3ULVC

Structure of quaternary complex of human tlr3ecd with three fabs (form2)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
210
structure length
210
Chain Sequence
SVLTQPPSVSVAPGQTARISCSGDNIGSYYVHWYQQKPGQAPVLVIYEDSERPSGIPERFSGSNSGNTATLTISGTQAEDEADYYCSSYDDPNFQVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-like receptor 3
publication title Lateral Clustering of TLR3:dsRNA Signaling Units Revealed by TLR3ecd:3Fabs Quaternary Structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2011-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ulvC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ulvC01
3CDGB 3NZHH 4KTDL 3DI2B 5EIIB 5FXCH 4QRRB 3CC5A 4O02H 3RI5F 2OP4L 4ONOA 2ZUTA 3MJ7A 3ZDZF 2VABB 1RHHA 1MRDL 4R0LB 5I1JL 1P7KB 2HFFB 3NVQA 4R7DB 5HGDA 4FQQB 4U7KA 1CLOH 5CJXC 4ZD3L 2F54D 1X5GA 3LEVL 2XPGB 1V3LA 4GLRH 5IB2A 1EFXD 4YNYA 1S9VA 4XH2B 5HVGB 1MCWM 3CXHJ 4XP5H 1T89C 4AIXA 5DURD 1WVZA 4YGAB 4YHYB 2PW2A 4JM2F 2AJ3A 2DM7A 1L0XA 3GSVA 4LVHC 1N6VA 3U2SB 1XCTA 3UCRA 5DF0A 4NRYA 5IVNA 5EU7C 1IM3A 3O3UN 1A4KA 2DKSA 5C09D 5EZIL 4JG0L 3ZDYF 4MSWB 4MXVF 5JNYA 4CVWA 3MCKB 4HJJL 3MJ8B 3LCYA 3FHAA 3QSKB 3BMWA 3ZHKA 3QULB 2VXQH 2IFFL 1KXTB 1I1CA 1DQML 4NIKB 2D7MA 5ENWA 3GMMA 1JVKA 4JVPA 5E1AA 5MERA 4FXKA 4DKDC 1KC5H 4HUKB 4NNXA 1YDPA 3RIAK 2DM2A 3MSPA 2EIBA 4O2EB 3SKMB 3B8YA 1F8TH 2A1WL 1T1XB 5C08A 2XXMB 3KYKH 1T7VA 1ZV5A 3A67H 5I1GL 5IV2A 4FZ8H 1ZT1B 4YXHH 3TA3C 2R8SL 3MV7E 3CLEH 1DBKH 3BT2H 1KJ2H 3IXAA 3QJFA 4HK0A 1UH2A 4JR9H 4Y4KA 4ZNEE 2V9RA 4QHKJ 2EXWD 4YHIB 2X4PA 4K8RL 5IFAH 3JUYA 2H2SD 4LEXL 5DJAB 4MAUL 3NCCB 3H3PL 1KOAA 1SBSL 3CLFL 3RPIA 3QUKA 2FJHB 5L2KE 1OARL 3NIDE 4Q9CA 3WUWA 4PP1C 4XBEH 3BD3A 1QSFD 1A7BA 2X4UA 1BJMA 4MX7A 5FYJU 1KSRA 2NY5L 4NYLB 1MIEH 2M26A 3VFPA 4DKFH 3PWVA 3G5VA 3TBWA 3WHE1 4M5YH 4AEIH 4HFUL 4ODTL 3ZKMD 3BIKB 3MV9E 4MDIB 4JG1L 1ORQA 5ISZA 1U2CA 2VLLB 3L3KA 1JYXA 4OIBA 3H3BC 3DVGB 4NZRH 4ZXBD 1NEZB 4CDGC 1AKJA 1NGXB 1VB9A 2C3XA 1Z3GH 3B2UD 3QA3A 4U1NB 3TN0D 3TZVD 1J5OH 4L9LB 5INDA 5FKPB 2F54B 4NKMA 4V2BA 1H8NA 1S7XB 5EU3B 4MA8L 4S1SL 1EFXB 2X41A 4MXVE 3NZ8A 4PJAA 2B2XL 2Z91B 3K81A 3MO1A 4XPHH 2EXYD 3QBTB 5DURB 5BV7L 1CWVA 3D85D 2NLJA 1JWUA 3QHFL 4LLQB 4GKZB 3U7WL 3V0VB 4ZDHB 2OMBA 5BV7B 4ZOAA 1DBML 4KY1L 4PJFB 2BRQA 2VQ1B 1FGVH 3RNKA 3QO1B 1R3IL 1GGTA 2P5WB 2XWBA 2X4TB 2C26A 4KAQL 2EIDA 4AT6A 1EERB 2P5EE 1CDUA 5HDQL 5HVHC 1U8IB 4X5WA 5IJKA 2DYPD 2A77H 3ARBB 1X44A 2WP3O 4KVCL 4YPGA 2FO1A 4XAKE 3U82B 4XCNA 1U8NB 1M7IA 5D2NE 5JDSB 1WF5A 4F7CB 5LQBL 4IRJA 4ZOBA 1FLRL 2CDFA 5JR1H 4JFOB 4XMKH 1UGNA 1TZIB 3C5SB 2J6EL 1G7MA 4HS6B 2WWKT 1LEIA 4WV1B 2IQAA 1V3JA 4JO1L 1M6OA 5JLZA 5T5NG 1WAAA 3QUYC 2PYFB 2R23B 3ZYZA 1RK1B 5L9DL 4I48A 3OAZH 2W91A 1S9XB 1F4XH 2D7NA 3MRBB 1KG0A 1PX3A 3ZSTA 4Y4HD 2NPLX 4HZLA 5FUOL 4I8DA 3IS0X 3WN5B 5HD8D 4ZAKB 1JZ6A 4JZNA 3MV8A 3BPCA 3AXLA 5I71B 2C9AA 4WDIA 4OD2B 1J1XL 4MD0B 4XWOD 4OSUL 5EFIB 5C6WH 3RGVB 1FIEA 2DI9A 4WI8A 3L3JB 5DJ6A 4J1UA 1QSFB 1NEUA 3O6KH 3VFSA 4LIQE 3D1MC 1QLRB 3S35L 5GSVB 1EEYB 4NT6B 5TE6H 1A1NB 3QXAB 4YIQB 5D7JC 4GW1B 1IEBA 4JFEA 1REIA 4UUJB 4KTDH 3RVXC 1T20A 3RUGA 1VEOA 5GIRA 3SGKC 1P53A 3MREA 4WTZG 1MCPL 1KPRA 5C0IB 2GCYB 3I3DA 1OT2A 3TN0B 2AK4E 3CUPA 4GH7B 3VGFA 3GMPA 3HUJF 2IEPA 4YLQT 3TFKD 1FO0L 4ZD3H 3D18B 1LDPL 2OTWA 1UM6L 3LEVH 4CMMB 2ZNWA 4NSKA 5CBEB 1R3KB 2C1PA 1FO0B 3CU7A 4WO4A 5IVOA 4E41D 3L1OL 2Q76A 3G5YA 1N7ML 4XNZC 3EO9L 5T1MB 2VWEC 5HHXL 3CVIL 3D87B 3QEHB 5DHVA 4N0FB 4J3SA 4X4ZA 3UO1L 2D31B 2FIRT 4C58B 5GZNC 4GKOA 5I17B 4PLKC 5EZIH 1ZAGA 4JG0H 3RY6A 3PP3K 3LQAC 3S97C 1IL1A 1JWMA 5I1IL 1H3PL 2DYPB 4JFPB 2QQLL 5FHAH 4HJJH 5E9DB 2KPNA 4HDIB 1XR9A 3KHQA 3X3GH 5LVEA 1WFOA 2IFFH 1DQMH 4MD4B 3PL6D 3RVUC 3V6ZB 4ZPTA 4YHPB 2Q8BL 1T0PB 4J23A 1R24B 4I0KA 3VH8G 2AXHA 3HI5L 4MQTB 5EU7E 4NN7B 3SCMD 2A1WH 1I3RB 4APQA 4U1HB 4WVRA 5I66B 4RWHA 1F3JB 1C5DA 4POZC 5E8NA 2R8SH 3PIQB 1LHZA 3FCTB 4Y4HB 4H1LB 1S78D 2R9HC 2OZ4H 4PLJD 5IFJA 3MUGA 4E0RA 1WGOA 2BCKB 1AO7D 4JVWA 2DLEA 3JTSB 4M7KL 4JE4B 3INUL 2FH8A 4MAUH 5IW6A 4N90D 2IALB 3H3PH 4QWWC 1UZ6F 1JI1A 1SBSH 4N0UE 3CLFH 1CFTA 4DW2H 3F7YB 3FHQA 4R3SB 3VMOA 4BQ9A 4HIIA 4Z78A 1MCWW 3KPOA 2VDOL 2NY5H 3NACL 1VACA 4ODBD 4I5BB 1ORSA 4K3HA 4EDXB 2CK0L 4HFUH 4ODTH 5E6ID 2ESVE 4RISL 4FP8L 1KGCE 1YEIL 3KS0J 5A2JH 4GAJL 1JHTB 4ETQB 4Z0BL 1KJVA 3QIBC 1T1WA 3CDYA 4U6HA 1ZWIB 5BVJB 1T7YA 1G9NC 4KJYB 3UTOA 1S7RA 1WCBA 2FZ3A 1KT2A 4KUCD 4MA8H 4S1SH 5C0JB 4TQEL 4OF3A 1EVUA 1HHJA 4E41B 3GFUA 2EDRA 1I8KA 4A6YH 4N0CC 3VJ6A 3X3FH 2PXYA 2WIIA 4PGJA 5J11B 3O8XA 4M1DL 3U7WH 1DBMH 1U8OA 5FF6B 5FA3A 1RQ5A 1H3XA 1A0QL 3CAFA 1RHFA 1S7VB 1R3IH 3UPAA 3WNKA 3ULUD 4KAQH 3L5WB 1KJMB 3EYOB 5CS7A 1RZJL 3BE1L 5HDQH 2HTKC 3KPPB 1M7DB 1BD2E 3EYQD 2XG4A 1S3KL 4FXLA 5E8DH 1ZEAL 4KVCH 4WFGE 3O9WA 3PL6B 3QP3A 1F4YL 1TJHL 3O6FA 4B0MM 1FLRH 5DJCA 3KPRE 2YPVL 5L2KA 3PWPA 4LLUB 3MNVA 4YDLB 6FABL 1K85A 3NCJL 1T22B 3C87A 3SO5A 4JO1H 4JAMA 3U83A 2EYSB 2F74A 1B6DA 4K9EC 3E2HC 4ZNCD 3MV9A 1WBYB 1WBZB 4KPHH 1J0KA 4Q2ZB 4JM2A 5FUCC 1MQKL 4UAOC 2FLRT 5B22A 3S3PA 4X6DE 