4TVPD

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
242
structure length
242
Chain Sequence
QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
total genus 37
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpD01
1J18A 5FO7B 4P2RD 2C9AA 4O02L 3V5KB 4OFVA 1L7IL 1PX4A 4PJAE 1S7SB 43C9A 5D7JB 5DD6B 4FZEL 1U3YA 4BKLA 4JDVB 4CUCA 2IMNA 5IB1B 1UCTA 1IQWH 1T89C 3EW3B 4J8RA 2HJKA 4LFHD 3BD4A 1SMOA 5KZCB 1L7TL 5EU7E 2EDEA 4HGWA 1UJTA 3X12B 5CWSB 3CFDA 5F9JB 5MEQB 1F42A 3DRQA 4LLDB 5D7LE 4D0BA 4KDTA 4CJ0A 1UM4L 1A6AB 3C2SA 1VKXA 3H6JA 4ETQA 1I7RB 5FF6B 3MRBA 4KJPC 5KVFH 5EBMA 1AO7B 5C08D 1KELH 1NCCH 2AGJL 4JR9H 5DURB 3KNBA 5KOVC 5E99L 2R0LH 2VSDA 1TQCB 3QDJD 4KI5E 5FECA 3CGTA 2MHAB 3PHQA 3NABH 5EC1A 5IQ9B 1FL6B 2UY6A 3RDTC 1IAIH 4P99A 2NXYD 4XCEB 1CWVA 3D0LB 1HH9B 1YEIL 5KJRL 4S1SL 3GJEA 4J2XA 5E94A 4HS8L 1EA9C 3BDYH 3IGAB 4PGCA 5D1XC 3I02A 2N56A 3I3BA 1IEAB 1ACYL 1IC5L 3MRNB 3ES6B 5J6HB 1MHHB 1NBZA 5DTFB 3KJ6H 2H32B 2DWDA 4AL8L 5MENE 2EYTB 3L3OA 4KV5F 1T22B 2P5EA 2GYSA 1XR9B 2PCPA 3TNNB 3SQOL 3O4LD 2IPTL 3HAEB 3H8NA 5TF0A 3SKJH 1QZ1A 3GSRA 1KEGH 1NEUA 3RWJB 1FFOB 2FD6H 2C3WA 3ORJA 4OQTA 2GI7A 5ITFA 1MRCL 2BXZA 4OLEA 2WBWB 5D1ZD 5EBWB 2G5RA 4F15C 1HSAB 1LEGA 3DMMB 5F7DA 4ELMB 2JELH 5SWZB 2B5IC 4C59B 5SWQA 3BIKA 4GBXD 4GRLA 3ARGB 5FM4A 1RHHA 3KPSD 3MZGB 5C08B 1CICB 3FCTA 5FM5O 3HCVA 4NUJB 1T6VN 3PP4H 4HC1H 1I7UA 1HINL 3BSZH 4PRBB 1SY6A 3MREA 3O3BA 4NNXA 5AEAA 4XXCC 4P3CH 2ADIA 1G6RL 1INEH 1DANU 5ACZA 4LCWA 4U1NB 1CDIA 2R8SH 1N59B 4M00A 3BN9D 2D0FA 1B88A 4D9LH 3BEWA 5INDB 1KNOB 2F5BH 1ZLUH 3VFVA 1OGAE 3IFOB 4Y4KD 3PGDB 4WY7L 3I6KB 1WT5A 4CDGC 2BJML 1S7XB 2YBRB 5FO8A 2OJEB 4EDXA 4Z9KB 2XWTA 4XMKH 5CEYB 1K8IB 3CXDH 3VJ6B 5E9DD 2IEPA 5I8CA 2R1XB 3CSPA 1PZ5A 2ZCKH 2ZG3A 4NDMB 1RULH 3ZTNH 5DK0A 3IFOA 4J6RL 3TO4D 4F9PA 1E4JA 1F3JA 2HFEA 3TZVC 3N1MC 2XRAL 3WXVH 2R2HA 1XZ0B 2DQFA 1C5BH 4ZTOH 1DQQA 5D1ZB 4BJLA 3UBXI 5I1CL 4X6CA 4NBXB 2QQKH 3SE9L 4JZJB 4YFDB 1P53A 3KPRD 3M1BA 4GSDL 3PP3K 3O6LL 5SV3A 4TQEH 2P8PB 5I1KH 1CFVL 5FF6A 2IF7A 2P8LA 2EZ0D 5DMIH 2J4WH 1KGCE 4OLUH 3BT2H 3EYQD 2YKLH 4JFQB 3V4PL 2A2QT 4U6HB 4GUPB 3WXWL 4JPVH 4MQTB 4N9OB 5FCUH 4JRXD 4NZJA 3H9SB 4G42B 3BYYA 2FB4H 1Q9KB 4LVHC 4UUJB 5TH2B 1BD2B 4KPHH 4X9BA 4MA1C 4RIRB 1KIRB 3IDNB 5GS0L 2Q7NA 5B39G 1H3PH 1I3RA 4U1KB 4M6NH 1BFOB 2Q20A 2FX8H 4PJEB 5FOJA 2DJUA 4HJGA 1FZOA 3HMXH 5F96H 1CFQA 1XCQA 1JF5A 4K9EL 4XNQB 1ITCA 1J9CT 1OP3K 5E6ZA 2Z0BA 2D9QB 2E6QA 2PO6B 2Q86A 3EO1A 4OZHE 1R0AL 3PHOA 4NSKA 4QRPA 1I8KA 5K93A 3DMMC 5E8PB 3AROA 4MAYD 3P3YA 5C6WH 2JCCF 4TRPH 2LQRA 1VA9A 4NFCA 2H3NA 4Y7MA 4NQTA 4U7KA 4M5YH 5DRZA 1MCIA 2WMPA 5AAWA 5T5FL 2IH1B 4CADA 3P0YL 4V2CB 3WHXB 4LLYA 1AGFA 3SJVA 3NCJL 2E7HA 4OZHA 4KK6C 4S0TD 4TSCL 1P4LB 1FLTX 5BOPA 1T21A 2F8VA 1X4XA 1JPTL 3G6DL 3V2AR 1A1NB 3ME0A 2W92A 1FG2A 1AO7D 4PYHA 1H3TA 4J3WA 5CLWA 4RX4A 2C4FT 3WHXA 2O93L 5DFVC 3Q48A 1TCMA 4Z7UA 5F6HJ 5ESVB 1NMAL 4NQCA 1IC5H 3BHBB 5BVPH 4NFDA 4LIQL 2JE8A 3GGWA 4X5WB 4N8CL 4YH6A 2Q8AH 2EDRA 1KOAA 4DTGL 1LGVA 1U92B 1JGVL 1F4XL 3OSKA 3D85A 1BWWA 1IAIL 4PRPA 1BZ7A 3LN5B 3QUXD 4OLZL 5IMKB 4XNMB 3CDCA 3OKOA 3ARZA 4RGMC 4PJFE 1OTSC 1D9KA 2J88H 2R4SH 2WWKT 2Z31A 3SDYH 1RVFH 1UXWB 1S5IH 4B7LA 4Z7VF 5FGBC 2EE3A 1P84J 3WS6C 4E41B 4AYFA 2XZQL 1I1CA 2HFTA 3TH3T 1PGRB 3VFNB 1HI6B 3D39E 1EO7A 1HYRC 5ILTH 5C0AB 4HF5L 3RWDB 4FFYL 2ICES 4LL9A 3B2UC 4WEUD 3T65A 4P9HL 1T7ZA 4LVHB 3GNML 3RWIA 4X5XB 4ZDHB 3U83A 3OKKA 4X6BA 3VWKB 5E2WL 2JJTA 4X6CB 4Z7WF 3QAZB 4KK6D 5EOCH 2X7LA 4PJCB 5HD8D 2HJFA 2VDML 5EWIL 2QHRH 1X4YA 3ZKQD 3ZDZE 3GJFH 1B4RA 2DKUA 4F58H 1SJEB 4PRHE 4K3JH 4PY8J 4JPIA 1HINH 1NGYB 3BSZL 3IDMB 4OGYH 1E6JH 1DEEA 5EA0L 4C57C 1G6RH 4EUPG 1RUPH 5JNYA 3H9SA 4K07A 2FJHA 3X11B 3U0PB 3K4DA 4L3EA 5MHSD 4MCYA 5HDLA 1IGJA 3BVNA 3RVXC 4JFED 4JN1L 4JLRB 1Z9SA 4F9LC 4M7JH 2BOBA 2BSTB 3SGKA 2AJZA 1CDBA 4PJXA 2D0GA 3CVHL 1OAQH 5ESAA 4Y19E 2VXQL 2YMXL 4HIEA 5I18H 4QT5A 3SJVE 4KMTL 2PW1A 43CAB 4HIIB 4CDHA 4NNYB 5C07D 4BFEA 1LEIB 4PG2C 3U7WH 3UMTA 3MNWB 3K2UH 1UG9A 3DX8A 1K2DB 4WFED 5JPNB 5MI0C 2PW1B 5HHXL 2IADA 5GSRB 5DZOA 3KXFB 2F5AL 2NCMA 3L1OL 1WC7B 5KSBA 1FVEB 1DQMH 2DTML 3HRZA 1KC5H 1LO0H 1HHGB 1IGCL 3ZL4L 2BNQD 4AEHH 2FEDC 2P43B 3G6JB 1D5ZA 1X9QA 1XGYL 2LAGB 1DN0B 3OAUL 3QHFH 4DVBA 2NY4C 1T5WB 2GT9B 2ADJA 1CGVA 1U8IB 1EEYA 5DRXA 3U0TA 4YBQC 1J05A 1CE1L 1JUFB 4Q2ZB 5K59E 1HHJA 4EDWL 2OTWA 2NLJB 1AD0B 1OPGL 2JCCB 4XXDB 3SE8H 1KACB 1R3JB 1JYXA 4M6AA 5FUZL 1ORQB 1OSZB 5CIPB 3NCFB 1RD6A 1G0DA 4GW1B 1FZJA 1MIEH 3WNOA 2NY6D 3FRPG 2OSLA 2BCKB 4YWGL 3FRUB 3QH3B 2DQDH 4RAUA 3KLAB 4WI9A 4Y1AD 4F7MA 2ZCKL 3IF1A 3N06B 3F8UB 1Y6NR 1KB9K 3AS2A 5EUOE 3LV3A 5LQBH 5KS9A 1R3KB 2X4NB 4U0RC 1RFDH 5EU6E 1WAAA 4M4PA 3KWWA 5EUOF 4ENEC 3BDYL 4LQFH 3VMPA 3TA3C 4G9DA 1EEZA 5DJ2B 3QFJD 4PV9B 3KXFD 4A6YB 1G7HB 4JN2B 3LN5A 3U46A 5DSCA 3DURB 1F4AA 1NMBH 4W4NA 1AY1L 1N5YH 3VFGL 3MRBB 1RFDL 3OAYK 2VISB 2WP3T 3D25B 4LSVH 1ED3B 2NX5D 3W0WE 2VAAA 1JZ6A 1C1EL 2VUOA 4H0GA 5KOMC 1OB1B 5K9QG 2EIZA 1EEZB 4HWUA 5DJ2A 