4TVPD

Crystal structure of the hiv-1 bg505 sosip.664 env trimer ectodomain, comprising atomic-level definition of pre-fusion gp120 and gp41, in complex with human antibodies pgt122 and 35o22
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
242
structure length
242
Chain Sequence
QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Structure and immune recognition of trimeric pre-fusion HIV-1 Env.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 37
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2014-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4tvpD01
4PP2B 5EU7E 1I1YB 3VMNA 2IFFH 2VITA 3CJJA 3QBTB 5IROA 4GAGL 4YHMH 5FA4B 3F62A 3VFRB 1HXMB 4FN0A 3SN6N 4F58H 3ARQA 2Q8AH 4JQXA 1TLKA 4B50A 1EAPB 1QHPA 4Y89A 1B4RA 1T89A 4JQIL 1NUGA 12E8L 2DJ4A 3KLSA 4ISVB 4GG8A 4V2BA 4LF3B 4PG2C 4XPTH 4DKDC 2HKFH 1AY1H 1OW0C 1BWMA 1IGML 4MDIA 4UAOB 4NCC1 3TO4B 5C0FA 2OP4L 4GG6B 1GPOL 3WIHA 2YD8A 2WZPD 2IANA 3PWPB 3IDNB 1GAFL 3A6OA 3UBXA 3VXSE 3WFBH 3X3FL 4JZNB 4O2EA 5CP3A 1T4KA 1NEZB 5T5NF 1A3RL 2OTWB 4P23B 1KJ3L 1NC2B 3IVKA 2JIXD 5ENWA 4OB5L 1DE4A 5F44A 1RU9H 4LASL 1UKTA 4JFEB 4G9FA 1NLDH 2BY0A 4JJHA 1HOCA 4AY0A 1UXWA 1JGUL 1F97A 2QHLA 2IPKB 1BQHG 3U7AA 3ULVL 2R0KH 4DGYL 4QTIH 5HHPA 4NQVA 1RZJH 2C3XA 5KSVB 2J8UF 1ZHKB 3FB8A 4XX1E 5D1ZD 3K74B 3BZFA 3F7YA 2LQRA 5KAQF 1DUZA 5JPMA 1XGYL 3LEVL 3DX7B 3T2OA 4LQFL 5IP4A 2FL5B 4MXWH 3R8BB 5FV1L 3QUYA 3QXDA 4OI7A 3VE0B 3MXVL 1J05A 2AEQH 3IFLH 4I13B 3HR5B 5E6IA 3TNNA 1S9WA 1H8OA 2AEWA 1T6VN 2OJZH 1WFTA 3RY6A 4KY1L 3OAZK 1D5BB 5DJ0A 3MODH 4I1NB 3RI5K 1FVDA 5FYJU 3TC9A 3V0WL 4F8QA 1TCRB 1AKJB 3H9HA 3PWJB 3L3HB 1T5WA 1A2YA 4CVWA 4FTVD 3GSUB 3K2UL 5BZDA 2FZ3A 1RZKH 4MQTB 4NC2B 1TTFA 3ZKSD 1PLGH 4FXKA 5IK3A 4OIAA 4XX1G 2VITB 2BCKB 4Z8FL 2LVEA 3GSXB 1P7QD 4Y4KC 3RP1A 1L4IA 4JFFE 5F7EL 3NA4A 2QKIA 1SYVA 1OF2A 5DMJB 3I2CL 4EOWH 3N85H 4M6NL 1NGXB 4H0IA 4RWYH 3RHWF 3GMQB 3JWDL 2VSCA 4NRYB 1J0KA 4RIRA 5C0RH 4PJXE 1A02N 5T3ZL 1KJVA 1TJIH 5IWLA 5JDJA 4D94A 5IB4B 5C0FB 3GSOA 2FHCA 3DUUA 4FQ1H 3O3BA 2ED8A 3K3QA 4JKPL 1DBKL 1A7BA 1NFDE 3T09A 2VDQL 1U8MA 5CILL 1RPQA 3S35X 4O9HH 3LKQA 4O2EB 1T4KB 2J1KA 1RSFA 5IHBA 4LFHG 1G7IA 2R69H 3D0VA 1U58A 1LHZA 3CC5A 1DN0A 4HPOH 4I77H 2PYEE 4G5ZH 4PG9A 3IVKB 4XRCB 3B8YA 5ENWB 3GJFA 3ULUD 1WTLA 4QYOA 1OAZL 2YWYA 4EI5A 4LVNC 3O9WA 5DFTA 4TQEH 1NMAL 4E41D 5E1AA 2HVJA 4NSKB 1XF3B 3H7BA 5I66A 1UM6L 4R4FL 1A7RH 2ESVA 3JTTB 1BJ1H 4XCEA 4JB9L 3QNYA 1H3PL 2NQCA 3KPLA 5JOFA 2Y6SC 4OCNC 1CD8A 1FC2D 3WJLC 1LE5A 3K8KA 3BZFB 3OB8A 3BDXA 3F7YB 5FO9B 1U8OA 1DUZB 2JTDA 3UZQA 4ZD3H 1N5YL 4C56D 3D2UA 3IFPA 2P42B 4N9GA 2D3VA 3ROOA 3WFHB 4XVSL 3GSQB 3KXFD 5I8KH 4WW2C 4L8DA 3MRKB 2NY6D 3SQBA 3QA3A 1TTGA 5E6IB 1S9WB 1BD2B 3VXQB 3AU1B 3S96B 1QFUL 2VLRA 3HA0A 1FL6A 4APQA 2FBJL 3BPCB 4KQ4H 4NZDA 3G6DH 1FVDB 3GNMH 4FZ8H 4NN6B 3GK8H 1NMCB 3ARGC 4TVPH 2P24A 1T5WB 1A2YB 1GC1H 2QADC 5BVPL 4HWEH 2Y23A 1QRNA 3VD9A 5BZDB 4JM2C 3V95A 3RDTD 1NL0H 1WF5A 1H5BA 5E94A 1N7MH 4U1KA 4KAQH 3WIHL 2NZ9D 1VFAA 4WI6A 3OAYK 4ONGH 2HT3D 1TXKA 5F9OH 2H9GA 1DFBL 3TNMA 1OF2B 4LU5H 1T1ZA 4X98A 2CXGA 3O4LB 4ZSOE 3VD3A 1IC1A 1QUNA 5A16B 5C0ND 2LU7A 2X70B 2E6QA 3FL7A 1OB1A 2YEZA 3VCLB 5DEGA 1A7OH 5E6YA 5FF6A 1XCTA 2W65B 1EVTC 3CZJA 5KVDL 4HIXL 1G6RH 1AGFB 5GJTL 4O4YL 1MCHA 4V1DE 1E4WL 1QR4A 3DUUB 1ES0A 2NY7H 4W81A 4F2MA 4N1CA 2DICA 3TWCL 4JKLA 1A4KB 3DVGA 1T2JA 5IEKB 3FT4A 4GAGH 2FCBA 4WTXA 2O93L 3LKQB 4CAGA 3QEQD 1DR9A 1G7IB 1WEJL 5JMRA 4LSQL 1U58B 3CC5B 1DN0B 2HJFA 4LIQL 1I4FA 2BP3A 3QDJE 1NFKA 4JQIH 3GJFB 2AJZA 1HIML 5DRXA 12E8H 5DJ2A 3SO3C 4PGCA 2FD6L 2HA1A 3P9MA 3NFPB 3HTLX 2F8VA 5KVEL 5CJBA 2F58H 2HVJB 5ESVB 3SDXA 5EIIA 1IL1B 1IGMH 3IFNL 3H7BB 1IAIL 4HT1L 1KEML 3KPSB 1WZMA 1V3JA 1KGCE 1DBBL 4JO1L 1GPOH 3KPLB 5JOFB 1LO5A 4Z7OE 1K85A 4PG2A 3KPOA 1SJEA 1GAFH 3MYZA 2ZUYA 4KRNA 4P2OD 4POUB 3WNOA 1VPOL 1JRHL 1OW0A 1UC6A 2YUZA 4HX1A 2VWEC 4WHCA 3ZE1E 5E8NA 2ICWA 3X3FH 3CCHB 4P5MA 4XCNA 3B9KB 4H1LG 4YHIB 2XN9D 4TSBL 1A3RH 4PJEF 3ROOB 1KJ3H 4CU7A 1U8KB 4NN7B 5LCVL 4OB5H 4GKOA 5EDXA 4LASH 4U6YA 1J0JA 2MNUA 3D69A 2VLRB 1ONQA 4APQB 2BNQB 3TH4T 3K7UA 1E6JH 5D1ZC 1JYVA 1JGUH 1LD9A 4PRID 3ULVH 2Q87A 4J3SA 4DGYH 4J1UA 2EYRB 3OJMB 2E9JA 2DQTL 1E0OB 3N1GC 2R15A 1MPAL 1LMKA 4ONFL 4OZGF 2ZUTA 5E24E 1H5BB 3L7FB 1QKZL 2EDEA 3QO1B 1RMFL 1XGYH 5C0EA 3LEVH 4MWFA 4LQFH 3GRWL 1T2QL 4X6EB 5BO1L 2H9GB 5IMOA 1NCUA 3MXVH 4HEPG 4Y5XB 2P43B 1F3JA 1N8ZB 4K3JL 1OB1B 1IKNC 5DEGB 2XKSA 4KY1H 5FF6B 4K8RD 4MXVF 4WY7L 1WFUA 3NPSB 3V0WH 2QV2A 4LCCC 4DCQA 4P3WA 2Q7NA 3LRHA 1X5AA 1JL8A 2DD8L 2D0HA 1BFSA 5MHSE 3U46A 1ES0B 1MFDL 3K2UH 4PGBA 4OJFH 3T1FA 1QRKA 3GIVB 3DVGB 5TE7L 4Z8FH 1TTUA 2B4CC 4KHXH 1OP5H 3L3DB 2AJYL 3B9EA 2W0FA 1YN7A 1Z5LA 1X5IA 1Q0XL 2VAAA 3HC4L 5F7EH 1FYTD 1U93A 2HJFB 3MRQA 4BFIA 1UJ3C 3I2CH 2AJZB 5DRXB 2FSEB 4M6NH 1S7UB 4PGCB 4Y4KA 3CDGA 2R0WL 3JWDH 1QSEE 3RGVD 4WUUA 3CUPA 4MSWA 2KQMA 2QQLL 4PJ9A 5T3ZH 3SDXB 2J8HA 1KC5H 2OXGA 5IR1A 1NQBA 3MRRA 3L9RA 3WBDA 5L2KD 5E8OB 4GQPH 1G7JA 1A0QL 3WHXA 4TYUA 1SJEB 3KPOB 1KG0A 4JKPH 3UTTE 1DBKH 4A2LA 