4F8NA

X-ray structure of psaa from yersinia pestis, in complex with galactose and phosphate choline
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
137
structure length
137
Chain Sequence
b'NTFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pH 6 antigen
molecule tags Cell adhesion
source organism Yersinia pestis
publication title Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis.
pubmed doi rcsb
total genus 18
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f8nA00
4F8PA 4F8LA 5LO7A 4F8OA 5LN8A 5LNDA 5LN4A 4F8NA
chains in the Genus database with same CATH superfamily
3CVHH 1NCOA 1D5BB 2XG5A 1F3RB 2DQGL 4HLZH 1AG6A 3TT1L 3U0TA 1JPFA 4PYHA 4YBLB 5E6YA 1MJUH 4P57A 2CUIA 5DFVC 3US0A 1ZIBA 2B0SL 1QSZA 1TMCB 3G08B 2FLRT 3QP3A 4DKEL 2W65B 4YC2B 5DK3A 2P3YA 1A3LH 4NUQA 1OP9A 4NO0D 1FAIH 4OSUL 1D6EA 5KBMA 3CN3A 3VXMB 4ECNA 5AKTA 3OB8A 1BQHB 4AQAA 4QHMA 4N8VB 2P5EE 4EIGB 3RWHA 1BFSA 2CLVB 3OZ9L 4ZMXA 2FWOB 2XKUA 2GFBA 1BGXH 1K4DB 2HTKD 2BOBA 1T3FA 4LCWD 1I8KB 4BINA 3WXVL 2YQ2A 3MUY1 2GABA 3VI3F 2CKNA 3TA4D 4LKXA 4BFGA 4KQ3L 3WIHH 3SYQA 3QCTH 1OSZB 4ZYKB 5DO2C 3RVVC 5JHLH 4HPYL 1THCA 1XH0A 4NS0A 1P0SE 5LBGA 1NAKL 4FI6A 5CZXD 3RHWK 7CGTA 5IVXA 3WLWD 5EA0H 1GGCL 4L8SB 5AZ2L 5ICUA 2EC8A 5I18H 1CLYH 4OY9A 3AG4B 3HFML 3MKKA 3PL6C 1Q0XH 2JQMA 3QG6B 1PIFA 2PF6A 1QFOA 2GCYB 4PJ7F 4PREB 5A2BA 4PLOB 4ODHH 3QNYA 1FO0A 4ZFZA 2ESVA 1XCXA 3FO2A 5I8EA 1WP6A 2W9EH 3V6ZA 3GMPA 5BO0D 1D6VH 4KO5A 4PREA 1HXMB 3HZVA 4ZPTA 3FCTA 1QSVA 4NAMA 1W80A 2QV4A 2VLJD 5H94A 2NY7H 5FUZL 4PP2B 5C3TA 5BUPA 1CFQB 4OJDH 5E0FA 2E9JA 2J6EH 2WVVA 5J6GA 1EAPA 1A4JB 2WLJA 4P5KA 3FT9A 1H6EA 1J1XH 2R1YB 3PNWA 2CWRA 1A4CA 5BO1H 3NJJA 1SVBA 3P02A 4BUQA 3T0XA 2FYVA 3ZE1E 4OZFB 3V9CA 3A67H 2I9TB 1A1NA 3QZPA 4R5VA 1KNOA 3SGJC 4OGAC 4EQ3A 5CGTA 1ZAGA 2J88L 4LLVA 4CC4A 3QWRD 1BM3H 1R3LB 2GQHA 2VO5A 4X4XA 4JY4A 4EUPB 3SE6A 1GY2A 1IAMA 2DEWX 3MROA 3DROA 1QTPA 2CDGB 4OFKA 1NMAL 3FSWA 4J12A 2F19L 2DICA 4NC2B 3VG9B 5DHYA 1AHWA 3T77B 2OMYB 2VUYA 3BX7C 3C60A 4RRPM 5K93A 2AS5M 2XIBA 1Q0YH 8CGTA 4LAQL 4Q4IA 3RI5F 1RULH 3NAAL 4DP5X 4TNWF 2YUXA 3MLXL 5D7SH 4GEJA 5F1NA 1J1OH 3BN9C 4TSBL 3MUUA 4WSKA 1UJ3C 3OB0H 4A7VA 1ZSDB 4ELKA 1Q94B 1EDQA 4U6XB 4TUJA 4XPTH 3MDJA 4EN2A 4PGCA 5T5FH 4OGQC 4CC4C 3WTTA 1S6NA 1UFGA 4WNQB 2QADC 4OFIA 3N43B 3X1NA 4HJSA 2APSA 1V8HA 1T0MA 5BRZA 3IGLA 2VZVA 2ERJC 3LIZL 4GP8B 3D0AA 3HTLX 3M88A 3ZSSA 4I85A 3D85A 1ONQA 5EU5A 4EZLA 2A4EA 2OW6A 3U2SA 2R9HD 4MASA 3TBWA 1BD2B 3NJVA 1E4KC 2VDNH 2WINB 2VGLM 1P4BL 3T1FB 5CM1A 3GFUA 3DPBA 1XGTA 5C08D 1G1OA 5DHMC 1KFAL 3PWLA 1RZ7L 2ZUYA 3VWJC 5DD3H 2HT2C 4JFWA 5KSBE 2P5PA 4KOCA 4A63A 1TVBA 3WTUA 1A6PA 3BMWA 3GTNA 4FA6A 4JFFE 4KMQA 1HVXA 3D9AL 5DRZA 4HJGB 2VZ3A 4LMQI 4M9OA 3VFSB 3HI5H 1ADQA 1QTSA 3MQIA 3WNIA 3TH4T 2ORBL 4JZOA 3ARBA 1WISA 3BWUC 4P5TB 5F44A 1DVSA 1MG3C 4HUXA 1BAWA 1UFUA 2VXUH 4UAOB 1OB1A 2HWZH 4Y1AA 5JHDB 3QUXC 1VGKA 3QQDB 3S5YA 5EO0B 1PYWA 3AB0B 2VZUA 3Q1EA 3EXJA 2W88A 3K2UH 3JXAA 3UCQA 5A2FA 1U58A 4HD5A 5ID1B 4DPCX 4CADA 4LVOC 5IROA 1KY7A 5F89B 1U8PB 4MQSB 5DJZA 5KVEE 3NPSC 3T3PE 3ULUD 1G4RA 5EF0A 4PVBA 3GMMB 1QSEA 3JVGC 3VMNA 4Z1PA 1WITA 1F1GA 1RUKH 1IL1A 3JWOH 2FHBA 4ZFOA 3PHQA 4M7LH 5CD5C 3V4VA 1L9PA 3SDAA 3BAXA 3BGAA 1I7UA 3FT3B 1EIBA 1E9PB 2J55A 4OIIH 1XD0A 3SGKA 5H94B 3AG2B 5D9SA 1PX4A 3WIFA 5KTEH 2JJSA 1ZEAL 5F7KC 3CDGA 4YDKH 3T1FA 2QQLH 2A9DA 2FX7H 3U30C 3QC6X 1G0XA 1F6AA 2A38A 2RQEA 1CK0H 3QYCA 1UZ8B 1KJ2B 2DLIA 3L3KB 2F53D 1FL6A 4U1KB 1I9IH 4G3YL 4HPOL 3RL1A 4KK5C 5IMMB 1YQVL 5B1JA 2L3BA 2R7EA 3FQRB 4ODBD 1M2VA 2BIMA 2LW3A 4M43L 3ASNB 3FB8A 4XMPH 1GGTA 1AQ8A 3ARTA 4PJ8C 4Q14A 3ARZA 2CIKB 3LS4L 3VB9A 3ARDD 4HBCL 4ZUSA 4UMSA 4AGPA 4LGRB 4AV0A 1T80A 2OK0H 5ABDE 3NESA 4GIOA 1WAAF 5DWUL 2JJWA 5I8KH 1U8PA 1T5XA 1ZTXH 1H5BA 4S11A 5AUMA 5B21A 4O9HH 1T4WA 2IAMD 3EYUH 3M7FB 1L9NA 5EZIL 1BIIB 3MRNB 5EO0A 3II3A 3BESR 2H26A 4I0PD 2ED9A 4MA1B 2H2SD 4AL8L 2OYLA 4DVBA 2BSDA 4H8UA 2QADB 3WJMB 3LN5A 1KIPB 5B39B 2KS0A 3Q8FA 1VEPA 1XEDA 3K8MA 4MNQA 3S3BB 4DH2A 2DQEL 1CG9A 3DX4A 2IFFL 4XNXL 3FQWB 3BW9A 4EEEA 1O5PA 1FNEA 1FVCA 1HE8A 2HUEA 4JM4L 4ALAC 1JWUB 1RZJC 2GIYA 1A4KB 3KDPB 3EYOB 3KL0A 5KS9A 4KV5E 5IK3A 4MWFB 1DZBA 4PP2A 2WQAA 1GGUA 2VITA 3AY4C 4GIAA 1HH9B 2DEYX 5E6IB 4GSDL 5I1CL 4A2FA 4B41A 1DQTA 5HHNB 1UD2A 3BKJH 1I1AC 32C2A 1CE1L 2I85A 4JY6A 1SLUA 3WKQA 1U8KB 1NMBL 3T2LA 1NMAH 4MYWB 3RIFK 4MZ2A 1JZJA 5CWSB 3RDTA 5CR1A 2YN5A 3AM8C 3CZNA 3F04A 2VMCA 1CR9H 1OW0A 3E8VA 3G6JE 1Q0YL 5HHOE 5IJVB 5I74C 4GJTB 3CFTA 1A1MB 5D1ZC 3ARQA 1DL7H 1PQZA 5DURB 1PLGL 1EO8H 4NQVB 4F5CA 5C0CB 1H6UA 2MSPA 1T5XB 3DMMD 3GKZA 1XBDA 4LVOB 4UV4H 4K55A 4DVRH 1Q0XL 3CSYB 4YSUA 2NXYB 4RMRA 5DI8A 1JG9A 1MCFA 3ZZLA 1CF8L 15C8H 3LX9A 5TJWK 4MQ7A 3SCMD 3ZTEA 3NSCA 4E9YA 1W8EA 2Q9OA 4QIRA 4N90D 3O4LE 3W11D 1EHAA 3L9RB 4ZPVB 4Y7OC 4UB0L 1EFXD 1OCCB 2LOEA 2A6KA 5E03A 4AH2B 2W0FA 3D0LB 4W93A 1WFNA 4PJIA 4M4RA 3DKHA 4LHQB 4DPAX 2VLJB 3IDJB 1WA1X 2Y5TB 4OAWB 5F9WC 1VENA 2A0LD 2Y7OA 3AGVA 1LGVA 4J6RL 1AH1A 5IB3B 5DJAB 4NSKA 3KYKH 4K5PA 3ULVC 4XPHH 