3ULVC

Structure of quaternary complex of human tlr3ecd with three fabs (form2)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
210
Chain Sequence
SVLTQPPSVSVAPGQTARISCSGDNIGSYYVHWYQQKPGQAPVLVIYEDSERPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSSYDDPNFQVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 3
publication title Lateral Clustering of TLR3:dsRNA Signaling Units Revealed by TLR3ecd:3Fabs Quaternary Structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ulvC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ulvC01
3QIUC 1IKNC 1XGPA 4LGSB 4X7EC 1GL4B 3MCLL 5F6IB 2F5BL 3P9MB 3JWDC 1YEDA 2PF6A 5IVOA 4PJXB 3EFDH 2V2WA 2R1XB 4UB0H 2DQCL 5A2IH 1JF1A 4X7CC 5JHLH 2XZQL 1Q9KA 2QKIB 1LO3H 4PTTB 5K9OA 2XQYG 4OBRA 5J3HD 1BIIA 2FB4H 2IG2L 4EDWL 3KXFA 3BKJH 5MEPB 2HKHL 2WP3O 5F7EL 1IM9B 2X40A 3G5VB 4H0IA 5KZCD 2A83A 4XVJL 2W60B 3N85L 1QQDB 1MCWW 5FA4A 5F97E 3LPGA 4LF3B 3LV3B 4OM0L 4PJAF 4JGJA 4UOW0 5I71B 2EZ0D 3HE6C 2NY4B 4XCEB 4D9LH 4C56E 3SDAD 1MCOH 3OR6B 4NRYA 4DN4L 1VKXA 4DKAA 5IB1A 3CFDB 4OQTL 4YFDB 3CXDH 3S37H 4E41D 3MNZB 4HS8H 2BXYA 3JTTB 3SGKC 1EEYA 3BFOA 5L9DL 1U3HB 2R0LH 4Z6AT 3R1GH 1G84A 4BQBA 1CG9B 5FKPA 3D3VE 3CXHJ 3JWNC 3ARDB 12E8H 3D25B 5C09A 3RWJB 2W0KA 4HIJB 1ZGLB 1IGTA 1JPFB 1I4FA 2APTA 1OGTA 4PBWD 4N5EC 4NT6A 3RIFK 5IOPB 1A2YA 1UYWH 2IAMB 2EH7L 5JR1L 4WV1A 1RJLA 2R2BB 4XVSL 1DP0A 5L2KA 4RMVA 3VWJD 2WUBH 4G7VL 4LSQL 4CVZA 1SVCP 1HYSC 1TIUA 4P2OC 3GIVA 5D7SL 4OLWH 5DLML 2UWEA 3EAKA 1XR8B 4JDTL 7FABL 4FFVC 3QEUB 1AGBB 4EN3C 3CLFH 1MCFA 5L88L 3C60D 2Z93A 5D5MB 1SEBA 4N0CC 5SWSD 3JTSB 4YR6B 3RNKB 5EWIL 3V79C 4PRPE 4M6NL 3EFFA 3B2UD 4QOKB 4JPKH 1GVIA 4M00A 5E8OB 3EZJB 2IQAA 2VZVA 3MLUH 3DETD 5D1XC 3BH9A 1F3JA 3ULSB 4ZSOE 1ADQA 4XH2A 1L4IA 1NGWB 4DZBA 3QDJB 1J10A 1OP5H 3QIWA 1RJZB 2C1PB 2ZCLH 1VEPA 1V3LA 2XKSA 3PDOB 4MGXA 3P11L 5DC4B 3KLAB 3MBEB 3GSUA 3LKOB 1BEYL 3VXMA 1BLNB 4KROD 3STZB 5IROC 4G3YL 3I50L 1F90L 4BFGA 1OD9A 3BEWB 3QIUB 4Z7QE 4OUUB 4ZTOL 2W0FA 2XZAL 4ZS6D 3H3PH 3G04B 4I9WD 1B3JA 3FTGA 5JW4Q 1V3KA 1WITA 5HGAB 2FHBA 4I0PC 2J4WH 3O81A 3KXFD 3OV6A 2L4OA 5ICZA 1F11B 4RMWA 5IGXL 1MFBL 3ABZA 3GBMH 2AS5M 2F19H 4JFOA 3PP3H 4FXGA 3CVHA 4EI5A 4BSWB 1NJ9B 3S97C 4BJLA 3DO3A 1AR1D 5DUBA 4OKVB 1KCUH 3EYOB 5IB5A 3SKNA 1ERNA 1JZ6A 3HE6B 4IMKA 2XICA 1KJ2H 3B6SB 4S11A 5IWLC 3VWKD 3RHWK 4WWKA 3LEYH 1Q8MA 3QEQB 2BVQB 5TF0A 4PJIF 5H37G 2ZG2A 2H9GB 1D5MB 2CUMA 1FNGA 2JB6A 5M95B 4EVNA 3IAGC 1INQB 4LIQH 4QTHA 3AAZA 1BQUA 1IAOB 1TPXC 1C5BH 4JY5L 4HF5H 2FX8L 4OZFB 1YEHH 2CK2A 3ULUC 4X6EA 4MD4A 4UIMB 5DTFA 1M7DA 1GGBH 3RX7A 3E8UH 1B9ZA 4PRIE 1ZHKB 1IRAY 2B1HH 4ZXBA 4N90D 4R4BB 5BJTB 2WIIB 2VITB 4CU6A 2LU4A 3U4EB 5DZOA 1DLFL 3T0VA 1KG0A 3MGOA 3MRNB 4F58L 1X4YA 3FQRA 4XHQA 1MCSA 3LB6D 4QRPB 4XP5H 1MCHA 1UT9A 3O2WL 4L9LA 4ZUUA 3U4BL 1F3DH 5JNYB 2EXYC 4U6VH 4V1DE 1MWAB 4PREA 2HMID 5JHDB 2VC2H 3W9EA 1NAMB 4F7EB 3CZFB 1UACH 4JFQB 5TE4H 4Y5VB 3GMRA 1RI8A 5BQ7A 3O4LE 4U1MA 5HHMB 1ES0A 3OAYH 5D1XB 2QQLH 5I8OL 3V0WH 1JWSB 2XA3A 5INCB 4JO1H 1NL0H 2ZCHL 2BOBA 3SHSA 2L0DA 2LVEA 4ELKB 4ODHL 3QULA 2GCYB 4UTBH 3VXMD 2UUDH 4XP4L 5DD5H 3IDNB 1FL3B 2V5SA 1P6FA 1P4BL 3WNOA 3JWOH 3PE9A 1MJUL 3BPLC 4YDIL 3TCLA 1XIWA 2WLZA 3OAUH 1UC6A 5EBLA 3GRWH 4MHHI 2ZOKB 3CK0H 4NBZB 3GJFB 4XCFH 4NJAL 1RAMA 1WZKA 4IRJC 3TPUA 1MHPL 4XNYH 2ZUQB 5GIRA 1GOFA 4JVUA 4I0PB 4K7FB 5E0QA 2W65B 1J8HE 1N0XH 4KTDH 5I73B 5CGTA 1DBBH 4YK4B 1G7JA 5F7MC 5AYUH 1KBGH 1VFUA 2YN5A 3UJJL 3MQIA 4MA1B 4HUVA 2C3WA 5A16B 5J56B 4EI5D 3ROOB 4CBPA 3R06B 3WFBH 1NEZA 3H7BB 4XWOD 3RUGB 5CUSL 1QSZA 1W8NA 3OHXA 2P45B 3OKMB 2VR5A 3V0VB 1IM3B 1WIUA 1KEGH 4P2RB 4OM1L 1T7ZA 2XWTB 1U3YA 1ZHNB 5T1MB 3CSBA 1KCSL 4OLEA 1ZSDB 4D0CB 5GRXG 1JFQL 2Y7QA 2MOVA 5T3XH 4MNQA 5C08E 1TPXB 4KPHH 4HK0A 4J7RA 3UPRA 3R0MA 3PABA 4PJGA 3DGGA 4JFEA 1U8MA 3HCVB 3NZ8A 1U0QA 2ZSVA 3T65A 1DEDA 1DEEA 5DZLA 4ZXBD 1ZVSA 4WY7L 3X11B 3F7YA 4FABH 1S8DB 4MJ2A 1ZANH 2E8ZA 1SY6A 4MJ6A 3MXVL 5IJKC 3CX5J 4KAQH 4RA0C 4IMLB 2NX5E 1EFXD 2DQEL 3QDAA 4F8TA 1FPTL 2MQCA 5C0BE 4WI7A 5C0GA 4NZTH 1P84K 4N8VG 5ESAA 5AD0B 5IESH 2DQDL 3TM6A 3HNVL 2QR0A 3MV9A 1DQJA 2FSEB 1LE9B 4HC1A 4FQXB 4WI4A 5I1KL 2AEIT 3ARGA 4KJPD 4FG6C 3TH3T 4P59L 1G7IA 2DWEA 5DJCA 3EJJX 1DQML 4JKKA 4M48H 5I1EH 1L0YA 5F1IB 3SGJA 4NO5A 5MEOA 5HDQL 2D0FA 4UDTA 4OLUL 5FM4A 1XF5B 2E6PA 2EO1A 4RAUB 5DRXA 4XCNA 5CZVL 1YPZE 4M5YL 3X3FH 1E4XL 4XBPA 5KSUB 3BZEA 1T4KA 1EJOH 5MENB 1OGAE 2C4FT 1FG9C 3RWDA 2YOCA 5FO7B 5B39B 1KSRA 4K9EH 2EDNA 1A6VL 3EYSH 5I6XC 3TLRA 3I9GH 3INUL 4MAUL 3BPLB 1RVFH 4GBXD 1DDHB 4XVUC 2R4SL 5DRWB 2VXVL 5SX5K 2P49B 3C87A 5T1DH 1U41A 4IRJB 3TV3H 4YHKL 1U91B 1AGFB 4WIQA 5D7KD 1ZA3B 2BC4B 1MCWM 4OB5H 1MFAL 3ZE0E 4YDVA 4U31A 4YX2H 1BOYA 1JV5B 3SDYL 3D18B 3S35X 3IDIB 3T4YB 2XPGA 4AQOA 2GUOA 3RWFA 2LE9A 2AK4D 5GS2H 4P9HC 4XCYA 1ZLSL 2R23B 4O02H 4YIQA 2X89D 2PO6C 1T89A 3OGCB 4FQJL 3GIZH 2VXSL 4JPVH 5FYKU 3FB8A 4Y0GA 5I16A 5C7XL 3AS2A 4Z8FL 4YEFA 4L4TA 3UTSB 1KELL 5DYOB 3VDCA 1PG7X 4MNQD 4RMQA 5GGRY 5EZJA 1T21A 2SEBB 4TPRL 3QJHB 1XGQB 1IGIL 5GSVA 3VRIB 4Z7OF 