4TVPD

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
242
structure length
242
Chain Sequence
QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 37
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpD01
3BPCB 1QFWL 2MKWA 3DI3B 1VPOL 3FT2A 5DT1L 5DMIH 5EDXA 5TH2A 4E5XB 3ARWA 1MUJB 1ADQL 3IJSB 2OK0H 1EHLH 2Z35A 1QEWA 4XPBL 3KPMB 2P8MB 2Q3AA 4TSCH 1ORQA 4PJ9A 1P4LA 1QSVA 3LEYH 1EZVY 2C3VB 3O6KL 2EO9A 4EUPB 4RWYL 2AK1L 4YEEA 1QP1A 4NWTL 2E7LC 2B2XH 4BH8A 5FYJL 2BSSA 4M7LL 3VXOA 1R3HB 4EKXA 2MTPA 5I18H 2QKIB 1MRDL 2XQBL 4JFFA 5FYJD 2AXFB 1CDGA 1DBJH 3LV3B 3QUYD 4XH2B 1G7QA 4MAUL 4PJXE 2VXTL 4D0BA 5BZWB 5F1NA 4AMKL 1QR1A 2E8ZA 3H9SD 2YD9A 2DWDB 4FFZH 1UYWH 4QTIL 5KSAA 4TOYL 4RQQB 2WW8A 2J8UB 3QRGL 1CFQB 3VRJA 4MD0B 4YFLF 4JE4B 3O41B 4HK3J 1X44A 3MV7B 1QOKA 1PD6A 2BOBA 4D0CB 3OB8A 4N0YH 4OI9A 4DQOL 3GRWA 1KB5L 3UXFA 3X14A 3U30C 4UT6L 2D0FA 3L3JB 3STZB 4P99A 4AEIH 4W4OC 5EU4A 1HHGB 2D7MA 2OMNA 3GMQA 2ICWJ 4G6FB 4F7CB 2EDLA 2XN9A 2C26A 3RAJL 4GRLB 4OLWH 3SDAC 1AQDA 2VE6A 2VH5L 2EKJA 2G2RA 2VDQL 1CXEA 1NFDA 5CGTA 2KQMA 5FAAA 3BZEA 2YD8A 4X6DB 3UROR 2CR6A 3ARGD 5A2FA 5E0QA 4MD4A 4LKCB 4ODVL 1A9BA 4PG9B 2X89D 4G8FB 4NO0D 4DGYH 5F96L 1EH9A 3C09C 1NMBL 5T1KB 1PGRB 4TNWK 1JTPA 3QEQE 5SWZB 5F3BA 1HNGA 1MCKA 3CVHH 2EYRB 1HH6B 4Z5RA 4PD4K 5JXEC 4JDZB 2V2WA 3P0GB 2UV3A 2ICES 4QT5B 4DN3L 2QSTA 2WBJA 2VXQH 5IVZB 5DYOA 5EZLA 3OGCB 5ELIA 1A4JB 2A74B 4H0HB 3O9WB 3WFHA 5IVNA 4YE4L 2XZZA 2BY3A 4FZEH 2R23A 5E8OB 2JB5L 4AENA 5IVXB 2XRAL 1IAII 5GGUA 2FR4B 2RAMA 1JUFA 4KI5F 1FE8L 4HH8A 4MXVF 3OKOB 4MQTB 5E00A 3FL7A 1J0YA 3HRZB 3PABA 1VDGA 3GMNA 5EA0L 1NC2D 3DRTA 3NFSH 2FJHB 4XMPH 4OTXH 3KPNB 1MF2L 4Y19B 5D7SH 3UJTL 1B3JA 4YBLB 3OKLA 5A2LH 4K3HA 1TZGL 3QUMA 4J3UA 1U8QB 1A6VL 3F5WA 2XKNB 1SY6L 4PBVC 4G7YH 4BH7B 2ZCHH 2YA1A 3SPVB 3ZT6A 1HQ4B 1BVZA 4XP9H 3AREC 1SEQL 2XTLA 2LV4A 4FQXB 4ZQKB 5HSFA 2DQGH 3MRKA 1TENA 1D5XA 5GRJH 4G42B 3DX7A 3GSNA 3TIEB 3DMMC 2VZUA 4ZPTA 3L5IA 3W0WB 2BNRD 2HJKA 4HXAH 2GSIA 4NHCH 5JUEH 4K8RH 3JTTA 4G8IB 2VIRA 4OAWA 3WJJA 4BQCA 3FHQA 5LKNA 2VQTA 1JTTA 2BK8A 3CLEL 4PJDA 4FXLA 1T3FA 4D9RD 5ACZB 4WEBL 1NSNL 2VXUH 1U8LA 4H8WL 1OD9A 1KBGH 3BIAX 4QXTA 3GSWA 3CC5A 4M93B 4PV9A 2CLZB 2VLJA 4BZ1L 2VDML 2HRLA 5F71A 4QGTA 4LSQH 2EYTA 1BWMA 5DTFA 3E0GA 5KSBB 2C3HA 1FVDB 3QSKB 3TNNA 5DFTA 1RD6A 3ZHDA 2V7HA 2VMFA 1MHPL 5F6IB 1A7NH 1BVKB 2BVQB 4M9PA 1I4FB 4G6FD 5EWIH 3K7UA 2YD7A 1JV5A 3MRMA 4GRLD 3LKPA 5JZ7C 5GRWA 4HQQH 2AEQH 2BXYA 1I3VA 4AQ1B 3PP4L 3WXVL 2XT1B 2DL2A 3P73A 4HPYH 2H2SC 2CUMA 3BE1H 4NM4L 1AR2A 1B6DA 3I50H 3DETD 4J1UA 1BBDH 1S9YB 4HG4J 4S1SL 2JJVA 1MCJA 1N8ZB 1DSFL 1WV7T 2F54E 3BVNB 1PSKH 3ALXA 5HGDA 1A3LH 4KDTC 1G9NC 1ZS8B 5M95B 1OSPH 3TV3H 3Q6FA 1AGBB 2AJYH 3B83A 1A3RL 2JCCA 5SWSA 1CDYA 3DXAB 4OIBA 1GYAA 2VAAB 4R0LA 2YD4A 3O9WD 4Y1AE 3QI9B 4IIQB 2NY1C 1AR1C 2F15A 5HVFB 1OAQH 4LGRB 4FN0A 1HKLH 3JWDL 1XGRB 5FKPB 4CMHB 1IKNA 2P49B 3QZWA 5F3HA 4OZHE 1LDPL 1W8NA 3MV8A 4PJHB 2P5ED 4FQXC 5D8JH 3KDMA 3ZO0A 5DQDH 1I7UB 1ZLVK 1AE6L 1UGNA 4EQ3A 3CDYA 4YK4B 1G6RA 1HIMH 1GC1C 1X5IA 1P4IH 1OHQA 3BZFB 2HMIC 4TSAH 5DEZA 3V7AE 3KNBB 3NIGE 4MB4A 5CJQL 3K80A 3ZTNL 3T0VA 5I1DB 4NRXB 1QO3A 1S78C 3MRCB 3TBWB 3WFCH 2R2CA 3PGCB 3BPNC 3D6GA 4M93C 1HXMB 3OX8B 4Z77A 1MFAL 1GZPB 3B9EA 1NJ9A 4XBPA 1QRNE 3PV6B 4GLRI 1YNLH 3W0WD 3BZDA 4Q0XL 1FZOB 2C1OB 1RZKL 4HKZA 4DFIA 1MWAA 3U1SL 2C7UB 5D7JC 1EGJH 3DPBA 3VFGL 3MRDB 3PDOB 5K93A 3Q2CA 1V7NH 2I07B 3UYRH 1JI1A 4HX1B 2DBLL 4FP8L 5F6IC 3HCVB 3C5ZD 1FNGA 3RPIA 35C8L 4WRLA 2P1YA 3OHXA 4XNUL 5DC4B 3F7VB 4RFNC 4KJWC 2APWA 4YDLB 4OCSL 2NY5H 3B5TA 4B7IA 1M7IB 1JYNA 3GIZL 1IM3B 1KB9J 3BP4B 4K3JL 1FGNL 5FCUH 3O2DA 4F7PA 2R69L 4C58B 3TT3L 5FO7B 5I8KH 3S5LA 4WO4B 5B38B 4OIIL 4TVPD 5EORH 5HHXL 1QD0A 4Z0BH 1KYOJ 5A2JH 1PLGH 2IG2L 4NGHH 5LVEA 4FQLH 3V7MA 5JLZA 1ZVSB 2DLFL 2X4TA 4P48A 2Z92B 3VWKA 1LO5B 4M62L 4JFHD 3EJZD 1N6QL 2C1PB 5D7KE 2CGRH 3QI9C 4IIQC 3MRLA 1WCBA 1J8HA 1RFDL 4MNGE 4CU7A 2O61B 1QFWI 5FHBL 2V7NA 5AYUH 2GUOA 1YYMH 2X4QA 5I6XB 1PQZA 4I77H 5DA4A 3IFOB 2B8OT 1QPPA 4U1MA 5C09B 3CCHA 3NCMA 4WHTA 1QFHA 3HZVB 5SV4A 1MCPL 4YHNA 3FCTA 2BDNL 4OLYL 3RJQB 4NDMA 3DXAD 1DQDH 1JE6A 1F8TH 3S35X 5C9KA 3RUGF 2WNGA 4YK4C 1XH3B 4NT6A 2APFA 3EOYG 1ZSDB 1YC7A 3N85H 4OF0A 4X9GA 5C0EB 1UWGH 4YQXH 4XMKH 4GG6A 3V5DA 4KRLB 3UJJH 1J8KA 2GY7B 1F4YH 2QADC 5F7MC 2O5YL 2DTMH 3MLSL 4PJ5A 3P9MB 5D7LE 2AJZB 5CMAB 4ODSH 1IC5L 1RZ7H 3WIIL 3L7EB 2E7CA 4R4FH 5EZIL 3QDGA 1LP9B 4M7KL 1LE5B 3UPRB 1XGPB 4XX1E 1WTGT 1N5AB 3F58L 4HH9B 5F89A 5D1QA 5IMKA 4XP6H 4UDTB 4DOHE 4UOJA 3MUHL 2G5BB 3TT1H 2RHEA 2IBGA 1XGTB 4WWKC 1FLTX 4KKLC 2Y6SC 2EC8A 5DLML 1SMAA 2V2XB 3VFOA 3TJEL 1FO0A 3B9VA 5DRWB 1D5IH 1G6RL 4HWEH 5E2VL 3MR9A 1SEBA 5JW3H 3W5NA 1OAYH 4LNVA 1MJJB 2UWEE 3R06A 1FIEA 5B3JF 1MREL 1FL6A 5EIQA 2J6EL 4K9EC 4K3EH 5CEYB 3V95A 4NKOB 4HC1H 4I5BB 4WO4C 1FFOB 3ARBB 4P9HH 4K71C 1TJHH 4ZYKA 4JRXD 1UXSB 3BP6A 4IOIB 3SCMA 4WFHE 2A73B 3HC0A 4FQQA 4MNHB 3WNKA 1VGEH 4LASL 1NGYB 1P7QA 1DFBL 1YNKL 4JZOB 5FKAA 4CVUA 