4AJVA

Structure of mouse zp-c domain of tgf-beta-receptor-3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
167
structure length
152
Chain Sequence
TFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFISPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRNKGSQKLPKCVTPDDACTTFTKPLAVVLQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSFORMING GROWTH FACTOR BETA RECEPTOR TYPE 3
publication title Identification of a Novel Tgf-Beta-Binding Site in the Zona Pellucida C-Terminal (Zp-C) Domain of Tgf-Beta-Receptor-3 (Tgfr-3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 27
structure length 152
sequence length 167
ec nomenclature
pdb deposition date 2012-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ajvA00
3NK3A 5BUPA 4AJVA 3NK4A 3QW9A
chains in the Genus database with same CATH superfamily
3SJVA 4CSZA 3LKQB 5D1QC 3SBPA 5KVGL 2JB6A 4W9CC 2X4UA 4LSQL 2DQFB 1TZGH 4L4VE 1T6WA 3C5ZD 2BLFA 3QIBB 3QG7H 2RCSH 1AI1L 1KXVA 3PDGA 4HLJA 4QRQA 2ZXCA 2WO2B 3RZCC 3C75A 5LCVA 1D7BA 1L0XA 1UZ6E 4PJBF 4LCWB 5AD0B 3QCTL 3LHAA 1XGYH 4IBUA 3NCJH 5FF6B 3NJLA 3W37A 4HUXB 2QDWA 1AXTL 2LGNA 4PB9H 3TT1H 5A3ID 4QTFA 3OPUA 3B6SB 4L3CA 1SEQH 1YAZA 3B7RL 2RQ8A 3ZDYF 2OPCA 1PJWA 4Q74A 1AG6A 3QE5A 3WFEH 1JZDC 2KPNA 2H9GA 4I89A 5I0YA 3QIWC 4JPIA 1RHFA 1SF5A 5BOPA 3PV7A 1QFPA 3V4VL 1XL6A 2EUWA 2CDGA 1V3MA 1O0VA 2HN7B 3KGRA 5FEBA 1BOGA 4OCXH 2D7MA 3C9NA 3S3CB 4K7PY 5TGBA 3C6SA 4M8RA 2A6DB 2E9WA 2HFEA 5IB1A 4XMTA 3NZSA 1WWCA 3NRQA 4FFWC 4M8QA 4M43H 5FO7A 2PR9A 5HSFA 5INDB 3SDXE 2WSPA 1AGFB 3FT4A 1BLIA 3HJEA 4XP1L 1P84J 3TBWA 3SJVB 4R84A 3UBHA 4NWTH 1SOSA 2JB6B 1LO4H 2X4UB 2HTLD 2NQCA 4BGLA 2PW1A 5B1KA 3DMMD 3S3JA 2PWEA 4LLWA 4NZTL 4WSKA 3U6XA 3PDDA 1OE2A 3FXIC 4QRQB 4OIAA 3VXUA 1BFOB 1OTUD 4NQVA 2A1WH 4GNKB 4RESB 3RNKA 1IIIA 2FHFA 4FX5A 2KZWA 1KOAA 2BSEA 4R0LB 3GBMH 4CUCA 1RPUA 1A8JH 1LLAA 1SN2A 2BVQA 2OCFD 4OD3H 4YSDA 4PJHE 3TJEH 5D1ZB 3AREC 2QADC 2H9GB 3Q9QA 5FKAA 4C56D 2UWEE 3F3HA 4JPIB 1M7IB 5HDRA 5EEVA 1GZHC 3H2PA 4YLBA 4OFDA 4MA3A 1P9MC 3BZDA 1LGVA 1OPGH 4XE5B 2CDGB 4LPCA 4FNTA 5FHBL 4KZEL 3C9NB 2G5UA 4PY7A 5TGBB 1OTSC 3C6SB 4PJCE 4RRPM 5IB1B 5JOPE 4WUUA 3FAXA 1L7TH 4M8QB 4UT7H 1LDPL 6TAAA 5FO7B 5GS1A 1DBKL 4JE4B 3HZKA 4ODHH 4XC1H 3FT4B 3TASA 1NMBL 2ZWNA 4IBQA 2HLEB 3ZQ9A 5MEPA 3W1ZA 2YD5A 2LU5A 3ESUF 2APWA 2W0KA 4B50A 3D06A 3TBWB 4YDKL 1NC4D 4LSVL 3LKRA 3HE6B 3Q05A 2ZKMX 2CGRL 3ISYA 3PXJA 1N0LA 4M7LT 4FXGA 2PW1B 5IJVA 5D7LE 1UACL 4LLWB 4YXLH 4GXUN 3SGEH 3EDFA 3VXUB 5JMOC 1OLLA 3OSKA 4DESA 4NQVB 5K9KB 1NBVL 1GJIA 4WI2A 2OXHA 4KH2A 4HCFA 4BWWA 4N2FA 3MJ7A 3GIZL 4ENZA 1WYJA 5AW6B 2NLJA 1VACA 2ENJA 1CFQB 4L1BA 2BVQB 2O5ZL 3F62A 4XXWA 1GPOH 4GG6F 3MGOA 2R0LH 5IQNA 1UWGL 5FKAB 3O4LD 1QHQA 4HMCA 3IDJA 4IQHA 2NY5C 3NN8A 4G7QB 1BVKA 2MPAL 4DP6X 3VGFA 2B3RA 3ML8A 1F6LL 4J3SA 4ZS7L 4NNYA 5IESH 5BS0E 2BH0A 4KI5E 4M3KB 4WUUB 1MFAH 3K3QA 5FO9A 2VXQL 2VB5A 1EAQA 1GY2A 2XFXA 5GS1B 5G2NA 1J9RA 3HZKB 3U9PH 1BJ1J 5MEPB 3W5NA 5GGVL 2VJXA 4DT2A 3ROLB 1SBSH 1TKWA 1U91B 1A1NA 4OT1H 1H8SA 1AG0A 4A7GF 3NPZB 2V2TA 4KX7A 1DUYA 4UILH 4XVUD 3UJIH 3RVUD 3U79A 4DHLA 1CR9L 4FXGB 3D39E 3TTYA 1WDAA 5IJVB 4LVNC 5T3XL 5K33A 5CJXC 3UBFA 1IJNA 2OULB 5AWNH 1GTFA 3VD5A 2ICCA 3E6FA 3QDGD 1QSEB 4Y8AA 5IP4A 1O7SA 4KK5C 4WFHD 1RZKH 3MJ7B 1IMHC 2JKIS 4NO5A 2GHWB 4Q7DA 3FZUC 4L18A 4Y4FC 3S9DB 3EH2A 3L16A 3HG5A 4OSUH 1YY9D 4TF4A 3UROR 1QA9A 2CK2A 1W80A 4Y1TA 4JRLA 1FYTA 1DQMH 2FHBA 1AOZA 4AUJA 3IRPX 2XYBA 2C9AA 1KYFA 1E43A 3H42L 3IDJB 3QORA 1JZJA 4XCCH 5D1QE 3NN8B 4NXKA 1BVKB 3HC0A 3ZYOA 4JFXA 2BHZA 4MCYA 5DWUH 1AYOA 4NNYB 1D5MA 4IBLT 1MFCH 1LEGA 4YIQA 3K5RA 4OW6A 4U1NA 4RFNC 4LSTL 4R4NC 2XFXB 3DVIA 5EMYA 4FLQA 1XWVA 3MUY1 1TKWB 4PJ6A 1HWHB 1XXDC 1YEDA 2O5YH 5C6PB 3OBAA 2R29A 1CVSC 2V2TB 1DUYB 2WVVA 4C57C 3WO3B 4PU2A 3FT3B 2NW3A 3R18A 1IBDA 4C4KT 2OMZA 3JSSA 2J20A 3FL7A 3GK8L 3GZOA 1WAPA 4O5LL 4U0RB 3AU0A 3R19A 4AGPA 2NDGA 3PWLA 2ZPKH 2J4WL 4KRNA 5IHHA 1GCFA 1JGUH 3KR3L 3E6FB 4MASA 1ZLWH 5J0BA 2G5BB 1F1GA 4WK2B 4EI5D 5DC0A 3KXFB 3MBXL 2E7LA 3B9VA 4J3OG 4R26L 1INEH 2DQTL 3PAYA 5JIMA 3ULUF 5E99H 3F7QA 3NIDF 4NBYB 4HIJB 1KCVH 2PO6C 5I28A 5D2NA 3WBDA 2H6PA 2XX1A 2G3XA 3PG2A 2APSA 1Z5YD 2VMDA 4U1SA 3TJHC 1QA9B 1E67A 4OCWH 3FRUA 1TO4A 3US9A 2AQ2A 3NIFE 1CDGA 2AJVH 5HYJD 3GBNL 1PBYA 4F8OA 1DVUA 3C5XA 5TE7H 3WKPA 1RCYA 4A2MA 3HC0B 2NY3D 4NGHH 2ICEA 5E1HB 3GBEA 4JFXB 4TLUA 2YKLH 1X5HA 1PZDA 2B1HH 4NFDA 4WHYG 4JFFD 3GHEL 3U2SB 4AL8C 1CDCA 1U33A 2EKSA 1TZHA 4A37A 4RAVA 4MKMA 1LEGB 3D85D 1L9RA 4XCEA 3GJFA 3RVXC 1DBJL 3P3SA 4QRUA 4JB9H 5GGTH 4APQC 4X4KA 4EKJA 1YEDB 1CZ8H 1NCCL 4KMQA 4X7SL 1JXFA 2E86A 5SV3A 1IQDB 3KM2A 5GGRY 4EUPA 2WVVB 4MNHA 3P9WB 2NW3B 2Y0SA 4JG1L 3TA3C 3JWOH 2OMZB 3FQTA 2UXTA 2Z91B 3P0YH 4HWUA 4JM4H 5KG9B 3AT9A 2AI0H 5KSBA 3LD8B 5I73C 1AMXA 1MW0A 5LCVL 4M9OA 3SDAA 5CEZL 4NQCE 3NJNA 4IDJH 4D7PA 4KQ4H 2EDBA 5HHPA 1FNAA 1OSZA 5KTEL 4QNPF 5HGDA 1TIUA 1A4KB 4LCCC 1XH3A 2EIMB 2H6PB 3A6BH 4FTDA 1NDMA 3NZHH 4MS8C 4KWUA 4TMPA 3HI5L 4U1SB 4V1DB 5EORH 2JIXA 4P46A 3FRUB 4D2NA 2AABL 3H4HA 3HC3L 4ODVL 1AR1B 2HH0H 4IEFA 5DQ9A 2CGZA 