2A2QT 1SYVB 2NY6D 3Q5YA 1XD1A 2YMXL 4YZFF 5BJTB 3RWDB 1USQA 3PNWB 2AJSL 2ZUWA 3BPCA 1A0QH 4A67A 4OUUB 4QTIH 4YDVA 5HP5A 1QWHA 2DM2A 3SE3C 3AS0A 4JKPL 4QGYA 4P3DA 3MRPA 6FABL 3N41B 1GRWA 2O5XL 2P5WD 1A4AA 5IW6A 3NIGE 1WFUA 3IYLW 5E1IA 5H35A 4NO2B 5E6RB 1G7PA 2NY0B 3EFFA 5SWZD 3U9PH 1EZUA 3D39E 2F8IA 5DD5H 1R3HA 1B6UA 2VXQL 4WDIB 5B38A 3N3EA 4PIRF 4Z7WE 4K71C 5DS2A 3S37X 3V0GA 1AKJB 2AEPH 5GHWH 1YJDC 5KSVB 1GJWA 4H0IA 2JJVA 5E9NA 4HX1B 1OTTC 3MTXA 4O4YL 3LHPL 2FUTA 3IDYC 3CHOA 4D7BA 3FT4B 2FWLB 2CGZA 3V4PB 1A64A 1U0QA 4PBWD 5FM5O 2W07B 4IYKA 3N0PB 2ZP8A 5I5MA 4K3DL 3QH3B 1FC2D 1BQLL 2RFXA 1RULL 3A0OA 5CIPH 1QYGH 5DU7A 3OXSA 4JFDE 4CL7A 3U7YH 3KGRA 4E41A 4R90H 3NEOA 5DK2B 3HRZB 3EGXA 4X42A 3FU7A 4PRBB 2O6FA 4FA7B 1ZVSA 1JFHA 4JJ5A 2I07B 5HGAA 4GFXA 4H8PA 2MQ3A 4DN4H 2DYPB 4JDZA 2AFNA 1MW3A 3PJSA 3CHXA 1DSFH 2VDOL 4WY7H 2JKTM 5EUOA 2Y7LA 1WGOA 4WWNA 1JD7A 3QZWB 4OKVB 1KOAA 3OB0K 3SE8H 4PBDA 2X4NB 4PS4L 1Q9WA 1YN6A 3TYFB 2J8UE 4QHKJ 4C4UA 4LKCB 5AOKA 1B0RB 4F8OA 1EEYA 5IHZB 1OGAB 3VFGL 3T4YB 1D7CA 2W95A 1IC4H 2XZZA 4JRYB 3N9GL 3P0VL 1MJ8L 1SDAB 3UEZA 1X5MA 1WFTA 2Y06H 5T3XE 5I0XA 3VXNB 2YSTA 1JGUH 2PW2A 1KJVA 3CAFA 3FBKA 3FQXB 3QR2A 2UUDH 3VFOB 4EKXA 5HPMA 5JOPE 2UXGA 4IHOB 4ELME 3KAAA 4P06A 5DQ9B 2VR4A 2WPGA 3B43A 3OMZA 5IBUG 3W37A 1IZKA 1I75A 3KXFE 4BZ2H 2BERA 1F90H 2P4AB 1INDL 3QI9D 3RUGB 4HZ1A 1CLCA 4ZT1A 3VH8B 2F8VA 1MFAL 2HLAA 2J8OA 3QORA 4PG2C 3T3PF 5B8CC 4XP4H 1UWXH 3BC9A 2X3AA 4K2UL 5ADOH 3BH9A 4JKLA 5DK0A 3C2SA 2VDRH 1IGIH 4D9RD 4KDWA 5FK9A 5EMYA 1LHZA 4APQD 4CKQA 3MV8A 4LHUG 1E4XI 3E7JA 4H8WC 3FTZA 5DHVA 2W0PA 3SPGA 3GLEA 4F58L 4ZX6A 4F7PB 2B7DT 2VXTH 3RDTC 4RGNE 4JPQA 2HLFC 2WKOF 1S8DB 5C09A 3LXBA 1X5JA 4QJ5B 2MWCA 1B3JA 3CGTA 3Q9PA 3CZUB 4TQIA 3DIFB 4KVNL 4RQQB 3T4AC 3NQKA 4FFWD 1IQWH 4TULL 4P2YA 1SXAA 4PJFA 3VD0A 2NQ3A 4QOKD 3PIQA 4GKZA 5A16B 1TU2A 2K70A 2XJLA 4AWJC 4ANWA 5I1GH 1BVKB 3EH5B 1SY6H 5TE4L 1ROCA 4JUTA 3QZWG 3MLRL 4KO7A 4LVNB 4RMBA 4AQ1B 2YAOA 5GS0D 4FG0A 4GXUN 3U7WL 4ICXA 2ADFH 2LGNA 2ZXAA 1N67A 5FGBA 3F12A 4EIBA 4QYOB 4FXKC 5FWQA 3WNLA 1NFDF 2EEAA 1FNHA 4QAWA 5KVMC 3TCLA 1OHQA 4QHMB 5JZ7D 1F4YH 2X4OA 4NOBA 3NPZB 1ZT4A 3P4OB 3O45B 5GGTL 3GRWL 4M6ML 4JN2A 3FUDA 3ARDA 3PDOB 5DZVA 1AI1H 1F86A 1X7QA 2GY7B 3UZVB 5JMRA 3UTPD 4PWHA 3ZT5A 3QEGH 2FBJH 1ITCA 1WJ3A 5JHLL 3VA6A 5L6YL 4UOJA 3S35H 2FJHB 2CDGA 1CLYL 4PRHE 5FGSA 4BEIA 3UAEA 4F2MB 2GYSA 5A40E 2EDJA 5EZIH 4YSRA 1SN2A 3UZQA 1CI3M 3WFEH 3VFRA 4K23L 2NDFA 3OKLA 2YPVH 3UTPE 4G8FA 3WOVA 2PCFB 4JG9A 1XEUA 3ISWA 2GC7C 2Y5TA 4N86A 4OAWA 5AOIA 3Q2LA 1YUHB 2CKBB 2YOCA 5EZJB 3KBHE 4M00A 4PV9A 4YN3A 1UWEL 3OGOE 4AZ8A 2FR4B 1PIGA 3NJXA 1XTLA 5I76B 4NN7B 1FG9C 1SLWA 1YJDH 3WFHB 1W2KT 5K1NA 4WW1B 4OZIA 3DUSB 4JHBA 3VFWB 1M6OA 1PKQA 2FQDA 2Q3ZA 4H26B 4ORZC 5FOJA 1R17A 4UDTB 2VW6A 1S9WB 4G9FE 1BG1A 4MD5A 1IAIM 4YHPA 1KIUA 4QI3A 2JKJA 4BQ8A 1HCFX 3KM1A 1RUPH 1XFPA 1ZSHA 3TVMA 5JW4R 1N0LA 3LTVA 1DQJA 1ZHBB 2ATPA 5F96H 3CFMA 2G3XA 1AZBA 1K8IB 5J6HB 4Y9GA 1JHLH 1XXDC 4X6CA 2Q8AH 1F1DA 2YD8A 1AXSB 1UC6A 3GXDA 3SE4A 1A8ZA 4WI7A 4M8RA 4MB5A 2NY3C 2WXOA 1MCQA 4PWGA 3SCMB 1B4LA 3MLXH 1F6LL 3QO1B 3VG9C 2BFGA 2W94A 3BIBX 3KPPA 4JDEA 4CVZA 3VFVA 3DC0A 4AM0A 2NLJA 2E74C 3FUIA 3RWEB 3CD4A 5EZOH 3C2AL 5HGHB 2A74C 2J4WL 2B14A 2DS4A 2WBWB 3BSZA 1BJ8A 4HISA 2AEIT 3RWCB 1NAMA 3CVCA 3KHOA 1NWPA 1U2HA 2YQGA 3P40A 4IW4C 4J8RB 5E4OA 3SPHA 1LO3L 4F33A 1BJ1H 5IESL 3BPCB 1R24B 1RMFL 3FAXA 2HAZA 1URIA 3PJNA 1IJ9A 5BJTA 3QHFL 1FL5B 1DBKH 2HTLC 2X4SB 2XJKA 4JO2L 5D8JH 1NCAL 2XTJD 3AAZB 4IMKC 3RTQA 3STLA 3WS6A 1UD4A 2IDUA 2AC0A 3KPLB 3KL3A 4N87A 4WW2C 1ZLVH 1U4EA 3ZKND 5EBLA 4X0NA 1BV8A 1RD6A 5A3IC 5AB1A 3RFRA 1T0OA 3EYVA 4KKAD 4X7TA 1ZRUA 1SHXA 1A6TB 1DBJH 3MYJA 3UDWC 2LHAA 5D7JB 1AD0B 2E46A 4JNXA 4HIHA 4IHOA 4L5FH 4LL4A 3SOBL 2CUHA 4U05A 5E70A 4PWEA 4M61A 3NCWA 4MAZA 1KG0B 4L8DB 4AGNA 2BM3A 4P2AA 2XKNA 1YZZA 3S4SB 1YEKH 3NIGF 4JRYA 4PP1C 4EXPX 3UPAA 1MCSA 1J9CT 2MQGA 1EEYB 2L04A 1JZGA 4Z3GA 5DA0B 3PV7A 1H9VA 3ZTCC 5C6TL 4NUMA 4PCKA 3O3BB 4QHUB 1KACB 2XZAH 3P11H 4MQTB 3SDAB 3NUKA 4JS7A 3TC9A 1KGCD 3AU0A 5A2AA 1ITBB 1EJOH 1I4FB 5B3JF 3VWKA 4DKFH 1NIEA 2G2RA 7FABH 1IGYA 2CRZA 1MIEL 3NP4A 2O93L 3UJIH 3CXHJ 4DP7X 1XWVA 1F6AB 3L1OL 1OQOA 5FB8B 2EINB 4Q7DA 1K8DB 3T2NH 1NC4D 3CN0A 3MGTA 1ID2A 4WTQA 4AK2A 5TK2A 5CR8A 3S0PA 3S36L 3NN8B 1KMGA 4ABVA 1MAMH 1T66C 5EOQL 1HYSC 4CDHA 3N91A 1TFPA 2XV6B 4NQTA 4DCQB 1CGXA 2VDQL 1TYEB 3EJZC 3KPSE 3QZLA 3N1FC 2OSLB 3VMOA 1NGYA 3CMOL 4K9EC 4LRIC 3LZOA 3QG7L 5FDYA 2OA9A 5DC4B 2YIHA 1Z32X 2P8PB 2VDNB 2DQTL 1NL0H 3Q5TA 3GBDA 5CEZL 3HMXH 1N19A 2HFGH 4DKEH 2Y5QA 2GJ6D 1FPTL 2CKBH 5FIEA 4YFEA 1FFRA 5C0GA 5EU3B 4XXWC 5EZPA 2Y2TA 4PJ5B 4U1GC 4N0YH 1UHVA 4N8CL 1UENA 1E7VA 4HDIA 3NABH 4KFZC 5ILTL 3U6XA 5EORL 1AR1D 5IQ7L 4HXBH 2VLJE 1BJMA 2R59A 1IGMH 4PS4H 2ZOTA 2NY3B 4XPAH 1T2QL 1KV7A 1TPXB 3BWSA 3GS0A 3ZR6A 2BSTB 2ZAHA 1LP9B 1H0DA 4YDIL 5F3BB 1I85C 2XWXA 2BHFA 3KVDD 1WBXA 1DVYA 2M8XA 4S1DD 3CVBA 2QSTA 3GK8H 5AVQB 3BPNB 2QSQA 1ZTMA 4LQ1A 4UQ2B 3BWAA 3LQAH 1TEYA 2BXZA 4DGUA 4J1UB 1XZ0A 