1VB9A 1FH5H 2RR3A 4TQEH 4Z7UB 1MQKH 1U41A 3MQIA 5CIPB 4Z7OF 5AUMB 2A9ML 2O5ZL 5A43C 2DQUH 1F58L 5L8LB 3L95A 2DQHH 4YHPA 4U1SB 5I6XC 3EYSL 3VXUE 1O5DT 4IDJH 4PJ8D 3S8WA 1QVOB 5H37G 43CAB 5I71C 3LMJL 4WW2F 5DUMH 1C7TA 1XZ0A 4WHDA 3B2UC 2R0LL 4WFGE 4OZFA 4PGBB 4W81A 3RVUC 4NFCA 3VFPB 5GRUL 4KGLA 1PKQB 3O2DL 5GGVY 1OL0A 4LP4A 4OJFH 3RVVC 1FGVL 2HFGL 4WU5A 3IXAA 1YEJL 3PL6A 5MEOB 3ZTJH 5LQBL 1DN0A 2FATH 3ARDA 1Z0NA 4KDVA 4NIKB 5GS2D 5ISZE 1CG9A 3ILPB 1H0DB 3RVUD 5T3ZE 5DD5L 1DEEA 4PREB 2EDTA 2FEEL 4NQEE 2P47B 3RX5A 2OL3H 4H1LA 3D2UD 1M7DA 3RVWD 4I2XE 1MRFL 3EO0A 4PGDB 4EBQH 1LEGB 3F7RA 2Y23A 5IKCB 2NY6C 3NCFB 4NBYB 3P0VL 1SMOA 4H0GA 3DSFL 5CUSH 1K8DB 5D1XC 3BUYB 1OGAB 1ZTXH 4NJ9L 4APQA 1EFXA 4P5MB 2Y06H 4KY1L 4DN4H 4YZFF 4N0FA 1AGDA 3N1PC 3VFMA 5D6DC 1JJUA 3WNMA 1Q0XH 4OZIF 3MRHA 3ZKNC 4LAQL 3MBXH 3FN0L 2EKSB 2HVKA 1N5YH 3BW9B 4HIJB 4YPGA 3RY6C 3BD5A 5DD1H 4U1HB 3ARBC 3QCUL 3VXMD 2I60L 1PX3A 3HPLA 3LDBC 2ZKHL 2P7TB 2X44D 3U0PB 4EJ1C 1UWEH 4RGNB 3IJHB 5IMLA 4TUJA 5E7BA 3L3GB 5CD5D 1IBGH 1RJZB 2FB4H 2Q6WB 5DK2A 1WAAE 1RSFA 2DQTL 4ZO7A 1NAML 4Y4HA 4KRPB 3HZKA 3MRBA 3SJVA 1JPGB 1SJHA 3W9EB 5C07B 4R7NA 3BYYA 1A6AB 4X7EC 2AJ3B 1MLCA 1Y18A 3VGHA 3VRLF 4HD9A 5KS9F 3GSUB 1I1AB 2VL4A 3H7BA 4PJIE 4QHNA 4OQTH 1IT9H 2FGZA 2IALB 2RJMA 4FMKA 3S37H 5HGHB 3NCJH 4GAGL 4PB9L 4X6BA 5HYQB 4E0RB 4XVSH 1MHEA 1ED3B 2OR9H 2XTJB 2IADB 2E9IA 3TA3A 1I9RH 4DKEL 3G04A 1RULH 3QXTA 1G7JA 4YHOL 5HHOB 5HTSA 3QDJA 3O8XA 4GKOA 1MLBA 3ARYA 3V6OC 1MCCA 3D18B 4LLWA 1MI5B 1FIGH 1BQLH 1T1XB 1T0MA 2R1XA 1Q9LB 2FO4A 1CGVA 4ZXBB 4WIQA 1H3GA 1RZJH 4RAVB 3FONA 4AK1A 5D5MA 1ZA3A 5FOBB 3RPKA 1EPFA 1R6VA 3NFPB 3VFTA 5B39G 4PV8A 1CFVL 5F9AC 1EEYA 5E8DH 4QF1A 5E08L 3FHAA 3RL1A 5TDPB 3RWIA 3IU4H 4EDXB 1WIOA 3FQRB 4JN2B 2X42A 3BGMA 2XPGA 3JV6A 1I1YA 3DO7A 2R2BA 4P5TD 3BQUB 1T04A 1NCDL 1L6ZA 3R0NA 3IYLW 4JO2L 4R2GD 2AABL 5BS0A 5KVFL 5IB2A 2YMXH 2ITCA 3FO2B 4U6TA 4HK0B 1QTYT 5IQ9B 3PQYA 2WLZA 3EDKA 4ZUWA 1A1MB 4RZCA 1JNLH 3QT2A 1A6ZB 5T1DL 3RDTB 1X6NA 4DUXA 5DEFA 1NCCH 2LAAA 4FQHA 3CXDH 4PRPE 4UBDD 4G9FD 1U8KB 5F9WB 1J10A 2E7HA 3EYUH 3DVNB 3WO3B 4BKLA 3W11C 2UY6A 3VG9B 2FWOA 4D9RE 2XKUA 2ZOLA 5DD0L 4M1GH 4L8DA 5CKAA 1S5IH 5INDA 3QIUB 1MJ8H 5KANI 4XAKE 5HBBA 4JLRA 4AT6A 1CDHA 5DZNA 5INCB 1G9ML 3VI3E 5DQ9B 1M05A 1K4CA 4RGND 4KK8C 1I1AC 1TJIL 3D85D 1IGYA 2OQJA 5C6TH 3TFKD 1EFQA 4I0PB 4P23D 3V6BR 4PBXA 4OZIB 3JTSA 1HHHA 3ALPA 4I18B 4JFFE 1H5BB 4KRPD 5K9QG 2XTJC 5C07D 1LNUA 5CBEB 3S36L 5I16A 3EFDL 3LOWA 5IMOB 3BDYH 5HDQH 2WBKA 4HHAA 5LAXB 4Z78A 3UP1A 2WMPA 1CR9L 4ODUB 3BIKA 3QPXL 4YGAB 1A9EA 1GJIA 5DWUH 4G6JH 1BFTA 4ZXBC 3EDDA 5I8CA 2ZSVA 1C1EL 4P9MH 5HHOD 3WIFA 1DQMH 4DKAA 4MYWB 2R0WH 1NEZB 2V2TB 3RFZC 2OJZH 1S9XA 4WHCA 2N1KA 4X99A 1ZXQA 2XN9E 1R3LA 4MXQD 4WTWA 5FCSH 5HYSG 5T5NG 2H45A 3LZFL 3TIDA 3BN9C 3NIFF 4K7FB 1TVHA 3CXHJ 4NO2B 3UBXG 1NFDE 5EOQH 5IIEA 2UYLA 3HPJB 4JCLA 3O4LB 4LLMB 2SEBB 2AV1A 2UUDK 1VSCA 3F12A 3WFBH 5TPWL 5AYQA 1EXUB 3BGAA 3BQUC 3MLZL 4HJ0C 2DQJL 5BVPL 4CW1B 3DNKA 1T03L 3BAEL 5ESAB 1OM3L 2X70B 1FG9C 4PRHB 5EUOB 1IM9B 2VLKD 3GHEH 1G9EA 1TETL 3VGGA 3S97C 4HUNB 5DJYA 4AIOA 1CDJA 3RDTC 2R2HB 3SGKC 5B4MC 3WLBB 4ZTPL 1ZEAH 3F62A 1P5VA 5I2IA 1KIPB 3GSQB 3Q3GA 5KJRH 5F9WC 5HI3C 3OSKA 1I8KB 4LQFH 3BQUD 5EC1B 4WFEE 4HJ0D 3VG9C 3U2SA 1VACA 3MRIB 2VLRB 3UTSB 1J5OL 1X6LA 3EYFB 3L9RB 3RIFK 3PGDB 1N3NA 2CKBB 3QAZC 4FZ8H 5KG9A 5FYLH 2FO1A 1NCBH 3BEVB 3FO1B 5HJ3A 1DUZB 2VKWA 3ROOA 4HF5L 3VXQB 5AZ2H 4MDIA 3REWA 4JGUA 5JO5A 1EBPA 2MPAL 2FLRT 4ZUUB 4HZLA 4I18C 4LCIL 4P2RB 2XNAA 1QKZL 5DRZB 2F5AH 4ALAH 5L88H 2Y1VA 3MLTB 1Y6MR 3G5XA 3QIUD 3W2DL 3X11B 1RJYB 2B4CH 1UVQB 2V5YA 5K59F 1IL1B 1F90H 5H8DA 4MNQD 3VXNA 2YPKB 4FFYL 2E7LA 3H6JA 1AXIB 1O7SA 4I0PD 4X7SH 1QQDA 3SKMA 4WTXA 4M8VA 2MHAB 1FYTA 4A6YB 4LVNB 2XOTA 2AJSH 2R1YB 1CTOA 1D6VH 4G43B 3ZHLA 2BNQA 4XVJH 3ULUH 1KJ3H 4U6VL 2H3NB 5IOPB 3EOTH 2J88L 3ARFB 4PJDE 5DFVD 1KTRL 3RWCA 1CLYL 3WDJA 4HWBA 2XFXA 3GBLA 2BY2A 1VESA 5BJTA 1I3GL 2VLJE 3MRRA 1OCWH 3D69B 3QHZH 4Z0XB 1G1CA 3RWHB 1AXSA 2DMBA 1C08A 4KKAC 1DUYB 4NQDD 3WLWC 1A1NA 5IR1B 4KJYA 2NR6C 2FX7H 2YWYA 3OAZH 4W4OA 1D6EA 2YPLB 3I02B 3HI6L 1T66C 5MENB 4P4KB 3KPOA 1CT8A 5D6CA 3O2VL 3SDAA 1CGWA 4LMQI 4U0RB 4DGVH 1MVUA 1GH7A 3BRGC 4N0UA 2DD8H 3T4YA 5HI4D 5ETUA 4O2EA 4MVBD 2ZCLL 1AJ7H 4P46C 3QG6A 1P7KB 4ZS7L 4C56B 5ESQA 4PGJA 5IB1B 1J12A 2CRIA 2DYPA 1T66D 4PRHD 1YPZE 1EEZB 5IEHA 5CP7A 1QSFA 4LLVB 1VENA 4IDLA 1FZJB 5AAWA 2W9EL 3WBDA 1QBAA 3P4NB 5C0GB 5JXEA 3T0WA 1GL4B 1MFCL 3H9HB 5SWSE 1F4WL 4JVUA 5J89A 4X6CB 3VD9A 2H32H 4LLQB 2QBWA 4HGWB 3K46A 1MCSA 1WBYB 3NACL 5DJ8B 4E5XA 2A6KA 4NC1C 5D9SB 1I3RB 2VLRD 1FRGH 5E2WH 1LK3L 4RFOH 3HUJA 3WIHH 4AH2B 3BSZL 2ADIB 2P8MA 3KPMA 4JY4B 1WICA 1YNTA 2DQCH 3SGJC 5EH1A 5LGKA 4OF5A 2C3VA 2X1QA 2HTKC 1ZLSL 4OFKA 4EUPA 2QSCL 2J8HA 2PW1B 1A02N 1F97A 5FYKH 1MIMH 5DJCB 3DI2B 1IFHH 1II4E 1J1PL 3SE4C 3GJFH 2QKIA 1MCHA 5HYJA 2CLRB 3LV3A 4XH2A 4FQJL 3FTGA 3WD5H 4N0CD 3NA4A 4DKFH 4JG0H 3PXJA 4LCUA 1RJCA 3ARFC 1KCUL 5FM5M 2DWDA 4M43L 