3IBOA

Pseudomonas aeruginosa e2q/h83q/t126h-azurin re(phen)(co)3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Azurin
publication title Relaxation dynamics of Pseudomonas aeruginosa Re(I)(CO)3(alpha-diimine)(HisX)+ (X = 83, 107, 109, 124, 126)Cu(II) azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3iboA00
4AX3A 3X1FA 1WS7A 3IE9A 1NPNA 1X9UA 3SBPA 5B1KA 4HCIA 2XX1A 3T6XA 1ZPUA 3CZUB 2VW6A 3FS9A 1ZIBA 3X1GA 3IBOA 3CVBA 4UF7C 3UABA 3AG2B 1PY0A 3ABLB 3BVDB 1ASQA 1MZZA 2PP8A 2HX9A 3AG3B 2R7EA 1RKRA 3PXLA 2H47C 5I28A 1I53A 2QDVA 5PCYA 3JT2A 3QJUB 2Q9OA 1B3IA 3QQXA 5TK4A 4DP9X 4JKNA 3SBRA 4HAKA 1JZGA 2AZAA 4AKOA 2UXTA 4YSSA 1AS6A 4DP0X 4E9SA 4JHVA 3EF4A 1GY1A 1MG3C 4CSZA 2UXGA 2ZWNA 5PAZA 2XV0A 1L9QA 4RH4A 5B1AB 1NIEA 4Q89A 1JOIA 3FPYA 1ZDSA 3ASOB 2J55A 5I5JA 2VM3A 4AKPA 4F7KA 1N68A 4HALA 1ET8A 2IWFA 3DTUB 1KBVA 1AQ8A 3QJQB 4A2EA 4KNUA 2EILB 2UXVA 1GY2A 3OMIB 2YAFA 3UGEA 2YAOA 3X1EA 3QJVB 1OCOB 4JHUA 4PAZA 1E5YA 1NIDA 2JXMA 1OF0A 3EH5B 1KDIA 1SDDB 1BXAA 2XYBA 4DP4X 1T5KA 1ETJA 1EZLA 2HLEB 3CVCA 4A2FA 3FSVA 5IY5B 1A4BA 1JERA 1IBZA 2B08A 4YSPA 3OM3B 3T6WA 3GYRA 1XB6A 4GYBA 1CURA 2VMJA 4KOBA 3PAZA 1E65A 4WKXA 2MTAA 2VW7A 3FQYA 1E30A 1AANA 2Y69B 2YARA 2GB2A 4G7QB 4YVNA 1GS8A 2BWIA 2GHZA 4YSOA 3GXUB 2PP7A 1AG6A 1BAWA 1SNRA 1NWOA 3FPXA 4BK5C 2ZXWB 2IH8A 3S3DB 3AW5A 3TBCA 1OV8A 1RZPA 3U25A 1BXUA 4F2FA 2YXWA 1NIFA 2YXVA 4BWTA 1OOWA 2XU9A 4W9ZA 2ZONA 1NIAA 2FWLB 1E5ZA 1NTDA 3HEIB 1OCZB 3QJTB 3EHBB 2BW5A 2BHFA 1OE3A 2BZCA 2VN3A 4YSRA 2J5WA 3MX0B 3FSZA 4EF3A 5TK2A 3FYEB 2IWEA 3TA4D 3WNJA 4A2HA 4HZ1A 1TKWA 1IUZA 1SDDA 2FQFA 1AZBA 3FSAA 4YVUA 1OCRB 1XB3A 2HRHA 2BWDA 1PF3A 2BP8A 1IBYA 2Q5BA 3TASA 1WA2X 3ABKB 4UANA 5D4HA 2TSAA 1UATA 1GR7A 2FT6A 3CVDA 1IC0A 2PPFA 3TU6A 4E9XA 3N2JA 1WA0X 3PLYA 4N4YB 3T9WA 1A3ZA 4KO7A 1JZIA 2E86A 2CBPA 4QKTA 5F7AA 3WKPA 3ABGA 4W1TA 2BP0A 4YSCA 1TEGA 4E9VA 3ZDWA 3ZIYA 1YLBB 5I5MA 3S8GB 2YQBA 4BDVB 5LDUA 2CCWA 3NSYA 2PPDA 2YAMA 3FU7B 4KNTA 1TEFA 2QDWA 1N70A 4Q8BA 1A4CA 1AS7A 5D4IA 2PCYA 3V9CA 2HX8A 3IN0A 1R1CA 3FQ1A 7PAZA 4BWWA 3PPSA 3TBBA 3NP4A 3WNIA 4YL4A 4FA7B 2X88A 4P5RA 4M4RB 1E67A 1M56B 2BW4A 3UAAA 2PPEA 5AFAA 1BYOA 4BXSV 2WO3B 1J9QA 4E9WA 2OCCB 1V10A 4GP4B 4X4KA 4A66A 4DP8X 4FAAB 4MFHA 2XWZA 4GY4A 1BQKA 1L9SA 1V55B 4UAHA 1F56A 1FFTB 2DWSA 2FTAA 1PZBA 3G5WA 3H4FA 2XXFA 4N8UA 2W88A 2P80A 1URIA 1KCWA 3S8FB 3T6VA 1BYPA 1PLBA 3QJRB 1J5CA 3OMNB 2RACA 4GP8B 1AZUA 2XXGA 1DZ0A 1QNIA 1JZJA 4DP7X 4ENZA 4DPAX 4PCYA 4G7SB 2IAAC 1J9SA 2J56A 3ABMB 3FU7A 2MRYA 2PCFA 2DY2A 1ILUA 3KW8A 2QT6A 4YSDA 4CSPA 4YSQA 4WTQA 1KV7A 2XLLA 1HFUA 2GBAA 4YSAA 4DPCX 2YAHA 2AVFA 6PCYA 3CDZB 3FYIB 2UXFA 5B7EA 3PCYA 2VSKB 2BO0A 1JXGA 3WIAA 3AG4B 1NICA 3RYMA 4BWUA 3FSWA 3SQRA 2WSDA 2VM4A 3NYKA 1WA1X 2FT8A 4DP2X 4P5SA 3OD3A 4AI7A 1JZEA 1ASPA 2JKWA 3JTBA 1ADWA 2H5UA 9PCYA 4DP1X 4ZK8A 2W8CA 4DP6X 1ET5A 2NRDA 2HX7A 5B1JC 1HAUA 5F7BA 4AZUA 2FQEA 3HB3B 1PLAA 3D12B 2YAEA 3H4HA 1AAJA 2IDFA 2OV0A 2N0MA 4BXVA 4E9YA 1J9TA 2CJ3A 2R7EB 3QJSB 5AKRA 1BQRA 2B3IA 4M3HA 2FT7A 1NIBA 2ZOOA 2PP9A 3AZUA 2IWKA 1CYXA 1GW0A 4HCFA 1JZHA 2IDUA 5I26A 1J5DA 1FWXA 3UACA 3IEAA 2GSMB 1J9RA 8PAZA 5E9NA 3V9EA 1ILSA 2XX0A 1AZNA 2J57A 3DIVA 4GXFA 4HHGA 4A2DA 3AY2A 2PPCA 3SBQA 1AG0A 4F2EA 1JXDA 1MZYA 1BQ5A 1KCBA 4HHWA 2EIKB 4KO6A 4NERA 3DKHA 1RCYA 1QHQA 1BEXA 2FJSA 3NJMA 3PAVA 4YSUA 3ZBMA 1RZQA 4HCGA 3C75A 4G7RB 5I6OA 3GDCA 2AFNA 1SFDA 5I6NA 2EIMB 4DP5X 3FT0A 3NT0A 1ASOA 1JVOA 5B1JA 4A68A 1BXVA 2DWTA 3OMAB 1WS8A 1AACA 1NINA 1SFHA 2P80D 1KDJA 1XB8A 3UAEA 1ZDQA 4AKQA 2TSBA 1CUOA 2XVBA 1PMYA 4K9JA 4A67A 2DYRB 2GIMA 1SHXA 1X9RA 1A65A 3QPKA 1JXFA 3NSFA 1CC3A 1AS8A 5I5IA 1SF5A 3PAUA 2JFCA 2BZ7A 