4AJVA

Structure of mouse zp-c domain of tgf-beta-receptor-3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
167
structure length
152
Chain Sequence
TFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFISPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRNKGSQKLPKCVTPDDACTTFTKPLAVVLQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of a Novel Tgf-Beta-Binding Site in the Zona Pellucida C-Terminal (Zp-C) Domain of Tgf-Beta-Receptor-3 (Tgfr-3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords TRANSFORMING GROWTH FACTOR BETA RECEPTOR TYPE 3
total genus 27
structure length 152
sequence length 167
ec nomenclature
pdb deposition date 2012-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ajvA00
5BUPA 3QW9A 3NK4A 3NK3A 4AJVA
chains in the Genus database with same CATH superfamily
2DJMA 3MUHL 4WTZG 3EOAA 3CVDA 5EHFA 1J0ZA 5HY9B 1YEGL 3RNKA 4OQTL 1OVZA 1JGUL 4WI9A 2WANA 1S9KC 2EEDA 1KFAH 3ESVF 4W9FC 5IOPB 2Q10A 1KB9K 4R84A 4WI0A 3QCTL 1KFAL 4JO3H 3RP1A 5FGCE 4F7KA 5KAQG 4MLIA 4E9YA 4YZFF 3D0VB 2FE0A 3U6XA 43CAA 1UACL 2WO3B 5FGCB 1JZ2A 5I2IB 1K9TA 4UV7L 4R7VA 5BUGA 3SD5A 2A9NH 4GRWH 3GMPA 4NHCH 4GLRI 1SEQL 2WLLA 5LBSA 1P1ZA 4XB3A 1D5ZB 3KCWA 3ZDZF 1Z3RA 2CHZA 2I60L 1EFXB 3O0LA 5ISZD 1WEJL 4TNVK 5EBMA 3M1BB 2XTSA 1S5IL 3FQUA 1BPVA 3C5ZD 2M26A 4UINL 2HB0A 5D7LA 2K9UA 3MRRA 4HUNB 3ZKMD 5I82A 4DKAA 3O0RH 3QUXC 3V0WH 4S1QH 4LSSH 4HH9B 4E9SA 4WI8A 2DLHA 4WUKL 2NY2B 5HHOE 1W0YT 1JNNL 3JTTB 3FMGL 3FCSA 4H4NA 4KK5C 2Z35A 3OKDB 4P2RB 3UEZA 3FTGB 1QFHA 4CMHB 4YDLB 4ZTEA 1SNRA 3W81A 1HCZA 4M8QB 2JELL 2XTJB 3FQXB 3JVFC 4RBPH 3C5JB 4HPOL 5KVFL 2ZG3A 4NZDA 3FU7A 3WN5B 3QAZB 1WCBA 2OULB 2PCFB 4MNHA 4XCCH 4G42A 3T65B 3HE7D 3B56A 1FNHA 1Z0MA 3IJSB 3L3HA 4OZFB 3CHOA 3ARFD 3O9WA 4IOIB 4NKQB 4E9XA 3ZO0A 3U9PL 3TM6A 3QRLA 2FX9L 4P2OD 1TVBA 3QR0A 2HKFH 4ABQA 4NQED 4NBXB 4PJ9D 3BRDA 3HRZB 5SV4A 4FQQA 4A38A 4G5ZL 1BFTA 4PUBH 5I5MA 2WZAA 4XZUB 4QYAA 4AQ8A 3DYMA 1QSVA 3SJVD 3O6FC 5J3HC 3D07A 3EW3B 3ETSA 4H1LB 7FABL 1TT6A 3MUGA 3U4BL 2A6KB 2YQ2A 1R17A 2BH0A 3RVVC 2ZKHH 2J7LA 5C0IA 1A6WH 3P11L 3K6NA 4YPGA 1SXNA 1A7QL 4IIQB 4NZ8A 3S3BB 2O6FA 3BQUC 3SDXE 4JM2B 5KSBF 2WLJA 1HYRC 3MGOB 3D85B 4KX9A 4XGZA 4XPTL 1ZEAL 3RYMA 3NYKA 4WHYG 3D25A 4XXCC 4KPHH 2IQAA 5IMLB 2FO4B 3MLUL 2VDOB 4DFHA 1BF8A 4K8RC 3INOA 3L1EA 4Z78B 4PJBF 4G1MB 2FL5A 4AK1A 4I2XB 4G9FA 4YSQA 4AJVA 1A8JH 4YOKA 2DJUA 4D94A 5CU9A 2O6CA 3MRPA 4S1RL 1SYVA 2OMWA 1UXLA 5ICZB 2R0LL 2ALWA 2A73B 1XFPA 3PYCA 4HPOH 4ODTH 1RIHL 5CGYD 1NC4A 2PYED 5EZLA 1E65A 1NGWA 2XI9A 4XE0A 4BUGA 5HI4D 4QXGH 1MQKL 1KCRH 2HSIA 2IGTA 4I3SH 3QJTB 4HFWA 5ESQB 2CA3A 2OMYB 3VRJA 3B2MA 3BAEH 1OGSA 3HG0A 4YDKL 2IALA 1YCSA 4YR6B 3GIZH 2DB8A 3F7RA 3LS5L 2N0MA 1A1OB 4P57B 4LP4A 4I0PA 1FH2A 3UTTD 5E6RB 1VACA 2DJSA 2G9HB 3GZQA 1CL7I 3O4OB 1N4XL 3VCLB 4EIZC 5IB4B 4WV1A 3LNHA 3JV6A 2NY6D 3WO4B 2PYFA 5EPMB 5HD8D 5H8DA 4AQEB 1QW8A 4AJWA 5DJCA 3HNVL 2BX5A 5D8JH 4HHGA 4PJ7F 5AENA 1SBBA 1LQSR 2Z31A 5JIKA 3BSZH 4F7MA 8FABA 1AQHA 3KMDA 5DZVA 4YBQD 2YSSA 3WN6A 3BKCL 1YEHH 1QABA 4DGUA 5LVEA 3CFUA 5GRWA 4WO4C 4EI5B 5T1DH 4LSQL 4HWUA 1PLGL 4HOWA 1ZJAA 2WVUA 4CJ1A 1XGYH 4K07A 1VHPA 2ZIDA 4NLHA 4CSSA 4A1RA 1MIEH 4YHPA 1Q38A 1MWAA 1UT9A 2BVYA 4M6OL 3CFMA 2HT4D 3T71A 1AXSB 1HK6A 1LILA 1NMBH 1BZ7A 4KUZH 4BJLA 1XSKA 3HG2A 3QPKA 3CQQA 3ZSTA 4Y16C 1KYAA 1MI5D 3CVCA 4U6YA 3O3BB 4QJ3B 2GJZB 1JWUA 2DBLL 1K5NB 3QDMD 1JFQL 4ZW3A 4HIJB 1XZWA 1CVRA 1XHHA 3LKQB 3TYFB 3L1OL 4WU5A 2XOTA 3T6QC 1TJXA 3WL9A 3ZE1F 5B1BB 1TETH 1W2KT 4WW1A 1ZLSH 1G1CA 4HK0B 2B4CL 3O6ML 3ZHNA 4H20H 4ZO9A 4Y4KC 3CFEA 2DLTA 3P3UA 2KKQA 4IRZH 4C55A 5MENB 5CN2A 2GT9A 4XAWL 2IWGA 4YDVA 2ZUUA 1RUKH 3VFNB 1TR7A 1OK0A 1FNEB 4JN2A 2H32B 4BEIA 3DPBB 5EEWA 3IXAA 2XN9A 1U3HB 1JHLL 3CDZB 3GMRB 1E4WL 3DO4A 4GKNB 2J1WA 3WXVH 1CZ8H 4ZS6C 4GT0A 4Z1PA 4RQQA 1F8TH 1NLDL 2A6DA 4X5WB 4LEOA 3WIHA 4ICXA 1T89A 4H26B 4BWUA 5ICYB 4N22A 2Z93A 1G6RA 4ZRGA 1BSIA 3PWPB 1JNLH 4AYDC 3HI1B 1A1NB 4H25A 4LKXB 4TLKA 4UANA 3W0WD 2BNQD 5E7BA 5FFLA 1K2DB 4UDUA 1DFBH 4XO4A 2J44A 3FB7A 1KY7A 5C0DA 3PNRB 3A24A 3S96A 5DUPL 2NMSA 3BZ5A 4JHZA 4QO1A 4QTHB 1BWWA 4GG8A 1ZRUA 3PY9A 2C9AA 2QDVA 1VB9A 5KG9B 3ZL4L 2H2PD 1WZAA 4CSZA 4OQTH 1KEML 3LOWA 4J3OD 1U8NA 4BUHA 3RG1C 1X7QB 3VFUB 3AW5A 4FHJA 5CUSH 4OZHA 3CX5K 1RUQL 4XI5C 5KZCB 3KYKH 3R19A 1QFUH 2XWJA 4KKZA 5JYLA 2W65B 5JA8B 4WFED 3X3FH 4DEPC 3WTXA 2OXHA 2X5PA 1GVIA 3HR5A 4F8NA 5AEAA 2CJSA 4P23A 4YFLI 2A83A 4QRUB 3MZTA 1SRDA 1OP3H 2ISDA 4BDVA 5HGBA 1YJDC 5GISH 1MCRA 2QFPA 3SN6N 3RHWK 1BQ5A 3CSPA 2HPTA 5EN3A 4Z7QB 1QLRA 3IPFA 3ES6A 1ZA3A 1RIVL 3HI6L 4I3RH 2KHAA 4Y1AB 4CKVX 4HGMA 4ZZFA 2WBXA 2EDJA 5KAQF 3WG7B 5J11C 1TU2A 1U8HB 2CUHA 4Y1AE 1CDHA 1S8DB 3ABLB 3UH8A 4HFUL 3MQIA 4PTTA 3VFRB 3WO4C 4X98A 1WWWX 1QNZH 2K9FB 3KXFB 3MDJA 3IDYB 4RZCA 4W9LC 4IGBA 4JPIA 2FEEL 3GSRB 3R06B 1QHQA 2JIXB 5DRXA 1KGXA 3FULA 5LDSA 1UADC 2BIQA 4YHPB 3ASWA 4Z7VF 4DTGH 4RFEA 2NXYD 4HSCX 4AYEC 2L04A 4PJDA 5EO9B 4FLQA 4Z3IA 3VFSA 4KTDL 5DHMC 3BWSA 1B0GB 4O02H 4ZMQA 1O6SB 3WKYA 3B2VH 1OAXH 3GS0A 3M1BA 4QHKI 1FO0L 4LIQL 1J0IA 3AQDA 4XNZB 5DJZB 