4AJVA

Structure of mouse zp-c domain of tgf-beta-receptor-3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
167
structure length
152
Chain Sequence
TFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFISPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRNKGSQKLPKCVTPDDACTTFTKPLAVVLQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords TRANSFORMING GROWTH FACTOR BETA RECEPTOR TYPE 3
publication title Identification of a Novel Tgf-Beta-Binding Site in the Zona Pellucida C-Terminal (Zp-C) Domain of Tgf-Beta-Receptor-3 (Tgfr-3).
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 152
sequence length 167
ec nomenclature
pdb deposition date 2012-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ajvA00
4AJVA 3NK4A 5BUPA 3QW9A 3NK3A
chains in the Genus database with same CATH superfamily
3OBAA 1D7FA 4U6XA 3PRZA 1ODUA 1B0GA 2F68X 4JQVA 3UTQA 1N2RB 4HJIA 3DO4A 3MLVH 3TTSA 2PLTA 5DRXB 1K8DB 2Y6SC 1F90H 4YR6A 5K39B 3SOBH 3FN3A 5CLYA 3BUBA 2WLNA 3RGVB 4MA7H 2DKMA 3QIBD 5LBSH 3W39B 3WIAA 3ZRFC 4J3OD 1UT1A 4FQ1L 1BBJA 5HTSA 2EZ0C 4NP9A 1ACZA 3L3JA 3K6DA 3HI6H 4F57H 4Z7WE 4OCWL 3C2AL 2FBJL 4NQXB 3DI2B 1MY5A 2E3VA 1U8QA 1QLRB 2Z31A 4JFFB 4MDIB 4WWKA 2BIPA 1OCRB 4A2FA 4Z7WA 2HKHH 2APTA 4HUKB 4NN5B 4E42B 5E2WL 3WO4B 1QP1A 1AD0B 3T1FA 4DAGL 5KBKA 1QTYT 2R4SH 3C5ZB 1IFHH 1NGQH 2IDUA 4NZUL 3MXWL 4DEUA 1FH5H 1FV1B 4L8CB 2SEBB 1VZIA 1T1WA 1CE6B 1CFVH 2W92A 1F13A 2FJHA 5AEAA 1J0HA 4BSWA 2BS71 1G9NH 4YOKA 5AAWA 3D9AH 4YDVA 4DT2A 1DBBL 4NO3A 2NUTA 1JXFA 1T1XB 1LO3L 2Z1KA 1R5WA 2AVGA 1J1OL 4Y7MA 3P4LA 2WNXA 5EOTB 3HNVH 1H3UA 3NJJA 5I28A 5E2TH 5D4QA 4PG2C 4J4PC 4NIKB 1GW0A 3B5TA 3MU3A 4MZ3A 3IGAB 3P73A 5BJTA 4NRYA 3WXWL 3OKDA 4KPHL 3SDXF 2CJSA 2FT7A 2V7HB 4UU9A 1L7TH 5KZCD 4HJEA 1Q9OB 2FNBA 2OK0L 2AKRB 2CJUH 4R7LA 4JQXA 5E7BA 3SBWC 2CXKA 5I75C 2XQYA 2BXZA 3RU8L 2XY1A 1RHHA 4JVPA 1RV6X 1KB9J 2ITCA 3GNML 1CFSB 4FQXA 3WMSA 3E2HC 2V3FA 2DQCL 1WWBX 2WYHA 3HA0A 3ALXA 4YPGB 4Z3FA 1KCRL 5F0JB 4FFWD 4GUPA 3PGCA 4D94A 1QWNA 1H5BB 1I9RL 4IEFA 3P9MA 4TLTA 2NW2A 3LIZL 4PG9A 3NSYA 4NPYA 3RWCA 1GPOH 4KZDH 4UQ3A 2BSBA 3QHZL 5FUOL 3PDOB 3KCWA 3MRGA 2ISDA 3IXAB 1IGTB 4G6MH 3QWRD 2A74A 3G9AB 4NUJB 4JLRB 2Y0SA 2OMVA 4D8OA 2WZAA 4QLWA 1CU4L 3RE0A 4AXWB 3FQXA 4KQ0A 4H0GA 4XOAA 3WEXA 5IBLD 3FB8A 2NY1B 2VDLH 3V4UL 3QJHB 4TTDC 3QQ9D 4M3JA 2J8UE 2HG5A 4ZAKB 3PNWA 4JRXB 1NCCH 1LEKB 2WSDA 2ZP0T 1M7DA 3LKPB 5GGTA 2JF1A 3MLVL 5T3XE 2J8UA 3E8UH 3SOBL 4CVUA 1BMGA 4FTDA 5DO2C 3FT0A 2VUKA 2VKXA 3I9IA 1NA8A 4MA7L 5LBSL 2BVOA 3MFFB 3NYKA 1S7RB 4I8DA 1RPQA 3BI9X 3ZQXA 4LB8A 4XBPA 3U46A 5J11B 2XG5A 1I7RA 1RZIA 2CDEA 1ZIBA 5MI0B 4F57L 2AQ3A 2DIBA 2R15A 4HHAA 4W1TA 1MCKA 3QUZC 4NQTA 3W81A 2HKHL 1OT4A 3JWDH 4H0IA 5FM4A 3L4CA 1U8JA 1XF3A 2OAAA 4PGEB 1IFHL 2NZ9C 1NGQL 4BGDA 1W0WB 1FH5L 2G5BA 1LQSR 1AHWB 2XKNA 5HDQH 3JV4B 4B9GA 3UGEA 1CFVL 4NNYA 2R1WA 1DVZA 4YSUA 2ZT9C 5E8NB 5CLTA 2TSBA 5H8DA 4PJDE 1G9NL 1PDKB 3LB6C 3D0VB 1T0MA 4ODHH 3IXTB 1NBZA 5D1XE 4BSVB 5EU6D 4TLUA 5KSAA 1SYSB 2EDFA 1M1XB 4PJDA 5H94B 4I18B 4N9GA 1R5IB 2CO7A 3HNVL 3RAJH 5D1XA 3SDDA 2HRGA 3KPQB 3NJGA 5E2TL 4KAQH 2HWZH 3WHXA 1VCAA 1K2DB 3ZE0F 1GKEA 1RFDH 4U6YB 5FUCE 1TXKA 2F7RA 3D39D 2RIKA 1BP3B 3Q6FB 3F8UB 3L9BA 1V05A 1BZ7B 2PYED 4HWNA 3DDGA 5CP7A 1L7TL 5D7LD 4MXQC 4ZTPH 1UWGH 2DWXA 4FJYA 4F27A 3EYVB 3MRLA 4KFZC 2CJUL 4P4KC 5E9DD 4YXKH 4AV5A 4DZ8B 5DHVB 2NNAA 3GMOB 4EIZC 1DBKL 3TURA 4JZNA 2VLJD 3DTUB 4IDJH 1F4YH 3F5WB 3S36H 3HUJE 4W9FC 2FHFA 5BVPH 4D0CB 1MCBA 2PWFA 5ETUA 3HUJA 2PNDA 4I0PD 3ECBA 1UXWB 1QLEH 1RUMH 4MAZA 3WE6B 3ISWA 3UEQA 3K2UH 3FUHA 1GPOL 2FX9H 3CZNA 1KC5L 4KZDL 4R7VA 1MFCH 2I5YH 5DRZA 3IJYA 4IRZH 4ZFOL 4HH8A 5IFHH 2O4EA 2XZQH 3EHBD 5KSVB 3RZCA 5C0BB 4HIXH 3ILEA 4G6ML 3V9CA 3RPIB 1S7WB 4PJXF 2XVLA 4R5TA 3H55A 1S7XA 4YSEA 4ZMPA 2KMWA 3SKOB 3L6FB 2Z4QA 3I6GB 2DIJA 2VDLL 3BAEH 3RVTD 2Y22A 4LSVL 1M56B 2DI9A 2VW4A 1KLFA 2J4WH 5SWZD 3FTVA 5EO1B 1S9VA 1NCCL 2AMUA 3L54A 5IEKA 3U6XS 4BK5A 1YMME 2DLEA 4Y19D 2X40A 3E8UL 1T3FB 4DK3A 3K71B 3RWFA 1AKJB 1YMMA 2WB7A 5DLLA 2EDEA 3FFDB 3FYIB 1JNLH 1SXCA 4U4BA 1LD9A 3WL9B 1EXHA 3ZDZE 4UIMB 2FEEI 2WB1A 2NR6D 3C60B 3UP6A 1FRGH 3BKMH 2CLVB 4AEEA 1PZ5A 4X0KA 5DMYA 3RFZA 3VAEA 3OKKA 5DEGB 1YY8B 1A9BB 3C5XA 1FGNH 2B5IB 5HDQL 3N41F 1XZWA 1P4LA 1S7SB 2QPDB 3WJJC 4A6YB 3LKNA 1HHHB 1G6RA 4R96B 1AXSB 4ODHL 4BELD 4M6OH 4Z78A 1E27B 5B7MA 1WCBA 1VAHA 4X2UA 4KKCD 1YDPB 1L9PA 1KJ3H 2MCMA 3QHFH 2EEAA 3RAJL 3WHE0 4D0BA 4AQ1A 2HP4A 4KAQL 2HWZL 2ADGA 2BVPB 3B34A 1XXDC 1MCLA 3L4WA 4X8JA 4KJPC 5HDOA 2WBJB 2KKQA 3QIUB 1RFDL 1A4AA 4DP7X 4CU6A 3DXAB 3M1BB 3QNYB 5AALA 2IV8A 2ZP9A 4RSVA 4ZTPL 2EDHA 4FXTA 1M7IA 5I66A 1UWGL 4R9HA 4G7VH 1KCKA 4Z5RA 4LEXH 4XVOA 4YXKL 2X0WA 3UDWA 3FS9A 5IJBC 3EYUH 3RP1A 2Z7ZA 1EERB 1HX0A 4IDJL 1F4YL 5DQ9A 3L16A 3S36L 4APXB 2EICA 5BVPL 2A6IA 1IAKA 5DRNA 3W5NA 2G30A 1GY1A 3FFCD 4IRSA 3ULUD 5HDLA 3DECA 1EZLA 2YD6A 5D5MB 3TH2T 5JIMA 3MJ7B 1RUML 5E5MA 3DGGB 3SYPA 4M62H 3K2UL 2OJZH 3QUMH 2FX9L 4H26B 3AGVA 1J9SA 1FAIH 2I5YL 4XMKH 4IRZL 1U21A 5IFHL 2XZQL 2IXQB 4HIXL 5FF6B 1GYWA 1XIWA 2AQPA 4L5FH 3TJEH 4QYOB 