2D7OA 1CICA 3VDAA 4GRLC 4JM2F 3HPLA 4XMKH 3QG7L 1UXSB 4MD5B 3HE7B 1MFDH 2EXWC 1G7HA 1KCRL 5A2FA 1R3LB 2VDRH 5HHPA 3DIFA 2XKNA 2R29H 4J3OC 5ANME 4TYUA 2VR9A 1M1SA 4WEBL 3S9DB 3GGWA 4YPGB 4HUXA 5ILTH 1QLEH 2QQQA 5F70A 1C1EH 2Q8AL 1FLRH 5FM8A 4QXWA 2X09A 3FT4A 1AHWA 4RSVA 2D7MA 3CCHB 5HYJB 1EMTL 1XF2B 1SYVA 1RUPL 3HS0A 4PJ7A 1X6NA 2NNAB 4NKMB 4MD0B 2EIDA 4FNLH 5DVLA 5J7CC 1BVKA 2BRRL 5ISZE 3E3QE 4X9GA 4F7CA 4PJBF 4JPWH 3SE3C 2WV3A 3H0TA 4MQXC 4QRRA 3QXAB 4NQEE 4X6FA 2DQUL 3Q6FA 2UYLB 3VFMB 4PLJD 5HHXH 5EOCJ 1NKOA 3QUXC 5HYEA 5C0CA 5KSBE 1MFCH 2D4DA 3FB7B 4N8CL 3W5MA 5FDWA 3QWOA 4XXCC 3UAJC 3HC0A 1AXSA 2Y07H 1YQVL 3GSWA 4F57L 1OAQH 4D0DB 1FBIL 2HRLA 5DS8B 5C0AB 5I6XB 1E4KA 4Y5YC 1EGJA 1FYTA 5E6IC 2VL4A 4NQCB 1T83A 4JM4H 1MI5A 4KRMB 4TNVK 4FXKB 3QXTA 3PWPE 1NMAL 4YDKH 3C8KA 1JZ5A 2YXMA 4ZG1A 1L0XA 2X7LA 4ZTPH 3BT2H 3C2AL 3KYKH 1IGJA 2AK1L 4S2SB 2ARJB 1RUML 1CDIA 4UTAL 5GZOD 1D9KC 2ESVB 5EC2A 5EZLA 4DW2H 2FGWH 3UTPD 3P9WB 2W92A 4U2YA 4WUKH 4ZFOA 3VRJA 2V7HA 3MNWA 1DSFH 2VLKA 3RJQB 2PO6B 5BMFH 3KPQA 1ACYL 3FQXB 1OTTC 5J3HC 3QNXB 2E7LA 1ETZB 2EDYA 1TQCB 3HFML 1DQDL 4Y19D 3GK8L 4I48A 1IGYA 5ALCH 1IQDA 4L4TD 1SM3H 4PJFB 4WU7B 2PYEB 3QQ9C 4PGDA 1A8JH 5J4MA 4YXHL 3WHXA 1GIGL 3RAJL 3VFUB 1OAZH 4Y4KB 1CICD 1DBML 1P7KB 2A74B 43C9A 4A2MA 3B5TA 4GRLB 1Z9SA 2VZTA 5DJDB 2VDKH 1M05A 5SX4H 5DHYB 4LLWB 1TETH 5SWZB 2F54B 5E2WL 1I1FB 3PXJA 1CGSH 5IBUG 3H9SA 5JPNB 2AXJA 2ICWJ 4BH7A 2CLZA 1A6WH 3CFCH 2HJFA 3QNYB 3T2OA 4XNUL 3RPKA 4U49A 3MCKB 1JP5A 3LKRA 1INDH 5FYJE 4XPBL 5C0IB 2RAMA 3DGCR 4GQ9H 3KPLA 4YWGL 3SGEI 1FGVH 3HR5B 1PSKH 4ZDHA 3SCMD 5I1CH 3EO0A 3SDDD 4DOHE 5F7YC 3OTTA 1WCQA 5EO0B 4JKLA 1KXQE 4GAGL 1BREA 5KVEL 1LO0L 4I4WA 2OR9L 3VXRE 1B2WH 1I8LA 3PWVA 3QA3B 3VH8B 1W72H 3MGAA 3OXSA 3C5JB 4PJIE 2AJ3A 3SDCC 1EO5A 4FFYL 4PJEA 5HHQB 4J6RH 2IQ9H 1G6RH 5CEYA 1EHLL 5KN5A 4K23L 5IMOB 5HI5C 3C60C 4BFEA 4FFWD 2C3HA 1QNZL 2FRGP 2BJMH 1MCPH 5F89A 3S35H 3ALPA 1G9NH 4QCIB 1HWGB 1I1CA 5T1KB 2VLRB 2J8UB 4QY8B 3UO1H 1A3LL 3B2UC 4P2QA 1RURL 1KCVL 2JE8A 3SN6N 5CP7A 1CL7H 3CC5B 1YEFH 5T5FH 1PEWA 4Y5YB 2B4CC 4UINL 3MOQA 1MI5D 1GC1L 4Q7DA 5K59F 1A6TA 4D9RE 5B38A 1YJDC 4MXQD 4H1LA 4K55A 5A43C 3D87B 3H2WA 5FYKL 1QSEE 4Y7MA 3DROB 3EDFA 1PG7H 3TA3D 2OZ4H 5GQBA 3HZVB 3E1F1 1D5IL 3MTRA 4XMPH 4Z76A 4XGZA 3T08A 3TC9A 4U0RB 3L5JA 4KROC 1B0RB 1D9KB 5FK9A 3RVTC 2AI0L 1WC7B 2DMKA 2DQTH 3ARBB 2XYCA 3TH4T 4YQXH 4M7ZC 4Q9CA 2IG2H 5HGHA 4GKZB 4WNQB 3VGGA 1YECH 1UZ8A 1EO7A 4ZS6C 1I7RA 2Q7YA 2YZ8A 2B2XL 4FTVE 2DQGH 2YKLH 1U8HA 3D2UA 3SKOA 2VISA 5KJRH 3JV6B 4HXAL 4OM0H 4OI9A 4BUGA 3HG1E 1FDLH 4L3CA 4B53A 3FAWA 5IV2B 1U95B 3MGTA 5KZCB 4J4PA 5E94B 3RKDD 2YPLA 3G6JE 4GLRI 3AREA 2O61B 1U58A 3GMOB 3QO0A 1YN6B 4L5FH 4LASH 4JO2L 4C56D 4HKJA 3MSPA 5F96H 4LGPB 1AR1C 3TBWA 1WCBA 3C5ZC 1A21A 5D7LA 1BBJA 5ID1A 3U46A 4GJTB 3VWKC 3NCYP 2J8OA 3SDAB 5ICYB 1X5AA 3BQUD 3OF6D 3WIIH 3W2DL 3RX5A 4Y4HA 3ZLQC 1JVKA 4HHAA 4I18B 3P73B 2HFFB 3BW9B 4E41B 5DFVD 3D3VD 1IKFH 5FCUH 2Y36H 4PB0H 5JR1H 5GISL 4Z18A 3T0DA 4JPIA 3BIKA 1BZ7A 1HSAB 2AXGA 3ZDYF 4DGVL 2B0SH 4NC0B 2P8PA 1HQ4B 4Y4FA 3RGVB 4HIXL 4A6YB 1OSPL 4JJ5A 1H15B 2V6HA 3IFNL 4HEME 4GUPB 4NYLB 4KKAD 4XNMB 4WV1C 4PRNA 4RMUA 4NCDA 5FOBA 3VWJB 3MYZA 1DL7H 4KHTL 4XBEH 2DWDA 2R69L 4PJXF 1XR9B 3V52H 1RZJC 2W1NA 4YO0B 4HX1A 3LB6C 1DUZB 1FJ1B 2V5RA 2HVKA 1R5WB 3TO4A 1XZ0B 5EUKA 3MRLA 4JLRA 3C60B 3QXUA 4PRPD 5SWSB 2YD1A 1G0YR 4YBHA 5KTEH 4WDIA 2HMIC 4WFHD 5E4EC 3MUGB 4KI5D 2G5BB 4JO3H 1F8TL 3QG6B 3SEPA 5LJYH 2VERN 1CLYL 1I9EA 2HFTA 3P11H 5I17A 4M62H 4ELMA 3P4NB 4Q0XL 3D0LB 3CPLB 4G42B 3QCUH 3DXAA 2A6DB 4LLQA 5DJ8A 1MNUL 4R97B 1MREH 2VNCA 1XGYH 3QRGH 1PD6A 2D3VA 1I8IA 5EFIA 3ZMRA 2Z91B 3ECBA 4I77H 2CPCA 2A38A 1YEDB 1QYGL 4M6OH 2H3NA 4WGWB 2V2WB 4HJGB 3BDBA 2A6IA 5CEZH 3D2UD 4YH6A 1FP5A 3MLWL 2DLFL 2ZSWB 5K9OB 1XGTA 3X12A 1BIIB 3P4MA 2V17L 3KXFB 4FQIH 3TO2A 2YC1B 3ZT7A 3W39A 4LCIL 1CFVL 3VMPA 4X99A 1RD6A 3LSOA 3MROA 3LMJH 4Z0BH 4R6UA 1JGLL 3PV6B 2IBBA 4NHCL 4RGNE 1SMAA 2AV7A 2AEPH 3WE6B 3WS3B 5FA4B 3QXVA 3F6LA 3FO1A 5D7IA 1IE5A 5C1MB 3DHMA 4UT7L 5LQBL 3LQAC 2GTZA 3VWKB 5BOPA 1BBDL 4LKCB 4NRYB 4HUUB 1VKXB 5IB1B 4Y4HD 2FEDC 2VYRE 4IDJH 4JY5H 5HVWA 4L8CB 2BHYA 1CT8A 4PYHA 2PETA 3MR9A 4XC3H 4JHBA 1UENA 1EEYB 4HD9A 4WW2C 4LLYA 1M7XA 5D2LA 5DUPL 4HFWB 4UT9L 3OPZL 1WWAX 3BD5A 2KH2B 5J12C 2VMFA 1IGTB 4K7PX 5DMJB 3ZDZF 3CU1A 1I4FB 1N4XH 5ETUA 1BZ9B 4PRID 4PGBA 4Q9BA 1E6JL 4WV1B 1RJLB 3OAZH 1KULA 3NPSC 3EYUL 3VMOA 3REWA 1MJ8L 1ZHLA 4LLAA 4MJ5A 4AEHL 2BSED 3NCFB 4X98A 3VJ6A 5E2VL 2VUYA 1WVZA 3K80A 2UWEB 2YWZA 2Y25A 4OIIH 2BVOA 5CCKL 3W0WA 1Z5LA 3NPZB 3TO4D 3MJ8B 2YD5A 4I0KA 5D2NC 2XQYK 2E8YA 5F71A 2Z93B 1SEBB 4Z7OE 1QKZH 5E4EB 3P0VL 3O4LD 3DSNA 4O58L 4N0RA 3EFFB 2OI9C 3QR2A 4KJPC 2IQAB 2NY5H 2DOCA 2X9XA 3BH9B 5EOCL 2R56L 4XH2B 4H5SB 1CGTA 4DZBB 1K4DA 1RUAH 2JLLA 1NPUA 2RR3A 1CGUA 5E70A 4UNVA 3BPOB 4EZMA 4CKVX 3O9WC 1IGCH 5GGSB 3GSUB 1XH3B 3VXMB 4QF1B 4OKDA 3WHE0 1MAJA 3QH3A 5K9KA 1UWEH 1WK0A 3EYVA 4N0FB 2FX9L 5HXMA 5J8OA 1KIPA 5HDLA 4MZ3A 1L7IH 4L3EE 4GBXC 1TTFA 5JQHC 1MCKA 4WEUD 