2Q8AH 1T5XA 1ZA6B 5D4HA 1A5FH 1BXVA 1EX0A 4DWHA 4M5TA 3ULVC 1OOAA 2EDQA 2NNAB 2KQMA 4XAKD 1M9SA 3JWDH 4RQQB 2AK4B 3KJ4C 4GT7A 1T5KA 3CN3A 4PBDA 1IC5H 2YPLD 1EH9A 1UZ6F 4KQ0A 3LNIA 2IFFL 1HIML 1MLCA 4PTUB 1U8LA 1OHZA 4POZD 1VACB 2G9HA 3QNFA 4I18B 2JXMA 3ZKNC 4XZ4A 3DPBA 4TXVB 2AJXH 3O8XD 2JI2A 1E28B 1AD0B 3IU3B 1P4IL 3W2DH 4FNLH 3CU7A 3CMOH 3CLWA 1LO2L 4OZIA 3OXRA 1YAIA 3O2DL 5CFHA 4TL4A 2BVQA 5C0AA 1D9KD 2H3XC 3IJSA 3L3HB 2UV3A 4OZFA 3SY0B 3W9DA 4C4KT 4RAUA 5K9QG 2PWFA 4LAQH 3HR5B 4E9VA 2JE8A 1NMAH 2VLJB 3MRJB 5TE6H 2BSED 5H37H 1B2WL 3BT2L 1MWAL 2A73A 3QRGH 2ICES 5CS7A 3MNVB 3T0VA 1HDMB 5T3ZL 3OJDA 4NN6B 1ASPA 2AGJL 4GLRH 2VDRL 5F21B 3U0TB 4OZHB 3OL2A 2BP3A 1MI5B 1KB5A 1KBKA 2VDOH 4GW4B 3QJUB 4Z76B 3ULUL 3LSOA 4R4FL 5DT1H 1K8DB 4OCRL 3LZQA 1KIQB 3QJHB 5D9SA 4M62H 2RMNA 3ROOA 2VDNL 3NIDF 3DX9A 4HGWB 3ZDYB 4M62L 1EDYA 3FTYA 2OR9H 2LGNA 2DQUL 2YLHA 5I1LA 2BZ7A 2D3JA 1N7ML 3VD4A 3FQRA 4EDXA 2D73A 5JTWA 3VTMA 5I1AB 5TGBA 1ILSA 1JBJA 4M00A 5GGUB 3WE6A 1GYUA 5DHDA 3V6OA 3BWUC 4K7PX 3CLFL 2AQNA 5HDWA 3FONA 3N04A 4KQ3H 1S9YA 3SDCD 3PL6B 5IUSA 1LM8V 1DBBL 4P4KC 3MUGB 3X1NA 3IBEA 2VUOA 4Q9QL 3GI9H 1JNNH 1NMBL 1ZSDA 3HC4L 3L5JA 3RWHA 4N9GA 1FC1A 3RX9A 3RWFA 3EIFA 5HPMB 5KBNC 2G75A 5E9AA 1RPKA 3U25A 5J13B 1M7XA 1CLYL 2JCWA 3ELQA 1QO3A 2XICA 1XR8A 3WNNA 4LPVA 5IB1B 3ZJAA 1DN2A 3U36B 4JFFA 5JIHA 2Y9RT 1L3WA 1FSKB 2IADA 3QUMA 4X6DE 4H7VA 1DBKL 3RGHA 1SMAA 4QLWA 4I0PB 5EN2A 4ES9A 1FBIL 5BRPA 5E70A 4M1CD 3FUMA 4X8XA 1JTPA 2IMNA 1VZGA 2PUQT 4N0FB 4CNIA 5I6MA 5E8PB 5C6TH 4L4VD 2OMYA 3OJMB 3VRJB 3QRFM 1HKLH 1WCBB 3UEQA 3UPRA 1JZ3A 2VM3A 1OAQH 2NW3B 3SDDB 3QJOA 5D7HA 2ITFA 1KPVB 5K59E 4EN3C 1WO2A 2QGBA 5LXVA 2A77H 2R39A 4YHZL 3S34H 5D70L 3MNWA 2OMWB 3MBXH 4UOZA 1Q0XL 2YWZA 4P46B 5E1QA 5FHBH 4QPEA 4EDWH 1K4DA 3KJ6H 3ESNA 1PZCA 1YC7A 4V33A 1ZE3H 3KW8A 4KJQD 2F19L 3HFMH 4NIYE 5HGDB 2X4QA 1NLBH 1SOQA 3GJFA 5C86A 3MRLA 2LAGB 1G6RH 2JTDA 4BHUI 3GUTA 4OI9A 3KPLA 2EC8A 3V95A 1EJOL 4MMYB 3TVMB 4NZTL 4HJ0C 3VH8G 3JWDC 4MB3A 2W0FA 1ETJA 1FG2B 1KPUA 4G80B 5IM7A 3FFCA 4HD5A 2PABA 4WGKA 5EBLB 2X53A 4UF7C 4GRLD 1S9WA 2HT3D 4XP1H 4YSOA 4TVPL 3T0AA 3UO1L 3HNTL 3KYMA 2FB4L 5DFTA 4Z0XA 4HS6B 1AKJD 4N5EC 5E2WL 5I16B 1ACZA 5E2TH 1Z5YD 3MREA 3GSVB 4PJ8C 2ZOKB 2D9CA 2J4WL 4OD2B 5I15L 3D12B 4E42A 1DDHB 5E1AA 3TBBA 2VMJA 1F5WA 3GXDA 3MOBL 2X10A 2DKUA 3ISWA 2XV0A 2ZX8A 1PFOA 3C2AL 3GI8H 2VLMD 1IC4H 5MEQA 4XH2A 1DANU 3BCDA 2WKGA 4NUJB 4PJIA 1C5CL 4OKVB 4C54A 2D7NA 2VZSA 4ODUB 3MJGX 3GNML 4YJZL 2ZKHL 5K1NA 3STZB 1J48A 4OIIH 4XMKH 4YHYC 2LOEA 3MLVH 3NZUA 2ETWA 3MV9A 3VWKA 4ADIA 4GXVH 1CBVL 4MMZA 5GGVL 4GBXC 3ZU8A 5BXFB 3LRSB 4LU5H 2IAMC 5I1LB 1MJ7L 1IAIM 1OCWL 4FERA 1G0XA 1BQHA 5E6UB 2NY7H 4BHUA 1IBBA 1XL6A 1F3JB 1NGZA 1SF3A 3BEVA 3BH9A 1JPGA 2E7CA 4TNWF 2HAZA 2PTTB 3QI9C 2VL4A 4M48L 4WUUD 1AHWC 1U21A 5FA4A 1H3XA 4LCYA 5LNDA 5IQOA 1B90A 2NQCA 3BGMB 5SX5H 5FUOL 2DQDL 4APQA 4K3DH 2VE6A 3L95B 3FOMB 1YEHL 1FNSL 2AP2A 2ZSWB 2Q76A 4P3DA 4C56D 5T1LD 5EF1A 3HPJA 1ET7A 3L17A 1PG7H 1UD4A 1KV3A 4AQ1B 2IBZY 1IEHA 4FFZH 2NY0C 3I75B 1Z2KA 3T9WA 1D5XB 3R1GL 2F9BT 1T7VA 3HZKB 3K8LA 2RBLA 1SBSH 4L1SA 1ZGLB 1ES0A 1UXSA 3BSHA 4EZLA 3CVBA 4BZ1L 3K4ZA 5EF2A 4H1LA 4XHJC 5CJOL 2VB5A 5F1OB 2RAMA 1JWSB 2YMOA 1T0MB 2NY0B 2Y1ZA 2R1XA 1Y18A 2Z4QB 2X4PB 1OARH 4QHMB 5DD6A 5IB1A 5KYYB 3CZSA 4NP4H 4ZUWA 5CD5D 4JO4H 4O58H 3PREA 1MW2A 6FABH 2P5EB 3EFFA 4PTUA 4MD4A 2R1XB 5BS0D 7FABH 1N8ZB 1YYLH 5SX5K 1TNNA 3IDJA 4P3CL 1EV2E 1RZQA 2O5YL 4L5FE 3QUML 3L5HA 1B3JA 2KT6A 3CSTA 4Y19B 2DI8A 1AXTL 1J1PH 2GJ6E 5IIEB 3SDXB 3S37H 4K3HA 1H8NA 3QORB 2VT0A 4MQTB 3TFKD 2J3SA 4TNVF 4MD0A 3V8CA 1MELA 5FYJU 1J1XL 5LDUA 2BM3A 1A6TA 4NQVA 2H32H 3P4LA 3K0YA 1B88A 1ZLVK 4EVNA 3CDGB 4IDLA 2PTVA 3P02A 1FFOA 5C08A 3WDIA 3X14A 4L1HA 3MUJA 5FW6A 2C9QA 3QUHA 4NCDA 4PRHB 1ZVYA 3KH4A 4UIMA 1FL6B 5K5YA 5GS0D 3SBWC 4U2ZA 1K8DA 2K6WA 3MJ8B 3CLEL 5GZND 2DQIH 3C5ZC 2Y06H 3C08L 3L4XA 3DDGA 3DO3A 2BP5M 4G71B 1F3DH 1JRHL 2X1XR 5AW5B 5GS2D 2PR4L 4S1DC 1N64H 1S8DA 4MMZB 12E8L 2B1HL 5JHDE 4JMXA 1DQQB 2D31B 1NBYA 3MV9D 3CN0A 5ACZA 1GOFA 2CBQA 3V0VA 3WFEL 5LHDA 5JHBA 2F6AA 2WLLB 3HRPA 4WQOA 2X87A 4KRPD 1NCHA 1JXDA 3F7PC 3X1FA 3C60C 4LVOB 4S0SD 4A55A 2NTFA 4JY5H 2B1AH 4JDZA 2VLKA 4FYRA 4TQEH 3MNZB 5H2BA 4ZFGL 1E40A 4R0LA 5HI5D 3COOA 3D3VD 1YECL 1RERA 2YQBA 2FZ3A 2O6EA 3HE7C 5J6GB 3QIBB 3RWIA 5F1NA 4P4KA 5TE7H 1X5MA 4X2UA 4HJJH 3AITA 4BZ2H 2QKIA 2YAFA 1A7OL 1T1ZB 4P2OC 3VQLA 1R24B 5T5FH 1IGJA 4LVHC 4JFOA 4YMPA 1Y6MR 1ZV2A 2A74B 3RFZA 4RNRA 2WWOA 4WFGE 2V9RA 4KKCC 5SWZE 3D5OF 4UT6H 3V5KA 4Z7NF 2F7PA 3PDOB 3NRFA 4WW2F 1AP2B 5CZXC 3NABL 2JJTA 4W9GC 4LKCA 3QIWA 1J1OL 1S3KL 3PV6B 1LE5A 1A1MB 3H9HA 3K6DA 4FTVB 1WBYB 2AJUL 5KVEL 1DQTA 3MRQB 1D9KB 2WXGA 3X3GL 2X0UA 5C97A 5J5EA 2VRAA 3DJZA 4BFEA 4GUOA 2YRLA 1DJIA 2A9AA 4Y9CA 4PJAA 3JWNG 1DVZA 2XWZA 2IDSA 3T0EE 5DVPA 1AHWB 1BAGA 3GMOA 1UKTA 3WNLA 2OK0H 1JP5A 4GMSL 1I1CA 2BVPA 5E1IA 1H5BC 5EUKB 1CTMA 2DM7A 5F89A 4F8TA 2I26N 1F13A 1N2RA 3P9WB 2Q5BA 2CXGA 2G5RA 3JV5A 5F0JB 2XRAL 4JN2B 4K94C 4BFKA 4R2GC 2ZXQA 4B9YA 4S1SL 4FI7A 4JMNA 1AS8A 2B3IA 5K9QI 1ECYA 