3LY6A 3ULUC 3OB0K 4HX1B 5E8NB 2ICWB 1QSFA 4A2MA 4P5MB 1A9EA 2W0LA 4NKOB 1Y6KR 3GJEA 5DTFB 1MCOL 4Y2DD 4JGUA 1VB9A 1S7QA 3PV6A 1OAZH 3D69B 4Y19A 3N1PC 1ONQB 3L5HA 3MNVB 1U2HA 4WWKD 3PG2A 5B8CC 4MA1B 4WGWB 3TJEL 1NMAH 3D25A 4PRHA 3DYOA 5IFJB 4H5SB 2BMKA 3QIWC 4ZUSA 1Y6NR 1UM6H 4J1UB 4R4FH 4EI6B 3HE7D 2V5SA 4JB9H 4OI9A 1H3PH 5JMOC 3NTCL 1HHHA 3EAKA 2OQJA 3F7PC 5C0BB 1KB9K 4QTHA 4G8GE 4UT6L 2CK2A 5C0EB 4MNGE 2LU3A 1N5YH 1IAOA 4MWFB 4NPYA 4L4TA 4IRJD 5DJYA 5IMOB 3L3IA 1X9QA 1EBAA 2OI9C 4XVSH 4M9PA 4UDUB 4OV6F 1F3JB 4P99A 3WJLA 2XPGB 4MVBD 4M8QA 1R3JA 2BVUA 2QEJA 3CDYA 3FO9A 1QFUH 4F37F 1MIML 3RQ3A 4HKZB 5LJYH 4JHAL 2FBJH 3LH2L 3BSZL 1MJJA 3ECBB 1DEEB 2ICEB 4GLRI 5B39A 3NCJL 3KJ6L 3I6KA 4N8VA 1ULVA 2NZ9C 4WW2A 4K3GA 5BVPH 2HT3C 3WLBA 3SDAD 1CCZA 4NZUL 3PDDA 4DGIL 4F80A 3FFDA 4HKJB 2C26A 3BD4A 2QQKL 5J3HD 5C0NC 2VE6A 2RJMA 1TPXB 3WIHH 4NT6A 1YN7B 1Z5LB 2FX8L 1UZ8A 3H7LA 3O6LL 5HHXL 1JTTA 1JYNA 1FL5A 2VAAB 1DFBH 1EZVX 3MA9L 2RGSA 1U93B 4W70A 5M94B 4E42B 3MRQB 4JM2A 3D3VE 4BFIB 4D2NA 5CP3H 3VFUB 3RTQD 1LK3L 2YMXL 5KG9B 4U6HA 1E4XI 4ZNEA 3CDGB 4U05A 2WSKA 3H42L 1E27A 4WUUB 5KVDH 1JTOA 4G6KL 4HIXH 4PJ9B 5DQ9A 5GJTH 1WFNA 2CGRL 1UJTA 4O4YH 4F33A 2ZSVA 1E4WH 1EXUA 1EJOL 3SJVB 1G7JB 3RA7L 4D8PB 4JPIA 1BP3B 1XGTA 3TWCH 5D1QD 4K7PY 5LGHH 4ZOCA 4C55A 3N1MC 1ND0A 1QSFB 2E6PA 2EIDA 3BD3A 4GRMB 5BZWA 3FJTA 5KVMC 4R90L 1RVFL 1WEJH 4LSQH 1BOGA 4HS6A 4BSWA 1YNKL 4DUWA 1FZMA 4RFEA 3OR6A 1HIMH 3C09C 4PJBE 3DGCR 2FD6H 1D5XA 4P2OC 3RKDD 5KVEH 4JFDB 4MDJA 3D25B 4PRHB 3IFNH 4ZUSB 1IAIH 4HT1H 1KEMH 5I1DA 4I18C 1INQA 2MWCA 1DBBH 4JO1H 4LFHD 4R8WL 4MAYD 4JFFD 4O51A 5DHXB 1ZHLB 3LQAL 3MGOA 5BV7B 1S5HA 2EE2A 1Q9WA 3RJDA 2HTLD 1VPOH 4MQXD 5E0QA 1XH3A 1IAOB 4AL8L 4NPYB 5F3BA 2R39A 5DJYB 1T5XB 4TSBH 3L3IB 9CGTA 5SX5K 4KTDL 2JIXA 4U3HA 3FMGH 2NMSA 4HMDA 5LCVH 3IAGC 5D93C 3S8WA 3IF1A 4R97C 4YHOL 5FM5M 4Y5VC 5EO9A 1XF2A 3GSNL 1SYSA 1QACA 3K4AA 1HXYB 1MJJB 4U1JA 2WW8A 3ZTNH 1M6OA 5DGRA 1FO0L 2UWEF 2DQTH 3F12B 5J6HB 4YO0A 4HMEA 5HI5D 3AROA 3FFDB 3R06A 5IMLA 2PYED 4KZEL 4K9EC 5D1ZA 4ONFH 4J3WA 1QKZH 1BREA 3O45B 1RMFH 2XA8L 4NT6B 2YA1A 4UINL 2GJJA 1UZ8B 3GRWH 4K8RC 1T2QH 5BO1H 5L2JB 3LOWA 1FL5B 2VUOA 4PRBA 1HHKB 3HFML 4NZJA 3DSNA 1DQTA 4W6XB 3GBNL 3HMWL 2F15A 1HCVA 4K3JH 3ALPA 2IFGA 4X6DE 4M3JA 5HGBA 2E8ZA 3AC0A 4WY7H 1E27B 2VXQL 2FGZA 1Q9OA 2DN7A 4N8PA 3PWUA 5AEAA 2DD8H 3VXTA 1EXUB 4FTVA 1IKNA 1MFDH 2AJXL 2ATPB 5TE7H 3MRNB 1P7QA 5E00A 4LCCA 4YEFA 1ND0B 1OL0A 2AJYH 2KPNA 4XP1L 1LDPL 2FH6A 4HUUA 5BV7L 2QSTA 5FOBB 1Q0XH 4JGJA 3HC4H 1X5ZA 4GSDL 4PBVC 5CJ5A 4RQQA 5GIRA 4HS6B 5C7XL 3D18A 4LNRA 3OR6B 2YUVA 2KQNA 1IM9B 2GFBA 5GRUL 2R0WH 5F7KC 1D5XB 1UADC 1I7ZA 1WLHA 4JDZA 3QDHA 2NY0B 1LEGA 4NGHL 4MDJB 3MRPA 4FQCL 1UJ3A 3PNWA 1X5HA 3MCG1 2APBA 5I1DB 4FHBD 3ZDYE 4XB7A 1U42A 1INQB 4C57C 1HNFA 4O51B 3ARRA 1A0QH 4Y2DC 2B39A 4ZG1A 5E4EC 4KTYA 3DVNA 2J3SA 4WU7B 4WTZG 3A6CL 2WLZA 4KJWD 5F7DA 1I1FA 5E99L 1JHKL 2HFGL 5K59F 2BSRA 1IZKA 3E8UL 2BSSA 5F3BB 3MJ7A 5CD5D 1Q9LB 2VKWA 5EU7C 1EVUA 4L3EE 4EDWL 2CIIA 4JANB 4NO2B 1MCOH 1CXLA 4JHBA 3HE7C 4V1DD 3IF1B 5EO9B 1XF2B 1SYSB 1TNNA 4XNYL 3SCMD 4RRPA 4E41A 1QLEL 5E56A 4IRJC 4LCWE 1DBML 3G08A 4HIEA 1FE8L 3SEPA 5F7HA 3VD5A 4JRWA 2F53B 3QZWA 3NTCH 4R7NB 2Y06L 3PWVA 1VEPA 4MCYA 5B8CA 5IMLB 5DA4A 3WEXA 4MVBC 5C70A 4GQ9L 4UT6H 4K94C 3VFTB 3WJJC 4C56A 2YD6A 3NCYS 2A77L 3CK0L 3KXFA 4WDIB 4YHNA 3C5ZD 4YHPB 5KSAD 1I75A 4WTWA 4LCUB 5FAAA 1F11A 3CFDA 4OZ4B 5SWZE 3SDAC 5HHVL 5JNYA 1KGCD 1MIMH 2Y25A 3JTSB 1NCAL 4JHAH 5T1MB 3LH2H 3BSZH 1U8NA 3GMNB 3BIBX 5TDNA 2GAZA 4WFEE 4RA3A 3OV6A 1KCRL 3KJ6H 3NCJH 4OFIA 2HLFD 4F15C 4X7SL 4RWHA 3VXTB 4NZUH 3RDTA 4DGIH 5KVGL 1QFWI 3O2VL 3ZT5A 4AYFA 3RTQC 2PYFB 2QQKH 2EDKA 1P7QB 5E00B 2PTVA 2AVGA 4NO0D 3SKJL 2LV4A 4FMKA 2RBLA 4G6AD 1DZBA 2CIKB 3C60D 5HHXH 3O6LH 1Z9MA 3CVHB 4WI5A 3MA9H 2GTZA 5DVNA 4RQQB 2ZSWA 3D18B 1EHAA 4PYHA 2MQ3A 2A0LD 4LNRB 1VDGA 1LK3H 2X4TB 2YMXH 3FQWA 3BZDA 4XAWL 5ANMB 2H45A 3KPPB 1I8LC 5D1QC 1I7ZB 3H42H 4JDZB 2H1PL 4OFDA 4MNQE 3DPBA 4G6KH 4Q9CA 1UJ3B 2CGRH 15C8L 3MV9E 1OLLA 5C07E 1EJOH 1R6VA 3JUZA 4ZUTA 3RA7H 3MV7E 3TFKD 2XI9A 2EEAA 1C08B 1VFUA 1J0HA 4CJ0A 4P2QB 3BO8A 4Z76A 1I1FB 1EPFA 1MH5B 3MGTA 3PJSB 3QEQA 4R90H 1RVFH 3RKDC 1R3HA 4CMMA 5EUOB 3IYLW 3LPWA 1CLOL 1I7TA 1YNKH 2IMNA 2E5EA 1CBVH 4MMXC 3O6KH 4IOFD 4MAYC 5MHSD 3NACL 2MJWA 3W39B 3DX6B 2V9QA 4AENA 1TIUA 2HTLC 4PBXA 4E41B 4MQXC 5CIPA 1Y6MR 2WNGA 3FB6A 1AH1A 4HIHA 5CS7A 3G08B 1I8MA 1HKLL 1CFQB 4R8WH 3HI1B 5CBAB 1J18A 4BQ8A 1MREL 3QZWB 4ACPA 4P2OA 1EUTA 4K2UL 3EO9H 3NCYP 3VXRB 4U1MA 5I18L 1E4KC 5FYKE 4UV7L 5I0ZA 4LRIC 2DLTA 4C56B 2E9BA 4JY5L 2XN9A 4I18A 5CEXB 3IDYC 3MOAL 3QEUB 1U91A 3QCUL 4QF1A 1QSED 4KTDH 4R6UA 3VFPA 2NY6B 4MJ5A 1F11B 3N1FC 3CVHL 4GXVL 3RWCA 5JNYB 3GMLA 4YHOH 1ZSDB 5HI5C 1CD9B 1JGDB 3ESUF 3KPRE 3UTTD 2YKLL 4ODUA 3DVFA 1RHHA 4PRIA 3OJDB 4PLJC 1N4XL 3CMOL 4Y5VA 1JWMA 3KAAA 3RDTB 4M02A 1F4XL 2HJKB 2E9IA 4KZEH 4N1EA 1QFOA 3EJZD 5B3JE 5GQBA 4PJ5B 2XA8H 4TVSa 3FFCE 3EJYD 1TQCC 4UINH 3F7RA 5HYIA 1FVEA 1DLHA 5GGRB 4HQQL 5CSGA 2CSPA 3T0AA 