN6N 1JE6A 4J3XA 1PKOA 2NY6C 2WQ8A 5CP3H 5F7KC 1Q9KB 1CT8B 2AXGA 3EOAB 1XMWA 3U7WH 3T0BA 3S5LA 4JRXE 1REIA 3ILQD 4ZUUB 4CL7A 5MENE 1F6AB 3P73B 5I1IH 3NFNB 1F90L 4NZRL 2B0SH 2XWTB 3MUY1 4LU5H 5LG1A 1VGEH 4JRYD 4KDTC 2B1HL 2IADB 3U0TA 4RX4D 3O41B 2ZOLA 5IT2H 2CK0L 3KPPA 3MRLA 3GRWH 5EZLA 5IB4A 4TQEL 1UACL 1DL7H 4YQXH 2DQTH 5SX4H 3UYRH 4QKXB 2EKJA 5B4MD 4M8VA 4X5LA 4PJBA 5J9PB 4LEOB 2VL5B 5ITFB 3P9MB 3PQYB 4KVCH 4XNUH 5FGRA 3S3PA 1IGCL 1QFWM 1XIWB 3CH1A 1ZS8B 2ESVD 4LKCA 1RK0A 5KSAA 3IDMB 1HYSD 3DHMA 5DMGC 3T3MF 5AWNL 3WE6A 4G7VL 1FORH 4KU1A 2AEQL 1CIDA 2V17H 3EDEA 4XPBL 1T0PB 3MV8D 2NY2B 4I0PA 4OFDA 4XNYH 3TCLA 1W2KT 2XZQL 4GRWE 3IETB 4IHOA 4HH9B 1ADQL 1RUAL 4GAFB 1KTLA 2AVGA 1M7DA 4GUPB 1HH6B 1CZ8H 4LLVB 1E0OB 3IKKA 4K07A 4DKAA 1RSFA 2DQFA 4JRXD 1DBKL 5DEZA 4ZAKB 2VDRH 5C92A 2R56L 2OI9B 1U58B 4L4VB 4R4FH 1WEJL 5F96L 5KG9A 4R2GC 4HUNB 1HEZA 4B5EA 3P0GB 3HE7D 4X4ME 1DN0B 4YBLC 2O5XH 5DJ6A 4JHAL 2FX8L 3BMVA 4PJGF 4RBPK 4RFEA 4BSWB 5SWZA 3BVNB 1MCPL 2R0KL 1KYOJ 1LD9B 5HYJA 4U6YA 4JLRB 3VFMB 4QXUL 4YR6B 1PQZA 4J3TA 2KQMA 4ZOAA 4AK1A 3Q5OA 4GRLA 4ALAL 4N0UE 3HCVA 1HHHB 1K3IA 3DMMC 3WDJA 3NBNA 4WDIB 3D0VB 2F5AL 4P2QE 1L7IH 3NZHL 4MJ2A 2MPAH 4OLYH 1QSFA 1MY5A 3UBXG 3BKCL 5L7XL 5IKCB 1RHFA 1G7PA 1HINH 1NGXA 4H88H 3EOBA 3VA6A 3D9AL 2F53A 1D7FA 3FT3A 2XKNB 2Q20A 2VB5A 1J1PL 3GIZH 1IGTA 4P48A 1R3IH 1B3JA 1PLGL 3B8YA 5D9SA 3OKMA 2AQ1A 5F7HA 5GS0D 5HYSB 2CLRB 4PPTA 3HAEG 3REVA 2BSRA 3VU2A 4HWEH 2DLTA 4LLYA 3GKWH 4NQTA 3V5KA 3IXTA 2EIZA 2AJYH 4UUJA 3B3IA 5J6HB 4JY6A 2VYRE 5GJTH 2H1PL 1SJEA 3S34L 3MR9A 3UAJC 1VFAA 1A1OB 4I2XA 5C0AD 1KCSH 1IM9B 1EX0A 4MA7H 1OGAA 4XCNA 1TJHH 3EYFA 1QFUL 1I1AB 2C9AA 1F4XH 3VGAB 5ANME 3O3AA 5I1HL 4PB0L 4P2QD 2QSCH 4ZUVB 4O4YL 3HE6B 5D6CA 1VEOA 3BPNB 5KBNC 2OTUA 4AG4H 1HZHH 2BNQB 2WBKA 3VFUA 4GG6E 4QHLA 3V4VL 1WT5C 5KW9L 2YOCA 4YHNB 1FYHB 2I60L 3BP4A 4L3AA 1MAKA 3MLWL 4MDJB 1UWXK 3QI9B 4FZ8L 1AJ7H 4W4NA 2FZ3A 5F9OH 4U2ZA 3ULUE 4G80A 4DVBB 4KRNA 2HT4C 1J10A 3QFDB 5T3ZL 1O0VA 2NY3B 1WIPA 4HMDA 3MOQA 4YFLI 3KYOB 4L9LC 3VWKC 5DK0B 3PGCA 1IQDB 2FB4L 5D4QA 1CGSH 3QDGB 5GS2D 1MCKA 4QWWC 4BFGA 4F9PA 4GW5A 2ADGB 1JI2A 4QHKI 2MSPA 3GJFK 4N0FA 1MJUH 1CFQA 1EHAA 3WIIL 3WIHH 5LJYH 1R0AL 1E4XI 2LABA 1KJ3L 3DUUA 2CIKA 2BDNL 5GGVY 3M07A 2Z92A 1Q9LB 5D7LE 5CZKA 4ZS6D 1PGRB 1NSNL 2YZ8A 5HY9A 2YWYA 3OHXB 1ORSA 4KK8C 2QADC 4G8FB 4XC1L 2VOTA 4NKOB 5CJXC 1FL6B 4YHIB 4O2EA 1N0XL 1T1WB 1KB9K 3TN0C 1OSPH 2NY5C 4ZUWA 3JTSA 1FNLA 4HK3J 4ZSOB 3LMJH 1IZJA 2YRLA 5JA9A 1B6UA 3E1F1 3UJTH 1N3NB 3ULUD 1MJ7L 3BISA 2VDLL 5TE4H 1EHLH 4BZ2L 4MX7B 3FQNB 3KVQA 5C0GB 1VACB 4QT5A 1A7OL 3H9HB 3BPCA 4H1LB 5DHYB 4KKBC 2BRRH 2R2HA 4G8GA 1ZEAH 4LKXB 2VZUA 1K4CA 5IMKA 4HS8L 5IOPA 1IKFH 4WW1B 2HWZL 4NP4H 2R0WL 3C60C 4ZMAT 2DQHH 4JRYA 5FCUL 1BZ7B 4RX4A 2FR4A 5EWIH 4NJ9L 3VG9B 5HGDA 3RU8H 4PGJA 2H26A 3OX8A 3ABZA 1GZQB 1I7ZB 4K94L 5BW7A 5D7LD 2A6JB 3L95B 3QUMH 4GKNA 5IFAH 4DFIA 1U93B 3RWDB 1CICA 2IALB 5CJQH 4MZ2A 4PJEF 2ESVA 2XT1B 5HI5C 2F54E 4KUCD 3SGDI 2UWEE 3DXAA 3IAGC 1QBBA 4LPCA 3MV8A 3U0WH 4JVPA 5C0DB 2GI7A 1OTSC 4LHJB 3JV4A 2Z8SA 4APQD 3CZFB 4XNXL 5LQBL 1IL1A 3FB8A 2JIXA 3B9KD 2IBZX 3CXDL 5DMIL 5HI4C 4FQJL 1B0GA 4AJ0A 4UMGA 1NLBL 4Z77A 5JIHA 2ZUUA 1OM3H 5DDHB 3AU1A 5K33A 3DRTB 4IMLA 1TVBA 2WBJB 4GLRI 2AJVH 3PHOA 4LCUB 4C54A 4HDIA 2VLRA 3NAAL 1MFEL 5A2FA 4KK6C 1K8DA 1EEYB 2CLVA 4ODWB 5TE7H 5E8OA 2D9QB 3QCUH 4OZFA 4AZ8A 5E00B 5IMLB 5D5MB 5KSAC 3AS1A 3DUSA 2FGWL 2ICWI 3QEHB 2COQA 3X14B 1WQVT 1MFDH 3JTTA 1FGNH 4OJFH 1WFNA 5EOTA 2HH0L 1RZ7H 1INQB 1X5JA 4PBXA 5FGSA 2RAMA 1C7TA 3GBMH 1DBBH 4ZFOB 4WI9A 3NN8B 3RWCA 2C4FU 2EDEA 3UTSE 3UZVB 4HGMA 4Z7VB 1N64H 1P69B 3T77A 3U4BH 3KPNA 5FA4A 3GSWB 2LQRA 2NCMA 4P4KC 1A1MB 1VPOH 4YDVA 4ONHA 1OPGL 3KPOA 4ZODA 5HDQL 3WUWG 2VXTH 2DD8H 1VGKB 4MAUL 1T7XA 4QRTB 4X0KA 2DM2A 1FNHA 2YEZA 1XAUA 1AR1C 5C0AA 2W0LA 1EAJA 4LBEB 1A1NB 3O4OB 2OS7A 1BFTA 3DIFB 4IEFB 1DDHA 4OQ1A 1A7NH 4N0UA 4IIQC 1MJJA 4FFWD 1GIGL 4P2QA 3U1SH 3IXAA 5IROC 3J8F7 3O2WL 5FUZL 4W4OA 4MCYB 1H3UA 3PP3K 3GMMA 1U8LB 4MA3B 3M1BA 4L5FH 4LRIA 2V5YA 4DN3L 5IVZB 1LEGB 2WQRA 3ES6B 1MWAB 3FOLB 3UTSD 4RAUB 4O02L 4XNQB 4OZIA 2C1PA 3WXWH 1FO0B 2CDEB 4Z7UE 1IEBA 2BJML 1V3KA 1A0QH 2HT2C 3QCVL 4NQXA 2P5EB 1MUJA 4M7JH 3L3OB 3VFRA 5D1XB 2NYYD 3RNKB 2IJ0C 4OM0L 5JORA 1X5IA 5CILH 4YHLL 4X7CC 3B9EA 2B1AH 4PJGB 4ZS7L 5H37H 3ULSA 4WRLA 3MNZB 4LAQH 1R3KA 4KGLA 4U1MA 3HNSH 3TA3C 4ZQKA 1Q0XL 5C0IA 1RZKC 5F88A 3ARBD 5F7YC 3VWJD 4KI5E 3TJHC 1FDLH 2B4CL 3DROB 3QO1B 5HVHC 2ICEA 3U79A 5LGHH 4D0CB 4FXKB 1LNUB 1MAML 2C3VB 3AFLA 1CFSB 4GG8B 4M48H 1OF2A 4TVSa 3KNBB 3FO9A 1ZT4A 1BWMA 2OXHA 2XNAB 4JFOB 3UTTD 1UM5L 2Y5TB 2CO7B 5T1KB 