4AJVA

Structure of mouse zp-c domain of tgf-beta-receptor-3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
167
structure length
152
Chain Sequence
TFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFISPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFVFKSVFNTSLLFLHCELTLCSRNKGSQKLPKCVTPDDACTTFTKPLAVVLQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRANSFORMING GROWTH FACTOR BETA RECEPTOR TYPE 3
publication title Identification of a Novel Tgf-Beta-Binding Site in the Zona Pellucida C-Terminal (Zp-C) Domain of Tgf-Beta-Receptor-3 (Tgfr-3).
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 27
structure length 152
sequence length 167
ec nomenclature
pdb deposition date 2012-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ajvA00
3NK3A 3QW9A 3NK4A 4AJVA 5BUPA
chains in the Genus database with same CATH superfamily
1OP3K 2NZ1A 4RAHA 4OM1L 2DYSB 5INDA 1RUQH 3CVIL 1UKSA 1KF9B 4RVBA 5IQ9B 3A67L 4OLVL 4B9FA 1GW0A 4DT2A 1SVZA 3K2UH 1A14H 2YPVH 2C9QA 2L7UA 5J1AA 3DMMA 3O0RL 4Y4HB 3ZQXA 4JKPL 2NY3D 4WFGE 4UTAH 5D1QE 3LH9A 3AXIA 3TBBA 2NPLX 3NZ8A 2O6CA 5FA4A 4H44C 4AUUA 3QCVL 5DF0A 1T0OA 4LLMA 5KSBF 3GS4A 4WHCA 4OLXL 4ZMXA 3EH5B 3FU7A 5CLWA 2G60H 4ZMZA 1BD2B 4R7DA 4X7TA 4P2RB 1XO8A 5EIVA 3SDYH 2VO5A 3T71A 1FLTX 2VQ1B 3U25A 3SN6N 3VJ6A 4YUEL 2Y36H 4KQ3L 4MKMA 4AV4A 5J13C 3MO1B 4YHMH 4LCWA 5GISH 2F5BL 4F37K 2FK9A 4KRLB 3WEAA 4UAOB 5CEZE 3A6OA 3P30H 2AI0H 2WVSA 5E8DL 4N22A 4BFIB 2A3TA 4NQVB 4PW3A 1MLBB 3BPOB 2O5ZL 3PV6A 5D71L 1GYVA 1E9OA 2DQIL 4NO5B 4Y7OC 3RGVD 5D93B 5B38B 3MOBH 2ZJSH 4F2MA 2QQQA 3MRGB 1YVLA 5ICXB 4X4YA 1NGXA 1NDGA 2NUPA 4PU2A 4G8GD 1SZNA 1G7PA 3LPFA 3L2MA 1IKNA 3MZGB 4Z7VF 2FZ3A 1X5MA 5KVDL 4BDVA 2BNUB 4FFZL 4TNFA 1Q1JH 4BFJA 1T2QL 2NY5L 3TBTA 5I75B 2QGCA 4HGKC 2FD6H 3LIZH 5IESH 3EH4B 2VLRE 2JLLA 2WIMA 2YKLL 1W72B 2YPKA 3KJ6H 3MMEB 4FA6A 4Z3IA 3MUY1 4CMHB 3LTVA 4JUSA 5BRZA 2LOEA 3N1QC 4MCNA 5F8QC 5CO1A 3UAFA 4BRVA 5FKAA 4X6CB 4K5MA 4FMKA 4WI8A 4X6DE 4EZJA 1WHOA 3UEQA 3RP1A 2MTPA 1QP1A 1F45A 1CDBA 5ID0A 4OM0H 5I82A 2N7SA 1ZGLA 4ZRGA 1DBAH 1JDDA 4KO9A 3IGAA 5DJAA 4JM2B 3X12B 1UD8A 4QDGA 1JDAA 1MG3C 5L6YL 3O4LA 2JQAA 4WEUD 1S6NA 5MEQB 2R2EB 5LBSH 1WSST 4F3FA 1BQKA 4N6RB 1P4LA 4F2FA 1JDCA 1HESA 4FYRA 3BP6A 2X89D 2HWZL 1M6UA 2JNZA 3KR3L 5TDOA 3ZDZE 2CA4A 4Q8BA 2X7LA 1FPTH 1FBIH 4P4KA 2QVKA 5E2JA 3T0ED 4WJ5B 2YD2A 1HWHB 4ZQKA 4MQTB 3QA3A 4BUQA 4EUPB 5CMAB 1AMYA 3VXTB 3MCKB 2Z9TA 4PG9A 4Z7NB 1OGTA 4ZD3L 1T6WA 3QDME 1IEBB 3UCRA 5L2KD 3B8SA 1IGFL 3C5ZC 5C0CE 3MLTA 4PJXB 1FH5H 3ZYJA 4W9KC 2QR0B 2F18A 2PYED 1WUNT 4F5CE 3TESA 3FTVA 2A6KB 3TN0A 4GINA 3KW8A 3D25B 4U1LA 2OKMA 1KB9J 4MASA 4BCXA 5TH2B 2G4EA 4L5FH 2ZKHL 3FRUA 2H6UA 1IKOP 1FQ9C 5FDWB 4PJEF 4XWGH 4AMXA 4MD4B 3ES6A 4P9ML 4QRFA 1GZHA 2FX7H 5C0EB 3QAQA 4P5KA 1BVLB 2OPCA 1ET8A 2P5PA 4R5VA 2Z91B 3SPVA 4AGQA 3ASWA 5EUOA 1LK2A 2EYRA 4KHTL 1QMUA 2ZUXA 4ZO8A 4ZMAT 1D5IH 5I66B 4IBWA 4EF3A 3LHAA 3SCMA 3QI9B 4GXUM 1RJYA 4K5PA 1HXMA 4L4TB 1RKRA 2AERT 1L0YA 3BAIA 3ARFD 3QXAB 4IEFA 4U6HA 2JIXB 1F18A 4XCCH 3CCHA 4XAWH 5EUKB 1HSBA 5F1OB 3SKMB 5HYJA 3G9AB 1EUUA 1IM3D 4PRAB 3U46B 5FOBB 3SBRA 3GQFA 2R0ZL 1INEL 5JQ6L 1DBKH 3ASOB 5HHOD 3THML 5BCAA 4R7VA 2F68X 4LCWE 4TPRH 2MCPH 3G6DL 4OD3H 1HXYB 1WE5A 1OGAE 3VW3H 1BQHB 1ZV5A 4M4RB 2Y5TA 4WW2F 1O6SB 2X44D 1MJ7H 3P9MA 4HJJH 4B9KC 5F89A 2JKLA 1KYUA 3HPJA 3S4SB 2WJ5A 1PS3A 2V5TA 3ILPB 1W0VA 1IC7L 3STLA 5C07B 3SYPA 1W72L 4MJ6B 2QPUA 2XKNB 4OQTL 4HS6A 2PCFA 4YDJA 4NENA 3OC5A 3NRFA 2P24A 1U30A 3CQPA 1T04A 3MREB 1WS8A 3GXIA 2F19L 1TZHB 4S1DC 2D4DA 1RPKA 3QJRB 4UF7C 3BP4A 2IANE 4BXSV 5I2IB 1KGJA 4HCRA 1X7TA 2PTUA 4D9QD 1S3RA 4PAZA 1KBVA 1MZYA 4WWPA 2Y6TE 5DK0A 4DSYA 1AACA 4AQ1A 2X4TB 1U8CA 4LSRL 1K2DB 1RK7A 3ARGB 5SV4A 4URKA 5EDSA 1CL7I 5L88L 1S7SA 1E67A 2TAAA 5DURD 2EILB 4NCC2 4OZGA 1I8IB 3EJYD 1MCPL 3GI8H 1FC2D 4HUUA 4R4BA 5HGBB 2O26U 3WN5A 1OEZW 1QLEH 4MZIA 2OMZA 4MA7H 4OFYD 4XE5B 2GSIA 5B1AB 2J57A 2CNYA 3IDJB 1MIMH 2CLVB 5ELIA 1DVYA 4XPGH 2LFEA 4YGAB 1HOCA 3K72A 5ITBH 5JOPD 3K80A 4Y19E 4YSUA 1JGEA 1J5OL 3DK2A 2UY6A 5IMOB 5CNHA 3LZRA 3KLKA 5DR5L 3P4OA 1LO4H 1RURL 1TVHA 2ZG3A 5HGDA 1IVTA 3D2TA 3FHEA 2VSMB 4LVEA 3P54A 1MQKL 4OUOA 2JQZA 4FQQB 4A2EA 2I7SA 1TYJA 1ODUA 5KVMC 2AK1H 3E2HB 3HMWH 4PRHA 4JFEE 1COBA 1I8AA 2DLGA 1A7RL 5D7KE 3BGFC 4JKNA 3T4AA 2OXGA 4FP8H 1RUKH 1LO2H 1ZMYA 3RNQA 3CAFA 3I9GL 2V2TB 1TJIH 2EIZA 5E5MA 2DEWX 1E5ZA 4Q6YA 2FJFA 2VDRH 4P2OD 4NYLB 4GKSA 4F15B 4D9RD 2PP7A 4G3YL 4JMNA 2BFVH 1U2YA 3O41A 2H8PA 4PWJA 1EZUA 4KROC 2I85A 2K78A 2JFCA 2OMNA 4FNTA 1ETZB 4NFCA 1G7MA 4S2SB 3A6CL 3TBCA 5J6GA 1QTSA 2F54D 1QG3A 2XJLA 5F9DC 3W9EA 3EADA 2W0FB 1A6WH 2OR7A 3CK0L 3QEQB 1SYVB 4FL4B 2ZKWA 4GMTL 4LT7A 3UAJA 5C0AB 4UTBA 2VZUA 2WLKA 3FTZA 1M7UA 3D52A 1SEBA 3CBJB 5D70H 4NGHL 1ZHNA 3GJFK 4PJAB 2F53B 2D31B 1MH5A 2H3KA 4HKXA 2OYLA 3V6FA 1UHVA 1OSEA 1A6UL 4NUQA 2IDQA 2VDLH 3P0YL 1OT1A 5C0IA 1QSVA 3FS9A 2XPZA 1VGKA 4IOFC 3IF1B 3K2MC 4J8RB 5ADPL 2Y06L 3W82A 1MPAL 5ICZA 5T1KB 1RZGA 3NJXA 4IKIA 3RL2B 5E23A 5CJOH 4ZNEE 3FQWB 3N44B 1F42A 2R1XB 3BVNB 3CFIC 2CLRA 2WINB 1V7NL 1X6LA 1MF2L 