3IBOA

Pseudomonas aeruginosa e2q/h83q/t126h-azurin re(phen)(co)3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Relaxation dynamics of Pseudomonas aeruginosa Re(I)(CO)3(alpha-diimine)(HisX)+ (X = 83, 107, 109, 124, 126)Cu(II) azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3iboA00
2BW5A 1GS6X 5F7BA 3ZX1A 6PAZA 4DP8X 2GIMA 3OMAB 1M56B 3CZUB 3ZIYA 1ASOA 4YVUA 2GC7C 4YSOA 4G72B 4Q8BA 1AR1B 1SDDA 2BP8A 3QJQB 2BWDA 1J9TA 1AS7A 2EILB 3IE9A 1XB8A 1DYZA 1ZIBA 2FT8A 1SF3A 2WO2B 4NERA 4E9SA 4NB7A 1JERA 2ZOOA 1JVLA 1WS8A 3NJIA 1L9PA 1SHXA 4QKTA 9PCYA 1NIEA 1L9SA 1AZCA 3FPYA 4KNSA 5B1KA 4WTQA 2FJSA 5I26A 1IUZA 1KCBA 1RKRA 3V9EA 5ANHA 2CBPA 1OE3A 4HAKA 2MTAA 2BZ7A 4M4RB 1HAUA 2R7EB 2UXGA 3T71A 1YLBB 1RZQA 1M9WA 3FYIB 4QLWA 1B3IA 4BK5C 1A3ZA 1SNRA 3G5WA 5I6KA 1KCWA 1PLAA 1E65A 5D4IA 1JZHA 4PAZA 2AFNA 3NSFA 2PCFA 3SBQA 5D4JA 2X88A 3WI9A 2EIKB 2XX0A 3QJUB 3X1NA 2IDSA 1SJMA 2AANA 1NIAA 2HZHA 4FA7B 1OCRB 2I85A 3H4FA 4DP4X 3TBCA 2IDFA 2BO0A 2LLNA 3PXLA 2J5WA 2IH8A 1TU2A 3QQXA 4HCFA 5B7MA 3T6VA 1BYPA 2I7OA 2PPFA 1J5CA 4DPCX 4HCGA 3NP3A 4EF3A 1JZJA 3NJGA 4KNUA 4N4YB 3NJHA 1ETJA 3FU7B 3NJJA 1FA4A 2OCCB 1NIFA 2VSMB 5AKRA 2EINB 4N8UA 1OF0A 2TSBA 2XXGA 4A2EA 3WIAA 3WNJA 1A4BA 2FQFA 1KV7A 2XLLA 3CVCA 5I6OA 4HHWA 2CALA 3FQ1A 2YAHA 4L0PB 4BDVB 5PAZA 2QPEB 4M3HA 4F2EA 4MFHA 2DWTA 4KO6A 1A65A 1W6LA 2GB2A 1T5KA 2Q9OA 3JT2A 2FQDA 4G7RB 3SBRA 3GYRA 3T6WA 1CUOA 5B1JC 3WG7B 4AKOA 1AZUA 4DP6X 3DTUB 7PAZA 4E9RA 1IKOP 3AZUA 1PY0A 3T6ZA 3UABA 1NPJA 1IC0A 4GP8B 1ZDSA 2X87A 2HX9A 2EIMB 2ZWNA 3PLYA 2WSDA 1L9QA 2JXMA 1KYAA 1A4AA 2CJ3A 3HB3B 4F7KA 2JKWA 1BXAA 1OCZB 1E67A 2QDVA 3IN0A 2GI0A 1BQ5A 3BVDB 4BWUA 3IBOA 4AZUA 4A66A 1KBWA 3TA4D 1PF3A 1PZBA 2FQEA 1W8EA 3AG3B 2QDWA 1VLXA 1GR7A 3FS9A 4W9ZA 3C75A 1GYCA 1FFTB 1HAWA 1QNIA 1SHWA 4FAAB 2A3TA 3QPKA 4P5SA 1BAWA 1ZIAA 3S8GB 3MBWB 3UAAA 4HALA 3FQYA 4JHVA 3EH3B 3S3BB 1JOIA 5D4HA 3MX0B 3OD3A 1IBZA 2N0MA 4A68A 2Q5BA 2J56A 3ABMB 1KDJA 1PNDA 4A2GA 4KO7A 2EIJB 5B1AB 3QJSB 1GS8A 1AZNA 4YVNA 4E9TA 3N2JA 3U25A 3OQRA 5I28A 3FPXA 2VW7A 3ZBMA 1PNCA 1AG6A 2YXWA 2YXVA 1BQRA 4GP5B 4CSPA 2Y69B 2BWIA 1BQKA 1NTDA 2XYBA 3ASNB 3AY2A 3BQVA 4HHGA 2UXFA 3L45A 2IDUA 2J55A 1KGYE 4YSQA 4PCYA 4YSAA 1ET8A 2R7EA 4DP2X 2YARA 4DPAX 5EHFA 1AS8A 1AG0A 5B1JA 3NYKA 1J9SA 5TK2A 7PCYA 3UACA 3PAUA 3QJRB 3OMIB 1RCYA 1AIZA 3CVBA 2OV0A 1WA0X 2CUAA 1OCOB 4E9XA 1V55B 1I53A 3D12B 3CDZB 4G71B 2XXFA 1PZAA 1OE1A 2PCYA 2XV2A 4UANA 1HFUA 4G7QB 3TU6A 1AQ8A 2HLEB 2XX1A 1AACA 1NIBA 1PCSA 1V54B 3PPSA 2WO3B 2FTAA 1W6WA 2ZONA 3AW5A 4NAJA 4DP0X 3ABGA 1URIA 4DP5X 2BW4A 2HX7A 1BEXA 1N70A 2E86A 4G70B 4DPBX 2IH9A 3NJMA 2HRHA 4DP1X 5PCYA 4RH4A 3WKQA 4A2DA 1E5YA 5I6PA 3ABLB 4AKQA 3FQ2A 3SBPA 4BXVA 4CSZA 2IWEA 1TEGA 1A4CA 1GS7A 4GP4B 2DYSB 5I5JA 3FU7A 2YAQA 3AG2B 1JXDA 4KO9A 2PPDA 2YAMA 2OJ1A 1GW0A 2P80D 1DZ0A 3NSDA 4UF7C 2BP0B 4GYBA 2AZUA 4GY4A 4YSRA 5B7EA 1OCCB 4YSPA 2VSKB 8PAZA 3H56A 3RYMA 5B3SB 1PMYA 2IDQA 3ASOB 1NWOA 1ADWA 1ZV2A 2GBAA 1JXGA 3NJFA 2IWFA 1CURA 1ASQA 2VW4A 1F56A 1PLCA 2YAEA 1JXFA 2YAOA 4DP7X 1NZRA 2AZAA 2ZXWB 3SQRA 4G7SB 2FNWA 3WKPA 1ID2A 4DP9X 1SDDB 2BP8B 3X2QB 1J9QA 2PP8A 2RACA 5A7EA 4AKPA 2XV0A 2DV6A 4KOBA 4ZK8A 4YSCA 1MG3C 2QPDB 3TBBA 3EF4A 1NDTA 2JFCA 1UATA 2TSAA 3CG8A 3ERXA 1NPNA 5FC9A 3DIVA 2DY2A 4E9YA 2CCWA 1ZPUA 3FSVA 1CYWA 2Y1AA 1TKWA 2GSMB 1AS6A 5I5IA 1BXUA 5E9NA 3UADA 2PLTA 1X9RA 2BHFA 1WS7A 3PCYA 3ABKB 1XMEB 1KBVA 4X4KA 2VN3A 2DWSA 2CAKA 1GY2A 3H4HA 3S3DB 2UX6A 3N55A 4JKNA 3FT0A 2FT6A 3EH4B 2XWZA 3NT0A 1EHKB 2AVFA 4TXVB 1SFDA 4KOCA 4UAHA 3NP4A 4HIPA 3S8FB 3IEAA 4F2FA 2QT6A 1PAZA 2B08A 3EH5B 2FT7A 2IDTA 5B1BB 3KW7A 4WKXA 5B7FA 1KDIA 4E9QA 2H3XC 1EZLA 2PPAA 3CVDA 3PAZA 1J9RA 4HCIA 2VM4A 5I6MA 2VMJA 1E30A 3S3CB 1ZDQA 3UGEA 2GHZA 1CYXA 4BWWA 3IN2A 1E5ZA 1PZCA 2UXVA 2GC4C 2P80A 1QLEB 2H47C 1WA2X 3JTBA 1OOWA 5IY5B 3FYEB 1WA1X 2VW6A 4AX3A 5I5MA 1MZZA 1XB3A 1OV8A 4A2FA 3GDCA 4KNTA 3WNIA 2HXAA 2UXTA 1ET7A 1SFHA 1A8ZA 2PPEA 4KO5A 2B3IA 3X1BA 2HX8A 4Q89A 3FU8A 5I6LA 3NJKA 4A2HA 1ET5A 1BXVA 1BYOA 1JZEA 5LDUA 4ENZA 3EHBB 1QHQA 3NSCA 5AZUA 2XVBA 4A67A 1FWXA 3FSAA 1IBYA 1L9TA 3NSYA 1ILSA 1CC3A 2HRGA 2IWKA 2PP7A 3NJNA 4YSDA 1ASPA 1M57B 3X1EA 1GY1A 1RZPA 1OE2A 1JZFA 3UAEA 1XB6A 1SF5A 3CDZA 1GSKA 4AI7A 3T6XA 1WAEA 3KW8A 3OMNB 1J5DA 1R1CA 5TK4A 1AOZA 2BZCA 2I7SA 4YSTA 2J57A 2MRYA 2H5UA 3QJTB 5F7AA 3TASA 2DYRB 2YAPA 2YAFA 4W1TA 1MZYA 4YL4A 4GXFA 1X9UA 3T9WA 2NRDA 3AG1B 2YQBA 1ILUA 6PCYA 4YSUA 4BDVA 3QJVB 2W88A 2FQGA 3DKHA 3NJLA 1PLBA 1AZRA 3GXUB 4E9WA 1V10A 3FSWA 4YSSA 1L9OA 2UX7A 3HEIB 3FU9A 2XUWA 2PPCA 4HZ1A 1NICA 1JZIA 2IAAC 2XV3A 2VM3A 3PAVA 4K9JA 2XU9A 3X1GA 3ZDWA 3V9CA 4YSEA 1N68A 1MDAA 1AANA 2BP0A 3OM3B 1AAJA 5AFAA 1MG2C 1NWPA 1L9RA 2PP9A 3FSZA 4BWTA 5I6NA 2W8CA 1AZBA 4P5RA 1NINA 1JVOA 1TEFA 3X1FA 1JZGA 4E9VA 4JHUA 4BXSV 3AG4B 2FWLB 1NIDA
chains in the Genus database with same CATH superfamily