3SDXA 3WFBL 4ZD3L 1FV1B 1HOCB 2HRPH 3W81A 3RZCB 3WFHB 3C5JB 4BELD 4G8GA 5IQ9A 1U93B 3PWJA 1EBPA 4PGDB 1UWEL 4CGTA 1V7ML 4KUCF 4X4ME 4XNZB 2A73A 5KS9E 1WZ1H 1Q9WA 2EICA 1WT5C 1FV1A 1HOCA 2A6DA 5EO9B 1TTFA 4XPBH 4G8GB 5BRZD 4GG8B 1A0QH 5J1AA 2VZVA 1U3HC 4R4FL 4P4KB 2CKNA 3VE0B 5LJYH 1SYSB 4PP2A 2NY7H 6FABL 4XVSL 1KB5A 4U1MB 4E41D 3ARSA 4TUJB 1KN2H 4Q9QL 3CX2A 4QYOA 1RUKH 3INUL 3QA3A 2PTTB 1J0ZA 1CICC 5C0AD 2VDMH 1DEEB 1OL0A 2Q8AL 1AR1D 2AV7A 3ULUD 5L9DH 5HGBA 3L3JB 3L3HA 5CBEB 5AZEL 5TE4L 5TE6H 2AV1B 4ZFGH 4G5ZL 1GGIH 4CU6A 5DJDA 2EYTA 4R7NB 2X1XR 4XI5C 5D8JL 5AWNH 3HC4L 4XBPB 3SDCC 1AGEA 3QIWA 4OSUL 5KVEH 1NDGA 5J1SC 2HP4A 3RZCD 1MH5B 2EE9A 1W8NA 4YDLC 3RDTB 5I18L 3MOBL 1IE5A 4N0UE 5IB4A 3LEXA 5E9DB 1KXTB 1VFMA 4YPGA 1U91B 2ZUXA 1L0YA 3RVTC 1PYWB 1N59A 3QDMD 4PJBB 1EMTL 2ICWA 1RIVL 5KVEL 1KNOA 4UZGA 5AG9A 4HH9A 1E27A 4NKIL 3HFMH 4OGAC 5L8LB 3G5XA 5C6TH 2C3VB 3QO0B 4OJFH 4HUXB 4Z76B 3SBWA 4R4BB 1T5WA 2GT9A 1A1OA 3EO0A 4YE4H 5DURD 3RBSA 2A0LC 1G9NL 1G9ML 5DK0B 1NCAH 1JF1A 5GS0C 2Q3AA 3TBWB 5LG1A 2CLZB 1FGVH 2E5EA 2NXYB 3GKWL 4HUXA 4Y2OA 3EOAB 4U1SA 3O2VH 1RV6X 4GKSB 1A7RH 4UOW1 4R8WL 1DBAL 1JPSH 1YPZF 4Y4FA 1M7DA 1AGBB 5FO9B 4J6RH 4NHCH 4ZUWA 4ZS7H 1A7OH 1MWAB 2NY1C 4XNXH 3V6ZA 5IP4A 5I8KH 5FCSH 3S3PA 3VJ6A 4MCZB 3TZVA 2OJZL 5ID1A 4NC1E 5TDNA 1X7QA 4G8IA 4IMKC 2NY0C 3D85D 4N0FB 4WRLA 1A4JB 2BNUA 1A64A 5HGHB 2VABB 1CG9B 3KPOA 2NY6B 1CDHA 2HN7B 3QCUL 4UBDD 4DZ8A 3IFLH 1LE5B 4U6VL 1X6NA 3AM8A 5JIHA 1N3NB 4YHYB 5JHLH 5HHMB 4E42B 4NQDB 5KBNC 3L9RA 4JANB 1LP9F 1OAZH 3NVQA 2WUCL 3DRTB 3W2DL 5CAYB 5C2UB 1NUNB 4MNGB 2MQ0A 4TUJA 1BEYL 1GVIA 3VXUD 3NAAH 4PUBL 3QZWG 3TIDA 5I19L 1EJOL 2FIKA 2BXYA 5B22A 1UB5A 4GRMA 4M43H 1NGXA 4ZFOB 3CLFH 3QHFL 1DCLA 3NIGF 2B20A 4WDIA 1MHPL 4KQ3L 2XQBH 2Y23A 3CVHB 4NZRL 5FYJD 1CGWA 5C0BD 1CQYA 3IJHB 1LK2B 1F5WA 4YAQB 4DOHB 3WLBB 3MRMB 2GY5A 3AU1A 1WQVT 4NYLB 3TIDB 3D18B 5GZOD 1YC8A 1FG2B 2G9HB 1U9KA 4RQQA 4ODHL 5GRVL 1LILA 2J5LC 5E8PA 3KR3L 4F15B 4OD1L 2GK0A 5KW9L 3NH7H 1A3RH 2FGWH 2D7MA 4Y88A 3JVGA 2E27H 4ZSOE 1UM4H 3QRGH 5J56B 2P49B 4JDTL 1KJVB 2EDXA 1QLEL 2N7BA 3ZKMC 4N0YH 3D85B 2FO1A 1FAIL 1FNGB 1VEMA 3K74B 4O58L 3WKNA 2PTTA 1FYTA 1U91A 5JOPE 5LWYH 3HUJE 5D2NE 2W9DL 5D1XA 1KTLB 1LK3L 4KKLD 5JHDA 5B4MD 1MCNA 4GMSH 1EGJH 4JY4A 2RFXA 3N0PB 4C83B 2VQTA 2LAAA 1RJLA 4KK5C 5H35A 4JZOB 2PNDA 5HHMD 4IS6A 1MFAH 4HUNB 5I8EA 2CDFA 5I1IL 3PL6C 5D5MB 5CSGA 3L3KA 4L3EE 3LPWA 1SJVA 4LKCB 4PJ9C 2AXFA 5HDQH 4IRSB 3EYOB 4ZFGL 3FT2B 1JNHB 2HKFH 3H9ZA 1M05B 3B2VL 3KLHC 4PLOB 2B8OT 3VXRE 3MRCA 4MJID 3QNYB 5DJAB 3SKOB 4LF3B 2R23A 32C2B 3PGCB 4X5XA 2FDBP 5F7NC 2DJ4A 1KENL 1U8OA 4F9PC 4NUJA 3Q6FA 3KPLA 5DO2C 4GKSA 4JFZL 4N1EA 5DVNA 2FYYB 3MV9B 3QNZA 1YNTA 3V6OC 1MI5A 3T2OA 3W0WA 5DUML 3G5XB 5IVNA 4KI5C 4KUZL 4YZFF 3TBYA 1JWSB 1PW3A 2ZKHH 1NGWB 2R23B 2B1AL 32C2A 3O3AB 3ULUH 3SCMB 3IAGC 3IAQA 1NL0L 3QIBC 3KPLB 1ZLSL 5I15L 1SBSL 4PJHB 4F37F 4KHTL 4OKVA 4K94C 5IFAH 1OTTC 3FOMA 2HFGH 3N1QC 5J8OA 1LWRA 4HCRA 3B3IA 5IVZA 5D2LE 4KDVA 3SDDA 2ARWA 4K3JL 3RWIB 1E28B 1S7XA 2YBRA 3BP7A 2X4PB 2X4QA 4OZIE 5CEYA 4Z0XA 3S8WA 2XA8H 3B5TA 1QSEA 2D7OA 4V1DA 5SWZD 5D2LF 1KLGA 1T1WB 2YUVA 3MJ7A 1QBLH 4Q58C 1JTPA 4QXWA 1XGTA 4H0HB 2NYYC 1OAKL 5F70A 3EFDH 4UI2A 3DX8B 5GGRA 3C09B 5I1HH 2CXKA 2NTSP 4UINH 3OV6A 5A16B 3MA9H 3S88H 1LNUB 3QUXB 3DPBA 5DUBA 2Z93B 4GMTL 1IZJA 4XP1H 4P5TC 3GSNA 3O6KH 4RAVB 1S9VA 3WUWA 4GW4B 1U42A 3OJVC 2GK0B 1I85C 3O6FA 5EO1A 2W0PA 5FUCC 1LHZA 4X9HA 4XP1L 4G6FD 2YEZB 5CIPA 1FVDA 4OGXH 4GRMB 1CZ8H 5E6IC 4FQIL 1FL6A 1ZT4A 4ODSH 2UYLB 3OMZA 5D5MF 4EKXA 4YHML 4YHPB 1D7FA 1IT9H 2FSEB 4JY4B 3OWEA 1MCPH 1QBBA 1UXSB 4LSQL 2XTJB 1DVFC 3MOAH 4I4WA 4L29B 2V17L 1R24B 3HNSL 5I8OH 5JR1H 5I2IB 2DWDB 3AREA 5DMIL 5CP3H 1RZIB 4JRXB 5F1KC 4LCCA 4M3JA 2VDLL 2F19H 4K94H 4HKZB 2AEPH 4G80B 1TIUA 5D7KE 3X17A 5D2NC 5F21B 3NFPB 3BPLB 3S96B 1I9RL 5HHQA 4H1LA 1FCGA 3LN4A 3CU1A 1NGPL 3GJFB 1GPOL 4M1DL 2PO6D 1HQRB 3B5GA 5IMMB 4HK3J 1BZQK 4I2XA 3JBG7 3QIUC 4N5EC 3CFEA 5ABDE 2VOTA 1G6RA 2X4NA 1ZVSB 4L8BA 3MJGX 3GM8A 3VFTA 3OAZH 3GJFA 4EZMA 1ZWIA 4Z18A 1T0MA 4F33B 4XCYA 1EO8H 4R97B 5GRJH 2CSPA 1FL3B 1IGTA 5INCB 5J12C 35C8L 4I48B 3V0VB 2OXHA 3MLZL 3RWEA 4FQLH 3TPKA 1NCBL 2HKFL 4WI5A 4L3CB 3MLUL 2BNQB 4Y4HA 2Y5EA 5F1NB 2PYEB 4OLYL 5F3HB 2J8UF 1AQDB 4DKAA 4WI8A 1WWAX 5BCAA 2MCPL 1K8IA 3VWKA 1TXKA 5L6YL 3MNZB 2QQKL 4MJIB 2ZCHH 3T0AA 2ESVB 2NXZB 4QY8A 4ZPTB 4HFUL 4Q7DA 1OWWA 2FCBA 3VXTA 1MRFL 1P4IH 1OOAA 4DN3L 1I3RB 2ICEB 4Q6IC 4CU7A 2O5XH 4GAGL 2MJWA 2GHWB 1XCQB 4XNQA 3BRGC 1NAMA 5MEND 3K2MC 1RMFL 4U3HA 2QBWA 3JSSA 5C0CD 4ZODA 1ZGLB 3UBXA 1A3LH 1HXYA 3WIFB 1MH5A 3EYSH 3MBXL 4EUPA 3SDYL 3LKQA 4X8JB 1ZKAA 2RBLA 1IJ9A 2BOBB 1J0KA 3K4AA 3UPAA 4JN1H 3VGFA 2B7DT 4DGVH 3OKNB 4ZFOL 5ISZE 4OLWL 2DB8A 4U1HB 1K9TA 3HPJB 3P77B 1FYTE 2OMBA 1QKZL 4JZNA 5DJXA 5GHWH 1DBKH 3U4EA 2XOTA 4P2QA 1AE6L 4CN4A 5DQJA 1EHNA 4X8JA 5DGRA 3OZ9L 4FG6D 1D6VH 5GJTL 5BW7C 3RVVC 3HE7C 4NP4L 5CKGA 1IGFL 5HXMA 4M93C 5T5NF 4DKEL 3GBNL 3U1SH 1RZFL 3LH2H 3VXRA 2EC9T 