3ULVC

Structure of quaternary complex of human tlr3ecd with three fabs (form2)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
210
Chain Sequence
SVLTQPPSVSVAPGQTARISCSGDNIGSYYVHWYQQKPGQAPVLVIYEDSERPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSSYDDPNFQVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
publication title Lateral Clustering of TLR3:dsRNA Signaling Units Revealed by TLR3ecd:3Fabs Quaternary Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ulvC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ulvC01
3VGHA 1WZMA 1DBML 5I1JH 3OR6B 4FQJL 4N9GB 4AENA 3T0AA 4IDJL 3HI1B 1FL5A 4LRIC 4H5SA 1MHHA 2ZNWA 3HB3C 3TA3B 2ICWI 2HRPH 3QFJB 1RMFH 3DRQB 3EYVB 3LB6C 5J13C 5KW9H 1F2XK 1FFNB 1EHLL 3QDGE 1WZLA 3LHPH 4MD0B 1A22B 4L4VA 2MTPA 1BHGA 1RUQH 4XP4L 3HPJA 4NN6C 1FFOB 3MRBA 5ITBL 1I9IH 3PHSA 5CJXC 3PDGA 5TGBA 4XWGL 5EWIL 5FGCE 4RQQA 3FJTA 1FDLH 3QRGH 3SKMB 1ZHLA 1MJJB 4GBXC 5CGMA 4QY8B 3PQYB 1M71A 2IPTL 5L7XL 4LSQL 4XWOC 1GGYA 1VKXB 1UWEH 3QG7L 1A7NL 1I7TA 1GGBH 1JPSL 1BQLL 4GKSB 5ESAB 1SY6H 1I3RA 3Q6GL 1OP9A 5J56B 3CIQA 1HYSD 3VFPA 1MVFA 4PYHA 4H88H 4JFXA 5GGQH 1ES0B 3EDFA 3WFEL 1HYRC 3BIKA 2K3TA 4XAKE 2NLJA 1QFWM 4CN1A 2PTTB 4YXLH 3ULVE 1ORSA 1A14H 5L9DL 1YNKH 1QEWB 4PJXE 5B8CA 4OCXL 4Y4HC 5EUKA 4WGVB 3CFEA 2JB5H 4QNPE 2WQRA 4J6RH 4G3YH 5HVGB 5IBTL 1K6QH 3DIFB 1MCKA 1X5YA 5FYLL 3Q2CA 4N0RA 2W1NA 5CKGA 4R2GD 1OW0A 4D8PA 3OGOE 4IRSC 4JDZA 1VFOA 1HXYB 1FFRA 5KTEL 3RWIA 3B43A 4M7LL 1ONQB 4HWZA 2WNGA 5I74C 1NGPH 3WIFA 2VDRL 1RJZA 1IEAB 4LMQE 2CLRA 1E28B 3TN0B 4DGYH 4ZTPH 3QIWA 4JO4H 4WI2A 3P9WB 1ZLVK 4Z0BL 1QTYT 4XNUL 3B9KA 5GGVY 3SGKC 3ZDYF 1Q9KA 4GG6F 3KXFB 1RZFH 2GK2A 4TVPH 5DLML 2YUVA 5F1NA 2C1PB 3SHSA 3MOQA 1BZQK 4YK4B 1QACA 2HJFA 5JW4R 5CBAB 1NLDH 2ATKB 3HS0B 1NDGB 3NGBC 1S7QB 4J7RA 3HCVA 1CICD 3UTSB 2DYPA 3AS0A 2LAGB 5DD1H 5DGRA 1GGIH 2HMIC 2C3HA 4HXBL 4LKCA 4F7CB 4JPVL 4F33B 2DKMA 4I3SH 4X7EC 1QPXA 1MCOH 3L3JA 4HUNB 3DX9A 2ERJB 5SWSD 3RVXD 3QO1B 3UC0L 3NZHH 2O5YH 4C56B 1JNJA 3LEXA 4KROD 2A77L 3VXMA 3S9DB 5HXMA 3V5HB 5FUZL 2MQCA 4LL9A 1HXMB 4RFNB 4PJIA 5SWZE 4WW2B 5DD6B 4IEFB 4GUPB 3ZTNH 5HHOB 4EZMA 3CFIC 4UINL 4QOKB 3FQWB 4L3EB 4N68A 1KB5B 5F8RC 4TTDD 1UXSA 5FEBA 4OCWH 3MLWL 4P9MH 5SWQB 3ARBD 3OPZH 3V4VH 1PVHA 1GPOL 5EPMA 1PY4A 2ZP0T 1ZT4A 1PLGH 1JNLH 3P40A 1KCUH 4U1IB 4ZS7L 3K1DA 4NIKB 5T3XL 5FA4B 4MVBC 2PW1B 1IAMA 4P2QB 3IYLW 4WIQA 4AMKL 4HFWA 5JIPA 1MQKL 5KSAC 1FNHA 4YBQC 4RAVB 4YE4H 4OZHE 1EEZB 3QFDB 1C12A 1LP9B 3QJHA 4PRPA 2FJHA 4EI6B 1DQQB 1X7QA 5IEKB 3EO0B 3EOBA 1QLEL 5JDSB 2J8OA 5JHDD 3SPVB 1VFAB 1ZK9A 1J1XL 3W9DB 4N8CL 5CHNB 1R5VB 3M1BB 5J6HA 1NMBH 2DQUH 4FQ1L 4RDQG 5JORB 1XIWC 1HHIB 2YD3A 3WNNA 2V2XB 2C26A 3TNNB 3BE1L 3VJ6A 4ZUVB 4G9FA 3N1MC 3CH1A 4Z77A 2FO1A 5F7DA 4IIQB 3OKEA 2Y7QB 4K94L 1U36A 5DEFA 1MCJA 3BYYA 1PG7H 3VXUA 1RULH 3QHFH 1XGPA 4JO3H 5CEZE 4MAYA 1K8DA 1CE6B 5EO9B 5HGBB 1CVRA 1UM5L 4WUUA 4O5LH 2R0KL 4NNPL 3D5OF 5C9JA 4JY4A 5L6YL 1MRCH 1PY9A 3L9RA 4K3DH 1AD0B 1EO8H 5DSCA 5J3HD 5HYFA 3H9ZA 4KKAD 2VLKA 4QF1B 4W70A 4G80A 5LBSH 4NRZA 3H9SD 3ES6B 3BP5B 3F12A 3CNKA 2Z91A 3EJJX 2PXYC 2ICWA 5CP7A 5ABDE 4S1DD 4YHNA 5DK2B 4NOFA 4LCIH 2BZDA 4R26H 2V5MA 1XAUA 2Z8WC 4UQ3B 3FFCE 4OGXL 1T04A 5IEHB 3S8WA 5TE7H 3RDTC 5I19L 3FN0H 3BH9A 3AB0C 1A6AA 2AJSL 2XZAH 3O2VL 1X5ZA 4TYUA 3ULUF 4WWKB 1Q9WB 3RL1A 2DQGH 3KPLA 4LDLB 3CCHA 4IMLA 1NGQL 2Y5TB 2YA2A 3HI5H 1OLZA 3SDDD 3EOYG 4V1DA 5HJ3B 1U3JA 3ARFA 3T0XA 1FV1A 3TZVB 3MV9B 4RDQF 1EJOL 5IFHL 2DI9A 1R3IH 1MHEA 3VXSA 2Z8SA 1IGML 1IILE 2D0HA 3SE9L 3WFCH 3ORJA 4AT6B 5C0IB 5IB3A 2GI7A 3ULUL 3MCLH 5FO9B 4GAJH 3S88L 3EJZC 1WIUA 2Z93B 1NCNA 5C08D 4U6TA 1A4KA 1DQDH 1D6VL 3D2UA 1EJ6A 2NXZB 3DX7A 3BD5A 3QG6A 1U3HA 1HILB 5I1KL 5BZWB 1XH3A 3F7YA 3FOMA 1JZ7A 2X2YA 1X4XA 4KXZH 3ULUD 1Q9LB 1FZJB 3PABB 4LVHB 3PWVB 4NRYA 5D7IE 5ESQB 3CZFA 3ZT5A 2GJJA 4GMSL 3ARXA 1UWGL 4PRHA 1AXTH 1OAZL 2H8PB 2IFFH 1H5BA 2PCPB 1PGRB 3X3FH 1A02N 5A2LH 2EXWC 1SMAA 5DS8B 1IFHL 5FHBH 3F65A 1SVCP 2ESVB 4UMGA 1IC5L 3IDIA 4GW5A 5EU6D 3WIIL 4EUPB 3BUTA 4DOHB 1CXKA 4P5TB 4KKLC 5ACLA 2AEIT 2XWBA 1KT2A 2OK0H 1U8JA 1F4AA 3HFML 4JRYD 4OCSL 2EYRB 4MZ3A 1IC7H 5T1LD 1M7DB 3U2SA 1HDMA 5JHLH 2A83A 5DVOA 3I6LE 1CXFA 2P24B 4NBXB 1KCVL 2JCCF 3B2VL 3NCEB 5BZDB 4Y5YC 4LHUB 3TO4B 2VISA 4JHWH 2X70B 4D0DB 3KYAA 1HCFX 5FV1L 5BOZG 4MXVF 1E4WL 2NY4B 4KMTL 4WU7A 4AIOA 1U92A 4F8QA 3DVGB 5TDPB 2QADC 2DN7A 4DJMA 3IJHB 4PR5A 5BJTB 1WCQA 1LDPH 3L5WA 1UKSA 4JRXD 2XICA 3VFMB 5FB8A 4GAGL 5IWLC 1YQVL 3HE6D 4MSWA 4RCAA 5E8EB 3ROOA 5E2JA 2BJMH 3FQXA 2DQHL 4CVUA 5D1ZD 1BIHA 1MCRA 1IRAY 5D93C 1A1MB 1GGCL 3OB8A 5CMAB 1FVEB 3FT4A 3VWJC 1QHPA 5DD0L 4JFOB 1BWWA 1CDJA 1D9KA 3I2CH 2H32H 4PJFB 4MWFB 5GRWA 4F3FB 3EYOB 2X9XA 5TQ2H 4FG6D 4DUVA 2CDGB 4FQHB 4NQXB 2NY5H 2Y6SD 4OLZH 5AZEH 4OCYH 1T1XB 4AM0A 2EICA 3K81A 2W9DL 3BW9A 1NFDF 2B4CC 3BGFB 1B2WH 4P46B 2VXUH 1KCRH 1I9JH 3LQZB 3R8BB 5IQ9B 4OD3L 3CSYA 4G7VH 3DETC 1Q72H 1U58A 1FZKA 2HT2C 5F7MC 4R9HA 5AG8A 1YMMB 4NQEE 5HY9A 5CEYB 1MI5E 3F7VA 3VWKA 1ZSDA 5BS0E 4IOIA 4PB0H 1ZE3C 5DURD 3HMWL 