4F8NA

X-ray structure of psaa from yersinia pestis, in complex with galactose and phosphate choline
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
NTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell adhesion
molecule keywords pH 6 antigen
total genus 18
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f8nA00
5LN8A 5LNDA 5LN4A 4F8OA 4F8LA 4F8NA 5LO7A 4F8PA
chains in the Genus database with same CATH superfamily
1KGCD 1P69B 2Q7NA 4U1GC 2W0LA 5LGYA 4XX1E 5IT2H 3PJSA 5BS0D 4O00A 5TQ0H 1KENL 5AVTB 1E6JH 5I5RA 3ZYJA 2VIRA 2FO1A 3OQRA 3U6XS 2WLHA 2ZOKA 3O2DL 4LAQL 4H1LH 4WTQA 4KXZH 5K33A 1NAML 1UH2A 5TH2A 1GGIH 3BO8A 2GI0A 1PBYA 3V4VL 5IFJA 4E9VA 3U7WH 5LBSL 3JTBA 2ZNXA 4ELME 4WZ9A 1JFQH 4M5SA 3L1GA 4R90L 4MAYD 3VGAB 3N40F 5ITBH 1N18A 5FUZL 5EBLA 3BOVA 2GHZA 3STBA 4QRRD 5DUMH 1QYGH 3L4UA 1X4XA 1GTFA 1C5BL 1HX0A 4TNWF 2YAEA 3NCJH 2VDPH 4GBXD 4O9HH 1PLAA 4PRID 1NINA 2ADJA 3UBHA 2IAAC 1NAMH 4J12A 5JR1L 4NPKA 3FN0L 4WW2B 3VXRD 3L4CA 4M00A 3TZVB 4ZW5A 1N26A 4OKVA 1PPIA 2X4PB 1KPRA 3ZU8A 3NJGA 3X1FA 2VR7A 3VXNA 3ZL4H 1EXUB 1XGTB 1UA6L 2MRYA 1OWWA 3ARRA 1NCWL 2BP8B 3DVIA 1JN6A 2EH7L 1V05A 3WUWG 4FXKA 4E41A 1QFWM 3Q44A 4BFIA 3LIUA 3K2KA 1U42A 4M5YL 3WTYA 3SDCD 1BM7A 2WGNB 2PNDA 3S4SA 4P9HH 1P84K 3VI3E 4GSXA 1JGLH 2CLRA 2W81C 3IDXL 3WFBL 1T6VN 3WNOA 1T4KB 3T8XA 5DJCB 5DGQA 1WRFA 2DI8A 3B9AA 1RAMA 1JRHI 3REVB 4A7SA 4X4ME 4K94C 1B3JA 4LLWB 1YMHA 3KW7A 4XRCA 2FX9H 2UY6B 4OJEH 4WUUE 1A4KB 5T1MA 4G6MH 3QDHA 3L4WA 2W8CA 3U48A 5IFAL 1KSRA 3WKYA 3SGJA 1UD8A 3JWDH 4XE5B 3T6VA 2G4GA 3CFTA 3WY1A 3HE6B 5AG9A 2QTVA 2YUWA 4HZAA 1NBYB 2FH6A 1ICTA 2DQUL 4BH7B 4QEGA 1SMDA 1P5VB 5DMGC 1RJZB 4PJCB 3MLTB 1LEKB 3RIFF 4W9GC 5B3JF 4LHUA 1TIUA 5ALCL 4U3CA 1T5WB 4BCYA 3IGLA 4UDTB 1HSAA 3MLUH 3TBSA 3VRJB 3BAKA 4ZUTB 5T3ZL 3GS4A 1Z2KA 1GAFL 1WZAA 2DMCA 2GVYA 5E24E 3IGUA 2WXHA 3B5TA 5SWZB 2EE9A 1RVFH 4L3EA 4OGAD 3US0A 1HNGA 2OMUA 2X4NA 4P4RA 5A40E 4KO9A 1GOHA 1I3RB 1PMYA 2V8MA 3C8KA 2Y7OA 5C08D 8FABA 1T5XB 4N0UE 1MCQA 1DCLA 1R0AL 2GK2A 3CLFH 1NMAL 2R56H 4D2NA 2X41A 5AW8B 1LK2A 3HUJE 4HJIA 1R17A 3F01A 5IQ9A 4HWZB 1RZKH 2NNAA 3ZN6A 3KBEA 3QUMH 4I3RH 5CEZE 2YQ3A 2JQZA 2VH5L 2VXUH 4ZTPL 5FWRA 2AK4A 3EZJB 1JF1B 1U93A 4QD2E 4AE1A 3V2AR 5IOPA 3R8QA 1KGJA 3RPBA 4BA8A 1AQDB 3FYEB 4ZNEE 1FC1A 3DHMA 1DUYA 4JGNA 2I07A 4HEMA 1I9IL 2DKSA 4FQXA 4M5ZL 1F6FB 4KZ0A 4ZZKA 3PUCA 5KVMC 2JLPA 2ZUXA 3POHA 3HI5L 2D0GA 4FFYA 4OZHF 1I8MA 4QYOA 2K7PA 2A9BA 4N68A 3LRSB 3KLKA 3NSCA 4YHYB 2JELL 5KZCD 3U46A 2ENYA 2GPZA 3CHXA 3FSVA 3KH3A 4FHBD 5FYJH 2XVGA 2HLAA 2ARJA 1BLNB 2Q3ZA 2A0LD 5KSUA 4DJMA 4XP1L 1C12A 2OMWA 2VR3A 5SWQA 5JHAA 1R1CA 1RK7A 1A1MA 1U0QA 1W0VA 1XH0A 4LSSL 5SWSA 2EDWA 1TU2B 2BK8A 3D2TA 3PWUB 4O51A 1Q9WB 3KS0J 4RRPM 3H55A 3I6KA 3AADB 4QXVA 3EJRA 4V11A 2UXVA 3D85A 3PDOA 4QYAA 5CM1A 2OZ4L 4BFFA 1USQA 3DOSA 1OWRM 1RULH 3W81A 5EORL 2H32H 3DIVA 2L3BA 3Q6GL 5BO0D 1VB9A 5MEPB 4RVBA 1QHOA 4W93A 1N5YL 2M26A 1B3IA 1ZKAA 5D1ZB 3JSSA 1BA9A 5CBEB 3TBWB 1A4KA 4AGOA 5C1MB 4GQRA 1WAAA 5C6PB 4PW4A 3TA3C 3ULVD 3X1EA 3VYPA 2NY0C 3O4LE 4FFZH 4DKEH 1VCBC 2YA0A 4UT6A 3QYCA 3WIHL 1R3JA 5E4EC 4AMKL 3BEWB 3FFCA 3NFPB 1ILUA 2GTZB 3TBYB 4E9WA 4M8VA 5GGVH 3E1ZA 3LSOA 1WFNA 2Z8VC 4LP5A 3D48R 2AJYL 2MQGA 3V5KA 3GMRA 1XX9C 3H42L 3MRKA 4N0FA 3T6WA 4BFRA 1JZEA 4AQ1C 3AM8A 4BZ2L 3FT0A 1T5WA 3DTUB 3QIBA 5FYLE 3ULVL 3FUDA 3Q0HA 2Y22A 2EO9A 2EIKB 3B7SA 3HAEA 4JN2B 2KS0A 4NQCE 3HS9A 3SSGA 1K3ZA 1S7WA 2BXZA 2FNBA 2N01B 3EO0A 5HHNA 1MLCA 2CGRL 4WI5A 4QRFA 2VLKB 1NPNA 2X4UA 4RAVA 2X1WL 3ZE0E 4WKZA 1U8KB 2HT2C 1TFPA 4PMEA 4PG2A 1XF5A 2EACA 5JW4R 2DW5A 2YAOA 3S3PA 3ZTNH 3WSQL 2LW3A 4GKSA 1FNEB 1ZOXA 3RNKB 1U92B 3DK0A 1NCUA 4YBQC 4EN3C 1QZNA 3EGDB 3HAEB 4G1MA 4HJEA 2CPUA 4JRXE 2APVA 4RIRA 1TTBA 2P5EE 3L9YA 3LZPA 4X0NA 5IB2A 4FABL 1SXSA 1ND0B 5F7UA 3ULVF 2CA4A 3KL3A 2VITA 4POYA 1S7TA 3HHSA 5E1QA 3A67H 5I26A 3L5HA 4R97C 1U33A 1HTYA 3WTXA 1ZS2A 2J3SA 1IUZA 2LU5A 3IBOA 3QJQB 5I30L 5JHMA 1NEPA 3QIWC 2H41A 3S36H 5IBLC 3SQOH 3EOAA 4NM4H 5L88L 1K8DB 3G5XB 3PJSB 1JZ7A 1JGVL 1D5IH 1EBPA 3ASOB 3F3HA 1GGCL 4HPOH 1IFHL 4DO6A 2WMPB 1FCGA 1MEXL 1UWEH 5EIIA 3J2PA 2OMYB 1IV8A 4MS8C 1LXMA 2GBTA 4N5ED 3AABA 3IETA 1E6JL 2EVGA 2VAAB 4PWEA 1KWGA 1MVUB 2X9XA 5H2BB 5HYQB 1IKOP 5DEZA 4R0LA 1R75A 3QI9B 1I53A 4PTUB 4LIQL 3H9SB 3O6FD 3P73A 4BFOA 4F37K 4PS4H 2F08A 4XPFL 4R90H 3HUJF 4KUCD 2DBLH 3VFMB 2FWOB 3EJUA 3GT6A 1WPCA 2P28B 4NP9A 3RNQB 1A4JA 3D2UD 2GABA 1JTOA 1MEXH 1UWEL 2EDDA 2K8QA 2YD7A 1E4XI 5SWZA 1IM9B 1PZDA 3FCBA 2MH4A 4UDUA 5CN2A 5IM7B 2QGEA 2AEOA 2DQJL 1QQDA 4ZMYA 4D9LH 2R1YB 3O3AB 1S3KL 4N4YB 5JR1H 4AVKA 1CXEA 3D0AA 1CFNB 3WNMA 3ARED 4P2RD 5IEKB 2R8SL 1P4IH 3GBNL 1NDGA 2MWCA 1MREL 3FFCD 4IKKA 1BAFH 2G60L 5EO9A 1SEBA 4HJGB 4HIXL 1KJ2A 2OR9L 1OAXL 3QDMD 4G80B 4LGRB 4JW3A 4P5MA 1E43A 3C2SA 3D6GA 4MQ7B 3K0WA 1SUHA 3ARYA 4YO0A 1N9PA 4MB5A 3GDBA 5I1LA 3MYZA 5EEXA 1S9VB 4PB9H 4M5YH 7PAZA 1YVLA 5FECA 4X0KB 1F2XK 4R4ND 3VX1A 1SF5A 4HFWA 3NIFB 1FVDA 4A2HA 1RERA 1U21A 3PHSA 3I84A 1JZ6A 3PQYA 2ETWA 3LXAA 4XB3A 2VXSH 