3HFMH 3WIFA 3W0WE 4YR6A 3U9PL 3GBNH 5F21B 3JWNC 4MQ7A 4LBEA 2DIJA 3QWRD 2E27L 3FQWB 4JRYE 4GW4B 3PABB 3AS1A 5JORA 5T5NG 2CUHA 5IF0B 2VXQH 3X13B 4PRAA 4EQ2A 5H35A 3ZKXC 4Z0XA 3X12A 4G8GD 5DRWA 1JBJA 1A9BA 4OIIL 5JW4N 5MENE 3T0XA 2DQFB 3G5ZA 3CPLB 3D0LB 4ZUTB 2BOBA 2AJXH 3LV3A 3P73A 4K55A 4XVUD 4NKDB 5J56B 2BHUA 3BO8B 4XP1H 5E2TH 1AIFA 1XMWA 3I84A 1LDPH 2DQGL 5A2JH 5BV7H 1TVBA 1FYTA 1R3HB 3H8NA 4GSDH 4OZHF 1JGLL 1I7TB 1VFOA 5C7XH 1SEQL 3SBWC 4A6YL 3VH8B 2XWBA 3TH3T 2NR6D 4U6XB 5GRUH 3I6GA 4HIIA 5D7IA 2HAZA 3DECA 5HGDB 4Y4HD 4Z77B 4KJWC 3BP7A 4NGHH 3IETA 3FQXA 5MEQA 4FQCH 5CIPB 5EOCJ 3FB6B 2PN5A 4YGVA 4HIHB 1I8MB 3C09B 5CD5C 3IXAB 5L2KA 4QXUL 3OKMB 1H3UA 1FH5L 3P30L 2LVCA 2VISB 1NCDL 3QCTL 3D3VD 3CLEL 3A6CH 4U1MB 1MFAL 3VFVA 5E99H 1JHKH 2HFGH 3E8UH 5JPNA 1ZS8A 3PHSA 4I18B 5FGCE 3WS3A 1RJCA 2IC2A 2ADJA 1P7HL 4EDWH 4Y2DA 3VFPB 4OGXL 3VWKD 1CU4L 5HVHC 4X5LA 5F8QC 1KCSL 4WWKA 5TDOA 1G1YA 4RMQA 5FCSH 4XNYH 3IDIA 3C5SB 1QLEH 4ODUB 3PDOB 4LGPB 1FN4A 1RHHB 5F3HA 3VGAC 1S7RB 2XWTB 1DBMH 5F9JA 3HE7A 1FE8H 4WFGE 4Y5VB 2VLKE 3C5ZC 2Y06H 5KSAC 4KRLB 3IXTA 5E70A 3TPUB 4GQ9H 4OLYL 2VB5A 1XGUA 1HE7A 4IRJA 1DLHB 4PBWD 2A77H 5B38G 3CK0H 2JCCB 1U92B 2NY1C 3LKOA 1BQHA 1KT2A 1K6QL 2HLFC 3BW9B 1IGIL 4LBEB 5HHVH 1MRFL 4GW5A 2CRIA 4GUPA 5J0BA 2PETA 1NCAH 1ERNA 3TO2A 2VQUA 5JORB 3G5XB 4LSVL 3EOAA 4PRAB 5H35B 4OFVA 2HVKA 5DJ8A 1KCRH 1A6UL 4Z0XB 4UI2A 2O5XL 4XHJD 3ELAT 5DRWB 1A9BB 3RL2A 2X9WA 3FQTA 4UUJA 3C60C 3EGSA 3SDAA 4X7SH 3KPNB 3BGFC 3G5ZB 2W0PA 1I3VA 5L7XL 2BOBB 5KVGH 2A0LC 3AXLB 3O2VH 3P73B 2EKJA 4ZPTA 3WO3B 3DIFB 3SKJH 1J11A 2Q3AA 2YZ1A 1FYTB 1U8PA 2AGJL 1KLUA 5GS1B 5I8CA 4BZ2L 4L29A 4RMSA 3RTQA 1AQDA 4UOW1 3Q1SL 1NAMA 3HPJB 4XAWH 1K4CA 2HFTA 3I6GB 4HIIB 3QULB 3LEXB 5D7IB 5CUSL 3TFKC 3RGVB 4HCRA 3E2HC 2N7BA 1P4LA 3BP7B 5ISZE 3FQXB 2UZIL 4AEIL 5MEQB 2VUYA 5E08L 4YGVB 15C8H 1NCTA 2ADFL 3Q3GB 4NNPL 5DLML 4KKCD 4P5TC 3FTGB 2FYYA 3I6LE 1I8LA 5D1QA 4EUPG 1PEWA 3OKLA 1BFOB 1URLA 2V2XA 4IOFC 3T3PF 1LGVA 1ZS8B 1CXIA 1X7QA 3WS3B 2IH3B 4IRZH 4OFPA 1NUDA 1CLOH 4Y2DB 5CFHA 2XYCA 3MRIA 2A73B 2O5YL 4I48B 3NIFF 2R2EB 1U9KA 4FQXB 2F8XC 1L9NA 3NACH 1UZ6E 3BIKA 4WWKB 3RWEB 3HMXL 2P5WE 2J6EL 3MSPA 4XPAL 3PHQA 1G0YR 2JJVA 1FN4B 4JO4L 5F3HB 2IH1A 3S34L 5F9JB 1HKLH 3HE7B 1FJ1B 3MV8B 3SO5A 3BJ91 1ROWA 4JFFA 4MAYA 25C8L 3THML 3DBXA 4K2UH 2GUOB 5FA3A 4NBYB 4YBHA 2VZTA 5I18H 3OJVC 4UV7H 2A6JA 4WHYH 4JY5H 1WC7A 4WW2F 4PJFB 1CL7I 1T22A 3LKOB 4PJXA 2HTKD 2WBKA 4YEEA 2BFVL 4OF6A 1T21A 2NY5C 1ZTXL 3CVHH 1I1AD 4GXVH 1E4KA 3HRPA 4GW5B 4G9DA 1JV5A 2MPAL 4JEGB 4LMQI 4LRIA 3W82A 3MLTB 1SJVA 3U30C 3S3JA 4NNXB 1YEFL 4KU1A 3EJZC 5DS8A 4P57B 2YKLH 4F7PB 5ALBL 4HWBL 5E5MA 1ETZB 1NFDA 3FQTB 4JM2F 4QRSB 4ZPVA 3ZMRA 5C2BL 2A74A 4WW1A 5BJTB 1N4XH 2BJMH 5C0GA 1UENA 3CMOH 1LO4H 1R3KA 1WAAE 3O4OC 1MCRA 4L3ED 3H9SE 5HVFB 1CGUA 2PYEA 3FOLB 4HJ0D 4ZPTB 3V0AC 2R4SL 3WXWL 5F6HI 2FJHB 4P5KA 5ACZA 5EZLA 2UY6A 3V5HA 3TLRA 1U95A 4MD5A 2UV3A 1PYWB 2I26N 4HQQH 3IJYA 5EU3A 5C0AB 3CH1A 1U8PB 1PQZA 3V5KA 4D9QE 4LCWD 4M4PA 2E27H 4OZFG 3L6FA 1P4LB 1KTRL 5CKAA 1NGYA 4HWNA 4LPXA 4OIIH 3JUYA 2Q7YA 1I7RA 3OKLB 2FLBT 1JJUA 3IJSA 2NR6C 2WWKO 3NCMA 5SWZD 1BQLL 2FLRT 5HBBA 1DQDL 2DQGH 4LLYB 2G5BB 3MNZA 4WJ5A 1UGNA 4N8CL 1JGLH 4WFED 1SEQH 4IJ3C 3QPQD 1KIQB 4F3FA 3HLAA 5ELIA 1VFBA 1J0IA 1R5VB 1CD1A 4WNQA 3RX7A 3QDGE 5DMKB 1OAQL 5D7SL 4OF8A 1X4YA 4NQUA 1RAMA 4N5ED 5K9JL 1ZLVK 3SBWA 1GZQA 5FM5O 4R96A 3QWOB 3WS6C 4LPUA 4QXUH 4DN4L 4JFFB 1FH5H 3P30H 2XZQL 4KROB 1TZHA 1NCDH 2FATL 3QCTH 4OKDA 3ZE0E 3MLPA 2FHBA 3CLEH 4ZSOA 3VWKC 4G3YL 4BZYA 1MFAH 4HUMB 5F6HJ 2APFA 2A6JB 1CFSA 2QBWA 4JQVC 4H0HB 4NFBA 4CVXA 32C2A 2EDTA 4MNQD 3RRQA 3S88L 3VDAA 5IOPA 2VZSA 3FT2B 4OGXH 5EBWA 1SM3L 1T21B 1Q9KB 1CU4H 1QNZL 1K8DA 3BH9A 3MV9D 4FQQA 4KV5F 4V1DA 1G9MC 2CDFB 1KCSH 5C07D 1MJ8L 3MV7D 3SCMA 2DWDA 1QD0A 1TZGL 4DVBA 5AUMB 3DUSA 2DLIA 3DRQB 4JCMA 4H1LA 4NQTA 4YDKL 3OL2A 4WW1B 1YUHA 5C0GB 4XCCL 1W72B 1R3KB 2BVQA 5D1XD 2PYEB 4B41A 1IILE 1T66D 3GB7A 4M1DL 4OLYH 5EZLB 3V5HB 2DJUA 1B0GA 5CEZL 3IJYB 5EU3B 3CH1B 5EBLA 3UYPA 4P2RB 3C5ZA 4XHJC 4HV8A 5KSAA 1K6QH 1QOKA 2VXSL 4OM0L 3BKML 3LKPA 4ZAKD 1IGIH 3QYCA 4YFLI 5EZIL 1MRFH 4ZFFA 4I2XB 3ZYIA 3HRZA 4M7ZC 1I8IB 1M7IA 5IBUG 3JWOC 4LSVH 1X5KA 5GZOC 2F5AL 3DO7B 3DHMA 1CWVA 3O6ML 1A6UH 1D7FA 5JXAL 2O5XH 1UB5A 1E4JA 3O41B 5FYKD 4UQ2A 5JUEL 3OKKA 1MCKA 4YXKL 4X7CC 2Q7YB 5BMFL 3IKKA 2YD4A 5CIPH 2OR8A 2WP3T 4LHUG 1DQJA 4MHHI 3ZKXB 1G7LB 4NO0A 3MLWL 1QO3B 3TT1L 3JV4B 2ZWLT 3C60A 5C08E 3LDBC 2IBZX 4WJ5B 2I9LA 1LNUA 2WQ8A 4KTEL 1C5CL 4NQED 1WTGT 2AGJH 3H0TB 3KPRD 2VZUA 4PJGE 1H9VA 1HINL 4R2GD 4Z7VB 4OQTL 2XG4A 5DUPL 4Z7WE 4YDLC 3FB5A 3FOMA 1VFBB 2X1XR 4JFHE 4EKXA 3WFZA 3Q1SH 4KKCC 3EO0B 1CD1B 5CP7A 5CUSH 5E95B 1ED3B 5IJVB 2CLVB 1QLFB 1SEBB 5JOEA 1RJZA 1QSVA 3QIBB 1AGDA 3P2TA 3TN0D 5JIPA 3IU3B 1OAKL 4X6CE 1WGOA 5E08H 2BVYA 2ADFH 3BIAX 3FFCD 4NNPH 5DLMH 1X4XA 3ULUF 5EIVA 5ICZA 4FFVC 1TZHB 4LLMB 3QQNA 3W0WD 4ZSOB 8CGTA 3T3MF 1J88A 1JZ7A 5I1LA 1W72L 4QRUA 4JRYD 3TBWA 2X6MA 2X4PA 3HAEG 4WI9A 2XFXB 2ADIA 3E0GA 5IOPB 5GGSB 5F7LB 