4TVPD

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
242
structure length
242
Chain Sequence
b'QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 37
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpD01
3MBEA 1QFWI 3PIQA 3IFOA 2C3GA 4J1UA 3TPKA 2F5BL 1FZKB 3QEUA 1I8KA 4P9HL 2ZG1A 4XWOC 4WFHE 5KBNC 2P5WB 3LRSA 1IE5A 4LF3B 3QDHA 3BZEB 5BVJB 1S7QA 1EMTH 3RZWA 4X6DB 2WMPA 3SCMD 4P2QD 4ZFFA 6CGTA 4P3CH 2Z92A 4PIRF 1HN1A 5IFJA 4ORGB 2HKHL 2V17L 3QWOA 1QYGL 1JUFB 2Q86A 4JN1H 4I0PD 4QRQB 2EDJA 4POZC 4Y4HA 2X7LA 2NR6D 3TWCL 4XHJC 4LKCB 2C7UB 3KPRE 2J4WL 1BEYL 2I07A 3QPXH 4QGTA 2IQAB 5F7EL 3VGEA 2DYPA 3R06B 1RPQA 3PGCA 5C08D 2B0SH 4MDJB 4XPBL 3N1MC 3HA0A 3O4LE 2DQIH 3MV7D 3LKOB 5B3NA 4PJFB 1FN4B 4HF5H 5E2TL 4QRRE 2OSLB 4R6UA 4EVNB 5HGBA 5JIPA 1PG7W 5I1LA 3CVIH 1P5VA 4HUXA 3U4EA 5DJ2B 1DQQA 1IKFH 1RZ7H 4POYA 4Q74A 4IS6B 3S5LB 4KVNH 2A73B 4HUMB 4X4XA 1LNUA 3VH8B 2DJ4A 1MPAH 2EDXA 1JZ6A 4JG1L 2FZ3A 3LEVL 1HK6A 1HWHB 1MCKA 1QPXA 1P4BL 2MHAA 1MCJA 2ICEB 3MLYH 3O6LH 1T0PB 5BQ7A 4F7CB 1F58L 2X9XA 3WFBL 2XWBB 1KACB 5ICYB 1LVEA 1AD9B 3BEWB 5J11C 4OZGB 3S34H 2X2YA 4KQ4L 2FSEB 5ESQA 2HLFD 3U6RB 4AK1A 4DQOL 1UZ6E 5C9JB 4HUNB 5ALCH 2WANA 1RZFL 5CKAA 4M8QA 4QHUA 1WBYA 4D0DB 4MA8H 4KK9C 25C8L 1A1OB 2FX9L 2CDGB 3BKYL 3IJSA 4AL8H 3I02B 1F6LL 1MAKA 5SX5H 1E4XL 4MA7H 3QCUH 4HPYL 3VGHA 4XPAL 1CK0L 2OJEA 2J1KA 2VXSH 2V7NB 1E4WL 3HG1D 5HD8D 4TQEH 2ADFL 4RAVA 4P4RA 1ZS8A 5C0NC 2H6PB 1YEKH 2DKMA 4QEGA 4NJ9H 4QHNA 5M94B 4X6BA 4ONGH 4Y19A 1AQKL 1OPGH 1N8ZB 5FYJH 5FECB 2HJLA 4XP5H 2NLJA 1FZOA 3RL2B 2DQTH 3RPIA 1OGTA 2WBJC 4WFGD 3TC9A 3WDHA 2CJUH 3ALWA 4AH2A 4L1DA 5KN5B 2Z8VC 2Q8AL 1CT8B 2BC4B 3H0TB 2FD6L 2Q7YB 4DGIL 3B43A 2AJZB 2VAAA 3NN8B 2A9MH 5EWIL 3V4UH 5C92A 4EUPH 1NJ9B 3ULVD 2EIZB 1UH2A 3PDOA 1NCBL 2EZ0C 4ZFOL 4NBXB 5CSBA 1MVFA 3NA9H 1DVFC 2JE8A 1KSRA 1RK0A 4J2XA 1J05A 3C5ZC 4HIXH 3SKOA 3JTSA 5DJ8A 4D9QE 1U9KA 3AM8C 4EOWH 1J10A 2QQLL 3GHBH 3VFNA 4PUBH 1E4JA 2GFBB 5JW4M 3WD5L 1FVEA 1A6ZB 2G2RB 4ETYA 4R4FL 2M8XA 5FKPB 4Y89A 1A6PA 2X6MA 5LAXB 3MV01 3T2NH 4LPYA 4LSVH 2EXWD 2LVEA 1C8PA 3MOBL 1TETL 1U36A 2V9TA 2HTLC 4Z7WF 1FYHB 3GSQB 1LEGA 1ZLUH 3HUJE 4B0MM 5JOPE 2WWKT 1WTLA 3UTPE 2KL6A 1JK8A 1YEEH 4YC2B 2EYSB 5JHLL 5FA4B 3QCTL 1B3JA 2WUBL 1QKZH 4X6EA 1QSFD 1UWXH 5F9OL 4L4TA 4Q58C 3VE0B 2NXZB 7CGTA 2YUWA 2EDYA 4YHNA 4OLUL 1CD8A 1HH9A 2BVQB 4K3JL 5EU6A 1DUYA 1NBQA 4N0CC 4XVUD 3O6KH 3TF7C 4WEUD 3VGAC 4Z8FL 3ZT6A 3WNLA 3OWEA 1I85C 1MWAB 4TSCL 3PGFL 4GRWH 4UILL 1MI5B 1AXSB 4QXUH 1FFNA 1XR9A 3GMOB 4M43L 1QSED 4PJIF 4UT9H 2DI7A 2R1YA 3U79A 4PGJA 5C0AD 3MBXL 2NR6C 2CUMA 4KMQA 5ACZB 4YUEH 4JFDE 4M48H 2H3NB 4X98B 5JHDE 3VXUE 4ACPA 5IKCA 1D5BB 4NM4L 2DQCL 3TO4D 5HXMA 1D5ZB 4H20H 3HRPA 1IFHH 3HE7D 1V05A 3EYOA 3WHE1 3JZ7A 1WICA 2VNCA 2IGFH 5DHVB 3BW9B 4CRPA 4FXKA 3OXSB 3BEVA 4YJZL 2V2XB 2OK0L 4GKNA 5E7FA 5AUMB 4LL9A 1CLOH 4UIKH 3FT4A 3MLWH 1JVKA 3WUWB 5DI8B 4XZUA 5E9DB 3BKMH 5HYJE 2FEDD 3TA3A 2IWGA 4QHLB 3RNQB 1MCQA 4OFYA 3AS3A 4U6TA 1BFOB 1RQ5A 4HS8H 1IGCH 3MLSH 4LCIL 5F7LB 3JV4A 1YEGH 4CMMA 5DK2A 1DBMH 1GOFA 2FNBA 4RGOL 3S3PA 3N85L 3QXUA 1S9YA 1ZE3C 3BGMA 4YXHH 2HLFC 1ORQB 1FSKC 1KJVA 3BZFA 5E1AA 1GXEA 5DQ9A 3AY4A 5E5UB 4PGDB 4AIZA 3DXAE 4R7NA 5ID0B 2Q3ZA 1FVDB 4HJGA 1I7UB 3HZYB 1QLRA 1MUJA 4RZCA 2X4QB 4R9HA 1DCLA 4P57B 1AH1A 1AR2A 2K7PA 5LVEA 3QPQD 4ZS7L 2X9WA 2LQRA 4KGJA 1OAYL 5EPMA 3T0DA 3R8QA 1QEWA 1W2KT 1NUDA 1OTTC 3ARWA 3TZVA 5FO9B 1QRNE 2I5YL 2LAAA 2NY2D 1XEDA 4NCDA 2CIIA 4NQSB 1NMBL 2M26A 3ULUD 2Z31A 3DOSA 5AD0B 1QD0A 1BD2B 5GSVA 5IFHL 1AJ7L 4PJ8D 3RWGB 4P99A 4YC2C 4MJ6B 2RIKA 4JR9H 3MX0A 3BRFA 1OD9A 1BQLL 4P5TA 1MCOH 5DD5L 3OKDB 3RWJA 1P7KA 1G6RL 3ULVC 1LD9B 4LPUA 1H5BB 2OYPA 1OTUC 3E1F1 1G7JA 3MGOA 1T1ZA 3QFDB 2ZWLT 2G60H 2AABH 3EBAA 3H9SA 4JQVC 4YDJB 5C1MB 4M6ML 1X5LA 4KAQH 1RZIA 2ZCKL 1X5KA 3BH8B 3LZFH 2ENSA 3BP4B 3P4NA 1QQDB 5JNYA 4QXGH 4P0DA 5E4EB 4ETQA 5FEBA 1ODAA 1UACH 3CSYA 2R1XA 4HZLB 1M7DA 4KI1A 3LV3A 5MI0B 1ZEAL 4Y2OA 5E99H 4IRJB 4ZMAT 1AKJD 1R5VB 3ALPA 1YECH 1TCRB 3IDMA 2AJVH 3OJVC 4X4YB 4JQIH 4I2XB 1OP3H 4HEPG 4M7KH 5IV2A 4JG0L 1Q94B 1FNGB 4LHUB 2ADIA 2ARJB 4ZO8A 5IESH 4W4OA 2BNQB 1I4FB 3WFHB 3IDXL 3IRPX 2DDQH 3RTQD 1KCUL 1MQKH 3I6LE 1DBKL 4OIIL 4OBSA 1NCCH 2LU3A 5LWYL 1Q8MA 4G6ML 5E03A 3BKCH 4U7SA 1ZVYA 5IHZA 4RCAA 3TBVA 2GJZA 5DUPL 1GSMA 1DLHA 3EOBA 3SE4A 1T2QH 1JP5A 5DRNA 1H3PH 4MD0A 1T22B 3ZSTA 3OXRA 5HVHB 1XR8B 4LCWE 5EZLA 4PGBB 4YHKH 4ZXBB 3MV9D 3TH3T 4C56D 4MHHG 1AXTH 1RUQL 4E9LA 1BJ1J 2X4UB 4UV4L 1R3HB 3JV6A 3IXTA 4CBPA 1AGBB 1HXMA 3I9GL 3I3EA 2XWTA 3LS4H 4NO5B 3P11H 2BNUA 1CD1B 4NWUH 1C1EL 1AGFA 4GMSH 5IEKA 1MHPH 1YUHA 3QULB 2ZSWA 2LTQB 4UOW1 4KTEH 5E8DH 5CP7A 3I3DA 3QIWD 3UTTD 3NFNA 1BGXL 4GBXA 4HKJB 4N5ED 1A3QA 2UY7A 5F3BB 1T7YA 1AGCA 4HEME 1EEZB 3RDTD 5J57B 4OI9A 5KSBA 1JZ7A 2RFXA 1CZ8L 4KJQC 1QFWH 2R8SL 5DVKA 3IAQA 3VG9B 3BPCB 4ONOA 4FG6D 2P8MB 2QQKL 4LMQI 4QWWD 3NCFB 4PTTA 3U0TA 1G1YA 4XCEB 4L3CA 3A6BL 2Z93B 3MCLL 1MHCB 5AAWA 5IB1B 2X42A 2BHZA 3SN6N 3TBWA 1R3LA 3K4DA 2XTJB 2E7HA 