2GC4C 4KNSA 1AR1B 1PLCA 1SF3A 2UX6A 3NJHA 2X87A 3NJFA 4NB7A 5B1BB 3X1NA 5D4JA 3NJNA 4KO5A 1M57B 4BDVA 2YAPA 5EHFA 1OCCB 1WAEA 1NDTA 1ZV2A 2EINB 4TXVB 3NJGA 5I6KA 3T71A 2IDSA 2AZUA 3AG1B 5ANHA 1OE1A 1L9PA 1AIZA 3NSDA 4L0PB 3X2QB 3FU9A 1DYZA 4DPBX 4E9RA 5B7MA 5I6LA 2A3TA 3NJLA 3X1BA 2HRGA 2GC7C 3CG8A 3S3BB 2BP8B 5B7FA 1L9OA 3NP3A 1PNCA 3KW7A 1SHWA 1GYCA 3NJJA 4G71B 6PAZA 3WG7B 2QPEB 4GP5B 2IDTA 4QLWA 2XV2A 1MDAA 2HXAA 3OQRA 1FA4A 4KOCA 2VW4A 4YSTA 5A7EA 2WO2B 3FU8A 2BP0B 2OJ1A 2EIJB 3MBWB 4KO9A 1IKOP 2PLTA 2CUAA 4E9QA 4NAJA 5I6PA 2GI0A 5FC9A 1OE2A 3H56A 4A2GA 2FQGA 1A8ZA 4YSEA 1ID2A 1TU2A 4G70B 3BQVA 1MG2C 3ZX1A 2HZHA 1GS6X 1PZAA 1VLXA 1KBWA 1M9WA 1AZCA 2H3XC 2I7OA 1ZIAA 1QLEB 1L9RA 3N55A 3ASNB 1ET7A 3NJKA 5B3SB 2Y1AA 2YAQA 1NWPA 3S3CB 2I85A 1NZRA 2LLNA 1L9TA 1KYAA 1A4AA 3IN2A 2FNWA 1NPJA 2VSMB 5I6MA 1AZRA 2CALA 1JVLA 2DYSB 1HAWA 2XUWA 1V54B 1XMEB 3ERXA 1PZCA 4HIPA 1GSKA 1W6LA 3NSCA 3WKQA 3WI9A 1PCSA 5AZUA 1GS7A 1PAZA 3CDZA 3FQ2A 3NJIA 3EH3B 1W6WA 1PNDA 2AANA 4G72B 3UADA 2DV6A 1SJMA 7PCYA 1EHKB 2FQDA 3L45A 2IDQA 1AOZA 1CYWA 2QPDB 1W8EA 2IH9A 2UX7A 2I7SA 2XV3A 2PPAA 1JZFA 2CAKA 3EH4B 3T6ZA 4E9TA 1KGYE
chains in the Genus database with same CATH superfamily
1NGYB 4G3YH 3X1FA 1IQWL 4L4TB 1CK0H 3MV11 3BSGA 4M7JL 1FE8H 1PPIA 4XZ4A 1CBJA 4U0RB 1HC1A 5DHDA 5CZXC 1E43A 1R34A 4O2CA 4OZFB 3FTGA 3HHSA 3NTCH 3I75B 2AQQA 3UTOA 4XO9A 4PWHA 3BVDB 2VZ1A 4XH2A 4KFZC 2FO8A 3O6LL 2CR6A 2J25A 2CNZA 2J44A 4NN6B 5E6UB 5DJZB 2Z4QB 4M8QB 5BXFB 3O9WD 4WWKA 1A6ZB 1I53A 5D6DC 5PCYA 1UT1A 5IBLC 4PB0L 2OKMA 3FUDA 4MCZB 4PV8B 1XSIA 3SPCA 4XVTH 1KTLA 3SKNB 2CZNA 3E2HC 5IB2A 1TCRB 5CMAB 4H0LC 3FMGL 3GHEL 4O2EA 4P3CH 3QXUA 3U7WL 1BFOB 4YDVA 3REWB 4PGEA 1BX2B 1U8OA 5KBDA 1IGCH 1JIBA 2UXGA 1JN6A 3MA7B 1CGUA 3V5DA 2NQ3A 3DX9B 3K7UA 4JRYB 2ARWA 2J55A 1MLBB 3TCLA 1UOKA 2QVFB 4P23A 1HHKB 4HWBL 5HHPA 4PVNA 4DUXA 2QGDA 1B0RB 1CFTB 5DRNA 1ZXQA 5LNDA 3MMEB 3EO1B 2DQFA 3H42H 5LBSL 3RL2B 3X1EA 4L37A 1F3DJ 1KIQA 4NO0D 3DO7B 4PAZA 4FI7A 3EH5B 3VXME 1SXSA 1S9XB 3P0VL 2DAVA 1GIGH 3FN0H 3KHOA 4OD2A 2G30A 2P5ED 3QEQA 1MJ7H 3LZLA 1JV2B 2O5YH 2FYYA 2QEJA 1DQQA 2DLEA 4ELMF 1Z32X 1CL7I 3BAYA 4EI5A 4GKSB 3K46A 1FZKB 2C7FA 1FZMA 3Q3GB 2HRPH 4GYBA 5DO2D 5EOCL 3IVKB 4IKJA 1T5XB 3FQYA 4BINA 1RI8A 3KXFA 3F2LA 4P4KB 1TQCB 4PSPA 2H9GB 4YVNA 2GB2A 5JZ7D 3MRRB 2Z1PA 4IOIA 5FO9A 2VLLB 4YSOA 4Z6AT 1ULVA 4KKAC 5IB1B 2DLHA 3FHAA 4N1CA 3SPVB 5JIKA 4HIHB 5EIIA 3M17B 5C70A 3EYQC 1SDAB 3WYRA 1DO6A 3HC3L 5AAMA 4PGZA 1TMCB 3HE6D 4ODUA 1GHFH 1MFNA 2NY0C 1JTOA 4U1IA 4EOWH 4J6RH 2Z8WC 3BGFC 3L1OL 2LAAA 5HXMA 3BVUA 4XNYH 2ITCA 4KUZH 3EHBB 1EXGA 4B9PA 1ACYH 1QFOA 4ZMTA 3HS0B 4N2LA 4Y2NA 4X99B 4BFEA 1ZE3C 2Z35B 2WOBA 1WCQA 1M53A 1YNTB 4NNXA 4K5OA 4Y1AE 1UACH 4HWBA 3GGWA 2JJVA 1FDLH 1JI2A 2YSTA 3UC0L 4U31A 1BD2A 1WIUA 3ZTEA 3OBAA 2ZOLB 3QDME 3DX0A 5IUSA 3EADA 1WCBA 4JDVA 1PCXA 5J11C 2PW2B 3M1BB 3C6LD 3KPRE 2WKGA 1F18A 4GW1A 5T5FA 3K1KC 3VI4F 1ZS8A 2PPFA 5ID1B 4CC0A 4G8AC 4PB9H 5E8EA 2HH0H 4KHXH 5ADPH 5KBMA 1T6WA 4XPTL 1QSFD 1ZXKA 3R1GH 3GSVA 1MUJB 1QFUL 1QHOA 4PJXE 3FTYA 4GW4B 2Q3ZA 1GJUA 5INDA 5I30H 2FD6H 5EPMB 1IM9A 2GSIA 2DQJL 5EO9B 2Q6WB 2YQBA 2BOCA 3EGSB 4O58H 3BPNC 1MY7A 4G7YH 4Y19B 2DI9A 4PRPE 3INUH 1MF2H 4H4NA 2JI1A 4FZ8L 1CFQA 3VD5A 2X4UB 4OF6A 4MWFB 2OK0L 2BCKB 2VAJA 3Q5OA 4NLHA 4XCFH 2ZWYA 5FYKE 5INCA 3SODB 2QADD 4A6YL 4WY7L 1SHSA 1S5IH 1XEUA 5C0FA 2Q76B 1DLFL 1LK2B 3F5WA 2OTWA 2OL3L 4N2EA 2FH6A 3ZT5A 1EX0A 2BK8A 5I76B 3CDGA 1YMMB 2X88A 2IEPA 3BDYH 3X12A 1CGTA 2WXGA 4L2YA 4BFRA 5HPMA 2NTFA 1TNMA 3UAAA 2MH4A 1IAMA 4G8IA 1HHIA 2AV7B 1YYLL 2R0LH 2XKNA 5DI8A 3B2UD 5TE4H 3K6SA 1J9QA 1I85C 1NFDE 1M3JA 3CE1A 1ETZB 2X4QA 