4Y0GA 5DD6B 5T5FL 5IMKA 2V5SA 5K9KB 4HIJB 4NQDD 1MCQA 4LF3A 4Y5XB 5FUOH 1KTLB 5SV3A 1AO7B 2FJFA 1YC8A 4QRPD 5FO7B 1XAUA 1IQDB 1IRAY 2FBOJ 3F65A 1SVZA 1FG9C 5FYJD 2AERT 2ZUQC 1J1XH 1QEWA 4P3CH 5J1AA 3BZEB 4OSUH 3RNQA 1SJHB 2YUWA 3T4AB 3ZLQC 4ZS7H 4V2CB 3FQNB 1E6JL 4HQQL 1JGEA 4BH7A 3RVTC 2K3TA 4J7RA 4JDVB 1JF6A 4QF1B 3KPTA 1F58H 4ENEC 1Z9SA 1CFSA 1OGAD 4UT7H 3STLA 4P2RD 1MCPH 3X14A 1D5IL 5C0CE 3BRGC 3PWLA 5SX4I 5DDHB 4AENB 2DQIL 2E6PA 2FECL 5D2NA 1LEKB 4GG8B 3MNWA 2FH6A 3GKZA 1FO0H 2BVTA 2OXGA 5I0DA 3DX8B 1A9BA 3S5LG 4ZG1A 1KCKA 1UM6H 4NNYB 3IDJB 2ZNXA 4HUNB 4WI2A 1DDHB 3NGBC 4GKSB 4MQXC 4DVRH 3WFBL 5B3NA 3L1OH 3MRDA 5E2WL 2Z9TA 4XNUL 4FXGA 4WI4A 1N5YL 1YMMA 3WNMA 3ULUL 4GG6B 5JORA 3EO9H 1N4XL 1HSBB 1FRGL 3UO1H 5SX5K 3DV4A 3I6KB 1IAOB 4DTGH 3SPVB 5DRWA 4I13B 3V6BR 3BGFC 2QJDA 2AV1A 3GJFB 1NUNB 5I1IH 4NBZB 5LKNA 2QQLH 1NGWA 2BNQE 3HE7C 4GRWE 1DN0B 3HPLA 1QRNA 4HJGA 3BPLB 1JF1B 2DLHA 4NOFA 3HLAB 1I8LC 2Q8BH 2EDLA 2VL5B 4TOYH 2VWEE 2BC4A 3T1WA 3BN9C 2W0KA 2Q3AA 2HJFB 3KYAA 4PS4H 3ZKSD 3EDDA 3HI5H 4MJ5B 4FQLH 2JJUA 1DSFH 3MRPB 4XB7A 4GKNA 3MRGB 5AG9A 1OTTD 2NX5B 4H1LH 5JO5B 3MRFB 3QG7L 4F33B 3LIZL 4ZO7A 1QACA 3MA7B 1MFEL 2AK4A 5F97E 5FYJL 2XFXB 2FNBA 3I6GA 3MMEA 4QRPB 2VL4A 3RWGB 2GJ6B 3NH7H 1R5IB 5DJXB 5ID1A 3INUH 1CVSC 1OY3B 2CKNA 3HMXL 4KUZH 4WTZA 4PJ5B 5D93B 2LAAA 3ZZ1A 2XZCH 5FM5M 3VW3L 3FN9A 1PEZA 4FQIH 4ISVA 5DVNA 3RL1A 5GZOC 4ZPVB 5KSUA 4FMFA 1BFOA 4WHCA 4G7YL 1QHPA 5E4EB 1MRCH 2VDOH 3ECBA 3G6JF 4G8IA 4XP6L 3ROLA 1DQQA 4ONHA 1OGAB 2CK0H 4P2RB 1IM9B 2VAJA 3A6CL 4M4RA 4RISH 4TNWK 1JNLL 1YEIH 2C7UB 4GAJH 5E5UB 2ICWI 1A6AA 4Z0BH 5CJXA 4LSSL 4EI5D 3FTGB 4HC1L 3C60D 2GK0A 5CJ5A 4D9LL 2NZ9D 5TDPA 4KKCD 3DGCR 3ULSA 5IJVB 5J9PA 1MAKA 4PTUB 3GUTB 3VFUA 3CU1A 1T89A 5IB3A 5T1LD 3S98A 1BECA 5BMFL 3E6FA 4TQEH 5GS2D 1H8OA 2WSKA 1BJ8A 4ODHL 1TVBA 5E2UL 1XF4B 2O93L 4QXTA 2H45A 4H8WH 4J3UA 5HVWA 2CXGA 1MI5A 2IG2L 3QCUL 5HDBE 3LVEA 3QISA 4FQPA 2EDTA 1U8KB 2AJXL 3WO3B 4MHHG 3VH8A 4BSWB 1RZJH 3BE1H 4LKCB 1FFPA 4MJID 4OM1H 2CJUH 1S3KH 1E4WL 2AP2A 3MRLB 4DFHA 3MRRA 1F4YH 1TJHH 1IGIL 1FL3B 2WWMC 2LV4A 1G7HA 2EC9U 1R5WA 2YPVH 1EXUB 5INCB 4LP4A 2R2BB 2G5RA 6FABH 2ORBH 3NCJH 1WFNA 1T7ZA 1EDQA 4G6AD 4JFYB 1GGYA 2P8LA 3GSUB 5E2VH 1C08A 1FNSL 3HAEG 3FQTA 4AY0A 2CLZB 5ICYA 2ESVA 2JJWA 1FJ1A 2FEEL 3TJHD 1QO3B 1P84J 4ZO9A 4TN9A 4U7SA 1NPUA 3G6JE 1P5VA 1NGQL 2BVYA 3QHZL 3WHXA 1QPXA 1AHWC 4DEPC 5A43C 1SBBA 1B4JL 3DGGA 2YMXL 5DMKB 2MHAA 4JFHD 3WDIA 3DETD 3HI1A 4PGEA 2ARJA 4MYWB 3V4VH 1I8MA 2E7CA 1ES0B 1B2WL 4H0IA 2CLRA 1E6JH 4C55A 5F1NB 2G2RB 5FUCE 5IM7B 5IW1A 3QIWD 4OFPA 5D2LE 3FB7A 4BZ1H 4GMSL 3SDDC 3SDXA 3WIHA 1MCCA 1W72A 5HBBA 4EI5B 4CRPA 1INEH 1D5IH 4JZOB 1BD2A 4R2GD 5D7IF 2DL2A 1A9EA 1UZ8A 5E8EA 1UADC 3CFCH 5CFHA 4XWGL 2DQIH 2UZYB 3LD8B 5T1LB 2ITDA 3PQYB 4P9HC 2DN7A 2YS4A 3U4AA 4R96B 5I1LA 3MUZ1 3KPLA 3HZVB 1FZKB 1VKXA 2MQCA 2VJXA 2LE9A 5I8OL 3EJYD 3Q5OA 3WFBH 2Y7QA 5GHWH 5C2BH 3UPRB 1WZLA 5E2WH 1C12A 1N5YH 1DBAL 5CD3B 5JW5A 4EDWH 5GRJL 3STBA 5DMJB 2GQHA 1WZ1L 1FRGH 3HB3C 1JPFA 1HKFA 1TTUA 2LTQC 2VLJD 3EYVA 4M02A 1B6UA 1OAYL 4PJCE 4X6DA 3IFLH 4JRXD 2Z8VC 1QFPA 2HG5A 2ILLA 5B39A 4UB0L 3KGRA 3FQWB 5IB5B 1WTLA 4PYHA 3QXWA 4DUVA 4KI1A 3G5XA 1WIPA 3G08B 4NHUB 4ODUA 3LMJH 5ADOH 2NY3D 5JXED 3OXSA 2YD9A 3KYNB 4G6ML 2VZVA 3KPSE 1A2YB 1AY1H 3QUYA 4D0DA 4XPFL 5GRUH 1XIWB 4MQSB 3ARVA 1FFRA 3DMMD 2H32A 2XWTB 1GH7A 4TVPD 3BP6A 3KR3L 3NFNA 2IPUG 4J4PD 5I1KL 4TTDC 3UTQB 3QG7H 1DUZB 5KW9H 2OI9B 3LIZH 3UTPE 5I76A 1MFEH 5C0CA 5FYJH 4HMCA 4KKAC 1AD0B 1CD1A 4IJ3B 3QIUA 3G9AB 4M6NL 1M71A 4JN2A 5J13C 1DANT 3QDGE 4N1HB 4WJ5A 4UINL 3WS6C 1FH5L 2ID5A 3HMXH 5D7IE 3ZKNC 3EHBC 5D7JA 4MGXA 3VW3H 3HN3A 1RZKC 5HPMA 3UYOD 1CGWA 1FL5B 5BZWA 4G7YH 3SGKA 1V7MH 4JLRA 2G9HB 4XMPL 3ZHDA 5IIEB 4BQ8A 3S5LA 3HS0A 1OD7A 1TNNA 3H6JA 4LVOB 2V5TA 3WLWC 3A6CH 1JNLH 4YXLL 4CU8A 2EDDA 3WD5L 1MVUA 4RAVA 4LSSH 3SO3B 2Y25A 4HC1H 4OD3L 1C5CL 4D9LH 3LB6C 2X4QB 3WIFA 1FG2A 2F58L 2BXZA 3V4PL 5CGMA 2R1YB 4NZUL 3KJ4B 3L7FA 5H8DA 5BMFH 4FG6C 5DEFA 4PV9A 1KIRB 4RFOL 5F71A 2APWA 1YEFL 1ZA3B 5GISL 1EH9A 5E2UH 3V7MA 3IXTA 1G7PA 3H42L 3MGOA 4M1GH 4C56E 3LZFL 2IG2H 3QCUH 5I19L 3UROR 2AJXH 2GKIA 5J0BA 4F9LC 4MB4A 2YKLH 3UJJL 4G6JL 2ZUYA 5I18L 3C6SA 1I3GH 3PHOB 1S7WA 1UKSA 5CP3A 1E4WH 3LRGA 2NY3B 3MR9B 2DQCL 4V1DA 2W38A 3EGSB 4I0PC 4LSDA 4TVPL 5CINL 2XN9B 4BFIA 1QNZL 2P42B 2NY4C 3DMMB 5JUEH 3FAXA 4Q74A 3BJLA 2RB8A 3FOMB 2R4SL 2D0GA 1AR1D 1FL6A 1HHHB 5C70A 4FFYL 3WFHB 2ERJB 1FNSH 5K9OB 2CH8A 3BPOC 3UJTH 2X4OB 3BRFA 2BOBA 4NUJB 1KIQB 5EBMA 3MLSL 3GI9L 1NGQH 2G5BA 3HZYA 3VCLA 2NW3B 3QHZH 2WINA 2DTSA 3D2UD 4OZGF 4E42A 2R29H 4X9FA 3PDOA 4NGHH 5IHZB 1B4JH 4G9DA 3EO0B 2YMXH 5IG7A 1P7HL 2QR0B 2XKNB 4XC1H 1FCGA 3E1F1 2RFXB 2I07B 3GGWB 5C92A 3BHBA 1K2DA 4LHJB 1HWHB 1E28A 3NTCL 3FKUS 3RHWK 1B2WH 5HHPA 5DO2D 4NQEB 4OB5H 4ORGA 2ZUUA 1F6FB 5SWZD 3RL2A 4Z7VB 1JUFB 2OR9H 1T04A 2XWJB 4PREB 1N59A 1NDMA 4EUPB 2J5LC 2P49B 5FA4A 3LKOB 1IEHA 4KDVA 5D1QD 1MY5A 1F11B 1BOYA 3QI9A 5AWNL 4U6VL 5GS2H 2XA3A 4XWGH 1LE9A 1CDJA 4O58L 3IFOB 3Q6GL 5J57B 2XTJB 