3BIKB 4ZQKA 2NYYC 2R2HA 2ICEB 3HCVA 1GGCL 1JWSA 3CFKA 1ZPLA 1XAUA 5GRUL 3GXDA 1DLHA 2HJFA 2IFFL 4O02H 1IU1A 4PTTA 2EKSB 1NGXA 5DDHA 2DLIA 4C54A 1TZHB 1T2QH 1O7DC 4FL4B 4RAVB 5ACLA 3B8YA 2JF1A 4XCEB 3BAEL 3RL1A 3GJFB 4UQ9A 3MRPA 5BMFH 4XRCB 3NRFA 4NHUB 4QRUB 3P11L 4MXQC 2AMUA 3BD5A 4ZW6A 4H7VA 2R0ZH 2VXTH 1W15A 4EUPB 2YFOA 3ZGHA 4PS8A 4WUKL 1UA3A 3FQTB 3BAIA 1K9TA 1TTCA 4KHXL 4TQ8A 3VG9C 1FBIH 4BELD 3NGBB 5KSBB 4FKKA 4K5OA 1SLUA 1OAXH 5GSVA 2XSKA 2EACA 4XOCA 4AV0A 2DBLH 4WFGE 1A14L 4GSXA 5DWPA 4AMKH 7TAAA 3DRTA 4KXBA 1P69B 3UTSD 3QDMD 1B4TA 5C0EA 2BINA 2CMRL 4Z95H 1D6VH 3TN0D 15C8H 1YECH 5HHPB 1OSZB 4LAQH 2VIRA 2NY7H 4QCIA 1LP9A 5HGDB 1XH3B 4XX1E 5CP7A 4WNQB 4UINL 5HY9A 4F92B 3ELAT 4Q89A 4I2XA 1D9KA 2J5WA 2NMSA 3W11C 4G9DB 4OM1H 2XZQL 1F5WA 1SHSA 5E7BA 1NANI 1WCQA 1QRKA 4IEFB 5DQ9B 2ZOKA 5F1IB 5F2FA 4ZQKB 3MJ8A 2EADA 4C83A 4LU5H 2BDNH 1BP3B 2R2HB 2VDNH 3BGMA 3HCVB 2COVD 1D5ZA 5FX3A 5L88H 2EUZA 3CFKB 3QI9A 4NB7A 4PGBA 1DLHB 2HJFB 3QJSB 1CGSH 2HKHH 5DDHB 2XG4A 5C08D 4BH8B 3RL1B 3MRPB 5IW1A 1TQBB 5D1XC 4M6ML 4JO8A 1WBZA 3AACA 3U1SL 4HAKA 1JZ8A 1ZANL 2QDVA 2SODB 2Y22A 1JSYA 4Z3EA 1DVSA 3GXNA 1J0IA 4D0DA 1Z32X 1S5HA 1AR2A 2VMJA 4MMZA 4JZJA 5CLWA 2FX9L 1ZWIA 2QHRH 1AJ7L 3WY2A 4YR6B 4P2OA 4LBAA 1P4BL 4OZIE 2W9DH 4J3OH 4BSWA 1PU0A 1TLKA 3KBHE 3OHXC 5BO1L 2Q6WA 5K39A 3MLXH 4LVOC 5C0EB 1PL3A 1YEKH 3TLRA 4EQ2A 1THCA 3W56A 5L0QC 2VIRB 3BAKA 4F7PA 4QCIB 1KCWA 1LP9B 2JQAA 1IAIH 3GZKA 5CP7B 3A67L 1O9WA 5HY9B 3E3QC 2GK2A 4I2XB 1D9KB 1ULVA 3GKWH 5L2KD 1J8HA 1E90A 2C3WA 2I60L 3HAEA 4C83B 2ZOKB 2VL5A 3MJ8B 4UTBA 1A1MA 5D7JD 1BEXA 1W72H 3BGMB 4P2AA 3TT3L 3IAPA 4WHYH 4TQHA 4XP6H 3I3BA 3QI9B 1UM6L 4PGBB 3PL6C 2LVEA 1LXMA 3T0VA 3UDWA 4Y2LA 2XG4B 1JFQL 1PCXA 2YZ1A 3FTXA 5IW1B 2BNRE 5JHMA 5LNGA 1WBZB 1JZGA 3O6FC 2ZG1A 1QFHA 1M6OA 3FH5A 1QAWA 3ECUA 3QXTA 3VXQA 4NAJA 1CD8A 1LP9F 1KYDA 1JE6A 2QPEB 4N4YB 1UD3A 4GAJH 4PS4H 4PREA 3QFJD 4WV1A 2IAMC 2X9WA 1S5HB 4D0DB 3ECVA 4XNQA 4BEIA 4D9LH 2BNUB 4JZJB 2EIJB 4X6FA 3ARXA 2QSQA 4MAUH 4HC1H 4G71B 1OSPL 5D9SA 1ZWIB 5SWSA 1RIUL 5ISZE 3B9KA 3HRPA 4P2OB 1DVQA 1RULL 4BSWB 2Q6WB 4Q56A 4ZK8A 4JRYD 1XD0A 5K39B 5J12B 2XNAB 1R75A 1QG3A 3KHQA 4BH7A 3RA7L 4XBMA 1PD1A 1UH3A 2AJ3A 4R90L 2JSFA 2UZIH 4F7TB 2AEQL 3BP6A 5F9OH 8PAZA 2NX5E 4QOKD 3SKOA 4Z7WA 5HDWA 2EE2A 3PAUA 5DUML 4LRIC 1N18A 3HAEB 1FLRL 4R3SA 1KJ3L 1HINH 4X0NA 2VL5B 2XJLA 4OD2B 2OZ4A 3RILA 3VXSE 1A1MB 4N25A 1HHKA 1A6VL 1DQLH 4XOEA 5D7IA 2JCWA 4FA7B 2R7EA 3MRIA 4XN5A 2DTSA 4DAGH 5J6HB 4CVXB 4QAWA 1FZMB 3BPLB 2EDXA 4C55A 1ZAGA 2HPOA 5H37G 3K72B 7PAZA 1KDJA 1QBAA 3F7KA 5JZ7C 1GYUA 4KJWC 3EGXB 4MJHA 1Q72L 1M6OB 4NKIL 1AHWA 5C6TL 2DEXX 2R29L 4FXLA 3N1GC 3DXAD 3ZOAA 4GRWE 2DL9A 1PX3A 3PQYD 3QRFM 2JB5H 2FUQA 2KQNA 5F1KC 4PREB 3QUYB 2OQJA 3UAFA 4YSQA 1EEUA 1I1AC 4XNQB 1SFDA 3AUWB 4AGQA 4ONFL 4FQJH 3VU1A 4DP4X 5JDSA 2C3GA 2Z31C 5SWSB 3VD0A 1VB9A 3B9KB 1S7UB 5T33H 1EPFA 3BC9A 4M7LL 4JZNB 1BVNP 2E46A 4FCAA 1UOLA 1XSOA 3DIVA 4BH7B 3WXVL 3BUYA 1YMHA 2ZOOA 2IAND 1O7DE 1F3DH 1MVYA 3AITA 5KUKA 3BP6B 2F61A 4QRSB 4Z7WB 3CTTA 2N0KA 4HKZB 3LNIA 5I0XA 1MCDA 4N90E 2EO7A 3HBGA 3CN3A 2C3VA 4R3SB 2R0KH 3TZVC 4F7MA 2GSGA 3FQUB 4UIMA 5BQ7A 5I5RA 3ARSA 4ABUA 1HHKB 4WEBH 4NZUH 5D7IB 4Q6KA 1TZIA 2R7EB 3MRIB 3B2VH 4UDUB 4FFTA 1QRND 1I9EA 4K73A 1BYPA 3WI9A 4WY7H 1KIPA 3LZNA 1FSKC 5TTRA 1FCGA 1HESA 4OGQC 5E2WH 4LSPH 2WK2A 4QRPE 4HQQH 2WVUA 4G1EA 1A3RH 3TURA 1TJHL 5MEND 3RGVA 1AHWB 4PJIE 4P5TD 4Y4HC 2GG1A 2GB2A 2X1PA 3WELA 4F8PA 2VR7A 1HNGA 1ODUA 3REWA 3D7PA 1COBA 2OQJB 5DMIL 5T5NF 4L4VA 3KYNA 4Z7WF 2X1XR 3CH1A 2OP4H 5JDSB 1CPUA 3U83A 1EZLA 1RLBA 3DTDA 3ATAA 3ZKXB 1W8NA 2A77H 2WTRA 4PVBA 5MHSD 3VXPA 3ZO0A 1SJVA 3T0BA 2QVMA 4W9LC 4B5ZA 2L8AA 2ZKWA 3BUYB 1YMHB 1XCWA 1BZOA 5IHWA 2Y9RT 1DEEA 4NC2B 3IJYA 2OK0H 3PHQA 4M5YH 5DJCA 5F6HI 4ZMPA 2FVNA 2JKSA 5D1XE 2X7LA 1T7WA 3CFBA 5DFVC 1F56A 4JN1L 3BZ5A 4ZJ9A 3TH2T 2Y2WA 1F0LA 1ADQA 4DOHE 2C3VB 4F7MB 4L4TE 2GSGB 4UIMB 1YMMD 5BQ7B 3EOAA 1FDLH 1TCRA 1U8CB 3ASWA 3N1PC 4FNRA 1KBPA 1TZIB 5AYQA 2DYPA 3NCWA 3FFCD 5GZND 3JTTA 1KIPB 4HDIA 3X1NA 4NIKB 2NZ9D 1UWFA 3BEVA 5AVWB 2YUVA 4M6NL 4LOUD 2WBJC 1S3KL 4XE0A 4JGJA 3EFFA 3KPOA 3GB7A 4G1EB 3SDXA 2ZIDA 1AO7D 2YPLD 3ZKSD 4ERSH 4EZKA 1NM4A 5CZKA 1EA9C 3RGVB 4LPTA 1OO2A 3FU0A 4YHZL 5F6IB 2RD0A 3CN0A 4YBLB 4G83A 4XAKE 3AB0C 3E3QE 4L4VB 4CJ0A 2WLKA 1Y0LA 3KYNB 3IPFA 5TK4A 2FSEA 3CH1B 5JXEA 4B9IA 1IFRA 3I75A 3T2OA 3JZYA 4LHUG 1RJZB 5FYJD 1CBJA 2BWQA 3FO2A 4PMFA 5C09E 3HZMB 4UIKH 4W81A 2WTRB 2DQDL 2X0WA 3VXPB 3T8XA 4M9PA 3U4EB 1NFDF 1EK3A 1O9ZA 4I1PA 1CL7H 3PAZA 3MRGA 1EDQA 1NAKL 3PHQB 5DJCB 3QC5X 2UZYA 5I17A 4GSDH 3T2NL 4WCYL 2D73A 2WBWB 3CFBB 3LNGA 5CD5D 4ANKA 4LEOB 4S0SD 4IW4C 2UXFA 4JAMA 2K7PA 3AAZA 1H3TA 2QFPA 3EOAB 2ZE0A 1TCRB 2P3YA 5J1TC 5HDQH 3L7FA 4JL2A 4NP4H 3BP7A 5BPPA 5DYFA 4RGMB 3JTTB 1WCBA 4HDIB 3Q6GL 1BVZA 1XEUA 4PJCA 3DX7A 5H37H 3BEVB 3ZKMD 4ZMVA 1YEHL 3DROB 2C5DC 3DI3B 4BRVA 1S7RA 2L7UA 5D5ME 1ILUA 3H56A 1UZ6F 4I0PD 3GB7B 5GGUA 3SDXB 1K4DA 4DJMA 5CM1A 1FVCA 2Z9TA 4XPAL 1MCBA 2JJWA 5A6IA 4R97C 3D12B 3LH2L 5I6PA 2X89D 3KJ4C 4PRNA 2ZYSA 3BFWA 5GJSL 