3VTTA 3CMGA 2OSYA 3WHE0 1N70A 3ZBMA 3F2LA 1C08A 2OXGB 1F90L 3RUGF 1EVUA 5KBKA 1ET5A 2B1OA 3CFDA 3QDAA 2COQA 3RJDA 3MJ8A 1X5ZA 2IPTL 1SY6L 3U48A 5IQLA 4PV9B 4PI0A 2NMSA 1PD0A 5HDWA 3ZHNA 4EUPA 2QLYA 4ELKB 2BH0A 1E9PA 4NIYE 3HAEA 2X4PB 1WG3A 3LDBC 4OSUH 1HKFA 5IHUL 2R51A 4J8QA 5AWNL 1ZXKA 1JZ8A 4APXB 4ZQTA 4F58H 3QPKA 3JBG7 1YYML 2KKQA 1HHKA 2NX5D 3DV6B 3H7BB 4BFKA 4QKTA 2PYFB 1OCZB 5I17B 2UZXA 4ONOA 2Z0BA 1AVAA 1EFQA 3T0EA 5I15H 1G5AA 4KZDL 3ARFB 2A6DB 1KJMB 1T1YA 4GAYB 3QO0A 4B9YA 1SJHB 5KVFH 1XGQA 4X6DE 5MEQA 1T1WA 5IF0B 3LN9A 4OLWL 3TCLB 3KVPA 5I18L 2SEBA 4M7ZB 4XPGL 5BV7H 3UZEA 3WO4B 5ISZD 2AK4A 4AT6A 4P5TA 4B6ZA 3IXTA 2FO8A 15C8L 4HX1A 1WUZA 4PM1A 4CBZA 2FHFA 2XY1A 3DVGB 2WHVA 2WQWA 3U0WL 3DGCR 3F6IA 2ARJB 4X4ME 1VSCA 1OP5H 3ZU8A 5I1LB 5IMOB 1NEZB 3KGSA 3OKOB 4JO1H 3VACA 2IWFA 3FS9A 4IK7A 3Q01A 1RSYA 1KCUL 2H47C 2XACC 3N06B 4JO2H 5D8JL 5FO9A 5E9DB 4KKQA 4M1CC 3QUYB 3QCVH 2MCG1 2IANA 1SFDA 3LRSA 3DJSA 5HGHA 2X0VA 4OQTH 2L7UA 1N4XL 4GAJL 1II4E 5KVFE 5F2FA 3UL4A 3ATEA 2KLRA 1F58H 4R0LB 3TJHC 2IANB 1C5DB 4S1SH 3ZKSD 2C1OA 3EUUA 4YUEL 4MD0B 1UOKA 4PRPE 1E8ZA 1E6OL 2D7NA 2H8PA 2UY7A 1FIEA 1FH5L 1PZCA 1QRNB 4O02B 4K8RC 3U4BH 4CMMB 3CFCH 3EYSH 5C0RL 3BH8A 2P1YA 2HT2D 3PDDA 4TL5A 3O0RL 1VHPA 1X4XA 5DFAA 2YD9A 5HGDA 5ISZA 4BZ1H 1TSHA 5D7JD 2ZYRA 2XPZA 1I8UA 4AJ0A 1QVOA 2YHGA 3NSJA 3QQ9D 5BV7C 1SEQL 4WEBL 3QB7C 5MEQB 5FW6A 1TZIA 4R7NA 4WCYL 4BSWA 4LNRA 5JA9A 5AL8A 3V6FA 3ALXA 4I1NB 3L3HB 1BX2A 1KLFA 4NPYB 1FL3B 4QHKI 4GRMA 5D6CB 3KPRE 4J23A 1RZFH 5D72H 4Z78A 3EXLA 4Y5YA 1XH1A 4XCCL 3G08A 2NZIA 4KO6A 3H42L 4C58B 4JQIA 3UPRA 3OR6A 1JCKA 1L7IL 1NLBH 3GC3A 2JB6B 2YGOA 4XVUD 4P4KA 4UM9D 5DCCA 5DI8B 5AOJA 3IGKA 4WI3A 3QAZB 3WTWA 35C8L 1JHLL 4MCYB 4U1JB 2OM5A 4UQIM 2D0GA 4W1TA 4ORGB 2WV3A 2A9NL 4LHUD 4XI5C 3UGEA 3OC8A 2G3NA 1FWXA 4M1GL 3NCJL 1P5UA 3RE0A 1R3JB 4RGNC 3MBEA 3QVAA 5DEGA 1E42A 2FZ3A 5AW3B 3RURA 2J1ZA 4NN7C 3QZWA 4OKVA 4Y5XB 3QA3B 1DFXA 3Q8EA 1MLBB 5ICZB 4XC3H 5FFOA 3K8LA 2BRRH 3MACL 3DXAB 3RTQD 1QQDA 2X1OA 1FQ9C 1YQVH 3ZL1A 3TJEL 3O8XB 5D2NC 1MAKA 3WJLA 4XBPA 3TEXA 3MFGB 1NCUA 4DW2H 3EFOB 4H0LC 4OGZA 2IALB 4R3SA 3VSTA 4I89A 4LLWB 1MWAL 4Q4EA 2XLLA 3F8UB 3K71A 1JV5B 3GZOA 4JG0H 5IK3B 5B38G 4FXKA 4M02A 3T4AA 1OKEA 3FTSA 2BWQA 1A4KA 1P69B 2HRGA 1PY9A 2JTDA 2Y6TE 3KEDA 3OJVC 4JX0A 4YVUA 5CJXA 2Y1YA 4MXWH 4UILL 3O4LA 3VYNA 3MC0A 5KYXB 5IUCA 4AXWA 5FFGA 2Q76A 4ZFQA 3U1SL 1VFUA 3WIIL 1GGBL 2Z1KA 3RWHB 4Z7AA 5CKAA 1PNCA 3EJJX 3GIZH 5H4YA 4XPBL 3U6RA 2ZG3A 1DQML 3D2UA 3MNVA 3ZO9A 3CLEH 4F8PA 4N90E 2ZP0T 1CLOH 1RURL 3FT0A 3SE3A 4LEEA 3I02B 4Z7OB 1AY1H 1H8OA 1LO5A 3SZKC 1QLEH 4PW3A 5GRJH 5GRWA 3LB6C 5TDOB 1AO7A 3SDCA 4W4NA 1ORQA 1K2DB 1CGSL 1QHOA 3NIFE 3GMRB 1E9OB 5ACLA 4MSWA 4QHNA 2EKSB 4JY5L 1MLCB 5LAPA 4TUKH 5CAYB 2ESVE 1E4KA 1RZKH 4YBQC 1UACH 3PDGA 5EIIG 2OSLA 2MJWA 5AAWA 1S7WB 5CFHA 4OF3A 5F6HI 3TWCL 2V5RA 1NFAA 2VZOA 3IJEA 3IAPA 1KBWA 1MY7A 3JVFC 3TO4D 1PX8A 4LIQH 4U0QB 3EYQD 4X4YA 2NPLX 5FGCE 1SQMA 1VFAB 2DW5A 1SF5A 3IU4L 2NCMA 4ODHL 3O41B 3NTCH 5EC2B 1JERA 4M7LL 4NC1E 4PH8A 2BVPB 5EUOB 1YLBB 5KYWA 4LLUB 3EADA 4XMTA 2Y7SA 1PD1A 4P2QD 4QNPE 5GGTA 5CN3A 5CUSH 2E56A 5L4JA 4G11A 1MF2L 5FKAB 1JZ6A 3VRIA 4BM7A 3PP4L 1HQ4A 1CICD 2WXJA 1PEZA 4FFVC 4A2MA 2G5BA 2OKMA 1VJSA 3MCG1 4ALAH 4PJAA 5JORB 3MNDA 3RFZC 4OIBA 2BO0A 2FAUA 2BZDA 3OKDA 1P84J 3PGCB 4RA3A 3PQYD 2XWJA 1NGXA 2HX8A 2ZD0A 3U79A 1AIZA 3OPUA 4G6MH 3V5HB 4PRIE 2WZ0A 3P1VA 1ZVNA 1LYQA 4KRLB 1MFDL 3JVGA 4N9GA 4UT9H 3D87B 3O2DL 1M71B 1E8WA 4OB5L 2UZPA 4R8WH 3D69A 4YXKH 3EJYC 5J9PB 5DJCB 3BAJA 3AQYA 1A2YB 1G9MH 2CM5A 1OAZH 4XCYA 5BQDA 5CHNB 3NAAH 4NEHB 1T1ZB 3CVHB 2LTQB 4JANA 5AW2B 1P7HL 2QVFB 1V7MH 4IIQC 1IGFH 4JQXC 2B77A 5C0CD 5C86A 2CE6A 1RUML 2YZ8A 4UIMA 4NKOB 4GUOA 5ALBL 5LGHH 2W91A 3BEWB 1N3NB 4OD2B 3CFIC 5E1GA 3SGEI 3U4EB 1J5CA 3QUXB 4HIJA 3HR6A 5FYKD 1BYNA 1YEEL 2K3TA 2BVQA 1GKEA 3AB0C 3HMWH 1S7TB 3CC5B 1YC7A 4P5TD 5JOFB 2NZ1A 3D6GA 2Y0SA 2WZPD 1DVFD 4OFQA 4LU5L 1JVOA 1OZTG 1P5VA 2ZF8A 3V0HA 3X13B 4DJMA 1KBPA 1LXMA 2FRGP 4U31A 2X53A 4KK5D 4GRWB 3QK0A 5LHDA 1CQKA 4JFFA 1MNUL 5SV3A 1YJDL 4K4KA 4ZO9A 3APCA 4ODWB 4KQ4H 1VKXA 3KWWA 1OD7A 3BAEL 2YWZA 2V37A 3PQYE 2R56L 3O3EB 4KVPA 4M5TA 1OGAE 1OTSD 2HJFB 3TO2B 2WQXA 3CFEB 5KYYA 1G9MC 3VO0A 3RWIA 2XX0A 2UX6A 1HTYA 1MFVA 4RX4A 3L9RA 1ZOXA 1D7DA 3BDYL 3N6YA 4ZPVA 5J7CC 5EEWA 2O61B 2J1YA 2X6BA 3TIDA 4WSJA 1WTLA 5CP7B 1AGEA 1PG7W 3NEXA 4IKLA 3UBGA 5JTWA 4TF4A 2APTA 3MUZ1 3HG1E 2ZCLL 1TVDA 5DD1H 3S7GA 1MQKL 1TEGA 2E4FA 5E7FA 2ZWKA 5DLMH 2QZ5A 4L4TE 4EOWL 2YMXH 2W81C 2Y7QA 1PZ2A 4J5VA 4G6AD 5DHYB 1NFKA 3MLTB 2BPBA 1EHNA 3HS0C 3SCMC 4NUJA 1ADQL 2DB8A 3MOBL 4PVMA 4R2GC 5AVYB 4DW2L 2OYMA 4RGND 2C1OB 1EXGA 2VL5B 5TDPA 4KNUA 1AKPA 1NINA 1O7SA 4WUUB 1J5OH 4WWKA 4TVPL 2DTMH 1BZ7B 2ZSWA 4Y89A 3UYRL 2WAQA 4Y4KB 2JKXA 1G7JA 5EU4B 3SDXF 4WCYH 1G7IB 4LLDB 5E08L 3ESOA 1KFAH 4DP0X 1M42A 5F7DB 3K4DA 4IGBD 4Y5VA 3CFNA 5SV4A 2JELH 4ABQA 2EYSB 3DOSA 2IPUK 3KDMB 4G3YH 4H1LA 4HPOH 2DYPD 3V6BR 4Z7WB 5F9AC 3T2OA 3GXUB 1N5AB 1OK8A 2R4RH 4Y19B 1HCZA 1IARB 5LKNA 