1XEDA 3PV6B 2B8OT 1FO0H 5C0EA 1OM3H 5L8KB 3LEYL 4H8WC 2C7UA 1AJ7L 2BXZA 1S7VA 1QRKA 4KRLB 1NLBH 3TCLB 1MIEH 3U4BH 3MRFA 3R0NA 3V5DB 1BFVL 4YUEH 3PWJA 2JLLA 2IMMA 3RP1A 5I18L 4ZS6C 4BFEA 1PDKA 3SKUD 4X4YA 3LKSA 3UTPD 3UPRA 1PZUB 4MGXA 4Q97A 2EC9T 1EMTL 3QH3A 4GXUM 1B6DA 4BKLA 3A6BL 4RMQA 1QVOA 4XCFL 3N1FC 3RX5A 2DQIH 5IIEA 1P84K 2BNQE 3F62A 1IEBA 1LK2A 2YOCA 2VKWA 2XQBH 4G43A 1UZ6E 4QTHA 1XR8B 4QXTA 3EYSL 5C0GB 5F8QC 3BJ91 4MMXC 3LRHA 2X4SB 4Q9RH 1AP2A 2AABH 2DMKA 3WLWC 5TF1H 3UYRL 2O5ZL 3MGOB 4OCMC 1G84A 3BHBA 2QSVA 2KBGA 2V9TA 1CLOH 5HBBA 4OUUB 2EDOA 2MHAB 1WICA 3NFSH 1FYTB 1QRNA 1QSEA 3T08A 3RVWD 1ZHKB 4H25A 4UQ2B 4NM4L 5ACMA 4Z7UB 1Y6NR 4JFHE 3RTQC 3H7BA 5E8DH 4HCRH 4PJDE 2AEQL 4LLWA 4NKIL 4PTTA 5C0BE 1TQCB 1EEQA 3C09B 4MJIE 3MA7A 2X6MA 5JPNB 3FTGA 1MUJB 4I8DA 3WFHB 1BP3B 2OR7A 3RGHA 5K9KB 2ED8A 4BFIA 5C6WH 2ZG3A 4ORZC 1TJGL 1MHCB 4Y1AA 3HZYB 4F7PB 4KK9C 3PP3K 1MAML 2GJZB 1HZHH 2NQCA 2DQJH 4Q58C 4YZFE 4EEEA 1IGTB 3STZB 4UOW1 5JIIA 4PV8B 4PJ5A 3VXRB 1MEXH 4RIRB 1II4E 3ZTJG 2J4WL 1J88A 1P7QD 3GSWA 1DBBL 3SKNB 1HN1A 1LQSR 4XMPL 5HGAA 3B5HA 1A3LL 4LRNH 4JN1L 1KTKE 4MA1C 2FJGA 4M5ZL 5HHMD 4HH9B 4P23A 3B4NA 1HI6B 4QHNB 2ZUWA 3MXVH 2WLYA 4UT9H 2BERA 5K33A 1DCLA 1AGDB 5J1AB 1D5XA 1KCLA 3GI9H 3RU8H 2DAVA 3FQNB 2R29L 1KNOB 4UT7H 1RVFL 4P3WA 1WBZB 4I4WB 2CK0L 4M62H 3BZFB 4XP9H 4XPBL 2XTJD 4OBRA 1KELH 4X6DA 3GJFA 5EU5B 1EHNA 2N1KA 3LOWA 4P57A 1Q0YH 3UBXI 5IMKB 2ZJSL 1RJYB 5HI4C 1OARL 1PZ5A 2VN7A 3BZ4B 4Y4FA 2R15A 1FL3B 1MFBH 1S8DA 3WD5H 1CD8A 4WW2F 3FQRB 4OLVH 4PGBA 3WNKA 3P11L 4OKVB 2VDLL 2QQKL 4G7YH 1CDCA 1FH5H 4NUGL 8FABA 4OFDA 5H94B 2ICEA 5KZCB 1Z3GH 2OTWA 5ISZA 4MQ7B 5CJ5A 5DYOB 1IC1A 2NX5D 4FFZL 5DTFA 5MEPB 5ACZA 5C0CD 5D9SB 1WWCA 2E9JA 3TBVA 2VDQH 4WDIA 5DK0A 1B0GA 2G5BA 1I7RA 5E2WL 2DM2A 1KCSL 4Q6IA 3DTXB 3ILPB 3DUHA 5D71H 1L4IA 1A7QH 4KDTA 1TCRB 3T0EC 3E2HB 4X6EA 4XAWH 4ZSOB 1FHGA 1SJEB 3CVHA 3QPXH 1CFNA 4YH6A 4NGHH 4DGVL 1KB5L 5DJCA 3KPSB 3DX8A 4LSUL 2YWZA 1I85C 4YIQA 1UJ3B 1ZA3B 1JGEB 1YN7A 2XN9E 3VFSA 3MREB 4K9EL 2ARJQ 5L8LB 3MNZA 3U9PH 1LGVA 1QO3A 4ZO6A 5IOPB 1AR1C 3U6RA 1HNGA 1SJHB 3FO2A 3MV11 3T0VA 1TIUA 2IAMC 3DXAD 1G6RA 1ZHBB 3O2DL 1JF6A 3T3MF 5K9QI 2B5IB 2H2SD 1C5CH 1CU4H 1OAKL 1A6WL 2OBGA 1IQDB 1L7TH 3HMXL 5KVMC 4MNGE 3UTZA 4JM2D 1ZLWK 1MLCB 2XZQH 3ARUA 5MHSE 1FJ1B 5SX4H 4Y4KC 3QDGB 5I1CL 3BWAA 3VD5A 5HGDA 1U91B 3ZKNC 4NNYB 1AKJB 4KZDL 1CICA 2NY0D 2Z31B 4OB5L 2VR4A 3RKPA 1MIML 2C4FU 3OZ9L 1NMCC 1UZ8B 2J8UE 1CL7I 2KZWA 3L5HA 4W68A 3M8OL 4YR6A 2UZYB 4CAGA 1A9EB 5EC2A 1OP5H 4GQ9H 2ICES 4IRJD 5DJ2B 1XGQA 4DN4H 5KAQG 4OV5A 2OS7A 2NY2C 5SWSA 4EUPG 4PGEB 4RMRA 1KN4H 2QJDA 3GRWL 1T1WA 2F74B 3BPNB 2CIKA 1MOEA 3HC4H 1VDGA 5DUML 5GJTH 3C60D 1I4FA 1RZGB 4ZXBB 3BT2H 1CI5A 2Y23A 4PJAE 4LHUG 2PETA 4I9WD 3KLSA 4L8CA 4PJXB 3DV4A 1YEGH 3VDAA 1KACB 4PP2B 3AU1B 5ITFA 1KYOJ 3C6LD 1BAFH 4M1DH 4XI5D 1AHWB 1S3KL 2R0ZL 3OKOB 5DQ9A 4FQLH 3VH8B 3QQ9C 4K7PH 2A6JA 3KJ4B 3S4SB 1IT9L 4M93C 1C5DB 5T1MA 4RX4A 5TH2B 1KJ2H 4IOSD 1T1ZB 3JV6A 4FXGB 5CD3A 5DMGC 1X4YA 4OI7A 1DBAL 2DTSA 1OD9A 3SE4C 4QRPE 3OKKA 3QUYC 1YECL 3G08A 3WV0A 3RY6A 4XPHH 4ZO9A 3OX8B 2HJKB 3U36B 1YMHA 1IC4L 2DDQH 3F5WA 3PG2A 1E4KC 3L6FB 3U0PB 2V2WA 4P2RD 3D3VE 1KPVA 1ZVSB 3O4OB 4DCQA 3UYOD 2W59A 4X5LA 2VUYA 1Q94B 3QEGL 4YBLB 2VN4A 1DDHA 3BKCH 3P77B 5FGBA 2HG5A 2Q86A 1E27A 3GIZH 4LNRA 1CIUA 2NW2A 4OGZA 1X4ZA 3V52H 1JZ8A 1S7WB 3GBNH 1N2RB 1IGJA 2XA8L 1EAPA 5DUBB 4TNWF 3QDJA 4F8TA 4LCYA 2I9TA 5IBUB 5IB2B 3H6JA 2H32B 4BH8A 2NY3B 3MGTA 3ZHKA 1YN6A 4MXWH 4HUWA 5CUSL 2P7TB 1F4YL 1QD0A 3ZE1F 4U1SB 4P2OD 1R5WB 2VZOA 4RGNE 5E6IB 4Y5VB 1KTDB 7CGTA 3MLZL 1ZS8B 2FEDC 2EYTA 4IRZH 3WXVL 5EIIA 1WGOA 4JGUA 4HBQA 3H9SA 2W9EH 3PWNA 1NAMH 2OI9B 1FLRH 5JO5B 1VFUA 4YNYB 1Y0LB 3T1FB 4K71B 4WY7H 2VAAA 1FRGL 4N0FB 5SWZB 2WBJB 5E5UB 4DN3H 1J0IA 3CLFH 2GSGA 4I18B 2G60L 2IANA 2DWEA 3LAFA 1ZWIA 5I1JL 3PIQA 5FK9A 3IDGB 3OHXA 1FGVH 3FRUB 4U1JA 3LY6A 5I1IH 4EJ1C 4KH2A 2DB8A 2HRPL 1RMFL 3ARZA 5KW9L 3SDDA 3UBXA 1H0DB 4JAMA 2VL5B 3LHPL 2MCPH 3NFNA 4H26A 4P48A 3EDEA 1DEDA 2FX7H 3PV7A 1RUQL 4QHUB 3IT8D 3QNYB 3FL7A 4PJ9C 2YPVH 4OZHB 2DLEA 2XTLA 1WC7B 2EDHA 5CLWA 3WHXB 1VESA 3NIFF 5HSFA 1FDLL 3QRGL 1GXEA 2NY1C 1T3FB 1T5XA 3NH7H 5FKPA 2MNUA 4ZQKA 2BCKB 4B41A 3S98A 5I6XB 3O3AB 3KWWB 2QR0B 5HPMA 3JBG7 2HLAB 2F58H 3G9AB 1FNEB 2CDEA 1UWEL 3FO9B 3ARQA 3MV7A 3QUZC 1ITBB 1NC2A 1U6AH 2FBJH 4YFLF 4KGLA 1GGBL 2FX8H 5E9DE 4OZGA 4R4NC 4U7SA 1SY6L 3BRFA 4YHLH 3PNWA 1K4DB 3LV3A 4H88L 4U33A 5GGQL 1ADQA 3QNZA 3WJJA 3L7FB 5BVJB 1T7WA 3WN5B 3K4ZA 1JTOA 3VE0B 3LMJH 4XCYB 5D2NE 4YXLL 1A14L 4KKNA 4M3KB 1T22A 1YNKL 3W39B 5FA3B 1FIEA 1U8QA 4MB3A 3GSNA 3DO7A 4I48B 4XP6H 3RVTD 1FVCA 4J6RL 4G3YL 4L4VE 2JIXB 4R3SB 1K6QL 5IG7B 3H9HA 5F6IC 4JRYA 3EYQC 5E4EB 1DUYB 1LE5B 5IVOA 2KZ1B 4WHCA 4ZAKC 1A1OA 3FFCB 3DI2B 5D1QD 5INCA 5MEQA 5HYSB 1FCCA 4KI5E 4QT5A 1KXTB 5L2KD 1NGPL 3MO1B 4ZUTB 1G0DA 2OR8A 3MRIB 3GGWA 5KSVB 3G5ZA 3CZJA 5CS7A 1JZ4A 4ONOA 3TVMD 4DGYL 4ZTPL 1FNAA 5ETUB 4JO4L 2C5DC 2BVYA 2CKBA 4DZBA 5HD8D 3TA3C 2X4OA 3RWJA 1RZFL 4TVPL 3L95B 3NN8A 4XHQA 