4F8NA

X-ray structure of psaa from yersinia pestis, in complex with galactose and phosphate choline
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
NTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pH 6 antigen
publication title Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell adhesion
total genus 18
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f8nA00
5LN8A 5LNDA 5LN4A 4F8NA 4F8LA 5LO7A 4F8PA 4F8OA
chains in the Genus database with same CATH superfamily
5EOTA 4YHOL 5MEQA 2FX9H 4HLEA 3DRTB 1OAJA 1IM9A 3TZVD 3D5OF 2OBGA 4K71B 4G9FB 2GSIA 4JN2B 5J1SC 1QI3A 2CHDA 5CEXB 4EAEA 5KJRL 3ARDC 1BM3H 3RIFK 1Q9KB 2VRKA 3PWNA 1TVBB 1DANU 4MXQC 4HT1H 1I8UA 3KLHD 5D2LB 2X6VA 3LVTA 3PWPE 3QS3A 3PAZA 4PGZA 4MB1A 3CZEA 1ROWA 4DP5X 4MHHI 1WAAF 4PJXE 3V5HA 4PJBF 3DJ9A 4QEGA 5HHXL 3CVHB 1S5HA 4UILH 3QFJE 1T5XB 4BFEA 1DBML 5IEKA 3K2KA 4YE0A 4JO2H 3EOAB 4O02H 1CWVA 4L1HA 4F7TA 3CXHJ 4PI2A 4PCKA 3SE3C 3O45B 4JZJB 1EBPA 3DXAA 4JO3L 4LKXA 3C60B 4OU3A 3VG0L 4JZOA 3U4KA 3UJJH 2OMTA 4BDVA 4G9DB 4OKVB 5MEQB 4AYDC 3ZX1A 3AG3B 1IM9B 3CFNA 4OD1L 5JHLH 2HFGL 2GSIB 5T1KD 3LS5H 2JKTM 2UZIL 3BFOA 3NJNA 3NQIA 2HTLC 2HFFA 3BVXA 1KGCE 3ME0A 1MCIA 4JPVH 3EW3B 4XNDA 1BPVA 3PWNB 3WS6C 2NT1A 2DWYA 5AVVB 2EIMB 4ERSH 2NNXA 4UT9L 4W9KC 2A6DA 2Z8RA 5FYKE 5IG7A 3FOMA 2VLJA 3V5HB 2NY4B 2W9DL 4UM9A 1S5HB 3QI9A 3SBWA 4L1SA 2VXQH 1TETH 2BY2A 3ZO9A 5IEKB 1QMUA 2HA1A 4F7TB 1NKGA 4FFYL 5DCCA 2CR3A 3L5WA 3DXAB 4YDIH 4LKXB 4Y8AA 1OP4A 4JZOB 1MQKL 2Q9OA 5K1NA 2OMTB 2H3XC 5AZUA 4BDVB 1GTFA 3MV9D 3OR7A 4GRWH 1FORL 4ABVA 5DVLA 3K5RA 4Z7UA 3TVMD 1FUNA 4BQBA 3LNDA 3P3YA 2CHXA 3AU0A 3P77A 4ODXA 4M1DL 4XPAH 2HFFB 4ZFZA 2RCSL 4JM4H 1QX1A 4RGNB 4OJFH 1C08B 1ZKAA 4ELKA 4Z1PA 1WFMA 4POYA 5DLMH 5IJCC 1MPAL 2W9EH 4KNQA 2YLHA 4AIZA 2X4TA 3QDMA 1OGPA 4ZMVA 2A6DB 4OZHF 5IG7B 3FOMB 3DTUB 1D3CA 4CC4A 4I48A 2XJKA 3SE4C 4UM9B 3QI9B 1PY0A 3O81A 5KZCD 1SN0A 1UB6A 4E41E 5L8LB 2IEPA 1PJWA 3F7QA 4X2UA 3FT4A 4B9IA 3MLRL 5FM5M 3KPSE 3L5WB 2O72A 4F58L 4NJ9L 3UPAA 3FYIB 2JIXD 4GFTB 3BEWA 4ZG1A 4TVPH 3KM2A 4TTDD 1DZ0A 3OR7B 2WWOA 4FQPA 4X42A 4Z7UB 2ADGA 3OX8A 3ZUNC 2L7UA 2VDML 2VXSH 3KLQA 1X5XA 4ODXB 1RHHA 1F90L 3P77B 1L7TH 4P5KA 1P84K 4GXUN 3VFGH 4ZFZB 5A2LH 4AYSA 4CSTA 2P5ED 3C08L 4GAJL 4CC1A 4ELKB 5AD0A 5EO0A 1KYUA 3SKMB 4WLCA 2X3CA 35C8L 3L5XL 3K74B 1KCLA 3R4RA 2X2HA 4AIZB 2X4TB 3QDMB 4EJ1C 4YHOH 4MQSB 4RAVA 1GXEA 5I75B 1BOGA 4PRPD 3A67H 2BNUA 4NAJA 3IDXL 4N26A 2L8AA 4I87A 3Q13A 4I48B 4QKXB 1KJ2A 4LK4A 4HMDA 2ZXWB 1UB6B 2X38A 1K5WA 3GSNA 4I0PA 4O4YL 4EDXA 3DBXA 1KENH 5KJRH 2AABL 3FT4B 5JIQA 1UOVA 4R4NC 5FC9A 2XTLA 3N55A 4JFEA 1O6SA 2HRGA 1OY3B 2OMXA 3BEWB 2BZ7A 5L8JB 1KYAA 5EULV 3BP4A 2XVBA 1PFOA 2ADGB 3OX8B 2GFBA 4OCLC 3IDGA 1RHHB 2FEDD 1DBMH 5FIEA 2OYLA 4P5KB 5CGYC 3QJZA 4HLZG 5AD0B 5EO0B 2L04A 3VD4A 2YXFA 4JO3H 1AD9A 3VG0H 4X9YA 1NFAA 1KTBA 3PWUA 3WL9A 1ES0A 3PHAA 5DLLA 4RAVB 2BY3A 1BOGB 4R84A 2BNUB 4WEEA 5GSVA 4OD1H 2HFGH 2X53A 1F3DH 3FAXA 4WGVB 1KJ2B 1ZD6A 2UZIH 3VWKD 2HUEA 4RAUA 3GSNB 4I0PB 4EDXB 3DBXB 3WLWC 1BAFL 1W0YT 3GIVA 5GS1C 1MLBA 4JFEB 4J4PD 1O6SB 1SEBA 2OMXB 2V37A 1EWHA 4UT9H 4F15C 3AQXA 3L1EA 3MV11 2HT3D 3BP4B 4MAYC 3F2LA 3GBDA 5T3ZE 5I1DA 3HAEG 3BWAA 4MBOA 5IK3A 5L4MA 2LW3A 3IDGB 1YYLH 5M7QA 3V5DA 4KI5D 4Z9KB 4FXGC 3E80A 3FQWA 3DJZA 1SPDA 2BY1A 4FFYH 3DUUA 4WWOA 4YBLB 4OUOA 1AD9B 1E67A 5HDQL 4YFEA 1MQKH 3PWUB 4X5LA 1ES0B 3WL9B 5D8JH 3VI4A 2ZYHA 4TSCL 2FSEA 2P26A 1FORH 5EZJA 5CZKA 1XL6A 5GSVB 3O3AA 3BISA 2GITA 1U3HD 4DEPB 4AT6A 3UBXA 3WTVA 1QRNA 2PTVA 5E4IA 5B38A 2RCSH 3VFRA 3NIFB 4HETA 2XYCA 4F2MB 5C7ZA 4CMHB 3GIVB 5E1AA 3NAAL 1MPAH 3B8YA 4W4OA 5D1QC 2DJSA 1MLBB 1OB0A 3CDFA 1SEBB 4LLWA 1BIHA 4LRIA 2NZ1A 3TWCL 1NMCC 5CEZE 3RVXD 3AS0A 3BWAB 5I1DB 5IK3B 3WIHL 4JM0A 4BCZA 2MH4A 5H4YA 3V5DB 5G2NA 3FQWB 4XOBA 3MUHL 5AW4B 5E8DH 3DUUB 3NSFA 3S34L 4F58H 2H2PD 1G1CA 4NJ9H 3U6RA 5KSBA 2QV2A 2Y3AA 3EGXA 4M6ML 5LAPA 5JA8B 3WFDL 4KNSA 3VRLE 2QLYA 5HTSA 3VI4B 3GUTA 3HLAA 3KW7A 4NLHA 2IGTA 1OTSC 5EZJB 3VWJD 5DZNA 2Z93A 3O3AB 1KGYE 2VDMH 3L4CA 2GITB 4YHML 1EGJL 2JQAA 1F90H 3RB5A 3UBXB 1QRNB 1YPZF 2ISDA 3VXPA 3VFRB 5B38B 2DW5A 2AJVL 3QWRD 4ZUUA 5HDBF 4I5BA 4XP5H 1GS7A 4Y4FC 5DYFA 5E1AB 3AJ7A 3TZVC 3UTZA 3I9PA 1NFDE 4XB7A 1MVUA 1OE2A 1WPCA 4LLWB 4WO4D 1Q94A 3X2QB 4JFVA 1NPUA 1PL3A 3IDXH 3FXIC 3CU7A 4PB9H 1RUPH 3HG1E 1DBBL 3KLHC 5SX5K 1DQLL 3DROA 1SY6A 2C26A 3G6DL 5ESVB 2F8IA 4IJTA 3A4EA 2AABH 3W2DL 2E6PA 5HI5D 3U6RB 5KSBB 3EYUL 2B9AA 3ZMNA 3ZL1A 3EGXB 2ZG2A 1C5BL 1LK3H 4J8RA 3HS8A 5ACZB 3GUTB 3HLAB 2XXFA 3QIWA 2Z93B 2AQRA 5CWSA 4X6DF 2NPLX 4HUWA 1OE1A 2E7DA 4XNMA 4UDUA 5DUJA 3VXPB 4JE4B 1T0NA 4V33A 3V4PL 4ZUUB 3EOBA 4I5BB 3N85H 1A4KA 4IBSA 3CSPA 3UTZB 4ZUVB 1MVUB 1GZHC 1RZQA 4P2RE 2XIBA 4BK5C 2JVUA 1P6FA 1Q94B 3FN0L 1E90A 3MNZA 1X9QA 2V8LA 5T5FA 3JXAA 4K94C 2CRMA 1L6ZA 1RZJL 3ZRSA 1F18A 5LDUA 3K46A 3S3JA 4PTTA 1DQKA 3QK0A 4DTGL 4UQAA 5DHEA 1NJ9A 4OFVA 4X6BB 4J8RB 4Y19E 4YSUA 3MTXA 4PHXA 4JKMA 2O1AA 5HVWA 2NX5D 3BVVA 1ZGLM 3QIWB 1QG3A 3D39D 5CWSB 4H4NA 4L8BA 1EHLL 5CF3A 4HUWB 