4G9DA 1QR1A 1O9ZA 2H6UA 3QIWC 4OZFH 4HP5A 3DX9A 4Y19A 3HEIB 3QRGL 1AXSA 1RHHB 2F54B 5HHXL 2IH1B 5D7JC 4DKAA 2AJYH 2JCCF 4XBGB 4OR1A 4KROB 1ULVA 4ZYKA 3UC2A 5CCKL 3CPUA 3E2HB 5H8DA 4JO3H 1MFAH 1E65A 2VMEA 4HQQH 4RFOH 3QUYC 1UM4L 4J2QA 3ZT7A 2P80D 4K3EH 4NO3B 1ZANL 2NY5C 4N8UA 5J3HD 2C4FU 2ZUQC 4W68A 3WEBA 2WVTA 4Y4KA 3S3JA 1ZLEA 1AYRA 4JFED 2BWIA 2J21A 5AEAA 3GSQA 2QQNH 3EJCA 3CDYA 2CO4A 4K5LA 4FG6D 1J9RA 5KVDL 1HCYA 5HVFB 1WICA 2VWEE 3I6SA 1DQLL 3T04D 1BQLH 2DQEH 4OQTA 3UOAB 3WNPA 1OCWL 1YHPA 5JQHC 1N18A 5DJ8B 1A21A 2WXKA 3P0GB 5EOTB 3GM0A 4WO4A 4JQVC 2BP5M 5FYLD 4QXGL 5EU5B 3MBXH 1IT9L 1RUQL 2AXGA 3O3AA 2OXHB 4FAAB 3L9EA 4B9IA 4EI5A 1PG7L 2VC2H 2K8QA 2YKLH 5HDBE 1HINL 2DI7A 4XVTH 4J1UA 3TBYA 4RWHA 2EUWA 2NY1C 5EZLA 3J07A 2NY4B 1T20A 3GLDA 3I6LE 4G7YL 4JR9H 2MNJB 2P42B 3DRQA 4QCIB 4EDXA 5GQBA 3V79C 3KVQA 1ZV9A 3O45A 3DWTA 4B9FA 4QXUL 3WN5A 4JFEA 1LP9A 2K78A 1JWMB 1BEYH 3ZQWA 5ICXA 4JK0D 2EVFA 4ODVL 3UBHA 3G3LA 1ORQB 5DQJA 2NTFA 4A04A 2PLTA 3B2PA 2OJ1A 3X11B 2CDEA 4FXGA 1NFIB 3P3RA 5JQ6H 2XWBA 2OMYA 3VFGH 3VXSE 3DTXA 5EOTA 1GYUA 1XR8B 1T6WA 3H56A 1MNNA 5GRYA 4RAUB 4FADA 2ZOWA 2XFXA 2B9BA 2VDPB 5A43C 1I9JL 1GS8A 4BKTC 2F6AA 3QDGA 4JFPA 5AAMA 2ODIA 2EADA 1U4FA 1PZSA 2H9GA 3MJ7A 1U8NA 1J8HE 1GYVA 4MMZC 2UZYB 2DYPA 2XZCH 4O51B 4P3CH 3D4ZA 2BJMH 4B9ZA 4IRJC 2HRLA 1S7TA 3AU1A 5JYLA 4ZUWA 4FEMA 2YWYA 1KC5H 3T6VA 4NP9A 3K6SB 3K72A 1GC1L 3QUXA 1MUJB 4HIJB 4I9WE 4JRXD 4RDQF 4IK6A 5DZ9A 2B16A 2AJ3B 3HRZA 1XGYH 2C26A 2D3JA 1F3DH 5CEXA 4WNJA 4LSPL 2V3FA 4J27A 3CN2A 1KEMH 5DD6B 4JFZH 1HZKA 2OLDA 4XB7A 1J5HA 1X5IA 1KBGH 4XC1L 2EACA 4OJAA 3L6FA 3K80A 5FA3B 1I1AA 3IWVA 4JRLA 4C4KO 5IHUH 2DQUL 4JRXE 4CN1A 1FLRL 4B96A 1JPGB 4UM9A 3RILA 1INEL 1IEBB 3L3IB 3P30L 5DC9B 2YUVA 3P54A 1QFUH 5DD0L 1EA9C 1W0VB 4AENB 3BN3B 4JE4B 1ZA3B 4MKMA 2WO3B 1ZWIB 3QUML 3DRTB 3LXUX 4JFTA 1TSRA 1CR9L 2JKIS 1ND0A 4A7SA 1DFBH 1LQSR 4JPVH 3TVMB 1Z9SB 2EH7H 1XF3A 2VSMB 3GI9H 5A1AA 2NY5L 1SNRA 5GGQL 3OSVA 3VRLE 3GLZA 3MBEC 1KTDB 2PCXA 4KDTC 2NNAA 2PCPB 3L9BA 1KPRB 4NM4L 3HLKA 5DHDA 1ZHNB 4DP9X 4KZEL 2JB6A 1NEPA 4N22A 2YGPA 3I9PA 4DHLA 2YLKA 5TDPB 3E6HA 2Q2LA 3UAJC 4BKLB 4EE2A 4YX2L 3L9YA 3L5WB 5D2NA 2FHCA 4E0RA 2XVBA 1UYWH 2P26A 4ZJ9A 1QSFA 5IEKB 4KI5C 1BOGB 1Z5LA 1P5UB 3LS5H 5I82A 4DAGL 1YUHA 2ICWJ 4GG8A 2JJTA 1SXZA 4AGMA 2MHAB 5GZOD 1D5BA 4MNGB 2VB5A 2YRLA 1HIMH 1RUMH 1NCCH 1F4XH 1OALA 2ZUXA 1GH7A 3CXFA 4PY8I 4WTZG 3S3PA 3SQRA 2R56H 5D71L 4F9LC 1SUJA 5DEFA 2AF2A 1QW8A 2K9UA 2YAFA 2W0FB 3D0LA 1X9QA 4RBPK 1MCPL 5CLZA 5L2JA 3GMLA 2H1LM 3TBTA 5J6GB 1SJEB 3UJTH 4OH2A 3RWGA 3L3HA 1UCTA 2X4RB 3WO3B 4ZMPA 5I1EH 2HT4C 3NIDB 4L5FE 3UTSA 2NY6C 5E8DH 1SDDB 4L37B 4D0DB 2EDYA 1N6UA 3ROLB 4MB3A 2X2HA 3IPBA 1WT5C 2Z31C 2EUXA 3N85L 4B0MM 1T7ZA 5E2UH 2OMBA 5HTSA 4X6BB 1OAUH 2G2PA 3L7EB 2CO6B 1PQZB 3QPQC 5CJQL 4YFDB 3K0WA 4N24A 5F0JB 4AQ1A 3LD8C 3LXAA 3IDYB 1P4LA 3N04A 3QYNA 1IC4L 3FT2A 1P7KB 3JV6A 5T5FL 2DQJH 3DX9B 4A7GA 2J6WA 5KSUB 1AZVA 5ANHA 4ELMB 5BV7B 3MUJA 5IOPB 4U1HA 5J12B 3GMPB 5C97A 2CLVA 2COVD 3L3OB 4U6YA 2FL5A 3N43F 2GEQA 2BS71 1JRHI 4JO5A 5D93C 3RBSA 4L05A 1JGVL 1ZXQA 1MCHA 5DJ0A 5FYJL 3LRSB 3W5NA 3DXAA 1C12A 5D70L 1ZT1B 4RGOL 3DBSA 1BVLB 4FMVA 2P45B 1B3IA 3UTZA 3LH9A 5HYEA 3VGBA 5JPNC 3T08A 3STBA 4QXGH 5IVXB 3DYOA 5EU4A 4ZMOA 3C5ZC 3FPXA 1O6TA 2LE9A 3QDHA 2OL3B 1SOSA 1XF2B 3CWGA 5I16B 4ONFH 1QHPA 3D39B 5AKSA 1QASA 4TTDD 1HWHB 1CBVL 2EUVA 1LL1A 1PCSA 2BRQA 1O6VA 2J43A 3A6BH 3W39A 1L7TH 3B56A 2B20A 3PGFL 1QI5A 3SE9H 2PW1B 2X44D 4LEOA 5DJYB 5C3LD 4AV4A 2GSMB 3FUKA 5F93C 4HUUA 4WSGA 1YQ2A 5GSVA 3GUTB 2HSIA 4JFFD 5HHVH 3C60C 2OTWB 3WE6B 4NRXB 1QSEE 4W9HC 2XN9E 4FXGC 3VA2C 4DT2A 1D5ZA 1DLHB 4QRUA 1X5LA 4HWBA 1JYXA 4KQ0A 4H88L 4TOYH 1AHKA 3X14A 2EIMB 4FZ8L 4P5SA 1DCLA 3FSZA 2FIRT 1M6UA 1YCSA 2RD0A 3NZSA 4DN3H 4KROD 3SYCA 2DKUA 4WV1A 1CDIA 1JZ7A 1E30A 1XIWA 3IT8D 5TDNA 5F0MB 2ZWZA 5C7ZA 3TO2A 2EDFA 25C8L 4ZNCD 1MWAA 1AQHA 3MBED 2ZKXA 4KKRA 1HNFA 4RRPG 2QVKA 3L5JA 2JCCB 5ETUA 3DETD 1B2YA 1NBQA 2DLHA 4XVJH 5D7IA 5D1XA 3EJZD 3CBJB 5C9JA 4HPYH 4W9JC 4EXKA 5T1KB 3ULVH 1VESA 5H37G 1WZ1L 1WAPA 3WHE1 2EKSA 1TJMA 1A9BB 1PLAA 4QRPA 2HTLD 5ADPL 3VSQA 5EBMB 5L88L 3QUMB 5E9DE 5E5MA 3F00A 2V33A 2XNAB 5CEXB 5E5RB 4UNVA 4OV6F 5MHSE 2R29A 1MUJA 1H3UA 5I1KH 3H6JA 5TF0A 3QQ3A 3IE4A 1E3ZA 1CDYA 3WTYA 2R0WH 1I7ZA 3MXWH 5DSCA 3B3IA 3BO8A 1N3NA 4FQIL 2BP0A 4URKA 3WTVA 1E6JL 3D12B 1KWGA 3EGSA 1PSKL 4ZX5A 4ZTPL 4L2YA 5JW4Q 5HYQB 4ALAL 2ZKYA 5LNGA 1KTJA 4HMEA 3ZKXC 4TNVK 1S7XA 4N4YB 3RVTC 4NM4H 4FXKB 3RVXC 1MCWM 4X98A 1YMMA 2R0ZL 3L1EA 5KYXA 4UQCA 3HS0A 4PJAF 1H3WM 1IBFA 1IGYB 3O4LB 4O2CB 3V7AG 1JNNL 1E5BA 3TJHD 4YHOL 1GGYA 2DQDH 1MDTA 3KPMA 4FRWA 1A6VL 5JIPA 3EG9A 3U30B 5CZKA 5KBNC 2DWDB 2GT9B 4RIRB 3VFUA 4HVBA 1GA2A 3D34A 3DV4B 1ZS8A 4QHUA 4RMQA 1OT2A 3E9UA 2IAMB 5D7LD 4ADIA 4C56A 4YBLC 3P2BA 4CKVX 3LMJL 4G8EA 3TNMB 4PY7A 5JPNB 1GZHC 4MDJA 5F88A 2K1MA 4ZZFA 3G5XB 2EDXA 3MJ8B 5F0PB 1U92B 3FQTA 1T0NA 1JZ4A 1AC6A 3C2AH 3IJ8A 4HOWA 3HG1A 5IHBA 2BSSB 1WD9A 3KNBA 4PB9L 2HRHA 1FNSH 1QFUL 5HVHC 1J11A 4TNFA 1MREH 2PTUA 