4FABH 1UZ8A 3GSVA 5DFVD 1QPXA 1JJUA 1T1YB 3HC4L 5CP3H 2DQ6A 2CDEB 5HHXL 2OMXA 1FNEB 2AQ2A 4RNRA 4H26A 2VC2B 5F7DB 4ODVL 1FV1A 2E4TA 1I85A 2MTAA 4IKKA 1JL8A 2PETA 4QAWA 1E4WH 3QPXH 1MRDH 4FNQA 3NABH 4POUB 4XCEA 2XZZA 4GUQA 5DK2B 3T09A 4S10A 1JNHA 2UWEA 1FO0B 1CFTA 1U8NB 3VXPB 2BXZA 5JYLA 1AH1A 3A4EA 1ZLWH 2V9TA 1LNUA 3ZTNH 5L0QC 2FUQA 1D5BA 3WKML 3CBKB 3QIWB 2HLAA 2B4CL 1XZ0B 2W60B 2YD7A 1GGBH 2KS0A 2BY3A 2R9HC 1W0WA 2P47B 4K7PH 4KRPD 4LDEB 5JXEC 4W4OC 2Y5EA 4RMRA 4DPBX 2NY7H 4OCXL 3S3BB 5GZOC 2J6EA 2IWGA 3LXAA 2BHYA 3U4AA 4ODUA 2RFXA 1FNAA 1KOAA 1R34A 2E6PA 5SX4I 3UTPD 5TE6L 5I1LB 2EYTA 4GAGH 1FH2A 3BW9A 4FLRA 2OW7A 3VWKD 3LS5H 4NUPA 3T2LA 3DSFH 1E42A 2KERA 1JRHH 3QULB 2Q3ZA 1T4KA 1G6RB 2FE0A 8FABB 4I9WD 3BWSA 5FK9A 4QOKD 1H5BC 1DBBL 1E4KA 5F70A 4P07A 3ULVL 3BUTA 2ZSWB 4IHOB 5LAPA 3O8XA 4QT5A 1OAYH 4XMLL 2CR3A 2AK4A 2R0KL 2OMWB 5DJ8B 4ADGA 1EHNA 4TSCL 1OAQL 3OMIB 1HL8A 4WW1A 3ZQ9A 4IDJH 2D7PA 2GSGB 1T3FA 1X5IA 3EG9B 1WPCA 3DJSA 3MV9D 3CWGA 3MA7A 4QHUA 5F3FA 3R0MA 1ACYL 4AE1A 4HUXA 1X5HA 2MHAA 3JWDC 1OGSA 1WF5A 2CRIA 4G6MH 1T1WB 5DEGB 2YQBA 3SY0B 4YO0B 1N19A 3LNHA 5JHLL 1JZIA 1YQVL 1KJVA 3O6LL 1NMBH 3EJPA 1RD6A 2NQ3A 1AHMA 3HW7A 1CXHA 4H88L 5CBAA 1HH9B 3PWNB 3Q2CA 1DVZA 1KXVA 4X42A 1KB9K 3I2CH 1Q72H 3OX8A 4P2QD 2X6MA 1PLGH 3NSXA 2BC4B 4U49A 4NZUL 1A3QA 1VFUA 1DANT 3CPLA 2YMXL 2IH1B 2G75A 1RZJC 4YDIL 3BEVA 4JG1H 4F7EA 1UCBH 1ZT7A 3HE6B 1RZKC 2P3YA 1H3PL 3PAVA 5AVYB 5KS9B 5C70A 1DEEA 2QVTA 5I0ZA 1AQHA 1QSFE 4KI5E 5E00B 4KUCF 1M9WA 1MRFL 1N6QL 4KJYB 3OGCB 3N9GH 1U8OB 1XCTB 2ICWJ 5E2VH 5A40E 3TH4T 1D2OA 3GPEA 1EJOL 3KPMA 4B5EA 2W0KA 4IRSC 3ZDYE 2Q7YB 3WTTA 1ES0B 3R1GH 3BZDA 2VC2L 1EMTL 4DO4A 2IBZX 2J44A 3P0VH 3D05A 4NKDB 4GIOA 4S1DD 4B0MM 3HA0A 3ZE1F 3VYPA 1RPUA 1VJSA 5E8NB 1FO0L 2EYSB 1YEIH 3MBEC 4JM4L 4EIUA 2J25A 3FU8A 1QFWL 1G7IB 4ZO7A 3ULUL 3FQNA 3SGDH 3FT4B 1CYGA 2H0FA 2IPKB 1IQDB 3RE0A 3PXHA 4I18A 5KSAC 1EFXA 1QR4A 3HKFA 3BVVA 1H8LA 3Q9QA 1CT8A 5IHZA 3DHPA 5D72L 3WYRA 4LSVL 1WC7A 4C54A 1RP8A 2X2HA 2QV2A 5FYJL 1RMFH 2AEWA 1M2OA 3G5XB 2JJSC 4RIRB 1V3KA 5FO8A 3JT2A 2H1XA 3S34L 4JDTL 2RJMA 4N90D 2ICEB 2C9SA 4OJFL 1G6RL 1MDTA 4ZX6A 2A9NH 2GAZA 4PBXA 1U8IB 1H6EA 3Q48A 5H94A 4XBPB 3RWCB 4EAEA 3V6OE 4JHVA 3PF2A 1ZT4B 2PCXA 3WLWD 2DQTL 1FFTB 3C5SA 3U0PB 4GI8A 3KHQA 4PRPE 4XPAL 3CZKA 4UOJA 4N87A 2EXWC 1SOSA 3CHQA 1J12A 2IO5A 5AVUB 3GB7B 4HX1B 5E4OA 3TZVA 1IGTB 4CC1A 4G5ZL 4B9CA 4E5XB 2P7TA 2FBJL 3TVMB 2QKSA 5CINH 5F6HJ 3S97C 3NSJA 2B7DT 4NT6B 5D5MF 3F65A 5DHVA 4QHNA 2IFFH 5HGHA 1PVHA 5EU6E 3O4OC 3MRFB 5DMKA 1IFGA 3QDJE 4L8BB 4RZKA 4P2YA 5F3BA 1ORQB 1C1EL 5HHVH 2N59A 5I1AA 1DZ0A 3FO0L 3MTXA 2KMWA 2GTWB 1XL4A 2XU9A 3HNVL 1F00I 1WEJL 4W9CC 5GQBA 3TTYA 5FLUA 1VFOA 1ADWA 4HWBA 3G6JB 2NDGA 3QR1A 4HULB 2O4EA 3L1FA 3QZMA 4Y5VC 1HJBC 2PF6A 5DWUL 1IAOA 2Z7WA 4UV4L 3D7PA 4X8JB 5IV2A 3GMQA 1LQBC 2WOBA 3T1FA 4G7VH 1BFTA 3U7WH 4BYHA 3QCTH 3MLRL 3AWGA 2WGXA 3G5ZB 1XD1A 4JANB 3H3BC 2F8XC 4ONFH 4JHWL 2AANA 2F5AH 4XTRD 1R17A 4K8RL 1AQDA 3NQIA 3A0OA 1D5XB 5HYFA 3QUZA 1CQYA 1JF6A 3K6SA 4ZPVB 3L6FA 3MRJB 5KN5B 4W6YB 3GJFB 3V55A 1EPFA 1Q38A 3REVA 2ZZUT 3MRHA 3DMMD 3EGDB 1AKJB 3ARWA 3UX9B 3EJSA 1E9PB 4MZ2A 4N28A 4XODA 5G55A 1F97A 1YMMD 2HYMA 3BH8A 2RB8A 4OAWA 2ZOKA 4PTTB 2BOCB 4ABWA 2CJTA 4Y16B 4KKLC 4O4YL 1RCYA 4LHUB 1SJHB 4J6IA 4WLCA 3RNKB 5IROC 4PLOB 4XHJC 3ZE2B 5M7QA 1BYOA 1FF5A 4OGYH 1AZZC 1KB3A 4IYKA 3U48A 3SOBH 4NPJA 4JN2A 3DK0A 4GRMB 1TEFA 2NNAA 3QJOA 1KPRB 1DVTA 4PJGA 4U2ZA 1YEKH 3I9PA 3LY6A 5D1XA 3IK2A 4KXDA 2UY7B 5C0FA 3GMRA 1Z9PA 4PI2A 5AZEL 4HAKA 4I7ZC 5BZWB 3W11D 1PJ9A 5ISZA 4RSYA 4XP1H 1UENA 2I9TA 4LLQA 1JCVA 1ZA6A 2P8PB 3MYJA 3GSNA 5GZOD 2VDQL 2ZP0T 3NN8A 2VITB 2XKSA 4WU7A 1U0QA 2UZXB 2HFEA 2RD0A 2W07B 4UMSA 2L3BA 1X4XA 3FCGA 4K9EC 3QHZL 3MZTA 5AYTA 2PXYC 2WXQA 3NIGE 4ES8A 3ABMB 1B0RB 1Z9MA 3V4PH 4L8CB 5J6SA 3I9AA 4NWUH 3AWFA 1ORSA 5EOCL 4DAGL 3N43F 5I26A 1OCCB 2YBRB 1CXKA 3D4CA 3MX0B 4Z77A 2VXQH 5AKTA 5CEZH 5CZVL 1UM6H 5AQ0A 1CYWA 3WXVL 1Y0LB 3TCTA 5DRWA 4JRYA 5DS8B 4UQ3A 4YR6A 4LO9A 4RX4D 3WKYA 2BNQB 3WFDH 5HHMD 1X7QB 3U7YH 4HQQL 3HNTL 2WP3O 4A7TA 2YK1L 1I8LC 1IKFH 1EHAA 5IB2B 3MV7E 4QRSA 5BRZD 3WTWA 4NO0B 4Y2DD 4Q2ZA 3P9WB 5BUGA 2H2PC 5IBLD 2WUCH 2X4SA 4PJ5D 1ZS8A 4ZTPH 1UWGL 2ZF8A 3RI5F 4X5LA 3PE9A 4HJUA 2NCEA 5FGCB 2V5SA 4H8WL 5AB1A 2D0GA 5AENA 2ZAIA 2FBOJ 1W91A 4LSUH 3W0WB 1UADC 3WV0A 3O4LD 3FQRA 5EIQA 3VD0A 1OE3A 5AVXB 2AAAA 1D5RA 2PCPA 4XN2A 1JGLH 1HCFX 2LW3A 2P80A 4DTGL 2OYKA 1GC1L 1JHTB 1JVKA 1KB5B 1DQJB 3O3DB 3OVUB 3HC0A 1QR1B 1IAIH 4ZOAA 3DGGA 4WI4A 4PJHB 2IAMC 3AU0A 3DJTA 4HFUH 1A1MA 4YDNA 2RR3A 4HS8L 1OTUC 4JW3A 5B22A 5LBGA 3WNOA 4HAGA 2IMMA 3GYRA 4AEFA 5GZNC 1SYSA 4IBVA 4KNQA 1MW1A 32C2B 4LLYB 4FNLL 1L9RA 2Y72A 2QELA 2WTOA 1ADQL 1NFKA 2VDMB 2WIIA 1BBDL 3P3SA 4UDTA 4GRWB 2VIRA 3W39A 4C83B 4PV8B 1OANA 1DLHA 1OE1A 2BP5M 1NFIA 1NCJA 4LEEA 3CSYB 1DQQB 4JFDE 2VDOL 4XI5C 5DC9B 5CD3A 1NC4D 3BIKA 3TBWB 1CFNA 4U1KA 5EZLA 1EXHA 3DX9A 3I50L 3IDNB 2OK0H 3IVKB 3H9SB 4GXVH 4QRBA 1LILA 1T22A 1OPGH 4XMXA 1P4IL 3FUKA 1ACCA 3TO4B 3WMPA 1DQDH 1D5ZB 1S5IH 1SFHA 3VXRD 3RFZC 1NFDA 3I75B 2PLTA 