4BKTC 2HX8A 2IFFH 3UZVA 2Q7AA 2Z0BA 2PCXA 3E8UL 4MWFB 4LCCA 1M9WA 4W9KC 5JIQA 4BIKA 4LEXH 4BWUA 2GUOA 5IQLA 3C5JB 2UWEA 4MDRA 1SYVB 5IFJB 2J8UA 2VLRE 3RJOA 1XH3A 2B0SL 1J05A 2CZNA 3LH2L 4F93B 3IFOA 3QDGD 3GKWL 3SBWA 1PSKH 2G3MA 3N1PC 5E5RB 4GG6F 4N2OA 2EJ1A 1HYSD 5DJ0A 2A7BA 1MW3A 2H6OA 3U7YL 3NFNB 1NPUA 4ONOA 4D0CB 4RX4D 4Z5RB 4OLYL 3RB7A 3X1NA 4G8AC 3ZDZF 1MVFA 1PZSA 2JCCE 3CHSA 3OKYA 2H8PA 2WIMA 3QUMB 1AHWB 1ETZB 1Q9OA 1K85A 2EDQA 2JI1A 4U2YA 4OKDA 1QO3A 4FTVA 5LAPA 3TZVA 1ERNA 4NQEB 3L3IA 5FF6A 5T1DL 3CPLA 1CPUA 4F7EB 3EFDL 4UOQA 1HHKA 1ED3B 2BOCA 1KEMH 3ZKNC 3BPLB 2MHAA 1QSVA 4ICWA 2H6UA 1GGYA 3SGDH 2YSSA 1Q0XH 1GZQA 4FXGB 3GSXA 1T4WA 2KPNA 3OHXA 5JOFB 3WO4B 5F89A 2VQ1A 4ZOBA 3TT1H 2CK0L 2P8MB 3QDME 4OD2B 2JK5B 3KAAA 1MCJA 3C60C 4F7MA 3WAKA 4RH4A 5LQBH 4P48A 4GG8A 1LQSR 2VMEA 3ALWA 5L6YH 1WO2A 2ZSWB 3TC9A 4TSCL 1XGRB 4XMLH 1DJGA 1DFBH 2VN7A 4NO2A 3EYFB 4ODVL 3STLB 3WO4C 5JIIA 3KPRE 1U8NB 4NZTL 2I85A 4HEME 1K9TA 2VXQA 2CAKA 4W9ZA 4OM1L 3GUTB 1WK0A 3BDYL 5JDJA 4LSUL 4W9CC 2IPKA 4XN1A 3NRPA 5IW1A 4HXBL 1DP0A 3MV7B 2K0RA 4H8QA 3BRFA 1NKOA 4X4ZA 2VZUA 4GRWE 2AK4E 3FK3A 3NBNA 4HSCX 3TT1L 1X7QA 1AKJD 4PRPE 1V7MH 3QW9A 5INDA 1KACB 4JFDD 4KAQH 4M6NL 3RWCA 4OFYA 2VYRE 4A2LA 3P77A 1MLBA 2GT9A 1TNNA 4XHJD 3UGUA 2ZYSA 5AW1B 3TBVA 4YFLF 1D2PA 3FH5A 1YEIH 1XVSA 4MD5B 1IFRA 5DD6B 2WP3T 3OKNB 4BFBD 2IXQA 3K2IA 4X6FB 2CMRH 3TBCA 2XHNA 4FG6C 2BIQA 2FZ3B 5BV7B 3QJRB 4OFQA 4HH9A 2FH8A 5FIEA 5F6IC 4GO9A 3KS0H 2X4NB 5I19L 4JANB 2JKNA 5D6DC 5CLTA 1NMCC 2VM3A 3VFWB 1XL4A 4L05A 1EAJA 5JUEL 4CRPA 2KLSA 4RSYA 3QORA 3VFOA 1A64A 2A99A 5D72H 3SE3A 1LEIB 1FYHB 4HUXB 2BZDA 3UMNA 3A6CH 2DEWX 4JRYB 1KV3A 3F12B 3MNVB 4KTGA 1NBZB 4LNRB 3P9MB 4GUPA 3UX9B 5GGUB 3FQTB 3IFNH 3S5LB 3MLXL 4UQIM 2ZX5A 2YN5A 1OSPH 4NFBA 3GEFA 3AAZB 4Y1AE 3CK0L 1SXZA 2QPEB 3ULSA 1O9ZA 3AACA 5DQDL 5L8KB 3QG6A 1FNGB 2EC9U 2JCCB 5CEYA 1ZLVH 3FUJA 3UCRA 5EU5B 5ISZD 2MTAA 1VZIA 5HHVH 1AKPA 1VENA 3SY0A 1T2QL 4UIKL 2ESVD 5EV7A 3TO4A 1G7QB 3LPGA 3LZRA 1TO4A 2ITDA 2XQ0A 4JN2A 1TPXC 3EXLA 3FT2B 3KPRB 4NQXB 4FQ1H 1GYVA 1AOZA 1CE1H 2X5PA 3NIFF 2VLRB 2WQVA 3TV3H 3PGFH 2OCFD 4PREA 3IF1B 1KIUA 3BE1L 1J8HA 4ALAH 2YC1A 3B7UX 4KO7A 3IDUA 2YJLA 2HA1A 3VM5A 4PJAE 2DQIH 2GBUA 5AVYB 1HCFX 3WTUA 5C6WH 3DBSA 4X6DE 1OZTG 1K4CB 2V2XB 3G6JA 3G6AA 4M7JL 1G6RL 1B4JL 3KW8A 3PWPE 2XZCL 2E9IA 2JJTC 3S3SA 4XBGA 2WVVB 1JWMB 2O26U 5DZVA 5HGHB 2YGPA 3FQUB 3VD0A 2XWXA 4MQ7A 5HYJB 3EIFA 5C0CD 2NQ3A 4EZKA 3KXFE 5EHFA 3VB9A 4JLRA 3MO1B 4GP5B 1HU8A 4ALAL 1MWAH 4NQVA 5A6IA 4P23B 1WWWX 1QX1A 2GKIA 2KH2B 2EYSA 4IRJB 5C0JB 3FQRA 5J8OA 2CDEA 4AQEB 3OB8A 1VGEH 2B4CC 1JGUL 4PGZA 4XO9A 3BQUB 1AQHA 1F56A 3EH5B 3RIAF 3IFPA 2ZCLL 4XZUB 4ZMQA 5I30H 1IAOB 2B16A 4YJZL 5F7HA 1Z9PA 1JGVH 1Z0MA 2KDYA 1USZA 2QL1A 4JZNA 3KPQA 2XQYK 4OV5A 1LLAA 1BEXA 5CHNA 2EILB 1N10A 3SOBH 3NTCL 4TSBL 1ZY9A 3BP4B 2HJKA 2J71A 2W0KA 2FDBP 3DX6B 1A7QL 4FZ8H 4NC1E 5F6HJ 4EI6B 3GSRB 3NMEA 1RFDL 2R0WL 4HZLB 4LIQE 2VIRB 4MQTB 1RZIA 4IU2B 3OHMB 4XP5H 2X05A 2XWTB 3UC0H 1SN0A 2QFPA 1XF3B 2YPLB 2XT1B 4Z78A 3QH3A 3AS1A 1T04A 4LF3B 4UUJB 4FZEL 2FJGA 4W4OA 2F0CA 2ZUYA 4MMYA 2R4RH 5FFGA 3VFNA 4MA3A 3F5WB 3GSVB 5DVNA 4DGVL 4JKKA 5I66A 4J2XA 3HC2A 2RCSL 2SEBA 2VW6A 4DKFH 4HJJL 1ESOA 4P2RA 2OQJA 3P30L 1R24B 3BUYB 3DNKA 1VFBB 1Z9SA 2QQLH 4QMEA 1QI3A 2WO3B 3FU7B 3DX2A 4UIMA 4I0PD 4WNQA 4L4VA 4UTAH 1IBYA 3VVVA 2YXVA 4HKJA 4OJFL 4S1SH 3GBNH 2V3FA 1FSKB 1SJEA 4HIPA 3STLA 2LTQC 4MCZA 4OLXH 2BW5A 4OV5B 5E2UL 4S0SD 2VC2L 3S5YA 4CMMA 2HMID 2J1ZA 3RAJL 4FQCL 1SLWA 1AMYA 5JHLL 3B43A 1G7QA 2IQ9L 4JZJC 4TVPE 5F9WB 4BFEA 2R1WA 1I82A 4YE0A 1XF1A 2HH0L 5E70A 5GZOC 2E6PA 1MVUA 5GZNC 1ZGLB 3QVAA 1NSNH 3EFOA 2IFFL 2XXFA 5F9AC 3BESR 2Z4TA 4YHLL 1OM3H 1QBMH 2FT6A 5D96C 2VMCA 3MFFB 2P24B 2JF1A 3BH9B 4PRIA 2N4IA 1YNTF 3CHPA 2AJSH 2H32B 5KJRL 5A2LH 2RA1A 4L8BB 4JDZB 3N55A 1VRSA 3GI8L 3FU5A 3H6JA 4QXUH 4Z5RA 1DVFD 1UOWA 2X2JA 2EE6A 4Y5XB 2JB6B 2QHRH 4ORZC 2ICCA 4Y2DC 3T77B 1X6LA 2D7TH 2NNFA 2KUTA 5GS0C 3FQWB 4HFUL 3DJSA 4L4TB 2OJ1A 3ECQA 3MGAA 3MRNB 1GKEA 4GH7B 4FP8L 4Q9RH 3RKDC 5IJCC 4BH7A 2E0PA 3K4AA 5C09E 2DICA 3X13A 3APMA 1KMGA 3L7FB 2CGYA 1ZVHA 3HRZC 4WHTB 1F97A 4PLKC 1XIWB 1P7QD 1LO0L 2QEJA 4LKCA 2LT9A 2Z35B 3OXRB 5D7JC 3X3GH 1I7TB 3SKOA 3RY4A 4MZRA 1KXHA 4WQOA 1KPVA 5AVWB 1CJYA 3GUFA 1NANI 4YSEA 1KXTB 4YUEH 4D7PA 1K5NA 2DLFL 5E4IA 5C0AD 1E4HA 2MOVA 3TIEA 3WFCH 3MA7A 1L6PA 3LNFA 5JHBA 3VACA 5IVNA 1FO0B 4AZ8A 1MRCL 5C70A 3SCMD 2BX5A 4CL7A 4PVBA 1BP3B 4WU5A 4KH9A 5L0QB 4OJDH 3MBWB 1ROCA 2LE9A 5CP3H 4N3TA 3B7YA 5JIPA 3O11A 2G2RB 4O02B 4N1HB 2RHEA 1ZANL 5LAXB 1KCSL 4OZIB 5DZ9A 4FG0A 3IS1X 4DP5X 3FT4B 4NOFA 2W9DL 4NRXB 1RZ7H 5DHVH 5KSBB 3C08H 1ID2A 3L95B 4H8WH 3DURB 4RMBA 3OVUB 2Q76B 3H9SD 3O6FB 4OLZL 3QPXH 3ARFD 2B8OT 1OSYA 3LYRA 4Z3JA 4ZD3H 4P3DB 1KB3A 4Y89A 3QJFB 3IN2A 3DO7B 5HHOA 4PTUA 4WWKD 4MHHG 2A6IB 2IBZX 3OKNA 3SDAD 4K7PH 4WY7L 1MRCH 1O5DT 3U36A 2VDKB 2BP0A 2QQQA 1KC5H 5ICXB 2HJFA 2NRDA 3BCDA 4KK8C 1AH1A 3AB0B 1MLCB 1NCHA 2CR3A 2PTTB 5KVDE 2YS4A 4IDLA 5L7XH 1S5IL 3U2JA 1AGEA 