2CO6B

Salmonella enterica safa pilin in complex with the safb chaperone (type i)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
216
structure length
208
Chain Sequence
LNSATKLFSVKLGATRVIYHAGTGATLSVSNPQNYPILVQSSVKAADKSSPAPFLVMPPLFRLEANQQSQLRIVRTGGDMPTDRETLQWVCIKAVPPENEPGATLDLNLSINACDKLIFRPDAVKGTPEDVAGNLRWVETGNKLKVENPTPFYMNLASVTVGGKPITGLEYVPPFADKTLNMPGSHGDIEWRVITDFGGESHPFHYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
total genus 35
structure length 208
sequence length 216
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
B PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2co6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2co6B02
3ISWA 5FHBH 3SE4C 2OJZL 5T3XH 3BXNA 1EIBA 3QIUA 2GT9B 2YZ8A 1NSNH 5CCKL 1IKFH 2FD6L 4RAHA 2VUYA 1UEYA 1DTUA 3U6RB 1A1OB 1J1PL 2OM5A 1AGBA 3WFCH 4RGOH 2Y5EA 4EIGB 4AIZA 4XH2B 5HD8C 3F7YB 4X7SH 1T5XA 1KEMH 5IMLB 3VXRA 5E99L 4ORGB 4CVXA 4YHYC 1KGCE 3ZT7A 2JJVA 1QG3A 1D7FA 3MRQA 1ZHKB 2RQ8A 2H3NA 1UKTA 3OKLA 4PJEE 4ZUWA 3HNVH 3SKUD 1JF1B 5IVZB 4HUMB 5C08A 5E4EC 2ZOKA 1RIVH 4ELKA 1JHKL 5DRZB 3GBMH 2X1OA 4WY7H 1T03L 2FX9H 2X4RB 4HH9A 4HUUA 4YHPA 4QRPA 1OTSD 3VGFA 4H1LA 2F53E 4YZFE 1G7MA 4UIMB 3SDXB 3QO1B 3WLWC 1G1YA 1I85A 3ZSSA 1T4KB 2M26A 4J7RA 3TVMB 4ALAH 3VFPB 1D5ZB 2KQMA 2NY2C 3MLUL 3A6CL 3DYOA 5DQ9B 1JUFA 3V4VL 1A1NA 4UIKH 3GFUA 3WLBA 5SWSE 4RBPH 3UO1H 4HCRH 2J8HA 3NIDF 2G9HA 4Z78A 1PY9A 4EDWL 3EYUH 4WTXA 5C0BE 2FYYB 3WIIH 3FN3A 3Q5TA 4I3RH 3EYVA 4W6XB 4WV1C 2OR9H 1QEWB 2EH8H 3UTZA 3QDME 3QAZB 2GJZA 5D7LB 2QL1A 3I9GH 3B83A 1UCTA 5D2NB 1PKOA 2A6IB 4IOIA 1J8KA 1ES0B 4MVBD 2YC1B 2HVKB 4K7FB 4U6YA 2FLRT 1DLHB 1R24A 1JWSB 3HHRB 4I48B 5IBLC 1YN6A 2YPVH 2YD8A 5JOFB 2VN4A 4HIJB 4G43B 1IT9H 3MBEA 2Q7YB 4PJ8C 1K8IB 3OL2A 5D7SL 4HUVA 3BI9X 1Q9OB 3P30H 3SDCA 3NCEB 6CGTA 5F44A 3GSQB 4LCCB 4OD2B 3W0WD 3VRIA 1BJ1H 2C3WA 3D85A 3UYPA 1CGXA 1OPGL 1Q72H 1VESA 3STLA 1FVDB 5TDPB 3VXUD 4HHAB 3VE0A 3RPIA 3S6CA 4P99A 5DK0A 2ORBL 2AEQH 2E9WA 1XF2A 1T22A 4WNQB 4OFYD 5J11B 1IAMA 3RWFB 4OJFL 5DXWA 2QHRL 1PYWB 4UT9H 32C2B 4ELMF 2W9EH 3QH3A 1N2RB 1T20B 4LU5L 5HYIA 4Z7QF 1EHAA 4JO3L 5DJAA 3DOSA 4CKVX 1QO3B 3TBYA 2A1WH 3T4YB 2XYCA 2X10A 3H9HB 3T8XB 1A6AB 1MHEA 1TETH 3QUYB 4TOYH 4OFYA 3QRFM 1N5YL 3IDUA 3NH7H 4U1GB 4HUWA 3SE4A 5DJ2B 1VGEH 3HCVA 3KNBA 4APQD 1OD9A 1AP2B 5H37G 2J2ZA 3VI3F 3GZKA 1NCAL 2AK1L 2MQ3A 4A6YA 2H41A 1D5XA 4RQQA 5F6HI 1YEIH 4NQXB 4R2GD 2FO4B 5E2UL 4YO0A 3EFFB 5TDOB 5I1LB 5IQ9B 4JLRA 2FIKA 2IG2L 4J1UB 4WWKB 1CZ8H 3TIEB 4ODXA 4CN6A 3UTSE 3BO8A 3DX9A 4QTHA 1S7UB 3BKML 3JTTA 3OKYA 5DHVB 3DGGB 3HMXL 1KB9K 3GKZA 4YXHH 1MHHB 4KI5F 4Q6YA 3TVMC 4F2MB 2VDPH 2AAVA 2AJSH 4LLYB 5SV4A 1MJUL 2C9AA 4JFQA 1V7ML 3QXDA 5ADOH 1BQHA 2BY1A 4KQ4H 2AK4D 1ZHBB 5KVFL 3WLWD 2X4OB 2A0LC 5HYJD 3UTQB 4HS3B 4R8WL 5LWYH 5C0RL 3HUJA 2NY2D 4AEHH 4ZNCD 4KK6D 3VMNA 1NCUA 3QAZC 1C5BL 4WGWB 5D9SB 1I9EA 4M4PA 5D2NC 4ZOAA 4PLKC 4ZFOA 2R0KH 4JFDE 5EU3B 1F58H 2R4RH 5JORB 3Q5OA 4UAOB 5HHVL 1WSST 4PRHE 3CDGB 1MFNA 1QBAA 3CVHB 1YEGL 1VFBA 1TTFA 4BFGA 4QKXB 3EFDH 4XC3H 3ARQA 3EOAA 1M7DB 3F7QA 1HDMB 1ZOXA 4UV4L 4LCCC 2R1WB 3U0TB 1HE7A 5C0CE 2R1XA 2JB5L 1P69B 1CGTA 2H9GB 2XICA 2ESVE 4H5SB 2YPLD 4PJ8D 5L9DL 3LN9A 2VLRA 5D7IA 4WV1A 2Z8SA 2D03L 4QT5B 1IL1A 3KPSB 4NQVB 4TULL 4H1LH 4H8WC 2NTSP 4J6RH 4HG4J 4ZDHB 5J11C 5HGHA 1OAZL 1JHTA 4PJBF 3O6ML 5HI5C 3C9NB 2VDKH 1JF6A 4K2UH 1HILA 3I50L 3IVKB 2ICES 3V5HA 2Q8AH 4PJ8A 3TJEH 3TZVD 2Y7QA 4FZEL 4PJ7F 4ZFZA 4GXUM 5BQ7A 1F4YL 3VDCA 3QUYC 4ZAKB 5FYLD 2XN9E 2PETA 2MKLC 3ZYOA 5LQBH 1FL3B 1RURL 3WL9B 4S0SD 4U1GC 4ZYKB 1CLOL 2R9HD 3T0WA 3H42H 4GUPB 2GT9A 2ENSA 3MLSH 4M9OA 4P2QE 3X11B 5I6XB 2VR4A 1H5BB 3WKMH 2LABA 3U6RA 1R3JB 5I1JL 1A1OA 4GSDL 1YPZF 4NO0D 3DROB 4WWKC 1SJEB 4XH2A 2E5EA 1OAXH 2IANE 2D7TL 5IMLA 5D2LB 4KY1L 1A0QL 3IAQA 4ORGA 4CMHB 3KS0H 3ELAT 1X4YA 3PHSA 4CDGC 1E4XI 4K9EH 1I9RL 1KB5L 1ZHKA 1VGKB 4CN4A 1EXUB 5HDQH 2P44B 1VFAB 3BHBB 4NO0A 3GRWA 5DFVD 5C6PB 1AD9B 2X4SB 1JF1A 1A4KB 5IVZA 2DQCH 1JF5A 3TVMD 3P4MB 5CZXD 3WUWB 2WMPA 3RP1A 1WZMA 3U7YH 5M94B 3MNWB 1URLA 2X4RA 1S3KL 4ETYA 2WZPD 1RUQL 1G7LB 4UAOC 4CU8A 2A0LD 2EXYC 1MY5A 3ALXA 4UIMA 4JQXA 1YC8A 3SDXA 3QO1A 4XVTH 1T4KA 3GMMB 4M6NH 3TVMA 2IFFL 3VFPA 1D5ZA 1MJ7H 4N0UB 3P73B 5EOQH 5DQ9A 4N90E 4PJGB 5FM4A 4A6YH 1ROWA 4OZFG 4NM4L 3HC3L 3NTCL 3ARBB 2DTMH 4MQTB 1V5JA 4R4FL 5GQBA 2FYYA 2XACC 4R26H 1A2YB 5L8KB 1JIBA 4JPVH 1QEWA 4G6KH 2Z0BA 2I24N 3JVGC 4FQLL 5D7LA 2OBGA 4NQSA 3JV5A 4PJXB 1TFHA 2PYEE 5ESVB 5D2NA 5GGSB 1ES0A 2ARWA 3O81A 2P4AB 2YC1A 2HVKA 2DQUL 4K7FA 1DLHA 4O51B 1K3ZA 3ZTJH 4ESKA 3DHMA 3VFSB 1JWSA 1KCSL 4F8TA 4I48A 3IYLW 5JOFA 3VA2C 1SVCP 3B6SB 3CXHK 5EZJB 1A8JH 4JB9L 1BF2A 1K8IA 1Q9OA 2VKWA 3GSNB 2P47B 4XI5C 3DNKA 4Z7VB 3K7UA 4ZAKC 4BH7B 5GZNC 3GSQA 4LCCA 1MCOL 3OJDB 1QBLL 3ETBF 1AE6L 3QEGL 1NFDE 1FVDA 5TDPA 1VEOA 4HHAA 4LSQH 3QEUB 3QISA 3QUYD 1QSVA 1IC5L 4WNQA 5I6XC 1H5BC 3RWFA 3L5XH 4OBRA 4CVZB 1PYWA 4XNUH 32C2A 3L1OL 3MACL 1MFBH 1N2RA 1T20A 4KRPD 3QSKB 3T4YA 3H9HA 3T8XA 1A6AA 3O3DB 2NY5L 3QUYA 2X4TB 4IOSD 3GUTB 1GPOL 4LHUG 3CZFB 4AEFA 