3S97C 3A22A 4KVCH 5C07A 1FIGL 5I23A 1IEHA 4QLRA 4GSUA 1A3RH 1TETL 3BZEA 1MHPL 4X7TB 1CFNB 1J8RA 1KC5L 1DN2A 1Y0LB 2X41A 5E6ID 3G5ZA 3PABA 1XSIA 1BX2B 2D0HA 4N1EA 3C6LA 5F3FA 3EG9B 4YDJB 3HHSB 4POZC 5GZOA 5AENA 4BRJA 1RFDH 3MODH 4MA1C 4Z7UB 5DF0A 3VXRA 1ZD6A 2R29H 3I9GH 1XL4A 1CU4L 2LLNA 2WAHA 2CO7B 3Q6FB 4G8AC 4X98B 3WNJA 1U8CB 5ISZB 4P2OD 2AAVA 3NA4A 3MLPA 4HBQA 4FFYA 3V6FB 2PWFA 2J44A 4QRPE 1TZIB 4R7NB 3IMUA 4X8CA 3S6CA 1FZOB 4FFYH 4HWNA 3SDCC 4LASH 4O5LL 1X5GA 1HSAB 3QXAA 2X89A 4LBEA 5SWZB 5DC0A 4LLAA 1INQB 2A9BA 2WUCH 3REVA 5GZNC 3QCTL 4GRWH 3QUYD 5FPIA 2A83A 1Z66A 1JV2A 1SHSA 3JTSB 3C6SB 5KYNA 3IDIA 4MAYC 4Y5VC 4LB8A 4LDOB 2DMBA 1D3CA 4XVUC 5DS8A 4MNQD 3O6FD 2YKKA 5G2NA 4TS6A 1HEHC 4PJCF 8FABA 3ARUA 1EJOL 3OJDB 4OZGB 1WYJA 5CGYD 4AOFA 5BV7L 3PGDB 1OP3H 4P9ML 2GBUA 2X3CA 4TVUA 4ZAKB 4RSYA 3VUAA 3QCUL 4OLVL 1URLA 3MRFA 5I1EL 2WUBL 1G7JB 1TTAA 2BLFA 3FQNB 2EO9A 4HCGA 4YX2H 1XCQB 3FCBA 1Z0MA 5T1DH 5B3JE 1IILE 3QNYB 2NY7L 4NNPL 2IWKA 3BW9B 1WSST 1E27A 4Z77B 2X6AA 2CO2A 2ZAGA 3ZXAC 3IN2A 4EDWH 2FJGA 3WXWH 3S8FB 1H3PH 5JHMA 2E75C 3VX0A 1GZPA 4PG9A 1CXKA 5EC1A 5F9JA 3QUGA 2VAJA 1I1RA 3DO4A 4B9KC 2GVYA 4M1DL 2VH5H 3DYPA 1RPQA 4WV1C 1FYTB 1LWJA 1MHCA 4D8PB 1O5DT 2KPNA 2PR4L 3GB7A 4JB9L 3RDJA 3WDIA 3NCYS 3WYRA 3GXNA 4Y8DC 1ZV5A 2CMRL 1VEMA 1UM5H 5KG9A 3OLEA 2YRPA 2PMZA 1AXIB 4A2HA 2BNRA 1G9HA 4YHLL 1MI5A 5E2JA 3SDAC 3DYMA 2ICES 4V2BA 1OLZA 2YS4A 5FYJH 5DZNA 3AXHA 2JCWA 3GB7B 3RZCB 3HE7C 2HWZL 2FYYA 5IW3A 2JFCA 3NCJH 3T77A 4XCEB 1E5CA 1K3IA 3EZJB 3LSOB 3MYJB 3ZDWA 3HMXA 2FX9L 4F7TB 3P4LA 4N20A 3BP7B 1BZ8A 4HWZB 4L1LA 4R4FH 1L9MA 2A4ZA 4ERSH 2EDMA 2JXMB 3O3DB 3QDJE 1NMCC 2ZX6A 5DUMH 1ZANH 4NN6B 4ZMWA 5EDSA 1IGTA 4Y4FA 3JWDC 3ETBF 3QHTC 4M93C 4AI7A 3T3MF 3THMH 2BP8A 3GSVB 1ZGLM 1WIOA 5L88H 4XXCC 4R96A 4IS6B 4KAQH 4RNRB 1C08B 3D39D 4MNHB 2VQUA 5AYUH 3LEXB 4FNQA 2OL3A 3FU3A 5FUCE 5AVWB 3H9SE 5J1TC 5EOQH 4ZD3L 4HKBA 1G6VK 2HRPH 3BVWA 3WKYA 4YWGL 1UGNA 4P23B 4HMDA 1ML0A 3BT2L 3EDEA 4P99A 2JKSA 5T8IA 2XZQH 1M7DA 2CLZB 5F7EH 5K9QG 1TQWA 1AD9B 3EZ8A 1CB4A 4WU5B 3N0AA 5E2WL 2BRRL 1DUZB 5JNYA 3BPOB 4FQHA 4W9IC 5BZWB 3CDZB 3PPEA 3U46A 3L5IA 1W16A 3BLKA 5C0JA 4DZBB 2JWYA 1E67A 2K6WA 3NGBC 5E2VL 5K59E 3C5JA 1XO8A 3IMVA 1E28A 2P5WE 5IJKA 1U21A 5DA4A 1IAOA 4HJTA 3QE5A 4PJFB 2QJDA 3UTTE 4RAVB 1IC5L 1KIUB 12E8L 1N5YL 4L2LA 2XUWA 5LBVA 3BVDB 2DQCH 5FYKL 1UM6H 2WWMC 4JDVA 1NLDH 4EQ2A 4P49A 3JWDH 1EO8L 2DL2A 4AGQA 5BRZD 3MTRA 4YHNB 5DQ9A 1IKOP 2D0FA 4AEHL 5JPMB 4NPJA 5EEZA 2CO7A 3Q6FA 3IJSB 2D7MA 4MJ5B 1PZAA 3RWFB 4XP6L 3GGWA 3QI9B 3K6SA 2VR7A 3G9AB 4X7FC 5C0CE 3V4VH 2WKOA 1OAXL 2Z7YA 1NCJA 3DUUA 2B1AL 3REWB 1WGVA 1UD3A 5HHOB 1G7QB 4XT1C 3ULVD 3JWNE 5GGVH 4WFFD 4JJOA 4DCQA 1KIQB 5B1KA 2X4UA 3TA3A 1CYGA 2FNBA 4QF1A 2HYMA 2OJZL 5I8OL 1N64L 2IV9A 1CL7I 1D2PA 1E43A 1LNUA 1CFSB 1UG9A 1ASPA 2DY2A 1MVUA 3ML8A 1S5HB 1X4ZA 2R39A 1EGJL 4UZUA 2TRYA 5D96C 5G4OA 1XSKA 3QFJD 4HSCX 2DJMA 2GW5A 4FKHA 2APXA 4LCCA 1S46A 3KYNB 4YXHH 4JDZB 1WS7A 2MPAL 1KCBA 2EC9T 3S2CA 1UEMA 2BVUA 2EIBA 4FQ1L 5ECJE 2PYEB 1KG0A 1U3HD 2J71A 3V5DA 1RZKC 3BP5B 4UUJB 1HXKA 4M7KL 1AGCA 4EJ1C 5IJDC 1S9YA 3WAJA 5JZ7C 5D5MA 1E6JH 3H9SA 5INCA 4IKKA 2X88A 2XKNB 3V0AC 2YD6A 3UPCA 4NX0A 4FOMA 3WLBB 2N59A 4F15B 3R0MA 4Z7NB 2CQVA 4NQQA 1A6AB 4AMXA 3FT4A 1KUMA 2GTQA 3FK3A 3HZYB 4G43B 4M93B 5AW9B 4C54A 1L5GA 1HJBC 4LCWB 3FQUA 4X4ZA 5LQBH 3NOIA 4A38A 3HG1D 3A5VA 1L9TA 4IM8A 4FNLL 1BXAA 1UATA 1E5YA 4F8LA 4FDWA 3CZGA 3FU7B 3TEZA 3O6FB 1A3RL 4KO9A 4Z3FA 2CHXA 2X9ZA 4HEME 3UP1A 1UYWL 1HWGB 3BKML 3QJTB 1N68A 1BVLA 2IXQB 2YEQA 4DAGH 3K72B 3TT3H 2QHRL 4Z23A 3T8MA 1I3GH 3WL9A 1XV8A 5EF1A 4Z76B 5D2LA 2YQ3A 4TSCL 2V2WA 3NSXA 2ZJSH 4WO4D 3SQOL 4GRWF 5E08H 3O8XA 2R2HB 1JRHL 3UXFA 3L45A 4JKNA 1QQDB 3U1PA 4D9RE 2CO3A 3OQRA 2XBTA 4DGVH 5FC9A 2F1AA 1CTMA 3MU3A 1QLRB 3D52A 4L29B 1E6OH 4NZRL 4XXCA 2W9DL 2DLFL 3PQYB 4HIIA 5DMYA 4PJHB 2F54A 1RK1A 3BUQA 2OI9B 2GTZA 1MFEH 4OCMC 4GW4A 1DLFL 1DVZA 2CO6A 4X6DF 4JVWA 4HOZA 6PAZA 1U3YA 1ZS2A 5IB3A 3FFDA 5CP3A 1F18A 1QA9B 3N1MC 2VIRB 4L9DA 5HHXH 1BZ9B 1MRDL 2DIBA 2XWRA 4PV8B 1JWMA 5IBTH 1VFOA 5MI0B 3H9ZA 1RJYB 3X14B 1LK2A 2EYSA 4S0HA 3SKJL 5IT2L 4GUQA 2HA1A 4JZJC 2Y1VA 5MP6L 5JR1L 2R2BA 4YHMH 1AFVL 2NY2B 1J18A 2KLTA 1RP8A 2XT1B 1ACYH 4WWPA 2JQAA 1J5OL 1GGBH 2Z4QB 3QIBB 2BNRB 3MBWA 5LBSL 4X5PA 5AAMC 4P2OC 3ARBD 1FFQA 3MROB 4OLUH 4WJKB 3S4SA 4HLEA 5BCAA 3A4FA 3S8GB 1BF2A 1A7NH 1X5HA 3DECA 3DVFA 4H25A 2QVIA 4QHLB 1TENA 2EH8L 4KRPB 4TUOA 1VCBC 4M3KB 1YNLL 4WK2B 4X50A 1CGVA 1E3XA 5D1XD 1ZTXE 4GG8B 2IDFA 4NM8H 2IDTA 2MTPA 3LNIA 4ELDA 2HXAA 3HBQA 1RZ7H 2R1YA 1GR7A 4FMFA 2JJSC 4X9GA 4DETA 3BWZA 3O8XC 4FJZA 4TUOB 5D2NB 4XGZB 3TTYA 4KKZA 4E0RB 2XKSA 4PS8A 5D5ME 1HZHL 2NYYD 3H9HA 1XB3A 2FNWA 3NJGA 4N6QA 2LTQC 2RFXB 1N0XH 2VLME 3FO9B 2MRYA 4OD1H 4G1EA 4ODSH 1G1YA 4NNXB 4AW4A 5ANMB 1GL4B 1IM3D 4WENB 3BE1L 3V7MA 1CXIA 1FYTA 3ZTJG 3H9YA 1ET8A 4B53A 1TO5A 2JQZA 1IAII 2NTSP 3CFEA 3JZYA 3MLUH 5D4HA 3ILQD 3STZB 3LNEA 1B0WA 4JUSA 4W6WB 1H3TA 5F0LB 3BN9D 4AQEB 5GS0H 2CR0A 1SLXA 3HRZC 2FVNA 4UT6H 4ZSOA 2ADGA 