4F8NA

X-ray structure of psaa from yersinia pestis, in complex with galactose and phosphate choline
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
NTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords pH 6 antigen
publication title Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
total genus 18
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f8nA00
4F8NA 4F8PA 5LN8A 5LNDA 5LO7A 5LN4A 4F8OA 4F8LA
chains in the Genus database with same CATH superfamily
1URIA 5IKCA 1U0QA 3S3SA 4OLYL 4U6VH 3FTGB 1QSVA 4HMCA 1IVTA 3MRIA 3M1CA 1FGVL 5JUEL 1BQLL 1B4JH 1LO4H 4MLSA 3FB7A 2EECA 4UDTB 4XMKH 3BGFB 2CJSA 4P5TD 4HC1H 3FCTB 1G0YR 3LZFH 4L8CA 5GZND 4P2RE 2EUWA 3Q9PA 2P5EE 4HUUA 3ZE0E 5KVEL 4DZBA 4WW2F 3DX0A 5E70A 5CP3A 3Q8FA 2JTDA 3IDNB 2DKMA 3BD5A 1GW6A 2OJEB 4W9HC 1TVHB 2OJZH 2QGEA 3AY2A 2IH8A 1HU8A 3DVNA 4LHQB 3NEOA 2UWEF 4JAMA 1ZSDB 3IWUA 2H0EA 3D48R 4M7ZC 2BP8B 4FF9A 1BVLB 2CUAA 25C8H 2G9HB 5GRVK 4P2QD 3SCMA 5DMKB 3L4VA 3A47A 3P3TA 2XETA 4N6RB 4RFNB 3GBDA 2A38A 4UTCA 2DLHA 4JN1H 3EOBA 1RZIA 4BDVA 4PLNC 2ZX8A 3QUKB 2CKBH 3HG4A 3E1ZA 3Q2CA 1A2YB 2FR4B 5DJXA 3RILA 4AJYV 2FGWL 4OCSH 2VNCA 1TYEB 4H88L 3C87A 3VYPA 1YC7A 1V55B 1WZ1L 2VDQB 1IE4A 1ZDSA 4KVCH 1DEDA 4HKBB 3ZE2B 4FQCH 1T5XA 4JPWL 1AXSB 5JHDE 4IOFC 4EQ3A 4KJWC 3U7WL 1WVZA 4FNUA 3CCHB 5AWNL 2O5ZL 1IKNC 2QTEA 3KPQB 1BZOA 4JZJB 2Z31A 4DO5A 1W0VB 4GINA 5EO0B 2B7DT 3TURA 1DQQB 1IC7L 4HIXL 4K3GA 4H20L 1PZBA 3G5XA 4GP8B 4KY1L 2UZYB 2UVEA 3IDIB 2YOCA 4Q6IC 1RUKL 4OY9A 3FT2B 4Y5YB 3M7OA 4ZMZA 3L17A 1Y18A 4HIHA 4FQ2H 2WKOF 5HYSA 4ZS7L 1IEAB 3OXSB 3QYCA 2R0KH 4Z7UF 4FLHA 4MSWB 3NFPA 3VG0L 4XX5A 2XVBA 4HP5A 4NUGL 5BZWB 4D7PA 1MFUA 1Z0NA 1YECH 2Y72A 1R6VA 2K6YA 4HC1A 4PJ5E 2Y4SA 1D3CA 4ODVL 3B2XA 5D1ZC 1AGEB 1T2XA 1L6XA 5F0PB 3EDKA 1C08A 1IGYB 5FYLD 1Q4NX 3GRGA 4K2UH 1NBZA 2VC2B 2WP3O 4A38A 4X5RA 3V5HA 6PAZA 4OTXL 2NT0A 2CGYA 4R0LB 1ZPUA 3LS4H 3U4BH 1H0DB 1MJJB 2XZAL 3BP6A 5E0QA 2JKXA 3AXLA 1ED3B 3ML8A 5EMYA 2G75B 4JB9L 5GRYA 4V1DB 4HAKA 4NUJB 4ABWA 2XT1B 2GJJA 2IDTA 5I9QC 4KQ4H 3V6ZA 2ITDA 4XMXA 1QRNA 4EKJA 4PCTA 3VTMA 5IHZB 5CSZA 3HRZA 2GK0B 4ODSL 2CAKA 1VKXA 3GS4A 4FP8H 4BZYA 4N0RA 2Q8AH 4XBGA 2R83A 1T66C 1Y0LA 2QKIC 3BAYA 5I8KH 4PJIB 4UYQA 43CAB 1AS8A 2P49B 1MHCB 4IKIA 1FCGA 4Y19B 1KXTA 3RDTD 2WP3T 5GRVL 4GBXD 3U1SL 3I2CH 2DQUH 5DZVA 3U9PH 3KPRB 4H1LH 4JMXA 3TT3L 5DK3A 3VSVA 2XTJE 5JW3L 1Q9KA 5JW4M 2WCPA 4OR1A 4X99A 1DVUA 3HC0A 3MOBH 2WTRA 2JKTM 4HSAC 2BOBA 5HHMD 2TSAA 3V55A 2WXIA 2JK5B 4D9RE 3FH7A 2ICEA 3D0VB 2BY2A 5TQ2H 2CR0A 3WD5L 4XAKD 1MCDA 3BAXA 2QL1A 1OAUL 2VDLB 3X12B 5T3XE 5JHLL 4DWHA 1L7TH 4FGMA 3IF1A 3CSYB 1UCTA 1CDCA 4F7CB 5HHOA 5F9AC 1EJOL 4JO2H 3QP3A 4XMLL 4DH2A 1O5PA 4QAWA 2V5YA 3GUFA 5DQ9B 4LDOB 1JPGB 2D03L 2OZ4H 4MCNA 5EDXA 3VWKB 4MTMA 3IDXL 3NJFA 3UJTL 3BZEB 1CL7I 9PCYA 2YEQA 3K71A 2G2RA 5J11B 4TLSA 3HC3L 5LKNA 4G2AA 1DEEB 5DD5H 4XCNA 4QO1A 2X2HA 1PDKB 1FNSH 1NUDA 2KDGA 3GLEA 4XP1H 3RL1A 3EFOA 1HOCA 1E5UI 3A6BL 4FFVC 4AMWA 4IGBA 2MPAH 2W9DH 5HYJE 3L1OL 3MRHA 4UT9L 2HT3D 3CUPB 4M7JL 1QPKA 4YDNA 2P47B 3QRFM 1CFSB 1EAJA 1ZANL 1WS8A 4IM8A 3II2A 1WZKA 1YN7B 4GO9A 1OY3B 2QPDB 4FHKA 2O6EA 4H7VA 4F8TA 4FXGC 3SPCA 1E5CA 3S98A 3OPUA 5DRXA 4GUQA 1JZGA 1E4KC 3QNZB 3PABB 2QHRL 4I1NB 1KGJA 3ALPA 5KVFE 4H8WH 1KCRH 2JKJA 2VJ0A 1JK9A 2XTJC 4CMMB 3S35X 4KI5D 4WKZB 3WTYA 2X70B 1QLEH 4DKTA 4MJID 3IDYC 1BZQK 1CGSL 3E6HA 4AV5A 5G5DA 1EIBA 1GOHA 3ARBD 2WLKA 1GMIA 5DR5H 3VFGH 4NJAH 4D8PA 3V0HA 3FYIB 4KJQC 2D7NA 2R39A 2VISA 5E4IA 5IBUB 5KSUA 1LP9E 1AY1H 3CPUA 2E7HA 2VN5A 4M7LT 1ECZA 5ADOH 1L9SA 1RK1A 3CZKA 3O45A 4PRBB 2ZOKA 1SMDA 3VG9B 4I18B 3ULVE 2ZUQC 4FEIA 1Z6JT 1UB5B 4AEHH 4UBDD 3EH3B 1V7NL 3T2NH 3DJSA 3TCLA 4G8GB 2OSYA 1MI5D 1MFDL 3MX0A 3UJIL 1HVXA 3MJWA 5E8EB 4S0HA 1QPPA 3FCBA 3ROLA 5EIQA 4KRPD 4RDQF 4NO0D 5DMGC 4BSVA 4NCDA 3V6BR 5J8OA 4J5VA 1SLUA 3L3OB 1XGTB 4Z8FL 1HE7A 5CKGA 5E4EC 5JA8B 3TBCA 1KCKA 2XN1A 4P05A 5I71B 2VYRE 1SHMA 4K3JH 1R0AH 1CF1A 4MKMA 4NSKB 3T09A 5FM5M 4F15B 1DQML 1EZVX 1A7QH 1AC0A 4MAUH 1F4YH 2AV7A 3TL5A 1QABA 5L2JB 4KKNA 2Z1KA 4UQDA 5JIIA 4H13C 1G9NH 3ZQXA 1AHWC 3GMQA 1J1PL 4PREA 2R2CA 3APFA 5DSCA 2FH8A 3IBEA 4Y16A 4Y7OC 5ID1B 1E50A 1VGKA 1U3JA 3FTSA 1RZJH 5BRZD 1KCSH 5IEHA 5CJOH 5AW0B 2A5UA 2L8AA 2YIHA 1UXLA 4FNLL 4JGJA 2QADC 1E40A 1QSEB 4PVNA 2Y2WA 4GB9A 1R3HB 4Y1TA 1KBBA 4OZFA 4AM0B 2C9VA 4WFHE 1RH8A 1MG3C 3EF7A 4JRXE 5CD3A 5JORB 1EHNA 5DMJB 4Y4KA 3MV9E 2QTVA 5TJWK 2XTSA 2H7WA 3BZ4A 3VX0A 4HJIA 1TKWB 1LO3L 4HBCH 3AU1A 4MDRA 5E9DD 2C1PA 4OLXL 4YUEL 5ENWA 4RGOL 5CINH 3DXAD 3OKLA 3OVUB 4IU3A 5I0VA 4RGNB 2UYLB 1YEHH 2KQNA 2BRQA 3AXIA 3ULVC 1EWHA 3HB3D 4F7PB 2D4FA 4KGLA 2BNRE 3VYOA 2DQHH 1S9VA 2NUPB 5K9OB 5IV2B 3VACA 2P24A 2E86A 2EILB 1F3DJ 2X7LB 1JMZA 1VACB 4P23D 1UYWH 2L7QA 4KOCA 3V5DA 1AZUA 3SE9H 2G3ZA 3LNFA 1WD8A 1CK0H 2APVA 3VJ6A 1AKPA 2WQXA 4LVHB 2WYHA 2P44B 1AFVH 4Y4FC 3SYCA 1ETJA 3MLWL 1GPOH 4KAQH 4XPBH 5I5IA 1Y1DA 1AQKL 1ONQA 2GTQA 2C3XA 5AQ0A 3BPCB 5CCKL 4RZCA 4MA7H 4OGAD 5HD8D 3OF6A 4XMUA 3BKCL 1DJYA 2FLBT 2VMFA 5TGBB 1BVNP 4WUUA 