5FM5M

Crystal structure of the myomesin:obscurin-like-1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
123
structure length
123
Chain Sequence
PAAPLDVKCLEANKDYIIISWKQPAVDGGSPILGYFIDKCEVGTDSWSQCNDTPVKFARFPVTGLIEGRSYIFRVRAVNKMGIGFPSRVSEPVAALDPAEKARLKSRPSAPWTGQIIVTEEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords MYOMESIN-1
publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 123
sequence length 123
chains with identical sequence N
ec nomenclature
pdb deposition date 2015-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm5M00
1YEJH 2BJML 3OMZA 3MZTA 3BO8B 4ONOA 3GMNA 1LQSR 1JI1A 1U8IA 4NHCH 4PJXF 3BIKB 4OQTH 4B53A 4JM2F 4TRPL 3QDME 2VITA 3G5ZA 1KCVL 4IJ3C 5EBGA 1NCAL 3BGMB 1HKFA 4M6ML 4MJ6B 1PSKL 3FB8A 1YEDA 1IGJB 2EKSA 2BXYA 3BPCA 1FORH 2VZTA 5KJRH 3P11L 1JMXA 4IRSC 1EBAA 3CFJA 4XC1L 4LLDA 1A9EB 3IU4H 1YMMB 4KQ4L 1BD2D 1PY4A 3L5XH 4Y89A 3OTTA 3RI5K 1T7VA 1KNOA 2XACC 3AU1B 1JF1A 3OKMB 2YKLL 1DQQB 1R3HA 4F7MB 4KH2A 1NFIB 2VLRE 4PYGA 1GC1H 5C0AA 4BQ9A 4YFLF 5FGBA 2IH1B 5DVMA 3QHTC 4C59B 4JVPA 1R5IA 1KG0A 3A67H 5IHZB 2ZNXA 1UCBL 4PJAE 4D0DA 1G6RB 4K3JH 3MYZA 3HI6H 3TPUB 4Z7VA 3LB6C 4LK4A 5DO2C 2EYSA 2I60H 4LEOA 3ES6A 3KYNB 1S8DA 7FABL 5HVWA 2AJ3A 1K6QH 1QSFB 4S2SB 5I76A 4PBXA 1RZFH 1WT5C 3X12A 4QT5A 2OK0L 4NC0B 4JJ5A 3DYPA 3BIAX 5SWZD 1FGNL 3DGGA 4HKJA 5F7WC 4TULH 2VKXA 3SDAA 4CN6A 1MPAL 4HJ0D 2Z91B 4XPTL 4NDMB 2K7QA 3P73B 3LEVH 2VISB 4G8FA 3UX9B 1BECA 4M7KH 4X7TB 5MERB 1F6FB 4LCCA 3QXDA 2HVKA 4ALAL 5DVKA 3BEWB 4PJ5D 1T2JA 1OSPL 4JLRA 4MVBC 5D2LF 4M00A 4ZUWB 2YUXA 2BCKB 4NHUB 2FYYB 4XPHH 1NGXA 2YN3A 2F53D 3OAUH 1BFOB 1I1AB 2OS7A 2LTQC 5EU6E 5GGTL 5J11B 5CEYB 3SDXF 4R4ND 1KGCD 3GSNL 5KOVC 2VDQH 4MXWH 3CH1B 3I6GB 2WUCL 5GS2H 5D70L 5MEPA 5EA0H 1CIUA 2DM4A 1DVFB 1J86A 1TPXB 4PGDA 4DGYL 3BW9A 5JDSA 3DSFL 4LCIL 4Q6YA 1AP2B 1I8IB 4NRXB 1A1NB 3HE7C 5I1HL 2A0LC 1V3JA 1TZHA 1TJGH 4GS7B 4IOFD 4J3SA 4LHUG 2OQJA 1BAFL 1AQDB 4I3SL 4OLXL 3W0WB 1PDKA 5FECA 5BJTA 4J3XA 1D9KA 1KV3A 3FOLB 4PV9A 3TYFB 2IGFH 3L3DA 2V7HB 3OKDB 5CZXD 5D9SB 5FO7A 5KN5B 5EC1B 3OB8A 1K4CA 3CSPA 4OZFA 3VXTB 4XHQA 2C1PB 5KVGL 3D85D 3RZCC 3TBSB 1J9CT 4TUKH 3O3AA 1NMCC 1NLBL 1G7QB 1CGSH 2X1PA 3IXTB 1D5ZA 2QSTA 4PJFE 3JVGC 4GAYB 2GJ6E 3OPZH 4YBHA 4KRPD 5M95B 3L5JA 3AS2A 2AV7A 1YEFL 1YJDH 1YNTB 3NPSC 3GB7A 4EN3B 3IETB 4WDIB 4X8JB 1NCNA 3S6CA 5GRVK 3BDYH 3KPQB 3WUWB 2W9DH 1JTPA 5AAWA 4YHOL 3RVXD 1ED3A 4P4RB 5CSBA 2MHAA 3LRHA 3Q6FA 3TNMA 4JZJA 5FYJD 1LEKA 4Y1AE 1MLCB 1REIA 1X5HA 3LKQB 3KPMB 4R7NA 4AG4H 3GSNA 5DJ0B 2PW2A 3NZ8B 2EICA 2ZCKH 5CBEB 4OJFL 3LMJH 2EE6A 1JP5A 3ET9F 5GS1C 4GMSL 4G9FB 3NCJH 1E6JL 3QXTA 5F1KC 5HHMD 1YYLL 1FL3A 3PJSB 4KAQH 3PWJA 2OP4L 3OX8B 3WLWD 2Y5EA 4A6YB 1LVEA 3FTGB 1CL7L 2ERJC 1T80A 3I2CL 4K8RL 3RX7A 4ZNEE 2ADJB 2Y4SA 3VFWB 3FHQA 1RIVH 3P4MB 4P23C 5D7JA 4QRSB 1LHZA 1S9VA 2DWDB 4G6MH 4ODSL 4Z6AT 4NWTL 1S9KC 4ORGA 1DLFL 2WWKT 1A7QH 5EU5B 3LKOB 4RFNB 4PJDF 5M94B 5JOPD 1JFQL 5BVJA 4MYWB 4KJQC 4XPGH 2E7MA 1NDMA 4X83A 3N1QC 4FQPA 4DVRH 4KHXL 4OCSH 5I1IH 4KDVA 2IALA 2FH6A 2R4SH 5KS9E 3V52H 1QSVA 3CZJA 5E6IA 15C8H 5GSVB 3RL2B 5HYSG 1DEEB 1R3IH 2BOCB 4U0QB 3S88L 3GHEH 4JREB 4PB0L 1ND0B 3MUZ1 1TVBB 5HHVL 2PYFA 4X6DB 4XWOC 4OLEA 3NGBB 2ZKHH 1OAXH 3VFSA 2XN9E 3O6FB 2NYYD 4PJGF 1QBMH 2NX5B 3OKKA 3L3GA 5ICXB 3GI9L 3STLB 3MZGB 4GSDL 1UM6H 2R2HA 3KLAA 4M7JL 1CU4H 3S4SG 3UTZB 2PTTB 4QRUB 4I5BA 4HQQH 5IEKA 3BP7B 3HFMH 4F33A 2CGRL 2J6EA 1T7WA 1H0DB 2YR3A 3HE6A 2VXUL 1LILA 4HIIB 4NZTL 3SE8L 1A5FH 4ISVA 4EBQH 2DLTA 1PLGH 4KY1H 1F90H 1MNUL 3MO1B 4OZ4B 2OCFD 3AM8C 1DFBL 4AIZA 1J1PH 4ZD3L 4U0RB 4C58B 4LVOC 3U2SA 3RWHB 1IM9A 4WFGD 1G6RL 1SHMA 2PW1B 3RQ3A 3HI1A 1CFSA 2X4SB 3IDGB 1WBXA 4X6CA 3RUGA 5DUPH 5FA4A 2VLLA 1LEIA 5AZEH 1L0YA 4KJYB 4YDLC 4JKWA 4NQEA 3KHQA 4IOIA 3RWDA 3QIWB 4LMQE 4QF1B 3BPNC 1FRGH 1F6AB 3LN4B 5I66B 4NO0A 4OM0L 4HIXH 2E5EA 5L0QC 1BVZA 4DFHA 3SO3B 2FRGP 1QO3A 5E8DH 1A02N 4GW5B 4ZPTA 4BZ2H 4Q2ZA 1H8SA 4H0HB 3LHPL 1KIRB 4X5WB 5FGBC 5DJ2B 4P2OD 3O8XA 3GKWH 4YGVB 2P45B 1MIEH 5EC2B 2XTJC 4PTUB 5IMOA 1FIGH 2FO4A 3EZ8A 1JWSB 2QHRL 3ARED 5F72S 3MROB 1IMHC 3E8UL 3BO8A 1BBDL 4I18C 5SWZE 2UWEE 4IMLB 2APBA 3BIKA 3D2UB 1EEZB 3S36H 3BGMA 1XGUB 4XBEL 4MJ6A 1JGDB 2P7TB 5IEHB 1IGJA 2DLGA 2QQKL 3S37L 5I1EL 5T1LD 2D9QB 2CMRL 2Z31D 4F15C 3LKPB 4I9WE 3QRGL 4AQOA 1A9EA 1YMMA 2QSQA 1MFCL 4PRIE 4KMLB 1JF5A 4XGZB 4P2YA 4Z7WE 1U36A 3AU1A 4MAUH 3OKMA 4QXUH 2F9BT 4LCCC 4ZUVB 1J10A 2F19L 3T2OA 1DQQA 2BVTA 2P8MB 2UZIH 4HEPG 4BFBD 4F7MA 2H32H 5JXEC 2FHBA 1NFIA 3C5ZA 1A4JB 1OARL 2IH1A 2VDPL 5IMMB 1JL8A 1TCMA 2L7UA 5DVNA 2R23B 1MUJB 5IHZA 5BMFH 1G6RA 4YC2B 8FABB 3TPUA 5FYKD 1GGTA 3MFFB 4NQCB 2X89D 1DDHB 4JHWL 4WI7A 3KYNA 4GRWF 5DFWH 1QSFA 5LXGL 1B6UA 4M6OH 4S2SA 1TZGL 1AHWC 3R06B 4GBXB 4HXAH 4XCCL 4ZOAA 4XNYH 3MOAL 2E7LA 5FM5M 3G6JE 3WIHA 2W38A 2WP3T 2Z91A 4NDMA 5E5RB 4XCFH 2VISA 1C16B 4DQOL 4QTIL 1P7KB 3P77B 3CK0H 4X7TA 4ZUUB 5GPRA 5MERA 5IR1B 5T1DH 3BEWA 4NBYB 2QHLA 5J6GB 4ZUWA 3ARGC 1TNMA 2EDYA 4H8WL 2BCKA 4NHUA 4YK4B 2FYYA 4D2NA 3E1F1 2RCSH 5T1MB 5DZLA 5TE4L 1BFOA 1I1AA 