5SWSA 5EU5A 1WITA 1GOGA 1PG7X 3ROLB 3CDGA 3QFDA 2YC1A 5C6TL 1UACL 1V05A 3EYVA 3KS0J 3ZKXB 1OT2A 5FHAH 5IBLC 1BM3L 1XGQA 1R3HA 3RNKA 1S9YB 4HKZA 2GAZA 4AQOA 5A2FA 3SKNB 1CR9L 3OR7A 5LGJA 3OB8A 2WINA 1BFVH 2ZNWA 4IM8A 4KAQL 1EUTA 1NMCB 4ZOCA 5KZCD 2F53E 5FUOL 5H37G 1FZKB 3FOLA 4PBWD 5D71L 4PJGA 3P4LA 4EDWH 2VXQH 2YMXH 2BY2A 2FZ3B 2H45A 1J8HE 4JPVL 3WO4C 5B8CA 2VLJA 4O4YL 1MCHA 4AT6B 1EIBA 4R0LA 4XTRC 3QEQA 3G6AA 3I2CH 5E5UB 3OAUH 1EHLH 2P47B 2VXUH 4UQ3A 1MPAH 2IBZY 1U36A 1CG9A 4F33A 2NQCA 1A6WL 2ZUUA 3HG1A 4KKCD 3D6GA 2X42A 3GHBL 5F88B 5HHXH 3UTSD 2HRLA 4XZUB 3MRQA 1BPVA 3K8KA 4PJ8A 3QCUH 4PLKD 4Y8AA 5LCVH 2Y25A 5DVLA 1MWAA 3UJJH 4JFYA 5DJ0A 1HHHB 1F11B 1NBVH 4MYWB 4A2MA 3E6FB 1JHLL 3HG1B 4XMLL 1S7SA 4FQXD 4NRYB 3IS0X 4OD3L 1EEQA 2HJLA 3RDTD 4JFDE 1DBJH 3S9DB 2YD2A 3KVQA 5JW4M 2Z9TA 2PYFA 1C16B 1HYSC 4WFHE 5DHVB 4EQ3A 5FYJU 4PRPD 5DJ0B 3QDMB 1X5KA 2VLRA 4UB0L 5LAXA 3SDXB 3N50A 1KJ2H 5DEGA 3HKFA 4Y1AB 1XIWA 4GT7A 4YEFA 1PKQB 5J6HA 1U8JA 4YUEH 2Z31D 2W9LA 4OB5H 4XMKL 3VXSD 4NC0B 2PXYC 1PKOA 4HG4J 1NCAL 3HS0A 1CL7I 4JO2L 2GJZB 1QRNA 1I1FB 3DYOA 1LO4H 4LAQL 3MLUH 4OBSA 1EO8L 5CJXA 3QFJB 4WVRA 3SEPA 4XTRD 4WHCA 1JF6A 2FGZA 2E7LA 2DQHL 4XP9H 2IADB 1P7KA 5TDOA 4H20H 3AC0A 5F89A 4HDIB 4WI2A 1FP5A 2B1AH 1ZT7B 3MCLL 1MHEB 2VJXA 3MGTB 4JFQA 1YY9C 4XI5D 2YPKA 1RHHB 3MV9D 3QQNA 3QI9A 3DX9A 3QO1B 4Y4KB 2OS7A 3T2QA 4NWUH 4MNHB 1CL7L 1T1XA 2NTFB 4UQ2A 4P23D 2BC4B 1J05B 3SKOA 4CMHC 5IV2B 5I75B 3HC4H 4ERSL 2WBJB 4JZNB 3LRHA 1K3ZA 5I1DA 2CIIA 1T1XB 3HI6H 2FO4A 1UKSA 4LLMB 4TULL 5C0CB 5D7IE 2OMNA 4ZO8A 5J89A 5GGSA 3R8QA 3O2WL 2R69H 1FGNL 1G7LB 4MJ5B 4WUKH 5JUEL 1J8HD 3TA3A 1YA5A 3O41B 1FDLL 3QXDB 1FNHA 3QDJB 4JHWL 3UO1H 4GW5A 3RNKB 3S97C 1FFNA 1BD2D 3J7HA 5GS0D 5ESQA 5IF0B 3E8UH 3RY6C 3CSBA 4ZUVB 3UPCA 3RWCB 4JZJA 4HFWB 2OL3H 5BO1H 4P0DA 1YNTB 1OF2A 4XWOC 4D0CA 4XB8A 1P69B 1FNSH 1QFWM 5F8QC 3VG9B 3VGGA 1QLFA 4HD9A 4QXGL 3NCBB 3ZE0F 1HXMA 2AJ3A 1U92A 1K6QL 1UM6H 1UQSB 4CMMB 2I5YL 3D5OF 1XR8A 3HPLA 3TVMA 3GHEH 4BSVA 5FA4A 5DI8B 1HILB 3MFFB 1XF5B 3CLEL 1A9EB 1ZLVK 4HBQA 3V0WH 5IUSA 1MQ8A 2B4CH 2ZZUT 2L7JA 2PW2A 3U7YL 5K9JL 2DI8A 5IKCA 5CINH 2VLMD 4K7PX 4HS3A 2FEDD 3VFSA 1KLFA 4UBDC 5HI4C 3D69B 1WFNA 1OQXA 1HEZA 1XGTB 4X4YB 5JW3H 3O6FB 1PFCA 3CCHA 1PEZA 5KG9B 5L88L 5T3XD 3P4OB 2O26U 4XHJD 1K5NB 5C0ND 3JWOC 4NIKB 1U58B 4MQ7A 3GSOA 1FIEA 5EUKA 2OM5A 1HH6A 2ZUSA 1EK3A 1A6TA 5I1CH 3FQXB 4YDJB 2CGRL 5DHVA 3EDFA 5FM8A 3ZZ1A 1GGTA 1KELL 1XFPA 3L3JA 3VG0H 25C8H 1G7MB 2X4SB 2MTPA 3GSXB 4L29A 3AMLA 1URLA 3WE6A 1C08A 1KTKE 5EC1B 3QI9B 1VFBA 3FFCA 4XCCH 4FFVC 3MJ9H 4Y4FC 3C09C 2L7UA 1DVFD 2HH0L 1SEQL 3ULVC 5KSBE 2CK0L 2AEWA 3MLSL 4HWNA 4FHBD 4D0BB 5IB4B 4AY0A 3ARUA 4PGBB 3ZKSD 1HCVA 4PRPB 5IJKA 3FB8B 4RISH 1V3KA 4JM2A 4KK9C 3IDGA 3CJJA 2B39A 5I1GL 4NN6C 2G75B 4NCC2 1IGMH 1A6WH 3EOTL 4MD4A 1I4FA 3H3PH 4YHZH 1T21B 1KN4L 2VE6B 5IMLB 4G9FE 5EU4B 4W6XB 1HIML 3UYRL 2DOCA 3OPZL 1C8PA 1G1YA 4OZGB 1N8ZA 5F1IB 3QP3A 2Q7YB 4MQXD 3HI5H 2LVCA 4HUUA 1GPOH 2CKBB 5E94B 3JTSA 3TYGL 4UV4L 1VPOH 2F74B 5ELIA 4TSCH 1ND0B 1JBJA 2OR7A 3PWNA 4QRQB 3H7BB 2A9NL 2ZOKA 5IBTH 5I1AA 4IIQC 4JDTH 4PB9H 4D3CL 5HBBA 4L9DA 4KY1L 2YK1L 3LKOA 4O58H 1F3RB 4ODXA 4HH9B 4CKVX 1G7PA 5BMFL 2ENSA 3BPOB 5T3ZE 1XT5A 3EJYC 3IDXH 4NWUL 4P23B 3V6ZB 2F54A 1IFHL 2C1OB 5FOBA 1A5FH 3WS3A 1X5JA 3RVWC 1ZWIB 3RIAF 4KTDL 2W0FA 5T3ZD 4JFOB 1JNJA 3Q6GL 1MHCB 3LPGA 3L7EA 3DV6B 1HILA 4LBEB 2F5AH 1B0RA 4XBEL 5GGUA 2DL9A 1HSBA 5MEPB 4OAWA 3ARFB 1DQDH 1YNKH 5AYUL 1MCFA 3DARA 1KEMH 3SQBA 1YEGL 4PBVC 5JMOC 1T6WA 1MCEA 4D0CB 5ICXB 3O8XA 5D96C 4NQED 3RTQA 4XX1E 3U9UA 3V5KA 2R2HB 1W72L 3WUWG 3IU3A 1HSBB 5MEPA 3EJZD 4URTB 1IC7L 4HF5H 2FLRT 5IVXE 1FSKB 4HIHB 3T8XB 5KVMC 1KLGB 4YBHA 1GAFH 3MXVL 3HC3L 1NANH 2CH8A 3VXNA 3KPQB 4C58B 1FLRL 3QEHA 3TH4T 3UJIL 4WW2F 5IIEB 4Z7WE 2OR9L 4OZFH 1KG0B 4POUB 2X89A 3MYJB 1Q0YL 4X6FB 1RUPL 5JOFA 1F90L 2AJSH 3MCG1 1T5XA 2UWEE 2IJ0C 4M6MH 4BUHA 2PF6A 3N85L 2YC1B 3M8OH 4HUKB 4XVUD 5D6CB 2FJFB 4HEME 3BGMB 5EUOA 2NLJA 4RBPK 3SE3A 3VRLE 3JUYA 4CAGA 1OAUH 4M62H 5DQ9A 5SWZE 3D3VA 4EVNA 2BSSB 5HPOA 1PZUB 3SO3B 5I17B 1QFOA 1OSPL 2V2XB 3L5WA 2YA0A 4Q9RL 3VFOA 4WTWA 3N85H 2VDPH 3D0LA 2CJUH 4JQIL 3AUVA 3Q5TA 4ZYKB 4ODUB 4P3CL 3MRDA 1QA9B 4U1MA 1HKFA 1MNUL 4PRPE 1E6OL 2YPLE 5CSZB 5EOCJ 3NPZB 3LQMA 1UJ3C 2LU3A 3MV8E 3OX8A 4I3SH 1UB6A 3GI8L 4HUMB 4PRNB 3P0YH 1PDKA 5DF0A 4LPWA 3RVXD 1CXEA 2P5EB 3ULVD 1I1YB 3HE6C 4OV5B 4S1RH 3PXHA 2ITDB 3L1OH 3ARRA 5I8KL 4PGBA 4HJ0C 2EE2A 2NR6D 4P59H 3MR9A 3PIQB 1ZGLP 3UTTE 3PXJA 1AXSA 2QKIB 5C2BH 8FABA 4R97C 1TJHH 4S11A 3N9GH 1I4FB 1X5YA 4D9QD 5BV7B 7FABH 1OD9A 4LCCB 2D0HA 2H3NB 3D0VB 4LLQA 3QI9D 4XC1H 1LO5B 3LKRB 4LHUD 4U0RB 3C5ZD 5HYJE 3T0EC 3LS4H 3GMNA 2IH1A 4CADB 2VLJB 4AT6A 1MFBL 1DR9A 4X6CE 5DMJB 1MLBB 3JZ7A 3TYFA 3C8DA 3F7YA 3VRJA 3C6LC 3WN5B 1IKNC 5DHVH 4HEPG 3U7AA 4D8PB 3MV9E 3B6SA 3H9HB 5JHDD 3TYGH 3LS4L 3P73B 4QTHB 3JV4B 1INEL 4JREC 2IAMC 2R0LL 1MLBA 3ECBA 2YN5A 4UIMA 3A6OA 4UOW0 3MUJA 1F6AA 1NFDB 5C0EA 3MLWH 3PE9A 3PG2A 1FH5H 