4CSSA 4HJJH 1BBDH 5I18H 3I84A 3ESMA 3EFDH 4KRPD 1Y0LB 3HC4H 2ROYA 4LCUA 4OFYD 2FSEB 5LN8A 2ZP9A 1SMDA 3DX9A 1YY8A 3I75B 3RIAK 3WY4A 3FO2B 2E9JA 2YEVB 4K8RH 4GUQA 1HFUA 3T8XB 2B14A 5DEGA 1CGTA 3QH3A 2XWEA 3MRGB 2B5IC 4KBPA 1NEZB 3IS1X 2OL3A 5I17B 4PWIA 4P99A 1DL7L 1VEPA 3SDXF 5BVJB 3JVFC 5I74B 4F15B 1BVOA 5F71A 2CBMA 2C4XA 2UWEB 1KPUB 4JAMB 2E9IA 3JWDH 2WZ6A 3UPAA 3AAZB 4UTBL 3ULVL 2WAQA 3HMXA 1S5IL 4XMKL 1DJYA 4F58L 1QSFA 3EJCA 1O6VA 1XCQB 1WCBB 4KJYA 5HHVH 4GBXA 4PJCB 3J07A 1QI5A 2MH4A 4GMTL 1FGVL 2GIXA 3PWVA 4PWGA 2XETA 4Y5VB 1KJMA 1S7RB 3GI9L 4MGXA 5L8KB 3VRJA 3F5WA 5GGUB 2FLRT 1OAZL 2YMOA 4Y7MA 5DD1L 2WWOA 3S4SA 3SQOH 1BMWA 3S3PA 4BSVA 1BM3L 3P1VA 4GT7A 1E50A 4K94L 2KPWA 1ASPA 3CAFA 3BRGC 1RY7B 4PRNB 1KIQA 1HHHA 1LK2A 1ZVNA 2AZUA 2D2OA 3L3KA 5LBVA 1TQVA 1A7PL 5DHEA 1MWAH 3EYQC 5F6HJ 3C2SA 4PJHF 4AQ1A 4ES8A 3M88A 1DVFC 1ZVYA 2JI1A 4B27A 5IUCA 4NS0A 4JREB 3QHZL 4XR8C 2UWEF 4EN2A 4WI0A 2Y7OA 1EV2E 1YY8B 2FJSA 2NY0D 2VE6B 3DX9B 1QTSA 4OVVA 4TOYL 3QUGA 5GRZA 1H15A 1RZ8A 4W4OA 5E2TH 5J9PA 1E28A 3I6LE 5DEGB 5EEYA 1WITA 3HFMH 3HNTH 1DBBL 3Q1SL 3M17B 5AOZA 5IFHH 3MX0B 2WGNB 2OL3B 2MCG1 3IMWA 2BK8A 2N7AA 5B1AB 3IGKA 3ZTCC 5KVFH 2GJZA 5HHXH 3MROA 2ZOLB 2I7OA 2IPTL 1V3KA 1N9PA 2GITA 3ZL1A 1DSFH 1QPXA 2VW7A 2YWZA 1F4WL 4I48B 4ZDHA 2B2XL 4Z3FA 2CDFA 5E94A 1A7QL 3O6MH 4KJYB 1QBBA 4GBXB 3LRHA 3CLFH 4M5ZL 3S5LG 3O8XD 3WY3A 5BS0B 3D48R 3PWVB 1JL8A 2YMXL 3V6ZA 1MXDA 4HW6A 4UT6H 4HT1L 1EZUA 4KNQA 4F27A 3F5WB 5B22A 3S4SB 5BZDA 5I5MA 2YAFA 4JHAL 1L5GA 2GPZA 4XZ4A 4F37K 5E2VL 2F8OA 4BSVB 3E7JA 3TIEA 1E4JA 2CD0A 3E2HC 4HMDA 4YX2L 1KIQB 1HHHB 3CLEL 3L3KB 2CCLA 1TETH 3CSFA 2YPKA 3ARWA 3KMDA 3KHOA 4OTXL 4ODXA 1RV6X 4DFIA 2GHZA 4AKOA 4FQ1L 3R0NA 2QSVA 3EGSA 1BM7A 3D39B 2QZ5A 2VLJA 5C0DA 1C7SA 4FABH 3QXAA 1L9TA 4WI0B 2NY3C 2QR0A 4L1SA 4LBEA 2UUDH 5D70L 1R24A 1H15B 1RZ8B 5I1JL 1IGFL 4KJQD 1XH1A 3BOVA 4XP4L 1SY6A 1E28B 1RURH 3ARFD 3R7QA 2IV8A 2A6IA 2BCKA 4A2LA 1KG0A 1S9XA 1NMAH 2AQTA 2LLNA 4KI5F 3DO3A 3QIUC 1OOWA 2JKJA 4HUNB 5JIQA 4M61A 4MX7B 4RMUA 2N56A 5A2JH 2GJZB 1Q9LB 4U1JA 1UEYA 2OR9L 3JVGA 3TCXA 4AT6A 2XQBL 4N87A 4TSAH 2GITB 5D1QB 4KZDL 3QUXC 4B60A 1UYWH 1T66D 2WYHA 4KUZL 4TRPL 2ED6A 3JXAA 3W0WE 3LMJL 1MCEA 2CDFB 1HEHC 2Y72A 1QFWH 1EHKB 1CFVH 3LIZH 3GHBH 3Q9PA 4PBVC 5E94B 1ZLSH 4DW2L 2EVIA 4JKWA 5D71L 5BZDB 1L5GB 1UD5A 4N28A 2HG5B 1JNHA 1SYVA 1BQLH 3TIEB 3VMPA 3ARQA 3GLZA 1GHFH 1VFBA 1J18A 2EDWA 1BXUA 1C8QA 2OZNA 3SGJC 4OI7A 2YPKB 4EDWH 4N6RB 4ODXB 1TYJA 4GW4A 1DBML 3T6VA 1T21A 3EGSB 3IT8D 1GOGA 5C0DB 2W0PA 1MY7A 4FJ6A 4HBQA 3QIWB 3KG5A 3QXAB 4N1CA 5FYLH 1GZHA 2QR0B 2X6UA 4LBEB 4WFFD 5GSRA 5KVEE 3HG3A 2P5WE 1P9MA 1R24B 2FIRT 2WAHA 1B4JH 5F9JA 2WB1A 3S2AA 5IIEB 1I9RL 2EZ0D 2PWFA 2OMUA 1RLWA 1QOKA 1T3FA 2A6IB 2BCKB 2Z0BA 3DVFA 2PKDA 1NIEA 4KRLB 4ZMXA 1R5WA 1UT1A 3M6DA 4BBWA 3DDGA 4ORGB 3NIFB 4R2GC 1P5VA 1ADQL 4U1JB 3SD5A 2Y4SA 3DIFA 4XNYH 2ZP8A 4AT6B 4WU7B 1N8ZB 1S6NA 4CA4A 5IMMA 5FW8A 2CJUL 3AS2A 4ZZKA 3O2DA 4LSQH 2R2BA 2V5TA 1DLFH 1MW2A 1EAJA 1MCWM 2QVIA 1KWGA 1AI1H 1I9JL 4XPFL 5B38G 1XH0A 3V0VA 2QPDB 2FEDC 4ADJA 1QSZA 2XICA 2LFGA 1YNKH 2DI7A 3H9SE 2P5ED 3GMOA 1L4IA 4GQPH 5BOJA 1AXTH 4UMGA 3B1UA 1KGIA 4O2FB 3IKKA 5E4EC 5E8NB 5F7BA 1VFBB 3BWAA 1A22B 1MREL 3LPOA 3E8UL 5F8RC 4YHIA 1KXHA 4BFEA 4FZ8L 4B9PA 1WIPA 3AREB 4HMEA 2QADB 3SCMA 5E0QA 3NIFF 3SPHA 5GSRB 1JZ6A 1JGDA 2R9HD 3LZFL 2WNWA 4NQCB 3VDAA 3N40P 1E4KC 4DQAA 4UNVA 2OMUB 3OZ9H 4QPEA 5L9DH 4P9HC 4WFHE 2ZOUA 2NYKA 5EO9B 3HI1A 2F7RA 3VWKD 3WTVA 1WIOA 3WD5L 4HKJA 5DO2C 1U0QA 4LESA 2VUKA 1P5VB 4L5FH 4DGIH 3R06A 5E8OA 2GC4C 5KJRH 1MIEH 4OGYH 4H1LA 1J9SA 5EC2A 5IMMB 4JDVA 4BINA 1JGIA 4LLQA 2PCFA 3TU6A 3NBNA 2R2BB 2AXFA 1NCAL 4NZTH 1E8XA 3CU7A 1AIZA 1DJIA 2CDEA 3DTUB 3QEQE 4GAYA 3O6KH 3U30C 4NOBA 3A4AA 3V0VB 3K80A 4EIZC 2AQSA 1G6RA 1TO5A 2EDQA 4ODTL 1WVZA 1WV7T 1QQDA 3CVIL 4W9EC 4HS3A 4BM7A 2Q0ZX 1NLBL 4YDLC 1EDYA 1JVLA 3MOAL 2EABA 3BWAB 3OF6A 4RMBA 1EERB 4ZAKD 3S8WA 3D2UD 1BW8A 3T0EC 4YHIB 1IKFL 4CDGC 3VI3E 3BXNA 2R23A 3HVNA 1F6AA 2MFNA 1QEXA 1EXUA 1YNTF 4NO3A 4X4ZA 3SCMB 2J8UE 4UBDD 3BKYL 1JGDB 3CH8A 4G6AD 2IO5A 4JFYA 1RZKC 3Q8FA 2IDSA 3IDXH 1P1ZB 5FHBH 4PJ8D 3BN3B 4GRLD 3VFPA 5C7ZA 2RH0A 3MCYA 2QGEA 2QSCH 3C6LC 3AS1A 5KYXA 1OW0C 2H0JA 5CCKL 3HI1B 3FN3A 3UPCA 1AAJA 4HKJB 3TBBA 1NMBH 5DT1L 5DZLA 3OWEA 5JXEC 2F58L 2ZWYA 3QP3A 1P7QD 4KPHH 5E8OB 1MI5E 3IBOA 4N0UA 4M03A 4NZJA 5B1JC 5K1VA 4TV3A 3FO0L 4H1LB 3HMXL 5EC2B 2CM5A 1EH9A 4JDVB 1E5CA 4KX8A 1VPOL 4S1RL 4JW3A 2AXFB 1LYQA 1GMEA 3UTTD 1UACH 3JUYA 4LVNB 4P2YA 3MYJA 3ISRA 3S36X 3NACH 4GAYB 5DZVA 2WQUA 5DJAB 1TOXA 2XQ0A 1U36A 1G6RB 3LZOA 3GIZH 5AB2A 4S2SA 3U7AA 1QQDB 1WISA 4OZFA 4EIGB 4DGWC 2NY4D 4Y4FB 4R83A 3OQ3B 3GRWA 4UM8A 2W9LA 2X42A 4DGYH 1ICTA 1G1OA 1FIGH 5EU6D 2BNQD 1RZFL 3NJVA 4JJ5B 2R23B 5DJXB 2P8MA 2G2RA 5B1CA 5CJ5A 1F6AB 4K3DH 1EXUB 4NO3B 2W65A 4I3RH 2G3ZA 2O5XL 2FBJL 3EAKA 5JORA 5ISZA 2IDFA 2ZG2A 3GZQA 1E0OB 1QATA 3DYPA 4JFYB 4L2YA 3GWJA 3SPJA 4FG6C 1T89C 4NUGH 1I3UA 2YBGA 4TNVK 5IVXE 1PZSA 2FYYA 4M6AA 4JFOA 1JPTH 3CDZA 2X12A 1FGNL 4RFNB 4AK1A 4WI5A 3OKDB 3S35X 5K1JA 2XRAH 1ET7A 4HUCA 