1CL7I 4L4JA 5I1GL 4LGRB 2CDEB 5EZOL 1HNGA 4EJ1C 1MCCA 1Y6KR 1XGTA 2NY5C 5KSAD 2W0FA 5IW6B 2K9UA 4NO2B 4J4PA 2IH3A 4LLVA 4E41E 1BAFH 3N1QC 1HSAA 2CRMA 1DFBH 2ZSVB 4P23B 4OZIA 1H3UA 3Q1SH 2AEQL 5F7KC 5EG6C 1MQ8A 3FO1B 4D0BA 1K3ZA 3QDME 2PYEE 5FGBA 1G7IA 4PJDE 3CDGA 2BZDA 4MAUL 3ULVH 1LE5B 5ISZD 1ULVA 2LE9A 2NY6B 5E4EC 1KPRA 4JRXA 3SOBH 4ERSL 3JV5A 1F90H 5J1TC 4Z7VB 1EEUA 4MZ2A 4NP4L 3QPQC 3SDYL 3VFTB 5H35A 5MI0C 1R3JB 3WNPA 3U1SH 3W82A 2K3TA 3VXME 4JREB 4JCMA 2OJZH 5F7UA 3D85A 3ULUC 4V1DD 3ZL4H 1J0KA 5TDNB 2HMIC 1SYSA 2VQTA 3IU3B 5LCVH 2YD4A 1MWAH 3TJHD 1TIUA 1KB5L 1H8NA 4CNIB 1HHGA 3MLTB 3QDJA 5LGHL 3D3VB 1RUPH 4HUWB 5CJXC 3MRPA 1TJGH 3F7YB 3M1BA 3PUCA 2VL5B 2NX5E 3ARYA 5DZLA 3ULSA 3WIHH 4ZG1A 1ZSDA 5BW7C 1RJZB 2VZUA 5CILH 5D2LB 1Q9WA 4MAYB 4U6HA 5T1DL 3B9EA 3AU1A 4X6CA 5HVHC 4FZ8L 4ZXBC 5IVXF 4L29B 2D7TL 4K3EH 1I3GL 3QWRD 1MCEA 2DBLH 2A6JB 4X7CC 1U93B 5KSVB 5DHVH 4YEFA 2VDRH 3DETC 2MQ0A 1ZT7B 5D1QA 3K2UL 3CFDB 3HTLX 4WVRA 1KN2L 4NRZB 3B6SB 2OXGA 3VRIA 3O3AA 2JTDA 2GHWB 3C6LA 5HDQH 5DRZA 4JRWA 4G6AC 1YJDC 1H15B 5CD5D 4LRNH 2LTQC 1WEJL 2ORBH 4OM1L 2ITDB 5DJDA 4QYOA 1RJYA 1WC7B 1CIDA 4KKCC 4O5LL 2IPUK 3WNKA 2QKIB 1EUUA 1HHIB 1U8IB 4NZDA 1WAAA 3MRFA 3IS0X 3QUZB 4I48B 5AYQA 1BF8A 1TTGA 3KPMB 4RGNE 2B8OT 4OQTL 3WKMH 5DVNA 4P48A 1E6JL 4MNQA 4MNGB 1EMTL 5F7WC 2XG5A 2H9GA 4E42A 4G6JL 3VG9C 3RWHA 1AE6L 4P3CL 2OZ4L 1IZKA 2OI9B 1QTYT 4JANB 3N1PC 3TO2A 3VFSA 2O61B 1KJ2H 5FXCH 4B53A 3CAFA 1RZ8B 3WHE0 5T3XE 4W6XB 4F15C 3IVKB 2CD0A 3MV8E 4TNWK 4PRIE 2XWJB 2R0ZH 3G08A 3MLPA 2XTJC 2YZ8A 1F11B 2YS4A 2LU4A 5E8NA 2YR3A 3B9KA 2Z8WC 3VW3L 4WUKL 2B0SL 1CICD 2IMMA 5TQ0H 1E6OL 4XBGA 4UUJA 2HRLA 2DQIL 4GT7A 2ZUXA 1PG7H 4PJ5D 4NM8L 3NVQA 1WWCA 4JY5H 1R24B 2FO1A 4P23C 3CVIL 2I9LA 5IT2H 1D9KB 2W65B 4YK4B 4KVNL 4YXLH 5I16B 3EZ8A 2NY5H 1GGBH 3RIAF 3VWKD 4OCRH 4S2SB 1A4JA 4IM8A 5BCAA 5C0CB 5JXAL 1WJ3A 2NY6C 3RDTC 2O93L 1KXVC 5KS9E 3MLYL 5EU5B 4OLVH 4EUPA 4HUUB 2D7QA 5BS0E 3S4SB 4F7MA 4M7LH 4HIJA 3S34L 1U8PA 4FG6C 4QWWC 2R4SH 1UWEH 4XCFH 3EYQD 3WSQL 4XNUL 3WS6A 1ND0A 1K3IA 1ZLWK 1CD0A 4CVZB 4RNRB 3G9VA 3D9AL 5A43C 4UINH 4PYGA 3QCUL 2DMBA 1N64H 4FFWC 5KG9A 4NNXA 5HHOB 2QHRL 2W9EL 1I1AB 2E6PA 5CBAA 1L9MA 3FL7A 3EO1A 3PNWA 3QZWB 4I18A 5CP3H 4C4KO 4JKWA 3ULUH 2XFXB 1NGXB 4NJ9L 3ARGD 4ODWA 5FYJL 4MAYC 1YEFH 5DURD 4PJBB 4ZUTA 4F7PB 2DQTL 3L3OB 4EBQL 5F44A 4KK6D 1P2CA 3IDGB 2C3VA 1CE1H 2WV3A 5CHNB 3WXWL 1FLRL 1LO5A 4PJAE 4NQXB 4J7RA 2W38A 1BM3H 1LO2H 4NQEB 1SJEB 2AXGB 3V4UL 2A83B 3CFEB 1AO7A 1MFBH 4MJ5A 1TQBB 3BMVA 4I77L 3Q6FA 1IKNC 3RA7H 5FKAA 3MRLB 1LO0L 3OKEB 3PQYE 5HHNA 4X9BA 4X0KA 4GG6E 5A2FA 4NDMB 3ARUA 3V6ZA 2Q76B 1JMZA 1ZA6B 4KMTH 5HHXH 1MIML 3PWNB 4R90L 4UDUB 4Z0BH 3WLWD 1TNNA 4S10A 2GIYA 4LLMA 4X4ZA 5TF0A 3L9RB 2V2WA 1JF5A 3DI3B 2ZUSA 1YJDH 3ZZ1A 5DS8B 4R2GD 4ZSOB 1XIWB 3RGVD 5I2IA 5I74B 1FHGA 5DJ0B 5C2BH 3T2NL 3EO9L 1I8LC 1R3IL 2AEIT 2JIXA 4DZBA 5GGTL 4K2UH 4M93B 2AERT 2IPKB 4LVNB 3C2AH 3O0RH 4QCIB 5A40E 5J8OA 3NIFE 2A6DB 2HFGH 4AG4L 3F58H 4WJ5B 1I3RA 3BUYB 3MRMB 2OR7A 1YEEL 3X14B 3KJ4B 3DJ9A 4BH8A 3FT2A 1N5AB 1T03H 4PRPB 3BDYL 1TITA 3N1GC 3DARA 2J5LB 5EFIA 3SGEI 1YNLH 1HIML 1PEZA 1D9KC 2EDKA 3GJFB 3I50L 4M1DH 5FV2A 1CTNA 1YPZA 3PGDA 1WCBA 4YK4C 1P1ZB 5IMLB 4ZFZB 2M2DA 1T0NA 4FABL 1J0HA 3CPLA 1UXWB 4UT7H 4XHQA 1WT5C 1G7QA 1UH4A 4RFEA 3F5WA 4D94A 1A22B 2NYYD 4UOW0 1MELA 2X4PB 5J56B 3CFJA 4LRIC 2YWYA 3MOAH 3MRIA 1Q38A 4MD4B 3CCHB 5I1DB 2FJHB 3P77A 5DXWA 2H26B 2WBJA 1KN4L 3OGCB 1VACB 3PWPA 1JPTL 1UB5B 3KYOA 3MJ7B 4Y8AA 2V7HB 4DOHB 5IW1B 4LSUH 4YHOH 5TGBA 1GL4B 1MF2H 1FFOB 5J9PB 4J3VA 5DZNA 4HAGA 3TYFA 1HINL 1Z5LB 5KSUA 3CFCL 4M48L 5DEFA 4YHZL 3ZDYE 2AEWA 5I8OH 5TE6H 4PRAA 2J3SA 1DVFA 3FQTB 4QHMA 1I1AC 1FGVL 1NCDL 4JPIB 4TYUA 2J8UB 3C5ZA 1KTKE 4JM4H 2EDRA 2BRRH 1NEZA 1IEAB 2BVPA 3AM8A 5EBWB 2I24N 1X3DA 2DL9A 4JFZH 4UIKL 4Y19E 1FZKA 3SE9H 2YD9A 2P5WA 3BKML 3VWKC 4XBEL 1KCSH 2PW1B 3MCG1 4LF3A 2B2XL 5BVJA 2ADJB 3SKNA 1IGFL 4X6DA 4ORGA 2QSCL 5E2VH 2NY7L 1RJLB 4QRQA 2FL5A 4EKXA 2BCKA 1FYTD 2IPTH 2VDML 5DD0L 3TBSA 4JO4L 3TPUB 1A1MB 1W0VB 1I75A 3S6CA 2IQAA 3EYQC 2VDKL 4NWTL 5SX4I 2IG2H 1D5IH 4MDJA 1HYSC 4Z7NF 2EKJA 3BQUD 4KDVA 1FZJB 4PJFA 1Q9LB 3QDAA 1T1WB 1M1SA 4KROD 5F96H 2XN9B 1KEGH 4PRBA 1ZVSA 4WEBH 1OWWA 3L5WB 4IS6A 3S5LA 3MRNA 5GS1B 3A0OA 4LCUB 1GC1L 3VH8A 1XIWC 1A6WH 5GS0D 4H0IA 2ED9A 5I74C 1FDLL 2Y36L 5JOFA 4M6OH 3VFUB 4FXGB 1ZLUK 4Z95L 4M93C 5JQ6H 3VFVB 4X80L 4LVNC 1NUFA 1JPFA 4FXLA 2XV6B 4F7CA 4UB0H 2Z35B 2VTFA 1BJ1H 1I85A 4P2QA 3BEWA 3IGAB 4OZGA 4L8CB 4HH9B 3KJ4C 4JR9L 3U6RA 3DRQB 3G9AB 5IVZB 3P4OA 3WFEH 4I0PA 2HN7A 1UWXK 1A1OA 2GK0B 4BK4A 1W72B 1CL7H 2CDGA 3UBXG 2YEZB 4K7PX 2FDBP 4N90D 3B5GA 2GITB 2J5LC 3L3HB 5GS3A 4LSRL 5HGGS 4L4TE 2O26U 4KAQL 4D9LH 1CWVA 5ICZA 2V7NA 1M6OA 5A2LH 5I1IH 4Y88A 2CK2A 3MV7A 4AQOA 3PHSA 3LZFL 5CEZE 3ECBB 3QQNA 4H88H 3LS5H 4QXGL 2EYRB 5ESAA 5EU6E 1JN6A 4HS3B 2XYCA 1RJCA 3LOWA 4OB5L 1N8ZA 1HI6B 4JFYB 5FECA 2HKFH 4EN3D 3RGVC 3RL2A 1ZLVH 4A6YL 2JKXA 1VA9A 3LKQB 5IVOA 1FFPB 2XKSA 2KH2B 3FOMB 