3INOA 1VERA 2VLJE 1RZ7L 1DQVA 1WA2X 3FULA 3OZLA 4P3DA 1X6NA 3IFLH 3MRJB 1L7TH 2NY6B 1CBJA 1EK3A 2FNWA 3MLYL 4LEBA 3FRUA 4JK0D 2I60H 2X4QA 5DFTA 5IEKA 5AKVA 2WWNA 4O2EA 1TITA 2BP0B 5ICXA 2DQTL 2FIKB 1BHGA 5DQJA 2JQAA 4RFEB 2WBWB 4O02A 1MWOA 1XGZA 3VXPA 4RIRB 2VERA 3F7RA 1HHHA 4X5WA 3HKFA 3RWJB 1YYMH 3GLEA 4J4PD 3SD5A 3CVHL 4QGTA 2XVBA 3EGDA 3MFGB 2XIBA 4LRIC 2YPLD 4L1BA 4U1HA 3M07A 4X4YA 2FIRT 4IRSC 1NGWB 4JMXA 2ZWYA 1FWXA 4G2AA 3WN5A 1TJIL 4LLVB 5LDSA 4TLTA 5DQDH 2XTJB 3LKOA 3NIDE 1X5ZA 3ZT5A 1RZJC 2MCPL 1W6WA 3TO4B 4I2XB 5AD0B 4JY6B 4K55A 2B7DT 3L16A 5ID0B 3HN5A 2R15A 1T2QH 4GRLC 4I5BB 4O58L 2EIDA 5EB9A 4EOWH 4ZMZA 1UHVA 3R18A 1I1YB 1PZ5A 2YMTA 4WHTA 1INQB 3D25B 5ENWB 1IEAA 1WAEA 3IDJA 3KVPA 2IGFH 2ZXEB 3FONB 3G6JE 4PN6A 4GFXA 3MACH 3CVBA 4DT2A 4KTEH 2VLME 1AZNA 3VTAA 2E8YA 4PSRA 4IU3B 2BNQA 2D3JA 5AAWC 3WNPA 3WU1A 2WVUA 5D7LB 1EO8L 3PIQA 4M7JH 4HH8A 5IG7A 2P5EB 4DKDC 5IB1A 2XZCH 4WGKA 3VFVA 3CHQA 4NP4H 4OJCA 4PBDA 4F8QA 3FTSA 1FZMB 5F3HB 4BQBA 3FSWA 4NNYB 2W1NA 4LPYA 2FR4A 1T89C 4ZOEA 3FO9B 3HJ0A 4RNRB 2FX8L 2DWTA 1K3IA 3F85A 4S1QH 1HHJB 2QPFA 4UT9H 5LB1A 1IC5H 3SD2A 4RBPH 1ZSHA 4LXFA 4EE2A 5C7XL 3R19A 4OBRA 4L9LB 3GK8H 3P4NB 4MVBD 5I1LB 1B0GB 2VLJA 2OFQA 4J7RA 5GJTL 1RCYA 4BGLA 2Q2EB 3L3KA 3BGMA 2PR9A 3VFPA 3P4LA 4H8PA 4XVTH 2P80D 1LHZA 1FHNA 2APXA 1Q9WA 1J0JA 1U3HA 5ISZB 3ZTJH 3MUGB 4JO3H 1DBKL 1V55B 2WNGA 2JXMB 4Z7OF 3DXAB 12E8H 4G8GE 4P2QE 5B39A 3MV7A 4FJ6A 1E6OH 2OSLB 3D3VB 3BVVA 3HN3A 1SLXA 3OR6A 4ZUWB 1JI2A 1WH0A 1XHHA 1YMMD 3TBBA 4G83A 2QQKL 4X6DB 3WG7B 3RFZC 1Q9LA 3BZ4A 3M88A 3ML9A 1X5IA 5FGRA 4DZ8B 2YGQA 4J3WA 1TQVA 3PWPB 3P4OB 2DL9A 3FO2B 1HEJC 4DEPC 2Q20A 5I1KL 1PF3A 4HGKC 3IXAB 2AJZA 4TVUA 4LSVL 4YHIB 4EIGB 2B08A 3NRQA 4WO4B 1XBDA 5FCSH 1KBGL 2FAUA 4JKNA 1QASA 1RURH 5MEQA 4OQTA 1DVUA 4MCYB 3A23A 2OL3B 3LB6C 4K15A 5ICZA 1K4DA 3QIUD 5F1IA 4OJFH 2ZCKH 5FYKH 1T7ZA 4PJEE 3ZE2B 3O6KH 3UZEC 4UCFA 2QQKH 2DD8L 4JPKH 1JVLA 5LNEA 4MXQC 2RD0A 3EH2A 3SO5A 4AH2B 2VE6B 4PP2B 1KYAA 2R2HB 4MGXA 1BVNT 3Q05A 1FYTD 1PD0A 3G3LA 1EDQA 1IAIM 1U2YA 4NIYE 1G7HA 2XKUA 5TK2A 4PJBB 1A6ZB 5A16B 2VR8A 1Y0LA 3KYNB 1C8PA 3M46A 1L7IL 1O7VA 1R4XA 2YK1H 3PV6A 3QRFM 1K6QL 5IHHA 2GUYA 3FZUC 1XGRA 3QP3A 1SGKA 4BCZA 4H25B 2J6WA 4IJ3C 5HI3C 4D0DB 2FSEB 4UV7L 1FFNA 3JWNE 1FAIL 2CCVA 5G4OA 4LSTL 3MR9B 5HGBB 5F70A 2ZIDA 3CCHB 3OKOB 3QIWA 1BZOA 4HUVB 3TX4A 2BFGA 4YSPA 1S7VA 2ENQA 5K1VA 4YE4H 5MEOA 2IADA 1JTPA 1T6BX 3EJTA 1NGQL 3QWRA 1I75A 2H0PA 4LCWD 2DRUA 4ECNA 2JJSC 1S7UA 1QRND 5LGHL 1D5ZB 4JFEA 4W9JC 1HI6B 3TLRA 4X0KA 1D9KB 4XBPB 1MAJA 1CDCA 3LXUX 3WIFB 1R3IH 2AQ3A 1DE4B 4JFFD 1FO0H 4TN9A 4XN8A 4ODXB 5CILH 3TF4A 4AGMA 4GSQA 4YK4C 3A5VA 1KEGH 1NWPA 4W9EC 1MCKA 2MPAL 3AUVA 1FLRL 2VDLB 5D1XA 4XCNA 2LU4A 4TQHA 1XXDC 3P11H 3FTVA 1KXVC 2CLRB 5C0NC 4WTZG 1UA3A 1F11B 1JMZA 1RZPA 2EUWA 1JNJA 4POUB 2VNCA 4B27A 3PV6B 4QTIL 4DTGL 4PV8B 1VIWA 4TULH 5EBMA 2HPTA 4L0ZA 4NHUA 1QR1B 5CSZA 2NXYD 3QGVA 3HS0C 1UKTA 4G5ZH 5ESAA 2I32A 1NBVL 3KPNB 2VQTA 2NX5E 2Q1EA 1JI1A 4PGEB 1I4FA 2EXWD 3QUYB 2UXGA 4JREB 1KTDA 2AI0L 4QXTB 1KEGL 5AZUA 3SDYL 5IHUH 2UZXB 2WXFA 2C3GA 1BWWA 1AR2A 2ODIA 3NVQA 3S5LA 1F0LA 3B83A 5E9DA 1U3NA 1YEFL 4B95C 3QQDB 3CSBA 1GCYA 1MRDH 1ZA6B 2XPYA 3D69B 3HLAA 4L18A 2KQMA 4N26A 2CH8A 3QFJA 1LO3L 3BH4A 2FWSA 5DC9B 1OK8A 4DK3A 5EEZA 5HY9A 3NN8A 4K9JA 3R1GH 2NXYB 5EZPA 3ZR6A 3D52A 3FQXA 3KWXA 2AI0H 4PGCB 3O6LL 3HB3D 2IOIA 2VLJD 2AZUA 5SWZE 1KXVA 2PYFA 4OF0A 1X9LA 1KC5L 2VDNL 1UD3A 2GCYB 4U6TA 1GYUA 4PWKA 4V1DE 1QSFE 4UAHA 2VN3A 4U1KB 3BWAB 1FAKT 3RDTA 2DIJA 4ZXBB 3FH7A 1UENA 5C0BA 4HWEL 2DWDB 1NBQA 2Q10A 1G9MC 1PY0A 1HKLH 1K2DB 2RFXA 3CNKA 1F5WA 5F6IB 2CGZA 2WGXA 4PJIF 5JXEA 5KVFH 1TTUA 1F86A 1IGML 2F53D 3G5YB 4F92B 3MJGX 3ELQA 3O6LH 3N5AA 1OTSC 4ERSL 3OKMB 4HAKA 1MJ8L 3CWGA 3CG8A 5E4OA 4H0IA 5E95B 4DCQA 5AL0A 3W1ZA 1BJ1H 3MLZL 1AGFB 5E08H 1F1GA 3EO0B 4BCXA 4TV3A 2ZSVA 2Z31D 4OLWH 2O1AA 4F8TA 4IMKC 4AOFA 3MBEC 2HT4D 4PRNA 3US1A 1QSED 5LN8A 1Y7VA 2XWJB 3JTSB 3QI9D 4P59L 2XQYA 4MNQA 4YDVA 5DFVD 5IESH 1JK9A 4OZFA 3ABKB 5GGSY 4X6DA 5EZJA 1NGYB 3MRCA 4NO0A 5CMAA 3GWJA 3L95A 3V0VA 4DQAA 2FK9A 4AQ8C 4CC4C 4ERSH 1AFVL 3BT2L 2PPFA 1F90H 3ALPA 2DQDH 5FYKD 1YEKH 5IW6A 3NP4A 2IOOA 4JPQA 3RI5F 4YQXL 4NN6C 4YSUA 4PJAB 5TFSL 5CWSA 3N1FC 3BKMH 2D0FA 1SLUA 4PCTA 4Z0BH 2R2CA 2E7DA 1KZQA 3QJOA 4DVBB 3FNKA 5PCYA 1ZXKA 5KBDA 2P5WD 1QVOB 1EFXD 4B9FA 4FX5A 5E8NB 3JV4A 2ZWNA 3BT0A 4UT7H 1ODAA 2ED8A 3I9AA 2LR4A 3HE6A 1KPRB 3V9EA 1A9EA 3ZQWA 1KB5L 4KTEL 4GKOA 3U4BH 4BFJA 1RZ8A 5A2FA 1XSIA 3GJFH 3CZEA 4JCLA 1CDBA 5DMIH 4OFKA 1YPZF 3FCTA 3HZYA 4LKXA 4PWIA 3TJEH 2YOAA 5CGMA 1O9VA 5K9OB 3MLRH 1N59B 3WEMA 2V2XA 3G6JB 3ARGB 3HRZA 1G9NH 4L3CB 2Z35A 3OXRA 1BBJB 2JKXA 3N44B 3BKML 5JIKA 4YBHA 3B2XA 3JUYA 4Z7IA 1N6UA 1F8TH 3O2WH 1WF5A 5F9DC 3O8XA 4ONGH 3O3UN 5DJCA 1KIUB 3E9TA 1LEGB 5DI8A 2VLKD 5K9QG 2PPCA 3NFNA 1LMKA 4GKNA 4BE6A 5KVGL 3T8XB 1RIHL 1XCQA 3O41B 3ERXA 4F7CA 5DXWA 1R5VA 4MNHB 5H8DA 2V6HA 3HBQA 3V8OA 4Y5XC 1U3HD 5DQ9A 3OJMB 3L1EA 1NOAA 1PG7W 3VW3H 3EJSA 3FOMA 4WO0A 