2HKHL 2YA1A 5LJYH 3TBTB 3H3KA 3L6FA 3LKRA 5CIPB 4RAHA 5I8OH 4PJBF 1YPZB 1MREL 5C07E 1MHCB 2R0WL 2FL5B 4QXGL 2B4CL 2NXZD 1WZ1H 1JPTL 4WWKD 3V6FA 3S4SB 5IVZB 5DI8A 4PG9A 1I9JL 1OAYH 2H26B 4OJFL 4RFNC 3G6JA 1ONQA 2YN5A 4UB0H 5DK0B 3LPWA 2ZG1A 1BVLB 1U8QB 5A2LH 3V6OA 4H25B 1J0YA 4NFCA 1VFMA 3DSFH 3HAEA 1EUUA 3UYPA 3ZE1F 2ED9A 3DYOA 2GSGB 3MJ9A 4G6MH 2G75B 2Z4QA 4S1DC 3VFMA 4F7PB 1S7UB 2GW5A 4HHAB 4XPFH 1UQSB 4P59L 4OZGE 2QQKH 4D2NA 4F9PC 4C4KO 3KNBA 5D2LA 3QEGH 3FN3A 4LCYB 1CD8A 4X4XB 5D7LE 1HHIB 1CS6A 1IAIL 2YR3A 4PJXB 4UQ3A 5BXFB 4LSQH 3MYZA 1MH5B 5FM5O 2JCCF 4Z7WF 1UCTA 5ILTH 1KPUB 3P4MB 4TRPL 4M6NH 4MXQC 3UDWC 3D2UB 2BJMH 5DVKA 4UQ2B 2AS5M 3CH1A 5FB8B 3L5XH 5ANME 5GS3A 1G6RA 4LHUG 1BQLL 3GSXA 4X7SL 5SWZB 5H94B 1QLEL 1AGCA 2B7DT 2YEZB 4XMPH 2UWEB 3F5WB 4JFZL 4PJCA 5IOPA 1YY8B 1KCSL 5D1QB 2ZSWB 3BX7C 3U9PL 1RIVL 3HTLX 3WD5H 1WIOA 4YHNA 2D0HA 3WNNA 5HYJE 1M05B 4PRPE 2X70A 4OD3H 1C5CH 1XCQB 1ZVSB 3RJDA 4UMGA 3ARUA 3R0NA 5EZLB 1B0RA 3V4PH 1KTKE 3QDAA 4O5LH 1FC2D 1BZ7A 3AMLA 3O2DA 1XZ0B 4RFOH 1P4BL 2VLRD 4J12A 4JRYD 1YEFH 2HFGH 5GISH 3WE6B 4D3CH 1FV1A 1CGSL 1JPST 4KK5C 5T3XH 1JNNH 3EBAA 1A4JB 4OZHB 4NKIH 1G0DA 1Q94B 2OM5A 3LZFH 3L3IA 4WW1B 5I0ZA 4G7VL 1PFCA 5I6XB 3WDHA 5I19H 1S8DB 3HE7A 4JDZA 2J2ZA 1A7NL 2F53E 1OM3H 2D9CA 4NKDA 3EO1A 4RGMC 5ABDE 2BMKB 3TV3L 3UJJH 4G6JH 5BRZD 4KVNL 2VUYA 4QRUA 4QXUL 1I8LA 3JWDH 1CL7L 1CFQB 4L4VE 3IJHA 3O41B 4Z7WE 2ADFL 4TVPH 2J8UB 3CDCA 5CINH 43CAA 5MP6L 1IGYB 1QNZH 3TCXA 3QEQD 4IS6B 4IOFD 3SE9L 4O4YH 4N0YH 1T1YB 3TNMB 2R4SH 4RGOL 3VXMA 1GPOL 4ZS6D 4PGBB 3HNVL 4LPTA 4PR5A 5F9JA 4S10A 5I9QB 4PIRF 4RRPG 1UJ3C 4TSBH 3GI9H 1AGBB 2EE2A 4PJEB 4Y5VC 1M4KA 4MLSA 4HPYL 4EOWH 1KULA 1J88A 5E95B 4K71B 3F7QA 4PY8I 4PBWD 2A74A 3C5ZC 3O6LH 1K8DA 3I6LE 2X7LB 4OV6F 3L7EA 3G6DL 4KRPC 2VDMH 1F3DH 3VI4F 1EFQA 3NTCH 2X1QA 2APBA 3HRPA 3TIEB 3VD9A 4C56A 3PXJA 4JHBA 1T0NA 3MV7D 4P49A 3S88L 1RJZA 1SEQH 1BBJB 3QUML 2J4WL 5C9JB 3CFBA 5J7CC 2PYED 2WUBL 1YEJH 12E8L 2RCSH 4FFWD 4WHYH 5AWNH 2WBJD 3QUMB 4U6VH 4FHBD 4FZEL 1CFNA 1QSED 4LKXA 4PJIF 4OZIE 4O58H 5EORL 3RVWD 1NFIB 3TBVA 1INDH 3HRZA 4CVXA 3H9SE 4Z8FL 2ZPKL 1YMHA 5KSAD 5I75C 3LKNB 1DTUA 3WUZA 4P57A 1MREH 3P30L 4LMQI 2YOCA 3DUUA 1YNKL 3ET9F 2R0WH 4YBQC 4QXGH 4WRLA 2B4CH 2R69L 5J6HA 3CFEA 2IBBA 3G9VA 4F7EA 5EUOF 2QSQA 3O6MH 1U3HC 4LEOA 1I9JH 3SDCD 1YN6B 4OJFH 1ED3A 2EYRA 3PWNB 2HWZL 1B0GA 2IANE 3IDYC 3GMQB 5F3HB 3SJVA 3B9KD 3WKNA 2O61A 3D25B 4LPCA 1B90A 2VISB 4KWUA 3ARDC 3SBWA 3WXVL 3M17A 3FOLB 5CJQL 4U1KA 4GBXD 4JREB 2FJGA 3UAJC 2BSED 2DMKA 4M4PA 1HYSD 4P59H 4UDTA 3VXRD 1DQDL 2IBGA 1MCEA 4X6BB 4D8PA 1T2JA 1EO5A 4OI8A 4FFVD 5EU5B 5KS9B 3VI3F 4XTRD 3M1BA 1P4LB 4JKLA 4DAGL 5BQ7A 2R2HA 5EC1B 1CBVL 3EDFA 2PO6B 4G9FA 4PRHE 1AHWA 3LRSA 3FB6B 3HC4L 2GUOA 1WQVT 3FFDA 1K9TA 2XQBL 4X7CC 2A38A 2DWEA 4CJ1A 4CMHB 3T0XA 4LRNL 4PY7B 3H9ZA 4PJ7E 1X5ZA 3P0YL 3X11B 3GHEL 3HC3L 4U7MA 5EO9A 3DLQR 4RAUB 3X12A 5I73B 2YRLA 1GZQA 3FQRA 5C07A 5DUPL 2Z31B 4F7TB 1GOHA 3MQIA 1KIPA 4XPAL 1WBXB 4PJ9D 3MRNA 4JFZH 4YDJB 1NGYA 4LDLB 1KCSH 1U95A 5E56A 4EIGB 1AC6A 3U9PH 4PRBA 1RIVH 4OUUB 2WBJB 4UV4L 1A6TA 1CE6B 3OKOA 1QSEB 4GFTB 2YUXA 5DC0A 3WMSA 3IS1X 5EOCJ 3ZMRA 2EDHA 4DGYL 3QFJE 1CFBA 2CXKA 4BSVA 1YQVH 5D1ZA 3OF6A 2GHWB 1F6AB 1CGSH 2DQFB 3W0WE 2NY7L 5TQ2L 1J1PL 4Z95H 3QDJE 5JPNA 3LQMA 5D7LA 2A83A 4F58L 3WEXA 2WV3A 4K8RC 4DGIL 5F89B 4XGZB 5C0FB 1KNOB 1VGKB 1FORL 2AJZB 2Z93B 1J05A 1CXLA 4HKBB 1E27A 5CLWA 1QA9B 3PHQB 2FX7L 3H7LA 3TV3H 1V5JA 4FFZH 4LLDA 3VI3E 4KVNH 4LOUD 3IKCA 4OFIA 1T2QL 3QQ4B 5C0DB 2NY5C 5KTEL 4M43L 5ANMA 2ADFH 4DUXA 3MRMA 4JPWL 1QBLL 3QYCA 4L9LC 1RU9L 4OFKA 4K3EL 1F02I 4I18B 1HNGA 4FABL 3OB0K 2WNGA 5EZOL 4RGOH 4Y8DC 1SHMA 2RBLA 1P7QA 1PKQB 5KJRL 3GB7B 1RJLB 4UDUA 4RX4A 4O2FA 2ADIA 1A7PH 3VGDA 3WDJA 3CSYB 2ZCLH 3QUXD 4LHUA 5HYJA 1K4DB 4QRSB 4ZODA 4PRPA 3WS6A 4XC3L 5FK9B 4CDHA 5BV7C 3NCYS 3OKEB 3BDBA 4MZ3A 3QHTC 1DP0A 2GFBB 2GSIB 4HPYH 5E7FA 3RWCB 3EAKA 5CSZA 1KBGL 1IAIM 5K59E 3ARBC 3OKMB 1CR9H 1NANI 4DJMA 4LPUA 3QXDB 4YFDB 3SE4C 2RR3A 1I7TB 2MCPH 1ZOXA 1MIML 4PJ9B 5JQ6H 5H37G 3QNYA 2QTEA 5FYKD 1LP9A 1T3FB 2F53A 1J8HB 4WV1C 3ILQD 3B3IA 2J4WH 3FFCE 1DE4B 1EA9C 2Q7YA 4CN6A 4PB0H 4TSAL 2OXHA 4FZEH 3HPJA 4L4VA 1ZLWH 5EORH 1AQKL 3BW9B 1CGYA 3O2WL 2DMCA 3QNZA 2W65A 3JWOL 4NKOA 1YC7A 2EXWC 1BEYL 2ZPKH 3WN5C 1O5DT 4XBGA 5HHMD 3TA3D 3D0VB 5I71C 1FGNL 1OB1A 3V5HB 3VXTA 1YNKH 1L6XA 4LCWE 3WV0A 4F9LA 2R69H 5E94A 4MA1B 3H9HA 3RGVC 5EUKB 2X1XR 4L8DB 1Q9WB 5F7EL 1MJUL 3Q48A 3KYOB 1NH6A 2HWZH 3STZB 3ZKMC 4LRIA 4XNMA 3VFTA 3GSWB 4XNYL 3D9AL 3HE6B 4PV8A 1Q0XL 3W81A 3WXVH 3EJZD 4PUBL 1T1ZA 2AXFA 4MA3A 1UFUA 1NCCL 5CJQH 1MFCL 4JVUA 4ZXBC 3TN0C 1HN1A 3B2UC 5A3ID 4ZUTB 3VFRB 1RUQL 2VZ1A 5DJ8A 5CZXD 5ESQA 1R3LB 1KEGL 1FP5A 3P11L 1DL7L 2EXYC 1SYVB 2LQRA 3N85L 5LWYL 5C0AD 4DAGH 3P4LA 4AIZA 3UMTA 2PETA 3QUXB 1CBVH 2HRLA 4LCCC 4QRRE 4G8GD 4NP4L 1L0YA 2XQBH 2A2QT 4OZIA 4FA8A 1A5FH 4LRNH 5DS8B 3VG9B 3P0YH 3H9SA 1OP5H 1CLCA 3GHEH 4U1JA 3TM6A 4IOSD 1U8MB 5FYKL 3UTZA 2ICWJ 3RAJL 3ARFD 3GBNH 2BHUA 2ZSVA 3REVA 4PRNB 1MOEA 2C3VB 1ZGLP 4XPAH 