4XNMB 4UDUB 3M1OA 1T0NB 3L48A 1EHAA 1ZE3C 2FWSA 3D25A 3EOBB 3FYEB 3G6JF 4G72B 3SGKC 3TBVA 3TT3L 1A4KB 5A16A 1FAIL 3TVMC 2GJ6A 5HDQH 3D8MA 2VN4A 1P2CA 1QLEL 4YSCA 1WD9A 4AY0A 3NSCA 2V5TA 3ERXA 5AG8A 1CMOA 4YC2B 1SFDA 3LIZL 4TSCH 5JUEL 5GRYA 4BFGA 3MNZB 2VW6A 3TA3A 1BF8A 1HI6A 4HEPA 4CU6A 3A23A 3TBYA 2QKIB 4UIMA 2J7LA 1IB5A 5C0AE 3PXHA 4EIBA 2EDOA 3QUKA 1U36A 3MUY1 4PCSA 5K9KA 1E2ZA 2APFA 2GVYA 4ZFQA 3EHBB 4WWKA 2X40A 3BHBA 3NAAH 4GT0A 1CUOA 4PTTB 2ADYA 1NJ9B 3W37A 3RY4A 1QI5A 5HGHA 2HRLA 1IAOA 3X12A 4U2ZA 1NC2A 5EU7C 3TWCH 1U8HA 5INCA 1I82A 1N5AA 2E8YA 3ILEA 1MKFA 3WIHH 4L8BB 5DRXA 3S3PA 3MUGA 3TASA 4BXVA 3MZGB 3JVFC 3L2NA 3RAJL 3N43F 2BMKA 4YR6A 2XBDA 4U0QB 4FZEL 3IE4A 3QZWG 1PLCA 3D25B 5A16B 3RY6C 3TBVB 4TTDC 3OSVA 5T33L 2H3KA 3L9YA 2GJ6B 2YUWA 3C5ZA 3FCSB 4M6MH 1P2CB 2K9FB 3WJLC 2GUYA 1TQWA 1TR7A 4K5NA 4WK0B 1NQBA 3FFCD 3TA3B 1U2YA 4U1NA 2DB8A 1HI6B 2G3ZA 4YHMH 1EGJH 2DMGA 3TBYB 4UIMB 2WQ8A 4OB5L 2XZAL 4MQTB 4WI7A 4XI5D 1QR4A 2AJVH 1MNUH 3QUKB 4AC2A 3W11D 5K9KB 4M62L 4MKTA 4JRYA 2BWIA 3UXFA 1TKWA 4KDVA 3BHBB 2Y6SD 4NCC2 4WWKB 3B1UA 2O30A 2I9TA 3F7LA 4MCNA 1MCCA 5HGHB 4BUQA 4PJXF 1IAOB 2XVGA 5FPIA 3X12B 5E6RB 1NC2B 1O7SA 1GJIA 4M02A 1U8HB 5INCB 5IF0A 1N5AB 4WHTA 5DRXB 2WLYA 1DBBH 2VW4A 3O9WC 4LVOC 2I26N 3EKCA 1Z9NA 4YR6B 2BMKB 1DQLH 3V4UL 1CFNA 3C12A 3W2DH 4U4IA 3M46A 3WO3B 1WSST 3EJZD 3EYUH 4YHYB 3IJ9A 3QCUL 1C5BH 2G0LA 3BAJA 1LO4L 2WM0A 4PJ9D 3SBQA 1AZCA 4PJ7B 3NSDA 3LQAL 4U7MA 1A4BA 1ESOA 4NZTL 5MEND 3RBGA 1YJDC 3QNZB 4U1NB 1JHKL 3WNMA 4KK5D 1XGRA 3EH5B 1AR1B 2D31A 4JRYB 4M93C 4LCIL 1TKWB 2FLRT 3ZE1B 3MRPA 2WN3A 3N1QC 2I9TB 4GIAA 6PCYA 3VWKC 3US1A 1WZAA 3EF7A 3FN0H 4RMVA 5IF0B 2QR0A 4WHTB 4WGWB 1RZJH 4R90L 4PRBA 2AMUA 1GGCL 4P2CG 4YOKA 2OP4H 4A6YH 4HC1L 5I28A 1WUZA 4X9GA 3CHXA 2WP3O 3IMTA 3AS2A 3M1CA 4RMBA 3ZDZE 2IBGA 1HHJB 4FXKA 2XY2A 4LOVA 1WAPA 4PJEF 2L4OA 5AALA 3OAZK 2NY0B 1SMAA 4KI5C 5D1ZA 1KYDA 3MXVL 2AVGA 2X2UA 1LE5A 4P3CL 1EHLH 3T1WA 2HFTA 1FFOA 1QPPA 1XGRB 2BHUA 4AJVA 5EUOE 3TT3H 2D31B 4XMXA 1SN2A 4NLAA 4BELD 4IS6A 2AV7A 4JANA 3MRPB 1U3HC 5EZPA 2EVIA 1QLEH 1LWHA 3LIZH 1L0YA 1R3IL 1BVNT 3LZNA 4FJZA 4ALAL 5JUEH 2R29A 1KYOJ 2XQYA 4H13C 4WFHE 1G1KA 2JKNA 1R24A 2QR0B 2VZOA 4E9LA 2XC8A 4ESKA 2Y1AA 2Z7WA 4LGSB 1AGCA 4PRBB 4WNSA 3QDGD 4H0GA 1CXFA 1EA9C 3AB0C 4S1QL 4P3DA 3LZRA 5DZVA 4AGQA 2CCLA 4P49A 4NENA 3WKQA 1RJYA 3RVXC 4FXKB 4A68A 3WFHA 4WJG3 2Z3FA 5D1ZB 1INDL 1UASA 3VX0A 2H6OA 2R56H 3KBFA 4EIGB 1LE5B 1VZHA 2H2PC 2CXKA 2JQMA 1NCOA 3RAJH 2WO4A 1FFOB 4FZEH 2QHRL 5T33H 4Z7AA 4OCYH 5IFHH 3VWJC 4IS6B 2AV7B 4JANB 4ZX4A 2DQCL 2FK9A 2AERT 3GYRA 3G04A 3RX9A 5CJ8A 4ONHA 4G5ZH 2EC9U 5AVRB 3FH5A 4KDTC 4MS8C 3L4YA 4OB5H 3E7JA 1AGCB 1QHQA 1P7BA 3ZIMA 3CSTA 3C5XA 3OTTA 1KBVA 4WO4C 4M62H 2YD4A 2X1WL 4N2IA 4P3DB 5DZLA 2WBKA 3IN2A 4NENB 1RJYB 1A6WL 2VM9A 1X4ZA 1A02N 2EXSA 3JV5A 3O11A 2GSGA 3BMWA 2QTVA 3VXUD 2PWHA 2YWZA 3OB0K 5HI5C 1CCZA 2DYPD 3T77A 4IKJA 4HIPA 3C6EA 4KK8D 3V4UH 4ANKA 1P6AB 1GKEA 3V2AR 1GJWA 3U2JA 3ZMEA 1LO4H 4M6AA 3G04B 3C09C 2X4OA 1RPUA 4FLOA 3LQAH 4ONHB 3WJJA 3BH4A 4NZTH 3O0LA 4QTFA 4OJDH 3VU1A 3FO1A 1CDBA 3FTZA 1JZEA 3D2UA 2WQXA 1JHKH 3SDCC 1BVNP 1DJXA 1Y07A 3MNVA 4O5LL 4KX8A 1NAML 1MWAH 3QSKB 4OJAA 1Q38A 4XPGH 3T3ME 3QYNA 4RSVA 3UZEC 4LCIH 2IPKB 2AJSL 1ADQA 4RIRA 4YL9A 3KYNB 3CXDL 5E0QA 1B3JA 5AOJA 4H8WC 3O11B 1WFIA 2GSGB 4XOCA 3KBPA 3U30C 5T5NG 4CBPA 3LCYA 1JJUA 4R90H 3NJGA 2DKUA 3T77B 2P46B 3JBG7 2CQVA 2PCXA 4HC1H 4LSDA 4X0KA 3WO4C 3ECWA 4EI5B 3S3CB 5AOIA 3NSXA 3S36L 2OJEA 5FYLE 5TH2A 1AKPA 3HE7B 4J39A 4L23A 3QDHA 1KZYA 3ZHDA 5C1MB 5E7FA 2X4OB 4FQXA 5CUSL 4QTIL 4L0YA 2X5PA 3MXVH 5IV2A 4N6QA 3FO1B 2YWYA 4P3CH 5AQ0A 3D2UB 3NCBB 3QRLA 2VN5A 2CRIA 2MSPA 3MNVB 2R8SL 3CHSA 1MH5A 5D7IA 4NGHL 1DQML 3S4SG 4RIRB 5D1QE 2FT8A 3GSWA 4XBPA 4LF3A 2WNKA 4JRWA 2Y23A 2OCFD 3EIFA 3SQBA 1R3IH 4KC3B 4U6TA 3R7QA 2M2DA 2XX1A 3S48A 3N06B 1RY7B 2IDTA 1ZRUA 3QCVL 4KGLA 5E9DA 1YCSA 1G6RL 4X0KB 5DRWB 1G9MC 5ANMA 5DZJA 1DCLA 4S1QH 4XVSH 3VRLF 3EDKA 2QQLL 3EDFA 2EUZA 1VA9A 2DTMH 2OJEB 4MMXC 4X99A 1AMYA 2MEJB 4R5TA 5TH2B 3EG9B 1IE5A 4AYMC 4FCAA 3G5XA 5J11B 2DY2A 4FQXB 5IB2A 2PWEA 5IV2B 3TBWA 2YQ3A 5IB1A 5AEAA 1BVOA 3WKNA 4KXZI 5KAQF 1JP5A 2WPGA 2GW5A 1PLBA 2QHRH 1NFDF 3BT2L 1MH5B 1PZDA 4TUUA 4CA4A 4XAWL 3VH8A 1USZA 4A2FA 4PB0L 2DQCH 4ODSL 3GSWB 4XBPB 1ZDQA 4LF3B 3HI6L 2D3LA 3MV8D 4LLQA 3SQBB 4XI5C 4HJJL 4PRIE 4Y7MA 3VSUA 3AU1A 2CJTA 3DI2B 3FCGA 5CBEA 3Q3GB 5AKRA 3RGVD 2Y6SC 5E9DB 4GG6F 4FRWA 3ESUF 1TMCB 4XZ4A 3GXNA 4LT7A 3T1FA 5ANMB 2Z91A 4PY7B 6PAZA 3ARWA 1F41A 4NC0B 5IVOA 4AEIL 4X99B 4LSPL 3IS0X 2SODB 3G5XB 2GAZA 3DOIA 3TEUA 5IB2B 2H5UA 3GTTA 2F7RA 1ANUA 3TBWB 4NN5B 1JERA 1QEWA 5IB1B 3EJZC 4H25A 2XICA 3F83A 1KWKA 1FRGL 3HEIB 1BWWA 3F05A 3VD9A 5ABZA 5HYJA 4ONFL 1E4WL 3VH8B 4L1BA 3B7RL 3FJTA 1F13A 1MHEA 1ZLVH 4AEEA 4KRNA 5K1JA 4HPHA 2J20A 2LLLA 4L37A 5D7KD 1F4YL 4KK5C 2ZPKL 2YPVH 3VCLA 4J3XA 5A6MA 3KJ4C 3AU1B 2GI0A 2CIKA 3H6AA 3BUIA 1KMGA 5CBEB 5KANG 4BGDA 4GP5B 3RVWD 2F54D 2CK2A 4O5LH 3OMAB 3ZMRA 3O3DA 3O2VL 2Z91B 3NJVA 5C9JA 