4E0RB 1BJ1H 2VDQB 4CVZB 2X1QA 1BFSA 4MMXC 2GJ6D 4FTVE 4JCMA 4Y7OC 2CXGA 4UAOC 3WMQA 3SO3C 1UJ3C 2GTWA 1T7ZA 1BJ1J 4M8UA 3K8MA 4RNRB 5B4MD 5BQ7B 3DX7A 3VXME 3CFQA 3SKOB 4L3EA 1P5VA 3BEWA 2F53E 2JQZA 3HZYA 4Y89A 3RG1C 4CMMB 3US0A 2KLRA 4MJ6A 1E28A 1N0LA 3FOLA 3SY0B 5BMFH 2BXYA 2ZTBA 4OM0L 1W16A 4MZIA 1TLMA 2J73A 3DC0A 3UAJD 3WE1A 1BOYA 2XPZA 5F9WC 3OX8B 3AITA 2WD0A 4OGYL 5BV7B 1IQWL 3OXSA 4Y9EA 3ULUC 4JG5A 1DUYB 1I7ZA 2YPVL 2CJSA 1BM3H 4KNSA 3NFNA 5HPMB 4FQLL 1P84J 5I26A 1KCBA 2CLZA 3R1GH 4GQZA 4AV4A 1NGWB 4ONGH 1HNYA 1S7UA 3GJFB 3U9UB 3FH8A 1NAMA 1ZEAL 2JKXA 4JBSA 2JQAA 3JWOL 1I1FA 3CVHA 3QXDB 3FU0A 3VFRA 1CFNA 5FO7A 4GT7A 2E6QA 4RLDA 4NRYB 5JDSB 1AMXA 5JW4M 3T0DA 3Q48A 4F7MA 2BOCB 5E1IA 5EC1A 1EX0A 2VM9A 1N8ZB 1UA6L 4X98A 4PRHB 2V2WB 4XP5H 1E6OH 2GHWB 2C9AA 5TFSH 3P3RA 1TJHH 1JS4A 2Y2YA 1DANT 1EFXA 3V5DA 3QI9C 1Z0MA 3TBYA 2BSSA 2WKOA 3S4SA 1ZRUA 1FCCA 4GT0A 1T7XA 2C5DC 4OQTA 5K93A 3SKMB 2QKIC 1KF9B 4IKJA 3C08L 1ZY9A 3KL3A 4TRPL 4UOZA 4PY8J 1KOAA 2EO1A 3KWWA 5C08D 1Q9WA 2WBJB 4UTBA 5C07E 3FUMA 2R69L 2F9BT 5E9DD 2XG4B 4FQXA 3GQFA 1ETZB 1CFSB 4BZ2A 4IIZA 3LIZA 4K3JL 4KFMA 2B4CH 1WUNT 2MPVA 2ZUUA 1N59A 1ZD6A 3IDNA 3C5JA 1KJ2B 3GGWB 2ZUSA 4XVUC 4PJBB 4L8CB 5HHXL 2W0LA 3PDDA 4YXLH 4XXDA 1BOGB 4OSUH 1LVEA 5IVZA 4K5PA 4YE0A 1VFAA 3T0EE 4F20A 5HHMB 3KG5A 1GGIH 3ZE1B 3MLYL 3EZJB 4K8RD 3QWOA 4OZHE 1MAJA 3HS8A 4LGSB 3RNKA 5HP5A 5DA4A 2ZOLA 3KR3H 5CEXA 5I6OA 2QPFA 4HHAB 4BCZA 1BD2A 1B90A 2FEDC 2ZUVA 3DRTB 4FJZA 4K7FA 3MUHL 2XA8L 3V0DA 3NK3A 1E4XH 3MXWH 2XZQH 3GO1H 3PIQB 4OF0A 4EBQL 3ROOB 4UZGA 3BGFB 1DBML 2FQDA 2LVEA 5B1JC 1YQVL 4X5PA 1YNTA 1EPFA 1KPVA 2X6CA 1NMAL 5JHBA 5J3HD 3MRGA 2D3VA 3KCWA 3QB7C 5IR1A 3L5WA 4HBQA 5I76A 5MEQB 4FNLL 1MW2A 3NPSC 1NPJA 3REVA 2X2HA 3GMMB 4BCYA 4RGNE 1KYOJ 3BJLA 1OZUA 2CJ3A 1U91A 3KYNA 3R0NA 3VFNA 1I7RA 4YFLF 5C8JA 4XTRD 3NIGE 3G5YA 3C5SB 3NZHL 4FP8L 4IGBB 3KYAA 2X1XR 3I02A 1OK0A 2DQUH 4AZUA 4BE6A 2UV3A 3NRFA 5HGAA 1YEJH 4XNQB 3IFLH 1DLFL 3KNBA 4PI2A 4NGHL 2HTLC 3QI9A 4Y9CA 3VM7A 1H15A 2XNAB 4V1DB 4J23A 4AH2B 2QKIA 3DV6B 1EMTH 2C9SA 1KCKA 4PI0A 1AO7D 1URLA 3A6CL 5E23A 1FHNA 3QPKA 3ETTA 4P5SA 1EAPA 2VABA 3VD7A 4ZX4A 1BLNA 4Z5RA 2EO7A 5K33A 4LCWD 1T6VN 2DL9A 3FQ4A 4EN2A 1WZAA 1XD1A 4OFPA 2DWDB 5ACMA 4M5ZH 4DZBB 4OF7A 1AGEA 5EFIA 1O9ZA 4BGLA 4LP4A 4QXUL 1T1WB 5IHUL 4OZHF 1FVCB 4H26A 3NSJA 1MVUA 5HHPA 4P5MB 1NCBH 1OWRM 3WUWA 2DIEA 2N7BA 4N0UB 1LO2H 5DZ9A 3DHPA 4N2KA 3D39D 3BH9B 4JFDE 1M6OA 5EUOB 1SOSA 2Y36H 1XF1A 3IETA 3DX8B 2RCSL 4AE0A 1IX2A 3B9VA 5H2BB 3SPGA 4AM0A 3L5IA 1LO4L 2VDNB 3SYOA 4LNRB 2VZSA 2AK4A 1QOKA 2NY0C 3FFCA 3EJTA 1NCTA 3QUYC 5HHNB 3SE8L 1U8MA 2F1AA 3MV8E 5FGBC 2Z64C 4G8GE 5LKNA 1UVQA 2LU3A 3MJ9H 4R0LB 4AVHA 4J2XA 4Z3IA 1TNNA 5C0NC 4ACTA 5B1JA 4NRXA 3NZ8A 5F0LB 1N6QH 4YDLB 5CEZE 4OQ1A 5C0EB 5CWSA 3NIGF 2OZNA 4Y4HC 1S7RA 3UZVB 3M07A 3QG6B 1QFWM 1T04A 2PCPA 5FFOA 1MLBB 1VAHA 3LQAL 4NUPA 5T3XE 5JUEH 1RK1B 4HWZB 4Y5VB 4XNXH 1SEBA 5E2JA 3TU6A 4K5MA 1OSYA 4LHUD 1M2VB 2DLEA 3PWNA 3CD4A 5LGHL 3TV3L 1IFHL 4GFXA 2BW4A 1ZT1A 5A6LA 1D3CA 3GSWB 1T0PB 2HFGH 2JJSC 4WFGD 4Y2DD 1YQ2A 3MYJA 3MLRH 2BSBA 2GT9A 2VXSH 4S1RL 1TF4A 2PWGA 4QHMA 2P5WD 3BPLB 3D87B 5SX5K 3JTSB 4F5CE 1X9QA 4LNVA 1T1ZA 3N04A 2X4NA 3FTZA 2NY1B 4KUCF 3VFOB 4ZQKA 1FFOA 3DPBB 1CN4A 4CSZA 1TEGA 3VWKB 2GCYB 4HIIB 4G2AA 2ITDB 4CVUA 4HS3A 1XF4A 1YEFL 1INDL 2H41A 2EXSA 4PGZA 5K5YA 2ZOWA 2E5EA 1S9VB 5DS1A 3Q8BA 3EUUA 3IDMA 2FZ3B 2OI9B 1RIUL 1CGVA 2IPKA 5IOPB 1H9DA 5EMYA 3DPDA 1J8HE 1HX0A 1SM3L 1XHHA 1EXUB 1MWAL 3DUSA 4QYOA 4YHML 2CIIB 3H56A 4Z7NE 1RUAL 1FSKC 1FZOB 3UO1L 5GISH 5EU3B 4AYID 5B39A 4MX7A 1NWOA 1QPXA 4RGOL 4AC4A 3AY4C 1WG3A 4Z3EA 4P2OB 4FS0A 2IPUG 2VC2B 3WKYA 3C60B 4YHNB 4FYRA 4PN6A 5ISZB 3GNMH 3FUDA 4LLVA 3CDFA 3TIDB 1TEYA 3SQRA 1QKZH 2FNWA 3TO2A 2R9HC 4C47A 4ODSH 4RRPM 2WCPA 3SGKC 2Z7ZA 3BKMH 2ZF9A 5EA0L 1MF2H 2ATPA 1XL6A 1R3JA 1UATA 2EEFA 4F2MB 1P7BA 1Z9MA 4NZUL 2XG5B 3PG2A 5A2AA 2VDQL 2AGJH 3FSVA 4H25B 2Y1AA 1MJUL 4JRXB 5DJ8B 1NGYA 3HPLB 3RWJB 2QQLL 2P5EB 3CZGA 5DS2A 4ZAKB 2CGYA 1WD9A 2OR7A 2YXMA 3QHFL 3UADA 2VZUA 4Y4HA 1IL1A 1A7OH 5AYUL 4UT7H 4ENEC 4FRWA 3NG5A 4KHXL 3OAYK 3T4YA 5BRZB 4NQEE 1ZXKA 3B2UC 3DX6A 4XOBA 3CLFL 2ZP0T 3PHSA 5KVDH 1AHWB 2VCOA 3KLDA 1DBKL 3CFEB 5T1LB 1G43A 1TLKA 1T6BX 3RX9A 1JL8A 15C8H 5F93C 1ZTXE 4WY7L 5BV7L 4GRWH 1LP9A 5FECA 3EH5B 2DWXA 1MH5B 3O6FD 2JJSA 4LLWB 5B1BB 3LD8C 2Z93B 2IBGA 3CVDA 2QVFB 3PAZA 2IH3A 5C0GA 2BK8A 2VM4A 3VXSA 4CC4C 1YNLH 2PCFB 3KL0A 3WGVB 4CC0A 3IVKB 5I74B 4ODUB 3SKNA 4Z7NF 4X5QA 4BFIB 4JFOB 4XN9A 1UM4H 1OOWA 2APVA 4KX9A 5IY5B 1NGPH 4WRLA 4PB0L 3RVWC 3CQPA 3GI9L 2RALA 3CN3A 5AWNH 4I13B 2BC4A 4FFYH 4L1LA 4D0BB 4KNQA 3ARUA 3VGAC 5I6LA 2G0KA 2PR9A 2W0KA 3TCLB 3GS4A 3AY4A 1MEXL 2VLKD 5CGYC 5EULV 3TEYA 1WTLA 2ZOTA 4ENZA 1I1RA 1M3IA 2WNGA 3Q8AA 2Z65C 5TH2A 1I1CA 3CUPB 4WNSA 1TTUA 1MY5A 1IGMH 5CMAB 1LK2B 1RP9A 1NC4B 4FADA 3K6IA 5KYUA 3EGSA 4F8TA 4JB9L 1KJ2L 2E7CA 1TQCC 3TJEH 4DAGH 1KIRA 5FGRA 1NEZG 1QFWL 2K9UA 4HK0A 3SGKA 5B38G 1YC7A 5EZIL 1KN4L 5JW5A 3O8XB 1GYUA 5F6HI 5KVMC 1OSZB 3X12B 4UQ9A 1H8LA 5F7AA 4LSSH 4NC2B 3A6BL 4OAWB 3TBWB 5EU6B 3OSVA 1LE9A 3OXRA 2IQ9H 1F11B 1N2RA 4W1TA 4XI5C 4EOWL 2VLLB 