1AP2B 4M4RB 3SO3C 3UTSD 3U25A 5GRUH 1FHNA 3QCVH 5CFHA 4NAJA 3FJTA 1F97A 1P7QA 3BAEL 3M07A 2Y5TA 3GSUA 3HAEG 2IDSA 1AI1H 2J4WL 3D50A 3AS2A 4L3ED 3PWLB 1QLFB 1HNYA 4LLQB 5ACZB 2CE6A 1E9PB 2EE3A 3B3BA 5C86A 4PRBA 3ZMRA 1BCIA 1F8TH 3PIQA 4WENB 3NJIA 1QFWM 3H9SB 4RAVA 1U3ZA 1WH0A 2G3ZA 3QQ4B 3IMUA 4HMDA 4QXUH 1JNLL 1GYCA 3DWTA 4TUJB 1HSBB 3O9WB 1SHSA 1ZAGA 4Y4HC 3FRPG 2DWTA 2X0VA 4Y0GA 4XB8A 5EPMA 1KYFA 4ODWB 1C08B 3EYFA 1ZWIB 4FG6D 1JF1A 3NRQA 4GI6A 3LKRB 1FRGL 3BKML 1QHOA 1M6UA 1Q1PA 3HTLX 4FQPA 4P57A 3QXDB 2H32H 4TL4A 3B7SA 3SY0A 3KPMA 1FGNL 3NIFB 3TBWB 5J12C 5F1SA 4YHIA 3OLEA 4IJ3C 3D6GA 3BKJH 3HEIB 1Y1DA 2VL5B 4NFDA 1AMYA 4UM9A 1KCUL 3WAJA 1ZD6A 3FTUA 2CJTA 1CDUA 2J43A 4KTEH 4M6OL 3IDXH 1IM3B 4IIQA 4TSAH 5F9OH 1NCOA 1KJ3L 3EYOB 2C9SA 3UJIL 4GRMA 2BSDA 4G42B 1PZUB 2VDMB 4YL9A 1BBDL 2F53B 3VVVA 5AVYB 1EFXB 3NDZE 4L8SC 5IG7B 1ND0B 3ZE0E 4F93B 2YKKA 2WW8A 4CC0A 4U1NB 3L4VA 3M1OA 5C0IB 5CUSH 4PI0A 2NY3D 4G7VL 1G4RA 2CR6A 4X6DB 1AZRA 2C3GA 2VC2B 3OAZH 4LEXL 1MCSA 3VGGA 5LNGA 1MQ8A 2HTKC 3EYUL 4HFWB 3KE0A 4XN1A 5FGCB 3AS1A 1GOFA 2FQGA 3FTGB 4KFMA 2AEOA 1E2ZA 3PPSA 2XN1A 1ETB1 1TETH 2H3KA 2BK8A 5HYSB 1JG9A 5INDB 2IJ0C 3KPLB 3WEOA 1KENH 2BCKB 2D9QB 2DYPD 2KLSA 3GMLA 3IE9A 1Z3RA 4M62L 3B9EA 2OJZL 3QUML 2Q3ZA 3VUAA 1A1MA 1FVCA 3VD7A 1FAIL 1U8NB 4XMKL 2W9EH 4HKJB 4NZJA 5FCUH 4ZMWA 2OJEB 4IGBD 2O30A 4Q4EA 5AZ2H 1MI5B 1SMDA 4L5FL 3TJEL 2VDOH 3H3PH 4AZ8A 1S7TB 5CWSB 4Z7QE 5GRUL 4K3GA 1X5XA 4PJXE 1G94A 2PCFB 5I6MA 4HJJH 4N0CC 4XBGA 3F04A 1T1ZA 4PJXA 3ZDWA 3L3IB 1UASA 3LZOA 3MTXA 4ELKB 1JDCA 5F7LB 1DQDH 4J4PA 1ZGLB 3X1FA 2VISB 3OM3B 3NJXA 1P5UB 1F8TL 3IJ8A 2NYZA 4FNSA 3CBRA 5AYUH 3L9RB 3T0BA 2YGQA 3CFCH 1E0OB 4EDWL 4YHYC 5JA9A 2HZHA 4QXUL 3KCPB 4MJ5B 3ES6B 3Q8AA 4P2RB 3N40F 2FO4A 3B3IA 5E4OA 2DLTA 4PBXA 3ARVA 4QRRD 5CGYD 4LLWB 4I85A 2C34A 4MKMA 5FYJH 1MFVA 4XCNB 4J3WA 2VR6A 2JB6B 1TKWA 2APBA 1TNNA 3WJLC 2HA1A 1ZTXH 4BFRA 5BRZE 3BKJL 2QL1A 3AU1A 4WJ5A 1QQDB 1BGXL 4W4OA 4E5XB 5BRZA 3HB3C 3MLPA 1GCYA 4B0MB 4KTEL 3IDXL 2XJLA 4TSAL 1IRAY 1KIQB 3PHQB 5F9OL 3KJ6H 2XFXA 2V5YA 1CXHA 1T7WA 5DUPL 4GFXA 4NUPA 3SKMA 5FB8A 3OKLB 4F37K 4FKKA 1HQ4B 3T1WA 4FMFA 1LLAA 2YPLE 3F65A 4NDMA 1JYWA 2Q86A 3T8XB 4E9VA 1HWHB 2YPLA 4V33A 4LOVA 3MV7D 4WK0B 5DVLA 4F8TA 5IKCB 5CUSL 2WPGA 5D1QD 3TV8A 2L8AA 2QKIB 1MCWW 4PGZA 1THCA 4XX1E 3FU7B 4K5NA 4P46B 1OVZA 4L8BA 1XGZA 1KBWA 3ABZA 3M8OL 2ID5A 2VDNB 3FK3A 4B95C 4BFGA 2GSMB 4LFHG 1B90A 2EAEA 4DGUA 2J6EA 1IAOA 3VXNB 3VM7A 1YNKH 4JO2H 3QUZA 1KENL 3RJQB 1OSEA 2L7JA 2YUWA 3ZO0A 1SEQH 2WUCH 2Z7YA 1Q1JH 3W9DB 3MLTA 3DTXB 4PRPD 3RWDB 5JMOC 4J6RL 5GGSA 3F7PC 2W9EL 1CFTB 5FCUL 1BVNT 4GBXD 3MRNA 4X7TA 3I6KB 5AZ2L 5JR1H 3P9WB 5I8EB 1NICA 2VDOL 1HNFA 3H3PL 3MKGA 4LSDA 1XT5A 1F58H 1PLAA 4PH8A 4UDTA 3KPSB 2ENSA 5E5UB 1ANUA 1BQKA 3VGDA 2L0DA 1KYOK 1MG2C 5GJTH 5I6OA 3EJCA 3FSWA 3HRZB 3LQZB 3QUYD 5D7IF 1YA5A 3KJ4B 1RJYA 1T22A 5E1IA 4H88H 1SLUA 1DQDL 2MCPH 4P4RB 3V0VB 2GSGA 4N3TA 4DKFH 3V4VA 2GJ6B 1G84A 1BW8A 1U3NA 4XMVA 2VLRB 5AYUL 5F3HA 2YRPA 3CFCL 3L4ZA 1OTTC 1OKEA 1TPXC 2IANE 2GG1A 4NT6A 5DVMA 2X3AA 1JP5A 3L4UA 4DP9X 3LDBB 3ARGB 5D72H 5HYQA 2Q2LA 1OF2B 3MCLH 1X6LA 4P4KA 2IANA 5C08E 1XHHA 1ZV2A 4WLCA 2F74B 2ZYRA 1YEDA 5DJ8A 2ADJA 3CZEA 5H35B 1A1NA 4JHAH 4L1HA 5L6YH 5JW5A 5HDBB 3CPLA 4QOKD 3OZ9H 5FYJL 3GMMA 3MRRA 4WI3A 4PIRF 5DC4B 1KY7A 1S9WB 4LAQH 2BP8B 5A2BA 2VB5A 4LK4A 5CGMA 1TTUA 3PWVA 3VH8A 2NY2B 5HGBB 4CNIB 3UBFA 1F86A 4UUJB 4JRWA 3I9GH 4U6HA 2GHZA 4FQIH 2J8HA 3THMH 1QBBA 5CEZH 3STLB 3WS3B 4HK0A 3D8MA 1IJ9A 3FF7A 4QHNB 1BEYH 1X9QA 1MRCL 3V0FA 4FAAB 3KJ6L 1HL8A 2K6WA 3OQ3B 1TVBA 5HXMA 4GOSA 1G7MA 1UA7A 4DP5X 4NWTL 4YHKH 3OAUH 3T2OA 4H5SA 2NDFA 1FDLH 2P3YA 1KIRA 4NBXB 2WV3A 3H0TB 3GZPA 1Y7VA 4Z7OF 3KGUA 3P3YA 1E9OB 3QEUB 4LCYA 5AVXB 3S48A 5D70H 2BOCA 3B9KB 5F93C 5I0DA 4X4YA 4O00A 4LSPH 1XB8A 2AXHA 5HHNA 5DU7A 1FC2D 4E36A 2UUDH 4L0YA 3FQNA 1FNEA 5C0CB 4KK6D 4DPCX 5E6UB 5IP4A 4ANWA 3KGRA 1I3GH 3DVGB 1I9JH 4U1GC 3SODB 3D4GA 1IU1A 4WKZB 1XD0A 2CDFA 3MRKB 3SJVE 2VDPB 1YNKL 3BVUA 4ZPVA 1YYMH 1CXKA 1HOEA 4JO8A 5LCVA 1ZK9A 2WNKA 4CRPA 3P0VL 1SEQL 2WUCL 4ZRGA 1Q1JL 3SJVA 5C8JB 1ZT1A 1O9WA 2FWSA 3BVVA 4H25B 4KMTH 4G6JH 4DTGH 1MCQA 1PEWA 3T6QC 4GUQA 4G9DB 1DDHB 4BXSV 1CDJA 1J0KA 1KG0B 2YD5A 3KLDA 4OLUH 2PXYC 3CDGA 4PTUA 1QNZH 1XCTA 1RZ8B 4MMZB 3FZUC 1SJVA 4ELME 5JR1L 1CQKA 1GKOA 2C9UA 3NCJH 1R3HB 4JG5A 1XH1A 4P3DB 1IGCH 1F58L 3WJJA 5EU7C 4AYEC 4ELMA 5HBBA 1L5GB 2FEEL 4JQIH 5T5NF 5B8CC 4PM1A 1FBIH 1GC1H 2ESVD 1E5YA 5PAZA 4PCYA 4QF1B 2D3LA 1TFPA 1J8HE 1V3JA 2AXGA 3SPHA 3KLHD 2EEXA 4HUWB 1J9TA 4MJ6A 5GJTL 3MPCA 2YD3A 1J11A 3OQRA 4I87A 2G3NA 4XO3A 4H88L 4PW9A 5KEZA 4MAYD 2D7NA 2MCPL 4HKBB 3GMPB 3VXPA 3ARTA 4DKFL 1K5NA 2BMKB 4G3YH 5DJ2A 3W0WE 2ODIA 3IAPA 3UAJC 2EO1A 3PF2A 2KZKA 4PJGB 3W0WA 4DKAA 1S9YA 2DQHL 3B2PA 2D7QA 5D72L 1JF5A 1PD6A 2J71A 5DHYB 3MCLL 2APVA 4PVMA 2C4FU 5CAYB 4F58H 3FONA 4DVBA 4W9LC 3BHBA 4IMLB 4N2FA 2ZUXA 4JHAL 1IKNC 5L6YL 2FZ3B 5J3HC 1Z9LA 1ZIAA 2ZUYA 2QADB 3ECQA 3JUZA 3OZ9L 5SX5H 4PGCB 5CLZA 4LAQL 1Z3GH 2PCPA 2Y2TA 5DO2D 2EDRA 3HJEA 2XN9D 3I6SA 3MC0A 3CDFA 1V54B 1M71A 