3VRLF 5DJ2A 3P11L 4WWKD 4S2SB 2ZKHL 4L8DB 2OK0H 5EOTB 1AP2A 1XGQB 3LPWA 2CGRL 5H8DA 5GJSL 1NGQH 2OP4L 3ARFB 3CFEB 4IRZL 2FO4A 3AB0B 3EFFA 4X9GA 3E2HB 5I1LA 5IQ9A 1EO5A 5DSCB 5KANI 2DM7A 2Q8BL 4ZO8A 5B3NA 4KK9C 1SEQH 1YYML 2EDFA 4JVPA 4J1UA 4WWKA 1J9CT 3TIEA 4LSRL 3S3PA 2P49B 1S7UA 5DHVA 3DGGA 4G6ML 3BEWB 1MHHA 1CS6A 4PJHB 1UM5H 1LGVA 2A74B 4F2MA 3MRDB 1LD9B 5I19L 3SDYL 4NZTL 1K85A 4OLUL 2EXYD 1DQML 4XP4H 1Q9LB 1ZHBA 2X4OA 4Y1AB 4HS3A 2DLFL 5F3BB 3H3KA 5FGRA 2XT1B 4NNXB 1BVZA 5D9SA 4G8IA 4XPGL 2LAAA 1P6AB 1ZT1B 5EU3A 1XIWB 1P4BH 3WDJA 5JORA 2YD7A 3CAFA 2V5MA 3V0VB 3FN0L 3X12B 1NBQA 1Q0YH 2OR8A 3CDGA 4N5EC 3CVHA 3TWCL 4QOKD 1BLNB 5I15H 2OR7A 3KPSD 4AY0A 2IMNA 1RVFL 1HDMA 2WINA 4J2XA 5I9QB 5DEGB 3SE9H 2R1WA 2BRQA 3RJQB 3U0TA 3RU8H 4TSCL 5HGGS 1A3LL 3OAZK 2NX5B 3RWDB 2H9GA 2P48B 2YMXL 4H5SA 3TA3B 4HKBB 5C7XL 3PGFL 3N1MC 5TDNB 4QT5A 3S96A 3BRGC 4M3JA 3KPSA 3WBDA 4ENEC 3JVGA 3OTTA 4NQVA 5GZND 5F88B 2H45A 4ZDHA 4Z7UA 1BJ1J 2AQ1A 3S35L 4OKDA 1E6OH 3RHWK 3C9NA 4OZ4B 4M1GL 3IVKA 3QJFB 3IAPA 4ODWB 4YQXL 5J8OA 1CD0A 4Q0XH 4ZAKA 5CEZH 5BV7L 3WL9A 3O4LB 4ZYKA 3HPLB 3STZB 5EFIB 3W0WE 1PQZA 5IM7B 2FGWL 3D25B 2DI8A 5FGCB 4GUPA 2DQEL 3MOQA 2ICCA 2Z92B 1UADC 3QP3A 1K3IA 3ARFC 4TUKH 4CMMB 3KYMB 3OX8B 3UBXG 3VXUE 4PJ5D 5DC9B 1H5BA 3E2HC 4LGRB 1I9IL 2XY2A 1OT1A 2NY4B 1R3JA 3ILPB 1Y6MR 1DSFL 5EBMA 3SOBH 3JSSA 3DROA 1SJEA 2QADD 2DBLL 2YRPA 4K3JL 1ZANH 1SQ2N 5D2LA 4PY7A 3VXQB 3DJ9A 4L3AA 4K71B 3S36L 1CDIA 1VGKA 3WHE0 1EXUA 1GHFL 1VEPA 3BKYH 3CK0L 3IFNL 1VFAA 3BHBA 1MJ8H 4GW5B 5JW4M 4H8WH 1AD9A 2X4SA 1A4KA 1ZT4B 2Q20A 3EYSH 1TJHL 1D5MB 3MBXH 3P4MA 3WUWA 1WFUA 5IBUB 1TNMA 2BRRL 4GG8B 3CSYB 5KSAB 3MNWA 4LHUB 4KMQA 4EI5D 1XIWC 1G7LA 1D3CA 4K8RD 3RI5F 4G3YL 5I74B 4DKAA 1GIGL 4Y8AA 3GMMA 3HLAB 4N0UA 3P73A 3HUJE 2R56L 3PDOB 4KDWA 4PJGA 3ILQC 1VPOH 4FG6C 3U1SL 3U0PA 3FL7A 3AGVA 1MRDL 3UPCA 1A22B 2GYSA 1F3JB 5E6ZA 2V2WB 4FA8A 3KPTA 1AQKH 4N5ED 1KEGL 2J12B 3ARRA 2AK4E 3TA3C 3GSOB 1A2YA 5HYJE 4HF5L 4LASH 5L7XH 4M48L 3OMZA 5ESVA 1PKQB 5GGSA 5DHVH 1UWEL 1DQDL 3FB5B 3EZ8A 3MLXL 2JJSC 1HYSC 1CU4H 2YD1A 4HPOL 4O51A 1U93B 1N6VA 2AQ2A 3VFSA 4G6AC 2FLBT 4XPHL 3B6SA 4KXZI 5K59F 4MZ2A 3Q2CA 1E4XH 4UT7L 5D7IE 1T3FB 5KOMC 2V17H 3CUPB 3V0AC 1NCBL 4Z7VA 4RGMB 2VDRL 4BH7A 4NO2B 3AAZB 2RB8A 3D39D 3GI8L 3HG1B 4PFEA 1XGYL 4OQTL 4AL8H 1KN2H 2H26B 3L5WA 3OGCB 3PDGA 3KXFB 1DDHB 1I3GL 4U6HB 1QBBA 4FN0A 4MNQB 4YDKL 1XF4B 4ODUB 2LU4A 4LP4A 2X2YA 1CDBA 2DLIA 2YPLE 4MAUH 3KHQA 1CYGA 1UWXH 2CQVA 3QEUA 4Y4HB 1RZKC 43CAB 3EYFA 1D6VH 4CVZA 2YZ1A 2MCG1 1U3YA 3CVHH 5L88L 5EZOL 1DQLH 5C09B 3VG0H 1ZS8B 4M1DH 4LSPL 5J12B 4KUCF 1C7SA 3O3DA 1UFUA 4WHYH 2X4TA 3GUTA 4K71C 3S34H 5C71A 3BE1L 5IWLC 5ALCH 3CZFA 4R7NB 2FBJL 5FYLE 4RA3A 5EOTA 1XGQA 5C0AB 3WO4C 4NN7B 4OCNC 3K46A 2VLKB 3ARFA 2NY7L 3FN9A 1UZ6E 3KS0J 3RVWC 1KLFA 2Y06H 1CTNA 4QRUB 5DSCA 5LG1A 3TT1H 5KSAC 4KUZL 3IKCB 1TVHB 5EUKB 1DBJH 5D1ZD 5I74C 3BEWA 3K80A 4YZFF 2F15A 4OZGE 2A74A 5CWSB 4P5KB 1LD9A 5A2FA 4LIQE 3G5XB 1KCLA 1XIWD 1LK2A 4U1KA 3GKWH 1YJDL 4KK8C 5E94B 2Q86B 1VSCA 4LSTH 1Q9LA 2VB5A 4EBQH 1NCTA 4MJ6B 3MA9H 4LLMB 4Y7MA 2DL2A 1QRKA 3L7FB 4Y1AA 5K9QG 1LE9A 4DJMA 5KOVC 3SDXE 5F3BA 3DRTB 3P9LB 4NNXA 4YNYB 3BRFA 4NDMB 5FKAB 3ILQD 4ZD3H 1C12B 4FG6D 3MOAL 5E5UB 5KN5B 5IROC 2DQGL 1G9MC 3N85H 1N5AA 1ZT1A 1XIWA 3VGAB 2I60H 3GHBH 3V0VA 4U6XB 3RWHB 5DD3H 4YHKL 4XP5L 5CJQL 5TJWK 2ZUTA 1NL0H 3CFIC 3BZDA 1EK3A 3H7BB 4HUKB 3MJ8B 2HAZA 1J1XH 1QSEB 4RGMC 1HYSD 5DEGA 5TE6L 1ZT7B 1MCPH 4L8BB 2VISB 1PY4A 2OCFD 5CMAA 4Z7NE 3GK8L 2NX5A 3TBTB 5FA4B 5E00B 4HKBA 1XZ0B 4JAMA 3FQXB 5TDNA 4XX1E 5K9JL 4Y4HC 5F88A 4W4NA 2XA3A 5HYSB 2XZQL 4NQDB 1PW3A 4FQPA 2JJSA 3T0XA 1G1CA 4HIXH 2CKBL 4OZ4A 4OZFA 3AROA 1UA6H 3QJFA 3T3ME 1HHGB 1KBGH 2W60B 4ODWA 2E9IA 5J12C 2ATKA 3M45A 4DGVL 5E8EA 2VLMD 4WHTA 4M61B 3GIVB 3THML 1YNLH 2G5BB 1EZVY 1JK8B 1NJ9B 1ZMYA 4KAQH 4M00A 1NC4B 4NGHH 3STZA 5EFIA 1BOYA 3FKUS 5IEKB 5IM7A 1W0WB 3D25A 4NN7C 2Z92A 2BC4A 3TYGH 2YS4A 4CMMA 1SVZA 3KYMA 4PJ9B 2DDQH 1NC2D 4B50A 1FFNB 1UYWL 3DI2B 1CFTB 1ZWIB 5JXEC 2YN5A 3TGXA 4PJAA 3F5WA 3GSNH 4FQ2L 3GSWB 1WZKA 1KPUB 2DWEB 4DOHE 2XQYG 2ADFH 1EBAA 2HG5B 2C1OB 3VXQA 4QRTB 1IQWL 1IKNC 1JGUH 3LEXB 4G7VH 5IIEB 1NC2A 3MJ9L 5IWLA 1X3DA 5I1IH 1P84J 3UDWC 7CGTA 3KLHC 4LHUD 1UH3A 4LVNB 4GW5A 1WF5A 3LMJL 1LHZA 2OXHA 1D5MA 2VDLH 1ETZA 5GRJH 4L4TD 5IMMB 4O5LL 1Y0LA 3Q6FA 5ID1B 4GG8A 3DSFH 3CSYA 1T89C 4NC0B 4PREB 5IG7B 4K7PH 4NP4L 4IJ3C 4KK8D 4LHUA 4J3OC 3WFZA 4OM0H 3VGAC 4P2OB 1INQA 1VADB 1FO0L 1U42A 2R2EB 2UY7A 3HLAA 3OBAA 3KG5A 1CI5A 1GC1L 2VAJA 4UUJB 3PDOA 2CIIB 1X5IA 2C4FT 3U7WL 4PLJD 1ZLSH 4WI4A 4M5YL 1F3JA 2V2WA 1T7ZA 5JW4R 3QQ3B 3H3PH 4QY8B 5E8NB 3QDJD 3BD5A 2C26A 4DN4H 3GSOA 3GMPB 5F9AC 3AS3A 2YUXA 2EDDA 1OP5H 2Q1EA 3GMOB 1PKQA 5IROA 3L3GB 3FB5A 4UV7L 5F6HJ 2WQ8A 1U93A 3IS0X 4MNQD 4OM1L 3ET9F 1FN4B 3C6LD 1HCVA 1FLRH 4I8DA 3N9GH 1INEL 2VDQH 4NKDB 4KVCH 4Y4HD 2AJUH 4QOKE 1T3FA 1JCKA 1MWAL 3KPSE 5HPOA 2MQCA 3AAZA 3HG1A 1MHPH 4N1CA 3QG7H 5CJOL 4Z7UE 2H26A 2LE9A 3OGCA 3KXFA 1DDHA 4U6HA 4MNQA 4JY6B 1G6RB 4BKLB 1XF4A 1QLEL 2RFXB 