4PYHA 3C8KB 4BZ1L 3T9WA 3GIZL 1GAFH 5DMIH 2DYPB 4LDCA 4UMSA 1RU9H 3H53A 4JGMA 3QHZL 5J1TC 5KAQG 4MQSB 4J3OH 1S9WB 2OR9L 2JXMB 4U0RC 3VRLE 5T5FA 3L3JB 1PLBA 3QZBA 4GW5B 4O58L 1UXWB 4ZTEA 3GXTA 3ZTCC 4K73A 5CP7B 2IAAC 5AEAA 3LS5H 5EBWA 3T1FB 1MDAA 4JN1H 4TSAH 4X50A 4KVCH 3ECBB 3SDDD 4CC4A 2XFGB 3TVMC 1AP2A 1I3VA 4P46D 1AZBA 5IJCC 1XSIA 2VDLH 4QRQB 3MCKB 1Z9LA 1ZLDA 5KBMA 1VZHA 2V3FA 4NT6A 4UDTA 5L9DL 1X7SA 4OLEA 4MMZC 1XDTT 4XO3A 4JFFD 1AQHA 2AK1H 3KCPB 4M4PA 3DVNA 1CXFA 1AD0B 1CGUA 4NNPL 5D1XA 4G6AC 2FT8A 4PJ8B 1QFUL 2BRRL 1OM3H 4OIIH 2IQAA 3L2LA 3UAFA 4JMNA 4LLUB 4NXSA 2VXUH 1I8MA 1U3HC 3TTYA 2OTPA 1XGYH 2WXGA 4QF1B 2WQVA 3LMJL 4NI3A 1HYSC 3BO8B 4S1DC 3WFDL 4AXWA 1F2QA 3KGTA 2QHRL 3U7AA 1CDJA 4O2EB 4PRPD 3C09B 1KTLB 3CU7A 4P3DA 3U9PH 2GUOA 4C83B 1QSEB 5TDNB 4G80B 2NY2C 1DO5A 2F15A 2CKBB 2CK0H 1QSFE 2J1XA 3Q1SH 1K4CB 4XWGH 2A4ZA 4QOKA 2CHNA 4UT6H 4L4JA 4JO4H 2FEJA 3RX8A 3TS8A 2AV7A 3FQNB 3RWGB 4GH7B 3A47A 4RFEB 2G2NA 4RDQG 1FJ1A 3UIYA 5TE6H 1OP3K 1A6ZB 1MKFA 2FX8H 3GRBA 1TCMA 2G5UA 1FN4B 1OSPL 5FYJH 5L2KB 2DIJA 1A21A 3FT3A 2A6DB 2ZSWA 4B6ZA 4FXLA 3FBKA 2UY7B 3FT1A 5H4ZA 4XCEA 5H35A 1LO3L 2AANA 2PETA 2PUQT 4JZNA 4FA7B 1LO0L 3VD9A 1L0XA 4N0FA 4NUGL 2I85A 2O5YH 1N4XH 3WELA 3VI4B 5JNYB 4JQIH 2OTUA 4YLQT 4U1HB 5FCUL 3PXLA 4WEBL 3TVMA 3P4LA 4Z7VE 5ESVA 4ECNA 1HILB 3D33A 1BYPA 1R5IB 3HAEH 5KYXB 1LD9B 5EOQL 4PJDA 3QPQC 3FF8A 2APTA 1JZJA 4MCNA 1NCJA 4KWUA 4MMZA 3QIUC 1ULVA 3KYKL 2Y07L 4XB8A 3SOBH 3Q05A 1DSWA 4NC1C 4IOSA 1WAAA 4HU2A 2IDCA 1PD1A 4MAZA 4G42A 4WI7A 5JXAL 3MLVH 1TTCA 4NQCE 4MS8D 1UM6L 3SDXA 2TAAA 3QO0A 3ESUF 2EADA 4FGMA 4PREB 5TQ2H 1AD9B 1RZ7H 3EJSA 4UB0L 4LPWA 2GTZA 3BD5A 2F19L 3O4LE 3VI3A 1Z66A 4PRID 5G5DB 1U3HA 1BX2A 4WI3A 3TEZA 3PGDB 1E6JH 5C70A 2UY6A 4WI9A 1HDMA 4HVBA 5JHAA 1T5WB 4NENB 2AKRA 1DDHA 2W1NA 1LJMA 4EN3D 4KAQH 4P2QB 2LFEA 4F9PC 1FLRH 3AS0A 4OFQA 4QO1B 3S34L 2I9TA 4LAQH 1PX4A 4Y5YC 2DMCA 1QRNA 1PDKB 1FNEA 2EVJA 3B9AA 3W9EB 4LVNC 2MOGA 4JO2H 5BOPA 4WW1B 3LRMA 2VC2L 4F7KA 2VOTA 4X9FA 1DVTA 1HOCA 4LLQA 1XGRB 4K94H 4UT9L 5AOMA 4B27A 2CJUL 2N59A 2ZKMX 5TDPB 2OQJA 4GXUM 2X6UA 3FN9A 4DCQA 2P4AB 4TM9A 3LHAA 4NO2A 3RWCA 3EYQC 2GK0B 5T8IA 3HZKA 1YYCA 5MP6H 4A7GA 2CO3A 4PJCB 4UILL 4JY6B 2J5LB 1EO8H 5FYKD 3UAJC 3O11B 1H6UA 1X4XA 4ONFH 3TH4T 3UXFA 3AABA 1DJGA 3BUBA 1BAWA 1UM5L 3JV6B 4Z7VF 3TBTA 4V2CB 5CZVL 1ZPLA 2A38A 1J5HA 2QTVA 2ESVE 3LIUA 5D4HA 1JHTA 1GGBH 3MRMB 3UYPA 4F33A 4LK4A 4M29A 2J88H 2IANE 2Y4SA 5CILL 2R0WL 2NYKA 4GQPH 4M56A 3VX0A 1JK9B 1GJWA 5KSAC 2E8ZA 3I50L 3W0WA 4F91B 3G6JB 1BF5A 4KRPD 4N2AA 1CDIA 2V8LA 4KO7A 1TETH 2J8UA 1JPST 3EOTH 5TDOA 5FYJU 4YVNA 1OGAE 2NLJB 3O6MH 5DD6B 2WQAA 4MD0B 5F3BA 5IV2B 3ZUNC 1MFAH 4YPJA 1CLOL 5HGBA 3QIUA 1AQDA 1E4WH 4YPGA 3KMDA 1F5WA 3QDME 1X9LA 2DMGA 4LSVL 1UB6B 5F3HB 1KGYE 4KZEH 1KBBA 5GGSA 5C7XL 4AL8H 2AXHA 1CXLA 1KGWA 5F7FA 5JOFB 1FC1A 3WN5B 4DP2X 3R4RA 5JOPD 2CPUA 4DPAX 2AMGA 2WCSA 1FORH 3C6LB 4AZ8B 4APQB 1J9SA 1JNLL 2DQEH 3PAUA 1AQMA 1XGQA 3BWSA 3NAAH 1QACA 4UYQA 3ZDYE 3QDJE 3LX9A 2ENJA 3DURA 3H9SA 4YQXH 2FLMA 4DO6A 1WA0X 3FZUD 4H13C 1JWSB 3HRZC 3L5JA 1MRCH 1PEZA 4F9PA 3B5TA 4FABL 3QEQE 1IAIH 1FFQA 2EKSA 4LOUD 4Y5YA 2PCYA 3OLEA 4PTUB 5C0CE 3ZMRA 5IT2L 3TJHD 5SWQA 3Q2NA 3KGUA 4PU2A 5I82A 5DCCA 3U7WH 4JG0H 4XCFL 2BSRB 3E7JA 4R7XA 4AQAB 4PV1C 3MODH 4DPBX 3NEXA 3VGFA 1H3PH 1Z0NA 2YRZA 5J13C 1D5ZB 2YA1A 3ARFC 1JIBA 4H20H 2J1WA 4Z1PA 1I8AA 1UEYA 1A6WL 1RJYA 1KYUA 2VITB 4BXVA 3BP4B 5IIEB 4UBDD 4QRPD 1OGTA 3RY5A 1PLGH 4J1UB 4FTDA 4ZUWB 4ODHL 1ACZA 3NTCL 2FGWL 1JTTA 5KSAA 4JRYD 4ZMTA 3KH3A 1OCCB 2ADIA 5DZNA 1N10A 1RUPL 1WBYA 5LGJA 5DHVB 4XTRC 2OR8A 1TZHB 5DUPL 3QK0A 3UTPE 1UTDA 3MYZA 2IOOA 4QJ4B 3WHXA 4NC0B 2BS9A 4M7KL 3CHOA 3WNOA 4F92B 3AXHA 1RUKH 4HOZA 2V17H 1ASQA 3ZPDA 1YNKL 2AJUL 1IKFL 3EXLA 5SWZD 3EGDA 2Y7QB 3WKPA 1A4KB 4OCSH 4YR6A 4DP9X 1ACCA 3BDYL 2Y5EA 5D6DC 4QTHA 1E2VA 5IB4B 4LSTH 5EEVA 1SVZA 5I15L 2F53B 2JFCA 1EA9C 3FB6A 5EC2A 1EAJA 2EJ1A 2X41A 3TO4D 3L5XH 5DJDB 5FPIA 1UWEH 1Q72L 1ND0B 2AXJA 3GIVA 3ZYOA 2K0RA 4BKLA 1FAKT 3OHXB 5AB9A 4L3EE 3QIBA 4XVJL 5GRJL 3HRZA 5DK0B 1FQ9C 2AJVH 3H9HB 4TVPL 2WWMC 3NCJL 3ILQD 4R26L 3X14B 3P0YH 3LB6D 3IDYB 4JPIB 3FB8A 3W1ZA 1OOAA 2DQTH 1CR9H 2NY5H 3CZKA 3BVXA 2DLIA 1DFXA 3ILDA 4IRZA 1YRKA 3T0BA 4C57C 1T03L 2XZAH 5IQ9A 4F2FA 2PXYB 2C1PA 2Q7NA 2B08A 3APDA 2WZ5A 5HI3D 1GGCH 3T2QA 2EYTB 3WE6A 1JFHA 3AWEA 3ARFA 2MOQA 4MYWB 4NKOA 2X70A 5MEOA 3NN8B 1ZDQA 3UGEA 1M7IB 5AOLA 3EFFB 4BWWA 1H3UA 2C9XA 3MRHB 5EO1A 1XAKA 2D7TH 3QUGA 3VRJA 2CKBL 2FJGB 4KJYB 4MA8L 2R56H 3VVWA 5J7CC 4TUKH 2H47C 4UNVA 1BZQK 1F1GA 2CBOA 4MNQD 4U3XA 4M6AA 4WI2A 3QCUL 3ZGIA 1DQDL 1MQKL 1VACB 3NCXA 4IMKC 4OVVA 1QTPA 2VDMH 4YBHA 2K4AA 1JGUL 5HYJB 3L9RB 1QYGL 2DQJH 3LRSA 1HU8A 3GKWL 4R4FH 5GZND 1ETA1 5EU7E 2BX5A 3FQXA 3W9DB 3HPJB 3Q43A 4P48A 3GI8L 4PEEA 25C8L 2ALWA 2VZ1A 3L13A 2RFXA 3EH1A 4Y2DC 3FSAA 1Z9PA 4NM4H 2C26A 3STLA 2QADB 3T0EB 3HMXA 1J87A 4KRNA 3MRIA 2VMDA 1GC1H 2CHZA 3O3BB 3K81A 1G0YR 3MNVB 3OR6B 3UAEA 3QJFA 4GMSH 2QFPA 4OI7A 2FRGP 2JE8A 1ID5I 