4AJVA

Structure of mouse zp-c domain of tgf-beta-receptor-3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
167
structure length
152
Chain Sequence
b'TFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFISPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRNKGSQKLPKCVTPDDACTTFTKPLAVVLQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSFORMING GROWTH FACTOR BETA RECEPTOR TYPE 3
publication title Identification of a Novel Tgf-Beta-Binding Site in the Zona Pellucida C-Terminal (Zp-C) Domain of Tgf-Beta-Receptor-3 (Tgfr-3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 27
structure length 152
sequence length 167
ec nomenclature
pdb deposition date 2012-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ajvA00
5BUPA 3NK4A 3NK3A 3QW9A 4AJVA
chains in the Genus database with same CATH superfamily
5L9DH 5I8OH 1ACCA 5CP7B 2P4AB 1S9XA 3H56A 4JFOB 5HTSA 2B0SL 3DHMA 5CIPB 1JZJA 3DO4A 2Q8BH 1TR7A 1ZANL 4K2UL 4ENEC 1URZA 2J1YA 4LGPB 5GRYA 4XB7A 3QCVH 2WBJA 1H8OA 3GRBA 4ZXBA 5T1DH 3MNWA 5EBLA 3FF8A 3CFBB 3TWYA 3PUUA 2VAJA 2IAMC 5FYLH 3WENA 1S9WB 1MHCB 2CBQA 3GMQB 4B0MM 1AGCA 4J6IA 5HJGA 2PTUA 1A5FH 1NBCA 2VSDA 2X0WA 1ND0A 1TJHH 3QNYA 4JFDE 4QWWD 3SQOL 1XFPA 2FBJL 3K6SA 1URIA 3EHBC 1EVTC 2DQDL 1L9MA 2K1MA 1S7XB 2MCG1 3OC5A 4XN7A 4IMKC 4OZ4B 4NQEA 3HJEA 4DGIL 3STZA 3K71A 5SWZA 3B2UC 3U7YH 2TSAA 4AL8C 3ULVL 1N2RA 1VJSA 2UWEA 2YGOA 2FX8H 2ROXA 2Z1KA 3FU0A 3NRFA 4BDVA 4IBWA 1NC2D 5CGTA 3O3UN 4U05A 2H3NA 5HVWA 3MKGA 2MCMA 3WAJA 5EHFA 3IJHA 4HKXA 1IAII 3FRPA 4XNQB 3T6QC 1ADWA 1CFTB 4PBWD 3ZZSA 2GJPA 1J1OH 1HKLH 3LH2H 4L8SA 1NDMA 4L1HA 1Q0XH 2WXNA 1CICD 3VXRE 1HFUA 4F1SA 2H0PA 1HDMB 2W91A 3BWAB 2ITCA 2FEEL 3V4PA 5I1EL 1CLYH 2X41A 4IKIA 4F58L 3ARVA 4F15C 1OPGL 2MOVA 3BSZH 4Z5RB 4M5YH 1JNNH 2L7QA 4H7VA 1KCUH 3LKNA 3ZE0F 4LHUG 1AIZA 5TE7L 1Q9KA 2K7QA 2GUOB 2P49B 2Z31D 3QPXH 1D5IL 2WCPA 5IQNA 1IGJB 4JK0D 1KYOK 3SN6N 1W72B 2ZKWA 1S7TB 1OM3L 2A74B 1RURL 1J1PL 4UINL 1BVKB 4KTEH 3WNLA 5IVXE 1INQA 3RX8A 5K1JA 3HB3C 1GH7A 4KFZC 1Z5LA 2BCKA 4FNUA 2H47C 5EORL 4PS4L 3T4AC 3F5WA 3ZL1A 3TZVC 4IDLA 3B8YA 1AFVL 3UJIL 5E1HB 1DE4B 1EEYA 4YSTA 5AZ2H 1GYVA 3AU0A 4FMKA 5KYWA 4PGDB 1YEGL 1QA9B 1U21A 4P5RA 1T83A 2YXMA 4Y1AB 3ARED 4XXDA 2CO6B 3WYRA 4AEIH 5IBTH 1ORSA 1FNLA 2E7DA 4X7TB 4F80A 4W9JC 2DQJH 4F2FA 1MCWW 3D7PA 1JHKH 1YMMB 5KYNA 1TT6A 5J1AB 3A4EA 1UCBH 2AITA 3STLB 3VRIB 1JPTL 5DVNA 2DV6A 5E2TH 3MBEB 3MLWH 5C1MB 5ICXA 2ENJA 2A83B 2FBOJ 3UX9B 1U92B 2B77A 1N70A 1BM7A 1RHHB 4XPGH 4X6DF 1WFUA 3LVEA 2VLRB 1I85C 1MCKA 1NGXA 4LKCB 2OL3L 3CFNA 1G6RA 1HWWA 3G9VA 4DW2H 3A23A 3FUKA 4WCYH 3O0RH 5EBMB 3BN9D 4K15A 1ZT7B 2QELA 1D7DA 1VKXB 4LSUH 1AZRA 1HHKB 1KGXA 1A6VL 2CO2A 3WNPA 1ASOA 1PY9A 2ZXGA 4TNVF 5GS1A 4XP5H 4NIKB 2OMVB 3QRGH 4TLSA 3TBVB 5ADOL 1JDAA 4XNDA 5CAYB 3T6WA 1AR2A 1OAUH 1T0MA 4Z7NB 3PG2A 3PQYD 1NCAH 1FVDA 1W9XA 5JXAL 3KL3A 4R2GD 4ZUTA 4WTZG 4PVMA 5C6PB 4HETA 4QT5A 4M1GH 4EZMA 1XGYH 3C6EA 3Q44A 4W9LC 3CFDB 5HHOE 1QSFA 3HR6A 4RLDA 4B41A 1PCXA 1HCFX 1CS6A 4ADIA 2E46A 1T4KB 4R0LB 5B7EA 5IJKA 3BUDA 1QVOA 1QYGH 3WNKA 5JIQA 4XX5A 1I1AC 4OJAA 3L2MA 4R8WH 3U1SL 4QXGH 2DEWX 2V9UA 4K9EL 2YQ3A 1JGDB 1FL6A 1B2YA 3WS3A 5FECA 4I3RH 5DJ0B 4PJXA 3UPRB 3NIDF 4JQVC 1A1NA 3BN9C 2N7SA 2GIYA 2VDMB 1N6QL 1O9ZA 3M1CA 5DFTA 1ZPLA 4HA1A 2ICWA 3IAPA 3L5WA 1NFDE 1MCBA 1FFPA 1HSBB 4J8RA 3T0WA 5KW9L 5L6YH 1S2EA 3V5HA 1MCPL 5IM7A 4DKEH 5B39B 3BZDA 5AG9A 1SEQH 1K5WA 1L3NA 4B5EA 2FT8A 5DO2D 1ZVSA 4HLJA 1JF1B 2NY4D 1KYFA 4HAGA 3N50A 4R5XA 1QUPA 5GGUA 5LBSA 4YDKH 3OGCA 4M6ML 5T5NF 3UAEA 2OYKA 2ZT9C 4JLRB 1EZLA 4ZFQA 4DNLA 3RDJA 1A6WH 3TNNA 3WS6A 4JFDD 5F1IA 2YD9A 2ICES 4GFTB 5TQ2L 1RP9A 1OO2A 1RUAL 4FDWA 1JK8A 1GYCA 5DJZB 1E9OB 1FAKT 5DQ9B 4X5LA 1U8LA 4FQXA 5CD3B 1DVYA 4NHUA 2WZPA 1T1YB 3TYGL 4E5XB 5EO9B 12E8H 4OZIE 3QQ3B 4R7DA 5KYUB 5AOZA 1B6UA 2OCJA 3MRDA 3RUGF 3PCYA 1LXMA 1PZCA 2DWEA 4G7VH 5CN1A 4UUJA 2C3HA 1NUNB 1IGTB 3NAAL 4L4VE 4HISA 3BIKB 1NGQL 2RQ8A 1WEJL 4X8XA 1V05A 1EIBA 5HHVL 1WFMA 5C0RH 1P84K 1WAAF 4MNHB 2I7SA 2MJWA 2F5BH 2FGWH 3EDJA 4KJPD 2VJXA 4ODXB 4FI6A 4KGJA 5ANMB 5GZNA 1GPOL 3D4CA 5G2NA 2GSIB 2I07A 2P8MB 3BT2H 4FQ2H 4PLKD 3U4AA 4FFYL 5JPMB 4R3SA 5CSZB 1UM5H 5E51A 3LRHA 2OI9B 5DI8B 5FM8A 4OJEH 3VXRD 4NUJB 5F0JB 5M95B 4IHOB 3L95A 4C56E 4Y1TA 3SDDA 4YSSA 2X9YA 2WLYA 2AW2A 1LQBC 4UBDD 5F0LB 4AZ8A 1T2JA 2VH5L 1YEIL 1K4DA 4PRPB 4TLUA 3ZQXA 3ZSTA 1SM3L 2VR5A 1JXFA 4NRZB 3G5XB 5FXCH 3B7YA 3MRRA 5I18H 5KBKA 4YIQB 1SJMA 2EEDA 1FL5A 1KEGH 3MRLA 2YEVB 1Z32X 2PTTA 2CJ3A 5TE4H 4QKTA 4XH2A 5FS5A 2KDGA 3IXAA 4PLKC 3QRLA 1WICA 4M61A 1AGDA 4LVHB 4Z18A 3Q48A 2G75A 3HG3A 3WKNA 4PRHE 4H2AA 5E2UH 2OZ4L 1C5BL 1E5YA 4AJWA 4WHYG 4JREC 1MCQA 5ELIA 4I18C 1JGEB 5IY5B 2LABA 3BD4A 2EIEA 3VXTA 5HGDA 3Q5TA 4YEEA 5H8DA 1AGBB 4KVCH 3L6FA 1MXGA 1M6OA 3MZGB 1T6VN 3N06B 3KS0J 1F6AB 1HHGB 1EAOA 3M88A 4KKPA 4NKIH 3OKOA 4HV8A 1WVZA 3POHA 4G8GB 3U7AA 2NZ1A 3NK4A 2KZ1B 1AQMA 3HPLA 1OEZW 1Z66A 4OSUL 2VDLB 4KROD 4H1LA 3BN3B 2W60B 2CIKB 3RRQA 4MAZA 1FBIL 2QQQA 4X6BB 2FQFA 2F15A 4M93C 1JGVH 3SE9H 1Q9LB 3TVMA 1BZ9B 2ZUQC 4MFHA 1DUZB 4FTDA 2X9ZA 