3MI6A 2NX5A 1N64H 5D7EA 5GGVH 4APQA 4FQHA 2VSCA 3LS5L 4FE9A 3N55A 5A2BA 1G7QA 1MVFA 1IEHA 2H0FA 3B2MA 3FCTA 5DR5H 2GJ6E 3PGDA 3UXFA 5I1CH 5AOJA 4LHUD 5I1KL 1CR9H 1TQCC 3BAYA 4I77L 4G8IA 4AV4A 4WWID 3SE3C 3S37X 2A0LC 1FFNA 1WTLA 3DETC 3KJ6H 3O9WA 4S2SB 4OZIF 2GBVA 1CFTB 2VLMD 4JRXA 1WLHA 4OZFB 1QPKA 3UFIA 1NKRA 2WLYA 1KXQE 1KTDA 1G7MA 4PVNA 1AQ8A 4UM8B 4J8RA 4M48L 4LCCA 4OLWL 2UY7B 4HLEA 3JWOC 4BUQA 5EUKA 1C1EH 4KHTL 1W91A 4Y2DC 2P8MB 4XT1C 4FP8L 3R8BB 4BFBD 2DQUL 3EO0A 5CJQH 2JKWA 1P5UC 2W65B 3H42H 2R69H 1JMZA 5JORB 5ISZB 3MRKB 2QT6A 3G5XA 2ZYHA 3O3AA 2PCYA 1XT5A 1SY6L 4L48A 4P23A 2H3NA 1MHHA 1LMKA 3UTSE 2FYYB 3QDME 4JFOB 3MV01 4HSQA 3BE1L 3AXLB 4G5AA 4JGMA 3BUQA 2NX5B 3MRDA 4Q9BA 1CDYA 4APQB 2FX7L 4FQHB 1TJGH 4W9ZA 1G7QB 3HS9A 3JWNG 1A8ZA 1TMQA 2JJTA 1DZBA 5A7BA 3FCTB 3PGDB 4GUPA 1HEZB 3VXSB 1G84A 3TA3B 4AQ8C 1CLOL 3FNKA 4OQ1A 1XSKA 4UV4H 3R1GL 1CQYA 3EF7A 1XGQA 2DH3A 3V0EA 4G8IB 4MD0A 1E3FA 3KR3H 3IWUA 5I73B 1FFNB 3M7FB 4MA1C 3U36A 5I24A 4N8CL 2WYTA 1UZ8A 5T1LD 4R26H 2DQTH 2VDQB 4JRXB 2K8MA 3OMIB 4PP1D 4DVBA 4X98A 5LXGH 3OAYH 1E2WA 1KTDB 1G7MB 1U3HD 2IH9A 4GRWB 3MRHA 2CBTA 4LCCB 2CHZA 4RWYH 2EEBA 5EUKB 1OE1A 1NTDA 1PKQA 3K4AA 5E6RB 2OR8A 1FAIL 3F7PC 3TWCH 5H4ZA 3VFVB 4ZMQA 3QG6A 2F18A 3EO0B 4YNYB 1YEEH 1G0YR 2OLDA 4NX0A 4HPOH 2B9AA 3G5XB 4OF8A 2F2HA 1UH2A 5FKPA 2ZNWA 3GHEH 3IPEA 5A2AA 4QLWA 4P23B 2H3NB 1MHHB 1ZCRA 4C4UA 2WLJA 3FUIA 4KOBA 2NNFA 2R56H 3NFSH 3MQIA 2ZD0A 4QI3A 3Q8BA 5EO0A 2A9AA 5E1GA 1GZPA 3MRDB 1GSKA 3LZRA 4X7SH 1NCCH 3ZYJA 3KLLA 2VDOB 2H4EA 4L4TA 2YUWA 4J2XA 4GRWF 4GUPB 2X3AA 2YD7A 5FA4A 3T0EE 4Z7IA 2WXOA 1AZZC 4KTYA 4YFDB 1J87A 3SDDD 5FUOH 2Z8VC 3CQPA 3CFCL 2PPFA 4MD0B 3MXWL 5I1HL 1HN1A 2WXNA 4IBVA 3U36B 4UYPA 5LCVH 2EJ1A 1UZ8B 3IF1A 3AQZA 4QRPB 5F88A 1JZIA 4XO4A 4DVBB 4X98B 4WWOA 3WAJA 5D93C 4KH9A 2XIIA 5I8EA 4PJIB 5KTEH 3FTSA 1UATA 1WBXA 3BSHA 3IYLW 1DCEA 1PTZA 3ABLB 4IBTA 4AE0A 2OJZL 1CLZL 5C2BH 1PKQB 3HI5H 7FABL 4DP1X 5C0AA 5JYLA 1NH6A 3QG6B 1OARH 4X6CE 5LWYL 2F9BT 5JHDA 2QQKH 2DIAA 3GRGA 3FU6A 5E03A 2AXJA 3WKMH 3BUDA 1GGCH 4TUOA 5J89A 5GRUH 4OLUH 2OV0A 3CV5A 3C08L 2C4FU 2IFFH 1XH2A 4OM0H 3WS6C 4P4KA 2VN3A 1QNZL 4K0OA 2BRQA 3KLAB 3F83A 1BAWA 4OLZH 5D1XB 1GZPB 1JI2A 3O6FA 2DIJA 4Y5XA 1JXDA 4PJIF 2YRZA 2WIMA 4L4TB 5AW8B 5FA4B 2APVA 4F2EA 3MJ9A 2X4NA 5IMKA 3W9DA 4RSVA 2XWJA 1X5JA 4KX9A 4MBRA 2D31A 3SKNA 4KZCA 4AH2A 5HHOE 3V7AG 4ZG1A 4JPVL 2XWDA 2DWDA 1GOFA 3IF1B 1X5YA 5D5MA 2D2CC 3OHXB 5F88B 4LVOB 3WV0A 3BT2L 5I8EB 4MXVE 2VUOA 3NRPA 3TBYA 1E6OL 5L0QB 1WBXB 2VUYA 3O0RH 3TM6A 1YLBB 1N5YH 2IQ9H 3G5YA 1QBLL 3PPEA 1EJ8A 4RFEA 4X4ME 3SB3A 3VFWA 4Y4KC 4XMPL 4Y2OA 5DMKB 6FABH 2XZQH 4JRFA 5JA9A 1FNHA 4LRIA 5JHDB 3AT8A 1U3YA 3BDBA 2KLSA 5EOTA 4TUOB 4TXVB 1R3KA 3SKMA 5ECJE 4PCKA 5FM8A 4P4KB 4XP9L 3HR5B 3SOBL 1G9EA 3QDJA 1IGML 2HFTA 1GC1L 2X6BA 2ZAGA 3VGAB 1UXWA 3O6FB 4A6YA 3UTZA 4J6RL 4ZUWB 5T5FH 4FI8A 25C8H 1ZANH 1IM9D 3JWNH 3QUZD 4S1SL 4TULL 1H3PL 2Y36H 4YDZA 1UG9A 1C12B 5IBUB 3ZR5A 5KVDE 3M46A 2ARWA 4LDLB 2IAMB 4YSEA 5IMKB 1I1AA 4LQFL 5ALBL 3UAJC 4EEEA 2XWJB 2R59A 2NY0C 2FX9H 3E80A 1YA5A 2D31B 1MHCA 4IK6A 2CE6A 1P6FA 1YN7B 1PSKL 3SKNB 2Z31A 2J7LA 1I1FB 3V8CA 3I6SA 5EG6C 1VESA 4XC3L 2DWDB 4M7ZC 3KPQA 5D5MB 1BSIA 5G55A 4RX4D 3JV6A 1U2CA 3WEXA 2C9XA 3TBYB 6PCYA 1BEYL 4XVOA 5J3HD 3NCYP 2KMWA 3L6FA 4NRZA 1IVLA 2BY1A 3G5YB 4RFEB 3ZZSA 3OB8A 5SX4I 1L0YA 4B41A 1MNNA 5CFHA 4YC2C 5C07D 4XVSL 4DKFL 1BCIA 3FU3A 3O2WL 1HXYA 1PLGL 4RGOH 4RZKA 5T3XD 5HDBE 4X4XA 5LDSA 3UTOA 4XBGB 4RSYA 5D7HA 1RUQH 4FFZA 1JDCA 1UADC 1ACYL 4ZUTA 3EOBA 3T4YA 2P42B 5EOTB 3MACH 4HIIA 3EJSA 3PWJB 1R3KB 3SKMB 3T3PF 4UF7C 2HMIC 4L8DB 4PRBA 4YHKH 5C0CE 3FRPG 4EBQL 3ARVA 1E3XA 2RB8A 3FN0L 4Q2ZA 1JFQH 3EJPA 3ZE1B 3C5JA 3S3DB 5TQ0L 5T1MA 5D5MF 1KEGH 2EE0A 3FUNA 4X6DE 3UTZB 5A2LH 1Z66A 4HK3J 3LIUA 3ESPA 2J1YA 3LQAH 3MV8E 3VVWA 2E8YA 2OTUA 4TQEH 1DFBL 5KSUA 1V3JA 4JMXA 3QGVA 1G9MH 5E1IA 1I1AB 1VJSA 2J57A 1Z7JA 2VERA 2KLRA 5DZJA 2XIBA 4M5SA 4XWGH 4UI2A 1MHCB 5FGCE 2NZIA 1OSPH 2Z31B 5BV7L 1RIUH 4JPSA 4NSKB 1LO3H 2FJFB 2VR3A 4OJEH 1ES0A 3KPQB 4GXUM 1NINA 2VDQL 4K3EL 4XTRC 3JV6B 2A4EA 3NMEA 2O6CA 3WEXB 3ZTEA 3UZEC 2DQCH 2CKBA 1CMOA 1PLCA 5DJ2A 1HXMA 3S0PA 4NRZB 5A2FA 3GSRA 1NSNH 4KKZA 2AEQH 4HG4J 4NJ9H 3NCMA 4Q9QL 4YK4C 4M1DL 4CC4C 1HXYB 3QIBD 1XX9C 1FLRH 3TZVB 1KJ3H 1H6UA 3FSAA 3H0TA 3F84A 4ZFGH 5C97A 1BD2E 4ZUTB 1XF1A 1GXEA 5EF2A 1UWXH 4HIIB 2H1LM 4LCWD 5GPRA 3LEYL 4PLKD 1FSKB 1T5WA 4PRBB 2EILB 2WBJA 4Q2ZB 3C5JB 1ESOA 2F68X 3L5HA 2J6EA 3U7WL 2Q5BA 5T1MB 1LL1A 4ZMAT 4PWFA 3LKOA 2HJKA 5SV4A 2AJYL 3FSVA 5C0FB 4K23L 1CT8B 1Q9WA 4NKIH 4Y4HB 3U4BL 2R29H 1XGZA 4RIRA 2VDOL 2F15A 2APXA 2O6FA 2Y7QA 2FT6A 2OTUB 4JG9A 4CADA 1QBMH 1RIHL 3CZNA 4YHOL 3TH4T 4U6TA 4U1LA 1KUMA 5L7XL 3KWVA 4XNZC 3OMAB 5F3HA 4JDTH 3AU1A 4AVIA 5C8JB 1CYGA 4Z7UA 1NGPL 1XIWC 3DECA 3BZ4A 2XBZA 5DJYB 1E27B 5FUZL 3GXIA 2XXFA 1MHPH 3PWPE 4JBSA 2WTOA 2CKBB 5DJ2B 1HXMB 5MEOA 5FDYA 3GSRB 3SJVD 2VM4A 5IFJA 3GMRA 4U3HA 2BFVL 3E1F1 4L8SC 2PN5A 3HAEG 3LZLA 1HAWA 3H0TB 1GW6A 1CLYH 2W5PA 4GSQA 5IGXH 2GIMA 3VE0A 4W9GC 5EIIB 3X13A 2AEIT 2DB8A 3C2AL 4EI6B 