2JJWA 3DARA 3NFSH 3F7VA 1H0DB 3FTGB 3UJJH 1UEMA 1J8HD 2H32B 1F3RB 4OCYL 1R3JA 1MHEA 1CDUA 5ICZB 4EDXA 1HIML 5I1JH 2CGRH 1HHJB 3BYYA 2BY3A 4OM1H 2C9AA 4GKSB 5TE6L 4P23A 3H42L 5EU3A 4YXLH 3CVHB 4EI5B 1ZGLP 3QUZA 1BOGA 4FP8H 4KHXH 2YD2A 3BPNC 5DUBB 5J1AA 1HCVA 1WUNT 3FZUC 4XZUA 3DUHA 1ORQB 1BGXL 4YGVB 1VPOH 1YN7B 2VSCA 1R3IH 1KOAA 2IGFL 3OKNA 1PAMA 4EVNB 5C08D 5F1SA 4LRIC 3HMXH 2BVEA 1EIBA 3S34H 2EDBA 4OLXL 3ZTNH 2LAGB 3H9HA 3GMLA 4GKNA 1OVZA 5C07E 3G6AA 2Q6WA 3TFKC 5B8CC 5J12B 1MUJA 5IQ9A 4ODTL 3GDBA 3OB0K 1OSZB 1J87A 4MD4B 5TFSH 3HLAA 5DTFB 1M7DB 5IHUH 1ZS8A 3FCTA 1HXYB 5EU6A 1U92A 4JR9L 4HBCL 2YUXA 4GRMA 4NZUL 4ZXBB 4I3SL 2NX5D 1JYVA 4JFFE 5FGSA 1F4YH 1S5HA 1OARH 2HFGH 2XIDA 4W6WB 5MERB 4AIZA 5C0BD 3BRDA 1EFXB 4H20L 2QBWA 3BP7A 3KPPB 2BNRA 2NY0D 2X4PA 4L9LB 4F9LC 3P2TA 3Q2CA 5D2NB 3NACL 3O6ML 4P59H 3EHBC 4BK5A 1KLUA 2O26U 4G5ZL 3MRDA 3IXTA 1GAFL 1DQMH 3LZFH 1C12B 3W9EB 1A22B 4M7JL 4HPOH 3N1FC 1D5ZB 4X9HA 3MRHA 2OI9B 3VFOA 3DSFH 3IFLL 4U1MB 3PF2A 3RUGF 1IQWH 4U1IA 4DVRH 4RDQF 1RULL 5FV2A 3UEZA 2I9TA 1G7QA 2CIKB 2VABB 2V9TA 4YZFF 5L8JB 4HZLA 3L7EB 3V0AC 3QULB 1OGAD 4Z5RA 1KJVB 2J6EL 1BPVA 3WFDH 4L3AA 1WQVT 5L6YL 1AGCA 2A77L 2D7PA 4OFPA 4N1EA 1RIVH 4QHKI 1XF4A 4JQIH 3TCLB 3SKJH 5EBLB 4EIGB 1JGUH 4GBXB 2HFEA 4K3GA 3QCVL 3ULUF 3TPUB 1WT5A 3L3KA 5H35B 3MPCA 1RUKH 3L3DA 1NQBA 4YHNB 3MA9L 4LSSL 5FKAA 3HHRB 4HCRH 3X14A 3IKCA 1G7JB 1LD9A 4X0KB 1X5KA 4WUUA 5HI4D 3DV4B 2R8SL 4HUVB 2ZZUT 4K7PH 3F58L 3ES6B 3T4AA 2EDHA 2AK4B 5C7XH 4O4YL 5MHSE 2CRIA 3P0YH 4LARH 4XMLL 2H41A 3OHXB 5SV3A 4JHAH 3OL2A 5DD1L 3BPNB 4X8JB 4FQPA 3QJFA 3RJDA 4G8FA 2MCPH 5BOZG 4M03A 4PY8J 1WBYB 3PWJA 4U3CA 1UKTA 4QGTA 2YXFA 2AQ1A 3MV11 5IW6A 1ZHBB 4N0UA 4DKEL 3FRUA 3GMPA 4RNRB 4MNQB 1H8SA 1A6ZB 1R6VA 2IANA 1B6UA 4HK0B 1CICC 5C9JB 3PABB 5KVDL 3DGGB 1IC5L 4ZFGL 1U8MB 5DWUH 1TJIH 1TNNA 3T0BA 5I19L 2ZSVB 1RZKC 1JPSL 1WIPA 2HTLC 1NBYB 4QLRA 1OAKL 3QUMH 5DUML 4RMRA 1ZVSB 2Z8SA 3ZHKA 4LBEA 4YHIA 1EMTH 4MJ6B 4OLYL 2EDXA 4JQVC 4N5UA 2ICEB 4OZGE 1NCCL 1R3KA 1FAIH 3BAEL 5C0RH 3FQUA 5EO1B 1FL6A 4OV5B 1QVOA 1GZQA 4OCMC 2W07A 3CNKA 4M7LH 5J6HB 1KTDB 4JRXE 3QIBD 5C0GB 3QHFL 3SCMC 5ESAB 1WWBX 4PGJA 4WTZA 3SDDC 1XMWA 5ISZD 1AJ7L 3AC0A 1N7ML 4OZIA 3D85A 3AGVA 2QR0B 4JE4B 1HZHH 5GSRA 1KIUA 4J1UA 4L8DA 1N0LA 4NQED 4Q9QH 2X4NA 4PR5A 3QI9A 2AAVA 2XG4A 5EU5B 1G7IB 4ETQA 5KS9A 1VEOA 4OGAD 2NLJA 4NO5B 2W0PA 1IVLA 1EHNA 2Z35A 4NZRH 4UDTB 2YA1A 4NQSA 1CFNA 3WIFB 5DRXB 2CKBA 4XCNB 3L3HA 3S4SA 1UH3A 2VLJA 5IEKA 3CSYA 4K3EL 3ZDYE 2Z8VC 3BZEB 1ED3B 1T4KB 2KDGA 4M7KH 1HHGA 4UILH 3ARFA 3HRZA 4M3JA 3FO9A 2XN9A 1IT9H 2PR4H 2X9WA 4F2MA 1WLHA 2JTDA 3WJLA 1GGCL 4OTXL 1JTPA 1T1YA 2P5EA 3C9NA 3FQWA 1IMHC 2BNQE 1QSEA 2LU7A 1NAKH 3B2VH 4P5TA 5FF6A 3GUTB 5CLTA 1T22A 2IH1A 4RX4A 15C8H 2IWGA 3TA3C 3TJHD 2HRPL 4GW1A 5JIKA 2FL5A 5ERWB 3GSRA 3HPJA 4PUBH 1BQHB 1KC5H 4WUUD 5HYSG 3IU3A 1QR1B 2XY2A 4ODVL 5FHAH 2GUOB 1I7UB 1IGML 4LLVA 1QLRA 3HI5H 4YIQB 3JV5A 4YC2B 5JMRA 1WF5A 3WD5L 2Y23A 4X5XA 4CVXA 4B7LA 4G6FD 5I18L 3FB8B 2FIKA 5I16B 1CZ8H 2HLFD 1WICA 4Y19B 4X6CA 1JWMA 5EUOA 4L4TB 3RKDC 4KMTL 5EZJB 3RWHB 1A3QA 5GSVB 3EOBA 4RZCB 5EIIA 3V4PL 1IFHL 1CICB 3DVGA 3HPLB 4A6YL 5I9QB 3DO7B 4H26B 4NGHL 3AS1A 1G7HB 2VAAA 3RWIA 3UX9B 5GGQL 4GAYA 3BQUC 1HDMA 4K94L 3NAAH 3D39E 3VW3H 4ESKA 2VLME 4HIIB 2EH8L 1NGZA 1MAMH 2YBRA 5TGBA 2DLGA 2FD6L 4K2UL 5DFVC 4Z7WB 1NKRA 5BXFA 1DQLL 1WZMA 5HDBF 2NY1D 3GGWB 4LVHC 5FYJD 4HUXB 4Y16A 4GMTH 4TSAL 2DMBA 4NZJA 3FT4B 4X80L 3LKPA 1UXWA 4CN6A 3SCMB 3HS0B 1CD1B 5IVXA 2P24A 4KKAC 1G9MC 1K9TA 3UBXI 3VXRD 3D85D 1OTUD 1U6AL 2JJSC 4DGYL 1BVKB 5D5ME 2UV3A 3KPNA 3DRQB 1S7VB 3MXWH 4K8RD 4F7CB 1EHLH 2CK0H 3CH1A 1CDHA 1SJHA 3QI9D 1T3FA 3H0TB 1KACB 1QSVA 5JIHA 3TNMB 1QNZH 3VFGH 4DZ8A 3S8WA 3F65A 4U3HA 2ICES 3ZKQD 2P8LA 5GRVL 5K93A 1KCVH 4GG6E 1V7NL 4R26L 3U0PB 5KSAA 2FATH 1I1AD 3QDJE 3ZYOA 3JWDH 3HNTH 3WN5C 1H3PH 3EDJA 3QWOB 1RZFL 2WINA 4WFEE 1CGVA 1AXSB 3OR7B 4JB9L 4PJFF 1OAYH 3NA4A 1WWCA 2L7JA 2XN9D 2BP3A 4D9RD 1FYTB 2P5ED 2C7UA 2VXQL 3L5HA 1MI5B 1QSED 2AEWA 3QRFM 3AY4C 2FWOA 3C8KB 1N2RA 5LGJA 1LQSR 4AK1A 4GG8A 3N9GH 3QAZC 4JGMA 5DFTA 1TFHA 3TA3B 1J5OH 2WANA 2I07A 2MPAH 1CLOH 5ESQA 2XWBB 2YRLA 2A1WL 4TUJA 5FYKE 5EZLB 1EHAA 4ZQKB 3SKUD 5I1IL 2DICA 2VDMH 5AUMA 3KLDA 4HXAH 43CAA 4ZFOB 2WBJD 4OCRH 4QT5A 5D1QC 4GMSH 3L1OL 3CUPA 4KV5E 1SEQH 2V7HB 3R0NA 4JG1L 4EJ1C 2VLKB 5GPRA 1ZT1A 1DBKL 2VN4A 5FXCH 5IFHL 5DHVH 4BM7A 5D7JD 3HG1D 4PJCE 3F12A 4LLUB 2JK5B 3QWRD 5F7LB 3RI5K 2F58H 5J0BA 4CDHA 4HS3B 5I66A 3ARXA 4PGDB 3P0GB 4QNPF 4ZOEA 3WHXB 1I7TA 4RRPG 3VFNA 4KZDH 43C9B 4LDOB 1SJXA 4C56B 3UC0L 3FN3A 1M05B 3GHEL 1GXEA 2VIRA 5BS0A 2NMSA 5JW5A 5CAYB 4NFDA 3BQUB 2J8UF 5GGRA 4Y4HC 3HUJA 1S9XA 2AJVH 3K2UH 3CGTA 5DT1H 1OWWA 4QYOA 2CLZB 4P3DA 1OSPH 3D3VB 3P30L 3MACH 4PJ9D 1MWAH 1CE1L 5KOVC 4Y16D 1T20B 3SPVA 1DN0A 1FVCA 1NAMH 2VZOA 1RZJL 1D6VL 4XP6H 4FN0A 3IDYB 2ITDB 4LHJB 4JFPA 3FB6A 4HH9A 1W2KT 2R2CA 3EO0B 5E5RB 3KNBA 3D0VA 4LRNH 3JVGC 1FC2D 5EZOH 5IB2A 4ENED 5IBLD 5IKCA 4YHOH 4HAFA 4PYGA 2VDLH 5ITFA 3MFGB 3OXSB 1ADQL 2A6JA 