2BVPA 3BESR 3F85A 1XEDA 2RGSA 3ML8A 2ADGA 2VZTA 1NCDL 1U33A 3KLAB 3X1GA 5CGYD 2VABA 3MRQA 4F24A 2WZAA 1TKWA 4N1EA 2WQXA 8PAZA 3KZ8A 4M9OA 3I6GB 5E8PB 3VFTA 2BMKB 3PWUB 4GQ9L 1FIEA 1GY1A 2BW5A 4OIBA 3ZTCC 5K59E 3CFBB 1FDLL 3Q1SL 1HDMB 3SCMD 1T66D 5IK3B 5HPMA 1BMGA 1SM3H 4GAAA 4U1SA 4NQCA 4L37A 4XNMB 1R5VA 1A9BA 1CICA 1B3IA 1DEDA 1HQRB 5C09A 3TFKC 5HYJD 2P5WD 5IEKB 4Z9KB 5AVSB 5LB1A 3T2NL 4NO3B 3HHSB 2Z8RA 3T6ZA 1J8HB 4NKMB 3L3JA 5ENWB 4HJ1A 2XXMB 3QIBB 5SWZA 1EV2E 4EI5A 4LHJB 1Y07A 4NQQA 4CSTA 2YMOA 2A6DA 4L3AA 5DVPA 5EN2B 1CBVH 3S35X 3ESUF 2XSKA 4G43A 3RDTA 4N3UA 3JV0A 4KQ4H 3D18B 5TF0A 3CZFB 4W9IC 4Y8DC 3LS4L 2QKIC 1CFMA 4M8QB 1EAOA 4Q56A 1GHFH 5AZUA 4QO1A 5AVTB 4L29B 1FUNA 4X80L 1WIUA 4MRCA 4PUBH 3NTCL 2AGJL 4HUKB 1LWRA 1K85A 1R6VA 4JM0A 4Z7WA 1OP4A 2RACA 1UZ6F 5KJ7E 3EOTL 5EF0A 1MCSA 2ENSA 2WWKT 3H8NA 4JRYE 3UG3A 4ONGL 5IGXH 3T77B 2NZIA 5I6XB 3IFNH 5KYXB 1BYPA 4HUWB 3MQIA 4OLUH 2VDNH 1AR1D 5DJXA 5F9WB 5HGAA 1ZCRA 5EBWA 2O72A 4LOUD 1MHHB 5F9OH 5ACMA 3C6SB 2MIZA 4C56D 1L9NA 3BQUB 1D6EB 2FB4L 3KWUA 3QWQB 3IXTB 1MXDA 3GNML 3BXNB 1HIMH 1FORH 5AUMB 4K7FB 4NKQB 2H1LM 5E2WH 1ZLWK 2VDML 2EDOA 3VB8A 4KXAA 4JFFA 3JV4A 3MNDA 3B7UX 4ODHH 2NZ9D 2F6AA 3IJSA 3QXWA 4FG6D 3NIDE 4LCIL 4PJIA 5K93A 1PG7X 4BE6A 3CLEH 2D3VA 5LCVA 2MEJB 4PY7B 1CLVA 3WJJC 3X3FL 5FO7B 4E0RB 4PRHD 3MNVB 1OK0A 2ESVE 2CKBA 3BC9A 3QAZB 4Q6IB 1IGIL 2XG4A 1J05A 2ZX8A 1QKZL 2C9UA 1JWUB 3AW5A 3EDDA 3LQAL 4O02A 4YLCA 1IE5A 2A6IA 2VXTL 2YD5A 5GS3A 3EYOB 4PMFA 5LWYL 4GW4A 1YO4A 4X6EB 4FLHA 5C71A 2AJXL 2D03L 4FERA 5C9JA 3OAYH 2BSDA 1N8OE 3FFCE 3VI4F 3Q8AA 4G8FB 3AY4C 4GS7B 1JERA 2O6PA 3F58L 5LGJB 1UASA 3PL6B 2F58L 4BKLB 1HNYA 3PGDA 1VDGA 4ZPTA 5I5MA 1XSIA 2YUZA 3HMXH 1VADB 2XYCA 3K2UL 3L7EB 5F0MB 4NZDA 1SXSA 3BWZA 5IW3A 4DZBA 1NFDE 3L3KB 3IJYA 4HPOL 5BQDA 3SDCD 2DMKA 4X0KB 2JELH 4KUCD 4LCCC 5FF6B 3FC8A 4XC1L 4PREA 3JYBA 5HDBF 3MBWA 3RB5A 1LP9A 5DEFB 2XPGB 5FA3A 4F1SA 4ODSH 4JHUA 1O5DT 3TBSA 2XZAH 5GHWH 1AD0B 2LTQB 3NAAH 4J1UA 3GWJA 4YHML 5E2UL 4FFYL 4JFHD 4KV5F 4RA0C 1ETB1 3QRFM 3CFDB 4MB3A 4Z8FH 3KLHC 2ENYA 1R0AH 3BUDA 4GI6A 5B3SB 2H26A 1MCRA 3L1OL 4CMMB 4DH2A 3UJJH 1NIBA 5SWZE 2SEBB 2QHRH 5C86A 5AOLA 2ZCHL 1AKPA 5IB3A 2Z6FA 5E5UB 4N1HB 3PXLA 3VWJC 1DSWA 2R2BB 2QTEA 4QRRB 5JYMA 4HISA 4BWTA 1UATA 4IMKC 2X1QA 5B7MA 1LK3L 1WFMA 4YQXH 3Q9PA 5EA0L 2K9FB 2NXZB 5GGSA 4EDWH 4NHUB 2YPLB 5D2LB 3C5ZA 3L9EA 1T5XB 4Z7WF 4Q0XL 3ZHKA 4U33A 3FQXA 3IDGA 1RLBA 3MJ7B 5DTFA 1E5UI 2APSA 2OP4L 5JQIB 5JOPE 1F4XL 3RUGB 3ZRCC 4IK6A 3PJSA 1BCIA 3ALXA 3WIFA 2I9LA 2FJHA 1OCWH 1R47A 4PV9B 4AT6A 4DVBA 2C9AA 1N8ZA 3JQOB 3D34A 5DMIH 5CSZB 4GAYB 2UZYA 3D9AH 3TO2B 3RVTD 3TWCL 1JF5A 1CL7H 3M86A 3I3BA 4J7RA 3EF4A 2G2NA 5ANME 2HH0H 2WWKO 4DPCX 3V6ZB 3D0AA 3TV3L 2UXGA 3HRZB 2AQTA 5FYLL 1WITA 4LASH 3S2AA 4YSAA 2DF3A 4LSTH 4D7PA 1DTUA 4FHBD 3O8XD 5JOFB 1I1YA 2DJUA 4TTDC 1IVLA 5D6CB 1QLRB 2AK4D 5E7FA 1MCDA 3BDXA 2XVKA 3VXSB 4EVNB 1AYOA 1EZLA 1QLEB 2KQMA 1KTLA 3B43A 3N0AA 5G5DB 3VE0A 3ATAA 5GGRB 4AENA 2QMJA 3ZDXE 4Q9BA 2NY4D 4D9RE 1I1AC 3AG1B 4FEMA 3KVDD 5J3HD 4TVPD 1Z0NA 1A0QH 3O45A 4ZX4A 5FUZL 4AV0A 3O2DH 1CDGA 1XMWA 1NUFA 1XF3A 2HJFB 1I4FB 3CD4A 3QDGE 5EHFA 2FL5A 3FQTA 4GT0A 5EZOL 4LAQL 5K33A 1A1NB 4ZUSA 1DFBH 4UM8B 3T08A 1A2YA 4P5TD 4FEIA 2Q2LA 1KZYA 1NEUA 2I60L 3WS3A 4UT6A 2DYRB 1SEQL 2A5UA 4RETB 3ZIMA 4OF3A 3B3IA 5FB8A 3CDCA 4ZODA 1P7BA 2C26A 4WSKA 4XC3L 5DS2A 5CR8A 4LLDB 1EEYA 2EUVA 4K71C 4PCKA 4U1HA 4JY6A 4JPIA 2WBJC 1S7WB 4FC3E 4L5FL 4KNSA 3TFKD 2ICWB 5HSFA 5IZ7A 3IFOB 1ECYA 5ALBH 4B9ZA 1WYJA 3NIFF 1JWMA 3O9WB 2WBKA 4X99A 2I32A 2DLFH 2DLIA 2QADC 1OHQA 1PZDA 2G5UA 3WLBB 3BHBB 4HIHA 5IVXF 4RISH 3V7MA 43CAB 3QORA 5I1JL 2VDRB 2QT6A 3UYRH 4B9GA 4H4NA 1IQWH 3HI1B 2EEFA 3KGRA 4KJWC 4G6AC 3QYNA 1D5IL 5JW4N 5I0XA 1TO5A 3BJ91 3AG4B 2BPBA 5I1IH 4OGAD 1P6WA 5KVFL 5C3IA 5B1CA 1QRNA 4KX8A 4MX7B 4H8VA 3QIUC 4FXGC 4JZOA 3BEWA 4YMPA 3D3VB 5TGBB 1MCKA 3DPBB 4JQVC 3FH5A 3VX1A 1AO7D 3ULSA 3KBFA 2DQDL 2JI3A 2YXMA 2PMZA 3NFSL 4GRLD 5FGBC 1NGYA 3GSWB 3KPNB 3SPGA 1GCYA 4TPRL 4JFOB 1YEJH 2NSMA 4OT1H 2UYLB 2F7OA 4BJLA 2PP8A 4CVZA 2J88L 3BDYL 1T5WB 4UBDC 1MJ7L 5K5YA 5E6ZA 1D7FA 4N0YH 2Z8VC 1BDYA 3BKJL 4TYUA 4Z23A 4K3DL 5IMLB 2FWOA 1L3WA 1LM8V 5DT1H 3QXUA 5I0YA 4Z5RB 4ZO9A 3LRGA 5EIIB 3BFQG 3TYGH 1O6TA 4Y4KC 5K1NA 2FR4A 4OI8A 3FONA 2D9CA 1ID2A 3BSHA 4F2EA 4U6TA 4WY7H 3V0VB 5DD5L 3WY4A 2MCG1 1QABA 3V0JA 4YZFF 2VZOA 3SKNA 4U1NB 3T3ME 4ELMB 2HT2C 4QGTA 3RZCB 4UQDA 2EIEA 3N5AA 4M3HA 3IDMA 5EBLB 3GJEB 1IZKA 1HKLL 2HRHA 2F8VA 1F58L 2ZKXA 4R0LC 4XNXL 3FAWA 1U8HB 3GI8L 4C55A 2DYPB 2CK0L 1R5WB 3VXUA 1M6OA 2VMCA 3NZHH 1FA4A 4MNGE 3TZVD 2V4LA 3MV9E 4YDKH 2WYIA 1DCEA 2QLVB 3LXUX 5SX4H 4P99A 3US0A 1C12A 3V10A 2ZP9A 1RZFL 4X9FA 4ONHA 4M7ZC 4XPGL 1HQ4B 3PP3K 4GAJH 2CRMA 4ODXA 4Z3FA 5IM7A 4IDLA 4IK7A 4LK4A 2Y7QB 3MOAH 3MRPA 5FYKE 3T8MA 5H37A 1AR2A 1MWAA 3GMMA 4AMKH 4JRLA 5ITFA 4LL9A 3FUHA 3TGXA 4KKCD 4ERSL 5DMGD 2LFGA 2YGPA 4A6YH 1BQRA 3K71B 1XGPA 1QEXA 1PZ2A 5C0BD 5I8OH 3KPRB 2XWBB 4ORGB 1L3NA 1NL0H 2AK1L 1N64L 2MNJB 4XMKH 1XR9A 1SJXA 4BK4A 1CBJA 2AQ1A 1H3UA 1MFAH 3P77B 1YY8A 2O5XL 4G9FB 5HVHC 