4GP4B 3MMEA 3ZHKA 4YDVB 2Q76A 4NM8H 1DUYB 3ZKND 4YBLB 1M7IA 5IHBA 1EHLH 2LV4A 2Z65C 2FZ3B 3L9YA 5C3TA 4N1CA 1W72L 1E4XI 2YGNA 1GGBL 1QHPA 1Z9PA 4ZQKA 4N0UA 4JKMA 1GGCL 4OTXL 5L2KB 5T1KB 1BHGA 3BLKA 3QR0A 1MUJA 2GVYA 3VGFA 2EKSB 2HSIA 3MDJA 4MAYD 3GNML 2BNQE 1N59A 4MQSB 5AKRA 4XNMA 3QDHA 4GI9A 3CXHK 4I48A 4K3DL 4KROC 1WA1X 3O11A 5HHOD 4P46B 5IKCA 2MWCA 3ARBC 4X5WA 4G3YL 3AT8A 4ERSL 5I1JH 2X70B 4QRAA 4OFKA 1PCSA 1GMEA 3FB8B 4PWKA 4JCMA 1O9VA 4F20A 4GW1B 3BLBA 3AU1A 3P3RA 2DI7A 2RFXA 4TUKH 3ZKNC 4MQ7A 3FUMA 4N85A 1MHHA 1MQ8A 1LM8V 1RU9L 4TVUA 5D7SL 5HVFB 4W93A 3GWJA 2ZWLT 3NCBB 4UDTA 5FGBC 2PMZA 2IV8A 3TIEA 2HKAA 3O8XB 2WINA 1YY8A 3M1BA 3H4HA 2YJQA 2F54A 3KPMA 5EEWA 1HL4A 1UXSB 5FW7A 2O93L 4JFHE 3MLXL 5MHSE 3C5SB 2RALA 3KAAA 3HAEB 3W2DH 1B0GA 3WI9A 4KBPA 1ZK9A 1F58L 4X42A 4OUUB 5HDWA 1UB5B 2P8LA 4BZ2L 1VZIA 1A6AB 4Y88A 4UWQB 4ZBJA 4L8CA 2G9HA 3L3OB 2J8UE 4OT1H 1R46A 2AJVL 4XMKL 5MEPB 1MFEH 3MNZA 3MRHA 4HJIA 5D1ZB 3GJFB 3G6AB 1JZ8A 2RJMA 4Z7VE 2DQTL 3U2SB 2DTML 4FL4B 4JCLA 2W8CA 3T2NL 2AVFA 5I23A 2N7BA 4JZJB 4EIGB 4AE0A 2QGDA 1HINH 3AGWA 3V79C 1LVEA 3PWLB 3B9AA 4RDQG 1OHQA 3P3YA 4F7EA 1QATA 2IIJA 2JK5B 3BEVA 2X6BA 1V27A 3GXUB 3NUKA 4K7FB 3V4VH 4BIKA 4WSGA 4FP8L 4GMTH 1VPOH 1EXUB 1XR9B 2XV3A 3WKPA 1NJ9B 2JJWA 3QFGA 3WTWA 1YDPB 5ICYA 2H6OA 4PAZA 1MFAL 3QXDB 3PL6B 2YRZA 4C56D 3FKUS 4JE4B 5BCAA 2VDML 4NI6A 1A7OH 5CLWA 1S9YB 1VGKB 5JLZB 3Q2WA 5HGAB 5CN2A 3BFWA 2QSVA 4PGCA 3KLAA 2GY5A 2EIBA 4FQQB 1YPZF 1OK0A 1WFJA 3BPCA 3M07A 5DEZA 2R8SL 3ARFB 2PXYA 3W11D 3PDDA 2BP0B 5IW6B 2ZTBA 4OFQA 4Z7QE 1F4HA 1II4E 1RY7B 1KOAA 1GAFH 4OIIH 2DKUA 2B4CL 2EE9A 4NWTH 1VF5C 2NX5E 3CZNA 3WLWD 3TBYB 3BUQA 4EPSA 2R59A 3MCYA 5IMMA 4PRHD 4X7FC 1TCMA 1KJMA 4Y4FA 3HVNA 3U9UA 3VFMB 1KCLA 5DRNB 1XGQA 1D6EB 1UGKA 2XZAL 3BPOC 5LNDA 3MV9A 4XBPA 3I3BA 2DYSB 1JF6A 4YXKH 2YAFA 1BQLL 3R18A 3B43A 3ROLA 1RV6X 4OLVH 3BKCL 1PG7L 1AQ8A 1NSNL 2A4EA 1A25A 3IFPA 3VXUB 5IROD 4HALA 3LZOA 4HIXH 4F57L 1T6BX 3TP4A 4IGBB 5D1QA 3ZT7A 1IKNA 5IF0A 5DUPH 5AD0A 2XA3A 3FMGH 2ZXWB 1KBKA 3PHAA 2DICA 1CGXA 5F93C 3DXAA 4HQQL 3NFNA 1KB9J 4PV8A 1EGJA 3WLWC 4ZMQA 2FD6H 2OTUB 3B9DA 2EIZB 1NICA 3D2UB 3QYNA 1ED3B 4ODTL 5I1HL 5KVEE 2MH4A 2O6EA 3BMVA 1LWRA 4X4YB 1KTRL 3U0TA 4JAMB 2D7QA 4HHAA 4HWBL 1CYWA 3PGDA 3BW9B 4G1EB 5FPIA 2HFFA 2P7TB 2J6EA 1TZGL 1XF3B 4NKMA 4Y19E 1SJHB 5D71H 4A7SA 2ZXQA 3HI1A 1E8YA 4JM2A 4LL4A 5IHUH 4AIXA 3VXQA 5I82A 4JFZH 1WFOA 4AQAB 3IGKA 2BVPA 3EZJB 4EIUA 1N7MH 3EFOA 3NCFB 3HG1B 3IN2A 3QO1B 3ALXA 5IROC 1WS8A 3QIUA 4N2MA 5FHAH 1M1SA 4S2SA 3CBJB 3L5XH 5KBPA 1T89A 4GQ9H 4IBTA 4NUGH 5I1KH 1HI6B 1R4XA 3GSNB 3NSDA 3ARGB 2BNQD 4GKNB 3MFFA 2UWEF 2D4FA 4GW5B 4PJFA 4MCMA 1GZQA 1FH2A 1VCAA 3OHXA 4PUBL 1DBJH 3EDEA 1ZVHA 4FQCH 2HWZL 3ABMB 3FQWB 4AYSA 1TQWA 1KTJA 2EICA 4JHZA 4EI5D 3J8F7 4XMLL 4X7DC 3B83A 2RB8A 3DVGB 3KDMA 1BZOA 1MF2H 1E6OL 3PWNA 3WNMA 3HZVA 2WMPA 1U8HA 3LEVH 4PRIB 5CFHA 4L8BB 3DX7A 5DEGA 8FABA 1A4KB 1T20A 2BY1A 4NQUA 4WNJA 3BISA 3FBQA 3ABLB 2A6KB 2RD0A 1IAMA 2VDLL 5E99L 3RY6A 2KZWA 3P3UA 4R7LA 5CS7A 4JFHD 5MHSD 1B2WL 2Z1PA 2G2PA 3LKSA 1JNJA 3UC0H 3DV6B 5L88H 4FMFA 4OZGB 4RH4A 3T77B 3UBXB 4GRWH 4LLQB 2B1AH 3U4KA 2HLAA 2X1OA 2CGRH 4W6XB 5D70H 1DFBH 2X3CA 2XWZA 4K9JA 1HQ4A 5TDNA 3O2DA 4JY4A 3RL2A 1JNLH 5EIIG 4JFPA 2PN5A 1U8KA 1P7BA 2BWDA 1PPIA 1BBDL 2XQBH 3HCVB 4PVNA 5C7XH 3PP4L 3SGEH 4XVOA 4Y2DA 4FFZL 4K3JH 3OQRA 4HSCX 4HCRA 1BVLB 1W0WB 4A7GA 3OKKB 1YEDA 1K72A 1BFVH 3EOAB 3O2WL 4NXSA 4BH8B 4Z8FH 3IGLA 2ZWZA 4PVLA 4H44C 1ZS8A 3GMOA 3DX6B 3FUHA 2PCYA 2H4EA 1SF3A 3HW7A 3RKPA 1WLHA 1YVLA 3T2LA 1H5BB 3S8WA 4LLUA 3I02B 1KB3A 3SJVE 3QIBD 3W5NA 1XSJA 5E5LA 3VI4A 3LH8A 1BFOA 1C12B 1AS8A 1FO0L 3QA3A 3APNA 4KKCD 3RTQA 1GMIA 3KPPB 5K69A 3BAXA 4DP2X 1PW3A 3O3DB 3UG5A 4MNQB 2OM5A 3FT4A 1U8JB 2JFCA 3VXNB 1PIGA 4L9DA 1WG3A 3MTRA 2LVCA 1NLBH 3NCCB 2DQEL 4UQDA 4QAMB 3KHQA 3WHXB 3D0VA 4J3TA 4JDEA 5EEUA 1MDAA 3BDYH 5CEYA 5BOZG 4ZS7L 5CZVL 3HMXL 3L1GA 3QCTH 3E2HC 1XIWA 3UTSB 1KN4L 1OTUC 2NX5D 4P3DB 1PYWB 2ZAGA 5AVVB 1KIRB 4PS3A 3ARXA 3TH3T 3ZE0E 1ASPA 1KTBA 4OVUA 1UD3A 4XI5D 1FLRH 3UABA 4IIZA 2JTDA 3MUUA 4XO9A 2WCGA 1PLAA 1CDIA 4YK4B 4AGLA 1YEJH 1ZT1A 2IWEA 4TQEH 2WBXA 4KKCC 4XTRC 4A2DA 3DBXB 3RJOA 4Z7AA 3H8NA 3MV11 2Y7OA 1RZGA 1XF2A 4MWFA 4CVWA 4N2DA 4Z77B 2QBWA 4RMUA 5IMOA 4YO0B 2OKMA 1LP9B 4G6KH 5FLVA 3DETD 4NO0A 4HS8L 1PD1A 3QC6X 5AW6B 1X5JA 4UM8A 3INUH 1XO8A 2VXUH 3WAKA 2WB7A 4NNXB 1PZDA 1YN6B 2FIKB 4WGKA 3L3IA 3T1WA 3FC8A 3WNOA 3QUGA 1MWAL 4JY5L 5DYOA 3ISYA 3WL9A 1BXAA 4J39A 2ZWNA 5F7AA 4UV4H 4QPEA 4TTDD 5J6HA 35C8L 4PYHA 5FA4A 3CN4A 4G42B 1BMGA 2VJ0A 4NCDA 4G8FA 5JHLA 1J05A 5CUSH 1VGEL 4XI5C 4OLZL 3X14B 1AS7A 4D9RE 5CXPA 4OFDA 4YLCA 4Z7WB 2DQUH 3DROB 3SDCA 3MLTB 2VR9A 1CLOH 4ZAKA 3LDBC 2BS8A 1A9BB 3ECBB 4P9ML 5GHWH 4Y19D 4XVSH 3QEQA 2DLIA 1TZOA 3LSOA 5AB1A 1J9CT 4OF8A 3DETC 1MLBB 4BUHA 2JCCB 2TRHA 1QTSA 1KCVL 1QLEB 3PYCA 2GEEA 4OFYA 1PAMA 5KJRH 2D7PA 2O5YL 5M7QA 3EYFB 4DQAA 2DQMA 3N0PB 4OBSA 1OGAE 3W38A 3WEXA 2IQ9H 3RWGA 3SDAB 1B0RB 1I7ZA 2FWOB 4H20H 4I88A 1LEKB 1ZAGA 1WDAA 5DEFB 4OB5H 3T4YB 2YR3A 3TT1L 3A6CH 3WXVH 4YZFF 5D8JL 1K8IA 