1OAXH 3B7TA 5KYUA 4J28A 4OZHB 2X1XR 5AOZA 5DD1H 3CFKA 1ZGLB 4A37A 4LARL 2NW3B 1IM3D 35C8L 5CCJA 5HGAB 4TQEH 5DI8A 5EG6C 1AZZC 2IWKA 4AYFA 3C2AH 4YPGA 3EDEA 3KE0A 3QUYB 4ZUWB 3F85A 1SJXA 3EJUA 3GMMA 3GXMA 4I5BB 1J9SA 4KKBC 2C9AA 2ARJB 1NMAH 3SGEI 2YAQA 2CPCA 3QEQE 3VFOA 4PG9A 5F93C 4OLVL 1YYLH 1TQWA 5DJZA 1O6TA 1DBMH 4I3SL 4QOKD 1JGIA 4S1QH 4R6UA 5LXVA 1P69B 1I1YB 2OXHB 1TZIA 2A7BA 1EZSA 4L5FL 1HZHL 3MRDB 2VH5H 1FF5A 5IFJB 1NAMB 2PXYB 1I8KA 1TXKA 3QEHB 4DN4H 4JZNA 4RLDA 3ABGA 1LYQA 2Q86A 3TTSA 4BFNA 2DQFB 4U6XB 5BZDA 1GKOA 3QIBD 3BKJL 3QORD 4WI6A 4YSPA 4HJ0C 1WT5A 5I23A 5DUML 2RBLA 4CSPA 1HEHC 4OUUA 1D6VH 2DLGA 4PJ9B 4PWEA 3H9SB 3UO8B 3ILPB 3NVQA 1KPUA 4JO3L 4ODHL 5DS8A 1L9NA 4BFIA 2YC1B 2QSQA 5EC1B 1A4BA 4ONHB 3FK3A 4ENED 3HPLB 5MHSD 3DJTA 3QQ4A 4EZJA 1JZ7A 1UWXK 4UT7L 2FWOA 2PP9A 3HI5L 3BD4A 4QKXB 3PXHA 3VD2A 2B20A 1F4HA 4O51A 3ARZA 3VMPA 4BE5A 3M45A 4Q74A 4N20A 4KC3B 1FE8H 2LV4A 2CLRA 4TL4A 1Q1JH 3SCMC 2YMXL 3WYRA 1OHZA 2YXFA 3N55A 3QDGD 4RMTA 1IFRA 4K07A 4TSCL 4OIFA 2CMRH 2NNFA 5E95B 2X89D 3C8KA 3CGTA 3LQZB 3NOIA 4YHNB 1JHLL 3I50H 5G4NA 3THML 4LPUA 1BZ7A 2VTFA 1QRNE 2Y6TE 3RWFA 2JCCF 4KVNL 3FUIA 1CLYH 2J8HA 1YEGH 2HJFA 5FW6A 3L3KB 3CFBB 2VSMB 2Z34A 3EGSA 1ZK5A 5KUKA 1FV1B 3UBFA 5HVHC 4HEME 3NCWA 1D7BA 1UOWA 1A4CA 2AKRA 4BXSV 2VITA 1J5OL 1ZK9A 1CICB 2XTLA 4UT6A 5DJDA 4GAYA 4IJ3C 2DJSA 5TFSL 3DPBB 3ULUE 4P3CL 3HR6A 2WLNA 3Q8AA 2YGOA 3O4LA 2MJWA 4WW1A 4LAQH 4P59L 5I5RA 2QELA 2OMXB 1JWMB 1MWAA 4WFFD 4KITB 1E3FA 3LIUA 4K5OA 5DEGB 5EBMB 3CVHH 1Z5LB 4WKXA 5AAMA 3SDDC 1L9TA 2DQCH 3GYRA 2EINB 3RJQB 2Z35B 3MNZB 1W8OA 3EOAA 4KXDA 3TJHD 5HHOE 1DVYA 1WWAX 3HZKB 1TVBB 2XWCA 4CGUB 4YGAB 2RA1A 1HNYA 3TBWB 2V33A 5IBUG 2BP0B 2GBAA 4MZIA 1ZLVH 3ULAB 4Q0XL 5T1MB 5D4HA 2DTML 1KB5A 1KJ2L 1IT9L 4PGEA 4K8RC 5ICZA 2BHYA 3CFJB 4I77H 2JIXB 5L88L 1GZHA 4N2CA 4LBEB 3B2UC 2PCFA 1FI8C 4TKWA 5I26A 3HBPA 1GGCH 4XBPB 1SQ2N 4G6MH 5H8DA 4WSKA 2EAEA 3HRZC 4OCYL 1BOGA 1V3MA 2OMWB 1A9VA 1GYCA 3KWWA 3WIFB 4KXBA 1D5ZB 4ETQB 2AJXL 2V5MA 3UPRA 1IE5A 1O75A 3QQ9D 3NA9H 5SV4A 3FU7B 3NCYP 1ZT7A 1A1OA 1AGDB 2N7BA 4MJJA 3ZXAC 3GFUA 3ULUC 4Z5RB 3FS9A 5E56A 5K1NA 1DE4A 2ZX7A 3OHXA 4BV1A 4GKNA 3K6FA 3I3EA 3L5JA 4Z7WB 1HNGA 3V4VH 4G8FB 3ARFC 3HFMH 1F00I 4WJ5B 2YUVA 1BFTA 1DVFD 4N2HA 4JDZB 4X7EC 5EOCH 1FDLL 3RFZA 2ICEC 3SBRA 5HGBA 3IRZA 1U21A 4UQ3B 3EFFB 1U4FA 1T2QL 5JLZB 4IIQC 5AOIA 3RNQB 2Z8SA 1OD7A 1YY9D 3O3BA 3MV8E 5J1TC 4A6YL 3VQ1C 1X9LA 3RWHB 4KU1A 5I6OA 4XOBA 5F7NC 1YEWA 5I1DA 3HR5B 4P4KC 4CC0A 2X4RA 5D6DA 1JI2A 1Q72L 2VAAB 3Q8EA 4LHUB 2FX7L 5GRJL 1DSFL 1S9XA 3DNKA 4C56B 4RAVB 4J3VA 1DUZA 2ZSVB 1HKLL 4TSBL 1XGPA 2ZWSA 3MCKB 4P3WA 1ZKAA 4TPRH 2D9CA 2R9HC 4HK0B 2R7EB 4PWFA 1UWEH 4S10A 1NCOA 4OKVB 4IGBC 4YXHH 3PWNA 1YQVH 1G94A 5H37H 3VXMB 3WTUA 5DRNA 1F0LA 3MROA 2VO8A 1KN2H 1UENA 3GSNA 2CM5A 1AD0A 3HLAB 3FQTA 5HXMA 3B6SA 3ZUNC 2X4TA 4J8RA 4NRXA 2W5PA 5GHWH 1CDUA 2HN7A 1RL1A 2IGFH 4A68A 4I9XA 2KT6A 2X28A 1J9QA 2WLJA 2QEJA 3UPCA 3FOMA 4R26L 3OKOB 5CCHE 3L1GA 2AXHA 2E5EA 3MJ7A 4FE9A 1K6QL 3H4FA 3RGBA 2XPGB 5KBNC 3IDGB 5I0ZA 3OR6A 1W72L 2OL3A 3SDAA 2EYSA 1WAPA 1XZWA 3AACA 3FSVA 3CPLA 4FXKA 2VDQL 1MCEA 1UVQB 3K72B 1I9EA 4GRMB 5E5LA 1ADWA 1BYNA 5FYKE 3QK0A 3RUGA 3X11B 1A6TA 3SDXB 5IREA 1A4AA 4ODTH 1AYOA 3QIUA 3T0ED 3VCLB 5I8CA 4MYPA 1TQBC 5LGHH 1RCYA 4XNZB 3N0PB 1PZUB 1RHHB 4AEIL 2WLLB 4X98A 4EN3D 1YJDL 2IH3A 5IB5B 3L5HA 1ZE3H 3ELAT 1MHHB 2J71A 5LNEA 4P2QA 1N12A 2BNUA 3LV3B 4JKWA 1NWOA 4QRRB 4UV7L 4R7NB 1UT1A 4I3GA 5HVFB 1IBHA 3QI9B 1HZLA 3SO3B 4I0PC 1E2ZA 3CX5J 2Y07H 1S7XB 2OPCA 4BH8A 1E28B 5AUMB 1OTTD 3DECA 5KYNA 1XD0A 3I6LE 4IS6A 5CEZL 1TETL 1X5XA 4F2MA 1XF3B 1U6AH 3O4OC 4HX1B 2HX8A 2X6BA 2H5UA 2KHAA 2JSFA 4UU9B 4XN5A 2VC2L 1R3IH 3KLHC 3FBKA 3GF8A 1RZFH 4BZ1L 3JWNG 3UTOA 1MLBA 3V79C 3LRGA 1Z3GH 4NM8H 2B1AL 1ZVSA 5HJ3A 3WBDA 3HC2A 2PWGA 3UYRL 4M1GH 2UY6B 4ZQTA 3IVKA 3C60B 4OZIB 4P06A 3UBHA 2GUOA 1UUSA 2WXJA 4HPYH 2R8SL 3MACH 4WY7H 3ZJAA 1C5CL 2XUWA 1XCWA 4FQLH 2ZXCA 4NWUH 4YHML 4OLEA 3D30A 4M8QA 5EU6D 2YPKA 2C7UB 3FT9A 5KSVB 3CZFA 1T0MA 2AGJH 4UV4L 1WWBX 1KT2B 1PL3A 4WFEE 2FLMA 4XMZA 4WWKD 3FO9B 4AY0A 2AJ3A 1M42A 2IAND 4L8BA 5F0MB 5GGSY 1J9CT 3S3PA 4N2KA 5CMAB 4W4NA 1A64A 1JGUH 4L8DB 5ISZA 4HOWA 3JZ7A 4YR6B 4FYQA 3RY4A 3L9EA 4XNUL 1KCLA 1D5BA 3R18A 1RY7B 1OIOA 1GJWA 3D12B 4PU2A 3MTRA 4N3UA 4C8XA 4PJGA 4U1NA 1RURH 3PWLA 2VDLL 4WHTB 1KIQB 4HUWB 4OFIA 1PY0A 1VGEL 2A74A 3S7GA 4YXLH 1BX2A 5CWSA 2OI9B 3GMPB 2R4RH 2AQSA 4EKXA 4KGJA 5CXPA 2D31A 4ZW6A 1NL0L 5BOZG 3IKCB 5J0BA 5IF0A 1UASA 3U30C 4GAAA 5KBLA 2FB4L 2VDOB 2DQGL 5FECA 1RJLB 1EVTC 2E7LA 2F74A 3D3VA 4QPEA 3V5KA 1NIDA 1RKRA 1AIFA 3FUDA 4N87A 2Z1PA 4IRZL 2IJ0C 4YO0B 2VKWA 2CALA 2Y7MA 1N8ZA 3LNDA 4U7SA 3P0GB 1PSKL 3BWSA 4YSOA 2CZNA 2QSCL 3PV6A 2C9UA 3OZ9L 3NACH 2EC9T 2YD3A 4U6TA 1EJFA 3I3BA 1G7JB 4MVBD 5E9NA 2OAAA 1DLHA 3V4UH 3BGMB 1ET7A 5JDJA 1BFOA 1HHHA 4UIKH 2ESVA 2Q1EA 4LPVA 4DW2H 1FUNA 1CT8A 4YDZA 3DSFL 3DGGA 4XN1A 5I1JL 1MAKA 5J56B 1A4KA 2AEWA 2Y7SA 3O4LE 3AS0A 2J44A 7FABL 3FQXB 3D1MC 1B9ZA 1XAUA 1WWCA 5C0AD 