4WSJA 4M3KB 4MB5A 2BZCA 3FO1A 2P7TB 5TQ0H 4EUPA 3OJDB 1MI5A 2LAAA 2E27L 2YAFA 3L1OH 5C92A 2EDLA 5KVEE 4YL4A 4W70A 4NLHA 1BD2E 3NRQA 3LSOB 4U7SA 3AG1B 5H4YA 4NUJB 3MLTA 6PCYA 4ZOBA 1AHMA 2UYLA 2R0ZL 3BFOA 4G6KH 3IF1B 3HE7C 4W9LC 5E8DL 1JPSH 3GMPA 5F96L 2FQGA 3T04D 3QZMA 1A3RL 2DQCH 4E9WA 1RZKC 2WB1A 3ULUE 1J8KA 1AIFA 5GS3A 2DQHH 3NIGB 3F58H 1VEPA 5GZOC 1TMCB 1U8JB 3RVXC 4W6WB 4PGEA 4BH8A 5IB1B 1ECZA 2X4SB 3OM3B 1RZGA 2OMXA 2NX5A 2MQ0A 1MG2C 2WKOF 3D9AL 4XOAA 3WGUB 3HVDA 1HQRB 3IDJA 3ZDXE 1N5AB 2CCLA 3K4DA 2VIRA 3RPIB 2YRPA 4Y8DC 1SVCP 1D5XA 4JHUA 4KHTL 4C55A 3AG4B 4AIZB 2EDTA 4X0KB 3IK2A 4RAUA 2BY2A 4QTIH 4WO4C 1TTBA 5LG6A 4IRJD 3IFPA 3ALPA 1MREL 1KEGH 1N6VA 4M8RA 4N86A 1IBFA 3M46A 5DFVD 4IMKA 3CZUB 1X5MA 4IBTA 3VFSA 1ASOA 4R7DB 4KZ0A 1OAKL 3ZIYA 4YSOA 3UERA 3UBXG 5DYOA 4XNAA 4P4KD 3EJZC 4NX0A 1F6AB 2PW1B 4DSYA 3GMLA 2WJ7A 1SF3A 2FIRT 3N1GC 1T21A 3QISA 4BFNA 4G7YL 1RURL 3OZLA 4LSUH 2EDWA 4NB7A 4P23D 3JWNC 2F74B 4W9GC 1WS8A 3CK0H 1JGLH 4OW6A 3HBPA 5AVYB 3RE0A 3VO0A 5GRVL 3ARGC 3SDCC 2FD6H 5D7JC 3I74A 4GBXB 1KLGA 4JFDB 9PCYA 4ZUVA 3B8SA 4JLRB 2OL3H 3BGAA 1UCTA 2YUWA 2DB8A 1TQUA 2EE3A 4G8IB 3TWCH 5AL8A 2YSSA 3G6DL 5K1NA 1OE3A 3AREB 2WKGA 1JD7A 2JCCB 1UWGL 1IC7H 1YN7A 2APSA 5DU7A 4J3OG 1UOLA 1O5DT 5FKAB 1PGRB 4F27A 5A7BA 4DGVH 1IEBA 4KDVA 4ICWA 1YNTF 2X4TB 4X42A 2AK4E 3FFCE 4WSKA 1E65A 4IDJH 3ULUF 4FA8A 4AQEB 3JV4B 1XCTA 3CDGA 3U79A 2W59A 1EBPA 5F7EH 3TYFA 3QWRD 3HE7A 5D4JA 2VRQA 3W5MA 5EU4A 3ELQA 2AQNA 3TEWA 2F1EA 2QQQA 4UI2A 4TULH 5D1XD 5LBSL 5C0BD 3ZDXF 4XNUL 3N6YA 1W9XA 2EP6A 2ZIDA 2B20A 2XIDA 2Y7OA 3DGCR 2ZCHL 1DQVA 2DM4A 1MVYA 3B4NA 3SCMD 3IM1A 5GZOA 5IW6B 4D0CB 4PJ9B 1DLHB 2QHLA 2LLNA 1ZHBB 1I1AD 2XWXA 1EEZA 3AQDA 5B7MA 3QRGL 2I7OA 2ZYHA 2CRZA 2QSQA 3RI5F 1ZHNB 3RY6A 1MW1A 1D5MA 3STZB 1W72B 4OD1H 2RQ8A 4X6CB 4WO4A 5DRWB 5LWYH 4ZS7L 3JTTB 2EYRB 5HHOA 1NIFA 3CLEH 5AKRA 3PHQA 5IHHA 4AVIA 2VZOA 5E4IA 1RZJC 3ARYA 4AEEA 3MAWA 1RHFA 2CO6B 2ENSA 5L7XH 2J6EL 2AJ3A 5F7HA 1Z2KA 5FW6A 5HI4D 3K1DA 3HUJF 3GBMH 4QHUB 3ATAA 4CKQA 5DJXA 2Q6WB 3WFCH 3CH1A 1XAUA 5DQ9A 4ZTOL 1REIA 4ZO9A 1SHSA 1BVZA 2XOTA 4OF3A 3GYRA 4ZXBC 1WDAA 3ARGA 3SBRA 3SDCA 3WG7B 5D7JA 5I19L 4UOW1 5AZEL 4YS4A 4DP6X 3GB7A 7PAZA 1NSNL 1XGTB 3I6LD 3F6JA 1D6VL 3AZUA 1SLXA 3HZVA 4P46C 4H0GA 4JR9L 2VLME 4N9OB 1E8YA 5E8OB 2ADFH 1DVZA 4TNWF 3S98A 3LOWA 3PV7A 3LEYH 1IRAY 1AZVA 3UC0H 1Z7JA 4X99A 4M1DL 4O2CA 1LDSA 1TO4A 4MB3A 2BIQA 4XBMA 3BEVB 3IN0A 35C8L 3IBOA 4LVOC 1KJMB 4LF3B 4A66A 2YD1A 3P11H 4W81A 2QKSA 3PGFH 3MCLH 3D3VA 3CXDH 1UD3A 4G9FD 4MDIB 3QS2A 3C75A 1FFTB 3K2IA 3IU4L 1B0GA 1HAWA 3BQUB 9CGTA 3ZRFC 1JHLH 5KYYB 2XKNB 2ZPKH 3C9NB 3H6JA 5DVKA 2D4FA 1S4IA 4XHJC 5IKCB 1G1YA 4OY9A 3HAEG 4MGXA 2QVTA 4YIQA 2Z92B 3PDOB 3EYVB 4HQQH 4FN0A 2VISB 3EO1B 5KSUA 3PWUB 4G5ZH 5AB0A 2PCXA 2X3AA 3ABMB 2XPGA 2H1PL 3T0AA 4XX1G 4XX5A 4FG6D 2IGTA 2YEVB 5KSVB 1CD8A 1NFIB 1FNGB 4JJ5B 4K71C 3BE1L 4PUBL 1FL5B 4KROD 4OTXH 4JDVB 4Z23A 1R0AL 1YEEL 2OCJA 1LP9E 5I28A 3VFTA 5EDXA 5IW1A 4PHXA 2AJYL 2VTFA 1NAKH 1YN6A 1MFEH 3U0WH 1XZ0A 2CSPA 1QUNB 5ID0B 2C3WA 3VXSE 5KZCB 5GS0L 4LEXL 3LNHA 4HPOH 5EBMB 1E4XI 4ZYKB 1FFPB 3T2NH 4YSQA 4PW4A 3V8OA 1N26A 2DM3A 3LN4B 5DJAB 5SWSB 4QRRA 2V8MA 4J4PD 4PS8A 3GSRB 1ET8A 1FIGL 2VH5L 4X4YB 3FUFA 1QA9B 3TF4A 4PB9H 1ZT4B 3IMUA 1FYTB 2HUEA 3T8MA 1AS8A 1KEMH 4ZXBA 3BZFB 1YECL 5EOCL 1Z3GH 1NCGA 3DGDA 3IB4A 3NYKA 1JYNA 1D5IL 2CO7B 2NW2B 1D9KB 4ZOCA 4GKZB 1R19A 5DS8A 3V0IA 4OGXH 5FYLD 1KUMA 4XMLH 1OT1A 4WUUD 2HT3C 2ICWJ 2XFXB 3INUH 3V7AE 2B39A 3PWPD 1JWMA 3SJVB 4Q9CA 3LXUX 4FQJL 5IFJA 1C5DA 4K5OA 1L0QA 1RLBA 3NA4A 4DH2A 2JJWA 4N5ED 2XX1A 3MOQA 4AQ1B 4NWTH 5MERB 3L3HB 1HEZB 1V54B 3HC0B 4TNVK 3QNXB 4N22A 3RU8H 3U7YL 2GFBA 2IGLA 4JMXA 2HVBA 1N70A 2E86A 3TBVB 1AXSA 2IH9A 3KPPA 3LEXA 4Z7QE 1X6LA 1AFVH 4DETA 4LRNH 1ADQL 2VXQL 4QHNA 1XIWB 1G87A 4NN6B 2EKJA 2JKSA 3CSFA 3MZTA 4AIOA 3RTQC 3I75A 3JWOC 4HC1L 3MROA 3WSQH 2H2PC 2VXTL 4JKWA 1Q90A 2BIOA 2O5XL 3KLAA 4KO9A 4F15B 1HWHB 1QHOA 1J5IA 3QDHA 3RA7L 4WWKD 2AJXL 1FVDB 3K1KC 4LOFA 1T7YA 3GXDA 2ICEC 4XPHL 4F1SA 2YMOA 4PBXA 1UZ8B 3P4MA 4YSPA 3L4WA 5BUPA 1BZ9A 3PU7A 4OKVA 2VUYA 2J3SA 1EJFA 2Q7AA 3ASOB 3CCHA 4DFHA 4ELKB 3A23A 2NNFA 4XZUA 1GL4B 1HHIA 3BD4A 3DRQA 3QQNA 1ETB1 4OH2A 5CJOL 1U9KA 2ICCA 3HS9A 2D0FA 2VDRB 2WV3A 2DM7A 3WV0A 2IOIA 3O3DA 1Q94A 3L1FA 2P8LA 1KCVH 1JV5B 3ZQ9A 2BP8B 4AITA 1JWUB 2PP8A 2X4UB 4TPRH 2BNUA 4G1MA 4AKPA 1U6AH 5A2JH 4EKJA 2VLRA 4E68A 3E0GA 3OQ3B 2Z31B 4JY5H 1RJLA 2DY2A 4NQDA 4PJFA 3WJMB 1CYWA 3VWJB 4FULA 4G43A 5F7WC 3BWAA 2B9BA 4JNXA 3EJYC 4DHLA 1QQDB 4L9LA 2WUCH 1G9NH 2CMRL 3NABL 4X4ZA 3S88H 4M6ML 1YJDH 3P77B 2VQ1A 5I6XC 1FCGA 2CAKA 4RZCA 3RWIA 1J1PH 1NUNB 4P5TB 4Z7QF 2IOMA 5IFHL 2FBOJ 5ALCL 2AVFA 3DETD 1BAFH 5FWQA 2PO6C 4RFOL 5JIIA 2H7WA 3NP4A 2Y06L 4WV1B 5HD8C 4AK1A 2WVVB 1KCRH 2JTYA 1OPGL 2ZWYA 1U93B 1XGPB 1AE6H 3J27A 3CJJA 4A37A 2WWKO 4BYHA 5DSCB 5CCHE 2H3XC 5F1NB 2L7QA 2PPAA 2EH8L 4NUQA 1NBVL 3FB5A 1LMKA 2VJ8A 2QGCA 3D50A 2J4WH 1TQVA 3DVGA 5CHNB 2NOYA 5HJDA 3S3CB 4A7SA 1WZKA 4FFWD 2Y2WA 