3VFNB 3HE6A 3VI3E 2R23B 1NLDL 2AXFA 5D1ZA 4WV1A 5JXAH 1KBGH 1U41A 5K93A 3T3PF 3RWFB 1JPGB 3LRSB 1ND0B 2QQNH 4HWBL 4FFWD 3GMQA 1CD1A 1GGIL 5DJDA 5BCAA 2SEBB 3KPTA 1MELA 3IGAB 1IZJA 4QTIH 3PJSB 1H3VA 4TVPD 2C3VB 1K85A 2MWCA 4I3SL 4OJFH 2JJUA 4JZOB 1MCOL 4JRWA 4CADB 4U6XB 3OR7A 5FUOH 1M6OB 3NZHL 2O5YL 1FNLA 1LO5A 1MCDA 3BQUD 5E8OA 1K2DB 5L88H 1W72B 3MRHA 5D7IB 1T20A 2V5SA 2X4PB 2DL2A 4G42B 3BP6B 4P4KB 4HSQA 4XC1H 1H3PH 5GS1A 4GRLB 1NANI 1ZAGA 3CXHJ 5DHVA 3ZTNL 3WYRA 1ZT1B 3FAWA 3RKDD 3RGVD 4BSWA 1I1YB 4OCWL 3OJDB 4P9ML 5C70A 3OPZL 3V4VL 4KJWC 1KGCE 4M03A 4YO0A 1PLGL 1JNLL 1HOCB 2MKWA 1KCUL 4KRMB 3ZL4H 4ZOBA 2N7AA 5I17A 1J1OH 1M7XA 1ULVA 2JE8A 3T65B 3HAEA 4OCLC 3TH4T 3UTQB 5LGJA 1OTSC 3OMZA 4MHHI 5A40E 2ARJA 4YE4L 1JWUB 3HE7D 1J18A 4KKBC 5J6GB 3MRRA 1JF1B 1NSNH 3BOVA 3P0GB 4FABH 3MX0A 1OY3B 3H3BC 3TN0C 3MLUH 2X42A 1NMBL 2DQUL 2Y07H 4PJHF 3BO8A 3AROA 3MBED 3ISWA 4NKMA 5B3NA 1JK8A 2K1MA 2R2EA 2O61A 2AP2A 3O3DB 4F9LA 1SYVB 1IAII 5IESH 4O2CB 1FNFA 4YK4C 4MA7H 5D7LD 1DQJB 4PJIE 4EN3B 3ARDD 1PG7L 1UWXH 1RULL 4X6FB 3QHFL 4M7JH 3WJLA 2BSTB 4JO3L 4NKOB 3GMLA 4RBPH 3TBWB 4C83A 3ZDZF 4NOBA 1UKTA 1QQDA 4DUXA 4S2SB 4O5LL 1WTLA 3JWDH 2P44B 5CJQH 1I7UA 2WINA 4G6AC 2G2RA 2ERJC 2R2HA 3GMOA 1MRCL 4K3DL 5DGQA 1EO8L 4DKAA 4Z5RB 3FONB 3VH8G 4HLJA 3VXPA 4L3CB 3RVVD 3G5YA 3DBXB 5FYJU 1QHOA 2P5EA 5FYJD 1GOHA 4TPRH 4OD1H 2FZ3A 5LBSL 3S4SG 4OQTH 1A6TB 1AGEB 3H3PH 2ITDA 2OJZH 3KYMA 3VU2A 3IFPB 4PJCF 5JZ7C 4NQEB 4UILH 3DLQR 1MI5B 2DBLH 4JFPB 4LCIL 4R26L 2E7MA 5BS0B 1QUNA 2WP3T 4CKVX 1HSBB 3PWPE 1DANU 2IPKB 4RFNC 1MCFA 2A0LD 1LEIA 1AGCB 4N0YH 4NN7B 4WW2C 1MREH 5TE7L 1P7QA 3FN0L 4OZIA 1E4XH 1U8MA 3EYFA 2XZAL 4BFGA 2X4QA 3WLBB 5EO1A 4KQ3H 1WBXB 2DQGL 1T7YA 5FAAA 4HPOH 5MERB 3RI5K 4K9EC 1B3JA 3HI5L 4XNQA 3F8UB 2FD6H 4LPUA 4KRPB 3HG1A 5CJXA 1R3IL 4WUUE 2AKRA 1R3KB 3G6JA 3WFCL 5CIPA 5IBUG 4GBXA 1X9QA 4NN5B 5T1DH 2BOCB 2BNQB 3MCLL 4NZJA 4PGZA 4MQXD 3ZE0E 5TE4H 1MJ8H 1YDPB 1U95B 4GAJL 1IAKB 2NY7H 4ODTH 5B39A 1JWMB 2CDFA 1INEH 2R1YB 1DQDL 5T1KB 4YAQA 5BQ7B 2P5WB 4Z7VA 2X9WA 4QNPF 5KBNC 2G5RA 3S36X 5C8JA 3H42H 5DEGB 3MROA 3ZYJA 2NX5A 5C0CA 1OF2A 1TPXB 3SY0A 5T5FH 3NZ8A 1MNUL 2EXYD 4B5EA 3MRCB 3LS5H 2O5XH 3GKWH 4MCZA 1AXTL 2VXVH 2IFFL 4PJDB 3X3FL 4X4XA 4Y4HA 1RK0A 5C0BB 4LCWE 3W0WE 4OF0A 4GRWF 5FHBL 3T0ED 3U46B 4MJIB 2W92A 4CU7A 3PE9A 3TPKA 5CZKA 3V2AR 4YDIH 4V1DE 3R0MA 3TM6A 2OK0L 1TZHB 3OF6A 5D2LF 1IC7L 4IRSA 5JHLL 4ZPTA 4M8QA 2HVKA 5CEXA 4KVCH 4U6YB 1CWVA 4XXCA 4PLKC 1EHAA 4P9HH 4JHWL 1LD9B 1T5WB 2VITB 3P4OA 4NQDD 1YQ2A 4PJEE 5JIKA 5E2UH 1I8KB 1OB1B 4I0CC 3UAJC 5F7YC 2LU7A 4JM2A 1TTUA 3OKMB 3ZKSD 2J12B 4TULH 5CJBA 2X4TB 4HHAA 5I1HH 4WWKC 4FFYH 1LDPL 1IVLA 4OZFH 2IADB 1NCWH 1UT9A 1U2HA 2B7DT 3TZVC 3W81A 4PRHE 2NNAA 2VLRE 1OSZA 2BJML 1I7ZA 1W0VA 2W0FB 3MRDB 4NQSB 4AQ1B 4KI1A 5DVKA 2FH6A 1AXSA 1OGAA 1MVUB 1OGTB 4H1LH 5IM7A 4ZPVA 1J10A 2K9UA 3I2CL 1W8OA 4KUZH 1RU9H 2OL3H 3O9WD 4MD5B 1VCAA 1NEZB 3TH2T 4NPYB 4PRAA 5TQ2L 2VQ1B 1WJ3A 2IBZY 4WEUD 5I8EB 3C08H 15C8H 3CUPB 2NY5L 3N9GH 3FKUS 2NXZC 4OLZL 5AZEL 4OCYL 3ARGD 4QRUB 4DGIH 2X1WL 3KPRA 3C60A 1JWSB 1CXLA 1B2WL 4PRBB 3R1GH 3EGSA 3P9MA 4LNVA 2VXUL 1KCRL 1I9JL 3X17A 2GQHA 4G7VL 4LVHC 2W60A 4W6WB 6CGTA 1Q72L 3DUSA 4Y2DD 4JJHA 1BD2D 1YNLH 5HYSG 3L3HB 1JUFB 3K46A 4X9HA 2FYYB 3CFKA 2LVCA 3C6LA 4PB0L 1LNUB 4K3HA 1H3XA 3I02B 4ZUUB 2ORBH 4PYGA 1RUKH 3OJMB 1OAXH 1FO0L 4OZHF 1OM3L 1T0MB 4JFFD 4CN4A 3QRFM 2YZ1A 1XF4A 1IAIM 4P5TC 1NLBL 1MIEL 3I75A 5C0ND 5IT2H 2XN9B 4K2UH 2YEZB 5CZXC 4YUEL 3SCMD 4PJBA 1F97A 3B9AA 4YHIA 5DVLA 4OV6F 5C07D 5KSAA 1KJVB 5IFJB 4ZO7A 2EC8A 2Q8AH 2FWOB 2IH3B 4Q7DA 2EDFA 3O4LD 4X4MA 4TRPH 3TO4C 2YBRA 2MPAH 3G6DH 3OBAA 1EDQA 1Z5LB 4X8JB 1YUHB 3TYFA 5I2IB 3ZYOA 4MNGB 2HP4A 4K8RH 2NY4C 5KG9A 1MCQA 2DQIL 4P2RA 5GZOC 1NH6A 3RZCD 2XQBL 3FT2B 1ERNA 4P4RB 1LO3H 1N6VA 5M94B 3UPAA 2W38A 5CZVH 1NDMA 1UQSA 3O3BB 4XPAH 1JTTA 4Q9RL 2AABL 1OWRM 5TF1L 4I3RH 4PJ7F 3P4NB 3T77B 3K1KC 1QBBA 4LPCA 5FDWB 5EO0A 1X5AA 1CLOL 2J8UB 1KLGA 3X11A 4YHPA 1CDIA 3PL6D 3NFSL 1L7IH 5IB1A 5I0DA 1RZ8B 3VI4E 2HKHH 2BNRE 4CVZA 5E8DL 2AVGA 4NC1E 4HCRL 2X4RA 1QYGH 4Z7NE 2VOTA 4WFFD 1JYVA 3U7AA 1S9KC 3T0BA 4FP8H 5GHWH 3BIBX 3VXNB 3STBA 2Z92A 3BGFC 1GAFH 2PXYA 4P46C 1JGVH 3AY4C 3BPCB 4PJAB 3B9DA 4BH7B 3TYGH 2MJWA 4FQ2H 4M02A 1HZHL 3SE3C 5C71A 3IDYB 5BXFB 2DQJL 5B38A 5E7FA 2ZWLT 3GSUA 2P49B 3T2OA 1YEHH 4IHOB 1NGYA 3RDTA 4QO1A 1MEXL 4HULB 3GI8H 1RHHA 4NO2A 3SO3B 1B0RB 4R4BA 3E3QC 4LEOB 3JV0A 1H15B 1IGFH 3ME0A 4O9HH 1AO7A 2J6EA 4LRNL 3VXTB 5JOEA 4JY5H 4GXUN 3RWDA 2W91A 5HDOA 4IOFD 1IL1B 2EZ0C 1QRNE 2E6PA 3MXVL 1QSEE 4UT9L 3IDJB 4QRPB 1I1FB 3MJ9H 3GI9L 4HJGB 5EZOH 3RU8L 1A6UH 2ZOLA 1K4CA 4LLYB 4UT7L 5JPMA 2APVA 1OP5K 3ZHLA 2BSRA 4M62L 4XP9L 4YDVB 3D3VB 2YZ8A 1KELL 5F71A 3R8QA 1MCLA 2V7NA 1CIDA 2N4IA 1Q0YL 1T7ZA 2VO5A 5T3ZE 3P73B 4U1MB 1EEYB 1MFBL 3DURB 3WD5L 4OLVL 2QHLA 4HXAH 1A7RH 2VZVA 4G7YL 3GJEA 1FH5L 1QA9A 4PV9B 3BPLB 1VADB 1Z3GL 1E4JA 1G9EA 5DQJB 5ENWA 3FQUB 5IV2B 1CQYA 5IMOB 1TLKA 2VDQL 3GBLA 1YEJH 4MNHA 4XBEH 1BJ8A 1WBYB 4RGNB 5D71L 5JW4M 1ZGLB 