5IVXB 2HVKA 2ZT9C 1EJ6A 3T77B 2I5YH 1T1YB 1FH5H 3TWCH 1NIBA 4YK4B 5CFHA 3EO1B 4AKPA 1F3JB 2XWBA 4KTDH 4Y9EA 1FFPA 5AW8B 3G6JB 1T5KA 3ZTJG 3W0WB 1JPSH 4YDIL 5ALCH 4NFBA 2BIIA 1BF8A 2W65A 5E5UB 1UWGH 3BDYL 3LPGA 2VMEA 5E8OB 1KF9B 3T0XA 3VXRE 1FHGA 1AR1B 1SDDA 1OM9A 2X1QA 1U8HB 2Y22A 4GKZB 5CKAA 1ES0A 1P53A 2XBTA 1OB1A 3V0AC 5IT2H 1MFNA 4FOMA 2MTPA 3VGFA 1UZ8A 1QA9A 1G0DA 2VAJA 1VLXA 5FKAB 3CDGB 1QWHA 3FHAA 3PL6D 2KLTA 4LHUG 3LH2L 3S36X 4NKOB 4K3EL 5TPWH 3GJEB 4LKXA 4X5LA 1KJ3H 3TJEL 2APXA 3ZE0B 3OKNA 4R90L 5KAQF 4JPIA 4ODUB 3U25A 4JL2A 5GGSB 3ARBA 4QF1A 5D7JD 4RWYH 2YMTA 3Q1SL 1CLOH 3KPSD 4IJTA 2WUBH 2BZ7A 3OKDB 2DZEA 3L6FB 4HZLA 5I1HH 2YMOA 2VXVL 4JO4L 2VMCA 2DL2A 3OQRA 3HBQA 3PPEA 3QPXH 1EEYB 5AW3B 4GPVA 4FULA 4IYKA 3QNYB 1FNEA 2GW5A 4KJPD 4WNQA 2I26N 1DSWA 1MUJA 5DJ2A 1UH2A 3VXPB 3FT4B 1NAKL 2BINA 1FZKA 3L3IA 4U1JA 2FO1A 3F01A 2BCMA 4HKZB 5D7LD 4N0YL 4NO0A 5AAMC 3OV6A 1A3ZA 4FADA 5I74C 5C9KA 3MMEA 1Q0XL 4N0CD 3RNKB 4XVJH 3DMMA 2AXGB 1OF2A 4W9DC 3LN5A 1SN5A 1X6NA 1AOZA 1KYFA 1A21A 2X9XA 4J3UA 3MLVL 5AVRB 3EO0A 2MH4A 2N0KA 4U1SA 2DYPD 5JHDB 3TEXA 2P28B 4KNQA 4LRNL 3TV3L 4X8GA 4LIQL 1WC7B 2RJMA 5HHNA 1P4IL 3IJYA 1MIML 4CNIA 4F93B 1GZHC 1R3KA 4JREC 1WGOA 1S8DB 5FOBB 3RE0A 1KN4L 4HS3B 4I85A 5C0GB 1IB5A 2WYTA 5IR1A 3V7AG 4MA8L 2BRRL 3HI6L 4MJHA 1D5MA 4XNXH 2ZP9A 1OF0A 4LCWB 3E0GA 3BZFB 2DI8A 4H44C 5BS0B 2AJYL 1XH3B 1WZAA 4R7LA 5DWPA 3F65A 4YE4L 2HLAA 4PJ5B 1KTBA 4E41B 3WNNA 3QIWA 5DFWH 2ODHA 3BP4B 3HNVL 2Y24A 2GEEA 2Z7YA 5IOPB 2B59B 2LR4A 3OHXC 3WFCH 3ZK0A 4BFKA 4XI5C 1IC4L 2HRPH 5LGJA 3L2LA 4P3DB 5T5FH 2ZJSL 1I7RA 3H2QA 5DYOA 4RAHA 3EG9B 3P4MA 1GS8A 3MUGB 3AFLA 3TO2B 4Q9RL 3CSGA 3L1EA 3WNJA 1XF4A 5AG9A 5C0RL 3M86A 5D55A 2FAUA 3RUGE 1T4KB 1ZTXE 3QPKA 3O2WL 4LL4A 5FUOL 2FO8A 5E6ZA 1R3LB 5L2KA 4NQCD 3K0WA 4TVPH 5DJCB 1CYWA 1YMMB 3CX5K 3RA7H 3VWJD 2NSQA 1MCOH 5D6DC 1NAML 4PUBL 5F3BA 1KIPB 3BAEH 1NKOA 2HT4C 1QHPA 2OR8A 1NCBH 2UZXB 3EYQC 4N2MA 4P2QE 4Q8BA 1M05B 3T6QC 1T0NA 3KHQA 4U1IA 5FGSA 2X1PA 3BCDA 3PPSA 4DJMA 4BK5A 4LSTH 1YUKB 1SY6H 3RWGB 5GSRB 3P73A 5DRZB 4MWFA 5DUJA 3WJLA 3ZL2A 1U8MA 4BQ8A 4KK9C 5IFAL 3KWVA 5E94B 4PW4A 4PGDB 4R8WL 2A73A 2X09A 3TZVA 1IARB 4UUJB 4FQPA 3VXQA 3T6WA 4WEBL 1N5YH 1I9IL 4F8LA 1NBVH 1FAIL 3SBQA 1OPOA 2B1HL 2A6KA 3UABA 2ZUQB 4WO4D 1JZIA 3KYNA 3QJFA 4X6CF 5HHVL 1P7QB 3WSQH 4JRFA 1A65A 4L18A 2XKNB 3MNMA 2OMYA 3P30L 4IRSA 1QFWL 3C6SA 1BXAA 3WE6B 5C2BH 1U8NA 4X9BA 5D7IA 3FB6A 4P5TC 1AQDB 3GSVB 4GUPA 3IJEA 1G7HB 4TNWK 3ECBA 2CBPA 3A5VA 3OAYK 4N24A 3TBVA 4G82A 2A3TA 3NTCH 3NABL 4BINA 3TA4D 5GZNC 1BYPA 3HKZA 1DFBH 5AVZB 5E4EB 4AYDC 5C86A 1K5WA 3Q3GB 2HA1A 1MG2C 3MGAA 2IG2L 5F7AA 4WI0B 2I69A 5F1IA 5C97A 1E7VA 2R51A 3MAWA 4PV8B 2ZUVA 3K6OA 5K9JL 1JI1A 1PIGA 3G6DH 4HHGA 5I1GH 1VB9A 2KQMA 4NQDB 1AHWB 1P4UA 2ZF8A 5ISZE 2ZSWB 2B8OT 3KW8A 3MV7D 3N40P 5E6YA 1RFDL 3GRWH 2H32A 1UZ6F 1R5IA 1B0IA 4QXUH 5AKSA 3CC5A 1WHOA 1K2DB 2X89A 2VDNB 4TUJB 2QADB 2YWZA 5AVYB 4ECNA 2CWRA 1JNLH 5HHQA 5LXGL 2DM4A 1TJIH 1FO0A 2DQEL 3NIDB 4LCCA 4PJGE 1E9PB 1OZTG 4MJ5A 3KVDD 4X5XA 2C4FT 4JG1H 3MU3A 1F8TH 2NZ9D 5LGYA 4ZG1A 5E51A 5E2TH 3PS6A 1LP9B 1LO0H 1M2VB 3M17B 3ULSA 1OP5H 1FIGH 5K9QG 4HJJL 5C7XL 1PX8A 4M5ZL 4NNXA 4L9LA 3GXTA 4O4YL 1FNAA 3C6LD 5E0FA 4JPQA 1PCSA 3P11H 4IK6A 2ZWKA 3HBZA 3MRBA 1D5IH 3QUXD 3MNDA 2ZXWB 4XP4H 3IXTB 2OCJA 3H7BB 5DUPH 4DP7X 1IL1A 4JUTA 4YZFE 4M43H 2UXVA 5HHME 3TBBA 3GZPA 3U7AA 2ATKB 5IM7B 4Q9QL 5LBSH 1U92B 4EN2A 4XAKE 3LH9A 4OD3L 1J12A 3APNA 3FF7A 2DN7A 1D6EB 4H5SA 5HDBE 1N18A 2BVUA 5B39A 1AOHA 1WHPA 3RGVB 3G5YB 2FATH 2YBGA 2E75C 1M6OB 1ZWIA 1I9JL 4X4MA 4HMDA 3IU3A 2DOCA 1HNFA 1R24B 1SXCA 2J6EA 2NLJA 1E2VA 1ZV2A 4URKA 3F2LA 1UB6B 4F33B 4M8VA 4KUCF 3SSGA 4R97C 2FJSA 4TLKA 1F97A 4PB0L 3UIYA 4YHLL 3BAJA 3D18A 1X3DA 3N9GL 5FYJL 3TF4A 4ADIA 4NLAA 1AC6A 1JPTH 4R4ND 4AQ1A 5CZRA 3NG5A 4ZNEA 2GITA 3D2UB 2Z9TA 3QZPA 2A74C 4JG0H 4XZUB 1AKJA 3FQYA 3DHMA 3V0WL 1EZVY 3QRBA 3MV9B 1UA6L 4U6HB 2R2BB 4PJDA 1IJ9A 3QCTL 2WPGA 4RQQB 4LNRA 4KDTA 1JDCA 3KCPA 1J8SA 2EDQA 3H9HB 4WI5A 3GSOB 4PJBF 1JXFA 1FH2A 4OU3A 2YKLH 2QQLL 1URLA 4GBXC 2E7LC 1HH9A 2X2UA 5IMOA 3GTNA 1YVLA 2JJVA 2SEBA 2BNRB 2J4WL 2O26U 4G6FD 1E4JA 1CTNA 4KI5E 2VM3A 4HUUB 4CDHA 2JF1A 2QMKA 4DPBX 5EU5B 4DZBB 1DVFA 2IPKB 3NJGA 4XPHH 5FR3A 3LXBA 3V6FA 2VM9A 1VPOH 3BYYA 4PWHA 4NGHH 5BMFH 1W15A 3FUMA 5DHXB 5GGTA 4GAGL 2W07B 2XRAL 3OBAA 2R29H 5CLWA 1MHPL 4N9OB 3IJHB 3KLSA 5KW9H 3QYNA 1GHFH 1GMEA 4L1DA 1Q9WA 3ABKB 2BZCA 1DJGA 3CN2A 5AYUH 3SCMB 5B1CA 2W92A 4RMQA 1QBBA 3OLDA 1S7RB 1A9BA 4W9LC 1KNOB 4R2GD 1MI5E 2AS5M 1XGQA 3CU7A 2XQYA 3QDJA 1NCWH 3BISA 1JXJA 2XBDA 5HDWA 1IFHL 3H53A 2L7JA 1RK7A 3OGOE 4YL9A 1ZMYA 4JM2F 4UIMB 4HIJA 3AS2A 5C92A 3HS9A 2KPWA 1I3VA 3P0YH 3PHQA 5HVHB 1BMGA 2BFVL 2XG4B 3QEQB 2O5XL 3NCEB 3RVVD 3TGXA 4TL5A 4I0KA 1OGPA 4JR9H 4R9HA 5E2WH 4F20A 1JOIA 2HT3C 3Q2LA 1SLWA 1GVIA 1I3GL 4IJ3B 1OT2A 3OMAB 5F9JB 1LEKA 3WNOA 4AYBA 3P4NA 5EU4B 1ACXA 2CHWA 3OKYA 1ORSB 5ERWA 4WTXA 5K9KA 3OZKA 1HSAB 1IQDA 2CU9A 1TYRA 2R15A 1BMWA 1WPCA 4GLRI 2X9YA 1Y18B 4KI5C 3SDDB 1JWUA 