4WDIA 4ENED 1IEBA 1QSFE 4ZOAA 5IBUB 3KPOA 2XXMB 2A74A 2ADFL 1N0LB 2PPFA 2P8LB 4JQIL 4PB0L 4QDGA 1KPVB 3L7EA 3QO0B 1REIA 4G80A 2CZNA 5DUJA 4LSTH 1RZGA 4ANUA 4JFXA 5HBBA 3PNRB 2VN5A 5E1AA 3EGDA 2FSEA 1OPOA 4LCIH 4UIKL 2WVSA 3NZUA 4FTVA 4X7DC 1CGSH 2M1KA 5ESAA 5INDB 2X4QA 2V8LA 2CRIA 1AI1L 6CGTA 3MNWA 5HYSG 3BYTA 1U93A 1M1XB 2FGZA 2F1EA 3H2PA 1KTCA 2Z9TA 3GZPA 4EI0A 3Q6GH 2J7LA 5L6YH 4E9XA 4WJ5B 2YARA 2OW7A 2LFEA 2VLJA 2UVFA 5DEFB 4QY8A 5FW7A 3KPSD 4UOW0 5DDHA 4UQAA 1QSFB 3GRBA 4KUZL 1OAKH 3S96A 2IV8A 3UTTB 1S7QB 1TTUA 3CLFL 2PTTB 3MLWH 4HFUH 4O2EB 2R69L 3QORB 5FB8A 4IEFB 3C8KA 3CFDB 4OUOA 3LIUA 5FW8A 4QOKA 1SXCA 2CNZA 5CN2A 1XB8A 3ESVF 4H8WL 1K9TA 1WC7A 4I3RL 5FHAH 1I53A 4NQEA 5FX3A 5E99H 4JM2A 5FYJU 2FD6H 4H44C 5C07E 5DWUH 2OMUA 2XZQL 3MHZA 2XWTA 4XNMB 1CO1A 2VN3A 3IF1A 3ABMB 1OOWA 3VD5A 1WWCA 2FEJA 2GKIA 1JYWA 2O1AA 2XBDA 3VFUB 2F5AL 4Y5YC 1UJTA 2OR9H 3WY3A 5I24A 2R27A 1LP9F 4Z3IA 3DGGB 2BSTA 4HW6A 2XYCA 4ZK8A 1IL1B 4U1KA 3RDTB 1CD9B 4GB9A 4PJDF 1XF3B 1D5ZB 4ONHB 4N8PA 1YMMB 2GK2A 2WIIB 4NGHL 2IH8A 4ZS7L 4ZS6D 2CLRA 1B4RA 4AQ8C 5LLIC 1U8HB 3L4WA 2GSIB 3PWVB 2OQJB 3MSPA 5KANG 4HUVA 3QIUA 1H3XA 1QZNA 5D9SB 5GGTH 3QEQB 1DJXA 4DIXA 2AKRB 1KJ3H 2XPYA 4PRBA 2RR3A 1NGPL 4KKBC 1SJVA 3DVNA 3V52H 3DV4A 4RISH 4ZTEA 3FFCB 2P5EA 1W0WA 2DLTA 4UQEA 3HI6L 5C0IA 1DSWA 1S78C 3K2IA 4ZTOL 4X7SL 2AQTA 3TOPA 3S36X 4AQ1C 4NQSB 5AW4B 3WHXB 3JWNC 3OAZH 3D39A 1FL5A 1MELA 2X4SA 2YXFA 3F7PC 3FQWA 4HWEL 5CJ5A 3MYZA 4MX7B 1OB0A 3DGDA 1JIBA 4MS8D 4PRHA 1X44A 4Y9FA 2D2OA 3WJMA 5B39A 5IHWA 4KGJA 3QUMH 3MREA 1JTPA 4PAZA 1YEGH 3NGBB 4YAQA 2Z34A 2WNXA 4L3EA 3ZT6A 5KW9L 2F68X 3ES6A 2DQGH 4GKSB 4MAYA 1PG7X 3MLZL 4MYPA 3L48A 3BSGA 3SD5A 3NDYE 4X6FB 4MJ6A 3ZL2A 5C7XH 3PG2A 1I7RA 1MI5D 2E47A 4FLOA 1QFHA 4W9FC 1PDKA 2VDOB 3IGAA 3ZLQC 1A6WH 1D2OA 1VPOH 5D7KD 4EIZC 4NO5A 2KPWA 5F7UA 2V5SA 1YNKL 1NGXB 1FSKC 5I1HL 1SHWA 3IDMA 1JE6A 3CH8A 3EJTA 3HI5L 4PUBL 1TEFA 2FCBA 2E4TA 1R3KB 4MDIA 2I60L 1KLGA 4X6BA 4AIOA 4WHTB 4YHPB 3QRGH 4LAQH 4G6FB 1Z1WA 1BP3B 3BD3A 4HZAA 4N0UE 2ZXBA 3GHBL 4LSSH 1AQMA 2ZJSL 1AXTH 1Z6JT 4JO3L 1G6RH 1WE5A 3K2UL 1OE1A 2ZCLH 2VL5A 3NIDE 2YAMA 3S3CB 2FECI 4MGXA 3MUGB 3VVVA 4IJTA 2ICEB 3V4PL 4HT1H 2NSQA 3X1GA 4AV5A 4BQ6A 4F8QA 1TQCC 2ICWA 3HI1A 4IBVA 4CUCA 3ULUE 3IDJA 1XL6A 4J3OG 3LEXA 1MIEH 4PJIB 3ZDYB 4UT7L 2HVKA 2C4FT 3FT3A 2DH3A 3CHQA 2EEBA 4DFIA 2W0KA 2PCFA 3OKLB 2VW4A 1DJSA 3R4DA 3TF7C 1FO0L 2FLBT 1CJYA 3GSWB 1J1PL 1MLCA 2Z91A 5K9JL 2AV1B 3HG5A 3SQBA 2FO1A 3OF6A 3B9KA 5INDA 2R9HC 5HYIA 1P6AB 4GG6B 2B3IA 4MB1A 3FUEA 1H15A 2C9XA 2N3JA 3D18B 3P4MB 5BUAA 2HG5A 2APBA 1P1ZB 3QDMB 4NQED 5D71H 5CD3A 3FZUC 5DJDA 2A74B 3OF6D 4LP4A 5LCVH 4FI7A 3OAUL 2WMPB 4X4XB 1GIGH 2WNGA 4EUPH 1TCRA 4D8OA 2NY1D 2Q5BA 4KDTA 3OVUB 5FUOH 1BHGA 1HL9A 1MG2C 4XOBA 5A6LA 3M1OA 1QFWM 2CHZA 4O58L 4FFZL 3GO1H 3A23A 3GNML 4PLKD 5KSUA 5IJKC 2B4CH 1MCOL 2EDOA 5KSBA 3A24A 4MMXB 4ELMF 5KSVA 1QRNA 5LN8A 1YNTF 3RNQB 2BWDA 4AIZA 4DTGH 4G8GD 3D09A 4PJXB 4XMUA 3SDDB 4HEPG 4NQDE 4OZIF 5B38B 4LOUC 2Q86B 5BOPA 4R4FL 3UAJD 4K5OA 3BAWA 4IBWA 1PY4A 4FNUA 5E6ZA 3QJRB 1EHLL 1I9RH 2F53E 4DGYH 2APWA 2XY2A 3GBMH 5HY9B 5KEZA 1BD2E 3CC5A 1HXYB 2VXSL 4ZMAT 3CFBA 5IR1B 5JIQA 4LHUB 3HA0A 1BZEA 1JK8A 2KERA 3IMWA 4NQDD 4J3OF 4OGXL 4QRFA 4ZUVB 3VCLB 4MWFA 2X12A 4O00A 3PGDA 3LQAL 4FFZA 2CAKA 1N59A 2FZ3B 5DYFA 5D2LF 5CEYB 2VM3A 3QEUA 4N0FB 2CGRL 1YY9D 4WWKB 4D3CL 1EANA 1PZDA 2Z91B 3GDBA 3SKNB 3ZYJA 4Y16C 2WTRA 1W9XA 5CKGA 4AG4L 5IVXF 4YHZL 1J1XL 2QADD 3E6FB 2AGJH 2IPTH 1UXLA 3L4CA 3I2CL 2A9AA 1GZHA 3UTOA 4KX9A 4FQXD 4X7CC 1RIUH 5C0AE 4X83A 3HIZA 5CEZH 1TTCA 4UYPA 1P1ZA 3QDMA 4AX3A 3F64A 4Q9RL 5FV2A 3RWGB 4XNDA 3ULSA 1I7TA 1EXUA 2EXWC 4N2CA 5GXBB 1FL3A 2QGEA 4QXTB 4Z78B 1AGCB 2H45A 4IGBA 4L4VD 1DVFC 5CP3H 4IDJH 1BQKA 5AVVB 3V55A 3RX5A 1WBZA 1L9OA 1UD5A 2EXTA 4MA8H 4MS6A 4GW1B 4LF3B 1HQ4B 4GSRA 3EIFA 5HJDA 2XN0A 3T4YA 4ILDA 4M3JA 2WXHA 3EBHA 3JWNH 4F20A 1C16A 2DIJA 5HHPB 1XGPA 1MSPA 4HJUA 3TT1H 4BFNA 3HPJB 3IBOA 3L1GA 5GIRA 4NAQA 1CT8B 4MNQE 1EGJA 2OYPA 2HJFA 3T6QC 1ZTXL 1FBIH 3DI2B 3MGOB 3B7SA 1IJNA 1AZCA 2G30A 1QBLL 2I24N 2O6PA 1TLKA 1MPAH 2Z31B 4QF1B 5FHBH 1HOCA 5I28A 2VLRB 2XX1A 4MMZB 1CGYA 1N6QH 2OMWB 2NX5A 3HNVH 4IRJB 2AI0L 3U0PA 4PJ9C 3MRMB 4X8XA 5LWYL 3V4VB 1MN4A 3C75A 5IIEB 1MFMA 1JXJA 3DMMB 5DFVD 3ZMRA 3QNZB 5F7FA 3FQTB 4EVNA 4ZFOL 5CUSL 2VT0A 4Z76A 2VJ0A 1HH9A 1KN2L 2G75A 3FH7A 4KPHH 4FTVD 1G9NL 2ZX9A 2P5WB 3I75B 3BEWA 4LSUL 4XP1H 4ADJA 5KSAC 1SDYA 4Q8BA 1R0AH 1TQUA 4HEMA 3L5HA 4KHXH 2YRZA 2F5AH 4Z3HA 2QGDA 1BVNP 1NAMH 3RB5A 4EPSA 2Q7YB 2YK1H 4JHZA 4J4PD 5E6UB 3UCRA 5HHQA 3BH9B 5I66A 4M4PA 4HOXA 4Q74A 4NRYB 3BVUA 4G71B 3VM7A 2VC2B 3DHJA 2R15A 5SX4I 4MJ6B 4F7CB 1DEDA 2BNQD 4AQAB 2EDLA 4MQXD 1XIWC 3B9AA 4Z95L 1NCTA 1O9WA 3QULB 3DX1A 4JO4H 3O2WL 4V1DB 3PHOA 1OD9A 3HW7A 5T1MA 4N28A 3P4MA 1JYVA 4J39A 4L8SC 1XCTA 3P4NB 1QRND 5FM5M 1FZMA 2BNQA 4E9WA 2ZOKB 2YA1A 5ICXB 4UV4L 3WGUB 1OM3H 2R8SH 4XN2A 4HS6B 4HGWA 3POHA 3OKDB 3N42B 1DQKA 1MZZA 2WXPA 5EUOF 3S48A 3JWOL 3UBXI 5C0AA 5EBMA 1UTDA 4QT5B 3ECUA 4QRQA 5T1DL 4KKNA 