4ODUA 4WEBL 3PNWA 1BEYH 3BJ91 4PJ9C 3BN3B 4Y4HA 2OLDA 2Y1VA 3BOVA 3UJTL 2EEDA 43CAA 4R0LB 3X3FH 1CE6B 1HHJB 3MRJB 2EE9A 3BEVB 5C09A 5C0AD 2V2XB 3T0EB 1BFTA 4KKLC 1RHHB 1OCWH 1I1AB 1FLTX 1ZS8A 3BIAX 1CD1B 3O3BB 3WFDH 1ZLUH 5BVPH 3I2CH 4RNRB 3NFNB 5KW9H 1R6VA 5I8KL 3H9SB 3VFOB 5B22A 4OLXH 3FAWA 5JXED 3KPOB 1JPSL 4R7NA 4BZYA 4PGZA 2UVEA 4PD4K 1FVCB 4LVNC 4YUEH 5C0AA 5DK2B 5MEQB 5HHMB 3HR5B 5DI8B 1A14H 1BF8A 2VLKA 1DJSA 4X80H 2VXTH 4FFZH 4TRPH 3FT2B 5GS0D 4MA3B 4JHZA 5GS1B 4KV5E 3WV0A 5JW5B 4DTGL 3KLHD 4D2NA 4PJ5E 1A5FL 4OCYL 1QHOA 5A2KH 4KXZH 5JXEA 2CRZA 1LEKB 1MCBA 1NFKA 3IKCA 4PJIF 1HXYB 3U2SB 4YHOH 2G75B 1TVHA 3C8KB 4P2OC 5EUKA 4LHJB 1KOAA 1CXFA 1WZ1H 2JB6B 2VR9A 4MJ2A 4R90H 3K1KC 1IKNA 4M7KH 5CWSA 3EO9H 3QXVA 3UDWA 1G6VK 4P5KA 1NMAL 2W9DL 3RZCD 2Q86A 5E94A 1RZKH 4S1SH 4MJ6A 1V3KA 3I75B 3L7FA 2E27H 1ODAA 4PP1C 3DRTA 3P9LA 4YNYA 3SY0B 3LQAL 2PXYD 4NDMA 5FKAA 1T89A 4F7TB 1QSED 1C12A 5KN5A 4Y16B 4W70A 4ETQB 1IBGH 4PJGE 4YK4B 4ZSOB 3RWHA 1QQDB 2B1AL 2HT3C 4EUPB 5JLZB 2QQKL 2F5AH 1UM6H 1IGFL 2EEAA 1JGLH 2HTLC 1X5GA 3MJ8A 1QSEA 4LKXB 3OKKA 4L8BA 2FWOA 3LS4H 2VISA 4YDLB 5FM5M 1U3ZA 3TBTA 5E00A 2AGJH 1RUAL 1KC5H 1TTUA 1XZ0A 3FQXA 2NW2A 3HI6L 1NFDF 4TSBL 5HYSA 5FK9B 3ESVF 3LSOB 3U36B 4NQDA 4R0LC 5E8OB 4Z7VE 1AJ7H 3FQUB 3HZKB 4D9LH 5DJDB 3WD5H 4C4KO 4IOFC 1UQSB 3VD9A 4ODTL 3T0EC 1HHGA 1L7TL 2W60A 1JRHL 5GGVH 1I1AC 5KSBB 4PJ9D 4M61A 4OZIB 2EC8A 4YHLH 5AYUH 3ZDXF 5GGQH 3SPVA 3S3SA 4DVBB 2G5BA 1NJ9A 1JK8A 2VC2H 5I0ZA 4PR5B 1NC4A 3D39E 2AV1B 2OZ4L 5IEKA 1DFBH 1W0WA 3EKCA 2XI9A 2VL5B 3FONB 4WJ5B 3FMGH 4C83B 1O5DT 4PJ9A 5D5MB 1HYRC 4PRNB 1ZSDA 5GS1C 3T0VA 1FFNA 4GLRI 1CFTA 1P5UA 2VQUA 3EIFA 2A9NL 1ZWIA 1WBXB 4NN6B 4J3VA 3KPMB 5DURB 4NQED 1NCNA 3GSWA 1KPUA 2DWEA 3SGKC 1A7NH 4M4RA 4PRBB 1OWRM 3QHTC 1EMTH 2C3GA 2AVGA 1KXQE 2C1OA 4QRTA 1S7XB 3MV8B 3LEXA 5JMOC 3S98A 3B43A 3BSZL 4FQQB 1U8MB 3C60D 4G7YL 4MS8C 4NQEA 3T77B 1YDPB 3FO0H 1OL0A 2GTWB 5CINH 5E0QA 1JZ7A 2HMID 3TFKD 1RZ7H 2CH8A 1D5IH 5IMMA 1Y6KR 2FSEB 4NFBA 5ID1A 2AJZB 5DVNA 3QHZH 4JGUA 5CUSH 4PREA 5IG7A 4V1DB 4Y16C 1MIML 5HI4C 5DD5L 4R6UA 4P2OA 3NIGF 4HMCA 5DUPL 3EBAA 1QFUH 4TQEL 4YK4C 4ONOA 5HHQA 3W9EB 4BZ2H 5HYQB 1DEDA 1VADA 5J06A 4PP1D 4L1HA 1I8IA 2R2EA 1F4WL 4OGAC 5I1DB 2IGFL 4UNVA 5IBTH 5KVEL 4UUJA 1WZLA 3IRPX 2CIIA 1T80A 2DQDH 4NZUL 2HT3D 2VH5L 3QCVH 4H26B 1HSAB 5A1AA 4QY8A 5E8NA 4M02A 1GGBL 1IEAB 4XTRC 5JDSB 2X1QA 1FFOB 3GMPA 2HTLD 4DUVA 3KYKH 1LE5B 1UXWB 1BM3L 4TPRL 1U8QB 1OGAD 3GMOA 3A67H 3QUML 1JE6A 3L3GA 5EA0H 2F54D 4LCWB 2XTJC 4X4XB 4HJJL 3VW3H 1LO4H 5KAQF 5E6YA 1IFHL 2X89D 3FZUD 4HSQA 2CXGA 3MLVL 4JPKL 4NJAL 4QF1B 1D6EB 4NKDA 2EYRB 1CXKA 1Q94B 3ZKMC 2BCKB 1MJJB 5I1HL 5E8DH 4KDTC 2HFGH 1W0YT 5BRZB 4NYLB 6FABL 3D87B 3QFDB 3NACL 4IOFD 4X7DC 2O93L 1JZ8A 4XNXH 1KJ3L 4JY6A 1G6RA 5DA4A 4BKLA 3SDDC 2RFXA 3N1QC 4KROC 1XR8B 2BJMH 2X89A 2ZG1A 4PUBH 3MLZH 3VWJB 4R0LA 1L0YA 4NN6C 1HHJA 3MRJA 5DWUH 3BEVA 5HHMD 4W81A 3T0EA 1RHHA 1I1AA 5CJBA 1CD1A 3O3BA 2EKJA 3KLDA 3BESR 4AMKH 3NFNA 4O4YL 1E28B 2VLME 1JFQH 3H9SA 1HCFX 5FHBL 2PYFB 5T3XL 4RMWA 3OZ9H 1J10A 1MAMH 4PJAE 1FVCA 5MEQA 5DK2A 3HR5A 5DI8A 3FT2A 2N1KA 4MA3A 5GS1A 1BFVH 5MP6H 4FQJH 4JKPL 5JW5A 3RWIB 1D9KB 5EB9A 3O45B 3TIDB 3NCYP 2XZCH 1YMMB 1LEKA 3WFCL 3U2SA 2G75A 3C8KA 3SGKA 4X7SL 4Q7DA 5D4QA 1G7IA 1KEML 2BNQB 4I77H 4UQ2B 4XCYB 3Q6GH 2JB6A 3SGJC 4POZC 2HT2D 2WLYA 2CSPA 2P8PB 1UKSA 5DMKB 3WNMA 5D72H 4QNPE 5HI4D 3CD4A 3DYMA 4U7KA 3HNVL 3OJMB 3HUJF 3N50A 3MMEB 3I75A 1R3IH 4GW4B 5JXAH 2GITB 4OGAD 1X5JA 1RIVL 4EDXB 1A7RH 3GBML 4L4TE 4WY7L 2FX9L 4Y16A 4ETQA 4GH7B 1EHLH 3C8DA 3MSPA 4JFFB 4P4RB 1TVBB 1CE1H 3TCXA 1ZLWH 3EOTL 4ZSOA 1QQDA 1I7TA 3DVFA 4OAWB 1JYWA 4XTRD 5JLZA 2J8UE 4ALAL 2WP3O 4NHCL 1UACH 2IAMD 4FHBD 2YHGA 2MMXA 3EGSB 3QPXH 3BN9C 4LKXA 2XTJD 2D9QB 3NFSH 2CO7B 5D7IF 5I73B 3UO1L 1RZJC 4HCRL 5TQ0H 3EYUL 1SEBA 4I3RL 4JN2A 2OR9L 5EZLB 3QDJE 3U7AA 2UWEB 3I9GL 3T2QA 3CXDH 2X05A 4OCLC 2HN7B 5FYJH 3LSOA 3U36A 1DLFL 3VWJC 4BSVA 2WANA 3BP5B 3ZYZA 3EDKA 3FQUA 1Z0NA 3HZKA 5DJDA 4I0PB 4DKFL 2AJ3B 2YPVL 2E7HA 3SDDD 1UQSA 4KROD 1IT9L 4P2RB 2A38A 3RY5A 4MNQE 1UH4A 3WFEH 5KSBA 3P30L 2I9LB 3R4DA 5C0NC 4KMTH 4OZIA 4KDTA 2UV3A 4ZG1A 4DVBA 1BIIB 4PR5A 3UAJC 1Q72L 2AV1A 4M7LT 3SDDA 4WENB 3VXTA 4WJ5A 1C1EH 4C83A 1Q0XH 4TVPD 4B41A 2AEQL 1CQYA 1RHFA 5D5MA 4PRNA 5ILTH 1F11B 4UT9L 3REWB 1JNNL 5IB5B 1S7QB 1S7TB 2W9EL 4O2EB 1D9KC 4Y5YC 3WHXB 2FR4B 1X5LA 1WBXA 2BSTB 2UZYB 3KPMA 5I1KH 3V6OC 3T4AB 2XZAH 5C0AE 2A1WL 2KKQA 1X5XA 3B9KC 2BVPB 4TOYL 3MV8A 1S7XA 3EJZC 2I5YH 4OZHA 3NH7L 1G6RH 4V1DD 5L2KD 5HXMA 3U0WL 4FQQA 1VGEL 1KN4H 4M93B 5JIHA 1U8MA 2JIXB 4Z5RB 3VXMB 3DURB 4XP1L 3UZEA 3T77A 1YDPA 4ZO7A 2GTWA 3RGVD 5IP4A 5L6YH 1YEIL 1J0HA 4POZD 2FSEA 1PEWA 2WBWB 2B2XH 4NQUA 2AJZA 4Y0GA 4RMQA 1XF5B 3SDXF 4V1DA 4PY8I 1I7ZA 1CZ8L 2NY0D 3PXJA 4ELMB 1HQRB 1LP9B 3B5TA 3W9EA 3SGJA 1BFSA 4MCYB 1A02N 5T3ZD 5I1DA 2VDPL 2AJSL 5LBSL 5IW3A 5F97E 1TZIA 5ADOL 2VDOH 1CDGA 5I73C 4RGNB 5KVMC 4H26A 3U83A 1HSAA 1NEUA 2D7OA 3VFNB 1MAJA 4GLRH 3AUVA 2VKXA 1IEAA 2YD5A 5JDSA 3RX7A 1NEZG 4G9FD 1FFOA 4K55A 