4NQCE 1A1NA 5EBWB 2O5YH 3BPOC 4GLRH 3BH9B 4V1DB 1ODAA 1A21A 5MEND 2D7OA 3HMXH 3SCMB 2L7UA 2J6EH 1JHTA 2EXWD 4XPAH 3QJHA 4IRSD 2ADGA 1QFWL 4JO4H 1EJ6A 1CDUA 4H1LB 4OAWA 1H15A 3S34H 1GGYA 4LCYA 3RWIB 3ISWA 1MF2L 4RZCA 4JDVB 3TVMD 25C8H 1LO0L 5GHWL 5TPWL 2Z35A 3THMH 5KS9F 2HTKC 4LEOB 4Q2ZA 3DXAB 3HUJE 1I1AC 2Z92A 1ZT7B 1R5WA 2A1WL 5J1AA 1ZLUH 4U1GC 1B0GB 1OTSD 3NFNB 4HDIA 1QSEA 5DHVA 2HLAA 5EBLB 5KSAB 4JHWL 3D48R 3TA3D 2BFVH 2H2SD 1ZTXH 1OAXL 4J2XA 3HRZB 2MPAH 4KK9D 4ZTPL 2NX5E 1YEFH 3UTTA 4HJ0C 1YNTA 4BFGA 1IJ9A 3IDGA 5ALBH 4HWBH 1K4DB 5HSFA 4YZFF 2VTFA 5C2BH 4HAFA 1KJMA 3UJJL 2XTJB 2GT9A 1X6NA 5MERA 2AKRA 1DQJB 4GAFB 4OTXH 1W0WA 1QVOA 1TQBC 2KL6A 2R4SH 3WXWH 4P3DB 1YECL 2WIIA 5FYJL 2WBJD 3C60B 4NJAL 3KYAA 2NTFA 1LNUB 3BGFB 4OLXL 5GGTL 4MJ6A 3RPIA 5C9JB 3RVVD 1N26A 3QUMA 1G7HB 3MOBL 3FB5B 4QT5B 5IMMB 3QWRA 4AQOA 1VKXA 4WFGD 4XP5L 3VXUE 4AZ8A 3OHXB 4LNVA 2VLKD 4DN3L 4HK3J 3UTSB 2Z8RA 4G8GA 3V6OE 4MNGA 3DRTB 1J8HE 1EIBA 3BP4B 1QYGL 2X4NA 1IGFL 4CN1A 4MB4A 3QUZD 1DQDH 1T7ZA 3TBWB 4OF0A 4BJLA 3VG9B 4N8CH 2ADIB 4LL9A 4N5EC 3EYFB 3OAYH 4U2ZA 4LQ1A 4YK4C 2VL4A 2BRRL 4M43L 5T33L 2GJ6B 4L8SC 3FRPG 3JBG7 1OAQH 2MSPA 5D7SH 3MRBB 3KYKL 3QJHB 2ADGB 1JI2A 4K94H 5H8DA 5K9JH 2GI7A 3ARDD 5F8RC 2BNUB 4OAWB 3MUGA 3BRFA 2NY2D 4DN4H 2NXYD 4RZCB 2Z35B 1N5AA 1JPTL 2FATH 3D3VA 4AEFA 1ZANL 2PXYD 2Z92B 1GVIA 1TVDA 1R5WB 2D2OA 5J1AB 3QRFM 2DKSA 2AV1A 2I07A 3WS6A 2WBWB 4HDIB 1QSEB 5DHVB 4X4YA 2HLAB 2AI0L 2R4RL 1EV2E 3KPMB 3S88H 5ISZD 4Z95L 5H2BB 3VWKA 1SM3H 4LMQE 4XPFL 3BKJL 4NQSB 1QNZH 5K59E 2PW1A 4XP6L 4BELD 4JQVA 1WSST 1MJ8H 3I6LD 5T1KD 3UTTB 1T66C 4DJMA 1FV1A 1TZGH 3U36A 1MI5B 3IDGB 4OCXL 1TZIA 4N0YL 4YDKH 3SDDD 4XCCH 3GSWB 4X7TB 2D0GA 4F7MA 4XVTL 2GT9B 1MCCA 3D85D 3VFWB 1RFDL 4ZAKC 4LLDA 4YDIL 1BGXL 1W0WB 3JXAA 1C16A 1R5IA 4M1DH 4PJBA 1JMZA 2D9CA 4S2SA 4ZYKB 5JHLL 1KBGH 5CEZH 2NTFB 5JW4R 3QFJB 2P5WD 4MJ6B 3IDXL 4YBLB 3O4OB 3I3EA 1PKQB 2DQDH 2VXSH 4OM0H 3BKMH 1S9VA 3B9VA 3IS0X 1ZWIB 4LSTL 5EZIH 3BD5A 3H9YA 2FR4A 4BK5A 2Q1EA 3UAJD 5C0CE 2R0ZL 5KZCD 4QRRE 4AIOA 4HAGA 3FQRA 2M2DA 4UV4L 2F5AH 1FFPA 2O5ZL 4M7JL 2A6DB 1NCBL 5JXAH 4G8GB 4CU6A 5JUEH 5ERWA 5DJ6A 4G42B 5DUBB 2R1WB 4YXKH 4XTRD 1A1OB 4BSVB 2Y4SA 5BMFH 3PL6D 4R2GC 4Y16C 1ZT4A 4U7KA 1P84K 3TBTA 4QHKI 3MLWH 2R2HB 5J89A 1Z0NA 3TT1H 2XNAB 4TTDD 4KTEH 3TN0C 5EZJA 5GZND 1C5CH 5ITBL 3PXJA 1I3RA 1HINH 1OAUL 4OQTH 4WRLA 5DUPH 4NO3A 4WEMB 1OP5K 1T1XA 1DN2A 4Z7UB 1VADA 3H9SD 4Y4HB 1NCCL 3DV4A 3BPNC 4LSDA 1OAKH 1Q72L 3MROB 4I0PB 4XXDB 2K7PA 1KOAA 3I02B 1JPGA 4U6VL 1P5VA 2C4XA 3O6FB 4UQ3A 3VFSB 1FL3B 1N5AB 1C5DB 5IHZA 2OZ4A 2EE9A 2P5EE 2QTEA 1U3JA 1W72H 2HFEB 4X6DA 2I07B 4MJIB 5CZXD 4X4YB 2EXWC 4IRSC 2W9DL 2NPLX 1UA6L 3QH3B 1BFVH 1T1YA 3NCCB 2PW1B 5ICXA 1ZLWK 4GMSL 3TVMC 1YPZE 4WTZA 1S7TB 3D39E 1ZOXA 3U36B 1FG9C 5AG9A 1QFWH 5CKGA 1MCDA 4LDOB 5IT2H 1MNUH 3ZSTA 5FEBA 1WK0A 1MF2H 1LO0H 5GHWH 5TPWH 4KQ3L 1B0WA 4K71B 3TA3C 4LLDB 2H2SC 4KDTC 1C16B 2VR9A 3W5NA 4PJBB 4KK9C 2NY4D 2A1WH 2LU4A 4KJPD 3QDGD 2DLGA 1MCLA 5DD0L 4WFFE 1YY8A 3E6FA 2G60L 5GXBB 5GRJL 1FRGL 3QISA 4JHWH 2J88H 5HHME 1S9VB 3KLDA 1I1AA 3S36L 1EO8H 1VACA 2L0DA 4N0FA 4PJAE 4K3DL 4KGLA 4P49A 4OLWL 4ZTPH 2YC1B 3H3BC 1FSKC 3AREB 5I9QC 1R0AH 2WBJC 5DJ6B 1QTYT 2R2CA 3LRSB 1C8PA 3ZE2E 3VD7A 3UTQB 1LP9E 4H8WC 3VA6A 3RVVC 3UJJH 4HS3B 4L3EA 4CU8A 2CO6B 4X6FB 2AQ1A 1ZT4B 3S4SG 2V7HA 3N50A 2EDYA 4LARL 1YECH 5ECJE 1NFIA 3TBYB 5FYJH 4NJAH 1P1ZA 2DM3A 3EYQD 2O26U 4OLXH 5EZJB 5GGTH 4HGWB 1U8IA 3MOBH 1HCFX 1A47A 4LCWA 3TIDA 1T1XB 2EE3A 4XP5H 1U8JB 3SE9L 2IADA 2JF1A 1VADB 4RX4D 4FABL 5E03A 5DGQA 3QCVL 1MWAA 3QUZC 1ORQA 1JPGB 2V6HA 4YC2C 3X11A 1QYGH 2JK5A 4H1LH 1XF5A 1K5NB 1JGEA 1IGFH 3LCYA 5C92A 5IHZB 1WFOA 3BGAA 1MLBA 2VC2L 3L5XL 5D7JD 5SWZA 1QFHA 1AC6A 4M5YL 2H2PD 4X6DB 4HFWA 3SKMA 3KPTA 4OCWL 1F90L 4JPVL 3PUCA 3ARDC 2XZAL 3U0WL 4ZO7A 2FBOJ 2BRRH 1AXTL 5T33H 2NY2C 3QJFB 2NXYC 5ICXB 5ESAA 4PJIB 4AIZA 2PXYC 5DURB 4OZHE 5AYUL 3KYKH 4I5BA 3S97C 1S7SA 2F74A 3VW3L 4Y1AB 4PJXF 3GHEL 1PW3A 5C08D 4L8SA 1CGXA 2RB8A 4RNRB 2HG5A 1QR1B 1JPTH 3RY4A 1WCBB 1ZANH 4G8IB 3CFJB 4JVWA 4P9HC 4UTAL 4K23L 4KKAD 2X4OA 2OXHA 5ITFA 4JFHD 4AMKH 1EA9C 2ZCKL 1PFCA 3P4NA 1ZLSL 1NFDF 2AI0H 2R4RH 4MNQA 4ZXBB 2XQYG 4QHNA 4Z95H 5DZLA 1YJDC 3SDDC 3JV6B 1I1AB 1T6WA 3BKJH 3RUGE 3MV9A 2NYYD 4N0FB 4G7VL 1EEYA 3S9DB 5C07A 4G80B 2P48B 1ZGLM 3DMMD 3DX9A 3MV7A 4U1GB 2VDRH 3SGDH 2D9QB 3CXDL 5IB1A 3FKUS 4LSSL 4YIQA 4OCXH 4N0YH 3LKSB 2VDNH 1GGUA 1MHEA 4ELMA 5DK3A 4XVTH 4L3EB 5D1XA 2ZG3A 3QI9B 5D2LF 4MYWB 1RFDH 4QCIB 4NQCD 3EFDL 4YDIH 1BGXH 3UROR 2B1HL 2N4IA 1NFIB 1JIBA 1QQDB 5JHLH 1P1ZB 4UU9A 3IDXH 2D4FA 4P46D 1KTDB 1BJMA 3RWFA 4ZAKA 1AHWC 4LCWB 4XTRC 4LSTH 5SX5H 1IGCL 1UWGL 4Q6IC 2Z9TA 1OSZB 2R0ZH 2IADB 1BJ1J 3FO2B 1W0VB 4JFQA 3VFMB 1ZGLP 4UV4H 3GO1L 1B9ZA 4M7JH 2O5ZH 1MWAB 1NCBH 1NGQL 4L3AA 5J4MA 3KYMA 1ORQB 5GS0L 2O61B 4GO6B 4OLZL 4F9PC 5GZNC 3VFNA 1P7KA 3GJFK 2WMPA 5FYLE 3PP3K 5GRWA 3DGGB 3P4MA 1MLBB 4X5XB 2VN4A 1PZUB 2SEBB 1ACZA 3DJ9A 1RZ8A 3MXWL 5DZOA 5FB8A 4LOUD 1AI1L 4HFWB 4OZIE 4MMZC 5FUCE 3KPRA 4N9OB 5ITBH 