5DEGB 2AJ3B 4X8XA 1HNGA 3HC3H 4PJEB 2FBJL 1HH9B 1FG2A 4P5KA 5HHME 1PZUB 3TO4C 4O2EA 1NGYA 4G6KH 2X4SB 1AO7A 4GFTB 4WHYH 1FVEA 4U1NA 1P7QD 4OJFL 4PRPB 3GJFH 4HWBH 5FO8A 5F89B 4GQPH 3NGBC 2BXZA 4G9FA 2RBLA 3KPSA 3ZE2E 3I02A 5JLZA 4ZSOB 4XC1L 5CP7B 1WSST 3T1FA 3VGAC 4UOJA 1M71B 4H1LB 5TE7L 4XWGL 3U1SL 1IGFH 2QQNL 4LSVH 1D5BA 3BMVA 4W6XB 1HSBA 1Q9LA 1AQDB 4XGZB 4JHZA 5FA3A 1HINL 1I85A 4OFVA 5DJAB 3NTCL 5D6DC 4WFGE 3TT3L 3L95B 1LNUA 1JRHL 3CVHL 5C3LD 1HKLL 5HGHB 5I1DA 2ZP0T 1CXIA 4D8PA 1Y6NR 1RFDL 3OG6B 3SKMA 4XP9L 1UZ8B 1U8PA 1I7RB 1JGDB 2EC8A 4QXGL 1MLBA 4OF3A 2Q7YB 4HG4J 4NN6B 3VD3A 1U8HB 2VQ1A 3D2UB 4NHCH 3RUGE 1NSNH 3VG9C 2KQMA 1MELA 1VFBA 2OL3H 1CFSA 3U7AA 1QBLL 1IBGH 1CD8A 4YZFE 4L3CB 3ULUH 3FMGL 3PQYA 2IPUG 1KB5A 3WUZA 2YPLB 5DDHB 5I0DA 5D72L 1U58B 3FHAA 3QO0B 4M6ML 4HKJB 1KIQA 4HK3J 4G6JL 3UDWA 5BS0D 2BHZA 3U46B 4EI6B 1RMFL 3TZVA 3OPZH 5CWSA 2Q8BL 1E4XI 4Y4HB 3SE4A 1K2DA 4OGYH 1QFWH 5GRJL 4M43L 3PGDA 4D94A 4RGOH 2GSGB 1I3RA 3VI3E 1A4JB 1CXLA 4DUVA 4JPIB 1BZ7B 4AH2B 2XRAH 4I5BA 3FFDA 2V5MA 4Y4FB 4ONGL 5BO1L 3OZ9H 5C2BL 4JJ5B 1LGVA 3O3EA 4PRIB 4LK4A 1JGVH 1EDQA 5FOBB 1OP3K 3QEGL 3W9DA 1G7LA 1M7IB 2M2DA 3GSVA 1B4RA 2DWDB 3HN3A 3V6OA 4ZO9A 5CGMA 4K3JH 4KWUA 1X5JA 1I3VA 4LCUA 3WFCL 4N8VA 1TITA 1FFOB 2B1AH 1XGUA 4HX1B 2HVKB 2NY0C 2J7LA 3TO4B 1AO7D 3WFZA 3WS6C 5EUKB 1WBZA 4JLRB 3PHQB 2GI7A 2M26A 3BRGC 4NUGH 3MV7A 4WDIB 3KPOA 4MAYA 1JPTL 2G5RA 3MLTA 3O4LB 2YK1H 5EIVA 1GRWA 1T7WA 3PWNA 4MSWA 3U9UA 1MRDL 1Q9WA 3JV4A 5C70A 3DVIA 3P9LA 3FFCE 1TJHH 1WAAF 2VXUH 3U9PL 3A6CL 5I1GH 3V95A 5F8RC 2NXZC 2NXYC 1YNLL 1P4IH 2NYYD 5BVPL 5DJ8B 1X5YA 4OZHE 2PXYA 2ID5A 3GMQB 2BMKA 2YD6A 1VADA 5CBAB 4Z0XB 3IAQA 4AT6A 4JFZL 4Z7NE 3A0OA 2IFGA 5HD8D 3MRPA 3ECBB 4NWTH 4GAJL 5K9QI 1N3NB 1U9KA 1MCEA 5JXAL 2A6IB 4DFIA 1AY1L 1J8HB 3TT1H 3X12B 4AL8L 3P4MB 4J8RA 2NTFB 5CP3H 3TO2B 3NBNA 4X99B 2UWEF 3JZ7A 3MROB 3PNWA 4DN3H 3PQYD 3C6LC 3QNZB 5GGUB 2PTUA 5HI4C 4L8BB 1LEKA 3CX5K 3X17A 2M1KA 3IF1A 4JRYA 2HWZL 4BK4A 3UTSE 5ACLA 3FO1B 3G6DL 4EOWL 3NABH 3EOTH 3QQ3A 5IW1B 4YHZL 4D9QE 5KAQG 3DUUA 2HH0L 4NDMA 2GTZB 4LVNB 4XPTH 3TZVD 1R5VA 4RAVB 3QDMA 2W9LA 1SY6L 4MXVF 4TOYL 4Q9RL 4F7PB 1IEAA 5C07D 2GITA 1VGEL 4KRPC 4LLYB 4Q6YA 4CU7A 5F6HJ 4B41A 3L5IA 5D2LB 1WTLA 4JR9H 4NZUH 2AVGA 1MSPA 3WLWC 3MBXL 1EX0A 2EIBA 3T77A 1ITBB 2Y5TA 1J1XL 3KJ4B 5ADPL 1F4XL 1DVFA 2O5ZH 5SWQB 4PGBB 5E00B 1HILA 1FIGL 5C9KA 5HYJE 1A7BA 5DMKA 4JFFD 4LKXA 4HPYH 5L0QC 4HC1L 5JIIA 3U2SA 2CDEA 1A7NL 1ZHLB 1EK3A 1A4KA 2OSLB 4ODUA 1JHTA 5KVFL 4G6MH 4XPAL 3QDGA 1CQYA 4JHWL 3O6MH 3U36A 3ZKNC 5CFHA 2RIKA 2YD8A 5JORB 3I3EA 5C0BB 3ETBF 2WBWB 3L9RB 4AEFA 2NY0B 2APBA 4XBGB 3QIBC 4M9PA 4UQ2A 5F72S 4KTEL 4JFDA 3E3QC 3NVQA 4FFZH 3CDGA 5CMAB 3LKNA 5J57B 2G2RA 1T66D 1ZLUK 5IBTH 2X1PA 2OTWB 3LAFA 2J6EH 5IEHA 4OGAC 1W0WB 3LDBB 1ULVA 1KPVA 1YPZB 1AI1L 2A77H 3RY6C 4MXWH 3UJTH 1NCDL 3OKLA 4PTUA 4P3CL 3FQTB 2EEBA 4XCCH 1OGAB 4P9HH 2VLLA 2AJUL 1KJ2A 4HZAA 4NFBA 3BSZH 4RWYH 5DJYA 3P77B 2IPTL 5JXEA 1KFAH 3LS4H 3NOIA 4AMKH 3TN0A 3MMEB 4YNYA 4RWHA 1YEJL 4KH2A 4DKDC 2ESVE 3PL6A 3BESR 5DJ6A 5DJ2B 1F2QA 3WKMH 1NFDE 3F7VB 4YUEL 1LK2A 5E5MA 3BEVB 4P46A 1R3JB 4M8QA 3SQOL 1MHEB 4R3SB 4CGTA 3RWGA 3TJHC 3BP5B 3PIQA 1DBJH 3NCCB 2H45A 4N8PA 1Z2KA 2ORBH 2DI7A 5HYIA 1RHHA 5MHSD 2E5EA 4P23B 4XPGL 1ZTXH 1X5GA 2YD7A 5GRUL 3O45A 1WISA 4QHMB 5IB4B 1MF2L 1BOGB 1YEKH 3GO1L 3N1QC 1MRCH 4WHCA 1S3KL 4QXTA 5CJXA 2DQJL 1SBSL 2ENSA 1AD0A 1GHFH 3OSKA 3LS5H 2D4FA 1YEIL 2COQA 4O2CA 3OKNB 4JAMB 3FN9A 5SWZE 1LO2H 1WIOA 4FQLL 3TBSA 2XZCH 4HKXA 1EEZA 4GW5A 5TDPA 3HR6A 1JPSH 2EE3A 3IDXH 4O00A 3H9HB 4TVPE 2EC9T 1U2HA 3GMLB 4GKNB 4WHYG 5DUMH 3NZHH 3L6FA 1NMCC 3ZYJA 3LOWA 1MCLA 3SBWC 3EYQD 1CF8L 2LQRA 4OGZA 2VDPL 4HLZH 3HLAB 4PS4H 3GSOA 2QQKL 4J3VA 25C8L 4NQVB 5FYLH 1ZS8B 1NC4A 2GSIA 1Q1JH 2VOTA 5ANMB 5F9WB 4EBQL 5L0QB 1C7TA 1WFOA 1FZJA 4U1LA 4IOFD 1NCBL 3AVEA 3QWQB 5I8CA 2X4QA 1U36A 3U7WL 4RGMB 1GOHA 1MFEL 1WGOA 3BVNA 4JRXD 4O9HH 4YPJA 1LP9A 1TENA 1LDPL 3JSSA 3U30C 3ARUA 1NCAH 1MIEH 1MFNA 4CAGA 4RDQG 3QIBB 5EO9A 5DXWA 1A5FH 3MRKA 4JFDD 3LKQA 3GRWA 1KLUB 5ISZB 3IXTB 4TULH 4BQ9A 1O0VA 1TVHA 2ZOLA 5EA0L 3QHTC 5CHNA 2BX5A 1CXEA 3FT2A 4RISH 1XGRA 3SE8H 3VFOB 4CL7A 3I6GA 4K8RC 3WJJC 2O5YH 4NQEB 4M5ZL 1EGJL 2VLRE 1JTOA 4QRSA 4UV7L 1K85A 3JUYA 3SJVE 1S9VB 3WBDA 5KSBB 4JY6B 3JXAA 1I1AC 4Z5RB 3PWUA 3B9EA 3B9KA 1IZJA 4G43A 4L1HA 4HKBB 1HEZA 2I60H 3GSNH 3RZWA 2X4TA 5JPMA 4KGJA 3DHJA 2EDDA 4LFHG 4NKOB 5IG7A 1X4ZA 1XF4B 2BNQD 4GRWB 4ZFOL 2HRPH 3M8OL 3HC4H 4L4VA 5A2KH 4ZOCA 1O7VA 3AROA 3L3KB 5TF1H 3QFDB 1CCZA 3L3DB 4DGIH 4P46D 4CJ1A 5JDSB 1IC7H 2HYMA 3MA7A 4IIQA 1RZGB 4HT1H 3HI1A 3X14B 5E2TL 3IT8D 1NCUA 4WUUB 4KQ4H 4UQ3A 3M17A 4NPYA 5C0JA 4PGCA 4CADA 5I18H 5JW4R 1CK0L 2I26N 2WBJC 3LN4A 5IIEA 2FJHB 5F7FA 1F2XK 1OD7A 1KIRA 3QJFB 4G8FB 2UZIL 5D7JC 4MCZB 4OLVL 4TQEH 4C57C 3PWJB 4G6FB 2FCBA 4RQQB 5IW6B 4N0UB 4LPCA 4PJ8D 2A6KB 3FRUB 3GMPB 3MO1B 5E2UL 3GKWH 1ZVYA 3DMMD 5B39G 4BZ1L 3VRLE 4O5LL 3TWCH 1BQLL 2IANB 3ARDD 3TYFA 4R8WL 1NMCB 2A9ML 3MODH 4R90H 2IMNA 2VAJA 3D39D 3WL9A 2VLMD 4PV9A 