1YDPA 1ZHKA 3PIQA 4PRPA 4UOW0 1JHLL 5EA0H 3MLRH 5EFIA 1OAUH 3QJHA 4NCC2 1IGML 5H94A 1W72A 3WDIA 3KYNA 3TJEH 5AEAA 4M9OA 1EGJA 2DBLL 4GBXC 2CGRH 3JXAA 1LK3L 3BN9D 5EZOH 1ACYL 2N4IA 2QLVB 3LKQA 1KJ2A 1NGZA 1IAIM 5AD0B 5C0JA 3K8LA 1P9MA 2GJJA 2I9TB 2ERJB 5EZJA 4PGEB 3VH8G 3S5LG 1S3KL 2XWJB 3T08A 2GTWB 5T5NG 5CHNB 3E6HA 2OX5A 4P4RB 1S7SB 3V0VB 3WN5B 4ONFL 1QFWL 1G9NH 5HHVL 2G9HA 3BIBX 1OAQH 4HIHB 4FFYH 3NMEA 4GXUN 5LAXB 3FRUB 4KI5D 3SY0B 3PXJA 2FWOA 2R15A 2P8PA 1UM6L 2NXZC 4OGZA 5IHBA 5C6WH 1JPGB 3SJVB 1BVKA 1U3JA 1ZVHA 3B9VA 2DOCA 4OCMC 2BOCA 4X8JA 3QUZB 2HKFH 3TV3H 1W0YT 1QEWA 4IS6B 4LPWA 2X7LB 3UTPE 4KQ3H 5ALBL 4PR5B 5EBLA 4DN4L 2BHZA 3CDCA 3W9DA 3CU7A 5GGTA 3L9RA 1FN4B 3HNVH 1F13A 2YMXL 3CFDA 2XN9B 3QCTL 4R4ND 1T5XB 4Y16D 3LQAL 1DQDH 1DQTA 4F33B 3ILQC 3CX5K 4Z5RB 4Z0XA 5EU7E 3MUZ1 1ZT1B 3IJSA 3G5YA 4MJ4A 2W0PA 2MKWA 4QXWA 3T65A 1R5IB 1J1OH 3MNVA 4OAWA 2FECL 4QGTA 3B9KA 2FD6H 3VXME 4FQQA 3HZMA 1J1XH 5E1AA 4OCXL 1F00I 3SO3C 4Y4KB 5B4MC 1UWEH 5IW1A 4V2CB 2F58L 4JCMA 5I1JH 2DYPB 3L6FA 5D8JH 1B6DA 2YUWA 1ZXQA 4LSPL 4KKAC 2WM0A 5C9JB 2LU7A 2V5SA 5FEBA 4LHQB 1MCIA 2R69L 4DVRH 1KFAL 2NPLX 1HYSC 4YXHH 3ALXA 2FX7L 2Z8VC 1LO5A 1H3PH 5JPMB 5C0CB 3DBXB 4RZCB 3UC0L 4X80L 5CZXD 5DC0A 4JHBA 4JO2H 5FECA 4FQIH 4FXGB 4U1GB 5JPNB 2GT9A 2E8YA 1YNLL 1UCBH 5DI8B 1UA6L 35C8L 3MROB 7FABL 1EBAA 3NIGE 2Z4QB 1T1XB 3WL9A 2ZP0T 1WAAF 5HGHB 5CIPB 5FDWA 4XMPH 3HE7C 3HMXA 2DQIH 3VXSB 2CDFB 1WBYB 2JCCB 1FH5H 1T20A 3MFFA 4LLUA 4H1LH 1I9JH 3ARXA 4GAJH 1P7QB 3MUJA 2D4DA 4UT7H 3N85H 1B0RB 1HCVA 4WV1B 1CXKA 5DLMH 2IGFH 3BD3A 3WKNA 43CAB 1E6OH 5IMMA 3DPBA 4KAQL 4D0DB 4LHUD 4JFDD 3IYLW 3VRIA 4ZXBB 4KZEL 3WFZA 4MDIA 3ARGB 1JNHA 3ARTA 1LP9B 4OCWH 4LDLB 4L4VE 1VA9A 4R8WH 1WZKA 4HIXH 3AS2A 2Z35A 5DD5L 5GS0C 1T03H 4HH8A 4NNYA 4M7ZC 5HVGB 2CH8A 5TGBB 1KIPB 3C2AL 4XVUD 4EBQH 2BXZA 1EJOH 3O6FB 4R9HA 4WJ5A 3BQUC 2EICA 5I1KL 3FN0H 3BUTA 4XPGL 3MMEA 4L8SB 3FL7A 4OFPA 1G7HA 1PYWA 4PJHF 2HYMA 5E5RB 5ID1B 3QXUA 1PEWA 1IC5L 1BEYH 3OPZH 3AROA 1A5FL 4JN1L 2YSSB 1KNOA 4WEBL 2NY2D 1Y18B 3VWJA 1HHJB 3VCLB 4XVTL 1XH3B 15C8L 3H9ZA 5FYLL 2BCKB 2APBA 4LRIC 5DO2D 3UJJH 3BT2H 2VKWA 1C1EH 1MFNA 5MI0B 2R2CA 2AJSL 4L4VD 3RZCD 3UTTA 1BZ9B 5MP6L 1U8PB 3BPLC 5JNYB 4Y5YA 4XGZB 2A2QT 4G42A 5B38A 2WLZA 2C3WA 4LCIH 4ACPA 3OTTA 1J5OL 2CO6B 4W68A 4MD4B 4M8QA 2G60L 2W91A 3BP6B 4XNMA 1RUML 1ZLVH 2QKIB 1U8MA 4NYLA 1AGBB 3OAZH 3U0PB 3SDDC 1BAFH 4W81A 4TUOA 3VGEA 4H20H 3BYYA 2ADFH 2R9HD 1XF2A 1P7KB 1MHPL 5D2NA 1AC0A 3OGCA 1J8KA 5DK2B 2GK2A 3O8XB 3IKCB 3T3PF 1C5CH 2CIIA 1KCLA 3VFPA 1KB9J 2PO6D 4ZTPL 3OMZA 1G7IB 5FUCE 2VLKB 5INCB 4XHJD 3FFCB 2UZIL 4URTB 1YEFL 3QHFL 5KVGL 4HQQL 4X7FC 3ULUC 3JV5A 5I66A 4HGWA 1H8NA 2CDGA 5E4EB 2J4WL 4PTUA 5I16A 4Y16A 3I50H 1UZ8B 3QDGE 5ERWA 1MF2H 4NHCH 3INUH 4J3UA 5T1DL 3ZDXE 3P0YH 3QIBD 1C08A 4GLRH 1P9MC 3EFFA 3MRPA 1MWAH 2LFGA 1AD0A 4JB9L 4OLUH 4DTGL 1ND0B 4N5EC 1I1AD 3CUPA 4H8WH 1S9XB 4I13B 3DO7A 3FQXA 1A6ZB 2BVUA 2JTDA 3MRMB 1FO0H 3E8UL 4NT6A 3QRFM 4WGVB 5FOJA 2XICA 1C16B 2PXYB 3HE6D 5D72L 4TOYH 2DQEH 4WCYL 4Y5XC 3FOMB 1OOAA 3O6LH 4PJIA 5C09B 4KK5D 4JAMB 2K3TA 3Q6GH 3T0EB 4OZHE 1DE4B 5F7DA 4WGWB 4MNQE 1FAIH 4M1GL 1YECL 3BE1L 1QNZL 2ZNWA 3QSKB 1TQCB 3K8MA 4PP1D 2PTVA 3MBXL 4ZUTB 3SE8L 4NQSB 1RJZB 3FAWA 4IRJD 4PV9B 3PWNA 4ODSL 3DVGB 3H42H 4P5TA 4U6XA 1JGVH 3QH3B 5FHBL 3CCHB 3SDXB 4NZUH 2KPNA 3FQWA 4OZFG 4KFZC 5I74B 2GITA 3ULVE 3DETD 2G5RA 2EH7H 5I17B 4WHDA 1OLLA 1I9IL 3BH9B 3LN9A 1VCAA 4APQC 5CSZB 4CJ0A 3CFKB 1LEIB 3HUJF 3QDGD 1P4IH 1WCQA 1GGYA 2G75A 4ERSH 3ESUF 1IAOA 5I8KL 4DKFL 2EKSA 4ODUA 3HC0B 1MLBA 1J8HB 4S0TD 2D7TL 3RP1A 2VQTA 3ET9F 1INDH 5INDA 1LK2B 4ELKA 1A6VL 2CSPA 2YD8A 4KTDL 1PSKH 4MSWA 4ZUSA 3L7FB 5ADOH 5AYQA 1HQ4A 4JHZA 4XP1L 1XF1A 5F1NB 1NKRA 3ARVA 3ZDYE 1T5WA 5K59F 3D85A 4H25B 2YBRA 5ISZA 1MCNA 3NTCH 3BW9B 3BKJL 4FP8L 1I8KA 4NM4L 3P9WB 4MNQD 3BRGC 1OSZA 4PJCB 3MODH 5IBTL 1I8MA 2X1PA 1MCRA 2A6DA 2X6MA 2DIBA 3L1OH 1GGBL 1NPUA 1W72L 1JN6A 4K3EH 4TUKH 2Z8WC 2BOBB 4GKOA 3L3DA 5JIIA 1PX3A 1EGJL 4LHUA 4PJAB 4JFDA 3DX6B 4MWFB 3WFHB 4RGMB 2D7PA 4GW4A 3ULVD 4YDKL 4KJWD 2J6EH 2R23B 1R5WA 1OAKL 3LDBC 3LRGA 2VQ1B 2NXYB 1HOCB 4OZ4B 1NBZB 2VUOA 3BP5A 4WWID 5HYQA 3SE9H 1QR4A 4F8TA 5FYJH 1NANI 1AY1H 2AAVA 5AZ2H 3BD4A 1H3TA 1OARL 1YMMA 1D6EB 2DLGA 2O61B 5DXWA 4GO6B 4NRZB 1KLGB 4P0DA 5D5ME 1BLNB 3C5ZA 3PDOB 1JZ6A 3GMOA 1JP5A 1URLA 2VZOA 1XGPB 5BXFB 2EYTB 5K9KB 5JIKA 3GBLA 1L6ZA 2FIKB 4LSSL 5T3XL 4X6DB 1A7PH 4EXKA 5LGJB 1MHHB 1U0QA 1PG7W 3W9EB 1HHGA 2R4RL 3AXLA 3B2VL 4FFWC 1ZHBB 1BQHB 2YK1H 4HJ0D 1MIML 5ICZA 1A9BA 4ODTL 5T33H 3P4MA 4PJFA 2GAZA 4Z7VE 1KUMA 3QIUD 3HZKB 4BELD 4F7PB 4XAWH 5C0FA 2XXCB 1V5JA 1WFTA 