1LVEA 5JHDA 1FZKA 2X4RA 1HSBB 2DQFB 2YD3A 4TUJB 3ZYOA 1MXGA 2WNXA 3RFRA 2ZUQB 4EZJA 2XBZA 4OU3A 5D5MB 1DBAL 2AFNA 4XVSL 2EDRA 2QPSA 4LBEB 4UOZA 1I1YA 1DUYB 43C9B 3ZO0A 4KKLD 1HNFA 1QWUA 4LHQB 4UQDA 4ZO6A 1YY9D 1H3UA 1TF4A 4TOYH 5J7CC 1JFHA 3CFQA 3VSVA 3KPOB 3IU3A 3HPJB 3L81A 4PJDF 4HZLA 4JRYA 5M95B 3CC1A 5E4AA 1MXDA 3QPQD 3OX8A 2C1OB 4OCXH 2UUDH 4X7FC 5F1NB 2FB4L 2CPCA 1I8IB 1MFAH 2VDKL 4JS7A 3SBPA 3KPQB 1PJ9A 3IGAB 5C0RL 4ZJ9A 5SWSB 4AUYA 4QOKE 1ES0A 5D7LD 4YHOH 2P4AB 4XO3A 2YXFA 1OCWH 4U6HB 4XTRC 4Y7MA 2CALA 4BZ1H 1TJHL 5G2NA 1I7UA 1TEYA 4L8SC 1AQKH 2C9PA 3IDMB 3J27A 4OCYL 1ACXA 4JG0L 4LL4A 4AK1A 1NLBL 1HHIB 3O6KL 5D7KD 3JV6A 1JXFA 2ZUTA 5JMOC 3H53A 4M4RA 2P5WB 2DMKA 1A4CA 2A77H 4HD9A 5DZJA 5DD1H 5FOBA 3WJJA 1O5PA 1P6FA 4JFPB 5TQ2H 5KYNA 3OF6D 3ARDD 4QXGH 4BQ9A 2VAJA 5F9OH 3LEVH 1KY6A 2VDKH 3W0WE 5MHSE 2R2BA 4Y4HA 4CA4A 3C6SB 4ZNCD 1L9TA 4FNUA 4AYMC 4HAFA 3HLAB 2XTJD 5F7KC 3SKOB 5BNXD 5HYIA 2H6PB 1K4CA 1JYNA 3DARA 2ZXAA 3N9GL 5C2UB 1CD1A 5EO0B 3APCA 1INEH 3JV6B 2J20A 3AXHA 1T1WB 3BISA 4L5FE 5DO2C 1UKSA 3MN8A 4G9FA 4Z7UF 3AG1B 1MF2H 4YDZA 5TPWH 2H0FA 3T2NL 1TJXA 3C8DA 3K6SA 4OD1H 4P49A 3GB7A 3QHZH 3QPKA 4KV5E 3W0WD 4OF8A 2C9SA 4ZSOA 3REVA 3FU8A 1VJSA 4BFKA 1M6UA 5IMMA 1HH6B 1KTBA 4ZDHB 4YE4L 1ES0B 2X6VA 1RUML 1NGQH 4RQQA 2AXGB 1YY8A 1FL3B 3RWEA 1FNHA 3C8HA 5B4MD 3MV8E 4U3XA 4DW2H 2WXQA 2XX1A 1JD9A 1MELA 2EAEA 3NCEB 2WYHA 5D1QA 5DD3L 3ROLB 3F65A 4ODSH 5J6HA 5JNYB 4A1RA 4LDLB 2VDPB 4YDIH 1P5VA 4J6RL 1MCPL 1G94A 1QRNA 5JW4N 4XNUH 3QEQD 5E6ID 4GW1A 2XYCA 3BKCH 1AAJA 1YECL 1ZPLA 5EEVA 3G5ZA 3QCTH 5F88B 1OTTD 2YJQA 1QA9A 1DSFL 1QTSA 2V8LA 3WTWA 3UPCA 3GSWA 3WGUB 2V2WA 2X4RB 2VO5A 5DS2A 4G7RB 4GI9A 1MFCH 3RI5K 4A55A 3MRRB 1IVTA 3L9EA 3NACL 2V3DA 3PV7A 3HB3B 4X4MA 1X4ZA 2K78A 1NBVH 9CGTA 4BUQA 3ZSTA 3RWIA 5F3BA 3OKEA 3D4GA 3ABZA 1I1CA 5EIQA 4QAWA 4R3SA 1FFPA 3GM0A 3FB6A 3AQDA 4HIJB 1OLLA 4GQ9H 1E4WL 1T20B 2H1LM 2AABL 5ABZA 5LWYL 3QZLA 4RZCB 5GIRB 1U2HA 3TIDB 5I6MA 4PJ7E 5HGBA 1W9XA 2NT0A 2K45A 3LX9A 3V5KB 3LS5H 3DBXA 1SN5A 1HL9A 2E9WA 4NT6A 3QIBD 4DP2X 2CLVA 5IK3B 2AERT 2XXCB 3DRQB 4MD4A 3ALXA 3MKGA 3LKQA 3ASWA 1FCCA 3R1GL 2Y3NA 1XT5A 3SPGA 2GW5A 3BVUA 3FUKA 4M02A 3VD7A 3GRWH 5IGXL 2C8NA 3VCLA 2AABH 5IBTH 5AQ0A 1A2YB 1IAKA 1BBJA 3OAYK 5J1SC 4PB0H 1KLGB 3L5WA 1J8HE 1ZSDA 5GGUA 1HEZA 2Y36L 3T3PE 2WZ5A 5B1AB 3PYCA 4PJ8D 1I1AD 2P48B 4L37B 1ITCA 3PU7A 5EU6A 5SX5H 1MFMA 1AIFA 2H4EA 4DGYH 5KSUB 4DN3L 3H7LA 1IL1B 2BHFA 4BV1A 3HI6L 5DSCB 1YN7B 2YUXA 3B3IA 5T1LA 5IM7A 5F0PB 4WFGD 2BOBA 2A4CA 3VDCA 4Q9QL 4ISVA 2BIIA 3UZQA 4NZJA 3S37L 3NZ8B 4U7SA 2EE0A 1RPKA 1Z5LA 1CCZA 2CBOA 1EMTL 3DV6B 5IGXH 2WLJA 4YXLH 3DYMA 3C6EA 3GXDA 4A2FA 2CKNA 4ZS6C 3WUWA 3W2DH 3UZVB 2PETA 4AQZA 4LLQB 2J6EL 2BP5M 4LLYB 4D94A 1WG3A 1F1DA 1NWOA 4AENB 4Z7OB 1KTRL 3GB7B 3KPMA 4EXPX 3VXUB 1TZOA 4RA0C 2PW2A 5IHBA 1RL1A 1G7LB 1MZZA 3KCWA 2Y3AA 1I9RL 5GGTH 4LT7A 2OCJA 2YD0A 5CLXA 1QLEL 5AYUH 1P1ZB 3FB5B 3MV9E 4JQVC 2VAAA 3DGCR 2OQJB 4YHPB 2X2HA 1UACH 1MLBB 5DJ2A 4P5RA 3NEOA 5ANMB 1MNNA 4XXWC 1UG9A 4LDEB 3C5ZC 4NBZB 4U1SA 2UZIL 4TUKL 5SX5K 4G7VH 1AZUA 1YMMA 1TT6A 1OAJA 1PKOA 4BKLA 1SOSA 3RU8H 2ZD0A 3NSJA 3QC6X 4XNXL 4Y0GA 2C3HA 4LVEA 2VGLM 4NQCA 3QEQA 5E6IA 5I28A 3K7UA 2D3VA 4FNSA 2JKJA 4UDUB 3SE9H 1NUGA 3AGVA 3GXTA 3OAWA 2CLZB 1W8NA 3QWRD 3RVWC 1OY3B 3UABA 4JRWA 5K93A 2ZP0T 4Y5YC 2C3VA 5A2BA 4JM2D 2X7LB 2ATKB 4GRMB 4ETQA 4FLRA 1URLA 3SE6A 2DKUA 3BSHA 3MNWB 5C0BB 3DX7A 5KBLA 2WIIA 3NCYP 2GJ6D 4WO4C 3OKEB 2VUOA 4NUJB 5T3ZE 4I18B 1UQSB 4Y4FB 1UURA 1IAOA 5SX4I 1ZJBA 3OMIB 4TVPH 5I0DA 1K8IA 4NYLA 1ZTXE 4ZMLA 2CJUL 3UTPE 1WAAE 2IDTA 1LE5B 3P54A 1ED3A 1YNLH 3W0WB 3AAZA 2AGJH 1R46A 3WHE0 4DAGL 1RSFA 4J5VA 4HHGA 1M3IA 1AY1H 1S7QA 1Q0EA 4Y4KC 2YEZB 1BJMA 1BQUA 3GI9H 1XCTB 1C7TA 3QARA 1UTDA 3IS0X 4XO8A 1OCOB 5HYEA 2JKSA 1N5AA 4RMSA 2ZKYA 3MYJA 2VM4A 4PGEA 3U7AA 2YPLA 3V4UL 3FTYA 1E4KC 2HUEA 4LK4A 4RGOH 1NIAA 4W6XB 3WS3A 4O9HL 4P57B 1BM3H 1YY8B 3FN0H 5JDSA 4C83B 1KYDA 2HJLA 4DO5A 3T2LA 1YZZA 1JPFA 2FATH 4AG4L 1GHFH 5FB8A 25C8H 2D7NA 5ADOL 3GI9L 1R34A 3NCBB 4UZGA 5HY9B 1U4EA 2IH3B 4N2MA 1A14H 2WLMA 1DQTA 3GTNA 3REWB 1BF8A 1FL5B 5JYMA 2J4WL 5D71H 1X5LA 3MBXL 3GSOB 4LCCC 1PY9A 2HRHA 4IOFC 2E4TA 5IMLA 3WTSA 4MD0A 4FXLA 3HZYB 3EDEA 2NY0D 1FO0A 2GBVA 4AZ8B 4KK9C 1KYOK 2YEZA 3E6FB 3FCGA 5GJSL 1QA9B 1KLUA 4Y88A 3BEVB 3MRGA 4MJIA 2C9UA 4G72B 1OCWL 2WBKA 5K9JL 4RFOH 3NH7H 3DETC 2FATL 5E03A 3L17A 3V0DA 2HRPL 2X88A 3BKYL 3TZVC 1ZGLA 4JO2L 1OLZA 3M8OL 1SXAA 4FI7A 1D9KA 3V4PH 2IPUG 3NJLA 2OXHB 2ZOOA 3ARSA 4GKLA 4CW1B 3MRPB 4Z23A 3UTTA 5CJQL 2NY3C 3G6DL 3K4ZA 4NWTL 2FYVA 2YPVL 3BSZH 3TTYA 1DQQA 4PYHA 2XQBH 5EUOF 1NCOA 2P43B 4NNPL 5FUOH 5HHOB 4AKQA 3QNZB 4PU2A 1E67A 1EJ6A 3TH3T 3M17A 3TEZA 3OSKA 3L6FB 2YUZA 2MQ0A 4XCNB 1OT1A 2KQNA 1J10A 1E8WA 4G6AD 5AAMA 2AJVL 3EADA 1XGUA 4CKVX 5KZCB 5I8KH 4JHAL 6FABH 5A3ID 4RFNC 1TTRA 3KGSA 4UOJA 2APBA 1ILSA 1FVDB 5CUSH 3RIKA 3UTTB 1ZS8B 5KBNC 5EOCJ 1GAFH 4X7SL 1MF2L 5F1IB 4R0LB 4OCSL 3FPXA 2ZXBA 1KN2L 4PJIE 4JMNA 2WXRA 4OGAC 1MUJB 4OZGE 3OAZK 1A3LH 2V17L 