5H8DA 1USZA 1HHGA 1LD9A 1TXKA 2EXYD 3HZVB 4OQ1A 3WBDA 5TPWL 5INCA 4Z76A 4PR5B 3LRMA 3BZEB 1TJIL 3VRIB 1RIVL 1UJ3C 3NJVA 4ZFQA 3MRBA 5JIQA 2VDRL 1I3RA 1WBZA 4JZJB 3B7RL 1F0LA 2WQUA 5DK3A 3ARBB 3FUEA 2MSPA 3FOMA 4H0LC 1CD0A 2CPCA 2H32B 1X44A 5J6HB 3ECBA 3OQ3B 4BRJA 4QYAA 4X6FA 4XRCA 1YY9C 4IOIB 2DRUA 4ZUUA 1NH6A 2AEIT 3GMLA 5FPIA 2YD3A 1OB0A 5I6OA 4QWWC 4KJQC 1FL5A 4W4OA 2YQGA 4PJ9B 4A2GA 1MW0A 3BFOA 2BNRE 3PGFL 2X1XR 4JFXB 5HXMA 1JGDA 3A21A 3GRWL 4OLZL 1CD1B 3F04A 4PS8A 1OSPH 1FRGL 1GPOH 1QBMH 5LDSA 5A2CA 1PZ5B 5EZPA 3VG0H 1NGWB 1E2ZA 4DO6A 1CIDA 2YD6A 4I48A 5JNYB 5D1XD 1H5BA 3DO3A 3PWPB 1U3HB 1CG9A 1FFOB 2HFGH 1IC0A 3B9EA 2AJYH 2XBTA 3UP6A 1OXYA 3GBML 2W65B 3FDWA 5ISZD 1ZXQA 5K1VA 3REWB 1ET5A 2NRDA 1KTDB 3S5LA 4Z95L 4TQHA 3MR9A 4M5ZH 4ZUTA 1KCBA 2L7EA 3MLUH 2P49B 1G7QB 3HI5L 1EVUA 4A7GF 1MCOL 2AV1B 1E4WL 5E9DE 5A6MA 5JTWA 1N4XL 2IAAC 3SYOA 3UGUA 2QQLH 1T21B 3HCVA 4FZ8L 1NOFA 1BLIA 3L81A 3QH3A 2VAAA 4Q58C 2XN9A 3GXMA 1RJLA 1MN4A 1H6UA 4KVNH 4OSUL 1JXKA 4KAQL 5C0GB 5IVZA 3LH8A 2HFTA 4OR1A 5GSVB 2IQAB 3EH3B 3FCTB 4FQIL 2DQEH 3VSQA 1MREH 1Y1UA 5TQ0H 2YARA 2CALA 2Z93B 4AZ8B 2OR9H 2F61A 2NY7L 3F3HA 5JW3H 2P5EA 2GPZA 2ORBH 2GT9A 2FIRT 2DW5A 4MB4A 2EDLA 1QWNA 1DVFD 3D0VB 3T0VA 3AACA 3CFNA 2IGLA 1PF3A 4NBZB 1D2PA 2HP4A 2BSTB 5C8JB 4ZTOL 4WGKA 3FCUB 4XVSL 3CVHH 3MXWL 1I9IH 3I6LD 1EEZA 2EDBA 2GFBA 4DNLA 4GG6A 5T3ZD 3C2SA 1S7UB 4MNQD 4FLOA 1F02I 1QBAA 3FU0A 5H35A 4Z18A 3IXAA 4HSAC 4OV5B 4YHNB 2IGFL 1F4WH 3AXLA 1F6AB 1TCRB 4IRSA 3DI3B 3WO4B 1QFHA 1DHKA 4WI0B 1QUPA 3TEXA 1RU9H 2BVUA 4U4IA 4LGRB 2NNRA 1RK1A 2ATAA 4NWTL 4AWJC 4E9TA 4JFZH 1KGCE 3S48A 1BPLB 4X4MA 4QR7A 4GKNB 4O2CA 2Y2WA 2HT4D 4TQEH 1KCSH 4HHGA 4N8VA 4OGQC 1R3JB 5EU3B 2RCSH 5CJQH 2QEJA 2YOAA 4WAFA 1QNZL 1PLAA 2AXHA 3G04A 5SWSE 3RWEB 4AQ8C 3ZKSD 4PJEE 3VQMA 3B37A 3LZFH 5LBVA 1K4DB 3QNZA 2YEZB 1TTBA 3FU9A 4K23L 4KJWD 3BZ5A 2J43A 1EXUA 1YMME 5F96H 4M93B 3QRLA 5KSAA 4QHLA 4PRDB 5IHLB 2AJVH 4HP5A 4FXKC 3JZ7A 4N24A 5IT2L 4HK3N 2FIKB 1I7TA 3SY6A 4RGMB 4JHZA 1ZSDA 4YIQB 3UBXB 1N7MH 2YEVB 1NBVH 3LEXA 2HX8A 5F7UA 4A66A 2JJSA 4JG1L 4YXLH 1OQXA 4HWBH 4F58H 1DQLH 5I17B 3FFDA 5D7LA 2XXFA 3N85H 1P5UC 3CZSA 4HGWA 1KNOB 1MSPA 5ABZA 1BIIA 2HKHL 4GXUN 5DVOA 5E2VL 2FBRA 3HUJA 3OJ2C 1I53A 5CAYB 1BOGA 4O9HH 2YZ1A 4XCFH 2BDNL 4NQCD 5IB5A 4P4RA 1GS6X 3IS0X 3NCFB 3OAYK 1FZJB 4NX0A 3OAUL 4BA0A 5I1KH 2IXQB 5C09D 4LLWA 1GAFL 1KIUA 4WTQA 4FZEH 3ZKNC 3BVDB 4JDEA 3EO1A 1VFAA 1HNGA 4FRWA 4PJFA 3M1BB 2QL1A 2ATPA 4OKDA 2AITA 3LKRA 1EAJA 2ZUSA 1YEIL 3O3BA 5ABAA 1KLUA 3SE8H 2Z31B 2JJVA 1ETJA 4JHBA 2HT2D 4IGBD 2WLHA 1DN0B 5HHME 1KIRA 3CSFA 4E9RA 4MSWB 2FX8H 3C60B 3F7PC 3MGOA 3PP4H 4FYQA 5FDYA 4LRIA 4NZ8A 2GITA 1SXBA 5GRVK 5EV7A 1HEHC 3ZHFA 2X6BA 2F9BT 3ZE2F 3SHSA 1QOKA 2H0EA 5D1QB 4BZ1L 2NXYB 2G9HB 3RRQA 1KELH 1D3CA 5GGTL 3DI2B 5IFAL 3M46A 4I0PB 1ZVSB 4OF5A 4I3SH 2R1YB 2XN9E 2X6UA 4ZS6C 1OTSD 5T5FH 5HYQB 1YYLH 5J12B 4MA8H 3A4DA 4PHXA 5AW9B 5AAPA 3IBOA 2DMBA 2BP0B 1BD2A 1MQ8A 1U6AL 4P2RA 3HJ0A 3T6XA 2X70B 2XOTA 4WFEE 3ZBMA 1IC4L 3HE7C 1NC2D 5T1DL 3RVWC 1MFCL 3TOPA 3M17A 4L3EE 2XA8L 4NP4L 1RZQA 4AG4L 2WSPA 4U3SB 1YJDC 1U92A 3SQRA 1B88A 4JO3H 4F9LC 1L6ZA 4OJAA 4KXZI 5CINL 2F08A 3B2UC 3BAWA 1N2RB 2XACC 2HMIC 1RJZB 2LU4A 5IEHB 4BFIA 1PYWA 3WTSA 1CLCA 1Q9OB 3C8KB 2C9RA 2A4EA 4NZRL 4BELD 3RAJL 1T89C 1HZHH 3GMOB 3CTTA 5B38A 2RAMA 1VKXA 1LMKA 3BUYB 3MDJA 5MEND 2W38A 2WLIA 1HXKA 1DQMH 4H0IA 5I73C 3IKCA 3RDJA 2XBDA 2AXFB 3FB7B 3NSDA 4P23B 3E1ZA 3QQ3B 3HBQA 3UTSD 2WUBH 4HD5A 4WQOA 4JG0L 2BNUA 1HK6A 3D0LB 1B90A 4QWWD 2CUMA 2PR9A 1IV8A 3WFHB 4A7QA 1R3HB 3CSPA 3GBEA 1EZSA 2EE9A 3U36B 2GUOB 3MMEA 3ZHLA 2CGZA 5DO2D 4IMLB 4TM9A 1TF4A 2AABH 3QCTL 4X5XA 3V4LA 5AW5B 1E4XL 4A63A 2E8ZA 2QPEB 5AL0A 3IPFA 3ZT6A 5E4EC 1ZRUA 1JPTH 3NEOA 3LNEA 4FFVC 4PS7A 2OJ1A 3II3A 3LHPH 5BO1L 2H1PH 4OCSL 5TQ2H 2JJUA 2VLKE 4C59B 1ED3A 5D7IF 2V8LA 3X12A 2WXPA 4J3OG 2A77L 1E43A 3BSGA 5E8EB 2WXRA 4PGZA 3OR6B 5I9QC 5MEQA 1BBJB 3ZDZB 1TETH 4LVNC 3C6EA 1BZDA 4N6RA 4A55A 1JMZA 4ZX3A 5HDQL 1FNFA 1I8LA 2XXCB 4U1GC 5IQ7H 3QEUB 1CGSL 3BOVA 3MJ9H 4KKAD 1Z1WA 2CDFA 3QYCA 1MRCH 1Y18A 1G94A 3DOSB 2ZXQA 4DCQA 4OGYL 2JB5H 3BGMA 5FO9A 3X11A 4G80A 1GGCL 4X0NA 3QDMB 3HUJE 1QD0A 4EUPA 1WTLA 5CMAA 3VXTA 4WGWB 4HLJA 5C0CB 3CZNA 3D69B 1HYSC 5FGRA 2BS8A 2VN7A 5GS0L 4FGMA 3RVUC 3C08H 3FMGH 2JLPA 4B3VA 1LLAA 1GS7A 2CLZB 2RQEA 4XBMA 4M61B 3TC9A 4QRQA 3DRQB 4PJXA 4XP1L 1NMAH 4J3OH 2AZAA 2QR0A 4UUJA 1S7VB 2EC8A 4PGBB 3BKCH 1RL1A 4G82A 5GZNA 5M95B 5INDB 1C5BL 3JBG7 2E9IA 1CZ8H 4M48L 5JUEL 3DHUA 3IE9A 4KWUA 4JKMA 3T0WA 4B3EA 3QUXB 4NWUL 5AOKA 2Y23A 3U1SH 3U4BH 2VRQA 1ROWA 4DGYL 2KZBA 4C56E 4E9WA 2B5IB 1JPGA 2APBA 4G6JL 4IRJD 4JEGB 2ZYIA 3NZ8B 2J1YA 1CFVL 4S1SH 4Y9BA 3UBHA 1UXMA 1NAMA 3HC3H 4KOCA 1ZGLP 3VFVB 1OM3L 2FHFA 1D9KB 4R7DB 4NQEA 1XXDC 2H9GB 4X7TB 5EUKA 2G3XA 1VA9A 5DC4B 3VJ6B 4ZTPL 3BX7C 4GY4A 4L9LA 5FOJA 5FOBA 4OD2B 3GTVA 3U46A 4LCWB 4ANWA 5IFJA 3C87A 2VXSL 3LZOA 4LQFL 4WV1C 2XVGA 4ESKA 1CLOL 2AEQH 1KT2B 3WIAA 4BUGA 4M4RA 3QZWA 4OCRH 4XMVA 1E9OB 1O6SA 1XTMA 3POCA 4M5YL 3IFLL 1GL4B 1M1SA 3ILPA 5DJ6B 5E9NA 5AYUH 1IAIL 2XKNA 