1U91A 1U6AH 1Q9WB 1MHCB 1GPOL 4NZDA 1X5ZA 4FFZH 4U1SB 1N7ML 2ESVD 2H2SD 3D5OF 2GSIB 5CEYA 1E4WL 4MLIA 3T0ED 1CXLA 2YHGA 3CH1A 3I6GA 4LEXH 2X40A 4YHYC 4FQLH 1E4XH 4ZAKD 4KWUA 3SGDI 2VZUA 4XBGA 1UG9A 4J3WA 2FEDC 3V0AC 3VXSB 4OI7A 1DVFA 1D6VH 5TPWL 3ARZA 2NCMA 1O7VA 3CSBA 1YNKL 2NY5L 1F5WA 5JR1L 1AP2A 1I8IA 4IDLA 4NRXA 1A1NA 5KVEL 3Q0HA 2O5ZH 3O6KL 1D5IL 5JLZB 4LSDA 1AQDA 1TVDA 2HJKB 5J12C 5HHME 3I3DA 3B9EA 4ODVL 4FZ8H 3W0WA 1KENH 1A7NL 3Q1SL 2F5AL 4N5EC 3MODL 5EPMB 2QADD 3FOLA 3V6ZB 4DTGL 1MI5E 1WC7B 2IG2L 3QG6B 4DOHB 4JFFD 3TIEA 2V7HA 5D9SA 5KN5A 2NY6C 3SE4A 5EC1A 3BKYL 4HGWB 3VXTA 2C1PA 3U9PH 3TBSA 1YEKL 4JPWL 1WV7T 4POYA 4G8GD 4QKXB 3IJYB 1G7QA 2QV2A 3RY5A 3IXTA 4LOUD 4X7SH 2IJ0C 4GAYA 1V3KA 3MACH 5E70A 3SBWA 3DV6B 4PP2B 4OCRH 2CK0H 4WO4B 1YNTA 3RZWA 3H7BB 4EN3A 1HILB 2P5EB 3IETA 4WDIA 2ADGB 4X8JA 4LSUH 2FD6L 4MZ3A 4N0UB 3O4OC 1ZV5A 4U1MB 3KPQA 4NBXB 3WUWA 1L9MA 4DKEH 4P4RA 5K9JL 1IC4H 5ADPL 3K3QA 3MRQB 2WZPD 1MLCA 4I0PD 4Y19D 3LKQA 3OWEA 3KPMA 5DJ0A 4KTDH 3KR3L 2GKIA 5I73B 1FAKT 3NZ8A 4KKNA 5DMJB 3VXQB 1OAYL 1CR9H 5DHVH 3B2UC 5CBEA 4ONFH 4HG4K 1RZ8B 4G9FA 4YUEH 4BYHA 3PJSA 3V4VL 3KPSD 3M17B 3OX8A 2EYTB 2NY0B 2OLDA 5CJBA 4A6YA 3ZMRA 3T0VA 3FTGA 1MCFA 3L1OL 4QCIB 1UA6H 4ZFOB 1Z9OA 1FVEB 4KVNH 5FV2A 1B88A 2ADJA 3B5TA 3RDTB 3HG1B 3RIFK 3VFWA 3P4MA 4QRSA 2DWDA 4GT7A 2E3VA 4HUUB 1TFHA 4QXGL 5EU5A 2XA3A 3LKOA 1IGCL 3JSSA 4G7VH 1KJ2B 1UACH 2VXQH 2JJVA 4R8WH 3FB5B 4PG2C 4YXHL 1FNGB 3HZYB 32C2A 4WCYL 4CU7A 4Q9RL 2IAMB 2VR9A 5KW9L 2K7PA 4NO3B 5FHBH 3VGEA 5GSVA 3RL2A 1T03H 4K8RC 3D39D 1BJ1J 1BOYA 1DEEA 1ERNA 2BOCA 4PJFF 4OZGE 4G3YL 4LIQL 4Y4HA 4AIXA 4K7FB 4QGYA 1GHFH 3EYSH 1ND0A 3BRFA 3L7FA 1TVBA 2VDLH 2NY7L 4X6DA 4LQFH 1YPZE 2BFVH 4HX1A 5IB1B 3O6FA 5CP7B 3BRDA 2IC2A 5C0BD 4X98B 4J2XA 2NX5A 1X6LA 3LRSB 5ICXA 5EZLB 3IF1B 2Q87A 1BJ1H 1TQBC 3MRHB 3UTZA 4DW2L 4NQDB 3MV8B 3PWPA 2PTTA 4QRUA 1XCQB 4X6FB 3BP7A 1FH5L 1NBZB 3TT1L 3KHOA 1SMOA 3V5HA 4JFDB 4WI5A 3SE3C 1H0DA 1S7WB 5L88L 4HIIA 5D5MA 1B2WL 1RIUL 1AFVH 4QRRD 3GSXB 1Q0YH 3MO1A 1FCCA 4X6BB 5LJYH 3RWHA 3QPQD 2DMCA 3BYYA 4YO0B 1NUGA 5JNYB 5BS0D 4KJPC 3KPOB 1FP5A 2V2TB 3U7AA 1RAMA 4OCYL 2PW1A 1SM3L 3EJJX 2X4SA 3VFGL 2BVOB 1QNZL 5CILH 3O2VL 1UWGL 4KJYA 3TV3L 5EULV 1UWEH 2Q7YB 3HAEG 2VKWA 1H5BC 3QIWA 2HRPH 4TPRH 2PYEB 4QF1A 2EO1A 3LN4A 5I66A 4JG1L 1TNNA 5E2JA 2HT4C 4IBLT 1NBYA 3CVHB 3SDDD 5CBAB 5F9WB 2EXYD 4GW5A 1R0AH 2B2XL 4X5WA 1KIRA 3BPOB 4EUPG 5DJ2A 4OF5A 2LABA 4YGVA 1OP3H 1ZXQA 2FJHB 1EX0A 5EC2A 4PTUA 1UB6A 2Y07H 1V7NL 1JWSA 1QFHA 4F7TB 3BRGC 1MAMH 3MROA 4AEHL 5HYIA 4KTEL 4IMLA 4HPYL 3EOTH 3D2UA 1EEZA 4LSSH 1VACB 1XGUA 3NFSH 1PKQB 2MJWA 3IFOB 3VFRB 1JGDA 2P7TA 4JEGB 5IEHA 5ITFB 5DJ8B 2E7LC 1IC7L 4Y5YB 4NQSB 3ESVF 2DKUA 4Z76B 3LKPA 5T33L 4GKZB 2BNQD 1P6AB 3FHAA 3MFGB 4FP8L 5HDQH 1SY6H 4XGZA 2DQTL 2J88H 4B7LA 3GSOA 3TJEL 4ZUVA 2QBWA 5HYEA 1HKLH 1MFEL 2P8MA 4AK1A 2ESVE 4WHCA 1MCEA 2MQ0A 1IM3B 1U3ZA 2B5IB 1A4JA 1DL7H 3B3IB 4HUWB 1A3QA 5IHUL 1RD6A 5IMMA 3CX5J 4NN7B 1ZVSB 2AV1B 1QRNB 2J4WL 1L6ZA 2R23A 1B9ZA 1BM3L 1MUJA 2CO7B 2LAAA 5LGHL 5EORL 3CVIL 3MV9B 3MLZH 8FABA 3H7LA 1HHIB 3MFFA 4NQCA 5D2NC 1DDHA 1NUDA 5JDJA 4O9HH 2L4OA 4G6AD 1UADC 3VD4A 3SKJL 3R06A 1EUTA 4GBXA 1IEBB 4LHUB 3L5IA 2D7NA 4MS8C 1A2YB 4IRJB 1WICA 3NCYP 3TA3D 5J89A 2ZG2A 4PR5A 3NCCB 1C16A 3C6LC 1P7KA 3P77A 5HDBE 4ZUUA 3HPJB 5GRUH 3MMEB 5IR1A 2DQDL 5DDHB 4LDEB 4MAYD 4X5LA 1ZT4B 1EHLL 5J6GA 3WLBA 4K3DL 2KPNA 3U46B 3GMMB 2FB4H 3KG5A 5GS2D 1KB9J 3SE4C 5T1MA 2HN7A 2BJMH 2Y9RT 1Q9WA 3RHWK 1MHCA 5JA8B 4U1SA 1MRDL 4TRPH 2GSIA 1KCVH 2VL5A 3VFMA 1NCAH 1WCQA 2YRLA 4M6MH 1PSKH 3UTTB 1O5DT 1MCKA 4JKMA 3ZDYE 4CUCA 1T5WB 4N8VG 1DANT 3VXSA 3D48R 3GRWL 3P11H 1N8ZB 4Z7WF 1K2DB 4XC1H 2R8SL 4KQ4H 4NQXA 4HS6B 1JCKA 4H8WC 5JW4M 1FG9C 4MXVE 4DFIA 5H2BB 4BZ1L 3JBG7 4ZFOL 4NYLB 5JLZA 2HJKA 3QIUB 4PJIF 1NSNL 1E27B 3KPSE 5T3XL 4ELKB 4P46B 3RVTC 3SPVB 4PGCB 1ZVHA 3DX6A 3V6ZA 1ZLWK 1WC7A 2VLME 3QG6A 1K4DB 1UCBH 3QEQB 3QUXD 1NGYB 4IOSD 4Z77B 3GK8L 3U4BL 3WJJC 3D0VA 5B3JE 4V1DB 2JCCB 2NY5C 3IJYA 7FABH 3P0YL 2HT2D 3G6JF 3DV6A 4PP2A 1MCLA 2OK0H 3ARFD 4X9FA 2HKHL 4OZHB 4WO4A 2BVUA 5C1MB 2LV4A 3H7BA 1FGNH 3G5YB 5I18L 4XT1C 1HILA 2YD5A 2P5EA 1DQJB 2ADGA 1MPAH 4XPTH 5KSUA 3W11D 4N0UA 2PUQT 4TSAL 1P9MA 4U1MA 5EH1A 5JUEL 5C2BL 3AAZB 4U1GB 4ALAH 5HYSB 1XR8B 3MRQA 4ZODA 1GZQB 4WNQA 4C83A 5IM7B 1OSPH 2VZVA 3SN6N 4W70A 4F8QA 5DHYB 3VMNA 2UV3A 4WI3A 2VH5L 1AGCB 3QHZL 2GW5A 1U9KA 2D7TL 1EGJL 1J1OH 2D31B 4QOKD 2WV3A 4CDHA 3Q5YA 1F02I 1I9EA 2P8LB 4M02A 1RZ8A 3GEWB 4FQIL 5GGTH 5HI3C 1OB1A 4OSUL 3ZYOA 2NXZD 1RUQL 3GRWA 3QI9B 4JREC 1RUKL 3GSNH 3FT3B 1FSKB 2V5MA 3HB3C 4JZNB 3M17A 1C12B 2IANB 1UQSB 2EYTA 2WUCH 3NGBC 5EB9A 1X4XA 4KJWC 5D70H 4HWUA 5F6HI 3S5LG 3S4SB 1YEEL 2Z9TA 3TLRA 2Z92B 4U1KB 4QCIA 1JZ3A 5E8PB 4ZFOA 3BP5B 1FVEA 4DGYH 3RDTA 3HG1A 3RGVC 5HY9B 3DSFH 4LCIH 4LLQB 1OTUD 4HUUA 1J1XL 5I1HH 4ZUSB 3MGOB 4NN6C 2AI0H 1FLRL 1KJ2A 2BY0A 1BAFH 4EI5C 1UC6A 1VEMA 4I3SH 5IV2B 1XEDA 3FB5A 1CIDA 4OLXH 4ENEC 1CE6B 1FNGA 3HZYA 2IAMA 5IHBA 1BPVA 4NO3A 4LKCB 5C71A 4JDTL 1VPOL 5KVGH 2EDRA 5F1SA 