1Z2KA 4LGRB 2DIJA 2ZUVA 3AXLB 5HPMA 3T65B 5T1MA 3ZYJA 3BUYB 4M6OL 4XWOD 2XY1A 4R26H 3BP6A 2FNBA 4ELKB 4TPRL 1LK3H 2IPKB 1MCSA 3BISA 4DFHA 1KFAL 2WBJD 1QLEH 1BJ8A 1F3JB 2W9EH 2CK0H 1S7WA 3T0WA 4FABH 3IJYA 2NY1D 3IU4L 1OT1A 1QUNA 4ELKA 3T2NL 5DJ6A 1RK0A 3P0GB 2JJTC 3SOBH 3S4SA 4ZOEA 4RZCB 3MUZ1 1INDH 4LSUL 2Y06L 3BH9A 3NCEB 4TQEL 5EUOB 1ITBB 5T3XE 5JW4N 1I3GL 4JM2C 3S34L 1I1AA 3GKWH 4HIHA 3T8XA 1QRKA 4XVSH 3FONA 3QHZH 4G8EA 3OAYH 4PJFA 4F2MB 4MX7A 3ARFD 3BXNB 4JQVC 3PP4L 4HC1L 1FBIH 5AYQA 1G9NH 3TGXA 3NMEA 3BH9B 2AI0L 1CFQB 4G6ML 3FB5A 5K59F 4LVEA 4EOWL 2PYED 5T1LB 1QSFA 3WDJA 4JRWA 2IMMA 1FPTH 1NL0H 1NC4A 4GXVL 2VZOA 5CGMA 2X6MA 3UJTL 1CLZL 5DDHA 4OCRH 2AXHA 2J6EL 1FFPA 4DK6A 3O8XC 1MQKL 2C5DC 1QLRA 2HAZA 2YA2A 3FFDA 3S36L 5FKAA 1NC2A 1ZHKA 3P0VL 1AC6A 3HMXL 4U3XA 5F96L 2IANE 2NX5A 3TJEH 4MJIE 3RPIA 3U30B 1EVTC 4OFPA 5D7IA 4FNLL 4P2RA 2XA3A 2FO4B 1GHFL 1TVHA 2DDQL 3CSYB 1S9XB 4DEPC 1M6OA 4K94L 1T22A 2YN3A 4OTXH 4G8GD 5BRZB 3BWAB 4X7SH 5DFVD 1OAUL 4M62L 2Z31B 2ADFH 2HTKC 4PR5A 1CU4H 1VGEH 4UT7H 2GITA 4FMFA 3O6FD 4B0MM 1OGTA 2Y07H 4HG4K 1S3KL 3OJMB 3QDJA 2OQJB 3GGWB 1DQLH 4CNIB 3TH2T 3LMJH 4D8PA 4BSWA 1IEHA 1OTSD 2ZJSH 3OHXB 5D7SH 1U8MA 1CT8A 3PL6A 4M3KB 2YD1A 2CQVA 5HGGS 1M7DB 1MJ7H 4JANA 3O4OB 1JHTA 5IESL 1QFWL 2ADIB 2QSVA 2W0LA 3HAEG 4OD2B 4PRHB 1WFUA 2KDGA 2P5ED 5ID0A 1CT8B 3PL6B 1K8DB 3C60B 4X99B 4I13B 1QP1A 5F71A 2ITCA 3B9AA 4HXBL 4MD0A 1BREA 5KVGH 3CD4A 5HYQA 2VDKH 5GJSL 2FB4L 2A0LD 2BDNL 3CFDB 5F9JA 3S37L 3QPQD 5MEQA 1DE4A 5C09A 5EU6A 1RJCA 3H9HA 2YUWA 4MQSB 2CRYA 2ADGB 3HC0B 3RPKA 3VMOA 3ZDYE 4Z7WB 2HJLB 3RL1A 2EO1A 1JN6A 2DQEL 3EYFB 3IFNL 4FQHA 4PV8B 4TNWK 4GBXA 3WIIL 4GRLD 1E6OH 1NFDA 4N0RA 5A43C 5C0EB 4LLAA 4P5MA 2Z92A 1SYVA 5EU3A 2F54D 4P4RA 4NFBA 4XRCA 3ZYIA 4XX1G 2CJUL 4JQIH 5D6DA 3TESA 3K4ZA 4HKJA 4NKMB 4XCFL 1K85A 1J8HB 3RKDC 4J3TA 3MBEC 5CBAB 5SV4A 4IRZL 2FR4B 4YHNA 3IJSB 4D9LL 2JF1A 5B38G 3QIBB 5DJXB 2HT3C 4JDZA 3V4UL 4Z7VB 4K71B 4PJAF 4RWYL 4ZFZA 3KPSA 3EOYG 4K2UH 1WC7A 2K7QA 3G5VA 3MRNA 2J8HA 2WWMD 5HY9B 5ALCH 5HHOE 3CSGA 2KKQA 4MA8L 5I74C 4GO6B 1CLYL 1IAOB 1TZGL 3WKML 4O5LH 3V6OA 3UBXB 3MLRL 1TNMA 3QEQE 4M6OH 4YBLB 1XGUA 4WIQA 4JFDD 2I9TB 3OZ9H 3WSQH 1E6JL 3FRPA 1IAKB 3G5VB 5F6IB 4KQ4H 3DYMA 3VD7A 1ZA3B 3ZHLA 2ZUWA 3JTTB 4XAWH 2R9HD 1N0XH 1W0VB 5E9DE 3SGDI 2NY2D 1T2QH 4YBQD 3TIEA 4J4PC 1YC7A 4PB0H 5I71C 2F53A 5DC9B 2C3GA 3HB3C 5C9KA 1GYAA 4PJ7E 1EXUA 2DBLH 1GC1L 2AEQH 4NZTL 3ILQD 1AGDA 3O6MH 5TE7L 4MMZC 2ICWI 2FX9H 1AY1H 2GTZB 4D3CH 2EH7H 3SN6N 2EDJA 3BW9A 4X7EC 5E00B 2XKSA 4HPYL 4OGZA 3MSPA 1CZ8L 1WEJL 3TN0C 4ZUUB 1O7VA 1EXUB 1MFDH 4PJHE 3TO2B 1DUYB 2UZIH 25C8L 1JPGA 1NDGB 1HZHH 3MACL 3QXDA 4ZO6A 3HZMB 5IOPA 1IMHC 1KV3A 1UENA 5BS0B 2H41A 4PJEF 1FFNB 2XWTB 5AYUH 3RGVA 3UZQA 1KJMB 2V7NA 4QHMB 1DVFB 5IQ7L 1PYWA 2FATL 3V5DB 3FAWA 4OTXL 2F19L 4P5TA 4O00A 1TDQA 3QULB 1JP5A 4HFWA 3ILPB 1NFDF 4XH2A 1CGSH 4IIQB 4PGDA 4ZOAA 4L4TA 3VI3F 3TJEL 4WI7A 4Z77A 3PF2A 3TCXA 1R6VA 2XKNB 3IVKB 4X7TA 3U4BH 2Y07L 1A9BB 4L9LA 2HVKB 1PKQA 3NACL 2VKWA 2V2WB 1P7QB 1ZA6B 4C54A 3RTQB 2HWZL 1FYHB 3IFPB 5D1XD 4W6YB 5C07E 1D6EA 3GSVA 4K3GA 3MMEB 4W81A 2P44B 5KSVA 1G9MC 2LU7A 1ZT4B 4P3DA 5BXFB 3DUSA 3V8CA 3MLTB 4DGVL 3MA7A 1XF2B 1P4BH 2UUDH 1Q9WB 3KNBB 5K9KB 2J6EH 2JB6A 3GHEL 1MJ7L 3DNKA 1WBYB 4X80H 1KXVC 1XH3A 1WLHA 1AR1C 4MMXC 1PG7H 1IGYB 4L1HA 4MDIB 2VMFA 1AE6H 4P4KA 1OSPH 2H8PB 3SCMD 3CVHA 2VO5A 1T7WA 4G6KL 3DRQB 4LLDA 4K7PY 5DD3H 1UZ8B 1JTOA 1IEAA 4H1LH 5IEKB 2UVFA 3D3VB 4EVNB 5HHVL 1YEEH 3L3IB 1A47A 1IL1B 4ZUTB 2Y36L 3G5ZA 5CJOH 5DFWH 4S1DD 1AIFA 2BHUA 2QHRL 4LPVA 3R8BB 4KKCC 1P2CB 5HY9A 1NMAH 3AFLA 4PJ9A 1LQSR 1UEYA 3GMNB 1G84A 4JM2F 4KFZC 5FYKL 5D1XB 1R5WA 4MJ5A 4MD4B 2I60H 1S5HB 4EUPH 1T0MB 5DS8B 3FQWB 2EXWC 1FE8L 5KSUA 3L3DB 1V3JA 1L4IA 1UCBL 1ZS8B 3KPPB 4HAGA 3EOAA 4U1SB 4OM1H 4P57A 1SHMA 1T20B 2AJYL 5F7EL 1HQRA 3F7RA 3WLWC 2CUIA 2VDQL 5AZ2L 2X4UB 5IOPB 4DW2H 1X5IA 1N5AA 4C56E 1QLFB 2QTEA 4TTDC 1JZ7A 5FEBA 1QR1A 2AJ3B 4TVPD 2JJSA 3S5LA 1KJ3L 5ILTL 2LVEA 1UGNA 3RTQC 1AO7E 3EO0B 3FQTA 4XNZC 4G6FB 5HGDB 4D9QE 2R29L 4JGMA 4KQ4L 1QVOA 3QCTL 3MUGB 3ZKXC 3WJJC 5CLTA 2WQ8A 4EXKA 1ZHNA 5J6GA 3QG7H 1G0YR 5HGAA 5IKCB 1Z5LA 4P4KC 1MIML 4NQSB 4R7DA 4WW2A 4OFYA 1IFHH 2P8MA 2XTJD 3INUH 3RI5K 4G3YH 1NMCC 3UZEA 3D69A 1ZANH 5C9JA 4NC1C 5JO5B 3EFFA 4OF3A 5EZJA 1H5BA 3BUYA 2XZCL 1FC1A 1IEBB 4HX1B 5EG6C 5KVFL 1MJJB 3SE4A 3BEWB 5C0AE 5JZ7D 5TDNB 3BKJH 1MJ8H 4OD1H 5GS1A 5KW9H 1MRDH 1RZJH 2BK8A 1TTUA 3I3DA 5DQDH 1CLOH 1B4JH 2E7CA 4XP5L 4ZS6D 5J57B 4MHHG 2FEEI 5BV7L 4HIEB 3S37X 4KZDL 1B2WH 4EBQL 1LE9A 4L9LB 2HVJA 4NQDA 3Q5OA 4H20L 4MNQA 1FFPB 5J13C 4D9RD 1IM3A 5IFHH 3WIHL 2EDNA 3GMQA 3M17B 2CKBL 4JCMA 1E0OB 4L5FL 3HAEA 1NC2B 5IHBA 2OR9H 3GSOB 1RZGB 1EDQA 5JPNA 1QTYT 4XGZB 2BNRA 2LFGA 2XZZA 1KUMA 3OKEA 1BGXH 1T1WA 1ONQB 2JIXA 4U6VH 1QPPA 1S7RA 3MJ9L 5E2VL 5JHDB 5JIKA 5GZOC 3X13A 3S36H 3ZKMD 1I7TA 5IESH 4N0UA 3UTSB 5JXED 1AIFB 4JHAH 1JIBA 3I6LE 1QSFB 2WWKO 3WE6B 3SBWC 4Y2DA 1ZLWK 4XAKE 3TBVA 5I1EH 2C7UA 4NQEE 2GFBB 