4E9WA 4RETB 4DF9A 3ZQXA 2FK9A 4A7VA 1WO2A 2HT3C 5A16B 4PFEA 4LLMB 1WAAA 4UV7H 4MB5A 4UOQA 2BVUA 4B50A 2AJ3A 2BFVH 3GIVA 4ZO6A 4HJ1A 4R96B 3BQUC 1TYJA 2B16A 5C92A 2DD8L 5EU3B 1RLBA 4LOUD 3ZTJG 4YDKH 3SKJH 2MWCA 2NYYC 3VG9C 3ZSTA 5IJCC 2AKRB 5FYLD 2NZIA 3P4LA 3FO1B 2J1KA 2VLJA 3OHXB 4LFHG 5DEFA 3RGHA 2RJMA 5CJQL 1KB5A 1X7TA 5E6ZA 4XI5D 1E28B 2YEQA 1A7OL 1TQBB 4PV9A 5C9JB 4XMXA 3NIFF 4KJYA 1S3KH 2AQNA 2PCFA 4ETYA 3EJZC 3QZWB 4HPOL 4LRIA 1BVKB 5FO8A 4YSQA 3QDJA 3FFCE 2GJPA 4AMXA 5KTEH 2ADFH 3Q13A 2F54A 1U4EA 3BZEA 1MEXL 1FCGA 1UXSB 5AB0A 5I75B 1UZ6E 4Y2DC 3ROOA 4HV8B 5IGXL 3FUEA 4J8RA 1BVLA 2IOIA 4G9FA 1WFUA 3ZDZE 1BLNB 5ANMA 3EZJB 1XGUB 4D0DB 3B43A 3B2XA 3ES6B 5D70L 4P5MA 5DMYA 5EZOL 4AQEA 3WY1A 5JHDA 4PRDB 4WNJA 4FFVD 1LTXA 1NUFA 4XO8A 2PYFB 3S36H 1RZGB 4PJAE 2CU9A 4BHUI 1ZGLP 2Q20A 1U8IB 4PGDB 1G9EA 4U7SA 1IGJB 3KL5A 4P5TC 4AQ1A 3F6IA 4EJ1C 4JFFA 4I3RL 4LCUB 4R0LC 1HNFA 5HY9A 3H4HA 4G6JL 3GXTA 4DQOL 1AXSA 5D8JH 3V0WL 1H6UA 1T0NB 2I07A 3JV6B 3VGGA 2D3LA 1AP2B 2WUBH 5C8JB 5I1EL 3DHUA 1AHWB 3NAAL 3HKZA 2EH7L 3BP7B 2CCVA 2DKSA 1G9HA 3R8BB 4D0BA 4JMNA 4KRPD 1K4DA 5FDWA 4OZGA 3LHPH 2ESVB 1VZHA 4ONFL 2WLLB 1NGQL 4ZZFA 3KWXA 3OPZL 4R26L 3WO4C 5FHAL 2AITA 5I0DA 1J5DA 1XGQB 2VE6A 1CI3M 3L4CA 3UACA 5BZDA 5IESH 3IEAA 5K1JA 1J9RA 1CIUA 3DRTA 4NZRL 1NAML 4GXFA 2WB7A 1YNLL 2ZZUT 4WHYH 3D85D 2P42B 4PWJA 1X7SA 1CGYA 2WBKA 3QNFA 4N0UA 1CBVL 4JNXA 4ZUTA 4ZX4A 4S11A 2VXQL 4H88H 1QQDA 4K3HA 4FHBD 4NP4H 3DC0A 1NGPL 3HVNA 4TUJB 2WWNA 2ZXAA 5B21A 5C09A 3NJMA 5E8NA 4AYEC 1UKTA 3SJVA 4CILA 2BIMA 5E6IC 4YIQB 2VDRL 2YSSA 1Z2KA 3P54A 4FYRA 5LNGA 1UD6A 5J4MA 4CC1A 4E5XB 4DO4A 3G5VB 4OLYL 1LXMA 1KXVA 4FL4C 3EFFB 1TIUA 3IFLH 4YXKH 3B2DC 2ENJA 3O45B 2MCPL 1ESOA 5DJ6A 1AACA 3ESMA 4JFZH 2CHNA 4PJIB 1W2KT 2CO6B 3GMMB 5DQJB 43C9A 5LJYH 1RZIA 1MREH 3W38A 4B9JA 3LSOB 1JXFA 3NSFA 1CC3A 3HN5A 1WT5A 4OFQA 4U1GC 1C8PA 1Z5HA 2Y7NA 4H1LG 1E0OB 2VR6A 3ARVA 5IMMA 3QIUC 3ZXAC 2BSTB 4P3DB 3FQUA 2GC4C 3AXLA 2YD8A 1CFVL 1SF3A 4L3EE 3QPXL 2YD2A 1PTZA 4Y1SA 4LSUH 4UIMA 5JUEL 1L0XA 1FL5B 3MODH 2LTQC 5IBTH 3CXFA 3KYMA 3DPBA 1IFHH 5DJ2A 4ZQKA 1ZEAH 4LLVA 4P2AA 4OJCA 1NAMA 5H37H 2YPVA 5HYJB 1V7ML 3NMEA 2FB4H 3D69A 3QUXC 1LO0H 3WAJA 3NSJA 1AQKL 4JAMB 3SZ6A 2KBGA 2E9WA 2TAAA 3PHQB 4HIQA 2Y06L 2V2TA 4Q9RL 4APQC 3P77B 1JD9A 1GW6A 1MNNA 2UVFA 4ZXBD 1TJHH 3WG7B 4RDQG 1U91B 5D1QC 2YKLH 2ZKXA 4J3VA 4MDJA 2A38A 3BN9D 3FL7A 4JX0A 5C07E 1XHHA 5F9WC 2DJ4A 1MDAA 5A3ID 2QBWA 1L9NA 1A7NL 1ZWIA 1HL9A 4GQPH 2H26B 1DE4B 3FU8A 4OBSA 5I9QB 1DCLA 5HHMD 4E9QA 4ZSOB 5CP3H 1DQDL 1F58L 4TNWK 1J0IA 5EOTB 3DVNA 4PJEA 1VFMA 1QRND 2DL2A 1HWGB 1YQ2A 4LLWA 1AKJB 2V7NB 4I3SL 5E2WH 4ELKA 3T1FA 1KPUA 1RHHB 1C5BL 3PV6B 5E9DA 2C5DC 2GTWB 1M05B 3T0BA 3QYCA 5L0QC 3WEOA 5DTFB 3CJJA 4YHIA 1QBLH 1QOKA 1XCTA 5L8KB 1V54B 1BD2E 1P84K 5F7YC 3ERXA 1KIRA 5BRZE 2WTRA 4XMVA 1OO2A 1KJMA 1KXTB 5JOPD 4Z0BH 3BKJL 5BMFL 1PAZA 1W6WA 3LXAA 4KKAD 3BUDA 3ZQ9A 3IFPB 2QFRA 5J12C 3MROA 4CC4C 3U46A 1YAIA 5IVZA 4MMYB 3EYQD 5CCHE 2UX7A 3TNMB 1JTPA 3EH4B 3U9WA 2EDLA 4E9TA 3MRPB 2XVGA 3RDTA 4U3SB 3RNQA 1WS7A 4IOFC 2F74B 2X2YA 3DXAE 2NX5A 5AW4B 3EG9B 4YLCA 3FB5A 3RZCA 1P7QD 4G7VL 1NOFA 4HIXL 2DQCH 3IKCA 1A9BA 2J8OA 2JWYA 5C6PB 2ICWI 2OZ4L 4L9LC 3ZIMA 4UZSA 1IEAA 3AG2B 3U4EA 3CHXA 1F45A 2ZD0A 3VAEA 3V8OA 1GZPA 1YRKA 4P2QA 5B39G 3WMPA 2VDPL 4FQQB 4KDTA 4JREB 1H3XA 2JKSA 5DK3A 2Y24A 1NGZB 2NTSP 3PXLA 4GIOA 1OAYL 3ATEA 5ICXB 2YGOA 5HGAB 5TK4A 1HJCA 4X83A 3MRQA 3HI1B 1ZSHA 2WXIA 2YGPA 2FRGP 3PXJA 1XTLA 1DR9A 5GGSA 4L0ZA 4UB0L 1LDPH 1QLEH 4XMLH 3ZJAA 2I60H 3MNVA 2YA2A 2NY3D 4PJBB 4ZS6D 5ISZB 4AWJC 2PR4H 3L7EA 1WAAE 4LEBA 2GW5A 3W3BA 5CLYA 4BBWA 1JOIA 4Y4FB 4LRNH 2NYZA 2VM9A 