4PJCA 4MB5A 4X4YB 1ZTXE 4N68A 1WAAF 1NDGB 2NUPB 1JPSH 2FECI 1G7PB 2WWMC 4RMBA 4AKQA 5JA9A 4FQ1H 2NY2D 4MMZC 2FZ3B 3EBIA 43C9A 4DP7X 4BDVB 3S2CA 3OKEB 3KPOA 3PABB 2DJSA 2WNXA 2WGNB 1CC3A 1KJ3H 1J0ZA 5I2IA 1QVOB 2VGLM 4OFDA 1SY6H 2OL3A 3MLPA 4C58B 4U7SA 3CZLA 2X4TA 4RAVA 2BSEA 4X6CF 5D1ZC 2A4ZA 2C3VA 2OK0L 3ZZLA 5FKAB 1NLDH 4UT9A 2CSPA 1L5GA 2BSRA 3R8BB 1OARL 1MCIA 1KEMH 5HGBA 4JM2F 2QKIA 3MLZH 3VXME 4NQXA 5DJAB 3IGAB 3RJQB 4NSKA 2COQA 2JB6B 4BCZA 1JYXA 2CLVA 2Q86A 4WI2A 6FABL 4B9JA 3S37H 35C8H 3RVVD 4F3FB 4OLYH 3QORD 3BP6B 5TDOB 3S35L 2AFNA 2OULB 4PIBA 4UQCA 3ZE1E 2HX9A 3RTQD 2X7LB 5F6IB 1UOWA 2OTPA 3L9RA 4P4KB 5IHBA 3ARDD 1VENA 2XNAA 1A6PA 3PCYA 4OKVA 3W2DL 4CKVX 5GRXG 4JFEB 3PAZA 4YDLB 5IJCC 4HC1H 1U2HA 4ZQKB 1TENA 3QDHA 5GGQL 4JRXE 3NPSC 3QA3B 3ATDA 3SDDC 1XMEB 2FWLB 1IO4C 4MWFB 4HK0A 4AIOA 2OBGA 1BZ7A 1QFWM 2A1WL 5EO0B 3ZKXB 3D4GA 4PYHA 3MLTB 3E3QC 2P48B 4ZS6D 4CL7A 2K1MA 2ZUQB 3EUDA 2CU9A 2VKWA 5EOTB 1B9KA 5AL8A 3SIKA 3ZL2A 2OI9C 2A9ML 3TN0B 4NYLA 4WNSA 1NCBH 3OPUA 2KQNA 2ZE0A 3MCG1 2I69A 1UOLA 2KZWA 4HD9A 1DLFH 1G9ML 4KH2A 3WTUA 3TA3C 1N10A 1S7RB 3IB4A 3QISA 2H41A 1O7DC 5T3XD 3ESVF 3UJTH 1V3MA 1H15B 5F72S 2W0FA 4P5KB 3QEQA 4PJ8C 5BNXD 5C0AA 3B2UD 3O6FB 5E4IA 1B4TA 3LN5B 3WDHA 2HMID 2P43B 3BSZH 3K2KA 5EUOB 2EYRB 4GSUA 4JBSA 1PG7L 1B4RA 4PJAA 1DDTA 3P3TA 2Z4QA 2F53A 2D31A 4NUGH 3BRDA 3V5KA 2DM7A 4CJ0A 3RWFB 1RJYB 3TTSA 1ZIAA 3MN8A 4P0DA 1HXMB 1Z7JA 3AY4A 2GBVA 4O00A 4MS8C 2YC1A 4IEFB 2AJUH 3IF1A 4TSBH 3CCHB 4J8RA 1HSBB 5T1KA 3RL2A 3H7BA 3S3JA 4ETYA 4F8TA 2R2HB 5F7NC 2ZXBA 3ZL4L 2R1XA 1VPOH 1PIGA 3H7LA 3B7TA 2WINA 3BUBA 3RGBA 4Q9QH 3BISA 4TVPE 1T4WA 1MXGA 3L5XL 3U30B 5EU4A 1FNEA 4LCCA 1HIML 1PSKL 1WFUA 4CSZA 1M7IB 1O7VA 2Y5TB 5KVGE 3UMTA 3DVGB 5F89B 3HPJB 5ESQA 3STLB 5A3ID 2GEEA 1W0VB 3OKLA 4M7LL 1RZ7H 4HS6B 4YDJB 5DK2A 1HWWA 4BWWA 2AXWA 2P24B 4FXTA 4PJ6A 2Z4TA 4XPTH 4HMCA 1T04B 4E36A 1KDIA 4PJCE 5J7CC 3QFDB 5F9AC 3OL2A 5JHDE 5AOJA 3BPLB 1GJIA 1M57B 3BP4B 3D39E 1FL6B 3ROOA 3MXVL 1BFOB 5KSUB 1KPVA 2KLSA 5FYKH 4P59L 4AQ1B 1XSJA 1YLBB 1GTFA 2PPCA 4U3XA 5DQJA 3MLVH 5F8RC 1S7SB 3CH1A 4KX9A 1FGVH 3VWJA 5LGYA 2J6WA 2Y2TA 1PNCA 2ADJA 2C3XA 1SOXA 2KHAA 5E2TH 5JW4R 4IMKA 5KYYA 3FYEB 2HG5B 2P8LA 2NT0A 2OMZB 1W80A 4X9YA 4G1MB 3RLSA 2H6OA 2ARWA 5C0JA 3QULA 1JHKH 5AALA 3CDFA 4EQ3A 4J6RL 1S7XB 3WFBL 5KBLA 4HWZA 3K72B 4IHOA 1WUZA 5I75C 1JGEB 4N8CL 1AO7E 3L2NA 2R69H 1NANI 3CMOH 2DM2A 3X13A 5L4JA 3P4OB 5K69A 2ICCA 5LHDA 1A6ZB 2OMWA 4HOXA 5HGDB 3VD4A 2ARJQ 4KITB 4LAJH 4W70A 5GRVL 2APXA 4ZAKC 4QHMA 3EZ8A 2XWZA 2GSGA 5EC1A 1BP3B 2ZG1A 4HJTA 1R24B 5BV7L 3ULVF 1GOHA 5ERWB 4JN1H 4R2GB 5GHWL 4DFHA 3VGAB 1ZLVH 3MA9H 1JYWA 4J3TA 3IDUA 4RESB 1T1WA 3T4AB 5DEGA 2OXGB 4KTEH 5CJ8A 4IW4C 3ZYIA 3ECQA 4XXDA 3HN5A 4KVPA 3OSKA 5E5MB 5JQHC 2ZYSA 2DMCA 4W4NA 4JHAH 3MLSH 1AE6L 1PLCA 4GKSB 3BFWA 3OZLA 1BZ9B 1ZT1A 3O41B 1KN2L 2H8PB 2WZ0A 4XWOC 2FJGA 1I1AA 2VM3A 2DN7A 2YQ2A 1LEGA 1CS6A 4HPHA 1EA9C 4RFNC 4H20H 2XQBL 5LNDA 4PM1A 1QSFB 1NOAA 3HE6A 5J6GB 1JS4A 1Q4NX 1DQKA 2WCSA 1EZVX 5KS9A 2YN5A 5IQNA 3CXHJ 5IMKB 3PU7A 1UUNA 1BEYL 3RQ3A 1L0QA 4AYBA 3AM8A 2HTLD 4G11A 1ZDSA 2K45A 1FSKC 4X4XA 5EZIL 4AEIH 1ZHNB 1N5AA 1U8OA 3H1ZA 2FHCA 1XCTA 1MH5B 4HKXB 1LWHA 2XWTB 2ZUYA 4F37F 4FYTA 1HZKA 1WH0A 2D3LA 4FNSA 1KTKE 2Q7YA 4TLSA 3KM1A 2P5ED 2ZNXA 5E0QA 1S5HB 5C0IB 4ZFGL 1VGKB 1Z3GL 3FQ1A 2VE6A 2DJMA 1M7DA 2WM0A 2WD0A 2Y1VA 2WWMD 4CKQA 4UIKH 3N44F 5AW4B 1BWMA 3MRCB 1RZGB 3O11A 1FIGH 1TVBB 4YHKL 5C0BE 4KZDH 3VD5A 2EIBA 2ZX7A 5HDRA 5E8NA 1UZ8B 3GSVB 4M6NH 1IMHC 5H37G 2YRPA 1UWXK 1G7IA 2IVFC 2OMXB 4RNRB 3NCEB 3KNBB 5IY5B 2YRLA 4H26B 1O9WA 4NQDE 3V5HB 3IU4H 1JZ2A 3EGSB 4HT1L 1FV1B 1C7TA 3NCXA 4YVUA 3H55A 2IPKA 4P9HC 4U1JA 3RFRA 3CZUB 1G84A 4PGJA 4HCRL 5JOEA 2QZQA 2WB7A 4J2XA 2ED7A 4XCEB 1KENH 1X5YA 2CHDA 4NBXB 2IOIA 2R0WL 3OLGA 4R7NB 4J4PA 1JNHB 1NDMA 1OPOA 4IBSA 3OKNB 4P3DA 3ZE0F 1KWGA 3ULUF 3BPNC 3C2AL 1CB4A 4JQVA 4YDVA 1A0QL 3S3PA 1LNUB 3NH7H 4O58L 1JZHA 5BOPA 1D5BB 2NY1B 2HLAB 3JVFC 1X5FA 3GO1H 4N2DA 5LAXB 2YXFA 5DHXB 4DGIL 1W0WB 1FZKA 1URZA 1U8IA 4FQ2L 3DX6B 4FQHB 4G42A 4XBPA 4WWID 4O5LH 3SBPA 1MIEL 1A4JB 1P4UA 4BFKA 1GYWA 2CO1A 5H37H 3EDKA 4AJWA 1EK3A 4X50A 3J7HA 3BW9B 3HIZA 3QQ9C 3VMPA 3COOA 1GR7A 1NPJA 4LNVA 1T4KB 2VXVH 4YBQD 4W9HC 5EU6B 4HW6A 3QDJB 2FX9H 1IGML 2X88A 2Q5BA 1FNSH 3LMJL 3IWVA 1CI3M 1PKQA 5D7LD 2KZKA 3MRFA 3HG5A 3UPRB 3NFNB 5A2LH 3ESMA 1TJGL 3OF6A 1LEKB 1ORQA 3DTUB 5TK4A 4W9JC 3RVXC 1CLYH 4QRPD 1I1RA 5I18H 5IB1B 1VZHA 4ZS7L 1PEWA 2GTWA 3TA3D 2QLYA 5FLVA 1HCVA 1NCHA 1FCGA 1FVDB 3DX3A 1CDIA 2CBPA 2WQWA 3EFFB 3GHBL 3LKPB 4JREC 4TSAH 1EO8L 3G6JA 3MA7B 4IBUA 5IF0B 4Y0GA 5JW5B 4HUXB 3V4UH 1ONQA 4HXAH 2MHAB 4R4ND 5CLTA 1K6QH 4PJ8D 4R90L 1AY1H 1NAKL 2B4CC 3QQDA 2VDPH 3B4NA 1QHQA 1RXLA 1E8WA 1R3IH 2E6JA 3KYMA 5A2AA 5D7SH 4DP9X 5L2JA 2NTFA 3BKYH 2WXLA 1GGYA 3NCJL 1LE9B 3P4NB 1KJVB 3UDWA 2EADA 5GSRA 2E8YA 1OL0A 4RZCB 4UTBL 3ZMNA 2H2SD 2VR4A 2W1NA 3ARED 3DIDA 3G5ZA 3JWNC 4JANA 1IAKA 4HIJB 3WL9B 1IX2A 1SJEA 4AL8L 4LARH 1G7LB 3OX8B 1EQWA 1GXEA 1L7TL 3GTNA 3QFJE 4WWKC 2GK0B 3MGAA 1A4CA 3U4EB 3GBNL 1D5XA 2BWQA 4ZZKA 4OZIA 