4N2LA 1DVFB 3CZNA 1E5ZA 4LEEA 4QOKE 2RMNA 4RDBA 3A24A 3RTQA 4HSCX 1GRWA 4HKJB 1WA2X 4B9JA 1KFGA 1NDMA 3BESR 5T3XH 1WA1X 3RL1A 4AX3A 2APWA 1JRHH 2WTRA 5CEZL 1J9CT 1QLEH 2H3NA 2ICEA 5DTFB 5DUBA 1A0QL 5FIEA 5J6GA 2VZ3A 1U8KA 1VFBA 2DEXX 5AOIA 4H1LH 3TT1H 2W65A 3PL6D 4HUVA 2WNKA 4ISVA 3OAYH 1SBSL 5ESAB 1YEWA 1NOLA 1OXYA 4L18A 3NSCA 4NNXA 3P02A 1H6TA 4Y19B 4BUQA 2YGNA 1MIEL 4OCXH 3TH3T 2AQRA 2AXFB 5AVVB 2CLVB 1EGJA 2XN9A 4TUJB 4IBSA 4FEMA 1A1MB 5DC0A 5JIKA 2P42B 2YK1L 2JI2A 4JFQB 2X4RB 4B96A 4OSUL 1WLHA 1C5BL 2EDNA 4OD3H 3UZQA 5C6PB 5J4MA 4X9GA 2MKWA 4PJDE 3EBGA 4KK5D 4N2BA 1RK0A 3SBWA 1TPXB 1W72L 3ZT5A 3ZSTA 1CZ8H 2CRMA 1SQ2N 1WAAE 2Z35B 4MNHB 2FYVA 1X5JA 4YHLH 2EZ0D 3EYUL 4DEWA 1E27A 1NUFA 2GW5A 4QRTA 3VU2A 1X9UA 4CILA 5IMKB 1E9OB 2XZQL 3MXWL 4NO3A 1BXXA 4L4TA 1JNNH 3KE0A 2AW2A 4YWGH 3VI3E 4FOMA 4P0DA 2DJUA 3MUJA 2R0LL 3TN0B 2GQHA 1IGTB 1MRDL 4X5WB 5I16B 4OVUA 4JVPA 2PO6A 4IBZA 5DGRA 1CLYL 4NO5A 4AYDC 1ORQA 2N1KA 4H0LC 2C9PA 4G7VL 4XNZC 3VX1A 2XV3A 4F3FB 5CEYB 5HJ3B 4UQ2B 2OMZB 4OZ4A 1G7PB 2AERT 2OK0L 5ICXB 3V0WH 1EHXA 4EDXB 4JVWA 3TO4C 1QRNE 4OIBA 1B4RA 3KYOA 4P4RA 5I1DA 4NXKA 2OYPA 1UKQA 3DX9B 3F7YA 5KS9A 2G30A 4B41A 3X1FA 1JZGA 1G1KA 2L7EA 3QUZC 3T2LA 3Q2VA 2NY4C 3D08A 5F8QC 1CMOA 4JKPH 2ADGB 2ZD0A 5HDOA 1WD8A 4PP2A 1KB5B 3E3QC 4HDIA 4KGJA 1EMTL 2R2HB 1ZLWK 4B95C 4DVBB 1X7QA 2MNUA 3UMTA 4DEPC 5ICZB 4QJ5B 4L3CB 3II3A 3O0RL 2GSIB 1OP4A 1YYLL 1U8CA 3OAUL 5I8EB 3RFRA 1P7KA 3Q3GA 2BLFA 2H32H 1IMHC 1YEDB 5FYLE 1PVHA 3UBXI 1KPUB 4PJDF 1L6XA 3MBXH 3F04A 3I3DA 5HI3C 4I0PD 4ALAH 1L9PA 1SHXA 2Z8RA 5TJWK 5JHMA 1K85A 2X9YA 1M4KA 3BHBA 4QKXB 2F5AL 4Y4KD 4Y5XB 4QAMB 4R8WH 2WUBL 1X5XA 1ZTXL 4K8RH 3W0WE 4K7PH 3D51A 1WAAF 1CBJA 1LO2L 3U4BL 3ETBJ 5CJXC 2J8UE 1UCBH 3GSOB 4E41D 1T2QH 3QCTL 3H9YA 4Z95L 5FO8B 1J11A 1OVZA 2R59A 2WXOA 3OWRA 3QDMB 2UZIL 2R7EB 5E8PA 5E2UL 3V4PB 4Z3TA 1FFNB 5IBTL 1MCKA 3IJ8A 4NCC2 5EWIH 4NC1E 2YEZA 3HIZA 4NQSB 4X6DA 5C09D 1SNRA 1CD0A 3VFPA 2YMXL 4HUWA 4Z7AA 4X9HA 3G04B 1F4XH 2PTUA 5D4IA 4ZS6D 4U1GC 3MJ9L 2AI0H 2VDPH 3D0VA 4QNPE 1N6QL 5I9QB 5GSRB 4TQEL 4A7UA 5IEKA 3ULVC 4FL4B 2HG5B 3QDAA 4LKCB 1QFPA 2R2EB 1P1ZB 3FT4B 3H9SE 3FTGB 3G9VA 3NSXA 1NIAA 3OKEA 4HJGB 3RKPA 1WHPA 4BELD 2ZNXA 3QIWB 1DJSA 2XTJD 3V5HB 3HHSA 4AW4A 1IGIL 4YDVB 1HKLL 3GMRA 1FV1A 1BQHA 2UVEA 4WDIB 2X89D 4A7GF 2LGNA 1JK8B 1QEWB 4C56D 1QI5A 4DPCX 4MSWA 1KCUL 4HH9B 3QUZA 4S0SD 5K9OB 2HFGL 3MO1A 1KIUB 3H7BB 4P8QA 4JQXC 2YN3A 4P2RB 2P47B 1MXGA 5IB5A 3RNQB 4LCYB 3FNKA 4JPSA 2C34A 2X09A 5I1EL 5ICYB 3QG7H 2A4CA 4IRSD 2FQFA 4U1KB 3U46B 2YBGA 1DSFH 2XWTA 3IDIA 4JFPA 4F9LC 1AVAA 1UT2A 2PTTA 1OP3H 2J8UF 4KKBD 1ROCA 3LKOA 3NFPA 4WSGA 1A65A 3KPNB 3MGOA 1W6LA 3MMEB 3ES6B 4U7MA 5I66B 3H2QA 3VXRE 4M62H 4HIEB 1B2WL 4KTDH 2Z91A 1OARH 4OT1H 5GGTL 3S5LA 2BOBA 3JQOB 4JGNA 4OBRA 5GISL 3DVFA 5CJXA 1NFAA 1EUUA 2PW2A 1RZFH 1UOVA 4L2YA 1MWAA 2EIMB 2ZWNA 2DMHA 2MKLC 1F90L 1L9QA 4PGCB 2P46B 5AG9A 4LSPH 1V5JA 1KXVC 1NLBH 2C7FA 4QNPF 3BDXA 1QKZL 1KN2L 3BRFA 3BLKA 1N7MH 2FNBA 3QUKA 2VDRL 2YKLL 4N2MA 1U8NA 2AEPL 2VERA 5T1KD 1VIWA 1VPOH 4M93C 4HEPA 4PV9A 5I2IA 2BVQA 3UIZA 3HZYB 3K5SA 1RD6A 5C2UB 2AGJL 5AAPA 4MJ6B 4GG6F 4XPGL 5F2FA 4N68A 3FOLB 3B37A 5JZ7D 3RGHA 5MEND 1JHKH 1XR8A 4PJ5A 2QSCH 2A77H 4OCWH 3F8UB 4CVZA 4JX0A 3N3EA 5H37H 2CPCA 1GHFH 2HG0A 2LU4A 4NHCL 2BP3A 1KACB 3NIFE 5BQ7A 3NFNB 2AF2A 5D70L 2VL5B 1Q9OA 5JQ6H 3VD4A 1X3DA 4FKKA 3SKOA 1EUTA 3X11A 4CMMA 1I75A 2LV4A 3RKDC 3JVFC 4PJGA 3T3MF 3VU1A 5GXBB 1NAMB 1FHGA 2VDKH 1VFMA 5FFLA 1CFNB 4Q58C 2R2BA 4B9FA 5D1ZI 1I9JH 3APCA 1DJHA 4MVBC 2ZJSH 4JQXA 5M95B 4YUEL 1GPOH 1BQRA 4WFFD 3LZFH 4ZJ9A 1DUYA 3QHTC 3OC8A 4LDLB 3BAEH 5HPMA 1R24A 2EO9A 3SYQA 3D5OF 2AS5M 3SZ6A 1KGJA 4NJAH 3S4SB 1ES0B 4PR5B 1MPAL 4F9LA 3B7UX 2C9RA 4ETQA 1YG9A 3S5YA 1JYXA 3GJFA 2E76C 2KLTA 1UM4L 1M7UA 1HE7A 1AKJB 3QXDA 4HS8H 3CN2A 1UWFA 3KWWB 4J3TA 4XAKE 5EHFA 4ZW5A 1AXIB 5DURB 3V55A 3S8WA 4HETA 5DMGC 3T3PF 5AWNL 5TK2A 2BOCA 4FQXB 1RUQL 4IGBC 4U6VL 4PRHA 2V2WA 1AGDB 2QV4A 3IJHA 2EIBA 2F61A 4K23L 1NGZB 4HFWB 4A7VA 1ONQB 3TA3C 1PZAA 5I30L 4X7SH 2IMMA 1MW0A 3BP7B 5F1IA 4UANA 2NW3B 5HHVH 2WQRA 1MNNA 3BZEA 2A99A 3DV4A 3R06A 3ZMEA 1VFAB 3U6RB 2WO3B 2H0PA 1DQKA 2R4RL 4MMXB 2XG4A 4JM4H 1BVNP 3T4AC 4UAOB 1ETZA 2ZCKL 4GSQA 1GOGA 1CFSA 1FH5H 1PG7W 1UJ3B 5JIQA 4ERSH 3RNKB 4KKLC 4ONHA 4QMEA 3BWZA 1KJ2A 1DQML 3GGWA 3MRRA 3LNIA 1VGEH 2IV8A 1TVBB 2WZAA 3NIFF 4PJBA 3MLWH 1SGKA 5CUSH 1MI5E 2Q8AH 4M1CD 4R5XA 3BVUA 3ETBF 1BOGA 3OWEA 4WHTA 5SX4H 3WY3A 1JXKA 1A4CA 4KKCC 2BIIA 4M6NL 3A0OA 4GP4B 5IBLC 1MFDH 2DYSB 3UP1A 5DGQA 5F9WB 2R8SH 3EDJA 4JO1L 4YOKA 5IM7B 2LT9A 2F2HA 4XO4A 5F89B 5GRXG 5AYQA 1HSAB 3BP6B 4IHBA 5IR1B 3L4TA 1J8RA 4XBGB 1CTMA 4DUVA 1G9ML 1G7HA 4J8QA 3ARBB 3REVB 4HHAA 3CZJA 3QWQB 3ZZ1A 3IFOB 4LL1A 4Q9BA 5DJ6B 3SDAD 1U91B 1ZGLB 3KYNB 4A04A 3PIQA 1XBRA 3ZDXB 4HCRL 2GABA 1V3MA 5FB8B 3NCEB 4KY1H 1I31A 2O6FA 3VG0H 4LPCA 4NM8H 3ULSB 5JXEC 3QDGD 4FFZL 2XWJB 2P45B 4M7LL 5HGAB 2NX5E 1DBBH 4TOYH 5MEQA 1A64A 2OX5B 4HUMB 4G3YH 1H15B 1TTAA 2F5BH 3S36H 2E47A 