3D0AA 1FFPB 4FQQA 2QMKA 4XCCH 1ZA3B 4BE6A 3I9GL 4FP8H 4UBDD 4FQIL 5CEZL 3A4FA 3OG6B 3THML 1UATA 2GBTA 4PP1D 4F2MB 2BIHA 4NQEE 4X9BA 2AZUA 4ZMQA 1BEYL 4LOUC 5DHDA 2ZICA 4J23A 4NQEA 3T4AA 2D3VA 2FLMA 4HUUA 4IKKA 4HJSA 4YHKL 1YEEH 2RFXA 5F1KC 2BVUA 3WY3A 3KWWB 4JMNA 2CD0A 1FDLL 1MWAA 3HFMH 2YAEA 5FFGA 2HUEA 4JRLA 4A1RA 4YSQA 3VMOA 4HWZB 3N1QC 2BNQE 2OYMA 3GBMH 1X5ZA 4LSPL 4ALAH 5IV2A 4A2DA 1K6QL 3W9EB 3IKCA 4F8PA 3O8XB 2Q7NA 4Q14A 3RILA 2BNQA 2BOBA 3GB7B 4PJBB 4PSPA 4YC2B 4LPWA 3F6IA 4GT7A 2VUYA 1AGDA 4KNUA 1I9JL 5CD3A 3G08A 1UD4A 2IDQA 4Y4HA 2C7FA 4XPAH 1EAQA 2A6DA 4GS7C 4OLXL 1YYML 3HPJB 5BMFH 1FL5A 3IAQA 1BQHA 1IC4H 1I1YA 1N8OE 5E94B 4POYA 2F7OA 2MKLC 4KMTL 4CMHC 3LH9A 4G6JL 4DTGL 1SVCP 2EUXA 4K7FA 4X9GA 1NDGA 1WG3A 4HETA 4OLUL 5CR1A 1A64A 1IL1A 2F54E 5A6LA 1DUZB 2BRRH 1TZIB 3V4PA 1JNNH 2D0GA 5TGBA 3DX6B 3NCJL 2F54A 4JQIL 4PEEA 1FBIL 1GC1L 3N42F 4LLDA 4TOYH 4W81A 5C2UB 5I76B 5T1MA 3TZVC 2X2IA 5AYQA 1U41A 2EDLA 4HALA 3VU1A 2B4CH 1AIFB 5JQIB 3Q8CA 2ARJQ 4N2GA 3ABKB 5DHVH 5A2IH 1EEZA 5D7IE 4AQ8C 4W9ZA 4NM8H 5AKTA 4G3YL 2I9TB 5E6IA 3B2DC 4HKZB 3O3AA 5D7IA 3SE6A 1JZIA 5HYJA 2Y1VA 2WXNA 3IJ9A 4N0UE 2PO6C 4QRPD 5IT2H 5JORA 2FSEB 1OXYA 5DT1H 1UFUA 2A6JA 2G2NA 3B7UX 3MX0A 5EEWA 1W91A 4N0UA 4FFYH 2DZEA 3PP3H 5IB1A 1FJ1B 2BVEA 1QA9B 4F58L 1SY6H 1PPIA 4OGYH 1D5RA 4E41B 3P4NA 4ZMZA 1CC3A 4W9KC 2IQAB 1DCEA 4HLJA 1KY6A 1Z3GL 3ULSA 4HCGA 1NPJA 4N87A 3O6FD 2BHYA 2QQQA 2VMFA 4Y5XB 4JFWA 4Q7DA 3MROA 4XCCL 3HG1B 4FP8L 2G0KA 2EC9U 1OCOB 2WQVA 4KI5D 3TO4D 4XP1H 4ENEC 4J3UA 3WGVB 2ATPB 1CTOA 1QI3A 3HHMA 4RDQG 3NABL 3GPSA 3II3A 4MB5A 2EH7H 1G6VK 1SGKA 1INEH 3T0DA 1YEEL 3WTXA 3SDAB 4TPRH 3HFML 3P40A 2WLMA 5IW1B 1RJLA 1SUHA 3H56A 4KX9A 1FZMB 1TJIH 2F1BA 3QQ3B 4MS6A 1Q9KB 4Z7OE 1U8HA 4FULA 4BFFA 1FZJA 1HWGB 3VM5A 3TF4A 3DX1A 1WHPA 3ELQA 5GS0H 2WO3B 1IC7H 2ARJB 4HDIA 3FCSB 3UADA 3VWJC 2XWCA 3I50H 4J8QA 1VACA 2HN7B 1XF4B 2F8OA 3S37H 4JFDD 4L4TE 1ACYH 3BYYA 3KEHA 3MLUH 4KQ3H 2A1WH 2IMMA 2YK1H 4KMQA 5D7JA 4XPAL 1H15A 2OSXA 4KJPD 3N1FC 1U0QA 1W8OA 2GBUA 4L4TA 4N0YH 1R4XA 5BMFL 3LV3A 1HI6B 4ZT1A 1COBA 1IC4L 4K0OA 3S36X 2WMPB 2VMCA 4PRIE 5GGUB 2XKUA 1U8OA 4X6FB 4NNPH 1NCIA 4IRJC 5F88B 2OYLA 3S9DB 2DH3A 5GGRA 3VDBA 1FFTB 2XWBA 4PRIA 3WJLA 2OXHB 1QBML 1TCMA 2BRRL 3UBXA 1HXYA 2KL6A 4BZ2H 2R23A 1I9EA 3JWNG 2P7TA 3AXHA 3L13A 3Q8BA 5DYOA 2WO4A 2WSPA 4K73A 3MLZH 5EF3A 4KXAA 2VNCA 4TOYL 3GMNB 1HSAB 3C6LA 5DUJA 2EDWA 3GTNA 1P0SE 2EDKA 3AQDA 2X4RB 4OUUB 3ET9F 3KS0J 2B4CL 4Z77A 4PRHB 2KPNA 4Z7NB 4F7EA 2ICCA 2GCYB 3DX2A 1DN0B 4MQ7A 5ERWA 4D8PB 1U42A 4NM8L 4ONOA 5GPRA 3ULVD 5D9SB 1RAMA 1ZHNB 1JNJA 1RKRA 2DQMA 4JFZH 3LMJH 4QNPF 5IT2L 5K1VA 3G5YA 1IGIL 1XH0A 2X41A 2ZZUT 3CIQA 3BDBA 5DT1L 2H6PB 2ZWKA 4S1RH 2ZWSA 4FFYL 5I9QC 2CKNA 4AM0Q 5KS9E 4LHQB 2YRZA 3CHRA 3GKWH 4X5WA 4OGYL 3BLPX 4JDEA 1ODAA 3D18A 3PL6C 4IHOB 2E7LC 1NCBH 4OZ4B 4GH7B 5A2LH 5KS9A 1TZOA 1PW3A 1H9DA 3QJVB 1EGJA 4U3CA 3L9EA 5GZOA 3Q1SH 4ATWA 2E7HA 6PAZA 4UQIM 3RDTD 4N9OB 1VFAB 2ICEC 4GKSA 4I4WB 4XNMA 4DGWC 1OGTB 4DVRH 2X4NB 3WCYA 4UMGA 1IAIL 2WM0A 4U1MA 1TYJA 3D4YA 4W6XB 5HYSG 1XGPB 2YZ8A 4XP1L 1KXTA 4MRBA 1ZGLP 2F61A 4FFTA 1G0XA 4AIEA 1MLBB 4JBSA 4WW2C 1X7SA 1JCKA 1JVKA 1S78C 2TRHA 3QZWB 4TVPE 5ESAB 3T09A 2EH7L 2E7DA 1INEL 3KYAA 5HPOA 4AK1A 3RX5A 5C07E 2C1PB 4PWIA 4X4KA 1ES0B 4RZCA 4WW1A 3T6XA 3NCFB 5L4IA 5E03A 4MS8D 1NMCB 3D2UD 3MRMB 3NZUA 1YEHH 4LP5A 4N8CH 4PTTB 5C07A 4BFIB 4EN2A 5JPNC 2DRUA 3IDMA 5D1ZC 3KDMA 2OBGA 3G04A 1N3NA 1IC7L 2B15A 2JMRA 3TNMB 1JPGA 2OZ4H 2RQ8A 3L2LA 5TDNA 5BQ7A 4LCWD 5EN2B 4K8RD 1RZKH 4EF3A 4EZMA 3S37L 4FI8A 4C83A 2XWEA 1ACYL 3MLUL 1V3LA 4J6IA 2A1WL 2WTRA 2YK1L 3A4EA 2H2PC 4PJCB 3SYCA 4JFQB 3F6JA 4TULH 2EVIA 3RTQB 4ONHB 1R17A 1OB1A 1QSZA 2XNAB 2LLGA 1YNLH 3HC0A 3GSWB 4NNPL 1PZCA 4PJ6A 2P8MB 3TVMC 4AM0B 5AWNH 4NN6C 3I3BA 2IDTA 5ITFB 3B5GA 1VPOH 2ZOLB 4RH4A 2E5EA 3VYPA 2HTKD 3ZYIA 1B9ZA 1DJYA 4HAFA 4XNXH 4PJ5D 4AL8H 5FUZH 2CGRH 4BZ2L 1BQRA 4K94H 2VDMH 2P45B 1OAZH 3V5DB 1T6WA 4Z3EA 2OS7A 3QNZA 3AU0A 3ETSA 1QUPA 4LL4A 3WTSA 3RKDD 3D3VE 3EDKA 3O2DH 2VLLB 2AABH 1RP8A 3ZE1F 5BV7B 3D3VA 3U2IA 1WD9A 4B9JA 3HS0B 4E5XG 1LEGB 3CD4A 4QHMB 4YHLH 2CRIA 5JXEA 4PWHA 5LDUA 1ORSA 1SOKA 3F64A 2A0LD 4JFZL 3LMJL 1BG9A 3QWOA 2G9HA 4OZHE 5TE6H 1K8IB 1JPFB 3CUPB 3P4OB 1EZUA 4S1RL 3MRPB 1VCBC 1YC8A 4PRDA 3RWHA 4OZHA 5DJZA 5L8KB 2OMXA 4YLQT 3V6BR 4PBDA 4HG4J 4K71C 2NXZB 2VABA 5F8QC 4LLUA 1NCBL 1TITA 5B38A 3C09C 5G5DA 4TUOB 4KJQD 3NSXA 5MP6H 5F3BB 1S3RA 3Q1SL 5JIDA 1MCWM 1JWSA 4AYMC 1CG9B 3SGKC 1JZ6A 3MRBB 2Z65C 3ME0A 3GUTA 1M05B 4NFBA 1G0YR 1UZ8B 4O2EA 5JHDD 3E8VA 4X6BA 4L4VE 4MD0A 2A2QT 2WLLB 2VR9A 1KXVA 4YDLC 1FVEA 5E0QA 3L5JA 4L4VA 5EO9B 5EU7E 4EN3B 1Y0LB 1PY4A 3B4NA 1RIUL 1E4XL 3NJKA 1UC6A 3TN0C 4LF3A 5F9JA 4U6XB 1V10A 3UTQB 4WO4C 3QWRA 2K7PA 4BCXA 5I15L 1S7QA 3QR1A 5TDPB 2Y2WA 3KHQA 4YR6B 5EZLA 3U0TA 3MCYA 1T2QH 1XGQA 5EEZA 3DHPA 4YLBA 1KB5H 4LGPB 5A3ID 3S3BB 4QHUA 3GTTA 1A6TA 3AB0B 1YEHL 1BBJB 1MHHB 3JTBA 4N8CL 2F8VA 1WT5C 4FZ8H 4HJUA 2E7MA 2X87A 2RR3A 1OGSA 1OV8A 2A9NH 5HHME 2B16A 4MA1B 2Z31B 1U8QB 4WWKB 1G9MC 3UAJA 3I75A 1EIBA 4ZS7H 5G2NA 4Z7WB 