2EDRA 3U9PH 1MCNA 4GG6F 3O9WC 4HKZA 1EGJA 3H7LA 1CICB 3ZT5A 4N2IA 5HHQB 5FM4A 5IOKA 1ILUA 4E5XB 5C0EB 1W72H 2JFCA 1HHJA 3MRKB 5GPRA 4G2AA 4JDVA 4WI4A 2A6JB 2VERN 2YQ3A 1CVSC 3SZ6A 3VXOA 5IEHA 3BHBA 4OY9A 2VXQA 4ICWA 2RH0A 2NXZD 5DWUH 1ETB1 2QADD 3CSYB 3PGDB 2WBJB 4JFDE 4IBYA 4UNTA 5F71A 3IE9A 1F4AA 2NY6C 3ESOA 3T0EA 4AWJC 2VSMB 1AGEA 4M7KL 2Q7YA 3B9KA 4F9PC 2EIZB 5JPMA 4I13B 1B0GA 1UJ3C 2VISA 3QEQE 2HKAA 5ITFB 1OB0A 2EXYC 3QDGB 4YFEA 5I5IA 1M1XA 1CPUA 1Q9LA 3N0AA 1SJEA 3L7EB 5K9OB 2EDHA 2J43A 4LEOB 1E90A 4JE0A 4DAGH 1IE4A 1T66C 5IFHL 3IFPA 3H7BB 5CEYA 4JFOB 3NAAH 2JCCB 3EFOA 1FPTL 3OX8B 4U1SA 2XY2A 3CFKA 5E99L 1UZ8A 5AD0B 2DWDA 1NANI 1SM3L 1CGWA 2B4CC 2DYPD 3G6JA 4KTGA 3OSVA 1O7SA 5CCKL 1JSYA 4L37B 4PRPA 3MHZA 4R97B 4DP2X 3EH2A 1PZ3A 2EH8H 3VYOA 3UDWC 1TYRA 1KJ3H 5C3IA 5INCA 4MAUH 3T6WA 4G3YL 2WXLA 4PMEA 1OGTA 3O6KH 2HVKA 3PIQA 4WU5B 1QATA 4F57H 1KN2L 1DTUA 2WD0A 3GI9L 3EBHA 3OLIA 2VLKE 3S8FB 5CILH 1KULA 1X4YA 2WZ0A 3CZJA 2MQCA 4J4PC 5BVJB 4QHPA 4YBHA 1FL3A 3MBED 4GAAA 1FZKA 2YIHA 2OV0A 4UUJA 5K39B 1A6AA 4RMWA 3VWJB 1M7DA 3D51A 1KIRA 4OGXH 5DK0B 1UXWB 3WLBB 5BQ7A 2O5YH 1X7QA 3N43F 5ALBL 4PY7B 1I8MA 2ITDA 5AW4B 1T4KB 3D4CA 3IJ7A 5DGQA 4EI5C 1EXHA 1CGVA 3HPLB 3IMTA 2HFGL 2Q86A 3ARED 2EDEA 1AD9B 1KGJA 1P6WA 4IS6B 4JO1L 1A1MA 3H9HB 3D05A 2BW4A 2UXVA 5C3LD 1AGDA 5D5MB 4KJPD 5DHVB 5E08H 1I3VA 4AYID 1I53A 3P4NB 1RZJC 4Y4HB 3H6AA 1ID5I 3QG7H 3UJTL 2VQUA 3O81A 3P3YA 4OZGA 4BZ1H 1PZ2A 2A6JA 4DVBA 4WSKA 1NIEA 2XQ0A 3QIUD 1OD9A 1KZQA 1R19A 4V2CB 1KIPA 5E7FA 1QRNE 2R1YA 3R7RA 2MMXA 2OCCB 1JNHB 2VDQB 2JB6A 5I1GL 1FP5A 3EYVB 4OFYD 3BDYH 1QRNB 1RSFA 4K55A 3SPCA 4IMLB 2IG2L 3RZCD 4KTEH 4X8JA 4LPYA 1MVYA 1BQUA 3KM1A 3P0VH 4W6WB 2BHUA 4K3JH 1O9VA 4MAUL 1IFRA 3BE1L 3SYPA 4LSVL 5MEPA 2DS4A 3DROB 3HAEG 1UXSB 3LB6C 5KSAD 4Y7OC 3S6CA 4OM1H 4BDVB 4ZI8A 3BVNB 1S7WA 2VXTL 1JGUH 2E74C 1AANA 2YRZA 4MXWL 5DJYA 2NY2D 1P7KB 3FB5B 4PJGA 4GSQA 4JLRB 4XCNA 5CD3B 1BM3L 5F96H 2ZONA 4Z7NE 5DRNA 1IJ9A 1JWUB 4FXGB 1ECZA 3F58L 3SGDI 3WV0A 2I7SA 4OLZH 3IJHA 3MJWA 3SJVE 5T5NG 3N85L 4PY8I 1CQKA 4YHLH 3MVSA 4KI5F 4CVZB 3WE1A 2FQFA 2GK0B 3T2NH 4W9CC 1ZLUK 3CZLA 1GRWA 4IBUA 3DV6A 1FFOB 5C08B 2WLNA 3VXUB 1JVOA 1KXQE 4TUKL 4XCEB 4WFHE 4F2ME 3MLSL 1AH1A 3VXRB 2WGNB 2AV7A 3FDWA 2X70A 2XHNA 3P9MB 4ODHL 4PBWD 2WXNA 5EBMB 3Q9QA 4KK8C 1P69B 1C12A 5DJDA 1XZ0A 3P0GB 3QG6B 4CU8A 3EO9H 3LNEA 2YGNA 3NIGF 1OP3K 4RNRB 1DUYA 1OP9A 2DQCL 3RVWC 3UP1A 5LGHL 1MVUB 5CAYB 2RJMA 3ASOB 1E4JA 1IJNA 2FBJL 5ID1B 2OBGA 4BKLA 5FUCE 4XO3A 4AIZB 4WWOA 1K4CA 4XMLH 4W68A 5EWIH 2VXQL 1NCAL 4H44C 2KDYA 2W9DL 2XPGB 1SLUA 4OD3L 3VCLA 5FYKL 4ATWA 1I9IL 4TMPA 2WXJA 3K1KC 2ZKMX 1Q90A 3N43B 2HG5A 2CH8A 1T7YA 3QW9A 4OCLC 3OF6D 3QGVA 3MREB 1QQDB 3NN8B 3IRZA 3V4PL 4ZZKA 4HGKC 3HCVA 2QTVA 5DT1L 5AWNH 5BO0D 1D5XA 1QBBA 4GUQA 5J06A 3IDYC 4M93C 1R3JB 2AXJA 3HKZA 5EOQL 1T2JA 4MJ6B 4TRPH 1NC4B 2C8NA 5DXWA 2Y23A 1QFWM 3FTZA 5ANMA 3OF6A 4Y2LA 4PW9A 3LRMA 1UYWH 2XACC 4MMYA 4TL5A 3EAKA 5EU5B 1ZK5A 3ILPA 1F6AB 4M93B 1D6VL 1U92B 1ZIBA 5C0FA 4ESKA 3M07A 5J12C 3BMWA 1KLUB 1RSYA 3SKJL 1NANH 1D7FA 3J27A 4JFUA 1CFSA 3MMEA 5D2NC 3HA0A 1QX1A 2QPUA 1YEEH 3E0GA 2ZUYA 4OZ4A 2V33A 4YDLC 3MNWB 1QLEL 4UT6A 4XOCA 3T8XB 3AGVA 2ZUSA 1CLOL 2KPWA 1G94A 4X7SL 3S4SA 3V6FA 5KS9E 1XGUA 3RA7H 4L3FA 5C6PB 1NMCB 1JXGA 1A5FL 1EAJA 5E5RB 2Z31D 4U1HA 3ARSA 3P69A 5JOPD 5F7FA 3UYRH 3KPOA 2AQQA 1WVZA 3PAVA 4WF7A 4OKVA 1U8CB 1M05B 3D0AA 4HC1H 5E8DL 1B4RA 1G84A 1BZ8A 1P4LB 1PZ5A 4XN7A 1J8SA 2AJYH 1NKGA 2X4PA 4QHMA 3SDCC 2NT0A 1IGTA 1CYXA 4X42A 2HJFB 5L8LB 4QEGA 5DVOA 4S1RH 1EQWA 2WY3B 5CNHA 2WLYA 2BSDA 1VFAB 3IN2A 1P5VB 3T0DA 2MOVA 5HYJA 4L8CB 1CLVA 2QMJA 5JPNB 1PDKB 4JFFE 4P3CH 4R7NA 2C7UA 3QWOA 4U0QB 4AIZA 1U6AL 5ESAB 4OGZA 4AV4A 2WXRA 1MUJA 2R0WH 4QRPD 2NCMA 2OMXA 4CBPA 4AUJA 1P6AB 2WQSA 4GY4A 1R0AL 2X2HA 4J8RA 3S0PA 1FORH 2AKRA 2DICA 4OJFL 1ZGLM 4TV3A 4IU3B 2W07A 4J3VA 1B2WH 1PGRB 1MEXL 3BT2H 5IM7B 2CRIA 3MJ7B 4DPRA 2PYEA 5JIIA 3CVHB 1MJUL 1JVLA 1W16A 4K8RD 3BAWA 3H4HA 5L2KD 3WIFA 3QQ9D 3UJIH 5GRJH 3B9AA 3SQBB 2XG5B 1R33A 2VE6B 3L95A 3HG4A 3OKNA 4HW6A 4G7VL 4I4WA 4XCFH 5DJ0B 1MHHB 1D6VH 5J56B 1I1YB 2BY2A 1P2CA 1OAUL 1PQZB 1QBAA 2IGLA 4MNGA 4TLTA 5KYXA 4ZDHB 5AZ2L 1UXMA 2MHAA 4D3CL 5BO1L 1IARB 1T1XB 4M7LH 5DYFA 3ZKQD 5T3ZD 3U7WL 1MCOH 2JJSA 3PL6C 3KPQB 2IGFL 2GJJA 3LRSA 2W59A 3W0WE 5I18H 4HBCH 3MNVA 2PF6A 3FU5A 1FDLL 3STZA 3QUZD 1UUSA 2UZIH 1K72A 3GM0A 4X0NA 1LO3L 2R9HC 1GZQB 4I9WE 5E8PA 3BESR 5J1AB 3QEUB 3CZUB 3DDFA 3SOBH 2V3DA 3BAJA 3GSOA 3ATBA 4O51B 1GZPB 1IFHL 3BWUF 4S2SB 2VUKA 3FFOA 2BOCB 1JUFB 3LZOA 4Z3HA 4XVJH 3TO4C 3UCRA 1U8MB 1RULH 2X6BA 2EABA 1W8OA 2AERT 3ULVL 1IM3A 4W6XB 3SO5A 1NC2B 3EDJA 2GJ6B 4OU3A 4OLVL 3P3RA 2QZ5A 3MBEA 4HKXA 3WJMA 3APMA 3ARFA 3MFFA 1NZRA 3V6FB 1UHVA 3AB0C 5I71B 2VR9A 4OCYH 4TUOA 1KELH 1UOKA 3MRDB 5BZZA 1GYVA 1P84J 2BINA 2IBGA 5KVDH 2JLLA 3DVNA 4JKKA 1QTYT 1FNGB 1RZPA 1YZZA 3RIFK 4D9LL 1FG2A 3PE9A 4JANB 4F58L 3FSVA 5KS9A 1FNLA 4OZ4B 1RURH 4BQ6A 5FO8B 3NTCL 4ELMA 3ECBB 5FCSH 4JO2L 1MFUA 4L3AA 4NYLA 3I02A 3DX9B 4CKQA 2Y24A 3F04A 1GSMA 4JG9A 3BP6A 2DQIL 4HKBB 5IT2H 3A67H 