1S3KH 3GSQB 4EI5C 4YSCA 1J18A 1RJCA 4GAGH 3FTVA 4UUJA 3L81A 3PQYD 2O6PA 2CWRA 2ZUTA 4E5XG 4Z5RB 2AC0A 4IGBA 1KB5L 4PVBA 2NQCA 2EDQA 4JUSA 4HD5A 3MUGB 4Y1TA 4YHOH 1JYWA 5T1JA 1Y0LA 4XNQA 4NKMB 4GG8B 5EFIB 1EJ6A 5AVZB 1XMEB 3GS7A 2J1ZA 1XL4A 2AJZB 4V1DA 3BAJA 3BPLC 3HUJB 4KROC 4N2OA 3TA3A 4AH2A 2VXUL 4J6RL 4BUGA 2DH2A 4RRPA 2FT6A 4X8GA 3QYCA 2NY1C 1XGYL 3KPQB 4OGAD 5F7NC 3BPOC 3VWKC 5DR5L 3HNSL 2YWYA 4L3AA 2HPTA 3QZOA 1PAZA 4N0YL 1TJIH 3O41B 2FBJH 4AM0B 1HC1A 2HLFD 4N8VG 4DZBA 2OI9C 1HWWA 3U9PL 1LMIA 1EHNA 5KBKA 3NZSA 1F1AA 1G0XA 1SZNA 3FFCB 1FVCA 2YPLD 2HKFL 2CK0L 3FTYA 4P5MA 2V9TA 4U4IA 4OF5A 3V4PL 2ARJQ 3UCQA 4QY8B 2NQ3A 1P7QB 2RH0A 3BH9A 5CKGA 5EUOA 1XH1A 1IAIM 3DX8A 3LTVA 5F9AC 5E8EB 2FX8L 1UD2A 2YHGA 5CWSB 5H2BA 4NIYE 4XB3A 3PWLB 3GD1C 5E08L 1S7RB 5FYJL 5L4JA 3KWXA 1T04B 2PCPB 3NPSB 5HHNA 2NUTB 5ALBH 3UL4A 3NDYE 1I9IL 1MJ8H 2O6EA 1A9BA 4X4MA 3RVVD 1M42A 4Y16D 3BI9X 3P0VH 3RHWF 4N2IA 5IHWA 4YBLC 5ABAA 2O5YL 4P04A 3C5XA 1N4XL 2XVBA 3DX3A 1MAMH 3PWNB 5JXEA 2APBA 3MQIA 3NSYA 2H0EA 1ZA6B 4HEMA 4YDJB 1S7WB 5C0EA 4GPVA 1G5GA 2HRGA 4ORZC 4PWIA 1M57B 3ZVVA 3QG6A 1O9VA 5JHLH 1GSKA 4EI5A 1IBGL 1RK1A 2VMCA 2X4NB 5JPNC 4Y5VA 4LSQL 5EIIG 1U95B 4HIHB 5E1AB 2AV1B 4YSTA 3RZCD 3LKQB 5HHOE 4AQZA 4BM7A 1AHWC 1MLCA 2AJSH 4HWBL 1M2VA 2QQKL 4TL5A 4HLEA 5I1IL 1GCFA 1XF4B 1CXKA 4WWKC 2XHNA 2IG2L 1FP5A 2BFGA 1ZANL 1KGIA 4KDTC 2EICA 4DGIL 4N2GA 3GSWA 3IDMB 2IPKB 2NXZD 4G6ML 4L0YA 1H9VA 4ILDA 1SXZA 3CSBA 3LKSB 1XSOA 1R5WA 2LU5A 3DUSB 3JTSA 1JV2A 3V79C 4KX8A 3RLSA 4AGMA 3TYGL 3VFOA 4MJID 4KVPA 4MX7B 5A2KH 1AZRA 3GXUB 4NI6A 3K6OA 3VWKA 1ZS8B 2GCYA 4HIIA 1HINH 2ITDA 3O9WC 2EYSB 4FLQA 2OBGA 1CDHA 4JG1H 2ZKHH 1FLRL 3B1TA 1XCQA 1S9VA 5GIRB 4XVSL 2FZ3A 4TUOA 5J6HB 2BNQE 5I18L 2NY0B 4ZSOB 4HUKB 3QUYB 2XN0A 1EBAA 4MLSA 1NLDL 1EXUA 3K6NA 3MV9B 4ELMA 1FZOA 5EU3A 1R3JB 1NCDH 2OMVB 5FUCC 1KT2B 1Y1DA 2EDRA 4P2OA 5I6KA 2FDBP 4HPYH 3HG1D 1QABA 3C60A 4YHNA 5D7LD 3SY6A 3ZX1A 4ABUA 5ISZA 5JHDD 3CN4A 3D3VE 3TIDA 3LPGA 1FBIL 1IL1B 3BFQG 4ONFL 1MW3A 4OZGA 5ETUB 1BGXH 3KLLA 1BCIA 5HGDA 1ZIBA 5FGSA 3DETC 1Q38A 4GAJH 1H0DA 2BVUA 1UH2A 3O8XC 2RTTA 3OKLB 1GGBL 1V27A 4AGNA 5HYQA 2J88L 4QXTB 3AC0A 1WFUA 2P48B 2KH2B 4A63A 4JRXA 5DO2D 4BQ9A 5IGXH 4B9YA 2P5EA 4N85A 3V52H 1NDGA 3CVHH 4ZAKA 3BPNC 3FPYA 4I18C 4AWJC 1B0WA 1I7UB 2NTSP 3GXPA 3O6ML 3QR0A 1RKRA 5ES4B 1FNSL 3EGXB 1FL3B 1NAML 1YEHH 5E0FA 3R19A 4PTTA 3S9DB 5K9KA 3H9ZA 4M4RB 1HAUA 1E4WL 1JF6A 5DEJA 3RGVD 1AHWA 3SKNB 1M1SA 5F21B 4B5EA 3CFEA 5T1LA 1I4FB 1DDTA 2XACC 3QZWB 1QO3B 4FQIH 4KZEL 3DO4A 3S35H 4AL8L 4ODBD 1MH5A 3FFDB 3UDWA 4LLWA 2Z93A 1IU1A 2IGFH 2JI1A 4QRRE 4KKZA 5L4FA 1XQ4A 1KXHA 4QT5B 4PWFA 4OQTL 3DTXB 3IT8D 3LIZH 2AFNA 3PP4H 2PCFA 4KZDH 1XH3B 2X88A 3RY4A 3IVKA 1L7TH 3B5GA 5CJQH 3W3BA 3HC2A 5D2LA 1PSKL 4ODUA 4MHHG 4HOWA 3O9WA 2DKMA 2XX0A 4N24A 2MCG1 4JFOA 3B1UA 3E8UH 5IF0B 2AEOA 4BZ2L 1WZMA 3A6OA 1ZVSB 1IAIL 2A0LD 2B9AA 2VNCA 3DOSA 3NFSL 3CN1A 2M8XA 4BZYA 2CQVA 3EGSB 1Y6MR 2NY6C 3GBNH 3MRCA 4AIEA 3VA6A 4JHWL 3RZWA 3KVPA 2Y22A 5HDBB 4JZJC 2J21A 4N3UA 3ZKSD 4D0BA 4WFHD 4S10A 5KVFH 2X3BA 3M88A 1NCHA 5FYKH 4PJ8C 1K72A 5E70A 1HHJA 3GUFA 4HCGA 4LPXA 1IARB 2ROXA 1K6QL 1H3PL 2FK9A 3CUPA 3FUKA 3BUQA 3ISYA 5C6WH 3OXRB 1N2RB 1I1YA 1LK2A 2R1WA 3BAKA 3EBAA 3BLBA 1VCBC 4FZEL 4NQUA 5DEZA 4HXAH 1A02N 2G3XA 5HYSB 3ULUH 4HV8B 3KDMB 4XPFH 4U1JB 1THCA 3CFJB 4CAGA 4A7QA 2HB0A 3O8XA 1PLGL 4UCFA 5JQIB 4RMRA 2DWTA 1OSZA 1P1VA 1ML0A 2D73A 4H8WH 2GB2A 4U4BA 3X12A 3GUTB 3D4ZA 3MOAH 1CICD 2ZYRA 1GMEA 4RCAA 3F7RA 4UDUB 3TBWA 3W81A 4I3SH 4DKDC 4WO0A 1F11A 2X4QB 1MCFA 5EBWB 3LD8B 2VLLA 3C8KA 2GEEA 2D7OA 1KCSH 3IDXH 1F4HA 2E9JA 5FUZL 1AP2B 1S9WA 1OLZA 1RUKL 2ZG2A 2JXMA 2YD2A 4N9GB 4Q56A 4PPTA 3NOIA 2CGRL 5DF0A 1RULH 4HFUH 4GW5A 3L9EA 4JN2B 2JKWA 4NT6B 3EHBC 1BXAA 5BS0A 1OCZB 4OCSL 2K6YA 4CJ0A 2VAAA 3B9EA 5CP7A 1KBWA 3QSKB 1UGNA 5ITBH 4IOFD 3DVNB 4HT1L 2VB5A 3NACH 2VLRE 3ECBA 1HH9A 4JFED 4NQDE 4NBYB 4PJFE 2EXYD 3MCKA 4TSCH 3R8QA 4Y4KC 4JPKH 1JI1A 2BS8A 3T2OA 1LM8V 1H3GA 3QQ9D 4BHUI 3WIIH 4HALA 1KJVB 4R2GC 5DRXB 3DX1A 1IBZA 4WI0A 3PP3K 3KCPA 4WTZG 2MOVA 3U1SL 4AXWB 1AD0A 1TQCB 5FGCB 5LQBH 2DQTL 1CR9L 1WBZB 1KGUA 2B8OT 2LW3A 2NY5L 4JZJA 4CN1A 4OZIF 3A67L 4KUZH 3LVTA 3KPRA 4NN5C 4P3DB 4PJ8A 3NIDF 1VA9A 2E6JA 3UTQA 1RIHL 3N85L 4ZFGH 3TNNA 3OQRA 1BBJA 1IC5H 3FPXA 4P9HC 2QLVB 1AG6A 4J3XA 1TZGH 4QOKB 1I3RB 4PCTA 1II4E 3AY2A 1R4XA 3BQVA 1FZMB 2MNJB 4UOW0 5IG7A 3BO8A 2UXFA 4YL9A 4ZNCD 4G8EB 4MJJA 1NEPA 2R56L 4O2EA 4HU8A 2I27N 5KANG 4U0RB 1KTLA 5D7SH 3S0PA 4OLYH 3X3GH 4C83A 4ZW7A 1QSEA 2ICWB 2NY7H 5TDNA 4G80A 4A55A 3KDPB 2D4DA 3KHQA 5F7UA 1EZUA 2APXA 2CKBA 2GJJA 3DXAA 3PPEA 1BQLH 5DUML 5CGBA 2HYMA 1SXAA 4KRLB 4JZNB 2G4EA 4MA3A 4LB8A 4OFKA 1Q1JH 3FQNA 1JZ6A 2WZPA 3RWGA 4X5RA 5DVPA 2HFEA 3TH2T 4RFEA 1P0SE 1QWHA 4PV8B 2WM0A 2W92A 1F3RB 3HS0C 1X5YA 5DUJA 3UG5A 4OV5A 1SHMA 3CDZB 5JA8B 1XXDC 1FN4A 2J5LC 3HJ0A 1VDGA 1HXMA 5L2KA 4XPTL 4PJDB 2A6DA 2HLEB 4YE4H 4R7NA 1NIBA 4PJFF 5AKTA 3W5NA 3PPSA 2XN9E 2Y72A 1BG1A 2BZDA 1URIA 5ADOH 2HRPL 1F1DA 