3MV11 4NM8L 5JIKA 3JV4B 4MAYD 5F6IB 3RWFA 4U1IB 3MLWH 2ITCB 4NN7C 4ZUSB 2IANA 3SKNB 1RZ8A 3G6AB 5CILH 2Q6WA 4RMSA 5SWSD 1MCSA 4LLYA 5GS1C 1RMFL 4RBPH 5FECB 4PJGB 1U3YA 1S9WB 1UH3A 2X40A 4DGYH 4PJ8D 4Y4HC 4OKVB 3R1GL 5FO8B 3SQBA 5HD8C 5IQ9A 3DHMA 4YAQB 1MHPL 3OXRA 1R0AL 4PGZA 3ARGB 5DUBA 4OD1L 1NSNL 2NY7H 4H0GA 1J1PH 2HJLB 4PJFF 4M6ML 3SE8H 3O4LB 4EVNB 5MEOA 4DGIH 5T1KD 1FZOA 3K74B 4YO0A 3C8KA 5E7BA 3BH8A 4D0CB 1FORH 2JLLA 1YUHB 3OKKA 1ADQA 1MF2L 1VEMA 2GJZB 2KKQA 2FX7H 1OLZA 4JKWA 3JTTB 1RVFL 1T2QH 5D70H 2R0ZL 1JYVA 5IR1B 1CXFA 4PJ7A 2B5IB 1GZPB 5KTEH 1U3ZA 4M43H 4NOBA 4LLMB 3ESVF 4F9PA 4JPWH 1QBLH 3TFKC 1DLFL 1MCKA 2H8PA 2EH7L 1BP3B 4HMEA 3GMOA 4K3EH 1VA9A 4FABH 5EZOH 2OR7A 4OM0L 1W0WB 3W9DB 4X99A 3OAYK 5K93A 5KJRH 4FTVD 3GJEA 3UDWA 4OV5B 1E4XI 2DLGA 1JK8B 3GIVA 3S7GA 4PLNC 3HMWL 3PV6B 4G8GB 5HY9B 5J11C 3IDXL 4U0QB 4F7MA 5ETUA 5DRXA 4FQHA 5IEHB 3T0AA 3C09C 1H5BB 1OPGH 2BNRD 4U6TA 2ZOLB 4JGMA 2F54E 3WFZA 5DC9B 1Z5LA 3TBYB 3ARFB 3I75B 1JGUH 5EG6C 3W0WA 1RZJC 3QDJA 3PL6C 1S7TB 5IVXB 4GRLB 1MIMH 5F3BB 4KRMB 1JGLL 2F19H 1D5MB 3VFNB 3C2SA 4ZMAT 4YDLC 1GGCL 5DD5L 1KYOK 3SCMC 5C09E 5ID0A 5T1DL 2W0FA 3KPMB 2JE8A 3RVUD 3JVGC 4IRSA 4JHWL 4TSAH 1JFQL 4U05A 1U41A 4PJ8B 1Y0LB 1AQKH 1NAML 1S78C 1KJ2A 1NUDA 2A6JB 3O2WH 5CEZE 5LBSH 3S35X 5I1CL 4PLJC 3JWOH 4Y5XC 1HILA 3S96A 1AD9A 2FIKA 3BN3B 5CLTA 4POZD 5MEND 1UB5B 3N1MC 1FGNH 4WEUD 1VFBB 4HCRL 2XICA 5DA4A 2OTPA 1IE5A 3DIFB 3N1FC 4NO0D 1NBVH 3IFNL 2AXGB 5D6DA 1K4CB 5I8EA 5F7HA 1P84K 3FT4B 1MJUH 4NQSA 3EJJX 2PKDA 5E6IC 4DWHA 5IP4A 4XNYH 3FB5A 3D9AH 3K4DA 1XGUA 1Q0XH 5GJSL 4PUBH 1NCAL 1XH3B 1NCCH 2YPKB 4D9RD 4EI6A 2EIZA 3O11A 3VFVA 1RUQH 4HWEL 5BO1H 1RPQA 3P11H 1QSFE 4U6XB 4HBCL 5DYOA 3CFDA 1UJ3A 4M6OL 3CFJB 3N85H 1DBJL 3PGDB 4N9OB 5LWYH 4ZO6A 4MWFA 3ZDXF 2V17H 3IDNB 3AAZB 3FFCA 4PP2B 4OCYL 3OHXB 4QNPF 4CADB 4Z5RA 3MRKB 2CO7B 1BIIB 35C8L 4UI2A 1QOKA 3C5ZA 3HKFA 3OB0H 5HHOD 1G7LA 1VHPA 1QFUH 2BNRB 3ULUC 2WP3T 1RZIA 2VDPL 4FS0A 4GOSA 5GSRB 1HSAA 3MZTA 2PR4L 3CDFA 4JO2L 3EYQC 2BVPB 2AJSL 1UEYA 2VXVL 5FYKH 3KS0H 1XMWA 4JN1L 5MI0B 5JOFB 3IVKB 3RAJH 2R1WA 5EA0L 1ZT7A 1ZLVK 1I7RA 4G80B 2VLKB 3UJIL 3BH9A 3W9EA 4NM8H 4BM7A 3D3VB 3EYFA 4DKEL 3DROA 2DBLL 3ZE2E 2BRRL 4QHNB 2GI7A 4LLAA 3LDBB 1FVCB 1S5IL 4Y19A 1F97A 4L8SA 5EO0B 5JXAL 1RMFH 4HUVA 4MDJA 1RZ7L 1QPPA 2HTLD 4G8FB 3FAWA 4YHLL 5F7UA 3D39D 1QVOA 5IBLC 1UB6B 3MXWH 4OCWL 4ERSL 4X6FA 1PY4A 4L29A 1UXWB 1MHPH 4S2SB 2EKSB 3DOSA 4ELMB 5K9QG 2A6IB 2EDQA 4OD1H 4JZJB 4HWZA 1DEEA 4M6MH 1AP2B 3QAZB 1YYLL 2JIXD 3CDGA 4B50A 4ZUWB 5GRWA 3ARDA 5D1XD 4N8CL 4QTHB 3RRQA 3MLUL 5E4EC 3AU1A 1MF2H 1DUYA 2VH5L 3R4DA 3F7VB 1RVFH 2NXYB 4HX1B 2R0ZH 1OSZB 1T21B 1OAXL 1P7KA 4JFQB 1ZSDB 2WUCL 4Q6IB 3IRZA 1ULVA 3FMGL 5HDOA 2XPGA 1G7IB 4ENED 2EEDA 2EH7H 3QDMD 2Q86B 2QQNH 4P2YA 4TSCL 3WIHH 5SWQB 5IESL 3IF1A 3BPNC 4OFDA 5DQJB 4M7JH 1LK2B 1U0QA 1R5VB 4GW4A 3HI6H 1MVFA 3FN0L 3U30B 4LVNC 1ZHKA 4Z7UF 4LCIL 5HHOB 5HI4D 3IDXH 4R26L 1JWSB 3GRWL 4Q9QL 3VXOB 4X5XA 4RNRB 2QBWA 5IF0A 4BFBD 2NNAA 3KPSD 5E70A 1ITBB 3A6BL 2VXSL 2AEIT 3F12A 4XXCA 5ADPL 2Q7NA 4E41E 5HGBB 1O7VA 1TJIL 3OGCB 1JF5A 3X13B 1U8HB 1T1XA 2CDEA 1H15B 2CO6B 1PYWB 1BREA 4JM4L 3SGEH 1GGCH 5DD5H 4H88L 3BO8A 1ZT1A 4I3RH 3ARSA 1OD9A 5T1DH 5HYEA 1OTTC 5D96B 3CIQA 1VADB 3QDGD 3ZHLA 1MFBH 4CNIB 4JHWH 4P3WA 3DPBA 4JCLA 1JFQH 4QHMB 3W11D 1HHKB 5TDNB 1NAMH 3IDGB 5DJAA 3VGGA 2A73B 2ZOKB 5I1CH 2ZCKL 3QRGH 4W6XB 3UTTA 2CMRL 4HUWA 4GG6F 4YC2B 4BFGA 2FJHA 5E6ZA 3HC0B 3DWTA 4HCRH 3T77B 2JELL 3ULUF 4X7TB 3GSOB 1P1ZA 2JIXB 1G0YR 5C08D 4DOHE 1EEZB 4GS7B 4AYFA 4MCYB 3IFNH 4Z76B 5D1XB 1JPGA 1CGXA 8FABA 2EIEA 4Y4FB 3WIIL 4KROB 4MDIA 4G42A 1CICD 3O2VL 4GAYA 1K8IB 2AJUL 1DR9A 4OGXL 3V5DB 1QBMH 1NEZA 5IW3A 5GJSH 1RUKL 3IT8D 4HH9B 5C0EB 1AO7E 1R3JB 4ZFGL 4HIXL 4WIQA 2F54A 4EI5C 3C60C 1BOGB 1N8ZB 1RUML 1S7XA 2NZ9C 1X6LA 4N90E 4KKCC 1S7SA 1EFXA 4HKXB 5I30L 4Y1AD 2Z91A 2YRZA 2W60A 1JRHL 4HWEH 3L5JA 3LD8C 2H3NB 4LLQA 1DBJH 1CIDA 4GKZA 4ZDHA 4M5ZH 4FQJL 3ZTNL 1TETL 5C09A 3VXSD 1L7IL 3QO1A 43C9B 4XI5D 5IQ7L 3BZ4B 35C8H 1FE8L 4LDEB 1RHHB 1QFHA 3IRPX 2EDXA 3RJQB 5HGDB 2BY2A 2VDPH 3CSBA 3ARED 3TCLA 2PR4H 3SE4A 4JO2H 4UIKH 5JDSA 3LQAH 2AJSH 5IROC 1I7ZA 2LU3A 4JFOA 4JN1H 4KZEH 1WFTA 5BS0D 2PW2B 5EA0H 1U8LB 2AJ3B 3GSVB 4WV1A 5I1AA 5K9QI 4NHCL 1CG9B 4C59B 1XCTB 2ARWA 3UJIH 4NRYB 2J6EA 5CP3H 4GG6E 1ZS8A 1IM3B 2PYFA 2DBLH 2R23A 3KPNB 2BRRH 5DD1L 3OX8B 2YA0A 4G6AC 1U3JA 1FFNA 1JIBA 3ULUE 5JNYB 1DJSA 2X9XA 2ZKHH 1R6VA 3GO1L 3TJHC 5JXAH 5ITFA 1RZ7H 2OI9C 2YD3A 3WN5A 4NO2B 2KQNA 3NCMA 5J1SC 1U6AL 4YGVB 4LLWA 1S5HA 3GMMB 5MERB 5E1AB 3TH4T 4IJ3C 4OLXH 2OJEB 1YDPB 3SE3C 3KLHD 4BSJA 2BERA 5ALCL 3VRLE 1DVFA 1QLRA 4NCC1 5C08B 3DETC 5KVDL 5IV2B 2W0LA 4UUJA 1NLDL 4W6YB 3TC9A 3EYUH 1QTYT 1CICB 5AZ2H 2GYSA 1MPAL 1TZGL 1L6ZA 5FDWA 5B3JF 3MLUH 3QIWC 4MMZC 3QJFB 4HK0B 5CKAA 4ZXBA 2GCYA 1EJ6A 4NQDE 3EFFA 3TN0A 3TZVA 5FM4A 2DTMH 2X4PB 1OAXH 4QRPE 1CLYH 2F8VA 5CBAA 5HHQA 2CIIA 1BM3L 2WUCH 5FYJE 3FMGH 3SO3C 1P4IL 3D18A 4Y1AB 3BIAX 3QUKB 2A9ML 4PLOB 4TSCH 4JHAL 1FO0A 3D85A 3SKOA 3BI9X 2X4UB 1G9NH 