4HUKB 3T2PA 4WEMB 5IJVB 5DJYA 1NLBH 2MKLC 1CLZL 2C4FT 5F3HB 4MXQC 4XPBL 1J0KA 3HMWL 2VXVH 2XQBL 5BRZD 1OWWA 1YEFH 3KS0J 5CP7A 4PJCB 3RL1B 4X98A 1HHGA 3DETD 1M7DA 3LRSA 2K3TA 1SJHB 4B0MM 5EZLA 2FLBT 3IF1A 5DJCB 3MRHA 5K9QG 1VEPA 1A0QL 1DR9A 1PD6A 1PW3A 3MV8A 4YHOH 1UGNA 1XCQA 4X6FA 5D7LD 1CN4A 3ILQD 2HG5B 3RUGE 1NBZA 4JFDA 4KV5F 1S7WA 3BN9C 4NQEE 4L3CB 3KS0H 3LS5L 1QYGH 3EYQC 2B39A 4F57L 3GSXA 3F7RA 2VABB 1J8KA 4X6BA 4OJFH 3P2TA 1FZMA 5SWSD 3TFKC 5JNYA 2IBZX 4YO0A 4GMSH 1AXSB 4U7KA 2PXYC 1E6JH 3DECA 3NIGE 3KPOA 1UM4L 1YYLH 4GRLB 2V2TA 4D9QE 1IL1B 1I1RA 2OP4H 3VFPB 2F54B 2BVOA 2ZCHL 3VWKB 1CL7H 3MLUL 1UZ6F 3I2CH 4K8RH 2Q7YA 4UV7L 4RMSA 3WO3B 4KC3B 4XAWL 3IDYB 1JVKA 4HC1L 1NMAL 2PYEA 4UOW0 3UYRL 4ODSH 5JW5B 3CVHA 4NWTH 5HHOD 2HT3C 5CBAA 1DLFH 2Z8SA 4HGMA 1RSFA 2APVA 4JPKL 1JFQH 3O4LB 1MCNA 4W4OA 2IMNA 4EVNB 1I75A 3VRLF 4I13B 2FJHA 1FAIL 1VSCA 1R24B 4KHXH 4U1NB 4B5EA 1MELA 4KXZI 2YRPA 4C56E 1YMME 4F7TA 4KDTA 3ROOB 3S36X 5H8DA 5I30L 4OZGF 1CE1L 3WL9B 3BGAA 1VACA 1PKQA 3S88H 2HFFB 3BESR 3IFOA 1YPZF 2BNRB 1I7RB 2D4DA 2E6PA 3UTSD 4PB0H 2O93L 5ITFA 5DJ8A 3NFNB 1KEGL 4Y5YA 4NQSA 5GZOC 4JFEB 3FQWB 4ESKA 4OCXL 1WISA 4Z76A 2WM0A 3KNBB 3SGDH 3BSZH 3GI9H 5LQBL 2HVJB 4GSDH 3U0PA 5TE7L 1TQCC 2CDFB 4JM2B 2H1PL 1IM3A 5LBSL 3EYVB 4WJ5B 3ZT7A 3B3IA 5C6TL 4HUWA 1OW0A 1EFXD 2CGRH 4NQTA 4NCDA 1ZVSA 2AV1A 1QRNA 3CMOL 1ES0B 2VXUH 3BI9X 4NZTH 3SE8H 1V3MA 4UAOB 3MLWL 2I26N 3MV9A 3DO3A 4PUBL 1MNUH 1HHIA 4JFQB 1DFBH 5I8EB 5HGBA 5D72L 4ZD3H 4KZEL 2IBZY 2BZDA 1J0JA 4NM4L 5C09B 5A16B 4LAQL 4OF7A 4Y4FA 3BDXA 4ZQKB 2Q86B 3DJ9A 1GIGL 3FN0L 1G6RH 1OF2B 3AB0B 4U1HB 2HYMA 3WKNA 1UH4A 4LHUA 2MKWA 2XOTA 3VU2A 4D0CB 2IF7A 4IRSD 1A2YA 2HH0L 3IU3B 1C7SA 3LKRB 3Q5TA 4XMPL 3O9WB 1T1ZB 1SVZA 4ZXBB 3Q3GB 4YXLL 1I4FB 4OCMC 3QXVA 2VOTA 4YHLL 3HPJA 3MMEA 5DDHA 4UT6L 2YD7A 3LHPH 4JRXD 1ZT4A 2GY7B 5IJKA 3U48A 5D6CB 3LPWA 4WGWB 2VZOA 3U46A 3GMMA 2XKUA 5MHSE 1GH7A 2QHRH 1IC5L 3E8UH 3LB6D 5I1KL 2HJLB 2XWBB 1FV1B 1C1EL 1M7IB 4UT7L 2GK0B 4QY8B 4XBEH 1UXSA 3W0WE 5JPMB 3UTTA 3HUJE 3S37H 2QQKH 2BVPB 5I1EH 1T5WA 3H9SE 2CMRH 3RTQA 3TCXA 1N8ZA 1K2DA 1J87A 3QRGH 1JYNA 1MFCH 4HS6A 2FECL 5ISZD 5C9KA 3BD3A 4FFVC 3ZDZF 4QOKE 5H2BA 3RFZC 1A1OB 3DVNB 4WEBL 4JB9L 2F19H 1K85A 3SDXB 1WITA 3QIUA 1JPTL 1E27A 1OARH 4MVBD 1HSBA 4ELKA 4P46A 1TJHL 4L3EB 3SPVA 2VDPH 1H3XA 4PGCA 1ZLVH 4RBPH 2DMKA 3BZDA 1X4YA 2M2DA 1K4DA 3QEQA 1NGYA 4Y5XC 3MA7A 5IESL 4LF3B 2OZ4L 5TF1L 2APXA 3V6OC 4JHWH 4OTXL 3EOBB 4V1DA 3BX7C 2JCCA 1OP5H 3RKPA 2BVYA 4DN4L 2NY0C 3I75A 5LXGH 4G6FD 4NC1E 1TZGH 1KT2B 1CGXA 4K55A 4XCCH 5E2UL 5MP6L 3MOAH 5MENB 3G5YA 3CDGB 1WF5A 1ZLUH 4G9FE 2AK4E 2A0LD 2EDLA 2VDML 2WBJB 4DQOH 3I85A 4QTIH 4DCQA 2UUDH 2V2WB 1WBZA 3IJHB 3AAZA 5HYSA 4ACPA 6CGTA 1XR8A 4ZFGL 1GZQA 5E00B 5IM7A 4ZOCA 4O58L 4IDJL 3WNMA 4XCNA 5DHYA 4H8WH 1AGCA 5BRZE 1NFDA 5H35B 5CLWA 4MQ7B 2JELL 2D31A 5TE4H 1U8KA 1PGRB 4TUOB 3PL6C 1GPOH 2P8LA 1S7VB 2AVGA 2NXYC 3RZCD 1WBYB 1SEBB 1N7MH 1YUHB 3QI9A 1E4WH 1PG7X 1R6VA 3FZUC 3FT3A 4JZNA 3ZDYF 1C12A 2IANA 3MRIB 1UQSA 1MWAB 3IXAB 2NY4B 5D7LE 3S4SA 3WEXB 3BQUC 5A2JH 5AUMB 2Z92A 3MBXL 4U1KA 2VQTA 1AE6L 5E8PA 3BP5A 3DUUB 5TPWH 1ADQL 5TJWK 4HHAB 3ZSSA 4MXVF 3NABL 4FZEL 5HY9A 1YNKH 2NY5H 4PRPE 4N90D 5JR1H 4KI1A 2YD4A 3ARBC 5KVEH 4OF0A 4Y16B 4ZUSA 3MGOA 1A6TB 3O6KH 5KZCD 4R0LB 5IV2A 2DI8A 3JV0A 4ODVH 4JRWA 5JO5B 1A7NH 3Q1SH 5C7XL 2F5AH 1CE6A 3MODH 5C08A 3OF6A 2EH7L 3T1FB 4LRIC 2VO5A 4DTGH 5E08L 2IG2H 1BX2B 3FRPG 5E9DB 5DD6B 2N7AA 2P5WE 5B3JF 3BKYH 1F97A 4LKCA 3HAEB 2CRMA 2ZZUT 3PWPE 5F97E 1YEKH 3IRZA 4JPWH 5IJVA 4XI5C 3A0OA 5F3HA 4IS6B 1CK0L 2HTLC 1QFPA 1XGRB 5HHNB 4G42B 4RA0C 2D0GA 5D5ME 1I3VA 2VLJD 4EUPB 1Q0XL 3H42L 2AGJL 4PJCA 5CSZB 2ITCB 1JWMB 3RL1A 4PJ9C 4P23D 2DICA 1SJHA 1SYSA 5DJCA 5F9WC 2FD6H 3QUML 1M05B 3CAFA 1ZKAA 4R2GB 4W4OC 1N26A 1QSEB 4KJQD 4LVHB 1TMCB 2OYPA 5ADPH 5L2KD 2HG5A 1EO7A 1J18A 3UTSE 1Y6MR 3ZSTA 4UNUA 4L3CA 5FF6A 3KR3H 2R1YB 2IADB 3QIBB 4RGNC 1OAYH 3TO4C 4PJGB 4LLWB 1Z0MA 2V5SA 2VL4A 5F3BB 2JJUA 3C87A 3QFJD 1A6ZB 3QUZC 4XXDB 1I3RB 4I0KA 2R4RL 4GRLA 2KUTA 3V4VH 2GCYB 5E7BA 1IL1A 2A83B 2MFNA 3VFPA 2F54A 1BJ8A 4XWOD 1CD1B 2IBGA 3OJVC 4ELMF 4CMMB 4UI2A 3ECBB 4FXGB 3L1OH 2QKIB 3L6FB 4PLJC 1QFWI 2FECI 2YA0A 1PY9A 4PRHD 3VXRB 5JW5A 1U2HA 2J1KA 3NCEB 4IIQB 4JO4L 4QXGH 4HAGA 5I1LB 5D7IE 2CIIB 2HTKD 3DHJA 3O4LA 1FO0L 4FN0A 4JO1L 4EVNA 4ZOEA 3WO4B 4NN7C 5ESAB 2JIXB 1R24A 4U1NA 3QXWA 4HUXB 5GGVL 4YXHH 3DX7B 4WCYH 4Q9RH 4P3DB 4FQJL 1U92B 5HXMA 5KW9H 3ROOA 4APQB 3LIZL 5FYLL 1P4IL 2NPLX 5EN2B 4CU8A 3WL9A 4OB5L 4FTVB 1G6VK 4G3YH 3LEXB 4JJHA 4LIQH 4K7PX 4DWHA 2HFFA 2JLLA 3HR5B 4ZTPH 1INQB 5EU3B 2BNRA 1I7RA 1F45A 1A7RL 2NY7H 3NFNA 4IRJC 4ZMAT 4JFEA 3FQWA 2OXHA 3KNBA 4KK6C 3SO5A 5JHLL 3KLDA 4LCYB 2E7BA 4YJZL 1F4YL 4NJAL 1EHNA 5F8RC 5HYJB 4U2YA 2HVJA 3FAXA 2I07B 5IROC 1EZVX 4PJXA 2CDFA 3OSKA 1E0OB 4JM2A 4M7LL 3WNKA 4P2RD 5J8OA 4DW2H 5C0AD 3EYVA 4MNQB 4WJ5A 3ARDB 4N1CA 3MRBB 3BAEL 1FH5H 3TT1H 2PCPA 1D5BB 1ZANL 1GAFL 5L88H 1ES0A 1QBAA 1R5VB 2AW2A 1RIUH 1HNGA 4N8VB 4JFQA 1F42A 5ISZE 5C09A 1B3JA 1ZA3B 4ZQKA 2Q86A 