1JI1A 1MFEH 2MPAH 3SOTA 1FIGL 1T4KA 3BKML 3MV7A 4P2CG 5J6HA 3NSXA 2MEJB 4EZMA 4JPWL 4Z76A 1LE9B 3IN0A 3QO0B 2WUCH 4K3DL 3OKEA 2DQDH 3L9RA 4E9LA 3ME0B 2NY3D 1FVCB 2PCYA 3QULB 5C70A 2A4CA 4M8UA 3K5SA 5L4IA 1L0YA 4DKFL 1BFVL 4X9FA 1M7UA 3HC2A 5BCAA 3DBSA 3SE3A 3NCFB 1NMCC 3S3JA 5D2LF 1D5BB 2YD6A 3WJMB 2Z7UA 3A23A 3SB3A 1JDAA 2ZYIA 4MS6A 3RTQD 1MZYA 2L7EA 3RKDD 3TBWA 2RCSH 3FQWB 1KEGL 1SN2A 2Y69B 1IGML 5HGHA 1VLXA 5MERB 4U1NA 4XP9H 3L13A 2EICA 2XLLA 5EOCH 3IGAA 2CHXA 2VR3A 4AQZA 1E9QA 2VR6A 4M1DL 1N19A 3ARFC 3KGTA 3IS0X 1TLMA 1HOCB 5JPNC 1QEXA 2LE9A 3OJVC 3ARQA 3GSVA 3FTWA 1DBKH 1TZGL 4ONHB 3TH4T 3ECQA 2NNAA 2EVIA 5HY9A 4JUSA 1TNMA 1U3HC 3QDJB 1WFMA 5E4AA 4YBLB 3PGCB 5HHPB 4F27A 2FLBT 1MCBA 2DH2A 3TBSB 1IQWH 3FPYA 2XWXA 5I23A 2D3NA 1PKQB 3FU6A 4P23C 2A0LD 4UMGA 1JK9A 2AMGA 1KGWA 5I1KH 5C07B 4D0DA 3VO0A 5EU6B 4FRWA 4R5XA 3CN1A 1QUPA 4EDXB 4LLWA 2XWBA 4NGHH 4DP7X 5DJAA 4J27A 4D0CA 4LAJH 2XZCL 3FO2A 2XQBL 3VGDA 4F2EA 3ZHLA 1P2CB 2J1KA 2SEBA 1II4E 4HCFA 2ZF8A 5E56A 2ED9A 3HNSL 1UXWA 3WLBA 4BK4A 5JW5A 2BHFA 2PP9A 1UENA 1WAAE 1DEEB 5AYQA 4JM2C 4QRPB 3B34A 3VH8A 4Z77A 4Q2ZB 1EHNA 1JWMA 3GFUA 4PWHA 4DERA 1BWMA 3PWLA 4P4RA 4FEIA 1ULVA 4MCYB 1J8HE 1LO0H 3I9GL 4OCWL 2QVMA 2VKXA 1ETA1 2WIIB 1CXEA 2ICEC 3IDUA 5DD1H 4BSVA 3MUY1 2VLJD 1T83A 5A3IC 3MYZA 4XX1E 4X7SH 5D1XA 3ABKB 3RWEA 4AYSA 1CGUA 5E4EB 4EI6B 3BVNA 3DKHA 4WEEA 1TZAA 5CEZL 4HK0A 4PCYA 2R4SL 1AD0A 5IJKC 4UOQA 1MWOA 2P5WA 1M6OA 3GDCA 2XIDA 3TEXA 1HVXA 1SVZA 2N59A 5GQBA 4H0LC 4PRPB 5CN1A 2WXPA 3B2XA 3CX5J 3GSUA 2A9MH 3C60D 3FT2B 5HJBA 4NM4L 1ZLVH 4YEEA 3ATAA 3IF1B 1FSKC 4XNYH 1Z9PA 3DV4A 3IMVA 1JNHA 3X13B 1BD2D 1ZSDB 3RWHB 1MJ8L 5EO1A 1KB3A 2OR8A 1N67A 4HIXH 4NHUA 5IVXA 1MVUA 3US0A 3D3VA 4NQCB 3N1FC 1FORL 2AEQH 2FWOB 2VZOA 1O6SA 4X9IA 3Q3GA 1NGPH 1C12B 3UYOD 3GEFA 3WNIA 4EN3B 3KPPB 5DZPA 2IDCA 3QDGE 2X89D 2Y25A 3SBPA 2X4RB 2F74A 4QWWC 3WKNA 3Q3GB 4KMTH 3KL3A 4JFSA 4JKMA 2V17H 1FO0H 4LIQH 3HE6A 1BEYH 4U6HA 4TUJA 4MA3A 3TZVC 3MGTA 3QO1A 1NBQA 1UJTA 5F7HA 4NFDA 1OSZA 3H3PL 5C0FB 4FFYA 4NXSA 4HCRA 4CC4A 3HC3L 1X5XA 1NPUA 1ORSB 4FJ6A 4A7QA 4XXWA 4RVBA 2BNUA 1S7RB 4DW2L 4UB0L 2IVFC 3II3A 4X9HA 1MFCH 2X4TB 1OW0C 1URLA 4KTYA 1A2YB 4U6XB 2F53A 3H42L 4U6TA 3SY0A 3W9DB 4XX1G 4ZK8A 1B9ZA 3APNA 4UILL 5FOJA 4L4TD 2GIMA 1CXHA 3ES6B 3QUYC 1V27A 3EG9B 5LGYA 5LCVA 5CWSA 4O5LL 1HQ4B 3RUGF 4HUCA 4ZMVA 5I6XC 3GLAA 2ZX5A 3LRKA 3VGGA 1AQMA 4IDJL 1BQKA 1TPXC 5KANG 3C8KA 4ZQKB 4KHXL 2LTQC 3KWWB 1UA6L 1HHIA 1RZ7L 2B1OA 4GAJH 5CJQL 3FCGA 3S96B 3HUJF 1KCSH 1X5IA 4B3EA 4X4YA 1TJMA 3OLDA 1IAOB 3OLGA 4G8IB 4O02A 5F9JA 3BKJL 2NXYB 3B3IA 3GYRA 4Z7AA 4M7ZB 3V0GA 4NNXA 3VXRA 3UO8B 2GC7C 2JF1A 1K2DA 2BNQB 4FZEH 5CBAA 4HLEA 4EUPA 3OHMB 3TFBA 4RFEB 3RWCA 1AGCB 1H3WM 1EBAA 1LK2A 1VEPA 4NQEB 4WJ5B 3JWOL 1AO7B 2RIKA 1TENA 4I3SL 4BD4A 1TSRA 4L0PB 4CDGC 4CGUB 4WUUE 2X3BA 4UTAA 4OCSH 1T20A 2R29A 4YHOH 4Z7OB 5AFAA 4JS7A 5BVPH 2R0KL 4GW1A 4Z5RB 1NCAH 4FQ1H 4MB1A 2LLLA 3QQ3A 2W0PA 4PHXA 2R2HB 4ZUWB 4NSKB 4OF0A 1T6VN 1A1OA 3ARGD 3IEAA 3KGUA 3EXLA 1IX2A 3S35L 3SBWA 4PRNB 2H6PA 4OZHF 1TQBC 1OGAD 1VFBB 2CR6A 1BBJB 2XDHA 3HEIB 1KXTB 1BMWA 1S7TA 2AAAA 2HT2D 3HNVH 4G8EA 1DQQA 2D31A 3MFGB 4XO9A 1FZJA 1K5NA 3RJOA 2YUWA 1V3LA 2B8OT 3O45B 2AANA 3FXIC 2BRQA 2QZQA 3S36X 3W5MA 1RZKL 5T1KB 3P4MB 4HHWA 1PY0A 1UM5H 5DZAA 3CXDH 4ZXBA 1WZ1H 3WIIL 4OGXL 5C9KA 4JQVA 4PV1C 1YDPB 2F5BH 3OG6B 2CK0L 3GHPA 4UQEA 2GIYA 4PLKC 4UIMB 1NCNA 5I6XB 4KKRA 4GKLA 3MGTB 4NHCL 3DSNA 4NO0A 1YAZA 5LBVA 4ELMB 4L8BB 4EO5A 5JDSA 2VN5A 3QT2A 1AKJA 5I1JH 2WB7A 3N41B 1H3VA 3B1TA 2HT3C 2I32A 3LJ3A 2H2SC 5AW7B 4EI5D 3KPSB 1EK3A 3HUJA 5C2UB 3QZWG 3TWCH 5JHAA 4TN9A 2A99A 3KYAA 5LN4A 4YH6A 2XWDA 4FHBD 4OBSA 2EP6A 3SGEI 3C5ZB 1T1ZA 1P5UA 4RWYL 3MLWH 1WUZA 4TVSa 2IQ9H 1PLBA 5C7XL 3QCVH 2GEEA 1V3JA 4PJCF 4QR7A 4N90E 1JS4A 1MCWW 4BSWB 4CADA 1BLNB 2ED6A 2CKBA 4KVPA 3CFBB 1GC1H 3ZSSA 4EOWL 2YKKA 1T2QH 3SYCA 2PNDA 4DZBA 5EZLB 2QPEB 4DT2A 5I76A 3RZCC 2V8MA 5HJDA 4PG2C 4J3WA 3VXNA 2H5UA 1W80A 4NQDE 3AFLA 3LZFL 4K9EC 4AEIH 3DECA 4L4VA 3FCUB 5F8QC 4CMMA 4N8VG 3OKEB 2OYMA 4HCRL 2NDGA 1OM3L 4HT1L 4ZFFA 4ZXBD 4D2NA 2W80C 3KJ6L 5ES4B 4J2XA 5KBDA 3HFFA 1VAHA 3ZZLA 4DCQB 1JF5A 3B9KC 4AIEA 4F9PA 2OSWA 4PY8J 1PQZA 2DQJH 5A2KH 1E3ZA 4Z7WA 1PJ9A 3CK0L 3H0TA 2V5TA 3D4YA 4AZUA 2M83A 5I26A 4PRHA 5CLWA 1J0JA 2X4SA 3GMLB 2E86A 4H8VA 4YSEA 2F08A 2CJ3A 3HHSA 4EBQH 1E67A 4FQIH 3GSWA 1BAFL 4IKLA 3STLA 4K7FB 4D0DB 2G5BB 1M2VA 1IGFH 5FGRA 5DO2C 4X83A 3GLDA 5GRVL 3ZYIA 4KPHL 1EXGA 2MJWA 4FXKC 3HZMA 3SQRA 2ENYA 3UG4A 3VD0A 4X4XB 4NWTH 1KBPA 1QFPA 3GDBA 4Y5YA 1HHJB 3MRKA 3V4VH 5D71H 3DRQB 1ZHLB 4XB7A 2P5EA 1DFXA 3IFLL 4GQPH 5EDSA 4NO0D 3HG1A 4R7XA 1HOCA 1N8ZA 5IJVA 1H5BB 1G1YA 5HHQA 3WMQA 4JFFB 4H8WL 2FYYA 3N9GL 3G08A 4CA4A 3HG1B 3GIZL 2ENPA 1DQMH 2I27N 1PX3A 4Y0GA 3D30A 1XSJA 2Z4TA 5C07D 5DI8B 1JZGA 5A16B 1T0OA 4Z7UF 1TMCB 4AIOA 5LWYL 3NIFE 3LH8A 2BSEA 3BCFA 1MEXH 1IV8A 5JW4Q 3SE6A 4FFTA 4JJHA 4MXVF 2JMRA 3KLDA 4Y4KA 4X4ZA 2YKLL 4BFIA 1R3LA 4MBRA 3ISRA 5L2KB 3GSWB 3STLB 5I19H 2OSXA 4H8PA 1KJ2H 1B0RB 5GZNC 1E27B 4A7UA 1F58H 1JHTA 1U95A 4JJ5A 4NZUH 1ZT1B 