3BP5B 3BVNB 5LBSL 2R2HB 3V4VH 3QHFH 2AJVL 2BC4A 3ZE2E 5SWSB 2Q7YA 2AJZA 4M7KL 3PHOB 3ESVF 5F3HB 1JWMA 1NL0L 1QUNA 2IQ9H 3EDEA 1CLZH 2ZKHH 1ES0A 3UAJC 4UI2A 2EIZA 4Y4FD 1JCKA 4OTXL 1DBJH 5ENWB 5I73B 3W0WD 2P24A 2BOBB 2X1QA 3PP4L 2B1HL 3V79C 4LIQE 4GKSB 3BKCL 4JVWA 1OTSD 1N26A 3L1OH 1RD6A 5DMGC 1TPXB 1XF4A 1CDIA 2FBOJ 1J9CT 1T2QL 2GFBA 1H3PL 4GLRI 1OM3H 3MRQB 5CWSB 5FKPA 3CXHJ 5LAXA 3ESUF 4GH7B 1AXTL 1PEWA 5D5MB 4TVPE 4G5ZH 1TQCB 1HHJA 1PYWA 1FPTH 4H1LG 4JY6B 3O4LB 4WV1B 3LS4L 2GAZB 4KTYA 4U1KA 2XPGA 4G8EB 4QRRB 3GSNL 4GMSL 2AJYL 2ICWJ 3BDXA 4ELMB 5IMKB 2D4DA 2EYSA 2NY0D 5I9QB 5E8DL 3KAAA 1MAJA 2K1MA 2ZUUA 3IFNH 1Z3GL 3MA7B 3AXLB 4YWGH 4KJPD 3KWWA 4AIOA 4JQVA 5I17B 1D5MA 5GS1C 4IEFB 1A2YB 4UMGA 4JKPL 2AK1L 1LQSR 3ZE0E 4FQLL 1T5WB 1CGTA 5DDHB 4LP4A 2DN7A 2VLKB 2PR4H 4PRNB 4FTVD 4HDIB 4HV8B 1MFAL 5C0FA 2E7BA 1MWAA 3QWQB 3MLUL 4HK3N 1AXSA 3B2UD 3S35H 4ZDHB 2ICWI 2UYLB 1TJIL 4JDVB 1S7WA 3LKNB 3VXTB 3JUYA 4AEEA 3C2SA 3UYOD 3MGAA 4MXQD 2GJJA 2X1PA 4DAGH 5D7JD 5ACZA 5I6XB 1BAFL 2H3NA 3OB8A 4QRUB 4X98A 5GGQH 1DFBL 2IAMB 4WTZG 3WIHA 1V3KA 5GZOC 3HS0A 3IDUA 1D5BA 2DLFL 1ONQB 1XGUB 1RHHB 4NQDD 3H9SE 1RUKH 1KB9J 2B5IC 3BQUC 1Z9LA 5EC2B 5T1LD 3VD3A 3E3QC 2AK4D 3HC3H 5GGVH 2P46B 1RIUL 3BW9A 3MO1B 3SJVD 2V2XA 2J6EH 4NNPL 1MRFH 4P3DB 2OQJB 3L5XL 1A6AB 3GJFH 3WUWA 3O2WL 3EYSH 1KIPA 5K9QI 1UXSA 3PDDA 4ZS6D 3NCYP 3CDYA 1OP3K 3QUKB 3V0VA 3V5DB 3GSXB 1U3HD 3RNQA 3ME0A 2ZJSL 2OP4H 3MLXL 2YD3A 3GSUA 5D1XD 4PP1D 5IFAL 3M17A 4HAFA 4GAJL 3ZL4L 3QDGD 4S0TD 3FRUB 5I0DA 4R26H 1ORQA 5I73C 1QSEA 4RRPA 3U36A 3KXFD 2GQHA 5FM8A 4ONFH 5J6GA 1CGXA 3GIVA 4PFEA 3OF6A 5D70L 2DWDB 2YUVA 5ID0A 4OFPA 4K3HA 1TJGL 2BSTA 2YPKB 4KMLB 1FVDA 1TPXC 5T33L 5FYLE 1KJ2A 3MXVH 1I7UA 1X5JA 2X4TB 1YA5A 4KI5C 2B7DT 3EGSB 3NIFF 4JFED 3NCCB 4EQ2A 4Z7OE 3K1KC 2WBWB 4HLJA 4EXPX 1JGDA 1CDCA 5I8KH 4OZFB 2MPAH 4P57A 3HUJB 3H8NA 1C5BH 3TBTA 3UXFA 4LGPB 3CX2A 5I71C 1TQCC 2VR9A 4OKVA 2V5YA 1KJMB 1EAPA 2EDQA 4EN3C 4KDTC 4QHKJ 4WV1C 3T0WA 2SEBB 4J8RB 4NQSA 5AD0A 1LP9F 1BD2A 1OAKL 6FABL 3W9EB 3GKZA 3PWLB 3LN5B 4LRNL 5HHVL 2ORBL 3OKDA 5I9QC 4IOFD 1LD9A 1A7OL 2PTVA 3O6ML 4H5SB 3IXAB 12E8H 4LEOA 3QFDA 4N9OB 1G7HA 8FABB 4D0CA 4QRPB 2YN5A 2A9NL 1RU9H 3VD4A 3FQRA 1IT9H 1OTSC 5KSBE 2VLJD 2UVEA 1S8DB 1FG9C 3D39D 3UC0H 1T0MB 1IAIH 2GJ6B 4BFGA 3L3GA 1QBBA 4QHKI 5EC1B 2W07A 2W92A 1DL7L 2ICWB 5JHDB 3RL1A 2P1YA 3MJ6A 4R0LB 1CGSH 4HWBA 4IOIB 4LHJB 1TCRA 3VFRB 4JM2B 5I15H 3C5SA 4X4YA 3O11B 4ZPVA 5TQ0L 2IMNA 4QTHB 5CP3A 2JJWA 3IDNB 1PG7L 1FNGA 4OUUB 2A77H 1F00I 4LHUA 4PG9B 5GGUA 5HTSA 2IAMC 3BXNA 4OGYH 5F6IB 4DWHA 2BNQA 4ZD3H 1I4FA 4KUZL 3G6DL 3GI9H 1MJJB 2BP3A 5IT2L 4WO4D 3SDXA 4OZIE 3H6JA 2FX8H 4MQXC 5EA0L 2NY5L 4XNYH 5CJXA 4OCRL 1N4XH 5BRZD 4ZOBA 3F62A 1L0YA 1W72H 1IILE 1OWRM 3Q0HA 5I30H 1S7VB 5BW7A 3AROA 4OLVL 2NXYB 3HZVB 1F4WL 1G9NC 2F9BT 3QQ4B 3MNZB 1T22A 2AGJH 5I19L 4I9WD 4PGBA 3RUGA 4ZXBA 2EH7L 1IRAY 5DD6A 4XCFL 3S36H 3VCLA 4NPYB 2X4UA 4OQ1A 1OSPH 3OAYH 1JBJA 1T5XB 1AGBA 3DXAB 4KJWD 5J1SC 4NO5A 1D6VH 1CD1A 5IMOB 2HG5B 1AKJA 5L6YH 3RHWF 5T5NG 3CD4A 4O4YH 5J13B 5LXGH 1P4IH 1N64L 2YMXH 3QDJE 1VFMA 3GJEB 5EO9B 4M6NH 4BSWA 5DD1H 4HWZB 1EZVY 3QP3A 4DGYH 4M5ZL 1EAJA 2JCCF 4C58B 1TJHH 4UDTB 4WEMB 4OF5A 3VA2C 2DJSA 5F3BA 1BVKA 3DO3A 4XNMB 1MOEA 5IJVB 1EHLH 1I8MA 1QRNB 4XXCC 1E28A 3HE6D 5F89B 3FO2B 1YNKH 1CE1L 4BKLB 3OKKB 5CZKA 1QR1B 4MNHB 4X6CE 1GH7A 4PGEA 2HWZH 5IB2B 4XCEA 1CBVH 1U8QB 3ZE1F 3QG7L 2XKUA 2JF1A 1OB1A 1DQJB 1MHCA 4B5EA 5B38B 5JO5B 1KLUB 1XGRB 4WWKD 3P4LA 2KBGA 1F2XK 2GSGA 2MTPA 1BQHB 3FFDB 4OLXL 5D1XC 5CJQL 1VPOL 2CDEA 4RGMB 2VIRB 5T5FH 3QUXB 3V6BR 4NO2A 3O8XB 4X7FC 5HHXL 1S9KC 3GMPB 3MRRB 2Y07H 2YD1A 4UIMB 3UMTA 3ARBB 4FQ2L 5MEQB 1SM3L 4OD1L 1WAAE 4HIIB 4O2FA 5GISH 4DVBB 3MUHL 3QQ9C 3UTTA 5C2BL 4MNQE 1LE5A 4OCYL 3SDCB 5HBBA 4KKBD 1FZMB 2G9HB 1QNZH 4L9DA 5D6CB 2C3XA 4K2UL 3RDTA 5A3IC 2EO9A 4S1QH 1BFVL 3C2AL 1X5FA 1RFDH 4Z7VA 1IC4H 3HNSH 5HGDB 3T0VA 1R3JA 3CU7A 1F4YH 1T4KA 1F13A 4JM2C 2AEPH 5E7BA 4QF1A 3W11D 4ELKA 1FFQA 5F6IC 3DPBA 4LP5A 5TDNA 4XCYB 2AJUL 2E3VA 3IU3A 2BMKB 1MNUH 1Q0XL 2CO6B 5FYJE 1NCAL 3D3VA 4IOFC 4TUKL 2VH5L 4DKFH 4HUWA 2WINB 2E8YA 4LCWB 3BMWA 4Q9BA 1VEMA 5DTFA 1VKXB 1RAMA 3WIFB 1IQDA 5DMKB 4PV9B 2VL5A 3QEQB 5IHLB 5D2LA 4JJ5A 2NZ9C 3MOAL 3P9MB 1OY3B 4ODHL 4FQQB 3IT8D 1T7ZA 1G7MB 2HFEB 3L7FA 5C0DA 4JGMA 4K94L 4LSUL 4YHOL 5HSFA 1I8IB 2F19H 1U93A 2FJGB 2CLRB 5KSVA 1ZT7A 5E6IB 4PJHB 3CFDA 1U2HA 1A7BA 5IWLC 1A1NA 1JHTA 1G9NH 4G7VL 4NRZA 3VI3E 4PBWD 5I8OL 1NC4B 4R4BA 5CJOH 5J13C 5TE6L 3WE6A 2P42B 5EU7E 2I26N 2DJUA 4J6RH 3H2WA 4U1JA 3VGDA 5MENB 3BIBX 4V1DA 2ITDA 2BRRL 3KLSA 5IGXH 2QKIA 3HAEA 3PABA 1HHIA 1OW0C 3TCXA 4I48A 4JFZL 3KPMA 2NW2B 2HJKB 2BY2A 1VFBB 1P6FA 3HRZA 1MH5A 5IQ7H 5KAQG 4ODXB 4ZQKA 4MMXC 3F7VA 1I8LA 5C7XL 1A9BB 1UZ8B 2FRGP 5E2VL 3S8WA 4YH6A 1NGPH 3ISWA 4XPTL 1RZ8A 1JHKH 2IPTL 1EGJH 2CGRH 2XWJA 2PXYD 1FJ1B 4DN4L 4U3HA 1EJ6A 1AO7E 4TPRL 4OZFH 4HGWB 4MA3B 3QIUB 3NZ8B 4RGMC 3OJMB 2HT2D 1YEHL 4HW6A 3QUXC 1D5IL 2JB6B 2V2TB 3MFGB 3O8XC 