4RRPG 1OF2A 4U1HA 4OCYH 5EUKB 1SM3H 2FEEI 3VFGH 1RJZB 1QNZH 3O2VH 1UWGH 3BUYB 4D0CA 5CKGA 3IU3A 1NL0L 4LASL 1U3HB 4K94L 3O9WA 1T1ZA 4JG1H 3MLSL 4ZXBA 3Q3GA 4MD5B 1I4FA 2E27L 3OAZK 3QCVL 4NGHL 4H25B 5KOMC 1UENA 1UJTA 5JXED 3QIUC 1XR9B 2KKQA 3ILPB 2B2XH 3ZTJG 1NAML 4GRWB 4P46C 3VMPA 3L3JB 4J6RL 1MFBL 5D6CA 1NEZG 2YN5A 3VXSE 2WLZA 3OJMB 2ICCA 3G6DH 1V7NH 3DLQR 2I27N 4GW4B 1VERA 4QRTB 2R15A 4AEHH 2DMBA 3C8HA 3BXNB 4KTEH 4HPYH 5DEFB 2HJLA 5DUBB 2XWBA 2YD2A 1FV1A 4K7PY 2HMIC 3ESUF 5E2WL 2GK0A 4QY8A 4FQXC 3KJ6L 2Q20A 1CFVH 5JPMA 1F13A 2BVPA 3QCUL 5EOQL 5INCB 1CICB 1IC7H 5D2LA 3D0LB 1F6LL 3F5WB 1JK8B 1T20B 4X7CC 2VLKD 1IRAY 4FP8H 1GOGA 4QRQB 2GYSA 2DQTH 3T0BA 1A1OA 1IQDB 2P4AB 3TJEH 3DVNA 5AD0B 2NY1C 4U1GC 4S0SD 1MFEH 3SDXA 2VQ1B 2CKBA 3THML 1LO5A 3K46A 3GSQB 1CDYA 1JYVA 5IHUH 4L3EA 5JORB 1KTLB 4JM4L 4TVPL 3DYMA 1T04B 3RU8L 2J4WH 3EDKA 2YS4A 2EDNA 3U4EA 2XQYG 5LGHH 5EORH 2CXKA 3CVIH 4LF3A 4PB9L 4OZIE 4LNVA 2DDQL 3V9FA 5K59F 3EOBA 2AEQL 5GIRB 5EBLA 1G7HB 4YLQT 4RSVA 5F89B 1G7MB 2JK5B 1JPST 1KT2A 1RV6X 2PO6C 3OGCB 3SKJH 3VFOB 2FEDD 4NT6B 1HIML 3CFEB 5I9QB 3M8OL 3K80A 2EDDA 2EKJA 3BHBB 5MENA 1XZ0B 3CDGA 3B8SA 4B41A 4PD4J 3WBDA 1BREA 5ERWB 2WBJA 2X05A 2LFGA 4YBLB 2V2WA 3IJHA 3DMMB 5D1XC 3VFUA 4TSBL 4M9OA 2DQDH 4PPTA 5E00A 1EHLH 4Y2OA 4KK8C 3GI8L 4N5ED 4MDIB 3DBXB 1Z3GL 4G7YL 1IAIM 4NFDA 1PQZB 3R8BB 43C9B 2VDKL 3GNML 3HG1E 4PTTB 2NY6D 1N64L 4MQ7A 1KTKE 1MAKA 1WUNT 4TUOA 3B9AA 1N6QL 1UWXK 2VAJA 4LGSB 1S7VA 2FHCA 1JYXA 3TN0C 1MRDH 1WBYA 3CUPA 1JHKL 1SEBA 3LD8B 1YUHA 2D7OA 1RJCA 3HUJF 1AXTL 5FUZL 3STZB 3FT4A 1F4AA 2F8OA 1RUML 3MRIA 1MWAA 3IXAA 5EU4B 4KTYA 3VDBA 5JIIA 3WEXA 4MA1B 5AUMA 1OAQL 4N8CL 1W2KT 4YHML 1BQSA 2NW2B 3DUUA 3GRWH 4KKCC 4XPFL 2R8SH 3QDJD 3FCTB 1IT9L 4DUVA 4N1HB 3OJ2C 1NH6A 1EHAA 3SDCB 4BZ1H 5IG7B 5DEZA 1GYAA 2VXTH 2H45A 4HLZG 1YC7A 3D18B 1AR1C 1FQ9C 2OTPA 1NSNH 4R0LA 5JO5A 4PLOB 3QEHB 5HGDB 4QEGA 4F9PA 4UOJA 3T1FA 1BX2A 3B2UD 5E9DA 5DD6A 1I3GL 5B8CB 2HWZL 5I74C 3GK8H 3HAEA 3U4BH 3ZZ1A 5D96C 3MV8E 3T0WA 1IKFL 4GRLC 1IVLA 3H9HB 4JQVA 1QHPA 4P2QD 4PJDA 3P0YH 4OAWB 3VWKC 4G42A 5IB3A 2X4NB 4MB3A 3IDYC 2HKHH 2QQNL 4EUPA 2NY3B 5CSZA 1JWMA 5DQDL 5I18H 3GUTB 4KKAC 1ZHBB 2AJXL 1C5BL 1M05A 3MR9A 2ZP0T 1TJIL 4TSAH 5JUEH 5C07D 5C2BH 1QSEA 1X3DA 3O41B 4PJFB 5C0JB 2GJ6B 1I8MB 2ZCLL 2IEPA 3SGEI 2IH3B 3HLAB 5ETUB 3LN5A 2VH5H 3CXDL 2PYEE 3QHZH 2D7TH 1EGJH 2ICEB 2IADA 1QPXA 3QIBA 3U30B 3FN9A 4PJGA 2B1HL 3DVFA 4K8RD 4LLWA 5F3BA 2QEJA 5IBLC 2O26U 1A6ZA 4FQIH 3WHXB 4XXDA 4OSUH 3GBLA 1I3RA 1RUQH 4U7SA 1KJVB 3N50A 1IGML 1RUKH 1N2RB 2GCYA 2E8YA 2A83A 4MGXA 4JHAL 4POZC 4LQ1A 1YEEH 3ECBA 5GSRB 2QKIA 2XTJE 3L6FA 3K81A 3MJ9L 2ED7A 5DA4A 4FXKB 3VXRA 1ETZB 4IIQA 4LU5L 2FL5B 1J1XH 4OIAA 3WS3B 1U8PB 3KLSA 1FLRH 1IGIL 5I1LA 2WIIB 2CIIA 3N9GL 1AI1L 5ELIA 3K7UA 5EUOF 1B0GB 2I9LB 4G9DA 3PXJA 3L3KB 5ESAA 2JIXA 3CX2A 4WUUB 4HUXA 4D8PB 1AGBB 3UEZA 3DX7A 2R0ZL 4S1QL 4P3DA 1QEWB 2X42A 4NHCL 5FUOL 5HJ3B 5C0EB 5D1QB 5C0CE 4APQA 1PZUB 2ZOLB 3P3YA 4JDTH 2WMPA 5EN2A 1VPOH 4KJPD 3UTPE 3AB0C 3LEXA 1I1FB 5D93C 4GW1A 5L6YL 1INQA 5EU3A 1CLZH 5DC4B 1G0DA 4XPBH 4UBDC 3HMWH 2XQBH 4EOWL 3O2WL 2EIBA 4Z7OE 5KS9B 3PV6B 4JFZL 5ID1B 4QTHB 4LCYA 2HT4D 5HYJA 2PNDA 3BEVB 2I07A 1HINH 2GTZB 1AGEB 1SMAA 5DJZB 5HPOA 1CQYA 3WS6A 1A0QH 3QDHA 1I1CA 2W07A 3DSNA 2FDBP 4MNQA 3MRBA 2A6JA 5K9KB 3MRKA 2DF3A 2XN9B 3K4DA 3OAYK 1R5VA 3JUZA 3LS5H 4ZTOL 1A7OL 3Q5OA 3VXMA 4F57H 2OMBA 5I75B 4N8VA 2X4RB 3TBWB 3BD4A 2BC4B 1ZA3A 3GM8A 3K8MA 3MJ9A 1Y6NR 2EDKA 3EDDA 1OGAD 1UM4H 2FX9L 2ATPB 5EUKA 1GGYA 2Z31C 1UEYA 1RJZA 3F7YB 1JJUA 2DS4A 1JNJA 2ZCHH 2ZOKB 3BUYA 3MLUH 3CIQA 1XT5A 3TVMA 4XAWH 2IQ9L 4Z0XB 1U3HA 1RHHB 2YWZA 1NMAH 4HC1H 4M7KL 5FHAL 4QWWC 4N1EA 2D0HA 5D7IF 1A1MA 3UYRH 1NCUA 4H25A 5IWLC 4UUJA 3SKUD 4NN5B 5E7FA 1XR9A 2AEWA 4JPKH 4WU5A 4YDJB 1JIBA 4ZYKB 3L3JA 1R3LB 3LQZB 1CFQB 1EEYB 5I8CA 1FAIH 4J3OC 4A2MA 3VFVA 4GW4A 3L5HA 4QRTA 4HPOL 1KYOJ 1T2XA 3BXNA 3VXOB 5EU7C 2OR9L 3WFZA 5I30H 5B4MD 3MXWH 1CE1H 3O3UN 2W60B 2E9BA 4HCRL 4KUZL 4K94C 3Q6GL 4H26A 4BSJA 4I48B 4ZSOE 2DKSA 3H8NA 1X7QB 1ZSDB 5INCA 3ZKXC 1CICA 1JNHB 25C8L 5C70A 1KEGH 4MS8D 4GQPH 2MPAL 3QEQE 3D0LA 3TBTB 3IFPB 4OCXH 4P9ML 2E9WA 4K23L 3PWNB 3WN5B 1JK8A 1KIQA 1RZ7L 5SWZB 1T20A 3KPRD 2YA1A 3C6LD 5CSGA 1U8NA 2BHZA 5I0DA 5LQBH 1L6XA 3AY4C 5TE7H 1IQDA 4TTGA 3X3GL 5AD0A 3AXLB 1NBVL 1AGFB 2VQ1A 4HUVB 2H1PH 4G6JH 5LBSH 3GSQA 5F1NB 4PJ5B 5C6TH 1QVOB 2JB5H 3REWB 5JORA 2GITB 3O81A 1KTLA 2AEPL 3BZ4B 3I3BA 1RY7B 1T04A 3CMOH 3QUYA 2VWEE 2ATKB 5DS8B 3TBVB 4YAQB 4PRIB 1H8OA 2F53B 1UKSA 4PUBH 3GM0A 4Z7WB 3QDJE 5D72H 4EIZC 4LGRB 4N0YL 4NM4H 5GIRA 4LAQH 5CJXA 1G7HA 1GIGH 5F89A 2JK5A 5BV7L 3OGCA 3VFOA 3CFEA 4GUPB 4EN3D 3GSRB 4Y2DC 1NFDE 1QR1B 1OPGL 3BHBA 2HH0H 1XZ0A 4XMPH 4YDVB 5JHDE 4Y16C 5ERWA 4YXLH 5IFHL 4UQ3B 5ENWB 1CZ8L 3B9KB 4PJBF 1VCAA 4Z7UE 3DMMA 4YHLH 1BIHA 3MRPB 4R0LC 1NMBL 5HHPA 3OQ3B 4UT6H 4XNQB 2BVQB 4HBCL 1J0IA 4P2QE 3RVTD 1A6WL 1NUFA 2QADC 4D9RD 3BGFB 3JV6B 4MDIA 3DBXA 3ARTA 1F3JA 2ADIB 5CINL 2YD6A 3G6JB 3V6FB 1ROWA 1URLA 1PQZA 1P2CB 4HD9A 43C9A 3G5XB 4PTTA 