1RIHH 3IE9A 3K5SA 5GRJL 3RURA 3U36A 2W9DH 3G5WA 4XCEA 3QDJE 3QJHB 4ZS6D 3TJHD 3GB7B 2Y2YA 4G6MH 4LXFA 1XH3B 5BV7H 4BKLA 4N2FA 4JFUA 1ID5I 3BVTA 5B38A 2CIIA 3MOAL 4IRJD 5DWUL 5K39B 3SEPA 5C8JB 5IHHA 4TULL 2AXFA 1UJ3B 3E8UH 2QTEA 1THAA 4QRQB 4QHUA 3ZRSA 1NC4A 4N0YH 2FB4H 1XT5A 4BV1A 4ZJ9A 2QQLL 4Y16A 4FZEL 3WIAA 1NBYA 3BJ91 2B08A 1GS6X 2Y7LA 4W6WB 2FQEA 4BYHA 1DEEA 4LIQE 2XN9B 3IU3B 4CBZA 5LG6A 3GMMA 1GSMA 4URKA 5KS9B 4X9FA 3NIDE 4JVPA 4TXVB 2XPGA 3FRUB 4IIQA 4L9LA 2CHNA 3VDAA 5C0EA 4ZUSA 3D07A 1ZWIB 4JPQA 2C5DC 1Q9WB 3O6KL 3KLDA 3ZU8A 4ZS6C 3EO0B 1YNTB 5JR1H 1Q8MA 3D87B 2JJTA 4R4ND 4AQEA 1CL7H 4X5RA 3V52H 5I76A 4IRJC 3F7VB 3TTSA 5D4JA 3FYIB 1J87A 4ABWA 4UT9L 1VADB 1OAZL 3RWIA 4QGTA 3OPZL 4A2HA 2VIRB 1E4KC 2OJEA 1FWXA 5DLLA 3EF4A 1KYDA 3GSNL 2HTLD 4DZ8B 3AG4B 4QOKA 5E08L 1IILE 2X4UB 5I75C 2Z4QA 5E5RB 3GMLA 1T1ZA 2XVLA 4H4NA 1I7RA 4PWEA 1YYCA 1W6LA 3LEYH 3S35L 3VXOA 3AS2A 3CDYA 4B7LA 3ARRA 5AVRB 4QYAA 2J1KA 2R0KL 3T3MB 1INDH 4NO3A 3W1ZA 3IGFA 3CH8A 1E28A 2NY0D 2CCLA 1WAAE 3T0EC 3FULA 5L7XL 2ARJA 3ZKMD 2YMTA 1ZLDA 2BNRA 3ZTNH 2HFGL 4GG8B 5FHBH 2OMWB 2P5PA 1MCLA 2K45A 4DF9A 3GQFA 4M8QA 4XMTA 5IGXH 1DBBL 4B9IA 4DK5A 3K2UL 2GHZA 4JKLA 1RFDL 3QUMH 3R8QA 2HTLC 4AQ1A 4JM4H 3C60D 4WWNA 4GJTB 3N1MC 5LWYH 1FYTB 2CLZA 5JOPE 3BWSA 4HHWA 1EUUA 4WZ9A 2AEWA 2DLEA 2E7HA 2MKLC 4HF5H 3FPXA 1KTDA 3H42L 1DL7H 3DRQB 1JHTA 1M3IA 5I6NA 1GZHA 2Y06L 3DURB 1TYRA 3QXAB 1KPVB 1PG7X 2YGQA 5C3LD 1KFAH 4LMQE 5ICZA 3S37L 3H3BC 3QORB 1RH8A 2JB6A 2NY0C 5I8KH 2WWKO 3MJ9L 2H8PA 5IVNA 1RZQA 4WEBL 3FB7A 4DPCX 2FECI 1JWSB 4MMXA 1RJLA 1A6TA 3EUUA 5DUML 5TK4A 3ZKMC 5EOCL 4HXBH 4K23H 1AGEB 3B9KB 3L13A 4G6JL 1R3HB 4YSQA 4L3EE 1RUKL 2QKSA 4W9CC 5E8NB 1YUKB 4IRZH 2HKHL 5JO5A 4WO4D 4M7KH 1DN0A 3O2VH 4PJDE 2EEAA 4CN4A 3PGFL 4I2XB 4POZC 2CXKA 3TO4A 1ZE3C 3C60C 4B6ZA 5F9OL 1YYLH 3HC3L 5C07B 2MMXA 1A3LL 5I0VA 1WYJA 4HMCA 4ELDA 1R24B 4JANB 3T65B 1YNKL 1Z9NA 4FULA 1YLBB 3BCDA 5GQBA 2CKBA 3X1FA 4KQ4L 25C8H 3AT9A 4QRFA 5TF1L 3HR5A 3JT0A 4YAQB 1NOFA 4D9RD 3L3JB 1SPDA 4R84A 4J2XA 3BLPX 3GBLA 4HEMA 4OIFA 2XJKA 4ABVA 4PB9L 2C26A 5C0JB 4PG2A 4KMLB 1F1GA 3EG9A 2YPLB 3EGSA 3R1GL 4PQXA 5HYJA 4LF3A 2V5YA 1NL0L 2ZF8A 1P7HL 1RZJL 1NGYA 2ITFA 3IM1A 1WHPA 3IKKA 1D5XB 1PKQE 1I53A 1OGAD 2F7IA 5E9AA 1Q72H 2A9NL 1MCWM 4GKZB 4OD3H 2MCPL 3WGVB 4RRPA 2XZCH 2G2NA 1MRCL 1J48A 5I71C 4QHKJ 2ODHA 3PNWB 3QDJD 3H9HB 4P2QB 5CSGA 3T0AA 3QWQB 2EACA 2WYIA 1MCOH 1AQKH 2BSED 3CH1B 3OX8B 4F27A 1XGTB 1BZ8A 1HWGB 4AW7A 4AM0A 2W81C 3PXJA 4XCCH 4DHLA 2HLEB 1IEAB 2HXAA 3VRLF 4E41E 3PGCA 4TVPL 2JB5L 1WWAX 4JHWL 4BINA 1L7IL 4P2RE 5TGBB 2GSMB 3VB9A 4NQDA 1UWXK 1XVSA 2C9UA 3HS9A 3MRJB 1E2ZA 2ZX9A 3KPRA 1IC5H 4Y5YA 3U1QA 1F8TH 4MCYB 2HVKA 1YCSA 3WY4A 2KPWA 1XCQA 4LCIL 4B97A 4ZTOL 4IS6A 3RZWA 3PAYA 1TQBC 1TJXA 2E86A 3ESVF 3P30H 4JQIL 1OANA 1P6FA 3GKWL 4P4RA 4I0PD 1QSZA 5FGCE 1GKOA 2XFXA 1U8IA 2QLVB 3VTTA 3FTUA 1N5AB 4FA7B 5I16B 4MMYB 4Z7UB 4MQXD 1HEHC 4L4TE 4LEXL 3C8HA 1DFXA 1QLEL 4S1SH 1CD0A 4GINA 1YUHA 3ULVE 4U6XB 4HMDA 2JI2A 2IOIA 3P40A 3H9SB 5TDOB 1JZFA 4G72B 4ZFOA 2L04A 5DK0B 1EAQA 3GMRA 4OCYL 5DLML 5E1IA 1S78C 4EN3D 2VTFA 2NNAA 5DYFA 5BOJA 3D0AA 1RIVH 3ARPA 3DJZA 1REIA 1YNLL 4BQ6A 2IBZY 5ALCL 4B50A 1EV2E 3IU4H 1FNSL 2YD7A 1FZOA 4ZNEE 5AKVA 5H35A 2IADB 3QJFB 1WO2A 5HYSB 2AI0H 2GAZB 2BZDA 2CBOA 2IPKA 3NSYA 4M43H 1LO0L 1U3HA 2O72A 3N40F 3OAUH 3ZDYE 3QEGH 5D6DA 4MJ6B 4KKNA 4HEPG 1U8PB 4JFQB 4HBCH 2UXTA 4MQXC 2E76C 2J5LB 4RFEB 1QQDB 4BGLA 1MVUA 1Q90A 1R3KA 2OMUA 1DVUA 1LJMA 1YG9A 2B9BA 4KK5D 1FV1A 4KKRA 4LCUB 3RNQB 3BKYL 1M9SA 4ZUWA 3HZMA 4KKLD 3ATFA 4FQJH 1J12A 3CQPA 2H1XA 2CBPA 3U46B 4AC2A 3UTPE 2YRLA 1J9QA 4OLYH 3TA3B 2WVTA 4LSRL 3ZYZA 4JM2F 4F37F 2VC2B 2QPDB 4YHIA 3RGVB 3RY5A 3DO7B 1D6VH 1DQML 1HHJA 3V2AR 2XETA 3FQUB 4WWKB 4XO3A 4J4PD 4YSCA 1YPZE 5I9QB 2VLKE 3HLAA 2V8MA 3IJ9A 3IXTA 3KXFB 3IMVA 4HWNA 2C1PB 1A6ZB 5AVTB 5CD5D 4IBUA 4NM4L 3X3GH 4AW4A 1QRNB 3PHOB 2VJ8A 3LKOB 5KVGE 1JHLL 2XTJE 4GEIA 2VZUA 3GHEL 3LY6A 1OAQL 4MNGE 4JN2A 4L3ED 5KZCB 4KK5C 4Z0XB 3MN8A 4GXVH 2DW5A 2HJLB 3QUKB 4M6OL 2NYKA 2D31A 2VLME 1WIUA 2GITA 2NQDA 4KKLC 4YNYA 2Q86A 1EEQA 1F3DH 1NBQA 2XZZA 4YJZL 2AZUA 5J1SC 2J21A 3HE6D 5ABAA 3SBRA 2E6PA 3QIWA 2VE6B 1UYWL 4A1RA 4XBMA 5EOQL 1N6VA 1KB5B 1MEXL 2EDJA 2JKRM 5IFJA 3QI9D 3WFEL 3JVGA 4J4PC 4DP4X 4PJIE 3QUYA 3MA9H 3PABB 5SWZB 3SGEI 5CLYA 4MA7L 3LXBA 2MNWA 1LL1A 4OLWH 2OA9A 3ZE2B 1RJYB 4ES8A 1BGXL 1ZA3A 5BRQA 3CPLB 1R5IB 1DBKL 4QCIB 2ZSWB 4FYQA 2V5SA 2YD4A 1W16A 1WZ1H 3BH9B 3IF1A 4OQTA 1JPGB 1QNIA 3I3EA 3G5ZA 4U6HA 1B3IA 4U1NB 4AUUA 1A7NH 1GIGL 4HX1B 3VFTB 4TOYH 1YEFL 2A9ML 1FIGL 4HT1L 4AT6B 4CNIA 2GG1A 4W9GC 2V2WB 5HP5A 1FAIH 3NA9H 3C09C 1KCRL 5HJ3A 2NY2D 4P2YA 3QI9C 2DEXX 1NCNA 5CCKH 4ZUVA 1Y0LA 2G0LA 3D51A 4RNRB 2YGPA 5ISZE 4QYOA 4L5FL 5D6CB 3GLZA 3FFCA 4GUPA 5E2WL 3CQQA 2FT7A 4TTGA 5I0YA 1BXXA 3U0WL 2VXVL 4WI3A 4XHJD 4GKLA 5AOIA 2OAAA 2ZOUA 4WK4B 3CPUA 4LGRB 3RZCC 1S7RB 4DZBB 1UQSA 4L1DA 4P2RD 3JWOC 4V1DE 5HVGB 2V7NB 3BRDA 3QZPA 3NFSH 2OSXA 4NT6A 2VXQA 2W80C 3QEHA 1CBVH 3TN0C 3UP6A 1AHMA 4GBXA 3KJ6L 2W07A 2PO6B 2K3HA 4G8IA 2ZWYA 1MCHA 1KULA 3CUPA 