4G8GA 2IDQA 2AJSH 3QH3A 3TO4D 5LGHL 5FF6A 2GIYA 3CXDH 2K1MA 1TXKA 2Z0UA 4PJBA 3MNMA 4PJ5B 2PXYA 2XRAL 1I85A 2GAZB 1WA1X 1LO2L 3DECA 2VE6A 1QEWB 3ARUA 3IMVA 4DUWA 1U3YA 4H25B 2HKHL 2JKXA 3L1GA 2E7HA 3MV9E 4HHGA 2PPFA 5HYJB 2NZ9D 1HOEA 3VXSA 2PPAA 3S36H 1J0IA 2HUHA 3QG7H 4L37B 2Y2WA 3C5SA 3D7PA 4QTIH 5CUSH 3VCLB 4PVNA 5BXFA 3QW9A 4M1GL 4G59C 2CIKB 1SDAB 2VSKB 4OZ4A 2VISA 1TYRA 4FHBD 3B5TA 5FEBA 3P4OA 2R8SH 3O3DB 3US9A 3J07A 1DQMH 1CDIA 4G8GB 4NGHH 5C9JB 3QH3B 4M43L 1PW3A 4GUCA 5FF6B 2P49B 2VLLA 1BFOA 1CI5A 3KVPA 2EILB 2A2QT 2PXYB 5EU7E 2W65A 2J1KA 1U30A 2VE6B 3QCVH 4MCYA 5JW4M 3HG0A 5FO2A 2EEBA 1G6RH 3VX1A 2NY6B 2VZUA 3ZPDA 4HGWA 3NJJA 1LTXA 2QQLH 3CFUA 2X9ZA 3VXSB 3W0WA 4OLWL 1TZAA 4HZLA 4H0HB 4DNLA 4Q9BA 3A21A 3C5SB 3CXHK 4O2EA 1JDDA 4X9BA 2HPTA 3VAEA 1LLAA 2KPWA 2I69A 5EF0A 4YSTA 3CX2A 4HH9A 4UZUA 4OZ4B 2BHFA 2M26A 2VISB 2W92A 4L5FL 2BXZA 3P4OB 1OAZH 5DEGA 5I9QB 4FQ2H 4N87A 4PRPE 3BT2H 1FGNH 4N3TA 4XAWH 4HUKB 1BHGA 2PETA 2P4AB 1YRKA 4PB0H 4JJOA 1KB3A 1AIZA 4ODSH 3QQNA 1BFOB 1HAWA 5F7UA 3K2MC 4UQBA 2WQAA 4UNIA 4UOW1 5DVOA 4GAAA 2VDKB 3DTDA 4HJJH 3FNKA 3DNKA 4J3TA 3L7FA 4ZAKD 2W65B 2BNQD 4J6RL 4MCYB 3NJKA 3A47A 3UC2A 3KPQA 2NXZD 4Y2OB 1HK6A 4HGWB 4AEIH 1BVZA 3K6FA 3W0WB 3QAZB 4FQJH 3V4VL 3IXAA 4HZLB 3VXTA 1ZVHA 4O2EB 3PHSA 4KK8C 1OEZW 3IJYA 3KYAA 5E6UB 3K4DA 5BRZE 1TTGA 1NAKL 3LKNA 3D34A 4KKNA 1VFOA 2HJFA 1FRGH 1N6UA 3NTCL 4EI6A 1CICD 5C0CA 5DEGB 4CUCA 4HUVA 3QQ9D 1J5CA 5KSAA 4MWFA 4R26H 4Y4HD 4ONFH 1E4WH 1G0XA 1XGTA 2J25A 4TVSa 3OLGA 1UWXH 3AS3A 2VR4A 4BGLA 2ZPKH 2E74C 4N2NA 3QUYA 5IESH 3SDYH 3L7FB 4PV1C 2RALA 4HMEA 3VDBA 4D0CA 4U3SA 3BAEL 3FL7A 3LB6D 1CLCA 4XVTH 5BJTA 3O2VH 1QSFD 4QOKA 3ZDZF 3KPQB 5C09D 1AY1L 5IUSA 1KG0A 3F64A 4KI5E 3IXAB 2XRAH 3STLA 3VXTB 1SQ2N 4TLSA 1LO2H 2FZ3B 2K7QA 2VDQL 3IJYB 1CS6A 3FUFA 3LKNB 2HKHH 2HJFB 3NCXA 5C0CB 4EI6B 5ECJE 1ZTXL 3HBZA 4BZ1L 5JMOC 4HUVB 5KSAB 2WVUA 2XIDA 3BQUB 4MWFB 4ZS6D 3TGXA 5KBLA 1XGTB 1NMAL 3B2MA 4B0MB 4KKAD 1QBLL 1OAYL 4WK4B 5F9WC 3F6LA 2V9RA 2ZYIA 3LNFA 5ALCL 1OXYA 5E1QA 4ODVL 4M1GH 5EF1A 4FLQA 4HULB 1Q0EA 2VDLB 4FP8L 1MIEL 5J57B 3D3VD 2R51A 1W0VA 4D0CB 4UQEA 4U3SB 5TDPA 5BJTB 5GGTA 2IAND 5F7NC 4FEIA 4OCMC 2N59A 1MCQA 4XC1L 4X5RA 3KEDA 5C08D 2FIRT 1KG0B 4M43H 2VLKA 4XTRC 4JHBA 4XZUA 4K7PX 3VXMA 3OMNB 1SRDA 3STLB 2V2TA 2DIEA 4JQVC 5D1XC 3II2A 3FTWA 5FW8A 1EXHA 4ZW6A 1XF1A 2XWTA 1U58A 3Q9QA 4BFJA 5BPPA 1WAEA 1MI5A 3D50A 4FG4A 1T89C 4OLWH 1F4AA 1SLUA 1CFSA 4M9OA 2X6CA 1J18A 2BNRD 5T1LD 1JAEA 4HAKA 5B1JA 1IAIL 1PIGA 4B60A 2A9DA 2AITA 1W0VB 1G7QA 2XT1B 4L5FH 5TDPB 4TNEA 1A9VA 3GRWL 1BMZA 2P43B 1HHKA 3V5KA 2DI9A 5BQ7A 3VXMB 3GLAA 1HX0A 2VLKB 3EJJX 4XZUB 4OF6A 1TOXA 3RGVC 5HD8D 4ZMYA 5C97A 3UAEA 2V2TB 3U25A 3H53A 4GXVL 3H6JA 1BF5A 4C55A 2FHCA 3QYCA 4HK0A 4J6RH 2COVD 3BKYL 3OKDA 4JRXA 3HC4L 4KKLD 2BSED 1YAZA 2XWTB 3QQDB 4L29A 5JLZA 5IROD 5CO1A 1JV2A 1U58B 5KS9F 3GLZA 1J10A 1YYCA 4LO9A 3KWWA 1MI5B 5GQBA 3V4VH 2XTJD 1P0SE 3O2DA 4WDIA 5IVXE 2WYTA 3WSQL 2J55A 3LYRA 1NAKH 3GSXA 1EHNA 1X9UA 5HGDA 2VDRB 1IM3D 1G7QB 1KEML 2WD0A 4QRBA 3T3MF 1WFUA 3MJWA 3RQ3A 3EYVA 5TF1L 1HJCA 4APQC 3IE9A 1HHKB 2DQTL 3DX8A 1AAJA 5DMIL 5A40E 2IDSA 5HDLA 4D7PA 5DTFA 5BQ7B 5EV7A 4MZRA 1UCBL 1AJ7L 2JB5L 3RVWC 3WUWG 3S35X 3ZHNA 4KJYA 1KBPA 5DJDA 4HK0B 3WNJA 2DI7A 1U8PA 4JY4A 1FE8L 4M8UA 1KACB 1EJ6A 3BAEH 5B21A 3OKDB 4JRXB 4N8UA 3RFZC 4ICXA 4L29B 1TNNA 5E6IA 5I71C 5JLZB 5I15H 1AY1H 1JV2B 1RZKH 2CHZA 2O93L 4O58L 4Y8DC 5EIQA 2X05A 5CD5D 2YOAA 3KWWB 3TBTA 1K4CA 1MG2C 2M8XA 4WDIB 1S8DA 1PG7X 1AQ8A 4PRNA 2C3XA 4JMNA 2VDQH 3ALXA 1I8IA 4ZOAA 4JO1L 3EDJA 4FF9A 3GSXB 5HGDB 3RWHA 1CLOL 1FO0L 5EOCH 4KRPB 2D7NA 4C4KO 1ZTXH 4BZ1H 2APWA 2WHVA 3DX8B 2A9CA 2N7AA 3ABMB 3KAAA 2MCPH 1J1OL 2H32A 3P4LA 5DTFB 3C2SA 1NMAH 2P42B 1CD1A 2ZX9A 1QBLH 1OAYH 5JDSA 4DT2A 3HJ0A 4KJYB 1T1YA 1JGUH 2J5LC 2G2RA 3AZUA 4ODVH 4PW9A 5ALCH 1ZLVK 2FYYA 4NRYA 5DJDB 4FP8H 1MIEH 1U8PB 4KKPA 2VDNL 4JY4B 3S37X 2IAMA 2CA3A 3QNXA 2ZZUT 1LO0H 5E6IB 2K6WA 3MFGB 1YQVL 4HGMA 4R97B 4X6CE 3L5HA 4LFHD 4F7KA 5ISZE 2K6YA 3TBTB 4OZGF 1K4CB 1KFGA 2XY1A 1OM3L 2Z65C 1S8DB 1OGAA 4PRNB 1RHFA 2LAGB 4OT1L 3BKMH 1I8IB 3HS0C 4JGJA 3RWHB 1BYPA 1XGUA 3CZUB 4NN7C 3FFCE 4F37K 2ZNWA 5CSBA 3IDNA 2WXMA 3Q01A 3UTQA 1CD1B 3OKLA 3VGAB 1PZSA 4JFZL 4G1EA 5JDSB 1T1YB 3I9GL 1G87A 1AHWC 2G2RB 5FWQA 1IAIH 2FYYB 4NRYB 2JK5B 2V5YA 5FW6A 1NCDL 3DJTA 3VACA 2IAMB 4AV0A 3QNXB 4GKZA 4OD3L 4TM9A 3WDHA 3GRWH 4BCXA 5AL8A 1L9OA 4P5TD 3GMMA 4ZAKC 1J5DA 4PLJD 1FFNA 3BUQA 4N0CC 5E6YA 2FEJA 3FO9A 3GLEA 4GXVH 1OGAB 2NXZC 4LB8A 1BD2E 2CO3A 1SHMA 2NSQA 2Z35A 3HC4H 1XGUB 3PP4L 5AVXB 1JTPA 4YVNA 5MENE 3BZ5A 4PJIE 2YD7A 2LTQC 4OIAA 3IDNB 2NCEA 4K07A 3RJQB 3UTQB 3ARRA 3BIAX 2APXA 4ONGL 2ZUYA 2R39A 3FTYA 4M3HA 3GNML 4G1EB 1CICC 4FYRA 4JM2A 4MNGE 5DFAA 1M53A 3MYZA 3QHZL 4AQEA 3EBIA 3WBDA 3WSQH 4OM1H 3NCEB 3PWPA 1KEMH 1X4XA 3HZKA 4GKZB 5TF1H 3DURA 2DQTH 3ML9A 5F1IB 5F7DA 5DMIH 2Q8AL 3D51A 3GMMB 3O8XD 3UBFA 5C0JA 4Y4KD 5TDNA 3MV7D 4XP1L 1AJ7H 2JB5H 4M3JA 2BS9A 3FO9B 4OUUA 5IJKA 4FFWD 2VM4A 3GI8L 4HJGA 5TGBA 3UDWC 