1QHQA 1YEHH 2VDPH 4ZFGH 2F61A 1Q4NX 4X4MA 2X10A 2IH3B 4P59H 4IOIA 3QCVL 1KIQA 5C0ND 3CFJA 4RCAA 1ZK5A 3MXVL 3RVWD 4MZ3A 1IMHC 2PKDA 5CZVL 4LFHD 4IOIB 2Z8WC 5D6DA 3FT1A 5IFAL 3X1BA 3QDJD 3IFLL 1ZVHA 3CQPA 4NP4L 5FWRA 4PYGA 1PZUB 5IQ9B 4RH4A 5L7XH 2NY6B 4K5NA 1VCAA 3RLSA 5CXPA 4Z7UE 4F1SA 3IJYA 4XXDA 2X3BA 3RZCA 1OARH 1UWGL 4X5XB 3SY0B 4HG4J 4HKXB 1OM9A 4F9PC 1WK0A 2WBJC 3LZLA 4PJEA 4RWYH 3SE8L 5KVFL 3IBEA 3FO0H 4RAVA 2FGWL 2OS7A 4HIHB 3UC0H 5FYJE 1UT9A 3TURA 5C0CA 1OSYA 3BH8B 1EAJA 5KYYB 5CSBA 3HKFA 4PD4J 2ENYA 1QFWI 1ZLUH 2QVTA 1CF8H 5D72L 2IH1A 4NENA 4TQHA 1NICA 1ZT7A 4GUPB 1EH9A 5AZEL 1A7QH 3MGAA 1I9EA 3NH7H 4OFPA 4LO9A 3WD5L 3ATAA 1L7IH 5C0DB 4OLUL 4JFOA 5AYUL 2VISA 1A7PH 1MW1A 3CSPA 3LKOA 1FO0H 2OCCB 4OF7A 1YYCA 2FSEB 4PJHE 3SDXA 3M1BB 1T2XA 2F7PA 4TLUA 1QO3A 1LK3L 4UM8A 3QIBC 5FEBA 1AXTL 4W9GC 4M1GH 5E9DA 4BSVB 5ICZA 1A9VA 3FTGA 3NFPB 4H40A 2DD8L 4UM8B 3WFCH 1IM9D 3TV8A 3CBKB 4GUCA 4G1EB 3RKPA 3SDXB 2MQ0A 4JDEB 5DHEA 4G72B 2ZSWB 4UQ3B 1QACA 3D85D 1BYPA 3GHEH 5K1JA 4PJIF 3VXMD 3B2VL 4ORGA 2YEZA 3H9HB 3VD7A 4JMNA 3II2A 1ZCRA 1IFGA 1OGPA 4L1HA 2XQYK 1RP9A 1OWWA 1YEKL 2XQYA 4YSEA 5B7MA 4P3WA 4MXVF 1FV1A 3UAJA 1LDPL 4YPGB 2E6JA 4I48A 3D0VA 2IBZY 3VJ6B 9PCYA 1SJHA 3U9PL 5DJXA 3WE1A 4DTGL 5EH1A 1Q1JH 4GG6F 2CALA 2XWTB 1QOKA 3ZQ9A 1DQQA 2FBRA 4M29A 3KM2A 3ZZ1A 3AUWB 1QZ1A 5I6OA 2BIIA 2AJUH 4HFWB 3P0YL 3VFTA 1TLMA 3GUFA 5C0BD 1RJCA 2G60L 5EU7E 3KGTA 5FCSH 1NBVL 2QQKL 2G3ZA 1V3KA 4U6VH 3ZYIA 4XRCA 4PTUA 3WEMA 3GUTA 4F24A 4FABL 2OX5B 1IEAA 1DQMH 5I73B 3MJ9L 2ROXA 5EBWA 3DROB 4UT9L 2P47B 3G7TA 4W81A 3FH5A 4N0CC 1IEAB 1RH8A 5AW7B 3IDUA 1R5VB 2WNWA 4JEGB 4U1MB 2IGLA 4G70B 3RUGE 1LO4H 2VLRE 5F21B 3B5GA 1Q1PA 3HUJA 1DE4A 1G9NH 3IRCA 1SJMA 2ADIB 3HKZA 5K9KB 1DVQA 3ULVL 4YBQD 2C9AA 4AYBA 1TG8A 2X0UA 1WVZA 3WIFB 3T3MB 3TZVD 3NQIA 1L6XA 1RUAL 3GMNB 4FF9A 5L2KA 3X13A 1JZ3A 2P46B 1JHTA 4F15C 4FXTA 1OSEA 4N2KA 4UTBL 2H32B 2DYRB 5BMFH 1LE9B 1CVRA 2YZ1A 4QXUH 5DXWA 4AQOA 3A3YB 5D2LB 3F7VA 2VLLB 1TQSA 5LUMA 3EH3B 1XH3B 3O6LH 3Q8CA 2BVYA 1CFBA 1GS6X 4JREC 4LK4A 4M1CD 2MOVA 2V7HB 3FKUS 5J6SA 1T83C 2AVGA 3SPIA 1I7RB 2GJ6B 1GSMA 4XPFH 2PPDA 3ZKXB 3QEHB 5HDBB 3AG3B 2VLKB 3FTXA 1BQUA 2A6IA 2WWKO 4JPWH 3LAFA 3J27A 4OLZH 4L29A 1QX1A 1ZWIA 2ZXQA 2A4CA 4W9EC 1EZSA 3B9KD 1A6UH 1RFDL 1EWHA 2N0KA 4LVHC 3ARPA 1X7TA 2GFBB 2HLEB 1KB5H 3L3IA 5F1SA 4AXWB 5IFHH 1FNGA 1OAXH 4V11A 4YK4B 2F5BH 5G5DA 1GYWA 2PYFA 5IB2B 3CLWA 1CPUA 1WZAA 4IDJL 5TFSL 1ACCA 2WXNA 2CR3A 4NQSA 4I0KA 1JGIA 3SPJA 4PJFF 2CIKA 5BVJB 4BGDA 2FTAA 1BAFH 2WOBA 1SPDA 4ZQKA 3WIHL 2VLRD 1N5YH 4P04A 2DKSA 1WDAA 2A3TA 3WUWG 1BZQK 2HPTA 1FZKA 3BVTA 1PL3A 2G75B 4PVNA 1CTOA 1QLEB 2YGVA 2AZAA 2PP9A 3AMLA 3QXDB 1M7IB 2I69A 5T1KA 5MI0C 1CXHA 4PLJD 3LB6D 2J4WH 2NSMA 2BOLA 3GJEB 1TO4A 1T0MB 4WIQA 2WXMA 4XN1A 4ZI8A 4KXAA 1PJ9A 4KJPD 1IAKA 1WFIA 1VAHA 4I4WA 5HYJE 3FSAA 3VXRD 1KN2H 5C6WH 5JHLA 3V5DB 1XR9B 2B9AA 2BOCA 1JGEA 2V7NB 2VDNL 1MNUH 4ESKA 2EE9A 1F42A 1EVTC 2NQCA 5IMLB 5K9OA 2CBTA 1CCZA 1NCHA 4W9LC 4LOUD 1SFHA 2YPKB 4N9OB 4F9LA 1R3KA 3HN5A 4JO8A 1T7WA 1WBXB 1NCDH 4CDGC 3JT0A 2AJSH 3PYCA 1FZJB 1TR7A 2AV7B 1NH6A 5ECGA 5AVSB 5JDSA 1Q72L 1RIVL 2VM9A 1QVOB 4GIPD 2VXVL 3LNGA 3MRLA 5I75C 4ZOCA 5JHDA 5AVRB 1VRSA 2OMZA 3QWOA 3LPPA 1TQTA 5FOBA 5GGRA 3ZK0A 3VWKD 1ZLDA 2AJYL 3BKCL 4KTYA 5E94A 5FLVA 1DJHA 5C6TH 5AW5B 1U6AH 1X4YA 3ECQA 5I1DB 4FI8A 3HZ3A 1B9ZA 5JLZB 2ED7A 4BBWA 3FTUA 1SHMA 1DVTA 1R24A 2AQPA 1DBAH 4MJ5A 5DUML 2VW7A 4DKFL 4GKOA 4YHNA 4E41B 3KLAA 4KRMB 1JK8B 1ZMYA 1HJCA 3CV5A 1F8TL 4H1LH 2RHEA 3QR0A 3CFCL 2DWYA 3MCLH 3SJVA 1B4JH 4LCYA 4FLHA 5FXCH 2C9UA 4RFNB 2UZYA 2YD7A 2A9CA 2BSEA 3PE9A 4ACTA 3U83A 1O6SA 4ZODA 4P23A 3MX0B 2Q86A 4FLQA 1UADC 3O4OC 4DZ8A 4FG2A 4G7VH 3CJJA 3QA3A 2ALAA 3QIUC 4AW7A 4KI1A 4X5WA 4KXZI 3WN6A 4N25A 3TESA 3CHSA 2WTOA 3FL7A 1KGCE 3AG1B 1YRKA 1UZ6E 3U9UB 2D73A 1GKOA 1CTNA 3G6JF 1AMXA 4GO6B 4R3SB 4NUPA 3RPKA 2W9DH 3L13A 3QT2A 2WLMA 1QR4A 2WMPA 3LKNA 1KENL 2Z64C 4KJYA 1BQHA 1WBZB 2GJJA 4X6DB 3NJKA 4IRSC 5ILTH 2C3VA 2VMJA 4FA8A 3ZX1A 3AITA 1FFTB 3HC4L 1ZLUK 2A6DA 2ZAIA 3ARFA 2AQ2A 4GRMB 4WEMB 4HH9A 4LCIL 4UIKH 3ZGHA 4MXQC 4MJ2A 5EIIA 4K8RH 4FFWC 1E4WH 3GRWA 4RDQG 5HYJA 4TM9A 3QXWA 5L0QC 2RB8A 4ZOEA 3LV3A 2D3NA 2ZWLT 5C2BH 4ONFL 4AMWA 5EZOL 1I85A 4N0CD 5D1QE 4U1MA 1WH0A 3BYYA 5EPMB 2H2PC 3DUUB 1N0XL 4JN1H 4Q58C 3VG0H 4ISVA 2W92A 4G1MB 2B08A 2HVKB 3HN3A 3IJHB 2MQCA 2HX9A 5HYJB 4NUJB 5JIMA 1XF2A 3RKDD 4OGXH 5L8LB 4Q6KA 3SGEH 3ZVVA 5M7QA 4F33B 4HCRL 4NQXA 3WN5C 3ARDB 4QTFA 4PWKA 2D7OA 3B2UC 5F1IB 2Y07L 2VDQH 4NZTL 2QPUA 3DXAD 3RTQB 2D9QB 2YXWA 2IADB 1URZA 4BFBD 3VW3L 1U8IB 2BFVH 4MBRA 1RU9H 3BOVA 4UI2A 5K39B 4ZW3A 3S4SG 1KZQA 3TN0B 4GPVA 3OJMB 1I9IL 2IQAA 1FLTX 4D9QD 1JNJA 3OR7A 3DBXB 5L4FA 3MRGB 3GIVA 3U9UA 2DDQL 4I13B 4N0UA 3L3OC 2DEXX 1FNLA 4GNKB 1QLRA 1UH4A 5JA8B 1TJHH 4HOMA 2B39A 3V5KA 2NW3A 3R7RA 3V8OA 3OR7B 1QR1B 3MNMA 3BXNB 3HN8A 1INQA 1XGUB 4F7MA 2O5NA 2E8ZA 3IPFA 3S35X 3B37A 4NWUH 2Y7NA 3L2NA 4YIQB 2P52A 5AVXB 1RZKL 2AJXL 5TE7H 4N68A 3RVWC 3CH1A 2Q6WA 4LOFA 1JK9B 1U91B 1VFBA 3QWNA 3TWCH 