1RZKL 5D4JA 3QDGE 2QGDA 1IBHA 3T1FB 1M3JA 3EJRA 5IROD 1AZZC 2OL3H 3QDGA 2VR4A 2WZPA 5FA3A 4G8FA 2G3XA 1IKNA 3TASA 1T1WB 2NY4C 3APMA 3FO2A 3SGJC 1YNLL 5DZNA 2FJHB 1ECZA 5AWNL 1VPOL 3MUZ1 3P11H 4YDVB 4NO3B 4TKWA 1KYUA 1R5WB 4P9HC 4WW2F 4XNXL 4AL8L 1ITBB 5FUZL 2CGRL 4OD1H 1E8XA 4KK9C 5EZJA 4K94L 2VDML 4HLZG 3T3PF 1OAZL 3TFKD 3KL0A 3BPOB 1NGPH 2CGYA 4FYSA 1MDAA 1NAMA 3EJYC 4Q52A 3WY1A 3LX9A 3O2DL 4FTVD 2AABL 2CZNA 3HZMA 4NRYB 1TO5A 3OKDB 4M8QA 3EGXB 5LVEA 1JYVA 3QEGH 4UU9B 5DWUH 3TYFB 1WAAF 3IK2A 2VC2L 5E24E 1HHJA 3E6FB 1T7YA 3HLAA 3VA6A 4YHLL 1ETZA 4WFFD 2WD0A 1AHKA 1I8UA 2EDXA 3UOAB 3MJWA 5SWSE 3DUSA 3N3EA 5TE6L 3HKZA 2XI9A 1SYVB 5SWSA 4FQXB 2A99A 2ITCB 4GP8B 4HC1H 1YECH 4QNPE 1QSFD 3RI5F 1JV2B 5I5IA 1G7QA 2RALA 4GUPB 3PGCB 3P3UA 4IEFB 2JQMA 4YBQC 3P9MB 3VFMA 2NW2B 4PG9B 4P2QE 1JZ8A 4NPYB 2YQ2A 3RWCB 4YO0B 2NYKA 4R4NC 3LEVH 4UQ3B 5MP6L 1BYNA 2HYMA 1DQLL 2IBZX 4P2QA 4X50A 5E4IA 2EKSB 3MRGB 3K5RA 4NZTH 5L8JB 3BDYH 1OTTD 4FZEH 5FK9B 2OMVB 5A2FA 2EE6A 1DR9A 4JB9H 3FQXB 3LIUA 4JY6A 4N2OA 4ANXA 3WEXB 3FB8B 4QT5A 3F00A 3OWRA 4P06A 2J1YA 3FSOA 3BE1H 1RZGA 3CHOA 1A7PH 2HG5B 3EJTA 1M7DB 3PXLA 3NQIA 3DUHA 2J8UB 4M8VA 2UVFA 3TZVA 4C56D 1T2QL 5DK3A 3VW3H 1IBBA 1U30A 2BVOB 2XIBA 3N9GH 3APCA 4PJAF 5CHNA 4XBPB 2DDQL 3U46B 2XG5B 1UZGA 1WZAA 3FCGA 4FZ8L 1I7RB 2WVTA 5AG9A 1RZIB 2CDEB 1PJWA 1FN4A 4MRCA 4AQ8A 4I88A 4YHPB 4HHAB 2A9NL 4YFDB 3PWUA 4HLZH 1XEUA 4JO1H 5DF0A 4WI5A 4ZS7L 5C71A 2PO6A 1QPKA 3DVNB 1AGBB 1BQLH 4GW5A 4KRPC 1U8JB 1QUNA 1XF3B 4FS0A 4PJHF 1CFBA 3MV8E 2OL3L 4YHML 2G5BB 2XKNB 3MV8A 5F7WC 2GBAA 5DVPA 1CUOA 4NNYB 2R1WB 5F0MB 4LEBA 1D9KD 1TYEB 1QVOA 5GRZA 2DV6A 3N44F 2DYRB 4YIQA 2QLVB 3IKKA 1T0MB 3Q5OA 2CBPA 5D96C 3GDCA 2JTYA 4CKQA 3O3DA 5KSAB 3ZKXC 4OD1L 4N9GB 2CO7B 4RFNB 5D1XB 3SDDB 4DGIH 4A7QA 2IFGA 4ZXBD 1NGPL 3WHXB 2QFRA 3QQNA 3R7QA 4H1LA 2FJUB 2ZXAA 3WELA 3CU1A 5FW7A 1BF5A 1PL3A 4G43A 4Z3JA 5J1TC 4Y2DC 5CP7B 2ZG3A 1T0NA 3AUVA 4G8AC 3QEGL 2CM5A 1AZBA 1EUUA 4WGWB 3DOIA 5DWUL 4DKEH 1RH8A 2IDFA 3KYMA 1I3VA 3VXMB 3HR5A 5LQBH 3MRLB 1MCRA 2PXYD 4ORGA 3ZE1E 4ABWA 3VD4A 4LESA 3EUUA 4JZNB 1AR1C 1HQRA 4A7SA 4JHBA 3S0PA 4C4UA 2OJ1A 4G5AA 4WF7A 2AQ2A 5JHLH 1BV8A 1YECL 4W9JC 3EXJA 3LRLA 5ETUB 3N85H 2VDKB 4MSWB 1TO4A 3ECBB 1AYRA 3WTUA 1A6WH 1A5FH 3CVHB 1EDQA 3QG7H 2PP9A 3SKNB 4QMEA 2PCYA 3LEVL 4OU3A 4MXVF 2ZYSA 3MUUA 4RWYH 1RU9H 4U6VH 2ZJSH 1KBBA 3IJYB 4K07A 5DRZB 1YVLA 2QSCH 4G8GD 4JDVA 3RZCB 1XAKA 3BDYL 4J7RA 3F7LA 5GJSL 3E1F1 4FZEL 3T9WA 3MXVH 4QRBA 3GXUB 1G9EA 4Y9CA 1QABA 1HHKA 4N2HA 1OO2A 4PHZA 3IU3A 3ZYJA 2WXFA 2Z4QB 3UL4A 4PHXA 4HXBH 2C3XA 4GG6E 3BE1L 2BY2A 2Z0UA 4ZMXA 3FQYA 3O4LE 1BD2E 1GJWA 1KLFB 1A7PL 4D9LH 1WFMA 5FA4A 1S9VB 5IEKB 3LTVA 4GG6A 2IAMD 4M7LT 4EQ3A 3O4LA 1BD2A 3JV5A 4BIKA 4EKXA 4AW7A 3AM8C 4PJ7E 5GHWH 3VW3L 1YMMB 3N9GL 5ABZA 1BLNA 2QFPA 4PJ7A 1XXFC 3VDCA 3FOLA 4HOWA 3P77B 2H0JA 2CIIA 4WFHD 4L8DA 3U7AA 3QXAA 4JO1L 2CRYA 2IO5A 3WY2A 5I6KA 3ZDZB 1BQLL 1PZ5B 3RNQB 1D6EA 2HRLA 1HINH 2AJZA 5TD4A 5DK2A 3RFZB 4QRQA 3GGWA 1Q8MA 3OKKB 4ZSOE 3BP5A 15C8H 3P2DA 4LPCA 4WFGE 4I0KA 1P9MC 4X6CF 1MFNA 1F4WH 1P4LB 2A83A 3PL6A 4ZSOA 5HVWA 1WK0A 5KTEH 2E6JA 2ZX6A 3LKNB 4X5RA 3LRHA 4CVWA 3MLYH 4Z78B 3BSGA 2ICEA 1WCBB 4DERA 3HE7C 4S1DC 2YAQA 5E8EA 4D0BB 4AQ1B 4IW4C 2ADGB 1XR8A 5CZRA 2IOMA 2WC7A 4X8JB 4KUCD 3E7JA 1EJ6A 3NJVA 1XB3A 4MDRA 3WD5H 1UJ3B 5D2NE 4XMLH 2BSEA 3DPBA 4DKEL 5LQBL 1M7IB 4GJTB 5I66B 3QFDA 2CO3A 1RQ5A 1ZTMA 2DW5A 5D2NA 4Z5RB 3B8SA 1OANA 1WAAE 2EDQA 5HGDA 3QI9C 3TH3T 3U48A 3TEWA 2Q20A 5C09E 4M9OA 4PLKD 5DC9B 5CCKH 1B6DA 1NEZA 2YUZA 1WAAA 4JM4L 1GZHC 3QEQD 2Y7LA 4AENA 2A6IB 1IAKB 5DRNB 5C09A 5MEQA 5E08H 4EZJA 1EZVY 1FLRH 1T89C 4IRSB 3WSQL 3N85L 4F15B 2QGCA 1EPFA 5E5MB 3JQOB 1A6WL 1A5FL 3QG7L 2UZIH 3GKZA 4P23A 3MLXH 2VKWA 2X9YA 3ARFC 2R2BA 3CQPA 4AE0A 4RWYL 1RU9L 3VXUD 3ARDA 2ZJSL 1UM6H 2AJYH 4U6VL 2QSCL 3WEBA 1U3HC 3CMOH 4EIBA 2I9LA 4P2OD 1XIWB 3QO1A 3ZYZA 1IBZA 3MXVL 3TVMA 4PY8J 2ZG2A 2GUOA 4NM4H 4Y4KB 2ENQA 1CICD 4LCUA 4ERSH 2Y5TB 4HXBL 1BZ9A 4DP1X 4D9LL 3VJ6A 3V0GA 2NXYC 1QI4A 1NPNA 3K6SB 4ZUSB 4PRBB 2DIAA 3FT2B 4OM0H 4OZGE 2DQUH 5ESVB 2Q7AA 3ZZ1A 3PIQB 5DEJA 5GHWL 3ESNA 2OKMA 3EGSA 4RAVB 4OZGA 5FECB 3NIDF 1YSOA 2NY0C 3KWVA 5I0YA 4PJAE 1G1CA 3PHSA 1GOHA 5EPMB 1FNFA 3EYFB 4FNQA 3TCXA 1SMAA 4PJAA 5LKNA 2J5LC 4NUQA 3DOSA 2B14A 2Y1ZA 1EZVX 4PJFF 3PABA 3CBKB 3U36A 1HINL 5DDHA 3WE1A 1UA6H 4P57B 4QXGH 4OF6A 4FKEA 3EJZD 4OFIA 15C8L 3SY0B 3KPMB 4PWJA 5MERA 1I3RA 3BAKA 4LO9A 2YN5A 1F4WL 3ARBD 4YHIB 3LD8B 5JUEH 3P54A 5F1NA 1MELA 4UM9B 5DZVA 4B9CA 3QR0A 2OPCA 3K0YA 2O72A 2LLNA 1TZHA 2H47C 3MLYL 3PP4H 4IIQB 4UOJA 2FE0A 3VWJD 1JGLH 4GRMB 2H0FA 1NKGA 4FLQA 5T1DH 1BA9A 1OTUD 4NO0D 5EZOH 1XH3A 3H2PA 4H8QA 1YJDL 4FF9A 3LPPA 3WD5L 3VGAC 3TN0A 2Z92A 1G5GA 2W07A 4WGKA 4XMLL 4NN7C 3ILDA 2XX0A 4WTZA 1LYQA 5E56A 3ZE0B 4UTAL 4LLVA 3MNVB 4R7DA 3M1CA 1TT6A 3QZWG 3DKHA 3F05A 1TENA 4JCLA 3LZNA 3QP3A 1WT5A 5E08L 3HI5L 5C6WH 3PGFH 2WOBA 2OXGA 2XXMB 4E9SA 5K9QG 1U91A 3FTXA 2AAVA 2IQ9H 3GMLB 1F02I 3BQUD 2UZIL 3MLXL 4MNGA 5DEZA 4KX8A 1A1MB 1FVCB 4HSQA 7CGTA 3BP4A 1UM6L 2AJYL 3WO4C 1SHXA 1UXSA 4MXVE 