4OF3A 4XNUH 1MAMH 5CJOL 1PZUB 5FOJA 2QL1A 1OW0A 1H3VA 4J8QA 3VX1A 4PREB 2PKDA 3DVNA 1IGIL 5AEAA 1ORQA 5DD1L 1KTLB 1S7QB 4RA0C 1KWKA 2DIJA 5B1JC 4U31A 2WKGA 4JJ5B 5MEQA 3SSGA 1K5NB 3KCPA 3QE5A 1EJ6A 4P9HL 2QQNL 4WV1B 4L4TD 4PFEA 3S35X 1IAIL 1PLGL 1SDYA 3KJ4B 4HIHA 4LIQH 4QHNA 4FS0A 4XHJC 3ULVD 2BFGA 3QVAA 2PABA 2DRUA 4N2BA 3X1EA 3E6FA 4BQ8A 1KJ2H 1A8ZA 3EH3B 3TBTB 4HK0B 2B9AA 1BIHA 5C6TH 4PVBA 3ZBMA 2CA4A 5SX4H 3C8DA 2NYZA 3LNIA 4ZOAA 2V9RA 4MLSA 4U6VH 5HHXH 4AEHL 3IDGA 2WIIA 1Z9LA 4QXUH 5C0DB 4ALAC 1MJUH 3HMWH 4JRYB 4HPHA 5TDPA 2PWHA 2FSEA 1IGMH 3RKDD 3CZUB 1QWHA 1UXLA 4N2OA 3QWRD 2X9WA 2Z64C 5GJSL 5TTRA 3ML8A 1EJ8A 4HGKC 3NQIA 4DEPB 1KYAA 1IX2A 3ME0B 3BIBX 1KWGA 5F89B 3L5JA 3DK0A 3ZYOA 4YHOH 5BRZA 4UTBL 3ULVC 4QRTB 2KS0A 1MI5A 4DGUA 3S37X 1WGVA 2VM3A 4WJG3 1XAUA 5DQJB 5ERWB 1P1ZB 1IAIM 1J5DA 3MXVL 3UTPD 2QEJA 2Q5BA 2XQYG 4ZUUA 3ZDZF 5GJTH 3S4SG 4MJIA 1NBVL 3SGJA 3O9WD 4CUCA 4K5LA 4X98A 4NKDB 1F4YL 1C7SA 2BVYA 1IAOB 2FYYA 3IFOB 2TSBA 4PJ8A 4NNYA 3RKDC 2VLKD 3FCSA 1FL3A 4NEHB 5DD0H 1F4WH 4OUOA 2VRQA 3C08L 4YLQT 2ADGB 3B6SB 5FCUH 2OTPA 1NCDL 2GJZB 2Y4SA 4ODHH 4FNRA 2XTJD 3EGXA 2XTSA 3CLEH 3VH8G 3WN5C 3KYKL 4UILL 5ACMA 3BPNB 4DK6A 5AWNL 4B95C 4KI5E 5AL8A 1NIDA 2W59A 2QR0B 3ZHDA 1EMTH 3ARDC 3WN6A 2Y9RT 5KG9A 1SXSA 4F2EA 3PDGA 4AH2B 4YEFA 3GUTB 2EDYA 2CR0A 5T5NG 2FLBT 2ZXCA 3IJYB 2J8OA 1CL7I 4K71C 4ODVL 5DZAA 2BLFA 2N3JA 5IK3B 1UZ8A 3FQXA 4ETQB 2NXZD 1TCRB 4KC3B 2OR9H 1XGPA 4L3CB 4M4RB 1IGFH 4XMWA 2VMDA 1J0KA 1SUJA 1EZVY 2AFNA 4HJ0D 2FGZA 2WXGA 4UUJB 1E5AA 2X6CA 4HIIB 1XV8A 3WJJA 4BZ1A 1KNOB 1UOWA 2XTJC 5CCGE 1QZNA 2WUBL 1A1MB 3C87A 2CPCA 1SN5A 2DLHA 3N85H 1NCWL 2A9BA 3V6ZA 2VDRB 1QHOA 1UACL 3TC9A 1NKRA 3K5RA 3AZUA 1HNYA 4TS6A 1ZIBA 2XA8L 1OCOB 1IEBA 1LP9F 5F7BA 2LLLA 1IFHH 1S5HB 3LNEA 3IRPX 3RWHB 1ZLWH 1B6DA 1DBMH 2HVJA 3T1FB 4EE2A 2HFTA 1M7DA 5ISZD 1MFDL 2HFEA 4BWTA 4EUPG 2VDNB 2XFGB 4PW9A 4XN1A 2MHAB 4HJ0C 4QHKI 4K8RC 4Y1AE 2YUWA 3P77A 1KJVB 3MV7A 4OD2A 1TZIA 4DJMA 4Z7WF 1NINA 1G5AA 5GGSA 4WTXA 2YC1B 1FN4A 1KY7A 1YMME 1JMZA 4LLMB 4V1DD 4NPYA 2WLLB 4YZFE 3VYOA 2IXQA 2M8XA 1AZVA 4FFTA 4NZUL 3GPEA 3LRGA 5C7ZA 2NW2A 3EO1A 4AV5A 4YUEH 4HUUB 1G7MB 5C08B 2XT1B 4KRPD 5C0BD 2ZNXA 2EZ0D 2X88A 3P0YL 4TM9A 1BF8A 1KB5L 4I3SL 2PR4L 4PG9A 4DVRH 3VGAC 4X2UA 3EGDA 3I9AA 2VLRE 2Z8SA 4UCFA 3MBXH 1MZZA 1CVSC 3RIAK 2J73A 3M86A 3B9VA 2B0SH 4JRFA 1F6FB 4U1SB 3D48R 2YKLL 5DC4B 4K2UH 2GKIA 2IBZX 2YIHA 3R8BB 5I1GL 3BKJL 4TYUA 5KSBA 2CRZA 3GXDA 3CGTA 3KWVA 4FEMA 3SKJL 4OI8A 1PL3A 2BINA 4Z7NE 3GMPA 1LO3L 3HPLB 5E6UB 1AHWB 3SQOH 3NJXA 1TSHA 3EJUA 5E8EA 2F0CA 4GRLB 2FBJH 4APQB 3MRPB 4GT0A 2R39A 4M02A 2DQDH 4W9DC 2OSLA 2PW1A 4J3OF 4JX0A 4R97C 5HGHB 3QPQD 1IBYA 4DGIH 2QTVA 3F00A 1OP5H 3IJSB 2AJ3A 1PZ2A 1S4IA 5TH2B 3ATEA 1XL6A 2BSSB 4YHPA 1UA6H 4U3XA 3O4LA 3FQ1A 2KH2B 3HRPA 4L8DB 4WJ5B 1CWVA 5MP6H 2Y5QA 2P5WB 4XZUB 3LRSA 4HJGA 2XC8A 4KGLA 3QDGA 3BESR 4M3JA 5FKPA 4YC2C 3ELAT 5IW1A 1C08A 1YMHA 1F56A 3PIQA 2C3VA 2EEBA 2X4QB 1E9PA 2YKKA 4TKWA 4A38A 5I15L 3TF4A 4DP9X 4E2OA 1HXMB 5LCVA 2Z34A 4WF7A 1CE1L 4UTCA 5EIVA 5I1EH 1B90A 1TTBA 4OU3A 3VXPA 1HIML 1OPGH 3GD1C 3NSFA 1M71A 2DLTA 4XN5A 3LH9A 4OJFL 3QPQC 1XZWA 1TTAA 3ZRCC 5IG7A 1G1CA 1A21A 1QEWB 4RFOL 4JKPH 2EDBA 5GRWA 4BFFA 5C9JA 1L5GB 3DYOA 1CFSB 3LRLA 4LPCA 3SOBH 2X4SB 3NOIA 2P80D 4BHUA 2XIDA 5HHMD 2NQ3A 5AALA 2WUCH 2UY7A 5HYEA 2G4EA 3T3MF 2EVIA 4ISVB 1J1PH 3FT3B 4OIBA 4P4KB 2WTOA 1O5PA 1XH0A 3V5KB 1Y1DA 5CGYC 1UWXH 1TPXC 2WTRB 5I2IB 1FH5L 3M45A 5ANME 5DZ9A 3CFUA 3DIVA 4KI5D 4O2FA 4OH2A 1JK9A 5EORH 5AVWB 2H2PD 3GHBL 4Q56A 5HVHB 4RGNB 3EKCA 1AFVH 1IM3B 3C5ZB 4P5TA 4RAVB 4XO8A 3QUZB 4OGXL 1QABA 2BRRH 5FM5M 4GKSA 3B7SA 4N0FA 4PJCB 4L8CB 4LLWA 3EJJX 1BD2A 1G9NL 3NDYE 4DCQB 3MOBL 5JA9A 4PRPE 4OCRH 1F90H 2YLKA 4KUCF 1KXTB 4MB4A 4M5ZL 3AG1B 4QUOA 4D9LL 1YJDL 2HN7A 2I60L 2P43B 4ZW3A 4TSBL 4UU9A 1X44A 1JPTH 2H6PB 3WFBH 2BO0A 1A65A 3JTTB 4X80H 4KI5C 1OOAA 2APVA 1I9JL 3OAZH 4DUVA 2H2PC 4NRXB 1GVIA 4CKVX 2BSRA 3GT6A 2K7PA 5IOPA 3FTWA 2OL3H 4JHBA 3Q06A 2A6DA 1KYUA 3KPOA 3PWUB 4BFGA 4U1KA 2Z7WA 1R3LB 2CO7B 4G8EB 4LCWB 1P4IH 3QZNA 1G84A 4OF0A 5DK2A 3KYOB 1M1XA 4I4WB 5DMKA 1AGFA 3FOMB 2DIEA 1YEHH 3NESA 5AOLA 4Y1AD 3RVTD 1UJTA 1WTLA 1AXTL 4GFXA 2IWGA 4XXCA 4HKZB 3LS4H 4PLNC 2EH8H 2WLIA 1BVNT 3SDYL 4ZFZB 1TVBA 2W5PA 1YMMD 2VQUA 4G8GE 1MCSA 2VISA 2NY5H 5JXEA 1PX8A 4QR7A 5DT1L 3LRMA 1XEUA 3OLIA 5TPWH 1AO7A 5CSBA 4OZFB 2XXCB 1RZ7H 1BJMA 3GEFA 3U1SH 3MBED 2F5AL 4K9EH 4E0RA 1NIFA 2CMRL 4N1EA 3ZHLA 1D9KB 4GXFA 5I8EA 2VLRD 3L9RA 3DTDA 4XBPB 3WS6C 2W65A 4ELMA 1N6QH 3D4ZA 2YAEA 5EZJA 3DGGA 4LL1A 4DGYL 1CI3M 3RWDB 1ES0A 3C6LA 3MNVA 2OXHA 4YHKL 1A66A 1LWHA 3X12A 3EOTL 1MPAL 3GJEB 5CEXB 2O1AA 3CU7A 3GSQA 2AJYH 2NPLX 1N5YL 3L4XA 4WTZA 3DIFB 4X50A 5F7LB 1FNGB 3TEZA 5L2KE 2FJGA 5DFVD 1U41A 4QTHB 2CO1A 3HN3A 3DXAB 2MTAA 5EO1A 3T5WA 4TLTA 4YX2L 1NOAA 2ENYA 1T0NB 4XWGH 3ZTDC 5FYKL 4ZFFA 4FTVA 4XVJH 4JKKA 1J5CA 1J5IA 3ILDA 5IB4A 5I8CA 2B2XL 3MBEC 3RX7A 4X8JB 2JI3A 1HT6A 2VMCA 3Q6GL 5BS0B 3PGDB 2OZNA 4OAWA 3CNKA 1FG9C 1RPQA 5E00A 1QACA 5E8PA 3UEQA 2C9VA 2VDNL 3REWB 3SDDC 5BQ7A 1A7RH 3NAAH 