4LVOC 3W81A 4U7SA 4E41B 5FF6A 4G8EB 3I6LE 4WW2B 4QLRA 2FJHA 1WZMA 5EUOF 1CLYL 2OL3A 1GAFL 3RZCA 4YX2H 3PWJA 4JCLA 2QHRL 3I9GL 1DUYB 2WBJD 4YNYB 5DYOB 2FJFB 1XF3B 2PCPA 5FKAB 2W9DL 1T80A 3STLB 1SM3H 2XPGB 1IAIL 4OCSL 3UPAA 4HXBH 1JYXA 1A4JA 4H0HB 5AG8A 3CFCL 1R24A 4NQEB 1SYVB 3HG1B 1A4KB 1WITA 5D7JD 4MXVF 3MXVL 1NBYB 5CIPH 1BBJB 1FCGA 5EU5B 3ARBC 3VWJC 1T6VN 3WFCH 2LVCA 1HDMA 2BVQA 3BIKB 4P23B 4P99A 3DX8B 4HUMB 4K7PH 1YMHA 4LFHG 5JIPA 3G6DL 5FDYA 3QUYC 1K2DA 2Z8RA 4GT7A 3ARED 3CNKA 1EIBA 2EIDA 1HXMA 4YPGB 4KV5F 2XZAL 1JTTA 4DAGL 2PO6A 3QQ9D 4AM0A 3I6LD 4KVNL 4R0LB 2P5EE 4IMKC 2QQLL 43C9B 3DRQA 3IU4H 4JO4H 1AE6H 4Q2ZB 1RHHB 4R26L 5B8CB 5ADPH 1T1YB 3MBEB 4NN6B 4PG9B 4FA8A 3IAPA 5ALCL 4XPTL 4N9GA 1KENL 4NSKB 1T2QL 3SPVA 3FONB 4LLMA 2XA8H 2ICES 5F3HA 4C55A 5JHDE 3QIBA 5I1AB 3FO2B 1T2JA 3GMPB 3CC5A 4TULL 4EOWL 3G08B 3GK8L 3C6LD 1C8PA 2CQVA 1BJMA 1NAKH 4YWGL 1DN2A 4KI5C 1PW3A 2IPTL 3DUHA 1DUZA 3LIZL 5E08H 3CPLA 1RU9H 1S7QB 1NDGB 4AIOA 2ITDB 1ZLWH 2ENSA 3DVNB 1FVEA 3GSNA 4PGBA 5CJ8A 1LO3H 1N26A 4LCWB 2W92A 1CE6A 1FJ1B 3IFLL 4CADB 3RPIA 3CFBA 4IRJA 1Z3GL 4Y16C 2OR7A 3IDIA 4JQIH 2P5ED 3NABL 2I9LB 5CLWA 2DLIA 1BVLB 1Q0YL 1XF4A 4FABL 3MJGX 4L9DA 1MHCB 3BO8A 1OQOA 3U46A 4P3CH 4OF3A 2VDNL 5GRYA 5GRVK 2Z93B 4L3CA 3GO1H 4OLXH 1S78D 3HC3H 3KHQA 1A6AB 5DJDA 1OP5K 1FC2D 5KANI 5JHDD 3GMQB 4JFXB 4K7PX 5L8LB 4JG0H 4X6BA 5DUBB 3VGDA 4X6FB 2QTEA 4IOFC 4NQVA 2IPKA 3ZSSA 4LSQH 4Y7MA 2GW5A 5IK3A 3MJ6A 1KGCE 1I7RA 4PLKD 5KJRL 5KSBF 4U1IB 3FMGH 2YC1A 5E9DE 3KPRB 5L8JB 3HMWH 5EBWA 4C83B 4MS8D 4OZHA 5TDNB 4OIIH 2DLFH 4YH6A 5TDPA 5FGBA 5FYJE 1RQ5A 2XN9E 1EUUA 3VFGH 3LSOB 4R7NA 5DJXA 2B5IB 3VFVB 3UBXI 4HKBA 3D18A 4GSDH 1S7UA 3S88L 1F8TL 5MEPB 3HR6A 2V2TA 1KJVA 1TZIB 4KMTL 5KVFL 4RAVB 3BGFB 4O58L 2GJ6A 2X4UA 4N0CD 1KACB 4HZAA 5EU7C 5HHOE 1NFDB 2OZ4H 4P5KA 5SX5H 2FEEL 3JSSA 2P24A 2E7BA 4Y19A 4NGHH 5JXEA 3VGBA 5DJAB 3CH8A 3H9SE 4JDTL 4CKVX 3DSFL 3QNXA 4MNHA 1A7RL 1BX2A 4PRDB 3HR5A 1M4KA 4XI5D 3MA7A 1AI1H 3QEUA 5C6TL 1KN2H 4QF1B 4Z0BH 5I19L 4JJHA 2YPKB 3HI5L 3SE3A 4I48B 3KPLB 1EO8H 4LSDA 2YN3A 3BEWB 4FZEH 3QUZD 1K6QL 1KGCD 4YZFE 3RUGB 1W8NA 1MPAL 5JO5A 2ZZUT 3WLWD 4JM2D 4OKVB 3BWAA 3CSYB 5E9DD 3N1GC 5CEYA 3QULA 3RY5A 4GS7C 4L1DA 5FYJD 4A6YB 2XN9D 4MQ7B 3BXNA 3ZZ1A 4Y4FB 4POYA 3VXUE 3IDUA 2JJTA 3STZB 3H3PH 3SGKC 4G7YH 3SKOA 1OT2A 1RURH 2J8OA 4BSVB 4OI8A 1N6VA 5J8OA 4JFYA 5GGQH 3U7AA 1GGTA 3QIUA 1MQ8A 3MRIB 3D2UD 4QXTB 2Z91A 2QQNH 2P8MA 4UBDC 4DZBB 4HV8B 3FAXA 5KS9B 5HHOD 1EAPA 2DM7A 3ETBF 5DZNA 2VR5A 4WFFE 5GRUH 4U1HA 2JCCE 3HUJB 3JWNC 4XVUC 3P9LB 2MQ0A 4IM8A 4OD1H 3HZVA 3H9SD 2A9NL 5ILTH 3JWDH 2AGJH 1JGDA 1EBPA 3FT4A 4ZNEA 3VFSA 3QG6B 4KQ4L 2AJZA 4CU8A 3RFZC 1J9CT 3PGDA 5DD3H 3RWEB 4JM4H 4P2RE 5EN2B 5KZCD 1N7MH 4XCYB 1G1YA 5F9AC 5IHUH 3MRDA 5B38G 2UVFA 4MVBD 5D7JA 1DEEB 2PUQT 1RJYA 3TWCL 3ROOA 2WUBH 1ZSDA 4JZNB 1V7MH 3HFML 2IANB 2NY2C 4JQXC 5TF1L 3S35L 5E2WL 4CW1B 1D5ZB 5C08A 4EI6A 4E0RB 2C3XA 3GHEL 3IDJB 3MCKA 5IQ7L 3GMRA 2AXHA 5EIIA 4BH7B 5D7IF 3VXUD 3C08L 4ZAKC 3MGOB 4O2CB 1WTGT 3M17B 2A0LD 1AP2B 3U83A 3RZCC 2KZWA 3MLXH 1TCRB 2BVOB 3U30B 3OAUL 3O4LB 5EPMA 4U1KB 5IB1B 5IESL 4NQDB 4Y5VA 4YXLL 2CRIA 1U36A 3SCMD 1YEGL 1S5IL 5DD0L 1IGIH 1R5VB 1U91A 3QAZC 5FM8A 3T4AB 1NEZG 5F7WC 1P7QD 2VXVH 1MH5A 1QQDB 2DQGH 5H2BA 1Q8MA 2DKSA 1A3LL 4GKZB 5B3JE 3WNMA 1AQDA 4LCCA 3RPKA 2APXA 1GC1L 1F3JB 4P2RD 1ZANL 3MACH 2R9HC 4P57B 5F8QC 2NY4B 1U8NA 3MCLH 5D1ZD 4UT6L 1I3RB 5KSUA 1JPFA 3T1FB 4G6JH 3C6LA 4HAFA 4EIGB 1RVFL 4X4YA 5F9DC 4PRHE 1QPXA 1UC6A 5DRNB 2VDMH 4J3WA 3MLTB 4TSCH 3AGVA 3M45A 3MRJB 5J12C 1IM3A 3CX2A 4F7EB 4MGXA 4P2OD 5DMKB 5D7SL 2EDTA 2LTQB 3B6SA 2V7NB 3PWUA 4KZDH 3IU3B 3P4OA 1G9NC 4PRNA 4XRCB 4WNQA 3G5ZB 3MGAA 3L3KB 3IJYA 1F45A 4XMKH 4ETQB 4NRXA 1F02I 3O6FD 3AAZA 2R4SH 2ICWA 2IG2L 1KEGL 1M71B 4OLZL 3ZLQC 2EEAA 5ICXA 2WP3T 2J8UB 3L3HB 1I1AC 5D70H 1CGVA 1RIUH 5E2UH 3TYGL 3VGAC 3SDCA 2EE2A 3IFOA 1CF8L 1JJUA 3HE6C 3QG7L 3BPNC 3F12A 2BC4A 3I75A 5A2IH 3LKOA 4BH8A 1QHPA 4RQQB 4W70A 4KK5C 3W5MA 1RULH 5F8RC 1X3DA 1T0NB 4CRPA 1RIVL 4V1DE 5IQ9A 1X5GA 5AZEL 4PRHD 2CKBL 4FTVA 2OQJB 3VJ6B 1T66C 3HLAB 4PP1C 2ZWLT 2PW2B 5BO1L 1UJTA 3OB0K 4Y1AB 5DQDL 2OL3L 4TRPL 4JPVH 1YEJL 5EU6B 3RY4A 5FUCC 1MEXH 2DQCH 2EC8A 4FQ2H 3RQ3A 3MRGA 5FO7B 2NY0D 4EVNB 5EDXA 3LRSA 4HLZH 3TIDB 1QBLL 3DETC 1BD2B 3S36L 4JY4A 1IC1A 5E95B 3MREA 1BF2A 5K93A 1RZ8A 3V7AG 2V9RA 5HHMB 4BZ1H 1GHFH 3NCYS 1MOEA 1BFVH 3QIWD 1FBIL 1EEZB 3UTQB 1ZTXH 4KH2A 3QUKB 1U8QA 1UXWA 2N1KA 4LIQE 4RDQF 4ZPVA 3C8KA 1YPZB 3WS3A 1OCWH 4LRNH 2X89D 4KDVA 1GL4B 4KJYA 4TNVF 1JWUB 3MOBL 4PJXB 1P84K 2MHAA 1FZMA 2ZG3A 1UM4L 3F8UB 3RVWD 2WWKO 4XPFL 3T0EE 3RRQA 2ZSVA 3BI9X 3PE9A 