3V0JA 3ESNA 1KBVA 2VDQL 4EKJA 5CIPB 2R23B 1R24B 3I9AA 2GFBB 1KG0B 2P8PB 3OZ9H 2UZYA 1QZ1A 2HKHH 4LLAA 5C08A 1M1SA 2YAOA 3NIDE 5F3FA 2CKBH 3WJLC 4M6NL 1IILE 1H3WM 4K8RL 1E5YA 1MIEL 1UOWA 2XTJC 1T5KA 3UTQA 3D09A 4BGDA 4LNRB 3BKML 5IY5B 5C0IB 3W2DH 2BOBA 3MNDA 2H0FA 2QQQA 1UCBL 1UWGL 5IF0A 3QDJE 3L3JB 3SYCA 7FABL 4LMQE 2FAUA 3T04D 1JK8A 1L6XA 4MHHI 5DYOA 4YHNB 2F54E 5J6HA 1E30A 1Q4NX 3CPLA 4DPRA 5CKGA 3VXUA 1INDL 1GS8A 1Y1UA 2BY0A 1IKNC 1X5ZA 4M7JH 2LABA 3IAQA 2NY1D 1WFTA 5IW1A 2H32A 1MCOL 2UWEA 4ILDA 1OGAD 3H6AA 2G0LA 4A1RA 2X70A 1AG6A 5FWRA 4NN7B 4J7RA 5JHDE 2ICWA 4L8SB 4YWGL 1OP3K 4Z18A 3TYFA 5KEZA 3O6LH 4X5LA 5T1DL 2F53B 2X1QA 1M9SA 4Z7IA 2XNAB 3LKQA 3UPCA 3VFSB 4F2FA 2FLMA 2YXWA 1NIFA 2YXVA 1WD9A 2V4LA 3CUPA 4FI6A 4YXHH 1WICA 4JRXA 3TLRA 1F3JA 1HCVA 3AUWB 3MYJA 2NQDA 3HEIB 4PB0H 3SE9L 1UB5B 3VH8G 3IDMB 5I0WA 5C0AD 5CHNB 4NQUA 5JXEC 5EU6A 1AIFB 3FMGH 3GHEH 4HW6A 4PS4H 3T4YA 3WXWH 5I0VA 3THML 3QULA 4OLXL 3U7WH 2IWEA 3WNJA 3OWEA 3UZVB 2OTUB 4XP1L 2F5AL 4DN3L 3GBEA 4W9KC 1JPSH 3FU3A 5EF2A 2OSLA 3HZ3A 4MJ5A 2VC2L 1UGKA 2ZOKB 4GSQA 4H2AA 1BZOA 2E74C 1NJ9B 1R0AL 4CVZB 5E9AA 4ODWA 1BZ8A 5DT1L 4LHUG 4M9OA 3N1FC 3ZN6A 3SPGA 5J57B 2AW2A 4L2LA 5LBSH 4PJ5B 1JZIA 5CGYC 3HB3D 4CL7A 4MASA 4Q97A 4ZTOL 2OMYA 3RY6A 4KKRA 3GBLA 5A2JH 3P2DA 1S7RA 1QLRA 3N43B 3V5KB 4P5TD 4TNVK 1R46A 3VI3A 4YLBA 4N0UE 3TTSA 2E7MA 3WL9A 4JY5H 2MQ0A 5E7FA 5LGHL 1IZKA 1HQRA 3V6ZB 1AS7A 3U1SH 1YMHB 3BPOC 4HBCH 2Y6SC 3RJDA 1WC7A 5SWSE 4G8FB 1IAIL 5KG9A 1BJMA 3ARSA 4JLRA 4K71C 3H9HB 3TBBA 1P5VB 6CGTA 4DK3A 1E9OB 4FA7B 3OKDB 5DDHA 1E67A 2E7CA 2NZ9D 3PWPE 4NQEA 4QRTB 3ZGIA 1TT6A 5E1GA 4N0RA 3DMMA 1Q0YH 4XN4A 5E2TL 4DQAA 5AFAA 2K6WA 5AG8A 4BXSV 2V9TA 2DQIL 5D7JC 3GXMA 3HC3H 4L4VE 3RWEA 2HLFC 1JYWA 4JFQA 3N3EA 4TQHA 1A3LL 4LARL 1B9KA 1NEUA 4PH8A 1RZKH 4J6IA 5MHSD 4MFHA 3L1OH 1KWKA 3W9EB 1HEZB 5DEZA 2NCMA 2D7NA 1R17A 4ZAKA 5HDQL 2C34A 1MI5D 4K07A 2YJLA 2XV6B 5T1KD 5HI4D 2OMNA 1JSYA 1QHPA 3NCBB 1RZ8B 2EXWD 2ZX7A 3KYOA 4K3JL 4MSWA 4EDWL 4F24A 2MNJB 1KCWA 1NGYA 1OAZL 5GJTL 4HISA 5KSBF 1OLZA 1P53A 4ENZA 1JV5B 3LHAA 2WV3A 3UH8A 1M71A 4MQ7B 3CZFA 1J9SA 2VUOA 2WK2A 1HKLL 3ABMB 3I75A 3RPBA 3U9PH 1XGRB 3HW7A 4GOSA 5IIEB 4KKQA 1DP0A 4W9HC 2QT6A 4AVIA 2WLIB 4WTQA 4XPTH 2DIBA 4LPUA 4HJGA 2Z4QA 2XLLA 4FQIL 4M8QA 5BXFA 4Y16C 5DS8B 4C59B 1A6ZA 4F8NA 2JKNA 1TFHA 4DPCX 5A2LH 1QR1B 4PV8A 4MCZA 5GRWA 5LKNA 5IKCB 2IANE 3HMXL 4HJJL 5I74C 3V4PL 1H19A 4UI2A 2DQJH 2V9UA 4QY8B 3SKNA 5HGHB 3TEXA 5DFWH 3ARGD 5CMAA 1S3RA 4MB3A 4FZ8H 4X7DC 5E94A 3F7VA 3SDCD 1BFOA 3REWA 2VM4A 1BX2A 3N5AA 3PHSA 4MDRA 2OK0H 3PF2A 3ZL4L 3QYMA 4LSDA 3TV3H 4W9LC 4A6YH 5DUML 5A40E 3MA7A 4ZTEA 3PWLB 4WY7H 1DLFH 3DX9A 1JG9A 4KROC 2OL3H 1MLBA 2A0LD 2IV8A 3ELAT 4DP6X 1PAMA 1HHKA 2OSWA 2HX7A 3VWKC 4JFWA 3IT8D 1BREA 4JHWL 5IZ7A 1B0RA 3D12B 4XVJL 4UQEA 1AAJA 4X5XB 3EO1A 3L3KA 1YYLH 2R51A 3IPFA 3EIFA 4AXWB 3AFLA 1B88A 3KPRD 5E9DE 2BNQB 3BFOA 4HEPA 4MZRA 1JV2A 5LGJB 1NANH 2E75C 2A7BA 4NQCB 4RSVA 4F7TB 3TFKD 4DETA 2CNYA 2DD8H 1FZKA 4GKSA 4F3FB 3Q3GA 2OMTA 5D1QD 4GAGL 2Q0ZX 2FEDC 1T5XA 3SPHA 1GW0A 4N3UA 4P4KA 2Y6TE 2FLBT 5DVOA 2WP3T 2AERT 2QKIB 3MRRA 2OXHB 4FFYA 1WFNA 4ZUVA 3DOIA 3LN5B 3BPCB 4Z7NB 4GLRI 2VLLA 5CJQH 4PREB 5IWLC 2IFFL 3HPJA 2DWDB 4PRBB 5IB1A 3SPVA 1S78C 4HIHA 3M17A 5KVGE 2VLKE 3TO4C 3MRDB 4MMZB 1NC4A 3HLAB 3F83A 2NX5E 5I73C 1LMIA 5F1NB 1MEXH 4WUKH 5BOJA 4TV3A 3ZZLA 3PAVA 3FK3A 4YSUA 4Q6YA 2WXKA 3J2PA 4N0CC 1S46A 5IGXH 3HS0A 5FO2A 5EF0A 2Z35A 3EFDL 5DURB 2OYMA 5IMOB 2Q7YB 3C60B 5FHBH 5EZOH 1JWUB 3ZYIA 5LLIC 1JVOA 2VUYA 3D50A 1BJ8A 2Y9RT 3QRLA 4Z3EA 2MFNA 4ODXB 2NXZD 1MFCH 1Z3GL 4XN9A 3M1BA 1DQTA 5GGUB 3ZUNC 5JPNB 5KW9L 1A6VL 3UAEA 1XZ0A 