2DN7A 3O2DA 1IC5H 3QDAA 4U49A 3P4OB 4P57B 3R4DA 5HHXL 1C1EH 4JQVC 4LOUC 2J2ZA 4UT7H 5BW7C 4Z95L 3STZA 1O0VA 3ARRA 5AZ2L 1OLZA 5EU4A 4KRPB 1KTRL 5C08E 4H0IA 5GQBA 1RJYB 4H20L 2NW2A 3MV7D 4XWGL 3W82A 4I77L 2CDEB 3FCTA 1CLOL 2VR5A 3IFNL 3FO0L 4CJ0A 2XZZA 4GLRI 4JRYD 3SDCA 2H2PC 3ZKQD 5IG7A 4WEBH 2JKXA 4JB9H 2O5YL 4IRZL 1X9QA 3H0TB 3SY0B 3RKDC 5HPMB 4I0PC 3D18A 3VDCA 3QRFM 1JPTH 3I50L 3PXHA 2ICWB 1TJHH 3NIFE 3QEHA 4QRPA 5HGDA 4DN3L 1CVSC 5B8CA 1WIUA 4F58L 5IESH 5TF1H 2OZ4H 3O0RL 5HI3D 4TSCL 4OTXH 3H9HA 3FL7A 3HB3D 2CRIA 4DN4H 4JPIB 5HHMB 4OAWA 4KJWD 3ULUE 3ZKSD 4N68A 4H1LH 3O6FD 5IKCB 5E2UH 5MP6H 2X4NA 1MI5B 3MCKB 1CG9B 2NX5D 1XIWC 4O2FB 3RGVD 4MMXC 1VDGA 4IIQC 4PJ7E 3GUTA 3H3KA 2WSKA 1ZHBA 2VDMH 1WWWX 3UPCA 2R2CA 1PKOA 4P0DA 5IOPB 3O41A 4PJFA 5C0JA 2GJ6A 1T6VN 1I8MA 4ZFGH 1CD8A 4F7EB 2IH3A 4O58H 4IDJH 4ENED 3T3MF 5ETUA 4P5MB 4HKZB 2CUIA 4W6XB 2YD1A 2ICEA 5DMIL 2KH2B 5T3ZL 5FOBB 2CK2A 4PRBB 4QO1A 1CGYA 4OFVA 3WHXA 1KJVA 1N2RA 2VNCA 3BKJL 3NA9L 4UTBL 5E0QA 4MXQD 1DTUA 2K1MA 3MBXH 5GSRA 4PJ8C 1AE6H 2CJUL 4HIXL 1ADQH 2EIDA 1YY9C 1OTTC 3NABH 4FXKA 4MD4B 4FZEH 2A73A 1ETZA 1JRHI 2EC9T 2OMNA 2FL5A 3WS3A 4D0BB 5A3IC 2WIIA 3EOAB 3O11B 3ARDC 1X4ZA 5TGBB 3TEUA 4YBQC 3D87B 5IVXF 1B0GA 4CN4A 2I9LA 3VXUE 5EZJA 3BN9D 4WUUA 4D8PA 1AGBA 4PJHF 3EYQD 3EZJB 4KKLC 2EH7H 4ZNEA 5E08H 5HJ3A 5C0EA 3U4AA 3D2UD 5E5UB 4UT9L 3M07A 2ZOLA 2HLFD 4PJXE 3TFKD 1I7TB 3ARYA 4J3UA 2PXYD 1I1FA 1RUPL 1YMHB 4J4PA 4M3JA 1CK0H 4WHYG 2PKDA 4OCWL 4XP5L 5KS9A 3PGFL 3PV6A 3H42H 5I8KL 1S78C 2AGJH 4S1RL 1NEZB 4QTHA 5ID1A 1N5AB 4RQQB 1E28A 3MLTB 3ALWA 3BEVA 2HT3D 4HIJB 4KK5C 1IAMA 2GTZA 1AGEA 5DJZA 4OZGB 1U95A 3QUMH 5FIEA 2NQCA 1RIHL 1EVUA 2VRAA 3NZHL 2HKFL 4XVTL 3BPLB 2HFEB 5K9KA 3OKNB 1G7IB 5DURD 5ANME 1YPZB 2XN9A 2E7CA 4P4KB 5KVMC 3I6LD 3UJIL 2V2XA 3AREB 2MQCA 4NQCD 1XMWA 3QO0A 4P3CL 4Y4KC 3FFCE 3RWIB 4N9GB 2X4RA 2V17L 3TBWA 1BF2A 5FA3A 2BC4A 3KPRE 3C60C 5KSBE 1TETL 1MJ7L 2R4RH 4GBXD 4F7PB 2ATPA 3F7YA 2CO6B 2HLAB 5HI4C 5T1LB 5GZOD 2ZOKA 4XMKL 2C3VB 5DD3L 5T1KB 5CWSB 4Z0XA 1RHHA 5C9JB 1BD2A 2GUOB 2DLFL 3BIBX 5HVFB 4ERSL 2W59A 4JO4H 2UVEA 4YDJA 1FO0H 2VN7A 4ZYKA 4JO1H 3IS1X 3LQZA 1CFQA 1EEYA 4BK4A 3WIIL 5D2LE 5IT2L 5GGVH 2DAVA 4FQJH 5DD5L 4Z8FL 3VXOA 3G5ZB 3LIZH 5FYLH 3IDJB 4Y8AA 2W60A 5H37H 4OB5H 5CGYC 3KAAA 5CJXC 2WINB 4YXKL 2H3NA 4BKLA 3GBML 1FPTL 4I48A 4HGKC 3E3QC 3DRQB 1D6VL 4L3EE 2VN4A 1X7QA 2QSVA 4GKSB 1A7RH 1JNHA 2NTFB 1JTTA 1UM5L 4WHDA 4C4KO 3PWNA 3WN5A 5SWZA 4HIHB 1KNOB 3HC4H 5JHLH 3LPFA 2OSLB 3NCBB 1F4YH 4HUMB 4OLYL 4YBLC 1MCOL 4QHKJ 3DMMC 1VB9A 3EO0A 2P42B 4WI4A 1OOAA 3AXLA 3PP3K 4M7LH 1AGFA 3MV11 4HUVA 4QHNB 3CFBB 5F1NA 5CEZE 4GFTB 4PJ5A 1ODAA 1QVOA 3BAEH 3REWA 2GITA 4C54A 4HWEH 3BZ4A 1ZANH 1GAFH 1H3PL 4WV1A 2ATKA 5DS8A 3TBVA 3VD3A 4YAQA 3MV7E 4PRIA 2EYSB 2F53A 1DBML 4RMRA 4Z7WA 3LD8C 3P30L 2SEBB 3OG6B 2ESVB 3A6CL 3T0EB 2I9TB 3X12B 2DL9A 4FG6C 2X09A 4MA1C 4JJ5B 3E6HB 4ZAKB 3BH8B 4HKJB 4GUPA 3GSRA 5DZOA 1QR1A 1UKTA 4CVWA 2Z4QA 2C1OB 4JVWA 1NL0H 4LASH 4K94H 4FFVD 3MLSH 3HZKA 4UQ3A 2E27H 5ENWA 1WCBB 3QCVH 4NGHH 3B9KA 1KCUL 4JLRB 3MRPA 3T04D 4XNQA 4FQCL 2BVQA 1NAMH 1YQVL 5D1ZC 4J6RH 1MFBH 3JV6A 1NGXB 5I1JL 2ADIA 1NC2B 3G6JA 3V6FA 3MGTB 3QJHB 3SGEH 2BOBB 1WWCA 1P2CA 2CRYA 2JJSC 5B8CC 3G5XA 5BV7C 3QWQB 1RZIB 4JFFB 2YPLE 4AQ1B 2I5YL 4LMQI 3P4OA 4P57A 5E1AB 4KMTH 1UVQB 1IKNC 5E2WH 2NY0D 2YUVA 5MEPB 3KJ6H 4L4TE 4WRLA 5EOQH 3QCUH 3ME0A 2NY3C 2B0SL 3RDTD 3AUVA 2OL3B 1J0HA 3GO1L 2Z8VC 3NFPB 2CDEA 1X44A 4PS4L 4XP9L 4EEEA 1KB5B 2VXQL 4Z9KB 2P47B 4PJDE 4MA3B 3UZEA 3SY0A 3H0TA 2Y36L 5HPMA 3THMH 4XPAH 3AMKA 4MJIE 4BA8A 3QNZA 2X4QB 4TVPH 1X5IA 1DQDL 3KJ4B 3RU8H 2DKMA 4CMHC 3OKOB 4OZFB 1L0QA 2XQYK 3P9MB 2XXCB 3PL6D 3S7GA 4PB9H 3DRTB 4TTDD 2DDQH 1IBGL 2NXYD 3O3AB 2EEAA 1OAKL 2A9NL 1FNFA 3FZUD 4HWBL 2FX7L 1U8MA 2AEQH 2AQ1A 4EIGB 4JPIA 1FZOB 3RJQB 3KPSB 3GKZA 5HVGB 3BQUD 2BRQA 2J8HA 3GB7B 5IKCA 1HIMH 3WDHA 3MCKA 3M8OH 1CG9A 4U1IB 3PGCB 3VGBA 4O2FA 4FABL 3VRJB 3ARBD 4LPUA 4Z7UF 4DJMA 1CLCA 4TQEL 2YSSB 3QHFL 4NQDD 3S97C 3UTQA 3VWJB 5CEXB 2MHAB 1C5DB 4L1DA 1LEKB 1MSPA 3BN3B 4JFDD 2P1YA 4OUUB 1NCWL 3QAZB 4TSBH 4F7EA 2A77L 4JN1L 1DLHA 2GHWB 3GI8H 2XY2A 4P5MA 1Z3GH 4HKZA 4G7YH 5D1QC 2MCG1 3VXRE 2AAVA 2VDKH 3GNMH 2DQEL 1A14L 4X7EC 1BFTA 1N64H 5FOBA 3DIFB 3N06B 1AD9B 2EDQA 3TT3L 5F9JB 1MQKL 1N6QH 1MFNA 3JV5A 3D39B 1JHKH 4OBSA 2BDNL 4XI5D 1DQML 3CXHJ 4OD3L 4BJLA 2OI9B 1AXTH 1VHPA 4FFYL 3TBYB 3V8OA 5FUZH 3NH7L 2HTLD 5ACZB 1RUMH 1EA9C 1OAQH 3QDGD 4N8CH 3T4YB 3S98A 4OLUL 4YHMH 4PJ9D 1QQDB 4XPFH 3VGDA 5C0BB 3R0NA 4MD4A 1IT9H 4LAJH 2EYRB 2DQFB 4XAKD 4D0BA 1PVHA 4JKPL 1VESA 3O11A 5TGBA 2FIRT 4RFOL 4Y88A 3T3PE 1G0YR 2C3GA 2L0DA 4DK3A 1I85A 4QNPE 4KI5C 1HZHL 4RRPA 1HCVA 2ZUUA 2QQQA 3D69B 5I75C 4ELMB 5D6DA 2ICWI 4QRRB 3TO4D 5HYJE 1I3GH 2HWZH 1MJ8L 4GG6E 1I7TA 5I1AB 1FC1A 2ID5A 3S3JA 1IKFH 1YMHA 2WAHA 1EXUB 3V0VB 1MCWM 1T83A 3HR6A 3VXME 5IQ7L 3AVEA 4EDWL 2QQNH 3OKKB 4PJ7F 3S35X 2UZXB 1NEZA 1N5AA 4GRMB 4RQQA 2XV6B 5DQDH 3CGTA 4HIJA 4OZGA 4NN5C 2AJXH 1C5BH 1TJIH 4F33B 2V9TA 1QRND 5HHQB 2ZCLH 2HFEA 4P2OA 1EV2E 1H3WM 