1A7QL 1TQCC 2I5YH 5CLTA 1BLNB 4JANB 4RRPG 4XAWL 4HUMB 5K59E 3C09C 4PRDA 3QPXL 4NGHL 2GW5A 1PJ9A 1C8PA 2JJWA 2QKIB 2FLBT 3JTTA 2A9NH 2CKNA 1RK1B 2E9BA 2RAMA 4F2MB 3U9PL 4ZAKD 5IBLC 2N56A 1VFBB 2I26N 4UOJA 2WUBH 1OAYH 5L2KA 1S9WA 2BVQB 4JQIH 5EH1A 1C5CL 1CU4L 4HZLB 3BEWA 1P5UA 3RUGA 5HYJD 1L7TL 1SQ2N 2GTWB 1N59B 1N6UA 4FZEH 2QV2A 3PWUA 1A9BB 1PG7X 2XZQL 3SDAB 2IPUK 5IWLA 5F97E 1KLUA 1S7SB 3Q0HA 3FAXA 3NCYS 5I8CA 4WO4B 4X5XA 3JVGA 3FFDA 5C0JA 3O0RH 4HFUH 5DRZB 5AAMA 2UYLB 4G8IA 3S37H 3GIVB 2E5EA 2P8LA 4GQ9L 5J1SC 3PQYD 4MDIB 4ZOEA 3D85A 3C5JA 3DROA 1IM9B 3BDYH 2DJ4A 1K5NA 5A2JH 1KN4L 3LIZH 4NQCD 5MEOA 3B8SA 3BQUA 3CDYA 2XQYG 4KJQD 4ETQB 3HC4L 1HHKA 5GJTL 1VSCA 2VLMD 3CC5A 3GSRA 4G8GA 1J8HD 1NGZB 1U8LA 4ZDHA 1MCBA 3BT2L 1J05B 1ETZA 2VDMH 4N1HB 4JKPH 1RHFA 3TBTB 5EBLA 4AENB 5D2NB 1FL5B 3OKLA 1YEGL 4NJAH 1JMZA 1BAFL 1KN2H 1AQDB 3DNKA 4N8VA 2PKDA 4L4VB 3O6LH 2XA3A 3E2HC 4M1DL 1L0YA 2NW3B 1CTNA 4FQLL 1BOGB 1T1YB 3CFJA 3P0YH 1P7KB 1M7IA 4K7PL 4LAQH 5D70H 5TGBB 1YEEH 4WU5A 3IFLH 5FF6A 2XKNA 1UJ3C 1KJ2L 3EO1A 1ZHLB 1RD6A 2CH8A 2PW2B 3BKJH 4XNYH 5DJZA 2Q3AA 2YWYA 1T80A 1M71B 4PJ8D 3MNVA 2H3NA 2YPKA 3QUMH 3HE7A 3UZQA 4F7EB 3MQIA 5SWSE 3QIUD 2B5IC 4XPHL 4XH2B 2V5RA 1TVBB 5ANME 4GKNB 4ELKA 4LCUA 3MFFA 1NEZG 5F7FA 4OZFB 1G7IA 3ZDYE 4PJDF 4GG6E 1G0XA 3X13B 5FOJA 1JPST 1HE7A 2RBLA 2NLJB 3SDCB 4JZNA 3BKCL 2BSED 1PQZB 3GIZL 5D5MA 3QEQD 5KANI 5B8CB 3TH3T 3V52L 2Z31C 4XXDA 3GBNL 1Z2KA 4KK5C 5DJYA 4H1LB 4LF3A 4LEXH 3TV3H 3RTQA 3MRPA 3T8XA 3EJYD 4NFDA 1F6AA 4QXGH 4ZFGH 4M9PA 3SQOH 4P3DA 5GGSB 1BFOA 5JW5A 3DWTA 2AW2A 4MXWL 2OL3B 1BVLA 5HI5D 3KPQB 4NO0D 4D8PB 3C5SA 2YR3A 4KKCD 1KIQB 2AJZA 3GMRA 2B20A 3BPNC 5FM5O 2KKQA 4IRZL 3QB7C 2XY2A 3V7MA 2QSQA 2W9EL 3DVFA 5D1XB 4X8XA 4D3CH 1ZHNA 4ZXBC 1NAML 4B7IA 1FLRL 1RJZB 1XF5A 1DQMH 1JPTH 5HHQB 4WY7L 5JHDE 4L9LA 4M7LT 4FOMA 1QR1B 4DVBA 1ZGLP 4DN3L 3BEVA 3VD4A 3ULVC 2FR4A 3CLFL 5JQ6H 1LO0L 5T33H 3I85A 1P1ZA 1NL0H 5JXEC 3E6HA 4HIJA 4L8SA 4BQ9A 2FO4A 5GGRB 5HGGS 1SBBA 3IFOA 3QUKB 3JSSA 1AHWC 3N85H 4WI3A 4HKJA 1FGVL 5DDHA 4ZODA 3HCVB 3DVNB 5I1IL 2ADFH 5GGUB 2PYEA 5C86A 3KJ4C 4QRRD 4G9DB 2AI0H 2B1AH 1MHPH 2MCPL 1N7MH 4CMHB 2FX7L 3LQAH 1A7PH 1T4KA 2YPVL 1PKQA 1XF3A 3L3JB 2BVEA 3MRLB 2DI7A 1K8IB 2OTUA 3DX9B 4WNQB 1G6VK 4Y16D 3WL9A 3WUWA 3FHAA 3NH7L 4JKKA 3LEXB 1IKNA 4TUJA 2ZCKL 3TT1L 3H9SE 2LQRA 3FOLB 4DW2H 2F58L 2ZUTA 1FNSH 3O4OC 1CXIA 5FKAA 3S97C 3MACH 1U6AL 2FBJL 4YBLC 4AQOA 4MJ2A 1U8OB 2FX8L 4HH8A 3TIEA 4PJIB 4YHLL 3U0WH 5A2KH 3IF1A 1EA9C 3K2UH 2NY6D 1YPZA 1MCWW 5LQBH 4CDGC 2PYFB 2NY3C 3LMJL 4YGVA 3T0EA 1RZ7H 1L6XA 3Q5OA 2BY1A 2X89D 5KN5A 5EN2B 3ETBF 1Q1JH 3WKMH 3WS3B 3RWEA 4EXKA 5E6IC 4XP6L 4Y5VC 5F6HJ 5DWUH 1DBMH 5F9WB 4FQJH 4WHDA 4KZEH 1C12B 1QBLH 3BN9C 5FGRA 3QXAB 5TF0A 2OI9C 2JELH 3EOBB 2R9HC 1MFCH 2XKUA 2IAMA 3AXLA 4K23H 3QNXB 1PEWA 4K71C 5DA0B 3O6MH 3PWPB 4NQDA 3GJFH 3ILQD 5C08E 4AZ8A 2WBJC 2X9YA 4FMFA 3C5ZD 4F37K 3VJ6B 4TNVK 4I18C 4HIIB 2JTDA 1WZ1H 4Z77B 4XWGH 4LBEA 5EBMA 4Y4KA 1HHHA 5IW1B 1AIFA 5DRNA 1G7JB 2P47B 4ZNEA 5DJXB 1HEZA 3CDGA 1XGPB 4MAYB 3JWNC 3SJVD 4APQB 3C9NA 2NCMA 4WUUB 1NFIA 1RUMH 4OD2B 1KBGL 1F45A 1HWGB 3WE6A 2WBWB 1UWXK 5EU6E 4PGCB 2QQNL 4JY4B 3HR6A 2O26U 3L9RB 5EULV 5DSCB 3X14B 3CVHH 4PJAF 3QQ3A 2OXHA 2P8PA 2DLIA 1Q38A 3IAPA 4QTIL 4QYOA 4UI2A 4G80B 4ZFOB 4JRYE 5I6XC 1D7FA 2P48B 4OJFL 5EU3A 5C9KA 2Z91B 4J3UA 2EIZA 1CYGA 2DWDB 2ICWB 5CP7B 2ZNXA 5DA4A 3KLAA 5FUOL 1QSFD 3J8F7 4PRNB 2BHUA 2QQLH 4ISVB 2A6DA 1YJDH 2UVFA 5C0DA 1G6RH 5ID0B 5L88L 1T04B 3HKFA 3H9YA 3BVNA 1XF2A 4Y2DA 3FO1B 1EXUA 5KS9A 2VQUA 1JBJA 2F54D 4JDVB 5E1HB 3WN5C 3G04B 3HTLX 4K3EH 3RWCA 4MDJA 4LCWB 3W0WB 4XC1L 3KPLB 3CCHB 4JRXE 1H3PL 3PGDB 5FIEA 4GRMB 4OF5A 5EZJB 5F9OH 4JFFA 1CFVH 5D7JB 4V1DB 4OUOA 1FV1B 2VDRH 1VGEH 2DM3A 3WDJA 1CDHA 4KGJA 2WM0A 4WTXA 1G1YA 1AXIB 3SCMA 1RFDH 2X7LB 3ZL4L 5E4EC 3MJ8A 1J1OL 1KTLA 1N64H 3OQ3B 5FHAH 2JCCE 4LHUD 3QUYA 3VXQB 3PGCB 4JZJA 4PJEB 3D0VB 5MEND 1T83C 5KSUB 1CDBA 1A4KB 1G7HA 3TJEH 3D2UB 1OVZA 5FO8B 4MXVE 1E4KA 1JHKH 2NY4D 4FTVD 4X4ZA 1NSNL 4FABL 2OQJA 1A47A 2HLFC 3RVUC 1D3CA 3BH8A 4Z76A 4UU9B 4XBPA 3F7YB 3RZCA 3ZE2F 3MLUL 1B6UA 2Y07L 4N0CD 5FM4A 4HUVB 3QIBD 4Q9CA 4NRYB 3NABH 3CZFB 5I76B 5EFIA 1JYNA 4UBDD 5DMKA 3WSQH 4PRHB 1T21A 2F9BT 2VLRB 3LRGA 5IESL 1H5BB 1V8HA 5IJVB 3BUYA 4JGMA 2WW8A 4MA7L 4AJ0A 5DO2C 1G9NH 3BX7C 4GW5B 1S5HB 2LTQB 3PL6A 43CAA 2UWEB 2Q7YB 3DO3A 1ED3A 2BVOA 4M7JL 3HC0A 1DVFB 1H3UA 5DJ6B 4MB4A 5DI8A 4U6VH 4EVNB 2D7MA 2R69H 2XWBB 1J87A 2V6HA 4L29B 2AJVH 1N5YH 2IG2H 1K9TA 5TDNB 3JWDL 3LQMA 4NYLA 5CJQL 3QO0B 2M26A 3O11A 1WK0A 4EQ2A 3D69A 4MQSB 3UTPE 2QHRH 1A4JB 3GFUA 3WDIA 3QDMB 1NFDE 1A7OH 3HUJA 4TPRL 4OD1L 2YPLB 4O02H 4OQTL 1XZ0A 2DKSA 4P2YA 1GGUA 3H3PL 5I16A 2OJZL 3OV6A 1I1AB 3D0LB 3EDJA 3QCVH 5HDBE 4UILL 3CVIH 2DBLL 5LWYH 4P4KC 2VYRE 4K7PY 4PR5B 4D0CB 4TSCH 3GK8H 3U4EA 3GMMA 4ODWA 4N0YL 4E0RB 3GSOB 1MREL 2W9LA 1XCQA 2X4NB 1EHXA 4X6CA 1E4XL 3TPUA 2OLDA 4J3SA 2XZZA 4OZFG 2XYCA 4KQ3L 3NTCH 5AUMA 3HPLA 1JHTA 1U8PA 3D48R 4HPOL 3K8LA 4OF3A 2A73A 4I0PD 2FD6L 4HGWA 2GK0A 1T6VN 5C0FA 