4PRNA 2C1PA 1OAUH 4JFPB 1GJIA 3ILPA 4Y16A 1K3IA 4FXGA 1WICA 1U3HD 5KANI 3DHJA 2DI9A 5DHVH 3QHFL 5HI3D 4IIQB 1C7SA 4ODTL 4ZUWB 3GUTA 1LK2A 1Q0YL 3CFEB 3TN0A 1NCCH 5CGYD 3P4LA 1Q72H 1S7SB 2F74B 3HCVB 5TGBB 1XF1A 4Z6AT 4KJYA 2AXHA 2VLJB 3FFCA 5CZXC 4U6VH 2IQAA 2ED7A 2HG5B 2YBRB 3ZT7A 3W0WA 5HYJE 4JO2L 2X4OB 3U79A 3N1QC 2ZOLA 2VZ3A 4JRYA 1YMHB 3NN8A 4U2YA 5HYSG 1U8LA 4UMGA 3ZKND 2IEPA 3P4NB 1TFHA 3VXUD 2YUWA 3AAZA 1CE6A 3HS0A 4N0UE 1BZ7A 1RZGB 4QHNB 2W9DH 1FAIH 2VXUL 1CF8L 2ARJQ 5FKAA 1HK6A 1G9NL 3ILQD 4CGTA 1UA6H 3T3PE 1J8HD 4PY8I 3PWLA 5MENA 1EEYB 4GMSH 5C07B 2A83A 2ZUVA 3MV7B 4LVHB 5EC1B 5IB1B 2CR3A 3VXOA 1P53A 4IRSA 4DKFL 4YIQB 2ZUSA 2DOCA 2NY4C 3I3BA 3L95B 1SY6L 4TSCL 4KJPC 3N0PB 5J6GA 3KYOA 4HXAL 1MHEB 4PRPE 4ELMB 3PGDB 3TVMA 5HDOA 5D1XB 2P44B 4PJ7B 5DJAA 5IVXE 5J8OA 2VH5L 4KQ3H 2HMID 1MCSA 2ZUWA 4YDJB 2NW3A 2DL2A 2R2BA 2X09A 2X05A 4NO5A 1DUYB 2ZCHL 3SHSA 5TDPA 1JTPA 1WIUA 3U0TA 5DD0H 4UU9B 2G60H 1P4BL 5GRJH 1FRGH 4ZAKB 3TA3A 4O02L 4KDTA 4HWUA 1VEMA 5FHBL 4IMKC 3S36H 3ZO0A 4TTGA 4JG1H 4HIJA 4K3DH 2A9ML 1G7MA 3S98A 1UH3A 3GMMB 4OLWH 1JZ4A 1J10A 1BFTA 1A14L 2DQIL 2HJLB 4LLWA 4MAUL 4PV8B 2AS5M 3ZDZE 2FDBP 3OR7A 3OJ2C 1RK1A 4NP4L 3LKNB 3BFOA 4OCYL 4LARH 3ZTJG 2WBJA 5I8OL 5JO5A 1RUPL 1MHHA 3T08A 1I85A 4PB0L 4NQEB 3KPRB 4R4BB 1YN6A 3O11A 4Y0GA 4PY8J 4XNQA 5C0IA 5DVKA 1P2CB 3MA7A 4QRTB 2VLKA 3SE9H 1LK2B 5DHYA 4FABH 5FXCH 4O58L 5HY9A 3QCVH 3ZYJA 5D7JC 4YQXH 4ERSL 3QUYD 1BIIB 1I3GL 2IJ0C 4KJYB 2H2PC 4KHTL 3FFCB 1F6AB 2V7NA 5C1MB 2F5BL 2IQAB 2BNRE 2J8UB 2Q86B 1YZZA 1JPSL 4YNYA 3V8CA 4B7LA 1GHFL 2VC2H 1YA5A 2QR0B 1G9MH 2ZOLB 3QUZA 2CDEA 4KK6D 1U8LB 2ZG2A 3UTZA 5C0CD 4OCWH 1F90H 3AAZB 4JPVH 4QRRD 1CE6B 3HS0B 1UEMA 3DURA 1NBVL 2XZAH 2IAMD 5IW3A 4M00A 3U0WH 3IFOB 4ZODA 1AXTH 3LQMA 1NGPL 4ZTOL 4NRZB 2A83B 3WDHA 1AXSA 2BVPB 4HUWA 4EUPA 2GK0A 4OUOA 1Q94A 3VXOB 4IRSB 4KKAC 5AYUH 4AT6B 4HJGB 2F54E 3ARDA 4XC1L 1HHIB 3HZYB 1B2WL 1I9JL 2J2ZA 3VW3H 3GHEH 4JZOB 2BHZA 43CAB 1F6LL 5J1TC 1S8DB 4P59L 2PXYA 4QHLA 1V8HA 2RFXA 2NW3B 4K23H 3VRIA 4NO5B 3FB7B 5K9OB 3DMMC 2ZCKH 1NGWB 5JIKA 1ZLSH 5A3ID 3U0TB 2M8XA 2MKLC 3DLQR 2AK1L 5ISZA 3TF7C 1CT8B 4TUJB 4HIJB 1G7MB 5E9DE 5T1KA 2OR9L 3CXDH 2D7TL 4GW1B 4LSSH 5KJRL 1DDHA 1S5IL 5GSRA 3QO0B 4LLWB 5EU5B 3SDDA 4KV5E 3HZMB 4ZDHB 3WO4C 1HYRC 1A22B 4P46C 1MHCA 4ODWA 3D85A 1TVHB 3IDJB 4YX2L 3DSFH 1M7DA 2ED9A 2B1HH 3TBVB 3DVIA 2VN7A 1NPUA 3KDMA 5JO5B 1MHHB 2OZ4H 5F1IA 2P5WA 1IM3A 2EDRA 3D39D 1YN6B 1CE1L 3MRDA 3O11B 3RNKB 5KSUA 3SDCC 2G5RA 5D70L 1IGCH 2ARJA 1D5MA 5D96B 3MA7B 2OL3B 2VLKB 4D0BB 1Y0LA 4PJCE 3GO1H 4P4KD 2BK8A 3GMOA 2H3NA 1NGQH 1L6ZA 1FIEA 1D9KD 3OGCA 4LOUC 3EYSL 1OCWL 2A2QT 3MREB 4XMKL 1AHWA 4OLZH 5I15L 3RVXD 2AK4B 4HGMA 5JHDB 4NM4L 3WKML 2UUDK 3PL6A 4Q6IA 4J8RA 4WFFD 1OWWA 3NIDF 3QWQB 3OG6B 3KYNB 4YNYB 1U3HC 5I1GL 5I1JH 5HHMD 4R3SA 4X80L 3QUZB 3MXWH 2OJEB 5D5ME 4CJ1A 5HI3C 3BE1L 1FVCA 4F9PA 4PY7A 5CGYC 2XZCL 2ICCA 4RAUB 3V0VA 2EE6A 4K7FB 1FAKT 4TUOB 4UB0L 2XTLA 1DVFB 5IUSA 2YUXA 3QHFH 3FT3B 1WAAA 4ODTH 2GK0B 4PJHF 4Y5YC 1Q94B 1Q0YH 3H9SA 4ONOA 1F02I 1Q1JL 3L5WB 2CH8A 5ADOL 3AS3A 1EK3A 2PO6D 3ZKNC 5CJXC 4YDVB 3QG6A 2NXYB 5IIEA 1JK8B 5JA8B 3JV0A 3M07A 1ZXQA 3Q5YA 3CMGA 4DVRL 3ESVF 4QHLB 3ILQC 4PD4J 3V6OC 3BN3B 4MA7L 3VRIB 4JO2H 5C09E 2FEDC 4XNZC 4LPVA 4GJTB 5DD6A 4HEME 5I6XB 5DRNB 4KKLD 3LQZA 5ISZB 1RV6X 2VXUH 2APWA 2ID5A 3H9ZA 4UNVA 4LP5A 2HMIC 4ZUVA 3LN5B 3PF2A 4DKFH 3MO1B 4POYA 2VABB 1U36A 1YEEL 4NOBA 2EICA 2OL3L 4TSCH 5E5UB 4H88L 4R0LB 4HXAH 1WT5C 2DMCA 3DROA 1II4E 1MHCB 2VH5H 4XWOD 4WV1C 2CD0A 3D85B 5D7LE 1RUAL 3R0NA 2W38A 1CG9B 1HQ4B 3WNKA 4EIGB 2ZCHH 3U9UA 4GKNA 1DCLA 4LCIH 3KDMB 3ARUA 3RZWA 3QDGA 3SPVA 4Y4FD 1IM3B 4QXGL 1K2DB 1IAKA 5L9DL 2YPLE 3MBED 5KS9E 5IG7A 1P4BH 5KSUB 4O02H 5EPMA 5FHBH 5CLTA 2ARJB 2DQCL 2A9MH 5KZCB 1FNGA 5EBMB 1Y0LB 3WFBL 4L4VE 4TNWK 3GSRA 1A14H 3GMOB 4PGEB 2H3NB 2ZZUT 2DQIH 3EFFA 4MB5A 2EDDA 4MAUH 4IMKA 3MNWA 3PL6B 1U8QA 4NQDD 3NPZB 4J8RB 1RU9L 2V2TA 2DQUH 1EGJL 4P4RB 4CADB 1VFMA 3W5MA 4NP4H 4R3SB 5CHNA 4OCYH 2WM0A 3AM8C 5I8OH 4NHUA 1RUPH 4X5WB 4PJEB 3V0VB 1EHXA 1L0QA 4BSJA 5LGJB 5J12C 1CDHA 2GCYA 2I9TA 4GFTB 1HDMB 3ALXA 4I9WE 4F57L 4IOIA 2FIKA 1RIHL 4GKSB 1KIPA 1OHQA 4RX4A 4O58H 1INDL 2BY3A 4ERSH 5ICYA 4KK6C 1I3GH 4KHTH 3QQ4A 2N1KA 3BQUB 4MCZA 1HI6A 2R23B 3QG6B 4ZOBA 4EVNA 1P4IL 2IAMC 4M6AA 2GITA 1JPSH 4OZGB 5DR5L 2V5YA 3DYPA 1GHFH 5D7JA 4KRMB 3MRGA 4QHMA 1M1SA 5C86A 3LQZB 3OAUL 3U4EA 2VXVL 1T80A 1NBVH 3F58L 3TYFB 4WFHE 4XC3L 4EN3D 5KANG 3ULVE 2RAMA 2DLHA 4J7RA 4X7FC 1O7VA 5DK2A 4LDEB 1YMME 2Q20A 3JZ7A 1NGPH 4ZTOH 4K3EL 5H94A 4PLNC 2Y36L 2LTQB 5HGGS 5I73C 4X8XA 5ETUB 4ZUVB 3W9EA 5FYLD 5IVZA 3MRMB 5F9WC 4XC1H 5DEFA 1B2WH 1A1MA 1I9JH 5FKPB 2Z31D 4FQPA 5A3IC 5C08A 1MUJA 3E6HB 3OXSA 4M8VA 1MCWW 4PJGA 2AXGA 4P59H 2KZ1B 2GSIB 3FCTA 4Z7WA 3PQYE 3T4AB 2NY4B 3B9DA 4URTB 3U9UB 1E6OL 3SPVB 5KVFL 2AK1H 5IG7B 1HEZA 2I25N 1XZ0A 3DMMA 2VIRA 4NCDA 2B1AL 4K7PL 2OR9H 4PUBL 1MY5A 4MA3B 3WYRA 4PTTA 2D7TH 1WUNT 5HYJD 3TT3H 4GG6E 5KJRH 1S5IH 3CFIC 4F7EA 3EFFB 3EDEA 4OLEA 1FNLA 3SY0B 1MELA 4YXLH 3F5WB 