1UGNA 2F2HA 1A8ZA 2WZPD 3IDUA 1FE8H 3GXMA 1S9WA 1E2WA 2Z35B 5E5UB 2P5WD 1HE8A 4P9HL 2FGWL 1JXDA 1NDMA 4O58H 3HAEA 5J12B 1F5WA 2P8MA 1SN5A 2LGNA 4IRZH 5K93A 3SGDI 2D73A 3HCVA 3UMNA 3UERA 4JM2B 3DARA 5J0BA 4ZS6C 4AQEB 4JO1H 5DK3A 4YSAA 4LGRB 1TDQA 3PWPB 1IAKA 1CLOH 1FO0H 4B9FA 3HZKB 1SEQL 4KKAC 3DURB 4U1GB 5F7DB 4P9ML 3QJFA 1J1OH 2KBGA 2H0PA 5C0JB 2PWDA 4YQXH 5TDNB 2EVGA 1EIBA 4OUUB 3CZFA 4BINA 3QNYA 4LCYA 4RX4A 4O02A 1X5FA 5DDHB 4B9PA 4Q97A 4X8XA 5C3LD 4HJGB 4GRMA 2DLFL 5TGBB 2W81C 4N90E 3N40P 2G75A 2VDNH 2JFCA 5DZ9A 1S9WB 3KPOA 1J8HD 2J43A 1YECL 5C8JA 1YQVH 1NDMB 1V3KA 4DQAA 2E0PA 3HAEB 5G5DA 3ARGD 4FADA 2P8MB 1D6EA 2QFPA 4KH9A 5DXWA 2YN3A 3MROA 2OPCA 5CJXC 3O41B 5DZPA 1OM3H 2VAAA 3HCVB 5KUMA 1K8DA 4RGMC 1JZ8A 4JY6A 2C9UA 3F00A 3PREA 4CN6A 1DQQA 2H0EA 1KIUA 2E75C 1IAKB 1JPSL 5I0VA 3ZDXF 3D4GA 3CE1A 1VRSA 5CN1A 4PFEA 2B3RA 2J1YA 1I7ZA 3QJFB 3CFIC 1Z9SA 4HUNB 5ID1A 5FYJD 5MERA 1NPJA 3OAUL 3PQYA 4JFZH 4AQ8A 3VSVA 2HVBA 4YWGL 3CZFB 3QNYB 4JFFD 4R2GD 3I9GH 4LCYB 1KGJA 1VEMA 1AZRA 2C3VA 4O02B 1RJCA 3VFOA 4CVZA 4GRMB 1LHZA 1Q72L 2NSXA 3T6WA 2G75B 4Q0XL 1NCDH 1H3GA 1NUGA 3KPOB 1WWWX 4XODA 2WIMA 1SMOA 4U6VL 1W0WA 3VXUE 5C8JB 1HJBC 1XSOA 4Y2DA 1MF2L 5G5DB 3SPCA 1D6EB 5KTEH 3MROB 3UTTD 1BVKA 2VDOL 4PRHE 4A37A 4E9RA 3V7MA 4CSZA 2VAAB 4L4VE 4HD9A 4PN6A 1QQDA 1K8DB 3ULAB 4N8PA 4JY6B 1K9TA 2ZOKA 5C71A 1DQQB 3HKZA 1KIUB 4OJEH 2VN3A 3PP4H 1IC4H 2QV4A 3D18B 3FUNA 2ZF8A 3BAWA 2COQA 3BGAA 2MOVA 5FCUL 1I7ZB 3EBHA 3LHAA 4GIPD 1Z9SB 2PW1A 5ID1B 2RGSA 5MERB 2GI7A 4ONGH 4ZW7A 4AGNA 5I6LA 4E9XA 1J8RA 3PQYB 4ENEC 4WW2F 3GNMH 3QAQA 4U1IA 4ODBD 2C3VB 3VFOB 4CVZB 3QHZH 3RGBA 5KVMC 1S7QA 3MRGA 4YDMA 4LPXA 4XO9A 3ABZA 2OR9L 1KYOK 4L1DA 1W0WB 3ASOB 4H2CA 4GRWB 2Q8AH 3RTQD 4Y2DB 1WFOA 5L7XH 2KZ1B 4XP1H 5GRWA 1WQVT 3ZKMC 1RIUH 1BVKB 2FUTA 1NDTA 3QGVA 4GUOA 3TCTA 1NUDA 1I8AA 2WXGA 4NRZA 4FTVD 5T1DL 3ZL4L 2R0KL 1QQDB 3GI8H 3HTLX 4KTGA 3E6FA 2ZOKB 4GBXA 4RETB 4KI1A 3MUUA 4V1DD 1X6LA 2WWNA 4JKWA 4JY5H 4P9HH 2FGWH 3PNWA 4OLXL 5ESAA 4ZNCD 2BOLA 2PW1B 5JOPD 1XGYH 4GNKB 4PREA 5IZ7A 4UT6H 4NBYB 1PY4A 3FHQA 2WXLA 1NLBL 5K59F 4U1IB 4PJDF 3CZLA 2NQDA 2LFEA 4UT7L 2A9ML 3OF6D 5K33A 5IHZA 1S7QB 1YNKL 3L1OL 4XNUH 4F7EA 1SJVA 3MRGB 4XHQA 4EZJA 5DO2D 4LDCA 4C47A 1EZSA 2Y5TA 1PD6A 3MCG1 4P9MH 4AUUA 1D7BA 1PDKA 3N91A 1YN6A 3TCLA 3KBHE 4X7DC 5D1XE 1GYVA 4NRZB 1DDTA 3EO9L 2P8LB 1WZLA 4HFUH 3BSGA 3F01A 4GBXB 1MZYA 2YK1L 3NJHA 1J7VR 2JCCF 3K2UH 3VVWA 1YEFH 5E8NA 1A4AA 5BW7C 1Z9LA 3L4UA 4K5OA 3ULUD 2ODHA 1CYXA 1YECH 3QZOA 3PNWB 5ESAB 2QPDB 5JHDE 4ODHH 2NOYA 1HKLL 2Q6WA 3OMIB 4PREB 5I6KA 1MOEA 1PPIA 4M5SA 1IMHC 3QZWA 4A04A 4EZMA 3ZQ9A 1SZNA 5D7LD 1J12A 4WFGE 4F7EB 1WE5A 2FNWA 5F7LB 1JPSH 2YFNA 3CLEL 2Y5TB 2YEQA 3N2JA 3WY1A 3KEHA 1PZBA 1PDKB 3VB8A 2DYSB 1YN6B 3TCLB 5GRJL 4B9JA 1KGWA 1I3UA 4YWGH 1GOFA 1RIVL 5F1SA 4EDWL 1IT9L 4P5TC 4NUMA 3AFLA 3VMNA 2EUWA 4GSDH 4JFXA 2DL2A 3UFIA 3FUEA 4Q0XH 4XMVA 1KN4L 4PLJC 3ZE0F 1UWFA 4NQED 1D2PA 1EHKB 1MF2H 1RZPA 5IVXF 3W38A 1VCAA 3BPNC 4H20L 5DR5L 2Q6WB 2VDOH 2AKRA 3CD4A 4MJ2A 1G0DA 3CIQA 3ILPA 1GS6X 3QZWB 2YD1A 3WN5A 4Z7IA 2FGZA 3NCFB 3V10A 1M6UA 4QXGL 5D7KE 1NGPL 4DF9A 1U92A 3FQ2A 3VD2A 3ET9F 3MYJA 1TUPA 3VU2A 2VSCA 5FCUH 4G6AD 3BCDA 3RX5A 2OMWA 2F54E 4NKIL 2NY3D 3QJSB 5AVYB 2W0FA 2X70A 5IW6A 3O4LD 3X3FL 3VA6A 4ZFOL 5DHYA 3O8XC 4AGLA 4NUQA 3EJSA 3O6FA 1U4FA 3IDMA 2HKFH 3CZNA 4YDKL 5I26A 2OR9H 4V2CB 2P28B 3QWOA 3ZGIA 4KXZH 3H9SD 2AKRB 3FSAA 1WCBA 3ILPB 5T1DH 3WN5B 3ZL4H 4L8DA 1T6BX 1ZLDA 5B7FA 2ZXCA 3BZ4A 4ZK8A 3DK0A 3G5YA 5HI4D 2YRBA 5JHAA 3WAJA 4TNWK 5HJ3A 5E03A 1U92B 3OAWA 2MNUA 3MYJB 4OLXH 1XCWA 4TUJA 1UZ6F 4UDTA 3COOA 4LNRA 4ALAC 1IEHA 2CGZA 2OMWB 4P23D 2ZAGA 1NLBH 2MTPA 4L0PB 1OP9A 1FYTE 1MXGA 4KTDL 2X70B 2NUTA 1UWGL 3RI5K 5IW6B 1FZJA 4UT7H 2A9MH 3ISRA 3V0DA 3OKKA 1YNKH 3L1OH 4HKXA 4OFYD 1YG9A 2NYYD 3CVBA 4Y19A 4YBHA 4X6CF 3IBEA 3MGOA 3IWUA 3O6FB 3IDMB 4JNXA 4XC3L 2IQAA 3Q48A 3MFFA 2MCAA 2YN5A 3J8F7 1FCGA 3QWOB 4BQ8A 5KBNC 3QORC 2MMXA 4GW1A 1WCBB 2LVEA 32C2A 3EO9H 5LG1A 4GH7B 1IEAA 1MCNA 4L8DB 4NZDA 1CL7I 1OPOA 3BZ4B 2R69A 2YK1H 3ECUA 1M42A 3ARGC 3G5YB 4GFXA 3BWSA 4JFYA 4LMQE 4DPCX 5HJ3B 3R8BB 5L88L 3W5NA 4RESB 3CFDA 5CLXA 4TUJB 1UKSA 4UDTB 3B2DC 1HKLH 4LNRB 2IMNA 2EO9A 1W15A 3PHQA 5C0AA 3ZOAA 4ZMQA 1U6AL 2XZCL 2V9UA 4W9DC 1IC1A 3EFDL 4U3XA 2NUTB 2WNGA 1FZJB 3Q7JA 3RKPA 1M4KA 3OKKB 4HKXB 4Y19B 4IRJA 3MGOB 2EE9A 2GY5A 1NMBL 2IQAB 1HQ4A 2NNFA 3CLEH 4RMTA 3RWGA 3I50L 3VW3H 1JOIA 3MFFB 5E2VH 4LRNL 2BNQE 3HUJF 3L4TA 3MRIA 5GRJH 1IILE 3GMPA 4DO6A 1EJ8A 4GW1B 1MWOA 32C2B 1RIVH 4EDWH 4Z3GA 1IT9H 1IEAB 1RUKL 2I60L 1MW1A 4HJ0D 4JFYB 4PJIF 3VQ2C 1KN4H 1OOAA 1CFVH 4XN9A 2DZEA 3CFDB 3ZDYF 4PMEA 5F1OB 2NY7L 2VZTA 5E8PA 5DR5H 4H20H 3PHQB 4QRFA 5C0AB 1G43A 3BXNB 2Y7LA 2Y0SA 3ARDA 5IT2L 4Y16D 4IU3A 1PQZB 2H4EA 3QQ3A 4PVMA 1JPST 1XVSA 4IRJB 1LJMA 4QXGH 4BHUA 1NGPH 4QKTA 1HQ4B 3RWGB 4Z76A 3D4CA 3I74A 4JPQA 4C83A 2VO8A 3BESR 2F6AA 3HE6C 3NVQA 1ZV5A 2W59A 3MRIB 4K0OA 3GMPB 3UROR 4ZI8A 3H3KA 3PV6A 1X5AA 3SE3A 5F3FA 4YXKH 5C09E 3C5ZD 2EH7L 2H8PA 3X3FH 