2W9LA 4MX7B 1IQWH 4LCCA 3KJ4C 3VFPB 2YZ8A 3PWVB 4P46A 1GGIL 3TBWB 1H9VA 3B9EA 4ELKA 3WS3B 5CAYB 2Y07L 3FN0H 5K33A 4N0FA 4MNHA 4PY8J 3SGJC 4JFFD 1ORQB 1OGAE 1F4WL 3L3KB 4X4YA 5E8PB 3FT3B 4P2RE 2IAMD 3RBGA 2GITB 4LCIH 1DQJA 3QA3B 2DYPA 3DURA 3GRWH 4JFPA 4Q9QH 4GUPA 4HT1L 3AREB 1PZUB 1TJGL 3HG1D 4ZFZB 1G1YA 3NZ8B 2XZAL 5C3LD 3FO2A 4OFVA 4PJAB 2APFA 2VXSH 2AJVL 3V6ZA 5BS0B 5ADPH 5IFHL 1F90L 5JXEC 2NY3C 1CLZH 4HWBL 1EJOH 5LAXA 1JWUB 3RQ3A 4ZFOA 1TJIH 4LPXA 4CU6A 3IDUA 3QXTA 3RTQD 3KJ6L 4D94A 4HV8A 4OLVH 3RNKB 4QOKD 2Y06L 3DMMC 3GDBA 5GS1A 5I66A 2XWBB 4H88H 5JW4R 5K9JH 4AT6B 1UENA 4ONFL 3QUZA 4X5WB 4J4PC 4Y4HA 2ERJC 4H1LA 4XCNB 1EVTC 4K94L 2A6KA 1AFVL 5T33H 3IETA 3NCYP 5TDOA 1P5UA 4IRJB 2CDFB 3C6LD 4H5SB 2CUHA 2ZCKH 4XP1L 4TNVK 2D3VA 1WV7T 3TO4D 2CMRH 1G7MB 4MMXC 1LEIB 2IQAB 4R3SA 4B53A 5F96L 3GSNL 1M6OB 3RWDB 1AXIB 4WU5B 1T4KA 5JLZB 1CGTA 2JELH 3MJGX 4UZGA 4KKLD 1HOCB 3GSNB 4APQD 1EUTA 3WCYA 4I48B 2B39A 5L2JA 3GSQA 3WIIH 5F1KC 1KG0B 3O2VH 4NWTL 3DV6B 1WUNT 1JHTA 3FONA 2AJUH 4ETQA 5IEKA 4OGXH 1OTSD 4KZDL 4JZNB 4BQ6A 1F6LL 4OCRH 1RUKH 3AXLB 5LGKA 4ZFGH 1YN7A 3EOYG 4WDIB 4MNGE 1VFUA 4OLYL 1RUMH 3TT3H 1EHAA 3X17A 5C0JA 4XCFL 5I30H 4JDTL 5DJ6B 3ZE0E 4J1UB 2BDNH 3QPXL 5MEQA 4E41A 1VFAA 1JRHH 5DWUH 4L9DA 1NGPL 4LQFL 1KLFA 4JFEB 2XTJC 3ABZA 3CVHL 2FSEA 1T20B 3RUGB 4JFFB 1Y6KR 3EYSH 1Q9LA 4FQJH 3ZTNH 4QTIH 4NWUL 2W92A 1KPRB 3CVHB 3PJSB 3C2AL 1S7VA 1J87A 2QHLA 3MRHA 5IQ7H 5DJDB 1ZHBB 3CUPB 3RIFK 3L5WA 3GMPB 3KPPA 1KCVL 4PRAB 5AYQA 1C16B 4AQOA 4N9GB 4POUB 2CLVA 1MSPA 2B4CC 2K7QA 3BAEH 2OTWB 4NSKB 4KJQD 2ADGA 3ZYIA 4EN3D 2C1PB 5IB4B 2MCG1 5GRZA 2OSLA 4L1HA 4WO4B 5JW3H 1KB5L 2Q76B 2C4FU 2HJKA 1PDKA 3SCMA 4NHCH 5CGYD 4JJ5A 1P6AB 2I60L 5DHVB 3DECA 2EYSA 3O8XD 4XVJH 3ES6A 1CT8A 1AR1C 1TTGA 5DD1H 5HI3D 1I1AD 5B8CB 1IL1B 1JWMB 1RUPL 4I0PD 2E7LA 5K9KA 4MJIE 3FQXA 1KTLA 3LV3A 3DRTA 2ZUWA 5FO7A 1KELH 3P77A 3C6LB 1IAMA 4NO3B 5D4QA 1U6AH 1T0MA 3O9WD 4YHOH 3TO4B 2A9NL 1N64L 4ZPTB 4J8RB 2FYYA 4EQ2A 3SGDH 3PWPD 5IK3A 5EBWA 4QHLA 1SJHA 1CCZA 5ALCH 3MOQA 5C71A 1T66D 4PJBB 4APQB 1X5KA 4W4OC 5E6IA 1C5DB 1NLDH 4JDVA 5E8NB 4QF1A 3OR7A 1MPAH 1TZGH 2CGRL 2ATKA 4OUOA 3VWJD 2IFGA 1W0YT 3MBEA 4E0RB 1OW0C 3O0RL 1XR8A 5D1QC 4GRMA 5B4MD 5IW6B 1DFBH 3AS0A 4AM0A 1NBQA 2R2CA 4GG8A 1BIHA 1LEKA 3WL9B 5BOZG 4LNRA 2XQYK 4Z78B 4ZYKB 1G0XA 3OG4B 3D0LA 2ZP0T 5ALBL 4HAGA 2JJSA 4GG6A 1ORSB 4JPIB 1HSBA 5TQ0L 2GTZA 4OZFH 4WU7B 3T09A 3O3EB 1F4WH 3SPVA 1A1OB 2NXZC 4JFDD 4HXBL 4WWKC 1T1WB 4S1QL 2JCCB 2OL3H 3F7PC 4HT1H 3ARYA 1MAML 1ZTXL 1S7RB 1WCBB 2FZ3B 1KT2B 5IBTL 2MPAL 2QL1A 5C0BD 1MELA 2XZAH 4IMLA 1F2XK 4X8JA 2JJTC 1JL8A 3HLAA 3MTRA 4WUUD 5IFHH 4Z7VF 3UBXG 1F90H 4HWBH 3VJ6B 1VCAA 4NQCD 4P5KA 2PXYB 3O8XB 2GTWA 3KJ6H 5C6PB 4ACPA 3DVNA 3T3ME 4LASH 5FA3B 2HH0L 4E5XA 4PRHD 1H3VA 1BGXL 2VLJE 3MRFA 4F33A 4ONFH 1EO7A 4NQDA 2C4FT 1SJVA 1TFHA 2P1YA 4LHQB 4ESKA 1H3GA 4BJLA 3PGCA 4RA0C 5I9QC 3O9WB 4XVSL 1QRND 1NL0H 2E6QA 1NGZA 1FNAA 2Y5EA 5DJXA 1AFVH 4NFDA 2FD6L 4PJDA 3O6FB 4P5TA 4XP1H 1I9EA 5DJCB 1C1EL 5ACZA 5CEXA 3PWPB 4PFEA 2VZ3A 3MNVB 3NFPA 3HR6A 1D6VL 5KVGL 2V5MA 3GSNH 4K71C 3HMXA 2IF7A 3VMNA 4JAMB 2V7HB 4ZPVA 4UOJA 3RX5A 3LN9A 2P8PA 3LH2L 4NO5A 1G9ML 3FB8B 4JO3L 4NWTH 5IMKB 3MCLL 2C7UA 4LF3B 1PX4A 1WEJL 2DI7A 2FJFB 5FOJA 4OZ4B 1PSKL 3QFJD 1AGDA 5FDYA 5C7XL 2DQTL 3GUTA 3G5ZB 5ESVA 3EIFA 4HC1A 4OLYH 1I1YA 4ONGL 2VIRB 4JDTH 4KTYA 3QPQD 4WI6A 5F44A 3WHE0 5DJYA 1JGEB 1BQHG 3GHBH 4LQFH 4BH7B 3BP5A 3MBXL 1YNTA 3CVHH 3VWKD 4Z7VE 1CFSB 5F6HI 3STLB 4UBDD 5B21A 1DBBL 4H20L 4JFDB 4WHYG 3C2AH 1U8KA 5FYLD 3WNPA 5F21B 4BSWA 4LKCA 4FQCL 3ILPB 4F3FB 3MNWB 1E6OH 4YUEH 4ZUVB 5C0BB 3KWWB 1KN2H 3P73A 1T80A 4WUUB 3WFEH 1PG7W 1X9QA 4KK9C 5IBUG 1FL3A 1EK3A 2XTJE 4NQCB 1JPSL 1EXUA 1KB5H 4XCYA 2UWEF 5INCA 2R2BA 4FXGB 1YMMB 4EZMA 5TF1L 4JREC 4PG2A 2I60H 5MHSD 1YPZE 4IOFC 4W70A 5EOCL 1MI5D 4UNUA 4YFLI 3DV4B 2QKIA 5DRWB 1F3DJ 4UTBL 5ICZB 2CLZA 3TEUA 2BNUA 1CU4H 4RA3A 1RUPH 4ZS6C 1V7NH 3WUWG 3LHPL 5ECJE 5FKAB 3U6RB 3PP4L 1Z6JT 1FZJA 3HPLB 1NBYB 1QRNB 3BOVA 4HJGB 2UUDK 2ZG3A 4MNGA 3SN6N 3WLBA 3UTSD 4TULH 4PRIA 5LGHH 3FQUA 1N64H 5DMKA 2ZJSL 1TVHA 5F9WB 2BC4B 2QQQA 4K23H 4OZHF 4CMHC 4JFXA 4OQTH 2I27N 1MUJA 4L4TD 1MWAL 2JF1A 5F1NA 3VXUD 4NBYB 3V7AG 4ZSOB 3U4EA 2HRPH 1CK0H 3QCVH 2Z31C 4PJXE 1RZKH 2CGRH 2AK4B 4NQVA 3I6GB 3MMEB 4MCZB 4EI5A 3C60A 4WCYH 4MNQD 2NY2D 4X6CE 2J8UF 3O0RH 3V7AE 3ROOA 4FFWC 4IDJL 7FABL 2WBJC 1GAFL 2DL9A 3PV7A 3GMRB 4X9GA 3LQZA 1JYNA 5IMOA 1YECH 3RVWC 3W39B 1L7TH 1BFOB 3UPRA 4W68A 3UBXI 1LO2L 2IGFH 3ECBB 3ROLB 3MLVL 1DQQB 5SWZE 4ONHB 4RSVA 3Q3GA 5I15L 5TQ0H 3TWCL 3LS4H 5HJ3B 3T0WA 3CPLA 4PJEF 1ERNA 2CIKB 3U1SL 1A6AB 2VKWA 4HXBH 4MJIA 4WFED 4FQ1L 3ULSB 5IB5A 5J9PB 3SDCC 1MAMH 2P8MA 5IBTH 3G08A 5IB3B 4NHUA 3B9KC 4R4FL 3S6CA 4P2OD 2N1KA 3E6FB 3KYNA 2ZUSA 4LAJH 3RDTD 1TVBB 1U3HD 1HDMB 4GBXC 5HTSA 4QXTB 2BVUA 1TQBC 1MHHA 2BX5A 3FZUC 1MI5B 4DCQB 4C4KT 1HYSC 4ZOEA 3T2PA 4FN0A 2HH0H 4OZHE 5C0RL 2E9IA 3N9GH 1BGXH 1T5XA 3UTQA 1DUZA 2R2EB 2VDLL 3U0WL 3L95B 5GRVL 4XTRC 3VH8B 3CSGA 1OP3H 5KG9B 3WYRA 5KSBF 5KAQG 2E5EA 1HHGA 