5JIKA 1UA6L 1OTSC 3AREA 3QUZD 3CVHB 4KK9C 2GTWB 4PJ7F 5EZJB 4XP1L 1CFQA 4X7DC 2YC1B 5BRZB 3MV9B 4A6YL 4RBPK 4W6YB 4PY8I 1GGBH 1MRCL 1XR9B 2VABB 4RMUA 3O41A 2IBZY 3P77A 3DMMA 2X4PA 2EDDA 3MV7A 3A67L 3HE6C 3QQ9D 2EEBA 1A7QH 5B39B 1H15B 3RVXD 5F7LB 4OZGF 1HHGA 4F7CA 1OTSD 4PJGF 3VH8A 4P4KC 4K23H 3GZKA 1TDQA 4JFXA 4Z7VF 1RURH 2R2EA 4GW4B 1FZMA 4S1RH 5DMIL 4HIXH 5F6HI 4X6DA 1W2KT 4FOMA 2OK0L 2MJWA 2BHYA 3ZDXE 1MPAH 3O6FB 3HE7B 4LRNL 2QQNL 1WFNA 4WI3A 5T1KA 3MA9L 2YPLD 3BISA 3QFJA 3OB0H 8FABA 5SWZA 5MEND 2NTSP 3SBWC 3RA7H 5E70A 4FG6C 4CVZB 3VE0A 3C60B 2KPNA 1NMAH 1HH6A 5EU7E 3ZTJG 3TH3T 4NKIL 1K2DB 1EJOL 4QT5A 4KUCD 3FOMB 32C2B 5IVZA 4Z18A 3LQAL 3MOAH 3OGCA 1RVFL 5JW4R 2B0SH 2JIXB 4P2OD 3GMPB 2KBGA 1OAZL 5CLTA 1XF2A 3S88H 2PTVA 5IVXA 1N0XH 2A0LC 4DVBA 3ZHKA 3DARA 2R8SH 2FR4A 4FG6D 1GPOH 3KLDA 1G6VK 4KDTA 3OKOA 6FABH 3DX8B 1JHKH 2E8YA 3HRZA 5DJAB 4O58L 4OFVA 5C0RL 1CDUA 1OAUL 2C3GA 4JHWH 4JPVH 2FJHA 1RAMA 1DDHA 5D71H 4GKZA 3KPNA 1MNUH 1KPUA 4Y19A 3BX7C 3ULVL 3WKMH 4FHBD 4WUKL 4AEIL 3ULVD 5BO1L 4MCYB 2ILLA 1KC5H 4LCCB 1MY5A 3VXME 1D9KA 5CP3A 4WV1B 4BH7A 3SPVA 2DQEH 4HPOL 4LLYB 3FOLA 4FQXA 1G7HA 4GBXD 2ZSWB 3VJ6B 4PRDA 4B50A 5HI5D 5GQBA 3UTQB 4XI5D 1IAMA 4J4PC 3TIEA 5IW6A 2NTFB 3WFEH 1CLOL 2VUYA 3NGBB 3V0WL 5MERA 4ZAKB 4L29A 2GJ6B 4G8IA 5IBTH 4HGMA 3U46A 1UM5L 3MRGB 5HYSB 3VFVB 1JGEA 1I7ZB 1SM3L 3FO0H 5ACZA 4LEXH 4OCYH 1LO0L 3MJGX 4MD5B 2CQVA 5IGXH 3UBXB 4LSDA 5BRZD 3MV9D 5JW5A 1XF4B 3FRPG 3JV4B 3RZCB 5L2KB 1ACZA 3QJHB 1NCAH 1V3MA 3DHMA 3JZ7A 3MUY1 4Z6AT 5KSBA 4M6MH 1BLNB 1JYWA 2XWBA 4U6XB 5E5RB 3HS0A 4X4XA 5D7JA 1NAKL 4M5YH 3O6FC 5CZXD 3HE7C 1EUTA 3GJEB 4NM8L 3O2WL 2BVOB 2BVQA 4Q2ZB 3RX7A 1A0QH 1P53A 1I4FA 3IDGA 3VGFA 4DVRH 3RP1A 3QG7L 4Q6IB 5DDHA 1WISA 1KCVH 3C60C 4XMPL 5A1AA 5C92A 5CEZL 1RUML 4XC1H 2VXSH 3TO4D 5DVNA 1A64A 3T0ED 3OF6A 4DCQB 4NRYB 2CDEA 3T8XB 2I27N 4HEME 3V0VA 3O6FD 1HZHH 1UH2A 5F1OB 2ZCHL 1Q9OB 1ZHNA 1UM4L 4K8RC 4LSUH 1U3ZA 3RKDD 1TJGH 1N8ZA 1ZE3C 4XP9L 5C0AD 4I1NB 3C60D 2B1AL 1I8MB 3FFCA 1ZS8A 5GRJL 3S98A 3HMWH 4NZTH 3RX8A 5FO8A 3KYMA 4XCCL 1AGBA 3WL9B 5BW7C 4CVXA 4GRWE 4J12A 4HXAL 4R7DB 2VAAA 2JIXD 4UNUA 4KZEL 5D72H 4PRBB 1KELH 5E24E 3V6FB 3QI9A 4IIQA 1CL7H 2NY4C 1NGPH 4PRIB 2L4OA 4LCCC 1OVZA 2CK0L 2ICCA 1XGRA 1X9QA 2PYFB 3UTZA 3TWCH 3BT2H 3VI4E 1I1FB 2R0ZL 3PWVB 4P0DA 4BUGA 1IEAB 3K2UH 1FDLH 3EBAA 1U3HC 3GKWL 2J7LA 3IAQA 3OJDA 4JDVB 1I7UA 2WINB 5HDBF 3DUUB 3CK0H 2EZ0D 1KULA 2F53D 4K2UL 4PGCA 4PLKD 3BZFA 3BYTA 1TQBB 3OR7B 2Q7YA 1F4XL 1KNOB 3RNKB 3NGBC 4XNXL 4Y5YA 4NN6B 2ESVB 1KPVB 1BOGB 4GOSA 4YDIH 2R4SH 4Z7QF 2X9XA 3QHFH 5I1DA 1QBLH 4NRXA 4L5FH 4NO3B 3TBWA 4QOKD 3WSQH 2IBZX 4JFZH 2A6IB 2BY1A 1JZ3A 1HXMA 3OX8A 5FUCC 1TVDA 1GZPA 4LNRB 3UPCA 3PV6A 4IMLB 2AS5M 3X3FH 2W0LA 3QWRD 1FZOA 2C1OA 4ZAKD 5I1CL 4HXBH 4EQ2A 4JQVC 2C7UA 2ADFL 3MRDA 4DW2H 3PDOA 1NKRA 4QGYA 1A3LL 4HX1A 3RVTC 3HCVA 1DBMH 3LKNB 4YUEL 3TBVB 1ACYH 2DOCA 3NFNB 4WWKA 5GISL 4Q6IC 3G5VA 1ITBB 3TCLA 3RZCD 1M7IA 4JREB 3UO1L 3HI5L 5H35A 1IM3A 5T1MB 2L7UA 5CJ5A 3BP4A 5JPNB 3HMXA 4F9LA 1AKJB 4HG4K 1UWXH 1ZVHA 2JJUA 1H8NA 3MJ9A 1B2WH 3SJVE 4KTDH 4NZUL 3E2HB 4D9LL 3VU2A 4XBGB 1ZLWH 4WO4A 4PJIF 1CXIA 5CGYD 4CN1A 3ZL4L 4U6HA 1KCRH 3D39D 5DQDL 4CJ0A 4F2MB 4GAJL 4M61A 4NBXB 4MAYB 1ZVSA 4PLOB 4LFHG 4LSRH 1OSZB 1WC7B 1LO5A 2P24A 4QNPF 4QTHB 2MSPA 2Y25A 5HGAB 3QHTC 5GGTH 2C1PA 1FSKB 2B1HL 4AJ0A 5I8OH 3JV0A 1DBBH 2O61A 1NLBL 1OP5H 4J8RB 3B9DA 4XPTH 5J9PB 3TPUB 4EIGB 2VC2L 3QDJE 5C09A 4GO6B 4XNYL 3MRFA 5D7IF 5E2UL 2ORBL 4OB5H 4QWWD 5FA3B 5E94A 2NY5C 4Y2DD 2X4UA 3B2VL 4DK6A 1P4BL 1XH3A 3QO1B 1S3KH 1UJTA 1AP2B 1V7NL 3UYRL 1TQBC 3QNZA 1YEHL 4PRID 2I9TB 3MRPB 4ODHL 4GKSB 1UJ3C 4NQXA 5DEGB 5H94B 3C6LB 1VGKB 3RTQC 5FYJU 5D1ZD 2AJZA 1A6UH 3AFLA 1NLDL 4PJBF 4ZS6C 2I25N 3HN3A 5L9DH 4NWUL 1JPSH 5I76B 4NUJB 1DLFL 4K94H 3UPRA 1CYGA 4KRNA 4IRJB 3TVMB 5I66B 1N5AA 4HH9A 1HINH 5I8KL 2ESVD 4UDTA 3MRQB 3DRQB 4QRPD 5JNYB 1OGTB 2FIKA 2G5BA 5CKGA 3JWOH 4Z0BL 3U9PH 4MNQE 1FP5A 1PLGL 4NGHL 5D1XA 2JLLA 4ZS6D 4RISH 1N26A 5AWNL 3PQYE 3L3HB 2DAVA 2YUZA 3L7FB 4RMWA 1KB9K 2DL9A 4U1NB 5BVJA 1HSBA 1E0OB 4JREC 2V2XA 2X4SA 4H0IA 4K7PY 2F8OA 4Y5VB 5DRWA 1KTLA 2HWZH 4HUUB 5D6DA 1RPQA 4G7VH 1MAMH 1MJJA 2UY7A 4BZYA 4XPAH 5AYUL 3VI3F 2AXGA 1R0AL 3C8HA 5GS0H 1GOFA 2F74B 3E2HC 1IEBB 2FGWH 3U79A 3RY6A 1KYOK 4PY7B 3BEWB 3ARBA 5T1LB 2DM2A 4HULB 2VB5A 2BRRH 1WZLA 3G9VA 2APXA 2Q3ZA 4JO1H 4OLXL 1X7QB 2W9LA 4OT1H 1EO7A 4KI5D 1UXSA 4EXKA 2A73A 4QHMA 1GZQB 4MAYC 4JZOA 3QIWB 2CIIB 2QV2A 1UWGL 3E3QE 2ZCKH 2HKHH 3UJJL 4NQDE 3QNXB 5CFHA 5AUMA 2OL3B 4YXLL 3I9GL 4YAQB 2HG5B 3GBMH 4LHJB 3O4OC 4ONFL 2MCPL 5C7XH 4O2CA 2CIKA 4I3SL 5ABDE 3GNMH 4LCWA 4G6MH 4KROC 1QVOA 1T1YA 43CAA 2X10A 1RK1B 4L9DA 3CUPB 4ZFOB 1JPFA 2MOVA 4MAYD 4LSTL 2WUBL 2N7BA 3HR6A 1DBKL 4CMMB 5JA9A 4N8PA 1BOYA 1RIUH 3EO9H 4XNMA 3VFPA 3TZVB 4YHZL 1JYVA 1FFNA 1PKQA 4JM4L 2ARJB 3QIBB 1CGTA 2N7AA 2P8LB 4LDEB 4K9EL 4QEGA 4NOFA 3OB0K 4G8GB 5MEOA 1NFDF 5C0ND 4P9HC 2OZ4H 3U7WL 5EU6A 3KR3L 4UQ3B 5T3ZH 2ED9A 4JB9H 1Q9WB 3PWPB 2IANB 