1KTDB 1U8MA 3QDMB 4JRYD 4PJDB 2ZP0T 4FNLH 2YD7A 4JZOA 4G6FB 4TULH 1CGWA 1R24A 1YDPA 3ARBC 4OM0L 2DL2A 5AWNL 1D9KA 1UJ3C 2W65A 3TT1L 1F4XH 1CXLA 1A6TA 1A6WL 4XVSH 3ORJA 1RZJC 1GVIA 1D6EA 4GRWE 4M6OL 1AD0B 2X05A 1WT5A 1JPSH 4Q97A 1S3KH 5FO7B 1WZMA 4YGVA 4Y5XC 5DHYB 2ZCHH 2ZUWA 1WBZA 3H42H 3MRCB 1Y6MR 1U3JA 4HUUA 4LRIA 1MVUA 2XY1A 4HK3J 4LSSH 1H0DB 1U3ZA 2R29H 3PWUB 4NZUH 4Y16B 1OD7A 3EFDL 4G8IB 1NDMB 4PB9L 4U49A 3KYMB 1GOGA 5MEOB 3OSKA 1UEMA 4YLQT 4DN3H 3P30H 4NN7B 1XCQB 4D8PB 5FUZH 4D3CL 5IJKC 4CVZA 4KPHH 4ODBD 4EDWL 5T1MB 4U6YB 5I1AB 5AZEH 1PVHA 3WEXB 1TZHB 4Z7QE 2R69H 4U1MA 1YPZE 1I1AA 3INUH 4PLJD 5H37G 4PJ5A 4JY4B 2DQFB 3HI6L 2C26A 5ILTL 1H8SA 3BP7B 4PJBA 3UJJH 4F7PA 3L3OA 3VWKA 3DX7A 3IDGA 1MCIA 5B3JE 5CHNA 4FQPA 2DIBA 2IPUG 4RMWA 2VKXA 1QFUH 3PWPE 3V4VL 2D7PA 2BOCA 1MCLA 4HKXA 1TNMA 3B9AA 1SJEA 5IROC 4BZYA 5E6IC 2A83A 4LFHG 1SEQH 3ZHKA 1DBJL 3EZJB 2JELL 3U7WH 5I75B 5J12B 5GGSB 1EFXB 2CSPA 4HJJH 4NDMA 3LRGA 2NY4B 1PX4A 2R4RH 2DQEL 3M8OH 2VWEC 2I9TB 2VXTH 4UDUA 3L1OL 4GRLD 1VB9A 3TFKC 3HZKB 4U33A 1U8JB 5D7SH 3FRPA 4J23A 3RWIA 3L9RA 5EN2B 4IJ3C 1BWMA 4BFIA 1LDPH 1WWAX 1RULH 4ALAH 3MV8B 3QFJB 4PRIB 4ZODA 5I8EB 2P5WE 3KYAA 1XIWA 4ZSOA 5JOEA 5SWZD 3S88H 1H3WM 3LDBB 4MYWB 4JHZA 4X6DE 2Z8RA 3OKOB 1OGAD 3E6HB 2F54D 4S0SD 5C0CD 1QA9B 1QBMH 2IPKA 4BYHA 4FQCH 4OCXL 2LV4A 1EHXA 4WW2B 1XAUA 1JNNH 2APWA 2DTMH 4ZNEA 2K7QA 2J88L 1JF6A 1KXTB 1RIVH 4WJ5A 3BUYA 3MRMA 3QIUC 3X14A 3MACL 5CGYD 4ZUUB 5EO0B 3RWCB 1OLZA 1MIEL 2XA8L 1N5AA 2MOVA 3WFZA 2JJTC 1FO0A 2N7AA 2FEEI 4FQXB 4M03A 1DBBL 2A74A 2E6JA 2VAJA 2HFFB 2J6EA 1NANI 4NFBA 4PJFE 4WCYH 1JGLH 4ISVA 3VXNA 5E2JA 3GJFA 3HPJA 4NBYB 1IM3B 3O2VL 4KRPB 1P1ZA 3B2VH 4ZFZA 1X6NA 3ROLA 3UTSD 1UG9A 1FFRA 5H2BA 5KVDH 3MRBB 1F8TH 1LEIB 5D7IA 1XGQA 4OV6F 2ZOKA 2F8OA 4GAYB 5GRJH 5HDLA 4TOYH 5I1DA 2FJHA 3RGVA 1QFHA 1B0WA 3FCTB 3D1MC 1I9RH 3OGCA 1RZJH 3S35L 4XNXL 2A0LC 4P2QE 2V7HA 4I3SH 4OZGE 5IW1A 2OL3L 3L3DB 3SGDH 4ZAKB 1OOAA 5J9PA 2D0HA 4ZTPL 4WFFD 2ESVD 4NN7C 4DAGL 2HA1A 5CLWA 4XMLL 2HAZA 4XPFH 1RSFA 2B4CC 3SQBA 3D69B 4AEHL 4DEPB 4H0HB 3QA3B 3QUMB 4OCSL 1PQZB 3P0GB 4LQ1A 4NKMB 2CMRL 2VLRD 1RK1B 3FQTA 4HZAA 4LASL 3DSFL 2V5SA 4OZHF 2J8UA 4P9ML 4WHYH 2D0GA 3MRHB 4ESKA 3MV7E 1IEAA 1Y0LA 1DQLH 5EBWA 4JO1H 4OI7A 3OHXA 1ZLVK 1MRFL 3ARDB 1ZHKA 1WIPA 4APQB 5JMRA 4QOKD 5DRWB 2BSRB 1NAMB 1QVOB 2PW1A 5HHMD 1GGIH 3MUY1 3DUSA 3R1GH 3K81A 2BVYA 4F3FB 4GG6B 3DURA 1LILA 3PQYB 4MX7B 1UM6L 3HB3D 1D5XB 5FHAL 4WW1B 1KELH 1EO5A 3I75B 5HI3D 1RJLA 4IRZH 2KQMA 4OD3H 1W0VA 4IMLB 2P8PA 5L88L 4G8FB 3P3YA 3MBEB 5I75C 3FO9A 4LLWA 1U92B 3PIQB 1M4KA 2UZIH 3GNML 3X13A 3ZKQD 3QEUB 1I7ZA 2NY4C 4F58L 1I8KB 5GZNC 2Y6SC 1X4YA 3LRSB 2PKDA 4QTIH 1HHHB 5IEHB 1S7QB 4PRHD 5CBEA 4ZFFB 3OG6B 4UV7L 2Z92B 3ZDXF 5IFJB 3QWOB 2Q86B 4PLJC 2X7LB 4LDLB 4LPWA 5FYKH 1INDH 3LDBC 4KVCH 2I07B 2ZCLL 3VFUA 2DYPB 1JV5A 2OTWA 3V4PL 4PJ9B 1YN6B 2Z35A 4WW2C 5B22A 2QQQA 4LBEA 2DQUH 2D7NA 4WFGE 1T20A 5HGBB 4L8CA 4HH9A 2F15A 1EDQA 3ZHLA 5I1LB 4HUXB 4WI5A 1DQQB 4X8JA 3K3QA 3QHZH 1RZKL 2VC2H 4FQXC 4X4XB 1LNUB 1W72A 2Y06H 5E70A 3ULVE 2YEZA 2GITA 3L3HA 2FZ3B 4YDIH 1QG3A 1YEDA 4KRPC 2MHAB 3BQUA 2J2ZA 1G6VK 4GRLC 3K8KA 3ECBA 3GGWA 3VI4F 5FO8A 3RX7A 4AY0A 4MA1B 5ESQB 1N0LA 1U2CA 3GFUA 5GRVL 2WSKA 5F8QC 4DFIA 5C0JB 2A6KA 4JFYA 5F9AC 4M8QB 4QHUB 4JFXA 5D96B 4G9FD 4YGAB 5JUEL 3IJSB 1CGSL 3FOMA 3BVNA 2R2HA 5JIIA 4XP9L 4ZAKC 5SWSA 1EXUB 2OJEB 3TVMD 4HWEH 3AREB 5F3HA 3EJZD 1CFTA 4RAVB 1REIA 1ZS8B 4P4RB 1PW3A 1FIGH 3V6FB 2FX8L 4CU8A 4X6BB 1MAML 5AEAA 1FIEA 1MRCH 4NQCD 2N4IA 1N4XL 2HJLB 4MXWL 1FZOB 2EDFA 3GJFK 2B4CH 1NFKA 4Q6IB 4WFED 2FH6A 1NCNA 5T3ZL 3ARDC 4KZEH 1DQDH 5F9DC 1MEXH 1U41A 2BY0A 2QR0B 3UPAA 4APQC 3S37H 3NABL 5CWSA 5E9DE 5TF1H 1UCTA 1N6QL 4OGXH 5D5MA 1TDQA 1IC5H 4PLNC 4NKIL 4YFLI 2RBLA 1P69B 4EN3A 1RK0B 1J05B 4WV1A 5JLZB 1D6VL 2IALB 1W8NA 2GAZA 2VDLH 4G8EA 2FJFA 5L6YL 5DFWH 2V5RA 3MBEC 1S7SB 4O4YL 3VFNB 1EO7A 5LXGL 1P4IL 4ELMA 2L0DA 5IMKA 5L2KD 1QSEE 2YMXL 4GRWF 4WNQB 4NHUB 3JBG7 1FVEB 5DD1L 5C0IB 3TV3L 3X3FH 4Y4FA 4DK3A 3MA7A 2DMKA 4GKOA 3WXVH 5JZ7C 5I17A 4MMZC 2BJML 4PJ7F 1A2YA 2E27H 4LDEB 4WUUB 2VXQL 3DV4A 4YZFF 2HWZL 1JK8B 1T5WA 4XWGL 5BV7C 3QUYB 5AZ2L 1CBVL 5CZXC 3C6SB 4G3YL 2VLKA 5D8JL 1UFUA 4PJ9C 4HDIA 4X9GA 4FN0A 4CAGA 5C09A 3KR3H 1AHWC 2IFFH 1A7PH 1BD2E 1CLYL 3K4ZA 5E95B 2UYLA 4KRMB 3GMNA 5J7CC 3VXTA 2VDPL 5EB9A 4FHBD 4YHNB 1PZ5A 3FFCD 1HH9B 2IAMA 2Y07L 15C8H 4P2RD 1BECA 3VXSD 4N0YH 3TESA 5EU6B 1ONQA 1XGUA 1RHHA 3RVUD 1T7VA 3O6FD 4YR6B 4WI9A 5B3JF 2ZPKH 3IFLH 2VKWA 4PYHA 1EV2E 1A5FH 4S1DD 1QNZL 4ZUVA 3OKLA 4MA1C 1XR9B 4KZDH 4P3DA 2VISA 2OQJA 1LGVA 4OF0A 4C59B 1RFDL 5D96C 1XGYH 1NLDH 2OR9H 4M8VA 3BRDA 5EUKA 3V5DA 1KCVH 5TE4H 5C8JA 4O51A 3KPRD 2E9WA 4TNVF 1F4YL 3IJYB 4BSVB 5GJTH 4FTVA 3AREC 4I2XE 5BJTA 3GM8A 5C0BD 3FRUA 2EYTA 3ULUE 1C16B 4L3ED 5GRWA 3BUTA 2BNQE 3DIFA 4FXKB 4GKNB 3SDXE 4O58H 2F8XC 3FT4B 1YQ2A 2Y25A 2DWDA 4PS4L 2CKBL 3TA3B 4Q6IC 1AI1H 3OX8B 1CXHA 4MDIB 1NEUA 2X4TA 3WO4B 4NQDA 5JW4Q 3TNMB 1T21B 3EGSA 4XXCA 3JV4B 