3QJZA 5ID1A 4I3RH 3UDWA 4G6JH 2D7TH 3VTAA 1X5AA 3C08L 3R8QA 4DQOH 2H6OA 4E41E 1MUJA 2JKJA 4HXBL 4RMVA 3V0WH 4GG6F 3BFWA 2B5IB 3KPNB 3MV7B 3HRZA 1BIHA 4GW4A 5AVYB 5GZOA 3MOAL 4DFIA 5I1EH 5EPMA 4XMUA 1NMAH 3LEVH 1ZVYA 4Y5XC 1FC2D 2EH7H 2F7QA 3EGSA 5EO9A 2Q6WA 3RP1A 5L88L 5D2LB 3DWTA 4Y19A 4AL8L 1OCCB 5EG6C 2YRPA 1E8XA 3GPSA 4KJPD 4M7ZC 1TTAA 3DLQR 2RA1A 2VB5A 4TSCL 3WFEL 2LQRA 4Z8FL 2MPAL 1DSFL 4MWFA 3QWRA 5BOPA 3ULVE 2BCKA 4FXGC 1J5HA 4ONFH 1EAPB 2J12B 5KVEE 1OB1B 3D4YA 2Q76A 1LK2A 3MREB 3OPZH 4R26H 4S2SB 2A3TA 1DBJH 2EDXA 1RLWA 3B37A 5I76A 3H3KA 4JHAL 4F9LC 4NZRH 3VQMA 2D3NA 4PRIE 5KOVC 4YS4A 1P69B 5FGSA 3SGEI 1GYCA 1CBVH 3NJJA 4G71B 2VXVL 1LE5B 3L4WA 1ETZA 4AVKA 2IJ0C 5AVXB 3VXUE 1G7JB 1NGPH 4G1MB 4QHPA 5A16A 4LLMA 3AS3A 3MLRL 4XBMA 1MIML 1J10A 3U4AA 3GK8H 4R96A 1DVQA 4DVRL 3I6SA 2DPKA 2VDRH 5EU3A 3NG5A 3R0NA 5FC9A 4X7FC 4D9RD 4XCCL 4OLYH 2E6JA 4YSEA 2ZXQA 1ID2A 4LAJH 3KLHC 1V05A 4GS7B 3FO1A 1D5BB 4GSXA 3OHXA 2EABA 4JRXE 2MCPH 2XTJD 3PDOB 4WTXA 2ZE0A 2FH8A 4FQXD 3RG1C 3MV9B 1E28A 5C9JA 4MJIE 4WEMB 3G3LA 3T2PA 3QZWA 3RFRA 4JL1A 4BD4A 1BVKA 1DQLL 3X11B 4OKVB 4NCC1 4JO4L 4K7FB 1X5MA 3U30C 1MKFA 2R0KH 2NY7L 4M93B 1CFVH 4XP4L 2J72A 3QPXH 1EH9A 1PG7W 3E7JA 3FQ2A 4HV8A 4GSRA 1PNDA 1GMEA 4TVPL 4MLIA 1BLNA 5F0PB 1XGUA 3MRJB 1XVSA 4D0DA 3ES6A 2OYKA 3GT6A 4YLQT 4PJ8C 2D73A 2DJSA 2VUKA 1ORQB 3Q6GH 1V7MH 1RZGA 3IE9A 1GKOA 1AQKH 2WLZA 5TF1L 3SBPA 4U1HB 2YD4A 3TCTA 3CSPA 1U8IA 2PUQT 4PGDA 4QRFA 5MEQA 1IGJA 1YC8A 3JWOC 1LVEA 2G60L 2JB6A 1U8CB 4LCUA 3CVBA 4Q9RH 4UF7C 3NDZE 1L5GA 5K9KB 3UABA 3U79A 1V27A 1DUZB 3LAFA 1KNOB 3CFCL 1AC0A 2RTTA 1T0NA 3JV6A 1AP2A 1FNHA 3G6JB 5AUMB 1JVKA 3RTQD 3X3GL 3WNNA 5C8JA 1VADA 2H47C 4MGXA 4Q0XL 1GAFL 2BSDA 3BP7A 3DO4A 3WXVL 2Y5TB 1UJTA 1UG9A 1TF4A 2O5NA 3RVXC 1IC4L 2K4WA 3CDCA 3X14B 5DFTA 4MA3B 1DQDH 1F58H 1IFGA 1OSEA 2BPBA 4N8PA 1OB0A 3DHJA 1QFWM 1A6WL 4M1DL 1ED3B 2ESVA 3EUUA 2WLLA 5D7EA 3PL6B 3Q9PA 4L3ED 3QFJB 2F8OA 3TEYA 3MZGB 3HNVL 3B1TA 1XGQA 1E7VA 2XQYA 3G5YA 4QWWC 1OXYA 1M7DA 4BSVB 4BUHA 1KCSH 2IPTL 4QHKI 3WELA 2Y1YA 1J1PL 1C5BH 5IT2H 4HGKC 5CNHA 4LHJB 2IWFA 3O2VL 5F6HJ 2NNAA 3ZZ1A 1U8PB 1OSZA 4L4TE 2CRZA 3OMIB 4TUJA 1IGTB 1UKSA 5IQOA 1D7FA 2ORBL 4Z7VF 4NBYB 1VRSA 1EZLA 3BKJH 1VHPA 5ITFA 2EYRA 3CVCA 5BMFH 1OWRM 2G4GA 3RWGB 4YIQA 2BLFA 1W0VA 5IROD 4Q58C 2RBLA 5SV3A 4E5XA 3I6LE 3ULUC 3EDJA 3G5VA 1S7WB 4PJDB 1XB6A 4J28A 5D7JD 5E2JA 5C07D 2HLFD 4PIBA 3O45A 3BH8B 4IMLB 1UXMA 3G6DL 3R4DA 1TTCA 4QRQB 3NIGF 4PJIA 3MCLL 5ITBH 4G7VH 5CR8A 4NJ9H 3VM5A 2ZT9C 4WU5A 2CO6A 2FGWH 3GMMA 5DQJA 4PI2A 1N3NB 4X4ZA 3WIHL 3HC2A 1Q9OA 2OZ4H 3LSOA 1O5DT 2EKSB 3O4LB 3WU1A 1FUNA 3QIWC 3GSOB 2VDPH 5IHUL 2IH8A 2DQGL 2BSTA 4P3DA 1T4WA 5HJGA 4JRYE 1TSHA 3LXCA 2NY6C 3VD3A 2R27A 5KSAB 1OAYH 3VJ6A 2F5BL 1HYRC 2Z6FA 1K5NA 4ODTL 1BYNA 1LWRA 3HC0B 5TE6L 4B5ZA 1FL5A 4BEIA 5CD3B 4UB0H 5F1KC 1OAUL 2DICA 5BRZD 1MY5A 5TK2A 5HYJA 2CUHA 3TJHC 1KIUB 3L3IB 2VXSL 5DRZB 4JAMA 4KK9D 2SEBB 3N06B 4ZMZA 4QGYA 2A74B 1TZAA 4N5UA 1G6RH 1PF3A 3PHQA 1KC5L 3OF6D 3CXHK 3LS5L 5CCGE 4EIZC 5D4HA 2JQZA 4G6AD 2WXRA 3P77A 1R4XA 2VDQH 4PD4J 3IMWA 2NQCA 3QNZB 2Y72A 1U91A 3TX4A 1GPOH 1L6PA 4MQXD 3N2JA 3DXAD 1ICTA 3MRFB 1TVHB 5IREA 2V2WB 4M6NH 2H0JA 5F3BB 4K8RH 3ORJA 1MIEH 4KROD 5CILL 4NQDD 2H26A 3ZIYA 3BKMH 1UD3A 3S8GB 4KVCL 4ZSOA 4H8VA 2IAMB 2FIKB 4UDTB 3FN9A 1UCBH 1UWYA 1FNLA 4LCCB 5EOTA 5FGBA 2WZ0A 5IBUG 2YO3A 4QOKD 2CQVA 1S2EA 4Q9CA 5D4IA 1AKJA 4BFJA 2V7NA 1RMFH 1PJ9A 4FNSA 3FQ1A 2Z31B 4FI8A 1RHHA 3PV6A 1MCOH 4JPQA 2XIBA 3IJ9A 5EOQL 3C5XA 4P5RA 3ZZQA 3N1GC 1ZLVH 2ZSWB 1IVTA 5DVNA 4PG2A 5DTFA 2QELA 1BYOA 1CD1B 4MNQB 4RGMC 2X12A 5T1DH 1DQVA 2F68X 4A39A 4P3WA 1KXTA 4ATWA 3J8F7 4RWHA 3P40A 