1LE5A 5FOBB 1UXWA 1MAKA 3QFJB 1U8QA 5JO5B 1EJ6A 3SBWC 3RVXC 2R0KL 1QSEE 3CLFL 1F58L 2R4RL 4LCWA 2RAMA 4X4XA 4P0DA 5IFHH 4I0PC 1JPGA 2ILLA 3IXTB 2QBWA 4JCMA 3O6FD 3TV3H 4XC3L 4QF1A 1F02I 1D6EA 2EYRA 4G9FA 3RIFK 1Q94A 1QPPA 5C07D 3MLUH 4GRWB 4MQ7B 2BCKA 1MJJA 3ZKQD 3FO1B 4HLJA 3QFDA 4I1NB 1BQSA 4XNMB 1DQJB 2CJUH 2V5YA 2CDFB 2DJUA 4PGCB 5I2IB 3MUHL 5BV7B 3L5IA 3T09A 1UXSB 1XR8A 5C0ND 3V6FB 4Y5XB 2AERT 1JWUA 1UVQB 1T0PB 3K8LA 3RAJL 4EUPH 3VWJA 3SHSA 2OS7A 4X9BA 3SCMB 3UAJD 2VDKL 3ZHLA 1TCMA 3RVVC 4ZS6D 1FNHA 3P0VH 3TJEL 3HAEG 2J88L 5GGSY 5DJXB 1QR4A 1F97A 4OCWL 4B7LA 3FT4B 5LQBL 1D9KD 5HDLA 2ICWB 2PYFA 4M93C 4JFXB 5EWIH 1OP3H 1RUML 3H42L 2ERJB 1F8TH 3MLSL 3MX0A 4OLZH 3B9KD 1F45A 4FQXB 1KIRB 3WKML 2JCCB 4OJFH 2QHRH 3K8KA 2BOCB 4Y5YA 1D9KA 3RWIA 1IC7H 3O45A 2DQFB 4KJQD 3TIDA 2APTA 3GBNH 4G8GB 2OX5A 1OAXL 3TBWB 4NQEE 4EQ2A 2BNQA 4QYOB 4XCYA 3WCYA 4WFHD 3B9KA 2GEEA 2GFBB 2WWKT 3PHOB 4CADB 4JDVB 2P8PA 3QQ9C 1G0XA 4K7PY 5DMKA 5HDQL 4JFFD 3DX6B 3ZZ1A 1F4XH 1EX0A 1SJHB 4RGNC 1NCAH 4FXKB 3MMEA 3P40A 4GW4A 4L4VB 2GITA 1M71A 5E2UH 4D0DB 3MFGB 4L8SB 4EDXA 4U7SA 4LSDA 5GSVB 1FBIH 4GRMB 3U7YL 4M1CC 1BD2B 2IG2H 3QDGB 5HYFA 1RIUL 1I1CA 5KVDL 4JFFA 5JHDD 1TVBA 5DGQA 4XVTL 5DEZA 4OAWA 3ZHDA 3HMXH 4GO6B 1GAFL 4GKZB 5DGRA 4C58B 4N8VB 1W72B 2GI7A 1MJ7L 2AS5M 1NUDA 5EOQL 4HC1A 3MXVL 3RVXD 3LQZB 5C0FB 3UYRH 4A6YL 1MJUH 3EGSA 4IDJL 1CGUA 5E2VH 1KV3A 4I0PD 2DTML 4WUUB 5CZVH 3B8YA 2D7MA 3MRMB 1GGIL 5BV7C 4R26L 4Z7UF 2Q87A 2P1YA 2CDEB 4JPVL 5EZLA 4G6KL 4Y5XC 2UWEA 5CJ8A 2HN7A 3G6JA 4XBPB 4RX4A 1KLGA 1N4XL 3BP5A 2ZG2A 3V2AR 1OGAE 3SCMC 2QQNH 4I0PA 4XP6L 2W0FB 2F54E 4DGIL 2AV7B 1FNEB 4P2RA 1YEGH 2I9LA 1QHPA 3KLAB 2ICWI 4LPUA 2HJLA 3P9MB 1ZA3B 3RVVD 1BIIA 2ZCHH 2JB5H 5HTSA 4HKXB 1BIHA 2ERJC 3G9VA 2HVJB 4ONHB 3DTXB 4LSQL 3ZT5A 4ZFOL 1WICA 4N68A 3WNKA 4N8PA 4FQXC 3WS3B 3L5XL 1RQ5A 4X6DE 1F3DH 1F11A 3REWA 2MSPA 5IB5A 1OAZH 1S7TA 4O2EA 3DO7B 2JIXD 3WHXA 3AREB 2Y6SC 3O6MH 4DN3L 1MFBL 2FR4A 5EG6C 4KV5F 5D2LF 2H32B 3MUY1 4JFED 3OF6D 4RFOL 5CGYC 5HHME 1W8OA 2DLGA 2CKNA 5CBAB 4JHBA 1RZJH 1F4YH 2BVPA 2Z31D 2YEZB 3EJJX 1RURH 3RVTC 4Z76B 2JIXA 5CS7A 4Z5RA 3DURA 3VXMA 2WIIB 4JFEA 2YXMA 1NGQL 3RUGB 1F2QA 3MR9B 4L8SC 5J13B 2ZOLB 3LV3B 5FUOH 2XY1A 1XF5A 1SEQL 2CUIA 3T2NH 4RGND 4F7PB 4YDJB 3SKNB 3OB8A 1HQRA 3FRPG 5ESQB 1LP9A 2EDOA 2R2HB 1T7WA 1UM5L 4PJGF 2D7TH 1A9BB 1MSPA 4MCYA 2BSED 3VH8B 2J5LB 5EDXA 1KTDA 1F2XK 1NCWL 1WK0A 3TT3H 4D3CL 4XP4L 5J6HB 1WGOA 3HPJB 1UKQA 2DKUA 2XNAB 3OKDA 2JF1A 3C5ZC 3RTQB 3TN0B 3VFNA 5FB8B 4ZSOE 5T1KD 5FOBA 4JANA 3QFJA 4XPBL 4E0RB 4M8QB 3UJIH 5JO5A 5CGMA 2QTEA 5GISH 5K33A 4DQOH 1Q0YL 3IXTA 3CU1A 4Z7VF 3H0TB 1NCDH 4HLZH 5I15L 3IDIB 2ZUQB 2B20A 3GRWL 1EH9A 2DBJA 5D7JD 1KCVL 4MQ7A 2I07B 2P8LB 3SE9L 5F1KC 3FO1A 1B9ZA 3HC3H 4XNMA 1DQJA 4H20L 2XTJE 1BWWA 4LIQL 3QUXB 2CDFA 4I2XE 4PGCA 5I2IA 1HSBB 5DZOA 4R4FH 3B9VA 4U1MB 3NN8A 4Y5XA 5KJRH 4N8CH 5AEAA 1JZ5A 1L6ZA 5FGSA 5KSBE 5IW6B 4FQLH 35C8L 1R3KB 2PTTB 1UVQA 5D7JA 3SGDI 1P4LB 4OZIE 1E6OL 1HNFA 3SCMA 3AREC 1KACB 4JB9H 1JTTA 5DQDH 5DJXA 5LAXB 4Q0XL 5CEZL 4JRWA 4WFED 5D5ME 1CG9B 2ICWA 1Z6JT 4FMFA 4JFXA 4KKCC 4YLQT 1RI8A 5CGYD 3DVNB 1I8MA 4TUKL 4CW1A 2YWZA 1GCFA 4O2FB 2JELH 4FQXA 1KIRA 1IC5H 5BXFB 4TVPE 4U4BA 3HMWH 4HUXB 3MFFB 3TO2B 2JCCA 2OMBA 3RVTD 2BOCA 4OZHE 5GS2H 2DQFA 3L1OH 5F7NC 5A2JH 2DI7A 3VCLB 1ZANL 5SX5K 3TBWA 2E8ZA 5IHBA 2HJKB 1L7IH 2NY5H 2GFBA 5HPMB 4XCNB 1X9QA 3PHOA 1GPOH 3OQ3B 1BD2D 4CADA 4JDVA 2Z8RA 1MCWW 4PRDA 1WVZA 3EOBA 2P8MB 4V1DE 5L2KE 4GMSL 3DX6A 3MV7D 4H8WL 3WIFB 1CLCA 5M7QA 2CGRH 4OV6F 3DUSB 5KZCB 4FXKA 5GJSH 3RTQC 4UBDC 3HC0B 3TN0C 3EYSL 3MBXL 2BSRB 3LAFA 4L4VA 3PQYB 4D0DA 1MCEA 5ID0B 2ZJSH 4L8SA 1FYHB 3KHOA 5HGBB 4E41D 5HHOB 5GSVA 4GRMA 4PGEB 1INDL 1BD2A 3QDGA 3V4PH 1UENA 1YYMH 3P4OB 5B38B 3C5ZD 1B0GB 3MV7A 1M4KA 1NPUA 3KYAA 5L2JB 3C09B 4GKZA 2XV6B 4N8VA 3OV6A 1W72A 1M7XA 2ZUQC 3RIAK 5AG9A 2HFEB 2E7LC 4WI3A 3UTTB 2WW8A 3LQZA 5C0FA 5T3ZE 12E8L 5DMGC 4OLUH 1U95B 4WUUA 1AQKL 3C5ZA 3QUXC 1HIMH 3BKJH 3D3VB 2CDEA 3RGHA 4LASL 1T0NB 4F37F 5L7XL 5DD0H 2Q3ZA 4G9FE 1J8HB 4TSAH 4XBPA 1CU4L 2JK5B 2ED8A 2MWCA 4WVRA 2BY2A 2W0FA 4PRPB 1H3TA 1IMHC 1FNEA 4E42B 1WIUA 3TWCH 1E4XL 3LY6A 5IB1B 1LO2L 1FDLH 2Z4QB 5BCAA 2V17L 3KLAA 5LKNA 4NWTH 4TNWF 3AS0A 2C3VB 4PB0H 3P9MA 5C07E 4AL8L 1KN2L 3GJEA 4OCXH 3VD4A 1ZA3A 2J4WL 1A3LH 4GRLB 4MB3A 1HEZB 4HKXA 1TLKA 4ONHA 2YBRB 1LO3H 3DTXA 3QZWG 1S78C 3E6FB 4URTB 1ND0B 4PJAF 1I3UA 1C08B 3WSQH 3WXVH 1D6VL 3CVHL 1VEMA 5IR1B 2EDBA 3D2UB 3S35H 4HG4K 3DO7A 3AREA 1DQLL 5DR5L 4M1GH 2H32A 3ARXA 4M1DL 4GRWH 3VJ6B 5AZEH 2NMSA 4YQXH 4OIIL 3ULUC 1JZ6A 1MI5B 5CBAA 1SYVB 3VD7A 2EE2A 1T1ZB 3PJSA 5I8EB 3S34L 2ATPB 5ALCL 1FE8L 2YEZA 5BV7H 1FFRA 3GJFK 4KZDL 4Z76A 4JDTL 3PWNB 2WIIA 2OL3B 2X41A 3RUGA 2Z91B 3MR9A 1JZ4A 1BP3B 4RMVA 1N7MH 1B6UA 2Y06L 2W65B 1GXEA 2ZOLA 1I9IH 2R2BB 3LV3A 3TT1L 2PTVA 4Y4FB 1YUHA 2IPUK 2P46B 1FORL 5F8QC 4P5TD 4F7PA 4U1SB 4FNLH 1HHKB 4UBDD 1RAMA 3TN0D 3SKNA 2IADB 5ESQA 4U6VL 2R2HA 5HHXH 2VLJB 3C09C 5GGTA 1A9BA 4PTUA 3B9EA 3MRPB 2V7NB 3VH8A 3S36H 4WFHE 3JUZA 4FFVD 5HI3C 