1JNLH 4M6NL 4IOSD 4PJBE 2R2EB 3OXRB 1PY9A 1RJYB 4J12A 3VW3L 1Q0YH 4UTAL 1GZQB 5GRWA 4KPHL 3T0EB 2F74A 2XQBL 4K3HA 2NX5E 3E6HB 3I9GL 4NHUB 1AD9B 3CFCL 1LP9A 5A2LH 1MCCA 1GOFA 3N1PC 5ESVA 5CEXA 2CD0A 5J9PA 1T20A 1MWAL 2FJGA 1I1YA 3K0WA 4OIIL 2UV3A 3E6FA 4O9HH 5D7JC 4MJ4A 5CKAA 5L7XL 4PJDE 3H42L 4NQVB 2F54B 3VFPA 3B43A 2UWEB 1MFAL 5E08H 3QDHA 3E1F1 1JNHA 3P11H 1YEFH 3H2WA 3NZHL 3QIBD 3HI6L 4NKQB 4U7MA 4WI4A 3P4MB 2B1HH 4E41A 2YA1A 3BHBA 3D25A 4QHNA 4OFKA 3BDXA 4QCIA 3WN5A 1SVCP 2EEBA 2LE9A 3OKMA 3B6SB 4NRYA 2NY5H 2ZSWA 3P73A 5E8DH 1CK0H 1CFNA 5ESQB 4YHNB 1ZHLA 3S4SG 4DGYL 1F02I 5E8EA 3RBGA 1C16A 1D9KB 2O5YL 3EOTH 1AC0A 5A16A 1UCBH 1HDMA 1X5GA 5LAXB 1H15B 3SQOH 4JFPA 2NY2B 5FXCH 4R6UA 1XIWB 3MRIB 1TJIL 1KG0A 3QDGB 5T1KA 1O5DT 1J10A 2ADFL 3MJ8A 3FMGL 3AAZA 3PQYD 3TZVB 1NCCL 2ATKB 3TPUA 2Z92B 3DBXA 1I8KB 3EHBD 2A74A 2Y5TA 4MQXC 4AIZA 2HJKB 4MJ6A 5E0QA 4P5TD 4N90D 5I66B 2GJ6B 1AXIB 3U82B 2BY0A 3IU3B 5EOCL 1MF2H 4U1GC 3SGJA 2FHFA 3MV11 2VXSH 2DQTL 2EDBA 3ZSSA 2IQ9H 5EORL 1YEKH 1AI1H 1D5BA 3UTQB 4JO4H 3RX5A 2FECL 4NWTH 2KL6A 1NEZA 4OZGE 2W38A 3WL9B 1G7IB 4CVZA 3PHOB 1KCRL 2HVJB 5F9WC 2DF3A 4I0PC 2AJUH 3G5YB 3NN8A 3OXRA 4PRHD 4FQXB 1J1OH 4ZMAT 4G9FA 1FVEA 4K8RL 1KCSL 4NGHL 4NZUH 4RFOH 1MNUH 3ZHDA 5HVHC 2BVQB 2DQHH 2IANA 1X4ZA 1RZ7L 1NAMB 4NZTH 5TE7H 4BZ2L 3QUYA 5IFHL 5C0DA 2NW3A 1NLDL 3G5YA 3NN8B 3TN0D 1OAZL 5F7LB 2VDOH 3DV4A 4FQXA 3X13B 5B3NA 3TZVD 5D70L 5JW3L 4HZAA 1QACA 1P7QD 4FFZL 3C6LA 3CFBB 3HE7A 1A6VL 2BZDA 5E00A 4DKDC 4J3XA 4HT1L 3MACH 1S7TA 3CC5B 1NGQH 2A9MH 4XCNB 3L5HA 3RUGF 3T0EA 4LLWA 2PW2B 2BSRA 3LKSB 4OM0L 4XT1C 1FL3A 5FUCE 1SVZA 3UTPD 1RZJL 4FQ1H 2H9GA 4LDOB 4OI7A 2J6EA 1MCLA 1EEYB 2VR4A 5DRXB 1G9EA 1O0VA 4KXZI 2A83A 4LEOA 5JR1L 5HHPB 3KDMB 1N2RA 2VL5A 5HPMB 1NGPH 2UZYB 3OXSA 1XEDA 4MLSA 4QNPE 4OZIB 2WINB 3Q2CA 4U6TA 2P5WD 4Y2DC 5CILH 5F88A 3GSRB 3QUKA 1I8LA 3FRUA 4OFDA 4N1HB 4N0CC 3O3UN 4Z95L 4L5FH 1T80A 4L4TB 3NZ8A 1P9MA 5EFIB 1JGLL 4X6DF 5EA0H 5F7HA 5KJRH 2Z35A 4FXKB 4ONHA 4QRTA 3MRJA 4U1LB 3RP1A 4NCDA 4P23A 4JY6A 3QUZC 4ZNCD 3PABA 4LU5H 5LXGL 3GRWL 3ZE0E 4QTIL 3QCVL 2B4CL 2IG2L 4RX4D 4ZXBB 4UIKH 5F9WB 5DEGB 1G7HA 4IRSD 3STBA 3MNVA 1A7NL 4QXUH 4JY6B 5MI0B 4PJGF 2FJHB 3BIAX 3MRLB 3DETC 1A22B 5IMLA 4LOUC 2WAHA 2YOCA 3VD5A 1B3JA 2XWJA 2V5TA 1VPOL 5DMKB 3K80A 1J8HA 3NPSB 3TA3D 4JO2H 4O51B 3RIAK 2HMIC 3V8OA 5ADOH 3WFBH 4MDIA 1FHGA 2VN4A 5CJOL 3QHZL 3MRPA 3VXSE 1OCWL 3BZFA 4J3UA 4HJJL 3VXPB 1KIRA 3IDNA 3HUJB 5D2NB 5IEHA 3DVNA 3BPCA 1JJUA 4Z78B 1HQ4A 3CXHK 4QRRA 5J4MA 1MFCL 1EO5A 4HC1A 3THMH 1LP9E 5ECJE 3FFCE 4U1HA 2WIMA 4Q9BA 2HKHL 3REVB 3SDAC 2EXWD 3QDGD 4NBZB 3LDBB 3QEGL 4JB9H 1MVUA 1TJIH 2BCKA 1Q0XL 2VB5A 4W68A 4FQPA 3PQYB 3RUGA 3NA9H 4V2BA 3FOLB 2ATPA 3MBXH 4M7KH 1SMAA 1E4WL 1KPUA 3O2DA 2FZ3A 1V3MA 4YHIA 5A1AA 3W9EA 4DVBB 5B8CB 3SDDD 3HE7B 4DOHE 2KZWA 3DJ9A 2ZOKB 5DRNB 4RMVA 1T03H 5HHNA 5BOZG 4ONOA 4YDLB 3KHOA 5GIRA 1DBJL 4QRPB 1A4KB 2UUDK 1YECH 2XXMB 4QHKI 3BW9B 3I6KA 3KLAA 4PS4L 3ULVL 4MS8C 3IXTA 1H5BB 2VLRE 4K7PH 4GQ9H 3KYOA 4PJGB 2CLZA 2GTWA 1F11A 4G8FB 4I77L 2BFVH 5K9OA 3R0NA 4FMKA 4LVOB 4E5XA 1FO0L 4IRJB 4HKXA 5HGDA 1EBAA 5ITBL 1S7TB 3R4DA 1MHCA 3LDBC 4UNUA 3ARFC 1NC2D 1RUAL 3HHRB 4OIBA 2HMID 3QO0A 4HWEL 2X5PA 2V6HA 5B39A 1A5FL 1YUHB 2BVOB 3CH1A 4LCYA 4TPRH 4WWKA 2GY7B 3SGEH 3CFEB 1DBBL 5ID1B 4E5XB 4X6DB 2VLKB 5B8CC 3WHE1 4U2YA 3RNQA 4HPOH 3JWDL 4Z7NE 2KH2B 1BECA 1LO0L 1CLOL 3GJFK 3ALXA 5GGRB 3C9NB 5IJVA 1PSKL 3WXVL 1TJGL 4PLNC 1MPAL 2YR3A 4M7JL 3IFLL 4I5BA 3DI2B 1OARH 1EFXB 4YXHL 3ECBB 4L4JA 1IVLA 4RGNE 3NACH 2XZAL 4YEEA 2ARJB 3K2UL 1VDGA 1H5BC 1JRHH 4M93B 5FV1L 5HI5C 3G9VA 5FYJE 4Z8FH 4I3GA 1Z9MA 1SJEA 1T04B 3F58L 3LS5H 5CP7B 5CUSH 1GHFH 2DDQH 1IGFH 3NIFE 4OZGF 4XPFH 2IPKA 1DUZB 2EDWA 3FO2B 1F4YH 1QEWB 2CLRB 3MV7A 4ODBD 2MMXA 3MGOA 4IRJD 5IQ7H 1KCVH 1V8HA 3QCTH 1W8OA 1DANT 2V9RA 3MR9B 1BM3H 3TT1H 4YX2L 1KFAH 1RZ8A 2XNAB 3DTXB 4HWZB 3WFZA 1I7RA 4OCRL 2JJSC 1EHXA 3BZ4A 3MLRH 5GGQL 1N4XL 5EBMB 4UMGA 4ENED 1XR9A 1JWUA 3C5ZC 3QJFA 5DVOA 1KCLA 2WUCH 1JWMA 4L4VB 4NN5B 5F89B 3BI9X 2DWEA 2WM0A 4M5ZL 4YDIL 1L6ZA 2JJVA 1M4KA 3WJLA 5J11B 2YPLA 5E8NA 4AEIL 1OW0C 3BZFB 1CD0A 5D9SA 1KPRA 1TQBB 3CLFL 1G7MA 3ESUF 4QXUL 2VSCA 4EI5B 2G9HA 4FA8A 3V79C 3LKPB 5IMKA 3WFEH 2XV6B 1KPVA 3DIFB 3IRPX 1OQOA 4PJAB 2QSTA 1I7UB 2XIDA 3TV3L 4NRXB 5F9OL 2Y7QB 4G6MH 5DK2A 2DKMA 4GKZB 3NOIA 3U0TB 3MJ9A 2NY1B 3DSFL 1QPXA 3THML 1CDUA 2HFFA 4LQ1A 1TZHA 1S9YA 1KPVB 3RA7L 3WNNA 4JFDA 4OZFB 4UNTA 4S1SH 4G8IB 2NY7L 6FABH 5IJKC 4IDJL 1TETL 3OL2A 1TVHB 4DVRH 4H25A 3PDGA 4U33A 3ULUC 2JELL 2MCPH 3T0DA 4BUGA 3SOBL 2CO6B 3AY4A 2DRUA 1T66C 1EAPA 5IB3B 4R4NC 2RB8A 2GJ6E 4Q9CA 4Z7QE 1GZPA 4OLYH 3VCLA 3Q0HA 4X8XA 2Y36H 4PJHF 4NDMA 1NLBH 3ROOB 4Q2ZA 1P7QA 3CDYA 4P3WA 5FO7A 3RVUC 5BS0A 4DGIH 2AK4A 4P5KA 3LQAH 1DEDA 4EEEA 4NN7B 1EMTH 1U8OB 4HGMA 4WHTA 1A0QL 5IT2L 1DQDL 1S7UA 1GRWA 3HLAA 5EUKB 3T0ED 2Q3ZA 1KENH 4JQXC 1MFCH 2P8PA 1IAIM 4HV8A 3BXNA 1A02N 4JFHE 4PJGE 2VLKE 2NY3C 3BP4A 4QRPD 5TQ0H 2ICEA 2VABA 3KPOB 5DA4A 4I2XE 4KZEH 