4X7DC 3KLHC 1AXTH 2AJ3A 2EDOA 3DARA 5MERA 1OTUD 2V9QA 1YN7A 4QRRB 5E2JA 4LF3B 4V1DD 4C4KT 5F89B 3HRZA 1TVDA 5HYIA 2EZ0D 5IBUG 1C5DB 3S4SG 1Q9OA 1A02N 2JK5A 5C70A 5E9DA 4XWGH 5CGTA 3WNPA 1NEUA 4FNLL 1W0WB 3C5JA 5CMAB 1FNAA 3WIFB 3P77A 1GPOL 4J1UA 3DMMB 1YEDB 3QHZL 4XZUA 2OM5A 3MJ9H 5F1OB 1YYMH 4GMSH 4G9DB 3QFJB 3SDAD 1WLHA 3V6OA 3ULVC 1F4AA 3W2DH 4YDJB 5BRZB 4PGDA 1FP5A 2QEJA 4KXZH 4TTDD 4XMLL 4BYHA 5I0ZA 4OQTL 4UOW1 3MOAH 3LD8B 1YEEH 3FQTB 5F93C 1PG7H 4OCRL 2ITCA 5HHOA 2A74B 3MGTA 5E99L 5BVPH 1QACA 4LSUH 1I75A 4NNXA 3VG9C 3EKCA 4YC2B 4J8RA 1ETZA 4UINL 3X3FH 4LPXA 3SE3C 3FHQA 1DVFA 3MYJA 4UT9L 3H9SA 3T0ED 1IT9L 3BHBB 3P4NB 3VI4E 4PJCE 4YDIH 4YHML 5DUPH 2OTPA 4BFIA 3D0LB 5IG7B 2DWDA 4LNRB 4F58L 3NA9L 4BK4A 1KPRB 4O2FA 3RL1A 1DEDA 1G9MH 1LO0L 4GMTL 3CD4A 4HJ0C 5JW5A 1ED3A 4PJAE 2P47B 2AXFA 4TN9A 5GXBB 3U82B 2JJTC 3LCYA 4JKMA 4I18B 5HPOA 2I07B 2HKHH 4M02A 3S37H 2JB5L 3REWA 3EJJX 5EO9B 4Z7WA 4UV4H 1PY9A 3DX9B 1OT1A 4FQXD 3A6BL 4M5ZH 1DBMH 2DMBA 4YE4H 2YD7A 3QWOA 5CINL 1QSEB 4S1SL 2D7OA 2QSTA 4M1DH 1FZOB 4AT6A 4UV7H 3QEQB 2EDYA 3P11L 4MJIB 2NW3B 4YO0A 4AEHH 2WBJC 5HHNA 4TNVK 1AKJA 4KPHL 5A16B 3EO9H 1YNTA 3VFOA 2XWBA 1KTDB 5I1GH 3SCMA 4HWBH 4PJ7A 3UEZA 2A77L 4KDWA 4WHTB 2FATH 3GIVA 4X6DE 4Z95L 2F15A 4I0KA 5FM5M 1UJ3B 3CGTA 1BMGA 3IS1X 3VWKB 2MWCA 3WD5H 4XP6L 3VGHA 1FVCB 3JWOH 4HC1H 3IVKA 1PD6A 4P2RA 5BS0A 4HPYH 3JV6A 2A9ML 5D1ZA 1JWMB 2E9IA 4X6CB 1HSBB 5HJ3A 4UIKH 1DLFH 1YN6A 1Z0MA 3CVIH 5IVXF 5DD1L 3AREC 1CXHA 3HC4H 4E41E 1JFQH 1FFPA 2W65A 4HT1H 2VDPH 1PG7X 4G43A 2EDDA 5D2LF 3G6JA 1CDCA 4PJDF 2X4NA 1SY6A 3QQ9C 1FG9C 1RZKL 1P4BH 3V0WL 4Q9RH 1LE5A 4A6YH 4P3DB 2DL9A 1MI5E 2OMBA 3QO0A 3KPQB 2VLJA 3U4EB 3DI3B 5E6IB 25C8H 3W0WD 4F57H 4D8PB 4HJGB 3LKSB 3SQOH 3QDJB 1ZLUH 4IOIB 4LL9A 4AIZB 4NC0B 3TVMA 3VMOA 2ICCA 4L1HA 1N2RB 3DX7B 4QHNA 2WUCH 1BFOA 1Z5LB 2GUOA 2HJLA 3PWPD 3CSBA 3P30H 3CK0H 3GSQA 4JG1L 4M7LH 2Q8AL 5EC2B 5CS7A 1O7VA 5FYKU 2DN7A 3WNNA 1KIQB 5IHZB 3EDFA 5TFSL 4KHXL 3S37X 2H6PA 1FGVH 4N8PA 2XQBH 1CBVH 2WANA 1I7TB 1EO7A 1RZIA 4NO0B 1JZ2A 1T89C 4Y2DD 5F3BB 2OBGA 1F42A 5F7EH 1D9KD 1E4XL 3BZ4B 5DTFA 4WI8A 1JGEA 1QRNA 4PRHA 3EYOB 1FL3B 3BP7B 5D6DC 4E41D 4PG2A 4H8WC 3OKDB 1INEL 4P9MH 5IFJA 4HHAB 3GZKA 1OW0A 1JNJA 1X7QB 1T7ZA 2Q3ZA 5JMRA 5D1XC 4R3SA 4GRWF 1MI5D 1UACH 2AXGB 5FHAH 5KN5A 5DHVA 5GGRY 4PUBL 3S5LB 3BRFA 3QIWA 3OXRA 3TH4T 3FO1A 1S78C 1B0WA 3IJHA 1IGCH 4ETYA 1TLKA 1HSAA 1QFWI 1AFVH 3KS0J 1QFOA 2BNUA 3U0TB 2FX9H 2NNAB 5ACZA 4OLVH 2ZOLB 4OLWL 5C0EA 5ESVA 1BREA 5AWNH 2D31B 3NCCB 3KPPB 3TBYA 2X4SA 3MRLB 4HX1A 5GGSA 1XZ0A 5EZLB 2AEQH 2VABA 5IBLD 4XPBH 1YJDL 2HLAA 4S11A 3R0NA 4PLKC 2XZQH 2HJKA 2YD2A 2OK0L 4PJBB 3ARFD 4LARH 1ADQH 5LGKA 2ARWA 3IS0X 4JPKL 1DJSA 1CFVL 4JFED 4LCWE 2UZXB 1BOYA 4MS8C 3KPSE 5HGGS 4QRPB 1FG2A 2XFXA 3C8DA 4V1DA 4EN3A 2UY6A 2JJWA 1FYTA 4FHBD 5ENWA 1DBKH 3GB7A 4QY8B 3LQZB 3PNWA 2R56H 4LKCB 3QDHA 4JKKA 1RK0B 2HN7A 5KSAB 3GUTA 1WEJH 3K1KC 3EO0A 5F96H 1BOGA 4BKLB 3WE6B 5DR5L 1BBDL 3B8SA 2CK2A 1HH9A 1ROWA 4I0PB 3TCLB 3O81A 2FX8H 3K4AA 1A9EA 2FECI 2X70A 4IHOB 3RNQB 3SDAA 4N0CC 3TBVA 4O00A 1KTLB 1M7DB 2JJSA 3WXVL 1MVUA 2HFTA 4PS4H 1MCBA 2YXMA 3TH3T 1S9WA 5E2VL 2AQ2A 1F3DH 3Q3GA 2PTTA 1J7VR 4ALAH 4R96A 4MB4A 1P6AB 4JRWA 1OD7A 5KG9B 2QHLA 3GI8L 4X6EB 1HEZB 1NCCL 3NZHH 3L7EA 4CVUA 2VXSL 4HIIA 4M7KL 2BVTA 4Z7OE 2O5ZL 3BKCH 1DQLL 5DJ6B 2DF3A 4E9LA 1KCUH 1OD9A 5SWZB 1FPTL 1KB5A 4YHPA 3KPRE 2C26A 1NCDH 5HYJB 3D9AH 2EXWD 3QUZC 1PQZB 4MB5A 1A6WH 3WLWC 3AY4C 4JM2C 4LCWD 1A8JH 2GIYA 3KPSD 3HCVB 4B53A 3MRCA 1PLGH 4LSRL 1FVDA 5H35A 3G5VA 3RDTA 5IR1A 1QSFB 5TQ0L 1G7PB 4AEEA 5DA0B 4Z76A 4GG6F 1UVQA 3RZWA 2F53B 3FT3B 4FQXA 4XXDA 2H1PH 3UPRA 2AABH 3ZKSD 2BY3A 2HG5A 4HWNA 4B7LA 1QBML 1WWWX 3V5HA 4WFHD 2OSLA 1T04A 5D9SB 3OKMB 1YUHA 2GSIA 3FB7A 3PV6A 1QFUH 4OF7A 4NN7C 5I1HH 4JQVA 2AI0L 2NZIA 3EO1A 4MMXC 3REVB 3C87A 2BSRB 2F5BL 2Y36L 2PR4L 4OM1H 3V5KB 2VLLA 4LGPB 2V2WA 3IXTB 4UUJB 2IEPA 2DDQH 3RUGE 3LN4A 3B3IB 1I7UA 2AEWA 4JY6B 1SJEB 4JFZH 1P4LA 3MR9B 3I3BA 1VFAB 2E9BA 4YUEL 4MVBC 1VFBA 1OGAB 4LNVA 1I9RL 3IFNH 4XCNB 3EYFB 2M26A 3EDJA 3O3AB 1BP3B 4AMKL 4U0QB 4U1GC 2AV1A 1Q94A 2DIAA 2DJSA 5D6CB 3FFDA 5TQ2H 5J11B 5FYKL 3VFUB 3OB8A 4QHLB 2A0LC 3BP4B 1B9ZA 2AKRA 4WTZA 1HIMH 3UP1A 2XI9A 4ZG1A 1JNLL 4U2YA 3D5OF 2FZ3B 3SCMC 3R06A 1DSFL 1WJ3A 2NY7L 4WY7L 4G80B 4E42A 4FQCH 5C1MB 4F15C 1J0KA 3L3JA 2JJUA 1MQKL 4NQUA 1NCBL 3PWLA 4Q0XL 4KHTL 3W0WA 1IMHC 1KULA 5KSVA 5IGXH 4ZOBA 4NUJA 1X4YA 3PGCB 4WV1C 1PBYA 3PWPA 1MHEA 3PF2A 1G84A 4FQ1H 4GW5B 2WIIA 2EH8H 4N0FB 2LVEA 1P5UA 2E7LC 3WFDH 3KDMB 3F65A 1DANT 1HWHB 2CIKB 4HFUL 4WWKD 4HS3A 2IAMA 4ZXBC 2Z92B 3VRJA 4YJZL 5CAYB 2C4XA 3KR3L 