3QUMB 2NTFA 3ARED 4WJ5B 8CGTA 3KG5A 1NJ9A 4H1LG 4HIXH 2JK5A 3RPIB 3AM8C 4BJLA 1UB6A 2NXYD 5T1DL 3QCUH 4WI8A 1G7MB 3O41A 1MJ8L 2X40A 5TE4L 2NY7L 3IJSA 4ODTL 4N5EC 2XACC 5E1AB 4JFED 1INEL 2XIDA 4GAYA 3WFBL 2CRZA 4JM4H 3OSKA 4PGDA 1RZIA 5E5MB 2A6KB 3F7VB 1A1NA 4HK0A 3JWOH 3TCXA 4HKZA 4IOIB 3H42L 3B2UC 3O45B 1XGYH 3V0VB 2XNAA 4MJ6A 5T5FL 2X1OA 3IU3B 4EN3C 3DYOA 3LS5L 2O5XL 4D2NA 3GKWL 4K7PX 3HZVA 4HMEA 1DSFH 2BNRB 2MQ0A 2VXVL 1S7VB 2H45A 3X12B 3MRFB 2EDEA 2YRPA 5EUOA 4U1HB 5HHME 3EHBC 4XB7A 2H26B 3KS0J 2ZPKH 4OIBA 3L3KA 4X4YB 4YDIL 1P84J 2HJLA 3UPCA 5FYKU 1LVEA 5FYKD 4OLXH 3JUYA 1IARB 4R6UA 1R3LA 1DBJH 1V3KA 4ZAKA 4W4NA 2XTJE 4KVCL 4XBGA 1ZA6B 2H6PA 3K3QA 3QYCA 4P9HL 1IEBB 4MNQD 4G43B 3FQTA 1HKFA 4QTHB 1QSVA 5HYJA 5E2UL 3FHQA 4NN7C 4HS8H 3OR6A 1GHFH 2DICA 2ENSA 4AIXA 2JKXA 4Z7VE 3BHBB 4TUKH 4PB9H 3TA3A 4TULL 5I1HL 3VFWA 4FFYL 5LJYH 1FFNA 3ARRA 1ADQH 4MD0A 1QRNB 2NX5E 3UTTD 1FG2A 1QSEB 5C0CE 1NCWL 5J9PB 4KRPC 2FECL 5B3JE 4GMTH 3CAFA 3MYJB 4FQXB 4LLWB 2IBBA 1MJJA 3BPOB 3O6FD 3FTGB 2HT4C 5KSBA 3PQYA 4NN5C 3RNKB 5AD0A 4BFIB 4YQXH 3PDDA 4KUZL 1N6QH 2P8MB 3A6CH 3SBWA 1RU9L 2OL3L 1VKXA 1N4XH 3L3GA 3LKRB 3W9EB 5IMLA 3C08L 15C8L 4TSAH 1F90H 3ZKMD 3N9GL 4GKSA 5ESAA 4DGIL 4Q6YA 2HTLD 1MQ8A 3DXAE 1J8HA 1RUAH 1ES0A 1GGTA 4N90D 1PFCA 2R1WB 4M6MH 1TPXC 1HKLH 4NM8H 3U9UA 2R2CA 2EYSB 1YNLL 2PTTA 1CL7H 2Q8BH 4LFHG 5I1EH 1QEWA 2CKBH 4NP4H 5BV7H 1TQBB 2ORBL 1RUKL 1OAXL 1U93A 4URTB 2D7NA 2XWJB 4GSDH 2HFFB 1D5XB 2J88L 4MLIA 5FO7A 5IT2L 3D6GA 3OKDB 4K2UL 5IJKC 1HQRB 3QIWD 1FFPB 5H8DA 2Q8AL 3RNQA 2APBA 3GJFB 1ONQA 1F42A 1CGYA 4TRPL 5CWSB 2MPAL 3G6DL 2I60H 3A6OA 4P2CG 1IEAA 1HINH 4PJIF 4K8RL 4Y0GA 2AJXH 3GSQA 2DYPD 1MWAA 1AI1H 3KXFA 1LO3L 3KGRA 1WUNT 1S78D 4J3TA 2OTWB 4AEFA 5CZVL 4V2CB 1R3HA 1CBVH 3CX2A 5E2VH 4XPAL 4I9WE 4O4YH 3TBVB 4I3RL 2ATKA 3HS0A 4WDIB 1B0GB 1I7RB 5DJ0A 4Q6IB 3MR9B 3UTSA 5FCSH 5TDOB 4M6OH 3S96B 4X6EB 1KUMA 4EI5D 5DHVH 3VXMD 1L7IL 4F33A 2HKHL 5IHUH 4NO0A 4R2GB 1AFVH 3M07A 1YN7B 1QYGL 3VFSB 3QO1A 1C7SA 4AEEA 4PJBE 1BIIB 5GS3A 1QO3B 1A5FH 4C56A 2ZCHH 4OGYH 5GHWL 1G6RB 4CMMA 3V5HA 1GAFL 2GAZB 5J57B 1OHQA 1JGVL 3QAZB 1RIVH 1WT5C 3ZMRA 3TYGL 4JG1H 1KEGH 4FQ2L 5LG1A 2NZ9D 3EYUH 3UTZB 2FSEA 4U3CA 4P2RE 1Z9MA 4Y7MA 4RFOH 2PTVA 5DD6A 4HT1H 1YEHL 4GUPA 5ICYB 5A3ID 4U2YA 5HGDB 4NBZB 1UVQB 3FQWA 3GI8L 4L3EA 4QOKA 2C4FT 4OM0H 2EDQA 1CE1H 2ZCLH 1BZ9A 4EDXB 5SWQA 4PRPD 1X5GA 1FVDA 2OJEB 5J4MA 1FN4B 1IGFL 4O9HL 5EOTB 2BHYA 4U1IA 4JY5L 4HC1A 1F4HA 5FA4A 2PW1A 4P2QA 5EC2B 1EIBA 4RAVA 5IVZB 4OV5B 1KB9K 4G9FD 4GW1A 3QFDA 1LP9A 3MJ9L 5SWSB 1L9MA 3SDYH 1D5MB 2YK1H 5EZOL 4EI6A 1DQQA 1A6UL 5ERWB 1ZLUH 5IEKA 3EO0A 4F7MB 1ZANH 1NPUA 5ANMB 3QWRD 1T1WB 5JDSA 3SPVA 2CIKB 1VFAA 2YD1A 4HJ0D 3W9DA 5CHNA 1R5VA 4JKLA 3M1BA 2OZ4H 3RWGA 5JORA 3VXUD 4DVRH 3KLHD 1I4FB 4GG6B 1J0ZA 4FFVC 5DFWH 4G5ZH 3T4YA 5SX5K 5E03A 2DF3A 2L0DA 1GOFA 2Y7QA 4HXAL 1F00I 1LE9A 1S7UA 5IW3A 1A7RL 3DV4B 5E99H 1NBZB 1U8KB 4TN9A 5DRWA 5ITFB 1V3JA 2VLKD 4LASH 2ZUYA 3LKOB 3H0TB 5EZIH 3VXOA 1CE6A 5EO9A 5HGBA 2LVEA 3CFCH 3ARBB 4LHQB 5TFSH 5DQ9B 2IBGA 3WEXB 4XMKH 4XBEL 4XGZA 5GSVB 3P0VH 4ONFH 1CD0A 5T1MB 4HPYH 1AD0A 2I5YL 5IQ7H 5TPWH 1PYWB 3BWUC 3OKKB 3ES6A 3BAEH 2BP3A 4OZ4A 2A9NL 5CIPH 2JJSC 5JHDB 1YMHB 5DEZA 4LGPB 1SJVA 4UQ3A 3ECBB 2V2WB 3IDYC 1U8HB 5HHNA 2CLZB 2WUBL 1OAYL 3VFTA 4XVUD 4DCQB 5GJSH 3VGEA 2LV4A 3ARFD 2L7UA 4XTRC 1OQXA 3SKOA 4JQIL 2YD7A 2PUQT 1GC1H 5DXWA 3SO3C 4FZEL 3VXSD 1WFTA 4G6FD 4X80H 3RHWF 5BRZB 1UXWA 4OF7A 4LNRB 2NW2B 2IH1B 5I1GH 1EEUA 2Y5TA 5D4QA 4LCYB 4PLJC 3SJVA 3MV9A 4BH8B 3MGTB 1EFQA 4HG4K 3ZSSA 1YN6B 4HUWB 2E7LC 5J7CC 1P2CA 1S7RB 3PGFH 4ZUSA 4U1KB 4WCYH 4ZTOH 3O0RL 1FBIH 4J1UB 4OCRH 4KY1H 1U3HD 4LLVA 3NIFE 5FO9A 3S37L 4KK6C 2EYTB 5EIIB 3H9SB 3TFKD 5F93C 5D6CB 3PXHA 5CP3H 1BQHA 3BDYL 1DZBA 2E9IA 2ZZUT 3LIZL 4HF5H 5I30H 1HILA 5INDB 1KIUA 5BZWA 2MKLC 1BF2A 3CJJA 4MB5A 4QRTA 1Q9LA 5I1LB 1B90A 3PABA 5L2KE 4X7FC 3PWVA 5JW4N 3BPLC 2VDML 2DM4A 5IHLB 3KYOA 3RUGE 4JKPL 2X4UB 5FK9B 1CT8B 2VSCA 2NYYC 5DS8A 1N5AB 3JWDC 5E6YA 1DL7H 4EUPA 2KDGA 4NJAL 3SDDB 4OSUH 4RGNC 3IFNH 4LPVA 1KN2L 1QFHA 4X83A 3FO0H 4H26B 3O6LL 4P5TA 3P0YL 4NRXB 2EYRA 3QPQD 1M7DA 1EGJA 4LAQL 5D70L 2BDNH 1YEEL 1DN2A 3ALXA 3P2TA 4NUJA 4AIZA 3IFLL 5IHZB 1O5DT 2EDKA 4LHUA 1T5XB 4QRQB 4XNYL 3BKJL 3QQ4B 5C08B 1DLHA 2X70A 4D0DA 4TVPE 5MENA 2VABB 3VFVB 4HS3B 5HPMB 5GS0D 3QUML 4X9BA 4FTVA 4Z18A 5JLZB 2CDEB 1C1EH 4POZD 2PNDA 1UJTA 3BSZH 1P6AB 2XZCH 5TDPA 1NANH 3IJHA 5BJTA 3PNWB 1D9KD 1BJ1J 1GCFA 1WLHA 3SDAC 3QNZB 1H3GA 3FMGH 1TCMA 4U0QB 2DJSA 2HTKC 4UV4H 5E8EA 5DO2D 4WO4C 1RAMA 5GGSY 5EU6B 1A1MA 5C0AD 5JA8B 1FVEA 1BPVA 4ZFZB 5DJ8A 3LKNA 1I1RA 1UFUA 4LEXL 3TV3L 2H2PD 1FVCB 4PJFA 4MWFA 1I1CA 4QXGL 4ZFGL 4JDTH 5ADOH 3V8CA 3H9HB 4JRYB 1J12A 3SQOL 3P4MB 2DS4A 5T1LB 1JPFB 4F3FA 3EYOA 2Z4QB 3I50H 2Y4SA 4FQHA 4NQXA 5DRXA 2HT3C 3IDMB 2K7PA 4U6HA 2AV1B 3MRJA 4LOUC 4GFTB 1A1OB 4PJGA 2HN7A 3SGJC 2APFA 4LIQE 1FZOA 1ZT7A 5ESVB 5INCB 4QT5B 3AY4A 1IAIH 3LQZA 3I84A 3M17A 5IQ9A 4D3CL 1DQML 2HRLA 3GGWB 3MLSH 1JPTL 1YMMA 1CXEA 5GGRY 3ULSB 5E8NB 