3CMOL 4CSPA 4S2SA 3TA4D 3C5ZC 3JBG7 4YN3A 5FM8A 2YXWA 2QZQA 4NM4L 2E86A 4NPJA 4OV6F 3NRFA 2Y25A 4BD4A 4XWOD 5AFAA 1RURL 4N2LA 4Z7QB 4B9KC 4EI5B 1OSYA 2H45A 3CXHJ 4LHUG 4Y1SA 3KPPA 4PJXB 4U2ZA 3GS4A 1REIA 3DYMA 2VMJA 1EXUA 2OMNA 4QYAA 1WD8A 3WMQA 2DQUL 4ZFQA 1HCYA 4UANA 3IFPA 2WLZA 5KVEH 1OAJA 4ILDA 3BVNA 1RJZA 1ACXA 3SDYH 2IGTA 1MVFA 3FT4A 5SWQA 3N2JA 3AZUA 1XZ0A 2MJWA 2H0EA 2DWEA 5FO9A 1AGCA 1FCCA 1ZA6A 2JXMA 4YPJA 5I8CA 1TLKA 1GVIA 4EPSA 3L5HA 3U9PH 3Q13A 4JKMA 3IJSA 4N2IA 2NNRA 4Y1AD 5J56B 2R69A 3ARED 3PJLA 2HMIC 2O61A 1UA6L 3E2HB 4ZZKA 4FI7A 5H37H 5KVGH 5IQ9A 3Q5YA 2WLHA 1T04A 3LVTA 4PJEF 3S3SA 4EZKA 3UPRA 1GGYA 1H6TA 2ZPKH 3WLBA 4FNPA 2CCLA 3AU1B 2QDWA 4WJ5B 4ODSH 5JUEL 1H5BC 5BRZB 4X6CE 3BRGC 1KPUA 4JZOB 3BUTA 4LSQH 2ATAA 3PP4L 1EQWA 1WAPA 3IDYB 1CI5A 3N41B 4X6CA 5IHZA 2XFXB 1WZKA 1JGLL 1PD0A 4TMPA 2D0FA 3MV9E 2OMTA 4R97B 3SKMB 5FB8B 1N67A 1DEEB 5T1DL 4LCVA 1JHLH 5E1AB 3B2UC 3HJ0A 3HN8A 3MV9A 4NDMB 1AJ7H 5EZOL 1QYGH 1Z5HA 5EOCH 1JGUH 4FMVA 2XETA 2Q86B 4MJ4A 1J5HA 2YPLB 5CS7A 2MOGA 2NY1C 1OOAA 2QR0A 4FJZA 1U6AH 5CD5D 4ZAKC 3D52A 3SDCD 1DEDA 5JIPA 3K6OA 4AYID 4WZ9A 4L8BB 3HPLB 2DF3A 2YD7A 3PGFL 4JFEE 1IAOB 3UJTH 4GSDL 1FQ9C 2VERA 2GTZA 5J11C 1F3DH 5H4ZA 3WTTA 3QUZB 1TSRA 1OAKH 4JFEA 1CFNA 2IQ9L 2HFTA 3DURA 3J8F7 4IBYA 5MI0C 4HJ0D 1N59A 5J6HA 5JOPD 5CBAA 5EU4A 1PEZA 4MDJA 5HYFA 1UHVA 1YN7A 1S4IA 2XBDA 3QJUB 4X7TB 1E5AA 3NCCB 5KSUB 1CQYA 4YDNA 4LIQE 3KPNA 4IU2A 4XI5C 3ABLB 2X6CA 1AHWC 1FNAA 3CQFA 4YBLC 4M93B 1X7QA 1KBGH 5DEFA 1ICTA 3BDXA 1LJMA 2HKAA 4RWHA 4I5BA 1DTUA 2A4EA 2XFGB 3ARZA 5ADOH 2X42A 5L2JA 1RJYB 1I31A 1T22B 3WKQA 5C7XH 2GSGB 3PJSA 4RNRA 5GRJH 1ZKAA 5KVEL 4Y2DA 5F3HB 4J3VA 1OTSC 3GXDA 4HK3N 2KQMA 3SDYL 4I0CC 5HYQB 3SE9H 4MQTB 1HILA 2ZNWA 4P4KB 2IANB 3NIDE 1DSFH 4MAYA 5AAMA 2FTAA 1FWXA 4DJMA 1YEDB 3FW6A 3II1A 3BKCH 2ADJB 1LK3L 3KW8A 3CFMA 1YQVH 1A1NB 4Z3HA 5C08B 4NQDD 3U9PL 5JW5B 1SDDA 2ZOOA 3CPLB 4LCCA 3GMMB 4WO4D 4J8RA 3U6XA 2OSLA 3I6LD 5KVGL 4PJFE 2NTFA 1ITCA 4N90D 3WNMA 2A9DA 1OPGH 2ZPKL 3PWVB 4J3TA 3OKOA 3VH8B 1F11A 2XQYG 4HPOH 3L4YA 4PJFA 1JZ7A 2IH9A 4ODSL 2L3BA 3MGTB 4U6HB 3OZKA 4XRCA 3L7EA 1HOCA 2ZKWA 2YJLA 5I6PA 4HK0B 2XN9E 3IU4H 1K3IA 4LSQL 5IVNA 5CLXA 2R51A 2MSPA 2VSMB 3M17A 4AVIA 2X6BA 4YLCA 2PWDA 3IT8D 1TVBB 2R2EA 1BYPA 1CLYH 2XN9A 1G7MB 1XCQA 5IY5B 3KWXA 3HAEA 1JHLL 3T6VA 2Q5BA 4JFHE 5GGQH 1WBYB 3BD3A 2H3XC 1AJ7L 2Q3AA 3LNHA 1QYGL 3RRQA 3TXAA 4V2BA 1DLFH 1JPST 4LCYB 3FOMA 2XWZA 3F58H 4X4YB 4HIIA 5HHNB 1LP9F 4CBPA 2HAZA 1U6AL 1FIEA 3AM8A 1KN4H 3FQNB 5GRXG 4K2UH 1FNEB 3LEXA 4XAKE 4KK9D 1SNRA 4R8WL 3V0WH 3NN8A 2YAFA 3V6OC 1LWRA 3UJTL 2CDFB 1HU8A 4IM8A 2HJFA 5BUAA 2BWDA 3DIFA 4GQPH 2BSRA 3CVBA 3K91A 5D93B 1OAKL 1K4CA 5I74B 4PWGA 3SJVB 1ZT1B 1UH4A 2VZUA 3MJGX 4OQTH 2N56A 2FHCA 5I1LB 3CDGB 1FO0A 2GW5A 4PTUB 1EDYA 3OKEA 3U79A 2VRAA 5ID0A 2ZAHA 3J07A 1KCBA 1JD7A 5JXAH 2MOQA 3LNEA 3IFNH 4OJAA 4P5TA 4ELMB 3FU9A 2R83A 3RI5K 1MCFA 1KBGL 4U1HA 1TQTA 2BHFA 3VG9B 3G5ZA 3FO0H 2AXGB 1T21B 4QUOA 3U1SH 4MJ6B 3T65A 1FAKT 5ADOL 1G7LB 3VXRE 3N04A 1J8HB 3G6JE 1NCDH 5C7XL 1NANI 3IGLA 1ZS8A 1EVTC 4YXHL 3VXPB 3VXRA 1K5NB 3G6JA 3QORD 5DJ2B 4DW2H 2PETA 5GRJL 2OX5A 1CBVH 2XXCB 2NW3A 1UWFA 3MLRL 3QIUC 4KKQA 1JI1A 5CP3A 1A6AA 3W0WB 1S9YB 2EKJA 4JPIA 4XPTH 4N4YB 3SE9L 3GJFA 4V1DD 3OF6A 1JGDA 1AS7A 1DSFL 1J9QA 1EFQA 3QI9A 2Y9RT 4HD9A 3FONB 4DVBB 2X3BA 4QJ3B 3BHBB 4TL5A 1KGYE 1YQVL 1GZHA 2CK0H 1P84K 2Y72A 5FM5M 4LPXA 4TSBH 3RY6C 3ISYA 1AR2A 4L1DA 1T89A 4BWTA 2PCPB 2J25A 3NZHH 4WIQA 1OPGL 2X9WA 1AFVH 5I6LA 4WI4A 4HPOL 1M71B 4FQQB 2TRYA 3LNIA 4PJEE 3ZVVA 3ARFA 2P49B 2CLZA 4FEIA 1KGJA 2EIKB 4G5ZL 5FKPB 1F5WA 4X42A 4GW4A 3CZUB 3IU4L 1C7SA 4PJEA 4YFLF 5KVMC 4HS8H 1U3HA 4NQEB 3T4AB 1A25A 1CLYL 1BXAA 1M57B 4HUUB 3MN8A 3QXWA 5IIEA 2RFXB 3GSNH 1HAUA 5GGQL 5T3XH 1HIMH 1MWAB 2QZ5A 3DLQR 5B4MC 4KKLD 1DLFL 2XU9A 4CDHA 3F58L 2VXTH 1CYWA 3U0WH 1HFUA 2GPZA 1NFIA 3IKCB 1RD6A 2VSCA 1KN4L 2BNQB 2V37A 4K2UL 5HJBA 2C26A 2W60A 1KFAH 4XO8A 4Y4FC 3LYRA 3QBTB 1C8QA 3V0WL 5BRPA 2LV4A 1AGDB 3Q2VA 2HKFH 2HLEB 3OV6A 2B0SL 4OGAC 3G08B 4ACTA 5CD3B 5EA0H 1ZVNA 2A6DB 3MRIA 4KDVA 3O9WC 1BQHB 4N2BA 5CIPB 3R8BB 2VYRE 2NY5H 1E50A 4YSAA 3G5VA 4K7FB 3B56A 3RHWF 5JZ7D 3JWNC 1IL1B 5HHVL 2XBZA 3ISRA 4JDZA 2EINB 2H1PH 4ZUUA 3V4PB 2CH8A 5CEYA 1HESA 3QDAA 1UD8A 4IJ3B 5TGBB 3RY5A 2F54B 3VX1A 4NQSB 3WKNA 3WLWD 2KDYA 1F4HA 5JXAL 1JZ4A 3IFNL 3F7YB 4S1QH 2NTSP 4LLDB 2F8IA 4AMXA 1BJ1H 4LSRH 5FDWB 5KYNA 5T1MB 3FO0L 1Y18A 3U1SL 1MRDH 3BKYH 3KL5A 2YMOA 4GY4A 5EIIB 1CR9H 1NCDL 2ZD0A 4G72B 2XN2A 4OAWB 3VI3F 1EEZB 1SXBA 2WQXA 1MW1A 3EZJB 2Q3XA 2UXGA 4DW2L 2DEWX 5E6IB 1CBVL 4B9YA 2WUBH 3O3AB 1Q90A 2JCCF 5D7IB 5AW3B 5ACMA 2D73A 3D85B 3DX4A 3BIKA 4G6FB 2CBMA 2A6JB 3MX0B 2V2TA 4U31A 4XPTL 4N0UB 4GG8A 3B5HA 1QZNA 1TCRA 1YYLH 4F8LA 1GR7A 1DANT 3AQZA 4FNUA 3P4NB 5KSBF 2CK0L 4UV4H 1TVHB 5L0QB 4TSBL 5D8JH 3W39A 4LSUL 5FXCH 5EF0A 1U8KA 2BP0B 4ZNEE 1U8PA 3ULSB 2VQ4A 4WQOA 3NZHL 5CLWA 1AFVL 2E6PA 4HU8A 3L7FA 3T2NL 4ZNEA 1J48A 5B1JC 2HFFA 3BPCA 3MROB 4KO5A 1B0IA 2NCMA 3LPWA 4NQQA 4DP8X 1KTDA 2XXGA 4E42A 1WQVT 5L7XH 3OGOE 3EYQC 3HHSB 4HS8L 4FA8A 