5J0BA 3ARGC 3MZTA 1G1CA 1MJ7H 2H9GA 1NDMA 4G9FE 2YR3A 3WYRA 4X4XA 1ORSB 4M4RA 1D9KA 1A7OH 4HGKC 2IFGA 3O4LE 3RWIA 4P2OC 1FV1A 4NQDE 4O2EB 4Z7QF 2VAAA 1OLZA 4QO1A 4Z8FL 2HWZH 1QLEL 2G5BA 4ZUWB 2UWEF 3JTSB 3DOSA 4X9GA 3BRDA 4NFBA 1HKLH 3LHPH 3O6FC 4QHMA 3UYPA 2IQ9H 1YY9D 3MZGB 5HVFB 1MI5A 4ELME 4QT5B 3BPCB 2R2HB 4S1DC 4F8QA 4PYGA 4Q7DA 1IC4L 4M3JA 1K4CB 5IMKB 3EHBD 3V79C 3IDXL 5T1LD 4ZFGL 5HI3D 5IOPB 5GS1A 4HKJA 2Q76A 2VXUL 4ODHL 5KVDH 1ZVYA 4JRYB 1F6LL 4NWUL 1I3UA 2FR4B 3LN5A 3WNOA 5HGDB 1S7WA 3OX8B 2EE6A 5JA8B 2MOVA 2XWTA 3SO3B 1H15A 2W9EH 1FNEA 3ARFA 1ZA3A 5MI0C 4G9FD 4JFEA 4GKNB 3N9GL 3NIFE 2PW1A 5DMJB 1U41A 1MREL 3R0MA 3O4LD 1CICB 3AB0C 5DMIH 4KK9D 2ESVB 4FQJH 1RZJL 4NQDD 1NLBH 2NY0C 3BSZH 1AC6A 2J2ZA 4GQ9H 4XNZC 5D2LB 3BX7C 5KAQF 2YPVH 3DXAB 1DFBL 4RFOH 2DB8A 5I1IL 3P9MA 3PQYA 3QQ3A 5DJZA 5A3IC 4MYWB 3QIWC 2B0SL 3MV8B 3NAAH 3BZFA 1QYGL 4LU5L 1VGEL 2BSSB 2L7UA 1JTOA 2ZCHH 5DRWA 5IT2L 2GTZA 3F62A 1IL1B 1JVKA 3FB8B 3VXQA 3GRWL 1AGCA 1EHNA 1TZHA 1B0GB 4N8VB 2DQTL 4Z77B 3UYRL 4NBYB 1A3RH 3RVWC 2HFGL 5AAMA 3AU1B 4HH9A 1ZT7A 4IMLB 5EOQL 1A6PA 2MNUA 3ZT5A 4HDIB 1FE8H 2VLRB 3TPUA 1OTUC 4WI4A 4XBPA 5EH1A 1FFOB 4LGRB 4XPAL 2CLVB 2J7LA 1JYVA 4HKZA 5E8OB 4ESKA 4U3XA 5EU6E 1KLUA 4OZFB 5J1SC 1MIEL 1KBGL 1FORL 4ZD3H 5IB3A 3DUSB 2V17L 3BD5A 3KPSA 2Y6SD 3WJLA 3VMNA 2BZDA 3BVNA 3JTTB 4JO1H 5E4EC 5EOTB 5AYUH 5HHME 3KLSA 5HTSA 3SDAC 3VFMA 1OPGH 4YR6A 2X5PA 3BGMA 2JJSC 5HDQH 1KPVA 3AC0A 2VDRL 4TTDC 5GISH 3DGGA 1YPZE 3UDWA 4R4FL 2P4AB 3IAQA 2D3VA 3RWCB 1FIGL 1GOFA 4CVZB 4NUGL 3T3ME 4LLWA 5EOCJ 5FO9A 3KPNB 1M6OA 5FA4B 5EZIL 2OYPA 2XTJE 4MAYA 3RGVD 4R7DB 2FYYB 4Z7UF 1GGIH 3DYMA 4M6NL 4YDVB 1VEMA 4ONHB 5T3ZE 3KPOB 4A2MA 5I8EA 3T0EC 2BFVH 2XKNA 4MB3A 4QRRE 1E27A 2NX5E 4NN5B 2E6PA 5EO0A 4IBLT 4X0KB 2FEDD 5FUZH 4F2MA 3MRKA 4WHYG 2WAHA 2YEZB 2ZOKA 1L7IL 2BMKA 4KTEL 3D3VA 2MPAL 3PWVA 4OLYL 2MCG1 5C0AB 2ILLA 5EU6D 1WV7T 1EK3A 5IB2A 3PHSA 3IF1A 3QFJE 5I74C 4KI5F 4HBCH 4N0UB 1MJJB 3WHE1 3OKEA 2BJMH 3JWDC 4P2QB 1D5IH 2FHCA 3GIZL 5T5FH 1R3IL 1NC4A 4OM0H 2DTSA 5ETUA 5IV2A 5D71L 3QBTB 3GMMB 3M1BB 2MJWA 1CL7L 1QP1A 4U49A 1MAJA 1FFNB 1YEKH 3D25A 4ZUVA 3GKWL 5J1AA 4HC1A 4UNTA 4OZIB 2AJYL 4UAOB 5GJTL 1IEBB 3KPMA 2XTJD 2VKXA 2KDGA 4NQXB 3T2QA 2C1OB 1MUJB 4YAQA 4NO3A 3VFRB 5T3ZD 3O0RL 3BGAA 5DFWH 3MLUL 4OT1H 4MA7L 1G7QA 2WWMC 2KUTA 5BMFH 2F8XC 5JORB 3MLYH 1MAMH 1UB6A 2NX5D 1KYOK 1F4XL 2XOTA 2R2BA 1J11A 3ULSB 5J06A 2IH3A 1W8OA 4G8IA 5C0BA 1G6RA 1R3KB 1UM5H 1Q72H 3O3EA 5IIEA 1HZHL 2AK4A 3QFDA 4U1MB 4NRYA 4NKQB 1CGTA 4ZQKB 1N59A 5C0IB 4WWKA 5F88B 4RGMC 1QSEE 5DFVD 1KCRL 1QZ1A 4NFCA 1WBZA 1D5XB 4IDLA 1EUTA 3KLDA 2ADGA 1AJ7L 4OZGA 4MJIE 1OF2B 5CBEA 3QJFB 3FO9B 1ZT4B 2R2EB 5DSCA 4GG6B 1SBSH 2PETA 4EIZC 1BM3H 5J3HD 4TVPH 3NFPA 1IAII 1YDPB 1ZHKB 3PIQB 4NZJA 3B4NA 4DKDC 3KYKH 3OHXA 4Q74A 2E6QA 4U0RC 3MJ7A 1IKNA 5EFIB 4YK4B 3OKNA 1KF9B 1XGTB 5H94B 1W72B 2EE9A 3KYNB 1CGSL 1QFWH 3H7BB 5HHVH 1FL6A 4FN0A 5E8DL 4UQ3A 2GSGA 1MJUL 1UM6H 5HVWA 2E8ZA 1KJ2B 5I15L 3L5XL 5SV3A 1NGZB 4Z6AT 1QRKA 5C0JB 1JZ5A 2DAVA 5ALBH 5T1LA 4DN4H 4RMQA 3K0WA 1H3GA 3C09B 4J3SA 3FQNA 4OGYL 2A1WL 1NJ9A 4UDTA 1KPUA 4Y2DC 5GZND 3H3BC 2YMXH 3E6HB 3MV7E 3NH7L 2G9HB 3LQAH 1X9QA 3O2DA 2P8PB 4Y5XB 5DEFA 1QSED 3OAYH 3CMGA 1QKZH 2ZCLL 3B2UD 2OCFD 4WW2C 1OSPL 2DJUA 3HAEA 4H5SA 5CBAA 2BOCB 4X8JB 4G9FA 3LMJL 4OF5A 1QEWB 3UJTL 4MJID 2GQHA 1EHXA 5TE4L 1EHLL 3ISWA 5JLZA 1J12A 4LLQA 1MLCA 2CRMA 3CFDB 2BRRL 1SMOA 3OJVC 4OCXH 1ZEAL 1C7SA 4HF5L 5D93C 2F58H 1T83A 4D9QE 3RWDA 1EPFA 4QOKE 4F37F 3NIGF 4Z0XB 3IJSB 1N5YH 4LSPH 3G5YB 2P48B 2DQHL 4APQB 5GS1C 1AO7A 4PY7A 3MNVB 1TJIL 2QSQA 3B9KB 2KQNA 2FX7H 1X5KA 3IGAA 4P23C 2VISA 2YS4A 3HZMB 1JK8A 5E1AB 3UC0H 5IBLC 1I85A 4TSAL 3SDYH 4YEEA 3QUML 5IFAL 1CDBA 5IW1B 3F6LA 3TBTB 3ARFC 1P53A 3L6FB 3MV7D 5EO1A 4CN4A 1KT2A 3QUXD 3RL2A 1YNLH 1XEDA 4WIQA 35C8H 3IFPA 5DJYA 3F7RA 2ARJA 4R0LC 4TSBL 3MTRA 4K8RH 4LCUA 4X9IA 3DURA 4QGYA 3CVHA 1LO5B 3U0WL 2Z31D 3FN3A 5IF0A 1KJMB 5B8CC 2GFBA 2XZCH 5E6ID 4CBPA 3S9DB 1EEYA 2MFNA 5CUSH 4NN6C 5FECB 2D03H 4LMQE 4GJTB 2GT9B 3G9VA 4YIQB 4J2XA 2LU4A 3CZJA 4JZOB 2NZ9D 5EIVA 4D9QD 1K85A 3G04A 1XCTB 3DECA 4QOKD 2OJEA 4PJEE 1CGXA 3WL9B 4JVUA 2AJVL 3DV6B 5I6XB 2FHFA 5FDWB 2X4TA 4FQLL 1NL0L 2AJXL 3RGVA 2F74A 5F7NC 1BGXH 3GSXA 1UZ6E 3WJJA 4RGOH 5TE7L 3NN8A 3QCUL 1OTTD 3BWUC 4P46D 4PJ9D 2EXWC 4LLUB 1JYWA 3BDXA 3HTLX 1GRWA 1TCMA 1FGNL 3WJLC 3VGFA 1RZ7L 5DQ9A 3EJYD 4OD3L 4NO2A 1EZVY 3GBML 1DBBL 1F97A 4DUWA 1IC7H 4OB5H 4U1SA 5IMMB 1HHIA 5I1DB 3VRIB 4CN1A 1FL5A 2FEEI 3WNKA 3HHRB 4MDIB 4DQOH 1JNHB 2X1QA 5I1KH 1NMAH 1IAMA 4F37K 3D39E 3DIFA 1VPOL 1G9MC 4BK5A 3WFBL 2Z35B 3O3BA 1OB1A 4XC3L 4LVOB 2W0FA 3V2AR 