1BBJB 5D2NC 4JRXB 4ODXB 2CKBB 2VJXA 4DZBB 5JQ6L 3PV6A 4PTUB 1NL0L 3CU1A 2X4OB 2X5PA 3RWJB 3TF7C 4R4FH 4YHZH 3NN8B 5IR1B 2VXTH 2RCSH 3GNMH 1CFBA 4YDKH 1BX2A 3LPWA 4L5FH 3N85L 1R3JB 2IF7A 4IS6B 5D1ZB 3J7HA 2RFXB 1RZKC 5D7LE 4MA3A 4FMKA 2ADFL 3LN9A 5JMOC 4L8BB 1XGRB 4LSRH 4TSBH 4OQ1A 1CD1B 2JCCB 4XHJD 3WS6C 2AI0L 2B1AL 1MHPL 1N7ML 4TVSa 3MCKB 5CD5C 3LQAL 1A7PL 3QEHB 4P9HC 4KI5C 4ORGA 3GHEH 3MJGX 1T89C 1UCBH 2WIMA 3SGEI 1TVHA 3DGCR 3ARSA 4F58H 2YSSB 1RIHH 3Q3GA 3U1SH 2XWTB 5FYJE 3LN4A 3OG6B 4PD4K 1I9EA 4OLEA 3S5LB 1XR8A 3MRHB 1T20B 4PJHE 5C0GA 2YXFA 1FNSL 5I8KH 3DMMD 2X4SA 3V7AE 2FEEL 3MACL 5CILH 4O2EB 3MGOA 4UNTA 4C59B 1EZVY 1A0QH 1WAAA 3SDCC 5J89A 5DURB 1T66D 4JFYB 1BVKB 3U0WL 4WFGD 5F96H 3T09A 1FYTA 3K2UL 1ZHKA 4UQ2A 2F15A 4S1RH 4Z7UA 5LQBL 4XNMA 4FS0A 3ZDZE 3BDBA 4HKBB 4Y1AD 5B22A 1RZ7L 4X6DF 2GUOA 4M6AA 1Q1JL 1PX4A 3WKML 5ECJE 1ORQB 4MJ5B 3L3DB 5JPNA 1MUJA 2PO6D 3CK0H 3WFHA 1FLTX 4J2XA 1RUPH 5DFVC 1NFDB 4HKXB 1Z0NA 4PJ5D 5DWUL 3FB6A 4G6KH 5EBWA 1H3TA 5CGYD 1JJUA 1MHCA 4KZEL 4F7PA 5D1XC 3QHZH 1QBLL 2JELL 5E4IA 4PJCE 1TZIA 1MFCL 4K23L 2VIRB 2GY7B 3O6ML 4MNQA 4QRSB 3TT3H 1IGTA 1Z6JT 3STZA 4P23D 4UDUB 3IU4H 3B3IA 3U79A 3VXRA 1JK8B 2R2EB 1NC4D 1WZ1L 1NCUA 4AK1A 1V7MH 3VFRB 4QHMA 4JCMA 4HH9A 4JQXA 3STLA 3UTTA 2IQ9H 3L5IA 1EZVX 1IM3A 4W81A 1V3MA 4A2LA 1IJ9A 1YPZE 4CMHC 1QQDB 5J1AA 4Y4FD 4DKFL 3FQNA 35C8H 1RUML 5AEAA 1KNOA 3T0EE 1EO7A 3O6FA 2G2RB 4I4WA 2R2HB 3BZFA 4K8RC 1Q0XH 2K7QA 2CRMA 3CVHL 3MRQB 3VRIA 5ISZD 2FZ3B 1RZJH 1RJYA 3QUXD 3KPNA 2ITDB 3KYMB 1FL3A 3V95A 3MLVH 5TQ0H 4C54A 2P5WD 4HEME 4OKVA 2QQLL 2Z9TA 1DJSA 4C55A 4Z8FH 4B50A 1YJDL 3PUCA 1JVKA 4Q9QH 4NQDE 1I9RH 1G6RL 1LEIB 5MEPA 1J5OH 5D6DC 1P7QB 2W0KA 3EYFB 4LU5H 2X4QB 4K3EL 4I3GA 3DTXA 3ILPA 4M1CD 3W11C 5HHMB 2Q6WA 4ZSOA 5F9OL 4GRWE 4NFCA 1SJEA 4ZNEE 5HDQH 1CFVL 1DP0A 1JRHI 1VGEL 4ENED 4KK8C 3X3GH 1UJ3A 1ZA3A 1JGEA 5F9WC 2WQ8A 1RFDL 5CIPB 3K8KA 5D2LE 5IF0B 2XTJB 4R97B 4UT6H 5JNYB 2KQMA 3RBSA 2YD4A 1N64L 3C8DA 1SJHA 2M1KA 3VMOA 2DLTA 5FHAL 1WSST 2NTSP 4D0BA 3B6SB 5IB4A 3WHE0 5B39B 2AXHA 5GIRB 3D25B 3TJEL 1IQDA 4WFED 3I6GA 1JHKL 2P42B 4Z7VB 3IS0X 5GQBA 4HWBH 4E41D 4XVSH 1MLCA 5C8JB 3QDGA 2UV3A 3U7YH 5FUCE 2H9GA 1M05B 2NX5B 4W6YB 5C0CB 1OF2B 1U91A 3NABL 3NZ8B 4NNYA 4Y5XB 1BD2E 2OR9H 1AKJA 3WSQL 5KS9E 4MCZB 4NHCH 4MAYC 1YNTB 4APQC 1J86A 2Z31A 1RK0B 1LEKB 1G9NL 4MX7B 4UTAH 3ARWA 4LK4A 4EI5A 1H8OA 4WTZA 4WHTB 4JFFE 2HFEA 5DJ2A 4U6VL 2R69L 3V79C 1N5YL 2AJVL 2IG2L 2YHGA 1CFTB 3QSKB 4ZPTB 3BXNB 2F74A 1WF5A 5C07E 5IP4A 3DXAB 1BZ7B 3O4LE 4LIQH 2QHRL 4RWHA 5DR5H 1A7OL 3P4OB 4ZYKB 4O02L 5DMJB 4JM2B 2RJMA 3QCVL 3CVIL 4PJXA 5LWYL 4WI5A 4RX4D 2YA0A 5HHVH 2R0LH 3JZ7A 2DMCA 2UZXB 4HD9A 5AYUH 4TSCL 1ZKAA 2BOBB 1FNGB 3GK8L 5F9JA 5DD5H 3V6FB 4QHKJ 1AHWA 4OIIH 3OKOA 1EBPA 5D7JC 3ET9F 1A3QA 4R0LB 2NNAB 2NY0B 4Z7QF 4KJYB 2EDTA 5K9OB 3OAYK 2VDPH 3NTCL 1A2YA 1C5DA 1NMAH 3CMOH 4MS8C 1F3DH 4PG2C 3S37X 5FOBB 2XKSA 2ITCA 3GMNA 1T1ZA 2VDOH 4FXGA 5J06A 4IRJB 1NUFA 3IKCB 4ZPVB 2YN5A 2YUXA 4AG4H 2EDDA 3MMEB 4PRAB 4HIXL 4XNZB 3QWRA 3OX8A 3TJHD 3U36A 3N1QC 1SBSH 3KYKH 3MGAA 4WFFE 5JOFA 1XGTB 5DUPH 3QCUL 3C60B 1HH6A 5FYJH 1EBAA 4KC3B 1ZVSA 2ICCA 3QDJD 3P9MB 1U3ZA 5D7KD 3TNMB 1Q94A 4KDVA 1G9MC 3ELAT 4JM4L 4ODUA 3P77A 5DFTA 1PSKH 3CFKB 4PJ7E 1H5BC 3JWOL 4NCDA 3C6LB 1S7WA 1DUZB 1R0AH 1XGYL 3ABZA 1U2CA 4D9LH 4J3XA 2LTQC 1KIPA 4JJ5A 4UZGA 2H32A 4LLQA 1DVFC 1HHGA 1DSFL 5T5NG 2P7TA 1FL6A 4MQTB 3I75B 1R5WA 2OYPA 4QXUH 4K07A 4ODVH 4PJBB 4Y5VA 1DBKH 2EIEA 2ZPKL 1DN0B 4G8FB 5E0QA 1ZS8A 2BVPA 2CO6B 1JFQH 4K7FB 2IAND 3NA9H 3RY4A 4ONHA 1PX3A 3FRPA 4OLXL 4TOYH 5JO5A 4OZGF 2G75A 4YNYA 1DBJL 1Y0LA 2G9HB 1D5ZA 1I1AC 3MRKA 5GZNC 2Y36H 4P2RB 1JTPA 5SWZA 5F1OB 1X44A 4I18A 5ICZA 5FCUH 4N9OB 1RI8A 4HS8L 5IVNA 1GHFL 1CLZH 3IDGA 4M7ZB 3F6IA 3VGAB 3S5LG 3FRUA 4TUKL 4PB9L 1KLGB 4YHPB 1H0DA 3K8MA 2VL5A 5D96B 1ADQL 1OTTD 5IB1B 3QNYA 4WGWB 4X7TA 3ROLB 1MRDH 4CNIB 1WC7A 4GMTL 4P2OB 2QQQA 3MV7D 1Z0MA 1NC2D 2X4RB 3WHXA 1I8MB 1BQSA 5A2FA 1K3ZA 4WI7A 1T3FA 1IKFH 1UENA 4UV7L 2E6QA 1MNUH 2EEBA 2Z92B 2GCYB 2WWMC 1T0PB 2QR0A 4YQXL 2HLAA 1N6QL 3A6CL 1FNEA 3O8XD 4HAFA 1N4XL 5T5NF 1M1SA 1D5BA 4NZTH 4TSAL 1F90L 4BZ1H 5B38B 2F5BH 3GSUB 1D6EB 4PLNC 1K4DA 3EDKA 1RUAL 5E08H 4LSPH 3K74B 2EDBA 1G7QB 5BVJA 5HYJE 5EC1B 3WN5A 4M6ML 3V6BR 1HKLL 4NM8L 3U7WH 3VE0A 5MI0B 3DJ9A 4XCYA 4OFPA 5F7LB 1CL7L 2YN3A 2Q8BL 5I1EL 4NC1C 5H2BB 2IALB 3W39A 1S9XA 5CSZB 4KJPD 2CKBL 4NP4L 5BV7L 4GRWH 5CSBA 3RWDB 5EOCH 3T0WA 3N1PC 3RRQA 5IG7A 2DLGA 2NR6C 4GSDL 1TJHH 2AK1H 1LE5A 1K4CB 4J12A 3R06B 2D0GA 4I5BB 3PDOB 3QP3A 3FFCA 3TBYB 3P9LB 5HYSA 1P53A 3HI6H 5KSBE 3PQYE 2WP3O 2V7NB 2V7HB 2I9LB 1ZLUK 3MO1A 2I60L 4ZUTA 1F13A 1KPUB 2ADJA 1HINL 5KSVA 4NQCE 1R24B 3DRTB 1WFNA 2AJXL 5ETUA 4BELD 4HIHA 2VLME 1TTGA 5I1DB 1J8HE 1AI1L 3WNMA 5DHYB 1T6WA 3L95A 5CAYB 3OAZH 1CBVL 3VFNA 5E2VL 1JIBA 3KJ6H 2XRAH 5FECB 3OB0H 4O4YL 1C08A 4W4OC 2BXYA 2WWKT 5C0AA 3RWFA 3T4AB 3KDMA 3LRSA 4FQXC 1I8IA 3JV4B 1MSPA 4M6OL 3MC0A 3HNTH 2CR3A 4PRDB 2GFBB 1QSZA 3MV01 3IGAA 3BPOC 3LH2H 3PJSA 2X1XR 3CSBA 2C3VA 5HDBF 1QNZH 