1VA9A 1C7TA 3NFPB 1FGVH 2HX9A 6FABH 1UEYA 2RAMA 3ARBC 3BKML 4ZFFA 1IM9D 2V37A 4YHYC 3I9AA 3DX6A 4ONGL 4MB3A 2YQ2A 3FT3B 2DIBA 1CXLA 1CXHA 1OCRB 3CHRA 3F7YA 2QGCA 4Y5VA 3LHPL 5E9DE 3DXAE 4X6BA 5FDWA 4U3SA 4CAGA 1NBZB 3SPGA 1KGUA 5D70L 5TE7L 1UQSA 2Q3XA 3MREA 4DGYH 2WINA 3D85B 1ZA3A 3MLXL 4WUKL 2EUVA 1TDQA 1KIRB 4UBDC 5DEFB 2EIKB 3BP6B 4K7FB 1YNLH 2IOMA 4X4ZA 5HGDA 1OAQH 4HA1A 3BSZL 2R27A 5T3ZL 3UZQB 5ACZA 5J13C 1QRNB 4KRPC 4Z95H 5CSZB 3MFGB 1U4EA 3W1ZA 1JNHB 1S7UA 1U91A 4OFPA 3QH3A 5EEVA 4XBGB 5KVMC 1Y0LB 2GB2A 5L2KE 4F7TA 3W37A 1R17A 4HT1H 1RSYA 3RZWA 5JIPA 5E8PA 2DI7A 5IVOA 4ZW8A 2ZWNA 3OMNB 3BKYH 5IEKA 4PB9L 2E59A 2OYLA 4EIUA 3GUTB 3HCVA 3VFWB 1QI5A 1A8ZA 2YD7A 4NQSA 2OMUA 3HC0B 4IU2A 4X99B 1KTJA 2FQDA 1WZ1H 1KOAA 2WTRB 2QVIA 3ARFB 1KXVC 2E9JA 3NP3A 2BOBB 1MHEB 1RSFA 4H25B 5IQ7L 3BWUC 1TCRA 3WI9A 4OB5H 1QATA 4JPWH 3HN5A 2FNWA 5F1OB 3NQKA 5IJCC 2ICEB 2ZCHH 1WG3A 3EXJA 3LQAC 4A7GF 4IIQB 4WENB 4FFWD 2CRMA 4OJCA 2FQFA 3BUYA 1UD4A 2OR9L 3ZLQC 4QOKE 1JHKH 1BAFL 4KY1H 3QIWC 4P4KB 4WHYH 2YJLA 5JZ7D 2XXMB 3IFNL 2Z93A 1RUKH 3N44B 1A7OH 2VDOL 4XX1E 3QZWB 4YH6A 2DLIA 4XN7A 4B5ZA 2W80C 1NJ9A 4WV1B 3G5VA 1GRWA 4P57B 4G9DB 4ZI8A 3ZE1E 5I66A 2IANA 3M07A 1G4MA 1WD9A 2DICA 5I76A 2DW5A 2G2RB 2IV9A 4NUGH 4ZMVA 3PHOB 2W38A 3DX7B 3O3UN 4P23C 4CVZA 3WEBA 2BOCB 4GG6F 3WJMB 2XWDA 3RL1B 3IXAB 2DWEA 5D93C 4JJOA 5EC2A 4IGBB 1PZAA 4FXTA 1SXZA 4LOFA 3MRHB 3N5AA 4XOEA 5FS5A 3SHSA 4OV5A 3DVGB 2EIBA 3ARXA 5D1QD 5KOMC 2CDFB 2O4EA 4J1UA 5DJAA 1UCBH 4HF5L 4PLKD 3NZ8A 5KZCB 3ARQA 2FBJH 4ZUVB 1FVDA 4OGAC 3L5WB 5EU3B 3S96A 3UH8A 3BUQA 3TA3B 2IV8A 3DOIA 3CHSA 1OAYH 1OCWL 5AAPA 3CH8A 3N06B 4X0NA 5HY9B 4APXB 5D6CA 1DBJL 5BV7C 4N0UA 5JQ6L 3V0IA 1N2RB 3E6HB 4KTYA 5G5DB 2CBTA 2I9LB 3WJLC 1KEGL 1SYVA 3PLYA 1M71B 4PGBA 4A67A 3RYMA 3TZVC 1TPXC 3QJHB 3T3PE 2VISB 4C4BA 4CSZA 5I6LA 2M83A 3GBNH 3MV8B 5JW3H 1JF5A 3BIKB 3BZDA 3O45B 1KTRL 1TQBB 2NY6D 2YBRB 4TXVB 1RIHL 5TTRA 1IO4C 3TEYA 2DTSA 5F44A 1S7QB 3SKJH 2BJML 4Q97A 2JQMA 3IMUA 4PJXA 3HUJF 4N85A 2G3XA 2K4AA 3WD5H 3TCLB 1G6RA 1JV2B 3GTTA 1OAUH 4MHHI 3VRJA 3W56A 4HWNA 5C0AA 1C8QA 4YHZH 4B60A 2WBJB 1WAAA 2WO3B 4BSVB 5JHLH 2ATPA 3QIBC 4QHMA 3L3JA 5SWQA 1LQSR 3Q6FA 4HVBA 3C08L 4FQ1H 1C5DB 4I0PB 4LPWA 4PWGA 3NZHH 4NNYA 3X1FA 3NCXA 1GC1H 5ESQA 3GSRA 5CIPH 2D2CC 5IUCA 1PX4A 1CDJA 4ENEC 5AOMA 1N9PA 2D03H 3R7RA 3LQMA 3WKQA 3ENEA 5FGBC 4GT7A 4NPJA 4X4ME 4E9LA 4XNAA 1MW3A 5GGVY 4PREB 2Y2YA 2VDPB 4XC1L 5DJ0B 3OX8A 3RB7A 4BUGA 2XJKA 1J5IA 3K4ZA 3HEIB 1E8WA 2VW4A 1UD5A 2VN7A 4YQXH 1VGKB 3GK8H 3G08A 4TQPA 4XZ4A 4MYWB 4ATTA 5FHBH 4P48A 4UT9H 1WAEA 5I17A 1EHKB 1S9WA 3PL6A 4ZNEE 4PCSA 3HG5A 4LCCC 2EDLA 1FZMA 2D7QA 3HMWL 2G0LA 3MI6A 3OMIB 5EPMB 3W11C 5E8NB 1H3TA 4PJDE 2BVPB 2BS9A 3OKEB 4OLWL 3C5ZD 2MOVA 5ENWB 3VXOA 1I8UA 1SLXA 4MD5B 4IU3B 5D7JA 2DQIH 4EUPH 5G55A 2APFA 3KPSA 3Q44A 1RZGB 1BZEA 3GPSA 3FCGA 5IQLA 4CU7A 1X5YA 2V17L 2Y0SA 2HG5B 4BUHA 2P24B 2IDCA 4ZT1A 2QQKL 3HTLX 1B2WH 1KFGA 3V5DB 3PY9A 2Y36H 3D25A 4J6RL 3VJ6B 4J6IA 1CU4L 2ITCB 4F7MB 1MY7A 4M6ML 1EMTL 5M95B 4KXZH 4EZLA 5D7LA 2VR9A 5JQIB 2DWDA 2NYYD 3II1A 4JRLA 4B96A 4YDMA 4ZO9A 1XMEB 4G6JH 4OQTA 4HWBL 1ONQB 1OSPL 3WL9A 4JHUA 2BSSA 4MD4A 1OD9A 4PRDA 3TJHC 5IMKB 1JUFB 1LK3H 4KMTL 3G6AB 3U6XS 5AB1A 4AKQA 4LGPB 5HDQL 3EJZD 3K6SB 1KBWA 4PW3A 5D72L 4CKQA 4DKEL 2DYPA 5CLZA 1KZQA 1LVEA 2MNWA 4NIYE 2GTWA 4HQQL 3MUZ1 4HHWA 3RVXD 3ZMRA 5T8IA 1IC1A 4YPGB 1INDL 1BCIA 3X14B 1DQMH 1JTTA 2FECI 5KANI 1XGYL 3FT1A 5AKVA 4LLDA 1DBKH 5FUZH 1LL1A 1MQKL 2Z91A 2ZYRA 4ZUSB 2X05A 3T71A 1L6PA 1QW9A 3W39B 4D9QE 5JXAL 1S7WA 5DJZB 4NKMA 3UBXA 1IGJA 3TBSA 1Z3RA 2VDMB 4U05A 1TZIB 3QQ9C 4D0DB 1KXQA 1QR4A 4KDTC 1TF4A 4OCWL 3VFRA 4UT9A 4YGVB 1S7TA 2A83A 3CVIH 1IVLA 4LOVA 5DHEA 1OP3H 2F5AL 3X3GH 1JTOA 5EZOH 2WWNA 3F58H 1P1ZA 4WHCA 5E1HB 2P46B 4W4OA 4FZEL 5L9DL 2EXYD 2AMUA 4OCLC 1JL8A 4HGKC 4OUUB 4Z7NE 1BXVA 3BAKA 1LO3H 1VFAA 1DVFC 1T7XA 2K8QA 3JUYA 3NIFB 4RGOH 5CJQH 3ORJA 1AXIB 4XB7A 2ZKHH 3QQ4B 4E5XA 4V11A 3H0TA 5D4JA 2BCKB 3DI2B 5T3XL 3FZUD 1EQWA 1YY9C 2A9MH 5A16A 3T0EE 4O51B 3JV5A 3QZLA 1JGDA 1ZS8A 2XWZA 4DTGL 4YNYA 2GJZB 3D52A 4NQCA 2QV2A 1DQDL 2GHZA 3VWJA 4N4YB 3AS1A 3NDZE 1ZRUA 3L2NA 1VZHA 4LT7A 1HJBC 4G3YL 1W6WA 4ZFGH 3B5TA 1LK2B 5D1XD 3C8KB 3QZWG 5IHLB 2XQBH 4B7IA 4N1CA 3MLWH 5F88B 4BM7A 5ESVB 4L3CA 4FQJH 5CCKH 4HW6A 1QSED 4PBXA 3QHFL 2VZOA 4P07A 5IG7A 4ZUTA 1BM3L 4MNGA 5DMYA 3NIGF 2VUOA 1MCSA 2VITB 4MCZA 1B4LA 1HQ4B 3MJ9H 35C8H 3KYMA 1D7DA 2EXWD 4M6NH 2P43B 2WZPA 3AWGA 4GAYB 5IMMA 1YYML 2K6WA 3FBQA 3L4YA 2ZOTA 5FEBA 5D5MB 1JWSA 5IHBA 4KZCA 1CD1A 2KI6A 4L48A 4NC0B 4UANA 4A2LA 1BOYA 1U42A 5KVFL 5KSAB 1S5IL 3L3HB 1XGUA 2VDNL 1FRGH 1MWAB 3O6LL 4B0MM 1P0SE 4MXQC 1CFTA 1FZOA 5FK9A 4WGWB 5IVZA 5I74B 4A55A 5I1EL 1GAFL 2FE0A 1THAA 3EOAB 4JK0D 3V10A 1UADC 1CFNB 2YPVL 1S7SB 2XWTA 4XP9H 5EU6E 1KDJA 2F19H 1U2CA 3VRLE 4M5SA 3CZSA 5AKTA 3VI4F 1AO7D 1Q9LB 2DMKA 3T0EC 3MBXL 3VXRB 1XQ4A 1U8OA 2J1XA 3FO1A 2IANE 5ICZB 5LLIC 4ODHH 1OKEA 1YPZF 1DJXA 4MB4A 4PG2A 1MF2L 2CJ3A 1XHHA 3L08A 3NIFF 3RI5K 2O6PA 3B3IA 3N3EA 