2WLZA 3OAYK 4PBVC 1KJ3L 2H2SD 3RWDA 3VG0H 4LLQA 4OZFA 5LJYH 2AK4A 4X9IA 5EU3B 5EUOF 3RUGE 3BO8A 3BGMB 2F19L 2Q1EA 4PJEA 1NBVH 2XZAH 3CVHH 5BOZG 4HLZG 3TIDB 1KJVB 1KJMA 3CZFB 3BZFB 5E1AB 4PJFF 2SEBA 1G9NL 1NAMH 2VDOL 5CJOL 4Q0XH 1EVTC 5D1XA 3FB6A 3BZ4B 3TVMC 1QLRB 4XMKH 1MUJB 3EJZC 1UWGL 4RZCB 5IGXL 3NFSH 3K80A 5I18H 1I9IH 4Q6YA 1S7RA 1OARH 4LPXA 3TN0D 4EQ3A 3KXFA 3F12A 4QRPA 5EPMB 4XP6H 4EI5D 4OZGF 2CIIB 3OGOE 1EEQA 3DGCR 1T80A 1S8DA 1YYMH 1IGIH 2Z4QA 1MLCA 3NH7H 4HIHB 4DUVA 2FBJH 3QUYC 1NGPL 1KENH 4DW2H 3G5ZB 4P5TB 2FIRT 1EGJL 2CGRL 4J3WA 4NOFA 3RWJB 5JW4R 2BVUA 1JTPA 5C70A 2KQNA 3HMXL 4Z7UA 3CK0L 1NBYB 1G7JB 3MGOB 4IOIA 2XTJE 4OGAD 3S5LG 1X5GA 4XTRC 4H25B 2VN4A 3VH8G 5BV7H 4EZMA 3OR7B 1J1OH 2R23B 7FABL 4FNLL 4GW5A 4YHMH 3IDNA 4AENB 2YPLD 4PG9A 5EBLB 1F6AB 4LCYB 2WUCL 4D9QD 5I1CL 3P4NB 5SWQB 5IG7A 5JNYB 4QRTB 4R4ND 1PZUB 3KLHC 3HI5L 1HNFA 5JMOC 3TCLB 1UT9A 2EDBA 1FH5H 3Q5YA 4Y4KB 1VEPA 5FCSH 1M7DB 4IOSD 3LV3B 5KZCD 3UTTE 1S3KL 3DVFA 2ZCHL 2AV7B 4FFZL 2VDQH 3IDMB 1S7VA 2AKRA 2AJXL 3QQ4A 1JI2A 3MNZA 4NZUL 1B90A 4JFFB 4XXDB 3TM6A 4HCRA 2VLJA 5AYUH 4Z7VE 2RCSH 3D39A 2CRZA 4Z78B 4NPYA 4DUXA 1ZGLP 2W59A 4PJGA 4GQPH 1G9ML 3HPLB 3SDAB 5IWLA 3HNTL 1CU4H 2GCYA 5IMOA 2HG5A 3GKWL 4BUGA 4DTGL 4TN9A 3GSOA 2GJZB 4HQQL 3EOBB 1X7QB 4RFOH 3INUL 2J12B 5DRNB 3D3VE 2YKLL 1C5CH 2HT4D 5B39A 1LDSA 3TA3C 4WY7H 3DROA 1X5ZA 5EZLB 5I1EH 2W60A 5HI4D 3RVUC 2Y5EA 1OW0A 3WO4C 3O6FC 4NCC1 3OJDB 1V7ML 4G6KH 3U9PL 4XNMA 1KBGH 2BY1A 1DE4A 2ED7A 3IXTB 5D2LE 5F89A 3STLA 1PKQA 2EDEA 1QR1A 1QFUL 3QEGL 4HJ0C 3I2CH 1AGFB 2JK5A 2QLVB 5IEKB 3CU1A 3QI9D 1U8QA 4ZOCA 1CVSC 3T4AA 1FCGA 2FHFA 5DLMH 1SEQL 5JO5A 1KLUA 2VITA 5CP7B 4JFDD 3O2DL 3FZUD 3VXUD 1SJXA 1BQHA 3OPZL 1QFPA 4HJJL 4WI7A 4Q9QH 5IVXB 2WP3O 1X6LA 3PL6B 3QIBD 3O8XA 4ZFGH 4V1DE 2VXTL 2X89A 4H8WL 1TZGL 1IM9D 2MMXA 3MRRA 3GRWL 1RI8A 5KVGL 3K8MA 5D7SL 1PG7X 3ARBA 1S9WA 5MEQA 5JDSA 3MRJB 1UJ3A 4PTTB 5C07B 2JJVA 3U0TB 4BM7A 1EUTA 3IU4H 3S88L 3BPNB 4LMQE 5IQ9B 1R3LB 4JQXC 5HYJD 4OJFL 2ERJB 4AT6A 5JW5A 1FZMA 2V9QA 4LAQL 2G9HA 3BHBB 4KWUA 3K2MC 4Y5XA 5E94B 1Z0MA 4P5TC 4FQCL 4XCCL 5E2WH 2GT9B 4KH2A 2AS5M 1RIVL 3NIGF 1HSAB 4IIQC 4WHCA 1U8HA 4OZIB 5HYSB 5DRXA 3ZLQC 4JDTL 3E8UL 4D0BB 2O5XH 3BAEL 4XP1H 4U1SB 4X7DC 5F7DA 3SDDB 4JE4B 1G7IB 1T6VN 4XCYA 4WCYL 2BMKA 1JGLL 1ZV5A 1U95A 4HWUA 4C54A 4Q9RH 4Y1AD 1PY9A 3B2VL 2OX5A 1KPRB 3BWUC 4P4KB 3WBDA 1KC5H 4JRXB 4O2EA 4Y4KC 1VKXA 3CXHK 4PLKC 2XXMB 4JO2L 1CG9B 5DMKA 3TN0C 3NTCL 1A7RL 1EZVX 1CIUA 2MSPA 3QEQA 1NCUA 4KQ3H 3P9MA 4FQQA 3D85B 4HS6B 1I9RL 3T0EB 3QO1A 1SYSB 1G7MA 2HFEA 3KNBB 2GK2A 4PJXF 4QT5A 4F80A 5HDBF 2FJGA 2CLRA 5CEXB 1J0JA 4UT6L 3QDJB 3WL9B 5IROA 1HHKA 5E6IA 4PJHA 5KVFL 3SDAC 5T1KD 4U1HB 2X4NB 2NY1B 5DFVD 2AV1A 4YE4L 2CK0L 4NQVA 4YHYC 4TSBH 4C55A 3QJHB 3RKPA 4OV5A 5MENA 5HHOE 4LIQH 4LU5H 4K9EC 5FGCB 1IGTA 5I8CA 4BQCA 4F7TB 4PJ5E 4JO1L 4RA3A 1A14H 5D1ZD 2OR8A 4M5YL 4K7FA 2XY2A 2NW2A 5DQDH 3LH2H 4PJBE 3W2DL 1VFBA 4K23H 2BNRD 3VXPB 2ARJQ 1BP3B 4XI5C 1URLA 2EE6A 1P84J 4GXUM 3O3AB 4K8RC 4JPVL 3C6LB 5IIEA 3OAUH 1A9BA 1UZ8A 4IMKA 4N1HB 5A2IH 3ARFD 1AFVH 4NJAL 4LKXB 1R5WA 4QYOB 1RJYB 4HGWA 4MA3A 3QIUA 4AM0A 4J3TA 2UZIL 3MRFB 1UM5H 2J8HA 4W70A 4YIQA 5GS2D 2JB6A 2V2TA 3PL6C 3I6LD 1KB9K 2JJTA 5K9OB 4MNQB 3UPCA 2H9GB 3EJYC 3RWHB 5DMJB 3MA9H 5CZVH 4AJ0A 4MS8D 3MSPA 4HBCH 4U1LA 1SBBA 5IR1B 1F2QA 2HT4C 2GUOA 5BO1H 2FH8A 3BPNC 1INDL 4ZSOE 3G08B 1EJOH 5AAMA 2ERJC 4U1IB 2QADD 5FO7A 3DMMD 3L7EB 4HT1L 1SBSH 4JKKA 3MRCA 4ODVH 3ZTNL 1JL8A 1XCTA 3HNVL 3U4BL 2I60L 4UUJB 1KEML 1A6VH 3PWUA 4N8VG 4G8IA 1NDMA 5FDYA 3UYPA 3IFPA 4ZNEE 3VXRB 3VU2A 3EKCA 4KKLD 4LLYA 3KYMA 5MEOA 2VC2L 2QJDA 3I6KB 3HR6A 3O3UN 4NZJA 3SDDC 3QXVA 4JFOB 1A4JB 4Z76B 5T1MA 4YDIL 4CN4A 4U6YA 4WGVB 5I1AA 3WEXA 1TZHA 4BFEA 4P4KC 4JRYA 4NHCH 1RIHH 1A7QL 4O02L 2PO6D 3HN3A 4HIJB 3QXAA 2XZQL 3TNNA 1MSPA 5EOCJ 4S1RH 5D7IE 2BVOB 1J11A 3TGXA 2VUOA 3IAGC 1ND0B 5EORH 4YDVB 2XNAA 4PB0H 3T0EC 5IOPA 5F9JB 4LSTL 1FC2D 4NZTH 4OIAA 1YMMB 4R3SA 4DOHE 4ODTH 2Z9TA 4CU6A 2NY3D 4W4NA 2AJSH 3OKNA 4LSPL 3ZT5A 2HT3C 4RFNB 4E41D 4GMTH 1G7PB 1A3RH 2YRLA 4ODWB 5GGSA 1KT2B 1BZ7A 1MCWW 1YEJH 1U6AH 2UWEF 4G8GD 4OLYH 4ZUTB 2X5PA 3WJLC 2J8UE 1P2CB 4FQJH 1S78C 2PYED 3CDCA 3X17A 5F1KC 1T04A 3HZKA 1B2WL 1AY1L 3BN9D 3T0BA 1UB6A 5EN2A 3S37L 4NUJA 4XPHL 3BE1H 3QFJA 3QNXB 1UYWL 1AO7B 1IBGL 3UYRH 4MJ5B 3OR6B 1CQYA 4K9EH 4NZRH 1UM4H 4ZUWB 3MJ9L 3OKOA 5FKAB 3E6HA 2XZZA 3VXMD 1QA9A 3RVTC 4NIKB 3V6ZB 4JEGB 2BXZA 2DQJL 5GJSH 4PY8J 2BRQA 4U7MA 2B1AH 3UO1H 4ZUUA 3LMJL 1ZAGA 2DLEA 4LK4A 5EO0A 2H45A 4K8RH 2V2WB 3U0PA 1PSKH 4FQXA 5DFVC 4M62L 5C71A 4GSDH 2O5ZH 3HR5B 5CSZB 2NX5D 1IM3A 2JIXB 1DSFL 1FQ9C 2IFGA 4Z7VF 3J8F7 5GXBB 1NGWB 1JWUA 1K4CA 4UNUA 2VXVH 5DYOB 4X7SL 3UDWC 4OUOA 3MRBA 4GRLA 5D1ZC 1NAKH 1MJ8H 1LEIA 1DZBA 3MCKA 1I3RB 5ANMA 1EERB 1ORSB 2EH8L 2R0KL 3PP3H 4MQ7A 4GAYA 4BH8B 4AQ1B 4XBPA 5T3XL 5L7XH 5LG1A 3H3PL 3GO1H 5SWZA 4PY8I 4O9HH 3H9ZA 5DVMA 3U82B 3J7HA 4FFYL 3CNKA 1A7PL 1OGAA 5EFIB 3L3DA 4ZAKA 1ED3A 3ZTJG 2YA2A 1WCBB 5KJRL 