4DCQA 2P42B 1ZV5A 3CFEB 4OCLC 1YC8A 4DAGL 4NUJB 4PG2A 5A2JH 1U93A 3C6SA 2ATPA 5L2JB 4LBEB 3EOAA 1J88A 4PJ9C 2NY1B 5EBWB 1FL6B 3RIFF 4R7DB 1JZ4A 3U30B 4HWUA 3IS0X 1NC2A 1TJGL 3OJDA 4DOHB 1S7TA 1EBAA 1EV2E 5TPWL 2B4CH 3MLVL 4Q6IA 1P2CA 3VXRB 3D85B 1OY3B 2RCSH 5GSRB 1YJDH 1PKOA 4J1UB 3Q5OA 1R0AH 5BV7B 4ENEC 3HZYA 5IBLC 2X4NB 1MEXH 4PR5B 1N6QH 3QI9B 4XPHH 2EYRB 2MMXA 4ETQB 1RZFH 3WLBA 4QXUH 4JB9H 1PYWA 4F8QA 2Z35B 1E4WL 3NCJL 1IC1A 5IVNA 4WFED 3KWWB 1CLCA 3L3HB 3S4SB 1U8LA 1I1AB 2JCCE 4BH8A 5CIPB 2K7QA 1BFOB 4PJHE 1M6OA 3LD8B 5TH2B 2AJYL 2AEQL 3HRZB 4HULB 3FO9B 2VDOH 2XN9B 4N9GA 1CGYA 3EIFA 3RWEA 2HA1A 5DI8A 2HT4D 3BXNA 1RIHH 4HDIB 2P5EB 3C9NB 3FQWB 3NFNB 4N0YL 1QSEB 4F7TA 1NGPL 1T22B 1CBVH 4ZD3H 1U8IA 5E2JA 1ZMYA 5FYKD 4I9WE 4GW1B 4O51A 5F93C 4Z7WF 3LRGA 4JG1H 3HPJB 1I8MA 1T80A 3IU3B 3BKML 5IJVA 4PJAA 3BH8B 1X5LA 4BKLA 4IBLT 1X7QA 1QLRB 2WBJB 2BRQA 4X5XB 3TBVA 2P5WE 4CVXB 4PLKD 3S88L 4AG4H 5D7JB 3HG1B 4X6DE 1FZOB 2WWKT 3CVIH 2HT2D 2EDWA 2FIKB 4JZNA 4JKPH 2W38A 3G6JB 4RGNC 4FQHB 4X6CB 2ZCKH 4K3DH 2P4AB 1MLCB 1IJ9A 3LH2L 4JCMA 4KXZH 1C08A 1YMME 3EOBB 3U79A 4M3KB 5EIIB 3IJHA 3RHWF 5CJBA 2FR4A 3DVGB 3FN0L 3CMOH 4L8SC 2PW1B 1DLHB 4D3CL 1A1MA 3I6KB 3VFRB 4LSUL 5C09E 2VAAB 5HHVL 3RWIB 1RZJH 3L7FA 5HPOA 1NGQL 1HDMB 2FIRT 1AGDA 1KLGA 1H5BC 5DR5L 4QRUB 3WCYA 4HGMA 1KYOJ 1NGZB 2YBRB 1TVBA 4LEXH 4Z78B 2XTJE 1XAUA 5BXFB 5L2KE 1WBXA 2OXGA 4PJ9B 1U8KA 4Y16B 3F5WA 4E9LA 4MX7B 2VZSA 3KPMA 2ZJSH 5HYFA 1QSFA 2UWEE 1QEWB 4X7SL 5E1AA 5EBMB 3LKPB 4HSQA 1Y6KR 2D7TH 1QFPA 4H88L 4BQCA 1Z9OA 5JW3L 2VH5H 5IVXB 2P24B 1P1ZA 3MRIA 4WI6A 5I75C 3G08B 1E6OH 3L5WB 1A9EB 4JZOB 3RL1A 4MJIA 3CH1B 3REVB 3V7MA 2EKSA 4GW4A 4DZ8B 3DTXA 3DBXA 5CKGA 1LMKA 3T0EA 1P7QB 1X5ZA 1HOCA 4MB5A 2YS4A 3CFBB 3LKSA 4LCCA 5HVHC 3WUWG 5EC1B 5BZWA 3WYRA 4XWGH 1CR9L 2H32H 3VXME 4AZ8A 5JW4M 3C08H 1DFBL 3WIHH 4P57A 5DSCA 4LSTH 2C7UB 3BI9X 4FZEH 3QT2A 1HINH 4IRSA 2FWOB 4HJ0D 5EH1A 2NYYC 1WEJL 3CVHH 3C5SA 1XT5A 3CFKA 3B43A 2H1PL 1WV7T 1Y0LA 3OKKA 1RFDH 1A0QL 1QLFA 4K71B 3GI9L 2QHRH 3LQAH 1ONQB 1I3GL 2ZPKL 2XTLA 4P9ML 4NM8H 2D31B 5HD8C 2AJZA 5AUMB 1QBLH 4HLZG 4QT5B 3DV6A 3RDTD 4WHTB 3CUPB 2VQTA 3VXTB 3FMGH 4DWHA 4RFEB 1ZT1B 2IF7A 2XNAB 1QBBA 1SHMA 2E6QA 3B9DA 3TIEB 1N6VA 5TDNB 4ZOBA 1JNJA 3ZL4H 4MA8H 4RFOL 3OX8A 4G6JH 4GAFB 3BKYH 5I66B 1ZAGA 3BJLA 5D71L 1IAIM 5DURD 5LGKA 1RMFH 1E0OB 2W9EL 1Q72H 1I7TB 2Q20A 4PJEF 3VFNB 3IVKA 5CSBA 2X9YA 2EDTA 1UJ3C 4JRWA 5E5UB 1W72A 3O8XA 1UM4L 5C8JB 1BD2A 5BS0B 3QB7C 5JW5B 3WNPA 4ALAL 1G6RA 4KI5F 5KBNC 5E8NA 5GRVK 5FGBC 2ENYA 3MLXH 1A7OH 2NTSP 3KYNA 1D6EA 4LOUD 3SPVB 1DN0B 2E7CA 3S36L 1QSFD 4F80A 2DI8A 3VMNA 4HH9B 2ARJQ 1KN2L 3BZFA 2FDBP 2W9DH 1FCCA 1KEML 4Z77A 2ICWA 3BUYB 4S1QL 1FGNH 6FABH 3D0VB 1ZWIA 3H8NA 3QQNA 5I75B 1NUFA 4Z7QF 4E5XB 3MRQA 3EW3B 4NKIL 4MJID 3VXNA 5IB2B 5FUOL 5IB3B 4C83A 5IKCB 1Z3GL 2OZ4A 1MPAH 2A6JB 4D0BA 5E95B 5EB9A 1KJMA 3KJ6H 1FG2B 2CO7B 4P5KB 4O2EB 1OB1B 2G60H 1QHOA 1YY9C 1AO7B 2C1OA 1ZA6A 3L3OB 4X9BA 1FVEB 3T0ED 1MRDH 4NO0D 4ACPA 1PZ5B 1S9WA 3ULVL 2BERA 2CLRA 2PTVA 2NW2A 2GAZA 3A6CH 4ODSH 1ZK9A 2EYTB 5L7XL 5HVHB 1T66C 2X4UA 3I02B 3FFCD 5BVPH 4HJJL 4NO3B 1T7YA 2OP4L 4NFCA 2AABL 5CJ8A 3KLHD 2OR8A 2FYYB 2J12B 4U6XA 4FQCL 3NFPA 1T2QH 5D70L 2AJSH 1TCRB 2IFFH 5EN2A 1OCWL 4OGXH 1KNOA 1D5BB 1HSBB 1TCMA 4KJWC 4S1RL 4G6AD 2AKRA 4GAJH 4W4OC 1R5IA 2N7AA 3GSXB 2EIZA 1A1OB 2I27N 5LBSL 2FZ3B 3HAEH 5E7FA 4XX1G 1LNUB 3W5NA 3GHBH 4AL8H 1YYLL 5DD3L 1A3RL 4EUPH 1PJ9A 1OM3L 4CU8A 1MLBB 2P8MB 1TZHA 5T33L 2Z9TA 4XNXL 3HZKA 1YNTA 4KY1H 5T3ZL 3EO9L 1VFBB 1DTUA 3V5KA 4Y5XC 4PRBA 1KN4L 3MLYH 2DM4A 1INEL 2OBGA 5HHOA 1GZPA 4KTYA 3ZE1E 3PQYB 2PCPA 1E27A 1KB5B 1A7PH 1QTYT 3DPBA 5E8PA 3UTSD 4UIKH 3JV0A 1OAUL 1VGKA 4LEOA 3VFPA 1DUYA 1KT2A 4Z9KB 3SQBA 4D9QD 4F9PA 1LILA 2Q76B 1KIQB 1F6AA 3NN8A 2HTKC 1NBVL 4MNQE 1UJ3B 3O8XD 4WI2A 1VGEH 3VG0L 1DANU 3TZVB 2CRZA 4PJGE 4JFEE 3NCBB 1L6ZA 3BHBA 4CMMA 3BD3A 1BAFL 1K2DB 3L3IA 3WDIA 3MRGA 1EJ6A 3G5ZA 2I9LB 1V7ML 5C07B 1JZ8A 1I3RB 5FO9B 4IOIA 5JDJA 4JN1H 4HC1H 1GPOH 3O2DH 3UYRL 1A7NH 5HYQB 1EXUA 2H26A 5GGVH 5KVFH 3EYQC 3TJEL 2F74A 2XY1A 4MCYA 4TRPH 2O5XL 4JFFB 1OAXL 3OQ3B 4NM4L 2X1OA 3MV9E 3M1BA 1KGCE 4LDLB 1MJ7H 1MQKH 4N8VB 3FOLA 5DA4A 1XGUB 4HLJA 3D5OF 1BVLB 4FS0A 5M94B 3QUYC 4OV6F 1A1NB 1WBZB 1J1PH 35C8H 3FQNA 2EEAA 3KPOB 1I8KB 2G75A 3RY4A 5I1AB 1J0ZA 2EDRA 4YBQC 3TYGL 1AE6L 3SDXA 2VB5A 5GS1A 4MSWB 5DRNA 3VFWB 3JV4B 3SJVA 5KW9H 2OJZH 4MVBD 4ZFFB 2WK2A 4AEEA 2YD9A 5J13C 5TDOA 2E27H 4CVWA 1J05B 1RU9L 4MZ2A 4BQ8A 2WUCL 3MRRB 3R8BB 3PDGA 3ARZA 2JJTC 1U3ZA 1PFCA 4P5MA 2R0WL 4ZAKA 5D2LF 2Z0BA 2L7UA 4AT6B 1B4JL 2XWJA 1U8QA 3MRPB 3S3JA 1W0VB 3O0RH 2LAAA 4S1SL 5DJZA 1YC7A 1CGWA 3UTPE 4QRTA 4PGEB 2QL1A 4X9IA 4BYHA 1S9KC 5AZEH 4P46C 2D03L 1Q9OB 2JB5L 4J8RB 5HYSA 4Y5XB 5LCVH 3O41A 1OF2B 4WCYH 3PNWB 5LGHL 1JN6A 5MEQA 1RZKH 3EYFA 4JFXA 4U6TA 3MZTA 1C16A 5DVNA 4P4KA 1SBSH 4NNYA 1IAKB 3IF1B 1NUDA 4JM2A 1N64H 1AC0A 1HXMB 3GNMH 5DZNA 1F13A 3FB5B 3HMWH 3WKNA 2ZKHH 4MNGA 4LLMA 4WI3A 4MA3A 2NZ9C 4B7IA 3DUUB 4ZUVB 2NY4C 4NDMB 3V6FB 3U7YL 4PB9L 5FB8B 