4HUKB 4JZOA 3U30B 5IHUL 2AJYH 4HK3N 4U6XA 3JTTB 1AFVL 1IAOB 1ZTXH 1M6OA 5D1QB 1A5FL 3U0TB 2CGRH 2ZCHL 4OGYL 1W72A 5L2KB 5D7IA 2KPNA 4FQQB 1RIVL 3BEWB 4JG1L 3TVMB 4X6BB 1KEGL 3NVQA 3HZMA 4P4KA 4K55A 3PWUB 3EYUL 5B39G 4G8EB 4RFOL 4HT1L 2DMBA 3N06B 4MJ4A 2WIIA 3U82B 1TQBC 4XP1H 5EORH 4OM0L 1CE1L 1KIRA 3KPPB 2YD8A 1CG9A 2ZCLL 4EXPX 5IW6B 3FB8A 1IGCH 1PW3A 3QEQE 3MNWB 1BQUA 1HOCA 4OKDA 1Q9OB 1A3RH 4L4TD 4LGRB 2BC4B 3T65A 3JTSA 1KENH 2IJ0C 4HX1B 2J3SA 1TETH 4JKWA 3AM8A 3HLAA 5LGHH 3SDYL 4HV8A 2YK1L 5J6GA 1JGLH 1JF1A 1K5NB 4QWWD 3EFFB 1ZANL 5F3HA 3BQUB 4BZYA 4TUOA 1T0NB 2E3VA 2OZ4L 1HYSC 1SM3H 2ATPB 4OZIF 1GJIA 2CRIA 4DVRL 5IKCA 4M61A 3DMMA 2V2TA 4ZDHB 3O3DA 3RWHB 4JCLA 5BMFH 4PUBH 1W8NA 1SYVA 1EPFA 1DEEB 4G5ZL 4O2CA 4ELMA 2EEDA 3OKLB 1DQJA 5E99L 2OP4H 5E8PB 4Y19B 4Q6IC 4Q74A 1VB9A 4X6FA 4LASL 4NKOA 1SEBB 1LEGB 3RGVB 3TBWA 5EZIL 2P5ED 1JF5A 3G6JF 5HI3C 3TO2A 2R56H 3CFCL 4HAGA 5TFSL 3WNPA 3CFJB 1NGWA 4M4RA 1T2JA 4XMKL 2FHFA 1AGBA 3AS1A 3WIHH 5L8JB 4R2GC 3P0VL 4ONFL 2DQDH 2XKNB 2PO6A 4QRRE 4HPYL 5L2JB 3O3EA 5IQ7L 5DJZB 5TPWL 4Z5RA 3FONA 4LLMA 3DBXA 2BVTA 1YJDC 2H3NB 2YPKB 4XT1C 3HE7B 1AGEA 4Z7VF 3I3EA 5GRVK 1SEQH 2A2QT 4MA8H 4UAOB 1CK0H 3BAEL 1TXKA 3HB3D 3IFPA 2J7LA 3QAZC 5LCVH 5HTSA 4YPGA 3LB6D 3WUZA 1MI5A 4JFPA 4I1NB 4ELKB 4LCUB 1MJ7H 1F02I 1HSBA 3MBEB 2D7PA 3EOTH 4RAUA 5GJSL 5B3JF 2ZKHH 3HG1D 1NC4A 4X9GA 3VW3H 3BKYH 2FL5A 4RRPA 1GC1L 4QHLA 1T03H 2GT9B 1NCCH 4X80L 5D7LB 4ZOAA 2F8OA 4GBXD 3BD3A 5I1GL 3ARDB 2H41A 2IMNA 5MERA 5I75B 3G5XB 4LF3B 5GRUH 1TNNA 3MRPB 4XWOD 2C3XA 4S0TD 3CX5K 4P3DB 2YMXH 5JW5B 3LEVH 2EE3A 2XXCB 4UIMB 3PGFL 4WCYL 4ZTOL 1FBIL 4OCRL 4KY1L 3C5SB 3L3OA 5F3BB 4NNXA 2BNQA 3QJFA 1YDPA 1U95A 3QQNA 1IAKA 3QUXA 3V4UH 5A16A 2ZOKA 4PJHB 2B1HH 3BP7A 3MUJA 4JM2F 1WEJH 2R1YA 1ZHNB 2AK4D 2JB6B 5F72S 1KC5L 1S9VB 4Q2ZA 1F2QA 5BQ7A 2P5WA 5LAXB 4POYA 4Y4HD 4HF5L 4L9LB 5I30L 4S1SH 3W5NA 2FR4B 5DEGA 5EU7C 1P1ZB 2VKXA 4L8SB 3MRCA 4O51B 1CLYH 2Q76B 2H1PH 4P99A 4TTDC 3OF6D 3IFOB 3MA9H 5F88A 3ARBC 3OGCB 4IRSD 4NKQB 5C0BA 4AEHH 3WKNA 1DL7L 3S34H 3U46A 1TJIH 3MRNA 2HVJA 5BOPA 4OSUL 4LVNB 3K2MC 3IFNL 3AGVA 4OF8A 3FO0L 5D8JH 2I25N 3SJVE 2F19H 3HNVH 2NMSA 1TZHA 1T4KB 3CPLB 3OAUH 1XF3B 2C1OB 5IJKA 2BDNL 5GRVL 4M9OA 4PJCB 1JZ5A 1INQB 1B88A 3UO1H 5C09D 2EIDA 4TUJB 2GEEA 3PWLA 1LD9A 3TEUA 1UB5B 3PP4H 1HHJA 1I8KA 1OB1A 2CXKA 4NWUH 5L0QB 1C1EL 5FGCB 4E41A 5J11B 1QSFE 3BSZL 4WW1A 3OKMA 3OXRA 2XZCL 4AY0A 2X4TA 2HMID 1BWMA 5F1IB 1OGAD 2F8VA 2E7BA 3IF1B 4OM1H 4HS6A 4B7LA 3IDXH 3FMGL 1YPZB 5EU4A 5B38G 5A1AA 1XCTA 2F54E 4UV4L 3SDXA 4PJBF 3MJ7B 3Q1SH 3BP4B 2W0FA 3MRDA 4NQSA 4XCCH 1INDH 43C9B 5KN5B 3IKKA 4TNWK 4GLRH 1OGTA 1MVUA 3G6AB 3KPRD 4K94C 2ZUQB 1EUUA 5J3HC 4LCCB 1U8NA 1WVZA 4NZDA 4KKAC 4WRLA 3IVKB 2Z0BA 4CVXA 4RZCA 4JDTL 5ADOL 1DE4A 3LZFH 2VQTA 5GRXG 1X5LA 3ZDXE 2DQTH 3DOSA 4MD5A 1NEZA 3QEUB 4NPYA 2VQ1A 3I50L 2DJUA 4P59H 5IHBA 5I8EA 3CUPA 4S1DC 4QRUA 1T2XA 3OJ2C 1NCTA 4YHMH 4JHBA 5GRJH 4NQDB 4PRBA 4FN0A 3JWOC 5MENE 1F58H 4KAQH 4OFYA 1IAIL 4FA8A 3B83A 4X98B 4FTVE 3TBSB 3K80A 3MLSL 3L3HA 4LBEB 3OKNA 2EECA 3QWQB 4MVBD 1LNUA 1AIFB 4ZUUA 1MWAH 5DRNB 4M00A 5IMMA 4GRWB 5KSAD 4YDLB 1P9MA 3C8KA 4YBQD 1CDUA 4X99B 1T0MA 3SDDC 4R4FL 2AEWA 4YHZL 2VXTL 2RCSL 4CUCA 3C9NB 3GNML 4YDKL 4L5FL 1BF8A 2V5YA 3VFGH 3EFDH 2YEZA 1VACA 5D2LB 5A2IH 4U7KA 5M95B 3N0PB 1XIWD 5IFJA 2EDRA 4LSRL 4TSBL 2X09A 1UG9A 2YS4A 2P8PB 4Z78A 4F7TA 4HDIB 3O9WB 1X5KA 4U49A 3V6OC 3GHEL 3WHE1 5EU3B 3E8UH 1UCBL 5F7UA 3VG9B 4X8JA 1MRFH 3UDWA 5I2IA 4MNGA 2GITA 3ARGB 3KLAB 2VLLB 4F58L 1RIHL 4PJGE 2A6DB 5JQHC 1EFXB 3U1SL 5C0DB 4IMKC 3FT2A 3ULUC 3ZE2E 2VLJD 4JY6B 3BVNB 3O3BA 4Y2DB 5I8KL 3IXTB 1BD2B 1EXUB 5KS9B 2Y1VA 4N0UE 1FZMB 3GSXA 5CILL 3P4NA 3T77A 3H7LA 4BK4A 3IDUA 1A0QL 2NPLX 4MDJB 5FDWA 2J8UA 2FIKB 5F96L 3GB7B 2ARWA 4JFFB 1FG9C 2FB4H 4NZRH 1RZ8A 1ZEAH 4S1RL 4NO3B 2PXYD 1YY8B 1A6ZA 3QISA 3SCMB 2FJFB 3BMVA 3MTRA 5C07B 1LO0H 2AXJA 4HC1H 4LPTA 4XPGH 5IROC 4YXHH 4KUCD 3O4LB 1KTLB 3EKCA 3CK0L 1FO0B 3RDTD 1RUPL 4WFHD 1UACH 4JZJB 2EKSA 4G6KL 4LPYA 2BY2A 4BH7A 3BPCA 2AV7B 1GIGH 3THMH 4DFHA 1QFWI 2YPLD 1OTUC 1XGUB 3QHZL 4LSSH 5EA0H 1I1AD 1AO7D 1ZVYA 3LKQB 5BXFA 1CR9H 1WCBB 2R1XA 4Z76B 3RZCB 2Z8RA 3TT3L 4IHOA 2COQA 3IU4L 4PG9B 3BI9X 4JFEE 5EZLB 1EV2E 1T2QH 12E8H 3BZEA 5EFIB 1B0RA 5DMKB 2ZG1A 1T21B 4CU8A 1H15A 5HPOA 1V7ML 1KXQE 1WIOA 3BUYB 1WAAE 3E0GA 3VXTA 1WWWX 4GQPH 5D1ZC 3EJZD 2ZCKH 2DD8H 3PL6B 4HBCH 2X1QA 43CAB 3TT1H 2IQ9L 2Y25A 4ERSH 3WNOA 2E7LA 4POUB 4E9LA 1AD9A 4QCIA 4QRPA 1I1FA 35C8L 4FG6C 2XG4A 2B2XH 4LLYA 5H37H 1WQVT 4U05A 2BVUA 4YDVA 1RY7B 3IB4A 4RISH 1Q0XL 3FCTA 1GSMA 3RUGF 2V9QA 3O8XA 4JHAH 5FYKE 1RZJL 4LPXA 1XZ0B 3FB7B 4U1MA 2EXWD 4MMZC 4E5XB 1EEYA 3DURA 4YDJB 1CVSC 3MLVL 5TQ0L 3QR2A 3GMPB 4PJ7B 4NSKA 1OAQH 3GHBH 1YEKH 4M6NH 4Z8FL 3UJJH 4MNQE 4Q9QL 4L8DB 4KKLD 4PV9A 1HK6A 2F5AH 1I9RL 2XXMB 3F7PC 2DIAA 3VCLB 5DQJA 2I07A 4Q0XH 1J5OL 5IV2A 4PBXA 5IMOA 3TPUB 4LU5L 4RMVA 3VFOB 3QDAA 1HIMH 3KYNB 4R96B 3PXJA 1ZGLA 3I9GH 1BLNA 4JANA 3UZVB 3UTTE 2ADGA 5HDQL 4HGWB 4ZFFB 4F57H 3ZZ1A 2QKIA 3X3GL 1NJ9B 