4GXVH 4NNYB 1FZJA 1ZAGA 2GY7B 5SWZE 1U3ZA 4F7MA 4LVHB 3EAKA 4WTZG 1IFHL 4MA3A 1E6JL 1T2XA 4U1NA 4YGVB 1MCOH 4XVTH 5IVZA 5I1LB 4WJ5B 1AH1A 5EORH 5DZOA 3D6GA 2YD4A 4UDUA 5SWQA 4OF6A 3A6CL 3EYSH 2CDEA 5ELIA 1G7HB 1PYWB 4HZLB 4DFHA 2AJSH 3L5WA 4KROD 2NR6D 5E8PA 1P2CA 4U33A 3KWWA 1GSMA 5IMOA 1KNOB 1WWBX 1N4XH 3VWJB 5I8OH 3KJ6L 5C7XL 4PJGA 1J5OH 2VZ3A 2G60H 4K23L 4OBSA 3V8CA 2BHUA 4OZFH 1RUMH 3JWOC 3I3DA 1TVHA 2X41A 2JELL 3GJFA 3D39D 3UTTB 4YDLB 1F58L 2ENYA 4UU9A 4FXKA 4Y5YB 2MMXA 1JUFA 2C3VA 1MHPH 5B38B 3SE4C 4M8QB 2DTMH 4I2XE 1UYWH 3ZDXF 4QTHA 4LAQL 4XNMB 4O9HH 1UENA 1BQSA 1U8MB 4GRLD 4JGMA 4NYLB 4XBEH 4CGTA 4ZTPH 2MQ3A 1FDLL 3WO3B 4U1LA 4I3RH 1F4YH 1KXQE 4HWZA 4Y4FC 5LGHL 2UZIH 3QHFH 3VRLE 1Y6KR 4ISVB 3OGCB 3MA9H 4WU7A 3TT3H 3BEVA 3S98A 5GGVL 4OF8A 3VXTA 2CIIB 3NIDE 1D5BA 1IGFL 3VFPB 5FK9A 4UQ2A 3QXDA 2XWJA 5EA0L 3WUWA 2X09A 1OAUL 1QVOB 1KELH 2P43B 5B39A 2BVPA 4JB9H 2IWGA 4TNWF 1VSCA 1PY4A 3ZHLA 4XXCC 4JKPL 3PL6D 5I66B 4HGWB 3SJVA 1YY9C 1ZGLA 1WC7A 5LWYH 1VFMA 4LP5A 4IJ3B 4PTUB 4WCYH 1JMXA 5I16B 3HNTH 4Y16B 2VC2H 4IS6A 2J1KA 5ERWB 3O9WD 5CJOH 1RUPH 1RFDL 3EHBC 1C08B 4M1GH 5HI3C 3EFFB 3MRPB 1SJVA 5I76A 3MBXH 1AD0B 3CUPB 3OSKA 3DO7B 3FQXB 1PKQA 3I6KA 4NT6B 5F71A 3V6FB 5FHBH 1SVCP 3MXWH 4XAKE 1IBGL 3TT1H 4C56A 3RTQD 1U42A 1R5IA 3TV3L 3ZDYF 4HK0A 4X83A 4F3FB 1I9IH 3MV7A 2ZSWA 5F7DB 4I3SH 3STBA 2VLME 5K9OA 1DLHA 2Z9TA 4FQHA 2MTPA 2R29H 4KK9C 4LPTA 5GS2H 3ROLA 4WI2A 1DQDL 1J18A 4XCEA 2DYPA 4P5TB 4U6XB 5H37G 2Z31A 4MCZA 1A6VH 1A7QH 4KTDH 2KL6A 1JHKH 2HJFA 3BH8A 3FQWB 4J4PC 5JOFB 2GITB 4G8GE 4UIMB 1NC2D 4ENED 2CJUH 5C0NC 4XP5H 3TCXA 3ZTNH 4AQ1B 2FD6L 1T22A 5C0CA 4QOKA 2G75B 3BKJH 1IAOB 4TPRH 4HIEB 4FP8H 4NM4H 2EKSB 4ODUB 1UWEL 1MLBB 1I85C 5IBTH 5JPNA 2XY2A 5INDB 4ELKB 4HUWA 2FRGP 4MSWB 3CFJA 4D9LH 4ZUSB 1RV6X 1CVRA 3MROA 1W72H 1NCUA 2DMKA 1U2HA 2VRAA 3LH2H 1HQ4B 3ULUH 5D5MF 1EGJH 4P46A 1IQWH 4PJ9A 4XAKD 4WENB 1T5WB 3I02A 1NUNB 4KRPD 3MLZH 1H3PL 1EH9A 2VXQH 3D85B 1KN4H 2ESVE 5ISZB 1KJ2H 2LTQC 2P1YA 2YBRB 1OAKH 1A2YA 1I8KB 4M03A 1OSZB 4M61A 3DXAE 2VLMD 1WBYA 4FQIL 1I8MB 5H8DA 2A6DB 4TNWK 3WS6C 1BVZA 1JN6B 2GKIA 4GS7B 5FYLE 3L3DB 4KRMB 4LHUB 3LEYH 4JFDB 3MYZA 3EYUH 1B0RA 1EV2E 4Z7VF 5ESQB 3VH8A 4GW4B 3O11A 1UGNA 4G8GD 4MHHG 1B4JL 4U6HA 4U31A 4XMPL 2P7TB 1I1YA 4G6MH 1FH5L 2FSEA 1S9VA 1S7RA 3BP5B 5GGTH 5I30L 4PJEA 2DI9A 4F7TA 2R4RH 3B2VH 5HYQB 2VLRE 3WFEH 1I9JL 1LP9A 5I8CA 4GAJL 5FM4A 5IBUB 1OAZL 2CXKA 3N85L 1DR9A 3O2DL 4WI7A 1F3RB 2FEDC 2IFFH 4D2NA 3T8XA 2HAZA 3T09A 3C5ZB 3GMOB 1WAAE 5GJSL 1XGYH 3Q6FB 2PF6A 4IRZL 4ODVH 4M6OL 2C5DC 1CICD 1E6OL 2EDLA 4YXKL 4TYUA 3AXLB 1KXTB 1CLYH 1GAFH 1VFOA 1EFXD 4NKMA 3DXAD 3I9GH 4OCWL 3SOBL 1A9BB 3MRQA 4XB7A 2OJZH 1RZGA 2E27H 5IP4A 3RKPA 4J3OC 4R8WL 4L8SA 1IAIH 4HUVA 5FYLD 3P4MB 4MNGA 2GAZB 1W0VA 1YY8B 3JUZA 4OCNC 5C0FB 5ID1A 1BHGA 3CFCH 5DJ0A 2JIXD 5FF6B 5C0RL 5C86A 5I0DA 2FJHB 4ZTOL 3DVFA 3RZCB 3D39A 1NGWB 2GK0A 3B9DA 3PWJB 5KANG 4RMRA 2XTJC 3QISA 4CU6A 2EIEA 3VA2C 2PCPB 2VLRD 2XA3A 3LKPA 4KGJA 4P59L 1VB9A 3RJDA 5JXAH 3G6DH 2EO9A 1A4JB 2XTLA 5C0AE 5BJTA 4XPHH 5D1QD 3QAZB 5HHQA 1CG9B 4X7SH 4F9LA 1A22B 3SKNA 1LDPL 1CD1A 1CYGA 4DAGH 3CVHL 2HFFA 4D0BB 4KVNH 3HMXH 2H32A 4DCQA 2QQLH 1HDMB 3BT2L 5DFVC 1C1EL 1KSRA 1N8ZA 1AXIB 1YMHB 4R26H 1F6FB 1ZLVK 1AGBA 1EZVX 3OAZK 2O26U 1CN4A 1K2DB 1KENH 4N0YH 4XPTH 5BCAA 3LD8C 1WTLA 4OZIE 1HXMB 1OWWA 1NUFA 5J3HC 5J12B 2PO6B 2DICA 5CEXB 4TULH 2I27N 4YC2C 4AM0B 4AEIH 4NHUB 1WICA 3GK8H 3ZE2F 4ZFOL 3DRQB 5GSRB 4NWTL 3SKJH 3PL6A 5KTEL 1HQRA 3ZL4H 1BAFL 2IPTH 3V9FA 3AMLA 4XCCL 4YBHA 4HW6A 3SPVB 2VAJA 3O9WA 4H20L 4LLMB 2ADFL 32C2A 5F3HB 4R4BA 3QIBB 4WTXA 1WSST 4YFEA 3CC5B 3MJ8A 1FZKA 1X6NA 4I18C 1ZLSH 5GZNC 1A14H 3RY6A 1C5CL 1IJ9A 1Z3GH 2DLEA 1AGFA 3TGXA 3RTQA 3TLRA 4PY8J 2WV3A 3B2UC 4NKDA 1Q0YH 3MLSH 3CPLB 1ND0A 1A6ZA 1FVEB 2VDNH 3GSNB 4PGBB 4PRPE 5I1CH 1CE6B 5GHWL 4L8BA 5DVOA 3I50L 5BVJA 3CFBB 4IRJB 4JAMA 4NHCL 3X17A 3O6MH 3IDIB 3P0YL 5SV4A 3T3PE 3K4DA 1NC2A 3DTXB 5CD5D 1XF4B 1UJ3C 4OLUL 2P5WA 3O6KL 4QXGH 3OXSA 1CFTB 3BO8B 1CK0H 3QA3A 4QRUA 3T4YA 3U46B 5C8JA 4MD5A 1VADA 1FO0L 1D5MA 1T3FA 4AEFA 1IILE 1CGYA 4TOYL 1MCQA 2DQEL 5DJDB 2FH6A 4DJMA 1GH7A 3O6LL 3F58H 2Y07L 1JBJA 4P5MA 5F9JA 1XCQB 3V52H 1P1ZA 3S88H 1FAIL 3KYMA 3H8NA 1F8TH 3QUXC 3DWTA 1KCVH 5IK3B 2WSKA 2HFEA 5KVFH 1I7RB 4O58H 4Z18A 4YZFF 2ADIA 5HD8D 2YC1B 3H42L 1OP9A 4M62H 1JYNA 2J88L 3LQMA 5EBWB 4OZHB 4NZUL 2Y5EA 5TDPB 1UEMA 2A83A 4NNPL 5EULV 5FUOH 5HGAA 1LILA 3GSRB 3VG0H 4MNQB 4R7NB 5DJXB 4PRPD 5E6IC 1NGQH 2YA1A 4HKBB 3D18B 3C6SA 3OKOA 1S7UB 5IHLB 3GJEA 3TNNA 2V2TB 1P4IL 4Q97A 3ZTJG 2NZ9C 1KJVB 1I1FB 3T04D 5I19H 1KEMH 1J05A 2GJ6B 2X4UB 5L6YH 3GMNA 