2G4EA 3S88H 3ARGA 2Z1KA 4G7RB 1CLOH 1JPGB 1FLRH 4L3EE 2X4QB 3WTYA 2MRYA 4NC2B 4L18A 2DW5A 3BP6B 3I6LE 4HKBA 4DP4X 4PRAA 4I0KA 5B38A 2YPLA 5I6PA 4JDTH 4JFDD 2CDGA 4QHLA 4UYPA 4PJ7E 1VFOA 5AVRB 5K1JA 1MIEL 5DC2A 1IUZA 2Q3AA 2EDYA 3BJLA 1J9TA 4OI7A 2G2PA 3ZYOA 4KUCD 4OAWB 1CDYA 1CR9L 3QEQD 1OGPA 1SOXA 5K9JH 5HI5C 1JPST 1A4AA 3ZE0B 4HU8A 1A6ZB 3P0YL 1UWEL 4YO0B 5KVGE 2H6UA 2K4AA 3IRCA 1D5MB 3TIEA 1N10A 5DMIL 2YPKB 1G9NH 2PO6A 4JPKH 2Y7QA 1CB4A 3SCMC 3LKSA 4GFXA 4L8CA 3EBGA 4X8GA 5CKGA 4R7NB 1YO4A 3QCUL 1DLFH 4AGNA 5F2FA 3SGKA 2X1OA 3BUPA 3L4ZA 2HWZL 4LP5A 3V0DA 1C7SA 4LLVA 4B96A 4FQQB 2M8XA 4Y5YB 3UTQA 2G2NA 1HCVA 4KRMB 2QSCH 4LEEA 3UBXI 2WLHA 1BFOA 3ZIMA 2EE6A 1N0XH 2AI0H 3RZCB 5IG7A 2OLDA 4IMKC 1X5YA 2EO1A 3GXTA 1Q94B 4G80A 5C1MB 3CXFA 2GEQA 2HLEB 2APXA 2P26A 2WVVA 4HQQL 4PJDF 4WI2A 1DSWA 4MDIB 5DHVH 3TBYA 3CHXA 4Y4FB 4MJIA 4TSBH 5SWQB 1YEKL 3UZVA 2YZ8A 4RWHA 3S88L 2MHAB 3IT8D 1MH5A 4Y16D 1YLBB 2O4EA 2H1LM 4JM4H 3LQAH 3VDAA 2XTJE 4D7BA 4N86A 3ZO9A 5D1ZA 4B9JA 2E27H 4JFEA 3MI6A 4XOAA 4IJ3B 3IJHB 1ZDSA 3MRRB 1ZK9A 1WJ3A 5BV7B 1LQBC 5BXFA 1PCSA 2GPZA 4MA7L 4YX2L 2DBJA 5D7IA 1VFUA 2F2HA 4XHQA 5J1TC 1VADB 2Y36H 2IANB 3JWNE 5CSGA 3RX8A 3GPSA 4Z7VB 2DEYX 3KH3A 5GGTL 5IVOA 3BPNC 32C2A 4ZMWA 2H0PA 3LXUX 1VESA 2YLKA 3WN5C 1L7TH 3ARBB 2UYLA 2NY0D 2BNRB 1OCOB 2XX0A 4PAZA 1CGTA 2NX5A 5FLUA 1Y07A 1U4FA 2QGDA 1UWXH 2X2JA 3U83A 5JQ6L 1K5WA 4NPJA 4YSTA 4A2LA 5E1AB 4N0CD 3FOLA 2KH2B 3UG5A 4XHJD 1I9IH 2GSIA 3OPUA 1TQUA 4NX0A 2AVFA 1TMQA 5DFVC 4QRBA 4V11A 5EF3A 1ZXKA 4DN4L 1S9YB 1C8PA 5DMGC 2HLFD 4O2FB 4Q6KA 1JHKL 2XWEA 3O6KL 4Q4IA 1OANA 3GSNB 1Q9KA 3KLLA 5FHAH 3BKYL 1XH1A 4PJIF 4H13C 4MJ5A 3L9YA 5JXEC 2W0FB 3MLXL 3JZ7A 1S7XB 4YQXL 3V0EA 3LXAA 1P7HL 5GRXG 3D9AL 3ZR6A 5FV1L 2AV7B 1AD9A 2XQBH 3DRTA 4J3OC 5DVMA 5CIPB 3DO7A 4FFVC 4YXHL 1AQDB 1NBVH 3DUSB 4OLWL 4GBXA 2WV3A 3QWQB 3PWVA 2DQGL 1EHLH 3VACA 1MI5A 2OW7A 3O3UN 4GW4A 1Q8MA 4HUMB 2X4NB 2Z65C 4ZYKA 5TQ0H 5AAWA 1J8HB 3WUWG 3KAAA 1TEGA 2OAAA 2Z64C 3O45A 3ATEA 5D96C 1LP9E 2GB2A 2JQAA 1CFNA 3SDAA 4GXUN 1XGZA 1IM9B 4Y9BA 1YG9A 2QT6A 4PB9L 3RRQA 1JZIA 1ACXA 5LNEA 1VFBA 2BRRL 1CI5A 3AZUA 4NQSA 2B16A 3OXRB 5I74C 2NY3C 4M7JH 4F9LC 1NCTA 3QXWA 4U7MA 2BVQB 3QA3A 1WFJA 4NKDA 4UCFA 3UTPE 3MV7D 3VI3E 5BOZG 1F11A 2VDLB 3F6LA 2DF3A 2JB6B 3IDXL 2XWJB 5G2NA 2VLRE 4KRPC 2IFFH 3SO3C 5AW2B 4WWPA 4HIHB 4AVIA 3BP5B 5BW7C 1HCYA 5HDBE 1WK0A 3KYNB 5ID1A 3RIFF 2OJ1A 1BVLA 1NFKA 2B77A 4QDGA 2WQAA 4I0CC 4JFPB 4FA7B 5DJZA 1ANUA 3LHPH 3G5ZA 4LSUL 3CK0H 4R4BB 3BYTA 4X6FA 4G6KL 2E46A 1BHGA 4R96B 4QI3A 3DX3A 4XPAH 1YN6B 3ZKXC 5DHVA 3ZTJH 4JQIA 3CD4A 1P0SE 3BT0A 4CBZA 5GSVB 4LQ1A 1G9MC 4MHHG 3FQRB 3UDWA 3ZTDC 4EIGB 1S9XB 1KBGH 5D72H 5B4MC 5E9DD 4GRMB 3KPRD 1T4WA 3RFRA 1MCSA 1OW0A 3QIUC 2BZCA 1NC4D 5F1KC 2EC9U 5GGTA 1RZ8B 1C9SA 2HRPL 2JIXA 3LDBB 3R1GH 2GAZA 4Z7UE 1DQVA 3RDTB 3UJTH 2FAUA 3NZSA 1EHLL 3QARA 5AYUH 5EZJA 2BS71 3H1ZA 1RQ5A 3EOYG 4CSPA 3T09A 3GSXA 4P2RE 5LXGH 4FHKA 4IRZL 2DYPB 4XAWH 1BZ9A 4CMMB 3VE0B 4J3UA 3NSDA 1INEL 2VMCA 5FIEA 2QGEA 3TC9A 1ZHKB 3ETBF 1OB1A 5CJXA 1RZGB 1QHOA 4QXGL 4OV6F 1E5AA 3NK4A 4P9ML 4AENB 1JL8A 1YRKA 1J0HA 1Z3GL 2KC0A 2P52A 5GHWL 5IFAH 2FK9A 5MENE 2NY2C 3F62A 4FLOA 1EMTL 2VDQL 4KI1A 3TT3L 4EI6A 2VITB 2JVUA 4I48A 3HRZC 5I8OH 2C3VB 4L37A 1X7SA 5EOCL 4R2GD 4XVUD 5I75C 2X9XA 4ZMZA 3SDCB 2IPUG 3RVXC 2RALA 5E6YA 2YAMA 3DXAB 4F7CA 4AM0A 1Q1PA 1L6PA 4CUCA 5C0GA 4E0RA 3M8OH 3CXDL 3PG2A 2VXVL 1GL4B 1KPRB 4TSCH 1JDCA 1KIUA 3GB7A 1BBDH 3QPQC 2E7LA 5FUZH 2CPUA 4NQEA 1YEFL 2ARJQ 1WC7B 3K6IA 1UCBL 4GXVL 1F4XL 4LFHD 1CBVH 4XBPB 4TQPA 3S3DB 4AEIL 1Z9OA 4L9LA 2ZXWB 4NNPL 5K69A 1I3RB 3QZOA 1ZHNB 4QXWA 2Y1YA 1A6VH 4FJYA 4M3HA 3H9SD 2WGXA 5IJCC 3F5WA 4QRAA 1AO7E 2ADFL 2VABA 2YD1A 3H9YA 4D8PA 2VDML 3KGRA 4KAQH 1X3DA 4GW5A 2WBJA 1OE3A 4I1RA 4MNQA 5GS3A 4P59L 2A6DB 3QC5X 4L2YA 1AQKL 4S11A 3PNWB 1LEKB 1QWUA 3AU1A 3PRZA 3KBEA 4G6ML 5LNGA 1NKOA 2P3YA 2IQ9L 1E43A 3TZVD 2GTQA 1TYJA 1DVYA 5KSBB 5KYWB 2P48B 1KJMA 2ZXBA 3RWDB 4HAFA 4RISL 1IB5A 5DD1L 4Z8FH 4AUYA 3EO1B 3EG9A 4K8RL 1EEUA 4XPBL 1H9VA 3FB6B 5CHNA 2DI9A 3FB8B 2R4RH 5D7LD 3H42H 1XF5B 4XXDB 1OT4A 3BISA 1SXZA 1OGTB 1O5DT 2F1AA 2F53B 4I9WD 1HKFA 1MHCB 2APFA 1DO5A 1OCRB 5CLYA 1YNTA 5I1IL 3VVVA 4LVNB 1KJ2A 1F4HA 1RZGA 3FSOA 4JVUA 1DBMH 5L0QC 3GGWB 3KXFE 5IHZB 1UWYA 4RFNC 1XSOA 4QRPA 1GJUA 3C5JA 1NUNB 3BEWB 3VWJD 3BFWA 4N2FA 4OZFG 4GB9A 2X4NA 4KHXH 5E8OA 2JCCA 1MJJA 3OX8A 2CHDA 2XVGA 1I3GH 1TJIL 1U41A 4MDJA 4ZSOA 5EO0B 4F7EB 3U9UA 5H4YA 5ITBH 4DGVL 3RDTA 4DETA 2F74B 5IB3B 1MLBB 4HAGA 5ADOH 1FZOB 3C12A 4JAMB 5GSVA 1SUJA 2LAAA 1A4KB 3NIGB 1MAML 1FNFA 1YMMD 5EDXA 3WHE0 1FN4A 1UURA 2COQA 1TVHB 3D3VB 1YNLH 4L05A 1Q72H 5ESVA 2MKLC 2FLMA 3QBTB 4ENED 2HMIC 2FECI 2WB1A 4N1EA 1DJXA 2Q1EA 1AZVA 3N42B 5FUOH 3WTUA 3G6AB 4KK6C 1IGJB 1Q1JL 1VSCA 5B3NA 3GJFK 2BC4B 4DO6A 1HYSC 4M48H 1SXSA 1M9WA 1QYGL 3G5WA 3CHPA 2F18A 3BP5A 3NJVA 4JEGB 1SPDA 4Y2DA 2QLYA 2O30A 5IW1B 4YN3A 2J2ZB 2WLIA 4M43H 3S36H 4WWKD 2OJZH 5DJ6B 4P57A 5HVFB 4PWJA 1W0WA 5JORB 3FTVA 3AVEA 2E59A 3QQ4A 1DZ0A 2JI1A 3PHSA 3SHSA 5JOFA 4F3FA 5E1GA 2HG0A 3AS3A 3BAEL 3PP4L 1YMMA 