4M7ZC 4XVSH 1OGTB 2FD6H 2R4RH 3PE9A 1C1EH 1R5WB 5KVGH 3N1QC 5IGXL 2IBZX 3LEXA 3QIWA 5I8CA 1C08B 3FQTB 4FQ2L 4JHZA 1KCLA 5ICYB 1MFDL 5IIEA 1FJ1B 2WBWB 4ODVL 2VMFA 4NZDA 5FGSA 4JO3H 4PJ9C 3MCLH 4OLUH 4MNQB 2NY2B 3BRDA 3OKDA 1C7SA 4OFYD 3OKLA 3QIUD 4L3ED 3WHXB 3BZFB 2CQVA 1NFDF 1Z9MA 2XI9A 2YK1H 5DGRA 2DQTH 3CMGA 1NCBL 3O4OB 2BY1A 2MHAB 1YJDL 4KQ4H 5EIVA 3LS5H 2R1YA 1V05A 3HI1B 4PGEB 2ARJB 5KS9F 1HZHL 5C2UB 1I8MB 1HQRA 4R6UA 1MQ8A 3TNNA 3SGJA 1R3HA 5IW1B 1QYGL 3EOBA 1PQZA 3FB7B 2Z8RA 1CZ8L 2VLJA 3LKSB 3SDXB 5FCUL 2X4RA 1W72B 4GW5A 1DBBH 4H20H 4JRXA 3UBXA 1ZT4A 1ZLUK 1A9EB 3BSZL 4KI5F 4Z0XA 1MAJA 4OCXH 1MCOL 1UZ8B 5E8EB 4MA1C 3PHOA 3RIAF 4B7LA 2ITDB 4OCSL 3VGBA 3ISWA 5JXEA 5I1HL 2FGWH 4LOUC 1FFOA 3KPLB 3I2CH 1VKXB 1YYML 2HT4D 2VLRE 1TQCC 4KJPC 1XFPA 2Y7QB 4JRYE 1G7JA 2MQ3A 4S0SD 4JB9L 1F4AA 4AK1A 5TF1H 3FOMA 1QR1A 1XGTB 1A1MB 2P43B 3I3EA 1JPFB 5EOCH 4J4PA 5D5MA 2F5BL 4K7PX 4X6DB 1LNUA 2NY6D 2HG5B 2F5AH 2X4OA 4X98A 1FIGH 3N1GC 3LHPH 1VESA 2C3GA 5BRZE 3ALWA 1SY6L 5D9SB 4OBSA 3QUXC 2NW3A 4ODUB 1QBBA 4V1DD 4Q58C 4PRDB 2WANA 5IHZA 2PTUA 3CMOL 4LK4A 2PW1B 2COQA 3RBSA 4KXZI 4D0DB 2RFXA 4MQ7A 4PYGA 3QEQE 1EV2E 2H32B 3VG9C 1SMAA 1CVRA 1A3QA 3BP6B 2X44D 3NFNB 4XVUC 1MWAH 4Z7VA 5KS9E 1IC4L 3ZL4L 2VR5A 4PREA 3VXPB 5I76B 3MGTB 4EUPA 2P5WD 5JA9A 2YD5A 2UZXB 3LAFA 4Y7MA 5CGTA 3WJLC 1CD1B 5AUMB 3QIUB 4L3EB 1M71B 4JN2B 3R0MA 1BQHA 3ARBD 3ILQC 3C9NA 3SY0B 5CEZD 1RURL 3FO0L 4HIEB 4JRWA 4OT1L 7FABH 3IFOA 1Z0MA 4P4KD 5D7JB 3REWA 5ITBL 3VA6A 1L0QA 3TBTA 4NM4L 5HPMB 5CIPA 5BZWB 3KPQA 4JJHA 4R4ND 1LO2H 2CDGA 1YPZA 4JLRB 3CX2A 4OLWL 4YDIH 1MHCA 3S5LB 4X6EA 3HS0B 5I15H 3TWCH 5IVZA 2IH1B 3U1SH 1MVUB 4RAVB 2WW8A 1GSMA 1RK0A 2B8OT 5EULV 1GYAA 3J8F7 2FWOA 2HAZA 2PYEE 4GRWB 4FQ1H 3QI9D 1BVLA 2VITB 4ZAKD 1QSEE 3ZDZE 3DO7A 2VXUL 3KG5A 2AQ1A 3GMNB 3L7FB 4M6AA 5DEFB 2GSGA 3MLXL 1OSPL 5A2IH 3RGVD 2Z92B 3EJZC 3OR6B 4YR6B 1RJYA 4ODWA 4XRCA 3SHSA 1UQSA 2W9DL 1HINL 3BWAB 5DHYA 1CYGA 4P5MA 5A3IC 3IXTB 3VFWB 3VDCA 2P7TB 2BXYA 5CZXC 2NY6B 4OTXL 1HHIA 1Q9OB 4PJXA 2DQUH 3U0WH 2VDLH 3BKML 1ZGLA 2DDQL 1LK3L 3UZQA 3T4YB 3K0WA 1MH5A 2OQJB 1HH9B 2AKRB 3L5HA 4X6CA 3PNWB 1S7WB 2BSSB 1IJ9A 1KPUA 3P4MA 5DD3H 5HVFB 3GI8H 3ZDYE 3D2UA 3LN5A 4V1DB 2DJSA 4HK3J 1AR2A 4UQ2A 3IGAB 3PGFL 1FFQA 5FO9A 4BFIB 4P2QA 3DBXA 1H5BC 3VXRE 3EKCA 4XCCL 3QZWG 1FL6B 5IGXH 3ZO0A 2P45B 2QHRL 4HGWA 2UUDH 4FQ2H 3P0VL 1NQBA 1MFDH 3ARFC 3F5WA 4DVBB 5KN5A 5LGJA 4Y5YB 2N7AA 3CFIC 4ODVH 4OF7A 1BAFL 1PKQE 4NZJA 4YZFF 5CEZL 1OW0A 3L3OA 2VERN 1Z9OA 4N68A 3OGOE 4UNVA 4MAYC 1WZMA 2A6DA 4RZCB 5E9DD 1M05A 1Q72L 4Z7OF 2YN3A 1IBGH 1XCQA 1NCBH 4P4KB 1GXEA 5IG7B 3LOWA 5EZLA 1EGJL 1HZHH 1K2DB 1XZ0A 1E28B 2HKFL 4PJ8C 3EW3B 1IC5L 5D72L 5HHPB 3WE6A 4FQXA 4NCDA 3HNSL 1F45A 3JBG7 3RL2B 3K4AA 1JN6B 1A4JA 4WWKA 1N59B 1NDMB 4R8WL 4HLJA 1CZ8H 3WNLA 2IPTL 5FCUH 3TLRA 1I9IL 4H0HB 2X4NB 15C8H 1J8HE 4O9HL 3BSZH 3QI9B 1IGMH 2BMKA 1MCOH 1DQLL 3HFML 3N1PC 5HGAA 2JJTA 1IGJA 1TLKA 5I1HH 2UZIL 1CFQA 5AG8A 3OG6B 4DZ8B 2X10A 3LKRB 1YYMH 2HT3D 1J12A 1IGYA 5I16B 2FO4A 4DK6A 3MX0A 1T1YA 4QHKI 2LFGA 3V6FB 2N4IA 5DI8B 2V2XA 2OP4H 3W82A 4PJGF 1MRDH 3MROB 5I1JH 3MJ9L 4M61A 4MXWL 1SY6H 1CXIA 3HAEB 4YZFE 3B5TA 4PBXA 3T8XA 1MCFA 5B38G 2M8XA 2Z4QB 3JV5A 1QLFA 3VFMB 3CMOH 4Z7OE 2YRPA 2VR9A 3D48R 2XA8L 4HPOL 2DMBA 3RGHA 5F7WC 4UAOB 5D2LB 2Q3ZA 1BFSA 1PW3A 5J56B 4GAFB 1MCRA 5F7NC 3VXMD 5MI0C 5GGUA 3TBSA 4X8XA 2CR3A 2LU7A 3QRFM 3FRUB 4QKXB 4CVZB 1JMZA 2ZUQB 1HI6A 1SQ2N 1QRKA 3BJ91 2J7LA 3CNKA 5EN2A 2EDYA 4RMQA 5F70A 2W59A 4YH6A 1RURH 3FO0H 5AD0B 1E4KC 4F8QA 4OT1H 4Y16D 3LDBC 2XV6B 3CH1B 1BMGA 4M00A 1SEBA 2A0LD 4R90L 5EIQA 2VLRA 4GXVL 1GRWA 4JRYA 2GY5A 2V2TA 5DJ2A 1WISA 3GSXB 9CGTA 3QCTL 1H3WM 5HYSG 1HIML 3LKNA 4PTTB 1AGCB 5I1GH 4J3TA 1EAPA 5FYKE 4PJCB 5IOPB 5IHLB 4L3CA 3P9LB 1CD9B 1TCRA 4JZJC 3RZCD 1PAMA 3VD7A 5JMOC 5BRZA 1F4HA 4K8RH 4LAQL 3O45B 4LEXH 5CMAA 4E9LA 2VISA 1IGCL 5L8LB 4OCNC 1B0RB 3AB0B 2VXUH 5DQ9B 1IC7L 4PJGE 2Y6SD 3HUJE 3MUJA 1BZ7B 1NDGA 3MLXH 1Q0YL 1OSPH 4IM8A 1OARH 5IVXF 4KHXL 3QEQA 5T3ZD 1IMHC 1A6ZA 4P99A 1ZLUH 2AXJA 2IPKB 5HHME 1G6VK 4X6BA 2FX9L 4Q6IC 4LSUL 5EU5A 3DARA 5KS9A 3L3IB 2BFVL 4JG1H 4OTXH 4JDZB 1QP1A 1DQTA 3NABL 2X6MA 2OMNA 3BKMH 4NKDB 3EO1B 1RULL 3ARTA 3MRQA 5FGRA 1LEGB 1NJ9A 3SJVD 3DI3B 2XTLA 3FT2B 1IC1A 3U30C 4U2ZA 3CJJA 3IJHB 4X9HA 4IOIA 4WEBL 4PY7A 2B2XH 3PGFH 3TIDA 3X11A 2RGSA 2X89D 4KKNA 5BV7H 2RAMA 2V7NA 1J9CT 1UA6L 4NJAL 3QHFH 2EICA 4XCCH 3VXMB 3DUSB 4X0KB 4IMKC 4KY1H 4F7TA 3NN8B 2K1MA 3MV7A 4PR5B 1U9KA 3P0VH 5F9JB 5C0AE 1N3NA 1KTDA 1CE1L 3BP4A 1BAFH 5CEZH 5E0QA 4ZNEA 3FL7A 3HA0A 4G9FD 2PYEA 4NQUA 1N5AA 2WBJA 4G8GE 2P44B 3CGTA 1QSEA 4Y16B 3M8OL 1BVKA 1UXSA 4TUJB 5LQBH 3VA2C 5DR5L 2A74B 5ICXA 5D96C 1K8DB 4MB5A 1EGJH 4L8CB 2J6EH 2HLAA 3SDAA 2HTLC 5KSAA 2NY1D 5B39G 5E8OA 1IC5H 1UZ6E 4OI9A 5FUZL 1F6AA 4CW1A 3HNSH 1T0NB 2NX5D 5JPMA 1W0VA 5L9DH 4YC2C 4DZBB 2PCPA 5F89A 2IPTH 3RZCB 5C0FA 4HKJA 4M93B 4Q9RL 3VXQB 5M7QA 1I9IH 1KNOA 2AJYL 3SDCA 3CFBB 2AJZA 5IBLD 4HKBA 4IRZL 4O9HH 5C8JA 3MOBL 3B9KA 2GJ6D 4Z7UB 5SWSE 3BGAA 3TP4A 4B7IA 1DQLH 3HFMH 