4OQ1A 3ILPA 3PWNB 3E6FB 1VPOH 4WVRA 1MFDH 2EEDA 3T3PF 5DT1H 5FDWA 5ICYB 3P30H 4PREA 3QO0A 1JGUL 5HD8C 4F37F 4L8BA 4FQ2L 4ZUSB 4IRJC 2RCSL 3CDGA 1JNJA 2HT4C 3VD7A 5HDOA 1H3VA 4PGDA 4PLJC 2UZIL 5DGRA 1LEGA 3TCXA 5J1SC 1S7WA 3I2CL 3C6LD 3AUVA 4Z7NF 3VFNA 3O6KH 3MGAA 4RWYH 3UYPA 2AK1H 5DD6B 1VGEL 1K8DA 4NWTH 3BUYA 3VMOA 1ZMYA 2HYMA 1OGAA 2OSLA 2VDLL 3DX9B 1FH5L 1FYHB 4M7LH 1PJ9A 3EDEA 4X5WB 4HZAA 4QKXB 4HUWA 3RUGA 1MRDH 2XQBH 5BV7L 3U7AA 1LMKA 1XF3A 2E5EA 1Z6JT 3TVMD 3OL2A 3PHQB 2GYSA 4MAUH 1QZ1A 2VXTH 1MFNA 2Z31D 2EKSA 3OQ3B 4AMKH 3BW9A 3WUWG 4WUUB 3I6KA 3RNQB 4QTIH 4U1HA 5EO0A 4LDLB 4TOYH 3HZYB 3AXLA 3QRGH 4Y5XB 4Y4FC 1MAKA 1VFOA 2EXYD 2P7TA 5IF0B 3IJHA 2WWKO 3WO4C 3BD3A 1FAIL 1VFUA 3QIWC 2VZTA 5DO2D 5DF0A 1RJZA 2WIMA 1KB5H 4RIRA 4UT6H 2FX8H 2YUVA 1AD9A 3TF7C 5C3LD 1JPGA 3TNMA 3W9EA 5C07A 3KXFB 3QUXC 1JGLL 3SQOL 3T1WA 1A6AA 3QJFA 2XZCL 1OTTC 2VH5H 5J6GB 4D8PB 2QHRL 2NPLX 4XCFH 1ZGLB 4WI6A 1H3WM 3O3EA 4L3EB 5C0FA 3GSUA 1I1AA 4RRPG 3MYJB 4AIXA 4NHUA 4RWHA 1Q1JL 5HGHA 3VFUA 3FKUS 4ODVH 4R3SA 3BWAA 1NGWB 3SE9H 3L1OL 5H2BB 1KJ2A 3ARXA 4JZJC 5KW9H 2ZOKB 1NMBH 2HH0L 4PJDF 4PUBL 3QIBC 2IADA 3LH2L 2BNQE 3L3IB 5CUSL 1Q9KA 4H26A 4OFYD 4LGPB 1RJLB 2P5WB 5GGSB 3ILQD 3MNWA 4DN3H 2NXYC 5LGJA 2JK5B 1XEDA 4J3VA 1TNNA 1MI5A 1Q0XL 3NIDE 3ELAT 4NQTA 3KLHC 1U3JA 1T1XA 3MBXL 4PJFB 3TZVD 5JA8B 2WWMC 3IT8D 1PG7X 5KTEL 1ROWA 2JB5H 1Q9LA 4ZXBA 1EBAA 3CH1B 4RAVA 1KT2B 4A2MA 4ZTOL 5K9QI 5DD1L 3PWJB 2VNCA 1K3IA 2ICWB 5FOBA 1X5LA 1FE8H 4G8GD 5ADPL 2MNUA 1P84J 4Q9RL 4EOWL 3NFPA 2IEPA 4IS6B 5AG8A 5EA0H 4XTRC 3NABL 3KPQA 1HN1A 4C55A 2F58L 4DAGL 2D7QA 2VOTA 1U8MB 1Z5LA 4TUOB 3UJTH 4Z7WB 2EEAA 5CZVH 5BCAA 5TDPA 3SDDB 2HTLC 2G9HA 4GFTB 4EDXA 4POYA 3ULVE 1TZGH 3P4MA 2AAVA 1A6VH 1SY6H 2R9HC 2DKUA 5KZCB 3FO2A 4HK0A 1SEQH 2Z91A 5IQ9A 2MQ0A 1ZT7A 1FG2B 2JCCF 4Y5XC 1BJ1J 1XFPA 1QSFE 4MSWB 4KK5C 5DFWH 1A1MA 5EU3B 3HR5B 4IRZL 3NCJL 1A6ZA 3RDTA 5HVHC 3EYVA 3SGKA 2EDEA 4XVSL 3K81A 3UBXI 3D0LB 3ALWA 2X6MA 4HS6B 1LGVA 1U8KA 1U58B 3DVNA 1Z9OA 1IARB 1I9RL 3K4AA 2HLFC 1RZJC 4MHHG 3DUSB 4I3GA 5F88B 1X5JA 3HUJE 2A83A 1NSNH 4H8WH 4RGOL 4Y4KB 1OARL 3KGRA 3OXSB 4PFEA 5INCA 2VDMH 5LBSL 3MJ7B 1ZANL 1DE4A 4YPJA 4KQ4L 5J6HA 3VXSD 4XMLH 4OZIA 4HDIB 1JWUB 1QLEH 4L8CA 1MHPH 3RWJB 1XIWC 5HYJE 2JJSC 5IW1B 2BHZA 2GI7A 2GY5A 3GSVB 5TGBB 2OCFD 5IFAL 5IMOA 3VWJB 4O9HL 1K8IA 3PP4H 2YBRA 3WXVH 5CEZE 5LAXA 1P1ZA 2ED8A 5KVEL 3ESUF 8CGTA 4MCZB 4ODUA 2IJ0C 3GRWH 2FH8A 1JGVL 4X9BA 4J3XA 4S1SH 1DSFH 4UUJB 2Z8VC 4KHXL 5DJ0A 3VFRB 2ERJB 5EBLA 3MO1B 1KV3A 1NEZA 2VZ1A 4ELKA 2V2TA 1E4KC 2V5SA 2EIBA 1NGZA 4JM2B 4JKMA 5KS9A 4U6YB 3Q5TA 3QWOB 4YIQB 3CXDL 2Z4QB 3IDXL 2CSPA 4K7FA 2BCKB 4OGAC 3I85A 2BVPB 4K7PL 3ZDXF 4NO2A 1XMWA 3EJYD 1FZKA 4P3DB 4PJEB 3FB5A 1SYSB 4X6DE 3MLXL 3O4LA 5DMGC 2SEBA 5IHZA 3U6RB 4MA3B 3H2WA 4JFED 4UV4L 1KJ2L 1EXUA 1YECL 4M1GL 1ZLUH 2NY3B 1HYSD 3WNNA 4LVHC 1TITA 3HTLX 5DVLA 1OP5K 1DVFC 3QFJE 5ESAA 2X70A 1M4KA 1IM9A 1UZ8A 1LDPH 1H8SA 3DYMA 2QQQA 3KAAA 4JHAL 4X6FB 1AE6H 2NLJB 3BMWA 2R2HA 5MI0B 3SDDD 5JOFA 1TNMA 5B8CB 3GSQA 3G5YA 3TN0D 1YMHA 3HNVL 1DQLL 4P46A 5CJQH 3ZTNH 4P2QB 3V7AG 1CGYA 3BDYL 4G5ZH 4ISVB 3UTSA 5KZCD 3EYFA 3V5KB 3L9RA 1L9MA 3RWFA 5A16A 3PGDA 2C4XA 2CKBA 4QOKE 2WIIB 1A1OB 3BEVA 1V05A 5FGRA 1N59B 1MFAH 3D25A 3WHXA 3N1GC 1JMXA 1YYLH 3IB4A 4PRAB 3BPLC 4S11A 2D4FA 3D9AL 4NN7B 5E6ZA 4GG6F 1RZKH 3CZJA 4ZUUA 4Y19E 3U1SH 3BO8A 3QUMH 3VFGH 4P2RA 1DQML 5FOJA 2DBLH 4FP8H 3DIFB 4UTAL 35C8H 3U0TB 1D3CA 4M48L 5FF6B 2DM3A 2OTUB 3MLTA 1L0XA 3QRFM 4Y4KD 1BX2B 5KOVC 2R29L 3X11A 4OCSH 3SGJA 1UVQA 5TQ2L 3VWJC 3NAAH 4XNQA 5DVKA 1EUUA 1IL1A 3EJJX 5JR1H 3MA7B 5BQ7A 3U36B 5JW4Q 1MELA 1Q8MA 1R24A 4K3JH 2MHAA 4TVSa 3SE4A 4V1DB 2HVJB 3T1FB 5CJOL 2LFGA 2R69H 1A7RL 3WS3B 3TT3H 4N8VG 1FL5B 1Z9SA 3GHEL 4OIIH 2H3NA 5IOPA 5HHXH 2J4WL 3ARFA 3C5SB 3MNZB 5MEQB 1S5HB 4G80B 4JM2C 4Q9CA 2IG2H 1I7TB 4MA8L 1CD1A 2RGSA 1ZA6A 2DLFH 1RZ8B 1A7BA 4M62H 3G6JF 1N6QH 3FQNB 3PE9A 1MEXL 3HE6A 1RFDH 3MFFA 4WI2A 1D7FA 4JFDD 4G6KL 2CH8A 5FHBH 1NCTA 5IR1A 3PG2A 4FZ8L 5E5MA 4ZUVB 5FYLL 2YN5A 3HG1D 4WY7H 1WTLA 1D5MA 3QULB 4L4TD 2R39A 4P4KA 5FYLD 2B4CC 4EN3B 2BDNH 4OLYH 4GUPB 5CSZB 3M45A 4F7TB 4JO3L 2I5YL 3TO2A 4LPTA 1CE1L 1YDPB 5DSCB 1BD2D 4LIQL 4YNYA 5B8CC 2DWEA 5L88L 3QDMD 1OW0C 3GJFB 2NY3D 3QQ3A 4HSQA 3WUWB 4PJXB 3MV01 1OOAA 1IAKB 2O5YH 2VITA 4C56A 1CK0L 2GAZA 3NPSB 3MLSH 4JPIB 3ULUC 3SN6N 1IKFH 3CX2A 3SBWA 4EI5B 1EEZA 1UQSB 2YD3A 3SDCB 4NNPL 4F80A 1IC5H 3WIIH 5EC2B 3OKYA 2CJUL 3FFCE 3P4NA 5TE7L 5EZIH 1N6VA 1QSZA 4FXKA 4M7KH 5E8EA 5J11C 1OP3H 2EDWA 3FQWB 1NUNB 4LLQA 3QEHB 5CJXC 4XX1G 1KJ3L 4L1DA 1V3KA 3GSOA 3P3YA 1U8HB 2LTQB 3ROLB 2ADIA 2GSGB 5HVGB 2X9WA 1OCWL 3QXAB 5DLMH 3QFDA 3TJEH 4G3YL 5IBLC 4X0KB 1G6RH 3RIAF 5DJCA 5E2VH 1UCBL 2RFXB 5IFHL 3KYOB 5D96B 2YRLA 1WT5C 3CLFH 1MREH 3QA3B 2ATPA 2J6EH 4R97C 5FK9A 2EDQA 3O3AA 2FX7L 4LEOB 1DL7L 4X7FC 4F57H 1INDL 4J3OC 2IH1B 3QEQB 1QR4A 5EB9A 4KI5E 4GG8A 1WBXA 4DGVL 2LU7A 4FQ1L 4LASH 3Q1SH 4L9LC 3THML 3CVHA 4GJTB 1DFBH 1YNKH 3ZDZF 2GTWA 2DD8L 