4HUWA 3QEUA 5LWYH 4O58L 1S2EA 3OZ9L 4H1LH 3FL7A 4HS3A 4TQEL 4GS7B 5I1IH 2XA8L 3ARGC 5F7DA 3EYUL 3RDTD 1IIKA 2ZQKA 3R8QA 4JKLA 5C7ZA 5TE6L 4HCIA 2XXCB 1OAZL 3SDAB 4PD4K 4BZ1A 2OI9B 2Y7LA 1J05B 1JZ7A 3AU1B 1LEKA 4JFHD 2I69A 3UBXA 4JRXB 4ALAH 5D7SL 5F72S 5CIPH 3ZIYA 2AS5M 3BGMA 5DU7A 4KITB 4NUMA 1YQVH 2W9EL 1DEEA 4LLAA 1KBBA 4XNYL 4G1MA 4AKPA 1E9OA 1F41A 3KLHD 4P04A 3UP6A 2VN3A 2DMKA 2DQGH 4LBEB 4KH9A 4MYPA 4PJEE 3PHOA 4YL9A 5BZWB 2PW2A 2NUPB 1BXXA 5ERWA 4ZUVA 1HEZA 2H6OA 2FO8A 2X41A 4PJEB 1OTTD 3K8MA 5C09A 3QUZC 1I3RA 5CCJA 3QHZL 2IQAB 4QXVA 5IMLA 2KYIA 3QE5A 4N2CA 1AOHA 1GY2A 4L4JA 2PYEB 3L7FB 3H9SB 3HVDA 3QUZB 4A39A 4XWGL 2UWEE 4OFYA 1Y6NR 2W5PA 3A6CL 4YDJA 2QLVB 1G4MA 1DVFC 5HVWA 3QVAA 3LIZA 2EDTA 1YJDH 4AGOA 3BX7C 2EYTA 3CHSA 3QIUA 4K4KA 4JDEB 5MEQB 2PMZA 4MRCA 2FX7L 5AVXB 3RX5A 3FF8A 3T6ZA 3HMWH 1AMXA 1JAEA 1PF3A 1N18A 3FUIA 5C0CA 2WBJD 4HWBL 4AYFA 3CFEB 4ZQTA 5B8CC 2AZAA 4YHZH 5D7EA 4OGAD 5DD6B 2AC0A 4LO9A 1QTSA 2GI7A 4WTWA 3CV5A 1O7VA 1I7ZA 1ES0B 4WSGA 1FH5L 1K8IA 4IRJC 1T3FB 2B59A 4UM9D 5H37G 4X4XA 2AXFA 4ANVA 5JA9A 1GAFH 3AGWA 4NKOA 4PJEF 1VADA 3I2CL 2BXYA 5HJ3B 2P7TA 1FCGA 2LR4A 4GPVA 1RK1A 5KJ4A 3GC3A 3TJEL 4BH7B 5L0QB 2H0JA 1BP3B 4OVVA 4ZFGH 3BSZL 3POCA 2RFXB 1E9PB 1G9HA 1TFPA 4L1TA 2ZOWA 3RZWA 4HWEL 4AGQA 2P24B 2K3TA 2FTAA 1ZKAA 3MJ9A 4DK5A 3CVHL 4L3EB 3P4OA 1ADQL 3BLPX 3IJ9A 3C6LD 3NTCH 4PJAF 2CA4A 4XPGH 2YK1H 4C83B 1X5GA 1EUTA 4HMDA 4BFNA 4YEFA 5AUMA 5T3XD 4S1DD 1NBZA 4NZJA 1F3DJ 3IYLW 4QJ5B 4ZW8A 4DCQA 3EJRA 1QUNA 1M2OA 4K3EL 1AYRA 5CGTA 3G5VB 4MX7A 5DUMH 3GMQB 1BQHG 4UIKL 3BPOC 3NJKA 4XP6L 1E5YA 3Q8EA 1NOLA 3BH8B 1IILE 2EKSB 3DMMA 2A7BA 1B9KA 2DN7A 5DDHB 4PRPD 2JB5H 4KXZI 4YFLF 3UBXG 4PP2A 1KCUL 3WFBH 1X9UA 1P7QA 4WEBL 4X7FC 2WWKT 1ONQB 1PZBA 1YEDB 5I5JA 5TFSH 3L3KB 4XNMB 1IGMH 4BQ8A 2LT9A 4AW4A 5KSUB 4AL8L 3FU9A 4OIIL 4CADB 4JFXB 3DOHA 4NT6B 3MLTB 2AK4E 4M56A 3U2SB 4FFWD 4ERSL 3F6JA 2YR3A 4K7PH 3PUCA 4FQPA 1RJLB 3MLTA 3MRBA 4YE0A 4QRQB 4ZFZA 1GZPA 3E1F1 1A6ZA 4YO0A 4OUUA 2W60B 2X7LA 1J8KA 1M1SA 2YPKA 3LCYA 3ZQ9A 3CWGA 4HXAL 5HHMD 4EZJA 1X5FA 4N2MA 2NYKA 4LCWB 5FO2A 1EANA 3D08A 5AZ2H 4D3CH 2DIEA 3WFCH 5D6DC 3AQZA 3ME0A 2P8MA 2OXGA 5HVHC 1F18A 1KTCA 2CO6B 3S98A 5EU6D 2PETA 5MI0C 2PPCA 4Z6AT 1TFHA 3PJLA 3H0TB 4YHKH 1IL1B 4BRJA 1AVAA 3L5WB 5HGDA 1CZ8L 5GZOA 2GTWB 4GBXB 3PHOB 3T8VA 1I8AA 1NINA 1F6AA 1CK0H 2D7TH 2HXAA 4DGVH 2YD4A 3FQNA 3KG5A 3BGAA 3M45A 2HRLA 1Z9LA 5F3HB 5SWZD 2WUBH 1DE4A 1IC7L 2FX9H 1PW3A 3D85A 4XGZB 3HG5A 3SDYH 4ZX4A 4MDIA 1UFUA 2YPVL 5IR1A 3HJEA 1UB6A 4XB8A 1RMFL 2G3XA 4JFZL 1P7KA 1OAXL 1JD9A 5IHUH 5AL0A 3UPRB 2RFXA 3L3DA 1OAJA 1U91B 4P5TA 2NY1B 2QTEA 2W07B 2JB5L 3SDAD 3BN9D 5BMFL 4FCHA 3WHE1 1ID2A 5J4MA 2LVEA 2GSIB 5J3HD 4PRNA 5T8IA 1UQSB 5IZ7A 4ODXB 2FBJH 4PJCB 3T0ED 4ZG1A 2P5EE 1FFRA 1BOYA 4PJFE 1YMHB 4KHTH 5ICUA 4HKJA 3LH9A 2Q7AA 5SV3A 4Z23A 3FSWA 5AVZB 5D7KE 2R2BB 2VQ1B 2H7WA 2FRGP 3LX9A 5TF1H 1KN4H 3CC1A 4FNLL 4LPUA 4UYQA 5PCYA 15C8H 4HJEA 32C2B 2EH8L 2GBUA 2WSDA 3KPOB 3NFNB 15C8L 2ZCLL 2EEBA 3EOAB 2ATKB 3HZMB 3BPLC 3RY6A 1XEDA 1L9OA 3Q43A 4B5EA 5G5DB 4NENB 1NFDB 3KYOB 1S9VA 1BVKA 2LLNA 3EGXA 3MX0A 3POHA 3VRIB 2FVNA 2MFNA 2VZ1A 4JFWA 5F7MC 1AZUA 2J8HA 5FYLD 1FI8C 2FD6L 3MRNA 4QHLB 4FQXD 4N68A 3INUL 5DEZA 3DOSB 3BN3B 3P77B 5CGYC 1WZMA 3QFJE 4K9EL 4HJ1A 1CE6B 5AZEL 2NUTA 1EHXA 5F7LB 4ZFFB 4N0UE 2QQKL 1ZT1A 4PWKA 2UWEF 2V3FA 3TZVB 2JLPA 4A2DA 3NACH 3RVUD 3WIFB 3LS5H 3WKPA 1DJSA 3T2PA 3U1SL 4MB4A 1QD0A 2IDQA 2KMWA 4IOFC 3U1SH 3U0TA 5I76B 5IHUL 4YS4A 1TQSA 3GS4A 4JRWA 5K1VA 1RK1B 2UZPA 2C4XA 4BZ2L 1JZ4A 1LO3H 3OXSB 5CWSB 3JTBA 3HN8A 3QUKA 3GHBL 5BPPA 1QLRB 2EE2A 3F7YA 4EZKA 5E4IA 4HK3J 4XNXL 5CJOH 3SDXF 4LPWA 3E2HC 4Z3TA 2WM0A 3L81A 1ADQA 2XPGA 5EWIL 3VSTA 2VLRB 4BXVA 3EGDB 2HFTA 4NRZB 4JFED 5JUEL 1IBGH 5D2NE 4M9OA 4PYGA 3DK2A 4Y2DB 4NM4H 3C60B 3HE6C 2HJLB 4KKPA 4H8WH 2CBMA 2WCGA 4I8DA 4GKSB 2XXFA 5DK2B 1ORQB 3MUZ1 5F0LB 1ZHLA 1CURA 2BFVL 1HE8A 1DBAH 1U8NB 5INDB 1GCFA 3D69B 4JKPL 4X5XA 3VD2A 3OMIB 1BQLL 4F80A 3K6FA 4G7VH 3US9A 4H1LG 4I18C 3CMOL 4Y2DC 4YHYB 2ZCLH 2ENJA 1IKNC 5ADPH 2CDFA 2IPTH 2VMDA 4QTHA 2QQNH 3BH8A 3RGVD 5FPIA 2K78A 5IVNA 1AS7A 4G6AC 2JNZA 4H0GA 2OM5A 1E5UI 1I8KA 2CIIB 1HILA 3HAEH 3UPCA 4NC1E 1A4CA 3WE6B 3ZT6A 4GAGL 3LV3B 3QIWC 3VUAA 2RA1A 5DO8A 5EBWB 3GUTB 3MA7B 3T6XA 4X0KA 3QRBA 4LVEA 1GHFL 3G3LA 4HX1B 3OAUH 1ZVSB 4ONFL 1F86A 4OFDA 2FATH 4GQ9L 4QHNB 3RVTC 5BOJA 1HN1A 4QCIB 4P9HC 5SWSE 1U95B 4P2QD 1XTMA 3E8VA 1I4FB 2LQRA 4BH8A 4PTTB 4WV1C 1F6FB 3T2QA 1XBDA 5ID0B 2D7OA 5GJSL 4OIAA 5AW0B 1YPZE 1CDJA 4X7TB 5ECGA 2VMFA 3EJQA 3P73A 3V5DB 1YPZB 4HJUA 5L9DH 4RMQA 2HT2C 2G3MA 5C08D 4D9RD 2GABA 1QLEB 4R8WH 5CO1A 3PWNA 1FQ9C 1ED3B 5JO5A 2ZYSA 1MHCA 2H1PH 4H88L 4EUPH 2YN5A 4U1IB 2C26A 1LVEA 4QRRA 4YAQB 2YD0A 1YY8B 1KJMB 3TXAA 3N91A 5A3ID 4WUUA 3DXAE 2BIMA 2JKIS 4NUGL 2BIIA 1EO8H 1DP0A 1N9PA 1XBRA 1T21B 5KVGH 4PGDB 1XDTT 3ARUA 3W11D 4CN6A 2JK5A 2BVPB 2W0LA 4PJ8A 5B39B 3C5SA 5FUCC 4KXDA 3BPCB 4W81A 4OV5B 3DIVA 2VABB 3EBAA 4TUJB 5K93A 3VMPA 3ZGHA 5FW7A 3VWKD 1ZA6A 2PXYC 1PAZA 3TJHD 2Z91A 4K15A 5GSRB 3VXUD 4ZUSA 2UX6A 1E4XH 1NGQL 