3OKNA 1G7IA 4V2BA 1YPZA 3P9LB 2GTWB 4P4KA 3MV9D 3CXDH 3GZKA 3AREA 4TOYL 4TYUA 3U2SB 2YUZA 3RWIA 4D94A 3RX5A 4N9GA 3V5DB 2B1HH 4JG0L 3F7VA 1IAIL 3FO2B 1IGMH 4F7PA 3BD5A 2XKSA 3KPTA 1F58L 5HGHB 1T7ZA 2W0KA 4JHAH 4WI6A 4IRJD 5T1LA 1E6OL 3WN5C 5FFLA 3QBTB 3FQNB 3ULVL 4KK6D 1EMTL 2C3VA 3MJ9H 5CWSA 3DARA 2BNQB 4I3GA 3GMLB 3SJVD 5C9JA 2GUOA 4AEFA 4X6EB 1F4XL 5F7NC 4UNVA 4Q2ZB 5GJSL 4LU5H 1HHKB 2G75B 4WW1B 1IGIH 1ITBB 3N9GH 1AI1H 1T89A 5IP4A 4F9LA 5GGSY 2R0ZH 3K2MC 4S1QH 1JE6A 1CF8L 5FUOH 5A2KH 3U7YL 3ZO0A 4L9LB 5E99L 4HT1L 2DI7A 2ZUQC 1TXKA 3MRMB 2X89A 3IDJA 4OFKA 2D4FA 2CDGB 2WINA 5L6YH 3DRQA 1VENA 1KEML 4GKSA 1P7QD 2NTFA 4EOWH 3O2WH 4C56B 2MTPA 1RUAH 4UDTB 3TA3B 1VFOA 4HIHA 4JFZH 5DI8B 4L8DB 2OSLA 5GGRY 1LE9B 1KFAL 1UJ3C 2FZ3A 2AXFB 4ZOBA 2XI9A 3C5ZB 2EH8H 4HS8L 3QIUD 3SKMB 2OL3L 3V6OE 5CP3H 2LU3A 1OWRM 2VZSA 1OY3B 3PWVB 4QHNA 3CFBA 4P46D 1XF1A 4GLRH 2B4CL 4BELD 4MAYB 3D3VE 4JPVL 3J8F7 3TZVB 2LU7A 1C5CL 1WZMA 1CI5A 4YEFA 5DA0B 1WFUA 4ZTOH 1A7OH 4M7LT 5T3XE 5KSBF 4OI8A 4V1DD 3ETBF 2SEBA 3WKML 1G7PB 2XG4A 2HMID 2ESVA 1DZBA 3T0EA 5H94B 4E41E 3BZFA 3HNTL 2I9TA 4FQXD 4LDOB 2FX9H 1T66C 3E6HA 1JZ5A 4ZAKA 3BH8A 1UB5B 3MRCB 4OLZL 3QUKB 1VADB 1UH3A 1PYWB 2C1OA 2IQ9H 5FHAH 5K93A 3FO1B 2GAZB 1IEHA 2A74A 1OVZA 4RAHA 2BSSB 2NY1D 1WCBA 2XPGB 4OFYD 1KN2L 2YZ1A 4XNUL 4L4VE 3TC9A 1I7ZB 4L1HA 3E6FB 1J1OL 2AEIT 4U6VH 1NC2A 3MGTA 3QJHA 3RRQA 2BOBA 1U91B 2NLJB 4I3RL 5F7KC 4PJEE 1RZIA 4JFFA 5JQHC 4HPOH 3QUXB 4PY7B 4JFOB 2OR9H 2FBJL 3QI9D 1BVKB 5E1AA 5BQ7B 1DE4B 1UVQA 1L7TL 1ZHKB 2IAND 5IBUB 4HCRH 4KUZH 5BO1L 4G8GA 3Q6GH 35C8L 4XBGB 3UROR 4EXPX 2PO6D 4QRPE 1AKJD 3FQTB 4CU6A 25C8H 4I0CC 4M5ZL 4CN1A 2MPAH 3TM6A 2OL3A 3NFPA 4P9MH 2E6QA 5CD5C 4K23H 1RZ7H 3VW3L 3QXAB 3OG4B 4PRDB 2AI0L 1L0XA 3RVWC 2EXWD 5TH2B 1GCFA 1KB5A 1JV5B 3CD4A 4RISL 1JN6B 3UDWA 1FFNB 3F58L 3X3GH 5D1XD 4UOW1 1NBVH 3FB7B 4MA3A 1UH2A 3HUJB 2J5LB 3R1GL 4HLJA 5F6IB 4KK8D 3OF6D 3H9SB 4OFDA 2HFTA 1JGVL 4NOBA 2X4QA 1J11A 1PFCA 3TIEB 2AEPH 5KSAC 1VKXB 1N59B 2I25N 3QDGE 5FM4A 3T0AA 3OKOA 3P9MA 1K5NB 4LP5A 4QOKB 4KRNA 3RIAF 4NBZB 3DRTA 1IAII 1N0LA 3TN0D 3T1WA 1CBVL 2DQIL 3ZE0F 5ICZA 2Y06L 4LSQL 4N0YH 4XAKE 2NXZB 2PF6A 5FGSA 2VXVL 1FNEB 1FZOA 4QHUB 3KPSA 2D03L 3ISWA 2HFGL 4JFHE 5BV7H 2FNBA 3EBAA 2GQHA 4AT6B 4Y5VB 4KKCD 4U1IA 1OPGH 3PGCA 3VE0B 4IMKC 3V4PL 4V2CB 3VRJA 2ZPKL 1LO4L 2Y72A 4RGNE 2YSSA 3EDEA 3VWJA 5IFHH 5CEXA 1CZ8H 5FCSH 4F7CB 1C5DA 1I85C 1NMBH 4OUUA 1AR1D 1DP0A 4BH8A 3PHOB 1QYGL 4HBCH 1F4HA 1A6WH 3KXFE 4S1DC 3N85L 3LPGA 5CINH 5D6DC 3SDYL 5JXAH 3S3SA 4QGTA 5LCVL 2J6EL 1NC4D 1T1XB 4M1GL 2AK4B 3B9VA 3DIFA 5F9JA 1AD9A 4JHBA 5D7KE 3KYKL 1P84J 3D39A 4GRLD 5HHXH 1LE5B 1B4JL 4YIQB 1IQWL 3TBYA 1BGXL 2BXZA 1T22B 4Z95H 5IFJB 3VWKD 5ACZA 2NR6C 5AZ2H 3V7AG 3QQ9C 4WUUE 3BISA 4GG8B 3W5NA 3T4YA 5SV4A 3RBSA 5EO9B 5BRZB 4H20H 4XWGH 1BEYL 1N0XL 3I84A 2G60L 1Q94B 1QQDA 4I77H 2ENSA 5C0BA 2J8UE 5GJTL 1CLOH 2ZWLT 4KKAD 2EYRA 2DQFA 1KLUB 3IFNH 1Z5LB 3FO0H 1T0NB 4C57C 5KBNC 3FQUB 3RY6C 5BOPA 5CJOH 4Q9CA 4W6YB 3IB4A 4RGMB 2O5YH 4IRZH 1OHQA 5D7LB 2P24B 2FBOJ 1GRWA 32C2B 3I50H 4P4KC 2YPKB 5I6XC 2AABL 3GJFH 3D69A 4DN3H 4ELMA 3RGHA 1KPVB 3HN3A 4QRRA 4PRPB 1QBLL 4LPXA 4LNRA 3MBEB 4RAVB 5DXWA 5GS3A 5GRXG 4F58H 4Y4HB 5IBLD 5SWSB 3O0RH 5I1AA 1EEUA 1WLHA 2R29L 1QFWM 4TSCH 2BNRD 2VJXA 3L7FB 3EIFA 1EXUA 4HW6A 4POZD 4JFED 4HX1B 3V0VA 4S11A 5EUOB 5J3HC 3BSZL 2OXGA 3LN9A 2QTEA 5GRVL 4KQ3L 4XXCC 1G1YA 4GRMA 2P5WB 3FN3A 2OR8A 3PWPB 2HTKC 5HHOB 4XP4H 3ZT5A 1BQUA 4XP6L 3V5HB 1A6VL 1RULL 4OQTA 5HHQA 4PFEA 5D5MB 1FYTD 1G0XA 2W0LA 5EG6C 3P9LA 2GTWA 1X5KA 4NNPL 1EHXA 1BD2E 3L3OB 5DMIH 5T3ZH 5C09D 3V5DA 3MNZA 4NNXA 4R6UA 4KRLB 3UZVB 5JQ6L 5CUSL 5EIIB 1I9RL 1W8OA 3B5HA 5EO0B 3FO2A 3MLXL 3BKJH 3NA9H 4UTBH 4AM0B 4UBDD 5A40E 5HGHA 1C8PA 4Y0GA 3UTSB 1FFOB 2AXGA 3EJZC 3LEYL 1G9ML 3FQNA 4MJ4A 1HXYB 2CJUH 1LGVA 1NAKL 2BNQA 3GMLA 1NBYB 4D9LL 4O02L 4CDGC 4X6EA 2X9XA 3T3PF 3LS4L 2V5YA 3WIHL 4WI9A 3S34L 1HHKA 1INDH 2G75A 4WW1A 4QNPF 5C0IB 1GJIA 3VGAB 5FYLD 1LP9E 2H8PB 4OF8A 1UB6B 5FXCH 3WNPA 5E56A 3T08A 3O45B 3BE1L 3P4LA 3FFDB 4PRNB 4GG6F 4OGXL 3MNWB 4AYFA 4L9LA 4UT9H 4RWYL 5EZIL 3MRMA 3ULVC 2FATL 1FCGA 5D7IB 4IJ3B 3STBA 2CDGA 4OIBA 4PJ5E 1RUPH 1T4KB 3C6SB 3WDIA 1ZAGA 3SDAC 3HCVB 4OCWH 4XP5H 4C56A 3ZE2F 3PGFH 4W68A 1ZS8B 2F53E 4H5SB 3DVIA 5I8KH 4UDTA 3JWDL 2X41A 4S1RH 3TA3A 5DI8A 4L8DA 3WDJA 3GSOB 4QWWD 5C86A 5GGUB 1KACB 3B43A 1LE9A 1EUUA 2AXFA 1KGCE 3EHBD 5TDOB 2BP3A 3SKMA 5J13C 1RIHH 3PWVA 3WHE0 1KULA 4MB5A 3W81A 3NZHH 1ZWIB 4PJIE 2HKFH 4MAYA 4XVTH 4BFIA 1CDHA 3TZVA 1FFPA 5I1GL 1U58B 2R0KL 4ORZC 1HWGB 3UJIH 1RVFL 3LKSB 2F8VA 4U3CA 4DKFH 3I9GL 1JZ8A 2D0FA 4X7FC 4HZAA 2OJZL 4P3CH 1KIUA 5CMAB 2V17H 1G7PA 4JKLA 5H94A 1TETH 3T09A 1MJ7H 3WFCL 1S7QB 1GZPB 2WWMC 5SX5H 5LG1A 2R2BB 2DWEA 1UB5A 3MRCA 3QUKA 1EO8L 2FJFB 4XMKH 8CGTA 4PR5B 1VADA 4WTXA 2B4CC 1PYWA 5DD3H 1JHTB 4E0RB 3FO1A 1Q9OB 4MLSA 4MWFB 5ISZB 2GAZA 2DLFH 3EAKA 3GIZL 2BSSA 5IFAL 4ERSH 1MY7A 2XPGA 3HPLB 3WLBB 1D9KC 1BHGA 1SEQL 3WNNA 4JE4B 1I7ZA 3E6FA 3WIIH 2HN7B 5DK3A 5IT2H 1X5FA 4LKXB 2NLJA 3HZMB 1DBAH 