5CD5D 4IIQC 4M7LL 4KRMB 1GHFH 3QI9B 1EFXD 5J6HA 4LSTL 4EBQL 4LPCA 3HPJA 4P4KB 2JE8A 3ROLB 2XNAA 3MA9L 4TN9A 3RTQA 4JFFE 3S37L 3TN0A 4M6MH 5FB8A 4WW2B 3MZGB 4Z6AT 5B4MC 1T66D 3AXLB 4MB4A 5D70L 4ZD3L 4D0CB 4E0RA 2DM2A 4M8QA 2Q3AA 2BX5A 3MJ7B 2ZUYA 4PJEB 4G6FB 3ALWA 5FIEA 2I60L 2FIRT 3MNZB 5DD3L 4G3YH 1FC1A 3BGFB 3QHFL 4LPYA 4EN3B 1AH1A 5JHDE 5ACMA 4I5BB 1DL7H 5DZLA 3IDIA 2E7LA 4YH6A 1J1XL 5F1OB 1RK0B 1WTGT 2I07A 2R56H 5F3HA 3B9AA 3U1SH 1MCPL 2F53B 3NZHH 1MRDH 3G6JE 4FS0A 4LMQE 1QBMH 1IEBA 4GRLC 1KXTB 1KIQB 4Z7WE 3QUXA 1KEGH 1HSBA 2VZSA 4N5UA 3AM8C 3MRKB 4U1MA 2VO5A 5F7KC 5IW6A 2OI9B 1R3KA 1XGUB 2PTTA 3C2AH 4M48H 4OLVH 5E70A 5SWSB 1P4LA 1R5WB 1DQDH 1VA9A 3MLXH 4HIXL 1Z9MA 2D0FA 1W72H 2Z93B 2HTKC 4QRSB 1YNTB 5C0BB 3FQWB 1KBGL 3QDMB 1J1OL 4LEXH 4AYFA 3VGGA 1MCWM 3EYQC 1F3DJ 4RRPG 3SO5A 3FQNB 2VDRH 1I8KB 1CG9A 4KAQL 1XGYH 4MD4B 3DV4B 1I3GH 3TP4A 4LP5A 1ZGLP 2DKMA 3NCJH 1KYOK 2F74B 3L95A 4PJCE 1C8PA 3DVNA 3ULUD 4UB0L 5HDOA 3DVGB 4O2FA 4X7CC 5TE4H 5F9OH 2EDRA 2YWYA 3MFFA 3TO2A 5JMRA 2X9XA 4RMUA 5L88H 4Y4FC 4LPWA 3TYFB 1HKLL 2R1YB 3TNNA 2X44D 4P9HC 3VCLA 3DMMB 5F7UA 2HYMA 1CTOA 2ADFL 4JFEE 4LSPH 3N1PC 4YGAB 5D1QD 3LRHA 3QIBB 4EQ3A 2HJKA 1UEMA 5HPMA 1A47A 5I1IL 3BE1H 1DN2A 4JQVC 4KVNL 4MHHG 2FBJH 3GSVB 5AYQA 1WWWX 2P8MA 3QI9C 4YE4L 5KVGH 3WIFA 5FYJU 4P4KC 4X99B 3DUSA 3PL6D 5I66A 3HC0A 4QO1A 4WCYH 4X7FC 2VDLL 2NY7H 1NUFA 2BSRA 5GRJL 3SGDH 3PQYA 4WW2C 1UZ8A 1LP9E 5ID0A 5HGBA 1JGDB 2H32H 4K7PL 5DO2C 5F7EH 4JPWH 4YBQD 4PGEA 2AP2A 3P4OA 4OM0L 3ZL4H 5B38A 5F70A 1B0GA 1U8HB 4C55A 1XF3B 1BVLB 4RGNE 1R3LB 3BGFC 4EN3C 3UXFA 2F5BH 5B4MD 5L2JA 2CMRH 5IGXH 3JV0A 2HFEA 1JRHI 4R7DB 1J8HD 1K5NB 3ARYA 3UTTA 3O8XC 5F7LB 4IIQA 4I18B 4FXLA 1OD7A 1O7VA 2AXGB 1A6UH 1ZLSL 1U95A 1K4CB 1YJDH 4PRPD 3SKOB 2W0LA 4KTEH 2GK0A 2XZZA 4DN4L 1BQUA 2ZCLL 1RUKH 1FCCA 3MRFB 3FRPA 1DQTA 4TNVK 1JYXA 1G0DA 2X09A 1T0NA 1J8HA 2VSCA 5DHXB 3MOAH 4GRWE 5FEBA 2JK5A 4GKSA 5ALBH 1MOEA 2BXYA 5GGTH 2VXVL 4PRPA 4RBPK 4UQ3B 1FLRL 3SDAB 4E42A 2YD3A 2VLLB 4XP5H 2VDQL 5IB1A 1OVZA 4KVCL 3ZE0E 4PY8J 2Z4QA 3JXAA 4RAUB 1Q9WB 4GAFB 3WE6B 3QCTH 4JFDB 5EU5B 1NBYA 2C3VA 1MHPL 2FEEI 1FGVL 4L3EB 2HTKD 4PRHB 4O2CB 4GRLA 3GK8H 4BUHA 1SJXA 1HEZA 3PG2A 3A6BH 3AM8A 2YBRA 3JV6B 4HGKC 3SJVB 3EYQD 1BEYL 1ND0A 5DRNB 1KB9J 1C08A 4LK4A 5TE7H 4JO4L 2XZQH 5IR1A 5JPMA 3D2UA 3V5KB 1IRAY 4MXVE 1TCRB 2CDGB 4HK0B 3EHBD 2MQ0A 5E2WL 2CKBH 2YPKB 3JWDC 1U9KA 4NPYB 1OGTA 3CFDB 3VJ6A 3DMMC 3MLYL 3OPZL 1NGPH 3BUYB 2EO9A 4DGVH 1R3HB 5I1GH 3D1MC 1SYVA 3T3PE 3HE7B 3QIBC 3MNVA 5F96L 2ATPA 5FKPB 1RJYB 1DANU 1AI1L 2NYYC 5MHSD 2K7QA 2JCCE 1HQ4B 4U1NB 4WFEE 3PWNA 4U6TA 4YUEL 5JW4Q 2OL3A 4NJ9H 1A14L 3U48A 5C0EA 2Z91A 4X80L 2VLJD 4FFZL 4TRPL 4XB8A 2XN9B 5FV1L 4OIAA 4FQCL 2W65A 5DUMH 1UYWH 2HH0H 2R2BA 3QI9D 4Y4FA 1JZ2A 4BSWB 5KS9E 2RBLA 4YHOL 3MV11 4P4KD 4U1SA 1HHKA 4YAQB 4MA7H 4P2QB 4V2CB 2CUMA 1WZ1L 4R4BB 3IDMB 5A3IC 4R90L 2VLJA 5A40E 1X44A 5D1XB 3MRPA 2WWMD 4M7KL 2V7NA 5DO2D 1WIPA 3EO9L 4HV8B 5T1LB 4JQVA 3BT2H 2N7BA 4IRSD 1RD6A 4I18C 1CWVA 3QI9A 1BD2E 2EXWC 1RZKL 1VB9A 4S1SL 5JIKA 3CCHA 4P4KA 1FZMB 1YY9C 3ROLA 3QB7C 4EN3D 3LMJH 2E27L 3RX8A 3MV7E 1NUNB 4WW2A 4XAWL 5GGUA 2V2TB 1KFAL 1HXMB 3AXLA 3O8XD 2B39A 4D0CA 1BJ8A 3MJ7A 4E41E 4PJEA 3HR6A 4DAGH 3KYNB 2E8YA 3JBG7 3MNZA 4U1LB 5E8PB 3TEUA 2WV3A 5LXGH 3QQ4B 4EN3A 3SDAC 2F5AL 1UM6L 4WFGD 5AAMA 4I5BA 4OF6A 1P9MC 5AUMB 2NXZD 1FGNL 1S7VB 5TQ2H 4Q9CA 4P2CG 1NAMB 3O8XA 1RK0A 4TTDC 5GZOD 1EJOH 3LS4L 3VI4F 1WAAE 2XA8H 1X5ZA 1KC5L 2PUQT 1KIUA 3MRKA 3QEQD 4S10A 3W11C 4NN5B 5T1MB 4BM7A 4XPFL 4GQ9L 1XGUA 5SWSA 4OD1L 2EIEA 4PPTA 4D9LL 1E0OB 3WD5L 4X6DF 1YNTA 3CMGA 5C0BA 3MLRH 4JFPB 4WGVB 3FQWA 3O3EB 1OAYH 2Y9RT 5CHNB 4GKOA 1AC0A 1AR1D 3QDMA 4LHQB 1KNOB 2PYEB 2DJ4A 4TUOB 4YHLL 3HE7C 4TUJB 3QJHB 5GGQL 1MWAH 2DICA 1I8KA 2HA1A 2MKWA 2VC2L 1KXVC 4WEMB 4PJFA 4MD4A 3DV4A 1DFBL 3GNMH 3DMMD 3FMGL 2F74A 1QLEH 2Y5TB 5F9DC 25C8L 2EC9T 1G9ML 1A3QA 2R8SL 1FNFA 3BDXA 4MX7B 3RDTD 1NLBL 3DVGA 3UJTH 1OAUH 2NYYD 1J0YA 4FP8H 1MLBA 3W9DB 2V9TA 2AJXH 2VZTA 3TYFA 4ZNEE 2R1YA 5DD1H 1FZJB 1QYGH 3UJJL 2LTQB 3DMMA 3ZMRA 2KH2B 1EMTL 3FCTB 4YIQA 1JYVA 3QIBA 5D1XC 4X8XA 3UX9B 2VDMH 5I8KH 4HBQA 4X9IA 3GSVA 4ZPVB 1X6NA 4Y4KB 2FX8H 1U2HA 3FO0L 4X99A 5CINL 5J1SC 4DKDC 2ICWJ 5A3ID 1RZ7L 4OV5B 3SGEI 3CXHJ 1Z2KA 3QHZL 5CUSL 1JGDA 5EIIB 1SBBA 2VIRB 3EDFA 2EXWD 2O26U 8FABB 1YY9D 3WUZA 1QFUL 5FYKE 1U8HA 1XF3A 4IS6A 1F6AB 1R3LA 4YHNB 1PZUB 3LKSB 5TF0A 1MCDA 1K2DB 3O4OC 3RKDC 2FHCA 4R7DA 1KTLA 3TO4D 5IBTL 1K5NA 2OL3H 3MRQB 4I18A 1QTYT 2H3NB 2GKIA 4X5WB 2AXGA 4XVJH 2DQDL 3DRQB 3P4NA 1K4CA 4ZMAT 3SKOA 5LCVH 4KZEH 1R5IA 2EDHA 3L3DA 3MRFA 1VDGA 1XT5A 3RQ3A 4NN5C 2ZNWA 3LQAH 3AFLA 1CLYL 3A67L 5SX4I 4P9HH 4XT1C 4S0TD 4YHPB 5EA0L 2H1PH 4L3ED 2Z9TA 5KSBF 4LLVA 1KTRL 2BMKA 3VFVB 1G7MB 1QSZA 3QNYA 3VW3L 1LO4L 4UQ3A 5EBWB 4OZIF 3SDAA 3SJVD 2VLLA 1P9MA 4RZCA 3REVA 3LKNA 1CIUA 4Y2DB 5J3HD 4RAUA 3WE6A 2IBGA 5E8DL 2HFGL 4JFDA 3CH1A 2ZSWB 5EU5A 2ZG3A 4OUOA 5HJ3B 4JFZH 1IC4H 4IM8A 4L3EA 3WLBB 2XFXB 4XNXL 4O2CA 1KIPB 5DA0B 2OMNA 3KPRD 3M1BB 4Z78B 5D5MF 2AJVH 3MRNB 1MY7A 