2AW2A 3BKJL 1CT8B 3BUDA 3HAEG 4G59C 4XMXA 5F71A 3CBJB 3KLAB 4I0CC 5GISH 3O81A 1JWMA 3FC8A 2A4EA 3GDCA 3TFBA 3QDJB 3N3EA 1UT1A 4Z95L 2WV3A 3W0WA 4OFIA 5JNYA 4M3HA 1E4KA 2G9HB 1L0QA 2H3NB 5I76A 5JPNA 2BCKA 3SE8H 3Q1EA 4GAJL 3T2OA 3FHEA 1SYSA 2GTWA 1ZD6A 3QFGA 4PWGA 3TYFA 3AROA 4HLEA 3S36X 1OZUA 2WKGA 2B15A 4XNUL 4CSPA 1FH2A 3J07A 1DVFA 1S5HA 3KM1A 3U1SL 3GNMH 1YECH 2VISB 3GXMA 3L3OB 4M5ZH 3WOVA 5FV1L 3SO3B 4X8JB 4LCUA 4R0LC 2G5BA 3WLBA 1MG2C 1MCWM 1YYCA 5DC4B 4KX8A 1MFCL 1PLGL 1GY2A 2MHAB 4N0CD 4GLRI 3SDAB 4E41E 4R4BB 3KCPB 1XF5B 3P3TA 1UOLA 2FEJA 2FHCA 4APQA 4L23A 1D6VH 5IQ7L 3SE8L 1OGSA 1DBBH 1E9OB 1NMBL 1QSEB 3CLEL 4IBSA 1C5CL 3VVWA 2Y5TA 4WAFA 1BPVA 4MAZA 4K3EL 3I6KB 4JM4H 3WFDL 1EA9C 4LL9A 4JFYB 3EHBC 2X44D 3O8XC 2Z8WC 3GBDA 5EG6C 2B1OA 3P0GB 2KMWA 4GIOA 3B2VH 3AC0A 3UGEA 3N43F 2ZYIA 4AVIA 2NZIA 2V9UA 1JVKA 4QXTA 4AQ1A 1KYUA 4RRPG 1G0DA 2AJXH 4PJGF 5BZZA 3ZDWA 1F41A 2QZQA 5KBMA 5E6SB 1XV8A 4PRBA 2WVTA 3MLWL 3ZDYB 3QXAB 2DJ4A 4L3EB 5EZLB 4APQB 4AYBA 3LV3A 4F9LA 5IMOB 4XCFL 4RWYL 2BNRB 5IHZB 4Z7WA 4ONFH 3EGSB 3AM8C 1N64L 1UZ8A 4H4NA 4W9IC 4PJ8A 2ICWJ 2OJEB 1JIBA 3L3OA 4MWFA 3ZYIA 2LVEA 2PN5A 2CUIA 3K1KC 1HFUA 4Z0XB 5LHDA 4DERA 1KJ3L 3L3HB 1AQ8A 1TCRB 2AITA 1B4RA 3WJLA 4PTTB 2VLJB 4EN3A 2BP3A 2I5YH 3S96B 2EDEA 4U31A 2UWEF 1SXCA 1DVTA 2CJSA 3GSWB 2QGCA 3ECWA 1VFBA 1Z9SB 5C0IA 4ZYKB 1KBWA 4M4PA 4HCRL 4MVBC 2DYSB 3H42H 4ATTA 2IDFA 3GMLA 4XRCB 1N64H 4L4TD 1EMTH 4JBSA 4MJ4A 4B97A 3LKOB 3ULVH 2RFXB 1CTNA 1BF5A 3ARVA 1Z9MA 3LEXB 1V7NH 1TQUA 4GBXB 4X7DC 3CH1A 5E9NA 3WHE1 2AEQL 3IM1A 1RP8A 2L7JA 4L8SA 4ES8A 3O3AA 3OTTA 1TMQA 3B3BA 4FFVC 2RMNA 4UZSA 2ICWB 3ZHLA 5C0AB 4HHAA 1ZIAA 5DZLA 1CFNA 1JD7A 2Y6SD 1OQOA 1IIKA 5ETUA 2EE2A 1ZT4B 3C9NA 2DYRB 2EDJA 1WEJH 2BVTA 1UH3A 2NDGA 3K2UL 3V8CA 2YMOA 4XPBH 1UCBL 1U8LB 2OI9B 3Q9PA 4FNQA 2FX7L 1CG9B 5D1XB 3C60A 2I9LB 1I1AB 4LPTA 4P4KB 3ESUF 4MS6A 1Q1PA 4RZKA 3RDTD 3DHJA 1BZEA 3S5LG 5HSFA 4H7VA 1V7NL 2GC7C 5IHWA 2O93L 1MRFH 1JF5A 4M7LT 4UANA 5F3FA 3CN2A 2LQRA 4XAWL 3GTTA 4J6IA 1TOXA 3PXJA 4I85A 4Z7AA 4UQEA 5C0EA 3OG4B 1BX2A 5DJDA 1A3QA 2NY2D 4GAYB 2QFRA 3SE9L 3ZTEA 1XTMA 4J3SA 4JJ5A 2W65B 1HEZB 4P4KC 5I66B 4AQOA 4G1EB 3K91A 5LBSH 3RLSA 5B8CA 1DDHB 2AKRB 2YAHA 3RZWA 2Y9RT 2MQ3A 4LBEA 4NUPA 5FUZH 3QO1A 1E8XA 4B9CA 3BQVA 1ZEAH 3UBFA 5FAAA 1QRNB 1NCCH 3QNZA 2Y7MA 2FSEA 5K69A 3UBXB 4X5WB 2NPLX 2MOGA 3LZQA 1SHMA 1EJFA 3THMH 3US9A 4F37F 4ZFZB 5ES4B 4M03A 1AG0A 1TXKA 5DMJB 1Y6MR 5I8EB 5C0BE 2Q8BH 3UTOA 4F33B 3BIAX 3I6LD 3BX7C 5DHVA 2W91A 3GM8A 3ZL1A 2AGJL 4DAGH 2J5LB 3FZUD 2OSLA 3IGAA 4QYOB 4YHML 4OZ4B 4NRYB 3BSZA 1OKEA 3SKMA 1UA6H 2JXMA 2DBLL 3ZDXF 2EDXA 2AK4D 4WW1B 1MNUH 2BC4A 3QWNA 4PJEB 3ZE2E 1FL6B 1K5NB 3V4UH 2HP4A 3D30A 4OFPA 4AGQA 3ZZ1A 3VH8A 4RGOL 2OSXA 2K9FB 3QJZA 1A47A 4MNQD 1ZV9A 4IKNA 3BDXA 5AB0A 4UB0L 1OL0A 2YQBA 3PWLB 1XAKA 2NW2A 3RGVD 3DX4A 2RB8A 3CN1A 4L3EE 4PJXA 3X17A 5C0AE 4AGNA 2GFBA 1M2VB 1P7KB 2XQYG 4QLRA 4ENED 1KZYA 3TU6A 2BFVL 1U6AL 4P5TD 5LGKA 4GSDH 4MKTA 5JW5B 4OZFG 2G60H 5CLZA 3AVEA 2H7WA 5B7EA 3A6OA 2WAHA 4JFFA 1RZJH 3D87B 4U6YA 3ZMRA 4EZMA 3DRQA 5ICYB 3ETTA 4ANWA 2ILLA 3SYCA 3B34A 5DHDA 4KQ0A 2V5MA 4LSRL 2J4WH 3RGHA 1J8RA 1D3CA 1TQCC 4F20A 1CFVH 1EAPB 1NCBH 4KGLA 4KVNH 3BZEA 4TRPL 3I9GH 1J8HD 4Y4KA 3VGEA 5C0CB 1UKQA 3PHAA 1G7HB 2N1KA 1SYVA 1J18A 3KR3H 4XVUC 5I9QB 5T1JA 3PL6A 4RGMB 4KH2A 4JPVL 1LP9B 1U8QA 4BFIB 1GYCA 3N1QC 3D0LA 4AV5A 5BMFH 4G42A 1MSPA 2ESVA 2W9EL 2VWEC 1BXAA 2AV7A 2NNXA 4P9HC 1B4TA 3W9EA 4AY0A 1GIGH 5D2LF 2MNUA 3V4PL 4NUQA 1H5BA 2LOEA 4M43L 4NN7C 1UWGL 2IXQB 3K3QA 4HK3N 1X4YA 4OBSA 3MTRA 1BFSA 4FRWA 4X6FA 2BY1A 4OM0L 2NT1A 3HHMA 2J8OA 5TE6H 3RWGB 1CFVL 2OK0L 1VF5C 4HWZA 3GKZA 5DS8A 1JGLL 2VMDA 3UJIL 2VLRD 2CRMA 3U9PH 2G5RA 3KWUA 5FF6B 4YBLB 1CLZH 5E8NA 4Y9BA 3UJJL 5EC1A 3FUMA 2IADB 4CMMB 1NFIB 4MMXA 4I0KA 1NMAH 3FQ1A 1CTOA 4DQOH 2ZUVA 3RY6A 5SWQB 1GZHC 4J8RB 4QF1A 5T1LD 4G8FB 5TGBA 6FABL 1UZ8B 2YRLA 3QUML 4GW4B 3VMNA 4RISH 1LEIA 4RGMC 3UG4A 3T4AB 1NKRA 1S9KC 1U8OA 1HVXA 4X5PA 4U1GB 1E9PA 4MB1A 2ZCHH 4NQCB 1E5ZA 4HUWB 2CO6A 5DJAA 3N42B 4F57L 3GF8A 1NFIA 3FQYA 2WLYA 2YZ8A 1N0LA 3OJDA 1AHMA 4JRYD 1I31A 4P05A 1JGDB 3KYOB 1A8ZA 3GSVA 3H6AA 3M1BA 5B1JC 1INQA 3D25A 4K7PY 3TBWA 4JM0A 4DQOL 5DK0B 1S7SB 4K3GA 2XN9E 3RPIA 1I7ZB 2PCFA 3SKJL 2JELH 2IBGA 3ECBA 1WBYB 2YXWA 4MJJA 3MLUL 3H2PA 4ODVH 2ADJB 4K23L 3Q8BA 1N2RA 4PGJA 2WQ8A 1RK1B 1Q4NX 2F74B 2QVKA 1RUPH 5FR3A 3DRTA 3ZO9A 1KLGA 3L5WB 4MB4A 1RVFL 5I15H 4U4IA 3T2QA 3FXIC 1DVYA 4XCCH 4GEJA 1IGYB 5IB3B 3BN9D 1EH9A 2NY7L 4LSQL 4MMYB 1VKXB 1CUOA 5DC2A 1MI5E 5CJBA 4U1HB 4W1TA 1JZ5A 4R7NB 5DRNA 4ZMVA 4NN5C 4ODUA 1ID5I 4ALAC 3PREA 4HJUA 5E23A 4H25A 5JQ6L 2EIBA 2ZAGA 1DVSA 3SKJH 4YEEA 1KYOJ 4H0HB 2FQEA 2EUVA 1NAKL 3WV0A 3HS0A 4NC1C 2ZOKB 2VH5H 2NY0B 2WWOA 2VXUL 3DX9B 1RPQA 3LKRB 1QEWA 2ICEB 1NM4A 1R3KA 1WZ1H 2VSKB 4MLIA 4EJ1C 2I9TB 4ZUWA 3MSPA 4WGWB 4AEIH 5E6ZA 2CBTA 4M48H 5E7BA 3QUZB 1BQRA 2DWEB 3X11A 1H3TA 2YUVA 1I9IH 2ZWZA 3MLPA 2CDGA 4DKEL 4WFGE 1TQTA 2NOYA 4G8GA 3NJXA 5AW7B 3HI5H 1BFOB 1MJUH 2HFFA 3RE0A 