1P4BH 2H41A 1HC1A 5I0VA 1JCVA 1QSFE 2E9BA 3PU7A 4MA1B 5C07A 1GYCA 4XI5D 3WAKA 4X4YB 4N2NA 2YSSB 5E5MA 3GD1C 4O02B 3NJJA 1P9MA 4WW2A 4FQXB 4NM8L 2EJ1A 3PGCA 2FATL 2Y1AA 2XWTA 5T1LA 3SYAA 1Q1JH 2EZ0C 1R9FA 2DQTL 4O02L 3I6LD 3QJFA 3F12A 2CHWA 4ANXA 3DXAA 2GJRA 5KSBE 2YXVA 4AEHL 2BCMA 4YXLH 3QEGL 4ZFOL 3DARA 4FG4A 1D5IH 4LCIH 1F90H 5D4IA 4WFHD 2NNFA 4HBCL 3MRJA 1XXDC 2HTKD 1CT8B 5BRZE 1E4WH 1NM9A 5F7AA 4EN2A 3C2AH 3GI8L 4MLSA 3TA3B 3WFDH 3U1QA 4AJYV 1MAKA 3TVMC 2G60H 2BWQA 4F8QA 3JTSA 3TX4A 1TSHA 3HC4H 2LV4A 4M3KB 5EIQA 1YPZA 4PRHD 3ZYZA 2KPNA 4WLCA 4F20A 3SPIA 1UCBH 1U8LB 1H19A 1HHHB 4YNYB 3AMLA 4OJAA 5SWSA 1RULL 1JERA 1XB3A 2E4FA 2ODHA 5E0FA 3PHQB 1IBZA 4P2OB 4YVUA 3LQMA 5AD0A 5AW6B 2YGQA 4W6YB 2E75C 4R7DB 4OUOA 1T0NB 2WYZA 1LWHA 3L5XH 4OFQA 1M1XB 1Q9LB 4QOKB 5EZJB 3QDJD 4HX1A 3S8WA 4J6RH 5ABDE 1VPOL 4AZ8B 1E2ZA 2GIXA 3EH4B 3GMNA 4QOKE 4BZYA 4D0CB 5DO2D 1J0YA 2H8PA 3RE0A 3QHTC 3WFZA 5SWZB 3LV3A 5EUOE 4MTMA 1JGDA 4FKEA 2K6YA 1TJHL 4NCC1 1BF5A 1NFDA 2O5ZH 2EIDA 3KPPA 1UVQA 4R4BA 1WAEA 3MV8B 3VXTB 4MDJB 5FYKU 3PUUA 4YLCA 5IV2A 4LLYA 5HHXH 1FAIH 5SX4I 1QYGH 1OAUH 1XCTA 5C0EA 2PYFB 3AT9A 1PU0A 4GKSA 5DK2A 2XWCA 3WUWA 1X4XA 1A9EA 4ZQKA 2OTUA 1SFDA 3CFJB 4U05A 2F8VA 1BXAA 2MCMA 4U3SA 3EGDA 4NRZA 1HH6B 3ZMEA 3O4LE 3AXHA 4ELKB 5GS0L 1ETZA 2AEPH 4XPFL 4Z3EA 4ZFQA 4KO7A 3N6YA 4XPFH 1FE8H 3FQWA 1JWSA 2OL3B 3LRGA 4G5AA 4Y19D 3S5ZA 4FF9A 4PP1D 3RTQB 4ENZA 1N8OE 5ESQA 1GJWA 4JRLA 2CMRL 4PW3A 3O9WB 4IOIA 4PJ9B 4YXKL 2VDPL 4P5TD 4IU2B 3X1EA 2J71A 3X1GA 5E8NB 3D87B 5ITBL 4K23H 2IO5A 2J56A 1TLKA 4A68A 3QQ3B 4KBPA 1MZZA 3VD1A 1NGWB 3D85D 2XQYG 2PW1B 3BD3A 3NJGA 3MLZL 1A4JA 4PJ9C 3B2VL 2X9ZA 3MC0A 1GCYA 1S3RA 3BP4B 2PWGA 5ALBH 1I7TB 3Q2CA 2IV9A 1AQDA 5EC2B 2C9PA 5E5MB 3NK3A 4LQFH 3G6DL 3T3PB 1CFVL 4DKDC 3H3PH 2N56A 1LDPL 1SJVA 5EU6A 5H37A 1WZLA 1OIOA 4KXCA 1S9XA 2WQWA 2XWBB 2CBTA 5LN8A 2X1WL 3HB3C 2VSCA 4BK5A 1HNGA 4JPSA 3P9LB 1PLCA 1RHHA 4N8PA 3PWPE 2XN1A 5GGRY 2FSEA 2B39A 4JCMA 5B8CA 3EJJX 1PVHA 1U0QA 3BZDA 1OO2A 2DLFL 4UTBH 1GGCH 4PWIA 1A65A 2ERJC 1ZLWK 2B7DT 1G9NL 3UTZB 3VXSE 1M7IB 1KTRL 4PFEA 5FS5A 3RWIB 5I30H 3S4SG 2QKIB 2FECL 5EEVA 2NYYD 5FLVA 2ZXCA 4KK6D 5T3ZE 3MXWH 1A6UH 1XH0A 4RFOH 4R90L 5BS0B 5IHBA 2EYRB 4JG5A 3MXWL 4RFOL 2XRAH 3DX2A 4ZD3H 2XSKA 3HKFA 5CU5A 4L5FL 4AL8C 3F05A 1LNUA 4QT5B 1WA1X 4Z0XB 4YSDA 2CDEB 3ULSA 2HP4A 1HINH 1U91A 3DMMD 4PS7A 4U1HB 3V10A 1ZHKA 3R8BB 1E7UA 2ZOLA 3EJSA 3HAEB 4HJSA 4PMFA 4X80L 5F8RC 2OYPA 2H9GA 4DH2A 3VGAC 1JV5A 2R56H 2TRYA 3CXHK 5C0AD 2PP8A 3MROA 4NN7C 2A9NL 3HBQA 5J6HB 1U42A 4H5SB 3CH1B 2F8IA 5CBEA 2WWNA 1D6EB 1QSZA 1NC2D 1JZDC 5D1ZB 2BHYA 2L0DA 5C0BE 5IWLC 1ZWIA 5KYXB 4Y9FA 1W8NA 1ADWA 3L48A 2GTWA 4U31A 2B9BA 4OJDH 4G7YL 1RZ8A 4PGBA 1KGYE 5DJ2B 2APBA 5FO8A 2YFOA 4LQFL 4LOVA 3SE8H 4O4YH 1E8YA 3MA7A 4Q14A 3QNZB 3EF7A 3I02B 4HUKB 4ZXBC 5HGGS 4PREA 2CO6A 1JHTB 3UGXA 4CN4A 1DVFA 2BOBA 3CDGA 2H0FA 4XP6H 4WI3A 1DANT 1TQCB 4G72B 1QZ1A 4S1QL 3N3EA 4L4TA 1U2HA 2R23A 2WKOA 3GMMB 2ZAIA 3NFPA 3UERA 2P9RA 2AK1H 2MIZA 1Q9WA 2VW6A 3B5GA 3BDYL 3QFDB 5JIMA 1Y1UA 4JFPA 5D7JC 2PWHA 4Q52A 1KYFA 3NA9L 1KCBA 4UM9A 1FFPA 2YAHA 5CLZA 3ULSB 1BFOB 1R3IH 1UA3A 5TQ2L 4X5LA 3GMPB 3K74B 3U6XS 5D7JB 5C0CD 3LPWA 2VXSL 4YIQB 2R29H 3N1QC 3VG9C 1TTCA 5CGBA 5J6GA 5KVGL 4HKJB 4Q0XL 4UT9A 3CC5A 5CJ8A 2JKSA 2P4AB 1KC5L 4IGBD 1DSFH 2A3TA 1R75A 2EIEA 4XC3H 1E42A 4JDZB 5DFWH 5IROA 2NXZB 4F7PA 1FO0A 1BLIA 4BUQA 3W0WA 2ZPKL 1FH5H 2ZTBA 2GY5A 1ZTXH 4LGRB 1C5BH 4LCWE 4BM7A 4W4NA 4H8WC 1JYXA 4HQQH 3I75A 5I75B 4MMXA 1NQBA 5BZXA 3T77B 4LASH 4IQHA 5H94B 4PS4L 2NY5C 1JXJA 3QNYB 3UPAA 1V7MH 3TT1L 1FC2D 4ORZC 4NM8H 1WE5A 2XN9D 2CUMA 4YLQT 4PS8A 5CJQH 1R5IB 3SGEH 1XH2A 1JV2A 3BKMH 5G4OA 4WEBH 3BEVB 1BW8A 1G7IB 4WFFD 4H5SA 3D25B 4MCNA 5J6SA 4G7QB 5JXAH 3V4UL 4JPVL 3C6LC 3C9NA 4TVPE 5DJ0A 2NLJB 4LLDA 1QRKA 2GSGA 1B0RA 1CGYA 4ORGA 1KPVA 4I87A 4QGYA 5DC9B 3TV3H 2EVHA 5IP4A 4OTXH 4UNIA 5D1XD 3EYOB 4RGNB 2VLJA 1TZHB 1SHMA 1T3FA 2B59B 5FECA 1LO4H 1SF5A 2BS8A 4GINA 5EIIA 1PD1A 4PJCE 2W88A 3SGKC 2WBWB 1DYZA 2FB4H 4MAYA 1SN0A 1GC1C 2GBVA 3U0PB 2YGOA 4AYFB 1P6FA 3ORJA 1HL9A 3F00A 4KHTL 2X09A 1F3RB 2JV6A 1F02I 4FQ1L 5GJTH 2R7EA 5I74B 4GSRA 2BIOA 1P5VA 3DIFA 4WI5A 4X4ME 3ZTCC 2YO3A 2WN3A 5D6DA 3TFKC 4NT6A 5I16A 3F3HA 4R6UA 4B60A 1H3PH 2ZOKA 2JJUA 2XV3A 3SBQA 2WXFA 4P07A 3TV8A 5GS1B 4G3YH 2P49B 2WOYA 3UZQB 1WQVT 3CDYA 1TQVA 2J57A 1A7OH 5F7WC 5C09E 2PWDA 1G5AA 5KN5A 3VGAB 4E68A 3ZUNC 3ARXA 2AXHA 2GSGB 1E3FA 3FKUS 3M7OA 3KXFD 1YEEL 2CCWA 2OMNA 3TYGH 4DQAA 3E8UH 2H0EA 3DURB 2FDBP 3PWJA 1HZHH 1QUNB 3SPHA 1MF2L 5BZWA 4LSQH 2AW2A 3HPLA 4EEEA 1FFTB 1E6JH 2CKBL 2P45B 3BPOB 4LOEA 3DGCR 3EYSL 1I7TA 1BD2E 1OPOA 2YZ1A 3QDMA 5ANME 5LJYH 1X6NA 2NW2A 3FBKA 4Y5XC 4ZXBB 2AFNA 4JY4A 2VKWA 2NY5L 3P4OB 3QZWB 2BHZA 5ANMB 3ZBMA 5A6LA 1AR1B 2E9GA 2PW1A 2XBDA 4PJBE 4GSDH 5DJ8A 5DSCB 4YNYA 2QV4A 3NCWA 1RUMH 1I8LA 3QDAA 1BYPA 2XFXB 1XB8A 3OMZA 1SY6H 3BAXA 4IBVA 1FE8L 2OTWB 1P1ZB 3KS0H 2UXGA 1IC5L 1HQRB 3RVXD 5JOFB 4DKEL 5JDJA 2GHWB 1VERA 4M6MH 3IU3A 4YHIB 4G9FD 2TRHA 3VVWA 2FHFA 1SJHA 4OM0H 5DR5H 2YBGA 1I1AA 4R3SA 3ZW3A 4KKCD 2H47C 