3CLFL 2HRLA 4UT7H 1CFBA 3HI5H 4EDXA 1KELL 2AI0L 4W81A 3DHPA 1PKQE 3INOA 3MA7A 3W9EA 1BOGB 3S9DB 3KWWB 2CJUH 3TOPA 3RKDC 3UPRB 1OTTC 1KPRB 1UM6H 4WCYL 3IM1A 2PPCA 1OQXA 2JJSA 1RZKC 3X13A 2P8PA 3HMXL 2H6PB 4CU8A 4G1EB 1ZT7B 3CK0L 3THMH 5AEAA 3VI3A 4JANA 5C0BB 5KTEL 1UT9A 1AJ7L 1X5JA 2HFFB 4NB7A 4F9PA 2ADFL 2RB8A 4M7KL 1JXGA 3BEVA 2ZP8A 1RUMH 4XP5L 3C6LA 5LB1A 4N0UE 4X5WB 3AQDA 5GGUA 3RL2B 2P1YA 5I18L 5GGRA 3QUXA 2W9EH 2R23A 3K6NA 5HGBB 5DVKA 1ZLUK 1WA0X 4DK6A 4PJ9D 4P5MB 5IB3B 3P9LA 2ZD0A 2C5DC 1T6WA 3EAKA 4FQHB 3WIHH 1K8DB 5EUKA 3O3BB 4LASL 2ZUXA 2VDRB 4AQ8C 4HFUH 1NCDL 3KEHA 3U4EA 5D5MF 5CGMA 1CZ8H 1GZQB 4JVPA 2F6AA 2AAAA 3KPMA 1KCWA 1YQ2A 2CBOA 5JIMA 4N3TA 4PJXE 5DHVA 2H1PH 2WN2A 5AZEL 1DL7L 3V0VA 1H6TA 2D4DA 4WWKC 3MO1A 3D39B 4PJEB 5C0AE 3BGAA 1A7PL 5L4MA 2BXYA 4EIGB 2P45B 4UOJA 3OAZK 2CA4A 1HOEA 2MCMA 1SMAA 3SJVD 1AXTH 1G7QA 2YD2A 5DJYA 3V7MA 3GNMH 4M6OH 4PJFF 2FJFA 4Y9BA 1R5WB 3AQZA 5F8QC 2ZXGA 4RSVA 4AH2A 5ID0A 4A2GA 3K8LA 1JG9A 3AGWA 4MNHA 3ZKXC 1BA9A 1IT9H 3NSFA 4IW4C 2IC2A 2X6AA 3MROB 2DAVA 1AD0B 3ARRA 2W0FB 3B6SB 4PVLA 5FO7B 4DK3A 2X4TB 2Z7ZA 1I7TB 2HN7B 2XVGA 1M3IA 4ZFZA 5GGQH 4PJHA 1UJ3C 5D2LA 3SKOA 2HMID 1LHZA 1UKQA 3T4AA 3FOMB 3WEAA 3ZTEA 4Z3GA 4P5TB 2I60L 1M1SA 1SJVA 3N41F 2NY0D 3RX5A 4WSJA 2AJXH 3BPOC 2VR4A 1PY4A 5DZ9A 4Y1AA 1E6OL 1YNKH 1DANU 2FRGP 1ZVYA 4GRLA 1DQLH 4XVUD 4ELKA 3CPLB 2WD0A 2YUXA 3QA3A 3VNYA 3EDDA 4K9JA 3B43A 4X0KA 1GY1A 2VJ8A 3BHBA 3RUGB 1A6TB 1I3UA 4KKZA 2VOTA 3S34L 3RJDA 5L6YL 4MVBC 4PJAA 4KHXL 5KYXA 4OJFL 3KPSE 1G7IB 4WJKB 2BIOA 1ZV5A 2IO5A 5AW6B 3WG7B 2CGRL 3NJKA 4A7QA 2ENYA 4EO5A 5FF6A 2VZ1A 1JXDA 3VXTB 1NDMA 1NDGA 2EYTB 4N8CH 4QRAA 4EDWL 3TV8A 4P2QB 3VFNA 4GRWH 1T2QH 4UM8A 1S7VB 3MGOA 4HHAA 2FEEL 1QFPA 3L13A 5KN5A 1YMHB 1EVUA 5D7LE 3SY0B 4P5RA 3P4LA 3U46A 4BH8B 4G80A 3Q6GL 1Q72H 3AXHA 1RP9A 4MCMA 2FX7H 1CDGA 4HWEL 1E4XL 3ESUF 4LSUL 5BRQA 4XO8A 2QSTA 4WW2A 1N0XH 2ZNXA 3H9YA 4JHWL 4PJEF 2UXFA 5EA0L 3DETD 3QRLA 4XWGL 2Z8RA 1MLBB 1IC0A 4K8RL 5E00A 4LL9A 4OFYA 1OSEA 4UTAL 5IGXH 5FKPA 1X4ZA 3QHZH 3AT0A 4XE5B 5CEYA 3ZN6A 1KJ2A 3PL6C 3CFDB 1XF5B 2XOTA 5HI5D 3BH9A 2GUOB 2VR8A 3H6JA 1Z5HA 2VXSL 4MQ7A 3UAEA 4LSDA 3MSPA 3E8VA 1OLZA 1OGAD 4XH2A 2EVIA 3GTVA 1NBCA 1EUTA 2XG5A 3LRMA 1HJCA 2FT8A 2X0UA 3QWRA 5MEOA 4M8QB 2YEZA 1KXQE 1T0MB 4PSPA 4R26H 3VRIB 3O41A 5DQDL 3T04D 1K4DA 1Z9SA 2J20A 3LS5H 2NSMA 4KK8D 5D7JC 4B7LA 4DN3H 2Z92B 1EEZA 3ULUL 3KLDA 3E80A 2AJ3B 5EF3A 3VFUA 1OE1A 5K1VA 4HXAL 5GRUL 2WWKO 1GJUA 4PWKA 3U0PB 1NCHA 2R2EA 2O5YL 3CN3A 1HIML 2E56A 5AW4B 4R97B 4KJPC 3ROOB 2E9GA 2OSLB 5MI0C 3UTPD 2HH0H 3V8CA 1D5BB 4KKPA 1QNIA 4EZKA 4YN3A 1E67A 1F90L 2EE6A 2KKQA 4J2XA 3GSXB 1CL7L 2VZVA 1T7ZA 4PJGB 5E7FA 3T08A 3SDYL 2A74B 1YJDH 4S1RL 4N0CC 3VFVB 3VGAC 3MRJB 2ZCKH 3ZDXB 2WKOA 4NQCE 2H1XA 1N26A 4GSQA 1MFBH 3JVGA 2F53D 3KW7A 4A6YA 4UV7H 4Z7UA 2WQUA 1SF5A 5AFAA 5FECB 4AEFA 3UGUA 2IPTL 4WSGA 3RDTB 3ZMNA 1FAKT 4GBXB 5AAWC 4O2FB 2GSIB 3FTGA 2WWKT 2PYEB 4QNPE 1MCNA 3UCQA 4PJCE 1YC8A 3MRFB 1I7UB 2BDNH 3WLBA 1XH2A 3JVFC 2Q2LA 3QCUH 4JFPA 4LP5A 4OI9A 4UDTA 5DD0H 5EU7E 1CLZH 4LSRH 1S78D 2VMDA 5HHMB 1MPAL 1HS6A 3PV6B 4WI2A 4JO1H 1WEJL 3FTUA 3KH4A 4MNGE 3CLEH 4BZ1H 4QJ4B 3GDCA 4M61A 1DBAL 1WFNA 4QTHA 3IDNA 3SKMB 5EF0A 1PU0A 2OJEA 4KPHH 1CT8B 1TVHA 4IDJL 4NI3A 5HDBB 3DGGB 3QBTB 4NS0A 3RVWD 3IB4A 1IAMA 5K59E 3CZUB 1A6WL 4UAHA 5E99L 1ZSDA 4H8QA 4LVEA 4WDIB 4DGVL 2BP8A 2VSDA 1BVLA 1WITA 2GC7C 1G9MH 4W4OC 2G9HA 5DMKA 1ET5A 1EFQA 4YHMH 2LTQC 4N6RA 4ABVA 4ALAH 5IVNA 3ZYOA 1ROWA 3QJSB 2DJMA 3I9GL 4Y88A 3L9YA 3QUKA 4U2ZA 5I1AB 3CU1A 3H55A 1OVZA 4XVOA 2E6PA 1FL6A 1A2YA 1W72A 4BWUA 2KPNA 3OC5A 4BHUI 1GZPB 1TTCA 5AYTA 2ZWZA 2IWEA 1U8QA 4HKBA 4CSTA 1MQ8A 1J8KA 3QQDB 1MH5B 5DS2A 3V4PB 3MLZH 5FX3A 4NDMB 4YVUA 1WIUA 3VWJC 2PPAA 4OH2A 1ES0B 3C6EA 4XNUH 4URTB 2DLEA 2LT9A 3MV7E 3CCHA 2YAHA 1QA9B 3FSZA 2N01B 3MZGB 3KPQA 4JZJA 2VDLH 1PAMA 1W0VA 1VGEH 5EO0A 1DQQA 4MD0A 1AG0A 1NGWB 3GS0A 4K94H 1RZJC 3C60D 3IDIA 4FNTA 5EU7C 4MJIB 3OKNB 2KMWA 2WW8A 3FT2A 5T3ZD 5H4ZA 2FYVA 4WFGD 1XR8A 3ETBF 1BLIA 2FB4H 4I7ZC 3WJJA 3OXSA 3ARBB 3HBGA 3RP1A 3AMLA 3UGEA 2A6JB 3NSDA 4K7PY 4MSWA 4YHYB 5DLMH 3BESR 2QQQA 4WEEA 3T6XA 4GKSB 5AVUB 5BZWA 5D71L 5E7BA 4IRZH 3ECWA 4LSVH 3SYPA 4BH7B 4BSJA 5ES4B 3EJYD 3GI8H 4NEHB 5I8EB 3SQBA 3TP4A 4WTZA 2VDPL 1RMFL 1AGEA 2EEXA 4WO4C 1BP3B 4M5YL 4WNQB 4GI6A 5D4QA 3NN8A 1MUJB 1PD0A 5DVOA 5DJ2B 4BZ1A 2KLSA 4QTIH 1H0DA 1MI5B 1MJJA 3L3IB 3CHQA 4U1JB 5FAAA 5J13B 3TF7C 4GSRA 1ED3A 4WGKA 4KRPB 1MELA 4NO0B 3HG3A 4V1DA 5INCB 4PP2A 3L45A 2AITA 3OB0K 3PAZA 4NUJA 5I16B 1SHXA 3UXFA 2H1LM 4XMTA 3FTXA 4LEXL 5IHZA 5FYKL 3IAQA 2J8UB 2GK0A 4R7VA 3SZ6A 5L7XH 1UT2A 4AGOA 3R1GL 4PJIA 43CAA 5E24E 3PNRB 4Q89A 4CN6A 1MHCA 3NJVA 4NQVB 2XZCL 4ORZC 4Y19A 3VD5A 2DQDL 3LZLA 3NRQA 2X41A 2ZUTA 1P1VA 3HI1A 4QRBA 4YDIH 5HJDA 1QX1A 3KPRA 2HZHA 3MLRH 4GSXA 3BDYH 3NT0A 5BRZB 3ETBJ 5IR1B 1UTDA 1JFHA 2WTPA 2X1OA 3NQIA 1FL3A 4I88A 2JK5A 3D0VA 3FONB 4UQBA 1EA9C 2JJSC 2NZ9C 4MS8C 1JGEA 4FFZA 3X12A 4PJHE 3PREA 2BSTA 3DWTA 4NOBA 5D2LE 5E9DB 3G3LA 3DXAB 4K3EH 