1OAYL 1UKTA 4D9QD 4F7EA 1FDLL 2YD9A 5AW7B 2HRHA 4ZD3L 4CADA 4G42B 4CU6A 2Z4QB 5JNYA 1E5CA 5EZPA 4K7PX 4JDTH 4U1HA 3V9FA 4LLMA 3QO0B 4A2DA 1B4JH 3TT3L 2DIBA 2DS4A 4FQ2L 1FAIL 2E9IA 5KYXA 4U3SA 2BIMA 3P0GB 4YNYA 4WVRA 1UASA 3V2AR 3IRCA 1BJMA 1FGVH 2HT4C 2WSKA 2Z0BA 1GH7A 3A3YB 4YBQD 3NGBC 4G6KL 2UY6B 5LN8A 4L4TE 1HDMB 1JPTH 1W0YT 3HMWH 1TSRA 3MV01 2MCAA 2ZICA 3N06B 2DQCL 2E0PA 1GSMA 2EUWA 3F84A 3EF7A 5FK9A 1LYQA 2I9TB 5BOZG 3D05A 1PMYA 1AD9A 2DQHL 4PY7A 1ADWA 2NY2B 3H8NA 1F97A 5GGQL 1MCPL 5G5DA 1MJJA 4AG4H 4JQVA 1OD7A 1HZHL 2YAEA 4W9KC 1RV6X 2YXFA 3PGDA 4LBEB 2ZXWB 2WBJD 4JFZL 1T5WA 3OAWA 3ZO9A 3LZOA 2FEEL 4P2QA 4GAYB 2WB7A 4G9DB 4JO8A 1SDDB 5KS9E 3X2QB 3HZKB 3BX7C 4QO1A 3N42B 4QTIL 2RA1A 4HJ0C 4YGAB 1T66C 1KEGL 1PDKA 2TSAA 3CG8A 3D25B 4FCAA 4WW1A 1VHPA 3RIFF 3D85B 4TYUA 1BJ8A 1XGRA 5DVNA 1UB5B 1GJIA 1T3FB 5TDPA 3N1FC 1I3GH 1BXUA 2VR9A 4GAFB 4WWID 2G60L 4CNIB 3HS0A 5HHMD 4LSUL 3U36B 4HWNA 3QQ3B 2CM5A 4PJCA 4JY6A 4Z7OE 4UV7H 1EHKB 5F3BB 5G4MA 2EDXA 2MPAH 3JV6A 3TNMA 2WLZA 5HGBB 4HIPA 4MCZA 2Z3FA 3M17B 1QNZL 1VJSA 3MRMA 2NYYD 1EZLA 3VQLA 1S5IL 1A4JA 3WN6A 1DEDA 4HJEA 3G6JA 5I6MA 4GOSA 4J3OD 5KJ4A 4DGVL 5JMRA 3EAKA 4UV4L 4BSJA 3CSYA 4MJ5B 2NLJA 4X6DE 3UGUA 3BVVA 3BH4A 5DD6A 4MD0A 5IV2A 4JPWH 3QCVH 2XSKA 1R33A 5HDWA 2Q3AA 1QLEB 5EIQA 2AEWA 2FSEB 3I3EA 4JRLA 1L7IH 4I3GA 4R5VA 2FB4H 3H9SB 1RSYA 3GDCA 1IJ9A 1FO0B 5F3HA 1QBML 3MV7D 4KO5A 2JELL 4GG6B 1U8PB 2UZYA 3LZPA 4Y5YB 5JOFA 3PJSB 5KS9F 1HL4A 4LVNB 4ZODA 2GJ6B 1C16B 4QDGA 3K0YA 5LBSA 4FMVA 4AZ8A 5KWYC 1QFOA 1ZSDB 4E42A 4YSDA 2YMTA 1QASA 1ASPA 1CS6A 1R3LA 1YYML 4N0CC 3ETSA 2PWFA 4ZO8A 4G6JH 5F0JB 1KELH 4L29B 1WAEA 3T3MB 3P3YA 3ESVF 1RJYB 4IMLB 5LLIC 2P52A 4PTUA 3O3EB 4QRSB 2PYED 4HH8A 3LH2H 4NJ9L 3VH8G 4Z7OF 4JE4B 3E3QE 2ZT9C 5E9AA 1EHAA 1OGTB 2DYRB 2SEBB 5CJ8A 4F8QA 4LXFA 2BSRA 2PXYC 3H2WA 3C12A 4FZ8L 4W4OC 1C1EH 1DZBA 2WWKT 4AQAA 4WIQA 1O75A 3ESOA 3VXRB 5CZKA 2OSWA 3TGXA 1SOQA 2YQBA 3BSZH 5KSAB 2ZWZA 3B2PA 1R3IL 2ADIB 2J6EA 2WLLB 3WBDA 3CXHK 4R3SA 5T5FL 2WLMA 1SYVB 3ISRA 2VITA 2VJXA 1PG7L 3H42L 4BRJA 4K9EC 3FT9A 3BP4A 3T3PB 5EZOH 1JSYA 5TPWL 3FU9A 4X6DF 2E7BA 5L6YH 2YFOA 4N1HB 5C0FB 3QJHB 4R97B 3EGDB 3RUGA 3ATDA 4LESA 3L3GB 5TE4L 3EJRA 4QTHB 4MA1C 5I6NA 1JTPA 2X1OA 4GKLA 5DHVA 1DQQA 5E9DB 1TEFA 2QFRA 4LIQH 2CLRA 1U4EA 2AP2A 1JRHI 3MCLL 4AEHL 3C87A 2FECL 3CXDL 1OD9A 3OZ9H 2YBRB 3QXAB 2ZX9A 1NH6A 4WWOA 2AABH 4Z6AT 1NC2D 5B3JE 1ANUA 2Y7QA 4G72B 3WKML 1JHLL 3V0EA 1A4KA 4M03A 2FX9L 3O81A 1WH0A 1A2YB 1J9TA 2H0JA 4L5FL 4I8DA 4O9HL 2EILB 2QL1A 5IB4A 4PJ5E 1XB8A 3ULVE 2HTKC 2PN5A 3FB8B 1C7TA 4U6HB 3U30C 4NERA 2MH4A 2WHVA 5B38A 5DJDA 2HLFC 5IQ9B 3AS1A 2DD8H 3E80A 1AGCA 3BUPA 3OHXA 4KK9C 2ZOKB 1J5OL 4NZRL 3GT6A 2DQDL 4PJGE 5J13B 1P4BL 2A5UA 1IUZA 5JIHA 2X70B 3H9HA 1AI1H 1AJ7H 2VO5A 4FI8A 5ANHA 4XP9H 3X14A 5IMLB 1VKXB 4HUUB 4JE0A 4JPIA 5IQMA 1A6PA 4Q6KA 1MFEL 3QORC 3V0AC 5K9JL 5HJGA 3VRJB 3RWEA 3MKGA 2PXYA 4W4OA 3VA2C 3N1MC 5DWUH 2H6PA 4LKXA 1LK3L 3SPVB 3C60D 4GIAA 3LPFA 1ZLWH 1A6AB 2W5PA 3FU5A 4A6YH 2H2SD 1H3VA 3WNNA 3V4LA 1M7IA 1NBYA 1YEGL 1GYWA 3EFFA 1R3KB 5E5UB 3S36X 5IJKC 3WI9A 4NZTL 3O3AA 2ZNWA 2FJGA 4PRHE 5LCVL 2RFXB 4W9EC 3SDYL 4IQHA 5D8JH 3ZE0B 3Q6FB 3STLB 4ADIA 5IQ7L 2EEBA 1LWRA 1NKRA 4JRXD 5HYJA 2FVNA 4LSRL 3G5XA 4U2YA 3L9RA 4GW1A 4XGZB 2P24A 3D34A 1WVZA 1WYJA 2UUDH 3QJFB 4NWTL 3RZCC 5C0AD 4ZMZA 5B3JF 3X3FL 1PY4A 3W9DA 5D71H 4IKIA 4LCWB 3FO1B 4MQXC 4OUUB 3ULVF 3GXMA 4N1CA 5BRZD 2RHEA 1MI5B 3MACH 2NT0A 4UIKH 3ZL4H 2EDDA 3VXNA 5I73C 4LRNL 1T4WA 4Y1AA 3MRFA 4B3EA 4OFDA 4GIPD 2DIAA 2TSBA 4MBOA 3HE6D 3E9UA 4PJBE 3VXUE 4IS6B 3J2PA 3O3BA 5DK2B 3OR6A 1KJ3L 4AEFA 4Y4FC 1KTJA 2UYLB 4EDWH 3D39B 1IBDA 4LEOB 4PJGF 3CGTA 1OQXA 4W93A 5D93C 1AZZC 3QULB 2DBJA 2ORBH 3JT2A 3V6OC 1AIFB 4HC1A 1QLRB 3ZE1E 5CLWA 2F54A 4O02A 3S4SG 4WW2C 1TCRA 4DKFH 4Q52A 3FU6A 1GTNA 4BH8B 5ADPH 4NUJA 1GZQA 3IDJB 3PLYA 3IF1A 4FX5A 4OFYD 2VIRB 3CHXA 3ZTNL 5I1CL 3GJFK 3Q2WA 3QORA 2BSEA 5JO5B 1D5XB 5EZJB 2O4EA 3KBFA 4RAUB 4FG2A 2B4CC 2Y5QA 2J12B 3IFPB 1BQ5A 5C0RH 3BVDB 3D2UD 1S8DB 1NQBA 4TPRL 4BWUA 1A7RH 2FLBT 4KKAD 3WEXB 2CZNA 3VFSB 2G75A 5FYLH 1RLWA 1U8JA 5IB1A 1GR7A 5DYOB 3DMMD 4YDIH 5K1VA 3LRLA 2BOLA 3OSKA 4W9ZA 4PJ9C 4F37K 3RIKA 4JFWA 5TE7L 1HQRA 1NC4D 3H1ZA 2YO3A 3V6ZA 4A1RA 1JTOA 1N5AA 3GMLB 5D5MF 2EVIA 3S37X 1T21B 3RPIA 3B7YA 3V4VH 2XXCB 5JW4N 5IJKA 5CIPB 2K8QA 1F4YL 3DYPA 1ZIAA 4XMTA 3OPUA 5DFTA 4X0KA 4Y2DB 1D5RA 3MC0A 2WUCL 4J3WA 4OF8A 2B16A 3FQYA 4RFNC 3K80A 1YJDL 3AADB 4TQIA 4ZUVB 1A1NB 3CVIL 1J1PL 4V1DE 5F6HJ 1UQSB 1A6TA 2VLJA 4C8XA 1PNDA 5EU6D 2YGOA 2CNYA 1BAFL 2YSSB 4HZLB 1F6AA 2PW1A 5C97A 2VQTA 4F7PA 2DYPD 3WEMA 2D3NA 4I9WE 4DQOL 3QE5A 1YN7B 1JP5A 1WWWX 3P9WB 4KKRA 3W38A 3ZBMA 1IEBB 3LKRB 4AEIL 4AOFA 2YXVA 1NL0L 4FQCL 4GBXA 1T89C 4JLRA 1AQKH 3ZE1F 4M7ZC 4B50A 1XCTB 2WINB 4G8IA 4JKLA 2J55A 3CHPA 3TYFB 3FQUB 5KTEL 3HE7B 2VZVA 2ZWSA 4X7TB 2NXYC 2IO5A 4ELDA 4I2XB 5EUOE 4ZMNA 1PZDA 2I07B 5CD5D 2JCCA 2KHAA 4LGPB 4OFIA 3ULAB 2Q7YB 1QLEL 3V6OA 2A0LC 3CMGA 5GHWL 5KANI 5EZLB 4X83A 4WW2A 7PCYA 