2X28A 1Q0EA 1E5UI 2YBRB 1AIFB 1NGQH 4JO2H 4YFLI 5DMGD 1WEJH 4Y5VB 3PV7A 4FE9A 3I9GH 4F9PA 3RI5K 5A40E 5CJXA 4JFFA 2V4LA 3CMOH 4Q9BA 3MV8A 1MFCH 1PZSA 3B7TA 2HRLA 3HI6L 1RXLA 3ALWA 3ECQA 3MGTA 4FFYH 1T80A 4DO6A 3M17A 2DH3A 5D1QE 4Z7UF 4I0CC 3PNRB 1MFBL 4NIYE 2DQGL 4NBXB 5CILH 2PYFA 4L1TA 4Q6IA 5I1LA 3WIIH 4LQFL 5DFAA 3V6FB 5L9DL 5I8OL 1SLVA 4FYSA 3NQKA 4Q4EA 2LU4A 3VXSA 3FB6A 1QTYT 4Y9GA 2NNFA 5EC1A 4BFIB 3JUYA 2Q8BL 1T7ZA 3KM2A 1TF4A 2VH5H 1MCEA 4MSWA 1YEIH 3QCVL 1K3IA 3ISRA 5EWIL 1JRHH 1V7MH 5T1DL 3TBCA 4CMMB 4CC4A 3DDFA 3UOAB 4OFVA 1SYVB 5DMGC 3NACL 3GPSA 3FRPG 4FD0A 1P5UA 2IDSA 1CIDA 2PYEA 5J3HD 1A5FL 1SBSL 1UH3A 4Y2LA 1TJHL 1G7JB 2UYLA 2VR7A 2IANA 2XWTA 1TMQA 3P02A 4NN7B 2HRPL 1V55B 5EZLA 5DHVH 4BCXA 4DWHA 1T6WA 3VWKB 3MJ8B 2ZUWA 4OCLC 2OZ4H 2J57A 2ZONA 1C5BH 2VW4A 1F1AA 2NUPB 3ABZA 4L4JA 4NO2A 1EZVX 1T1XB 3FONA 3HZKB 5MI0B 1U95A 1FCGA 2FX8L 3PDOB 1SXAA 4H25A 2Y36L 3BZ5A 1ZEAL 1R3IL 1UD2A 1S3RA 4R4FL 3X13B 2AQQA 4JFWA 1ROWA 4XN4A 2ID5A 4PJGA 3F7YA 3RWEB 4NO5A 4UB0H 3DYMA 4PRDB 2P45B 4NQVA 3TVMC 5E03A 5L2JB 1HKLL 3LH2L 2NXYB 4IMKA 3MRKA 4PRPD 3S9DB 4QRRB 1Q0XL 2OTWB 5J3HC 4DKFH 3C2SA 5SX4I 4PRAA 2NYYD 3UZQA 5GS0C 3SO3B 5A6LA 1P4LB 4OQ1A 3NCEB 1JTTA 1DVFB 2CDFA 4HS3B 3BSZL 3FO2A 4GO8A 5E6IB 4JL2A 1ZLSL 1BOGB 1FBIH 2KERA 4CSPA 6PCYA 1KCUL 4N2IA 2EE6A 1IARB 4TQIA 5DD6B 4BH7A 1T03H 2OI9C 1FCCA 3CXDL 2I9LA 1XB3A 3US9A 4FQHB 1U91A 1A9EB 2UZYB 3P2DA 2HRHA 3M7OA 2IMNA 5F7EH 1NGPH 4KTEL 4OD1H 4QEGA 1L0QA 3RHWF 4FFWC 1GGBH 4IM8A 1R19A 2GC7C 5DJXA 4OTXH 1GGCH 2XG5A 3GLDA 4ZW6A 1GZPB 4XCYB 3WCYA 1SFHA 1YQ2A 5HDBB 1JZ3A 3VXUE 2NYYC 3TJPA 3C75A 3WY1A 2WO4A 2IQAA 4W9FC 5DTFA 2JWYA 1KLGB 5AZ2L 3TBSA 1A0QL 1NC2A 3GC3A 7CGTA 3DX9A 4XOEA 4MJHA 4G8GD 5BRPA 3E9TA 4G3YH 4IBVA 5KUKA 1MY7A 4HIQA 3ZR5A 4OKVB 4ERSH 5D1XB 3X11B 4YS4A 2YSSB 2DYPB 1CZ8H 3IEAA 4F33B 2JI1A 2DQJL 3TL5A 4CVXA 1CICA 5FOBB 1JHKL 1ADQL 4K94C 3B2XA 3TZVA 2QKIA 5I17A 3IDIB 3OR6A 3MUGA 5D7SH 3VD2A 2R51A 3L4WA 2EUZA 2HG5B 3OGOE 4XE5B 1S5IH 4NO0B 4OW6A 4UM8B 3I74A 4B3EA 4ELKA 1X9UA 4LMQI 1D5BB 2WNXA 3OB0K 4GLRH 4M9PA 1NPJA 4NSKB 2Z31A 4RAUA 3B1TA 5L2KD 4IBZA 5T1KD 3S3SA 3MLXH 3KR3H 1YRKA 4N68A 4WCYL 1F58H 4U1IA 1NWPA 2GFBA 5AVUB 4LE8A 3VJ6B 1CXHA 4BZ2H 3KWUA 3VXMB 3WO4B 1YO4A 1ZHLB 5AVXB 4LSUL 4LU5H 5FO7A 3S96A 4EMZA 5L0QB 5I6XB 1IBDA 2VL5B 4P46D 2J88L 3RVVD 2WXRA 4L37A 1FZJB 4XMKH 2AJVH 2IDTA 2YEZB 1DQLH 4OF7A 5EU6E 4L2LA 4BK4A 2YFOA 1OAUL 3RFZB 2DQTH 2O5NA 2XN0A 1NCAL 1RULL 2XTLA 4NZRH 3T2NH 5IBUB 3DIDA 1I85A 5JZ7C 3HUJB 3V4VB 4UNUA 1CG9A 1EFXB 1PU0A 4ENZA 2JE8A 3R7RA 3EIFA 3KVQA 4PRIE 1M42A 3AREA 5J12B 1JNHA 1WSST 1W0VA 1ZLVK 4R8WL 4AG4H 4QXGL 4DSYA 2JTYA 4FP8H 5IHWA 3O8XD 4I3RL 2IPUK 3IAGC 5C09B 3RWGB 5TE6L 4U3SA 4WHTB 1Z3RA 2ICEB 3LIZH 3QO0A 4HJSA 1MFAH 4JFSA 3QDME 3RX9A 4HCIA 5D2NB 3TEXA 5L6YL 3CDZB 4OZGE 3RVVC 2MQ3A 4DKEL 1NWOA 4X0NA 1EJFA 3P73B 2R2BB 2KC0A 5IMKB 1SEQL 3NN8B 4DFHA 4Y4FC 4KKAD 2UZIL 4O02A 5D1ZD 1X5ZA 5CLTA 3TFKD 1KPUA 3WEBA 1QW8A 1WC7B 4X83A 3FTGB 4IMLA 4YSUA 4JQVA 4BSWB 2EYTB 1A6WL 3V55A 3LQZB 2AXGA 2DI9A 2DEYX 4N9GB 4F7MB 4NB7A 5KN5B 2E3VA 2HJKA 2B4CH 3EFFA 3O8XC 1ET8A 4WKZA 3SQBA 4TNVK 1NOLA 3JV6B 1JIBA 5D1QC 1IKNC 1KF9B 2GCYA 3DO3A 3PQYA 12E8L 3S48A 3MR9B 4YQXL 1KLUA 2P5EB 3O3BB 5JOEA 2QADB 3VMNA 2ZPKH 3T6XA 1QLRA 4G43A 2NY6C 1ZD6A 4HPOH 4L29B 2JIXB 4PJBB 1ZHBA 3CK0H 5MERB 2DM4A 4NBYB 1ZPUA 1KMGA 4ZO6A 5C0RL 4QIRA 3PL6D 3BZ4A 2EEFA 2IH3B 2FGWL 4Z76A 1BQLH 4ODUB 4ZSOA 2VLJB 2MIZA 3L3OC 1CK0H 3BT2L 5FK9A 4IBYA 2APFA 5I76B 5D1ZC 4UZSA 4KZEH 3RPBA 3SKOB 1L7TH 3APFA 4MNQE 4F57H 2DMGA 1UM5L 4WKXA 4JZJC 4JM2C 4N28A 5DVMA 3RL1A 1L3WA 3IJEB 3KGSA 5ECGA 3CC5B 3GBDA 5C9KA 3G04B 5LGJA 32C2B 2EO1A 3ARFD 4Y2OB 5KWYC 3MOQA 4ODTH 1KIUB 5I1HH 3O3EA 1MKFA 3UTSE 1VFAA 3NCJL 2H32A 2YPVA 1SJEA 1UM4L 4NOFA 5AB2A 1UCTA 2VAAA 3OXSA 4ATTA 5JQIB 5D55A 4F8QA 5KSBF 5EN2A 2YA1A 1TZGH 4UDUB 4S10A 1WIPA 1XF1A 1EDQA 5GGTH 4FQLL 5I18L 3PL6C 2JKXA 1ZKAA 4JFDA 5SWSB 4PJAB 4F2MB 3MSPA 1VACB 3MYJA 4PRBB 3W9EB 5I24A 1OP3H 4EO5A 2QMKA 4N22A 4WW1B 3VM7A 4QO1A 3KWTA 1AI1H 2CAKA 4WEMB 3SY0A 2AQPA 2BIHA 4G2AA 1LP9E 5BVJB 2C9AA 3AW5A 2BVQB 3VXUD 3OAYK 5A6MA 4TVPE 2FEEI 4IGBD 4TQPA 4AIOA 4GUCA 3O41B 2FJFA 3QFJB 3JWDL 3R4RA 3LKPA 4E5XG 5DRXB 5I66B 4PUBH 3VQ2C 4NKOA 5EBWB 4U0QB 2HWZH 1BQHB 3LN4A 3D2UD 3CFCH 3QHFL 2WWMD 3F64A 3KDPB 5KAQF 1SYSB 2XIBA 4DO4A 2FQDA 1U8NB 2QVMA 1ICTA 4Z7WE 3VE0A 1Y07A 4NKIL 4NYLB 3VXRA 4ABQA 5DRWB 4Z78A 3FB5A 2DF3A 4YDLC 4I18A 4CRPA 4FRWA 3B3IB 3DX8B 2YUZA 3QFDA 3OKEA 5AZEL 3TCXA 4BWWA 2SEBA 2JCCE 3MRMA 3WTXA 1IE5A 2Y69B 3GKZA 2GT9A 3HG1D 4JY6B 3LKQB 1JGVL 2VDLH 4KDTC 4LSQL 5E99H 3SE9L 3SPHA 3U9WA 2I5YL 4BQCA 4IGBC 1B2WH 3ZUCA 4GRWB 4Y2DC 2NY1B 4OBRA 1I3RA 2NNXA 3C2AH 4NM8L 3ARGD 3HNTH 4W70A 3FL7A 4BWUA 5IVXA 5JHAA 3FUIA 3NP3A 4E9WA 1QBBA 3VSQA 1N4XH 1XZ0A 5CLXA 1MIMH 1DSYA 1WT5A 3KPQA 1Z7JA 5IREA 4DP8X 1WBXA 3TCLB 4D0BB 1BBDH 4LLDB 4X6EA 3UERA 3NJMA 1ZHNB 3PP4H 4KZ0A 4MXQC 1X5FA 3HNSH 1RCYA 1XAKA 1S7SB 4QLRA 1JYNA 1USQA 3DKHA 2H0FA 5DHYB 3CZJA 2JKWA 4I89A 2F1AA 4PRID 4JKWA 5AKSA 5I1JL 1I9IH 3RVUD 3FSVA 1QHQA 2AEQL 