4NZUL 1YEGL 3P0GB 5J1SC 5DD5H 3BFOA 3JV4B 3QUXA 4PY7A 4JFOA 4Z8FH 2VL5B 5ACMA 1BVKA 3VFMB 5BQ7A 1DE4A 2ARJB 1U93B 4GXVL 1ZHKA 4YXKH 3GBMH 1FPTH 2V5RA 5D71L 5FYJE 5EBMB 1ZVYA 4P49A 4G6FB 3FQTA 4Y2DD 3VI3E 3ARFA 3SQBA 3R0MA 4LARL 4NQXB 1UM5H 4A6YL 4BK5A 4FFWC 3IAPA 3QXAA 3AS3A 4TVPD 4PRDA 4Y16D 3VWJC 4XTRC 3ZT6A 1KJMB 4OLYH 5TH2A 3WSQL 3HE7B 1MCOH 3MJ7B 1JV5A 1JN6A 2ICWJ 4JZJC 1OTSC 1FFNA 2X6MA 4HK3J 5F21B 3FB7A 3PABB 1LNUB 3HUJA 1S3KL 3BWAA 3DX6B 2X1OA 2P48B 4OKDA 4JY5L 3H9SA 1N5YL 3RAJL 3DXAD 1VKXA 3LDBC 1N59A 5IW3A 4BZYA 1H3PH 3ALXA 5F88B 1DBMH 1K5NA 3WJLA 4QOKA 4BUGA 3D0VB 2N56A 1KC5L 4ZPVB 3P30H 2OI9C 2AQ2A 5JOPE 3A6CH 3DX9B 2EDHA 1NMCB 1FNEA 5HDOA 2RHEA 4QHUA 2R2EB 2F58L 3N1GC 4PGBB 3MCLL 2XZQL 5D7JC 4AT6A 3DUSB 2JJWA 4Y5VA 4JVUA 2BRRL 3NPSB 5E4EC 3VE0A 2CPCA 5KSUB 4JQIL 4OZIB 4H0GA 4L5FH 5MEOA 2H2PD 3U0WL 2G2RB 4F7CA 1KCUH 4WNQB 4C83B 2ILLA 3RKDD 5A2IH 3MLYL 3QT2A 4FQCH 3PHOA 1YQVH 2C4XA 3E2HB 5E6IC 4KV5E 4NP4L 4PJEF 5I1JH 4NCC1 1DN2A 2EE2A 3WUWG 1T1XA 1N6VA 2AK4A 1OB1B 4BSWB 2I5YH 4NSKB 2DBLL 4G6KL 5GS1B 1LE5A 1M1SA 3MXVL 2P49B 4YIQA 1A47A 3N1FC 1T22A 5IFJA 2WK2A 3ZTNL 5ILTL 4GG8A 2ERJB 1FYTE 2B0SH 5EO9A 1MJJA 3GMQB 5BRZA 5T5FL 1UZ6E 2ZSVA 5JW3L 1XIWD 3GO1H 3NCFB 1Q94A 1ULVA 5I2IB 4PS4H 1VFAB 4XP9H 3TJHC 1KLUA 1Z5LA 4QHMB 3K8LA 4JHZA 1T0NA 1F11B 3FQUA 4WFGE 3GMPB 3DUHA 3C5SB 3ARVA 3HE6C 1SJVA 3HTLX 2Y36H 4JFYB 5D7LA 3VRLE 2P24A 5L2KB 4JCLA 2YPKA 3UMTA 4G43B 5B22A 1MREL 2P8PB 1KPVA 1DQDH 4FNLL 4GXUM 3SGKA 3EFDL 4PRPA 1QTYT 3MBEA 4RAVA 2GJZB 4FTVD 5CIPH 1IBGH 5SWSA 4ZTPL 5DJYB 1CGVA 1OAKH 2A9NH 3QFJB 4HWBH 4KKBC 2FX7H 3V0WL 2J3SA 1HXMB 5EO1B 3KLHC 5JW4R 1FFQA 3WXVL 1M6OB 2YMXL 4M1DL 4I8DA 5IVXB 5EUOA 3VCLB 1RPQA 5GHWL 4PJ8D 2B1AL 1HHGB 1M7DB 1WAAE 3X13B 4PJHB 1YY9D 1OTTD 2XWJB 2P5WA 4FABH 2F5BL 3OHXB 4TQEH 1JZ2A 1JZ4A 2Z0BA 3QHFH 3OB0H 3O8XC 5HHOA 5A3ID 1I8LA 4WFED 4W4NA 3ARDD 5DD0L 4YBQD 3NA4A 2QSCL 1NPUA 4NJ9L 1NCWH 1CFNA 3LSOB 1PBYA 5FGCB 1JYWA 2A77H 4JN1H 1PX4A 3DX8B 4KKLD 5E8EB 4W81A 2FWOB 4UDUA 1BQLH 1FZMB 2DQEH 3L3OA 1A14H 1FG2B 4MNHB 4I2XE 1DUZB 1DQLL 3TT3H 1MQKH 5CHNA 4ZDHB 5EIIA 5DRXB 2XNAB 5EO0A 3A6OA 2VQUA 2BDNH 3ARQA 3QB7C 1DQMH 4LPWA 4OD3H 4A2LA 4FFYH 4AM0A 3NH7H 2DD8L 5DSCB 3UTSA 4CAGA 1FFOA 2J8UF 4YDLB 4OLUH 1S78D 4NO2B 1HXYA 1Z9LA 3F65A 5FYKE 5DD1L 3MUY1 3BPNB 2A9ML 4KK5D 2XRAL 1S7XB 5L0QB 3C5ZC 2K9UA 5DQ9B 1U2CA 4K2UL 1IGTB 1FLTX 4LCWD 5C0IA 4JKPH 4IEFB 4RFOH 2H8PA 3LZFL 4YHZL 3G6DL 1EDQA 3QCTL 1ACZA 1HEZB 1MH5A 1HZHH 2XTJB 3O45A 1EAPB 4R96A 3FFDA 4PRNA 4N5UA 3MNWA 4I18B 2A1WL 5E5MB 3O6LL 4Y4KD 5B39G 1MJ8H 3BT2L 4LLYB 1G9MC 3VDAA 3C60D 1CFVL 5D7IA 4N8PA 4YZFF 5EIQA 1T4KA 3C6SA 4FA8A 1ONQB 5HI4D 4EJ1C 3HCVA 5ACLA 2EIZA 4Z7QE 2WLYA 2YPVL 1ZS8A 5IQ7H 4IRSA 4H5SA 4EDWH 5L8JB 5F7YC 4Z78A 5C0CB 3QDMD 3U0PB 1J05B 5GGUA 3GBNL 3ZDZE 3PDGA 4L29B 3T0EE 5F9DC 4OV5B 5TDOA 4JCMA 4FRWA 3CJJA 3B6SB 1XGYL 1ZWIA 3MNVB 2YWYA 1I1AC 1L7IL 1U58A 3LKSA 2DI9A 5HGBB 5J11C 5J0BA 4U1LB 5B4MC 4TOYH 2GJJA 3IYLW 4Y4FB 5CMAA 4JG0H 1DN0B 4UTAL 2VLRD 5CGYD 3JWDC 5I16B 1IAIH 1DVFC 1S7QA 1TPXC 1GZPA 1PG7L 1XGPB 1AHWB 1WT5A 3ZHLA 1F58H 2R2BA 4GJTB 1E6OH 3V6BR 1Q9KB 2FJFA 5GRZA 4HKBB 4JFFE 3ULVH 2X4OB 3UPRB 2CR6A 1EMTH 1JHTA 4E0RA 4GS7C 2DYPD 2VLKB 1Q9OA 4MWFA 1EJOL 5ISZA 3WMSA 1F4XH 3DMMD 1LP9F 1YQ2A 4PY8I 5GJSH 5F7HA 4G8GE 3U7WL 4P2CG 3HPLA 5F6IC 2X70B 4OZHF 12E8L 1XF3B 3ARGB 4MQSB 2IPTL 1HH6B 3JWNC 4Z5RB 1X6NA 4LKXA 3HZMA 1EH9A 5HGAA 3CU7A 1LK3L 1A9BA 4IHOB 3UJTL 2CLVB 1CF8H 3JV4A 4YPGB 3U7YH 3U9UB 5E99H 4HT1H 4FMFA 2DTML 2ARJA 1LK2B 1U93A 1UXSB 3SBWC 2MOVA 2Q3AA 3EYOB 5A2FA 2M1KA 4FG6D 2EC8A 4XNXL 4PJBA 5DK0B 2GY5A 3GSUB 4YHYB 3SQOL 5EBMA 3RTQB 5CJ8A 3C09B 4Y19E 4EN3C 1KEMH 1DBBL 5D4QA 3BMVA 1JI2A 5C6PB 3ORJA 5EU6D 1UXWA 1FBIL 4LPCA 1KJMA 4NQUA 1KFAH 3HE7A 3MJ7A 2VXTL 2CLZB 4O5LL 4HS8H 2BSRB 1HSBB 2OL3H 4ZSOB 2CIKB 3PABA 1LNUA 4OIIL 5F96L 5D1ZD 4CVXB 2B4CH 2OBGA 1TTGA 4JPVH 5GRWA 3UJJL 3ZKNC 1KPRB 1KJ2L 3SGJA 1C5CH 3JTSB 3MA7B 1HQRB 4NZJA 1HHHB 4OUOA 3CPLA 3RX8A 5F88A 4U05A 4X8XA 4XHJC 5KVFL 4ZPVA 3I75B 3WKMH 2DQHL 4BSVB 3DX9A 3HNTH 2P44B 2R1XB 4OZFH 3DTXB 4BQ8A 1J5OL 3GMRB 2R2EA 2NY3D 4PGBA 1OAUL 2ZUWA 3AS0A 3KYAA 3DUSA 3CX5K 4OLZH 4OCLC 3PP4L 4TNWF 1NQBA 4RFNC 4OZIA 1U0QA 3O3EB 3QDJB 4DCQB 1WBZB 3D39E 4M8QB 3IDXL 4JY6B 3O4OB 2GJ6D 4RGMC 4R9HA 2G2RA 2FSEB 1KN2H 3CDYA 4XCNB 4XNUH 1W0YT 1NFDB 2BMKB 3A6BL 1U8KB 3LV3B 1JNLH 5F70A 5C0BE 4I3RH 1LD9B 2XICA 1ZLSL 3MBEC 1B90A 3L3IB 1RQ5A 3FOMB 1ZHLA 4Y4HC 5JHDB 1MCQA 4BSWA 4WEUD 3QWRD 4OGAC 2FBJH 4NSKA 5B3NA 4Z7UB 5GS1A 2EDFA 3QH3B 1E4KA 1L7TH 4Y1AD 5FO9B 1WVZA 5J4MA 1SBSL 5BO1H 3IKCB 1MCIA 35C8H 4P2QB 3VI3F 3VI4E 3O6FC 4K7PL 2NZ9C 4F2MA 5GS0L 4ELME 3OJDB 5J57B 1O7SA 2WWKO 3GMQA 3SCMB 4M5ZH 4QRRE 2WBKA 4ZFFB 1KB9K 2Z8WC 5IVNA 1U41A 3VW3H 5I2IA 3WFEL 1VFAA 2R39A 4Y7MA 1NBQA 4QHMA 3F12B 5A2LH 1F11A 4RISH 5BS0E 4DUXA 1AC0A 3GMPA 3C5SA 3F58H 5C07B 3V4UL 4JFYA 3CVHL 3R1GH 5C08B 5L2KA 3HRZB 1A8JH 2VERN 3HNVL 1JGVH 2Y6SC 5BVPL 4G43A 5D1QD 2P8PA 2R9HD 3WNLA 4U0RC 3TPKA 2I24N 4NM8L 1MLBB 1MCPL 4JFPA 2NNAB 4X9HA 