1T03L 3Q44A 4N2OA 1NEZA 1N6QH 1J5IA 1SOSA 1TG8A 5JZ7D 2VW7A 1UG9A 4KNQA 3L4VA 2N01B 3OM3B 4AQOA 5I8CB 4MNQD 3TA4D 3VXTA 1TZHA 2MCPH 2EXWC 1TCRB 1FZMB 4D9QE 1BJMA 1WS7A 4I0PD 3UTTA 3H9SA 1OAQL 4HV8B 4N0RA 2X70B 3WS3A 4AMKL 1IQDB 3HZVA 4FTVE 4YHML 2HT4C 4HS8H 3PGFL 1JK8A 1DN0A 4F5CE 4LSTL 3T1FA 4OZGF 2CK0H 1FAKT 5C8JB 3VTTA 4XTRC 3Q48A 1H6UA 5CINH 5T1JA 4HFUH 2WCSA 4JFHE 4LOUC 4XWOD 1UM5L 3RPIA 3SE4A 1NBZB 4IRJA 2EXTA 3DV6B 3LQZB 2PLTA 4IGBB 4X6EB 2A2QT 4JY5L 2VZVA 1GJIA 4HUUB 1N6UA 1UZ6E 3CSBA 4TF4A 3RIKA 1UZGA 4JZOB 2V5MA 3BZ4B 5E51A 2DTML 4PGEA 4XMXA 4WO0A 3ZX1A 2B0SH 4GUPB 1H8SA 3CBRA 2NZ9D 3O9WD 3V9FA 5DQJB 1BAFH 3HE7A 1AY1L 1Z7JA 4XN8A 3WENA 4FZ8L 4G8EB 4JX0A 4K9JA 4RGNC 2ICEA 2A9ML 4LBAA 1FGNL 2DLEA 2NY4B 4Q6IA 1KT2A 3RVUC 3SODB 1IO4C 1RUQH 3Q13A 4LP8A 3EJPA 4DN3L 1IIIA 1WBZB 3RJQB 5GRUH 4XNXH 2WQUA 3WEOA 4JL2A 5JPNA 2NSXA 3I6SA 4N8UA 1ICTA 1QRNA 3LIUA 5AYTA 4DQOL 4F8PA 5I73B 3CUPA 4G8FB 1HAWA 5DS1A 2Y2YA 1OL0A 5I6LA 1M4KA 4OFKA 4OZGE 4Q89A 3Q8BA 5TE7L 3PNWA 4ODVL 4DGIL 5IQ7L 3V4LA 1PZAA 2J55A 2W9DH 1KC5H 4NUQA 2MPVA 3IU4L 5FYJH 1FFPB 2OMVB 3C5ZA 3ZZSA 4PGJA 4NFCA 3DC0A 4PV8A 3P4NA 4QO1B 5FCUL 4AH2A 1T2QL 4AUUA 3WI9A 3LEXA 3SDDC 1OWWA 2NYZA 2QQNL 4NFBA 1G7PB 5E9DA 2KQNA 4ENEC 3P9LA 4B9GA 1QNZL 5FKAB 1GY1A 5KJRH 1A9BA 2IPKA 2B08A 4AT6A 4RLDA 1BIIB 4RGOH 2RGSA 4ZUTA 5K59F 3WBDA 3LXCA 2XZAL 1G7PA 5E9DB 1I8KB 1AKJB 1UWXK 1N64L 2Y6SC 4EMZA 4NRYA 4BWTA 2Y3AA 2IV8A 1KLUA 1U8OB 1I7UB 1TKWB 1U3NA 3UBGA 2NR6C 1ZWIB 1L9NA 1MCQA 2C4FT 2HRPH 2ROXA 2UY6B 5LG1A 2F7QA 1HHKB 5DEFA 3IDIB 2FT7A 2A74A 2VDMB 2AXWA 4ILDA 4W70A 2EDMA 4GKNA 1CTOA 5HHOD 5DF0A 4RMRA 4IIZA 4HIHA 3L2NA 2ITCA 1Y0LB 1JPFA 3V4UH 1REIA 1N26A 1X9QA 2DMCA 2H9GB 5IB4A 2ZUWA 3CVIL 3UIZA 5I17B 3P30L 1PG7L 3VXNB 3GXNA 4XPHH 2VC2B 3DX4A 1OM9A 3UC0H 4QRRB 4U1IA 4XP5H 4O2EB 2CDEA 3ZK0A 1KYDA 3E6FA 5DUBB 3RDTC 3NN8A 3RAJL 2VLKB 3P3TA 1GKOA 3OKOA 2R4SH 1RVFH 5EZOL 1E6OH 2DY2A 3WNMA 3HS8A 2X4TA 1RVFL 3SKOB 3I6GB 4ZNEA 5ABAA 1BM7A 1BZ9B 4JNXA 1C1EH 1OZUA 1IE5A 1SYVB 2G30A 5ICZA 1LTXA 3AREC 2VJ0A 4Z5RA 1U8QB 4GRWE 5LG6A 5DTFA 3ZGIA 5DHXB 1UA6H 4XVUC 5FFOA 1G5GA 4XMVA 3G6AA 2OI9C 3L3OB 4U6HB 1E2VA 3C8DA 3NJXA 4UAHA 2OP4L 4GW5B 4JZNA 3TEUA 3DRTB 3HTLX 3QXTA 5D6CA 3AXLA 43C9B 4S0TD 4FTVA 3WXVL 5C8JA 4KKAD 4UTCA 1ZV9A 3TIDA 1F4WL 1PKQE 3ARPA 1NLDH 4LKXA 3TBTB 4IBWA 1R5WA 4XN1A 5EU6E 4TOYL 4G8IA 3B7UX 4ZAKB 3Q8CA 3AS2A 4QRTB 2UY7A 2YK1L 5IEHB 2BFGA 3D69A 3O8XC 4MXVE 1JXFA 4KQ3L 3ZKMC 1GZHA 4K5OA 2BSTA 3QUXD 5DRNB 3HHRB 4DW2H 4PHZA 3VW3L 4XC1L 1FZKB 3CSFA 3RY5A 3SZKC 2W38A 3NEXA 2VCOA 2YC1B 3CU1A 4IBSA 5IMKB 2EZ0D 3U2IA 4ODTL 1QFWI 2Z4QA 2GT9B 2EAEA 2IALB 3M1CA 3US1A 2X1QA 1WBXB 2H3NA 4YL4A 3QR2A 3TN0D 3S3PA 2G9KA 3EADA 3TOPA 4DESA 1Z66A 4EIUA 2E7LC 4P8QA 2CU9A 4OFIA 5F1IB 2IWKA 3RNQB 3F2LA 2YRPA 2OYKA 3RTLA 1AXTH 1JD7A 1J1PL 4X80H 1YHPA 5KSBA 4JN1H 2B9AA 4W1TA 5EF0A 2WIIA 4CJ0A 4E41B 2ENQA 3QYMA 3HPJB 3KLAB 1SJMA 1UZ8B 4PJAE 1HFUA 4X7TA 1CD0A 5I1EL 3T1WA 3LZNA 4LCUA 4XPTH 2R2EA 3RQ3A 2BFVH 5F9DC 5FA4B 1ITCA 2XWTB 4JZJB 5T1LB 2OMZB 4MQ7A 4GAJL 2PR9A 5AW9B 4JR9L 5F44A 3RWCB 3GLEA 4OZFH 1R5VB 2O72A 1H0DA 5DLMH 5DJAB 2ZUXA 3MTXA 3X14B 4LHQB 3VM5A 5IJDC 1ROWA 2NY5H 4MJID 2FQGA 1S7QB 4MXQD 5KSAA 2VISB 3OPZH 5EBWA 1UM4L 4TTGA 1J1OH 4EN3A 1DO6A 2VC2H 3MAWA 4F7MB 2A6IB 8FABB 4F58H 1LE5B 1Q9KB 5CN3A 1KGUA 4Q58C 3N5AA 4L9DA 5E03A 1HJCA 2DLFH 1WFTA 3RZCA 4RX4D 4A2HA 1XF3B 3PS6A 2YD5A 5BQ7B 5IF0A 5DZNA 1I75A 5IROD 1IEBA 1IKFH 3QFJD 5F7KC 3QHFH 2I85A 1YQ2A 1HHGA 3QH3B 2ICWI 4MD4B 4AJ0A 4KWUA 4X6CE 1C5DA 1NCBL 2XZZA 3WIAA 2AITA 4JQIL 2WUBL 2QBWA 4IBQA 4URTB 4AIXA 3A21A 3L1FA 4G8FA 3RIAK 5I18L 4KK9C 4KJYA 1CDCA 2VITA 4I48B 4ZO8A 3RPBA 1HYSD 3BVUA 1BFVH 3WKML 2EILB 2N0KA 1ED3A 1U2CA 5JO5B 3WEAA 4U1NB 1BFSA 4ZT1A 1O6VA 4KUCF 1IVTA 1HJBC 1XGPB 2V9TA 2WWKO 3HZKA 1WFOA 35C8L 1FLTX 1RLWA 3QJRB 4GNKB 5EU3B 3FS9A 3HE7B 4KO5A 4X8CA 1YNTF 4LEBA 4DOHE 1YPZF 4OD1H 3MKKA 1AQ8A 1TPXB 1OQOA 4G9FB 4UQ3A 3LNGA 2Y2WA 2Y4SA 4Y9GA 5F7EL 1I4FA 4BH8B 5D1QE 3CBJB 3WO3B 4L3CB 1A7QH 2CDGB 2DYSB 4JHUA 2V2WA 1K3IA 4IK7A 4ZMNA 4HDIA 2GTZB 1ZEAH 3D18B 4ONGH 2VOTA 3HMXH 4PJXE 1G7MB 2Z31C 4UOW1 4DP6X 4LLWB 1BPLB 1GYWA 1W0VA 1S46A 3B9KB 4PIBA 2Q7YB 5DMKB 5ACLA 1RU9L 3QIWB 4N5ED 1DN0B 2ZNWA 1S9VB 4NJ9H 1XV8A 4WEMB 1KXVC 4Y4KB 3K0WA 2COVD 2LTQB 2BNQE 3QS3A 5FW8A 4HWBH 2Z31B 4ZAKC 4C58B 9CGTA 4Z7WF 4FADA 1KCUH 3WFBL 4KKLC 3ECUA 6TAAA 3V4PH 1H3TA 4GG6B 3GQFA 3HB3D 4LSRH 5IIEA 1IM3B 2Z7ZA 2CUIA 2OL3L 4X9BA 2VDNB 1VIWA 1PDKA 4GG6E 3D1MC 2J1ZA 2WUCL 5KYYA 1NCBH 2WQXA 3CZEA 4QHUA 4FYQA 3G5YB 3NACL 1IMHC 2O6DA 1QFWL 1PPIA 1NWOA 1QI4A 1BG1A 1F45A 4ZO7A 2WK2A 4LPXA 1YUHA 3DRQA 4LDEB 2AEWA 3ZHFA 1GC1L 4KVCH 5IFJA 1RFDL 4BK8A 4CGTA 4K94L 1CXFA 4YDJB 2PCFA 4MNHB 1B0WA 4PR5B 3TLRA 4ACPA 4MQSB 4UT7L 3F65A 1GZHC 2B1AL 5D93B 1AJ7L 3L7FA 4ZMPA 3OMAB 3FQXA 1DBJH 2NNRA 2IOOA 4HEME 5EUKA 4FX5A 4GUPA 2CLZB 1TZOA 3QSKB 5FYKE 5DC0A 3U4BH 3PWUB 4NEHB 1YQVL 2NLJA 3H6JA 1T1XA 1CDUA 4UDTA 2EIBA 2JQZA 2YMXL 2SEBB 3MKGA 5L8JB 4MASA 2K7PA 2DQMA 2XZQL 4G1EA 3DO7B 2L3BA 1U30A 3CTTA 4XMWA 1MH5B 4ZS6D 5C3TA 4J1UB