2VAJA 4UT7H 2R1YA 5GGTL 4LSTH 4AZUA 3B8YA 5D2LF 1I3UA 3GXTA 3GSNL 1FP5A 2Y3AA 1HIML 5T3XL 5JO5A 2I69A 5EHFA 1RJLB 3WG7B 1N0XH 5J1SC 3S3JA 3TBYA 3U0WL 1U8HB 1FZJB 1Z66A 3LHAA 3W57A 4KHTH 2EUZA 2IPTH 4LBEA 4Z7OB 1OL0A 4HDIB 1LP9E 3HE7D 1KFAL 3CFBA 3FDWA 4NKMB 3EBAA 5BZDB 1P5UC 5I0ZA 5I23A 1VACB 2MPVA 3IGAA 3BOVA 3I85A 2HKFL 1LP9A 4PLJD 1MFDH 2D7PA 3OSVA 5AOZA 5D7JB 1F18A 5EA0L 1H15B 1WYJA 3OAWA 3LV3B 1OP9A 4O2CA 1G6RH 3IGFA 5G4NA 4F3FA 1U8OB 4JMXA 1JERA 3X3FH 1A8ZA 1JTOA 2ADFH 4RDQF 5GGRB 2XWBB 4PRIB 2JTDA 5F7FA 3ZHNA 3UBXB 4FG2A 1HXYB 1WWAX 4YPGA 2NX5E 1I85C 3SPIA 4S1QL 4NQCD 3EDFA 5HHOE 3C6LB 2NX5A 2WLIA 4PJ5E 1MRDL 3BKYL 3EGDB 5HHOA 1UT9A 3EFOA 1P7BA 1CR9L 4F7EB 2B77A 4MQ7B 5ERWB 3RVVC 3VWKC 2EDTA 4O02A 5HJDA 4JLRA 3J2PA 3KMDA 2WUBL 2YR3A 3G5YB 3UO8B 1VFUA 3C87A 3QJHA 1AZVA 2VDKL 3IWUA 3CSPA 4R26H 3FUNA 1YYLL 4AKOA 2W5PA 1PNDA 1QZ1A 4X5WB 3T0WA 4JDEB 43C9A 1A9VA 2QKIC 3D18B 5KS9B 3ZZSA 5D8JL 4ZOBA 4LOEA 5INCB 4C8XA 1CDHA 3PQYD 2RACA 4P46C 1LNUA 1U93B 1IEBA 2F2HA 4N1EA 5HDRA 1J12A 1E5BA 4GKSB 4XNMB 1T1YA 1NEUA 4FHJA 4LLAA 1B4RA 5FYKE 4OD3H 1DQVA 2DM3A 4U1MB 5L7XL 2O5ZH 4P5SA 3B37A 4U33A 4UT7L 4UYPA 4GRWB 1MSPA 4XB3A 1NC4D 2HXAA 3VXSD 2ZKMX 3JUYA 1AHWA 3JV4A 3FCBA 3A0OA 3L5WA 3SQOH 5DJYA 1HE7A 2LHAA 3MUHL 4RZCB 3DOHA 4FC3E 2VZOA 3MI6A 4WW1B 5DC0A 1PDKA 4HMCA 1N0XL 3P0YH 5C07B 3T2QA 4KDWA 1L0QA 3WOVA 2X1PA 5JLZA 1SYSA 2WWOA 1UFGA 2BM3A 3KDMB 5H94A 3G04B 3N06B 2IPTL 1N3NB 5CZKA 1XSKA 1JPGB 2DLGA 4Y88A 5TDNB 5BQ7B 3WDIA 3QYCA 1NCJA 2CQVA 2WNWA 3MREA 2KLTA 3CC1A 1JWUA 1S7UA 1R3JA 4HCFA 3ZOAA 2WTRB 3K74B 5F44A 4BQ9A 3NCXA 3LDBC 5BZWA 1H3PH 2QHLA 1N6QH 1XCWA 1NANH 1OB1B 1L9SA 4Y9GA 1G6RL 5F9WC 2X4TA 3HC0B 4CU7A 3X3FL 2ADFL 5GS2H 4JN1H 2X9ZA 1MRFH 3O3UN 4A2HA 4MD4A 4IK7A 3GIZH 4S0TD 2WP3T 4QRTA 5IROA 1DBJH 2R4RH 1HL5A 4ZUVA 2C8NA 5TE7H 1HJCA 1GIGH 1PYWA 3RGVD 4I7ZC 2NY2C 1R1CA 4P04A 2JKTM 4A2EA 3QNZB 1B2WH 3QRFM 3N1MC 3WFDH 1PU0A 3MAWA 3L4TA 1X9UA 2JCWA 2GY5A 3CVDA 9PCYA 4YZFF 1CK0H 1S8DA 2F19H 1NIDA 3D3VB 4JFFD 2EACA 3RPIA 3VRJA 1U2YA 3AROA 3T0XA 1ORSB 1VEMA 1MH5A 4RGND 3VI3E 3L6FA 1SJEA 3QWOB 2G9HB 4P0DA 3L1OH 4OFDA 1R3IH 3HHRB 3VI3A 2JCCE 2LU4A 5KZCB 3GEWB 4PRDB 3FH8A 4OZHB 5DJZB 3B9KC 4KVNH 1I9IH 1SDAB 1U9KA 2OMXB 4R26L 5EO1A 3NSFA 2JCCA 3V6OE 4G7RB 1F3JA 2VABB 2EO7A 3SOTA 1XGYH 1QTPA 4LLUB 1MJ8H 5B38B 5K9OA 4Y2OA 3Q43A 4U1GB 5G5DB 3V6OA 4DKDC 4UTCA 2GJZB 3GMQA 2JJSC 5KSBE 2BJMH 5IFJA 4R84A 1HZLA 1HYRC 3DUUA 3GUTB 2FEJA 3ME0B 4WHTA 1MCJA 4O2EB 5KSBA 5I8KH 3O6LH 4GI9A 1GZPA 1JV5A 5BS0E 4MD0B 4XX1G 4OD3L 5F89A 4AQAA 5GZND 1V3MA 1FVEB 2CALA 3ML9A 1AZNA 4X6EA 2NYYC 5BS0A 2O5ZL 4L4VB 5I19H 3OHXB 1W80A 3JT2A 5DEGA 5JW3H 4LF3B 4AQOA 5F9JB 4NXSA 1PZDA 4GINA 4MMZC 2HMID 1HJBC 1ADQH 1MFEH 1AE6H 3APNA 3SQOL 5EZLB 2NY6D 4FQLH 5D2LE 1XGQB 4OLZH 4WFED 2R39A 1VA9A 2XLLA 4IOSA 2A73A 1RI8A 4QHUB 4Z18A 1A6TB 3P0YL 5D2LA 2EECA 3VA2C 1NJ9A 2OCCB 3OX8A 4M3KB 3V7MA 3VO0A 1YUHA 2W95A 1X44A 4X99A 3MRQA 4RCAA 4JFUA 3I75B 3AS3A 2DLIA 3OPUA 5TPWH 1TJHH 4PJ8A 5HHMB 2BIOA 3KR3H 4R4BB 1SN2A 1A21A 3JWDC 4U1IA 4QXTB 4X0NA 4XP4H 3CBJB 1A3ZA 3OL2A 3QDGB 5FA3B 1AGFB 1H3PL 3DK2A 3DHUA 4Y5YA 1N6QL 3UTTE 4G8FB 1U2CA 2XTLA 2H2SC 1UD3A 3FO2B 2NY1D 3UACA 4TNVK 3UTTA 2A38A 4JN1L 1MRFL 1HT6A 4ZAKD 1ZSHA 4JRXD 3ZMEA 5IESH 3KDPB 1T5XA 1DBJL 2R4RL 1A6ZA 5CN2A 5TE7L 3NZSA 5EZJB 4LVHC 1GIGL 2UX6A 3DO7A 3N91A 1WV7T 1VGEH 2YD0A 2L4OA 2FB4H 3BJLA 1B2WL 1NAMB 1XL4A 1D9KA 2J3SA 3DRQA 4QHKI 3WFDL 2YO3A 4XHJC 3VH8G 2ZIDA 4QCIB 4M8QB 1DJSA 5EU6B 4L9LA 1UD5A 5JQ6H 3NCMA 1CK0L 2F19L 2AEPH 3QUKB 1HHJB 2JH2A 3NAAH 3KM2A 3S3PA 4QYOA 4FFZH 4ZXBA 1C16B 5GRYA 4N22A 3DUSB 1FLTX 2J6EH 3L1OL 2HJLA 1R3IL 5IUSA 2FYYA 1WGOA 2K6YA 2Z9TA 4UQ9A 5E23A 5SWSB 1I1AD 1G7QB 1I9IL 2DKUA 4KVNL 4LLQA 1NCGA 4Y4FA 3AS0A 4PS3A 4AH2A 4FG0A 3VFMB 3HN5A 3FUFA 3MNDA 4HV8B 4G1EA 3F62A 1WS7A 4YC2C 4YZWA 2OQJA 3QAZC 3A5VA 1U3JA 2HFGH 3IMWA 4GP4B 1PJ9A 1BM7A 2BJML 3QDHA 5D7EA 4ODBD 1KTRL 2CG9X 5GRVK 3H9YA 4OZFA 5HDBF 2QELA 3WGUB 5DHXB 4XP5H 2VDQH 12E8H 1OTSD 1C08A 4AG4H 5I2IA 4K7PY 1DJWA 5M94B 3UYRH 3WFHA 4UB0H 2P52A 4QHLA 4QT5B 5I19L 3JYCA 4XN4A 4F91B 5D6DC 1RZGB 1JS4A 5AVVB 2P9RA 3VD1A 1ZHKA 5CN3A 2H5UA 3V4VH 3X1NA 1ADQL 1MFEL 1AE6L 2JI3A 4XZ4A 3TIDB 4FQLL 4BSJA 1U8MA 4WV1A 1DQTA 4OLZL 1T7VA 2VL5A 3DMMC 2W88A 2CUMA 3L3KA 1J1XH 4Q6YA 3TV3H 3MODH 4Z9KB 4A2GA 3VFSA 4PB0H 1IM3A 1ID5I 5CHNB 3WENA 3EYOA 4A2MA 5CSZA 5I1IH 1FN4B 4AYDC 3N40P 4HCRA 4PYHA 4UIKH 2IAMA 1GOGA 3ZKQD 4CMMA 4YE4L 1MAKA 2OMZA 4G42A 3PWUB 3QYNA 4PMEA 4KNQA 4JJHA 5JDSB 2LGNA 1YY9C 2PO6B 5TPWL 5CXPA 4IKLA 1TJHL 4LGRB 4GW5B 4TVSa 3KR3L 3BEWA 2XIIA 4UT9A 4XP4L 5C0BD 4ANKA 3I2CH 5FYKU 2X2UA 2VDRB 1KTBA 3GSOA 4A39A 3OKNB 4AYSA 5J89A 3UZEC 3MV8B 1M9WA 3A23A 5FYLE 4M8UA 1QVOB 3SPJA 1YEJH 3K2IA 4YIQB 3HMXA 5IESL 1RZFH 1HAWA 1QX1A 2WXIA 3L45A 3FU0A 3O3DB 4K7PX 4MCMA 3L81A 3QW9A 5AYTA 1C5DB 2R2HA 5B1JA 3ABGA 3KPLA 4YHOL 1AKJD 5IHHA 1L9TA 2W9DL 1VGEL 1UD6A 1HH6A 1WA1X 4F92B 2FB4L 2TSAA 3MHZA 4Y5XC 1EO7A 4H1LB 4N5UA 1JXKA 3VFUA 4G43B 1EBAA 1T0NB 4IBSA 4YDKH 3C60D 2AEPL 3KYMB 3HR5B 3NAAL 2YQ3A 1NDMB 4ORGB 