1WIOA 2GJZA 5L8LB 3K1KC 1CBVH 3GMOB 2DQIH 3QFJA 2DL2A 5FO8B 2Y06H 4LSQH 1HXMA 5EO1A 5DHXB 2CH8A 4LCWE 3QZWG 1M6OA 4E9LA 5CD3B 5CFHA 2D03H 3QIWC 1K3IA 2HFGH 3FRUB 1S5HB 3VCLA 5IVXA 1K9TA 5AWNL 4NKQB 4WTZA 1SYSB 5AYUL 3X13A 4PJHA 5CGTA 3SO3C 2XWJA 4UILL 1HINL 1A6UL 4B7IA 4PRHA 1AH1A 3QFDB 3V4PH 2ZPKH 1LO4H 4P5TB 3OHXA 3I02B 1AO7D 3CMGA 1TQBB 5BXFB 2Q76A 5IVOA 5T3ZD 5DVOA 1RJLB 5C6WH 3O6MH 2PTUA 2XN9D 3TIDB 5FF6B 3LSOA 3BKCL 3BWUC 4KI5D 2UY6A 3RVUC 4EKXA 3N85H 1BZ9A 3DX8A 5E8EA 2RAMA 2FWOA 2XG5A 2BNQE 5J06A 3SDYH 1A21A 5LCVH 2J6EH 2HLFC 4PJ7B 1A7BA 1FG2A 4M1GH 4MNHA 3AM8A 1DUZA 6FABL 4ZDHA 3KYKH 5DRXA 1CDJA 2XNAA 2IBBA 1B4JH 1SY6A 1IQWH 1PZ5B 1BGXH 4BM7A 1F2XK 5DSCA 3L7EB 4LPYA 3Q48A 4LP4A 4PGEB 4NO2A 4UNTA 1BEYH 1N0XH 1H5BB 2G60H 3CU1A 2KQMA 5IW6B 3DURB 1GGBL 5GJTH 4PV8B 1S7XA 5A1AA 1CQKA 5DQ9A 4ZUTB 1IGTA 5CCKL 3LVEA 5DWUL 1NEUA 4P2RA 3INUL 2OR7A 4RCAA 1NANI 4UINL 3ZKMC 3E3QE 1HEZA 4YC2C 1QHOA 5ICYB 3RPIB 2AABH 4LBEA 1EIBA 1EAPA 3C2SA 3MXWL 3QEUB 3C2AL 3SOBL 4I18A 5E5MA 1QBLH 3MGAA 1QSZA 4LLYA 2EIEA 4OBRA 4QYOB 2O61B 4GBXC 4MB4A 2R29H 3DO7B 2Q1EA 3VXUB 1OGAB 3JWOL 2IMMA 1ONQA 2Y1VA 1WAAF 1UKQA 5DTFB 3VJ6B 1D3CA 2W65B 4KQ3H 4X80L 2BSED 5C0CA 1CXIA 4LL9A 4ZO6A 1J05A 4PJXB 4J8RA 4MQTB 1EFQA 3U36B 1HK6A 4L29A 5EOCL 4OV5A 4G6JL 5JXEA 2JB5L 4XP6H 1J8HD 1G7LB 4YK4C 3MRLB 2PCPB 3B6SA 1A6VH 1RULH 5IIEB 3MNVA 5KG9B 5E4IA 4I9WD 3MUHL 4HKXB 3ABZA 1I9IL 1TDQA 4PRID 3IRPX 5FAAA 4NNPH 4U1LA 1W0WB 4YDIL 3OXRB 5D2NB 4WWKB 1DN0A 5DT1L 5JQ6H 5CUSH 2GT9B 1I9RH 5K59E 5I16A 4HJGB 4YE4H 1FZJB 4MCYB 3MLXH 4UU9A 3S8WA 1XGPA 1AHWA 1BQHG 1QR4A 2WP3O 5ANMB 4O2EB 4P3WA 3PV7A 1IZKA 3LEYH 1Q9KA 1T0MB 4HKBA 1G9MH 2X4OA 3UPRA 1V7ML 3W39B 1NAKH 2VDOL 3FFCB 4D9LH 2VLKA 3B9KD 4O02H 3KPRB 3C6LB 1JF6A 2A6KB 5KSBB 3LS4H 4YGAB 1W72B 3WIHH 3S34H 4DZ8B 4WTWA 3F6IA 1JNNL 2X70A 5HTSA 3HZVA 1XF3A 3SGJC 3ARGA 1HYRC 1HH6A 2VIRB 4L9DA 4Z5RA 4YHKL 3BE1H 1ZGLM 3H6JA 3AFLA 3HMXL 4IHOA 2G9HB 5HGGS 1FVCB 2CLVA 1N6UA 4OGXH 2ZUYA 4YPGA 3DOSA 3U9UA 4LSVL 4G8IB 4RWYH 2AJYL 5EZIH 1LK2A 2FATH 2ORBL 3EYOA 5E1HB 1SYVB 2APFA 4WO4C 1WGOA 5DK0A 3GSUA 1T66D 4Z7QF 1Y6KR 2VTFA 5D2LB 1MCRA 2Y7QB 1U8HA 1QFWL 2Q8AL 3JWDH 1P9MC 3E0GA 4URTB 1AGDB 3TWCL 1C08B 2CKBB 2CLZA 4I4WA 3DNKA 1LO5B 2X1QA 4UIKH 5JZ7C 2BSRA 4ZSOA 2CIKA 4CNIB 3QQ4B 4ZS7L 4CVXA 3E2HC 4M3KB 5DJ6B 1MCHA 1AXIB 4Y8DC 5I73C 5GGTA 3S3PA 3U4EB 3RWGB 1X5XA 2V7NB 1LEGB 1KPRA 5F93C 2YXMA 5I1GH 2NY2B 3JTSA 2R0KH 3CDCA 1HQRA 1HHHA 1KJ3L 1RVFH 1ZGLP 4RMVA 4JDZB 3I9GH 2OJZH 1N4XL 1CDGA 5C8JB 1E4KC 1VGEL 5EBLB 1P69B 4BSVA 2NMSA 4OLVH 3WFCH 2R1XA 4OM1L 3DTXA 5DMKB 3GMRA 1MI5D 4KRMB 2G5BB 3RDTC 1Q9LB 1CXEA 1GL4B 1UZ8B 1OD9A 2W91A 1EO8H 1SBBA 5CD5D 3MV7B 4XBPB 3MJ6A 2VZ1A 4CW1B 2IFFL 3O3EA 3QDJA 4MX7B 3RVWD 4Z0BL 4M8QA 3UO1L 4XNZB 3VFUB 2XY1A 4JY6A 3GIZH 5IFAH 2YK1L 4JRYB 5TDPB 2FSEA 3HMXA 2F8XC 2AK1L 5CS7A 1SEQH 2IAMC 3MRNB 5KSAD 5F7FA 2BMKA 3V95A 1ZHNB 3LV3A 2DQCL 4KK9C 3C5JB 1LD9A 1N3NB 4TTDC 3L3IA 4NZUH 1YEGH 3FOMA 5JHDA 1K8IB 3ULUL 3CUPB 1CD9B 4XC3L 1A3LL 3FT4B 4Z7UA 3QH3A 4GXVH 1AO7E 5FO9A 3OKEB 1QLFB 4PLKC 5DYOB 3IKCA 5T3ZE 3IDUA 4P2QA 4WHYH 5D71H 5I15L 3TF7C 1SJEB 2FEEL 5EWIL 3OJDA 4KI5E 5C0RH 2ZUSA 3SCMA 1YYML 4LARH 2YPLB 1G84A 4A6YH 4ZFFA 3RGVB 1NDGB 1H15B 5ESVB 5SWSE 4YFEA 3F12A 3WSQH 5EBWB 4NN6B 3J7HA 3QXUA 4M5YL 4HF5L 5HD8C 5C07A 4EI5B 4L4TB 2MCPL 5EUOE 4M62L 1S3KH 3UC0L 3HRZA 1ZT1B 4S1DD 4JY5H 4PG2A 1IEAB 2YA2A 1N5YH 4CKVX 3RAJH 4W6WB 4M93B 1RI8A 1ZLVK 4RBPK 1MLBA 1W0VA 2W9EL 2R69L 3PG2A 5GS0C 2NNAA 3BH9B 1KXVC 5BZWB 3HA0A 5HHOE 5ALBL 1KC5H 1CDBA 3GMOA 5JPNB 4PJDB 2DIAA 5FO8A 1BP3B 3CH8A 1OP5K 5IB3B 1EO5A 4MJIB 4M03A 4JDVB 5CD3A 2NR6D 3QQ9D 4Q0XL 3FRUA 1S5HA 2F58H 4H1LG 4U3HA 1FNHA 5IB2B 1AD0B 3MCLH 2XZQH 2XKNB 4KGLA 1DUYB 2BRRH 3CFDB 3QFDA 2HJFB 2RIKA 4JQIH 3MR9B 1X5YA 2B7DT 5L2JB 4P5TA 3BPOC 3I02A 1ZLUK 5BXFA 3U0WH 3X11B 2UUDK 1RJLA 5B39B 2KQNA 2ARJQ 5KANG 1MFAL 4DKDC 5DVLA 3MLYH 3TIDA 4KDTC 4P4KD 3LN5B 3SE3A 1MAJA 4NP4H 2W9LA 3PQYD 4G80B 1VFUA 3W2DL 4JGUA 4PJ7A 3B2VL 4NZRL 4MMZC 1QPPA 3QWOB 5DJAB 2DBLH 4G6KH 3VI4F 3MXVH 1CXKA 1KCLA 1MVUB 2YD9A 3WFDL 2PXYB 3KWWB 4Y5YC 1XF5B 1PZ5A 2AJVL 4KROB 1EJ6A 2W0FB 4PY8J 3QQNA 5IF0B 1OGTB 1J8HE 2PETA 5J3HD 3ZTNH 3L7EA 5ILTH 1HYSD 5L9DL 5T1KD 4XZUB 4PGEA 5T5FH 1CDUA 4Q7DA 1EEQA 5JW3H 1H5BA 4LPTA 5IW6A 3DURA 5SX4I 4PV8A 4XCEB 4ODWB 4HFWB 2B5IC 1HH9B 1X5LA 1RU9L 4LFHD 2MSPA 4K71B 1OW0C 3TNNB 4Z7NE 1IGFL 1WJ3A 4ZUTA 4G9DB 3KVQA 4R26L 3UYPA 1WIPA 1MRFL 3MLRL 4LVNB 1NGQL 1KPUB 5F1IB 5ICYA 1T7XA 3RPIA 5DURB 1H3UA 1W72L 1JPSL 5C0FB 1MREH 2E8ZA 3CDFA 4FNLH 3QEUA 4DGVL 3L9RB 5F71A 5MEQB 2CD0A 3EFDH 4RX4A 3P9WB 4Y4FC 3RIAK 2X4TB 3VG0L 4QYOA 4GW1B 2O61A 1J12A 3TP4A 4JAMB 1CL7I 4DAGL 3DO7A 5KSVB 4JRXE 1TZIB 3V0WH 3VXUA 1OGAA 3WXVH 4X9BA 2YMXH 3EJZD 4M1DH 5DQJB 4HG4J 5DTFA 5GHWH 2B1AH 3HC4L 3MOQA 3VJ6A 2F15A 2W65A 4I1NB 3DI2B 1HQ4B 4ZG1A 3P73A 2BHUA 4RNRB 4GG6B 3CCHB 2F5BH 1BLNB 1MIML 2XYCA 3U36A 3WXWL 5IJKC 1TQCB 3WFBL 4UQ2B 5C2UB 1VA9A 2BNUB 3QPXL 1S9XB 2A6JB 1G7LA 5DD0H 4RMTA 3EUUA 3MRKB 3MRLA 1HWHB 2QSCH 4HWEL