3DTDA 1DE4A 4OF7A 3OLEA 5JUEH 3MJ9A 2NY6D 4N6RB 4YNYA 5EZIH 3VXOB 3T6XA 3GRWA 1QZ1A 2W0PA 1IGJB 1ET8A 3MHZA 1BZ9B 1R5IB 5IF0B 2G9KA 2RJMA 2GJ6A 4CKQA 2DJSA 2HMIC 5EEUA 5T5NG 2J43A 2HJKB 3DX6A 1TCRA 3B2PA 3IGKA 3ZJAA 2ERJC 1HE8A 5FW8A 4M9OA 2A1WL 4R26H 4IBZA 2BNRE 5I1AA 3EOAB 3NIFE 3N41F 4NHUB 1QR1A 5GZND 1BJ8A 1CO1A 5IK3A 3F2LA 1XH2A 1AKJB 2OZ4H 1ASPA 2O4EA 1ZXQA 3KD4A 4CW1A 4PJBA 3SQBB 3Q6GH 4UIKH 1FRGL 1HWHB 4X42A 4D9QD 1ZE3H 1J87A 3GS7A 2J5WA 4M6OH 3SDXA 3BMVA 4X4XA 5JXEC 4G8IB 3JYCA 1SM3L 4RSVA 3DVGA 1XWVA 4MCMA 4GBXC 4R26L 3GIZH 5I2IA 4HYTB 3V6OA 4L3FA 5DRZA 5I1JH 1RI8A 2BMKA 4F58H 5TDPA 1CICC 5FYJD 5GS0H 4J3VA 4TYUA 4XN4A 2E7LC 1CGUA 2NNRA 4Y1AD 5INCA 5I16B 1XCXA 3WY4A 1FRGH 1UCBH 5HHNB 1E5YA 2O61A 2A73A 1CBVL 2WKOA 1R3HB 4DETA 1GS8A 1HYRC 4C57C 4DEPB 1M3JA 3DURA 2ZPKL 4ABVA 1KOAA 3K0YA 5MERB 1XIWD 4MQXC 5DZOA 3F12A 3MNVA 4PJ8B 1E8ZA 4C83A 3ABLB 5JDSB 4XAWH 2XV2A 5CCKL 1MWAL 3HNSL 4NWUL 3RDTB 3QR2A 4B60A 3TXAA 1L0YA 1NCDL 1LP9F 15C8H 4XTRD 4KKAC 1P0SE 2HCZX 3BMWA 4W4NA 2YD2A 2MSPA 1FYTA 1J1PH 4AIEA 2QKIC 4GB9A 1BQLH 1M05A 5BQ7A 3P4MA 1YUKB 2WYIA 3BGFC 1OAYL 1S4IA 4KRLB 3EJQA 2YMXH 4NO3B 1C08A 3H85A 4PRIB 2COQA 5KYXB 1NFDB 3MRFA 1XEDA 4GKZB 4ZQTA 3HZVA 4U1IA 4KY2A 4AH2A 4M7KL 3VGDA 4R7LA 3TTSA 4G9FB 1VGKA 2FWLB 2OP4L 1A7QH 4I9WD 2OJZH 4MB3A 1FQ9C 3RWGA 5CCKH 1IBGL 3GSOA 3G5VB 1H3WM 2FRGP 1KBVA 1N7ML 3MRDB 15C8L 4FQJL 3WE1A 5L4JA 5LXVA 1E7VA 1FVEA 1TJGL 3HW7A 3CXDH 1MJ7L 1P4IL 5EIIB 1ZTXH 2WLIA 4G71B 1EVUA 2ZZUT 3CQPA 2HFFB 5GHWH 1BAFL 3X13B 5IKCA 3OLIA 4NO3A 5ITBL 2VJ8A 5GZOA 2D2OA 4ANXA 1TTGA 1MNUL 2VXQH 2XG4A 5DUML 4UILL 4XNQB 3S34L 3AXLB 4Y5VC 4R4FH 4BZ1A 4GI8A 5HGDB 3B9VA 5E0FA 1FFNB 1WIPA 5D5ME 1P4BL 4ZI8A 2YZ1A 2XNAB 3Q48A 1PZ2A 2BWQA 1N7MH 3FFCB 3NFPA 4FQJH 3NQKA 2EYRA 1AD9B 1U91A 2UY7B 4FNRA 3AREB 4LL1A 3N2JA 3N04A 1O7SA 2FYYB 3CVIH 4JFFB 2VRKA 4Q52A 2BFVH 3EF7A 1BQKA 3CSFA 1EJ8A 2QVIA 3ARBD 5DZAA 2F54E 4UAOB 2IGLA 4AUUA 4N1EA 5T1KD 5J9PA 5JOFA 3F6IA 3AS3A 1JPTL 4XOBA 5DRWB 1JZ4A 1UGNA 4UYQA 4S11A 2XFXA 3VWKC 4R4FL 3D2UB 4LCYB 3JWOC 3FFOA 5DC0A 1CE6A 2DKMA 4CC0A 3EBAA 5KN5A 4EN3B 2EXTA 3IDXH 3SDCA 3WFBH 3RWDB 1G9MH 4XVJL 2AP2A 3S3JA 2FJUB 5HHPA 4PTTA 4AKPA 1OP5K 1A7NL 3DO7A 1MCIA 1J86A 2Z65C 5F3HA 4IRSB 5I6PA 3RL1A 2ADGA 3BP7B 1JPFB 5KTEL 5JW4Q 5KBKA 1HKFA 2I7OA 4OD2A 4KFMA 2GBAA 3FQWA 2AJSL 3UYPB 1JPTH 4I88A 4OM0H 2ITDB 5TE6L 2OK0H 5FFOA 2DJUA 3U9PL 4AX3A 2HT3D 4ELDA 5I5IA 4ZPTB 4Z7QE 2YKKA 3IDYB 2ROXA 1CLZL 4L8SB 1BIHA 2WB7A 1QFWI 3L3GA 5FC9A 2R2HA 5E4EB 5ICUA 1QKZH 1URIA 4E9LA 5B7FA 2NTSP 2GJJA 5JIDA 4TQ8A 2Z7ZA 4PJXB 3N85H 2IO5A 4XMLL 2NX5D 5HI5C 3G7TA 1CF8H 1WCBA 4J3XA 2OA9A 1IT9L 3FT9A 1LWJA 5TE4H 1WSST 3Q43A 4HIHA 4OGYH 4Z3EA 3QUZD 3TA3B 3A21A 5E2JA 5D7JB 1UFUA 3OMAB 1RZ8B 3V5HA 2WJ5A 3R4DA 4K9EC 1MHPH 4AVHA 1XGPB 1AZZC 1NGWA 5EC2B 4OAWB 3AT9A 3C75A 4YK4B 4NZRL 4P46C 5DEGB 3U6XA 4I3GA 3QUXB 1G7MB 2W5PA 1EIBA 4IQHA 4OCWH 1K5WA 3EBGA 1R0AH 2FGZA 4M6NH 3WFHA 5DVMA 4YHZH 1IRAY 2E9GA 4BHUA 1RUQL 3BJ91 2I25N 4ZXBA 3QZWG 3NJNA 1MCFA 1Z3GH 3OL2A 4DPBX 2DI7A 4Z7WB 1IKNC 4BKSC 4DKTA 5MENA 1B2WH 4N22A 2CG9X 5HHOD 4YXKL 5CEYB 2VXTH 4C56D 3AXLA 5E8PA 1DANU 3FMGL 3WDHA 1LWRA 1PW3A 3ZHKA 1S9WB 2VDOB 5K5YA 4EZLA 1F3RB 3LY6A 4O02L 3QCUL 5GXBB 2ZOLB 3AU1B 4O2CB 4C56A 1RQ5A 3I6LE 1RUQH 2BINA 4MDIB 4DOHE 1AGBB 5SWSD 1G1CA 4TSCH 1TR7A 4AVJA 4IJTA 3L5XH 1SPDA 4HETA 5DJXA 1U3ZA 1HAWA 1O6VA 4L0PB 5MEQB 5H2BA 3A6CL 4F80A 2NW3A 3HHSB 3FTZA 3BD5A 4X50A 4F7PB 3HOGA 4G6KH 1ZV2A 3DSNA 5D1ZD 3A22A 1Q0YL 5EU7E 3BDYH 3EOBA 3BW9B 4AEIL 5BS0A 4F15C 5KG9B 4L1TA 4WI8A 2AXGA 5L7XL 2P5ED 3ARGD 4WJG3 1NBCA 2IV8A 2FWOA 1ZHNA 3SE3C 2ZJSH 4BK5C 1Z32X 1MQKH 1P9MC 2FQFA 1L9PA 2JB5L 2J72A 4Q89A 2VR5A 4NSKA 2EIEA 4Z7VA 5EORH 2H2SD 2B2XL 1YN7A 4HF5L 4OTXH 5EZLA 5FGBA 4F8LA 4P23A 2CIKB 3F83A 4KJWC 5KYWA 5TD4A 3KPOA 4LCIL 3QORC 2CDEB 4OFDA 4AQEA 3F7PC 4XPGH 1U3HB 1Q0YH 2IH1B 4MS8D 1CE1L 2WXOA 4B9PA 5JA8B 3CLWA 1HYSC 4TSAL 4GQZA 4L4VD 1I8KB 5FA3B 4XBGB 2G0LA 1J11A 4XXWA 2YAFA 2F1AA 5HI4C 1ZLVK 4C59B 3TO4D 1CB4A 2ZCZA 2PWFA 3K74B 5AB1A 1P1ZA 4AMKH 2WBXA 2K6ZA 1AJ7L 3KXFA 3RPKA 1Y6KR 5GGVL 3HC4L 1G7LA 2K3TA 4ZOAA 2XLLA 3S96A 3QUXC 4QRQB 1T0NB 1SMAA 2AJYH 1OPOA 2B2XH 4PG9A 4YHNA 3L3OC 3AGWA 3DX3A 3KGRA 3BZDA 1QHQA 3IDMA 3P0YH 5B22A 3QISA 3SPCA 1QG3A 3HE6C 5DVLA 1QNIA 2XV3A 3V4PB 4XPGL 4XNAA 1KJMB 1CDGA 1TTFA 3MNDA 2D7OA 4Z1PA 2Z64C 3G08B 3S48A 4RA3A 2RQEA 3JTTB 4WFHD 2CHXA 1XGPA 4QY8A 1QBAA 3JV5A 4F58L 1L3WA 3JWOL 1F13A 4F27A 2NR6A 3MRQA 4K2UL 4OCLC 4NO5B 1LL1A 2HUHA 3ARBB 4P5TA 4NUGH 3ZPDA 1R24A 3BUYA 2MCG1 3WJJC 4P23C 2Y4SA 2D03H 5CZKA 3Q2VA 3WD5L 4AMWA 2X9YA 1Q90A 4XO5A 2Y0SA 3B5HA 3SOBL 4PJDB 1AE6L 3NGBC 4RRPA 3S37X 3DX8B 4JHVA 2FJGB 4K94L 5BJTB 3QO0A 1LILA 3IT8D 4PLNC 2QLVB 5C86A 1G84A 3EHBB 2FO4B 1XD1A 4TUOA 3JWOH 1LE5A 4K7FA 5ELIA 1KBBA 4WV1C 3GSNA 1A6TA 1NEZA 1M57B 2AEPL 4QRSB 4HIQA 5DVKA 5FGSA 2NY3D 1BQLL 5B21A 5AAMC 4HKBB 1M7XA 1WIOA 1S7VB 3WUWB 2X4OA 3O9WD 1OTUC 3PDGA 4P8QA 1XB6A 3UPAA 1UM6L 2DMBA 5EA0H 1GZPA 3S3CB 1I8MB 4JANA 4F7MB 