4FFZL 5CWSA 1TJMA 2FH6A 3P0GB 2JKJA 1HQRB 2J6EL 3ZE1B 4YDMA 6PCYA 1O7DC 1E65A 3KBEA 3SY6A 5LCVH 3LH8A 4PJGF 3V0EA 3ZTJG 1RZ7H 4MQXC 1ETJA 2FUQA 1CDYA 3DJSA 3F7VA 3QEQE 5C0FA 3NIGB 1ID2A 1R46A 4JE0A 1C7TA 2ARWA 2HFGL 1MF2H 3KAAA 4JDVB 2NRDA 4XP5L 12E8L 2BS9A 2WBJD 3QIUD 4AG4L 1PY9A 3UYRL 3D30A 3DXAD 1HHKB 3NCWA 4U0RB 3CZKA 3IU3B 3WFCH 3BZFB 2JQZA 4HFUH 1BQHG 3SD2A 1F1DA 2GIMA 4JPWH 2W0LA 3OVUB 3NJFA 4GYBA 4JJOA 5FA4B 1I85A 3EO1A 4GIPD 3V4VL 1IB5A 4GG6B 1EH9A 3VB9A 5CCJA 2XTJE 3O4LB 3O11A 1BD2B 4HX1B 4ZYKA 5A16A 1QQDA 5F6IC 1J1XL 4AVHA 3TV3L 5A2AA 3DBXB 2DB8A 3MODL 4GO6B 1CICA 3DV6A 2E0PA 1A4KA 1BLNB 2WIIA 3FT9A 4PJ7B 4RX4A 3VWKA 1X4XA 3FOLB 5I1IL 4CN1A 4NI3A 3K4DA 4CAGA 2CIIB 4UMSA 1I8AA 3QXAB 2ZUQB 1XMWA 1QRNE 5GSRA 3S96A 5EIIG 3B1TA 3IPEA 3RVUD 4JE4B 3RL1A 4PJBF 1D6EB 4TRPL 3V6FA 2AJZB 1QRNA 4N8VB 3I2CL 1X4YA 5DK2B 1IGJA 4QRQB 3GGWB 3Q5TA 5I9QB 3RVXC 4C59B 3BP5B 5T33H 2AQQA 2MWCA 4FXKA 1OP3K 2WO2B 1UXMA 3PL6B 4Q6KA 3SZ6A 2A83B 3ATBA 1WC7A 1JZFA 4FQCH 3LIZA 4ZSOB 3FU7A 4YQXL 3K8KA 5AW8B 5J7CC 1YEJL 5MENE 4N2NA 5HVHB 2MFNA 4HOXA 2GBVA 5MENA 4BHUA 4FX5A 4KO6A 3H9SD 3ARBA 4APQD 3W9DA 4HMEA 5EOQL 1DFBH 1XR8B 1Z2KA 1GS6X 4ZUTA 3HNSL 3WDHA 2VXQH 3TONA 3GYRA 3JVGC 4K3DH 4JX0A 4Q89A 4YDKL 4LMQE 3U30C 2JVUA 3DPBB 1MQKH 3RHWK 3QFDB 5ADPH 3LN5A 5D2NB 3SKUD 4TXVB 1BAFH 5HGDB 5MEOA 1U4EA 2OSWA 1UM5H 3X1EA 5L2KE 5AW9B 3IDJB 1VIWA 5LBSA 1NEZB 4JRYD 4CILA 1H3TA 2MMXA 4EI0A 2Z8VC 5L2KA 5C09B 5LCVL 4C4KT 3T2LA 4J3BA 4AT6A 3LOWA 5MEQB 1NMCC 2X1OA 1G7IA 1QBLH 2ROXA 2QHRL 3HLKA 2P28B 2NY3B 3MCG1 1F2QA 1RZ7L 1VGKA 1VADA 4P23B 2R9HD 2QQLH 1BJMA 4ZMVA 5C0NC 2VLRA 1HTYA 2R2BB 1PX3A 5K59E 3ARDB 3UCRA 3QPQC 2I9LB 5EORH 3QO1B 4LASH 3KXFE 3JZ7A 2F74A 2DYPB 1CD9B 2VM3A 4WNQA 3ILQC 2X88A 3RTQC 1EFXD 4J12A 5HY9A 2GUOB 3KXFA 2GEQA 3WFCL 1IARB 2FDBP 2B39A 4LCUB 1OGAE 1BZ9B 4JPWL 1ADWA 4IGBB 3RWIA 2BP3A 4K3JH 3TX4A 3VJ6B 3ZLQC 1OGAA 3L48A 1ZLVK 4KRNA 2OZNA 2WXJA 2FT8A 2H3NA 2D2CC 4UUJA 4KKRA 3UIZA 3UFIA 4HULB 3UBXG 5FFLA 3EGSB 5CKGA 5MEPB 5LO7A 4OZGB 4QHNA 4XVSH 3ZL2A 2CK2A 4UYQA 1OHZA 5DQJA 3VGHA 1JZHA 5CZXC 1YG9A 3KW7A 3TEUA 4M61B 3S2AA 2N4IA 4Z7UB 3TFBA 3TIEA 5BV7C 3GRWH 1O75A 4W9IC 1TMQA 1R3LA 3AQYA 4PJAB 3H0TA 3DOSB 4DP0X 5T5NG 3D06A 2J1WA 4XBEH 3U36B 5DDHB 4KOBA 1MI5D 1CXLA 2ZCKH 3MRCA 5E4AA 5ESQB 5DJAA 1P7HL 5ECGA 2K7QA 4AIOA 4XNQB 2B59A 4K3EH 5C97A 2E6QA 3VMPA 3ZL4H 5T33L 5MERB 4D9RD 1WP6A 2H7WA 5AOLA 1A7OH 1XWVA 2Z8SA 2WWKO 3KLAB 4JCMA 4UT6A 2E9GA 5IZ7A 2NXZC 4F20A 1IFGA 2JJSA 3VSTA 4ZFOA 1TTBA 2AK4D 1TZHB 1U95A 1I4FA 3TP4A 1I1FB 5C6TH 3IFLH 4N2AA 1NBYA 1OWRM 3BN9D 3F7RA 1DFBL 1O7SA 2P5WD 3IJEA 4P59H 3GHBH 1XH3B 4ZUWA 2PTVA 4BZ1H 4P2RD 2VXQL 1T7ZA 1KB9K 4NI6A 4K3DL 2FBOJ 2ZXCA 4LVEA 4WGVB 2Z92B 2W07B 1YCSA 1Q94A 3TBCA 3TN0B 3VQ2C 1MQKL 4EN3C 5ADPL 3NA9H 4P3DA 5IOKA 1N7MH 1EV2E 1NLBH 2GSIA 2BRQA 2NY7H 1BAFL 3M7FB 4JQVC 3T08A 4ETQA 4Z7NF 1G43A 1UM5L 4LLVB 2HLFC 5T5FA 5C3LD 4HOZA 4R7DB 1IAIM 3UTOA 1QRKA 2WANA 2J88H 4R4FH 4U7KA 3AB0C 3MV7B 4FQJH 1QBLL 5IMOA 5K9KA 4MXWH 5D1QB 1U91B 4Q9QH 2B2XH 5DJCA 3VFRA 5BUPA 3DIVA 2ADIA 2CCWA 2QQLL 4AC2A 2Z31C 1N5AB 3QJZA 2YLHA 4PV1C 5D55A 3V4PL 1J8RA 3BP4B 4FQ2H 1OCCB 3RTLA 4AJYV 2YGVA 2KT6A 1UXSB 3AWGA 3QJXA 5EORL 4S2SB 4N1CA 3EH2A 3WTYA 4G59C 1U8IA 2NY4B 4LASL 1NMBH 3PWPD 5FC9A 4J3OG 4PS8A 2KZ1B 3ZW3A 3M45A 3NCBB 5D7KE 3CN2A 4QD2E 4OT1H 1BPVA 1NOFA 2BWIA 5GXBB 2LQRA 2DLFL 3KPPB 5AAWC 2G0LA 3ZKSD 1IFRA 1NPUA 4OLEA 4YJZL 1R9FA 2W59A 5IMMA 2VW7A 4XP6H 3FBQA 1NTDA 1EXUB 1FI8C 4NLAA 1GGTA 3LZPA 1GYAA 3LQAC 3MGAA 4MMXB 3BPOC 4WEMB 1BWWA 4XVSL 3BVNB 2H41A 1RJZB 4B27A 1I8LA 2E7BA 4DZBA 5AB0A 1P2CA 3LQMA 2X70A 4G6KH 5SWQB 4U4IA 4UF7C 1XZ0B 4ODXA 3GRWL 2DWEB 2NZIA 1AGCB 5E6RB 1WUNT 3X3GH 5FO9B 3D12B 2JXMB 4F7KA 5I8CB 4HEME 3PUCA 1BQSA 1BOGB 5CBEA 3VFVA 4XBEL 2ZCKL 4HEMA 2O61B 3D69A 3AXLB 5IQ9B 1CGTA 4JFSA 4K3EL 1T04B 4GUCA 2MPAH 4FQXC 3ZL4L 3UPRB 2DM7A 3WLBB 3ZKMC 3CFJA 3ESOA 2P5EE 4PJCF 4P5RA 1A7OL 4H0LC 3GB7A 5BQDA 1FFOA 2WBWB 3I6LE 1OM9A 2P5EA 3R0NA 4QOKB 2KH2B 1KPUB 5C70A 3JWOC 4X6CB 5C6TL 5IHZB 1PZ2A 3IFLL 4BA0A 4HWBH 2GJ6D 2PR4H 4J28A 5B38G 2OMTB 2VL4A 2MOVA 2CKBH 4ZD3L 3BWUC 4PI2A 2AHIA 5E6ZA 4P59L 3MV9B 3GHBL 3CFKA 4GAYA 1HH9A 2NDGA 3UTPE 3ARGD 2IH8A 3PS6A 4BZ1L 4Z1PA 2CBTA 1PBYA 2X2JA 1T66C 1WZMA 1UXLA 1KTLA 1A6UH 2DLHA 1TZIA 2J44A 3N43B 4S0SD 3NA9L 2QR0B 3VVWA 3APDA 1N7ML 3L9YA 1NLBL 4QGTA 5LDSA 2NY7L 2VQ1A 1J10A 3DMMA 2YGOA 5LG6A 1EDHA 2YIHA 3FYEB 3GLAA 1D5IH 4DP2X 1UKQA 1AQDA 1MREH 2E74C 3E6HA 3SYQA 2J88L 4R4FL 1PLBA 2NY2D 3LVEA 4MAUH 2WIMA 2KZBA 1E4HA 2GTZB 4FQJL 1MFBH 3AT9A 1ZVSB 3B6SB 1OE2A 4KDTC 4RISH 4JFEB 1CFNB 4Q9QL 3ILPA 2B2XL 1N18A 1N59B 4KRPB 5J6HB 5CBAB 3T6WA 1MXGA 5EU4B 4HKXB 1MY7A 4MDJB 2WXMA 4EOWH 1YN7B 5DURB 5T3ZE 4FQ2L 2D7TH 4JZJC 3SPCA 4R0LB 2A4ZA 2E46A 2IPUG 3UZEA 3BMWA 2BW5A 2X2YA 3CWGA 2J7LA 1NMBL 3KPNB 4IU2B 5EIQA 4X98A 4N5EC 2I85A 1X7QB 5DEFB 2FGWH 1MCIA 4OT1L 1BFSA 2DM2A 4AGQA 4PJ9C 3ZKXB 1XL6A 5KOMC 2WXKA 2AMGA 4GIAA 4CJ0A 5C0CD 5FPIA 1N5YH 5KSAC 4XP6L 3LRSA 3PJSB 2UWEE 3CFEA 2ESVB 2XVGA 4HZLA 3L2NA 2B3IA 4JHWH 2XV2A 4Y2DB 1HYSC 