3ZT5A 3Q44A 4H8UA 4M03A 5LCVL 1M71A 4YDKH 5AWNL 3B2PA 2X3BA 4KNTA 4X4XA 5E8PB 5F0LB 1AGEA 1L0QA 3BKJL 2JQZA 3CPLA 5I8OL 1NGWA 3SCMD 3ARDB 4ZODA 1A4JA 3WS6A 3DV6A 1T5WA 4IU3B 4KXCA 1QFWI 1RP9A 1SLVA 3L45A 3LXAA 3NFNA 3QQ3B 2FT6A 2JJVA 1J0KA 3HC0A 5KYWA 4NT6A 4Z76B 4RBPH 2A9NL 5E1GA 5I73B 3ULVF 3D3VE 3NABL 2QQNL 3R0MA 2Y1VA 3PV6B 2IANE 5CN3A 4K23L 2BZDA 4KTDH 4WNJA 1UWGH 2WTRA 2H8PB 3FB5A 4JDEA 4OQTL 4RMSA 4QO1A 3HN3A 3IMSA 4U6HA 4UB0H 1Z3RA 3ETBF 3F62A 3KXFD 3O3BA 1M71B 3BP5A 3H4FA 1DL7L 2ZTBA 2A4ZA 4XC3H 1KSRA 4P46D 4WHYG 3PHOA 1DVFD 1ZOXA 2WXOA 4X4XB 1AGEB 1ZA3B 1F4XL 5D4JA 5TPWL 3CPLB 3EYSL 1U21A 1NGWB 5EUOA 3ULUC 4C58B 5BVJA 1A4JB 4PM1A 3DV6B 1T5WB 2ZP9A 3WHE1 5DJAA 5IVZA 5DHVA 3NFNB 4ATTA 3SO5A 3QDJE 3K8KA 4BYHA 2PF6A 2VLRD 3HC0B 5KYWB 5L88H 1GZPA 3L16A 5LGKA 1TJHL 3KNBA 1SLXA 3P2DA 1EXGA 3D48R 3L3IA 1UOWA 4JHWL 4A7UA 1U6AH 2XZCH 4DGWC 5DSCA 3CVHL 3EFDH 4A6YA 3WY2A 2WTRB 3JZ7A 2WXKA 4JDEB 4U6HB 1EO8L 2B1HL 4QO1B 4W81A 1FLRL 4P99A 5E1HB 4DJMA 1OD9A 4K2UH 4BK4A 3O3BB 1UFGA 1F6FB 2ZUVA 2EEAA 2DQGL 1SMDA 2JLLA 2X7LA 3BP5B 4XNYL 1NMBH 1BZQK 3I50H 4WW1A 3K6IA 4LRNH 3WIAA 4EUPG 3VFNA 4YJZL 2CGYA 2DQIL 2J8OA 1FPTL 1VZIA 3E9UA 4NP4L 1YO4A 3ARFC 1HH9A 1LWRA 5FGRA 2KZWA 1X5ZA 5EUOB 3T65A 5BVJB 1RUKH 3TURA 2R0ZL 5DJAB 2I60H 5IVZB 5DHVB 5JNYA 1U9KA 4KROB 1GZPB 4K7PL 3B2VL 2RMNA 3KNBB 1RPQA 4N2MA 2QSVA 4AC4A 2DDQL 2NY7H 5ID0B 1J1PH 4Q56A 3L3IB 4S0SD 5HHVL 5GSRA 1JCVA 4OGAD 3OKEA 1TQCC 2XWEA 3QUHA 4A6YB 5IT2H 1JHLL 4ES8A 4OW6A 1A5FH 4WY7H 3WI9A 4FQCL 2X7LB 2NY3C 4WW1B 3MA7A 3VFNB 3ZKND 3KPTA 1H8LA 4PJAA 1HH9B 1A7QL 4AK2A 3T65B 5F7EL 2EH7H 2Q3XA 4RSYA 5LCVH 5JNYB 2B2XL 1P1ZA 1CDGA 5AWNH 5LBVA 4PJCF 2WIIA 1GIGL 2I7OA 3IJHA 2CIIA 3P1VA 5KYUA 3BKJH 1R9FA 2E5EA 5GSRB 2WQWA 3OKEB 1OCOB 5I8OH 4GQ9L 4DFIA 3PG2A 4K8RL 4EN3B 4CGTA 5GS1A 1WYJA 1RZFL 2W95A 3KM1A 2XKNA 3U7AA 5KBKA 1F3RB 2AEIT 2F15A 3AGWA 4MAYA 4K3GA 1F58L 3MA7B 4NO0A 1NZRA 4UTCA 2YA0A 2N0KA 2QQNH 4PJAB 2ZWZA 2HVKA 4K23H 5JOFA 1E3FA 3MRRA 1FFPA 3WFBL 1BVLA 3BOVA 3D85B 4OQTH 3NZUA 5E6ZA 5EUKA 2FX7L 2XLLA 5IREA 4G83A 1DL7H 2BW5A 1NEZG 4JKKA 4NS0A 5HY9A 3IJHB 2FQGA 3S35L 4PV9A 4KQ3L 4F8TA 5KYUB 1QWNA 1PEWA 4NQCD 3TO2A 3EYSH 3UEQA 3UACA 4LPTA 2D2CC 1MWAA 1XZWA 2WYZA 3QO1A 5IOPA 5D1QA 5HHOE 3RL1A 4GQPH 5BZZA 5GS1B 3NZ8A 5F93C 1OCWL 2XKNB 2K3TA 1NCAL 3ZRCC 1U8IB 2F53E 3II1A 5L2JA 1PG7L 4NEHB 4NO0B 2C9QA 4JHWH 3FU8A 2A1WL 3NG5A 2WBJD 1MELA 2O5YL 2P80A 2C9SA 3CVHH 2HVKB 3N1GC 5JOFB 2XYBA 2YMXH 1FFPB 3MRRB 1BVLB 2DJ4A 4TXVB 3T0XA 4EQ3A 1EO8H 1BG9A 1NL0L 2B1HH 1FLRH 5EUKB 3E1ZA 1BXXA 1QKZL 1JDCA 1D5XA 3NESA 4XNYH 5BZDA 2QADB 1D9KC 5HY9B 1A9EA 4HD5A 5AB0A 4PV9B 1E4HA 3TO2B 1FPTH 4JPKL 1D5BA 3DSFL 2EKSA 3NT0A 1KJ2L 1KBBA 4Z0XA 2OMBA 1MWAB 3S37L 2CUIA 3QO1B 3TZVA 3IGAA 5IOPB 2R0ZH 3GSNL 4P5SA 3DHMA 5D1QB 3RL1B 3NZ8B 3QJHA 3BRFA 3MLSL 3CIAA 4Y2NA 2DMCA 4K7PH 3B2VH 1KBKA 2F1EA 3CQQA 2DDQH 4Y16C 4JGNA 3FBKA 5L2JB 4TULL 3KL3A 3UZVA 5D5ME 3D06A 2YD2A 3GQFA 1QW8A 1JHLH 3P3RA 5I6XB 3PCYA 2SEBA 4BRVA 3DX2A 4FQCH 1D5XB 2AP2A 3HG5A 5DJ2A 2ZX6A 4I3SL 5BZDB 2ARJQ 1IGFL 1VKXA 3BDBA 1CGUA 4HHAA 1MIML 1F97A 1D5BB 4QLWA 2EKSB 4LIQE 2XTSA 3V0GA 5DFTA 2P5WE 4Z0XB 1J87A 5F7EH 2XNAA 4YUEL 3TZVB 3IGAB 5T1KA 5IMMA 1I8MA 2E9WA 5E9AA 1GZHA 3QJHB 2YD5A 4PYHA 4BK5A 1GIGH 1QNZL 4HISA 1K85A 1UA6L 1FA4A 1TYEB 4OZIA 1I1AC 2BP3A 3UZVB 5AOZA 4F9LC 3A24A 1PEZA 4K8RH 3ISYA 3ZUCA 1KTLA 4Q6KA 2SEBB 2Y4SA 3H9YA 2E9BA 2LLNA 2DEWX 5A3ID 3NCCB 5DJ2B 2X0UA 2Y6TE 1RFDL 3UJTL 3V0WL 1F58H 4B5ZA 2ALWA 4XN4A 1U3JA 4HHAB 3ENEA 2CNZA 2A6IA 2RACA 1QAWA 3SGKA 5ICUA 1XSKA 3MV9A 1C5CL 1S7UA 2XNAB 2AZAA 3OXRA 3TVMA 4P46C 3VQMA 3WFBH 1DVFC 5T1KB 5IMMB 1I8MB 2FX7H 3LZFL 4GO6B 2OZ4A 1FNAA 2CM6A 4PGCA 3MREA 3WTXA 1XF2A 1DVUA 2YPVA 3LD8C 3S35H 4KQ3H 4ICWA 4YPGA 4BKTC 1C8QA 1JGIA 3L3KA 4LDOB 2YA1A 4ZDHA 4OZIB 1SUHA 2ESVD 2ZP0T 2MIZA 1AGBA 5L4FA 1KTLB 3U0PA 1E65A 1KCBA 4TUOA 2H0JA 4LFHG 5FYJE 4KRMB 4NXKA 1TQSA 1YQ2A 4EBQL 3RGHA 1NCAH 1SDYA 2FCBA 2AF2A 2TAAA 1KXVC 3V0FA 2XXMB 1PG7H 1NA8A 2JIXA 2NR6D 2VGLM 4ZXBC 3RZCC 3A6CL 2A6IB 2IWGA 4ELDA 2O5YH 3MV9B 3RY6A 1S7UB 3OXRB 2ZUWA 3TVMB 2BSCA 4X8JA 2IO5A 2IFFL 1NL0H 2AQQA 4TL5A 1QKZH 3SGDH 3WJLA 4EI0A 1B2WL 1OP5H 2P5EA 3IRZA 5GGRA 4PGCB 4NFBA 3TV3L 3MREB 5I1CL 1ZPLA 2CAKA 5AW8B 4YPGB 1UZGA 4XCCL 1B4TA 1Z9MA 3L3KB 4JPKH 4ZDHB 3DSFH 4AMKH 4LOUD 2NLJA 5JQ6L 3SYQA 5EZLA 4PRPA 3S37H 1X5KA 1AGBB 2VZSA 3PLYA 4PGEA 4NAQA 3GSNH 5DJZA 5GRUH 3U0PB 2V5SA 1SY6L 2UWEF 4TUOB 5EORH 4AE0A 3X1BA 5KZCB 4X9IA 3MLSH 5A2IH 4OGAC 1UJ3A 3WTTA 1GHFH 4HUMB 5FA3A 4TULH 3D0VA 1AGFA 2OCCB 1PD0A 4NO3A 2EVHA 1YDPB 1SYSA 4NI3A 3U2IA 4KVNL 4X8JB 4L3ED 3ATFA 3ILQD 4NN6C 3WUWA 3ZKNC 4IIQC 1VADA 2P5EB 5GGRB 1TTUA 4FTVE 4I3SH 3BC9A 3T3PE 4IBYA 4CSPA 1FG2B 1IGFH 3LRGA 1P1VA 5I1LA 1J5OL 1MIMH 3AT8A 3N9GL 5ELIA 3WUZA 2NLJB 5T5FL 3A4FA 2VQ4A 5CHNA 2AQTA 4PRPB 5EZLB 4YUEH 5ICYA 4PGEB 5DJZB 1HS6A 4KO5A 3TF7C 1TEFA 2JTYA 2QELA 3A4DA 3IRCA 5D72L 5D9SA 3VWKA 3D0AA 1CVRA 3JTBA 1I7RB 4MQ7A 3TFBA 1QNZH 1UJ3B 2E7BA 5A6LA 4PY8I 5LO7A 2YIHA 3B9DA 4JKPL 