4JHZA 2XWZA 3VM7A 3SDAD 1J1XH 3IFPA 3LEYL 2YPLD 4MMYA 3QCVL 3UYOD 1T2XA 2P26A 4NFCA 1G6RB 1U93B 4KQ3L 3ZGHA 5BZXA 3NESA 3ZE0E 4OLXH 3VRIB 4N8UA 1HHHB 1JYVA 5DZOA 3MRPA 4U3SA 2F5AH 4XP1H 4DN3H 1DBBL 2GY5A 3O0RL 2BVQB 3EG9A 5C6WH 2VITA 2VC2H 4ABVA 1ZK9A 1FZOA 3CQFA 5I6XB 2C3HA 3ZSSA 1R0AH 2J56A 4CUCA 3ML9A 5KVDH 4POYA 2X4PB 4NZUL 5DT1H 4ZUUB 4Z3IA 4FQQA 2G2PA 2XBTA 1H8LA 2HTLC 1SOKA 3O6FC 2NY4B 1JZ6A 2P8LB 3ECWA 1JDAA 4JFEE 4LKXB 1HFUA 4ZTOH 1OTTC 1YMME 4I85A 1B90A 5ICXA 3QJFA 5HGAA 3VGHA 3KPQB 4I1PA 3NEEA 5DZLA 1F2QA 1OK8A 4GKNB 4XTRD 6PCYA 3CDZB 2CK0L 4I0CC 3DJTA 3BFQG 4XN5A 3N44B 1RU9L 5F9DC 4GEIA 4I18B 3IXTB 5LGHH 1OHQA 1CTOA 4PJBA 5ISZA 4BSWB 3KEDA 3RJQB 4XOBA 3GMOB 1IAIH 5LXGL 4Y4FA 1AKPA 3VXQB 9PCYA 2VRKA 3FZUD 4JO8A 3VSUA 5CIPA 2R23A 2ZWLT 4AZUA 4XPBL 2GFBA 1KG0A 2P8PA 3FW6A 3NJXA 5E2TH 4OGAD 5CF3A 3D0AA 2DQIH 2X89A 4KDVA 3TNNB 4N0YL 4WKZA 1J9TA 4R7DB 4LARH 5AKRA 3EYOB 3WNKA 4LNRA 2NT0A 5C0IA 5BQ7B 5AW3B 5HDQH 2PP9A 2V8MA 1OD7A 3MLYL 4WO4D 3L3JA 4MD4B 5C3LD 2CHZA 4NHCL 2E0PA 3GSWB 1J48A 4YHNA 4K3JH 1NDGB 3NA4A 4R2GB 1WIOA 4UWQB 5BW7A 4DUWA 2IDUA 1RJZB 3TS8A 1M7UA 4M43L 3D2UD 5GJTH 1TCMA 4FKHA 4AJVA 2YWZA 1JK9B 3SGKA 3DI3B 1HKLH 3MLXL 3X3FL 3MO1A 5DJYB 3HAEG 4H8WC 2F53A 3KLHD 2XNAA 5GGTL 1MFAL 4PY8J 3VFSA 4Z7UF 4JFDE 1E50A 1S7TB 3B1UA 2OR7A 5EN2B 1I9JH 4XC1L 4PJGB 3J27A 3PWPD 1HDMB 2G75B 3BXNA 2Y4SA 3HMXH 4HJJH 1UB5A 5AOKA 3OZLA 1TVDA 3V4PH 4Z9KB 2AFNA 5CHNA 4Z3FA 5AB9A 4M8VA 3C9NB 3MACL 1AIFA 3E8UH 2P7TB 4P9ML 3SYOA 1I8LC 2OTUA 4M4PA 4NCC2 4I87A 1WZMA 4EI6B 3ZL4H 4C4UA 1CXFA 3CHQA 1IE4A 3JWDC 3OMAB 4PJCB 5B38G 4OZGF 1IL1B 1E3XA 1OLLA 1XXDC 3IMTA 1NJ9A 3L2NA 3FSOA 3RI5K 1DJHA 5IVNA 4JM4H 3I9PA 2ESVE 1YY8B 4XVJH 4PJ8D 1UEYA 3GSRB 2W9LA 5ACLA 4PJ5A 5BO0D 1ZLWK 3GWJA 4FXKC 1IM3B 1J8HB 2AJVL 1AR1B 5B1BB 3V5KA 5SX5H 2E9IA 3NJNA 4K9EH 4KJWC 4J39A 2M2DA 4TXVB 3EYSL 2ZG1A 4FQLL 3V6ZA 2JH2A 3QZBA 4W70A 4GAGH 4U1MB 1YMHA 4QCIB 3F3HA 5KS9B 1BPLB 2XACC 2JLPA 1UA3A 2IAND 4GB9A 3QEUB 5G4MA 5A2IH 2NY5H 3H9HA 3DRQB 1P5VA 2OMUB 1E9OA 2WLMA 2HRGA 4V33A 2GC7C 3RWDB 1I1AB 4IMKA 3OKDA 1V3MA 2IFFH 1N19A 1BXXA 3RVXD 5I1KL 1K9TA 2QZ5A 4ADGA 4QRTA 2AXHA 3COOA 1OZTG 1JZ3A 1SHWA 4O02L 3UZEA 2CKNA 3OKNB 1I75A 1R3LB 1HCFX 2R0ZL 3IRZA 5E70A 1R3KB 3D3VE 4PJIE 4QLWA 1N8ZB 3O8XC 3W9EA 1HEZA 3LZOA 5B1CA 4HSQA 2OSYA 4W4OC 4DCQB 1WWAX 4UTAL 4OF8A 1CQYA 4MQTB 2VQ1A 4K15A 5I6PA 3EFDH 3DBSA 3GJFH 2FWOB 1RZ8A 4QJ4B 2CBQA 4FFWC 3WIIL 4LCYB 5IMKB 2ZKMX 4OCLC 4H0IA 3L13A 4YR6B 1Z3GH 1JV5A 2MHAB 3F7PC 3ASNB 3QXDB 4MQ7A 3TTYA 1NL0H 2Y1AA 4H8PA 5KW9H 1A6VH 1I1FB 1XGRA 4F9PC 1NBYB 5IIEA 5AAWA 2F7PA 5HYJE 4WFGE 2FNWA 2IVFC 4Y1TA 2WLIA 3IJEB 3C08H 1CFSB 2EYTB 5JDJA 4MMXC 4F5CE 1H5BC 5DS8A 1LWHA 1WZKA 4GW5B 1UWXH 3QE5A 4HIPA 3MOAH 1QR1A 4BCYA 1PCSA 1VFUA 5AZUA 5IKCA 5D96C 4Z3HA 3VU2A 4QY8A 5L88H 5ALBL 3MNMA 2AANA 2VLKD 1YEKL 1IGYB 3IU4L 1J05B 3QIWD 2VMFA 4OCWL 4TSCH 3LX9A 5G5DB 3WFEH 4P2OA 1I1YB 3Q0HA 4Z8FH 1JFQL 5HPOA 4MXVF 3ZOAA 3Q7JA 4ZMOA 2KQNA 2QV4A 3PWLA 2NY6D 4AX3A 5CEZL 1PJWA 3TVMB 3VXPB 2KZBA 4X8XA 2WJ5A 5B8CB 3ARFC 1BQHG 3T6XA 2J21A 3UTTB 4L1HA 4W6XB 1ZIBA 1MNUL 2JNZA 4JHAH 5AZ2L 2Q8BH 4OFIA 3P9WB 4JFYB 1TENA 1NCUA 4X5XA 4UTAA 4RNRB 2VXVH 3C09B 4NIKB 4AXWA 2KKQA 1Q72L 3M1OA 3VSVA 2AEQL 1PEWA 2OMXB 2WBJA 3AG3B 4KQ4L 5JR1H 1NSNL 2BNQA 4OF3A 5I28A 4N8CL 4WW1B 2HA1A 5IM7B 3MLRH 2WZPD 4MD0A 4BKLB 1MIMH 3ARPA 4PTTB 2W94A 4MLSA 4NQCA 1DBKH 2NNRA 4F7TA 4DVRH 4E41D 3DUHA 4F3FA 1QMUA 2BY1A 1RIUL 2GIYA 1NQBA 2X09A 3ARBC 4MQSB 5E1IA 3DK0A 3SE6A 4M03A 5JQHC 4JANB 1EEYB 1MJJB 5TDPB 1XF3B 2BS9A 1KEML 2QKIA 2OXHA 3CQPA 3R06B 1DVXA 1FFQA 3BPCA 3LN5A 3DETC 4PREA 3QZNA 1MW1A 4FQPA 1RP9A 3ASOB 