1RL1A 5DMGC 3ARSA 2ATPA 3QULA 4D9QE 2IWEA 2E9BA 4G6KL 3WI9A 5C9KA 1HILB 2EXYC 2O26U 3JV6B 4MAYB 1O7DE 3X3GL 1NCWH 3A47A 4LKXA 1AR1B 1XTMA 3NIDB 2C3WA 2F08A 1SDDB 2YZ1A 3OJ2C 4HIJA 3K6IA 32C2A 4J8RB 4LCCB 1A4JA 2OSLB 2VXUL 2BIMA 4XNUH 3T8MA 2MPAL 3UERA 1EANA 2IWGA 1IBFA 3OKOB 3IDNA 1F11B 3K81A 2JIXD 4AJ0A 1TQWA 3QUMA 2N1KA 4XRCB 2UXVA 1HOCB 3L7EB 4JFTA 5D1ZI 3NFNA 2APSA 4L5FE 2DTSA 2W8CA 2DBJA 1XH2A 1E40A 1KGXA 3M17B 1G7JA 3DC0A 3OHMB 1XF1A 2FVNA 2JELL 1RUKH 4IOFC 1OM3H 2R2EB 1PZSA 2YARA 2PR4L 2XN9B 4HWBL 1XCQB 3NQKA 4PYGA 4TVPL 4GXUN 1HI6A 3CN1A 2CKBL 2QSVA 4H7VA 3RZCC 1X5MA 1DP0A 5F7EH 4OV5B 2CSPA 3L3HA 4UQCA 3SBRA 4AJWA 1OSZA 1NUDA 4EUPH 2DN7A 3V0DA 2H2SD 3PXJA 1A6UL 4HIIB 2OMUB 4NCC2 5BRQA 2QMJA 5I18H 3S3CB 4KTYA 1SUJA 4L3FA 2QADD 4BK5C 3TPUB 3LEXB 4RA3A 1FZKA 5FWRA 1D5IL 2LU7A 2DY2A 2WGNB 4Z7NE 3C9NA 1MREL 4NZ8A 3NN8B 2HT3C 4MAUL 1UOLA 1CGVA 5I1HH 5JTWA 4LSSH 2HJFB 1EBPA 1MFBL 1NLDH 3DIFB 2BSRB 4GSUA 3K72A 2ZUTA 4RISL 3QDME 1K4CB 4F8QA 2KS0A 5IM7A 4EJ1C 1JXGA 1UH3A 1NBVH 1MOEA 3QDMA 4EOWL 3P3RA 3P4MA 3NK3A 2OR8A 2D7TL 1QSVA 4OCXL 1FG2A 1FO0B 2H32A 4HHGA 4ONFH 3OKEB 5ID0B 1UTDA 4ZOEA 4WUUE 5C0RH 4POUB 1IX2A 1XF5A 1KLGB 2B08A 4P5TB 5KVFE 4I89A 4YWGH 1MPAL 4FNLH 3BWUF 4WUUA 4U1HB 3FHAA 2HX9A 3G5ZB 2FGWL 1JTTA 1CD1A 2HVKA 3D33A 4RQQA 3T65B 3O8XD 4TLSA 4XOEA 1LQBC 3GS7A 3GXNA 3O45A 5J9PA 1VFAA 4I9XA 4CUCA 2FECI 2P80D 1N5YL 1ZS8B 4NRXA 5FHAH 2WK2A 1O9VA 2WQ8A 3VXRB 4OI8A 1OGTA 1TEFA 3G6JB 3QO0B 5IB3A 4AQ1C 2G5UA 2OX5B 3BP6B 1TEGA 3JVGA 4IQHA 2NW3B 4JHWL 2YQGA 4BUGA 2VSDA 1VEPA 2Y1YA 1MLBA 1DDTA 4KXCA 3UYPA 4LDLB 2X1QA 5FO2A 5JMRA 2HB0A 5ESAA 3CQQA 1UJ3C 3GJFB 4H1LG 4A63A 1DVSA 3QI9B 1MCEA 3SE4A 5DGQA 4PRAA 1NCWL 3S5YA 2BOLA 2BWQA 1BIHA 1ILUA 1GHFH 3AQXA 4M4PA 2OW6A 4LLYA 4QRPB 2Q8AH 1R34A 2XWJA 1BF2A 1NC2D 2EDBA 4FQ1H 3TM6A 1INQA 4XNUL 1TDQA 4W6YB 3SQBA 5K1JA 3C2AH 2FBJH 3ZMNA 4F15C 3ARFB 2OMYA 2CLZB 2CUAA 2E4FA 4GW4B 1PIGA 4PJEB 5E2WH 1DQIA 1U3HB 5I5RA 1IGYA 1RUKL 1YY9D 1OM3L 4M7ZB 3LXBA 3O6FB 4TLKA 5IIEB 3VU2A 4LHUA 1NQBA 1XIWC 1NMAH 5F7EL 3F7KA 3G6DH 2P8MA 2Y7QA 4UCFA 4Y4KC 3HVDA 2N7SA 2ZQKA 4MVBC 1Z9OA 5CNHA 3GT6A 4E41D 4FFVD 5I18L 3QVAA 4JM2C 4XTRC 4GQZA 1CWVA 2XA3A 3OMIB 1BVKA 4CN4A 2XZAH 4MZ2A 4ATTA 2GIXA 5GS0C 2AV1A 2W60B 1TVDA 3MJ8A 4HPHA 3BZ4B 2XYBA 3V0IA 3H2QA 2DOCA 2ITDA 5GIRA 2VLLA 2NY0B 3FUMA 4BBWA 5I1HL 3FC8A 3Q2CA 4LSSL 3BAJA 1PCXA 3HG1D 1NLDL 3MRIB 2C4XA 1PG7L 2RBLA 2OTUA 4QHMA 3QQXA 5FYJE 2HVBA 1AG6A 2J5LB 1ASPA 1Q0YH 1NBVL 3CH1A 4JPSA 4O9HH 2AV7A 3G5VB 5ICXA 2HT4C 2FUTA 5C0AD 3C8HA 4M5YH 1ZTXE 1K8IA 3CUPA 4UV7H 3VYOA 4NWUH 3ZR5A 4JDZB 3OC5A 5TE4H 3GNMH 4ZUUB 3SDAD 1O6VA 4AMWA 3Q48A 5C0RL 3NCYS 3NFPA 4H1LH 1O6TA 5E0FA 1LWJA 2EUWA 1CIDA 2Q10A 4N8VG 2H9GA 4YWGL 4FNLL 5BZZA 3UMTA 3LD8C 2H26A 1QMUA 5DMIH 1NEPA 3D48R 1WFIA 4IIQC 4NQCE 1M05A 2BY0A 2Y5EA 2EYRA 1LGVA 3WV0A 2EH8H 5FHAL 1YZZA 3D5OF 4U1JA 4OKVA 4AIXA 1QI5A 4NQCA 4AGPA 1H6UA 2N0MA 2XOTA 3BIKB 4EN3A 1Y0LA 4OJDH 4JO4H 2B7DT 3L3OC 4NOBA 3QUXC 4GG8B 5DS8A 1TCRB 4NAMA 2YPKA 3WIIH 4BJLA 2GHWB 5TDPA 1LE9A 1TZAA 1Z9PA 4AITA 1GHFL 4YVNA 1ZMYA 1E5UI 4PW3A 2Q8AL 3E9TA 1U8KB 3IBEA 1MHHA 3ZDZF 1U8PB 3BRFA 5EF1A 3BYTA 4I13B 1KSRA 5HPMA 3KGTA 1NEZG 3L7FB 4K15A 4MZRA 2HFFB 3BPCB 1QATA 1KTDB 4KKNA 1OD9A 1KEMH 3IBOA 1W72H 3BPNC 3T0ED 2X89A 8FABA 1AKPA 2R1YB 5HI4C 4LQFH 4I1PA 4YHNA 4PVBA 1NMAL 3CZFA 3NSCA 1JK9A 5JO5B 2YSSA 3N1GC 2Y7NA 3G6DL 4OLWH 3O81A 2K1MA 1BF8A 1TQCB 3VXSE 1AIZA 3KHOA 3BAWA 3TBYB 3RVWD 2CUHA 3FRUA 3IS0X 4EI5C 4ZJ9A 1XV8A 2AGJH 3LN4A 4TS6A 5DWPA 2XZAL 4LBEB 4AKQA 2QQNL 4OVUA 1TQBB 3BD4A 2UVEA 5I30H 4DUXA 3CFBB 3BIAX 3QUHA 5IW6A 5J4MA 4NC2B 1LP9B 5ALCL 3EGXA 5JIQA 3TYFA 1UWEH 3E6FA 4DPAX 2P26A 3NT0A 4O2CB 1Q0YL 3BVXA 1SJHA 4O9HL 1AOZA 2KDGA 4F3FB 1DBKH 4QWWC 4E2OA 1DVFD 3DETD 4M5YL 2YOAA 4UV7L 4NWUL 1SYVA 1KEGH 5DO8A 2PPEA 5TE4L 4CC4C 5CEZE 1JV2A 3ARUA 1L9NA 1RLWA 5B7EA 3VD9A 1GGCH 5IWLA 2NX5B 4HJGA 4YO0A 3T0AA 2WLIB 1KC5H 4W4OC 4JFPB 1DVTA 3AWFA 5EZPA 1RSYA 3EFOB 5DMIL 4ZQKA 5HHOB 2X09A 3MJ6A 1IGFH 2EKSA 1NBQA 4H44C 5L4JA 1T03H 3CX2A 4PJ5B 3IDYC 1OAYH 1RZJC 2Y23A 2EH8L 4O02B 5DJ6A 2YWYA 2J12B 4JM2F 4HWUA 4R97C 5FK9A 2R1XB 6TAAA 2ZX8A 3QPQD 3PAVA 4LKCA 1WSST 4P3CL 3FUDA 2IIJA 2X6AA 4KROD 5GGVH 4JO4L 4LSVH 3Q2LA 5FCSH 4XE5B 1UKTA 4RGNE 3VFGL 3MYJB 3D7PA 3WIIL 4ZOCA 3HE6A 43C9B 4HGKC 5KW9H 1PKQB 5ICYA 5CCHE 4ZNCD 2P44B 4CGUB 1UQSA 1LNUB 4WTZG 1IEBB 4H8PA 4DEPB 1RUPH 1SMOA 3HBZA 3IDUA 4I77H 5F3FA 4KDTA 1SLWA 5F71A 3JV0A 4CVZA 1IM9A 1Z9NA 4YHPA 5I17A 1T1YB 1E28A 5HI5C 3ENEA 1QW8A 3IN0A 5AL0A 4IJTA 3DVNA 1AGBA 1ZPLA 4JZJA 4R7XA 1IO4C 1KEML 5E5LA 1W72L 5FOBA 3FQ4A 4LQFL 1Y07A 1YEIH 2UZXA 3FO9B 4JQIA 4YBLB 3L5WB 2ICWJ 1NM9A 3VXOB 5DJYB 2GB2A 3GBDA 4OLWL 4F8OA 3HG0A 4M93C 4PJ9A 4P99A 4OW6A 5B1KA 2JKRM 2P48B 3NJHA 5JLZB 2D3NA 5FV1L 2AGJL 1INDL 2NXZD 3VX0A 1T5KA 3BJ91 2QBWA 4ZS6C 1XBRA 5I30L 2O6CA 4H2CA 2DEYX 4HCIA 5DD1H 1QACA 3MREB 3VXME 1JWUB 1S7UB 1R3JB 2VLKE 1UWEL 3SCMD 3VXMA 5BZWB 2BDNL 2VLKA 3O0RH 1Q0XH 3BEVB 4OFPA 4XMPL 5KVDH 3W38A 2X4TB 1WA2X 4D2NA 2VO8A 5J06A 4WWNA 3T0VA 4MD4B 1KEGL 3FQ2A 1BM3H 2HLFD