4PD4J 3TPUA 2ESVB 2XN9E 5I1IH 5CZXD 1YA5A 3S6CA 3MRCA 5KS9E 1LK2B 1JWMB 3QH3B 1OQOA 4KOBA 4G80A 5DUJA 1FO0H 2IC2A 1SQ2N 1P5VB 2FECL 2ZOKA 3DYPA 4WWPA 5EIIA 4PEEA 3GO1H 4PJ5E 2LTQB 3T8MA 1LTXA 4RISH 5D4QA 5A2JH 1TQCB 4HUXA 1T1WA 4W9HC 4MZIA 3E7JA 1FFOA 1JSYA 5DJYA 2YLHA 4JJHA 1GOGA 4O2EB 4XCNB 4LBEA 4YR6A 4CVUA 5E4AA 1OGTB 1NUDA 4PGEB 5GGRA 3IPEA 5HD8D 3V0HA 5KSVB 3MLPA 4HC1A 1IKOP 1WD9A 5KSUA 4F7PB 4I1RA 3D12B 5DDHB 5FGBA 3PWJA 3GRWA 4ZK8A 2BMKB 2KZBA 3LTVA 1CO1A 5LG1A 1J0HA 5HPMB 2C9XA 4MAYA 2ZNWA 5J13B 3IPFA 3CBRA 3FO1B 3CZFA 5K9KA 3T3ME 2FL5B 4G1MB 5HHOA 1F11B 1BXVA 1IB5A 1QKZH 1U4FA 3CFEA 2Y7NA 3Q9QA 4QF1B 5EUKA 3T9WA 4DPBX 2A6IA 2Z8WC 4X7SH 3OKYA 4HFWB 4HKBA 3V4VL 3CU1A 1HYRC 4P5KA 4X4XB 3WTYA 4ZAKC 3GSXA 2Y2WA 4GMTL 1DDHA 1VPOL 4MNQD 4KK8D 1HSAA 4QRUB 4M6NH 5FR3A 2ALAA 2GI0A 1HAUA 1UVQA 3NRQA 2ED7A 4E68A 1MWAH 4GY4A 5C0IA 1CD1B 4ELMF 4HZ1A 3H55A 1OF2A 3U6XA 1NFDA 35C8H 4IOIA 1SEBA 2ZXDA 3PRZA 1A7OL 1FYTE 1HXYB 4NHCL 4RETB 1VGEH 4XBGA 5E23A 4OLZH 3UTSD 3V0VA 2VZSA 1MY5A 2P44B 2X4NA 4ODSL 3NZ8B 5B3JF 1ZCRA 4HLZH 1H5BC 3N42B 2PUQT 3KYNB 5EEVA 3OM3B 1QASA 4EIZC 4P9MH 3SE4C 1MCJA 1DBAH 2CO4A 3D39B 4QTIL 2QVKA 2RTTA 1I9EA 3O3AB 3DSNA 3AFLA 1SJXA 3VVVA 3QULB 1GAFL 1KCVH 4L5FE 4OIIL 3BFOA 2VQ1B 4NWTL 3LHPH 4CBPA 2Q6WA 3HAEG 1IQDB 2PCPB 2O5YH 4KK8C 1OARH 2KQMA 2FLMA 3IDNA 3P0GB 5EF0A 5CBAA 4R96B 4OZIA 2VR4A 3RJQB 4A6YH 2R1WB 4GAGL 1N0XH 4ONGL 4I2XE 4TVPD 2F58H 1J8HB 1ZSDA 4L4VA 3T0XA 1HK6A 1HH6A 3NZHL 4Y16C 5C07E 3NYKA 3NPSC 4YXKL 5D8JH 2YD5A 4EJ1C 5BV7B 1I3GL 1BG1A 2IWFA 3LZLA 3FQNA 2EXYD 1JRHI 4OLVL 1I31A 2OX5B 2CQVA 1ZA6B 5ACLA 1TJGH 4HIXL 3NH7L 4IBSA 4YK4C 5DUPL 1JWUA 4TULH 3G08A 5KEZA 4C56A 4W81A 4FLSA 1NUGA 2QQLH 4POUB 4GRMB 2FD6L 1EBPA 3ZDXF 4JHAL 1IMHC 3P0VH 2W95A 1T04A 2DM3A 1FHNA 2GITB 2YPLE 4HIEA 4WW2A 3HOGA 3VD1A 1MLCA 1MW0A 5AW4B 4UQ3A 1JYWA 3M6DA 1NDGA 3E0GA 5IHUL 3IS0X 1G4MA 3VWJD 4XPFL 3SDAD 1LWJA 4JFZL 1HE8A 3KH3A 2ZE0A 4PPTA 3MROA 1LNUB 3GLAA 5FHAL 4XC3L 1C5DA 1G0DA 3V95A 4PRHA 3NCYS 3GK8L 3FSWA 4P2QE 3D2TA 43CAA 1QPXA 4M4PA 1BQ5A 4MD5B 4P5MA 5CR8A 5DHEA 4TMPA 4UT9H 2XWBB 2EDNA 3OPZH 5B4MC 2OR7A 3RNKB 2CLVA 2IJ0C 3GSNH 4A2FA 4JR9H 5E08H 3RU8L 5IB1B 1DBJL 1EANA 2CBTA 1CXKA 4F8OA 4FQCL 1DJGA 4J3OD 2A9DA 5IROA 3S35H 4JVWA 1WA2X 1PZAA 1L9OA 4MD4A 1OZTG 5AW5B 3B4NA 4AYMC 2XN9D 4KO6A 2R0KH 3FAXA 4PM1A 4APXA 3AB0B 4KK6C 4AQ1C 5JORA 3E6HA 2E56A 1YAZA 2H3XC 2XHNA 3LEVL 1WD8A 4MRCA 5KOMC 5L7XH 5T1MA 5C6WH 1EJOL 1M2OA 2HFGH 2EABA 2V7HA 4WQOA 3QUMB 3VFWB 1CXEA 5K1NA 3EYOA 4Q58C 1JTOA 5FA3B 5JOFB 4Z7UE 2V2XB 3QAQA 3EYQC 3RDTB 3HHMA 1DBBH 3K2UH 3ZL2A 3T3PF 3UC0L 1UJ3C 1U3YA 3JV4A 5DJ2A 3H9SE 1ZHKA 2AERT 1RJZA 3FTVA 1JXJA 3QHTC 2B1AL 4J3OC 2D4DA 1O6VA 1E8WA 1M05A 2CGRL 3D3VB 3OKNA 3H42H 4GBXB 1DFBL 2BP3A 2PW2A 4RGMB 2Y06H 1W0YT 5JHMA 4R7XA 3S37H 1GGYA 1SMAA 2XQBL 3ZTJH 3O4OC 4MMZB 3MJ9H 3DGCR 2BNQA 2ZOTA 3R06B 3IVKA 2NUTA 4P2OD 5C71A 3TU6A 4ONOA 5BOPA 2QGEA 1UC6A 5DUMH 2Q7YB 4AITA 1NEZB 3ARWA 4D8PA 3BQUB 3ETBF 2X7LA 2CO3A 1ZE3H 3CCHA 4G6JH 3ZDWA 3TEYA 5IVZA 1AP2B 1BFVL 3MCKA 3NJIA 4Z8FL 3S5LB 1H15B 3VO0A 4HIJB 4GLRI 2HKHH 3BP7A 3C5JB 3IMWA 4KZDL 1JPEA 4EI5A 5AG8A 3ES6B 2DQCH 3OB0H 5K59F 1CGVA 1XH1A 1E5ZA 2YHGA 3DV4B 2WCSA 3RWJA 5MENB 5F9OH 3GINA 3HC3H 4I7ZC 3WJLA 1ZV5A 1VENA 4PG2C 4QNPF 1CGTA 2Y7SA 1Q94A 4F7TB 1WFIA 3GMNB 2X89D 3P9WB 4KQ4H 1PEWA 4EVNA 1U8CB 2WQVA 5EU4B 1FYTD 3A21A 4Z7OB 1U8MB 2DLGA 3A67H 3X2QB 4FABL 3PXHA 5CHNB 5JW5A 1RQ5A 2FTAA 1ZT4B 4P23B 1H6TA 4U4BA 3K4AA 2UUDK 3VVWA 1YZZA 4RFNC 3IDUA 2DKSA 4KUCD 1M57B 1RK7A 4XN2A 3QORD 4WHDA 1XMEB 5ITFA 3F7LA 1K6QH 1M6UA 1N9PA 4EDXA 1QRNE 1MH5A 3EJRA 1LEGA 3HNVL 5FKAB 2ZXEB 2J20A 3R1GH 2V17H 3B9KD 2OMZA 2J8UA 3QNXB 5AFAA 4XNBA 1RZJH 4WWID 2XBTA 4Z7VA 2IDCA 5IB3B 2X05A 3I75A 1YEJL 3UBXG 3V0WH 3F04A 2A9NH 4M3HA 4TQEL 5AVZB 1H3GA 3F12A 3N43B 3M1OA 4HK3J 3OKMB 4F9LC 4FF9A 3C8KA 1BAFH 4O51A 5C07D 4GPVA 2GIMA 3C9NA 3PWVA 2GHWB 4U1LB 4Y5YC 4F5CE 5B1KA 2AJXH 4G6KL 3U7YL 1RD6A 1T2XA 2AJZA 3INUL 3KNBB 3QNFA 2CD0A 1MRDH 4MBRA 2WJ5A 3QORC 3W0WB 1FORL 1AZUA 3CZEA 3QIBA 4HDIA 3EJTA 1NA8A 1FJ1B 2JB5H 4JVUA 4Q7DA 4UV4L 1S9VB 3ZE2E 4Y4KB 3VFGL 5ID0B 3AJ7A 3B9KC 2FWUA 3P3SA 4OLUH 2UY6A 2AEPL 4RMWA 4JPIB 1G0YR 1KENH 2EE0A 1NANH 2YPLD 1EHKB 1MG3C 2DQUL 2BIOA 3EH5B 5EOCJ 4G71B 1CLOL 2JLLA 4KRMB 2VLLB 5GHWL 3L3GB 2K9FB 4LSVH 1SOSA 4GS7B 4ZTOH 3L4ZA 4XVSL 5LKNA 5HDBF 1BZEA 1J1XH 2Z7YA 2XWRA 4Q6KA 5IESL 2K4AA 4A7TA 3GKWH 3FU6A 5HY9B 3U83A 2NX5A 5CMAB 1U58A 5DRZB 2BDNL 1D5MB 5AENA 1U3ZA 4LEXH 4P2QD 3KE0A 1OAJA 1U3HC 5DUBB 2ITDB 5SWQB 1CBJA 3D33A 1X7QA 3OZ9L 1NZRA 4H20L 1FGNH 2B39A 3MRIA 4PTUB 1MWOA 4OB5L 4YXLL 1I1CA 4H8QA 3DRTB 1DSFL 1PQZA 3WXVL 5DLMH 1OIOA 1RIHL 2OMXB 3RY4A 3ESNA 1I7TA 1NBZB 1YNLH 5ALCH 3FFOA 1R5VA 4FOMA 4N8VB 2AANA 1FNSH 2DIBA 5BV7L 5K9QI 1Y6KR 2BC4A 4P07A 1FFRA 1FFNA 3S5YA 5TQ0L 2IMMA 2OMTA 3Q2LA 5EZOH 4I5BB 2WQAA 1PVHA 3MZTA 3G7TA 4N0YL 2V5MA 2DLFL 4AYDC 1GXEA 2WBWB 3KPNA 4NN6B 1EAJA 4AMXA 3SQRA 3DUUB 3BDXA 1D5ZB 4IQHA 4B53A 4FFVD 5ESVA 2CUAA 1HEZB 2YPKB 3QQDA 1VLXA 4XO4A 2F8VA 1KXQE 3OAYH 4Y19A 1N3NA 2OXGB 5F70A 3L5IA 