5EZJA 3UYOD 1NDGB 2YC1A 1WBZB 3B6SB 3HAEA 4OM0L 2VABA 1IGJB 2A9MH 3HB3C 4J4PA 2DLTA 1MWAH 2O5ZH 1F58H 3FB8B 3KJ4B 1W72A 2BERA 4HKBB 1TTUA 3UTPE 4R8WH 1FL3A 4HLJA 1IJ9A 4LSVH 4P3WA 3LMJH 1R3IH 3QXDA 5DRNB 5IQ7L 3AMKA 3U4BH 2R0LH 4G6AC 3T08A 3FT4B 4WI4A 4ZUTA 1Z9LA 5GRUH 3V9FA 1U91B 3EYOA 3U0WH 3O2DH 5E2WL 5GS1B 3D0VB 4F58L 3WFZA 2HFGH 3HE7A 4HUKB 1YEJH 3GDBA 1UH4A 5LQBH 1EEUA 4TTDC 1KEGL 2VDKL 4NFDA 4EI5C 3VFWA 4EN3D 4M9OA 4CVZA 3C60A 4XWGL 3PDDA 5DD5H 4S0TD 1WFTA 1K2DA 3FQXA 5JHDA 2V6HA 1CF8H 5HGBB 2PO6A 4YWGL 1MRFH 4LSSL 3GMPA 4JG0L 1NGXB 4CL7A 3P0VH 2NW3A 4PGEB 1R5VB 2FJFB 3DURA 4N1HB 3UTTA 3L6FA 4NQSB 3DSFH 1QYGL 4EI5D 2LTQC 3SDCD 4OM1L 4HFUL 3AY4C 3DX8A 5ESVB 5A40E 3FQTA 4KY1H 3S4SA 1U6AH 3W39B 2HT3D 2C3WA 5BW7A 1TTGA 5D96C 3EKCA 4LAQH 2YRZA 3FN0H 2M2DA 5D5MF 2W0FB 1Q94B 3STLB 1C16B 3W9DB 4BZ2H 1HHJB 1M6OB 5JW4N 5DS8B 4MCYA 4LCCA 3QCUH 3VGAC 1P2CB 4ELMF 1UADC 2ZKHH 5E6IB 4CU8A 2H9GA 5C08B 3WFDL 4YHLH 1RIVL 2EH8L 4S1RL 5C9JA 2PN5A 1U3HA 3V2AR 5M94B 3MLVL 3GB7B 2ZSWA 2GITB 3KVQA 4NN5B 3IU3B 1A3QA 3UTQA 2DQTH 1A5FL 1DQQB 1NAMH 5DMKB 5JORB 1BVLA 5IB5B 3P4OB 2NZ9D 3KJ4C 4X5XB 1AQKH 4ZNEA 2GJ6A 3QEQD 5IB4B 1TZIA 2F54B 3MRGA 1NBZB 1KEMH 5HYSA 1I7ZA 3A6BL 3ZT7A 5C0IB 3LS4L 3MOBH 3V4PL 4KTYA 1XF4A 4GAGH 1KSRA 3JV4A 5L2KA 3WJLC 2FNBA 1CFTB 5HY9B 3LIZL 1KTDB 5EFIB 3LN4A 4Y1AB 2JB6A 5GS1C 2Y5EA 4U6XA 5CGMA 5JQHC 3VW3L 4JQVA 1URLA 2Y07L 4DKEH 1ORSA 4YHOH 2V9TA 1T22A 3GJEA 4HKXB 2ICWI 3TH4T 4L3CB 4JKLA 4YBQD 4Q6IA 2ZJSL 1PEZA 4OZHB 1RIHL 4AM0B 4OCNC 4PJ7A 1WZ1H 3OKKB 5D71L 1MNUL 5DQJB 4H20L 5J57B 4HFWB 2PNDA 4J3WA 5EZOL 3EYQD 4DCQA 5EOTB 1HNFA 3LAFA 3T8XA 4LHUA 4CN4A 4XBEH 1W72L 2RQ8A 2EDBA 4XZUB 1Q9OA 1XR8A 5J06A 5BMFL 3IDNB 4OZGA 2V9RA 2P8PB 4GH7B 1CFVH 1JHTB 4NNYA 3T4AB 3Q6GL 4LCWE 4Z7VA 5E08H 1I8MA 1CICC 4GRWH 4WWID 1ZHBA 1QRNB 3WL9A 4JZNA 4N68A 3H42L 3WFEL 2YD1A 4R7DA 5IEKB 4PRBA 2GJZA 1E4XL 3V6FA 3ZYZA 4F37K 1PKQE 4JRWA 1BIIB 3FO9B 1W0VB 2VTFA 3VD5A 4C54A 3UZEA 5IG7B 2PYFA 2VQ1B 3LRSB 3SY0A 5E6IC 4XCEA 2X05A 5T1DH 4BSVB 3AU1B 5TQ0H 1IEAA 3MUGA 2VXVL 2LE9A 5EU6E 1F00I 5TE4L 4BJLA 4JDVA 4M6ML 5F9OL 1AFVL 4NN5C 1B0WA 4H1LH 2AXJA 4G8EB 1JN6B 2OJEB 3MSPA 4WNQB 3RNKA 1K85A 1L0YA 4U1IB 1JRHH 3HC3H 2WQ8A 1GOHA 2E9JA 3FB7B 1UJ3A 3LQMA 1BOGA 3DOSA 1G9MH 2XZQL 2Y4SA 4OSUL 3VXRA 1A4KA 2DB8A 4O2FB 3RTQA 1TJIH 4NO3A 4LCYB 1DN2A 1SHMA 1E28A 3KLAB 4I48B 4IHOB 4NP4L 4KKCD 5E4IA 2A6IA 2IAMC 1OB1B 1OWRM 3VMPA 3GMRA 4OLZL 3RUGE 4MZ2A 4LNRA 1FV1B 2A6DB 4IMLA 4CU6A 1JPTL 2GTZB 4DUVA 3S36H 1IVLA 1RZGB 4HIEA 4MNGB 2R1WA 3EFDH 3QEGL 3BXNB 2NW2B 2F54D 1UB6B 1MCLA 3LKNA 3HKFA 5DHXB 4J3TA 3HMWL 3NBNA 4D2NA 4RAHA 1KGCD 5HHMB 5C0BB 2PXYC 1CR9H 4M6AA 2D7OA 1KELL 1GIGL 2PTUA 4NKDB 5T1MA 3B8SA 2XWTB 1CL7L 3NH7L 4U1KB 4MS8D 5GGRB 1AKJA 4WHYH 2FHCA 3NCYP 2VERN 4LQ1A 4F9PC 1C1EH 5T33H 5AZEL 4OGYH 3G6DL 3KPSA 3W5MA 2G75A 2DIJA 4XBGA 3QUKB 4MJIB 3BKYL 3WHE1 1BFSA 3KYAA 3LZFH 5D7LB 5I8EB 1MCWW 1F4HA 3BIBX 4F2MA 2BNUA 1YN7B 1NFKA 2BC4A 3MGTB 4U33A 3L5WB 5TPWH 4JFEE 1WC7A 5LCVH 2EYSB 3UDWC 4F7MB 3CSYB 5B3JE 1S7SA 3UAJD 1LQSR 2DQJH 3NPZB 5FUOL 4DOHB 1MCDA 1SJEB 1ZHKB 1T03H 2YSSB 3QHFL 2NY0D 5TDNB 2XKSA 1OM3H 4Y16B 1BJ1H 4L5FL 1TETH 4QHKJ 1BM3L 2E27L 3TPUA 1QA9B 1BGXL 3KYNB 4ZTPH 1QRND 1TQCB 4YEFA 4I0CC 3MCKB 4JQIL 3GSRB 3IFLL 3LB6C 2LU4A 2UWEB 3QO1A 3TEUA 3ESVF 4Z7OE 1AP2A 1KXVC 3AROA 4Y7MA 5F97E 1JK8B 1J5OH 1DBML 2I9TA 5ALCH 3MRPA 4R4NC 2KQNA 4XXDA 2NYYC 3TBTB 4HC1A 4PRNB 3RQ3A 2CDGB 2VDPL 3BP5B 2IFFL 4V2BA 4W70A 4HF5H 3S3SA 3ORJA 1WCQA 2MPAH 1OP3K 4RFEB 4NUJA 5J13B 4LCIH 5F21B 4LBEB 1QKZH 2BOCB 4IRJA 4L4VA 1T0NB 2X7LB 4KTDL 4UV7L 1BF2A 4E41D 3OG6B 1HQRA 3W2DH 3MRQA 3DRQA 5JNYA 1OGTA 5ERWB 3VXUB 4TTGA 2W65A 4FFYH 5D93C 1I1RA 3F6LA 1AHWA 3L3HA 2NY2C 1A7PL 4U1NA 2IWGA 4J7RA 4HEPG 5GGTL 5IHUL 5D7KD 3KPRA 3HI1B 4RDQG 3BKJL 4F33A 3LEXA 5ITBH 5I8OL 1HI6B 5F9DC 5ENWB 3W81A 3EAKA 4U6VH 1OD7A 3IKCA 2J88H 4U31A 4QY8B 3JBG7 2F74A 1IEBA 1BFVL 3LQZA 5CWSA 2AK4A 4K3DL 5T1LA 1CLYH 2IH3B 1ZT4A 4LF3A 4Y4FA 5ISZB 1I3GH 1MCOH 2VDRH 4ZO8A 4JKPL 4O4YL 1GZQA 4YZFE 3DVFA 3QIWA 4NQEB 5EIIB 5HHQB 3B5HA 4S2SB 4K94C 4OZIE 4I2XB 4XXCC 1CWVA 3HG1E 2GIYA 3V5HB 4YAQA 2HG5A 3GMMB 1UENA 5DVMA 2J5LB 2NX5A 3QUXA 4OBSA 3HI6H 4Y16C 4NCC1 5B22A 4ERSH 3HLAB 2J8UF 5D7LD 2W38A 3O2VH 3PWUB 2Y9RT 3JWOC 4OI7A 1JPSL 2XA3A 3SE8H 3RGVB 1RK1A 4G9DA 2APTA 2GFBA 4OBRA 1TQCC 1XGQB 1OT2A 3QDME 1HINL 2ZCLH 2ZUYA 4RAUB 4CMMA 1XCTB 2IQAB 3QUYB 1PY9A 1I8IB 4RMVA 4ZS7H 2IBBA 4JZJA 3Q48A 2V9QA 3SKNB 3O6ML 2ARJA 3QIBA 3CSBA 2P8LA 3S6CA 5E6YA 1M7XA 3CAFA 5GS0C 2OP4L 1L0QA 3FZUC 4YFDB 3VRLE 3RI5K 3ZKXB 1F6AA 5KS9E 1MFCH 4X6DF 5LJYH 4P57A 1D5ZB 4UQ3A 1MCFA 2K9UA 3PWPA 1J1XH 1F4WH 2IANA 3MCLL 1LEKB 1W0WA 4RMRA 4LLUB 5ICYA 5J13C 3NACH 2BSTB 3GGWA 2EDYA 1KIQB 4ZUSA 1KB5B 1NDMA 3N9GL 4MQXD 5T5FL 5GS0D 4OT1L 4XHJD 2AKRB 5F1IB 1ZLSH 4F7EA 5DD6A 5D7IA 2QSCH 4HKJB 4JHBA 3DX9A 3QZWG 5DJ6B 1RUQL 5T3XE 1J1PH 4OQTA 4TN9A 2WANA 2A9NL 4I4WB 2EXWC 3VD4A 2Y5TB 5IVXF 4FQJH 4PR5A 5ALBL 4XVUD 5DHVA 4IRSD 3LPFA 