3P02A 2G75B 3MRJA 3EHBC 3EYUH 4XNZB 4PVNA 3BEVB 3GJFA 4TNVF 3TIDA 1A3LH 5DT1L 1ZT7B 5I15L 3T1WA 2X4PB 3TYGL 2K8QA 1BQ5A 3I6LE 1IC5H 4Y4HD 1YZZA 5T3ZE 1WLHA 1E9PA 1XF2A 3H6AA 4GUPB 1TYRA 2E9WA 2W9DH 3C6LA 3OXRB 3J27A 5AEAA 2F8IA 1QYGH 4M7KL 2XT1B 5KJ4A 2R4SH 4N2CA 4P3CH 3KPLB 4KK5C 2DQGL 1E28B 1IFHH 4AVJA 2DQFA 5BVPL 5FHAH 3ARTA 1BD2D 3Q6FA 4P2RD 4GRMA 3UP1A 2BY0A 2E56A 3HVNA 2D8KA 2WW8A 1GGUA 4W9LC 4GKZA 4QTHA 4HJIA 4MA1B 1JTTA 2ZUWA 4L0PB 3MSPA 3HS8A 4ZOCA 2CCVA 1PW3A 5GJTL 1Q0XH 3U79A 3O2VH 4ALAH 3EJZD 4Q74A 5H2BB 4ANUA 1VAHA 2VITA 1ZHLA 2UZXA 3NIGB 4PN6A 5ACZB 1EERB 4I18B 2Q87A 1HHIB 1NJ9B 4LSSH 1EFXB 4M1GL 2R51A 1IE4A 4GSRA 4PVMA 4ECNA 1FNGB 2J6EL 3II2A 1NEZG 2QQNH 1VESA 2Q2EB 3N50A 1B0RA 3S9DB 2ZXAA 2PWDA 1BFVL 3POHA 3U9PL 3QEGL 3AC0A 2B20A 1EH9A 2YBRA 3DV4A 3VI4E 4WFFE 3MX0A 2NUTB 5L8KB 2WOYA 3BMVA 1RZKH 3DOHA 4PS4L 5C9KA 1WWCA 5FO8B 1Y0LA 4UWQB 3VFGL 1J0JA 2PYFA 3ISYA 2CGRL 3MV7B 2OTUA 2BNQA 3QT2A 2GAZB 2R4RL 4PJBF 5H94B 2EDTA 5JIMA 1KIPB 5IB2A 5CZXD 1HAUA 4AGLA 3C5SB 3D08A 3VXNA 5CJXC 1USQA 1OM9A 3VXQA 4EEEA 1U8QB 2KC0A 1E0OB 2EKSA 3OMAB 5I1GH 4JPKL 3L9YA 1MFEH 25C8H 4ZW7A 1X5LA 5HDBE 2B0SH 2P7TB 4P46C 2E5EA 1G9NL 4JM2D 2CQVA 3UO8B 1U3NA 4AY0A 1A7OH 2O6DA 1V3JA 1MNUH 4QHNB 2GIYA 3EBHA 3Q8BA 4ZXBC 5HGHB 1JXDA 1JHTA 3US9A 1KB5A 4NZTL 2QVIA 1DQJA 4TKWA 4PCTA 5I1AB 4XVJH 1QR1A 3P69A 2NYYC 3PNRB 3VFWB 4XO8A 4N9OB 1WFTA 3N06B 3NK4A 1WIPA 1MFDL 1CWVA 3OZ9L 4M62H 4MAYB 3ZU8A 4JFDB 5IV2B 4PV8A 4WVRA 4DVRH 5DQ9B 4BBWA 3CSYA 1DQQA 2AQNA 1J11A 1QQDB 5FCUH 3TBWA 3KDMA 5DUML 3TIEB 1G0XA 4DP1X 3M8OH 1MAML 4IKNA 4EPSA 2ZWZA 3IVKA 3VDAA 1MFBH 3H9SA 5AB0A 2JKXA 4PS3A 3FT2B 3ZYZA 4KMLB 5IW1A 1J1PH 5DYFA 3VFNA 2IDCA 3QUZB 3L6FB 4X98B 3SDAB 2VNCA 3CXHK 4FG2A 3KWXA 3REVB 2WLNA 4OZIE 3KLAA 4NQSA 3ZR5A 3O81A 4CW1A 5JZ7C 4F9PA 1FNLA 1IT9H 1T6BX 3BH8B 2R29A 3MRIA 3PWJA 3KYKL 2O5YL 4UOQA 1UH2A 4XGZB 1O7SA 2D4FA 5E8PA 2WWOA 1H8OA 1EGJA 1W8OA 3PWUA 3R7QA 1MREL 3STZA 3WTYA 1D6VH 4O51A 4PD4J 1HDMA 3QI9D 5IBTL 1DVQA 2XUWA 2R59A 4L4TD 2ORBL 5EEZA 3RWHA 4I88A 4DEUA 5J56B 5J11B 5JHAA 1ZY9A 4XNMA 1NWOA 4JN2B 2JIXD 2YPVA 2XZCH 4PB0L 4POZD 3CFJA 4TNGA 1RSYA 2VZ1A 4PJGB 3LKNA 2EVJA 4I4WA 4YBLB 3GKWH 5MENE 1GOGA 3KYNA 4UTAA 1A4KB 3QZPA 4JY5L 5ICYA 1BM3H 2CIIA 2NR6C 2XCMC 3GMRB 3NACH 2LLLA 3WCYA 1ZANH 4K15A 1J8HA 4W93A 1TJHL 3IGFA 2IOOA 3Q8EA 4Z7UF 3V79C 3QIBA 1QFUH 4FMVA 4Y5XC 4LLQB 5B7FA 1OT2A 1F4WL 3GSNB 3G5VA 5DUPH 4YPJA 4KXZH 4PLKC 2AQRA 4M9PA 4NERA 5DVKA 4K8RC 3UTTE 4F57H 1TLKA 5EN2A 4NNYA 5HTSA 3ZSSA 5C07D 3CLWA 3QQ9D 3NOIA 4CGTA 3VTTA 1CE6A 1HT6A 1Z5HA 1ORSB 4M8QA 2CUIA 5CN3A 2AQQA 3UPAA 3VGDA 4Z77B 4RWYH 4L29A 3L4ZA 2IMNA 4AJ0A 2ITEA 1JPFB 3BYTA 4JRYB 3CFQA 4UQ3B 3KJ4B 4YR6B 3HOGA 4KMTH 2EEBA 3LB6D 2V17H 1PD0A 3NIFE 3S0PA 2N0MA 4CJ1A 2BSED 3LYRA 3ARGD 5F96L 4QRSB 5T1MB 3RVXD 2OTWA 4XNYH 2E75C 1MCLA 2DL2A 5IVXE 2EO7A 1ZTXH 3SODB 4V1DA 3FTUA 1JZ8A 3SE4A 2OSLA 1UJTA 2X4SB 1ZS8B 3QHTC 4L1SA 1IAMA 2I5YL 1TZ8A 2LV4A 2YUWA 3C6SA 3QG7H 5KW9L 3LIZA 1S2EA 4AVKA 1EEUA 3IJHB 1YPZF 4HWBL 2EACA 4BFFA 1UXWB 1N18A 2PCPB 1DQLL 3QPQC 4WDIA 5GS1C 3NIDB 5AUMA 1WT5C 2Y69B 2ICEC 3D8MA 3WTXA 4XNUH 4JB9H 5I30L 4CU7A 2ZX9A 3N40P 3WD5H 2L7QA 4PJHF 3BJLA 3GHEH 1AD9A 4LRNL 3DGGB 3RJDA 3FN0L 2V2WB 4O9HL 4XCFL 5DVLA 3TEWA 3HE7A 2ESVB 1A1MB 3DUSB 4FNRA 4HPYL 3TBYB 4UQ9A 4PY7A 2IG2H 1SYSB 4HEME 4E0RA 1UM4L 3QW9A 3MNVA 1UD5A 5LBSA 3ULVD 2YHGA 2WIIB 1B0WA 4WCYL 2AVFA 1R5IA 5CD5D 4UDTB 1JWUA 1YEFL 4IIZA 1DLHB 1ZSHA 4DK6A 4IRZA 3UO1L 3CHSA 3FFCB 2GBTA 1NIFA 1CFNB 1XF5A 4U1KB 5EZLB 4YC2B 4X6EA 3DX9B 2WQSA 5GGUA 5DLML 3VI3A 4HLEA 1P4BL 1T22B 4HDIB 2V5RA 1J9SA 1XF1A 4LU5H 3WUZA 2R8SH 2H5UA 3J8F7 3U6XA 4YZFE 3PL6A 3AY2A 4H8WC 4MDIB 5I1EL 1OAUL 3ZVVA 1MCWM 2DWXA 4IKLA 2DDQH 1NFDB 5EO9A 5I5RA 4NKIL 2BVPB 3E9TA 4B9YA 1BVOA 4UM9A 2BM3A 2ADGB 3WFEL 1MJUL 3LDBB 3QEQD 1T7ZA 3L3KA 1P6FA 1GC1C 1ZV9A 2VABB 2Y7LA 5C0AD 4K3JH 1ZLVK 4DOHE 4E41E 2X3AA 1A3RH 1URIA 1B6UA 3RZWA 4CADB 4X0KA 3VFTB 1J1OH 1JWSB 5IHUL 2F53D 3KBPA 1YQ2A 3DGCR 1YDPA 1RUPL 1GZQA 1YYLL 3U1PA 2XTJB 5MI0B 1F5WA 4OD1L 5C2BH 3GSNL 2XPGA 2NY6B 4U1SB 1N5YH 2X5PA 4JKWA 4L37B 5CUSL 3D09A 4P04A 2QHLA 1A9BB 2UZIH 3QE5A 2HPTA 1CICB 4NN7C 5E6SB 4M1CC 3Q01A 2XWRA 1CMOA 1F41A 5T1KD 1DJZA 4JO4L 3O2WL 2VDKB 5DEJA 2I24N 3R0NA 1HEZB 2EH7L 2HAZA 4B6ZA 3L3JB 3CFDA 2DBLH 2VR6A 3WN6A 5SWZB 5J0BA 3QZOA 1HINH 4EI5B 5TDNB 2MFNA 4NLAA 4KNTA 4X7SH 4KUZH 3FF7A 4Y16C 2PO6B 3UC0L 3ZGHA 1Z6JT 2X4QA 4U7MA 1KC5H 3X14A 4HF5H 4WUKH 4B50A 1JV2A 1OAZL 2AEPH 3SGKC 1I3VA 1HZHL 2OCFD 3FULA 4QHPA 5FM5M 3RKDD 3RDTB 1CXIA 4QRRA 1S78D 3HR6A 5KZCB 4P48A 4BZ2H 3PHAA 4G6KH 5I1HL 5I71B 3IRPX 4UILL 1MHCB 4ZSOA 4HK3J 2NY0C 2WUBL 4TVPH 4NHUA 2YAQA 5BRQA 4BK5A 3ULUD 1TTAA 5I74C 1SMDA 1FNHA 5HPOA 1KEGH 1KMGA 1CE1L 3QIWD 1B2WH 2HT3C 3RUGA 1JGVH 3RX8A 5KVGH 4DKDC 3QXTA 3GEFA 5IW6B 4GQQA 5JO5B 5LGHL 3OB8A 3QRGL 2XV6B 4LL4A 4WJG3 4GAYA 1T83C 5FYJD 3TO2A 5DJXB 1J9QA 3GF8A 3P11L 5EBWB 2ZXGA 3JWOL 3ERXA 2MPAL 3V6ZA 4V1DE 5I5IA 3IGKA 2YBGA 3V6BR 3DECA 1R19A 1WCBB 2V33A 1AI1L 2YA0A 3KHOA 2PNDA 3KPSA 5IUSA 2Z3FA 3CV5A 1OSYA 1TETL 1I3GH 