3VXUA 1CIDA 1FRGH 3QPXL 1LHZA 1LVEA 4TVPD 2W59A 4PJ8C 3THMH 3FO0H 5FYJL 3VE0B 1U3HC 1TZGH 3IU4L 3DMMC 4YBLC 1K4CA 1YPZF 3VFVB 1NMBL 3ARDC 5I76A 3RZCA 1J0YA 4KC3B 5HY9A 2NCMA 4HWNA 3KYOA 2Y5TB 4YAQB 5J06A 4R7NA 4DTGL 2OMNA 3KS0J 1E28B 4LKXB 4Z95H 4PJBA 2CDEB 5C0DA 4PJ7E 1A4KB 5BV7L 4OZGB 1JHTB 1HK6A 4ZODA 4KZEL 2ADFL 4GSDL 3U36B 4OAWA 1EBPA 4UU9A 4CN4A 1KCLA 3ILPA 1JYXA 4JRXB 3QUKB 1ND0A 2OM5A 4F33B 4QRRE 3UXFA 1ZOXA 2CKBL 1ORSA 4OD3H 4JFDB 1L7TH 2GKIA 4QTIH 3WFHA 1DCLA 2DMCA 3N1GC 4OD1L 1YEGH 3LKNB 4PRDA 4M1GL 3DUSB 2FHFA 3CLEL 3KGRA 2DLIA 2VKXA 3MRMA 3MJ6A 5C0CE 1O7SA 5TQ0H 4J3SA 3SJVD 2YUWA 3DX9B 3DVNB 1KPVB 3E6HA 5ITBL 2QSCL 1KPRA 2JCCA 2OTUA 1FYTE 2X42A 1JZ7A 1MI5E 2A73B 2VLLB 3CSPA 2VDQL 2J88H 1KJ2B 4KKBC 4L1DA 4KK6D 1ZEAL 4ZAKD 3EJZC 4POUB 5DJYB 3SGDI 1BX2B 1MIML 1JPGA 5CZXD 4YNYB 2X1QA 2HT4C 4JFYA 2BNQB 4XNZC 4QWWD 5B4MD 3HMXA 3NH7L 5DJ6B 1I9IL 4KK9D 1ZVHA 1HHIA 1LK2B 1GC1C 5E5MB 2VTFA 3RVWD 5KVGH 5IFAH 4P46B 4M8QB 1CK0H 5DD6A 2VLKE 4CVUA 1RHHB 4P4KD 4OLVH 4U1JB 1NH6A 4HW6A 3VXQB 2P5WA 2JELL 4CNIA 2AXHA 1IAIL 5DQJA 5FCSH 4P2CG 4X6DA 4HUWA 4FQ1L 4RIRA 4PLKC 3O3AB 5KSVB 2HT2C 4R8WH 1NDMA 4GXVL 4RRPA 3WNKA 1S7XA 3H9SE 3TBSB 3SOBL 1ZLVK 4HKXB 1YMMA 3RNQA 3QCTL 3PHOA 5E24E 4PJ8B 5TDPB 1G9MH 2O93L 2A0LD 3DMMB 5DMIH 5JO5B 1CGXA 4YBLB 3QXWA 4Y1AA 1DQTA 4HWEH 5KSBF 1MCCA 3QPQD 5IMMB 3RGVD 4NNPL 1IARB 3D39B 3GSOB 2GSIB 4H8WL 4ODWA 5B22A 3HKFA 4XVTL 5JOEA 4KKLC 5I1HH 3WXVL 2PYFA 4HEPG 4XRCA 1TJGH 3K46A 1FZJB 4U1LB 4EQ2A 2HVJB 5HGDA 4JEGB 4TSBH 1EAPB 2YSSA 1E4JA 4GRWF 3BJ91 2XQBH 2AV1A 4YFLI 4U1KB 1JRHI 3B3IA 3WFEH 1QBML 2F5AH 2VL5B 3IETA 1P4LB 5CSGA 3E2HB 4ZUTB 1I9JH 5K9JH 2PTTA 1T04A 2H2SD 3O3UN 4PJEE 3DYMA 3HAEG 1UB6A 2ZOLB 1JNNL 4XXDB 1LK3H 5IM7A 3FT2B 1S7RB 4H1LH 1JHKH 1JNHB 3I6GB 4EUPG 1FORL 4Y5VC 4JREB 1CN4A 3HNSL 1H8NA 4WFHE 2HKFH 4XB7A 5I30H 3NIDF 4KI5E 1VFAB 4HCRA 4NC2B 4P2QE 4GG6B 4W70A 4Z7VA 1T1ZA 2FX7L 1ZKAA 3LEXA 2VXTL 3V4UL 3QFJA 1NBZA 3AU1B 3SY0A 4PY8I 1F5WA 4YHPB 5C0EA 4NQDA 5CILL 3U0TA 3Q6GH 4TNWK 1NANI 4H0GA 3PWUB 1MRFL 4Y2DA 2DIBA 4YHLL 3SGEH 1S9YA 3S98A 5F3BA 5I8EA 3EGSB 4OCWH 3TGXA 2IALA 3VDBA 5IG7B 1A6UL 3D6GA 1UM6H 5FUZL 1CTOA 1B0WA 4QHUA 2YN3A 2BCKB 4NN5C 4XNZB 1YMHA 1BM3H 2R0KH 4UBDD 4MHHG 5TQ2L 1UA6L 5HJ3B 3LHPL 2ZUQC 1HI6A 1NLDL 4IIQB 4U6YA 4LNVA 5F9OH 2AGJH 3FL7A 5GS0L 3ZKXC 3HI1B 4FMFA 2CR3A 3MUZ1 3D9AH 5I73C 4YK4C 2DTMH 3M17B 1UB5A 3PP4L 3QUMA 2QSVA 1F3DJ 4HXBH 1FC1A 4JANB 2BDNL 4MA1C 4NPYB 1AD9A 4PGCB 1F58L 1NLBH 3OKDB 4IDLA 5BRZA 2P5WD 2YPLE 2CH8A 3LN4B 4U0QB 3RDTC 4PJCB 5AWNH 3UROR 2EDLA 1RIUH 4YJZL 2VJXA 5IR1B 3R8QA 4I3GA 4NP4L 1EEUA 5SX5H 1ZLWK 3WSQL 5T5NF 5GGSY 5D7LE 1KLFA 1RZ7H 1LO4L 4M7LT 4D3CH 1NCWH 1YMMD 3JUZA 4LAQL 3ALWA 1FN4A 5D1ZA 3ZO0A 4DQOL 5HHVH 2DJ4A 1BFVL 5DR5H 3PG2A 4MWFA 5MI0B 1RK1A 5C09D 9CGTA 4BFBD 3BDYL 1AXTL 5E1HB 3WL9B 3P4LA 1NGXA 4MQTB 4PV9B 3FONA 5EOTB 3MLRL 2X1XR 4APQA 2XTJD 4WTXA 5IMLA 5L2KD 2B8OT 2ATPB 3C6SB 3H3KA 3AS3A 3ZDXE 1HHHB 3GBNL 2NY6D 3PGFL 3P9MA 1I1YB 4PJXA 4LOUC 5JW4N 2R1XA 1A7RL 2OYPA 5C2UB 5GHWL 1IAMA 4JQXC 1KJ3L 3WNLA 5MEPA 3V7AE 4GLRH 3S5LB 3G5VA 4G8EB 4ZO8A 1T03L 4WJ5B 1RK0B 1P2CB 1QFUH 4NJ9H 4ZMAT 5BW7A 5H94B 3L5XH 3AM8A 5EDXA 4FQXC 4LF3A 3LV3A 2CXGA 1PG7W 3HZYB 3L3GB 3A6BH 1G0DA 4QRQB 1OW0C 4XCEA 4XHJD 4OT1H 2GEEA 2PW2B 5E6YA 1PYWB 3MLSL 3QIWD 5CSZA 4ELME 3CFDA 2IADB 4NQDD 1T6WA 4MJ4A 3UPAA 3MNZA 2YMXL 4RBPK 3DXAE 3G6JF 4Y2DD 2WLYA 2K9UA 1BFTA 4X6CF 4BH8B 2EKJA 4DKFL 5GGTH 3LIZL 4XI5D 2HP4A 2VZUA 3BWUC 1M6OB 1HHKB 4F7MA 4PIRF 5JQ6H 2HJLA 1J0KA 4B5EA 1ZGLA 4IHOA 1JPFA 1N8ZA 3KLHC 5IOPA 4NN5B 2HN7B 3WDJA 1UCBL 2IAMA 1H3UA 2R2BA 2LV4A 3ARVA 5AAWA 4X5WB 4JG0L 2BSTA 4KVNL 5A3ID 3Q5TA 4G6AC 3KPRA 4UV4H 1JE6A 3ZKXB 3QEUA 3OXRB 1AGBA 1KB5L 1YEEL 5F88B 1CU4L 4G8GE 4HIEB 1AFVH 1JTTA 4BKLB 1X7QB 3RDTB 4YR6A 2FJFB 3IDJA 4OCSH 5IVXF 4NRZA 2RB8A 1UWGH 5D7IE 1N5YH 4WWKD 4QOKA 3QQ4A 1FE8H 5E8OA 4JZNB 5EORL 4UAOC 2R0ZL 4IRZH 3IJSA 4K07A 3V4VH 3ULSA 4BZ2H 1NGWA 1UM4H 5DURB 4M93C 1RJZA 4YLQT 4ALAH 1H3VA 1EZVX 5ACZA 3IJHB 4QHLB 4OCXH 4NIKB 3PDOA 5IFJA 2FR4B 1CDBA 4ZNEA 5D2LE 1KCKA 3KLAA 3BE1L 3MBEA 1BLNA 1PLGL 3ZYZA 5MP6L 3HE7C 5KANG 4PLOB 2DQHL 3BKCL 1F4WH 4WO4A 1KLGB 1G9EA 4LSRL 3BEWA 3QO1A 2DJSA 2ZUSA 1IKNA 4PJ5A 3IRZA 5JUEH 1B90A 2EC9U 1BF8A 4O2FA 3F5WB 4S1QH 1JNLH 1T0NA 1JWUA 5CINH 1QSFB 5HGAA 2IEPA 1IC4H 5EULV 4YE4H 3W0WE 1G7MB 1CE6B 5I15H 1F11A 1FH5H 3EFDL 3IDMA 6CGTA 4UB0L 1P1ZB 1GH7A 4YHMH 5JHLL 3K3QA 32C2B 1LO3L 2FB4L 4BSWA 4MJIB 4R4FH 3BKJL 1I7ZB 3TF7C 3MRJA 3HE6A 3B6SA 3DTXB 4NO2A 4TTGA 3DBXB 2ADIB 5FDYA 3QEQA 4FQQA 2H9GA 1I3UA 1BQSA 4HUMB 3T0EB 2F9BT 2Q3AA 4UOW1 4NO0B 3I2CL 2ZUYA 4D9LL 5IQ7H 1MCOL 1IAOA 4LCCB 1RUQH 3SE9H 1A6PA 1K6QH 5DHVA 2I5YH 4S1DD 5BZWB 3CXDL 3FFCB 4ORGA 3S37L 3ULVE 2A9NH 3QDHA 4HS8L 4P57B 1XIWD 5DSCB 4UIMA 2R0LL 3R1GL 1MCNA 5DRZA 4OZHB 4JKWA 1PQZA 1J1OL 1ZHKA 3C5SB 4R4BA 5BJTA 2Z31A 4P2OA 2WIIA 1Y0LB 3OKKB 2VITA 3KPRD 3HI6H 1UYWL 3U4EA 4QKXB 3X3GL 4NKDB 4XNXH 4YXKH 1CD0A 2WUBL 1RJCA 5GGVY 4QRPA 4EN3A 2AJZB 4PBVC 3VFTA 4OLWL 5JNYA 3DV6B 