1OTTC 1YEEH 2D4DA 1RUAH 3MRIB 2BJML 3KVQA 5E2TL 3JV6A 3SJVA 4PYHA 2X9YA 4PUBL 3MLZL 5DRNA 1MVUB 4Q9RH 4OFPA 4TSBH 4U6YB 3MREB 3V5KA 1TCRA 2CDGA 3QWQB 5DWUL 1YN6B 2YPKA 4YHIA 4Q2ZB 4NPYA 3CFDA 4GOSA 4DK3A 4OZHF 1L7TH 1JRHH 4AMKL 3BUYA 1WWBX 3FO9B 4JM2D 1QFWM 1R3HA 2X1XR 3HE7A 1JFQL 1DE4B 2P45B 5D96B 5FKPA 1RJYA 3OZ9L 1HQ4A 4U1NA 4Y4KC 1MAML 1IAIL 3RFZC 2NY6B 3LEVH 1MCRA 3MUGB 2EZ0C 5DK0B 3BYTA 5D1XD 1XF2B 2XN9A 2EIZB 4JM2A 3LH2L 5MP6L 3ULUE 4FQJL 2QJDA 1EEYB 4W4OC 3K8MA 1EV2E 3W0WB 4RRPA 3V9FA 2XZCL 2A9NH 2I26N 1JPTL 4BSWA 2Z8WC 3BGMB 4KFZC 3IJSB 3AU1B 4YAQA 3QWRD 4I77L 4XC1H 3VXUB 3Q6GL 4P2QA 4R4BA 3IDMA 5D1XA 1A7PH 4HV8A 4Q74A 5D72L 1EEUA 2UY6A 1CFVL 4BH8A 4G7YH 1FZMA 4QHNB 3RBGA 1R3IL 1IJ9A 4NNPH 1N6QL 4LSSH 3RKDD 2V2TA 4P23D 1HXMA 3JWDH 1LK3L 5C9JB 2FIKB 2X7LA 4JJHA 3IAGC 1AKJB 1EHLL 1V3LA 1MIMH 4OFIA 4APQB 4Z0XB 1CE1L 3K0WA 3KYNA 3KYOB 4U1LA 5DUPH 5E8PA 4HK3J 1NGWA 3QQ4A 4AH2B 4HJ0C 4R2GB 5AUMA 3R06B 4F7EB 3BIKB 1F4WH 1S7VA 3JUYA 4Y2DC 1UACL 1CDJA 1NAMA 4JFQB 3BIBX 4L29B 2EECA 1GZQB 1RMFL 5FO8B 2CXKA 1J8HE 1KT2B 1U58B 2FJGB 2MTPA 4HMEA 5TQ0L 3V7AG 3K81A 1OTSC 1DBBH 5IB2A 4M7ZB 2XG5A 4PRPE 1J05A 1GGBH 1HH6B 2FH8A 3QXWA 3HUJB 3CXDL 2QSCH 5T1MA 4LCIH 2KZWA 5FYJL 3JTSB 3IRZA 1QFPA 3BVNB 2ICEB 4X83A 4LNRB 2AK4B 1DVFD 4PBVC 4HJJH 3M07A 4JFPA 3NA9H 5HYJB 5CHNA 3ZKNC 3WFEL 1KNOA 2VAAB 3CX5J 1X5YA 5E08H 4KMTL 4TUOA 4TUJA 3QJHA 3QRGH 2XWTB 6FABH 4MVBC 3LKOB 1D5BB 1PG7X 4MJID 2NY6C 1DEEA 1ZLVH 1C1EL 2Y5TA 5I75B 1CDHA 1Q0XL 2CK0H 3MV9B 4NSKB 4MX7A 1IL1B 3IDNA 1B3JA 2ZCKH 3S5LB 4NKOB 4HZLB 5DMIL 3TC9A 4XMPH 5JTWA 5KG9B 3W9DA 4Y4KD 3TF7C 5I1KL 1HKFA 2YPLB 2XZAL 2EZ0D 3KPNB 4PJ8B 3QNXB 2DIBA 2AI0L 4Z77B 3FCTA 4ZUSB 4G8EB 5BQ7B 4O4YH 2I5YL 5TFSL 1G6RL 3VXSD 2PN5A 1KN4L 5JW4N 4ZPVA 4Q97A 4Y4KA 1A1MB 5MHSE 4QRRB 4G6JH 5L6YL 4M6OH 3TZVB 5LJYH 4OV5A 3G9AB 3ROOB 3VFRB 4AENB 2B2XL 2XOTA 2VLJE 4W4OA 5EIIA 4JKPH 3ZE2F 2VIRA 3VXSA 4EJ1C 3S7GA 1LO5B 5HGDB 4FQ1L 4APQC 8FABA 5F7MC 1QA9B 1F6AA 4YHNA 4R2GC 5I8OL 2K9UA 3LKSA 5C2BH 1K2DA 1W0VB 4N1HB 1GGTA 3ZDYE 3VFGH 5ICZA 4JY5H 4LLUB 1GSMA 4X5WA 3UMTA 2VDOL 4UDUB 2ZUVA 4NO0B 3DRQA 1MREL 1WITA 2UWEF 4M7ZC 2DM4A 4HJ0D 3A6OA 3K74B 3G6JF 4OZGB 4Y2DD 1L9NA 2EH7L 3Q3GB 4WTZG 1Z9SA 4KJWC 5C6WH 1J18A 5IFHL 2W9LA 3VFVA 4HWZB 4OI7A 3EOTH 4X9HA 5EBWA 5C1MB 3TV3L 3T2OA 1T2XA 5F7HA 4J3WA 4Y2DA 4WFGE 4NHCH 4KK6C 5FGBC 3B2VL 2ZSWA 5HJ3A 1RU9L 2IBZX 1IC1A 2XFXA 2CJUL 1WTLA 3ZHKA 1KIPA 1FG2B 1LNUB 3M1BA 3SGEH 2Y07H 3ZKND 3MRNA 3VXPA 2IF7A 3MRIA 5I75C 4OGYL 2MNUA 3QBTB 4NQSB 1MVUA 3QEQE 4CGTA 4LL9A 4LEOB 5F9WB 3F7RA 3PABA 1DLFH 3MREA 2C3XA 4DKFH 2NY6D 2QQLH 4PJFE 4Q2ZA 3P0VL 2WUBL 1Z5LB 4UDTA 3MYJA 3FO9A 4LSVH 5IHLB 1CLZL 1CL7I 1UH2A 1DE4A 4Q6IB 4K7PX 4WI7A 2QSVA 3I02B 5EWIL 3FOLB 1JWMB 3L7EB 3DXAD 5I18H 3V8CA 1F8TL 4QXGH 3W82A 1NGXB 3PWLB 3MUGA 2KDGA 4OLZL 1N0LA 1ED3B 5DVMA 5SX4H 3TZVC 3AS1A 2EIZA 3D69B 2PR4H 1LEIB 1EEYA 15C8L 1JNNH 1IC7L 2VQTA 3W0WA 1LP9F 1RY7B 2DYPB 2OTPA 3GBNL 3OSKA 3K2UL 3BGMA 3DXAA 2R9HC 3IJSA 4Y8DC 3AU1A 1U36A 5DJCB 3VXUA 5IW1B 5B3JF 5FUZH 4PJDB 3PGDB 3SE3C 1TTGA 1AKJD 3U0WH 4LAQH 1F6FB 1F4XL 2F9BT 4KRPB 2YD4A 4XP1H 4DOHB 4OI9A 3HZVB 4NOBA 4NO5B 4QHNA 5E56A 1S9VB 5IJKC 3INUH 4MSWB 1N64H 1A6WH 4CAGA 4ZUVB 5GRXG 5C9JA 1IGIH 1FBIL 5ESAB 3ULVC 2D0HA 1A6PA 1AKJA 4JREB 4APQA 1H8NA 3NFPB 1W2KT 4Z0XA 5DFVC 3KYOA 4JQXC 3K4AA 2AJYH 4GRWF 4AH2A 3OKOB 2R23B 4LDEB 3R06A 4F7EA 3BIKA 2ADGB 3PWPD 5CZXC 5LBSH 3UYRL 4F9LC 4RDQF 4KJWD 5E2VL 2YR3A 4L29A 2IBBA 1GZQA 3ZE0F 5FO8A 4WHCA 1KT2A 1U58A 2FJGA 5CZVL 1MRCH 4PGBB 3N0PB 1HH6A 2R29H 2R0WH 3PWPA 4G8IB 3JTSA 2Q7NA 4HXBH 5F9WC 3TH4T 3CLFH 2QQNL 3BVNA 2ICEA 5IF0A 4LNRA 3FFDA 1MELA 1G7JB 2AK4A 4L3EE 4X8JB 1BVKA 3MV9D 5HYJA 4MXVF 3D48R 5E24E 2VAAA 1YZZA 3SJVE 2UVFA 3IT8D 3OXRA 1BAFL 1T1YB 2WINB 5E03A 5FGBA 2BHZA 3UPRB 5J56B 2QEJA 2XWTA 4Q6IC 2ZCHL 3LKOA 1D5BA 3F7VB 2CIKB 4HD9A 1OT2A 3MA7B 1VFOA 2JCCF 1QR1B 3KPRE 3MV9A 3KLSA 4NSKA 4QOKB 3S96B 4FOMA 4U1HB 3UP1A 3S5LA 4NKOA 4HZLA 4Z7UB 1F00I 3RAJH 3PWVA 5KG9A 2CLRB 5KTEH 1S5IL 1J5OH 4QRRD 5I71B 5IESL 4TTGA 1IAIM 3NBNA 2IWGA 2YPLA 3KPNA 3QNXA 2J88H 5KS9F 4Z77A 2W07A 4ZUSA 1CR9H 1RZJL 4G8EA 4OCWH 4MLIA 1MCFA 1FSKB 4LLAA 1AC6A 1N26A 2E9JA 2R0LH 1PQZB 1A1MA 1RUMH 3EAKA 4NWUH 4D94A 4QRRA 4KRPC 1RULH 3TPUB 3TZVA 4F7MB 3ROOA 2IPUG 2W59A 3VFRA 3VGHA 1A6TB 4AENA 3ZKXB 5FUOL 5FOJA 2P7TB 1LO5A 5EBMB 4JREC 3T2NL 5HGDA 4XXCC 4GS7B 3G6DH 3GHEH 1QA9A 4Z8FH 4XPAH 4PY7B 2FHBA 3SE3A 1W0VA 4PJ5B 4JCLA 3ULVD 4LLUA 3HC4H 3TT3L 1BMGA 2PO6B 4UDUA 4WU5B 4UTBH 2QADB 4AG4L 2B5IB 4WRLA 5M95B 5IJKA 4OZGA 1TPXB 4JZNB 3Q3GA 3UJIL 4LRIC 5IMOB 5IFAL 1ZHNB 1RIUH 5GISL 4DQOL 2YXFA 1CVRA 2BSSB 3FB8B 5KVDH 4HWZA 2O5ZH 4EI6B 3G5VB 1I8LC 1NDMB 5JPNB 1A3RH 1FG9C 1NCDL 4PD4J 3RNQB 4YDIL 1GAFH 5BS0D 4KKAD 1HOCB 2V7HB 3MODH 4F9LA 2LAGB 3MXVH 1TZGL 2XG4A 3O9WB 3U0PB 4IDJH 3MOBH 3ZE1E 4EI5B 2F8XC 5JA9A 2L4OA 1BJMA 1FG2A 1LNUA 4UZGA 3NCMA 1GGIH 3E8UH 1RZ8A 5EU4A 3IU4L 5KJRL 4N8CL 2YOCA 3PIQB 2EIDA 4MJ5B 5HDBE 3KGRA 2VR5A 2XXCB 4WWID 3DO3A 1T2JA 4LEOA 1N4XH 3AVEA 3BWUC 4XP6H 