1T5WB 3TF4A 3FTZA 2WBJB 1AZNA 3INUL 4MVBC 3WFDH 1IAOA 2DQGH 3LKOB 5E6SB 1BREA 4OIIH 1TJHH 5D1ZD 4G7YL 5CCJA 4RIRB 2Y7QB 4JHWL 5A43C 1WAAE 2M1KA 3RWDB 2ZJSL 5TH2A 5C0IA 3AB0B 4UM9A 5I1DA 2X4SA 4CADB 1FO0H 1QHPA 1PY0A 5DMIH 3W0WB 1JF5A 4U1LB 5ACMA 2QQLL 3G9AB 1QTPA 2H6UA 3EBIA 4WTXA 2R9HC 3AU1B 4Q6YA 3VD2A 2G4GA 1IKNC 3MYZA 4Z7UB 4LDCA 2LQRA 1OCZB 4F7EA 5GS0H 1NEPA 4FJZA 2A9NL 1BJ8A 2EYRA 3H9SA 3BN9D 1N6QH 1SJMA 3RDTC 4G6KH 1RZJC 1P6AB 3JYBA 5IOPA 5SX5K 1E30A 1WBYA 5MEOB 1K4CA 2VDLB 4GAAA 4C47A 1DQJB 3IDNB 3CHXA 3UYOD 3HE6D 2Y5TA 2P28B 4JGUA 4JM2C 2WN3A 2MCPL 2VDPL 2H47C 3VB8A 2H8PA 4IIQC 1YC8A 2ZUVA 2P5WB 4ZO6A 3WDIA 3VXUD 4BKLB 4CAGA 4N22A 5F7AA 5ES4B 4K8RC 1DZ0A 3D69A 3HZYA 4WHTA 3X13B 3IAGC 2BSED 3W2DH 3VXOB 1AQKL 1LO2L 3EUDA 4FYRA 5ESAA 3J2PA 2DEYX 5F9DC 3N50A 1S3KH 4JQIH 4AI7A 4BCXA 2GJPA 3OGOE 4AMWA 1NGWA 2VZUA 2YEQA 1WTGT 1IAOB 2H5UA 1KTBA 5EZLA 4Q9CA 3JWDC 1NM9A 3Q5YA 3KJ4B 4HA1A 4HJGA 5C0IB 3MJ9L 5I1DB 2X4SB 3GPSA 1KACB 4KK8D 5KW9L 1DVFA 3DBXA 3OR7A 2XBDA 3QEQA 4G6AC 5IHLB 3B3IB 3T0XA 3BSZA 5IT2L 4LDOB 4F7EB 3L5XL 4YXHL 4KKLC 1NPNA 2WQRA 4OJCA 2EYRB 3DDFA 3H9SB 3UACA 4CNIB 5IOPB 3FTVA 3HHMA 2B5IB 1K4CB 2WKGA 5AVVB 4CGUB 2VDKB 4B3EA 3FU8A 1YVLA 4JQXA 4LVEA 1JGVH 2GAZA 5F1NA 1OZUA 2H8PB 3MLYL 4GKZA 4QF1A 3ARGC 2A5UA 3OC8A 4JFDE 1K6QL 1ZK5A 1TFPA 3ORJA 5K59E 1QSED 1ZE3C 2QLYA 4AQEA 4YUEH 1N6UA 3D69B 3VI4E 4N26A 2QKIC 2HWZL 3Q6GH 5ESAB 4XCFH 4PG9A 5DD3H 2W0FB 1YEHH 4GT0A 3K6DA 2NY4C 5BQDA 4A6YL 4XXCA 1XF2A 4QRBA 5EZLB 4NIYE 3WNMA 4MMXC 2Q86A 5ABZA 1F3JB 5JNYA 1MI5A 4YLQT 4RZCA 3OLEA 3NFPA 1BF5A 5GJSH 3JT2A 4HJGB 4G59C 2OSWA 4BHUA 1ACZA 1PFCA 1DVFB 3DBXB 3LRGA 1I3RA 3ULUD 3BH9B 2DTML 3ET9F 4B6ZA 3V7MA 1MAKA 1UCBH 3QEQB 5LBGA 1A9VA 4JDEA 4XN1A 1PLAA 5ABDE 1KJ2H 2CHDA 2NXYB 4WRLA 2APTA 3OLGA 4RBPH 4IBWA 5E7FA 2KQMA 3QIUA 4PS3A 4WO0A 1UM5L 3VI3B 1J10A 3RWHA 5AYTA 3QCVL 5CINL 2GAZB 2WJ5A 3NA9H 4MQXD 4HWBL 4GKZB 5F1NB 1RZQA 1GGBL 2J8UB 3A4FA 1ZY9A 3MLPA 4PJXE 4FFZL 3QUXA 1WGOA 5I6XC 4AQEB 1AKPA 2XA8L 3KXFD 4F58H 2VL4A 1SXNA 5EPMB 2R15A 5IVXA 2J88H 3FUEA 2BRRH 4Y19A 4PG9B 3AWFA 4PRDB 1EO5A 4NKMB 3ROOB 1L9OA 1UGNA 2AZAA 1UXMA 4JQVC 1UXSB 1OAZH 2EXWD 1ZT4B 4K9EL 5AOIA 5GGSY 1R0AL 2Y6SC 1AVAA 4N2BA 2Q86B 1YEFL 3E2HB 3KPMA 5JNYB 1MI5B 1HSAA 4RZCB 5DF0A 3NFPB 1J5OL 2GJ6A 4F9PC 3A47A 3L4XA 4QHMA 3ARYA 1IRAY 3APDA 3VI3F 1I3RB 1IBGL 4OY9A 3SHSA 1ETA1 3QHZH 3WXWL 5D7SL 2V37A 4NN6C 2J8UF 4BFOA 5D2LA 4TOYH 1DQKA 1JG9A 3P2TA 4X83A 4ZD3H 5IMOA 4KNTA 4B3VA 2WVSA 5JR1L 3OLIA 4M93C 4EE2A 2VITB 1JJUA 1MZYA 2G4EA 1KXQA 2IBGA 4X7TA 1MIML 5CIPH 2CKBL 4X8XA 3ZYZA 3Q1SH 1QASA 3DURA 2CH8A 1RFDL 3UBGA 3QIUB 2VLLA 3FHAA 2QL1A 5F9WB 5HXMA 1JZ3A 1BECA 4TVUA 1R33A 3VXME 4MSWA 1S7WB 5DLML 1T03H 3NJGA 4JY4B 2DM4A 3MLZL 1V7ML 2EEXA 3QUXB 1ZLUK 4E9LA 5A16A 2J1KA 4N5UA 1F4WH 1PG7X 2Y1YA 4ADIA 5AKRA 4H44C 2BXYA 4AIZA 5IVXB 3WEBA 3QZNA 4Y19B 1Q1JL 4RMRA 2AMGA 5IJDC 5L6YL 4Y5YC 4FERA 2J6EL 4N2CA 3APMA 3IDIA 4R7XA 1Q0YH 4PSPA 4AQAA 2NR6C 4V1DD 4WGVB 5DS2A 4FG0A 1CO1A 1SXCA 3NSXA 5AYUH 4Z3TA 3I2CL 3KPMB 3MODL 4Q4IA 4WGWB 1HSAB 3VFNA 1AR1D 2GJ6B 3SGEI 5J1AA 2J72A 4OTXH 4QHMB 3C12A 3PGCB 5EZOL 1CF1A 4FQ1H 3MAWA 2FEEI 4Y88A 1CFNA 2LE9A 4WI9A 2FGWL 1VZGA 3OAZK 3WJMA 4XPGL 3F05A 4B7IA 4DKDC 5D70H 1SYSA 1T5XA 3D6GA 5IMOB 5B7FA 4ZT1A 1MDAA 4X7TB 4UZSA 4RMWA 2MRYA 3M45A 2LHAA 4HCIA 2HFFB 3RGBA 2AJUL 3Q2VA 1CFSA 3DURB 4URTB 1HH9A 2J2ZA 2PUQT 3MBWA 2IGLA 5ABAA 2R2EA 5DYOA 1BZEA 5B39A 4G5ZH 5J1SC 5IM7A 4R2GB 4K7PL 4MSWB 1TJIL 1IM3A 4QXWA 2OR9H 4LLVA 4K2UH 4MB5A 3ISWA 2WOBA 4N8VG 4AYDC 4KUZH 4TRPH 4IOFD 3LEXA 4U6VL 4X6BA 4XO8A 3LMJH 1T0MA 3N41B 4HX1A 4GB9A 4AIZB 5TPWL 4LE8A 2DOCA 1BVNT 1QP1A 4XPTH 3MRNA 1PS3A 4GMSL 3TVMC 4MMYB 5E5MA 3IDIB 1OP5K 1A7BA 3MUGA 3L5IA 5E4IA 5BW7C 2FJHB 4XH2A 2ZX6A 5E4EB 2VZOA 2XG5A 2D4FA 3VFNB 3K0WA 3QJTB 1XV8A 5J1AB 2YRBA 4O51A 4X7CC 3T0EA 2B20A 4OCSH 4IOSA 3UAEA 1QKZH 2ZXBA 1VENA 1WZ1H 3MLRH 5IK3A 1D5RA 5FOJA 3WJMB 4ANUA 3D05A 3BGFC 2UX6A 3KBFA 1HAUA 3G6JE 2MQ3A 1T5XB 1TTAA 2H1PL 3UTTE 4AEIH 4KTGA 1NICA 2I24N 3OQRA 4KJPC 5F89A 3RU8L 2NY2C 5I15H 1I9RH 4DGUA 1I8LC 5E9AA 3BQUC 3N41F 4KVNL 4DN4L 3C6LA 2ESVE 4M7JH 2B1AH 3FB8B 1OW0A 4NWUH 2FLMA 4L1LA 4PYGA 1CFSB 5L8JB 1HH9B 1I8KA 2J2ZB 5IQMA 1JZHA 4Q9RH 2R2EB 5DYOB 3I74A 1XCTA 1U8HA 2P45B 4Q14A 2H0EA 5KVFE 5IM7B 4OD1H 1U9KA 2P4AB 4X6CA 3LEVL 3BPOC 5B1JA 1T20A 2VN7A 3UJJL 1K8IB 2XPZA 3F7YA 4S1DC 5JIKA 4X6BB 2CJUH 3LEXB 5I6KA 3BVNB 4ENEC 2I07A 2QV4A 4HX1B 4G11A 3ZL4L 3VG0L 2WWKT 2VLKE 3CSTA 3RPBA 3FBQA 3MRNB 4BYHA 4PLJD 6CGTA 3LRLA 4AVHA 5I1AA 5E5MB 1P4IL 1WS7A 1RK7A 3DJRA 1MHEA 1KN2L 3MUGB 3FO1A 4YDLB 3KLHC 3PJNA 1UM4H 1D9KD 3EOTL 3EDDA 3GSQA 5JW4M 3GKZA 3BIAX 4XP5L 1BVLA 3QZBA 4O51B 4YVUA 3T0EB 1ZD6A 3E8UH 1ETZA 4FZ8H 1DN2A 3H6JA 4HLZG 1JXGA 4DQOH 4MQ7A 4OLXH 3P4LA 2CKNA 2OTWB 3QI9D 5FGRA 2CIIA 3BSZL 5DVLA 1L6PA 3LZFH 4RFOL 5F89B 1J8SA 4JCMA 4NZRH 1A7NH 2WXRA 1FJ1A 3NIGF 3HNSL 2X0UA 3RWCB 3RQ3A 1RP9A 1VF5C 3C6LB 2XX0A 4KKBC 3L4YA 4N0RA 4PJ5E 1I8KB 5C1MB 3V6FB 4YOKA 4X4MA 5D8JL 1XCTB 2G2PA 3X3GL 1U8HB 5F21B 5CAYB 2ADIA 2DZEA 2P8PA 4FQCL 4X6CB 4WNJA 