4AEIH 1MWAA 3IJYA 1NAMA 4JFQA 3CLFL 2AJXH 1TQCC 3EUUA 4UAOB 5D1XA 5T3ZE 4ZUWB 5INCA 1P9MC 4M93B 4JPKL 3W11D 3IVKB 4LPUA 4ELKA 1SBBA 4Y4KC 2N4IA 2FJGB 4JFED 3IDNA 3O8XB 4OLZH 5F7HA 2DQIH 3QEHB 1FL3A 4QO1A 2ZCLL 5GZND 4WO4D 1A7QH 2MKLC 5IROA 3ALXA 3RKPA 1C7SA 5GS3A 3RWCB 5EU6E 3GJFA 4HWBA 5F7NC 2CRMA 1MCQA 4AYFA 3CMGA 1OAXH 3A67H 4WU5A 4U6HB 1KXTB 4I0PA 2EIEA 5FAAA 2GK2A 2W65A 3KG5A 3FO2B 4Z77B 3H3PL 2BNRE 2ICWB 5J6GB 2DDQH 1AIFB 3BX7C 2RQ8A 4Z7UE 3MV9D 5A16A 3BD4A 1KGCD 2J4WL 1Y18A 1FFPA 3R06A 1NCTA 3ROOA 2DKMA 1EO8H 3ARGD 2R1YA 3OKMA 2E7MA 3S6CA 3NA9H 1IM3A 4I2XA 4P2RA 5IWLA 3GBML 2F19L 4FZ8H 5GJTH 2XWTA 3V6BR 1ZHNA 1AE6H 5T1MA 3IRPX 2F8XC 3IDUA 1ZSDA 5LXGH 3LEVH 1KCUL 4D0CA 3HZMB 1S9WB 1KJ2L 2CLRB 2DAVA 4DEPB 2NW2B 3Q3GB 3LEYL 2MWCA 3K74B 4M1DH 4PRHA 2VDNH 2X4UB 2OL3A 1MVFA 1T1WB 1LWRA 1YYMH 4LIQL 3MOAH 3GI8L 5DK0B 1V5JA 4OD2B 4U6XB 4HFUH 4KUZH 2EDEA 3NFPB 4GRWE 4JO4H 1C5BL 5EN2B 3X11A 3GB7A 2Z31D 1S8DA 2BVPA 3BGMA 4HF5L 5AYQA 1YEHL 4IMLA 4S1SH 1JL8A 1R5IB 2EIZB 1GGBL 3UTZA 1DR9A 5IT2L 4U0RC 3E8UL 3Q1SL 2B1HL 4EN3D 3ARBC 5CZXC 5AZ2H 5HPMA 5ADOH 1WTGT 1EUUA 1NFDB 4EEEA 4KRLB 4WUUE 5B4MC 2IH3A 1OPGH 4KK9C 1TZHB 1Q0YH 3RVWC 5IUSA 3NIDE 1LE9A 4XP5L 1RZ8A 3BZ4A 2E7BA 4M8VA 4WVRA 2Z92B 4I3RH 4JVWA 4PRBB 2NY2D 4EIZC 4OIBA 4U6VL 5J9PA 2PCPB 1E27B 2VC2L 5F1IA 5E8PB 3DURA 4P4KC 1UACL 5TE4L 1XF5A 4ONFH 4TTDD 3VFPB 4HWZA 1DUYB 1KT2B 1NDGB 4N0UE 5DF0A 3AUVA 3QPXH 3NN8B 3OKOB 3QP3A 5I8KH 5KSUA 2IANE 5FYJH 3I3BA 2EZ0C 3V0WL 5MENA 2R4RH 4JO1L 1NL0L 3SDAC 3BHBB 3H6JA 4J3WA 4M61B 5FO7A 5C6TH 5B39A 4CMMB 4KDTC 4PBXA 2HJKB 4G7YH 3L3IB 4UTBL 4I18C 3UTOA 2P44B 1DDHA 5DD5L 2K3TA 4WENB 4UDUA 4HV8A 2A0LC 4P4RA 3VD7A 3JWOL 4IOIB 4IRJA 1U91A 1AGFA 5SV4A 4K8RH 2H26B 1ZA3A 2BC4A 2XOTA 3OAUL 3QPQC 4ONHA 3GRWL 1U3JA 3CK0L 3RGVC 4GSDH 4XCFL 2F74B 3IXAB 4XNYL 3CX2A 3GKZA 2EYSA 3VWJC 4K94C 4FOMA 4N68A 1AQKH 3ILQD 4HQQH 3LQZA 1GCFA 4LSPH 4OZIE 4MQ7A 1N0XL 4KTDL 4QRRD 5CIPH 1DBBL 3RBGA 1KBGL 1B6DA 3OGCA 3ZT6A 3VGEA 2NY7H 5KS9E 1JJUA 4UUJB 3F7RA 1C5CL 3K4AA 1MJJB 5C0CD 1PVHA 2G75B 1KEGL 4RFNC 2SEBA 4PRHD 1XGQA 5FGCE 3SDXB 5CJQH 2VLJE 4B0MM 5GS1B 3I84A 5CP3A 3CFJA 1TVDA 3SJVB 2F8OA 2PUQT 2R2HB 3DETC 1FYTD 5EPMB 1Q0XH 2XN9E 5T3XL 4IJ3C 4XNQA 4KPHL 1R3LA 3GSQB 3L3JA 2DD8H 2P5EE 4L29B 3CH8A 4LFHD 1CLZH 1SYSA 4MMXC 5IJKA 3MC0A 3MCLH 2F5BH 4YPGA 2MCG1 1FO0B 1I9IH 4R97C 5F6HI 4P5MB 1CFQA 4HBQA 4ZAKB 2DQCH 2XWJB 4FABL 1U8QB 1ZANL 2X2YA 2XZQH 3UTTA 3D69B 4KAQL 1T1XA 2EXYD 3BYTA 5DJZB 4EDWH 4WEMB 2HKHH 4NKMA 5F7EH 4UBDC 1DQQA 2VLKD 4QRTB 4XVJH 3N85H 3FOMA 2ZUVA 4NZTL 4OZGF 3O41B 3QXAA 5DVKA 3K2MC 1J9CT 1IAIH 3TVMA 5IESL 1JN6B 4U1SB 5MEQB 2DYPA 4HUNB 2EDFA 3U82B 1C16B 4UT6L 4P4KB 4NNYB 4G9DB 3BN3B 2CRYA 1B88A 4X6CE 3VFMA 5EUOE 2V7NB 4DN4H 2KKQA 4MNGB 1V3MA 1SJVA 4OQTH 4OZ4A 4MA3B 5IVZA 3FB7A 3ZKMD 3QCTH 3RI5F 4M48L 5I1EL 3P4OA 5L9DH 2CR6A 3H9SD 4D0DA 2NR6D 3FKUS 1Z6JT 5C0AA 2WWKO 2XACC 3X3FL 5BZDA 1WFUA 4NQCA 5DK2A 1EJOL 2GT9A 1HQRA 2GJ6E 1K4CB 1S78D 2EH7H 1FQ9C 4XVSH 4OF0A 3ZHLA 5CBEA 4K9EL 3EYSL 5HY9B 3I9GL 4G7VH 4LSQH 1RVFL 1EVUA 3KYOB 2HG5B 2VN7A 4R7NB 3O3DB 2KBGA 5D7SH 1A6AB 5DLMH 4JDTH 7FABH 2CMRL 5EU7E 5T1DL 3ZHDA 1L0QA 2XTJC 1HE7A 3X13B 5C0DB 4S0SD 1F42A 5IVXE 4NCC2 4JZJA 4OB5L 5L88H 4WW1A 1J0JA 4OAWB 4CDGC 3PWLB 1GJIA 3EBAA 2PO6A 4YX2L 4N1HB 1ND0B 3FQXA 5EWIH 4KKCD 4M6NH 1ORSB 2DN7A 1DE4A 4O02L 3OB0H 1K5NA 2ITCB 4Y88A 3Q48A 3WFHB 4PJFA 2PYEA 3VFSB 2X10A 4G8IB 3ET9F 1MHCA 4RFNB 4JPVL 3TBYB 3V4UH 3VFUA 3MRMB 3GMMB 4P2QD 1P7KA 2A74A 3VA2C 4GRLA 2XG5A 3S7GA 3IS1X 5KOMC 4XHJC 4LLWA 2F54A 1BEYH 4C4KT 2GHWB 3QIWC 4IJ3B 3TBTB 2JCCB 1CDGA 3DX7B 2DKUA 5INDA 4G3YH 4OF6A 3WUWA 1BJ8A 3I50H 1F90H 4XMKL 1FZKB 2QSQA 3BPOC 2ADJA 4PJHB 3F8UB 3QNYA 1MFDL 4ZTOH 2BY1A 5DEFA 2XZAH 3RFZC 3LHPH 5C0IA 2R29L 3O4OC 3UTTD 3HR5A 3NIGE 1XGPB 2PN5A 2R15A 5ILTL 3DRTA 1QLEL 1C1EL 4AY0A 1FLRL 5IGXH 2CQVA 1L6XA 1MFBH 5F7WC 3VI4E 1JF1B 4MA7L 4FG6D 1P69B 1Q9KB 5DD6B 3QA3A 2HT3D 3SE3A 3TVMD 4X7FC 3KDMA 4ETYA 2DYPD 1KYOK 4G8GA 5F1KC 2OJEA 4FNLL 2A83B 4J4PD 3C09B 2YPLD 3T8XA 3ARED 3WSQH 4JPWL 5GRYA 5IMOA 4EI5C 3QUXA 4PP2A 2P5WB 4CNIB 4XWOC 1IEBA 2J2ZA 4X6DB 4QCIA 5D5MF 4XXCA 5D7LD 4IMKC 5T1KA 2WSKA 2J8UA 4QY8A 4WWKC 1BFVH 2ZUWA 5HHXL 3WO4C 1NDMB 5BS0E 1S7XB 4CMHC 2YUZA 1MFCL 4S0TD 4Y5YA 1QG3A 1G1YA 1YMMB 4XVUD 3PHOB 2FX8H 5E6IA 3RNQB 3SO5A 1UVQA 3HUJE 2Y07L 2D0HA 4GG6F 1OAQL 1ZE3C 3RRQA 5FKPB 4Y1AB 2DLHA 3KYAA 2V2TA 3LY6A 3IYLW 5C09B 3HZVA 4MDIA 4Y4FD 4JM4L 1OGTB 2P7TA 4NT6B 1A2YB 4YDKL 1B0RA 1D9KA 4H0HB 1DLFH 4AM0A 2XTJB 3BT2L 2PYFB 1VCAA 4F58H 5L2KB 4XRCB 2GFBA 4ZXBC 5CJOL 4CVZB 4X5LA 3O2WH 3KYKL 4NOFA 2NY6B 4WNQA 5HGDB 3GIVB 4HIHA 2GJZA 2YSSB 8CGTA 2AV1B 3U4BH 5DC9B 1CXHA 3GSNA 4DW2L 2FGWL 1TNMA 3JV6A 1T04B 4V2BA 4L9LC 2VZ3A 4WUKL 1C5DA 1DSFL 5IV2A 5JOPD 5BMFL 1BIHA 1AO7E 5I8OH 5IM7B 3GMOA 5ELIA 2ZCHH 4KV5F 1BMGA 5HVFB 3VCLA 5ALCL 4ODHH 4G9FE 1SM3L 4C55A 3KPSE 4PJCF 4Z7VB 3OJMB 1F3JB 4XP4H 2EXWD 4DKFH 5ICYA 3LEXB 3QFJB 3DXAD 3SY0B 3QIWB 1P4BH 1OAZL 4JDZA 1Z0MA 5C0EB 1MJUH 4NQDB 3U0TB 1QPXA 3P73A 4E41A 