1RK1A 5F44A 4JQVA 2QADD 1KJMB 3AVEA 2VWEE 4F2MA 3LVEA 1CGSH 4UT6L 1OQOA 1VA9A 4HUXA 1JHLH 1VFBA 4QGYA 1UCTA 1S7TB 2BMKB 1RIUH 1ZLWH 1L9NA 5E56A 1Z9LA 1F3JA 4OLYH 3Q6FA 4HZLA 2R2BB 4IBLT 2Z35A 1N59A 2HFGH 4QEGA 3CMGA 3NFPB 3FB5A 3VWJD 3BRDA 2GKIA 2ZUXA 1A9BA 4HK0B 4XVSL 3HR5A 2HKFH 2OTPA 3V7AG 1F5WA 4N90E 3U7YL 5I73B 3IRZA 2XNAB 4MCYB 4LLAA 3IETA 4RFEB 1TITA 5CGTA 4JFQB 1S7SA 3RVWC 3D85D 3G5VA 1VEPA 2GTZA 2OR9L 4NHCL 1OCWH 2HAZA 3CFDB 2JJVA 5DRZA 4UTAL 1CLCA 1JV5B 5DC9B 5HHXH 4G8GD 3DETD 4ZD3H 1DR9A 3VFUB 2CXGA 2HT2D 4EIZC 1KSRA 4Y88A 3GUTA 2WK2A 1EGJH 1R3LB 3GEWB 4WI9A 2P4AB 4ETQA 5GGTH 3QCTH 4MZ2A 2D31A 4LIQL 3BGMB 1JNHB 5A43C 3Q5TA 5DR5L 1NGZA 1J05A 1V3LA 5HYJB 2FDBP 5D5MF 3TBTA 4GG8A 5D2NA 2QBWA 4ZS6D 4HIEA 5HHVL 2R0LL 1QLRA 3OXSA 4AL8H 3INUH 3VFWB 1S7XA 5AYUL 1ITCA 3RIAK 1AQDA 5DD5L 3DGGB 1FG2B 3RX7A 4OIIL 2NW3A 4NDMB 1BOGA 1T1YA 1RURH 4R7DA 2MCG1 1P7KA 4PRID 2VDPL 4N1CA 4L4TA 4AEIH 3WS6A 1NMAL 3CMOL 1LO2H 4YXKH 2PW2A 3VXME 1CN4A 2VDOL 2XTJC 4R97C 4XRCA 5KSBB 4PY7B 5AD0B 1T89A 2BSSA 3WLWD 4LPWA 4F7EA 1NBVH 4AG4L 1OAUH 3L3GB 4XH2A 4NQCB 1BREA 1TVBA 5IMLB 1SBSL 3KYKL 4GKNA 1GC1C 2AQ3A 5IGXH 5DUPL 2UY7A 5DZLA 1J8HB 5FYJL 1KXVC 2APTA 2B39A 3RTQD 4OZFA 2X44D 3X13A 4UUJB 4WEBH 1OT1A 4JFDD 3SDCA 1Y18B 3U9UB 5IVXA 1FYHB 4Y5XC 1PQZA 1PSKL 3TP4A 1KLFA 4L1HA 1R0AL 5DVMA 4H1LA 3CFBA 1MLBB 4D9LL 4OAWB 3L3IA 5HI3D 4JPKH 1U93B 5GGSA 4KK9D 4PRPE 3MLRH 3C6SA 2OL3A 4JLRA 1OPGH 3KPQA 5FO7B 1NUDA 3ARVA 4EDWH 1UEMA 4QXUL 1LMKA 4ODVL 4WENB 3QA3B 4RNRB 1KIQA 1DBKL 1KPRA 3MRMB 4PJ8B 3RNQB 3RIAF 4FXKB 3BRGC 4RMWA 4XXCC 3U48A 1JFQL 5D1XA 4LRIA 4G9FE 3NA9L 3QIUB 5CINH 2H2SC 4TOYL 1XR9A 5FYLD 3IDNB 2ICWJ 5HHQA 1YYMH 4FNLH 4JFZH 2EDNA 1QR1A 1HH9B 1KJ2B 3GSQB 2Y36L 4JM2C 2VUOA 3SKJH 4ALAH 3V9FA 2PYED 3KNBA 3VXUE 3GBML 1MWAB 1DQLH 1YPZF 4O2FA 3BN3B 4CDHA 2LFGA 3RIFK 1AGFB 5FCUL 1R3HB 1J0KA 1YA5A 5GGRA 3QXDA 4GW4B 3QUKA 1CLZL 1F6FB 3QEQB 5DJ0B 4P5MA 5HGHB 4R0LC 2NY0C 1QFPA 4FQCH 3DVNA 5CJOH 3BESR 5GGUA 5HHPB 3U83A 3OAZK 3AMLA 2VLKE 4G9DA 4OIAA 1H8SA 5AWNH 3OB0K 5HI4D 3OWEA 2VMFA 3WFBH 1YEIH 4IRJC 2NZIA 1MRDL 4BSVB 3O3UN 4NO0B 3MRLA 1K8IA 3NACH 5EBGA 4WNQA 5J12B 4IIQC 4XNZC 5I15H 4CU6A 3V5KB 1IKFL 3LN5A 5F1SA 1P4BH 1OD7A 3DX6A 1P4LA 5FYKH 4CMMB 2AK4A 3C60C 3FOLA 4K3JH 5ALBH 1PBYA 2A74B 4NKDB 1RJCA 3DHJA 1TZGH 3O81A 4NZTL 1U8OA 1A6PA 4BZ1L 2FSEB 4JN2B 5EIVA 2F5BL 1WV7T 4BA8A 5E08L 4O58H 4LSPL 5KANG 1BJ1H 3C6LC 5D6DA 4C58B 1C16A 1NAMB 4XI5C 5I66B 5JA9A 1X6LA 1BZ9B 2PYFA 3VXSE 3U7WL 1FVDB 1MJUH 4CRPA 1AR1D 1FAKT 1KB9J 4NQVA 5EN2A 4QRRB 3MBXH 5H35B 3WS3A 2IAMD 2EO1A 2CLVA 3GSVB 5EOCL 4BQCA 2Q7NA 5F89B 1OP3H 3RIFF 5JUEH 4LLUA 2HYMA 4XVTL 5HVHB 2X1PA 4GW1B 3TIDB 3B8YA 4Y16B 3VD3A 2EH7H 3SGKA 1TJHL 2AK1L 3QXAA 2E8ZA 2F53D 1SYSB 3S35H 5KVDH 2QSCH 4Y4KD 5C09A 3QNXA 4J8RB 3PWPA 3RWGB 3HI6L 3ZKND 5T3XD 5KS9F 3HRZA 2DQCH 2AJ3B 4HIIA 1V05A 1IZKA 3T4YB 3HZKA 3S3SA 3MRGA 4LSDA 5BVPH 1H3WM 1LE9B 1S7UB 2E27H 2FLRT 4M7ZC 4WVRA 5BRZD 3VGAC 5IW1A 1G7JA 5DRWB 1AC0A 4JREB 2NY6B 4ODSH 5DJXA 2XOTA 2NY2D 2EO9A 3VXOB 5D96C 3KJ6L 4APQA 2XRAL 3MJ9A 3GO1H 4XP5H 4OD2A 3AAZB 4FXLA 1GZQA 4JPWH 4XGZB 4P2OC 4PGCA 4DQOH 3X14A 3HNTL 1QPPA 3QZWA 4ZFOA 3LH2L 5GISH 1QNZL 2CO7B 5DJAB 2R4SH 2AJYL 3S3JA 3D39D 4OZ4B 1AH1A 2DWDA 4HUUB 1SVZA 3REVB 1ZTXL 1SMOA 3KPMB 4PRNA 4Z0XA 4OI9A 1OWWA 4XC3H 5GS2D 2DIJA 4ISVA 2CGRL 5HHNB 1SHMA 1URLA 1EVTC 3VFTB 4NBYB 1A6VH 3FZUC 2X05A 5ID0A 3C5ZB 1NGXA 2CIIB 1KOAA 2CJUH 1G1CA 3QQ9D 2YC1B 3SKOB 1NCAH 2J88H 3FO1A 2GJ6D 4YC2B 4JDVA 3G04A 4HG4J 4LCWA 1NUGA 1UXWB 3W0WA 2FEEI 1UM4H 2R4RH 2ZSWA 4R8WH 5MI0C 1A64A 3PGDA 5DMGD 2EE9A 4GRMA 5EZJA 2QTEA 1G7LB 1GZPA 1CGVA 2YA1A 4JE4B 5D7JA 3QUYD 3SJVB 4XP1L 4LQ1A 4L9DA 5EORL 4PP1C 1FPTH 4R7NB 2VE6A 1F11A 3UMTA 1IGCL 4I2XA 4PG2A 4U4BA 1P2CB 4ZUSB 3DSFH 5C0AE 5E94A 1XIWA 2X7LA 2GSIB 1A3RL 2Z8VC 5JTWA 4LLVB 3HUJF 2PR4H 2Y5EA 4JB9H 5GRYA 3VXQA 3PGCA 1KENL 1TVDA 4PJEA 3D0VA 5KSUA 3MOBH 5CCKH 1BQHB 1TETL 5FO8A 5LGHL 1KFAH 4NHUB 4AH2B 4YBHA 5ILTH 1JGLL 1QSFB 4I77H 3VRJA 3RBGA 4YHOH 3KPOB 4UU9A 2VLJA 1EUTA 4QRTB 1SM3L 4HUVA 4KHXH 4X6CF 3V0WH 5I76A 5BMFL 4PUBL 2OSLB 1JE6A 3ZKXB 2F54B 3KYOB 2VLRA 4IM8A 5IJVA 3REWA 5E00B 3ULVH 3LDBB 3K4AA 2EH8H 2FEDD 2OP4L 4JVWA 1S5HA 5JDJA 2UWEA 2D03H 2Q7YA 4DTGH 5CKAA 5HYQB 1DVFA 3RVTC 3VD9A 5DJ6A 4EVNA 3SGEH 3RFZC 4L29A 2R56L 3NIGF 4ETYA 1MPAH 3EOAA 5TDNA 1N8ZA 5E2TH 1IQWH 3MV8D 3QO0A 1NBYB 1RZJC 2CRYA 3MFGB 3U30C 3WIHL 4AIZB 4NUJB 1I3GH 2WLZA 1DFBL 2DQDL 4NJ9H 1ROWA 1A4JA 3QDMA 1DLHB 5I8OH 5D1QC 1VGKA 5MENB 3MOAH 2YPLA 1OTUD 1SEQL 4MA8L 1CK0L 1I1AA 2RIKA 4FTVB 3D0LA 1MAJA 5LCVL 1CDGA 2VDNH 2Y72A 3TVMC 1JMXA 4XMLH 2UUDH 1KCKA 1MJ7L 3QI9B 3QIBB 4D0CA 4GXVH 5HD8C 1KJ3H 4PJ9D 3EOTL 4E0RA 2ZKHL 3GSOA 3DV6A 1U8IB 3NIDF 3VW3L 4GH7B 3BKYL 4BQBA 2X4NA 4JPIB 5EUOF 1T03L 2VC2H 4ELME 4G6JH 1NCCL 3T04D 2NY1D 4WFGE 1FE8H 4PY8I 3JVGC 1V7NH 3F7RA 4FFWC 4KV5F 5DJ8B 3LKNB 4PBVC 4P0DA 2R0WH 5GRUL 2M8XA 3U4AA 5SV3A 3GM8A 3QUMA 3QUZD 4Y1AE 2YMXL 4WJ5A 3VA6A 3LEVL 5IK3B 3NPZB 5DQDH 4R4ND 3RPIA 3BFOA 5DRXB 4U6HB 1WZKA 3MRJB