3KLHD 4HJJH 1DL7H 4MGXA 5T33H 3WNLA 1JHTB 4Z77B 4IMKA 3FB5B 1BQHA 3BQUC 3ARGC 5I30L 4X7SL 1WIUA 4Y5XA 3D18A 4U6YA 2E7LC 3UPRB 1AFVH 5KS9B 3VFWA 4HH8A 1J11A 1VKXB 3C5ZB 4UU9A 4C56A 1VGEL 4UT7L 1HEZB 3I2CL 4DUXA 2GJJA 3VWJC 3RNQB 2VLJD 3BZDA 1ZTXH 3RIFF 1ZV5A 3LEVH 5GGUB 2UWEF 1Q94A 3W39B 4WHYH 4HXBH 4ZTOL 1MFDL 3G08B 1HKLL 3P40A 3QG6B 4GMTH 4BFIA 3GSNB 5DMGD 2A1WL 4V1DB 1FNGA 2VUYA 5IW3A 2QJDA 5FYLD 1PQZA 2ERJC 4NNPL 3UTOA 2BOCB 4NUGH 3MRKB 3AB0C 2JKXA 4HK0B 1U0QA 3GKZA 1YEJL 4Y4FD 4WEBL 1JNNL 3BPNB 3DETD 5D7IF 1T04A 2CK2A 2D2OA 2OJZH 1WTLA 1UH3A 3QT2A 3D3VE 2YD7A 4FQIH 1QLRB 3HG1D 2FH6A 2AI0H 1JGLH 2P5WB 1Z6JT 4ZS7L 5IB2B 3C60D 2EEAA 1D9KD 4PG9A 2JLLA 1WCQA 4FQJL 4LF3A 1RULL 3ZTNL 3S98A 1NBYA 3MROA 4D2NA 4QOKE 5J1AB 3ARXA 5E8OA 1F2QA 3RVUD 1XIWD 3U79A 5D6CA 1I8IA 4U3CA 5BQ7B 3SDCD 1XGUB 3RHWK 1CLYH 1TZGH 5LGHH 5I1GH 3RDTA 4HLZH 4YIQA 1CE1H 2DYPD 4XCCL 1D5XA 3EIFA 2R56H 4FTVD 1AGFB 3SJVB 5EPMA 5DUMH 2WBJA 5KSAC 3OKOB 1LP9B 3DX6B 1RK1A 1P4LA 5DVKA 2CIIB 4NNXB 4X0KA 1UWEH 2HT2D 4YBLC 4P9ML 5DJAA 1CD8A 2X4TA 1CFTA 5EZOH 3U46B 5FKPB 2EDQA 5LQBL 5EC2B 5D4QA 4AEIH 3MUY1 4OI9A 3O9WB 1YEDB 3DX6A 1FNEA 3EJYD 3X3FH 4ZO7A 4YDIH 1G7JB 5T1LD 3C5SA 3UJIH 1FORH 1BVKA 3WFHA 4GAYA 2YK1H 4JFEA 5GRYA 5C0FA 1PY4A 4HW6A 1DBML 2CPCA 2QKIA 4JFDB 4MLIA 3NZ8B 2NNAA 4QHNB 2ZUQC 5E2TL 5I16A 3R1GH 5D2LA 1I1RA 2V5YA 5KN5A 3GRWA 3VXNB 4WUUB 5CEZH 4OF5A 1CVRA 5DD3L 3QB7C 4PB0L 2X1QA 2WSKA 1G6RB 4MWFB 2EDDA 3V95A 5DK3A 1JTTA 1NDMA 1A7QL 3DVGA 3LOWA 4D94A 1MWAH 1N0XL 2H26A 2NW2A 2P8MB 4YZFE 5EZLB 3NFNA 4YGVA 1BVZA 4Y8DC 3DO7B 3ZSTA 2B0SH 1FVCB 5AUMA 5C0BE 4RFEA 3TCLB 4OCWH 1RUMH 3HI1A 4S2SA 5SX5K 3G08A 3MRRA 3QUZA 1BD2A 4H8WH 2HTLC 1JK8B 4Z7VA 4HMEA 5EOQH 3UZVB 4DGIL 5FYLE 3HB3D 3IFNH 5FHBH 3HNVL 2CR3A 2X2YA 1HZHL 3QEHB 3O9WD 1I7TB 2AGJH 4X7FC 5JDSA 3P4OA 4PJ8C 2JJUA 3C6SB 1T5XB 2C7UB 5GXBB 3ARDD 4MX7B 5E4IA 3BMVA 3CK0L 2CLVA 5F9DC 5BXFA 4NOBA 5DQJB 4YXLH 5BJTB 4X7DC 2EYSA 1IM3B 4HWEH 1GCFA 4ZSOA 1WVZA 4UT9H 1T1YA 4DGYH 3AMKA 4PG9B 4LRNH 4G43B 3LHPH 4MAUH 3OKEB 43CAA 3BP5A 1RK0B 1Z9OA 3IDJB 1BJ1J 5DT1L 2AJSL 1MCRA 4OCYH 2EE6A 1CE6A 4I4WB 1R3JA 3NA4A 1T03L 3HPJA 3P77A 3M8OL 4QOKB 3RZCC 2DD8L 3V6BR 5J1TC 4P5TB 4AMKL 3VXQB 1B9ZA 4AJ0A 1W0YT 4F2MA 4IRJA 1EPFA 3KXFA 3AM8C 1IL1A 1GIGH 1UJ3B 4J3VA 2YWZA 4LPXA 1PBYA 3RU8H 3S6CA 5D93C 1IM9B 4KVNL 3E8UL 5EH1A 3O0RL 4JVWA 5IHUH 4DFIA 4RFNB 4OQ1A 2QV2A 1DN0A 2JJWA 4ZAKA 3VFUB 4JQXA 1NBZB 3ZE1F 4OIAA 4UDUA 4KZEL 3C2AH 2QADD 5DDHB 1XMWA 1IGIL 3QDGE 1KIUA 3L3OB 3HZYB 3BKYL 2Q7YA 3MREB 3QQ3B 4JO4L 1R3HB 3FB7B 3VXME 3VGDA 3NCYP 4WV1B 3UTPE 5K9OB 3EOBA 4N0CD 5H2BB 2Y1VA 2J8UB 1P5VA 4NQDE 1TFHA 5C0GA 3TT1L 1MCWM 3GK8L 3VDAA 4U1NA 1U2CA 1UVQA 5CS7A 4LCUA 1J1OL 3AREC 2R2BA 15C8H 3TYFB 1NAML 4XPTL 1XF5A 4XHJC 3LAFA 3ZL4H 5B21A 3QNZB 1VACA 3ARYA 2B2XH 4KGLA 4FP8H 5FFLA 1UFUA 2WQRA 5GS0H 2LV4A 5FAAA 2C1PB 1HK6A 4XPGL 3V0VA 3BKJL 3TNMB 1NLDH 5C08A 5EOTA 1BOGA 2Q1EA 4PJEE 1RZJC 4UIMB 1YEJH 4HXAH 4DJMA 5HYQB 4G6JH 1J88A 2J1KA 3VH8A 4ZO9A 3T4AA 2UY7A 4V1DE 1Z0MA 3IETA 2C1PA 5DGQA 3KYNA 3MA9L 1RUQH 3S88L 1U8KB 3I3EA 3U6RB 4N0YL 5IBUG 3D87B 1NBVL 1Y6MR 4FQHB 3KPMB 1F4YL 3MRRB 4M5YL 1B0WA 3EJZC 4G8EB 1OPGH 4OUUB 4PJFB 4L8SA 4P4RB 3GRWH 2OL3A 4W4OA 1MIMH 4TRPL 3C5JA 3O3AA 3KYNB 5IG7B 3MNVB 5A3IC 2IALB 3K3QA 1R5WB 4P2RE 3O4LA 4X9GA 4OGYL 3CUPB 1T83C 2OL3B 3SGEI 4ZFZB 2X1WL 4R26L 3W5MA 1EEUA 1O7SA 1UA6L 4YLQT 1BQSA 2FX7L 2X4QB 4JPWL 2GIYA 4YHZL 3HI1B 1CU4L 1K2DA 4HWZA 3PV7A 1FFQA 2DQIH 3EYFA 3OR7B 4PV8A 5LGJB 2AJXH 1R5VA 3OKLB 3RI5F 1AJ7H 4YO0A 1FSKC 4JAMA 3PGFH 3HTLX 4LRIA 3LKNA 3EGSB 1MAKA 1S9XA 2GKIA 4K3EL 3TWCL 1AH1A 1ZANL 2OR8A 3JXAA 2AS5M 4C56D 3SDDC 4NZDA 4JKKA 3OB0K 4K3DH 3O8XD 4Q6IB 3VXMB 4ZXBD 4NQEA 3RTQD 1RSFA 5F7WC 4DAGL 4LGPB 3CDGB 2YD9A 1TPXB 2X4OA 5J7CC 8CGTA 1Z3GH 4HWBA 4R0LB 4HUVB 4LLMA 3F7VA 5F3BB 1EVUA 2N1KA 3ELAT 4DK3A 2BVEA 2CUMA 1MUJA 4QEGA 3TVMC 1I3UA 1NUFA 4WTZG 1EFXD 1ACYH 2V5SA 1A1NA 5BV7C 3BAEL 4Y16B 5DD5H 4R4BA 1R24A 4JY5L 4J3OC 2N4IA 2X89D 3VGAB 2GTZA 5ICYB 3STLA 3WFCL 4I1NB 4FQQB 1KB9J 1T0NA 1OP9A 5E9DA 4IOFD 1LD9A 4GLRI 4LLVA 2AK4B 2ED7A 4PP1D 2EC9U 4OBRA 4XP5H 3AY4C 3VI3E 1L6XA 1MSPA 1EH9A 2K1MA 4ZUVA 5E6IA 4YXLL 1X44A 2FD6L 3TEUA 5T3XL 1EV2E 3BWUC 3B3IB 5IVZB 1WCBA 1KN2L 5I76B 3BP7B 3QUYD 3CAFA 3KPRA 3QWOA 4LAJH 4LLVB 1ZGLM 5F8RC 4G9DB 5A2IH 5GGRY 5HHOA 1D5MB 1KJMA 2V7NB 4O2EA 2ZCHL 4FXKA 4ONHB 1QBMH 1QFPA 4PGEB 4YHOH 5EBLA 5IHUL 4NCC1 1Q38A 3VXUA 3TF7C 5GS3A 4NQVA 1M1SA 4HS6A 2J8UE 5C9JB 1MRFH 4A6YL 3ARWA 4QOKD 4OLXL 4CJ1A 5DI8A 2WNGA 4H8WL 4WO4B 5SWSD 1QSEE 1YJDC 1SJHB 2XFXB 3GMQB 3HE7D 1VFUA 3M17A 4MSWB 4XBGB 4KKBC 5E5RB 1CFBA 4NP4H 1NH6A 3WS6A 5C0BA 1WV7T 2YD4A 3CH1B 4LCYB 2WIIB 3U9PL 1IM9D 4RGOH 1BZ7B 1MY5A 1YN6B 3BJLA 1A6AA 3P4MA 1MEXL 4HCRH 4N8VG 3MOBH 1YQVH 5L2JB 1DQJB 2WV3A 3DROB 4Y16D 1JGDB 3VFMB 5HYJA 1ZTXL 3WN5C 2ZUYA 2YUXA 4LSVL 4HGKC 3MLXL 5ITBH 1TTGA 3CPLB 4ZG1A 1MFBH 3BE1L 2DM2A 1BBJB 2GFBA 3SDCB 3C5ZA 1RZKH 3VWJA 5IM7A 4XH2B 4LHUB 3LQZB 3FN0H 2DYPB 1JRHL 