5JQ6L 5I71C 4KPHH 4HC1L 4DGIH 1XAUA 1Y18B 4LCYB 1Z5LA 3QXUA 3DHJA 3RHWF 5DQDL 1OAQH 4P3CL 1TJIH 1FSKC 4Q6IA 5BMFH 4Z7OF 5DJ6B 3RUGF 2DYPD 3I02A 5IB4B 2JJWA 3L5WB 3FOLA 1JWMA 4NUGH 4NRZB 5D8JH 3L7EA 4MAYB 5JZ7C 1M1SA 1NGXA 3PWLA 3SQOH 4XCFL 4MJIE 3IFPB 5J1TC 1ED3A 4Z0BL 3S4SG 2JELL 3D69A 1BOGB 4F7CB 3HMWL 1ZLUK 4NZJA 3EYFB 1LEIA 3ZKXC 4JO2H 3D39B 4KI1A 2DYPA 2X1PA 4DN3H 1EAPB 4X5LA 4I13B 4GS7C 5CJXC 2NY1D 3CGTA 4RFOH 1CXHA 4M8VA 2CLZB 5DJCA 5IW1A 1B0RB 4JHWH 4NRYB 1L7IL 4ORZC 3PGDA 4PJDA 3TLRA 4XGZB 1AR2A 2YN3A 4HAGA 1A7OH 2FCBA 3VXSE 3BQUD 1T6VN 2PO6C 5CILH 3HZVA 2QADC 4NO5A 5ITBH 2B5IC 1S9VA 2GQHA 5DLMH 5A2LH 4AM0B 1YECH 2HKHH 4MSWA 1TPXC 2B4CL 4F9PC 3MROB 1X5HA 2BZDA 2ZJSL 4F3FB 1L0XA 4ZUVA 4Q58C 8CGTA 3UZVB 3HS0B 5ESAA 3V4PL 3CFBA 3V95A 4XXCA 3NFPA 1CK0L 4KGLA 5BVJB 3BDYL 3NIDE 1CL7H 3OKOA 1V3JA 2R23A 3DX8B 3UPAA 1T7VA 2ADGA 5CBEB 4GJTB 5EORH 5K93A 1OM3H 4OUUB 3O9WC 4ZXBD 1WISA 1NCWH 1LK2B 4U1KB 4XMLH 4D3CH 3UYOD 3IU3B 4EI5C 4K8RC 4PGBA 1HIML 3BKJL 4RISL 5FYLH 5IVXB 1LE9B 3IDJB 4U7MA 5D1ZB 2DAVA 1IGJB 5DD0L 4LRIA 4XPBH 4TSAL 3WNNA 1QFWI 3VG9B 5IK3A 1BECA 1N5AB 4GAGH 2YK1H 1G7JA 4X8JA 1I8LA 4F15B 5FDWB 2YA0A 3BD3A 5GRUL 1FDLL 4OF5A 4HFWB 1FL6B 5JR1L 3GRWH 3MV01 4NWTL 1T1YA 1KCVH 3GGWB 4PB0L 3UPRA 2DQIL 2EDXA 1BPVA 4OCXL 4IDLA 2X1WL 1LMKA 3F7VA 2FEDD 5CMAB 1N6UA 2CIKA 4H20H 4LIQH 4MAYC 4NQTA 3MA7A 1LO3L 4KJPD 4JAMB 3ULVH 3BISA 2FB4L 1QR1A 2EEBA 3Q1SH 4QOKA 5DMJB 5EH1A 5A16A 4U1HA 1H8SA 1OLLA 3WSQL 3WXVL 4M62H 35C8H 4KQ3L 5DS8B 4RMTA 3FJTA 1YEKL 5L0QB 2QV2A 1RPQA 2CLRA 1XFPA 3ULUF 4XMKH 2AXFB 1MFCH 4OZFB 5JZ7D 1X5KA 3VI3E 5AZEL 4JM4H 2ATKB 5FFLA 5E8EB 4KTDH 4WHTB 3RRQA 1L4IA 3K3QA 2QSTA 2YA2A 2FJFB 5J0BA 4WW1B 1I7UB 3LCYA 1A9EB 5EULV 4EXPX 1BGXH 3PWJB 5IHZB 3MCLH 3TPUA 4ZFGL 2BC4B 3DXAE 4IBLT 5GJTH 3MGOB 1H15A 4F7MA 1N7ML 4HEME 1A6TA 5DJ8B 2EO1A 5EOCL 4X4MA 2P7TA 2PO6D 3F6IA 4PJAB 3F5WB 5ITFB 3LQMA 4KHXH 4FNLL 5MEPB 2YD2A 4CU7A 2DF3A 4HK3N 1B4JL 1T2QH 5CD3B 5CJXA 4L9LB 5HHXL 5CJ5A 1YEHL 3WIHA 4J3UA 1WWAX 3ZYIA 5CSZB 2NTFB 2AEWA 4PJ5A 1NC2B 4HPYH 3S4SB 5EZIH 2KUTA 4X4ZA 5I1AA 5C6TL 2GUOB 3GSUA 3IGAB 5EC2B 3Q0HA 3G5YB 2PO6A 1WEJL 4WU5A 4GMSH 4MNGA 3WO4B 4LARH 1QRND 5ENWB 3MGAA 5I30H 4M6ML 3ARVA 1ETZB 5D1ZC 4F9PA 1HWHB 1Y0LB 3Q6FB 4JZNA 3O9WD 5IMOA 3VG9C 1INDH 1ZHNA 1AGFB 2J1KA 1T83C 2BSSA 3FB8A 4EI6A 2FATH 1INQB 3G5VA 5B8CB 1NDMA 5JPNA 5TF1H 4F15C 3RNQA 1DL7L 1KCUH 3PF2A 3V5DA 4L4TB 2EDTA 5HSFA 1ZEAL 1HOCA 3CX2A 3H9ZA 2V7HA 4F8QA 3O9WA 3PWPE 12E8H 2SEBB 3NZHL 1QBML 4EI5A 4XNYL 2J8UB 2EYSB 2W92A 3QIWB 4ZFFB 4PJ7E 3PIQA 4MJ5A 2E7BA 3C5JB 4X5XB 3GBLA 3C2AL 4OLVL 2BNUB 5L0QC 1HNGA 1YMHB 4MMXC 1W72L 4GKNB 4MAYD 1Y18A 4LCYA 3QDJB 4LEXL 2WSKA 3QXAB 4H1LG 1MHCB 1EO8H 1JGVH 1LO2H 1EGJA 2XXMB 3MV9E 1CGYA 2OTWB 2VZUA 2FO1A 1H3GA 3MRHB 1EPFA 5DJ6A 4NKQB 5IB4A 4QXTB 5D7KD 4OT1H 2J4WH 4JRXD 1YPZE 4NRZA 3NCJL 4MAYA 1CXIA 2B7DT 3ALPA 3C6LB 3C6SB 3PNWB 5I1EH 4P2YA 3IFPA 1P7KB 2MOVA 1QFHA 5TE4L 1QLRB 5F9OL 1BOGA 4F7CA 1MCIA 4ZUUB 3D39A 5E5MB 1EAPA 4X6FB 2IQ9H 5DR5H 3FT3A 1RFDL 4QRRE 4L9LC 2CK2A 2CLZA 4OIIH 1B0RA 1O7SA 4NRYA 4NQCD 3IJHB 4H25B 2D2OA 4XGZA 1FE8H 4OD3L 4KZDH 1YYLL 1FJ1B 5KAQG 3PP4L 4WW2F 5KVGL 4JDTH 4HX1B 5FM5O 4H88H 4WCYL 3P0YL 2NY3B 1SY6A 3QPQD 4AM0A 3T0AA 3QUZB 2E7MA 4PJEF 5CLTA 2Y36L 3MROA 4F3FA 2VXQH 3VFTB 1FYTB 2FL5B 5F7EL 3HS0A 4JPWL 2WQRA 5E9DD 4JFHD 1FORH 3ZL4L 1FRGH 5B39G 1P7QD 5B8CC 5BVJA 2EDWA 3ARSA 3EDJA 2F5BL 1AO7B 4U6VH 2CMRL 5IGXL 3DX8A 5CBEA 3UBXB 5FV2A 2VL4A 4OUUA 4YC2B 3RVUD 5HY9A 4M7LH 1A6UL 3ULVE 1WJ3A 3IU3A 4HIIB 4KTEL 5BZWA 3IFOB 2F58H 3S37H 1P7QA 1ZLWK 4XCCH 5IVXA 4ZUTB 1Z9OA 3IDJA 4WU7B 1RUKL 5D1ZA 3QIWC 5I8CA 1IGJA 3D9AH 4NIKB 3TPKA 5J89A 1OOAA 5D70H 4IJ3B 2QHLA 1JNLH 1N8ZB 4IMKA 5ALBL 1OP9A 1T83A 5GGTL 4PLJC 3RZCB 2ZWLT 3MRGB 1WBZB 1QNZL 5FDWA 3QHFH 4R96A 5DZNA 3X13B 3ARDD 2HLFD 5ISZD 4IRJB 2XPGB 4PJFF 4HFWA 1FL6A 5CFHA 2PXYB 4XZUA 5BS0E 3QCTL 3GGWA 3ZTJG 2DRUA 3OKKB 2FWOB 1G9NC 1V7NH 2DQTH 3NIFE 2IQAB 3A6BL 3C6LC 3I6LD 1BQHG 3V7AE 5EO0B 2NW2B 4CRPA 2DS4A 4X7TB 2EDNA 2XKUA 2FBOJ 5TE7L 5DS8A 5H37H 1MCCA 2AEIT 2R69L 5C0GB 1ACYH 2ITCB 2BP3A 2EIBA 2AXFA 1TJGH 4AQ1B 5IT2L 2UUDH 1NGPL 2P5WD 1J1OH 4HULB 5I1GL 5ACZB 1IM3B 3OAYK 1EFQA 4MJ4A 4K8RH 3SPVB 2FJFA 4U0QB 1NKRA 3WDIA 4WW1A 4ODSL 1I7UA 3TBVB 3GB7B 1A9EA 3NA4A 3S88L 4NJ9L 5EIQA 3PWJA 5IHZA 2NY3C 5EO1B 1QFWH 3UTPD 3MGOA 3QUZC 4UB0H 2BVYA 3ARGD 1ZSDB 4JHAH 5DUML 2I27N 2HH0L 5DJ8A 4U33A 1LQSR 3HNSH 3MGTB 4PJDE 2VUOA 5F7YC 2A83B 5T3XD 3E6HB 3VD5A 2BNRD 2IEPA 4R3SB 5ITFA 1HKLH 1EGJH 5MEPA 4LPVA 5I0DA 1PDKA 4MA7L 5CD3A 4L5FH 4L9LA 5CSZA 3UBXI 2GCYA 2NTFA 5GS0C 3S4SA 3BT2L 3P2TA 1U8IB 3WO3B 4YC2C 2GUOA 4KVNH 3IGAA 5EC2A 3KDMA 3G5YA 4BFIA 5GRWA 4YE4H 3FFCD 5EPMA 3UC0L 3VDAA 4NQEB 1MCKA 4X6CB 5DJ0A 5ENWA 4TVSa 4K23H 1OTUC 1QUNA 1UB6B 2ARJB 1ZGLM 2NXYD 4UI2A 3OGOE 2R0ZH 4DAGL 1FHGA 4QHMA 1AGFA 3ULUL 4HS8H 3C60B 5DD6B 3RZCC 5B8CA 5HHQB 5LXGL 4U3HA 4ZOBA 3QIWD 1CFBA 1SMOA 4HWBA 2YSSB 1I8IB 4M43H 3H3BC 4IRJC 2DLHA 4L4TA 5TQ2L 5AZ2H 4AJ0A 5K9OB 2PXYC 2DKSA 2SEBA 3OB0H 1EJOL 1NMCB 