1UA6H 5FA3B 4LVOB 1QD0A 4Q9RL 3D0VB 1AGFB 2B7DT 2O26U 1ILUA 4J4PA 4TQEL 4NO3B 4A63A 2J8HA 1ZT1B 1SYSB 4AGOA 1V7NL 4DERA 3SJVB 4WK2B 1L7IH 4FNTA 4YLCA 3LXCA 2B14A 1BZ8A 5ABAA 2WVTA 3VDCA 3WUWB 1WUNT 3EO0A 1VADB 4H0IA 1ZA6A 2P48B 3GBML 1RFDH 3GMQA 3V0WH 1ND0A 4PJGE 1CGVA 5I1LB 4Z23A 4FG0A 4F80A 3CVDA 3SD2A 4CVWA 2CCWA 4LL1A 3ULUE 1C5CH 1AZUA 5CHNB 3SPGA 3C6SA 3MXWL 3SB3A 5ICYB 1MCWW 2GIXA 1U3HA 2BM3A 1U8KA 5D9SB 1Q0YL 3LZFH 3VWKB 4RRPG 4Q4IA 1M9WA 4MQ7B 2IH9A 2Y7SA 3Q1SL 4LCUA 5D7LE 3TH2T 2Z8WC 1NANI 3IFOA 5FWRA 1VB9A 3EBGA 1G9NC 4MJ4A 5BO1H 2GUOA 5ERWA 1HNGA 4NXSA 2WUCL 3BN9D 4EBQH 3EO0B 4JHAL 2WBJC 3OC8A 2ZXAA 1ZA6B 1NCTA 3S88L 3GMQB 1ND0B 5KG9A 3LDBC 1I9RH 4XCFL 4LSSL 3A6CH 4MVBC 4MNQD 1TSHA 5B3JF 1OZTG 2AQ1A 2VMDA 4NQEE 1CGSH 3IAQA 1K3IA 3JYBA 1MXDA 4JQXC 3VWJA 3C6SB 3GZPA 5FX3A 2UXTA 3B34A 3JV6A 2IFFH 1U3HB 4OI7A 1U8KB 2MPAL 4XXDA 1B2WH 5DHXB 1MJUL 3DGCR 3QWRA 5I1CH 2VUKA 4KDTA 4X5XA 2VJXA 4XCCH 4P04A 3TXAA 4NHUA 3IFOB 2E86A 4WO4A 3P40A 5B22A 4LP8A 3WFEL 2GUOB 2WKOA 5ERWB 3DYOA 3ILDA 1N0LA 1N6VA 2JNZA 3SOBH 4YHPA 5FLUA 1SJXA 2HRHA 1CC3A 1OALA 5JO5A 4G3YL 1MJ8L 1KDIA 5KG9B 3Q6FA 5DMGD 3B43A 1NM9A 2G30A 4FNPA 2DQDH 3AGVA 1CTOA 3VWJB 3CN4A 4KVNH 5LNEA 4Z7NF 3JV6B 1T2XA 4QRQA 2OMYA 4XB8A 2MWCA 3H9SE 5IMOA 5CGTA 3PFQA 4XXDB 5IVXA 1UWEH 5CIPH 4ONOA 2FO8A 2A5UA 1IBBA 4X5XB 3DPBA 4Z77A 3SDCA 1J5OH 3N9GH 1F1DA 3WTWA 4NHUB 2EYSA 1ZIBA 4UQ2A 4WO4B 1DP0A 4H5SA 5FECA 3UZEA 4K3JL 3ZZLA 4X50A 4JKNA 4ELME 4NQSA 2QQQA 2P7TA 1N0LB 3MCLL 4TKWA 5D72H 4YHPB 4WVRA 4DHLA 1T22A 5JO5B 4JKPH 1HZHL 3Q6FB 4Q9RH 1JMXA 2J1ZA 4TQEH 1ASOA 3S0PA 3AAZA 2C8NA 2O5XL 3IAGC 1BM7A 3QHFH 3U9WA 5A3IC 1JGVH 1AXSA 5TE6L 1V7NH 2CXGA 4P2OC 1FHNA 4QRQB 3D39A 2OMYB 4BWWA 5IMOB 2DL9A 3C09B 3QUXC 3LNEA 5DYOA 3T0EE 2IC2A 3GBMH 4GSUA 3SDAD 5DD0L 2JE8A 3DPBB 1Z2KA 2A9BA 3SO3C 4Z77B 2HYMA 2MCMA 1BEXA 2ZKYA 2EYSB 2R29L 4H8QA 2A74B 4UQ2B 2O6CA 3BEVA 3S8WA 5FECB 4WKZA 3MXWH 5DO8A 4FFTA 4NQSB 2OSWA 2P7TB 1Q0YH 3IEAA 1U42A 1BFVL 3TBCA 3V6BR 1DQIA 3MRDA 3Q1SH 3THML 1T22B 4QAMB 1NUFA 3AACA 3CMGA 2R9HD 1PS3A 4PQXA 1PX8A 1ZT4A 1N3NA 4WCYL 4XVUD 2DQHL 4BE5A 2EDMA 3WO4B 3AAZB 3L1FA 4BE6A 4F33A 5IM7A 4RFOL 2EDBA 2NX5B 1AXSB 4KMTL 3P0YH 1IZKA 1OCZB 5I82A 1Q8MA 4MMXA 3D39B 2WUCH 1ETA1 1M57B 4M56A 4ZZKA 2NR6C 3AQZA 4IEFA 4D9QD 1BOYA 2WLLA 5DYOB 1GTNA 4JBSA 5C0BD 3AWGA 3S88H 2X4NA 2X28A 1TQVA 2QVKA 5CJOL 1YEJL 2WLZA 4XCFH 4LSSH 4KUCF 4CMMA 4PJ6A 3UO1L 3FOLA 4KOCA 4QMEA 2Z7YA 3F3HA 4AJYV 4W9LC 4GI6A 5J1TC 2AJZA 2F1AA 3FFCA 1QWHA 4LU5L 1OCCB 1VJSA 4DSYA 1OARL 5BUGA 3RPIA 2RJMA 1MJUH 4LOUC 3N44F 3MRDB 4K3HA 2V3EA 5E56A 4D8OA 2J8UE 5FDWA 1DBAL 4TOYL 3OJMB 5D5MF 3QJUB 1ZT4B 1N3NB 4WFFD 1U3NA 4D94A 4F33B 5IM7B 3WFEH 1MCKA 2YXWA 3KR3L 4MMXB 5EO1A 4JG9A 2Z0BA 3R19A 2VZ3A 2BS71 2V6HA 1F6AA 2WLLB 4IEFB 1E7UA 2ZONA 2F7OA 4KV5F 2X4NB 3QIBD 4G3YH 1MJ8H 1CL7H 4PU2A 5B39G 4AL8L 3EFOA 1BBDL 4OSUH 1O7DC 2DI8A 5CINL 4M7KL 3ILQC 4M7ZC 5F9JA 4PJ9A 3FOLB 4CMMB 2WWMD 2K6ZA 3WV0A 5MENA 2R1XA 2AJZB 2DBJA 2BHYA 2Q5BA 3FFCB 3RWCA 3ESVF 4RQQA 4R7NA 1IGCH 4AEHL 4YDJA 3C6LD 3RPIB 1ADQL 1AS7A 1MCHA 4UIKL 1CIDA 5IGXL 3NBNA 4MNGA 3FN9A 5FDWB 1KLUB 3P73A 2YKKA 2AJXL 1ZY9A 3V0EA 3M45A 3L4XA 1KWGA 1W72H 1Y6MR 2VH5L 1EAJA 4K3JH 3CZGA 5I5RA 3D87B 3CHPA 2XFXA 4LSVL 4DZBA 3RJDA 4BFOA 1NSNL 3GMNA 2ZXDA 5EO1B 3ML8A 3LH2L 1F6AB 5TJWK 2ERJC 3ZTJG 4Y5XC 5F21B 1HZHH 1FZKA 2OSXA 5DS8A 3GZOA 2XV0A 1UENA 5F9JB 4PJ9B 2O5XH 5IMKA 3QRFM 2ITFA 5MENB 2G2PA 4PS3A 3K0WA 2ZXGA 2R1XB 5TE6H 2H7WA 4G9FD 4YHLL 3RWCB 4QIRA 1VFAA 3KS0H 4RQQB 4R7NB 3B2XA 1E6JL 1TQBC 4YDJB 4HOXA 3BZDA 3LN4A 3LRKA 5C2BL 3FU5A 2OYKA 3L9RA 3KJ4B 4MNGB 2CUMA 5DD0H 3P73B 4N2LA 3US0A 5DMJB 2R29H 5B1BB 2XUWA 1NICA 2XZQL 1T5KA 4X6EA 4ODUA 3GSVA 3QFJD 3HZYA 4WJKB 4TSBL 2FTAA 2XFXB 4DZBB 1RL1A 4PS8A 3GMNB 1GC1L 3TL5A 4J8QA 1BFVH 3QDGA 4AYID 5LG6A 1QZNA 3I6GA 2K4AA 3THMH 1FNFA 3ZHKA 3C60D 3OKYA 1FZKB 4WCYH 2DQHH 4GSRA 3MMEA 5DS8B 2JWYA 5AKTA 4HFWA 3BN9C 1DEEA 4ZNEA 5IMKB 3AQYA 4RFOH 4D0BA 4KMTH 2G60L 3X3GH 5FUCC 1N4XL 2J3SA 4GRLC 4XXWC 4LCCC 1JWMB 1S9XA 1VFAB 1Y18A 4OIIL 3U79A 2K8MA 1OVZA 1RSFA 4ZOCA 3LN4B 4U1LB 4IRZA 4S2SA 5DK2A 3L9RB 3PY9A 3IB4A 5CJOH 2Y25A 3TBBA 1TITA 5J4MA 4Y5YB 3UO1H 5JDJA 1GGUA 3LRSA 4X6EB 4XP4H 4ODUB 3SEPA 4A7VA 3GSVB 5DGQA 3HZYB 3V0AC 4IRSD 3CZSA 3BWZA 1OARH 1JYWA 5TE7L 3HNSL 5SX4I 2FB4H 1S6NA 2EXYD 1A0QL 2OSYA 3QDGB 5D93B 2VRQA 5D2NC 3I6GB 4P5RA 2W0PA 3DUSA 4UOJA 4DKTA 4TOYH 4LEOA 3MMEB 2F7QA 1A6VL 2V33A 4ODWA 1A2YA 4MZ3A 4XHJD 3U9PL 4A2HA 2Q1EA 5C86A 4D0BB 4Y9GA 3VXUA 4FG6D 3KR3H 3U7WL 2FX8L 3JTSA 1HE7A 1Y18B 2DYPA 3FU0A 4NDMA 4KX7A 4LPVA 5DK2B 4S2SB 3ZZSA 2MQCA 5EN2A 2ZUQC 5J06A 1N64L 4AL8H 3MA9L 3FPXA 4M00A 4M7KH 5CINH 4YEEA 4YLBA 1IKOP 1F8TL 2L7QA 4CU7A 4IBQA 4NUGL 2ZUXA 3LRSB 5C0NC 3Q06A 3BVUA 1L9NA 4E41D 3LPOA 4AEHH 1HXKA 1ADQH 3KPSD 4UIKH 3FQXA 4X5PA 5IGXH 2YUZA 3DUSB 3QULA 3RUGF 3ATAA 4LEOB 2AJXH 3TEZA 4KRLB 4X7CC 2BJML 4ODWB 1A2YB 1OB1A 1VF5C 4M29A 2VH5H 3VXUB 4E9TA 4LSVH 2QLVB 3LQZA 2IXQA 3ELAT 1NSNH 5DC2A 3JTSB 4MTMA 2DYPB 3L3OC 3SPVA 