2PETA 2EYRB 4NT6B 4LARH 4M7LL 1LK2A 2ZG2A 3SJVD 4TNVK 5KVGL 2I9TA 3O4OC 5JORA 1IGTB 3F6IA 2BSTA 4NPYB 1WSST 2YZ8A 4AENB 1BVLB 5E2UH 2IH3B 4XNYL 4GG6A 1F8TL 4NO2B 5FYLH 4R2GC 3IAPA 4QF1A 4Y4HB 2RHEA 1FN4A 1RZFH 3LPFA 4OCSL 5K33A 5B3JE 2H32H 2YRPA 5FECB 2R0KL 5JW4R 1YEFL 3NZHH 4JPIB 5IW6B 2ZJSL 5D7SL 2M8XA 2G75A 5E2JA 5FV2A 2J2ZA 4LNVA 3QUYC 1MCPL 1MHPH 3KYKH 4KQ3H 1RUQL 2BC4A 2A6JB 2FRGP 3P9WB 2J5LB 3DMMA 1S3KH 4J4PD 3ES6A 4XMPL 3HNSH 3NCYS 1WBYA 3MQIA 4RQQB 5TE4H 3B8YA 4OKDA 4U1GB 2MCG1 1U8QA 3MBEB 1MCDA 2QLVB 4LU5L 3TIEB 2H8PA 4I0PA 3F5WA 3U0WH 4JRXE 5CSBA 1ZHBB 3VG9C 4KKBD 3E3QE 1N5YL 4G7VH 3Q1SL 3ZKND 1LD9B 4Y89A 4RA0C 3H3PL 2IBZX 3MPCA 4LDEB 3RAJL 4HUWB 2QSCL 5DJ8A 4PJAA 4WO4C 4KK8C 4LPYA 4JHZA 3WO3B 4I9WD 4MJ2A 2AK1L 2X41A 3C08H 4QKXB 4QWWC 1CFTB 1MUJB 1G1CA 2GW5A 3G9AB 1NCWH 2QQQA 3GO1H 3PDOB 4J23A 5GZNC 3I85A 4H1LG 3UJJL 1A9BA 3O6ML 4L4VD 4NWTL 4X98A 3UROR 2CKBA 2E3VA 2A6KA 2W0FB 3WUZA 2W60A 3LD8B 3C08L 4X4YA 1E4KA 4JKWA 4OLVL 1TETH 1IQDA 1E28A 3LB6C 5KG9A 35C8H 5DHYA 3HRPA 3S35X 1QBAA 1YEGH 3TLRA 4QHMA 1NGQL 1NMBL 1FNFA 4EI5D 3LKOB 1YPZB 5D1QB 5IB1A 5EIVA 5ICXA 1WCBB 4F7MB 4L3AA 3VA6A 1MCOL 1NGWA 1NC4D 4JY5H 2KPNA 4HKBB 5T5FH 5DD5L 3ULUF 4U6HA 1RVFL 1YUHA 2BVOA 4Y1AE 3TN0B 4YXKL 1VENA 5T1DL 4G42A 4FQCL 4ODTL 4DKFL 3QUKB 4OKVB 4P2OC 5FHBL 1MELA 1XGPB 3ULSA 2VH5L 5EN2A 1JPFA 1DTUA 3BKMH 4FTVB 1U8LB 1INQB 1SEBA 4DAGH 2X4PA 1B4JL 2FWOB 4YHOL 3GFUA 4JCLA 4AIOA 4P46D 2XG4A 3MRJB 3QUYB 4LSDA 4U1LA 3ZO0A 4APQA 3MODH 5ANMB 3L3IA 3JWOH 3SKMA 4FQ1L 5I71B 3MRGB 5KSAA 3DGGA 1QHOA 3FQXA 3O45A 4JJ5B 4NKDB 4R3SA 1ZAGA 4PJBF 2V2TB 2FJFA 4P9HC 1MOEA 4GXVH 1U8LA 4JFYB 4PLJD 2MWCA 1FRGH 4ELME 5MP6L 1FNSL 2A9ML 3LHPL 3W39A 1BLNA 4BFIB 3EYQC 4O2FB 2D03H 3DVIA 2Q8BH 1JZ8A 2C3HA 3MV8B 2EO9A 3KPQA 3DVFA 1YYML 3FO1B 1WFTA 4L8DB 5JW4Q 2BY1A 1JV5B 3PL6D 1JVKA 3U9PH 1D6VL 4QGYA 4PJDA 5HYIA 2VXUL 2BVPB 3UTTA 4H5SB 4H0IA 5TDPA 4RRPA 4NM8H 3X14A 5HSFA 3ZYZA 5LBSH 5C09D 3A6BH 4XWGH 5CILL 1JFQH 4JM4L 3QXVA 5D7LD 3WEXA 3QUMB 2VE6A 5HVGB 3V0WL 1CR9H 1OAYL 1P9MC 5F7UA 4WV1A 2ZOLA 2QL1A 3DXAD 1HQ4B 4GRLB 1FAKT 4AM0A 4KU1A 1J5OH 5CZVL 1BJ1H 5D93B 3I9GH 3O2DH 4XNMA 4F8TA 4HUWA 3QFJA 4M7LH 4JG0H 2FSEA 3UAJD 1JI1A 4LSPL 4JFOA 1ROWA 4HQQH 4Y4HD 5L8JB 3PUCA 3LKPA 1A21A 1A7OL 4K8RC 5F6IC 5L7XH 3V5HB 5IB3A 3VDBA 1AGDB 1DP0A 4NJAL 3PJSA 4L1DA 2ZUTA 1ZVSA 4I18B 4L8BB 3WKMH 5B38A 4WW2B 5FYKH 1E4WH 3CVIL 3F5WB 3QQ3A 3TA3B 5HDQL 4CVUA 1HI6A 4X0KB 1DFBL 4LVOC 1G7PB 2BRRL 5J3HD 4WEMB 3ARTA 3U4AA 4X6BB 4L4VE 5FKPA 5CHNB 5AZ2H 2AJXL 2BDNH 4BZYA 2DJSA 5CEXB 3CFJB 1LO4L 5TGBB 4XPFL 2C3XA 4WW2C 1JYVA 1ZK9A 3S3SA 3MCKA 1CGTA 5F3HA 4OD3H 5GS2H 5JXAH 5J6GB 4Z7WA 4AEFA 1CDJA 1R5IB 1ZHLB 1P4BL 1YMHA 1J1XL 3MZTA 3VRJB 1A1MA 4XRCB 3CUPA 5C0IA 3ALPA 1D5IH 4JPKL 1GIGL 3ETBF 5INCA 4UB0H 3OAZK 1ERNA 4NKMA 1IC1A 4P2QD 3M07A 2BP3A 2HN7A 4M5ZH 4GUPA 3IDYC 3X12A 3S7GA 3IJSA 5IB5A 3QWRD 1WBZB 4GJTB 4GRWH 3RY5A 3I50L 3UCRA 2P42B 3SGKC 1V5JA 4OB5L 4L8SB 5HHOD 3Q3GA 2V2XA 3L5WB 3UAJC 3LSOB 3C6LD 1H0DB 2PR4H 4B50A 4HZLB 1CBVL 4IHOB 4LPCA 3QCVH 2DQFB 3U0WL 4KMLB 3NAAL 1IC4H 4PUBH 3EYUH 1KULA 1Y18A 1RURH 5DD6A 5EULV 4OCMC 4PRNA 5BS0D 3RGVD 4EXPX 3EDJA 2AK4D 1CGSL 1XGPA 3ULSB 1JGEB 1A6TB 2E9JA 2YXMA 5FA4B 1FO0H 4WI6A 4LASL 3RX8A 2AJVL 2F54E 4HGWB 4J1UA 1LO2H 1Y6KR 3I02B 3EYUL 4L4TD 3P30L 2YD8A 4XGZA 1NC4B 3FQRB 1MQKH 3ROLA 1C7TA 1AXSB 3DX7A 3BRFA 1A8JH 1FFRA 3T4YA 3AS0A 3EYVB 4JJ5A 4NKDA 1YY8A 3MNWA 2F15A 3SE9H 1I9JH 1PX3A 2VLKD 1KPUB 2DKSA 4R0LC 1AHWB 4O2FA 1I1AB 1FNLA 4LVNC 1WEJH 2QR0A 4P2QB 5F9AC 4GG6E 2B0SL 3HC3H 4KHXL 2FBJL 2UZIL 4ACPA 3UTQA 1JRHI 2HRPL 1HSAA 1LEGB 3MLXH 5B39B 2E6JA 2XN9A 1CE6B 5MERA 1BFTA 3ALWA 3IKKA 4MZ2A 5E7BA 3L7FB 3RWCA 1CICA 3FCTB 4Y5VC 2HLFC 2PUQT 3D48R 3DO3A 1OWRM 4I3RH 1C5DB 3QEQB 4YXKH 2NY3D 2RJMA 4B53A 3LRSB 3RIFK 3ULVF 1LDSA 5FYKE 2PCPB 3FFDB 1SJHA 2XZAH 4YIQB 3T1FA 3O81A 1S7VB 4DEPB 5DEFA 1BOYA 3RPIB 4QXTA 5DD0L 1YECL 2XPGB 1CXLA 1Q9OB 1KJ2B 3Q6GH 4OLXH 3P4NA 3L95A 2XA8L 5E5MA 4KJWD 1IRAY 3FB6B 4JG1L 1XF1A 5GGVY 3D3VD 1UM5H 5D2LB 1ZLWH 4XP6L 5BVJB 4D0DB 3SKUD 2EIZB 4QHUA 4N9GA 5DFTA 4PJCE 2FEEL 2DTSA 1WZMA 3B83A 4L8SC 3GI8H 5IVXA 4X99A 3GMRB 2E8YA 1ZLSH 4CVXB 4K3DL 4F7CA 2DYPA 3NIDF 4UINL 1I85A 1DN2A 1WAAF 1G7JA 2DLHA 3NFNB 1Q8MA 5B4MC 4PV9A 1GGIL 3SDDB 4MS8D 5FYJH 2D3VA 4MA3B 4N68A 4QRTB 3FO0H 3H7BA 4LP4A 3U2SB 1G7QB 1WAAE 2IPTH 1T66D 4BH8A 1Z5LB 3ZDZF 3CFJA 4Z5RA 3ZDXE 4PJ9D 2EKJA 3V4PH 3IB4A 4WUUA 1YDPA 1ZOXA 3VH8B 3FT4B 4G7VL 3LSOA 3A6BL 5H8DA 4MDJA 1JWMB 3BJ91 4L4VA 2IQAB 4WU5A 4EDXB 4P5KB 2KBGA 2EH8H 1Q1JH 5I1JL 4HX1A 4BZ2H 1KJ3H 5CD3B 5GRUL 2ID5A 1YMHB 3WJLC 4YJZL 2OI9C 4ODWB 3SO5A 5AG8A 3VRLF 3WIFA 4F57L 2OCFD 5FK9A 2OTPA 5C0NC 3SGDH 4GS7C 1M71B 3OJDB 2J8OA 5DMKA 4O4YH 1QOKA 5GJSH 1I3VA 2ADGA 3HC0A 1EGJL 5EZOL 1DLFL 4QO1A 4P49A 1OD7A 2GSGB 4AIXA 1IAOA 4LSPH 3AB0B 2EXYC 2H2SC 5IBTL 1XF4B 3F65A 5JXAL 1JHLH 5FGCB 3VGEA 4X6EA 1MIEL 2X09A 1TVDA 1T1ZA 3SPVA 3ZT5A 4Y5VB 1ZA3A 2XXCB 1AJ7L 2BX5A 2D31A 4NRZB 4P2QE 4PY7B 3TP4A 