2AQQA 3CSYA 4F7CA 3ZL4L 3TJEH 4JRYD 2AJSL 4JY4A 1TG8A 5TF1L 3ZBMA 4NHCL 4EEEA 2CK0H 3C6LC 2W91A 3HB3B 4FQXD 4R90H 4UZUA 4ZYKB 3TH4T 5LGJB 4Y1AE 5DQ9A 3SGKA 5T1KD 5F72S 3QUXC 5DHMC 5C0FB 3P4MB 4LCUB 2YD1A 1NFDB 4P23B 3VWKA 2HYMA 1BVKA 2P3YA 5E1AB 3BZEA 1XF4B 1KGYE 4GIOA 1CMOA 3D5OF 3MRGA 3PAUA 1NDTA 3N04A 1WIPA 2XV2A 3W0WD 4QMEA 2JJTC 1Z9LA 4PJAE 1E3XA 1PDKA 5EN2A 3CX2A 2VDML 3I85A 1CTOA 1I85A 1NM4A 3ISRA 5I1CL 4A7SA 3DHUA 4YBLC 1TJGL 2X4OB 5C6TL 3CUPA 3RIKA 4B95C 3FH8A 1CFSA 1HHIB 3ARWA 1DQVA 3ARDD 1YN7A 1FA4A 2X44D 1J0IA 4I1RA 2OTPA 1FSKC 4X9IA 4UB0L 4U1IB 2BFGA 3CZLA 1PNCA 2DLFL 3PABA 1J0ZA 1IM3B 4HIQA 4HJGB 4HU8A 5BV7B 1NCJA 2H2SD 4NM4L 2FSEB 4J23A 1SOSA 4PW9A 4XCCL 2WK2A 2FHCA 3P73B 1A7NH 5HYIA 4MWFB 1KEMH 2WQSA 3BUDA 1U8MB 2YFNA 4D3CH 2IGTA 4WKZA 2X70A 4R4NC 1I82A 5JOFA 2JJUA 2E9WA 2ADGB 3TV3H 1TPXB 1XEUA 2EDTA 1L0PA 1P4IH 1MIMH 7CGTA 3CFEB 4BKTC 4FG0A 4XXCA 4GI9A 4QOKB 2F0CA 2A6KB 4JFXB 5E2JA 4F8NA 4NPYB 3WENA 4OZGB 2R59A 1X5MA 3JWDH 3O6FD 5FWQA 3Q5TA 4PRBA 3T4AC 2UWEE 3C6SB 4ONFL 4KJYB 3UTTB 1U8NB 5F7HA 3HI6H 4GUPB 3ZE1B 3HN3A 3WDIA 3WY2A 5LCVL 3MOAH 3ECBB 3QORB 3QIBB 3SDCD 2CSPA 3TBVB 4JFED 3RWIB 4G8GA 4GRLC 1O7DE 2AJYH 4ZTOL 5B8CC 5CCGE 4YE4H 5E8EA 3RLSA 1XFPA 4LDLB 4CBPA 1OQOA 2WZ6A 2KZKA 4MNQD 2R69H 2HFEB 1JJUA 2VLRD 3L3OA 2AVFA 2FZ3A 1XGTA 1SYSB 1PG7L 4YSSA 2RTTA 1CLVA 3VGHA 4FKEA 1BD2D 1WQVT 3TX4A 5LDUA 3OKMA 2ZJSH 1P4BL 4NSKA 5F6HI 4ANWA 4FJZA 5EIVA 4ZPTB 3ZZQA 1H6FA 4IKLA 4L8SA 5L2JA 1CGWA 5AOJA 3QDGB 1NFDF 1R5IB 3GZKA 3WFDL 1MWAL 1UOLA 5D1XA 3O2WH 3LEVH 4N8PA 4R2GC 1KULA 5C07D 4AGMA 1JS4A 3ZDYF 5ID1A 2UX7A 3FMGL 4LCCB 1UXWB 2EADA 2DQJL 4MJ5B 2MCPL 4X5XB 4F37K 2P7TA 3L54A 3KLKA 1QSEA 1NAMH 4BRJA 4L2YA 1VESA 1TNMA 4AM0A 3AY4A 3T3PB 3BPNC 3RVVC 3WIAA 4JM4H 4WW2C 4Z7UE 3WKML 1EHLH 4E41D 2X3AA 4HLZH 4NT6B 1TKWA 5DK0B 5E2UH 1RJZB 5A2FA 1DN2A 2XY2A 1OXYA 4DP6X 4R8WH 3RGHA 1ROCA 4JX0A 4YXKL 4F7PA 2Y23A 4NKIL 5EZIH 4KHTL 1SOQA 2VO5A 1YNTF 2NUPA 5AOKA 1HYRC 1QYGL 4G7YL 5K9OA 2X7LA 2X87A 4XVTH 1O7DC 1IGCH 2B1HH 4JFDD 3J27A 5C08D 5HHVH 3GXPA 3EBIA 5HDLA 4XNDA 4OZGF 5B39B 4UTBL 3QDHA 4HISA 3QS2A 2JCCA 2OW6A 4NBZB 5I5JA 3ELQA 4YDKL 1QW8A 2E4TA 1ZWIB 1RQ5A 3HG1D 1YMMD 2WY3B 5LQBL 1HINH 3IU3B 2UZIH 3HFFA 4QHKI 3NABH 2NY2C 3JSSA 2NPLX 3OWRA 4M1DH 1MCPH 3Q9QA 5FC9A 5TGBA 4X7CC 3QNFA 2P80A 2VWEE 5ADPL 3CMOL 3L95A 2LABA 4M00A 4OZHA 4JPVL 1NGYB 4ZW7A 1ZGLA 3D18B 2NW3A 3D0LB 4R5TA 2FIRT 2XFGB 3TC9A 5GZOA 3ZOAA 3QUYA 2DD8H 4J12A 1IRAY 3FCUB 2VDRL 3IN0A 2ARJA 4JQVC 3ZE2E 3AROA 3ARVA 3GIVB 4LOUD 2HLEB 4LNRB 5JIQA 3JVGC 5EV7A 2I7SA 3AABA 4MASA 3WTSA 3GHBH 2OXHA 1EGJL 3OHMB 5LXGH 4P4RB 2IOOA 1HH9B 2YSSB 1WBXB 5TK4A 3HAEB 5IFJA 3AZUA 2LHAA 3QEHA 1CGYA 1FFRA 1SZNA 2V6HA 1ASOA 2JTYA 4GSDH 4IBUA 1F4XH 2A4EA 2DQFA 3Q7JA 3VTAA 5I1KL 1DVFB 2PTUA 2XFXA 3VAEA 1UD2A 4KUCD 2OX5A 3HC4H 4POZD 3V6FB 4G42B 4YX2H 1BEYL 5CLXA 4PJ9A 3H9SA 2BHUA 3ILPA 4R4BB 3WFEL 4M5ZH 3MRKA 4FFWC 3QUMH 4J3OF 1T1WA 2YC1A 4JQXC 5EC1A 4ONHA 4FA7B 5CEZE 2ZXEB 4HK3N 4RIRA 4TOYL 4JDTH 4JKMA 2DYRB 1Q9WB 3HJ0A 3NA4A 3S88L 5LBVA 2ZOLB 5JZ7C 4O02H 4NQDD 4FMKA 2B39A 5KS9B 4K55A 1RK0B 1IGIH 2DY2A 4KDVA 4C58B 2HT2D 4RFNC 2VWEC 1XGQB 1VERA 4V1DE 4M5TA 4AGLA 1MRDL 4ZFOB 1FBIL 3HPJA 4G7QB 5KVGH 4ZAKD 3VA2C 2B4CH 3ECQA 5HP5A 4HCIA 3KS0J 4GEIA 4YSUA 3L3KA 4Z76A 3CFBA 1C7SA 2R2HA 1GY2A 1K3ZA 1KTDB 1M6UA 3RHWK 1Z9OA 5D1QC 3UFIA 5DVNA 1CXEA 5I0YA 4Y19E 3P4NB 4PLKC 1CICA 3N9GH 2W60B 2WUCL 3OR7B 1IGML 2ZCLL 3DPBA 1I1AD 3ALXA 3KPRE 2VN3A 4LLQA 2NDGA 3EGDA 3OXRB 4M9OA 4POUB 1ZIBA 3F12A 3V0WH 1P7KA 4JCWA 4Z7NB 2OMXA 3QCTH 4BUQA 1JWMA 1JWUB 3TU6A 1GYAA 4NLHA 5DEGA 5EBMA 3WJJC 2O61B 1M53A 4AXWA 1K4CB 5AVTB 3DX6B 1WWWX 1JMXA 9CGTA 4GFXA 2Z35A 1NIFA 3MNZA 1MZYA 4JM2D 4K9EH 4XAWH 4XO3A 3S36L 3A4EA 1GIGL 32C2A 3RGVD 3T0EB 2VQ4A 1A3LL 2NY6C 3MREB 5DT1H 1AD9B 3HZKA 4KRMB 1TVBA 1ZTMA 4AKOA 1ZA3B 1BVZA 2E8ZA 3TBWA 4EN3B 3ZY7A 5I15H 4GS7B 3FH5A 2GIMA 2ZKYA 1P84K 2FJHB 5T1MA 3PJSB 4C55A 1KV3A 3LKSB 4NI6A 2A2QT 2VGLM 3AADB 4PWIA 4PRAB 5C1MB 1NCAH 1RULL 3MR9A 2AAVA 2IQ9H 4PHZA 1S7UB 3QH3B 2NY7H 3D2UD 3PGFH 3SBPA 2VLKB 4MBOA 5B7FA 1QEWA 5FFGA 3G9AB 2OMWA 5E8PB 4NP4H 3BUBA 1NCIA 1D5ZA 4ETQA 5KS9F 4OT1H 5IEKB 5AKRA 5FYLL 3V0JA 3QEUB 3WS3B 1IFHH 1U36A 4PS4H 1NEZB 2K4WA 3LB6D 4D0CB 1DVTA 3HCVB 3FU7A 4X5PA 4ZO7A 1UURA 2J56A 4FLRA 1IU1A 1AGDA 1KV7A 2ENSA 2OMUB 4NQSB 4QD2E 5GS0H 4AT6B 5JTWA 3MGTA 4G8EB 2AK1H 5DQJA 4JFTA 5IW6B 1TOXA 3WGVB 2WO2B 4NZRH 1GGUA 1E6JL 1JGLL 1FYHB 4DGUA 4WJ5A 4CN1A 1GXEA 1I3GH 4JDZA 2QVFB 5EWIL 3P77A 1TUPA 4YHKH 4UQ3A 3EBGA 3EFFA 4KKRA 3GSWB 4IOSA 5EU6B 3UOAB 3RNQA 1NGQL 1OE3A 2VXTH 5B3JF 3C5ZC 1A25A 3JXAA 3WFZA 4L23A 4Z3TA 1TEYA 3HR5A 4KV5F 4U4BA 4WWKB 3IK2A 2O6CA 1MFAH 1EAOA 2IANB 2NSXA 2VAAA 4IMKC 1BLNA 4LHUA 3VA6A 4ZMNA 3MLSH 2H6UA 4C56A 1BZ9B 2DYSB 4RAVA 4DEPB 4NHUB 4UAOB 5LWYL 2ZSVA 3A4FA 1CE6A 1LLAA 4O2EB 3QAQA 3MCKA 1V3LA 5D70H 1ZA6B 1PKQB 4HK0A 5EC2B 4WWOA 5TE7H 2R7EA 5A6LA 1K3IA 4OJYA 1KTKE 5BO1L 3MLXH 3ZKXB 1I85C 1VFOA 4OV5B 1EAPB 1NCTA 4X6FA 1RIUL 3E1F1 3OJ2C 5DJAB 