5EEUA 3N44B 2FJFA 3BZ4A 4YDIH 1KELH 5D1QD 1IBDA 1ADWA 1KCRL 4ZAKA 4ZS6C 3OJDA 3BMVA 1TTGA 4BDVB 3O9WD 1OTSC 3IFNL 4CW1A 2IMNA 2W60A 4R7DB 2IDCA 1ZGLP 4N2EA 1YMMD 4UB0H 3GSVA 4JO1L 3HR5B 5T1LB 4MA3A 5AD0B 3LEYL 1FSKB 2EIKB 1FG2A 3O8XD 4NZFA 2H3XC 3WUZA 4ZNEA 2IF7A 4FQIH 2GB2A 1L9QA 4YGVA 5D1ZB 4TTGA 5B4MD 3ULUL 3RYMA 1GC1H 3P77A 3WKPA 4XMVA 4R97C 2FQFA 5IB5A 1J9TA 3UFIA 3HMXL 2WSPA 4DGIH 2DJUA 4XWOD 4GSDH 1KBGL 4XC1H 3KXFA 43CAB 3MA9L 5DLLA 4YUEH 2AABL 2GUOA 4AIEA 4Y4FC 4U1LA 4A7QA 4YVNA 4KJWC 1R19A 3TV3H 4I0PA 1DUYB 3IMBA 2V7NA 2IJ0C 4CVUA 4H8QA 2VXVH 3Q1SL 1HT6A 2QELA 1LEIA 4IMKA 2DBLH 1V3JA 4NLAA 3MRKA 4PJAB 4B9CA 3MLYL 2B3RA 4U3HA 1T6VN 1LK2B 4IOSD 2F58H 4HV8B 3K46A 4JCLA 4U1NB 3HI1B 1KB3A 2GTWA 1M3IA 3PFUA 1OK0A 1HSBA 1M1SA 3EH4B 3W0WB 4ZXBC 3EYUL 3PAUA 3RQ3A 4BCXA 3ZE1F 1XTMA 3PAYA 3Q48A 2BHUA 4PRPD 3UDWA 4GRLB 2BSRB 4ANKA 4DP1X 1AZUA 3JV4A 4IBTA 3BRFA 4C56B 1NM9A 4QXWA 5I0ZA 1ETA1 1OVZA 1S9XA 4NFDA 4KJQC 1GCYA 4XB8A 4Z0BL 4ZW7A 3UEQA 2NY1B 1GZQB 2G2NA 3U82B 5KZCD 2LABA 1YNLH 2H2PD 3C09C 3HE7D 4E41D 5L9DL 5JOFA 2HX7A 3MNWB 3RTQC 4DEUA 2BVQB 3AU1B 1MCCA 3QQ3B 4NBZB 2DWXA 1BG9A 2Q3AA 1UT2A 2ED6A 2QSCL 2DH2A 4OZ4A 3ESMA 3WKNA 4X9IA 4XAWH 3SDXE 2LVCA 1R33A 1WZLA 3ARED 2J1KA 2R1XA 2ZKHH 1GZQA 2ZOLB 4I18C 4J8RA 3UO1H 2EO7A 1CD1B 1HQRB 1WUNT 2V5YA 4LP8A 3SDDC 1OQXA 1NCDL 4YSPA 3L3JB 4NDMA 4TV3A 1W0YT 4G42A 2JE8A 5FK9B 1NIBA 3C5JB 3WMPA 4XAKE 1DHKA 1CYWA 4HJEA 3QRLA 4DZBA 1SZNA 2X42A 3EHBC 3BDYH 4M6OH 4F92B 4N8CH 4ZSOE 3JZ7A 5JNYB 4YH6A 3B9VA 4APQC 2OTUB 3FUFA 2P49B 3BT0A 4X9FA 1AD9A 4OFDA 1NJ9A 3HG2A 3QNFA 1Q38A 4WUUE 4X6CB 4PW4A 1RJZA 4HV8A 4OF5A 5D5MB 3D06A 5AVZB 3IN0A 2XI9A 3QORC 2XVGA 5IT2H 4G6JL 4NJAL 5JORA 1YVLA 4OM0L 2H1PH 3SPVA 3PHSA 3FOLA 1Q90A 5B8CA 2ITDB 3H42H 2BSRA 5CGYC 3APDA 3A6CL 4RLDA 5C9JB 4LCCC 1RJLA 2ADJB 1KXHA 2WIIA 4M7JH 3EO0B 1CLOL 1VACA 3U0PB 1WLHA 3A47A 4CVXA 5I30L 3KJ4C 1MH5B 3LH8A 5CILL 5LGJA 3KPRA 2XBZA 1D9KD 4GS7B 4FCAA 3PWJA 2WKLA 3R4RA 1VFAA 1PY0A 1KLUA 3ULUF 1A5FL 1G7LB 5DFTA 5JW5A 1DQDL 2NT0A 2QPFA 5GRUL 2RGSA 3FPYA 4R97B 5EN2A 3RVUC 1FNFA 4M1DH 4WJ5A 1RU9L 5FLUA 2B4CC 1KTLB 1QATA 2XHNA 4Q6IC 5ADOL 2XPGA 3LRHA 1H8LA 3LPFA 3N1QC 1LVEA 3OAUH 3TEYA 4WI0B 4UTAL 2E0PA 1RZ8A 4F2ME 4XBEL 2QFRA 1ZVSB 4QTIL 4IBLT 4O58H 3T0WA 4JDTL 5TDOA 3SDCB 4IEFA 2BDNH 1M05A 5T1KD 2F7RA 5KBDA 2BNQE 4PRAB 4WW2A 4BK8A 3IB4A 3BFWA 4ODTL 3LN4A 1OAYL 2Y36L 1PD6A 3I84A 5HYQA 2Y72A 3VI3B 2QTVA 3JWOC 2A6IB 5DD5L 5I75B 4Y1AB 3ROOA 3B4NA 1BZ9A 2AANA 3ZJAA 4PJCB 2BVTA 2D03L 1TNNA 1S9VA 2DIEA 2CH8A 2A1WH 3HPLB 1EEQA 4JN1L 4B27A 2ZSVB 3U2IA 3UJJH 5FGCB 2MTAA 3OZLA 3WY2A 4LDLB 3MRFB 3P73A 2UZIH 3ILPB 3O6ML 3JQOB 5E7BA 2ATKA 4ENEC 1OGSA 1JVLA 4NNYB 3QEQE 4YQXH 2AERT 3QGVA 5IW1B 2W59A 1SF3A 1LE5B 2BVOB 4XWGL 4JRXA 4EN3B 4QJ4B 4YHYC 3QG6A 4BH7B 3MRMA 5F1IA 5C0DA 4HKBB 5IG7A 3IFPA 2EXYC 3FO1A 3ROOB 2AZUA 5JIDA 2CG9X 2GBTA 4LVNC 3VFMB 2XQYG 4OF6A 4PGCB 3E1F1 4OCNC 3E0GA 1PU0A 1JMXA 1GMEA 1IBZA 1XX9C 3HPLA 1LEIB 1OAQL 1F2XK 5EEVA 1FHGA 1WFOA 3LD8B 2ESVD 3INUH 1B6DA 2PO6B 4NHCH 1M2OA 5ENWA 3JV0A 3TN0A 1J8HB 4PVLA 3IS1X 3CSGA 5GRVK 4NJ9H 1BZOA 2QTEA 1JPTH 3AT0A 4ADGA 4U33A 3FO9A 3WIHA 4GT0A 4F7KA 4PJ5E 5EOCL 4F37K 2R0WL 2I5YH 1UB5A 3AACA 4TULH 3DSFL 3HE6C 1R1CA 5AALA 4WW1A 1EK3A 1NIAA 4MXWL 1Z9PA 3VW3H 2JKRM 2ZUTA 2PN5A 3PGCA 1F56A 3WNOA 4JMXA 1KSRA 2VR8A 4JCWA 3TS8A 4I3GA 3H7BA 3TXAA 1HWWA 2DTSA 2PWDA 3ZE0E 1YEJH 5IVZA 2G0LA 1MVYA 3OGCB 3BUIA 3ZTNH 1QA9A 5C0EA 3GKWH 4QTHB 3BP6B 3CFJB 4F2MA 4NGHH 3Q2WA 1E2VA 2W60B 2LT9A 1OAZL 5IVNA 5ALCL 3C6LD 3OKMB 3FFOA 4FX5A 4GMTL 5KN5B 2Z4QA 4PRID 3IDXH 3GSOB 4XZUA 5F88B 2ICWB 4LDEB 5C0AB 2HUHA 1L6PA 2ICEA 4OT1H 3VQLA 1NZRA 5FV1L 1N10A 5J06A 2NUPA 2OXGA 3KYOA 4MD4B 2PTVA 4L3FA 1MPAL 4NI6A 4FP8H 3D05A 4Q9QH 2FATH 2I07A 3B2UD 5HGAB 2MNUA 2DYSB 1EBPA 2R4SH 4JFOB 4FQ1H 3MRIB 4M5YL 4OCXH 5T3ZD 1T7VA 2W1NA 3EDDA 3RVUD 2CJSA 2HT3C 1DSFL 2XN1A 1RI8A 1UWGH 1A47A 5IHHA 3LJ3A 3OKNA 1JXGA 4PJ5D 1AC0A 2R69A 1DVXA 5ESQB 1ZHKA 4ETQA 1PKQE 3JWNG 1AP2B 1MJJA 5F3HB 3RVVD 4Y0GA 1YYLL 2EJ1A 3U36A 5DVOA 4H8VA 4DPRA 1KPUA 3ASOB 1S5IH 1IRAY 1XSJA 3MV9A 4O2FB 4X9HA 5GGRB 5TE4H 2IQ9H 4CU8A 4JHVA 3LQMA 3L6FB 4FLRA 1SDDA 4L37A 4OCWH 3VFSA 4ABWA 4D0DA 4X5XA 3V4LA 2Z3FA 2Z7UA 4A2LA 3BPLC 4S2SB 4LCVA 1DR9A 1EJ6A 2F19H 3V95A 1M05B 5JOEA 4K3HA 4IRSD 1KJVB 3QIWA 1YEHL 2VDPL 2OZ4L 3GZKA 2WZ6A 1NTDA 5D1QC 1DEEB 1GMIA 2FQGA 2G3MA 4LEXL 4MB4A 4XMXA 2OJEA 3OM3B 4O5LH 3ASWA 1FE8L 2VXQA 3SYPA 3O2WH 2CJ3A 1I3RA 1OGAA 3DMMA 1IGFL 1ERNA 4BE6A 1IBGL 2EKJA 2WVUA 1S9XB 2CPUA 3Q43A 3UYOD 1FFNA 4C56D 1SYSB 3MR9A 2XWCA 1Q0EA 3NCEB 5E2TL 2PETA 4OI7A 4XH2B 4LZKA 3FU5A 5TK4A 1ROWA 4AEIH 3KPRB 2DLFH 3IAGC 1UJ3B 2BCKA 4TSAL 3IRPX 2HP4A 1FFNB 3L4ZA 1D6VL 1LEGA 4F3FA 1OARL 3QPQD 3TO4A 2PO6C 3REWA 1ZPLA 2GEEA 1GAFH 1JZ5A 5F1NB 3AREA 1I4FA 4GQRA 1WRFA 3FXIC 1YN7B 3ULVE 1QW9A 4DP8X 1DO5A 5F9OL 1L9RA 4MJID 1TITA 3UYRH 1CQYA 1JGEB 5JQIB 1HESA 2DTML 1QYGL 3P9LA 3AJ7A 4WFEE 1IX2A 1IAKB 2QGBA 1PZ3A 1Q9LA 3DMMC 1LNUB 2V6HA 1HHGB 4EI6A 3KPNA 1HEZA 2HFGL 4D0BA 2J57A 1BWWA