1WZLA 3IKCB 5DQ9B 3EDKA 5FDWB 2QR0B 4RGND 1CD1A 2A6JA 3Q1SH 4HCRL 4U05A 1E27B 1JHKH 2UYLA 2BOCA 4WWKD 1YN7A 2CR6A 3MV7E 4Z7OF 1AD0A 1KN4H 2JCCA 1UXSA 1JMZA 4I0CC 3WMSA 3P9MA 3OHXA 2CDGB 4XC1L 1GC1H 2AEQL 4G5ZH 2Q6WA 3EBAA 4Z95H 4XXCA 2WBJC 5F1SA 2B1HL 4MB4A 5EO1B 2AXJA 2E9IA 2DI9A 4Z78A 1GGCL 4OV5A 1WIOA 1RUML 1I9IH 3V52H 4FOMA 3B9KD 2XPGA 1KCSH 4NGHH 4NZUL 3VXQA 2A9NH 3BO8A 3IYLW 2IGFH 4LCUB 3RJDA 1UJ3A 3B4NA 3G6AB 1MVFA 3LN4B 4XCNA 3LN9A 2AABL 2RCSL 4V1DD 5L2KD 3KYOB 4P48A 2BSRB 1WBXB 3ARFA 3KPNA 1VSCA 2H9GB 1MCJA 1MFNA 3WNKA 2IC2A 1CLZH 3EDDA 5I74B 4UILH 2P1YA 1HWHB 4Y0GA 5AAMA 1C5DA 1KBGH 4KMQA 2APWA 4Y2DD 1QSFD 2APBA 1N64L 2CRZA 2AABH 2RCSH 4WFGE 3RWGA 5T1DH 1X6LA 3FQUA 5TF1L 1YQ2A 3RWDA 2KQNA 5JMRA 4OFIA 3NGBC 5EBLB 3OKKB 4TVPE 2VERN 5JA9A 5ANMA 4L8CB 3JV4A 1OP5K 3MRGA 5KSAB 1QFWI 4WWID 4ZUWB 1MAJA 4KVCH 1KCUH 1W72H 1CXKA 1BIIB 6CGTA 4MNGA 3MYZA 3MYJA 4S1QH 2R69L 2YPLD 4S10A 4I9WE 3V5DA 1G9MH 3GB7A 3ULUL 4CMMA 5JPMB 1T2XA 4ONFH 4M61B 4W70A 4XHQA 1A14H 1VGKA 4FQJH 1J7VR 2FATH 2E9WA 3RWFB 4U49A 4WENB 1ODAA 4PJ7B 4MCYB 1DL7L 1ED3A 1SEBB 1JGDA 12E8H 1KCRH 1L7TH 1FNAA 4R90L 1K4CB 2AXGB 3KYMA 4DN3H 1WICA 4A6YH 4QYOB 3U30C 1RZGA 4DN4H 2GUOA 5CBAA 1XH3B 4KRPD 1QR4A 1ES0B 4AG4H 4AMKH 4UIKL 4YR6A 3QIBA 4P2OA 5EU7C 1QFWH 1DUZA 3DUUB 4O02H 2WLZA 3E0GA 5T1MB 2VLJE 5I66A 4HBCL 3D9AL 5IK3A 3QBTB 5HVHB 1AQKH 3MRPB 1GGBL 3QUZB 4MNHA 3FONB 4ZPTA 2ZPKH 2RFXB 1RAMA 3EZ8A 3MRMA 1NPUA 1RZKL 2O61A 2CDFB 4A2LA 4PJ9B 4F57H 1NFIB 2J4WL 4CW1B 3P9MB 4WFFE 2DQEH 5D1QC 5DRWA 1DBMH 5I1DB 5I73C 2P5EE 3EYOA 4JFHD 2HH0H 3STLB 1PJ9A 5GGTA 1LEIA 4Q9QH 4UDTA 1OLLA 4XP4H 1UZ6E 4XPBL 1T0NB 4DZBB 3W11D 3JUZA 4ZUTA 2DQTH 3H7LA 4OCSH 4JO3L 5C2BL 4I0PB 2GJ6D 3FO0L 1J0HA 3LEYH 3QH3A 3QJFB 5KN5B 4P46B 4NJ9H 3QUXC 3TT3L 2YWYA 4WGVB 3OKDA 4AH2B 2I60L 4JJHA 2E27L 3DGCR 4I18A 4KRPC 4X6DE 2JB5H 3WS3B 3IXAA 4FS0A 2VDKL 5CZKA 1RJZA 4Y4FB 4QRSA 3SDAB 1G9NC 3ARBC 5JIPA 1CVSC 1QRNE 5HJ3B 2R29H 4H26A 2HFEB 4RGNB 4X9IA 1T2JA 3GNMH 3MV8D 5IHZA 3B8SA 2QQNH 5GISL 4LSRL 4GQ9L 1CF8L 1HHKA 4N5ED 5TGBA 1BIHA 2YD6A 5E70A 4BSVB 1EFXA 3D39A 4JFPB 1DQJA 4JHBA 4JPKH 3WSQL 4MVBD 3TBWA 5DJYB 3H9SE 3S35L 4OF0A 4EN3A 3CZJA 4LIQH 1IBGH 1R5IA 4PRHA 4QXGH 2J8UA 2W65A 1MRCH 1K8DA 1BBJA 2PYEE 4MXQC 5EORH 3L9RB 3MCLH 4JFFA 1VGKB 4LSSL 5E1AA 5F97E 3MXWH 4Y5XC 3DXAB 4YPJA 4LGSB 1LNUA 1A3QA 3GK8H 1SBSH 3QQ9D 4CNIA 2P24A 4K7FA 4PJEA 4PJ5E 1HHIB 3CLEH 3RAJH 3L6FB 1A3RL 2FGWL 2NY4B 2IGFL 5IEKA 4FFVD 3BKCH 2RIKA 3T0VA 4KTEH 1FJ1B 3VI4F 4LHJB 4TNWF 1I7ZB 4I3RL 3LY6A 5I0DA 1JZ4A 1J86A 4IRJC 2CKBH 3MLTA 2APVA 1L9MA 5K9KA 2DQIL 4Q74A 5BZWA 4KK9D 1G7IA 4OCNC 4QOKA 4LOUD 1J0YA 5KTEH 1I8MB 5DHXB 2MKLC 1TENA 4POZD 3DWTA 3K8LA 5BJTA 1J87A 5TF1H 1PSKH 3ET9F 4ZSOB 1AKJA 4GMSL 3GSQB 4OUOA 2F8OA 5BZWB 1ZHKB 5FDYA 4KROC 3G6JF 1LE9B 4DWHA 3VW3H 1ZT7A 1NFIA 1ES0A 1A6ZA 4N90E 3AREB 1KYOJ 3DV4B 4R7NA 2QHLA 2I9LA 2Q76B 1A3LL 3HZYA 1YEHH 1CL7H 5DJCA 4C83A 4RBPH 3EO9L 3FB7A 1Q94B 4M8QB 5D96B 5TFSH 1IC7H 3JVGC 1LDPL 4H88L 1S7VA 5HYSG 2GJZA 1N5AB 1TPXC 4RMUA 3OGCB 1J12A 1IAMA 2VH5H 1W0VA 2AXFB 4KWUA 2ICWB 1EFQA 5C0RH 3CVHH 1MCBA 1M05A 2GEEA 3G04A 5C0JA 3UTSA 3LKNB 1MREL 4JM4H 3LKSA 5DD1L 3PWLA 4NQUA 5FIEA 3IDYB 3MUGA 3PWNB 2JK5A 1DBAH 1JPSL 3BUTA 4WCYL 5T3ZH 5HHME 1HIMH 3Q6FB 1A6PA 3F6LA 3QYCA 3QEUA 5GSVB 1H8SA 2Y7QA 4FZ8L 5DK2B 4K9EH 1FRGL 3TBSA 2R4RL 4R4FH 2X9XA 3ZHKA 4EI6A 1BWMA 5F3BA 1UH4A 2FIRT 3CFCH 5JO5A 3QUZD 1YEEL 3ARDB 2D03L 2Q8BL 4Y19A 3OBAA 5CJ5A 3PIQA 1GGBH 1BFVL 5E99H 3PJSB 4DCQA 5B38B 4R90H 4E0RA 3NCCB 4RDQF 5IF0A 1H3VA 2BNQA 4J4PA 4LKXA 3FT2A 5EFIA 4I2XB 1IGIH 2DQUL 1DE4B 5C09B 3O2DL 3AXLA 4GS7B 4HLJA 4XNUH 3MTRA 2ZWLT 4WU5B 5L8KB 4I3SL 1U6AL 5E4EB 1BHGA 4UTBH 1JN6B 3BP6B 3VFTB 1B6DA 5DLMH 4ODWA 4JO1H 2FBOJ 5J13B 1T7VA 2VDPL 4UU9B 4C56B 2QADC 4KXZH 4RCAA 4CN6A 3WV0A 2GSIA 1AGCA 1QFHA 1WZ1L 1Q1JL 4DVRL 4MA3A 3U2SA 4YNYB 3ARVA 3NIFF 3MRIA 2ZNXA 4FXGB 1G7QA 4U2ZA 1J1XH 2IFFL 2FL5B 4DZ8B 1Q72H 5GRUH 1HHKB 1UWXK 1YNLL 4XAKD 4M1CC 4Y5YA 1XF4A 4YGVB 4G6AD 4DW2L 2YRZA 5FO9A 5I19H 4RISL 2CRMA 1UYWH 4M03A 3BZEB 3PV6B 3HE6A 4LIQE 5L88H 4MVBC 2QADB 2ZSWB 4XMPH 4F9LA 2NY3B 5JOFB 1SQ2N 4OM1L 3V4UH 3NFSL 3VGHA 4YK4C 1U3ZA 5GSRA 1UWXH 4YDKL 1GSMA 2D9CA 3OJDA 3RGVC 1JNLL 1QQDA 4HFUH 2J7LA 3V4VL 2BMKB 4KDWA 5HYEA 4M48L 2HT3D 4LCWE 2BSSA 3VXRB 1N3NA 4TSAL 1Q9KA 4KK8D 4YO0B 4M7KL 4D9RE 4ONGL 5CP7A 5ENWA 1VFBB 1OAXL 4AIZB 3LQZA 2I9LB 2B4CC 1C5CH 2Q76A 4U31A 1F2XK 1QA9A 2CIKA 1N7MH 4ODVH 4OFYD 4KY1H 3P30H 4NO5A 3RY4A 5D5ME 1K5NA 2VTFA 3M45A 2D31B 4NRZA 3VDCA 4AENA 4LCIL 4MAUL 4WFHD 4BH7B 2OSLB 4DUWA 3UTZA 4EI5C 1BAFL 2D7PA 2ZCLL 1NGZB 4O2CB 4X5LA 2NZ9D 1EZVY 4XPAL 2Z91B 5ITFB 3IT8D 4MNQE 3DOSA 4EBQH 2NY2C 4YDVA 1MAMH 1MCQA 1DUYA 4LMQI 2DBLL 2OK0L 4O2EB 5KSAD 2CO7B 2HG5A 3NGBB 3HAEH 2COQA 3PWUB 3X14B 3OPZH 3F58H 1A4KA 3LS5L 4LCIH 4RFOL 3BD3A 4FQCH 4DKFH 4FFZH 4OGAD 4LKCA 3GBNH 3U1SL 1YNKL 1MRDL 2YPLB 4MAYC 3LZFL 3O0RH 3ZE1E 5LKNA 1VEOA 3S36X 3RGVB 5DO2D 3T77A 1GL4B 5ISZB 3PNWA 4RA3A 4PRIB 5I0ZA