3AMKA 1LDPL 3LH2H 1LP9E 4NDMB 4PJGF 3FC8A 2CRYA 4Y9CA 4FOMA 4MQXD 5EN2B 3D1MC 5ALBH 4RFNC 5F6HI 4CU8A 1E5UI 2XV3A 4PJFE 2WP3T 2WSKA 3C8DA 4QHKJ 2F68X 5CM1A 1JXFA 4YHLH 4JG0L 3CXFA 1ERNA 2A83A 3SDAC 5BV7C 4NQCE 1E6JH 2O6EA 5F7KC 1X44A 2Y22A 3NJMA 2TSAA 2WLKA 3TCXA 1I1FB 3CDYA 3FQXB 4N2OA 2R0WL 5F71A 4I8DA 3QULB 4UM8A 3S5LA 3WEAA 2VDKL 15C8L 4KKBD 3TBSA 3UBGA 1ZHNA 3HRZC 2EDHA 2OYMA 4AIEA 5JPNC 3L3HA 4JFHE 5IFJA 2VKXA 2XZQH 1OB1B 1F11A 4WU5A 4G8EA 2EUXA 4TSBH 2AAAA 3LQZB 1M7DA 2IXQB 2R9HC 3RY5A 3U1QA 3Q8AA 1GC1H 4XVUC 3SPVB 2Z92A 1ZXKA 1OAUL 1EEYA 3CVCA 5EOQL 1NOFA 4QHMA 3CDGA 3LKQB 2BOBA 5EB9A 1N4XH 2AK1L 2H3NA 2GJJA 2A83B 1T89A 3IGUA 4OIIH 4PSRA 3IVKA 1O7VA 2Y2YA 3KD4A 1B4LA 4UT6A 3CZJA 1FL3A 4FLHA 4J3OH 2UV3A 1PYWA 1VLXA 2G5RA 4HS3A 3RVTD 1GH7A 4UM8B 2X6AA 5A2CA 3S5LB 2QZ5A 1NKOA 1RLWA 3TBSB 2ICEA 2VSMB 4ABUA 1S4IA 4IBTA 6FABL 2Q2LA 2RTTA 3L3HB 3MV8A 5IB5A 5IFJB 5T3ZD 1F11B 1MY5A 3MJ9H 4G8EB 4WU5B 1ASPA 4OCRL 1M7DB 3RGVA 4KAQL 5TE7H 3HNSH 1CFQA 1A0QH 3FCBA 2Z92B 3TJPA 2NUPA 1CYGA 1EEYB 4OGZA 2PTTA 2V9TA 4LP5A 4QHMB 2XN2A 3L7EA 1A6VH 3CDGB 2ZKWA 3IJ7A 3KCWA 4G8AC 4JZNA 2MCG1 3KVQA 1W2KT 2BOBB 4N2AA 4DP6X 2CJUH 3AW5A 4OCXL 5E95B 3QIBC 3U7WH 2H3NB 1U8CA 3RWFA 2FX8H 2WQRA 2R1YB 4Y9EA 3IVKB 2ALAA 2XPYA 1OT4A 2W38A 3KGSA 1YNTA 3CLWA 3VUAA 4BK8A 1FL3B 1JZ2A 1MFNA 1PYWB 2H26A 3PDOA 4N9OB 4HS3B 2WXIA 3MA9H 4JUTA 4BM7A 1PZ2A 2J88L 3B8SA 4XWGL 4YBQC 2ICEB 1F8TH 5IB5B 4ELMF 2VDLL 3C6LC 3MV8B 1BPLB 4QTHA 4NUGH 1ZLWK 1DYZA 3RGVB 3ZKXC 3BN3B 4AUJA 3VSQA 2F54A 1D2OA 1CFQB 3UPCA 4BFBD 2I32A 3N40F 2NUPB 1LILA 2PTTB 2ATAA 3TO4A 1LK2A 4KJPD 2Q8BL 3GB7A 3RFZA 3L7EB 4JZNB 4NOBA 5FHBL 5D96C 2CDFA 2FJGA 3W57A 4I9XA 1U8CB 3RWFB 5J56B 1P9MC 2NDGA 2ZICA 1LDPH 4DK6A 5F0PB 1YNTB 5C6WH 1SYVA 1XH1A 1ZCRA 2IDCA 3FRPG 3PDOB 2H26B 4K71C 1ZGLP 4KWUA 5GZND 3ZR5A 4YXLL 3QC6X 4ABQA 4G1MA 2JJWA 3MJGX 3EH1A 3Q8FA 4HK3J 3W9EA 5E2TL 4XBEL 4QTHB 2WLMA 1KYFA 4XVJL 4WNQA 4Q2ZA 3HG1D 3CTTA 4YSOA 5BZWA 4HZAA 1IX2A 3LXBA 5GGTL 4AG4L 2BZCA 4OCWL 4TS6A 25C8L 2ESVE 2F54B 2VMJA 4E9VA 4DQOL 2R0WH 4LPCA 4DUVA 1JRHI 1WAAE 4HH8A 5LGJA 4BHUI 3TO4B 1LK2B 2VDKH 3P4NA 4LCWE 2NY5C 3GB7B 4R83A 3RFZB 3NYKA 5IY5B 3TEYA 5I71B 4GMSL 1PX3A 1JF1A 4J6IA 3OJ2C 4JZJC 2CDFB 2UY6A 3NGBB 5B4MD 4HCGA 3C60C 1CT8B 3EJTA 2AS5M 4EKJA 1PLAA 5AOLA 3HFML 4Y9FA 1I9IL 1SYVB 4FN0A 1OAUH 1AG0A 5LNDA 3HS0A 5EOQH 4HALA 4P2RD 4G1MB 3W9EB 1TFPA 1CE1L 4FA6A 5GS0L 1IBYA 1YEIL 1WLHA 4WNQB 4Q2ZB 1XD1A 2VDRL 2YGOA 1GYWA 5BZWB 3W82A 3ATBA 2AK1H 4EUPA 1M05A 2KKQA 2OM5A 5LN8A 2EC9T 3BUPA 3IMWA 5EEVA 3VSTA 3IDJA 5LLIC 3O6LL 4MD5A 1AIFB 1A6AA 1AHWA 3JYCA 4MJ5A 1SOSA 3APNA 3OVUB 5LGJB 2NY4C 3P4NB 4IRSC 2OMVA 1BSIA 2JKWA 1P53A 6FABH 2WTPA 4C56D 1CG9A 2EXYC 4BZ2A 1JF1B 1T7XA 4DEWA 2OXHA 4OCRH 4ZAKA 3GTVA 2UY6B 2BNQA 5A2JH 3F7PC 2OX5A 3MKKA 1W8EA 1CLVA 4KAQH 4JVWA 5T3XL 5HGAA 4XHJC 1H0DA 3LH8A 3HS0B 1ML0A 4L3EE 3O2DL 4OVUA 2VT0A 1O7DE 5KN5A 3CC5A 4AYEC 1XD0A 3UC0L 5J89A 3I2CL 5KVFL 4CNIA 3AG2B 2R2BA 4PG9A 1XR8A 4OCXH 4YH6A 4EUPB 2GTQA 1M05B 3DO3A 1VFBA 2KT6A 2WJ7A 1GSMA 4F20A 3IDJB 2JKRM 4MD5B 1CICA 4L1LA 3P0VH 4ZO6A 1A6AB 1AHWB 4A55A 4OZHE 2HCZX 3A4AA 3F12A 4Y4HA 1KIPA 3OC5A 1NBVL 4XWGH 4M6NL 2OMVB 3FU6A 3F65A 2VDLH 5DD1L 1CG9B 4YE4L 3QBTB 4Z7VE 1YYML 3PAVA 4ZAKB 2BNQB 3TJHD 2OX5B 4NNYA 2WTOA 1U2CA 3CN1A 5F3BA 2WXPA 2Y3NA 4Z7OF 2HX7A 3CVIL 1QSFA 2C9RA 2FHBA 2BSTB 2NXZB 2PMZA 2ZCLH 5C09A 2DM2A 5HJBA 3BWUC 3TJEL 3UDWA 2EE6A 2OQJA 4R9HA 5EZIH 1AQHA 5KN5B 1LQBC 3FUHA 3CC5B 3PUCA 2Q8BH 3SGEH 4N8CL 4BH8A 1H6TA 2BC4A 4Z78A 3SYAA 2K8QA 2LTQB 4PG9B 1XR8B 2DF3A 2ADFL 4I3RL 5DEFA 2EEXA 2X10A 5GGVL 1VFBB 1QFPA 4HEME 5GGQL 1CICB 1JIBA 4UQDA 3Q8CA 2KLSA 3F12B 4KKQA 1GPOL 2AXGA 4Y4HB 4MAZA 1KIPB 2O6FA 2XBTA 4YXLH 4H88L 3BFWA 5DVKA 1NEZA 3I6SA 5E2TH 3DX1A 3L17A 4OI9A 1D5RA 3F04A 4XBEH 5JOEA 2Q86A 4XVJH 4PJ8D 4N85A 1VZGA 4ZT1A 5GGTH 3LHPL 4AG4H 5GHWL 2HN7A 3D3VA 4NNYB 4OCWH 4UYPA 25C8H 5F3BB 4KKBC 1XB3A 2IANA 3MNWA 4DQOH 1QSFB 2YEZA 5C09B 4X4KA 2OQJB 2MNJB 5C08A 1G6VK 5ITBL 4NNPL 4ZFOA 1SUJA 4WIQA 2APBA 3UCRA 4BH8B 3LOWA 2BC4B 4Z78B 5A1AA 1UD2A 5KANI 4GUPB 1IFRA 1T2QL 2VQUA 5FUCE 3WS3A 5DEFB 1KLGA 1UH3A 2BIIA 5CJXA 2N7BA 4MNQE 3NIGE 3WNKA 3HFMH 1I9IH 4XX1E 4DKAA 4Q6YA 4FG2A 2AXGB 3IS1X 3Q43A 5M94B 4N28A 1MAML 3QDJA 1DEDA 2LAAA 1CE1H 3QPXL 4WRLA 1NEZB 3RHWF 5GS0H 1MFDL 1YEIH 2BNRA 2Q86B 5T1LA 3NP4A 3SSGA 4TVUA 4CRPA 2VDRH 1RAMA 2E4TA 3RVTC 2HN7B 3T4YB 3D3VB 4N2BA 1U91A 1HN1A 1FNGA 3O6LH 3QJRB 4G43A 2AANA 2IANB 2FLBT 3MNWB 4ZBJA 4Z95H 2PYFA 2YEZB 3C2AL 3R06A 3NSJA 3NJXA 4U1JA 5C08B 2IWFA 4YSEA 2FJHA 2GC4C 5F7FA 2P45B 4ZFOB 2NY0D 5JYLA 5DT1H 3ECBA 1E3XA 1QSED 2AV1A 2H2SD 4XPTL 3WS3B 1REIA 3P2BA 4QLRA 3MZTA 2Q3AA 3AQDA 3JWOC 1KLGB 1CBVL 4JW3A 1GS8A 3T6XA 4ZO7A 1EZUA 3L8QA 2BSEA 4KZDL 1V8HA 5FUZL 5IROA 4NSKA 1JXGA 2B15A 3F85A 2PKDA 1VDGA 3GWJA 3O2DH 1A1NA 1XX9C 1L4IA 4KX9A 4DPAX 3UC0H 4I7ZC 3I2CH 4P48A 2UXFA 4JFQA 2BNRB 5KVFH 5T1LB 3T9WA 1KELL 3U46A 1JZJA 1NANH 3L4ZA 1JZ5A 1U91B 1IM3A 1FNGB 4G43B 3WGUB 2AQNA 2HT4D 4MJHA 5J8OA 4GO9A 