4KK5D 2R0LH 4OLWH 1T0NB 2VO5A 1KGCE 3CPLB 5BMFH 3MPCA 4JFQB 3WFCH 5HGHB 1T7WA 3RVVD 3GI8H 4MJID 1G7QB 4L5FH 2DAVA 3F5WB 1PQZA 3SKJH 4F8QA 2D4FA 3Q5OA 2N56A 4LSQH 4W81A 5CINH 4RGND 3IFLL 3MRIB 5I1HH 1T89C 1P7QB 4GKZA 3P77B 3CLEL 3MRHA 2WBJB 4TUOA 3PWPB 4CW1A 3E3QE 3CVHA 3KYOB 4HC1L 4HXBH 4CDGC 4S1SL 2P5ED 3BD4A 1FNHA 2IH1B 4Q2ZB 3ARDA 2NTFA 1YEIH 5CUSH 4XVTL 3T3ME 1QLFB 1NAMA 4QNPF 3UTSA 1NLDL 5DEFB 5M95B 5GGRB 3DMMC 3V0WH 5TE7H 1S7TA 2Q3AA 1J12A 5GJTL 4WW1A 3LHPH 5SWSE 1DVFB 3EUUA 4D9RE 3HI1A 5DD3H 4RFNC 3DX6B 4IMLA 1YZZA 3LQZA 4P46D 4G8FA 2BVPB 1GIGL 1DEDA 4WHTB 2FGWL 2H1PH 5IM7B 1V7NH 1U92A 2DQHH 1G0DA 1J5OH 4P59H 3CSPA 2ESVA 2D3VA 5ADOL 5TJWK 5MERB 1K5NB 2XQYG 1HHHA 5IEHA 3GHEH 4XAWL 3DI2B 1AI1L 4RBPH 3SKNB 4PJCF 4H1LB 5IBLC 3QUML 2COQA 1N59B 4KI5E 2FL5B 3HC4L 2IBBA 2BCKB 4BZ1H 1OAUL 3TBSB 3MR9A 5C6WH 5BS0D 4YXKH 1YNTB 3RQ3A 1NBZA 3UCRA 1YN7A 5D5ME 4QOKA 4F57L 4PJ9A 4PG2A 1YN6A 1GGTA 1NAML 3MROB 4M1GL 3OL2A 3LY6A 2ZUYA 1AHWA 3RVXD 3RVWD 4C83A 4XMKL 4WRLA 4ELME 3S35X 4PRBB 4RX4A 1ZVSB 2APBA 4FZEH 2BFVL 1MFCL 3MRNB 1E4XI 3TT3H 5JOFB 2UZYB 5I18L 2C4FT 4Z7WA 1MFEH 1DLFL 3CFIC 1JPFB 3VGAB 3KJ6L 5D7LD 2G75A 1BVZA 3MLZH 3SCMB 1YYML 5BXFA 3RX5A 4P2QB 3Q6GH 3NH7L 4X5WB 4HMCA 3SKMA 1LK2B 5C0JA 3P4OB 3O3EB 4I0PB 2HN7B 2VLKE 5CJ5A 4LEXH 5FOJA 3PF2A 4NKDB 3O45B 3QR2A 4W6YB 3UTQB 5C09E 5FUOH 4X5LA 5C08B 2GKIA 5K59F 1EXUA 4X4MA 1A64A 1J1OL 5ICZB 4NCC2 1M6OB 3AREA 4JGJA 1NCWH 1BIIA 3MV7B 4NYLB 5A2KH 1EEYA 4YHIB 3UJIH 3V7AG 3V6FA 2A1WH 3V2AR 1Q9OA 5ESAB 2FEEL 1JN6B 4PJBF 3L3KB 4TTDC 2Y23A 2YSSA 1W0WA 5DK0B 1TVBA 3S4SG 4ZTOL 3P0VL 5D7KE 2FO4A 2W9DL 1FH5L 1JNHA 3W39A 4JCLA 2DM4A 5FAAA 1ZVHA 4Q6IA 4O2CA 2VDQL 5DT1H 1ZTXH 4FOMA 4JDZA 4I8DA 1BF2A 4XMPH 2QR0A 4LQFH 2MJWA 1FCCA 3V9FA 1JWMB 4R7DB 1MRDH 4NO0D 1ES0B 4GAGL 4Y4HD 3WJJC 3SHSA 3N9GH 1AC0A 2RCSL 5DC4B 1IMHC 4WI4A 1FSKB 9CGTA 3MRKA 35C8L 1ZA3B 2P24B 4N8CL 4KC3B 1IGML 3QZWG 3SGKA 1DN0A 4FTVE 4JB9L 5INCB 5JLZA 2IALA 1FE8H 4KK8C 2R56H 1S7SA 1XF4B 5LGKA 3O9WD 5INDB 3TVMA 3DGGB 4WNQA 4NHUA 3HG1B 2HFTA 4Z5RB 5C0IA 4Y8DC 3WYRA 1FL5B 2F53D 1OP5H 1U8OB 4HFUH 4NQDE 1HHJB 1OF2B 5CCKH 1ZANH 1PYWB 4JFPA 4WUUA 4WDIB 1Q1JL 4U1KB 2XPGB 4AEFA 2AK4E 1EO8L 3ZKMD 4PJEE 3QUYA 3C6SA 3NPZB 4N1EA 5MP6H 4GXVH 4LCCA 2ED8A 1ERNA 2EXYC 2Y7QB 4KKAD 1OQOA 4U6XB 3U0WH 5IBTH 2H2PC 4WI3A 3KWWB 3MMEB 2DKSA 4R96A 1D5MB 4I13B 1KCKA 1GGUA 1MCPL 3GMMA 1DBAH 1MCWM 3ARQA 4JN2B 1E27B 1I9JH 1GZQB 2DWEB 1FGNH 1LP9B 4YR6A 4N5UA 3KXFE 4QRPE 1MY5A 4UAOB 4Y19D 2VE6B 5C0FB 3BYTA 1QFWM 3SCMC 2LAGB 1UQSA 3C08H 5AG8A 5BZWB 1TZIB 3EFFA 4Y2DD 4I0PC 1S7WB 4L8DB 2APFA 2GJ6E 4KU1A 5H94A 5E2WL 1HWGB 4OSUL 1NGQH 3GIZL 5FCUL 2OTUA 1P4LB 4Z7UE 4YEEA 4LARH 1WVZA 3IJYA 3HS0B 3VRJB 4BSVA 2J8UF 3S36X 2DQGH 2O5XL 3BT2H 4XP1L 2EIBA 3R4DA 5DJYA 3RVWC 1C16A 1QSFB 2AXFB 3U7YH 4Q9RL 3KPSD 2YXMA 2JJSC 2P45B 2QQNL 3QO0B 4YHLH 1KC5L 2N1KA 4NUGL 1JMXA 4OLEA 1KIPB 3FFCA 1UXSB 1M05B 1R5IB 3V0VB 5CEZL 4XX1E 3VXSA 4IDJH 3OX8A 1H3TA 5J1AB 3MLVH 4MDIA 5L9DL 3O6FA 3TH2T 5K9JL 3GSUB 3O3DB 3TNMA 1T21A 1OAQH 1RURH 4WI8A 3M17B 3KYKL 5HJ3B 3NAAL 4M00A 2VLJE 5EU3A 5KVEH 3C87A 1QSEB 2EICA 3D39E 3U36B 2HH0H 3TIDA 3CZFA 1DQMH 5C0AB 1FORL 4PJGE 5J6GB 3GIVB 2IBZY 3KPRA 4BK5A 2BSTB 3MRGB 2GY7B 3RU8H 1KJ2B 1UKTA 5GRUH 4ODSH 3TO4B 2DD8H 3BZ4A 3RZCD 3HHRB 4L4TD 4X6FA 5CEYA 3HE7B 4LIQL 4LU5L 4MD5A 4UNVA 4GQ9H 5HD8C 1FAIL 5C0BA 1JGDB 1NDGB 5B8CC 5DFTA 4L3EA 1A14L 5CEZD 2HLAB 4N9GB 3TBTB 3DVIA 3C09B 3EDJA 1BBDL 2XT1B 4MVBD 1UH3A 3SQOL 4OKVB 5ADPL 4I4WA 2HVKA 1EAPB 3CZJA 1X5XA 1CDHA 1WZ1H 3KLAA 1WFNA 3QNZA 5EOCH 3CMOL 4JQXA 1PKQE 1ZHLA 3EYVA 2D03L 4HIHA 4TVPL 2JCCB 1X5IA 4H1LH 3T04D 1HZHH 4I5BB 1AFVL 3G5ZA 4TRPH 1AP2A 2DI9A 1ZGLB 5KVMC 3GMLB 1NBYA 1N5YL 4IIQA 4LEOB 3BWAB 3CXDL 1G7HB 4OLZL 2ZUQB 4NT6A 4D0CB 4H25A 2VXUH 1GGCH 3FQRB 3OR7A 2R23A 2YRPA 5HHQA 4AENA 5HYEA 5EBLA 1F6AA 3A6OA 3LQAC 4LCYA 5SWQA 3HZMB 3O9WC 1JGVL 4QRTA 5CD3A 1I3UA 3L3GB 4UAOC 2CO7B 5BO1L 3C5JA 1TMCB 3TCLA 3RNKB 4KHTH 4Y4KA 1JJUA 2DS4A 3RL1B 3DV6B 3RY5A 3TN0A 2UVFA 3KPOB 2AV7A 1SBSL 2EXWC 3BGAA 4FFVD 4TVPD 4OFYD 3C5SB 4ODVL 4ZPVB 5F71A 3OTTA 2NY2B 5ITBL 4JFFA 4Y5VB 4XXDA 2WWKO 5GGUB 3BXNB 3ROOA 1FC1A 3WUZA 4PJ8B 5I1JH 1F3DJ 4Z78A 3SDXB 3MLRH 5FM5M 1FNSL 4XC3H 1U8LB 3PHQB 3HPLA 3SDAA 2NMSA 4KKAC 4L4VD 2ITCA 5ERWB 3E0GA 3QXWA 4JAMA 2Q6WB 2XG4A 1X7QA 3WFDL 1KG0B 1WFTA 2YPLA 2WP3T 2EDTA 3RBSA 5GHWH 3RUGB 5EOTA 2EDDA 1G0YR 3CLFH 5DD6B 1ZLSH 1A0QL 3VCLB 1L7TH 4NKOA 3OJDA 4S1RL 4XVUC 4XAKE 3QEQE 4FQIH 4PY7B 1JF1A 2F5BH 3S3SA 5EORL 2BSED 1F3JA 4PB0L 3DX8B 3TZVD 2AW2A 5ABDE 3FN9A 3R8BB 4ONHA 2ZUTA 1AKJB 4ELMF 4HG4J 2FECI 4NZTL 2Z31D 3DVGA 2F5AH 2D2OA 5H8DA 3THML 4JPWL 5DJ6B 2AJSL 3FMGL 5E6ZA 2HKHH 3DHMA 1QYGH 4PJHE 4BSWB 1N0XL 4GMTL 3K4AA 3DUUB 2FIKA 1HYRC 3TWCH 3FKUS 3RTQB 3TO4C 2J4WH 1Z9OA 1BEYH 1BMGA 1VFOA 5F7EH 1INEH 1BVKB 4OLYL 5IVXA 1I8MB 1E28B 3HE7C 3H9SD 3PL6A 5ACMA 3T4YA 5MENE 1KTLB 4X9FA 5FYKE 4XPBH 1TFHA 2VWEE 1UZ6F 1A7NH 5FYLL 3C09C 1WIUA 4PGEB 5E2TH 3MRJA 5JW4N 5C07A 