4YHIB 3DSNA 3WXWL 4UYPA 1NIAA 2VQUA 1F1DA 5B39G 1FVDB 1HSBB 4PS8A 1UJ3B 4XPFH 3WNIA 3BSZH 1T20B 1PZ5B 4KQ3L 1M7IB 4EZMA 1XBRA 1NC2D 1XH1A 4RESB 1A4JB 2P8MB 5D1XE 3RX8A 2FH6A 3I75A 2AABL 5D6CB 4N0UB 3BPOB 3RVXC 3O2DH 1I8MB 4LEBA 3OC8A 2AP2A 1PS3A 5E6ID 2AK4D 3CN1A 1QSEE 1SYVB 2XPGA 4YFEA 3IDGA 2ZYHA 3AWFA 3U4AA 3ETTA 3EH2A 3B9VA 1E3ZA 3FQ1A 3O3AA 3PP3K 1SM3L 4TQIA 5KVDH 1KIUA 5IFHL 4PJ8D 1NSNL 3TCXA 4GQPH 4UNVA 3K72A 1UVQA 2WN3A 4G8IB 1ESOA 4GRMA 4KK5D 3NCYS 4XPGH 4B41A 4DERA 4DKAA 4OJEH 4XXCC 3X11A 1LDPL 2CO6B 4N86A 1BQHB 3SDXA 3U79A 3V4PL 5JA9A 1VFUA 3H9ZA 5BRPA 4D94A 4HEPG 4RGNE 1T0OA 2VR3A 1QWNA 3VG9C 4LIQE 4N25A 3T65B 2WLLA 1G6RB 4QRUA 2XA8L 5C0AB 4DVBB 4G9FB 1MZZA 4BCXA 3N1FC 2EXYC 4NAMA 1C16A 3EYUL 3HAEG 3LV3A 4C54A 1NLBH 2WBXA 4KKCD 1BAFH 1PNDA 4MXWL 4LKCA 4R7NA 3IFNH 1T7WA 5F21B 2VDOH 3GO1L 3M88A 3L3OC 2WIIB 3QI9A 1E5YA 2JCCE 1PW3A 1S7XA 1FLRL 3BIAX 5HSFA 1E28A 5AUMA 2FX9L 4FZ8L 4CGTA 3FZUC 1MKFA 2COQA 3ABMB 2C9RA 1AO7E 1THCA 2HXAA 3QCVL 5C0CD 1NINA 4BQ9A 2UVFA 1OE2A 4L8SC 1OGTB 1XV8A 4UU9A 3ARGD 2H2PD 3B9KD 1DYZA 2IH1B 4NO2B 4H1LB 2FEJA 1XCTA 4N5ED 5D1XC 1Q0YL 2B0SH 1PYWA 2JI2A 3PL6B 2BWIA 3WAKA 1C12B 1U93B 2UY6A 1BQUA 1CFVH 2A9DA 3C60A 2GT9B 1NMCC 4XXWC 4Y89A 3L9RB 3VDBA 4LCVA 2A6IB 3QVAA 2MWCA 4UINH 2HWZL 5TE4L 3AY4C 4HULB 3LEXA 1R47A 3P9WB 3AU0A 4I3RH 5D7JB 3L2MA 2DMBA 1C1EH 3KPSB 2FDBP 1A3RH 1DBJH 4KKAD 2EXWC 1IGFL 5HGHB 2F7IA 3DURB 1VIWA 3RTQD 1KEGH 2UXTA 1KT2A 2BNQD 2PCXA 3DTUB 3KJ6L 4RGNC 1U8IB 1A6AB 3GDBA 1DLFL 3FO9A 3NCMA 3CFMA 2Y2TA 3A6CL 3Q5YA 1XCQB 4P9MH 5MI0B 5CMAA 4QKTA 3D25B 4L8DA 3PYCA 5H2BB 5F7EL 4YR6A 2NQDA 5D7LB 1QBLL 1RIHH 2FJGB 1BGXL 2DWDB 4NYLB 3SB3A 4LVHC 5EZLB 2FD6H 4N2EA 2X6CA 1G4RA 3NFSL 4Q9BA 4A2HA 4B9CA 2LLLA 4JN2B 4PRDB 5FYKU 3KPOB 4WHTA 4HUWA 5BVPH 2P5WD 2PR4L 3P3RA 3E6FA 3UAJA 2JLPA 3GMPA 3JWNE 1XL6A 3HVDA 1X6LA 1CGTA 3EZJB 3AG4B 4ZX3A 2GAZB 4DFIA 1OPGL 1Z32X 4O5LL 1QRKA 3GT6A 4FCAA 1RJLA 5JIKA 3BEWB 3IU4H 3HS8A 5IQ9B 3RIAF 1PBYA 4HUXB 1WZLA 3TNNB 2JKIS 3N91A 4YO0A 2B2XL 1NUGA 5GZOC 2VJXA 1M7UA 2WCSA 3QUYC 3IJ8A 4R3SA 4F8PA 3K4AA 1S7WB 4XC1H 2HKHL 1MVYA 4GXUM 1J9TA 1QASA 1IEBA 1G7JA 3DVFA 4DP4X 3BGMA 4WAFA 1DUYB 4CJ1A 1BW8A 3S3JA 3LRSB 1ZEAH 2E7DA 4MAYD 3WFBH 1RD6A 3JTSA 5CEXA 5E23A 1B0GB 3MODL 2BY3A 4XMVA 4JE4B 1ET8A 1NEZG 2LTQB 3V9CA 3M8OL 2KC0A 3D4GA 4K7PL 5IVXA 1O7VA 2WBJD 3W5MA 1MRFH 3KXFB 4OLWH 3DIDA 3T77A 3QXUA 1T1YA 3T6ZA 4F57H 5BUPA 2BVOA 4NRYB 4PJ9C 3KM1A 1N0LA 1PPIA 1IBFA 5L8JB 3TESA 3CXDL 3H0TB 1QFUL 2OLDA 3G6JA 5GGRY 5LO7A 3W0WA 3N1MC 2MCAA 1JDDA 1UACL 2QQKH 2AJUL 5CGTA 4CMHC 3LNHA 1A0QL 1MVUB 2DIEA 3PGDB 4OV6F 1TZGL 3P9MA 3EUUA 4FFYH 3VWJB 5JXED 4M6MH 1EMTH 5HDOA 4KI1A 4ZZFA 2LW3A 3VXNB 4L3CB 4DOHE 1CWVA 1EO8L 3OPZL 2WM0A 2DDQH 4PJCB 2QLYA 1JYNA 3NPSB 1GGBL 2CGZA 4DGIH 4G5AA 5KWYC 2PF6A 3RAJL 3CDGA 1ZHBB 3LKQB 2ZOWA 4DO6A 1AQ8A 2WANA 4NKOA 3IWVA 5EORL 1VENA 2GY5A 4DQOL 3B9DA 4MNGB 3GXFA 1W8NA 1N4XL 4ZTPL 3SQOH 3HHMA 4HH8A 3KYMB 3PNWA 2NY5C 1TITA 5CHNB 3HNTH 3L5XL 5GGSA 5IMMB 1CPUA 1JWSB 1CICC 1INDH 4GAFB 2R0WL 4WO4B 3WUWA 4PLJD 3OKDA 1OARL 1XGYH 1Z0MA 3L6FA 2HMIC 4ZMTA 2EIJB 2EEAA 2EIEA 1XGUB 5JXAH 2V2TB 4N9GB 1EEYA 3QJTB 3QNYA 2NY0C 2FEDC 5IVZB 4JFEA 5FHAL 3VXPA 2WKLA 4K3DL 4OCWH 4X8CA 1OGAE 1EANA 4XVUC 3S5YA 5I75B 2XWTB 4MNQA 3KYOB 1AGBB 4OGXL 3RNKA 2AXGA 2BVTA 5BCAA 4FZEH 5L9DH 3E7JA 2LE9A 3ARYA 3IPBA 2B16A 1MAML 1JCKA 2VSCA 4OLZL 3WNKA 3A6OA 5TK2A 4M7LH 4YDLC 5JHDA 1BQHG 3QUHA 2F7QA 4NNPH 5I2IB 3APDA 3F05A 3BRGC 4LE8A 4YZWA 4C4KT 4QR7A 3AITA 3MV7B 2L7EA 5CO1A 3B3IB 4KXZI 5CU9A 3UTPE 4PS7A 4X6CA 4XN4A 1F58L 4XGZA 1CDIA 5DGRA 2CDEA 3WN5C 4AYGA 3QG7H 3W9EB 3OAUL 2YRLA 2J1KA 3B56A 5C0GA 3SN6N 4PRNB 2ZUYA 12E8H 1UGKA 3LIZA 1U95B 3B2VH 1YEFH 1SNRA 4HGMA 4TUUA 2P8PB 4XPTH 4LCWA 4YHOH 2EE0A 3BZFA 5I19L 4EBQH 2P26A 4HWBA 5BS0A 1XH3A 4JANB 4XXDA 1Z9NA 4E41A 2CIKA 2IALB 5IQOA 3OZLA 4EOWL 3QHFH 3KYKH 3BP4A 4P99A 3CHOA 3FUEA 5IOPA 2QFPA 3UTZB 5E8DH 4X9FA 5GGRB 3T2QA 1XEDA 2R23B 4P3DA 3A67H 4H1LG 3F8UB 3FO0H 5C0EB 5HI5C 3P9LB 3CFCH 4Z7QB 5CILL 3R8BB 3EG9A 2XJLA 1DVXA 3N43F 1XH0A 3TO2A 2DL9A 5EOTB 1OP4A 1QSFD 4JFDA 4OSUL 2FO4B 4TULH 5C08A 4PJ7B 3LPWA 1BHGA 1GGTA 3V0DA 5KVFH 3O6KL 4RISL 3KPMB 4U49A 1UJTA 2EYRB 1YHPA 1CS6A 1FJ1B 2GJ6D 4U1HB 5DHVB 4KK8C 1R3LA 2Q8BL 2FIKA 1GCFA 4UQEA 1H3XA 1MNUL 3IE9A 4FLSA 5DJCA 1FSKB 3QEGH 1YMMA 3MO1B 3UJJL 3WEXA 4NOFA 4P8QA 1FVCA 4GT0A 1E4KA 2UZXA 2WV3A 1F11B 4QRPD 3CDFA 3TIDB 1HYSC 2ATAA 3JT2A 1ANUA 5DJ6A 2GTZA 3V7AE 1FGNL 2WWOA 3P0VL 3L4TA 3L9BA 2V5TA 4XTRD 3CDZB 3MBXH 4K23H 3CQQA 2F58H 3QT2A 5GSRA 3ULVH 4AH2B 1TTFA 4HS8L 2HRGA 1TSHA 2CUHA 5IHUH 1WDAA 2DM2A 1MW0A 4PGDA 3LJ3A 3N42B 1MF2H 2XV6B 5IY5B 4TQ8A 2VZ3A 4PV1C 1HAUA 2GUYA 1S9YB 5ITFB 5D2LB 4Y5XC 4NN6C 3UC0H 2AI0H 4XVSL 4N28A 3U0WL 5TDNB 5I8OL 1S5HB 2H41A 1P7QA 5GJSL 4DT2A 4A2DA 2XKNA 1TZAA 2CCWA 3KBEA 2AQTA 2ENPA 2ICWI 5EZJB 2XWJB 2WZ0A 2XACC 4ZFOL 5B8CB 3GSVA 3F7LA 2VQ1A 3F62A 2X5PA 3HMXH 4P9HC 4ZSOA 4ELKB 1G7HA 2BP3A 3QA3B 1DBBH 1SXBA 5T3ZE 1S78C 3CVHB 3B8YA 5AD0B 2JI1A 4YOKA 