3SE4A 3CSBA 3Q8EA 4GLRI 3F7YB 4QJ4B 1KEML 2EC9U 2XZCH 2X9XA 3HBPA 3UCQA 4P2OD 2ZCZA 2I07B 1S9WA 2Z4QA 3MSPA 3SE3A 1GS7A 2IOIA 4F1SA 1CXHA 1LO0L 1ETB1 2PETA 2FX8H 3GO1H 4NOFA 5GS2H 1QABA 2EC8A 4LARL 5GGTA 1MHEB 4ANVA 3QRGH 3GINA 5CWSA 2Y69B 3N85L 3S98A 3GSQB 2PPDA 1BVLB 4B0MM 5FYKE 1MJ8H 1I4FB 1TZGL 1ETZB 5LB1A 2RCSL 3REVA 2CA4A 5FYLE 1KB5L 3QXDA 4HBCH 4MQ7B 5CU5A 4HXBH 4X6CF 1WJ3A 2CJSA 1HS6A 2CIIB 5I9QC 5HHOB 3BKYH 4MJ6A 5CJBA 5F44A 4MWFA 5DA0B 1MLBB 1XGYL 5HDOA 3ZR6A 4QRRE 4PBWD 1FJ1B 2MEJB 3D4GA 2YSSA 1EHLH 2Z1PA 2GJRA 3KPRE 4PB9L 3TEUA 3Q5TA 4LRNH 3TT1L 4LEEA 2H6OA 2CHXA 1NGYA 1SEQL 3SY0A 5CCKH 3Q2CA 3WFEL 5C9JB 2VNCA 3TFKC 2ADIB 3QUYD 4OFPA 4DK5A 5HYSG 2F58H 3GSOB 4OZ4A 4PVLA 2VKXA 2IV9A 3ZO9A 1AXSA 1JDDA 1RU9H 1ED3B 3FO0H 2D3LA 3HMXH 5SWSD 3B9KD 4JO1L 4OCXL 1NA8A 1TQCB 4NCC1 2VYRE 4GO8A 2Z4QB 1S9WB 1BGXL 2YQ2A 4O02A 1JFHA 3U4KA 1EANA 4ONGH 1AZCA 4M43L 1G7HA 4JHUA 4YE0A 4A66A 1URIA 2CO6A 2C26A 1MFUA 3HN5A 5CWSB 4Y1AE 2BMKA 4MXVF 1D7FA 3OGCA 3MV8A 4AEHH 5BRZE 3RKPA 3W57A 2XWRA 1PAMA 3DHPA 4QWWD 4F8NA 4XMWA 1RZFH 2E27H 4K5NA 1N0XL 3UBXI 2XN9E 4HZLA 3S7GA 1BMZA 4QR7A 1P5UB 5E00A 2A1WL 4G8EA 4MJ6B 1NPJA 1KN4L 3MNVA 4MWFB 1ZXQA 1A3QA 2H45A 1QTYT 1TYRA 5IOKA 1KBGL 2L7JA 4K5MA 1KYUA 1KIRB 4AKPA 4F37F 3GBML 4FYQA 2ALAA 3H8NA 3TPKA 3NQKA 1NGYB 2D7TH 3SY0B 3TJEL 1FG2A 4GUOA 1XB6A 2BC4A 2GTWA 2J56A 3ALWA 3SO5A 1BG1A 3LS5H 4GKNA 3F7VB 3PV6A 1KLFA 1RZGA 4OZ4B 3WDJA 4PV9A 5HDBB 3QWNA 2ORBL 1OPGL 3UTPD 1BD2A 4H20H 5L4MA 5DRWB 5I1KH 2E7DA 4QMEA 1AACA 3R8QA 3MLUH 5C0CB 1DHKA 1L7TL 4F8TA 5TE4H 4MA1B 1HK6A 1G7HB 3CFEA 4ODHL 2X4RA 2DMBA 2H3XC 2CO6B 1CGYA 2BHUA 4ZMNA 1AXIB 4QT5A 1RVFL 4JM0A 4DPBX 3OGCB 3MV8B 5DO8A 2DLHA 3GJFK 2J73A 4OLWH 3FSZA 4FCHA 3QUKB 3SKJH 1J8RA 1NLDH 1GMIA 5E8EA 3BLBA 4I9WD 1OP3K 3WMPA 4GKLA 4YXLL 4HLZH 3QARA 5AOKA 5FGCB 5E00B 5CBAA 3K2IA 2FEEL 5HDBF 3FOMA 4G8EB 3DYOA 4EIBA 3MNVB 3GDBA 1EFQA 3H53A 1P2CA 1ZHLB 3SDYL 3RGVD 2IH1B 3BE1H 1OCRB 3G6AA 4S1QH 5DUPH 1GPOL 4ZW5A 1FG2B 2BJMH 1VHPA 3BFOA 3OXRA 2BC4B 2GTWB 5E1AA 3UJTL 4A38A 3AQXA 2FX7H 4GKNB 4X6DF 4L4VD 3PV6B 1KLFB 5E8DH 1ZLEA 2JKNA 4PV9B 4UOQA 1IBHA 4U4BA 3HUJE 1GIGL 2VDNB 1DVTA 1BD2B 2A74A 3I3DA 2BVEA 1CLOH 1LEKB 1BXAA 5TDPB 3R1GH 2CJTA 2WWMC 3X2QB 5IESL 1J12A 3CMGA 2WXKA 3ILQC 3WHE1 3HG1A 2ZWSA 4DH2A 4W68A 1DSWA 1LJMA 4LKCB 4WJ5A 3VFGH 5C7XH 3CFEB 3U9PL 1Q94A 1AGCA 2X4RB 1BXXA 3VW3H 1SBSL 2Y5EA 4M1GL 4OT1L 5D93B 4QT5B 3TFBA 3UGXA 2H2SC 4PWJA 1OTTC 4MZ3A 1WAAA 3UJIL 3AM8A 2EXYD 1UWEL 4YHYC 5J6SA 5E8EB 2BIOA 2WANA 3CGTA 3KPPA 4J27A 4U4IA 4Y4KA 5ALCH 5FCSH 1WIUA 3GYRA 4HC1A 5AWNL 5CBAB 3L13A 5HYFA 5TD4A 3FOMB 5DJZA 4ILDA 1RZKL 5F7FA 1QLEH 1MCPH 2VRAA 4XXDA 1FLTX 3PWPB 1GJWA 3B2UD 3CHPA 3QRBA 4PP2B 1CFBA 1P2CB 5CCGE 3RJQB 4MAZA 3L3IA 1FZOB 3EO9L 1CG9A 1R3IL 3HN3A 1G7PA 1KV7A 3OXRB 1IGCH 3GMQA 5E1AB 3GC3A 4ATWA 1DQML 2QV2A 1UFUA 4NNXA 4KI1A 3V4UL 4XCCL 3C8HA 4KK8C 1W72B 5C07E 2YXWA 3BQVA 5INCB 5L8LB 4NFBA 5F7EH 1GGTA 2FL5A 2HT4D 2OMWA 4XO5A 5T3XE 3AUVA 2SEBA 3CFCH 1BOYA 1MFCL 1SPDA 3SE9L 3MXWH 5DK2A 1G94A 4WJ5B 4BDVB 1AZUA 1GH7A 4NKOB 2YLHA 3C60C 1AGCB 2DD8H 4EVNA 3PRZA 1GCYA 4R4FL 1G1CA 3A23A 1TXKA 1QPPA 3DOIA 3JWNC 3WEMA 3V4LA 5C0BE 3GPEA 3FQ2A 4AVJA 1NUDA 1ZGLP 2OCJA 2LAAA 4XB7A 3BEWA 4PV8A 1FORH 3KPPB 4Y4KB 4P3DA 2K78A 2ZPKL 1QWUA 4OKDA 5LWYH 3UC0L 4C8XA 1PNCA 32C2B 2YZ8A 1G5GA 4IDLA 5JOPD 5E4OA 3X1EA 1INEL 1MFBH 3BFQG 4I18C 4Z5RB 5E99L 4XXDB 3WFHA 5C92A 1UEMA 1UD8A 2VLRA 4LOFA 1FC1A 1KCVL 3C08H 2XBTA 4FFVD 4MQTB 5EUOE 1TEYA 2CZNA 3NCEB 2VXSH 3CFNA 4GOSA 2DWYA 5DSCB 1QLRB 4EXKA 1CG9B 3FK3A 4NZDA 5LNEA 1G7PB 2V2WA 3GMQB 1T22A 3PE9A 2CCVA 4LOVA 1PD6A 2AJVL 4NBXB 3S8GB 3ILPA 4JFSA 3PHOA 4NNXB 4IS6A 1JPFA 4JFDA 3QO1A 3GFUA 3IU4H 5TE7L 1HL9A 4NGHL 1WAAF 2YKLL 2B1HL 2XVLA 3U25A 5FO2A 1KGUA 2FL5B 2C1OA 1XTMA 4F91B 2OMWB 2PP7A 5I66A 3QYMA 3ZKND 2GYSA 4JZOA 1UUSA 2SEBB 1M1XA 1PF3A 2CO2A 5DK2B 5CGMA 1FZJA 4M7ZB 4LCWE 2XC8A 3N0PB 5JO5A 3KEDA 1YN6A 2PYFA 5GGTL 3CMOH 3ZHLA 4AYSA 3I9IA 2OYMA 2ZXAA 3KLSA 1KYOJ 2YC1A 1CZ8L 4W9FC 1G9NL 1E6OH 3HTLX 3LQAC 1LQSR 1BPVA 2VGLM 1YEGH 2GC7C 2DQHL 1OQOA 3BEWB 4PV8B 3LDBC 1G9MC 1QBLH 5AVSB 1J9TA 3N44F 4YC2B 2AI0L 4P3DB 3RBSA 3CU1A 1N59A 3PP3H 4BQCA 4CC4A 1MW3A 2CBPA 4MNQE 5BS0D 4GBXD 2V0AA 4KI5D 3D51A 2NUTA 3GEWB 4U05A 4IDJL 3WFHB 2DW5A 4Y9BA 3TBVA 1U8MA 2EDRA 4RQQA 2FO4A 1A65A 5G4MA 3HI6H 4XP9H 1U3ZA 2ZICA 3BESR 3NZHL 2DM7A 4XWOD 4YDJB 5EORL 3A6CH 3BCDA 1IGMH 2V2WB 3CFQA 3RKDC 5H2BA 1GC1H 1T22B 5EULV 5F3BA 3CSPA 2HH0L 3D39D 2FTAA 4WW2C 3PHOB 4AJVA 4IS6B 4MJ2A 2O6EA 4JFDB 1ND0A 3QORC 4S1SH 4PJXA 4XN2A 5AEAA 2XTSA 3GBDA 4OR1A 2C1OB 4LQFH 3CFDA 5ALBH 5I66B 4QTIL 4O02L 1L9PA 4JZOB 2XQYK 4ACTA 5ESQA 1EAPB 1M1XB 2ZSWA 2E4TA 3QJXA 5LO7A 2VOTA 4I88A 4FQXA 4TNVF 3RWGB 4DKTA 3EXLA 1AGBB 4KK9C 1FZJB 4GP5B 2QSTA 5CEZE 3VX0A 5JO5B 2G9HA 2HX9A 1YN6B 2PYFB 3KPTA 4E9TA 4XHJC 2YC1B 2R0ZL 4JG0L 5EF0A 1J9CT 2A3TA 2IPUG 2VXTL 3VRIA 3NSYA 1VKXA 5D1QD 3Q1EA 5HGBA 1FBIL 3D33A 4XVSH 4YK4B 3LD8C 4QYOA 1G7IA 4Z7OE 1N59B 1DQVA 3AROA 4L8SA 4DKFH 4DN3H 1NL0H 3C87A 4DERA 2DBLL 1RUAL 3MRCA 5K59F 4PJFA 2VERN 1K3IA 