2EEXA 5GIRB 5JOFA 1PZUB 2W88A 3AWEA 4MCYA 4EN3C 4JFFB 1JZ3A 2HA1A 4G59C 5D6CA 5I0DA 3ZDXB 3IJSB 3VXSA 4PJIB 4LPTA 1BF5A 3FUMA 4EVNA 1J0KA 4M8RA 1XB3A 5G5DA 4P2AA 4Y4FC 3DBXA 2DOCA 5F7HA 2BCKB 4ZMQA 4EN2A 2V37A 4JPVH 5J13B 5KWYC 1DBJH 1S7TA 2BHZA 4OCNC 2NYKA 1BGXH 3QDGB 4KJPC 3LRSA 4WV1A 1EZVY 2MNUA 2GJPA 3Q1EA 2XV2A 4X9GA 2HJFA 1I4FA 1I31A 3IETA 3FMGL 1D7CA 3VUAA 4G9DA 2A6IB 4KHXL 4G7SB 4UM8A 5C0NC 3PJLA 3SYQA 4GW4B 2FYVA 4XZUA 4GP4B 2Y22A 5JIIA 5A2KH 1E6JL 1PY0A 1YMHA 1HH6A 1OWWA 1NKOA 2CDGA 2C1OA 3NZSA 4LGSB 2KL6A 5E5RB 3RIKA 3JTTA 3PGDB 5D8JH 4Q4EA 1H3VA 3CGTA 2ICWA 1MWOA 4HIXL 1NEPA 2UX6A 3HE6D 1DL7H 1DN2A 1BVKB 1NLBH 3H85A 3IJYB 1CIUA 1H9VA 1XX9C 3D1MC 43CAA 1LO3H 5DRNB 2JKWA 2VDKL 4NJAH 4KVCH 3HPLB 2DWDA 1YNKL 3L95A 3MBWB 4K8RD 4IBLT 5ECJE 1LP9B 1UUSA 5JIPA 3Q5YA 4HCGA 1NGZA 2IBBA 2E7BA 5D96C 5FA3B 2C7UB 5HP5A 4M1DL 3D48R 1FGNH 1ND0A 3TBSB 2WXFA 1B4JH 3K5SA 5L9DH 2Y7OA 5HDLA 2X9WA 1BJ1J 3LQAC 1CLZL 4ZZFA 4KH9A 3V4VH 2D3JA 2J4WL 3GBDA 1T1ZB 2PR4H 2ZYRA 5TF1L 1AGBA 1DSFH 4GW5B 3NCWA 2N3JA 4NM8H 5TFSL 3V8CA 5D1ZI 3WKNA 3KPNA 3QZNA 5BZDA 4UNVA 2VUOA 5I8EA 2V3EA 5PCYA 2E74C 2H26B 3U0WL 2OCCB 1T5WA 4WO4C 2R56H 5E1IA 5C08A 5L7XH 1ZLSH 3AT8A 4NO2A 4GSDL 4U0QB 2XX0A 4F7PB 4J4PD 5DHYA 1DDHB 2J8HA 5D2LF 3QWNA 2YAOA 1L9SA 2X9ZA 4YLBA 5GGSB 3T3MB 5E1AB 3C5ZB 5AZ2L 2FH8A 4HKBA 3QBTB 4BH7B 3FQXB 3LEVL 1JZFA 5DTFB 1AIFA 4DGVL 3L8QA 1OGPA 4QXGH 2H0PA 4AGNA 4YAQB 1IBBA 3PJSB 3VSUA 3AMLA 3WIFB 1KCVH 2ADFH 1WD9A 4MBOA 3HB3C 4YDMA 2A0LD 3RY5A 3K91A 1TTGA 5EBLA 3ILDA 4DVBB 3GJEA 4MNGB 2HB0A 5TDPB 2UZYB 1U8HA 4JFWA 4OGXL 2DYPA 4E42A 1P7HL 2W9LA 4XVTL 1KEML 5IR1A 1A22B 4TNWF 4AQOA 4F1ZA 4FFWD 1S9KC 2GABA 5LCVL 4TRPH 4R84A 5SX5K 5LO7A 4MAUH 2VJXA 3FZUD 2X0UA 1MELA 3TVMD 3ECWA 2J5LC 1H6FA 1KBGH 1RV6X 2P42B 3KE0A 1KCRH 3HZMB 1QSEA 1X5AA 2CKBL 35C8L 3OKYA 1I1YB 3JVGC 1RLWA 1J0YA 2VMFA 2Y7QA 3EXLA 3DETC 4O02L 4BQBA 3KPSE 2AVGA 1TNNA 3BCDA 4LFHG 5ID1A 4DQOH 4AENB 5LXVA 1KTLB 3ILQD 3VE0B 5BW7C 2LE9A 3RPKA 3K71A 5TTRA 4DP4X 1GYUA 4PP1C 2WKLA 3KPRA 2XWBA 5DCCA 3I84A 3H4HA 3O45B 1LDPL 4APQA 5HBBA 4HBCL 1XF3B 4R7XA 3BQUC 4XO3A 4G9FA 5L4IA 2ZPKL 3TT1H 5G4MA 5E08L 2FL5B 2Z1KA 1I8MA 3H0TB 3ZKQD 2G5BB 2OZ4A 3WSQL 4I3GA 4PRNB 4TOYH 1A2YB 4PR5A 3BZEA 1QO3B 3VRIA 3KLDA 1SHXA 3V5DA 4LZKA 3B3IB 2BLFA 2H3NB 4JZJA 5I6NA 5FV2A 3B9KC 3CVDA 3QUYC 2V2XB 1EEYB 3FU5A 4JY6B 4M1CD 1A5FL 5J6HA 2HKAA 4GOSA 3VCLB 3I6SA 2YAFA 4ZFFA 1AS7A 4IOIA 1JWMB 5DLLA 4X99B 2BNRB 4M8VA 1AKJD 4HIHB 3NJHA 1YG9A 3ARRA 4Y16D 3QB7C 2EE2A 2X42A 5FUCC 2NQDA 4UQAA 4AV5A 4KK6C 4LHUD 5HJ3A 3WIIH 1NICA 4RMTA 4U4BA 3TPUB 1NCGA 3ZW3A 1CR9H 2VXUH 1JI2A 5CEYA 4TSBL 1NGWA 4TUKL 1XIWC 4PP2A 5HJGA 4XN5A 5JNYA 4IIQA 2JKRM 1QRNB 2MPVA 4JG9A 4X5PA 2CXGA 1I9RH 4OIFA 3L4CA 1BLNB 1HHHA 4GBXC 4JZOB 1IGCH 3PWPA 4KTDL 5T3ZH 4XPBH 1OP5K 3SBWC 3T8XA 4Y2OA 1OV8A 2NW3A 3ULSB 1BOYA 4GQRA 2EDQA 2W65A 4OB5L 2X2JA 4M7JL 5E6IC 1KTDA 3OKKB 5E9DB 5IBUG 2CIKA 1PFOA 1S9YB 1JIBA 4KZ0A 3SQOH 4CVZB 4XBEH 2IADA 4RGNC 1TZGL 4KK8D 2AV1A 3NT0A 1A6TA 1A6AB 4FQCH 2CMRL 1ZD6A 4NPYB 5DQDH 1T21A 3IMBA 2FWOB 1TITA 1P7QA 4ICWA 4M03A 4BHUA 2EDXA 5C08E 3BGFB 4FTVE 4FCAA 2FR4B 2VSKB 3FONB 4N0UE 1VEPA 1VFMA 3P0GB 5C0GA 1IBGH 2BIOA 3DC0A 3BP7A 1PD1A 5MP6L 2OJZL 1F4AA 2V9RA 2A2QT 1MAKA 2BZ7A 3VVVA 4CVWA 4ELMF 4LP4A 2BNQD 3NRPA 5D7IE 1RAMA 1CDCA 5DZOA 3E3QE 2Z93A 4DESA 4PJDF 4QXVA 2XJKA 3IDMB 4KROB 4NO0D 5JXAH 1D7DA 3D0VA 2K8MA 3QJFA 3UABA 4C4KT 1MJJA 4L4VE 4QRPE 1V55B 3VXUB 1BVNP 5FUOH 2E27H 1QA9A 4CU6A 3ABZA 3FUDA 3W5MA 1MOEA 1O7DE 5KJRL 1C12B 2WYHA 1JHKL 3H54A 3W0WD 1JFQH 4ONHB 5C6TH 2NY3C 4OV5A 3BUIA 2A7BA 2ZICA 1TCRA 4LP5A 4DKFH 1HU8A 3QJUB 3MRPB 2Z35A 5CCKL 2B1OA 4K3EL 1QSEE 2DLHA 5ITFB 4DO5A 4M7LT 4P8QA 3GK8H 3TU6A 4S1QH 1SHSA 4FCHA 4UT6L 1FVCB 4WTZG 2X6AA 4XP9H 4GKNA 1QZ1A 1XH3A 1YEHH 4L1BA 4S11A 5SWSB 4ZMNA 4HAFA 4PV1C 4OZHA 2Y07H 4G7YL 3QO0B 1YY8B 3RWEA 3HRZC 2Q20A 4TUJA 1JGUH 2G0LA 3UBFA 1EEQA 4PB9L 3P4LA 2HJLB 3S7GA 5INCB 2YEZA 3ABLB 1XAKA 3T0DA 3E38A 1CTOA 2HJKA 3RGVC 3MRBB 1P84J 5K9QI 3H9SD 1YNLH 1I3RB 3VA2C 5F7EL 1FAIL 1RUAL 2FIKA 4HCFA 3SJVE 2XN2A 2J2ZA 3INUH 3LQMA 3FOMB 3TO4D 5DHDA 3D12B 3U6RA 3P3YA 4YIQA 1SOKA 3WXWH 4GB9A 2VDPB 4PVBA 3R8QA 3ECBB 4H20L 4K2UL 4BM7A 5L0QB 4X6FB 2X4UB 3ZGIA 1E6OL 3GMLB 1ILSA 3BE1H 5I17A 3HAEG 1K5WA 1U21A 3HHRB 1TJMA 3PYCA 2FGZA 1FL5B 1Q9LB 2AF2A 3BH9B 3LNDA 2ARJA 4JGUA 2WBWB 3QXVA 4MB1A 2WQ8A 5JDJA 1JGDB 4WSGA 3FYIB 3Q6GH 1H3TA 1SF3A 1M05B 5EZJA 1RFDH 4ABVA 2DQMA 2ADIA 5BO0D 4YHOH 2CXKA 3UYPB 2EIJB 3TCLB 3WFZA 1FZJA 2BWDA 3L54A 5E0FA 4I48B 3EYSL 1G5AA 5F0JB 3TNNB 4HEPG 4EZKA 1RIHL 1E9QB 2WZPA 4LGPB 1H5BB 3ME0A 1KCUL 1UWFA 1CG9B 4KZDL 5T3XL 4AQAA 1WAAE 3M1BA 1J8HD 1P5VA 4MQXD 3DLQR 3LVEA 4J12A 3QIBD 1I9JH 5BS0E 2EUXA 1E50A 5EBMB 1ZS2A 3VGFA 2KPWA 3TH2T 4JR9L 4QCIB 5MEOB 1IAIM 1Z66A 1JMXA 4FXLA 3EUUA 2BOBB 4UB0L 2BVYA 4IHBA 3HAEH 2A38A 4OZFG 1HL9A 3T0EC 4HWEH 3F83A 3UROR 3OLDA 2NDFA 1KENL 3OM3B 4LIQH 4BFNA 1V7ML 4X83A 3MRRB 4MXQD 4NQTA 4YHPA 3QH3B 1THAA 5D1QA 4LSPH 2VAAB 3UXFA 2G9HA 2XN9B 5EBGA 3GBLA 4S1RL 3O6KH 3VD9A 4I0PA 3NH7L 1EDYA 3MV8A 5IVZB 1JNLL 