3MNWB 3BYYA 4ZFOA 1U3ZA 4NYLA 4DZBA 1FNEA 2V2TB 1U0QA 2V9TA 3D5OF 4OUUB 4Y19D 3BVNA 4NQCA 4MXQD 4U7MA 2ICWI 1OD7A 4YX2H 4RA0C 4JKWA 3CU7A 3ES6A 4XBPA 4WO4B 4P4KC 4P46A 2DTSA 3LPGA 5LAXA 5T3ZE 3O8XC 1D9KC 4JFEE 1CE1H 1CZ8H 2GCYB 2X4RA 4MX7B 1EUUA 4IOIB 1ZGLA 3RVXC 3CFKA 1QEWA 4GBXB 4PRPD 3FZUC 3PXHA 3PWNA 1JNHB 3HUJA 2XKUA 4BH7B 2P7TA 5ICYB 3B4NA 4UDTA 1OCWH 3OXRA 4WENB 4HULB 4XMKH 4YPGA 4C4KO 5I15H 3G9VA 4NM4H 4RGMC 3WKMH 2X1OA 1OVZA 2XRAL 1NJ9B 1KN2L 2GITB 2YSSA 3HZVB 1J7VR 5I1GH 1I8KA 4ENED 1NEZG 1CDCA 4X80H 4KQ4L 1HHJB 3MRGB 1BVZA 4QHMB 3BE1H 5HDLA 3UDWC 4NFDA 2NX5A 2XZCH 3ARFD 4ZQKB 4FMFA 2PO6C 4UB0H 4X6BB 1UXSB 1U3HA 2Z91B 1NL0L 1MCWM 1C5BL 1NCWL 5H94B 3FONA 5JZ7C 3ARGD 4JLRA 1Q1JH 2QADD 3MYJA 5CCKL 5ADOH 2KKQA 3G6AA 3IAQA 4W6WB 4KKLC 4RFNB 5FCUL 1ZA6A 4G6FB 3QEHA 3T4YA 1J9CT 1HSAA 1MHPL 4PLKD 5SV4A 2B20A 3CZFB 3QG7L 4Y5YA 2D31A 4DVRH 3C8KB 3LRGA 1EEZA 3VDCA 1JF1A 4MA7H 1HILB 2FNBA 3VXUA 3SKUD 3UTOA 5JLZB 3G5VB 3V6OA 5AZEL 2BRQA 3MJ6A 1HEZB 1J8HA 1Z2KA 5DD3L 3KJ4C 4XBEL 2IG2L 4XWOC 4LVOC 2BNRD 4OFYD 5E7FA 4ZO9A 1YEEH 4M93B 3V4VL 1VGKB 2OL3H 3GSVB 3SE4C 2VDKL 4Y4FC 4H88H 5ID0B 1BZQK 3KPQA 1ZLVH 1SHMA 2C3VA 4ZFOB 2QJDA 5EOTA 4NYLB 4UOJA 3MBEC 4X9HA 4EBQL 3BEWA 5ID1A 3IJHA 3T0EC 1N6VA 3HKFA 1JNJA 3RI5F 5CGTA 1RUAH 3QXTA 4M03A 1B3JA 2K3TA 4QOKE 1IQWL 4XBPB 4ETQA 2F58L 3IKCA 3BUYA 1T1WA 4P46B 4QXGH 5L9DH 2Q76A 4XAKE 4WV1A 2F54D 2X42A 5E8EB 1MQKL 3TIEA 4BQ6A 5I74C 5KSBF 2C1OB 1QEWB 3B43A 2DQCH 2F9BT 4X0KA 5TH2A 5I76A 5E5RB 2F19L 4ZS7L 1OQXA 3QDME 2FRGP 1A4JB 3WHE0 3STZB 5DWUL 2VAJA 5F71A 3IRPX 3OXRB 2X4UA 5J13C 4QHUB 4HKBA 1HQRB 4JREC 4LIQE 5L6YL 3VRLE 2GIYA 2BX5A 1EGJH 5L0QB 2YSSB 2OBGA 4MA8L 2ITDA 1E6JL 1PGRB 5EOQL 4JJ5B 3ARBD 5K9KA 5E9DD 4QXTA 5B3JF 4PTUB 5EC2B 1BD2E 5CD3A 1ITCA 5IFHL 3HHRB 5IV2A 4F57H 1OD9A 1GOHA 1RIHH 3QNXA 5E8PA 3AM8A 2DYPD 3FONB 1WJ3A 1YEGL 3BPLB 2M26A 1Y18A 1INDH 3MYJB 1XR9A 1F4AA 4XP9H 1N2RA 2P8MA 5D2NC 2ARWA 3BUTA 5HHQA 3UYRL 3MJ9L 4F7CA 2UWEB 1BVKA 3T4YB 3ZKQD 2XIDA 1P4IH 4Y5YB 2D31B 5F1NA 4AG4H 4EN3C 4MQSB 3PHOA 5DR5H 3L3KB 3BAEL 4UBDD 3QAZC 2XKNA 1K9TA 3GKZA 1GGBL 3O4LE 3UTPE 5C0CA 4QRRA 3MLVL 3OAUH 2VXVH 4O00A 1XCQB 4Z18A 1OWRM 2ENYA 2IAMA 4M61A 5C8JB 3F58H 4XC3H 2Z31C 1DQLL 4OJFL 3K4ZA 4Q9QL 1VHPA 5FUCC 3NABL 4K3EH 2Y36H 2CRYA 4KHXL 2PCPA 1UCBL 1BX2A 4RAVA 2ZPKL 1DQQA 5F7FA 4NOFA 3RNQA 3L3JA 2FGWL 3MV01 2HN7A 4FFWD 5DJZA 2EXYD 4U49A 2B8OT 1X6LA 3MQIA 3CXHJ 5EA0L 3U0PA 2WUCL 5ID1B 3IJHB 1T7WA 2VDOL 1WBXA 4GG8B 2C7UA 1CGYA 3SGKC 2EECA 4U1HA 1PSKL 1E6OH 4ETQB 2HYMA 4J3XA 4MDIB 5KVFH 5BXFA 3IKCB 1KC5L 1T1WB 1KNOA 3RWJA 1IGJA 4PR5A 2Q76B 5GGVY 4PJ8D 1LE9A 2FB4L 5T3XL 2IANB 3AVEA 4U4BA 5FK9A 3UBXB 1ZLUK 5TH2B 4BKLA 2B1AH 4K7PH 1FFRA 3B2VL 3KPSE 4MXQC 4PUBH 5C6PB 3GM8A 2P5EA 4IDLA 2X4UB 4P48A 4XBGA 3VWJD 1MCEA 2ZUQC 3EYVA 3UMTA 1Z6JT 4NC1E 1DE4B 4OGYL 1V3LA 2EYTA 3ULSA 4G9FB 1AGCA 3INUL 5I75B 1HOCB 1DP0A 1UXWB 3R0MA 2MOVA 4TULL 5JTWA 5AAWA 2ZUXA 5K9KB 1ADQA 1YPZA 1B4JL 5CINL 4CUCA 3D39A 5HHPB 3GGWA 4NQVB 5DMGC 5CD3B 3NBNA 5D2LE 2BNQE 5IV2B 5F97E 3FB8B 4CRPA 5J9PA 3LEYL 1MAJA 1BHGA 5JPMB 3OF6D 3REVA 3S4SA 1Y18B 3QIWD 4P4KA 4ENEC 3O8XA 1D9KA 3E1F1 3QUYB 3QXDB 1N2RB 4FQJH 5IHLB 3EOTL 4X99A 1DANT 1J05B 4RDQG 3ARFC 4FQHA 1CDJA 2XRAH 3TNNB 5D72L 1KN2H 2YPLD 1G7QA 1X5GA 1G7PA 4X4MA 5DJ0B 1KYOK 4PJAA 1YEHL 4M6ML 2P8PA 4NN5B 3H9HB 5C0CB 3VXNA 4L4VD 4GAYA 4JFYA 2XQBL 2FZ3B 3AB0B 1C5BH 1NCWH 4FXKB 5IK3B 1B6UA 4GRWF 1LP9A 4PLKC 1CICD 1XR8A 2PCPB 3UDWA 1DQQB 1PY9A 5I1AA 2ITCA 3RNQB 5CCKH 3L3JB 2PO6A 2YXMA 4UNTA 2QKIB 1SYVB 4H26A 2LAAA 4UNUA 4LP4A 4DK6A 5FCUH 3TZVD 1MHPH 3WIIL 3LHPL 5I73B 3QG7H 4NHCL 1WBXB 5AD0A 4U1HB 2E7MA 1CFBA 4IHOA 4M62L 4S0SD 3QXAA 5EZOL 4RIRB 3NGBC 1KJVB 5DXWA 2P47B 2B0SL 1KNOB 4RSVA 3GSOB 4PR5B 4XMPL 3O3BB 3GZKA 4CNIA 5AZEH 1OQOA 5DD3H 4NKIH 4RGOL 3CSYA 4XBEH 1CLZH 5LGHL 4U3CA 1JZ5A 2IG2H 1OOAA 1BLNA 1U8MB 4U6TA 1UZ6F 5I17A 3RWGA 3D0VB 2WV3A 3V4VH 1RZJC 1OTUD 3L3OA 2VDKH 4PG9B 3EYVB 1JFQL 1XGPA 3B8SA 5EB9A 4QYOB 2EYTB 4EBQH 4X7DC 3LPFA 3ULSB 4EI5B 1A64A 4DEPC 2FO4A 4MLSA 3OX8A 4WFHD 5FOJA 3ULVD 3O9WB 2LABA 1RUKL 1IQWH 1YMMD 5ABDE 5E1AB 3SE4A 4Y4FA 4PV9A 4NFCA 5I66B 4OZHA 2ESVB 3GGWB 3MBEA 2COQA 4XCEB 3QNYB 3V79C 1MQKH 2QQNL 2DB8A 5J9PB 1LE5B 1GCFA 2OR7A 1V7NL 4S11A 1U8OB 5FGRA 4NWTL 2F19H 4ZS7H 3REVB 3F6LA 3S4SB 1PEZA 1JZ6A 5DWUH 4HBCL 3D2UB 3IFPB 4N9GB 3PQYD 4QKXB 5SWQA 1GGCL 3DETD 3ARBC 3OWEA 4X99B 5FDYA 1RZKC 2P1YA 4L8DB 3FMGL 5C0BE 4NQDA 3QA3B 5L6YH 1GL4B 5DF0A 5HDBE 5INCA 1IQDA 4M7LL 2NY3D 1FL6B 1WAAF 4HW6A 4P2YA 5HHMB 4MA8H 3RUGA 3UCRA 1M71A 3H2WA 5EOQH 2P49B 4G8EA 3ZTNL 3PIQA 2P24B 3PE9A 4GAYB 4PGJA 1QRNB 1T7YA 1ZVSA 5IFHH 5D8JL 1KLGA 1RIUH 5E94B 4U1KB 1YEGH 1VFAB 2BSTA 1KJ2A 4KMLB 4ZO8A 5I1AB 4UBDC 4YGAB 2APXA 2PO6B 2OTPA 1FNFA 2L7JA 4P23D 3TNMB 3NIGF 2YOCA 2VLLA 1T1ZB 1NC2D 4X98B 4YXHL 2HFFA 3UYRH 3MJ9H 4XGZA 3H3PL 4U0RC 3HC0A 5T3ZD 2YEZB 4JFED 3ROLA 5F6IC 4NC0B 4JKMA 1XCTB 2IPUK 1NLBL 3BAEH 3QXAB 4DKEL 3EKCA 4OIBA 1GGBH 4XXCC 3MLRL 4MD0A 4MS8D 4XPGL 3MLVH 5IQ7H 4JFOA 4FFWC 4EN3A 2EXYC 