3LRLA 3PGDA 5J12C 3WUZA 3S9DB 3SCMB 3AZUA 4WTZA 3RB5A 2F53B 5F8QC 4DP7X 5LVEA 1ORQA 4PLJD 4NN7B 1BDYA 2WLIB 1A9BB 2IDSA 5DJZA 3T1WA 3D4ZA 4K7FB 4PCSA 4WNJA 3UGXA 5A3IC 2R27A 4HVBA 1MJ7H 5TJWK 1JS4A 4EIBA 2IDUA 3WAJA 1ZLDA 4KJPD 4OY9A 4PHZA 2NY4B 3ISRA 1IKNA 5ITFB 5FO8A 4FL4C 4P5MB 2C4XA 1P7QB 3S34H 3VI4E 2E47A 2VRQA 3ZKND 3DX1A 3G5WA 4G70B 4QTFA 1CFBA 1PZBA 3QH3B 1NC4A 2L7EA 1UFGA 4Q0XL 3X3FL 1HINL 4PMFA 2HVBA 2UXFA 1X5KA 2R69H 2CO3A 1CK0L 3M7FB 3GMNA 4KHTL 1RURL 3CC5A 1UJ3A 1DR9A 2ZUUA 4NT6B 2HTLC 3KLLA 3VFGH 1IGFH 2AQ2A 2R8SH 5FV2A 3CVIL 1AACA 3K6IA 3MCKA 1ZHLB 4LPWA 3ZT6A 3KJ4C 2FBJH 4XCEA 1OTSD 1HK6A 4RNRA 4N2AA 3D7PA 2PTVA 1JMXA 1GH7A 3PJNA 1D6EB 4OD3L 2ZG1A 3IJ9A 2R0KH 4KRPD 4UINL 2F58H 3UACA 3AB0C 2WINA 3QJXA 4LSPL 4X83A 2B3IA 1MCDA 3QCVL 3L3KB 4BFNA 5FWQA 4IDJH 3U2SA 3LTVA 4IRZL 2QDVA 2HT4C 1CK0H 3O9WB 1H8SA 4LKXB 2R0LH 4MD5A 4DH2A 3CZGA 1IKFH 5GSRB 4AQAB 3BPNB 4XC1L 3NAAH 5ACZB 3DXAA 4A2EA 1UXWA 2WB1A 5D70H 4DGWC 5HVGB 5EF1A 2PWEA 3QUYC 4LSTH 4PRAB 4PY8J 1BFTA 2OBGA 4AM0A 4JLRB 5E2UH 4MYWB 3I6GB 3QZMA 4UT9A 4WVRA 3UXFA 2C1PB 1FV1B 3SDXB 4NQDE 3FBKA 3R06A 2Z7UA 3IAGC 5J6SA 2HVKB 5IJVA 4ODHL 4OLUH 4IBYA 3VRJA 3B2UC 1E27B 3NAAL 4D0BA 1XXFC 5FB8B 4Q6KA 3TEWA 3QQ4B 4O4YH 1ZHNB 3D4YA 1DZBA 5DA0B 3QIUB 3LS4L 2L0DA 1QBML 3CSGA 2PXYC 2TSAA 3DIDA 4P2YA 3VE0A 4B9JA 3EOTH 1IT9H 3F58H 5DA4A 5I16A 3MLSH 4OKVB 3VH8G 4DP0X 1T03H 4AEEA 2CBQA 2VDLL 3AFLA 4I13B 1ZANH 3ULUD 3C5ZB 3SY0B 3TWCH 2PYEE 4APXB 4ANKA 4ODHH 4OLUL 3N40P 4NZRH 5D55A 1LDPL 4UZUA 3IK2A 4BINA 4AM0B 3DUSB 4WUUB 2WXMA 1FGNL 2DTML 2EQDA 3R7RA 1GJIA 5L6YL 5KVEE 4N2DA 2VJ0A 5C07B 4LFHD 5F1SA 3LKPA 4WFEE 3TN0D 3GLZA 4L8DB 3TF7C 1QBBA 3WFEH 1VPOH 1ZVNA 5JW3L 3MAWA 5D6CB 1WZLA 2VR9A 1U8JA 1T03L 2ED6A 2JKWA 1R19A 5CWSB 2AZAA 3ARDB 3KPMB 5DLLA 5AALA 2VDLH 2OSYA 4UM9D 2YIHA 4BD4A 1XGUB 4I0PC 4BH8A 1WTLA 3QA3A 2ZWLT 2QBWA 3BQUD 4YUEL 4O02H 1I8IA 1YEGL 5B1CA 2F53E 1IC1A 3QDJD 5D8JH 5E5MA 3VFTA 2X4TA 1KTLB 4UOW1 2QVFB 3QEUA 4TTDD 1UOVA 2AQRA 5EMYA 3QPQC 3ZZLA 4F7PA 3D06A 1KLFA 2WZ0A 3GSXB 4GSRA 4XBMA 1P2CA 2HKHL 5B8CB 3MTXA 3IRPX 3CDFA 1TZAA 2HG5B 3WS6C 1GA2A 2DF3A 1YYML 5FUCC 3PDOB 4ZBJA 5LUMA 3QS2A 3OG6B 1S9VA 1G4MA 4NKDA 1OAQL 3A4DA 3AT0A 4OB5L 3OKMA 1AZCA 2WBJA 1AGCB 1YEGH 4MMZB 1TU2A 4A63A 2GSGA 2ZTBA 5EU6E 5AUMB 3MXWH 3QZBA 1IEHA 3KH4A 4JJHA 4WY7H 1PU0A 1JNHA 2WAQA 3E6HA 3LHPH 1JGEB 5LO7A 4LCIH 1UQSA 2D7QA 1KFAH 1S7RA 4OT1H 4BXVA 3QT2A 3CMGA 4ODWA 2V9QA 3MLXH 4M3JA 2NYYD 2XN1A 1W0YT 3C5JA 1S5IH 3R8BB 3HBZA 4MXWH 4CU6A 1OF0A 2JJSA 3MBED 3MV9B 2X89A 3MACL 2DH2A 4M1CD 1VA9A 5JA9A 1KGWA 1U4FA 4Y16A 3CZKA 3D09A 3RJQB 3RWDA 2VZSA 4OLVH 1HQ4A 3K5RA 1FN4A 1EO8H 5CD3A 5HHVL 1CN4A 1WWAX 1P6WA 4PVLA 3P9LB 4PJEF 3VB8A 3P0YL 2N0KA 4M93B 5E2WL 1BYPA 1F3DH 3L3IB 3LHPL 4HBCL 3DROB 1EJOL 5IV2A 3P02A 3WXWH 5MEOB 3ZMEA 5D7JD 2V4LA 3TA3D 3QJHA 4FL4B 5HYJA 3ULVC 2QT6A 4U1IB 3BE1H 1MCSA 3VUAA 4LLWA 2IDCA 1GC1L 1FIGH 2IWGA 5ESVA 2DIAA 4UT7L 3ZZSA 4PGBB 4HOMA 1IC7L 1KV7A 1TJIH 1C12B 2OMWB 4ZW3A 4LEEA 3L5JA 2NQCA 2Y7SA 1MCHA 3QAZC 4K2UH 4BK4A 5C7XH 1OARH 2VKWA 1A6UH 2H1PL 2OMTB 1G6RH 4ZPVB 2WXJA 1KB5B 1AC6A 3FO0L 5TDOB 4O2FB 4AJVA 3MLRL 4LMQE 1QRNE 4N25A 4NO2B 4MA8L 3RUGE 1J1OH 4F9PC 4FXTA 4PJAF 1MIEL 3ZYZA 2R9HC 2DAVA 4KXDA 5CP7A 1U95B 1MCBA 2B59A 1DQJA 1S6NA 3QUXA 2GG1A 3RNKA 4W68A 1A3ZA 1D7BA 1WFMA 1QHPA 4B5EA 3VA6A 4GRWF 1ZT7B 5EO0A 5F0MB 1QUPA 1OB1A 1ZA3A 1TKWB 2C9AA 2H1PH 2O6FA 2X0WA 4PJGE 3ILPB 1U3HC 4R4BA 1QLFB 2X6AA 2Y24A 3IRCA 1UM6H 4YBQD 4EN3D 3SGEI 8CGTA 8FABB 1P4UA 1TQCB 4U1MA 1KNOB 1KGCE 1MCLA 4Y4FD 2V37A 4G9FE 2QGDA 4ZFFB 4EKXA 4NHCL 1XR9A 1DQLL 3L4VA 1TVHA 1S5HB 1R5WA 3QIWB 2XACC 4FFYL 4AK2A 4PJCE 2E9JA 1MAMH 3MU3A 4NKOA 3RVTD 4HV8A 1DUZB 1FFRA 4TNGA 3IMRA 1QOKA 4PJHA 2CHWA 3IU4H 4YXHL 3H2WA 4H44C 5DVOA 4FYRA 5E8OA 2XY2A 1ETJA 4BSWA 1XMEB 1IAII 5IBLD 1FE8L 1P1VA 1Z66A 4ZXBD 1QMUA 5B39B 3HG1B 3IKKA 3L2LA 3ESMA 4PV9B 5LBGA 2A9NH 5CLWA 4KY1L 2DMHA 4XWOD 1KCWA 4XVTL 4XN7A 2DN7A 2Q6WB 4QDGA 1U58A 4Z76B 4WWKB 4JFYA 1CT8A 1H15B 4X5XA 1A7RL 5D93B 3UAJC 1OM9A 4QJ4B 1ZWIA 4JPIB 12E8L 4JG1H 1WS7A 2OXGB 4BELD 5C71A 1MHEA 2FO8A 3ARGA 1OB1B 1ZA3B 3G5VA 4I5BA 4L3CA 3MGOB 3L13A 3O6FC 3ATDA 1NLBH 3VNZA 2YFNA 1IGFL 4HUCA 4FNLH 2GJRA 4ZNEA 1N68A 1MCNA 2EICA 1S7UB 1EXGA 2PWHA 4ABWA 3C6SA 2F54B 4ZS6D 3KEHA 2BSTB 2C4FU 4KKBD 4PI0A 2A9NL 3HBGA 5ADPH 1S2EA 1TQWA 5E6UB 1FZOA 5ACMA 2Q6WA 4AIXA 4DUWA 1RH8A 1DVFB 4G9FD 1I4FB 1OGAE 4LSPH 5TTRA 3SDDD 3ZK0A 4OZIF 5DFAA 4IRZH 4PJ9D 3QJTB 2FEDD 3LKSB 2P5EA 2R7EA 1KBGH 4TS6A 3K71A 3KBPA 3PGCA 3LDBB 4MAYA 2HH0H 3BUPA 3FQ4A 1O7DC 5DQJB 1DLFH 3BP5B 4JE0A 2F53A 3AT8A 1AO7D 3SKUD 4B3VA 5TGBB 5ESQB 5GGRY 1BOGB 3T2NH 4HHAB 2J44A 4Z7NE 2OMVB 5I6OA 5CILL 3W37A 4GW4A 1OM3L 2BP8A 1DQML 1NGYA 1QBLH 3ARXA 3MRCB 3QHZL 5KVFE 2DD8H 4XNBA 4UQBA 5DUBB 5KJRH 4WFFE 1T0PB 3TCLA 4HS3B 1E5CA 1Y6NR 1TQSA 4NKDB 5L4FA 4QXUL 1HZLA 4FA7B 4HJSA 1NOFA 4R84A 3QWOB 2G75B 1NIEA 2EEAA 1SFHA 4JM2C 4G5ZL 2WPGA 4Y1AB 4LU5H 4NQVB 1DLFL 2F15A 4JHWH 3AMKA 2PCFB 4FC3E 2GAZA 4Y16C 1FFTB 