5E00A 3KGRA 2P8LB 3BE1L 1OB1B 5HHPA 4CVUA 2W0PA 4F15B 2FEDC 4K9EL 1RUAL 3MV9B 5IQ9A 4NZRL 4C56B 1K6QL 4OT1L 2R15A 2GSGB 3EYFA 3BHBA 5E94A 5HVWA 4JG1H 3CGTA 1B0RA 2VABB 5GJSL 2GT9A 1IC1A 1T7XA 5EULV 1F58H 4HX1A 2B1AL 3UO1L 3V5HA 5HYSA 2ZUQC 4YDKL 4K8RL 1CFSA 1NFIB 4EIZC 3KPLA 4KQ4H 5F7FA 4O2FB 4U1SA 3MFFB 5KW9H 4CN1A 3SDDA 3QIWB 3UTTB 25C8H 2OS7A 2VR4A 2ATPB 4LFHD 4J12A 1KFAL 3GMRB 3RDTB 1E4XH 3QIBA 4P4KA 2VDNL 5E24E 4YNYB 4HPYH 2P43B 4XPAH 2D31A 1J0IA 3EOTH 2D7MA 1ACYH 3NZHH 1ROWA 1CG9A 1KTRL 3WHXA 1T4KB 3LQAH 3EOAB 3VWJD 2RHEA 4QF1B 2NY2C 4ELKB 1AQKH 3LVEA 4HS6A 4Y5VC 3T0EA 4DGVL 3KNBA 4PJ8C 4K71B 5F9WB 2YK1L 5HYIA 4QGYA 5CEXA 3WL9A 5KSAB 4MB5A 2FD6H 4DGIH 2GYSA 4U1HA 2X4NA 4PV8A 5DTFB 5EWIH 3GI8L 1S9VA 4L5FL 5DR5L 4EDXB 1IQDB 5F21B 1EBPA 3SKJL 2X1WL 2WWMD 3QG6B 3QJHA 4LSQL 1NCBH 1OT1A 4RQQA 5CINL 4JJ5B 4HKBA 4GBXD 1K8IB 5I1HL 3HUJF 4JRYE 4F7EA 1L6ZA 3WJLA 1KIQA 1NMAL 4F7TA 3NCYS 4HXBL 5ISZB 3L7FB 1FV1A 5C0DB 5KANI 4E0RA 5IK3A 1V3JA 2ARWA 2E9IA 3KHQA 4Y1AA 3UZQA 1JNLL 1GPOL 3CJJA 3GK8L 3GBNL 2I25N 1Y6NR 3WD5H 1A1NB 1JHTB 3VXPA 4AEIL 1HQ4B 4R4FH 4R4BB 5TE7L 4FFVC 1I1RA 1RV6X 2X41A 3WE6B 3LHPL 1PGRB 2E7MA 2CXGA 4U1JB 1A02N 5FFLA 3E6FB 4CKVX 4NC0B 4V1DB 4YDLC 3MOBH 4LKXA 1TETH 1UADC 3ARZA 3U2SA 1BZ9B 3TYGH 4J4PD 3HAEB 1S5IH 3PABB 3RTQC 2H1PL 5EU4B 2DQHL 4P59L 5HYQB 1AXIB 1Q72H 5IF0A 4NO3A 4K3DH 3UTZA 5JHLH 5K9OA 1JWSB 3HRZB 1MH5B 1TXKA 4KJYA 4ZQKB 5EIIB 3BOVA 3F7VB 3IF1A 2WUBH 1LK3H 3P4MB 5IR1A 4JN1L 5F9OH 1AIFA 1X9QA 4BZ1L 5GSRB 2IJ0C 3B8YA 3QFJE 3RWFA 3UDWA 5D1ZA 3QPXL 4U1IA 3MV11 3I85A 4JM2F 4OLUH 1HEZA 3H7BB 3TIEA 1MCBA 1INQB 3L7EA 2CRIA 2WZPD 4K3JH 2WQRA 4M1CD 4UTBH 1U8MB 2QSVA 2BNRA 4Z8FH 1QO3B 4JZOB 4HF5L 1YDPB 3VXRA 4TSCH 5HPOA 1F02I 4LGSB 1IKFL 1KB5B 1JGUH 1RZ7L 2EDWA 4M43H 1EVUA 1U58B 3I6KA 1EHNA 1A6TB 4JFOA 1MPAL 3QIWC 1T2XA 1D6EB 4Z76A 4N5EC 4YGVB 2FCBA 1WBZB 2DQCH 3O6LL 3PP3K 1MVUB 3GB7B 1T89A 2MQCA 3Q6GL 4LNVA 4WI2A 1IGYB 4IRSD 1EX0A 5ANME 2BVOA 5ALCL 1BX2B 4U31A 2OK0H 4MA8L 2XZCH 2Q8BH 5FGSA 2OM5A 4PBXA 4YDVA 2D9QB 4AL8L 5D1QD 1K8DB 3RX8A 1NFDB 1SJVA 4K71C 3DMMA 5F9JA 5F9WC 2G5RA 1XF2A 2YN3A 4MA7L 2VR5A 1YMMA 2H8PA 1OGAE 1O7VA 4HWBH 3V6OC 1CICB 1MFNA 1MFDH 2EE3A 5KSAC 2VXSL 1FNAA 2WIIB 4U1MB 1WISA 1FVCB 1NCWL 4LCIH 4TQEL 1KLGB 1WBXA 1YY9D 4PJ5B 3JV0A 3QEHA 1G7PA 4RGOH 5ETUA 1YEKL 4ONGL 1JPGB 1O0VA 1KT2A 2YRZA 5D2NB 3T77B 1F45A 1OPGL 1GYAA 4XP5L 3B5TA 4DCQA 3VWKB 3DX7B 3QCVH 2CJUL 3ZYIA 3X11B 5L0QB 1IQWH 1TTUA 1ZTXL 4MNQD 2B20A 3WO3B 2BOCB 2RB8A 4HKXB 4L3AA 5E2UH 2A9ML 2Z8SA 3QNXA 3DX9B 3UTSE 2PO6A 3OR6A 3ILPB 4YBHA 1A9EA 1TVHB 2Y1VA 4OZHB 3G6AB 1N7MH 5DUBA 4ZUWA 3VWJC 1NC2D 3VD5A 3NA9L 2ZZUT 4ZS7H 5JPNA 3B9KD 2WW8A 4HIXL 4I3GA 3MRDB 5F1OB 4TSAH 2I5YH 2VLLA 3VXOA 2ATKB 3L3IA 4EOWL 1NMBH 3GHBL 3TJHC 4PUBL 5ECJE 2QHLA 4LNRB 5IFHH 1ETZB 3OKMA 3RWIB 1AJ7H 4BFIB 3JVGC 4FMKA 3SGJC 1ZT4A 5FYJD 2IAND 4WFFE 2ESVE 3C60D 1I7TA 1IAII 1BQLH 5DD5H 5J89A 3M45A 3HR5A 2BK8A 3ARGB 3SBWC 2G5BB 5CSGA 1EPFA 4LSVL 3D0VB 5CSZA 1CXFA 4G8GA 4HFUL 5B38G 1K4DB 5DURB 1NGWA 4M6MH 5DYOA 2ZCKH 2R2EA 4TUJA 5TQ2H 3VFOB 1ORSA 3KLDA 3UBXA 5MP6L 4GXVL 4BZ2H 4QOKE 1FO0B 3L6FB 1XT5A 3MYZA 5CAYB 3RP1A 1IEBB 3LKSA 2A74B 1QKZL 2C4FU 4KRNA 3U0WL 3VXNB 1ZHNA 4ISVB 1J8HD 5EZJB 2WIMA 5CD5C 3HPJB 2R9HD 4NRYA 4M9OA 3ROLB 1DBAL 5H2BB 4J3UA 3LB6D 4JFQA 5HGHA 1I9JL 3P2TA 4M9PA 4DJMA 3MNWA 5D7IB 1XGQB 1HKFA 3O6KL 5ID1A 4Z7WE 3IDXH 3D2UD 2ZOKB 2CDFB 3A67H 1KCUH 4R2GB 3WLBB 4ODUB 1DBKH 1P7QA 3RGVB 4XWOD 5LWYH 1KIUA 4QXUL 5IBUB 2CLZA 4G6MH 1QLEH 2IH1A 2NX5A 4Q2ZA 4U1GB 4WHYG 3WCYA 4PJHF 4UT9L 3ZKSD 5DUPH 2O5YH 5SX5K 1QLFA 1QRKA 3FO0H 3FT3B 4YUEL 1NGQL 3S37X 4POZD 3VJ6A 5GGRA 2ADGA 3WJJA 1L0XA 4M7JH 1AO7D 4XHJD 3F6IA 4HFWB 2DF3A 4P2OD 1CICC 1W8OA 1RUQH 2DQGL 3FTGA 3BT2L 4H20L 3U48A 3DO7A 4M1CC 4UV4H 1IFHL 1GZPA 4X4ME 4JHAH 3T2OA 3PXJA 3DX6A 5FOBB 2IGFL 3P73A 3ES6B 3I9GH 1Y0LB 3U7YL 3VA6A 4WHTA 3OHXB 5D2NC 5IM7A 2CR3A 1C1EH 1CLOL 5H37H 1ZHKB 3MLWL 2E5EA 5DGRA 3LKRB 5MERA 1K5NA 5C86A 2H32H 5FM5O 4MJIA 5L0QC 2BSSA 3DUSB 3DRTB 1ZHBA 3EHBD 4H1LA 3DURB 2LFGA 4HS8L 1IGCL 3MLSL 1N59A 1JRHI 3BX7C 1OAQL 1BGXH 1YEGL 2MFNA 3B9DA 1DBML 4U6VH 4I0KA 5HGAA 1DEEB 1YC8A 1IAKB 2P5EA 4DK6A 2P8PB 4ZUSB 1YNTA 4YXHL 2R8SH 2F74A 3FO9B 4LLWB 4PJDF 1PDKA 3X13B 2QQKH 1I7ZB 2EC8A 4PRDB 3A6BH 1F3DH 3MROA 3MCLH 4ENED 4KK9D 1XGPA 4XRCA 5CBEB 3S96A 5DVLA 1EBAA 2KUTA 4KHXH 5FK9B 1A47A 1IEHA 2DLIA 4GQ9L 5EZOH 4X5XB 3LQMA 3F6LA 1OP5K 4UQ2A 3LEYH 1J0YA 4F33A 4QLRA 3ARGC 2QTEA 3HCVB 1JHLH 3HAEH 5C0ND 1JV5B 2OTWB 1OP9A 2AEQH 1WZ1L 4KK6C 3FQXA 1NKRA 3C8DA 3GSVA 4LBEB 3K46A 4WUUE 4XPGH 3SCMA 1T20B 2YXFA 4WFEE 1VFAB 4X5WA 2R39A 4KTDH 4MAUH 1HZHL 1LK2A 4KV5E 3O3EA 4G9DA 4WTZA 5B4MD 1JZ2A 1MCOL 4X8JB 1KPVA 3DLQR 1FYTB 1JFQH 4NKDA 3O45A 3UTQA 4OCLC 3SDYH 2G60L 4NP4H 4PJ7B 2AABL 5C08A 2DRUA 2ICCA 1YEDB 2EZ0D 3BJLA 1JI1A 1YYLH 2B5IB 3BQUB 4NYLA 3P9LB 4ZO9A 1N6VA 3WLWC 3C5ZD 2VUYA 4YHIA 3GGWB 4KROB 5FO8B 4GW4A 1DJSA 1KUMA 2JJSA 3L3KA 3S7GA 2A6KB 1UACL 5DK0A 1L6XA 1KB5H 4P2CG 