1DQLH 4F2MB 4NRXA 3WFCL 4Q9QH 4R4ND 3NABH 3F8UB 3OKYA 3FT4B 5HGHA 3S37X 1VGEL 1JWSA 1UCBH 3EW3B 2OMNA 3RL1A 2ZPKH 1KXVC 1TJGL 4AQ1B 3RWGB 2FGWH 3O2DA 3SJVE 2IWGA 5HYSA 2Z31A 1SJHA 1I4FB 1BWWA 5HDQL 4M7KL 4OZIA 4HUXA 1XGPB 5EA0H 2WUCH 3MCKA 3B9AA 5DJ2B 3L7EA 4OLVL 4PJ8C 2VDOH 2FO4B 3OX8B 3P9MB 4KI1A 4J4PD 3ZE0F 2A38A 1F3RB 1PSKH 1LEIA 5EIIB 5F93C 1AKJD 5EU6E 4OZHB 1NC4D 4RMVA 5HPOA 1WVZA 2IBGA 2FB4H 3Q6GL 4YE4L 3VWJC 1S9XA 5CWSA 5FM4A 5T3XH 1LO5B 5LKNA 4QWWD 1Z9LA 3BT2L 3SGKA 4JFDE 1ZMYA 3B2VH 1ZLWH 4XCNB 5HYJA 1OPGH 1JPST 3F7VA 3KNBA 2RR3A 2HRPH 4CW1A 3VRJA 4L3CA 4NQDB 4ODHL 3LIZL 3P11L 4OGYH 4N0UA 4U6YB 1CFVL 1IQDB 4DQOH 5C6WH 3FAXA 4LPCA 3INUH 2XXMB 1M71B 4G8EB 2H32A 1T20A 1DANU 4TULH 1LD9B 1B4JH 4NQXA 5CINH 1OY3B 4LSUL 4WU5A 1F3DH 3OTTA 1AR2A 2R1YA 3FN0L 4HLZH 5C3LD 1KLGB 4BH8A 5FV2A 4YH6A 3LEYH 3N9GL 4PRPA 4GKZA 1U2CA 3U4AA 1TMCB 5IVXA 2BSTB 1KJ2B 1CGVA 3MZTA 4QY8A 2QSQA 5FO7A 4QOKD 1A6ZA 2VLLB 3EOTH 4Y88A 4XGZB 2DIAA 5D72H 3UPAA 4U33A 4XAKD 1BF8A 2AJUL 5GS2D 1H0DA 3CFBA 4XZUA 3WXVL 1YEHH 1IAIM 4X9BA 4M6MH 4PS4L 3PDGA 1CICC 4DCQB 5A40E 4MD0B 3UXFA 3VXSD 1CXKA 3ARFA 1FZOA 3QDMD 3WLWD 3NIDE 2XQBH 3U46B 2V9RA 4EN3B 4PJGF 1JF6A 3IDMA 4PGBB 3T1FB 3TZVC 3QAZB 2X41A 1IBGL 4PPTA 4Z7WF 5DRZA 3ARGA 3RL1B 5HPMA 2W0FB 5J11C 1C1EL 3C2SA 3CX2A 5EU4A 1YQ2A 5HYSB 2Z31B 4HD9A 4X6CF 1ZEAL 4HUXB 2DI8A 3WIIH 4PJHE 1BD2D 3LHPH 4NHCH 4Y4KB 1BJ8A 5JXED 4M62H 4YPJA 4OF7A 3CUPB 4MSWB 5EZOH 1LEIB 4XMLL 1L0YA 3O81A 1QBBA 2B0SH 1CXHA 5IR1B 3MRRB 2DIBA 4XMPH 3L9RB 2QL1A 3WSQL 1NH6A 1XF4A 1OTUC 3WHXB 1KG0B 2NNAA 4OLUL 1INEL 4RGOH 3BN9D 1CTOA 2MTPA 1JGVH 2BNRA 3ULVC 4OFYA 1A9EB 3M17A 2XY2A 1CVRA 3F7VB 3KNBB 2VDLL 3GJEB 2VQ1A 1EO7A 1KJ2L 4I4WA 3UTPD 1YEDA 1JFQH 3O4LD 1CBVL 1S7QB 1AGEA 1A7QL 3O6KL 4NZRH 5JIIA 3PV6B 4L8CA 4Y19B 2CPCA 3FQUA 3OKDA 1RUKH 3TYGL 2H32B 1T20B 1MVFA 3HUJF 4KK5D 3QUXD 5JDSA 3CAFA 1GH7A 4Z78A 4E9LA 2BMKB 3U7WL 4IMLA 2F54A 3DETC 2QQNH 4LVNB 1HHHB 2C3HA 1X3DA 2OQJB 5I8EA 5BQ7A 3EO9L 2NLJA 1V7NH 4QTHB 4NWTH 2NY3C 3GFUA 1N3NA 3HE6D 4L4TB 4LPTA 1Z0MA 4HBCH 4QY8B 1PJ9A 3NOIA 1GGCH 5FO7B 2F53E 2VQTA 3CDCA 4UAOC 4CMHC 3P9LA 4M8QB 1R3JB 4XP4L 3FO9B 4M7LH 1QPPA 4D9LL 5E4IA 5TE4L 4NJ9L 5B39B 3ARBA 2G9HA 1F58L 5E9DA 3I6KB 4N8VB 2W9LA 2BZDA 4WW2B 1A6PA 3KR3L 3KPSD 4MJ2A 3WLBB 2QQQA 3CGTA 3SE8L 4LLQA 2GTWA 4P23C 3P3YA 5IW6A 4PGZA 5C0JA 3ARZA 5D8JH 3JWDC 4NBXB 1KELL 1JNLH 2DYPA 2VE6B 3ARGB 2QADB 3B9KD 2PW2A 1FFQA 3BHBA 4PLJD 1KPVA 5EU4B 3AMKA 1H3XA 4JM2B 5BS0E 3P9WB 4MS8C 4YXHH 4KDVA 1ZT1A 3OKNA 3ABZA 2BOCA 5BW7C 5C9KA 3FO1A 3H3PH 2CDGA 4U6HB 3VMOA 5D7KE 2BNQD 3RIFF 1RD6A 3HG1E 1NLBH 4R4NC 3GJFH 4DKEH 2OCFD 1MY7A 3PP3H 1LEKA 3MLRH 5DQ9B 4XPGH 4F33B 4PJCA 2ZSVB 5E1HB 1KUMA 5ANME 1MQ8A 1JNNL 4JPIB 1XGTB 3RVWD 3WFCH 2P46B 3KLAA 4XXCA 1VGEH 3AS2A 5E2TL 2NCMA 5BZWB 1TJGH 1F6FB 3DTXA 4J4PC 2W60A 6FABL 5D5MA 1BOGB 2UVFA 4BSWB 3LSOA 4P2QE 4WHYG 5IVNA 5HDQH 4M7KH 1FZMB 1YEDB 4RFEB 4WI4A 1A6TA 1OAYH 1AGEB 4L9LC 5JW4M 4L8CB 3V4UL 2KUTA 4OLVH 5DMYA 1RJLA 4PB9L 5GISH 4YBQD 3OKDB 3FQUB 4QWWC 3Q6FA 5EUOE 2YD1A 5IROC 1I1RA 4Z78B 1BPVA 4JAMA 4IMLB 1AQKL 4PJ8A 2F54B 3SO3B 3Q6GH 4YE4H 3MGOB 1O7SA 3K8MA 5JW3L 3QXUA 3BT2H 5I8EB 1S5HB 3ZL4L 5BQ7B 1Q9WB 1HH9A 2NLJB 3C6SA 4BFBD 4F8TA 4PREA 5IQ9A 4HG4K 1XH3B 4Z7QE 4GMTL 3O2WL 5CJOH 5C09A 2RHEA 1P6AB 3VWJA 3QIUD 1AO7E 1CFNA 2JIXB 4ODHH 3VXRE 3LIZH 2FO1A 3KVQA 3P11H 1CFVH 5FYKU 1BQUA 5SWSE 2EEBA 4LSPL 3LS5L 1S7WA 4U1JB 2G9HB 3QHTC 1FP5A 5E9DB 1K3ZA 4XH2A 1M6OB 1D5IL 4LSUH 3SKNA 4LLQB 2GTWB 3FN0H 3K80A 3MLZL 5F1KC 5IW6B 1NUFA 1PG7X 4YO0B 3QQ3A 3R06B 5D1ZB 3RIAK 3QDJD 3N9GH 4RRPG 2DYPB 1A7NL 3OF6A 3QIWA 1RURL 2PW2B 4JRXE 3BHBB 1KPVB 4PRBB 3UJIL 1PZ5A 2R1XA 4HH9A 1ZT1B 2BOCB 3WLWC 3FO1B 2CDGB 4PJ5E 2BSED 4PGDA 2YPLA 3F65A 1G6RA 5KS9A 5HGBB 2AJUH 1YEJH 4UT9L 4NCC2 4AH2A 3WXVH 1Q9OB 1LEKB 4PS4H 2NY1D 3V6ZA 4L4VA 3PWUB 4FTVB 3EO1A 5F6IB 3HPLA 1KCKA 5GJSL 3QPXL 2AQ3A 2YPKA 1IBGH 3TBSA 3QB7C 5C0BD 3KLAB 4LCCB 1CICA 2E7HA 4OBRA 2EO9A 5JXEC 4HUUB 1C1EH 3DTXB 1KCLA 3H3KA 3RBSA 2W60B 3U6RA 3T65A 5GIRB 2QSCL 3LSOB 3EYOA 3WL9A 1NMCC 1RY7B 1ZEAH 3EYUL 3TZVA 1A6TB 4S0TD 3P0YL 4E0RA 2EDNA 2VR4A 2GFBB 1RIVL 4OV5A 5CAYB 3WNPA 5INDA 5IKCA 1PKOA 3BN9C 1FLTX 1LEGB 1JYWA 4HJJL 4XMLH 3UZEA 1FNHA 3MRPB 3MRLA 3PNWB 3PV7A 4CVZA 2FX9L 4JAMB 1GGIH 4G43A 4LSRL 2GEEA 3WSQH 1P6FA 4WWID 3ZT6A 1R24A 4G8FA 3AMLA 4OLUH 1INEH 3DVNB 1HH9B 5F7DB 2BSRB 5HTSA 1JI1A 2BSSB 1YPZF 3MJ7B 3STLA 4IRZL 3VD4A 4KK5C 3QUXC 2VDLH 4P5TD 3NAAL 3VWJB 2AQ2A 2CIIB 2BC4A 4R9HA 1KJ2H 1MJUL 2GW5A 1A7QH 2AXFA 5F89A 2B7DT 35C8L 5EG6C 1WISA 2YS4A 1S7WB 3TYGH 1YMMA 5F96L 4NZTH 1BM3L 3HE6C 3I9GH 3MRCA 4OCSL 3U7WH 3VH8G 2Z4QA 4HIEB 5I1HL 2EH8L 1EERB 2OM5A 2IPTL 3SJVD 5I2IA 3KWWA 3PWVB 1CR9L 1NDMA 4MCYB 4J3VA 4YFLF 5B8CB 2IGFH 1I1YA 3WEXB 4HKXA 5FA4A 2DJSA 4PJAF 3QIWB 1G84A 1JZ3A 2XWJA 3SKOA 3LS4L 2VL5A 3PQYA 1PZ5B 3VMPA 1EAPA 3KXFB 4YHNB 5KSBE 4HH9B 3EZJB 5EU6D 5I1CL 3CFDB 4XP4H 4PGDB 3ZE2F 1PX3A 2YPLB 1LP9F 2W1NA 5KS9B 1FFOA 2BERA 2Z93A 1ZK9A 4LF3A 1U8NB 4D9LH 4AH2B 5TE4H 3QT2A 4LRNL 2GAZB 2JCCE 