2XWJA 1A25A 3IJ9A 5AVZB 1BQLH 5D55A 4X7FC 4B41A 1YNTA 3DETD 1J1XH 1WRFA 1AZCA 1UGNA 2Y25A 2V8MA 1TQCC 1URLA 4L23A 2GT9B 4WWKA 3TA4D 3VH8G 3V4PA 3DPDA 4L3EB 1N0LA 3H9YA 3UGXA 2X70A 3ZZ1A 5C3LD 1MWAL 1FN4A 2VXQA 3IFPA 1EEZB 2GFBB 3MCLH 1YEGL 4FF9A 4OJYA 5F88B 2OV0A 5DUBA 5GS2D 1BMWA 2VH5L 5C7XH 1ODAA 3BQUD 2FGWH 2P8MA 4OZFH 1CI5A 1E5AA 5H35B 3K8LA 3G6AB 1M3JA 2XXGA 1CU4L 4P57B 3IXAB 2YAEA 3AXLB 3NSCA 5AW2B 4PBVC 2QDVA 5IEHA 4FD0A 1ASPA 1UTDA 5GRJL 4FQXA 3C5XA 3NGBC 4IRSB 1U9KA 4UV7L 4R97B 4YE0A 2VERN 1II4E 1BAFH 3GMOA 4MJIA 4AEHL 1TMQA 2KH2B 4L05A 1GIGL 4I3RL 1P1ZA 1RK1B 3ARFC 3BUYA 1F3DJ 1JK9A 4RGOH 5C6PB 4EXKA 3O0LA 1TSRA 5JPMC 3FB7A 4P23A 5FYLD 1L9PA 4O2CB 2L0DA 2GTZA 1E8YA 2WXMA 5HYEA 4XPFL 1EJFA 2VLRA 3W56A 1CPUA 4DN3L 4N8VB 4RFEB 3D0LA 3MBEB 5K39A 3TPKA 3G04B 4H8PA 2X0VA 1X3DA 3KPTA 5HI3D 1X9QA 3WFHA 1R3HA 2OMVA 4AI7A 4OF8A 4I8DA 3QNZB 4NC2B 4XNQB 3U36A 4OZHE 3B5GA 4X6DA 4IMLA 4UDUB 3WGVB 5KSAB 3HRPA 4QHLB 3EFDH 3SE3A 2DIEA 4XN9A 4KI1A 2VLKB 1OAJA 4BUHA 5CJBA 4BIKA 12E8H 1I7TB 3UJIL 1ZSDB 3PL6D 5JR1H 1AGFA 3LEXB 3EYUL 1TU2A 4HMDA 5DDHA 2B59A 3M6DA 1BFSA 5E8EA 3FHAA 3NJKA 1XGUA 1BBJA 4OCYH 5IFHL 1YEDB 2WMPB 3FKUS 3FFDB 4HGWB 5BUAA 2CBOA 3OKDA 1S9WB 2FQEA 2AV7B 2VERA 1EHLL 2J1WA 1PZBA 2WZ6A 4AQZA 1QYGL 1UXSA 5I23A 1KJ2H 2PPFA 5CJXA 1RZPA 2WO4A 3CZJA 3ZUCA 3HUJB 3DOSA 1BOGB 3OG4B 1IFHL 4AVIA 5IB5B 2N1KA 4P4RB 3VG9C 1SVCP 2YD9A 4GP5B 4LLWB 2IV9A 4N2EA 1L6PA 3D69A 2DTSA 5CSBA 3S36H 3CC1A 1VFAB 3GIZL 2B1HH 3JWDL 2ATPB 2ZOTA 1KFAL 4F5CA 3LKRB 4JQIH 4KZEL 4LXFA 3CDYA 2Y2YA 3GZKA 2WXHA 4OH2A 5KVEL 2HRGA 5TE7L 5KTEH 1KIRB 5HVWA 4NNPL 2ZCLH 4KU1A 4ZTEA 1WD8A 1LO5B 3NJFA 4LSSL 3MGOB 3K6IA 4JE4B 4XE0A 5E1GA 1H8SA 4QRTB 2GITB 4G6FB 2IF7A 1QFWI 4QRRD 4Y5VB 1A7PH 15C8L 3EGXA 3QUXA 4BEIA 1RZJL 3LPPA 4MXVF 1ZGLM 2D9QB 2NXZD 3Q43A 2NYZA 2YPLD 4ABQA 4BSVB 4L18A 3L2LA 3A5VA 4MD0A 5AW0B 3V0DA 4FLSA 4IJ3C 2N01B 1W2KT 4TUOA 2L4OA 1UD2A 1AGEA 5LKNA 4AIZA 5KBPA 3MV8E 4PW4A 3V0FA 2Q8BL 1IZJA 2X28A 4XP4H 1Q90A 1X7SA 3IPEA 4P2OC 3VFVA 3JWNE 2O1AA 1D9KA 2H9GA 4JFPA 2EH8L 4NUMA 2RTTA 1RIUL 1CCZA 4B53A 4CRPA 1KYAA 4D0CB 2CPUA 1AHWC 1N0XL 25C8L 2B77A 3K8KA 3GDBA 3L48A 3M17B 4OD2A 3RU8L 3MCYA 4K5LA 5A2IH 2B0SL 1AOHA 1U92B 2ZP8A 1AFVL 1OGAA 1YYMH 1XXFC 3L9BA 3O6MH 1ZHBA 1OAKH 4XNBA 1YUHB 1KT2A 5CKGA 4YSCA 3AQYA 2I26N 5IVOA 5CN2A 1PYWB 1R3KB 3BAJA 1VEOA 2MRYA 4ZYKB 2NX5A 4LVOC 2QGDA 3QNFA 2NW2A 3GIVA 3VXSD 4EOWH 2EVFA 2F1EA 3QUMA 5DJ6A 5I6MA 4DHLA 2BIPA 1VKXB 1JNNL 2G2RA 4XP5H 1DVXA 1WZ1L 2WLIB 3NCCB 3RHWF 1IILE 2Y7SA 1XGYH 1UWYA 4N26A 3IKCB 4Z3TA 4MJIE 4K73A 1UACH 3WELA 2IANA 2NR6A 2JTYA 3OKEA 5HI4D 5GJSL 3PABA 5I6KA 2RQ8A 2DTMH 4RDQG 1SJMA 5DFVC 1QVOA 3CIQA 5DD3L 1KGIA 5J89A 3HBPA 2IV8A 3TJPA 2W59A 1P84K 4X5XB 5JORA 1TO4A 3IJ8A 4LEXL 2PXYB 1L0XA 1NIEA 1V10A 3VXMB 1A21A 1MEXH 1HE7A 2JJTC 4W6XB 2B3RA 2MQCA 4N86A 1JXGA 3K8MA 1CGVA 4G8EA 3WG7B 4B27A 2DD8H 4QY8A 1ED3B 4Y19A 4LSQH 3FT1A 2HCZX 2JB6A 4K0OA 3O9WD 2ENQA 4X4ZA 4YWGL 3BH4A 2PTVA 1YJDH 3SYAA 3MLYH 5FECA 2Q3AA 3SKOA 3ZE1B 3OGOE 2FSDA 4AC4A 1YN7B 2JK5A 4M43L 2BVQB 4OIIH 4AM0B 5LDUA 1ZLDA 4KRPC 1IARB 1UM5H 4IRZH 7FABH 2CDFB 4ZDHA 3HEIB 1D6VL 4CN1A 1Y18B 4JRXB 4Z78B 1EO5A 7PCYA 4DCQB 4JFEA 4K94L 3AT9A 4Y5YC 3BGMB 4JY4B 3X11B 5FO9B 4DUXA 4G80B 4XP6H 3HMXA 3KYAA 2XZCL 4W1TA 1CK0L 1YHPA 3FBKA 4MWFA 1LXMA 4G8IA 5DFWH 3VWKC 3ZTDC 1CGXA 3CE1A 2DIAA 5AYQA 4C4UA 1TTRA 2WSDA 1GYCA 3D3VD 3CSTA 5IJDC 2AS5M 5EO0A 2IC2A 4R4FH 4H40A 3ZE0E 3U6XS 4XOBA 4QRQB 2JI1A 1AXTL 5IQLA 4F27A 1MI5E 4GT7A 5EOTA 1PGRB 4TL5A 1CDUA 4UUJB 2ZCZA 4JO2L 5DUPL 4OI7A 1A7QL 2IAMB 4UOZA 3K2IA 3KXFA 1TLMA 2DH2A 1S7RA 4I1RA 1F6LL 5LG1A 3DX8A 1I7RB 5FYJE 3CLFH 2F15A 3KG5A 3N2JA 1H15A 2ZUVA 4WI7A 1VGEH 3P2BA 3HBZA 4JO1H 1O9VA 2WV3A 3O6FA 2BIMA 4LBEA 3LN5A 1JPGB 1RUML 2KZ1B 3LH2L 4FAAB 4KKBC 4X8CA 2IPTH 1DBMH 5HHNB 2Z31C 2IDFA 3RWFA 1NAMB 1ZJAA 3RZCD 2BRRL 4HJEA 2D7NA 5JW4Q 1A7NH 3JT0A 1V3LA 4M00A 2VTFA 1MFMA 4XNYL 4NM4H 1YUKB 5DHEA 4ODTH 1WBYA 4NQEB 4ZNEA 3RFZB 4XXCC 3TBVA 2EEAA 2PKDA 2DYPD 3AAZA 1EO7A 5GS0C 5ALCL 1AHKA 2R2HA 2PPEA 1EVTC 3BZFA 3BT2H 4L9LB 1E7VA 4TVUA 3IDXL 3AXHA 4U3CA 5IFJB 1A8ZA 4S0SD 5KANI 2NXYC 4Z0BL 2BINA 3VACA 2J8OA 4FMFA 4DQAA 1T2XA 9PCYA 3F7RA 2DIBA 4R26H 4YXKL 2OSWA 3PWVA 2DEYX 4RMSA 3H42L 1M7IA 1V05A 3E8UH 2XIDA 3GKZA 3EYFB 3QZWB 4KKPA 1LO0H 3BUPA 4JPWH 3BLBA 4MZ3A 4Y1AE 3DVGA 1PAMA 5AOMA 4QLWA 3NCMA 1RULL 4PJCB 3V0WH 3WO3B 3EW3B 2NX5E 4K9EL 5D7JA 3HJEA 1EAQA 5LVEA 5JHDB 3KEDA 5CILH 2IDUA 1T80A 3KPRD 1LEIA 1U8JA 3D39B 3L3IA 43C9B 3QFDA 4FFTA 2VLJE 2A6JA 2E59A 3NDYE 2XETA 2FT8A 4YX2H 3ZKMC 3K6DA 2XICA 3KPOB 4L0ZA 4HXBL 4M6MH 2Q8AH 1FL6A 4G9FD 1BFOA 3PGCB 4J23A 4F8PA 4ZOBA 5E99H 3RY4A 1FLRH 5KSUA 2OL3B 1AMXA 4O2FA 4D3CH 3B7SA 4RAVB 3MLWH 2ZCKL 2C3VB 1UZGA 5EO1B 2EUZA 2VISB 3QHFL 1L5GB 2BSRB 3WIHH 3ARBD 1MHEA 1QX1A 1EWHA 3HS0A 4AZUA 2QKIB 3O2DA 2HG5A 3FQYA 2X4OA 4G1MA 1UWEH 3SPJA 3ZLQC 3NA9L 1V8HA 4NQXB 5DU7A 4WF7A 1TOXA 2JCCE 4JDZA 3K0YA 3QCUL 4NSKB 3W5NA 3APMA 1S7XA 1MVFA 3HI6H 4FE9A 4RLDA 3ELAT 2Q86B 2C1PA 4M56A 3RA7L 4J2QA 4WHTB 1QATA 4A04A 4PJ9D 3RIAK 4W9ZA 1A6ZA