2OR8A 3H9SD 3QC5X 1OTSD 4FX5A 4HSAC 5AVYB 3RPKA 2H26A 1BAWA 5J9PA 2OQJB 2XYBA 5BXFB 1UXMA 1WHOA 2D9CA 1O6SA 3I6GB 3O45B 4YBQD 5IW3A 3V52L 3KWWA 5A16B 4KWUA 5LB1A 1E8ZA 4EI6B 4JRYE 1Q0YH 1S46A 2VZ3A 1G94A 3D0LA 4NM4H 3U30B 2WHVA 3QIWC 4AYBA 4PJHB 1JHLH 1MHEB 2GTZA 3MVSA 1V5JA 3P4MB 4MRBA 2VW6A 1IV8A 1CYXA 2ZAIA 1I82A 2IBBA 4KVPA 4IJ3B 1ET7A 4JBSA 5GGVL 5HYQA 1F02I 2C34A 5GGVY 1JE6A 1RVFL 3ZR6A 3U79A 4OQTL 4O4YL 1IBGH 2WSDA 2JMRA 4IRJA 3QYCA 3S97C 1RK0B 4WI0A 5E9DB 1G7HA 3UDWC 4AXWB 1OTSC 1ACYL 3KZ8A 5HI4D 2DJUA 3KGUA 4U6YB 1KELL 4FYTA 1OLLA 1X5YA 1E4KA 3JTBA 4IRSB 5AW2B 5I0ZA 5IZ7A 3TA3D 4UOW0 4YBQC 1MEXH 4FMVA 3ZTNL 1G7QB 3DNKA 3RGVD 5FHBL 4Q89A 3V0DA 4TUOA 3BYTA 3Q43A 4RWYL 4HS6A 3SYPA 5IJBC 4WWKD 2Q3XA 4MA7H 1MVYA 3FJTA 4J3OG 5IUCA 1Z2KA 3KXFD 1K4CA 1IBBA 2I9TA 4JM0A 1BGXH 4JM4L 3K81A 2EYRB 2VQTA 4PV9A 1KV7A 2E9JA 1QRND 3AY2A 3T6VA 3GS0A 3IDMB 4HF5L 3CD4A 1OAYH 1DL7L 4UTAH 1B4TA 5DD5H 5KZCD 2MOGA 4YSAA 1GIGH 4NS0A 2ZP0T 1YEFH 2Z91A 1YAIA 2A9MH 2QGCA 1FIGH 4HT1H 4JFYB 5I8KL 4LEOB 1OP4A 3EBGA 1JFQH 1TLMA 1KCRH 1MHPL 4O2CA 3TA3C 2ADJA 2XZQH 1HILB 5AB9A 4HXBL 4G7YH 4K23L 1X5KA 3PJSA 2D9QB 2E7CA 3QRBA 3RGVC 2JXMA 3LN5A 2D03L 3L4UA 4PV1C 4IRZL 3GXIA 3O2VL 4L5FH 3K6IA 3S2AA 2ZUXA 4XBEH 2R0LH 3I3DA 5E2WH 3SJVA 1EXHA 1X9QA 1YYLL 5SWZD 4IHBA 2EINB 2VXVH 4UQ2A 3FQTB 4MA1C 5KYYA 2DJMA 2GUYA 4XB8A 2Q3ZA 1AD9A 1J0YA 1JJUA 3MRQB 4G11A 5EU3B 3DARA 4IEFA 25C8L 4LT7A 2GTWB 2X6UA 3GS7A 3NCMA 4R7NB 1OB1A 4D0DA 2J12B 1KIQB 2C9QA 4HKJA 3SBPA 3CSFA 2AKRA 2LU5A 3QJUB 4WK2B 3JZYA 2FO4A 3LPGA 5GSRB 3WMSA 2K4WA 4PBDA 1Q1PA 3ZY7A 4BCYA 4WDIB 2I32A 4AJVA 4KTYA 3DPDA 1PJWA 3C60A 5SV4A 4EXKA 3ZTCC 4LHUB 5IQ9A 2BFVH 5F1NB 4AV0A 1FVEA 3GZKA 1I7UB 3MGAA 1MOEA 1KJ2B 5I1AB 3HC0B 2QQNH 1EAPA 1FPTL 1PLGH 2WVVB 1XGRA 1UASA 1QAWA 4ZW8A 5EDSA 1Q72L 4DEWA 5LVEA 1XGUB 4IK6A 5F9JA 1XSKA 1M2VA 3QG6B 5BJTB 2Z92A 1UZ6F 2Z7ZA 7TAAA 4XCFL 3EZ8A 3KPSB 1AE6H 5FWQA 4AEHH 3L7EA 3QJVB 4WO4A 5EPMA 4CVZB 4EEEA 3MRBB 1MCOL 2JJVA 3Q2CA 5C08E 1AQKL 3HKFA 2PO6D 1XTLA 2D2OA 3BZEB 3N5AA 3W39A 2VERA 4H5SB 1A9VA 2GBAA 4U1GC 5EF3A 5GJSH 4GRWF 4P57B 4PD4K 3NA4A 1NFDF 2BOBA 4KK9D 4PJEA 3QZLA 4PJ8C 1IC5L 1GL4B 3EO9H 5TD4A 4LCCB 4ICWA 1F8TL 3DI3B 1W80A 2L0DA 1UXWA 5FYLE 3N41B 4NZDA 4MA3A 1R5WA 5T3ZL 1FZMA 2HT3C 3NEXA 5TJWK 4NDMA 5BZDB 4N0CD 1QBML 4ODWA 3DX4A 4EAEA 1NBVH 3P4NB 3NJFA 4OZHB 4KXDA 2IALA 1UD8A 4ZPVB 1TLKA 3MGOA 1QP1A 3IPBA 2Y7QA 2PO6C 2OV0A 5AVSB 1U93B 1OGAA 3GEWB 4S1SL 2V37A 1P2CA 2UZXA 2C3GA 5FO8A 4Y8DC 4JRYD 3C08H 1E9QA 4YDIH 1AQHA 4J23A 2X4TA 3WBDA 5FC9A 5HJDA 1HL8A 2AXWA 3FT2A 4KK9C 2HMID 3VQLA 3RWCB 1BF2A 1FZKB 4LCYB 5A2BA 1RIVL 1H6FA 3QDJA 2V3DA 3KYKH 4UILH 2P5WE 3PY9A 3IU4L 1XXDC 3UH8A 3Q3GB 5B8CB 1WZKA 4JJOA 5IEHB 2BSEA 4WV1C 2XQYA 3OXRB 3KJ4C 4YHMH 2ENQA 1E2VA 5DC2A 3S4SA 5JDSB 5JQ6L 2PCFA 4M43L 4R5VA 2R23A 5T8IA 3OAUL 4N0CC 4J6RL 1D7FA 3QEGL 3UYRH 1I1FA 1TQTA 1GKEA 3EADA 4UT6L 5H2BB 1SDDA 1P53A 3BO8A 4HBCL 2JELL 1BBJA 3MRGB 7FABH 3BH8B 4IYKA 4PJ7A 3MKKA 3EH2A 3FT9A 1J88A 4Y2NA 2ERJB 2FO1A 5EU5A 4WW2F 1IEHA 4FQJL 4QHLA 1VA9A 1J9RA 2F6AA 2ZP9A 3L5HA 2WUBH 2CRIA 4OLYL 4ZRGA 2QZQA 2WYZA 2E8YA 3DTXB 4I0PA 1I4FA 2Z35A 1NCWH 5FW6A 2RACA 5GGSY 4G59C 1D6VL 1UACH 5LAXB 4DEPC 4EIBA 5E6RB 1URLA 1E27B 3PV6A 1CFQB 2XA8H 5F44A 3CMGA 5B3JE 4HWUA 4WHCA 4QXVA 5G4NA 1CT8B 4OM0H 2FRGP 2BVOA 3RPIA 4N2EA 5H37H 4LKXB 4RGNE 4CU8A 2WQUA 2ZYSA 4EN3A 1TZ8A 5T5FA 5JPNB 1MFDH 4PJCE 2LT9A 4ZX3A 1TVHB 1XL4A 5DS8B 5INDB 4PN6A 1Z5YD 4LARL 1UENA 1OKEA 4MJ2A 4S1DC 2R69A 1NGWB 1KC5L 1RSYA 3N42F 4K5NA 4AVJA 1WAAA 2NLJB 4NQQA 1L0YA 2ZICA 3L9BA 4NJ9L 3U9PH 1CF8L 2W88A 5GISH 3QHZL 1F18A 2QJDA 3FUEA 2YBGA 3NFPB 5BMFL 4AJYV 5ESQA 2ZX7A 5ENWA 3BPNC 1VERA 3CC1A 3P0YH 1KB5H 1DCEA 1Q4NX 4R4BB 2PR4H 3VW3L 1U95B 4OLWL 3VFSA 5CWSA 5FYKD 2IAMB 3D9AL 1E4HA 3GJFK 1SBBA 4MDIA 4EUPA 4AE1A 2PETA 4Y7MA 2HJFB 3ZDXE 5I1DA 3FXIC 4U49A 4F37K 1WZ1L 3DPBA 5ETUB 1G7IB 3IDJB 3BRGC 3HHSA 3EHBB 4RMVA 4LCWE 2R29L 2AV1B 4X9BA 4J4PA 5LN8A 3P9LB 2QPFA 3BKJH 4PR5B 4WU7B 1WUNT 2BOCB 3CFJB 5J57B 1NLDH 1KCSL 5BUGA 3NA9L 3Q6FB 4L2YA 4S11A 4A2LA 1LO3H 2J2ZB 3BSHA 3QJZA 3AUWB 3ULUH 5C0GA 5CCJA 2ROYA 3HPJA 4L3EA 1RMFL 3CHPA 3G6JB 4RSYA 3K72B 3L4TA 3V4PH 1KN2L 4OF5A 3WMPA 3BVNB 5IIEB 4PJDA 2XVBA 5K9OB 3WTUA 5C08D 4D2NA 4LLYB 2EDQA 2I9LB 2Y3NA 1NKOA 3W82A 2XIIA 2XBDA 3MQIA 1S7VA 1QUNB 4QDGA 4BJLA 4U1HA 3AGVA 4WAFA 4GAYB 3IKCA 3SPVB 2BP8B 4W4OC 3CFKA 3T8XA 3UACA 1I8IB 4HZLA 4URTB 1CBVL 3QI9A 1LE9A 5D5MB 5ICUA 1WP6A 4G7QB 3GGWB 3LB6D 4I87A 4XNUL 4XNZC 1JMXA 1QW9A 1V3LA 5FYLD 3GSWB 4KKBD 4QHPA 3UBGA 4CN6A 5GXBB 3GUFA 4P59L 1CE1H 1DZBA 4KXCA 2NNCA 1LMIA 1F1DA 4CA4A 1VSCA 5E0QA 3UYPA 3PU7A 3L1OH 1K3ZA 4GRLD 4APQD 3HB3B 2J8UF 4RFOH 2O5XH 3HE7B 1C8QA 1PKQA 4XMPL 1BFTA 2A99A 2D73A 5JIIA 4Z7VF 1E90A 3U0PB 4YE0A 5BS0E 3MLZL 4ES9A 3T4AB 3T3PE 1KJ2L 4GW4A 1P6AB 1I8MB 3BQVA 5GGQL 2APWA 3O81A 3OKDA 4AQOA 1MJJB 4P2CG 3MX0B 3D18A 3SB3A 2V9QA 3GM0A 2E59A 3BEWB 1NANI 3D85B 2IWKA 3PJLA 3DX1A 5HHXL 3LB6C 4L1LA 4HGWA 4LVEA 2P5WD 4HVBA 1HCVA 3IDXL 5B1JA 2FR4B 4PGJA 3AXLB 1BEXA 3DOSB 3E38A 2AQRA 3GHBH 1JZEA 