2DKMA 1INDL 1VENA 5D96B 3RX8A 2WZPD 1PSKL 1K6QH 2G2RA 4LFHD 4P5KB 1S5HA 5AUMA 3X12A 2P24B 2JCCF 3QQNA 3QRGH 3IDGA 3SO5A 3RI5F 2DWEB 3FO0L 1OTTC 3QNXB 3BJLA 4P2YA 4MNHB 1BX2B 1GJIA 4PD4J 2XYCA 3HR5B 3MA7B 1OL0A 3NTCL 3QEUB 1HOCA 3MODL 2CUHA 2E7CA 3HPLA 1JL8A 2QQKH 1N6QL 1JPSL 5FM5O 3CLEH 1DBJL 3EJYC 5T3XD 5JO5B 3BWAB 5CEYB 1H3VA 4LASL 3QULB 5DS8A 1YEIL 3EIFA 3OJDA 1LP9F 1EFXA 4GRMA 2J6EL 2IMNA 4W6YB 1MFBL 2XACC 3MUGA 4NZTL 5K59E 2FIKA 1MFCL 5DFTA 4QEGA 4Z9KB 4KQ4H 3QIUB 3ARPA 1F2QA 2P8MB 3NOIA 1QUNA 1WK0A 5AZ2L 1EAPB 1L4IA 1JNNH 3WEXA 3TWCH 1K4DA 5M7QA 1CWVA 1UT9A 3HZVB 3GHEH 1G0DA 5IQ7H 3P40A 1JGDB 4G8EA 1S9YA 5EU3A 3FT4B 3VFSB 1V7NH 2AJZB 3C08H 4K3DL 3S96A 5B3JF 3PGDB 5MHSE 1NFKA 5D1QA 4EI5D 4KROC 2NR6C 5ABDE 3MRDB 2FJFA 1WAAA 3K1DA 3AVEA 4ZFZA 4F7CB 3OAUH 5D7JB 5LXGH 1RJYB 3ROOB 2W38A 5F21B 1ZSDB 5IESH 5T33L 1U8OA 4I0PC 4KY1H 4RFNC 2WP3O 4HKXB 4XAWL 2AJUH 5C08B 4OV6F 1YEGH 3MCKB 4XVJL 5DD0H 4XWOD 1TTUA 1KIRA 5EIIB 3R4DA 2VZ1A 3EFDH 4G3YH 4JHWL 2EYRB 1OAXL 2X05A 3AREB 1A3LH 5ID0A 3AUVA 3TO2A 2F9BT 1GZPA 5EPMB 1GC1H 4DGVH 1SM3L 2Z0BA 2N56A 1KG0A 1ZANH 2QL1A 4U4BA 1NBQA 3Q2CA 3FQUA 4UT6H 2J3SA 4LDOB 3RI5K 2H41A 5DD6A 3TO4D 3RA7H 5L9DL 1TQBB 1RZFH 4NO5A 2CR3A 1M05A 4RISH 3WLBA 5B39G 1U91B 1SEQL 1MH5B 1R3HA 3TIEB 4I0CC 2HLFC 4GRLC 1E4JA 2VERN 1C5BH 3JVGA 4J23A 1AQDB 4LCCB 43C9A 1AD9A 1XR9A 5MHSD 4K7PL 1DQQB 1U8NB 1WGOA 3MBEA 5L88H 4HLJA 1X5FA 2CUMA 3C6LB 1XT5A 4NSKA 1HILA 4Q58C 4X4YB 2R0LH 3V4PH 4NKIL 3LOWA 3CSPA 1F11A 3MFGB 2IG2H 4RRPG 4MXVE 4OLZH 2FHBA 3UTTE 1IM3B 3IU4L 4JO4L 2VDOH 1AE6L 4Y1AA 4PJHA 3B6SB 5CEZL 4ZPTA 5ADPL 4K9EH 1JGLH 2ZNXA 3PWUB 2V5TA 4C4KO 3PL6C 1CF8H 2VR9A 3DHJA 3HA0A 12E8H 3LQAC 4PRNB 3B83A 2XA8L 4J6RL 2C7UA 3QHTC 4NRXB 3O9WC 1ZLWK 3AAZB 2ICWB 4KV5E 1J0YA 3MPCA 5ICXB 3HKFA 1LEKA 2IC2A 1NAKL 5BO1H 2NW2A 4PGZA 1CDHA 4KI1A 2OL3H 5D2NE 4PLJD 4WFGE 3IFOB 5JHDB 1TZGH 1BVLA 2NY6D 2W9LA 5LBSH 5E08L 1RU9L 3F12B 3RTQC 2BC4B 2PYFA 4CDGC 5J11C 1U8IA 1QBLH 1MHCA 2ATPA 4BH8B 2DRUA 5DT1L 3S36H 4PRID 1LO3L 5IQ9B 1A6AA 4FTVB 1ZHNA 2FIRT 4KUZH 3G9AB 1IEAA 4JFXA 4L3EE 4N8CH 1E4WH 2BNRD 4FG6C 5DUBA 2Q6WA 3SKMA 3SDXF 2AEPH 2B2XH 4JQIL 4LSVL 5CKAA 3ARQA 5FA3A 1EJ6A 1OGTA 4UOJA 5J6GA 1H0DA 2PYEA 3MRGB 4EDXA 4AL8L 3RKDD 3LRSB 4ENEC 1OAYL 1YQ2A 4JY4B 3MREB 3D1MC 4P3CL 1RZ8B 1H5BA 3GO1L 3QEGH 4OLXL 5E8NA 5TDNA 5I1EH 3K2UL 1WZLA 4F9PC 1U8QB 2FL5A 2VH5H 5C07E 1UXWB 3UCRA 3SBWA 4K8RC 3C8KB 3WS3B 3DVIA 1J0ZA 4X7EC 5ITBH 4JZJA 1SJHA 4P9HH 2LV4A 2D7MA 3TNMA 4M43L 4FNLH 2IH1A 1FNSH 2MHAB 1Q38A 1FZMB 4PJIE 1IGYB 1RUKL 4WFGD 4NM8H 5E24E 5FO8A 2ZSVB 2CUIA 1YYLH 4DGYL 4OIIL 4YGAB 4KRPC 3VI4F 4PJCF 5SX5K 3VFGL 5MERB 1IGJA 1YN7B 3IDYB 4XX1G 2ORBL 2XQYK 4XMLH 3HRZB 4GSDL 2X1XR 3C5SB 3KJ4B 1EA9C 2XG4A 1T21A 4L3ED 3U7YH 5FV2A 1Q9OB 2JK5B 4JM2B 4PJAF 2L0DA 5E9DB 5E99H 1F2XK 1Z2KA 4J1UB 5F9WB 4XZUB 4FFZH 5HBBA 2OZ4L 1ES0A 4BQ8A 5F6HI 3F7VA 4NC2B 5SX4I 4NGHL 1IT9H 2AK1H 3GNMH 4PGDB 3CMOL 5IW3A 3TZVD 3GSNH 3UTOA 3D2UB 4HSQA 1BECA 5C07D 3U2SA 2A73A 2ITCB 3VFTA 1QOKA 4Y88A 5HHOB 1AI1L 3MGTB 4GMTH 4Z0BL 1S9KC 4BSVA 1WZ1L 1EO8L 4J8RB 3NACH 3BN3B 2XRAL 5BW7C 4FZEL 4L4TD 4J12A 2Y23A 4NN7B 4ODXA 1U8JA 2JB5H 3MYJB 3GMLA 3NCMA 4JFFE 4OCLC 3H9SB 3HS0A 4OI9A 4X6DF 5ISZE 1HNFA 4M3KB 2WLYA 5BOPA 3V7AE 4X9FA 3HI1A 2R1XA 1ZE3C 1CICC 3HUJA 4PLOB 2AERT 2UV3A 2DWDB 4NIKB 3LRHA 4DZ8A 5KZCB 4XBGA 2GEEA 4EI5A 4LOUD 4O2FB 3RL1B 3P11H 1NFIB 3GI9L 4P5TD 3H3PL 1ZV5A 5JW5B 1ED3B 1JTPA 1B2WH 1RURL 4JFDE 1WWAX 1J86A 2AXFB 4HUXA 4I5BA 5GGQL 1AGEA 2QQNL 3REWB 1CDJA 4WW2F 5GRUL 3I6GA 3VXUB 3QWOB 3IT8D 2ZJSL 2IANA 2X4OB 4AT6B 1QA9A 1VHPA 4OD1L 5DWUH 3GSVA 2EDJA 1TXKA 5F1KC 5ILTL 1YMME 3K81A 5HHNB 1BF8A 1YNTB 2A9MH 3VFOB 2QQQA 2XWBB 5DD3L 3K7UA 5IEKA 3SCMB 1U92A 4O2CA 4JM4L 5EBMA 3TO4A 1N7ML 1NKOA 4PJ7B 4MJ5A 5IHUL 5IFHH 3OQ3B 3VE0A 4F15B 1TCRA 3GIVB 1NGPL 5DD1H 3ULVH 3D85D 4JFFD 1CTNA 5AAWA 5ISZD 1MRFL 1V7ML 4OUUB 5CKGA 1D6VL 4PP2A 3TESA 4JPWH 3IVKB 1RK1A 3TPKA 2JB6A 4P2RB 5BS0B 3JV6B 2HT4D 5D1ZB 1UKQA 4NJAH 1RD6A 1ULVA 5HJ3B 5ESAA 2XQYG 4GOSA 4PJFE 5IWLA 3Q0HA 1CL7I 1YN6B 4UILL 3MLXL 4IDJH 4LCYA 2DS4A 3OV6A 1XF5A 3UJIL 1FFPB 4QWWD 2W65B 3V5DA 4NQCA 4G43B 1I3RA 3G6JB 5CD3B 2NQCA 1HI6A 4P2OB 3PGFL 1BFSA 3MUHL 3BJ91 3U6RA 1IGIL 1PJ9A 3TYFA 2VXVL 3RWFA 4NN5C 5HYFA 1GYAA 1YMMD 1WVZA 3TEUA 3ARDA 2D0HA 1KOAA 4ZNCD 1I8LA 3C5ZD 3TVMB 4M6ML 3JVGC 1E4XH 4QHNB 3QPXH 1G7JA 3MACL 1BFOB 1EMTL 2E6JA 2GUOB 2HJLB 3MCLL 4G6JL 2NTFA 3GGWA 3TN0D 2X4QA 3L3GB 1MCCA 1INEH 4WU5A 4OFKA 4XRCA 3MRFA 5EUOA 2EC9T 3QZWA 2VDML 4ETQA 4Y8AA 1A3QA 4TSCL 1QR1A 5E94A 1RZIB 4KKBD 4W4OC 2DM3A 4PRIA 3PHQA 2AP2A 5DTFB 4PUBH 2IBGA 1JGEB 2BY2A 2XKUA 