1K6QL 1SY6H 3GI9L 2W0KA 5C3LD 1WWCA 5F7FA 2XA8L 1AGCA 1YNKH 3WJLC 2J8UA 1XGPB 1G7PB 5B39B 4X0KA 2EYSA 3QIWA 4ZFFA 1IAII 2ZPKH 2ZCLH 2JJTC 3NAAL 3C5JA 4X5XA 4O9HH 1CICB 4C56D 3V0WH 2BNUA 3K1DA 3NCYS 1GJIA 4P46B 4FTVE 4RFNB 4L4JA 3O2VH 1YMHA 3MJGX 4GKNA 3ARWA 2DWDA 3MLRL 4MNHB 2VXVH 1OAYL 3QDJA 3BWAB 3QXAA 3T1WA 1MHCA 3RBSA 4OF3A 4XWGH 2BVEA 2OTWA 1OGAB 2P42B 4D8PB 3MRHA 3IETB 1FGVH 2F54B 2ID5A 4LGPB 4MLSA 4QXTA 4DZ8B 4CL7A 5F7DB 2VXUL 4JM2F 3GNML 3C6LA 3C6SA 3WMSA 1P7KA 1BZ7B 1QLRA 3KR3H 2GAZB 1OAUL 3T0DA 3QDAA 4ZUUA 4FP8L 4JO4H 2AJXL 3I3EA 5DD1L 5E5MA 4JG1H 1QYGL 5E2WH 4X6FA 4OFKA 2NY3D 3MLYH 3OPZH 3QUZD 3WNPA 1PFCA 4X6DB 1H3PH 3B3IB 4LOUD 3TCLB 4BA8A 5C8JB 1FYTD 3IJHA 4H25A 5E2JA 5F96H 2VDML 2ED9A 5EBGA 1AI1H 1FJ1A 2FX8L 4X4ME 3EDDA 1NCCH 1U8JA 4HX1A 4GBXD 2A73B 3CSGA 4Q9QH 3HFMH 1AO7D 1X5AA 5IVOA 3QUZA 1A6VH 4FQCH 2VJXA 4OZFH 3VFTA 1FYTA 2FL5A 2EE3A 4LSUH 3C60C 4HBCH 3GIZH 4FABL 2DJSA 5DQJB 1G7IB 4MNGE 1TITA 1OAKL 1AO7A 4NO3B 1OTUD 2EDEA 2HMIC 3TFKC 2GJ6B 1JPFB 2J7LA 5CAYB 1BFOB 2OL3L 5ELIA 3UBXA 4K9EC 4N1EA 3P3YA 3SKMB 4JRYD 3LN4B 1NMCC 4XVJL 5ADPH 5GIRA 4NBYB 4HIIA 5LCVL 3MRCA 4KZEL 1LVEA 3IFOA 3AS2A 4Y88A 4ZUTA 4RIRB 4IRJD 4WU7A 1QRNE 3ZE1F 1JJUA 4XAWH 1KFAH 4EOWH 4WTWA 1FNAA 4YBLB 4P9HL 3MC0A 1AXSB 1CICC 4JPIB 4P57A 2QR0B 2H1PL 1N8ZA 3O41B 4P46C 2C4FU 4RFNC 5HDBF 4PP2B 3RZCA 3PXHA 1BZQK 3MRGA 1WBZA 1I7TB 2MJWA 4N0CC 3ORJA 3X13A 5K9QI 1J0IA 3HTLX 4IRJA 2XPGA 1MCLA 3F6LA 2QKIB 1FGNH 1F3RB 1P5VA 4LGSB 2PXYA 2DOCA 2RHEA 3LOWA 3LD8B 4JFZL 1IC4L 3VXRD 1ORSB 4PLOB 3WJLA 2AJVL 2GHWB 1YEEL 1SEBB 3J8F7 1XCQB 1KJ2B 2Q76A 2IQAA 4JN2B 3E3QC 4G5ZL 5EO0A 2JJTA 3FZUC 4XVSL 3K4ZA 4X7TA 3G5ZB 4Q9RL 1X4ZA 1BZ9A 4XPFH 5T1DH 2IAMB 4GQ9H 2DIJA 2HLAB 4BSVB 1U41A 5C08D 4OD1H 2HJFB 2XTJB 4HWBH 4J4PC 5C0GA 2D4FA 4QCIB 1KUMA 4I2XB 2ITCA 3BZ4B 1C5CH 4HS6B 4S1DC 1PAMA 4BK4A 3ES6B 4QRPD 4O58H 5ACZA 1IM3A 1MEXL 2XWJB 1DQQB 4WDIB 4P59H 3TBVA 3GB7A 1XF1A 3C5SB 1TVDA 2OTUB 3LEVL 1KULA 3SDDB 3VXTB 5D7KE 4KROB 4JRXE 25C8H 1G9MH 4WHYG 5SWQB 2R8SH 5EO1A 4W68A 1HH9A 1NLBH 3S8WA 1XMWA 3V6ZB 4HXAH 3MGTA 2A83A 5INDB 1RK1B 3E6HA 3PDDA 4R3SA 3STBA 4NM8H 2HP4A 4QLRA 3UJJH 1L6XA 4XC1L 2HFFB 3MLTB 1CIDA 1G9NH 3RPKA 2EDKA 2FEEL 1A7PL 1EVTC 3ECBB 3PUCA 4OZHB 3MBED 1U8IA 2FHFA 4NQCE 3LPFA 4Y19D 3SDCD 4EXKA 4DGYH 1I7RB 4X6CA 4S1QH 2WBJC 4NNPL 1G7HA 3R8QA 3EJYD 4LSSL 3D85D 5DUBB 3JWDL 3RWGB 3ZO0A 1UB6A 5D71H 2ARJA 4ACPA 1J88A 4YBLC 2HT2C 3FHAA 5L2KB 1I7ZB 2K1MA 2BERA 5E9DE 3C60A 4Y19A 5DD6A 4EEEA 1KELH 4JFHE 3H8NA 4KKBC 3RGVB 4X4YB 3S9DB 2YSSA 5IVXE 1CBVH 3H7LA 5K9OA 1CICD 4ZTPL 4U31A 1TZIB 4P46D 4HIEB 3LD8C 4DK6A 1MCJA 4BQ8A 1N59B 3S35X 2NY0B 3LS5H 3GMQB 4RMSA 1DBBL 3O6KH 4N0CD 3I85A 1XGPA 1G7PA 5B39A 2JLLA 2QSCL 3QT2A 4LCIL 3BPNB 1CLYH 1CICA 2IAMC 1FZKB 2BDNH 3WUWG 4P46A 1TQBB 2GSIB 4HFUL 1JPGB 2CRIA 4NOFA 5GS0H 3VGEA 1NLDL 5KANG 3NA9L 4MNHA 1DCLA 4YWGL 3BWAA 1H3UA 4UT6L 5HGAB 3WNLA 4G9FB 5HD8D 5E08L 1QZ1A 4FFYH 4ZODA 5ISZE 1QVOB 3QRGL 1OGAA 4D8PA 4J4PD 3IETA 3OJ2C 2F54A 4DZ8A 1WCBB 4S1DD 5F7DA 4RA0C 4XBGB 2BOBB 4MA8L 3OAUH 2BXZA 4RMRA 1XH3B 1AFVH 2CK0L 1WFNA 2IPKB 5E2TH 3O6FB 4LLWB 3LHPH 2ZCKL 1BZ7A 3I6LE 2GAZA 1JWUB 5C07B 3D0LB 4XMPL 2DQJL 3S36X 4J4PA 4OLEA 2NNAB 5IB3A 4GAYB 5EN2A 1JTPA 1MIEH 5CP3A 4X6DA 4P3DB 3B3IA 4LDOB 3TCLA 5IEHA 2E7CA 2P5WE 4YXKH 5C8JA 3PGCB 4QTIH 2GK2A 2O61B 4G6JL 1IAIH 3BD4A 3P4LA 1B6DA 2A73A 3W2DL 4M6OL 2L7UA 4WIQA 2VWEE 4ODVH 2GJ6D 3FRUB 5ICXA 3LH2H 1H3XA 3UTPE 4HAFA 4WI5A 1G0YR 2VLRD 4Y5YB 3CPLB 1JPTH 1SYSB 3E0GA 5T3XE 2BNRE 2WBJD 5DQJA 5FF6B 3QEHB 3RGVC 4NO3A 4KGJA 3VWKB 3B9KB 5C2BL 5HVGB 3JV4B 2GJ6A 1JPFA 5EU7C 5IBLD 4X6BB 3VFGL 1BFOA 3WYRA 4JY5L 3OHXB 2G5RA 2P5ED 3SKMA 3MZTA 2C4XA 3LN4A 1CFVH 2NY0C 4KKBD 4BYHA 5IOPB 2WBJA 3FFCE 4CNIB 2WLZA 1M71B 4HKZB 1C7TA 4RIRA 1N6QH 1PD6A 3BJLA 4YXLH 1IQDA 1LK3H 2EICA 3BPNC 4JO1H 5SWZB 1AXSA 4JPIA 2QR0A 3O41A 2P5EA 1TQBC 4N0RA 4PP2A 3VXNB 4F58H 3OKNB 3BDBA 4OFDA 4P3WA 4JR9H 2QKIA 1VACB 4OLWL 1PZ5B 5I76B 1ZVYA 3SE8L 4CVUA 1VENA 1ORSA 4B5EA 1RMFH 5ACLA 3RIFF 5C9KA 2Y07L 5JHDB 1F42A 3BH9B 1XCQA 1KJ2A 3O6FC 2YKLH 3G5ZA 3HI5L 5DRXB 1T0MB 2ZUSA 3F7YA 2IAMA 3IF1B 3G6JB 1TZHB 2DD8H 2HLAA 1KLGB 2HJFA 3WFBL 4C56E 4QCIA 4Z7WB 4I2XA 2QQLL 3BZ4A 4HS6A 1NAML 2AEPH 3ES6A 4LSVL 1Q1JH 3MQIA 4OBSA 3QCUH 2XWJA 1DQQA 2HJLB 5JHLH 4J3XA 2APXA 1MRFH 4WDIA 3LVEA 5CEXB 1GRWA 3AMLA 3UTOA 3RWEB 3C5SA 1ZVHA 2OTUA 4PJIE 5I18L 4QXGL 5DRZA 5T5NF 1EAJA 4XAKD 4ZS6C 5SWQA 5FCUH 2BY0A 5FO7B 1CF8H 3RJDA 2PR4L 2BHUA 5CEZD 4ERSH 3V6ZA 4UINH 5DMIH 4M5ZH 2G2RB 1UZ6F 1XEDA 5INDA 1RK1A 1FFQA 1MPAL 2A6KB 5D7LD 4PJCB 1F4HA 2E3VA 3CDYA 3QYCA 4PLKD 1FL5B 2HFFA 3MLTA 2AI0H 5J9PB 5FUZL 4PGDB 3VWKC 1ERNA 5GXBB 3ECBA 4J3TA 1JPST 5TFSH 3V52H 1FYTE 4LAQL 1ZGLB 4OZGF 3NGBB 1HHIB 4KJQC 4DUWA 1I7RA 2C3HA 4JFEB 1WCQA 1AGDB 2A6IA 5DVLA 5E1AB 2X40A 3INUL 5JOPD 3ULVF 1N64L 1A6WL 5KSVB 1AO7E 4C59B 5DUBA 3RWGA 1NGZB 1RUPH 1IGIL 2Z31B 3GEWB 4HIJA 4G43A 4NFCA 2Q7YA 5L2KA 1GZPB 5CP3H 4F57H 7FABL 4FQ1H 5CKAA 5LVEA 2AJYL 3U9PH 4OD2A 3RGVA 4X4YA 5HHPB 5HI5D 2DIAA 1T7YA 5I8OH