3LS5H 3P4OB 3TWCL 5PAZA 4CAGA 1CPUA 4OGXH 4E41A 1LILA 1EWHA 4P2RA 2W0KA 4JGUA 1R33A 4FI7A 3TXAA 1G6RH 1H3TA 3NT0A 3A4DA 4FQIH 1K2DB 4GRLC 2CM5A 5JNYB 2YK1L 4M1CD 1A4BA 1G9NH 4JPSA 5KOVC 2R1XA 4M29A 5K59E 2Y5TA 4KO9A 4B27A 2J1ZA 4JDVA 4JRXB 3BUPA 5F7MC 2R7EB 1ASQA 3REVA 4BFKA 4D9LH 3OBAA 3PXLA 1YJDH 5DSCA 1FNEA 1QI3A 1JCKA 2OFQA 2LQRA 2I60H 1V7NL 3T08A 3ZOAA 2G3XA 1KBBA 3D25B 3GZPA 1F6LL 1E4WL 4P4KD 2OL3B 2FJHB 1PIFA 1I9JH 5EC2B 2A73B 1TU2B 5IB2A 1CE6B 4GSXA 4L4TA 4LNVA 4M03A 2WP3O 1F4WL 4J3UA 1ZVNA 1SHSA 1T5WB 1Z9SB 1EQWA 4ODHL 4RGND 3P4LA 5JXEC 3UJJH 1IM3D 3AM8C 3C5ZD 5BNXD 4M1CC 5IJVB 3CLFH 4HPYH 2HAZA 3H7BB 1JPSL 3FOLB 1I1AB 2C3WA 5AOKA 2P3YA 4OV5A 4ZNEA 3Q8EA 3EYVA 4Z7OF 2N1TE 4LOEA 3VSVA 2G2RA 2VSMB 4NFCA 5G55A 4AC4A 3JYCA 3C6LC 4QRRE 3QWRA 4UOJA 1WISA 3M8OL 2F9BT 3FCTB 3OL2A 5EOTA 4PWGA 5D72H 5G4OA 4ZYKB 2NSXA 2DWYA 3NJHA 3GXPA 4P4KC 2DQFB 4Y8AA 2ZX5A 5IB5B 5DT1H 4FLOA 3CFQA 5BO0D 2EVJA 3WN5A 2O30A 2EYSB 1IGFL 1IAKB 2F5AH 2YO3A 2FJSA 5LXGL 3VQ1C 5C0ND 3MA7B 1ZOXA 2CHXA 1LD9A 3MUY1 4I8DA 5FAAA 3N55A 2WSPA 1QLRB 2VUKA 5HVHC 4RGNC 4AV4A 2BNUB 4BUGA 3V5DB 3C5ZC 2VITB 3QUZC 4DKTA 2EO7A 3P1VA 3UTQB 4DGYH 1XD0A 1OCCB 3N85L 5EEXA 4YHKH 3APDA 3O9WA 1IE4A 1MPAH 5A2FA 1OY3B 2XDHA 3MACL 3LPOA 1T7YA 2X2JA 1KIPB 1HX0A 4LCWD 3V9FA 1YPZA 2VLKA 5DJDB 2XWJA 4BKTC 2R2HA 1OSYA 3B37A 3VFUB 2YD8A 2J8HA 5HDBE 3DMMB 3WEAA 4YX2H 3HZYB 2E27H 4OGYL 5FYKH 1W6WA 1MREH 3WKQA 2C7FA 4KJYA 3EFDH 3ECVA 4MNGA 4HUWA 2AAVA 4ORGB 3FT1A 4LPTA 4LNRB 5SV3A 5IR1A 1Q9OB 4JQXC 1HHHB 3RWFB 1QFHA 1FI8C 5D1XE 5EN2B 2AQTA 5ABZA 2VDNH 1OK8A 2AK4B 5HI3D 3DJSA 1AQDA 1D9KD 2HUHA 3S3DB 4BGDA 3S88L 1T22B 1KLFB 1R17A 4IKJA 5E1QA 3FU7B 2FWLB 2YUVA 4F7CA 1FVCA 2OMBA 1D7CA 2K8MA 4PJIA 1G7PB 2VKWA 4CC4C 2Z0UA 2AJSH 2F8XC 2Y1ZA 4L48A 1WBYB 4DVRL 5F6HI 1P5UC 3IN0A 1JGLL 3ABKB 4LQFH 4LBAA 1ETZA 3JTSA 3MBXL 2OW6A 3JSSA 4Z0BL 3DXAD 1BG9A 5IVOA 3VFVB 4DKDC 2VR6A 1JVLA 2SODB 1S7UB 2YAHA 3ATBA 1FIEA 3CTTA 4MX7B 3VXME 1YEWA 5DS1A 1AMXA 1NIEA 4IDJL 5EWIH 1BX2A 4MXVF 2FEDD 1R3JB 2FDBP 5BS0D 1GS7A 3V0AC 1IGYB 2WXFA 5HI3C 1N12A 3SYQA 3NACH 1A4JB 1NMAH 4DO5A 2L7JA 5DHVB 1SBSH 4CMHB 3C12A 4B9PA 3HUJE 4XRCA 5ESAB 3OR7A 1BIIA 3ASNB 3MCG1 3OD3A 3WTTA 5M94B 3ILPB 3LPWA 5ISZA 4AL8L 2F74A 2HRPH 2GT9B 1NIAA 1D2PA 1U8OA 4Y4HB 4H1LH 3ZTEA 3W9DB 3T0DA 4RZCB 5LLIC 1OT4A 5HHMB 3O6ML 1I9RL 4BM7A 1UA6L 4X5QA 5C09E 2VERN 1MJ7L 5EB9A 4TUJA 1OTTD 2Y36H 1ZEAH 1R3IH 4V1DA 2BSBA 4R4FH 5MP6L 1OLZA 4ODBD 4WU5B 4HD9A 4ZTPH 5D2NE 1P7KA 5FDWB 1CXLA 5GS0H 4MCNA 5C0BA 4AYID 5KYXA 1WFNA 4NZJA 2AV7A 2Q1EA 4M93B 4PTTB 3U4BL 3WIFA 5A3ID 1OHZA 4QWWC 4WO0A 1XCTA 2PTVA 3BVDB 3FTYA 3P2TA 3CSGA 2J44A 1RZKH 1G9MH 4FZ8H 4Y5VC 2NR6D 3CSYB 3VA6A 4GG6B 1EEUA 4PJHF 1ZLSH 3RBGA 3FFDB 4LL9A 5INCA 1CQKA 1KXVC 4JKPL 3GSUA 1HH9A 2WLMA 5F88B 3SOBL 1J86A 3VWKD 3CXDH 1OTTC 1J11A 1J5OH 3QWOB 2P5EE 2QVFB 3VFRB 2WUCL 5HGBB 4F3FA 1XMWA 3TLRA 4QD2E 4WENB 4FNLL 4E9SA 3KYMA 4PJBE 1NGZB 3ARBB 3IMBA 5G5DA 1C1EL 2OMYB 3LQAH 4FFYA 5EO0B 2CDGB 4M62L 5A3IC 1QFWL 2VLJE 4WUUB 5DJYB 5I1CL 4X5XB 1CICC 2B59B 4HUCA 3ARTA 1F3JB 2QKIC 2NXYD 1NPUA 3MBWB 3FO0L 5GIRB 1A0QH 4QRRD 4A7VA 2BRRL 3OF6D 4YFLF 1SVZA 1OF0A 4HUMB 1WBZB 4GQPH 3RYMA 3AVEA 2DQIH 3GTVA 4ONHB 5CP7A 5I73B 3PWJB 4IU2B 4NN7C 4PJEF 1DVFD 2E4TA 4JFOA 4BEIA 5E6ID 1MIEH 2HP4A 2Z31C 4JG9A 5CIPA 4YLBA 3DUSB 3THMH 2XVKA 4WSKA 4XAWL 4MB3A 2VABB 4OCRL 1F90L 5GRVK 1ID2A 1PZ3A 2O26U 1HQRB 3VGBA 1ADQH 3CFBA 5MI0C 2FHFA 2A7BA 5D7KE 2VO8A 1DQQB 4HWZB 3H2PA 1S9WA 1MHCA 3GMQA 3UIYA 1M9WA 1DANU 2BY3A 4NKQB 4PJAE 5SWSE 3WFBL 1C16A 4F2ME 2C7UB 4X80L 1CFBA 4H26B 3J2PA 1JI2A 1DQTA 2NXYC 1S7XA 5CJ8A 5HI5D 1MW1A 2LGNA 2YAMA 4OZ4A 2P80A 5C0FB 1T21A 3VYPA 5GRZA 1BJ1H 1FNFA 3PP3K 5F21B 1F45A 3IRZA 2J3SA 2YRBA 3L7FB 1JPFB 4HXAL 3AREC 4NQTA 4XNXH 3GF8A 4YSOA 4AGNA 4YHNB 5IHZB 1F86A 2P8PB 1P4IL 3QFJE 4GXUN 2J88H 2PR9A 1A64A 1YEHL 4JUSA 3TIDB 3ULAB 5D1XD 4XNQA 1RULH 1CFTA 1PNCA 1VDGA 2G5BB 3A24A 4FXGB 1XR8B 2DYPD 3LS4L 2EH8L 3DUHA 1BZ7B 1UZ6E 3D1MC 3MLVL 4LLVB 4GKOA 3QPKA 4AYEC 4C4UA 2NY5L 3BWAA 5D7LB 5C0CB 3T2OA 1OT1A 5TPWL 1EDYA 2WK2A 3BWUF 1RZ7L 4PJ7F 4Z5RA 4NO0D 2BZ7A 1AR1B 3ULSB 1BVZA 5TE6H 4OZFH 5D96B 3PHQB 2PCXA 3QBTB 4A66A 1IGJA 2GJRA 4GRWE 1DO5A 1W72A 2HH0L 1S7TA 2A74A 2FLRT 3VXMD 1BVKA 3UGEA 2AJYL 2WO2B 2FX9H 3QNZB 1CTNA 4FQPA 4H88H 4LHJB 2WQRA 4YL4A 5D1XC 4R2GC 1SFDA 2UZIH 4FEIA 4ZMPA 4C83B 4AMKH 1WA0X 2K8QA 2XICA 5FB8B 2Q3AA 4ZMWA 4AKOA 3GLEA 4XWGL 1TETL 3BPOB 4NENB 4A68A 1NIBA 1SJVA 1DE4A 3IJ7A 4MA8L 4XVJL 4AYFA 1PZ5B 4PGDA 1EFXD 4KY2A 4LSPL 4PCSA 1QA9A 4U1JA 4Y1AA 2CO6A 5AUMB 4ZFGH 4BFJA 4YQXH 3MRNB 4X7TA 3QT2A 2ESVE 2FQGA 2YPVL 1A7RL 4AKQA 4NBZB 5C09D 3N41F 4JO2L 3AQZA 3SE8L 4HUKB 1X4ZA 2NZ9D 3ILQD 1YMMA 4P5SA 2J6EH 3WO4C 3WGUB 3I9GL 4KMTL 4DGWC 5J1AA 5L0QC 3CMOL 5I6XC 1MFCL 4YGVB 5DO2C 5C0AB 3STLA 3VRIA 4L0PB 2NY4C 3S3PA 4TPRH 4HUVB 1BJ1J 1BSIA 1TTUA 1E6JH 3MBEA 1KPRB 5SX5K 3SKNB 4NCC1 2YS4A 1RZIB 2A83A 2ENSA 2Z93B 1U92A 2WNKA 2J71A 2WLKA 3FBKA 1RHHA 5CILL 2VLRA 4ZPTB 4LKCA 3WIIL 2UVEA 4BZ2A 4DVBB 4KNQA 4PCYA 4OZFG 5EBMA 3WUWB 1N0LB 2WOYA 5FO9B 1ZT7A 1VKXA