1OGPA 2UY6A 4NOBA 4LARH 4LRNH 2VJXA 2WHVA 3QIBB 1ZVSA 4APQD 1IM9D 3EOTL 4NN6B 4UYPA 4X8XA 4XNZC 1V8HA 4LCWB 3PAUA 3QCTL 1Z9OA 2P46B 4KJYB 1BOYA 2BVUA 4ZW6A 5LCVH 3NSFA 4MA7L 3X3GL 5CJ5A 1LE9A 5AW2B 1QQDB 3U46B 1ZHKA 3NCFB 4J3OD 1J12A 5IG7B 2VZVA 3R7QA 3ZRSA 3DTXA 1F58H 4BBWA 3AQZA 2NSQA 2ZXWB 4JDZA 4HG4J 4M6MH 1LEKA 3UCQA 3H3KA 5F72S 1KLUB 5H37H 3WNJA 5C9JB 3D4CA 1DDHA 2AKRA 3MOAH 4YR6A 3CDGA 3K6SB 1MFEH 3INUH 4EO5A 3WIHA 5INCB 3KPSB 1HZKA 2CRIA 3GLDA 1A6VH 4QTIH 5L9DH 4LLAA 3IJSA 4HWEH 1O7DE 1H15A 3D08A 1PIGA 1CD0A 2VDQB 3EO9L 3VG0H 4OLZH 3Q5YA 3QPXL 4KKNA 7FABH 3GZKA 3QIUC 3DXAE 4G8GB 5D8JL 5DJYB 3MNWA 4NS0A 4WTWA 3G5XA 5AWNH 5AZ2H 1DFXA 1C7SA 4IRJD 3SODB 4K7PL 1M4KA 4PJXF 3UL4A 1UM5L 4MQXD 5F0LB 1N6QL 1MFEL 3IPEA 4WHYH 3UTSA 3MRLB 4F5CA 4YN3A 4AGPA 5A16A 3VXPB 1B6UA 3SJVE 4AYGA 2J88L 1LO5A 1O6SA 3CC5B 5CIPA 3ZOAA 5T3XH 4PY8I 5BVPL 5IIEB 3DETD 32C2A 5DDHA 4XPHH 4GIAA 5BO1H 4CBZA 3BUQA 3KYKL 1EDHA 2ENPA 5DJYA 4X7EC 3UTTD 5DRXB 3S37H 2AXWA 4Z7QF 2OSWA 4RMVA 3FTGA 4ZT1A 4G11A 1S7XA 1PQZA 1HE7A 3BPOC 4TKWA 4PRDB 4XNMA 4YBLC 2J7LA 2VN5A 3MBEB 2DQTH 2E8ZA 3KYMA 3MV9D 4N0YH 1D7DA 3OPUA 5FXCH 4KZEL 2NXZC 3ML8A 2DQGL 5TFSH 2IWFA 2X4UB 4RAVB 5E51A 4FMVA 1D5ZA 4G6AC 4JFEB 2F8IA 5AVRB 1QWHA 2XWBA 5IEHB 1PD1A 3EF4A 5CJOH 5DRZB 1KWKA 3KPRD 5EFIB 5AVQB 1V10A 2ZQKA 2ZYRA 3EYFA 3LNHA 3QBTB 3RQ3A 3TO2B 4XPHL 4DOHB 4OZIE 3OZ9L 1HKLL 2LLGA 3K6OA 3QE5A 4QJ3B 4FN0A 4Y2OA 7PCYA 5CINL 5KJ4A 2R39A 1HSBA 2DQFA 3AREC 4DEUA 4TUKH 3QXDA 2IPKB 5IW1B 4TL5A 2DLIA 3RU8L 2Q3AA 5IB1B 1D2OA 3QXUA 4NQSA 4QO1A 4PPTA 3G9VA 4QRUA 4O58H 3MXVH 2TAAA 5DS1A 3NCCB 1C5DB 2WWMC 5CEXB 2J73A 4IIQA 5E08L 3V0VB 4PGBA 1RK0A 3UTTE 4GIPD 1UZGA 3DV4B 1DBJH 5F44A 3X12A 1YEHH 4GBXA 5I1GH 2GFBB 5IJKA 1SY6H 4NKQB 4R5XA 5T1LB 1NGPH 5EC1B 3FQUA 4TLSA 1RIHH 2H2PC 4L9LA 5IF0A 1AQDA 2Y7QB 2YA2A 2F68X 3NRFA 1IC4H 5BUPA 4IKLA 3ABMB 3H0TA 2E7LA 2F7IA 5GRUH 5EEYA 4HUKB 1K72A 1X3DA 2EVFA 1J1OL 2B59B 4AIOA 2QMJA 2Q9OA 2X2UA 4U3SB 4KQ4L 3D18A 4MMXC 4RBPK 2EUXA 4XWGH 3BIKA 1YMHB 2OJEA 2JNZA 3JWNG 3UTSE 3F62A 2WJ7A 3PFQA 4GSUA 4TL4A 3STZA 4C58B 5ID1B 4AIZA 4S1QL 1SJVA 3OR7A 3GSQA 2R59A 5AAPA 1OP3K 4D9RE 1KB5H 2O5NA 2OV0A 3QG7H 3FT4A 1IC5L 4B9GA 1PDKA 3PL6B 3BP5A 4OUUB 1N8OE 4AYDC 3QXAA 3VU2A 1JXKA 3GXUB 4QCIA 3UG5A 1BGXH 4LPCA 4QR7A 3UBXG 1JK8A 4HUNB 1XCWA 2APFA 3FQRB 1SDDA 3DGGA 3RGBA 2FUTA 3N6YA 1DJZA 2HYMA 3BIKB 1ASQA 1UWFA 4XWGL 4YHOL 3OV6A 2Y1VA 4LVNB 1FUNA 3BWZA 3QQ3B 5FA4B 4BZ1L 25C8L 1FGVL 4EXKA 3B4NA 1MAML 5ADOH 4YAQA 3OGOE 1CLYH 2X3CA 1QW9A 2MQCA 4FMKA 3QG7L 1TCMA 5HYSB 4YDKL 5ICZB 3Q8CA 1U91B 3WKPA 4JM2B 2JV6A 3L54A 4ZFGL 3TNMA 5JHDE 3GSRA 1I9JL 4FTDA 1BVLA 4I77H 4PJ7B 1DEEB 3GZOA 4FQQA 4U1NB 4X6BB 3QEUB 5TQ2L 2CU9A 1HHJA 2DLTA 1XGQB 2WMPA 2J55A 3I85A 1AR1B 3CFDA 4LQ1A 5SV4A 1OAZL 3HR6A 4PJEA 3IF1A 5GJSH 4X8JA 5CR1A 4K9EL 3BRDA 4TNFA 3D39B 3UEZA 3X14A 4X99B 1PD6A 2F7PA 2D3NA 4JDEA 2RIKA 4JFDB 5BW7A 4IJ3B 2A83A 5AVUB 1G4RA 1SJHB 3N9GH 4OGXH 4M62L 3CBKB 3M86A 4AKOA 3EJCA 4PG9B 4YHNB 3ZT7A 4HW6A 5D7IF 4U33A 3CDYA 5C2BH 5EN2B 4H8UA 3MRMB 3VXQB 2V2WB 3S88H 2O6CA 3UADA 3FU3A 3WLWD 1AGBA 3VFMA 3U6RA 5KVEH 1IJ9A 4IEFA 1EEYA 1XDTT 2VT0A 5BZWA 3ZE2F 3ZKMC 1IB5A 5C9KA 3DRTB 4MTMA 4XXDB 1KFGA 4V2BA 1IQDA 2DWXA 3ARBA 3KWTA 1FNSH 5K9KA 5KUMA 4XBPA 3NABH 5B1JA 3LQZB 3DJ9A 3GYRA 2WCPA 3UJTH 3S2CA 4B9KC 3T0EA 1FAIH 3I50H 1GSMA 3NJVA 4A7UA 4KPHH 1MCPH 1OHZA 4B0MM 4JQXA 3NK4A 3SZ6A 5DLMH 3D39A 4KZDL 1E5BA 3ARGC 3CZNA 4GG8B 3EDFA 3L2MA 3MRNA 4CN6A 2ITEA 3BAIA 1YEJL 1T3FA 2PP9A 5CEZH 4OAWA 5CSZB 4F1ZA 2EZ0D 2XVLA 3U0TB 1NIDA 8PAZA 3ULUF 5GZOD 4NNXA 1CFSA 1FNSL 1NZRA 1U9KA 1NIBA 3KLDA 4P3CL 1HOCA 5TPWL 4X98A 4P2RB 3B56A 4LCWA 3BEVA 1E4WH 2N7BA 3MRGB 4KPHL 1LK3H 4MMXB 2X3AA 4WFHE 3IDGA 1JCKA 5EDSA 5I73B 1FLRH 1EEYB 3SPJA 2WD0A 4X7TA 4WU7A 5A6MA 3O6ML 5HDWA 3ZE0F 4BJLA 2Y5TB 3HMXL 3OSVA 1CDIA 1M56B 1PEWA 3FN3A 2EDKA 2BIOA 1JZDC 4Q9BA 3QI9C 4XMPL 1BPLB 4L9LC 2UZYB 1G9EA 1OAUH 4TQIA 1OP3H 1U8IA 4YZFF 3DX0A 4EUPB 4P3CH 3ILDA 3RKDD 3KL0A 4PJHE 3KHOA 3QDGA 3C87A 4YDIL 5D7EA 5I0YA 4JPWH 4P0DA 2OTUB 3MJ9L 5FYLD 3EHBD 3SO3C 5BRPA 2DLHA 3BD3A 1T4KA 3BHBA 3BP6A 3UZQB 3II3A 4ODWB 3SQBA 5BS0B 4HCIA 5CZVL 4UT6H 3UTZB 3WS3B 2BS71 3I75A 4X6BA 3O41A 3MLWH 4JGUA 1G9HA 3CGTA 4TPRH 2PLTA 2EADA 4Y8AA 3NIDB 1VADA 4X80H 5K9OA 2VDRB 4NPJA 1N67A 2CR6A 4Q9QH 5A2CA 1IQWL 3QJUB 3GGWB 1I1FA 2OYMA 1EANA 4B9IA 4DFIA 3RZCC 4EI0A 3TVMC 1PS3A 5CR8A 1V27A 4HJTA 4H8VA 4LOUC 2HPOA 3P9LA 4MD0B 2AEIT 4NBYB 1MCOH 1JWSA 2J88H 1JL8A 3JWNC 4AQAA 1MFDL 1PKQE 3WIIL 2QQNL 2HX7A 5FYKE 2EIMB 5I0ZA 3SCMA 1X44A 4UMGA 1XH3B 2EABA 4NPYB 3FCSB 4U3HA 5DMGD 5KVFL 4JB9H 2J21A 5DO2D 5IMKB 1JK9B 4OZFB 5E1GA 3WJMA 4JFZH 1MJ8H 2C3VB 1D7FA 1A7OH 5AKTA 5FS5A 1DQQB 4F1SA 3B1TA 4BQ6A 4L4VB 5B1KA 4KK8D 1U8CA 3BAEL 3PWNB 1QP1A 5EFIA 1A6WH 3BYYA 4RDBA 3H9SA 2YD8A 2WQUA 3JVFC 2JKIS 3K6FA 4UM8A 4PBXA 4XAKE 3O3EB 1A6AA 2J2ZA 4OZHE 2A6DA 4GMSL 2N7AA 2X38A 2F2HA 1SDYA 4JFXA 5EOCL 1QW8A 1ACZA 1MG3C 3HCVA 2QQNH 2ZAHA 4NQEA 2E74C 3CIAA 4KKLC 2BDNH 4MDIA 1KCUH 4K3JH