5D1XC 4LKXB 5T3ZL 4Y4FC 2UZIH 4U6YB 4GBXA 3HRZB 4PJ5D 3SOBL 1DEDA 1YMHB 5E99L 3MFGB 4LCUA 3VXRA 3S35H 3OF6D 4P57B 4XXDA 5EZJA 2AEQL 4KGJA 5J6HB 2Y36L 4JPKL 4ALAL 3VFOA 4F7EB 2I5YL 3UZEA 4LSPL 4DKAA 4Z77A 2P5EA 4LEOB 1IM9D 1EHXA 4JY4B 1ED3B 3BQUD 3QZWA 3CSYA 2JK5A 3SJVB 1K4DA 5CHNA 4XNQA 1X5YA 4OLZL 1LO3L 2FBJL 5DA0B 3V0AC 5FAAA 5JIHA 1LDPH 3BISA 5HI4C 4ELMF 3RWCA 4HKZB 5F9AC 5KVMC 1GIGL 5EOQL 3MLYL 4HK3N 1NC4D 1OAUL 5DMGD 1PG7X 2D7OA 4U1MB 1N7MH 4TNWF 4N8PA 3QXDA 5HHXH 3CVIH 2D7TL 4DGVL 4MD5A 3M1BB 4YQXL 2SEBB 4KH2A 1T7XA 1ZA6B 4FRWA 4FTVE 4G9FB 2CKBL 1EMTL 1H3PH 3H7BA 4CU7A 2VDNL 2GUOB 1UVQA 2GK2A 2CKBB 2DWEB 5I2IB 4QRQA 4R90H 2BNRE 1KACB 1Y6NR 1JTTA 5MEPB 2NY1B 3BYYA 3IJYA 3W11C 4GXVH 3IJSB 3FQRB 1AGEA 4B41A 3QCTH 3ZT7A 1HIMH 2JTDA 4YXKL 2PTVA 3D0VA 2D03L 1ZMYA 1KIPB 4M1CD 5DFVC 1LE5B 1JYWA 5DZOA 1NGYB 4PGDA 1RD6A 4PRBB 1D6EA 1UC6A 1RY7B 4YFLF 1Q9WA 3RVVD 2D7QA 1ACYL 1A6TB 1OLLA 3OKOB 3STZA 4LAQH 4M7KH 5DT1L 1IGCH 3MLRL 1CICC 1Q9KB 3ESUF 1X7QA 4BSVB 2H1PL 5D1ZB 3KHOA 4KHXH 4PGCA 3K2UL 4R4BA 5MENE 2HVJA 4CN1A 3S34L 4FMKA 4ELME 5JPNB 3NACH 2FX9H 5D7LB 2A83B 1JV5B 2I9TA 3WEXB 4LSUH 5B38A 1IT9L 2BFVH 4G43A 2KL6A 4FP8H 1JGDA 4DN3L 1J05B 3NABH 3BQUB 3RPKA 1RULH 3QUXA 2X1WL 3KLAA 4QYOA 5ACLA 4J3XA 3VD4A 2X4SB 4XI5C 4F2MB 2ICES 3PQYD 3QWRD 4I2XE 4WEBH 2YZ1A 3MRMB 4RMWA 4D9RE 1NC4B 3CXDL 1A8JH 3T2NL 1BFTA 1UA6H 3AREC 2O5XL 3I85A 4M1DH 4PRNA 5EO1A 1A0QH 5J13B 2VRAA 3HCVA 2DLFL 1TTFA 3JV4A 4LPYA 4UDUB 3GK8L 1CE1H 1IKNC 4O2FB 2AQ3A 4LHUB 4U1IA 4PRPB 5F88B 3E6HA 2H6PA 5HYSA 5E2TL 2YC1A 4RMRA 1ZEAH 1WK0A 1G9EA 5HHOE 4DN4L 3W5NA 4N8VG 4N0UA 3M8OH 3HUJA 4PJGA 5DC4B 1S9WA 5DR5H 3K1KC 1UM4L 4I77L 1PKOA 1HXYB 3MZGB 1JZ5A 5F6HJ 1WZKA 2LABA 4EBQL 1GCFA 4OKDA 5DJZB 5JOEA 4YAQA 1XIWD 1XF5A 4H26A 3TA3A 2VAAA 4YDVB 3U0TA 4S0TD 2R56L 5FUZH 1UH4A 1KB9J 3QNYB 5BVPL 1LP9B 5KANG 3BEVB 5F1IB 4K94C 3KLHC 4BZ2L 2F53B 4BK5A 1MQKH 4Q9RH 3P4NA 5T5FH 4D0CA 2AJYH 2R0LL 1BVZA 4EQ3A 4U1GC 4IRZH 1X5FA 2Q7YB 3TPUB 3MOBH 3F6LA 3JTTA 4BELD 4HEPG 2CR6A 4KKBD 5IR1A 1J0IA 3D39E 1CD0A 2D4DA 3MA9L 3SOBH 1CF8L 1OQOA 5E99H 4LSVL 3MLZL 4HQQH 5TE4L 1OB1B 4PD4J 1BLNA 3VXTB 2AEQH 4CGTA 5CP7B 2Y36H 1WWBX 5E94B 4JPKH 5C0AA 3H9HB 4HZAA 4ALAH 2I5YH 4LSPH 3OJDA 5D7SL 2HMID 4IIQB 5F7KC 3LKPB 5DMYA 1U8JB 3IU3A 4NQXB 4XNMB 3VFTB 1MNUL 4MA7L 4OLZH 25C8L 2HN7A 4C83A 1T1ZB 2AXFB 2FBJH 2IAMC 5DK3A 5DEZA 3KPRA 1H5BA 4U1SA 1KEML 5IWLC 1HH6A 3BVNA 5D6CB 4WI9A 3MLYH 2E9BA 2KDGA 3OZ9L 4XNUH 1M1SA 3G04A 3ARFA 3TBYA 3I75A 3QDME 3ULUH 2EEAA 1N4XH 5CD5D 4L1DA 4DGVH 3GJFH 4YQXH 2I26N 4AIZB 1U92A 4M48L 4MAYA 2VZUA 4UV7L 3QB7C 1MJ8L 1JHKL 3RTQC 1JZ4A 2E27L 5SWSA 3TO2B 1FZMA 2XIDA 2BSTB 3HHRB 4OZIB 5EPMA 3UZVB 5JW4M 3RY6C 4PJ8A 5B8CC 1HWGB 4WY7L 3S8WA 3H9SB 1IZKA 3I9GL 4U1JB 4EIZC 3O3BA 1K3ZA 2XN9D 3UTZB 1NAMA 4GT7A 3REVB 1UB5A 3C6LC 4YXKH 2D03H 1VFBA 3TO4C 2AI0L 1FYTD 1A14L 1FDLL 5T1KA 3QH3A 1HQ4A 1KCRL 1UT9A 2EC9T 3RWFB 5M95B 1YEKL 4HCRA 5LCVL 5DSCB 1U8PB 1X5IA 1K4CA 3N50A 3AROA 2Q6WB 3VFGL 1C5BL 2R39A 3T65B 4KKLC 4APQC 4LLYB 5GRXG 4AG4L 2AEPL 4P3DA 5L8KB 4PJAF 5DT1H 3MLRH 3T08A 3V79C 1EX0A 2E8ZA 3SKJL 1OTSC 2H1PH 4WWID 3OXRB 5DUBB 3K2UH 5IUSA 5FV2A 3MACL 2Y4SA 4UIMA 2B1HL 1U93B 3S34H 1CXKA 2FRGP 4NQED 4XP6H 3AGVA 1U2HA 3OMZA 1DZBA 3PG2A 1FZOB 4QCIB 1QQDA 4YO0B 1IT9H 5C08E 4FTVA 4ZQKA 3ULVF 3CX5J 4ZUUA 1XF2A 3IDNA 3OKKB 4O02L 1I1FA 2BNQA 2D9QB 3MRJA 1KLGA 4PP2A 4MHHI 3VXNA 5E2JA 4CADA 1KPVA 2HFEA 4RDQF 3F6IA 4NRZB 3BD4A 4PJ7B 2BNRA 3RHWF 4HWNA 5GGRA 3RFZC 5DD0L 2XTJD 1NCDL 3MRIA 3CXDH 2BVPA 2J1KA 4ODHH 4Q9BA 3GKWL 2H8PB 1WAAF 3GMOB 3T2NH 4Y1AE 2NR6D 2O5XH 4XP5L 5CEYB 4KJQC 4EN3C 1F2QA 4OZFG 2ICEB 4G80A 1D7FA 4LLVA 4TUOA 1IKFL 1BJ1J 4QGYA 2AABL 3T1FB 3OKNA 3GIVB 5CGYC 3VXSE 4QRTA 3NA4A 1E4KA 4WHDA 3O8XC 1T7WA 1YA5A 5E2TH 1BWWA 4F7MB 5ETUB 4FQHB 4XP9L 1J11A 5GQBA 4DN4H 1MCIA 5HI3C 1I1AC 1AIFB 1N6UA 4KK8D 2IH3B 2YPLD 3JWNC 1IGIH 4I77H 4GJTB 4P23D 2NW2B 1A22B 1Z5LB 4EBQH 2XKSA 4N5EC 3ORJA 5J89A 1KC5L 2CRZA 5MENA 1UXWA 1VERA 2VN4A 3DRQA 3IDIA 1EEQA 4MJ2A 4S2SA 4ELMA 5BS0E 3O9WC 3RUGF 3DTXA 1FYTB 4JZJA 3TYGL 2YA2A 1F8TL 5BVPH 4BH8A 4NO0A 4M8QA 3MYJA 4BZ2H 3A67L 2VZTA 2DIJA 1I1RA 1SVCP 5ID0B 4AZ8A 1T5WA 1T66C 2R0LH 1P6FA 4ZUWA 5EOTB 5F1SA 2DQHL 4QTHA 1XGPB 4Y19D 2NCMA 3BT2L 4IRSB 5L7XL 4POYA 4JR9L 5AZEL 1J18A 2DWDA 4HX1A 3VWJC 3S37X 4I2XA 4CUCA 5E1HB 5GGRY 4JFQA 2H9GA 1WT5C 1OAKL 1ZSDA 4NDMA 4O51A 4Q6IA 5HYQA 2V9QA 1G9MC 1UWEL 1CF8H 1TXKA 2FIKB 1XEDA 4YK4B 5B4MC 3MLZH 1FN4B 3EOAB 3DXAD 4XBEL 3CZJA 4NRXA 1YEHL 3QIBA 2W0PA 4GMSH 2MOVA 4RMTA 5DQJA 4DKFL 1LK2A 1QR4A 5I8EB 5D7SH 2YD8A 5F7LB 4NQSB 4BQBA 4QO1A 3EDJA 4NZRL 1MNUH 4MA7H 3FB5B 5HHOA 1XGUB 1IEAA 1J5OL 2Y5TA 3VXOA 4EI6B 1KEMH 3GRWA 3O11B 3VFVB 3NFSL 4NN5C 2EE9A 4IMKA 3OZ9H 4FOMA 1DBAH 1CDIA 5GRJH 4HAFA 4N8VA 5HGBA 3CFDB 2Y23A 4JGJA 1UYWL 3X13A 4MWFB 2LVEA 4M48H 4UV7H 2DIAA 2WBKA 4XX1G 1PYWA 5IMLA 2W1NA 4JFFE 3RUGE 1E4XL 1JHKH 2E27H 3VGAB 4S1RL 1MLCB 1QBAA 4KRPB 4YHZL 2YPLB 3B83A 2DKMA 1BF8A 2V5RA 1HSAB 4QHMA 1JCKA 4P23B 3D39A 4WY7H 3HG1E 4XX1E 3BP7B 4HS8L 2RHEA 5EBLA 