3SE4C 4CMHC 2X4TA 4URTB 1KY7A 2R0KL 2ROYA 2DBLH 4AQEA 2Y1ZA 2BY3A 3CVBA 3JV4A 1FO0L 2OV0A 4YX2L 1V55B 4X4ME 3JV5A 2WANA 3HNVH 4IYKA 1MIMH 1I9RL 2ODHA 4OCXL 5L2JB 3N0PB 4JO3H 4XMPL 4G7QB 1GOHA 1D5MB 4HEME 5EBLA 1V7NH 4KXZH 1BPVA 4WO4B 2CBMA 4PS4L 2ZCLH 2D0GA 3PHQB 1EWHA 5CNHA 4AY0A 3WUWG 3NJMA 1USQA 4D0CA 2FLRT 4PJ9A 1XEUA 3LH9A 3MR9A 1ZHBA 3NCMA 1P5UB 4PM1A 5D6CB 2G0LA 1CICC 3CH1B 1ZHNA 4LARH 4PWEA 3FTSA 2KPWA 3STZA 4FFTA 4X6CA 5DRWA 5B1CA 5DD5L 3F7QA 3RVUD 3SDCB 5D7JB 2EYRA 5IHZB 4ZT1A 4MAUH 1GW0A 1XH2A 1U4FA 5T5NG 4M1GH 3HZVB 3OKYA 4IK7A 2G3ZA 2CO6A 3MLZL 1OTSC 2BNQB 4S1QL 1DVSA 4QHUA 1PD0A 3ARDC 4DFIA 5I1HH 2JH2A 2IEPA 3IJYB 1X5LA 3INOA 3L7FB 3QGVA 1R47A 1IGFL 2DF3A 4NEHB 1JMZA 1VERA 3QFJA 4DGUA 2JB5H 2HLAA 4IOFC 5DD0H 1RHHB 1T89A 2DMBA 4HAFA 3KXFA 2YAOA 4DP7X 1B9KA 1S9YB 4JHAH 5MI0C 5JPMB 1XGTA 3OKKA 4NDMA 2DTMH 5E03A 1Q8MA 1R6VA 3D3VB 5E8OA 4ELME 1INQA 2XBZA 3M1BA 2DV6A 5KOMC 4ZK8A 3SQBB 2V2TB 2XQYA 3EF4A 3FRPG 4DK5A 1OTUC 2YC1A 3D69B 3ERXA 5ISZE 2RJMA 5IESL 3QXTA 1I8IB 3SE4A 1WO2A 1TOXA 4O5LH 5I5IA 1IT9H 1D6EA 4LPUA 4IRZH 1KJMA 4OZGE 2GITA 2EXTA 1W0WB 4R90L 5E9NA 2DQGL 4MXQD 5KSUB 2MHAB 5E4EC 1LXMA 2XPGB 4XVTL 5EORL 1G7LB 4N90D 4TLKA 2WYHA 4MAYC 4X4KA 4KBPA 1J0KA 3NZUA 1N0XH 1KNOB 4I77L 4OF6A 1MJ7L 3EH4B 3K71B 1TMQA 4FQQA 2P5EE 4TXVB 4GUOA 1XFPA 2E7HA 4J3SA 4LAJH 2Z92A 4TLTA 1YN6B 3PDOA 1UOKA 1XZ0B 2Q76A 4F15C 2VISA 4XMKH 1CXHA 1DVQA 2Q2EB 3EO1A 3FONB 3WD5H 5A3IC 5B7FA 3PWUA 5B39G 1DFBL 2CNZA 3EYSH 2QVIA 3QQDA 2Y7SA 4Z78B 1HH6B 1LNUA 5SX4I 4YO0A 4CN4A 3LXBA 4XH2B 5KSVA 5GJSH 6FABH 1NFIA 4KV5E 2F58H 1FNGA 3QXVA 1CVSC 4K3DL 4P2QD 2I60H 4JJ5A 1CYXA 1FL5A 2P80A 4ZXBB 2PR4H 4H4NA 1IC4H 1O7SA 4I0CC 1HHGB 1U8LA 4UINH 1HK6A 2Q3ZA 3SDDB 5I5MA 4QHKI 3VD5A 1QUNA 5ID0A 4MCMA 4P46B 4ADGA 2JB6B 2X6BA 2HXAA 5EBMA 2UXTA 3UG4A 4ZYKA 5JR1H 3MJ9A 4FCHA 3JYCA 3HMXH 5SWSA 3LN4A 4JZOB 3KM2A 3ARDA 5D2LE 1IBBA 4NKQB 4ELMF 5DA0B 1ET5A 5DLML 1QA9A 4TUUA 2P5PA 1BYOA 1NCCH 1ZT4A 1FYTA 4K3EL 5GJTL 1WFJA 4JFFB 3ARXA 2ZE0A 3QAZC 3ZKMD 3PFQA 3BZFA 2VN6A 4GLRI 2WMPA 5LNEA 2CO7A 4LVOB 4GKZA 4EUPH 4OJFH 5LXVA 2ED7A 2ENPA 4KRMB 2D03L 1MFCL 3UP6A 1MRFH 3X1EA 3KPPB 4AGPA 3FTUA 2BHZA 4OZGF 1JZ4A 1BSIA 2XFXA 2Z4TA 4OZIB 4AI7A 1A3LH 3IGFA 4JGUA 5FUCE 4QHNB 3SJVA 3S6CA 3NIDB 1DQIA 4LCIH 5FO9B 2A9NL 1TENA 4YBQC 5C2BL 1ZV9A 2FL5B 2H5UA 4DN3L 5CCJA 3FAWA 5MERA 3MROB 3QG7L 3L3HA 1HEZA 3HC0A 4OLVH 4PBDA 1WCBA 4P59L 4XN8A 3P9MB 3KLAB 1BVOA 2FJHB 2NZ9D 4LVHC 4X7FC 5CXPA 4PLNC 1N19A 4HZAA 4PRPB 3BCFA 5IBUB 2WVSA 3FTXA 2DWEB 3JZ7A 4MAYA 4P57A 2KZKA 2PWDA 2IFFH 3VFGH 1NCWL 1XIWA 3QJVB 1MHEA 4K71B 3CCHB 3K2UH 1OARL 5D9SA 5K69A 1OP5K 4XZUB 4WWNA 5KUKA 1LE5A 4KV5F 4X7EC 1HHIB 4YSSA 4HIXH 2FR4A 4PLJC 3PAVA 2KUTA 4Z7IA 2XU9A 3C6LD 5GGTA 1FVDA 4APQD 3O3DB 3TFKD 1J10A 4DVRL 2P8LB 3CBRA 1CL7L 3HNTH 4AMKL 5IB3A 5F9OL 1L9RA 4G1MB 3VDBA 4QCIB 3TC9A 3FB7A 3T6QC 3ET9F 4YFEA 5ESQB 1HEJC 5BS0E 5GGRY 4J27A 1RMFH 2V9UA 5D2LF 2XBTA 4PJFB 2O72A 3F6LA 2Y6SC 4G43B 5F7BA 3BWAB 2KKQA 5DDHB 3JUYA 5BPPA 2ZKWA 2A9BA 2VR7A 1CU4L 1T0NB 4DJMA 3C6EA 2NR6A 1OGPA 2XDHA 3VW3H 1JV5A 1EJOL 2BP8A 2QSCL 1JWUA 2X4UA 2VQ1B 3Q01A 2IIJA 2A77L 3RWIB 5GGVL 1SOKA 1BA9A 2NY3C 2CJTA 4D0DB 4W9FC 5F7LB 4CDGC 3GFUA 2Z31A 1O6VA 4E9SA 2AQ1A 3KHOA 2DLFL 3WJMA 3VWJA 4AQ8A 4NQTA 2NYYC 4G11A 4R5TA 1B4LA 4MA7H 1QQDA 5I71B 5C3LD 3JSSA 4J3OC 1FNHA 5B1KA 4TVPE 4D9RE 3CFNA 1LDPH 2IPTH 1CE1H 3KPRE 3P77A 3WNMA 5I1KL 3DYMA 2ZJSL 3LXCA 1BEYH 4PRIB 4S2SB 4M7JL 1PIFA 3RTQB 4JM2C 2A73B 3BAEL 3QR1A 5K39A 2E3VA 4POZD 4BK5C 1A6VH 4NJAL 5BO1H 4WV1A 4D9LL 2WVVA 4ZUUB 4F8NA 1XGPA 4E9LA 2H3NB 2ICEB 2PKDA 5F1NA 5DUBB 2G4GA 3QEGL 4Q0XL 4Z0XA 1U8KB 2XCMC 3CPUA 3D18A 4FNPA 3TX4A 3DIDA 4JKMA 1QSEE 4FTVD 2W65B 3R18A 4X9IA 1F4WL 2YLHA 3G5VA 4ISVB 1WZ1L 3DXAE 4LFHG 3BMVA 1J1OH 3MKKA 3CFBA 4M5SA 3F7LA 5CLTA 3VXMD 4NNXB 1T1XA 4HKJA 5KJRH 2F53D 3QJXA 3U6XS 1MHHA 3EJUA 3C8DA 3LQZA 3CDYA 3ZOAA 4ABWA 4JFHE 5L2KE 2WYZA 4B5ZA 4RMBA 1ZLUH 4XAWL 4FQPA 1UACL 2NCMA 4KH2A 3BKYL 1AR1D 5ESAA 5E51A 5JTWA 3NP3A 4L0ZA 3P40A 4B9CA 1UH4A 4Y19A 2BP5M 3UJJL 3L3DB 1JFQH 4XCCL 2CLVA 2EINB 1UWXK 1WT5C 2KL6A 3MOBL 4KRPB 4MRBA 4TUJA 2CBTA 4AUJA 1A1MA 5CUSL 2X42A 4JFQA 1DBAH 1R17A 4NO3B 2NYZA 3JYBA 4E2OA 4ZNEA 2Q8BL 4DGYL 5I6XB 5AZ2H 5EBGA 2W80C 4KXAA 4BSVB 4H8UA 1U8HB 4PRDA 3WXWH 2PO6B 2Q9OA 3CFIC 2Z35A 4R6UA 4MNHA 4K4KA 2CUIA 4YGVA 5DQDH 5AW4B 3FQWA 4KPHH 3DTUB 2AEQH 3UJTL 2X2UA 5IMKA 3T6ZA 2E4TA 4H88L 4P4RB 4NM8L 1KYAA 2WSDA 3DUHA 2CA4A 3KLSA 4S1SH 2D2OA 2W9EH 5T33H 3TN0A 2V3EA 2UVFA 1IGTA 2EIZB 4JM2A 4X5WA 1ZLSH 5FM5O 5I16A 2NDGA 1DBBL 2OTWB 4FL4C 4HCRA 2D31A 4BK5A 1Q0YL 1RUMH 2GI0A 3S36L 1MCJA 4P2QE 5CEYA 5HJ3A 4UQ2A 1PZBA 2OMZA 5GGVY 2X0WA 5ICXA 3BUYB 3FS9A 4EDXA 5FR3A 4NYLB 1QW8A 3T0ED 3UEQA 1YSOA 4F7CB 3QRLA 3Q3GB 2X7LB 4LASH 3UJIH 1ZK5A 5AKSA 2Z9TA 3O6LL 3O2VH 3P30H 4Z7OB 3FCBA 4BA0A 4HJ1A 5D1ZC 2ADGA 5EUKB 1GW6A 3B9KD 3EO9H 3AROA 1H5BC 3Q5OA 1KB5A 1IM3D 3HN3A 4HGKC 3ATEA 3UPCA 2R2HA 4UM9A 1HXYB 1DR9A 4FJYA 2GVYA 2GI7A 4PJCE 1I3UA 4WAFA 4QRUB