2YHGA 5I1AB 4WUUA 1KCUH 3FT3A 3RNQA 4M43H 1ZVYA 1YY9C 3HZYA 5E8PB 3MLUH 4XP1H 4Y5XA 4PJBA 1AO7D 2JTDA 4KHTL 1MRCH 1BECA 4N9GB 4WFGD 5IW3A 1UZ6E 4MQ7B 1NKOA 3A67H 3QQNA 3CMOL 2Z93B 4R26H 4N90D 5HHVL 4U4BA 5K9OB 3BRDA 4P2RE 2ZPKL 4QHLB 4MLIA 3CGTA 3KXFA 2J5LC 3X12B 4FXGB 5C0DB 5A2KH 1NC2B 5T3ZL 3VFSA 5ISZD 5J6GA 2EIZB 3OJVC 1ZGLA 1UACL 1RUAL 1U8JA 4L3EA 1MFDL 3HNSH 5T3ZD 3P30L 3MYJA 1EK3A 4NQED 3B9KD 1MHCB 3MBEB 4MX7B 1OF2B 3QUYC 3QCTL 5H2BA 4LRNH 4PP1D 2ZOKA 2QQNH 1XIWA 3MA9H 2JJSA 3R1GL 4UT9H 4MHHI 3L3IA 3O3BA 5K9KB 1NPUA 2VL5B 1CI5A 5HHPB 3S5LG 1RJLA 1D5BB 2P5WA 4HWBH 1DQTA 3WHE0 5GGSA 4UI2A 3RGVD 3ZKXC 4Y88A 4NKIH 3EO1B 1GXEA 1EJOH 4URTB 5KSBF 4XP4L 1QNZL 4M61B 4CKVX 3S37X 4EDWH 2BNRB 3LQAH 1RVFH 2QQKL 3CSGA 3FT2B 4PJFA 5D70L 1OAZH 5TH2B 5ANME 4CRPA 2FECL 2Z35B 3CH1A 5IFJB 1KT2A 5C0CE 1T89C 3PWJA 1SBBA 5KBNC 5E9DD 3I3BA 3K8LA 3EHBD 4PJ9B 1E4KA 4IS6A 4O58H 5C0RH 1OAUH 5DJ2A 6CGTA 1X5GA 1NC4A 4YR6A 3ARGC 1MJ7L 4BH8B 1IEHA 1AGFB 3H3PH 1U8MA 4TUOA 3ULVH 3NZ8A 1IC1A 4JFFB 2FX8L 5KVDL 5IJVB 1OQXA 4WUKH 4OCWH 5BO1H 4CVWA 1P5UA 1F6LL 5FUZL 5EPMB 4D0BB 4LP5A 4R9HA 1DVFA 2OR8A 4YXHL 5F1NB 4LLDA 4XCFL 1QR1B 1VEMA 5DXWA 4HPOH 4JJ5B 5KSAB 3P40A 3EZ8A 4XCNA 2J12B 3NIFE 1XCQB 2EE6A 1RU9L 3BJLA 2FL5B 3GHBL 3SE9L 3D0LA 3RY5A 4HS6A 3MJ8A 5KW9L 3RIAK 1CLOH 5F7EL 3V0WH 4M1CD 1JWMA 2Y7QA 4HBQA 2Q1EA 2OBGA 2CK2A 4LSPL 2YUXA 4J23A 4RSVA 1UM5H 1B90A 2X41A 3DUSA 1SM3H 5F88A 5BZDB 1CL7I 1LO0H 4PJHF 4P59L 2XN9B 3B8YA 2VE6B 2G2RB 4OV5B 3MJ7A 1A21A 3IS1X 1MOEA 1KJMB 5E8NA 1RK0B 4MD4B 1A9BB 4HDIA 4ONOA 1NAKH 2NY7L 4NKMB 3PWLB 4KXZH 4NM8H 3ARVA 4YH6A 3O2WH 3LRHA 1WF5A 5IW1A 2GHWB 3QG7H 3GSVA 5TGBA 2P5EB 3VWJA 2DLHA 5CEZH 2XV6B 1RUMH 5EG6C 5L6YL 1HSAB 1HHIA 5CZVL 4RX4D 3T0AA 1GGIL 2V2WB 1KENL 5FA4A 4OFIA 3MBED 5EO1B 4HJGA 1JF1B 2WBJB 4OIAA 5DYOB 2FEDD 5F7NC 4YDVA 4FNLH 5EZLB 3TC9A 3OKMA 1KCSH 4C59B 1UM4H 1P84K 4AENB 5CJBA 5GGUB 1LO2H 2R56L 1JUFB 3VFRA 3GBNL 5HYFA 2B1AH 4PJ9C 5K59E 1H3TA 1TTFA 4JM2A 1U2CA 3D3VA 5F9JB 3QWOA 4XCCH 3DRTB 2Z4QA 4PRPD 4QRQB 2BVPA 1FNEB 3CMGA 1INEL 4KZEH 1X5HA 4PJEA 5C2BL 1SYSA 4UU9B 5MEPB 4UIMA 3SDXB 4OZFG 4MA3A 3BHBB 3RL2A 2EC9U 3C5ZB 3BKCH 2BVUA 3QUMB 1HDMB 4WEUD 2X9YA 2CK0H 1TZHA 1L4IA 3F5WB 4GRLC 4XAKD 4PJ9D 3SGEH 1U2HA 2R0ZH 4UAOB 3ULSB 1IGMH 2BMKB 5GSRA 5ICXA 3L3KA 3GKWH 3X3GL 3PDGA 2M1KA 2A6JA 2NLJA 3MRKB 4XMLL 5E2JA 4K2UH 1HEZB 4JFFD 4UTBL 5JHDE 1QLEL 5B8CA 3DETC 2CO7B 3QCVL 1F4XH 4UINL 1OW0A 2FLBT 4XNXH 2GSIB 1S7UB 4M1DL 2H8PA 4H1LG 2VIRB 5CBAA 3E1F1 4OAWB 4P2QA 3JXAA 2AW2A 3UTTE 4ISVA 3V79C 2E6PA 5KSAD 3DROB 2D7TL 3GSWB 5ITFA 1NH6A 4KI1A 2VLJB 1IMHC 1WEJL 3O9WC 1C5BL 1FJ1A 3GRWL 4PRAA 4LOUD 1TLKA 1TPXB 3MX0A 5I1CH 4WENB 5DTFB 4BFIB 1ZK9A 2D2OA 4KKBD 5CJXA 1X5YA 5K9JL 3T2NH 5CAYB 2ADFH 5D2NE 5EBMA 4WW1B 5IROC 1N4XL 3DIFA 2QR0B 5CP3H 4YUEH 3U0TA 3JWDC 3VGDA 2R4RL 5FF6A 3CU7A 5TF1L 5GISH 2XN9D 1BX2A 1KGCE 4M4PA 2BJML 3NTCH 5HDLA 5FGSA 2FDBP 2UVEA 5DMJB 1LP9F 3UO1H 3MA7A 3HI5H 4YBLC 2QQLH 4ZSOE 4QYOA 5KSUB 2WBJC 1WT5A 4V1DA 2HFFA 3T1FA 2JJTC 4HWUA 1T5XA 3BD4A 4GW5B 4NZUH 4D9LH 3BMVA 1K3ZA 4S1QL 4WHYG 3MGOB 2H2PC 1YPZB 3OMZA 3ZL4H 1B0GB 4HBCL 3IAGC 1UM6L 3C5SA 3MNZA 5MEQA 1S5HA 1R3JA 4G80A 4GAJH 4L9LA 1I7TA 2D4DA 4DGIH 1U92B 3Q6FB 1RZ8A 5I17A 5GSVB 2WBJD 5SWSB 3ZE0F 5FUCE 4IM8A 5L2KE 4WFED 3TBSB 1T83C 3FQNA 5JTWA 1MCQA 4OD2A 2B1HH 3IETB 2D31A 4S10A 1ZKAA 3C5ZC 1HYRC 4G5ZL 4ODBD 1AGEB 1NLBH 2H2PD 3CVIH 5I1KL 4JANA 2VC2H 3MJ6A 3WIHA 4XNYH 2OS7A 5E2UH 2ORBH 5F8QC 1YYLL 4AEFA 4PJ7E 2C3XA 4GUPA 4Z7UF 5CSZA 4F7TA 5J56B 3B2VH 1P4BH 3FQUA 1YDPA 5DSCA 3DGGA 3QUML 1G6RB 3WYRA 3QNYA 1H3PL 1YEHH 1QLRB 1DBAH 3ET9F 5JIHA 3GJFA 4YHYB 1CE6B 1F4AA 4ODHH 4PJXA 1PKOA 4LPCA 2CDFA 4JRXB 2O26U 3NAAL 5E56A 4FQIL 4BQ9A 3HC4L 4OZGE 5JOEA 5JR1L 3AB0B 2PYEA 1NLDH 4PJGE 2HKFL 4MJ6A 4NWUH 1LEIB 3GSNL 1PY4A 5EC2A 4Z7VE 1Q72H 3OR6B 1DLFH 3EJZC 1OT1A 1QLFB 2I9LA 4XBPB 3TGXA 1HILB 1TPXC 5I0ZA 4E41E 5DK3A 1BEYL 4MQSB 4HKZB 3CPLB 1C12A 1SYVA 4NSKB 2VDOL 2HA1A 5IK3B 4ENED 4PJ8B 3MOQA 1U8HA 4HIIB 5IBUG 3TH2T 4TULL 5AWNH 12E8H 2GSGA 4OUOA 3MRNB 3FB6B 1DJSA 3AY4A 2VLJD 2UUDH 1ZOXA 5DJDB 5IWLC 5DI8B 4X0KA 5C8JA 2RFXA 3KYOA 3KYKL 1IAOA 1KACB 1CXKA 5L2JB 4Q58C 3QA3A 1CD9B 4CMHC 1ZV5A 1R0AH 1R5IB 3QXUA 4LEOA 4WY7L 2FD6L 4OF6A 3HZMB 3MLRL 1L7TH 4OLXH 3PIQB 4KTEL 1S7TB 3OV6A 3VXRE 3MXWL 5HGGS 2ADJA 3TLRA 1NDGA 2VN7A 4FTVA 4LARL 3RZWA 5JLZB 2X40A 3K4ZA 3B6SA 3D2UB 1HWGB 1JZ8A 2MQ3A 1AXTL 1IGJA 1CFNB 4P5KA 2AV7A 3ARUA 4D9QE 4YXLH 3I9GH 3F8UB 2I26N 5BXFB 4HKBA 1NBYA 1IKFL 2C5DC 4ONFH 1BBJA 4JJHA 2VISA 3FJTA 2MCPH 1EHAA 4I3SH 3K1DA 2V7NB 1WIPA 1PQZB 4M00A 5I19L 3LN5A 4U1MB 1U8IA 4WHTB 4GSDH 5DRNA 4LSTH 2WUBH 5CCKH 4YHNB 5SWSD 1DBKH 4BSWA 1YEFL 4KZDH 3WJLA 2GK2A 3O11B 4KJQD 2DBJA 4NT6B 1U91A 4YHZH 1J7VR 1QSEA 4JM4H 4K9EH 4YHYC 3NA9L 3D0VA 3VXMB 4YDLC 3KPSE 2F8XC 2NMSA 5FEBA 2HFEA 3U7WH 3AB0C 3KR3H 2WWKT 3MV8D 3CLFL 3G6JA 1JGUH 2DF3A 3GMOB 5GZND 4FQ2H 2RCSH 1L7IL 1I9IL 3DTXB 4RNRB 2FH6A 2UZIH 5F89B 1IC4L 4F57L 1NAMB 5IMKB 4TNVF 1YEDB 