4H0GA 4PRHB 4ORGA 2Y7QA 5JW4N 3EYQD 1OP3H 1Y0LA 2BNRA 4HS6A 5DQJA 5IFJB 4WUKL 4UAOC 1NMBH 4XMKL 2ICWJ 2R4SL 4HPOL 3AB0B 2X44D 2NY0B 4R3SB 4HCRA 4AIXA 4XNZB 3NCFB 5KN5B 5FV1L 4I77L 5D70L 5DHVB 3FJTA 4OSUL 2OK0H 1NAMA 4K7PY 3QIWB 3OXRB 5F7MC 2NMSA 3IJHB 2E9JA 1KC5H 2EYSA 3ZDZE 4Y4HD 1RULL 1OVZA 2BNUB 3LEXA 1A47A 1V3LA 5ACZB 5C0EB 5ESVB 4Z7OF 4ZS6C 5DR5H 3TBYB 2X4SB 3EOYG 4HX1B 1BBDH 5GGSB 4N0RA 2VABB 2HLAB 3BKMH 3RIFF 5DMYA 2HJKB 1JHTA 4YHZH 4JPVL 5HD8C 1G9EA 3X11A 4AH2B 2DQCL 3KYAA 3SGDH 1JWUA 4FQ2L 5HI4D 2DMCA 1FG2B 2XFXB 5D7KE 4V1DB 4EN3B 1TETL 3AS3A 4GKSA 5ENWB 1QLRA 2KH2B 1N5AA 4KWUA 2UY7A 2W60A 4WTWA 4Q6IA 1NEZA 4PY8I 2HN7B 3O2VL 4L3EA 4RMTA 4B0MM 3GUTB 1K8IA 4YK4C 1BOGB 1GHFL 1BFVL 1H5BC 3A67H 2I24N 3W39B 1HH9B 2VXSH 3P0VH 3NA4A 1NFDF 2O5ZH 1A9EB 2X70B 3CDGA 3SDAB 4EXPX 4LRNL 1FPTH 3TBVB 3SBWC 1MVUB 1WBXA 2EEBA 3RVVD 4JZJC 4D9RE 3TZVA 2O5YH 3JUYA 1S9WB 3DMMA 1NBVH 4R90L 1QTYT 5LCVH 3Q3GB 2PTTB 3C09C 4R96B 3MX0A 4K3HA 5E5UB 5C07A 1OQXA 4LSRH 1AXTL 2ADJA 3L7EB 4HIIB 5HHXH 1IEHA 1QSZA 3X3GH 1G7MA 4YHYB 4L4TA 3RUGF 1KB5B 1U8KA 4YHPB 2R0ZH 2MCPH 4XWGL 3O45A 5ECJE 2BY1A 1MFAH 3BPOC 5IW6B 1QBMH 5CGYD 1YYML 1U6AL 3MRCB 4GMSL 5D7KD 1FVDB 3EOTH 3QDME 5H35B 3W2DL 5BZWB 3G5VB 5DC4B 2D4FA 5IR1B 2YKLL 3BHBA 4NCC1 2GJ6E 1CU4H 1RUQL 1NLDH 1XGQA 5E7FA 4OCYL 2PR4H 4Z76B 3WKMH 1FRGH 2GJZA 3UO1H 5KS9F 3MOAL 1UVQB 1PG7L 2KKQA 1AR1D 4ONGH 4K2UL 5J13B 4FQXB 4XXDB 5BVPL 3UPRB 4LSUL 4Y19E 5KSBA 4CDHA 5DJ2A 2OR9L 4YBQD 2HG5B 3B9KC 1KIUA 4YUEH 4RWYL 4LGSB 3V5HB 1NCNA 2OSLB 4D9RD 5KVEL 1T04B 5K9JL 5DRZB 1YUHB 2GSIB 3FB7B 3FB5A 2IQAA 2YA0A 3EO1B 4YDIL 3C9NA 2VLLB 5C71A 2V2WB 2UZYB 5GGSY 3GHBH 3RIFK 1WT5A 3LN4B 5BV7L 1K5NB 1I7UB 4I3GA 2YRPA 3KXFE 1P4LB 4RWHA 4JFFA 4KJQD 5A16A 4NPYB 4MXQD 1VFBB 4RMVA 3LKNA 4RGNE 2HKHL 3S37L 4M6AA 5GGRA 5JR1H 1YQVH 2J5LB 3ZT7A 4M5ZL 5F6IC 1DSFH 4WHTA 1DBML 4YE4L 2YWZA 3QDMD 4XWOC 2AV1B 1Q94B 4M1DL 3FFDB 1ACZA 4L9LA 1A6UH 1ONQB 4UV7L 2DIJA 2GJ6D 4RIRA 4AEHL 2AKRB 5I6XC 1P5VA 2ZKHL 3EO9L 3MV9D 4PJ8D 4G6KH 4XH2A 2RFXA 3E6FA 4Y19D 5I1GL 2P46B 2BRQA 2FCBA 4HWBL 5DA4A 3V4UH 3GBNL 5JXED 3B5HA 1ERNA 3R06B 1JZ7A 2FATL 2HVJA 4HFUH 3ESVF 3TO4C 1UWGH 4E42B 3V95A 4ZNEE 1CXFA 4XCFH 1AQKH 3PWLB 3BAEL 4U0RB 3S4SA 3W0WB 2V7HA 1CE1H 3C8HA 3WD5L 5KSVB 3ZE1F 1VKXA 4NUJB 1R3LA 4HFWB 3ZKMD 5CJXA 1BJ1J 3PWPB 1MHEB 1Y6NR 4CU7A 3TN0A 2WIIB 3KXFD 3GM0A 4HJGA 5C08E 3CVIL 4RGND 5IWLC 1RMFH 4J3VA 4EQ3A 3L5HA 3HC4L 4HS3B 4AENA 1JFQL 1ZLUK 4HT1L 3VRJB 1N2RA 4U1JB 2SEBA 2VN4A 4Y2DB 1SEBB 1NDMB 1S7VA 4LLAA 1WIOA 1XGRB 1CS6A 4DEPC 4X4XB 1D9KB 1U8HA 3RWIB 2CKBA 4NOBA 4A6YL 4JFQA 1IC4H 5EU4A 1CFBA 2Y1VA 2VAAB 3IDXH 3C60A 1TENA 4F57L 2EXYD 2H3NA 1CXIA 4BQBA 3DGCR 3EUUA 3SQOL 4LVHC 1I1RA 2G5BB 3QXVA 4ODHH 4EUPA 5EB9A 5IVXE 1I8LC 1CLCA 3CK0L 3P30L 2NXZD 4QHMB 2NYYC 3LV3A 3FZUD 1MI5B 2J8UF 3CDYA 4KTYA 2UUDH 5D7IA 1NCWL 2M8XA 5D93B 4U3HA 3WO4C 3ZT6A 4GQPH 3N9GH 1J0IA 1IVLA 3CFEA 1MREH 1QD0A 4PLJC 3F7QA 4K3JH 4O5LH 2IMMA 1CDUA 5GS1B 4HKJB 4Y4HA 2Q76B 3T2NH 3UTZB 5HGBA 5JW3H 1RZJH 5F7EL 4WHYH 2AXJA 3VI3F 5FCSH 5C08D 3BESR 3TBSA 3T2OA 3LN5B 1DFBH 1GGCH 4JO3H 2H8PB 1S7WB 1H15B 4P9ML 1I4FA 1QYGH 5C3TA 1FNEB 1H9VA 3MCG1 3ARFB 1ZA3B 3CAFA 4HJJL 1LO4H 4JFEB 2NNAA 2PW1B 4GAGH 3D69A 1QHOA 4YDLC 5FKPA 2D31A 3VDCA 4DOHE 3TFKD 4Y5YC 4DK3A 5FHAL 3WHXA 1G0XA 3RKDC 1BJ1H 1CR9H 2HFGH 5EOQH 2CPCA 3QQ3B 4S1QH 5DJZB 4TUJA 2WW8A 4QRPA 1YPZF 3QQ4A 4KKAD 5L2KA 3BZFB 5J4MA 1S7XA 4MHHI 1ZHLA 3BN9C 4XP9L 2HP4A 4QY8A 1AFVL 3LQZA 1DP0A 5JUEL 4XPAH 1HE7A 2FX9L 4OLVL 3JZ7A 5DRWB 4PJXF 3VXRA 3MRNA 2Q7NA 4BKLA 1MIEH 1KBGH 2GTZB 4EDWH 3FQRA 1SY6H 3VXQB 1AGCB 4OFVA 4OQTA 1TZHB 4DW2L 4JN2A 3ELAT 2VL4A 5D2NC 3VFNB 3RNQA 4FMKA 4LARL 1ZT7B 3N1PC 2BSTA 4FTVE 1AHWA 3TPUB 1YZZA 4XBPB 5MEND 1CFNA 1RJLA 1TJGL 1X4XA 4HKZB 1KLUB 3OF6A 4X6EA 4Q6IC 1FIGH 4NUGH 5IB3B 2VTFA 1LVEA 1JF5A 5JHLH 1QO3A 3G6AA 2HRLA 4OUOA 3KPSB 4P4KA 3K74B 5EZIH 3WV0A 3Q1SL 4PGCA 4IJ3C 4R4NC 4M6NH 4X9HA 4PS4L 1BQLH 5FYKE 4Q6YA 3BGMB 5J57B 1KPVB 2L4OA 4KMQA 3DGGB 2ZCKH 3TZVC 5HHPA 5EC1A 1JI1A 2DLHA 2V5RA 1G0YR 4HMEA 5CJBA 4KTEH 4LLWB 2DQJH 3SDCD 5FO9B 1M6OB 3NCYP 1I3GH 1KCUL 3L5IA 3L3IA 4MAYB 1BWWA 4GAYA 4IIQA 1NCDL 2NLJA 3V7MA 4PREA 3CLFH 1AGDA 3IRZA 3LS5H 5I8EB 2AS5M 1A6WL 5IROA 1E27B 5DHVH 4OV5B 5EO0B 3EJZD 4ZDHA 2VZVA 4FTVD 3CFIC 2FLRT 4F2MB 3MRKB 3NZ8A 3H9YA 4H26A 5GRVL 5D71H 2ZOKB 2BMKB 3D3VB 4LOUC 1CL7H 3PWVB 4P5TC 2BERA 5CZVH 2VDQL 5IB2B 3IF1B 2K7QA 5CZXC 2FBJH 1HNGA 3V6OE 4HCRL 3OKEB 2F19H 2AABL 3BQUD 3QDMA 3O0RH 3MLUH 1NAML 4N90E 5FYKD 5CCKL 1NC4B 4BQ6A 5ETUB 5IV2B 4JPIA 5L2JA 4YPJA 4JKWA 3MV9A 4PJ8A 2GHWB 1T4KA 5I75C 3D25B 1T1ZA 4OM1L 3TA3A 5J1AB 2DDQL