2VDKL 4YDIH 1TETL 4Y2DB 1CGSL 4NJAH 4ISVA 1S9YB 1HSAA 1MHPH 2D7QA 2IALB 3VGDA 3UZQA 1HQ4A 1A6WL 1BWWA 3O4OB 4QHUB 1XIWC 3CFCL 2Q87A 1YMHB 4GUPA 4XNMA 3CFIC 5D96C 2W0FB 4EKXA 3UZEA 3MRFA 4GQ9L 1FGVL 4U4BA 1PSKL 4MQXD 5I1CL 2KQNA 1URLA 4LCWA 5CUSH 4G8GD 1XR9A 1BF2A 3SDCA 3WEXB 1FL5A 1UB5B 4YO0A 1DUZA 3G9VA 5DHXB 4AIOA 1R5WA 4JFOB 5L8KB 1XZ0A 1FCGA 4FXGB 1J11A 3PQYE 3QUXD 3C60A 1KCSH 1W72L 2WBKA 3GZKA 5SWSA 2VE6A 3UAJD 5IB5B 1JFQH 3SKNB 2G5BA 4J6RL 2IQ9L 1G6RL 2CDGA 4NSKA 4WWKB 3QG6A 3WO4B 3VA6A 1RZIA 3P4NA 2BJML 4CMHB 1MCPL 1FNGB 2JB6B 3S35L 2Q86A 3D0LA 1FN4B 1G9NL 3CPLA 4XAKD 4QTHB 3UO1L 2DQHH 3AAZB 1TMCB 2A6DA 4UMGA 1CL7L 4WY7H 1HWHB 4NQTA 1YEFL 4LVEA 3UP1A 3MXVH 4X6EB 3FONB 4R0LA 3ZE2F 5GZNC 3N06B 5EG6C 3BN9D 4APQB 5IMLB 2DQEH 3LN9A 1K3IA 2Z91A 5CZKA 1FPTH 1PG7L 3BIBX 2OZ4L 4XMPL 4HJGA 3RVXD 2DQDH 3W0WD 3HNVH 1KG0B 2DQTL 3MGOB 3V6OE 2B5IC 2ZSWA 3FQRB 4YQXL 1OTTD 5I1KH 2YC1A 1X9QA 1YECL 1YUHA 1G7PA 3U83A 1M4KA 4ZUUB 3K7UA 1MHHA 4Z7UA 1LO5A 3PV6A 3QQ9D 2DQGL 2YKLL 4PREB 4X7TA 5KJRL 3WE6A 5HDQH 3WS3A 3MV7E 4HAGA 4OLUH 3ARGC 3GMRB 5CZVH 1WAAA 1FDLL 5BQ7B 4M5YH 2X4RA 3C5ZA 3I2CH 1ES0B 5GRZA 1E4XH 1CFTA 3VWKA 4LKCA 3SGJC 3AS0A 4HUUA 5CSZB 4LPWA 3OMZA 1VFOA 4L5FL 4LASL 4L8CA 2BOBB 5F96L 4PLJC 1A6VH 1PGRB 3INUH 4MAUH 3MNVA 3ULVD 4HFWA 2R4SH 1JUFA 3VXSE 2VXVH 3WIIL 5LVEA 1GSMA 1J1OH 4F7MB 2HJLB 4YHKH 1KB9J 1OHQA 4IHOB 4JJHA 3T2QA 1N8ZB 1GGIL 1MVUA 1IKFL 5FCUL 1BZ9A 1XIWB 2Y36L 4PB0L 3X3GH 3RA7L 1MFAH 5D96B 5DVOA 2BSTB 4M02A 3SDYH 2B0SL 2Z31C 1T0MA 5GIRB 4WGVB 4NHUA 3KPRB 4LCWD 2DB8A 3LCYA 3VI3F 2I24N 1ZLSH 2LVCA 3SDCD 5GZOC 3VD9A 4BZYA 4FQJH 4P23D 5IHLB 2VXSH 3MJ8A 1DL7L 5HI5D 4XBEL 3CU7A 3QUZD 1NEZB 3QXDA 4Z8FH 3IDJB 3V52L 4NRZB 4YC2C 4JRYE 3M07A 1KELH 1T89C 3ZTJH 3QQ4B 4TPRH 1IGIH 5T3ZD 2BVUA 1OL0A 2NY2C 4TVPL 3IJSB 4RAHA 5DMGD 5KTEL 3QG7H 3O3BA 4H5SA 1FYHB 2HLAA 3BRFA 3QDME 2Y7QB 2QEJA 4JO3L 1VEMA 2DL2A 1KCRH 4TTDC 5DJ0A 4ZS7L 5ACZB 2VUOA 1JGEA 5IFJB 4I13B 3UPRB 4M62L 5GGSA 5I9QC 2X41A 1XH3A 4PJGB 4QF1A 4JFEB 4BELD 3NZ8B 3QCUL 4WEBH 3RP1A 3T65B 1DEEB 4Q74A 3RVTD 4WO4B 5EU6D 2Q8AH 1HYRC 4N0FA 5HSFA 4MB4A 3QO1B 4PJ5B 3F7YB 4HGKC 5TJWK 4O2FB 1T2XA 1MREL 1RUPH 4Y2OA 1XGYL 3QRGL 1H0DA 3O6FA 4MB3A 1T0NB 4OZHF 1JWUB 2CUIA 3QDGE 2H32A 2B5IB 1AHWC 2BRRH 2BNRD 2UZYB 4I77L 4ZPTA 5C0FA 1H9VA 3WIHA 1EZVY 5IHZA 4M6OL 2WZPD 4OF5A 1HHJA 3IDMB 5CJ5A 4Z7NF 4GKSA 5CEZL 3UBXG 2WAHA 2DQUH 2V2XA 2Y4SA 3MV9B 1DQJB 4JFDE 2YPKA 3K8KA 4FQIL 1KXVC 3ILQC 3OBAA 3ARGB 3MRJB 2APWA 1I9RL 3C5ZD 2M8XA 3NIFF 3LMJL 4Z0BL 3IB4A 4NO2B 2DWEB 4WI8A 4N8CH 2GY7B 5DJCB 1ORQA 4YGVA 5MEOB 1YN7A 2AEPL 1YQVH 4FQQB 1IAII 4F57H 5FECA 1FBIH 1VESA 3GI8H 4FFWC 1ZGLM 1FO0L 4WW2A 4XBPB 1U42A 5DHVB 1NMAH 4IDJL 3RWDB 4ORGB 5FM5M 4XC3L 1E4KC 1OSZA 3C2AH 1LE5A 2AK1H 1RUMH 1T83C 4UTAH 5DRZB 5IT2H 1JHLL 3LRHA 1HXYA 1PQZB 3Q1SH 3F62A 4LIQE 4MXQC 1CTNA 2Z31B 4P2OB 1N4XL 5F44A 3CSGA 5MERA 4YDVB 1A14L 1EFXA 2WIMA 1YNKL 4W68A 3KPPA 4EN3B 3QHZL 1ACYH 3VFTB 2XPGB 5D2NA 4X4MA 3RWFB 4OIIL 3HFMH 1DQDH 4XCYB 3GK8H 3BP4A 1C12A 3IJYB 5DQDL 1IL1A 4KI1A 1D5ZA 4YXHH 1GIGH 3RAJH 4WWID 3OB8A 4LP4A 2E7LC 2WWMD 1DBMH 1FNLA 2GYSA 2NY2B 1DANT 1QKZL 4GT7A 3PUCA 5E2WH 2CIKA 2VABA 1T21B 5LWYL 2Y9RT 3L7EA 2IAND 1H3GA 2NY5L 4FA8A 1DBAL 3O9WA 1KJVA 3ZKMC 3BO8A 3T2PA 3HA0A 1RUAL 5HI3D 3ARPA 3WXWL 5EBGA 4XNUH 2NR6C 3MRCA 5HHPB 5H2BA 1VHPA 3DIFB 4XPBH 1IGCL 5IK3A 2XKNB 2WQRA 4GBXA 4YWGH 2GJ6A 2APXA 1ZXQA 1LDSA 3O6FD 3WHE1 1S78C 3DI3B 1UWEL 1D5XA 4GO6B 5H35A 3IDYC 4WU5B 2UVEA 3SO3C 4GAGH 2JJUA 1AHWB 1L7IL 1LO0H 4YHNA 5KVEH 2OR9H 3IFOA 1LP9E 4CRPA 1BHGA 1SYVB 1U8JA 3NFSL 4X0KA 4PJ7B 3DV4A 3ES6A 4FFYH 1Y18B 1FFPB 4RA3A 2AK4A 5I1JL 1I8LC 1C5CH 4K23H 1NFDF 2R1YB 2CGRL 3UYPA 5F7KC 4QRRB 2X89A 1I75A 4X8JA 4I2XB 2RFXA 4YXLL 1QP1A 3HAEA 4X6FB 1WBYA 4KKCC 3Q6FB 2FEDD 1A3LH 4NWUL 1RURH 3MJ7A 4FP8L 4KHXL 5E56A 4EUPA 3K8MA 1ZHBA 3B9VA 4LRIA 2VLJD 3V8OA 5C0CB 3WEXA 5FDWB 4HKZA 4RNRA 4UINH 1QHPA 1GC1H 3HC0B 1A6ZA 4KI5C 1VPOL 4PRHB 1R3IL 3ARFD 3GSWB 5C9JA 2OL3B 3TCXA 1OP3H 5B8CA 5FYKH 2R1WA 3HMXL 3S34L 1D5IH 2MTPA 3NCMA 3ZTNL 1NBYA 2IJ0C 3GB7B 4P5TD 5J1TC 3BGMB 2BVPB 2AI0H 4L4VE 2X7LB 4RX4D 5HGGS 3MOBL 5T3XE 2ICEA 3CDFA 5TFSL 1IGJB 5IHUL 5EO1A 3UTZB 4OV5A 1OP5K 2B2XH 3V6ZA 5L8LB 1UCTA 2Z8WC 5EC2B 5J6HA 1KTDA 5HPMB 4F9LA 4UZGA 1RHFA 1F4YL 1OARL 2IH3B 2HFGL 5E4IA 3CXHK 3VRJB 3NMEA 3MNWB 5DA0B 4NN6C 4UT6H 1K8IA 3O2DA 3KPQB 4NNXA 1RZ8B 3BZ4B 2HT3C 1CDJA 3TVMC 5EU5A 4JO2H 3BOVA 4XPFL 5J9PB 4OZFH 3LZFL 2GIYA 4I48B 1IGYB 3V5DA 1IQDB 3DURB 4J4PC 3U4AA 4HPOL 1EUTA 3AREC 3WIFA 3EJYD 3DSFL 2PNDA 4HWZB 5DVMA 2X6MA 3T3ME 1PKQA 3FT3A 3W2DH 4YGAB 3O9WD 4H25A 1IQWL 3T0WA 2D7NA 4DVRL 1ED3A 4GXUM 4X4XA 2X5PA 3H9SB 3PP3K 1HH6A 5GISH 2GTWA 3SDXF 4KK8D 4BH7B 4NBXB 1G1CA 2ZG3A 4DGVH 2GJ6D 4ZPVA 2ZNWA 4HIXH 3WFDL 1H8OA 2AQ2A 4UDUB 4HV8B 3IFNH 2HJFB 2CMRH 4P4RB 4KDVA 4MS8D 1FV1A 1QA9A 3GUTA 1RIVL 1OQOA 4JQIL 3SO3B 3LKRB 1UZ6F 3SKJL 2ZUXA 4ONHB 4Y4FC 1JGUL 3KPLB 3N0PB 3ZT5A 4KHTH 4ZDHB 5ERWA 1BQHA 2R69H 1QR1A 1RUKL 1YZZA 2EYSB 4JZJC 2LTQC 1I7UA 4I4WB 3LQZB 4MQ7B