1LHZA 3I2CH 1NGXA 5I30H 1R5VA 5D2LB 1JFQL 4PJ8C 4NQSA 1EJ6A 2VLME 3GO1L 1N64L 3Q1SL 3RJDA 1FBIH 1IQDB 3K74B 2VDLH 2WP3O 3MACL 4MGXA 1MSPA 1CICA 1FVEA 3S35L 1FNAA 4ACPA 4WTZG 5BV7H 4X5LA 3W39A 3WMSA 5FHAL 3VFOB 4HUMB 1MWAL 3B4NA 3MR9B 2YXMA 4OGZA 1SEBB 4OI8A 3HNTH 3R06B 4R8WL 1JF5A 2W0FA 5ILTL 1C16A 3BKML 2KUTA 4LSVL 5DS8A 1R3IL 1IGFH 1P2CA 9CGTA 1AO7E 4ZYKB 4DZ8A 4QRTB 5E6IA 3U4BL 5C08A 4OKDA 5EU7C 4FQQB 1CS6A 1FAIH 3U0WL 2VWEE 4N90E 2GITA 3RVWC 3IU3A 1DQQA 5DMKA 5JORA 1A6PA 5IB5A 3P4OA 4L4VE 3SQOH 1JGLH 2OM5A 4LLAA 5D4QA 5J1AB 4JCMA 4EI6B 2XZCH 5IB4A 3IFPB 3L95B 1NGQL 5F7DA 1SJXA 5SV3A 2QHRH 1NBZA 2E9WA 3CFJB 4LKXB 5C0IA 1Q1JH 3VWKD 1E4WL 1CF8L 1XZ0B 2IAMA 2W0KA 4KVNL 4GRWB 4OLUL 4RMSA 5HDBE 4ETYA 4P5TB 3L1OH 1S9WB 1CFTA 1FN4B 1ERNA 3KPRE 1JIBA 1KTDA 4O51A 4YXKH 1A2YB 4Y1AA 4R2GB 2HH0H 4PUBH 2PTTB 1J8HD 2KDGA 1KUMA 3LH2H 1S7QB 2CUHA 4MWFA 1T1WB 5F7WC 3VG0L 4PJAB 25C8L 3IXAB 3MXVL 3VRIB 3PL6B 4Z7QE 2VLLB 2AK4E 4L3CA 1U6AL 5EIVA 1ZWIB 4JGJA 4AM0A 4G9FB 2OTWA 5CD5C 1CG9B 2PXYA 1L6XA 1Z2KA 5GRVK 5DQJA 1DEEB 3DV4A 2OXHA 5KTEH 1KN2L 4BZ2L 1UT9A 2X1WL 4ZTOH 1M7DB 2H1PL 3EO0B 5E9DE 4F9PA 1TIUA 3EFFA 4XZUA 7FABL 5ADPH 4Q9RH 4EOWH 2NX5E 1BJMA 2P8PA 4PJ5D 3WE6A 1KLGB 4YHLL 4RBPH 3NABH 3D85B 4GAYA 2OXGA 2F58H 4DAGH 5JDSA 4APQB 1EFXB 4P23B 2Q86A 3QDGD 5FM8A 4D0DA 2ADGB 5ACLA 5D1QD 4GMSL 3UDWA 1AQKL 4HMEA 3S96A 2C4FU 4AEEA 2W07A 2JKXA 3CJJA 3I6LD 1KEML 3AS2A 4YPGB 1W0VA 4OGXL 3IDYB 2UVFA 5IG7A 3LRSA 3MOBL 1HK6A 4YDKL 3HPLB 4IRZH 1FO0L 1BJ8A 3AU1A 5IMLB 4FQCL 2Z8RA 2IANE 1A6TA 3PNWB 3OBAA 3DGCR 3CFCL 4QNPE 4JRYA 5DK2B 5AD0A 4JO4L 1JN6A 4Y4HB 2OJEA 4RA0C 4WNQA 5EUOF 2M26A 4XPFL 4RGOH 3FB7A 1OARH 5GZOC 4O02L 1MLCB 1WZ1L 4S1DD 5LBSH 3SCMD 4O2FA 1ZANH 3A0OA 5D7IE 4LCYA 4QHNB 1GVIA 3KLAA 4KQ4H 1JGDB 3MZTA 1OB1A 2CXKA 5E03A 2ZZUT 5A3ID 3TJHC 4P5TC 4ZPVA 2XYCA 3U4EA 1MCWM 4XBEL 2QHLA 1FV1A 2A6DA 4R2GC 1MHEB 1NBVL 1FHGA 1RZGA 3IF1A 3H0TA 4MNGA 2NXZD 2VLKB 1DCLA 1YY8B 5GZOD 3BXNA 2NW2A 5IFAH 4ELMA 1K5NB 4O9HH 2KH2B 4WUUE 4N5EC 5LGHL 5GXBB 3QDJB 3O8XB 1UZ6F 2LAGB 1MLBB 4PJBE 5KVEH 4UBDC 5C0BA 4LLWB 1F6FB 3TJHD 3IDJB 4NKDA 1JGVH 4GXVL 1T0MB 2XWTA 4U1KA 3M8OH 3AM8C 3ZZ1A 2FO4B 4U7SA 1M71A 3WKNA 4KGJA 4KHXH 3X13A 4X9HA 1ZA3B 5I9QB 4N5ED 3PL6D 3KXFE 3QUKA 4MJIA 3FFDA 4RGNC 3OKDB 3VFTB 5TQ0L 4PV8B 1G9MC 3IDXH 5I8EA 3TFKC 4NJAL 4K7PH 4QRRA 2GCYA 4P23C 3VH8G 3FAWA 1LO3L 1I7RA 3RL1B 2XXMB 4NQCA 3MLXH 5EBGA 4KRPC 3MGTA 3O45B 3RWIB 5F8RC 3LKQB 4UV4H 1KJ2H 1YECH 2EYSA 1JRHL 4MB5A 3HC3L 4XXCA 4F7MA 3CSYA 3V4UH 3UZQA 1VEOA 1XF5B 5MHSE 1YN6B 5IBUB 4Y16A 4MNQB 2ITCB 5TFSH 3V52L 2P5WE 3PQYB 4JHAH 4APQD 1EFXD 1MY7A 1N2RB 2VUOA 5DEFB 3KYNA 4JFPB 2E7MA 1F3RB 1IAIL 3MCKA 1EHNA 2FYYB 3GSRA 4ZFZB 3HNVH 1DQLH 3U48A 4BKLB 4PJFE 1YEGL 4YFEA 5LXGL 1XGUA 1FFQA 1JK8A 3EOBB 2CMRH 3CFDA 4MXQC 4N8CL 5C0JA 5INDB 4XP5L 3TBTA 4AT6B 4PRNA 1FVCA 1M05B 2CDGA 3BP5A 4JVWA 2DRUA 2VR9A 3D9AH 4LAJH 3IGAB 3QH3A 3JTSB 3VXTB 1HHHB 4NQDB 5T33L 1PEWA 4LBEA 4Y4HD 4OGYL 4BFGA 1GOGA 4UTAH 1T0NA 2X7LA 5DR5L 3SJVD 1JZ7A 3AS1A 4M48H 5GJSL 4XT1C 3PP3H 5I16B 2R29H 5TQ2H 2DQIL 5EN2A 3VXUA 5KAQG 3O8XC 2F5BL 1CGXA 1MHHB 4HHAB 4MJ5B 2AQ1A 4X6CF 5LCVL 4LK4A 3T3PE 4Z76B 4QCIB 3BIKB 5CJOH 5LG1A 3HI1A 1A7RH 3H9ZA 1NUFA 4ONHB 3TA3D 5ENWA 1S8DB 1YMMA 3MODH 5I8CB 2ZSVB 2J4WH 2IPTH 5I9QC 4W4NA 4QY8A 4FFVD 3QDJD 3O8XD 1Y0LB 2EH7L 3MV11 1S9XB 3T0BA 4Z7NE 3ABZA 4KPHL 2IH3A 4MA8H 1IAIM 1R3LB 3F7PC 1TVHB 4GW1A 2OZ4A 1BZ9B 1GRWA 3DVIA 4QHUB 1A47A 3PJSB 5I1JH 1PZ5B 4PP2B 2OYPA 1MEXH 1JZ4A 1BFOA 5JQ6L 3GK8L 3P9LA 4S2SA 4G6KH 4LPVA 5ALCL 1U95B 3SO3B 1ADQA 1M1SA 1J18A 3QIUC 2DQDH 3MREA 4DUWA 2XQYK 4PYGA 4UB0L 1X5KA 3V5HA 3GMMA 5FYKU 4YX2L 2P48B 4TSBH 5DJXA 2Q8BH 3HLAA 1OTUD 1UC6A 3DLQR 1NL0L 4I0PC 4JO3H 2I5YH 1CE1H 2V5MA 4BSJA 4ODTL 4ZFGL 5GGVL 4FS0A 1T2XA 1H5BC 4LIQH 4JFOA 1XGQA 5JXAL 4OLVL 4NCC2 1DTUA 3V4VL 1XCTA 2IQAA 1CZ8L 3QUYA 1B4RA 1I8IA 4UT7H 4XWOD 3SKNA 3L3DA 5J1TC 1CK0H 5BS0D 5ICZA 3H9SA 1PG7W 3OPZH 3TBYA 3QQ4A 5DFVC 4U3CA 4HUVB 4JPKL 3CFIC 3QUZB 1HXYB 4KDWA 4NNPH 3PQYD 3QPQC 1AD0B 2CJUH 5TE7H 3D3VE 2EDJA 2RB8A 3I6GA 1OQOA 4NO5A 1JYXA 2X5PA 5ITBL 5JO5B 5GJTL 1EAPA 1T7VA 4M5ZH 4PJEE 3E3QC 4W6WB 4KJPD 1WAAA 3Q0HA 4DK3A 5IB3B 2XNAB 2ZWLT 5IVOA 5JOPE 1T89A 3G5XB 3G08A 4ETQB 3QPQD 1ULVA 43C9B 4F8TA 5I1LB 2AKRA 1T6VN 3ZKMC 1MCOL 1X5ZA 2V17L 2VDRL 3MNVB 4PG2C 5T3XH 1UB5B 3ZLQC 3VXNB 1A7OL 4G3YH 4HKJA 2EDNA 4U1LA 3ARGA 1UCBH 5IFHH 5HI4C 1EO8L 4NQVB 4MVBC 1NQBA 3DO3A 4KMQA 2NNAA 3V8OA 2X89A 2LQRA 2B39A 3KWWA 4NO0A 3DBXB 2DKSA 4EZMA 2Y5TA 1DL7H 2FEEI 5EULV 4IBLT 4KK6D 4U1JA 1INDH 4ERSL 1RUPH 2H6PA 3EGSB 2BNQB 2ICEB 4P2QE 3ZKMD 1A14L 2G60L 1BQHG 4FQ1H 4YO0B 3SE8L 3RWEA 3THMH 3JSSA 2W9DL 1DLHB 4AY0A 2DDQL 3O3UN 4OM0H 3CU1A 4N9GA 4CADA 4P2OB 4KMTL 3PGFL 4JPWL 3G5ZB 5JHLL 2Z93A 4XPHL 1N7ML 4KUZH 5CINL 5K9OA 1AIFB 4P4RB 4KJYB 5ID1B 5AG9A 4JG1H 5DUBA 2XQYG 1NC2A 2HJFB 3KPOB 5IQ7H 5D6CB 2JCCE 1J1XL 1MFEH 1YJDL 2EIZA 3BPCA 4J6RL 3LPWA 2OI9B 1J86A 1CQYA 1MVUB 3TP4A 2AJUL 1AY1H 4N5UA 1MUJA 