3AJ7A 5HI4D 3MUUA 2WQ8A 3BHBB 1DQKA 1AJ7H 2OXGA 1T04B 4B5EA 4Q9CA 4PJAB 3WIIH 1RZPA 2X1WL 1X44A 3Q3GA 4LMQI 5C0IA 5DWUL 2FSDA 1OM3L 1G6VK 1JZFA 1SDYA 3GJFA 1PLGL 3DUUA 3RVWC 1CYGA 4PV8A 3EW3B 5FF6B 1KB9K 1J48A 4X6DF 1NDMB 1HEJC 4XCFH 4LPXA 2F7OA 1XSIA 4LPYA 4NQDA 2EABA 1AHWA 1U41A 2X40A 2D3LA 3BT2L 1LO5B 1LO2L 2R4SL 2AEQH 2ZSWA 4OIBA 4PP1D 4R2GB 4Z7QF 3KYAA 5AL8A 2OMTA 3VSTA 5KN5B 3BCFA 3ZDZB 3P2DA 1NBYB 5ITBH 1K2DA 1JZJA 2HTLD 2IBZX 5BNXD 4O9HL 2E47A 2V5RA 3BX7C 5F9WB 3SO3C 2VLLA 3L4CA 2J7LA 2WXFA 4MFHA 1E9PA 2Z7WA 3J8F7 3S4SB 1N7ML 1I9RL 1T7YA 4WW2B 1TJXA 4AZUA 5FLVA 2YPVA 4LGRB 4AL8L 4ACTA 5E4AA 1SEQL 2Y1YA 4OZ4B 5A3ID 4G7RB 5E00B 5CP3H 1M2VA 4TNVK 3M17A 5C0BD 5IUSA 3VW3H 2NDFA 3ZHNA 2FK9A 4H0IA 2IWFA 4YIQB 2UWEB 4AW7A 3O11B 4E9XA 5L4IA 1I1AA 5CEYB 2HP4A 1KJ2B 5DDHB 1J8HB 2ILLA 3QISA 3V4VB 4DK5A 1B0RA 3BH9B 3D9AL 3IXTA 3H7BA 1E43A 4R5XA 3C60C 2XBZA 3GM0A 4WK0B 3FJTA 2QZQA 5DMIH 2ATKA 5IM7A 4FN0A 3EYVA 1NEUA 1INEH 3TYFB 4O00A 5MEOB 3IFPA 3WKNA 4GMTH 1U92A 1YEEL 1LMKA 1RZKL 2QPSA 4LNVA 2HKFL 4TNGA 4DHLA 2I27N 2EZ0D 1FFOA 3O41B 1IM9B 1Z9SB 4WRLA 1QQDB 2OULB 4JM2A 3E8UH 2WNXA 2B77A 5GISH 4U6VL 3RGVA 2XN2A 3G5YA 3EJYC 2R1WB 3KEDA 4EIBA 1B4JL 2V7HA 1M6OA 1MJ8H 4JRYE 4LLUB 3VFSA 3AAZA 15C8L 4XMKL 2R2EB 2W0KA 3U2SA 5IVXE 1MFCL 1Y6MR 1R24A 5C0DB 3MUJA 1UB6A 2EDOA 3LZFL 4F33A 3O0RH 5B22A 2R0LL 4OJFH 5LAPA 5DVPA 1CR9L 3FB8B 1CF8H 5C0ND 5ABAA 3W0WE 2OJZL 5EBWA 2YK1L 3NH7H 3D2UA 1PY9A 3I6GA 3U4KA 1L6ZA 4XZUA 2NTSP 1ZXKA 5F96L 2I25N 4Z7UB 4OIIL 3UAJC 4U6HA 2R2BA 4W1TA 1WBYA 2PTTB 2X2IA 2C3GA 25C8L 2CCLA 4RQQA 4KROD 5HHXH 2BS71 3H9HA 2PO6B 3GSOA 3ZDZF 3PRZA 3WLBB 1Q90A 3Q6GH 4JFPB 3O81A 5EUOF 4NQUA 1TT6A 1FNHA 4BQ6A 2BNRA 2ZZUT 4LSUH 2NY4D 5HYFA 3QYMA 4OCSL 5D7KE 4JHWH 3LZNA 2PPDA 4WEMB 2D7MA 4G7VH 4MJ6B 1KTLB 5EU5A 2J2ZA 2IPKA 4M61B 4QTHB 2ZICA 4HIEB 1RZ7H 4FQCL 2OP4H 1M7XA 2Y5QA 2ZKWA 4LLAA 3I6KB 4B27A 1TMCB 4AQEA 1Y07A 1YEDB 1TIUA 2FLRT 2W07A 2F1BA 3OAZH 3VH8A 3QRGH 4LEOA 1TQCC 1C5BL 3IJHA 3MRQB 1EPFA 3PGCA 4HPOH 4NJ9H 5DHYB 4L0YA 1BBDH 4YLBA 3GHPA 4ZTEA 4FQXC 1QR1B 2I9TA 4J3XA 3RIFK 1YG9A 4KZ0A 1S7RA 2K1MA 1JNNH 1KNOA 1X4YA 2BC4A 2F54D 4GMSH 3LYRA 4JFEE 1Z2KA 5CUSH 1W6LA 3IMWA 4YK4C 1FL6B 3NJMA 1V10A 3SIKA 1W72B 2RQ8A 1Q9OA 4MNQE 3WNMA 3ULUH 3H2WA 4L4VD 2K7PA 4Y2NA 3DLQR 1ZHLB 3U9WA 3DA0A 1KGWA 1S3KH 1WJ3A 3QJQB 2PPFA 4UIMA 4QHNB 3REVB 5I1LB 1U8QB 1XWVA 1OALA 4KKLD 2XG4A 2O5YH 3QEQA 1HIMH 1NCCL 3TTYA 3VM7A 2XDHA 5D1QB 4A7GA 3AB0C 4FNPA 1YEIL 3BC9A 3QUZB 4W9GC 4CVXB 3IRCA 1AR1C 3ZKMD 4Q56A 1G6RL 5F9JA 5GS0D 2Y5TA 3CQFA 3GIZL 4MA3B 2E3VA 5EU4A 3U4BL 1NC2A 1ORSA 4X6CE 1BVNT 1IGTA 2DWSA 4YDJB 4QHPA 4MD0B 3MDJA 5D7HA 2CIIB 1HSAA 1J05B 2H2SC 4AGNA 4PPTA 4KQ4L 3ASOB 3CAFA 1A66A 1XR8B 2MPVA 5E6IA 3TJPA 3PQYD 4FP8L 2WAQA 2Q8AL 4LCWE 5TE6L 2F18A 3SDDA 4P46D 3OGCB 2DKUA 3AM8A 5I8KL 3KLLA 4KRLB 1E9QB 1BFSA 3V6OA 5BS0E 1VZIA 5J6GA 4GG6A 1BJ1H 4E41E 3SQBB 2NY6B 4PRPD 2WOYA 3FT3A 4XBEH 3I2CL 3GRBA 3O6FC 5EOCJ 4AVKA 2DQUL 3U9PL 4JLRB 4LAJH 3NN8B 1JZ4A 1HHKB 3D85A 2EH7H 3ZRSA 3MOBL 1KIRA 2ZXAA 3KR3H 2VERN 4UTAA 5DEFA 4AOFA 2ZOUA 1W91A 4K7FA 4X6EB 4IDJH 3MC0A 2WJ7A 4PP2B 1EK3A 1UZ6E 3HS0A 4X5QA 1XBDA 2BIMA 2Y7LA 5TQ2L 1A6WH 3B7RL 4JFDE 1NICA 1XB3A 4OFQA 5C08E 3UZQA 4DVRH 5E99H 2A77H 2ZF9A 1AS7A 2HTKD 4X4XB 1UD6A 4DGVH 1JNHA 4DESA 1U8PB 1DCLA 3BZ5A 1L7TL 3PHSA 3O6MH 4AZ8A 3DTXB 3DDFA 3WHE0 1OAKH 3N1GC 4HEMA 2WBWB 4JO2L 1ZSHA 4MA1C 3H56A 2V8MA 3HG1E 1YMME 5JHBA 5J9PB 3EDFA 3MNWB 2JMRA 3Q1EA 4DCQB 2APWA 1L3WA 3HI1B 5FM5O 5JPNA 4A04A 1N64H 2PYED 2H4EA 3BLPX 3GUTA 3VFWA 3GBMH 2AXFA 3EBAA 1A6ZA 2NRDA 4LF3B 5FFOA 3ARFA 4LVNC 3US0A 1MHEA 3HUJA 4H25A 5I28A 1FL3B 5JR1H 2BSCA 1G1YA 2OMZB 1QKZH 2CHNA 4OQTL 3U6RB 2MQGA 5H35B 2W9DL 1L0QA 2FECL 3TO4D 4JFHE 4IIQA 1JGEB 5E5MA 3PAYA 2BSTB 3C5ZB 4QT5A 3S4SG 4QWWD 1FPTH 1MIEH 3WO3B 3KHOA 4P4KA 4HGWB 4JY4B 4CU6A 1CD8A 4QRQB 3QZWA 4H8WL 1KCRL 2X3BA 2WXOA 3NRPA 1T4WA 5DO2D 4WV1A 4FS0A 1X9QA 2F9BT 3MVSA 1JZDC 4P57A 1HKFA 4G9DA 4ZSOE 1BVKB 4ATWA 4G5ZH 5FFLA 3MLYL 5IWLA 3FQWA 5D71H 3PHOA 3DX7A 3MCLL 2EH8H 3MRGB 1MSPA 1A7RH 2BOCA 2VDPH 4DUWA 3PJLA 5DR5L 1PX3A 4ZQKB 5EN2B 3WJMA 3VFGL 4M5YH 4JJHA 4JQIA 4NJAL 2ORBH 1BSIA 3BFQG 3IXAA 3HZYB 1HEZA 1AY1L 1HK6A 5JNYB 3D34A 4PYHA 2AANA 1WICA 1RJYB 2UX6A 3DVGA 3F5WB 4S1DD 3WTVA 4MGXA 2J1YA 2CDFA 5F9DC 4NQDE 4XNYH 4X8JB 4OZFH 4U7KA 4EF3A 1QNZH 4M3KB 4ANXA 1LE9B 1OAZL 4ZUVA 1RV6X 1U3HD 3T2NL 1NLDH 3FSWA 3L5WA 5C0JA 5EU3A 4GYBA 2DJUA 3TA3A 3WXVH 3UP6A 3ZTNL 4OCRH 4PJBE 3QFJD 5LBGA 3HG2A 3ZT7A 5FYKH 4MMXC 2DV6A 5HY9A 5DC2A 1ADQA 1LXMA 4APXA 4DP5X 5JOFB 3NIDE 1N2RA 1HC1A 2WXPA 2I9LA 4AUYA 4JFFD 2YO3A 4YSQA 1M71A 1R0AL 6PCYA 4NXKA 2O6FA 4M62H 3QJHA 4OFKA 4MAUL 1A7QL 2XVKA 1F4YL 4LOUC 4XCEA 1KMGA 3MV8A 3ARUA 3ML9A 1OK0A 4H40A 3MLUL 4LHJB 3BIKA 1G9NL 3CSFA 2YBRA 4F8QA 1KGCE 2WXNA 3BSHA 4PRID 2Y6SD 3KWUA 1S7QA 1LTXA 4MQSB 2WLZA 1RZ8B 4TRPL 4FTVD 3CLWA 1TTBA 4I9WD 1RZJL 4JFYB 1JV2A 1KCSL 3AC0A 4MMZC 5CJOL 1H3PL 4IOFD 3LAFA 4RNRB 2WBJA 4UILH 2X6VA 4QEGA 3BP5A 3GXNA 1Y6KR 3T2OA 2FZ3B 1C5DA