2PYFB 5HHME 3R06B 1J9CT 4U1JB 3I6KB 3QDAA 5FKPA 4BIKA 1NBVH 2IV9A 2FJHB 1XH3A 4M6NH 1ECYA 3GBLA 4OQ1A 1U8LA 5DD1H 3LEVL 2EAEA 3ECBB 2AV1B 4YE4H 2WB7A 3P30L 4ZW8A 1YYMH 1CYWA 2XHNA 1SDDA 4KJPC 2PABA 2XA3A 4JJ5A 3CVIH 3TX4A 1AO7E 4NSKB 3TJEH 1B88A 1UC6A 1FHGA 2DMBA 1A1NB 4W9ZA 1SHWA 4CVXA 2IFGA 4N8CH 3OZ9H 2XTJB 1BM3L 4QNPF 4JFQB 2FH8A 3UTPD 4I3RH 3U46B 3QEQD 1C1EL 2IQ9L 4LESA 5GZNC 4W4OC 5FYKL 1TZIA 1IM3B 2Y7OA 2H32H 1M3JA 5GGQH 2F5BL 3HZVA 2Y5QA 2C3HA 2XQBH 5I5IA 2EYTA 1GPOH 5FKPB 1NC4D 1EQWA 3S3SA 1XH3B 4O02L 1NBZA 3RB7A 5E24E 1U8LB 2EDNA 4U33A 3LKPA 2X09A 2EUVA 1AC0A 2N56A 3LHPH 1PZUB 5GHWH 2KQNA 4KK9D 3ARSA 3ARZA 1SDDB 1T7YA 4MA8H 4KU1A 1A1OA 3NQKA 4JJ5B 3SDXE 1UD6A 4PR5B 1HKFA 2B9BA 1FQ9C 2B0SH 3X11A 3CBRA 1JUFA 1MHCA 1T80A 4NNPH 4WSKA 5ITBH 4CVXB 4IMLA 4ZSOA 3DLQR 5C0BE 4ORGA 2HZHA 1T2QH 4BQ9A 4PJHB 4LLDA 2WINA 4QXUH 4JG5A 4RMUA 3E1F1 2CLRA 5AVZB 1HCZA 1TZIB 2YJLA 2QVTA 1D7FA 2WKLA 3HZVB 3CX5J 2IH8A 4JO8A 4RISL 1NDGA 5I1EL 2EYTB 5CBAA 1X5HA 1MUJA 4UWQB 1MAMH 1T66D 2G4GA 4DVRH 5I19L 1NBZB 3QPXH 1B6DA 3L3JA 4MAYD 1E4XI 2FJFA 1MFDH 3LKPB 4K73A 1X5MA 3U0TA 4M1CD 4CN1A 2X1OA 3NK4A 4K9JA 4WFFE 3ZE2B 1V3JA 3M86A 1BAWA 4PAZA 1A1OB 5DVPA 2CDGA 5AW7B 5D4HA 4P5TA 4EI5D 1UT2A 2ATPA 3C2AH 2IF7A 4MS6A 4XX1G 3QIWC 3VXQA 4YS4A 5I0ZA 4P05A 1CGXA 5HI3D 3IMBA 4J5VA 3X11B 2RD0A 1JUFB 3HE7D 2AEOA 2ARJA 2X12A 1KGUA 1L9SA 4ZSOB 4FABL 5I5MA 2PN5A 1R17A 1C5DA 4ORGB 4XPTH 1R34A 1TO5A 2WINB 4LLDB 4OGYH 5CCKL 4HCFA 6TAAA 2CLRB 1CBVH 2YA2A 5SX5H 3BFQG 4KXDA 3VMOA 2CKBA 5FUZH 4QR7A 2DQJL 5CBAB 3ESPA 4HG4J 1MUJB 3INOA 4HLZH 3T6ZA 2QKIC 3V0VA 3L3JB 4ZQKA 2FJFB 4LL4A 5GXBB 5EHFA 2YD8A 2X89D 3U0TB 2GIMA 3RPBA 1AH1A 3Q05A 3EHBC 1ZDSA 2OTWA 5HSFA 3A5VA 1AOZA 1J05A 2DIJA 5EC2A 1I8LC 3KPPA 3TH4T 1X5IA 1Z5LA 2Y1YA 1XCQA 2CDGB 4AM0Q 4Z7QE 2H47C 4P5TB 4OFDA 2X6BA 3VXQB 1H8NA 2CLVA 1OT1A 2TRYA 3LQMA 3O8XA 4Y4KA 3MV7A 3TJHC 5I30L 1V10A 2ARJB 3AADB 5GGSA 1V7MH 3LEVH 3OGCA 5FM8A 4KY2A 4K4KA 1C5DB 1RK1A 3P30H 2DMKA 3T8VA 4KOBA 4S10A 2J2ZB 2Z6FA 3AY4C 2WZPA 3EH3B 2H1PL 5EU6D 3A67L 4Y4FD 5HPMA 3HAEH 4B9CA 5E6SB 2CKBB 2P5WA 3WLBA 1V05A 1NCNA 4G9FE 3AABA 2E6QA 5FGCB 3WEXA 1IBGL 5IWLA 4X7SL 3O2WH 3JZYA 3V0VB 1KENL 1NBYA 4HIIA 2IPUK 4PRID 1PSKL 4ZQKB 1CF8L 2UZYA 4X5WA 5IQMA 2OTWB 1BZEA 1C1EH 2VZVA 1A22B 2F8VA 1KTRL 1J05B 2IQ9H 2MQGA 4Q14A 4XMUA 5FYKH 1ODAA 5EC2B 1T1WB 3KPPB 4PIBA 5A2AA 1Z5LB 2F5BH 1XCQB 2WYIA 2N4IA 2YAEA 4YIQA 5EEXA 1TJIL 5EG6C 4LSUL 4PJ8C 4C4KT 2CLVB 1IARB 3O8XB 4Y4KB 3ARXA 3MV7B 1NIDA 1V5JA 4M6OL 1BP3B 4RRPA 1OK8A 1K6QL 3EFFA 5GGSB 3V9CA 1DVXA 3OGCB 5HDWA 3KYMA 3NP3A 4JHUA 1RK1B 3QORA 2HT2C 4YHYC 3DJRA 2O61A 1UEYA 5EOTB 1EUUA 2UUDH 3FAWA 5HPMB 1C8PA 1A7PH 2ZYRA 1J8HA 2P5WB 4LVNB 4IW4C 1WG3A 5DHMC 3WLBB 4F5CE 4QHPA 1KF9B 4PIRF 3ARGA 2ODIA 3WEXB 1CGYA 1QLRA 3PWLA 3FK3A 1NBYB 4HIIB 1W8OA 2J72A 2UZYB 3DKHA 5AB9A 4KO9A 3MHZA 3GINA 4X5WB 1DVZA 2XCMC 3HZMA 4HIQA 1JK9A 2GKIA 2ED9A 3QQ4A 2I5YL 5CEZL 1RUAL 2IG2L 4YIQB 1JF5A 4RISH 5I1EH 3VXNA 1YYLL 4FULA 3QNFA 4PG2C 3QUMA 3RWEA 4IBVA 3JWDC 4LSTL 5I19H 4PJ5D 1RULL 3EFFB 3MODH 5H2BA 5H8DA 4JFFA 3KYMB 2LABA 3O3UN 3RWIA 7FABH 3PE9A 1PJ9A 2UVFA 3GDCA 4K9EL 3ES6A 5D8JL 2O61B 4PD4J 1OL0A 2B4CL 1BYOA 2QMKA 4PJEE 1GZQA 2NY0C 3NEXA 4ZUTA 4D9RE 5K9QG 3TFKD 1J8HB 3JWNC 2H2SC 4N0UE 4WFED 1KUMA 1DVQA 3ARGB 2HH0L 2MOQA 4AGPA 4APXA 4E36A 1QLRB 3UTTA 2NW2A 4XMTA 1XSJA 3ME0B 3PWLB 4JQIL 2VR3A 1A14L 4FABH 4JFSA 3HFFA 3K81A 4R5VA 2HX8A 3U1PA 2A99A 4IBWA 5CCKH 3HZMB 2X41A 3LKOA 1B4RA 1QASA 2ENQA 3OG6B 1JK9B 3VFUA 3QQ4B 1Y6KR 3WKML 2YMOA 2GHZA 1N19A 2VLJB 1IKFL 2DQJH 3IN0A 3VXNB 1J8KA 2NT0A 1JGDA 2ZF9A 4ZMTA 2D3VA 3QUMB 3RWEB 4F1ZA 1CURA 4Z7VF 5E8DL 4AKQA 5DC0A 2M1KA 5H2BB 5DJ0A 4JFFB 4IKNA 2HT4C 4R2GB 3RWIB 1BQRA 3N41F 4AWJC 3H2QA 4FEMA 3ES6B 4FXKC 2ITEA 1HSAA 5E8OA 3HRPA 4ZUTB 1GZQB 2Z1PA 1E2VA 5D1ZC 1CJYA 1HXYA 4FTDA 4JVUA 3RTQA 4Y7OC 4APXB 3UTTB 5I30H 2NW2B 2ZCKL 4LLAA 3T4AA 5TE4L 4XP5L 4DH2A 2CBPA 1UOKA 2OJZL 4FTVA 1F56A 4L8SA 2X0VA 1G7IA 2Q10A 5IW3A 2QJDA 3LKOB 1CE6A 2H1PH 3VFUB 1GCFA 1T0OA 4V1DA 1JXJA 2YBGA 1I31A 6CGTA 4PB9L 1RUPL 3K1KC 5ICXA 1JGDB 2WO3B 1E5AA 3UMTA 1IV8A 1ED3A 1IBGH 3FTSA 4X7SH 2QFRA 5SX4H 3K0YA 2A4EA 4HJSA 3N42B 3OAZH 4GW4A 1PSKH 3GSUA 1YMMD 1CF8H 2H6PA 3IU3A 4TF4A 5DJ0B 3O9WD 4DO5A 4LQFL 3ZQXA 1JL8A 1LK3L 5FO7A 3VFSA 3U2SA 2OMUA 3OF6A 1CTMA 3IRPX 4YGVA 2DYRB 1HSAB 4LHJB 1Z5HA 2EVFA 4WSJA 2UVEA 2Z9TA 1HXYB 3HR5A 1TJIH 4LSUH 2JV6A 5F7AA 2I9LA 3RTQB 4EXKA 4M6OH 4KK9C 3T4AB 4YDNA 1P7QD 5KVDE 1K6QH 1BFSA 3H3BC 2XVKA 3N85L 3WD5L 1TQTA 2R69L 4FTVB 5FDYA 2PPDA 1ID2A 3T3PB 5BRZD 1JVLA 4L8SB 4K5MA 1G7IB 1RJZA 3NIGF 1L6XA 1SVCP 1URLA 2RQ8A 1CE6B 5D6CA 3HOGA 4V1DB 3NDZE 3UGUA 2NNCA 1DJWA 2XWZA 5ICXB 3FONA 3I6LE 3LKSA 1IFHL 1ED3B 3HMXH 4LLMA 5HXMA 2DLIA 3M6DA 1EAPA 3DX7A 4GW4B 3GSUB 2H6PB 3IU3B 5D7LA 5FO7B 3VFSB 4AJ0A 1THCA 2OMUB 1T66C 1EZLA 4YGVB 3WMQA 4DO4A 2I5YH 3F5WA 4XNQA 5CEZH 1RUAH 2IG2H 5F88A 2GFBB 3TNMA 3HR5B 4M1CC 3VYPA 2I9LB 2HG5A 1AZNA 4LSTH 1QABA 4ETYA 4UNTA 4U3CA 1RULH 2D0GA 3BVWA 2D2OA 3UP1A 4EI5C