4R2GC 5LGHH 32C2B 2PYFB 4JFXB 2P5WD 1DUZA 5E99L 4GOSA 1P84K 1YECL 3DYMA 4U1GC 5DZOA 2FWOB 5JR1H 2APXA 1IAIM 1O7SA 3K7UA 4JQIL 2AJ3B 4RISH 1Y18A 5D7LA 4R7DA 4HKZA 2ZNXA 5IESL 1CFTB 4XCNB 3WS3A 5I1JL 2XICA 2HTLD 4FZ8H 2DDQL 2D7TH 1ZA3A 1MQKL 2MCG1 1NCCL 5ICXA 2PTUA 5INCA 4YO0A 5K93A 1M71B 5INDA 3DGGA 2XRAH 3HG1A 4FMFA 2OCFD 4Z5RA 4YHKL 3FFCE 5B8CA 1WEJH 4OM1H 1FL5A 2CLVB 3N06B 3RY6C 5EZIH 3VXSE 4O5LH 3V5KB 2NYYC 4FQIL 1YC7A 5I71B 1U8OA 1GCFA 1OF2A 1VESA 3F8UB 4WW2F 4EN3B 4N0CD 2LABA 1UVQB 1VERA 4OQTH 3P11L 4WDIA 4NWUL 2X4RB 2FJFB 1E6JH 3B9VA 2F5AL 1VGEH 4G6JH 1MHPL 1AE6H 2OZ4H 1MJ7H 2R2BA 4KTEL 2EEBA 3K8LA 4NO0A 5IB4B 4LPVA 4Y4FB 2Y7QA 5KS9F 4U6XA 4P2OC 3W0WB 1S5HA 1INEL 3MMEA 5EUOB 3VMNA 3VW3H 4WUKH 1IGJA 1QFWL 1E6OH 5C0BE 1HDMA 1A7NL 3WDJA 4JN2A 3DV4B 4L3EE 1E27A 1GZQA 4NM8H 1FL6A 5ALBH 1H3GA 2DWEA 3O9WA 4LVEA 3T2QA 1LP9A 5CMAA 3NPSB 3ELAT 2VE6A 5FF6A 4H0GA 2EEDA 5C09B 4A6YB 3EHBC 2F53A 5DEZA 3EJJX 3KPQA 1CD9B 3N50A 5BZWA 1TZIA 3DUHA 5FDWA 3LPGA 3GMNB 4U3CA 4L8DA 5JXAH 3K74B 1NPUA 2OMBA 4P5KB 2P47B 3G6JB 1PZ5B 3GSWA 1P4LA 4NQTA 4PGCB 3Q1SL 4ZFOA 3VRJA 4BQ8A 3FB5A 2NY0B 1ZWIB 3WSQH 4EI6B 4ZNCD 5KW9L 3SO3B 4PJAF 4XNUH 4ENEC 1FO0H 3ULVL 2X9YA 4KROC 1QSFA 2AXFA 2HTKD 4ZUVB 3OKLB 3SE3A 3D9AH 2VISB 1U8KA 1B9ZA 3QO0A 1CYGA 3D6GA 3ZO0A 2XKNB 3SOBL 2VL4A 1IJ9A 1CFNA 3EOTL 4UU9B 3ARPA 1KCRH 1F90L 1ACYL 3NZHL 5GS0C 2QHRH 2W9EH 5DUMH 1M05A 4GG6F 1R5IA 3IB4A 5EUKB 5C8JB 4O51B 4TTGA 3D25B 5FUCC 5J1AA 3LQAL 3U1SL 2W0LA 4WGWB 5F7HA 3O3DA 3QB7C 3BISA 1FNEA 4O00A 2OJZL 4FTVB 5C0EB 3GMQA 3LRHA 5BJTB 1OTTD 5HJ3A 4PPTA 4JFFE 3IJHA 5LCVL 2EYTB 4EBQH 1MWAL 3DIFB 3GSNB 4Y2DA 3WXWH 1FLRH 5B4MC 1ACZA 5C0AA 1KNOA 1RUPL 5HVFB 4OFIA 5D7JB 3FOLA 1D7FA 3CX5J 5E8PA 1OQXA 3MRGA 4NGHH 2NPLX 4BA8A 4I77H 3TO4A 3WIHL 5HVGB 3NACH 4NQDB 5CILL 1OTUD 2E9BA 1LO0H 3HE7A 2NXZD 5T1LB 3RWDB 1GC1C 4LLQB 1NDGA 2YPLE 2AK4B 4K3EL 1HCFX 3WIIH 2DBLL 2HLAA 3SJVB 1MIMH 3BO8B 3KPSA 4GW1B 4N9GA 4OGZA 2VZTA 4PJEB 2EO1A 4R90H 2VDRL 5EIQA 2C1OB 3MJ8A 1NSNH 1WWWX 3PWVB 3KDMB 1U3HB 4CJ1A 4ZO6A 5HDQL 2A2QT 3G5XB 3VFPB 1MI5D 2JCCA 5D1XB 5A16A 3FB6B 3EO9H 4MWFA 4I5BA 1R3IH 3PE9A 1XH3B 3CSGA 3JWNC 5GGTH 3QDGB 5DSCB 1ZGLA 1I1FA 4Y4FC 3TYGL 3RJQB 1S5IL 3GMLA 2C3WA 3BWAA 1S7RB 1R0AH 2VZ3A 4AG4H 3KXFB 3F12B 1Q72L 5IVXE 3WKML 1P7HL 4K3DL 3TBYA 1KF9B 4FQ1H 1P53A 1CGYA 5DJCA 3BDYH 2Z4QB 1LK3L 3HZMA 1MLCB 3IKCB 3RZCA 1KJ2L 2W9LA 4JFEB 5J4MA 1HIMH 3NPSC 3I50H 5C07E 3SGDI 3ZDYF 2R0ZL 2XACC 5D6DC 3RNKA 4HWNA 4GUPA 4MB3A 2PW2B 4Z7UB 5E9DD 4FABH 3DV6A 4KRLB 5GPRA 3KPOA 1MLBB 4UTBL 4WIQA 5ESVB 4GW5B 4Y5VA 3LSOB 1QFOA 4JY5L 4P3WA 4PJ8A 1KN4H 3AUVA 2M1KA 1JPTH 5IG7B 1JGUL 4KY1H 2NY0C 4YXLL 1U8LA 3PHQA 3SO3C 1GGBL 3RIFK 4JFHD 1XFPA 4JZNA 1HINH 3OF6D 3CFCH 1RZGA 1A4KA 2QSTA 5ERWA 4YHZH 2IBZX 4KJPC 1RUMH 1J1PH 5I1KH 2Q6WA 2AKRB 3BYYA 3VXQB 1KG0A 4RWHA 4JRXE 1NCDH 1FGVH 2VLJB 4M7LL 2VZSA 3U46B 4PR5B 3D87B 2R4SL 3B3IA 1UWEL 4KJQD 1SJHA 3D39B 5ITFA 3DECA 3V95A 2CIKA 4PJGB 4PY7A 2XZCL 2Q8BL 1FNLA 3G04B 3DX8A 3V52H 4XBEH 2GCYB 3BD5A 2GTWB 3B2UC 3H3BC 3T0EE 5GS0H 2B2XH 4IHOA 4UINL 3GSOB 1BD2D 1IGFH 4HWBL 5DJXB 1MFDL 1ZK9A 5DJ6A 1FRGH 3N1FC 4MXQC 2QSCH 5D7JC 1G6RA 2NY7H 3VDCA 5B39B 4U0RB 3DROB 3ULUL 3DUUA 2VDMH 5DD0H 2W60B 2OLDA 4JO4H 1MHEA 3RTQA 3AGVA 4WO4B 2VDKH 1YEFL 4U0QB 4NWTH 3KPNB 4PJXB 4XVJH 1DE4B 2MKLC 1KTLA 3QCVL 5BRZB 3T1WA 2YUZA 5F1NA 2FR4B 4L4VA 3STLB 1PKQB 3L95A 1IQWL 4KV5F 1N3NA 4LPCA 2HTKC 5FGCE 3VRLE 1BM3L 1LO2L 1QSVA 2JK5B 5E2UL 4Y1AE 4EIGB 2P8LA 3T4AB 1MFBL 4ZS6C 2VITB 1J1XH 1HOCA 3MV9A 4C56A 1U3HC 3T8XA 1NGZB 1GC1H 1N7ML 1JRHH 2BVTA 4HLZH 3RA7L 1C7SA 1X5HA 1M7IA 1FDLH 2Y36H 3DHJA 4KDWA 4OBRA 4PP1C 4IRJD 3SKUD 4JZJB 4Z95H 5K33A 2VABA 4KMTL 4TSAL 4X80H 4Z0BL 3JSSA 1R3KA 5JORA 4LHUD 2HMID 1NFIA 2BNQD 1S9WB 2NW3B 4QXTB 5JDSB 1UJ3B 1PLGH 2GEEA 3NCJH 1YJDL 2X1OA 3MFFA 3D18B 3QIWA 2VYRE 2YBRA 3ZE2F 2ATPA 2PNDA 5CGTA 1PBYA 3AAZB 1LO4H 1SQ2N 4N0UA 4AT6B 4BSJA 5JW5B 4Y5XB 3QH3A 1WFUA 3GMRA 4N8VB 2NXZC 3HE6B 4LSRH 5D4QA 4YNYA 3O0RL 4E5XA 1JGEA 1KPUA 4OCNC 2HFGL 5TQ2L 2R1WA 3F58L 4RIRA 3TP4A 3RHWK 2J7LA 3I6GA 1U8HB 4ZXBD 3EOAA 3EO0B 4GAFB 4JVPA 5DRXB 3STBA 4DZ8A 3MOQA 4BZ2L 4A2MA 4OB5H 1T03L 2FYYA 3DETD 5F7DB 2BNRE 1QBAA 4WWKB 3FQUA 4A6YH 5E8EA 3H7LA 1U95B 1YNLL 4M1DL 1X44A 3VXRE 5LBSH 3CUPA 3V6OA 5KSAA 4G6AD 1L9NA 2H32A 4IBLT 4U3XA 3BZDA 4O2EB 1OVZA 2VERN 1KCLA 2P49B 4UT7L 1NL0H 4EDXA 4XP4H 3EDFA 4KKCD 5LGJA 4OTXH 3QG6A 3A67L 4JKLA 1K8IA 3QXDB 4YFLF 3PP4H 4YAQA 3W5MA 2B1HH 3QO1B 5ISZA 4NFDA 4F2MA 1QLEL 2RR3A 4QT5B 1MF2L 5FHBH 4PREB 2O5YL 2C4XA 3FO0L 1DQTA 1HHKB 4Z6AT 1J88A 4QRSA 1UGNA 4M7JL 2PCPB 1HQ4A 2AV1B 3PG2A 4NQVB 2PTTA 5DQJB 3VWJA 2C5DC 4OV5B 3EW3B 2XTJD 1YMME 5DGQA 4OF7A 2C1PA 3IDJA 3E6FA 1FG2B 4JM4L 4JHAL 1QHPA 5I8CB 1IGTB 4U0RC 3ZE0F 1BZ9A 1I7RB 4WO4C 5EU4A 2IADA 4K7FB 5DA4A 4P23D 3GSNH 5HYQA 3SE9L 4IJ3B 2AJYH 3JVGA 2FX7H 3SGJA 1KCSL 2P7TB 2Y5TA 1VDGA 2HJFB 1JWSA 5EIIA 3SBWA 1Z3GH 4UZGA 5IIEB 3T1FA 3P4MA 3VGBA 4U6VL 4ZPTA 2NY6D 5GSRA 2OTPA 1JZ8A 1OSZA 2UWEB