15C8L 1YECL 2E4FA 2VW4A 3CZGA 4NKDA 1HH6B 3TBVB 4LAQL 3VI4F 2ADFH 2FO4B 4RQQB 2N7SA 2NY7L 3UZQA 5D2NC 1NFIA 2MIZA 2OSLA 3DSNA 3FN0H 4YHZH 4EBQH 2QPFA 3FSOA 4PTUB 5H2BB 3VXRA 5LGHL 1S9KC 3JQOB 1Z3GH 4MCZA 4JFPA 2VTFA 5EU7C 1ND0B 3QIWD 4LU5L 1NGZB 3EJZC 4HXAL 2OMXA 2BDNL 4PJXB 1E4WL 2ICEC 1DFBH 3UG4A 2WPGA 4AOFA 5L88L 4U7SA 4AV5A 1JF6A 3QEGH 4XNZB 1CGSL 2FGZA 5ESQB 2HKHL 5H37A 1MN4A 1IKNA 5J06A 5FV1L 1LK3H 2ZXQA 3AC0A 4L8BA 5E95B 1XIWB 2KZKA 5EU4A 3SBWA 4FFWD 2ZOWA 2AJZB 5GZOC 1CD1A 4K3EH 5F1SA 5EF1A 2WIIA 3RDTA 4Z23A 3L3HA 1B0GA 2BY2A 3BGAA 1TQTA 1JVOA 4AJ0A 1DJSA 3VD1A 1IKOP 2X9ZA 3TO2A 2Q2EB 1VKXB 4PLOB 4MJ4A 4OZHE 5HGBB 1R3LA 4QYOB 1G7IB 2BP0B 4M1DH 2HX7A 4L8SB 5HJDA 4IIQA 2QHRL 1A0QH 1NBYA 2ITFA 3B7TA 3SYQA 2IFGA 4IOFC 3LN9A 3HOGA 4PJXF 5GS0C 3MRCB 1EHNA 2W9DL 3SDAC 2EUVA 4DKEH 3QR0A 5DEJA 2JJUA 3MLXL 4MLIA 4CMHC 1KGWA 1YEKL 1KB9J 4WEMB 4NKDB 5EN3A 4WUUE 4YSAA 4P5MB 1NFIB 4MD5A 3DIDA 4QTHA 4M8UA 2X40A 5DHMC 1HWGB 4P46C 3GKWL 3VXRB 1I3GH 3IPBA 2AF2A 2BW5A 2AJYH 4MCZB 4JFPB 3JWNE 3ARED 3OB0K 2QADD 3U4BH 3VXMB 5CCHE 5ICYA 1A3LL 3T04D 4ZX5A 3GXTA 5T3ZH 2AFNA 4PI2A 4IRJC 1RUKH 3PP4H 4L1DA 1TVHA 1YEIH 1D2OA 4NQCD 4H25A 4MCNA 2OXGA 1A21A 5FK9A 4ETQA 5PCYA 1OTSD 2E8ZA 2DICA 4MB1A 4X8CA 5EA0H 2E6QA 3AG3B 4L8BB 5EU4B 1YAIA 2O6PA 4ODUA 4F9LA 1BZ8A 3VQMA 5JLZB 3RDTB 1WZKA 1I8UA 4G6MH 2P26A 2ADGB 3VH8G 4GAJL 1MWAA 1OLZA 3TO2B 3GXMA 3KD4A 5D72H 4D9LL 1NGQH 4JM2B 2WNKA 4K3GA 1R3LB 1RIVH 2BFVH 4MAUL 1H6TA 1A47A 4HC1L 3KYKL 1VADA 3ARGA 4IIQB 3MJGX 3G6JA 2CRYA 2VDRB 3BPCA 2APFA 2AK4A 4V33A 1U93B 4P2RA 1E8WA 3VM5A 3BX7C 1X5XA 5K9JH 3NEOA 1T0OA 2ESVA 4HF5H 2OMTA 2YGQA 4R7VA 4QTHB 2M83A 1GY1A 1D5BB 2UZIL 5F9OL 3ZQXA 4AJYV 4DKAA 1HTYA 4ZX4A 3INUH 4UNUA 4V2BA 5I6NA 3IJEA 2E59A 1NPUA 2P24B 3LN4A 1HINL 1F18A 2BVUA 2KKQA 3SCMD 3G5WA 4XZUA 3VACA 4JHWH 4POYA 5DS1A 2ZJSH 4WFGD 4DAGL 5I2IA 3OPZL 4A7TA 4JM2F 3AJ7A 4H25B 2OXGB 3CPUA 3IFOA 5FK9B 4ETQB 3L3OC 3B9EA 4X5WA 1D5XA 4Q97A 2BP5M 1CLCA 4N0CC 1NAMA 4ODUB 3AWGA 2EYTA 5DHYA 1RI8A 1DO6A 1UOWA 3T09A 1RZIA 2DMKA 2JB5L 3DX8B 4YPGA 1MWAB 2OI9B 1UWYA 4MMZC 5DRZA 4HULB 4PY8I 4R5XA 1F4YH 1FYTE 1QW9A 4B9FA 1L9SA 1Z2KA 2VDPH 4FQJL 4YE4H 2E3VA 2MCMA 1VZHA 2Y3NA 3ARGB 4NQTA 3G6JB 2ENSA 4Z78B 3MLVH 4O2EB 2AK4B 4L0PB 4KK5D 4P2RB 1Y18B 1DUZA 4TVPL 4KFZC 1I85C 1A5FH 1AQKH 2ESVB 2QVTA 2OMTB 1K2DB 4Y4FD 1ECZA 1INQA 2XI9A 3FQYA 1YDPB 4PJ5A 1TFHA 3L1OH 3OF6D 4JKNA 1XAKA 1BQKA 4JQVA 1F2QA 4LSUL 1E7UA 3IJEB 3ZRCC 4R6UA 2C9VA 4MMXB 2NY1C 2IBBA 3LN4B 1JGLH 3VAEA 3II1A 3ULVC 2G0LA 2YQGA 4NZUL 5D96C 3ULUH 3PXHA 3MJ9H 1KCRL 1BZ9A 3B2VL 5I2IB 3W3BA 1L9MA 3V4PL 1YYMH 5CS7A 3LIZA 4WY7L 5I6LA 1BBJB 4XB8A 1TLMA 2VLKB 1ZEAL 1AS7A 3N2JA 4LSRH 5GJTL 2YPVH 4C4KO 4X5WB 3HPJA 3L5XH 1E4XI 1A3RL 4R4ND 3A22A 4LOEA 2EYTB 5DHYB 3V52H 2D4DA 4D9RE 5JYMA 2K4WA 5D2NE 1RZIB 2XTLA 1CN4A 3CZJA 3OG6B 3D34A 4YPGB 2YRPA 4WV1C 3ZL2A 1LWRA 3TNMB 2VAAA 5DRZB 1O6TA 1SEBA 5FAAA 3WHXA 4DWHA 1FFPB 1U3NA 2OP4L 2CLRB 3MLYH 3DX0A 5FGBC 4X5XB 1DDHA 5EU7E 1K6QH 1HX0A 1PY4A 4ELKA 2A77L 4WK0B 1B0RA 4NYLA 5I6XB 1BAFL 3HS8A 4JLRB 4XMVA 3K1KC 5E24E 2BNRD 2IWKA 1JK8A 3K1DA 5H94A 1UA6L 3KPRA 4G7VH 1OF2A 1FN4A 1P7BA 4XN4A 2HRLA 2YBRA 4XMZA 4ZW7A 1INQB 2OK0L 4PJ5B 1CE6B 1KY7A 4X9BA 4ZFOA 2NR6A 4K3HA 5SWZA 1H6EA 1F02I 4A6YH 5JW5A 4PIBA 4I3GA 3L4ZA 2CO7A 1GW0A 35C8H 5DURB 1FDLL 3DMMA 4H8WH 4NDMB 3UYPA 4A55A 2HAZA 5DFTA 1BZ9B 2W92A 5HI4C 5ISZD 1T7XA 4WNSA 5KSBE 1Z9PA 2DTMH 4PPTA 4KAQH 2W1NA 4XNUL 4NN6B 4W9IC 4M5TA 2PTVA 4ODBD 4M93B 3RVXD 1XZ0A 1AHWC 2NX5D 4Y1AA 2J1XA 4L23A 4TM9A 5EZPA 4APQD 5BRZA 3RIKA 4C56A 4RMQA 1ZRUA 2EDLA 3LS4L 5ITBL 2VAAB 3VXSD 1SEBB 2JKLA 1UM5H 3QQXA 3TA3D 1KTKE 3WHXB 4HWBH 1DDHB 1JPSL 5SX4H 4OI8A 3BZEB 2F5AH 4ELKB 3K2MC 3DSFL 1B0RB 4NYLB 3V0AC 3BAXA 4QRRB 5DS8B 2JCCE 1JK8B 2XWZA 4JRXD 1CL7L 5H94B 3M1BA 1Y6NR 3KPRB 4GXVL 1FN4B 3K6IA 1MELA 4CU7A 4GAGH 1GA2A 4GSDL 4Y5YB 1XFPA 5KS9F 4ZFOB 3KM1A 2ICES 5SWZB 1HOEA 3CDYA 3JBG7 4K9EH 4MS8D 5JW5B 1NC4A 4X0KA 5F3FA 1RZPA 1OP9A 1PIGA 2CO7B 3AT0A 4CL7A 5HGHA 3IMBA 4C58B 2F8XC 5HDQL 2NOYA 1ZHKA 4NM8H 4NP4L 3UYPB 3G9VA 4UQAA 1MJ7H 2NYYD 3GSUA 3KEHA 3S35H 1M3IA 3QA3B 4PY8J 3S5LA 4JO3H 5EB9A 1MKFA 1DEDA 2V3DA 2DM2A 3P3UA 4P23D 3X14A 2GQHA 2WNXA 4N86A 3T9WA 1I7ZA 4YSPA 2W38A 1I8LA 1XZ0B 5FUCC 3BQUA 1A9BA 1MIMH 4G6JL 4Y1AB 4CBPA 1HOCA 4MXQD 5F6IC 3O4OC 4WAFA 8CGTA 5BRZB 5H35A 4YBLC 4N90D 1SNRA 4HJJL 4DETA 2EYSA 3IFPA 3KWUA 3S37H 3O4LA 2BO0A 3MR9A 3EFDL 4GQZA 2XUWA 3HC4L 1CJYA 1CU4H 3BD3A 5DC2A 2XN9B 3SKUD 2ZX5A 3VQ2C 5CD3A 3GMNA 3RWFA 4A39A 4L9LA 1GRWA 3LSOB 4TUUA 3EH1A 4KV5E 4OCLC 2WC7A 3O41A 1ZT7B 1MAMH 4PSRA 2WBKA 1V3LA 5DRNA 4QRPD 5F96H 3SYOA 4PR5B 2WYZA 3ATFA 4YXKH 3M1BB 3P4NB 3QQ9C 1HQRA 3AQDA 5L6YH 3TVMB 5T5NG 3QPKA 1NC4B 4X0KB 2G3NA 4IU3A 4OJDH 3ENEA 2DAVA 4YEEA 3W11D 3MODH 4EI0A 5J4MA 2YUXA 1TT6A 1MCHA 1SXBA 2Z93A 1T6BX 4DGVH 5EZOH 1EZSA 5BVPH 2AXGA 3GSUB 4PWEA 3DC0A 5HHVL 3S5LB 1NWOA 4XPGH 3NJXA 4XI5C 2XPGB 1M7UA 3BGFB 4NC1C 4GRMA 4NM4H 1SOQA 3X14B 3FQXB 3SQOL 2CO3A 3TO4C 1J88A 1I7ZB 2NY2B 3PS6A 5D1XD 1FNGB 3BQUB 4QD2E 1A9BB 2WZ5A 3FCSA 5H35B 1KFGA 