4WU7B 3IJSA 1MHCA 1OF2A 2EIEA 4KKNA 4O2EB 4F58H 1XGYH 4N0CC 5DZOA 5T5NF 4D3CH 5IT2L 3IRPX 2HLAB 3IFNL 1KEGH 2VDKH 5K9KA 2VL5A 1WVZA 3MV8E 3QUZC 5HHPA 1LK2B 4JDTH 1D5BA 3O3DB 5CP7B 5IEHB 5J12B 4GBXB 4BUHA 3CFBB 1R3HA 4XWGH 1DEDA 3EO1A 1KFAL 2AXFA 5JDJA 4LVNC 5MP6L 3QQ9C 4YWGH 2AJVL 2BNRA 4LSSH 4I3RH 2AERT 1PFCA 4M4RA 5BZWA 3ZSTA 4CUCA 2A6KB 4POZD 3RVXC 4UDUB 4NZRL 1J0IA 1QYGH 5IFJA 2E6QA 4ZD3L 4OD3L 5IESL 3HUJB 1QFUL 4RQQA 2J8UA 3MLUL 4OM1H 4HFUH 3J7HA 4MD0A 1YNTB 1DP0A 1LD9B 4D0CA 1AGFA 3GI9L 2G5RA 4R26L 4X83A 5FYKE 1REIA 5IJVA 1FNSL 1N6UA 3L3JA 3STZA 5TJWK 2ENSA 3SHSA 5HYJB 5HVWA 4BYHA 3FTGB 5EPMA 4GRLA 3GEWB 4LCUB 4NOBA 4U0RC 2AQ2A 3WFDH 1RIVH 2EH8H 3HNSL 5FFLA 4JJ5A 2PYEE 2YPVL 4QXUH 3TO4B 3AREB 3T0EB 1SVCP 2EDXA 3MLVH 3QWQB 1XCQA 4LKCA 3IAPA 2W60B 4KH2A 4PG9A 2FL5A 1A5FH 2MMXA 4G8FA 1FYTD 4P2OC 3P77B 1ES0B 2X4PB 3DMMB 3LQAC 4UT9L 1AC6A 5TE6L 2BNQD 1WFUA 3LKRB 5C0AB 4OF3A 2RIKA 3RBGA 1E6OL 2EYRA 4HWBL 3WDHA 3A6BH 4JDZA 5BZDA 3LS4H 3VH8B 4M6OL 3V4PH 1QFWM 4JFXB 2OI9C 4EDWL 5IM7B 4OV5A 5JMRA 3EOAB 2R2EB 1A4JA 1FFPB 4JKKA 1FZMB 2A74A 3O9WA 3LIZH 1KJMA 1CVRA 2MFNA 5E8OA 1J8HE 1C5CL 1RK0A 1EMTH 3ULVC 3T09A 3VW3H 2Y07H 1WLHA 3HFML 4NKMA 4F3FB 3PWLA 5IROA 4WI7A 5E1AB 3QFJB 2YOCA 8FABB 2ZJSH 1RIHH 2IPUK 2P5EA 3SDAD 1JRHI 2O5XL 3VE0B 5DGQA 3AS3A 2ZNXA 5J12C 4GBXC 3H3PL 3PV7A 2OLDA 1HSAA 5HI5C 4H20H 3HAEH 4XI5C 2F53B 1QACA 5EZOH 2VO5A 4FTVE 5EO1A 4B5EA 4JEGB 1JF1A 2WV3A 4OCWL 5F70A 1U8QA 4GG6E 1JZ5A 3TYGL 5ADOL 4DZBB 1EV2E 1W72H 2XKNA 2JJTA 5BMFH 1XF2B 1HQ4A 3KLSA 2DYPD 4PJ5E 4DVBB 3JVGC 1W0YT 4MMXC 4ZQKA 3Q6GH 4QOKB 2EECA 1J9CT 1QSFD 1V3JA 2YEZB 4G42A 1HWHB 3QDGE 5F9JA 5JXED 1FNHA 4QRQA 3H42H 3W0WA 1DDHB 1FNEA 4OD1L 4GKZB 1KPUB 1T83A 5IJKC 1E4XH 1FAKT 4UU9A 5MEPA 1QSEE 3SDXA 1QRKA 5CZXC 3I6LE 2NY1B 3GFUA 3BHBA 1JNHB 3C5ZA 1HDMA 4TNVK 4CNIB 3RIFF 1D9KB 5IUSA 3M1BB 1KIUA 1C7SA 2CLZA 1IGTB 3DX6B 2PW2B 3S34L 3ULSA 2BMKA 4JKWA 2VXVH 3TO4C 3RY4A 3T0EC 3FOLB 3C9NB 4RA3A 5TE4H 1RMFL 2AJXL 5F9OH 1G7HB 5HHNB 2P42B 4MA7L 1FVDA 1AFVH 1U36A 2YK1H 4PRDB 5C6PB 3G6JE 1HEZA 3QB7C 5IW6B 3LKOB 4WDIB 1BVKA 2EDFA 5HYJD 5MERB 1S7UA 1BZ7B 4L29B 3RKDC 4BK5A 3U46B 2XZQH 4OSUH 4AL8H 1HH9B 3D39B 2BXZA 1JGEB 5DUPL 3ARED 3DROA 5CEZD 4XNZB 3C5JB 5CHNB 4NP4H 3BPNB 5GRVL 4IOSD 4U05A 5JW5B 2BSRB 4JY5L 3C2AH 4OLZH 2MWCA 2VZ3A 3IVKB 1DR9A 4FNLL 1CGSL 3DMMD 5C3TA 1BF8A 1KCSL 3MV7D 1C8PA 1JPTH 1NFIB 1S9YA 4BFIA 2XWBB 3ZE2F 3HS0B 1T7ZA 3QEGH 4X4XB 4HCRA 5D7JB 1LO2L 3BVNA 4WW1A 1KPRB 2QR0A 3PP3K 2XY1A 1NMCB 2FX9L 3IDGB 3MLYL 3AC0A 4RFNB 3KPLB 5DDHB 4Y2DB 5GPRA 3LSOB 3DXAA 1OAKL 5C08E 2EZ0C 2IPUG 5IWLA 1GIGH 3O0RL 4PLKC 3NH7H 2D0HA 4HMCA 5KSUA 2CDEB 3BKCL 3UC0L 4UOW0 3V0VB 5AZEH 5FKPA 4WV1C 3G6DH 4GW5A 1F45A 3VXPB 1QHPA 1ZHNB 5T1KD 3BKYH 3QFJD 1IGML 3MGOA 5SWZD 1YPZA 3QEUB 5D1ZB 1B0GA 4PJHA 4H5SB 4ORGB 4X7CC 4HS8L 5JZ7D 4YHML 3GSXB 4AYFA 3FFCB 5FO8B 5I73B 1LILA 3KYMB 1U92A 3DVGB 5GSVA 4WI9A 4CVXB 4IMKC 4ZAKC 4ZDHB 2XICA 3TBSA 2H2SD 3KNBA 4QRPB 5FUOH 3IETA 1AGEA 1JCKA 3MRCA 1G9NL 1BM3H 2O93L 1EZVX 2E27H 1D9KC 3PGCA 3UTZB 3RZCC 4JQXC 4M6NL 1BGXH 2BRQA 3HRPA 3ZDZE 5DK0B 3MLWH 4JQIH 3OJDB 3IFLH 3EUUA 4Y19D 2GK0B 3U82B 1JHLL 1EDQA 4U7MA 1ND0B 3T2NL 4PGCB 2I07A 4B7LA 2NY1D 1AR1D 1VERA 5TDOB 1QLRA 4MJ4A 5FGCE 2Q7YB 1CE6A 3ECBB 4Y5YB 5CGYC 2J6EA 1D9KD 1EIBA 1BQHB 3F7VA 5JIIA 1C5DB 3NTCL 2QADB 4NYLB 2FZ3B 4JRXA 4XPGL 2F19L 2VDPH 2IFFH 2APVA 4P3CH 1BHGA 1GGUA 3D48R 2QQLL 4FQXD 4XNZC 1LEIA 1GC1L 3OR6A 1NEUA 1QLFA 2HMID 1HILA 4HV8B 4UV7H 5FO7A 3W82A 1BAFL 5B38A 4X98B 3CPLA 4NSKA 5GS3A 5IK3A 4PJ8A 4Z8FL 1NMCC 1S78D 4HIIA 1RHHB 1A22B 4QWWC 4WWKB 4DGIL 3G5VB 3MRNA 4Y2DC 1A7PH 2Z92A 3FB6A 4UMGA 3TCLB 4KAQL 1OLZA 3WS6C 5IHUH 5DJDA 2D9CA 5DI8A 5E1HB 5H35B 3BKJH 5BOPA 5SX4I 4X4YB 5L2JA 4PTUB 3C6SB 5D7JD 4JRYE 2VN4A 3CVIL 2Q20A 1R5IA 3ZDYF 3IFOA 4TVPL 1BFVH 3HZMA 4K3DH 1KIRB 3HZVA 5D1ZC 4MXWL 4K71B 3PIQA 3KG5A 3QXWA 4KJWD 4U6HB 1S7TA 3M17B 4JKPH 3S7GA 1ZSDA 4OUUB 1V7ML 4O4YH 3ZMRA 5I73C 3OF6D 4NPYB 5C0EA 1OP9A 2X4NB 1YQVL 3D2UA 1DBAL 1GGCL 2M8XA 2P24B 2Y72A 4GQ9L 4NN6C 1CFNA 5D5ME 1FPTL 4HCRL 5BXFA 2YXFA 3E6HB 3P9MA 4HWZB 3L5JA 5CMAA 5FO9B 4ELME 3L7EA 5CD3B 4R90H 1Q72L 3FFCD 3I75B 4L8SB 5I71B 1EO5A 1LP9A 1LE5A 3MRFB 1G7PB 1XGPA 1NCWL 5E94B 5HHME 5C0BE 2X4UB 2LVCA 5BV7B 3O11A 3RWGB 2Z31B 3QI9D 3O6MH 3BPOB 4B41A 5BS0E 3QNZB 1QPXA 1RV6X 4K55A 1V5JA 1XGTA 4Y5YC 3VXMA 12E8L 2DQFB 2OP4H 4NQXB 4KI5C 4MJIE 5DURB 2I24N 1CIDA 5I1GL 1NEZG 4OCLC 3MCLH 2AEWA 4QRRE 1YC8A 2ZUWA 2VQUA 4NQCE 3OAUH 3GMOA 5DD3L 5CEYA 3WXWL 4MDJB 3DTXA 4RNRA 4NKOA 3SKJL 3BP7B 4I5BA 1NAMA 1FFOA 3N9GH 1YEDA 1L7TL 1MQ8A 5T5FH 2NY6B 2QADD 5D2LA 2FIKB 4IOIA 1U3YA 4QXWA 5I1EH 4MNHA 1WGOA 1NGYA 1IQDA 5KVGL 5D1XB 1HOCB 1RUQH 4Z7UA 1JF6A 1CLZL 1TCRB 5BVJB 1ZT1B 1HSBB 5CIPA 4PJFF 3UEZA 5E99L 1FSKC 1WWWX 2A9NH 2ZUVA 1UFUA 2X4SB 1KTLB 1U8PB 5CSBA 5ALBH 4F9LC 1Q0YL 1IE5A 3UTPD 3CX5J 3NN8B 4U1SA 1B9ZA 2AXGB 3L3OB 4Q97A 5C0NC 4GSDL 4WWKD 5CCKL 4PS4L 4KKLD 3LDBB 5E2TL 4KHTH 4QRTA 2Y6SD 3L5XH 4Z7WF 4KZDL