1OF2B 2DWDA 2C9RA 2QSCL 4PRBA 1N68A 4HALA 3DTUB 5C9KA 3ULVD 2FHBA 4KRLB 4Y7OC 3MRDA 4MMZA 4JO4H 2YAFA 3HLAA 3DIFA 3CFIC 1O9ZA 4JHUA 3SGDH 5F1NA 3GXNA 4ZOEA 2JXMA 2NY7H 2AEOA 5MEND 3T0EE 4XP4H 4PRID 5E51A 3UTPE 1YDPB 3MA9L 3TL5A 5F97E 3MJ9L 4OFDA 4TVPH 3EYFB 4P8QA 2A4EA 4QXGL 1CE6B 2O6DA 2Q7YA 3C60A 3U36B 2FBRA 1JWUA 2RQEA 2HKFH 2R1WB 1I3GL 1QSZA 4TL4A 3SBWA 5CD5D 4HSCX 4WJG3 3VG0L 2WNXA 1PG7X 3KH4A 1WUNT 1G7HA 2BHUA 5TF1H 3HG1D 4ZMWA 2B1AL 5GGUA 1DVTA 4QDGA 5C86A 1DJWA 2GHZA 1BZEA 1FG9C 3Q8FA 5I8OL 5KVMC 1JRHI 4RAVB 1XSJA 2ETWA 2G60H 3WEXB 1NEZB 1MCNA 3AGVA 2GK0B 3GXUB 1SJVA 3SYQA 1NMCB 5ISZE 3A67H 4U7KA 1MXDA 4P2RB 1YQVL 3OG6B 3CFCH 1HXMB 1YSOA 3KPNA 1JD7A 3MV7A 1XSOA 1LP9F 3X3GH 3D30A 1SMAA 12E8L 4MJID 4Q0XH 3MLUH 1JRHL 4HJ0C 3TIDB 4HU8A 5D2LA 5D5MA 4Z0XB 3WXVH 2COQA 1KTCA 4ZD3L 1IC4H 1T83A 5FWQA 3MBED 1H8OA 4OLVL 3AS1A 1NH6A 2HTLD 3WO3B 4Z77B 4UAOC 5F1IB 1A6WH 2K8MA 4M1DH 3TA4D 1BMWA 1SJHB 3MREA 4OFVA 1NDMB 4L1BA 2QVMA 3CTTA 3HNVH 4LCIL 4Y4KC 3TBVB 3U4KA 2J1YA 4BFNA 4XMPH 2IPTH 3LY6A 1MFBH 4HUVB 1J1PH 1JWMB 5FW7A 3HE7D 2DJMA 3O2VH 1UATA 3T2NL 4LEEA 1LE5A 4S1QL 1V8HA 1W72L 4I88A 3O9WB 1QI3A 5CEXB 4Y9EA 4G1MA 2UWEF 1TJGL 4A2LA 4F7CB 2ORBH 4WHCA 4KKLC 2LLGA 5CINH 1TEGA 3KEHA 3E3QC 4JM2F 4Z7VE 3MOQA 4JCWA 5I5MA 1PKQB 3KL0A 5EU7E 3S5LB 4XBGB 1XSKA 3RVUC 4AW7A 2F53E 1DVZA 2RALA 4LF3B 1W8NA 1A4CA 3O4OC 4P5KB 5C0ND 1VGEL 2YZ1A 1D5BA 2WQVA 5C3TA 4MAYC 3G6DH 1SYSB 3PDOA 1KGUA 5CU5A 2JQMA 3LNEA 5AEAA 3MCLH 4CBPA 4BK5A 3NIGE 3MV9A 2FEJA 3US1A 2Q8AL 2WKLA 3D4ZA 3WIHH 5C2BH 3VX1A 2HVBA 1A66A 3I84A 5I1JL 3I6KB 4NO0B 3X11A 4OKVA 4KTEL 2Y25A 4K7FA 4YE4L 2PXYC 5IHUH 3LQZB 2CHXA 3CLWA 2P5EB 2WVTA 3K4ZA 4MNHB 1HL4A 4DGVH 3JV5A 4IRJD 1S7VB 1FH5H 5E1AB 3TV8A 3ENEA 2HPTA 4A66A 2XWTB 2F5BH 1OD9A 2C3GA 3AT9A 3EO0B 4ODTH 5TE6H 1FFTB 1CICD 1OTSD 3MRJA 4JPSA 3AU1B 4OZIE 3KPSD 3P1VA 5EBMB 3RPIB 1I7TA 4PJ5E 1T1XB 4XODA 4TKWA 3B7RL 1ORQA 3VI3F 2P80A 3FB6B 2KDGA 3S8FB 3T6VA 1BYPA 1H0DB 3US0A 1U2YA 1QG3A 2VXSH 1Y7VA 3N9GH 4H8UA 4NRXA 4U1HA 1AZUA 3E80A 1DZ0A 1JZ4A 4R7XA 5ADOL 2ITFA 4AGOA 2VWEC 5K9KA 1J86A 1SLWA 3HE6B 4M3JA 4X6DB 4B9KC 2MRYA 3CK0L 1DUZA 5I1CH 3VD7A 1KNOA 1BGXH 4TTDD 3VFPB 4KK8D 1ADQL 2H8PB 3RIKA 4XP5L 3JBG7 5E2VL 3G6JA 5AUMA 5HI5D 5LNEA 3IJSA 3VSQA 4F8QA 3VFGL 5CILH 1YECL 2Y5TA 5FK9B 3FYIB 2Y2WA 3X14A 2WXPA 4MA3A 5DRWB 1PIFA 2ROYA 2CO3A 5AYUL 2ERJC 4BWUA 3H85A 1ZTMA 1ED3A 1LNUB 4YNYB 4B97A 3PL6A 4JJ5A 4OUUB 1IBBA 3QFJA 4FA8A 5JHLL 1BP3B 3L5IA 1OL0A 3C6LB 4BSVA 2ZF8A 2LLLA 5JW4N 3WDIA 2W9EH 4QF1A 4N90D 1EHLL 4JJOA 2H5UA 2WWOA 4HCRA 4ETQB 5EOQH 2WW8A 2Y36H 3O6ML 3UEQA 1CT8B 3LVTA 1U8PA 3Q48A 4W9IC 3K8MA 2BY2A 5I0YA 2ISDA 1IGTA 1TITA 3HZKB 4WI0B 3UGUA 2OV0A 5BV7B 2LT9A 2HJFB 3PJLA 3QJSB 2LU5A 4XOCA 4UNIA 5HGGS 2A9NH 2DLTA 1RZJL 4L5FL 4HWUA 1RL1A 3RWGA 1P4LA 3FUJA 1JDCA 2A83B 3LEYH 3M1CA 2W9DL 3GRGA 1OAXL 3MRHB 4PJDA 1S7WA 3PS6A 2QADB 5I1HL 4OLUL 3ZTDC 2P48B 1CYXA 3BH8A 4IMLA 4QRQA 5JIPA 1YN7B 3WN5A 1DBBH 1KXQE 4PRHE 1IT9L 1FWXA 4LK4A 3G9AB 4AT6B 1ZAGA 1N3NA 5T3XL 1AZNA 2EKSA 3O4LA 2R9HC 3SBQA 4NZUH 1MCBA 3GSOA 3PQYE 4FFWD 1QVOB 2YC1B 1AO7D 2X6UA 1SLXA 4J4PA 5C2UB 1PKOA 2FZ3B 1MZYA 5IVOA 2EDKA 3LZNA 1JZ2A 2BZDA 2WXLA 1N6QL 5GISH 3T8VA 4JZNB 3W0WE 5KSAA 2E3VA 4Z95H 4AC4A 1ZOXA 3RGBA 2UZIL 4IKIA 3HC0A 2YD6A 2CK0H 4FS0A 4FXTA 1OSYA 3HLKA 5CD3A 4LT7A 3VDCA 1HSAA 2GAZB 1RU9H 3MFFB 5BCAA 1NMBL 1KT2B 4OJFL 1ZJBA 3LXUX 4LEOB 1KIUA 3L3IA 4NN5B 4OLEA 5DRZA 4LL9A 3ZQWA 1QPPA 5DJ0B 4PLKC 2A74A 3ZE1B 1OSPL 1SMDA 1PBYA 4B3VA 1ZTXL 1J88A 2HT4D 5EB9A 5EBWB 5AWNH 4ZJ9A 3SQOL 4UM8B 3BRGC 5D1ZC 2HAZA 1I9RL 3QNZA 1QUNB 4XPBH 4A67A 5EIIG 3MRFA 1TVHA 4Y5YB 2V2WA 2GT9B 5A2BA 4MRCA 5F3BA 