4QY8A 1KWKA 2DLFH 4G9FA 5E2UH 2EYSB 1FFRA 2WYIA 3GRBA 2CBOA 3IFPB 3O4LB 4RNRB 3DX3A 3HB3C 4L4TD 1RXLA 3L1GA 3L48A 3CSYA 1J8HE 5F9AC 5G4NA 4K7PH 5CD3B 4G8AC 1JNNH 1TJIH 2LR4A 3BPOB 1U30A 3EGDA 3GMNB 4FDWA 4L9LB 3RWFB 4UZUA 4L8CA 3ULVE 3V10A 4JKPL 3O81A 3O41B 4X6EA 5E2TL 1T1XB 5DRNB 4Z0BL 2E74C 1PQZA 3HFML 2J43A 1HQRB 3CWGA 1C08A 3QRLA 1KZQA 2A2QT 5GHWL 3Q2NA 3X1GA 3KS0J 5I74C 5KVFL 4NLHA 4IU3B 3ARBC 2XA3A 5HHXL 4YL9A 2CNYA 2X2HA 1CUOA 3CXHK 3DHMA 5JHDD 3RVTC 1DSFL 1X7SA 1LHZA 2Q7NA 2Z93B 3HUJB 4LGSB 5CEYB 3RJDA 3O6LH 1Q8MA 4X42A 2CHNA 3NSCA 1JPGA 2VT0A 3O6ML 3CLFL 2XYCA 4A2EA 5B38A 4Q0XH 3PL6D 4JCLA 4X9YA 4P4KD 4TUJB 1NAML 1G4MA 1ZTXL 1XSIA 1P0SE 1A6AA 3O6FD 3FCSB 4DN4H 5EV7A 2K4AA 4LLDA 4QY8B 4XGZA 4CSPA 5MERA 4G9FB 5C0BA 5IVNA 3QHTC 1A4JA 3NK4A 4DIXA 3A21A 3BDXA 3N42B 5HYJA 3MFFA 12E8L 3CSYB 1OAJA 3ABMB 1WZMA 4HIEB 3P9LA 4FABL 2IAMD 4JREC 3IDYB 1F4XL 2K8QA 3EGDB 3LEVH 4KC3B 2R69A 1CLVA 1NCNA 4L8CB 4ZUSB 3R4RA 5D7IE 1B2WH 2A9BA 3HUJF 2DF3A 5F70A 2PMZA 4PJDE 5DD6A 1BZQK 1HSBA 2Z35A 1ROCA 1RURL 1RJLB 3D85A 2ZUTA 1PQZB 1IGIH 3ZL4H 4X99A 1NMAL 2IDQA 1J0KA 5CSBA 5F0PB 2XN2A 5AW7B 2TSBA 3MRQB 1WUNT 2WB7A 1L7IH 3DVGA 5DRXB 3VRLE 1WC7A 1RUML 4H8VA 4Z7AA 3STZA 4GH7B 4Z7VE 3EOTH 4P48A 1F2XK 4U2ZA 4TSAL 5DUJA 4ZW8A 3T77A 4CU8A 3SO3C 3QXUA 5DMJB 4NQEA 1QFWL 3LIZL 1CFVL 4RH4A 4YJZL 3T2PA 1ZLSL 1S9VA 2C34A 3T8VA 5B38B 2N0MA 2OSXA 3TX4A 4ZMYA 4HPHA 4XNXH 5KZCB 3GI8H 1M9WA 3VNZA 3RPIB 3AXIA 4Z6AT 1BQLL 2EP6A 3HNSH 4HGWA 5JZ7D 1TUPA 1E4XL 4XWOC 1GHFL 2FWUA 4KJWD 4XGZB 4P06A 5MERB 5C0RH 1S4IA 5C0BB 4EDWL 1A4JB 1OAQH 5EBLA 3MLTA 3IGAA 1HDMB 1ZA3A 4PGCA 2O61A 5B39G 5KJ7E 3MFFB 4AQ1C 5D4HA 3X3GH 2JELL 5L4JA 5LJYH 1HYSC 5FYLL 1I1AD 4YHNB 4FQCH 5KSVA 1Y7VA 4WZ9A 2B7DT 4I9WE 2Z31D 5JHLH 1B4JL 4W4OC 1MRCH 5DD6B 1X5ZA 1XEDA 4KXZI 4NQSA 4N2OA 2Z35B 2NT1A 1X44A 1NDGA 2ZCLH 3IDMA 2B4CL 4KGLA 3PF2A 2MNUA 3UG3A 2E7MA 4APXA 4ZFOL 3T6ZA 2A7BA 1X9LA 3DVGB 1WC7B 2HSIA 3COOA 5FUCE 1OGPA 3STZB 3N85H 5CXPA 1G4RA 4Z3JA 4XNYL 4LPWA 3DRQB 5DJDA 3T77B 3N0AA 1F42A 4BV1A 3TZVD 2FJUB 4OF6A 4JHZA 4NQEB 1DLFL 2Q76A 4JKMA 3UPRA 1S9VB 2ZUUA 1BWMA 1KB5H 3I6LD 1INDL 1G1KA 1OHQA 4XMLH 3CG8A 4UQ3A 1EGJH 1YNKL 2Q20A 1OHZA 3O3DA 2ID5A 3MV9E 1EUTA 1O9VA 3PNWA 4HGWB 4YSUA 5B3JE 1MRFL 2C7UA 4AYBA 5EUOF 3EJTA 4Y4HD 4JO4H 1XL4A 4ZUUB 3MLTB 1AGEA 1ZA3B 4PGCB 1JS4A 5HJGA 4K15A 5DI8B 2C9UA 1CFMA 3IMUA 4MNQB 4DUXA 1JZ5A 1TENA 3S5ZA 1MSPA 1IGTA 4LCYA 1AIFA 1S7TA 4JO1H 4NQSB 2V7HA 4KDVA 1Y6KR 3RRQA 3OZ9L 5IG7B 1BGXH 5L9DL 1WA1X 3QJFA 1NDGB 3IDMB 4WNQA 1R1CA 1ACXA 4NC1E 2CNZA 5KEZA 5LKNA 3DI2B 4ODWA 5CKAA 3OKKA 1A6ZA 4DPAX 3LHPH 3NTCH 5E0FA 2Q7YA 4L5FL 4DGIL 3HE7C 3OAWA 2FATH 5DFVD 5KJRL 1MIEL 2HCZX 3JVGC 5EDSA 4OGYL 5K9OA 2FD6H 5DJDB 3B5HA 3ZE0E 1SQMA 3JTBA 4HOWA 2G60H 4BK4A 2Q76B 1N0XH 3UPRB 1XDTT 3ZZLA 1IEBA 3O6KL 1JYXA 4KUCD 3SDCC 3UZVA 5EBMA 2HT2C 4WEUD 4FKEA 1QR1A 3QJRB 1KN4H 3KPSE 1A4CA 1J0HA 4UQ3B 4ANWA 2WBJD 5J5EA 3JV4A 4YO0A 3WN5A 2IJ0C 5AB0A 1KBGH 3FT2A 3O3DB 3PNWB 5DJ0A 2CXKA 1Y1UA 2C7UB 2ISDA 4F7KA 2VMFA 3MGTA 5JIPA 3GMMA 3LB6D 4RRPG 2C9SA 4L3CB 2YGOA 5DZNA 3LOWA 1AGEB 4XVJH 2H32H 4OZHA 2MHAA 1PEWA 5B8CA 2DLTA 1CXIA 1S2EA 4E9YA 1ZTMA 4Z7OB 3W0WD 1SJEA 2VSKB 4U7KA 2C3XA 2ORBH 4OF5A 1SJXA 2J1ZA 4WFEE 5CZVH 4LCYB 1WA0X 3IDXL 1AIFB 1S7TB 1BOGB 1SXZA 2BIQA 2QMJA 4JO5A 2HFEB 3QJFB 2QSCL 4JG5A 3UIYA 1S8DA 3I50H 4AUYA 2ZYIA 2P44B 1EJFA 2E47A 1SN5A 4JFZH 3C60A 4ODWB 2BOCA 2H1XA 1A6ZB 3OKKB 4AXWA 1K5WA 2Q7YB 5T5FA 4HJUA 4KPHL 3NVQA 2OS7A 1RVFH 3V2AR 2WGXA 3S34H 5K9OB 2BSSA 4YHML 2ED7A 1HXKA 1AFVL 1M71A 4YHYB 2P5WD 4GO9A 1JIBA 4J3BA 1X5LA 1HU8A 4GIPD 3NACL 1IEBB 1F58H 3ABZA 2J8OA 4Z7OF 5CILL 3IJ8A 3RNKB 1ERNA 3UZVB 4JRYA 1QR1B 1THAA 3KWXA 3N43B 4UT9H 1DVXA 1QO3A 2F6AA 4I18A 5GGQH 4JHBA 3JV4B 4YO0B 3TEZA 3NCFB 2DYSB 1HKFA 2ZOTA 2JV6A 3FT2B 4PBDA 1QUPA 2F7IA 4I1NB 3SDYH 4HHGA 3MGTB 4QOKA 4BKTC 3GMMB 4BWUA 4DGYL 1LE9A 2HG0A 2NSQA 1UD2A 3ME0A 1FIGL 4ZYKA 1X5KA 4OZHB 2MHAB 3UJTH 4K3DL 5FYJU 1V55B 3CZEA 3SCMC 5IW3A 4U2YA 2F54E 1SJEB 2IAAC 4I3RL 1HZHH 4YH6A 5EBGA 4EN3C 1SMAA 4MA3B 1BPLB 1J1OH 1GIGH 4PB0H 5CZXC 1QSFE 4PY7B 4NUGL 3T0WA 2DI9A 1S8DB 3H9SD 4HPYH 1JPTL 2K7QA 2XRAL 3C60B 4DP8X 1ZSHA 3N43F 1BLNA 1N64L 2BOCB 4UDTA 4M1GH 4AXWB 1XGRA 2ZCHL 3JYCA 4MJ5A 3KBPA 4MZIA 5DR5L 5I1CL 3LKRB 5CN3A 1YRKA 1H3VA 2IH8A 2ZAHA 4CVZA 2EE6A 3FYEB 1N0LB 3QK0A 1UWEH 2FNBA 1MZZA 4OZHF 1ZVSA 4R96A 1FFOA 4HUMB 1MFDH 2OXHB 3NJFA 3UBXG 3TEWA 3KJ6L 4N2IA 1QO3B 3AVEA 4GFXA 4I18B 3FFDA 4I7ZC 4Y0GA 2IANA 4M1CC 4D9QD 2NLJB 1X5FA 3BHBA 1VACB 1ID2A 5I1EL 2IADA 1OGSA 1A66A 1LE9B 2G9KA 3EO9H 4ELMA 1C1EL 1R3IH 3MGOB 4ZYKB 2NSMA 4U31A 2VDML 2Y7NA 3EYQD 1YUKB 2RJMA 4N20A 3DLQR 5CJQL 4OCMC 1DVFD 4KQ3H 4WW2A 4RMSA 2R69L 4GS7C 3V4UH 4BGDA 1QRNA 1W16A 1ADWA 3QEQD 2ZF9A 4YFLI 3EYSH 1SDYA 2ICWI 2VCOA 4QRTA 3CHQA 1NIAA 2XCMC 5KSAC 4YQXH 3W81A 5EZIL 3SE9H 4PV1C 2NXYD 5FO9B 3TCLA 2ICWA 2CUMA 2MNWA 2OX5A 2Z1KA 5A1AA 4W6WB 2R1WA 5E56A 4EKXA 4G8GE 1J8KA 1GC1C 2R0WL 4KO9A 3C09C 4UDTB 5ADPH 1A1NB 4XPBH 1TJGL 3HLAA 4R4FH 1XGRB 2Q7AA 4KY2A 1BMGA 2WXHA 3BLPX 1CDBA 2PYEE 2ZXGA 1KGJA 2NTFA