5TDNB 4NJ9H 1MCNA 2B4CL 2OI9B 4FXLA 1F58H 4JFDD 4NC1C 4ZMAT 4EXPX 3BDBA 4L4VB 3B9KC 3KR3H 2OMBA 2BJML 3SE8H 4GG6A 3G6JF 1LO4L 1M05A 3HPLB 1XEDA 2VKXA 4NN7C 3IDNA 1KELH 4KFZC 1AGBA 3TBSB 4C59B 1T04A 3BI9X 1HNGA 3EUUA 4DAGL 2OTWA 5KW9H 2GTZB 4P23A 3VXME 4UTBL 1I3UA 2ORBL 2ZSWB 4YWGL 1NC2A 3WL9B 2VOTA 4POZD 3S36X 3TZVB 2RCSL 1GOGA 1KB9J 1N6UA 1KCVL 1NANI 4JFEA 3ORJA 2C4FT 2UUDH 3RVWC 2NW2A 3ULUL 4BUGA 3VI4E 3ARTA 2X89D 1RQ5A 3LB6D 3U83A 2X5PA 5DO2C 5DUML 5BW7A 2W0KA 4G43B 3ZYOA 3SGDI 1AE6L 2H32H 3VG0L 1JNNH 1ZHKA 4Y5XC 1UM4L 4Z76B 2JB5L 4KVCL 4Y8AA 5IW1A 3CNKA 1JYXA 3DX7A 3MGTB 4YBQC 3DWTA 3QEQB 5CJ8A 1RZFL 4RCAA 5BRZE 4CMMB 6FABH 1WZLA 4KWUA 3VE0A 2G75A 2W91A 4UT7L 3HNSL 3HR5A 1UG9A 1W8OA 3C8HA 3V4UH 4PB9H 3LD8C 3OZ9L 1FCCA 4TNVF 4J4PA 1D5BA 4AENB 1TCRA 1AKJA 3PWJA 3L3HA 5IBLD 1NC4A 4LAJH 4JHZA 4L9LA 4CVUA 1AQKH 5E2VL 3QIUC 1F00I 4PJ7F 4DOHB 5I2IB 5JW3H 1NDMB 4P2OB 1UWXK 3MMEA 3ZL4H 4DFHA 3RAJL 1WQVT 2BCKA 3EIFA 5GS3A 3GSXA 3TV3L 3RUGF 4HKXB 4PJDF 2P4AB 3MJ8A 1RI8A 2XN9B 3O2WH 4GMTH 2XWJB 3MV8E 3SKOB 4J12A 2VL5B 3PQYB 1U91B 4XNXL 4QF1B 1MAKA 4MJ5B 2R56L 1D6VL 4ALAL 1IM9D 3RWCB 3GMLB 1NGXA 2NY3B 1FFOB 1SQ2N 2Z93B 3GMQA 4LSPH 3LS5H 4ZUUA 4NRYA 4PJFE 4XNMA 2NY0D 2FIRT 4PRIB 4CMHB 1J1PL 1D5IH 2I60L 5IB4A 5D93B 1YDPA 4R97B 1M05B 3MLZH 1JWMB 2GQHA 4BK4A 1FGNL 2X1WL 1AGBB 2MCG1 4X9IA 2H8PA 1T04B 1A7NH 2HWZL 2Y5TA 1RURH 1FVEB 1J0ZA 4MA1C 2W07A 3UJIH 2FHFA 2VLME 4QOKA 4OCLC 3WIFB 1IGTA 3MPCA 3LN4A 3T77A 4YR6B 4OQ1A 4XRCA 3QXWA 1REIA 4WI7A 1QBAA 4MQ7B 3WJJA 5A1AA 5I1IL 3Q48A 2NW2B 5C0AE 4UT9H 2Z8SA 4NSKA 1XF3A 3X12B 3VXSA 1IEHA 2J4WL 3QDMA 4OZIF 3JTTA 5IBTL 5K93A 2F53D 1CIDA 3LV3B 5GJSH 3QPXH 1EAJA 5FO9A 5GZOD 5IW1B 2JELL 1AIFB 4B7IA 1TVBB 4GRLD 4GXUN 5JW4Q 5BCAA 5CSBA 2ZKHL 3DARA 1KTKE 3WFHA 3GSQA 2QSCH 3LQAC 1WITA 3X3GL 5CEZE 4GRWE 2G75B 8FABA 3EYUH 3MRKA 2XWBB 4AK1A 1BD2A 3P0YH 3VXQA 3AU1A 3S96A 2ZJSL 1U3YA 1RIVH 5JXEA 3BPCA 4LGSB 1TETL 1X5XA 3IETB 4HJJH 4TRPL 4U1SA 5IFAL 1TNMA 1TPXC 2FX9H 1NC4B 4L9LB 5L2KB 4LSRH 5A2FA 4S1SL 5BS0D 1KB5A 4Y8DC 3MMEB 3MTRA 3ETBF 4QGTA 2D7NA 3VFVB 5L8JB 3MJ8B 3TPKA 5JPNB 5D7KD 3JV5A 3DNKA 3HG1D 1Z9SA 1UKQA 1SJXA 1UM5L 2ADJB 1YYLL 1QP1A 3NAAH 4JY4A 4PJ9C 3GMRA 4FFVD 4YFDB 1SVCP 3O4LA 1MJUH 5E4EB 3BDYH 5A16A 2X70A 2QLVB 1SBBA 4ORZC 5GGUA 4BUHA 3VCLA 1DBJL 5TDOB 4C54A 5IVXF 3IRZA 2DF3A 2W65A 35C8H 3IDIB 4K9EL 4ZUUB 1OLZA 1UQSA 4XNMB 3QUXA 3VGFA 5F96H 5GRZA 4D3CH 4IM8A 1E28A 1AGFA 3Q5OA 1OARL 1BM3H 4OCSH 1J1XL 1ZHBA 3IAPA 4K8RL 4FA8A 4X4ZA 4IBLT 3IU4L 5HHOE 2EH8H 5I1HH 4BYHA 1YDPB 2IPTH 5BOZG 2KH2B 4KZDL 3WMSA 3MLXL 3GRWA 1CR9H 1YC7A 3IXTB 1A4KA 2ILLA 4P2QD 5DC9B 1AJ7L 2H8PB 2YPVL 5IEKA 1HZHL 1XGUB 5GRVL 3HE6A 2Y5TB 4IRJB 3LS4H 3MCLL 4JVUA 1HWHB 3GEWB 4QOKB 3H6JA 1BQHB 1IGTB 3LN4B 3T77B 1KT2B 3WCYA 5I1CH 1T83C 1SBSL 1J1OL 4HG4J 4GUPB 4F9LC 3TO2B 2EDFA 3ZDZF 5BV7C 3NFPA 3EOAB 4LRNH 4P2RE 2B4CH 2HVKB 5DJ8B 5LBSL 5ESVA 1IL1A 3VXSB 2CUMA 3RL2B 4UUJB 3EGSB 3KPSA 3QDMB 3SDAB 5A2LH 2CR6A 4I2XE 5L88L 2C4FU 3CLFL 3RJQB 2EIBA 2IPUG 4KI5E 4POZC 1AO7D 1VEOA 4OTXL 4YJZL 3VXRD 3CCHA 3MRJA 3S37L 4F15B 3B9KA 3MUZ1 4YHIA 5SWSD 3GHBL 4DAGH 3CVIL 1KLUB 3LB6C 4UTBH 4CDHA 5I8CB 4L29B 2ORBH 3L1OL 1U8KA 4YWGH 5TQ0H 5LQBL 8FABB 3KS0H 2RCSH 1N6QL 3RTQB 2DMKA 1AQDB 1EX0A 1KCVH 1NAMB 1K4CB 5D2LA 3FAWA 3J8F7 2BNQA 4IOSD 4OKVA 4ZOAA 3ULUH 3RHWK 2Y07L 4HUKB 4Z7VE 4QNPE 3NIGE 3STBA 4U1SB 4OGZA 3L5IA 2CK0L 1JVKA 5DUMH 4OCMC 4GOSA 1MOEA 4DK3A 1AE6H 2EYRA 4JRXD 4PP1D 3VG0H 1F2QA 1QA9A 1BBDH 2FYYB 1KB5B 5D1QB 1EEQA 1UM4H 3R4DA 5E6ZA 2V2XB 3L7FA 3QO1A 2JB5H 3BEVA 4KVCH 4PJ5D 4M7LT 1X7QB 4X6EA 5F1OB 1RZFH 1D3CA 5FYJE 4JY4B 3S5LG 3GMRB 2FEEI 4Y5XA 2VMFA 3MRIB 4XNUH 4UT7H 5IBLC 3HNSH 4Q74A 1YC8A 1N8ZA 4U1NA 4KRPD 5GGUB 1NGZA 3BIKB 2YR3A 3OZ9H 1UQSB 3QUXB 3UC0H 3PHQB 3EDDA 1E28B 4K94L 1IE5A 1ZHBB 2IH1B 2LE9A 3TEUA 1MCJA 1EHNA 3GI8L 4MAYB 4XB8A 5E2VH 4G7YH 3DBXB 3G04A 3GIVA 5FA3B 3RAJH 3TV3H 5FHAL 1SVZA 3L3DA 3HE6B 2EKSA 1WC7B 3A6BL 4XNXH 3OKOA 2NY0C 1T22B 3QIUA 4PJXB 1KCUL 4FG6D 3DXAE 2R56H 1D6VH 4ALAH 2FSEA 5CZKA 4G9DB 1JV5B 1S7UA 2LFGA 2WP3O 3FN3A 1L0XA 3IDYB 1A6AA 2BVOA 5DS8B 1NAML 2IBZY 5E5MB 1NFDB 1J1PH 3HZKA 3KG5A 2I60H 4ZPVB 1T0NA 2F8OA 4HCRL 2A74B 2OP4H 5E8OA 1S3KL 2ZCLL 1FGNH 1FDLL 3QDJA 2EDQA 1W0YT 1V7ML 2HWZH 4P5KB 5ACZB 3MRJB 1KB5L 3FQNA 1U95B 1I9IL 4MD5B 1KBGL 1IFHL 3ET9F 4LEXL 4NKOA 2XTJE 4PJCF 5DTFA 2DQDL 1PQZB 3V5KB 1DTUA 4Q9RL 4NWUL 1MCIA 5LXGL 3MNVA 5D2LB 4N5UA 5I1IH 1TQCB 5LWYL 4KUCD 5HI4D 5DVMA 3L6FB 4OKVB 3V2AR 1QSZA 5H37H 1NGYB 5IFJA 4H5SA 5D5MF 4GRLC 2J4WH 4EI6A 5IBTH 1QA9B 4ZNCD 1I7RB 4WGVB 3UTSE 4DZ8A 2EDBA 5C0BA 3BEVB 3IJSB 2XOTA 2JELH 3MNZB 3RVUD 2ZKHH 2UYLA 1KXQE 4UDUA 2A6IA 3X3GH 4Y16D 4F3FB 2XPGA 3RZCD 3HLAB 1M4KA 1KTLA 4U1NB 4HFUL 5DVOA 2ZJSH 4WNQB 1NGZB 4HKZA 1LVEA 1NEUA 1J12A 1TETH 2ZNWA 1GRWA 3ECBA 1DEEA 2ICEA 4TRPH 5IFAH 2X4SA 1GZQB 4R96B 3U1SL 1L7TL 1IT9L 2GJ6E 4S1SH 3VGBA 3EBAA 3LD8B 3VXMD 3DUHA 4HKJA 3G04B 2Q8BL 1F4YL 2CJUL 2CKNA 1CFSB 2EKSB 4RBPK 4EXKA 5DFVD 4FZEL 2MQ0A 4CVXB 5ADPL 32C2B 3WUWG 3OKOB 2XICA 1UM5H