4P2CG 4BKLA 1NBZA 5DQDL 2ZOKA 4WNQA 3F58L 3SGDI 5JR1L 4Z7QF 3OJMB 1OF2B 3I84A 2WZPD 2R1WB 1NANH 1I7RB 2Z8SA 3KR3H 3MLTA 3BH9B 4BZYA 3HC0A 3WSQL 2AI0H 5I1KH 1A14H 1FDLH 2FATL 4CL7A 3EYFB 4X7TA 3DROB 3GSOA 1PD6A 1KCRH 1RV6X 2JIXA 5F9WC 5JQHC 1EEZA 2APVA 1P2CA 3N06B 4QOKE 1YEKH 3V5KA 2YWZA 5D1XA 5LCVH 5J4MA 1Y18A 4Y19B 5ACMA 3AS3A 1C5BH 4D0BA 4L8SB 3V8CA 2AEPH 4AG4H 4MDJB 4UINH 4KJWD 2JJVA 4S11A 1FH5H 2DQDL 32C2B 3ARRA 3DX6A 1QVOB 3SKJH 2ZUXA 4YDKL 1R3JA 5FEBA 4HS3B 4BQCA 4HFWB 4XMLL 1I7UA 2HT2D 3RX7A 3D5OF 4X6FB 3CXHK 1ZVYA 2YSSB 3MNZA 4AIOA 4ZTPL 5KBNC 3BFOA 3S9DB 3UTTD 3QDMA 3DXAB 1AXSA 4WHTB 4HWZB 2B1HH 5J1TC 3ARXA 1ZLWK 3BEWA 2DM3A 4RQQA 1JZ3A 2H3NA 1FLTX 1Y6MR 3QPQC 5J3HD 4PJBE 1L4IA 4YXLH 2R1XB 3CFKA 3ARDB 4XZUB 3AU1B 1DUYB 5EDXA 2B0SL 5FYKU 43C9A 3VWKC 3BZ4A 4UBDC 2F58H 5I8KL 1CDGA 5I1EL 3NIDF 4NZUH 2Q20A 2MQ0A 2YD1A 3H0TA 3KPSA 5DD0H 1NCDH 3GKWH 3ZE1E 3AUVA 4JANB 1PJ9A 1LO0L 3O3DA 3IF1B 3H42H 3NCEB 3B6SA 1U8LA 2VE6A 3WNOA 1CG9A 4C54A 3QQ9D 4GW4B 1QFWM 4Z7QE 1LO5A 3TJEL 3LPFA 1D5BB 1IKFH 2AABH 1ZHKB 3KPNA 1ROWA 2HYMA 5I18H 3OX8A 1ETZB 1EHNA 3U0PB 5F1OB 2ZWLT 3QDGA 5E00B 4N5UA 4KK9D 4X5XB 5FHAL 4U3XA 1DLHB 3P9WB 4XP9H 2DQCH 1G7QA 5IF0B 2JCCE 5D7IA 3X3GL 2NNAB 4NO2A 3V9FA 1BWMA 1RAMA 1WFUA 4I3SL 4XBPA 3F12B 4YGVA 3L3GB 3HZKA 4Y2DD 3T0ED 3GEWB 2OJEA 5BZDA 4FFYH 1K5NA 1RUAL 3TYGH 1U58B 2YBRB 5EC2A 1OP5K 2CDEB 3TYFB 3L5IA 3Q6FA 3BO8B 4W4NA 2PO6D 3MLSH 1CICA 1X4ZA 2DQHH 4MJ6B 2MFNA 2W07A 1UWXK 5L7XH 3TT1L 2OZ4L 3AMKA 5HXMA 5AZEH 3RI5K 3LKQA 4KI5D 3V4UL 4CBPA 3JV6A 3BDXA 4K3GA 1OL0A 2NY2C 1OAKH 3UTTB 1UWEH 4HUWB 4DW2L 4Y1AA 4EUPH 4RBPK 3PWPE 2Z31D 5DJ0A 3O4OC 5CJ8A 4QHUB 3MRCA 5L6YL 1YEHH 1P1ZB 3OTTA 4XB8A 1DVFD 4K7FA 3TPKA 4WFFD 4HLZH 5C0GA 5FGBC 4G8EA 1JPGB 3WS3A 1V3KA 8FABB 3VXSA 3FO1B 1YJDC 3EOTL 4U33A 5T5NF 4G42B 4QT5B 1QUNA 1SMOA 3P9MB 4GAYB 1QKZL 5E8PA 3FT3A 3BWUC 2YUZA 2GITA 4OZFA 4A2LA 4RIRA 5CIPH 5ESAA 5KSBB 3Q6GH 1YY9C 5BCAA 3AREA 3LEYL 2HKHH 2OL3A 2UYLA 1S7SB 4ZFZA 4LFHG 3NFSH 1BZ9A 1TPXB 5DTFA 4NPYB 2W60B 5BS0A 4JGUA 4P2OC 1IKNA 4A6YL 2ZUVA 4YEFA 1JPTH 4X7FC 3BKCL 4QY8B 3X3FL 3RDTC 4QLRA 1UYWH 4P46D 1SYSB 4A6YB 4HWBA 2XQYG 4UNTA 5C09B 3OJVC 2OCFD 5H37H 4F80A 1KCUL 1E4XH 2GEEA 4U1LA 1T83C 4JFDE 4JKMA 5FGCB 3I02A 3IDMB 2VO5A 4S1RH 2O26U 4YHZH 5GGSB 3PWUB 5E8DL 2Y1VA 5DEGA 3TCLB 1NFDB 1ZLSL 3AC0A 3UPCA 4HS8H 4Y2DB 3FZUD 4R0LC 5C0BE 3T0EB 5DQDH 1I7ZB 3F58H 4H5SA 4O2CA 3ZT5A 3U36A 4WUUE 5I1AB 4J3VA 5CSBA 4NQCE 2GAZA 1RZGA 1LD9B 3RWDA 1ZKAA 5D7KD 1IAIH 4WU5A 3WSQH 3VI4E 1YMME 2FATH 1ZS8B 5KOVC 5DGQA 4YHYC 1HOCA 3GSNA 3ZKQD 1T2XA 3EZJB 3PF2A 4KPHL 1FFNB 4TRPH 3W5MA 1SJEA 3K8KA 3QUZD 4K7PL 4ODSL 3DV6A 5J12B 3H9YA 3RY5A 5ITFB 2DQDH 1EZVX 4LLWB 1S5HB 1QRNE 4YDKH 3QIUC 4XMLH 4P3CL 4PJIE 1BQLH 4ZTPH 4R97B 4X7SH 3SDDA 3CCHA 4ZS7L 1QLEH 3QQNA 1DVFB 3GSRA 5C0ND 1FNEA 3K4ZA 4WI3A 4LU5L 1J8HD 2IJ0C 4JFFA 1F58L 4AH2B 4UT7L 5FDWB 1D5XA 4ZSOE 1U91B 1Q8MA 5H35A 2IAMA 2ENSA 3CVHA 3PJSA 5H2BA 2B0SH 4ZXBB 5EUOE 3EFFB 5DJDA 1ZHBA 4Z18A 3TZVB 5JZ7D 5IWLA 3JUZA 4R7NB 2IC2A 2QSCL 4PRAA 5CBAB 1C16A 5I8KH 5HHQB 4N9GA 4BUGA 4NC2B 3HG1A 5I1EH 2CIIB 1AGFB 1BF2A 1I4FB 4NN6B 2XY2A 1P4BH 3DX7A 1GOGA 3VDAA 3R8BB 4OZGA 2DLIA 5IB4A 3D85B 5TPWL 4DVRL 1LO0H 4HIHA 3SKOB 3BUYA 3PWJB 4LCCB 2BOCB 3DX9A 4P46B 4G7VH 2HT4C 3RTQA 4ELKB 1EAJA 2W9EL 4NFBA 1A7NH 1Z9LA 3TJEH 4HULB 4MNHB 1KB5A 4QOKA 4X4YB 4DTGL 4GMTL 5B8CA 1DQJB 1HEZA 1QFWI 4QXUH 5FYLE 2YXFA 3DURB 2ED8A 4GUPB 4XCEB 3HE6D 1CL7H 3KXFD 2NY6C 4XT1C 4KJPD 3DNKA 4M7LL 2CPCA 2F15A 3FO2B 5BJTA 3C6LA 5MP6H 4I3SH 4NO3A 4ZFOL 3SE9H 3TO4A 4J8RA 1EHLL 3JSSA 5F7DA 4TOYL 3CSPA 4ZFOB 5LAXB 3K8MA 1XT5A 1GPOH 2NQCA 2VC2L 4PS4L 1RUAH 3SDXF 1AQDB 4FQLL 4W81A 3HNVH 1MCJA 1DSFL 4HV8B 5MHSE 2QLVB 4PJBA 4F15B 1ZE3C 1IFHL 1OTUD 1MI5E 5GS1B 1N0LA 4OQTA 1HXMB 1L9MA 3MOAL 4MVBD 3QUZB 2IWGA 3RWIA 3WO4B 5KZCD 2D0FA 4DUWA 3TT1H 2YUVA 1I3UA 3NH7L 4I4WA 4Y5YC 1KLUB 3BZDA 2A6KB 3V4UH 2EDJA 3IETB 5TDOB 2AV7A 5GGVL 3UTSE 3G6DH 1QFOA 4KUZL 4XVUD 3WL9A 3GMLA 2LVCA 2XZCL 4FQIL 2BHYA 1ZK9A 3VRJB 1T4KB 4ZYKA 2HFTA 4P4KC 4A2MA 4L4TE 5L6YH 4IDLA 1MRCL 4PBVC 3KYMA 4X6DF 3VRIA 3S88H 5TGBB 3S36L 3VXUE 3QUMH 4JPIA 3VU2A 5L2JB 4LQ1A 3GSQB 4R4NC 2IADA 3EOTH 3V0WL 2OTUA 2WUBH 4WU7A 1V3MA 12E8H 1AE6L 2XZQL 3O3EA 1QKZH 1H3TA 4AEFA 1A1OA 3FONB 4EEEA 1FCCA 5DRZB 3O3AA 5IEKB 3Q2CA 1B4RA 5FOBB 1IGTA 2JCCA 4MNQE 3MBED 4Z7WA 1YN7B 2KBGA 2YD7A 3LEYH 4Z8FH 3QI9C 4EN3A 2WQ8A 4ZAKC 2LU4A 1CXEA 4UT9L 2YD6A 2BP3A 3ARGD 5MEQB 1VFAB 3P30H 2BVQA 4ODXB 1XGQA 1EBAA 1WSST 3BKCH 3O4LD 4H8WL 5IB1A 2FSEB 3RWJA 3QXVA 1Q9LB 3UP1A 2APXA 1EBPA 2DOCA 3C09B 1I1AA 1KCUH 3MRHB 4D9QD 4I0PA 3SDXE 2EDNA 2RQ8A 1JNJA 3KXFB 1INQB 2H41A 1N2RA 4WFEE 4OM1L 3BXNB 2CJUL 2CLVB 4GLRI 2OX5A 3V8OA 1ZLSH 2NTFB 3Q1SL 2DICA 4L4JA 2ADGB 5HHNB 4Z6AT 3V6OC 1FVDB 1DQDH 2OSLB 4K07A 2Z35A 2HJKB 2HVKA 1I8IB 2ORBL 3SCMB 4JJ5B 2WLYA 1ZHNB 2OR8A 4DOHB 2V7HA 1CTOA 3TVMD 3ES6B 5E2VL 1CT8B 4GRWF 4M9PA 3HC4H 2EDEA 3VWJA 3NPSB 5KZCB 5E5MA 3FB8A 3H8NA 4JY6B 5D71L 4K7PH 4ODSH 1XF3B 3FQXB 1WT5A 3CD4A 3LV3B 3DRTB 4OZ4A 3P77B