5HDBB 2W0FB 1G9NC 4AGLA 1SEQH 5C0CE 2WD0A 4QD2E 4AEFA 3IYLW 4G80B 2MKWA 4TPRL 2IAMA 2FIKA 4UDTA 2LR4A 4JFPB 3MLYH 4LCCA 3RDJA 4JFED 4NHCH 3AG1B 1F90H 4W6WB 1OE1A 5I19H 3CZSA 3GF8A 4XBEL 5LBGA 3SDXF 4E9RA 4M43H 1NGXB 2Z31A 1BECA 3UEZA 3PNWB 4F15C 5D55A 1MCFA 3ULSB 3RIAK 3IRCA 1KYUA 1PNCA 3MLXH 1QBML 3X3FH 1CD1A 2NNXA 1E9QB 4MNQA 2QPEB 3D52A 5GGTH 1MFAH 2BS8A 1I7ZB 3HKFA 5M94B 2PCPB 2GJJA 3G5ZB 4Z7UE 1UWEH 1NCWL 4RGNE 4HXAL 5T3ZL 5A7EA 4KRPB 3CWGA 3JV0A 2V5MA 4OKDA 4WI7A 1HZHL 2P5PA 4DKFL 4LGPB 3CN4A 2CUAA 1RPUA 4NAJA 1G6RA 1U93A 1ZA6B 3IFNL 3FHEA 3MACH 3GPEA 1OE2A 4WWKC 1HOCB 4FQJL 1HHHA 5FB8A 3W57A 2IPKA 2YD7A 2ITDB 4G70B 4AYDC 3PP3H 2BVQA 1PZAA 4XN2A 2B20A 2CGZA 2CE6A 5E2UL 4LSTL 3D85B 3DGCR 1NBVL 2E6PA 1BWMA 5IQ9B 2WCGA 3KGSA 1UM4L 1KYAA 4ZUUA 3BWUC 1OALA 5GRVK 5CGBA 3VGAB 2EO1A 4KTYA 4Z7OB 2P8LA 2EIBA 1IJ9A 3IDYC 3ILDA 1IB5A 4P23C 2FX7L 2EC9T 4LKXA 2J5LB 2AJVH 3EFOB 4ZMNA 1NCOA 4GKNA 4KHTL 3LIUA 3CDZA 2H3NB 3EH3B 4N5ED 2ZTBA 3P4OB 4W93A 2EUZA 2D7QA 1ES0B 1XGTB 3DUSB 4I18A 1S9YB 1OTUC 1GOGA 1HE7A 1RUQL 3IXTA 4HQQL 4JFDD 4P9HC 1UH2A 4BSWA 2EIZB 2PABA 4HFWB 1I4FA 2DN7A 2CAKA 1CI5A 3IJ7A 1RFDL 3KYAA 1M4KA 2VDLL 3CSFA 5TDNB 1N5YL 3VXQA 4ES8A 4EI5C 5CFAA 3QARA 3PWJB 4N20A 4DFHA 4OJDH 1ONQB 3V7MA 4DESA 2BIQA 1R75A 1CLOL 4YUEL 3QGVA 2VLRE 2DKMA 4O02H 5HJ3A 5J13C 3PGFL 3TNNA 3JUZA 3MXWH 3QVAA 4U1KB 2R0ZH 2VYRE 2CLVB 5MERB 2E9JA 2FNBA 4R7DA 4U7MA 4JFTA 3T3MF 4LP8A 5KWYC 3EYOA 3MV9E 4JS7A 1J0HA 3N85H 3VA2C 4Y2OB 5BQ7A 5IFAL 3SBRA 5AAMC 2YLHA 2O4EA 3K5RA 2G2RB 5GZNC 4E0RB 2UXTA 4MA1C 4MD4A 2AJXL 4D8OA 3GSWA 1L4IA 1NCJA 1NDGA 3WIIH 1RJZA 1SN5A 3PE9A 2VDOL 4YFLF 3LTVA 1CGVA 4BH8B 4RH4A 1JK9A 4JO3L 3JT0A 4LCWA 4KX7A 4WWID 1F4XL 2WIMA 4AKPA 4ZXBB 3RVUD 3KG5A 1QNZL 1G0YR 3QJQB 5DJYA 2X3AA 4RMTA 1ZE3H 3N41B 4RIRB 3KMDA 3QUYD 1XGYH 5DJ8B 1S7TA 1B0GB 3CHRA 5EN2A 1OCOB 2VSDA 2WLYA 5HHMB 4GBXD 1DO5A 4DK5A 5E8PB 2QSTA 4G8GD 2QPSA 5ALBH 5FCUL 1PD1A 1T7ZA 3H53A 1YEKH 1QRNB 4RMSA 3C9NA 4NGHL 5DQ9B 3IU4H 3RWJB 4PMEA 3NACL 1E8ZA 1E4KA 2EDEA 3D3VD 4IU2B 4OCWH 5FFGA 3WHE1 3APMA 2XN9D 4EI6A 3PAZA 4AGPA 4E68A 3VFVB 4PJCA 3Q5TA 2WKOF 5CEZH 1K3IA 4IDLA 4OZHB 3MGTB 1IL1A 2OS7A 4FFTA 1GOHA 3K3QA 2VMCA 1MNUH 4DKEH 1YY8A 1MWAH 2BSED 2PTUA 4QXUL 3GSRA 3QFJE 4OQTA 5HDWA 3RWCA 4Q7DA 2R2HB 5I15H 1Q72H 2P9RA 5EBLA 1IM3A 3ZE2B 1J8HA 1T4KB 2AEQH 1KV3A 2C3WA 2NT1A 4NZJA 2N1KA 4UQ3B 3P0YL 3T0XA 2XU9A 1DN2A 1NSNH 5D7IF 2ZONA 3ROLB 2G4EA 1E5ZA 2CMRL 3QB7C 5CJOL 3BUPA 3CHOA 5LHDA 2EICA 3GD1C 3DVFA 3H9ZA 4LB8A 4YSRA 4AY0A 1R6VA 3CCHB 4KZEL 1RIUH 2ZYRA 4LHQB 4U1MA 1BZ9B 2AJYH 5KS9A 4PLOB 4EF3A 2EH8L 1P7QB 3GMRB 3INOA 4NQTA 3JTSB 3QEUA 1KEMH 2F0CA 1UGNA 3UPAA 5E8OA 5KYYB 4Z7QF 3ARDA 3DRQA 2OMUA 3RWDA 3F7YB 1I1AA 4LEXH 2H7WA 4UNTA 4PBWD 1H3TA 1XD1A 2QSCH 4NBZB 2IWGA 2WAHA 3TZVD 1U3NA 2OI9B 3LKRB 1KOAA 1LM8V 3OKNA 4H26B 1QFPA 4N9OB 1MCCA 1R3LA 3UAJA 1R3KA 1Y6NR 4KO7A 1M7IA 3MXVL 1HQ4B 4KVNL 2X42A 3OQ3B 1N8ZA 1U4FA 1QEWB 3UIYA 1Z6JT 4DCQA 4EQ2A 4LRIC 5HVHB 3MA9H 3O4LE 2LU3A 4UYPA 3MJ9H 4Y9CA 2BVYA 2NY3B 2FWOA 4QXGH 1UOLA 2BJML 3L81A 2QDWA 3LMJL 4LCYA 1CGSH 1I3GH 5FUZH 5IMKA 1LQSR 3ZMRA 2X7LB 5C71A 1MWAB 4YR6A 1KGWA 4JG9A 5CZVH 1XCWA 4R7LA 2MHAA 4DOHB 2B1AH 4X6CF 3QXDA 5GGRY 4X7EC 3WHXB 3P69A 5C0RL 1I1FA 3APNA 5GHWH 1NBYA 5DC0A 5A7BA 3GUTB 6FABL 4KZCA 4OGZA 3IJEA 3PREA 1YQVH 4QXTB 1CFSA 2EYTA 2YPKA 5BNXD 4GW5A 4AQ1C 1XF2B 4WGWB 4PY7B 1G1OA 4KU1A 2B1OA 3ECUA 1A3RL 1JRHH 1LP9E 1P1VA 1BQKA 3LZQA 2O5XH 1ZLUH 3CVHL 2OCJA 1IGYA 2QVIA 4FLOA 2R9HD 2DWSA 4PRNA 5D7LD 3RZWA 3QDGD 5G5DA 1KLUB 3D18B 1I1YA 4OLVH 4LHUA 2AK4E 2XDHA 4IYKA 5ICZB 1X7QB 4UDUB 2NY1B 3T0ED 4U6YB 1PLBA 3UTPD 3TVMA 1DQKA 3QJRB 3VXPA 3GM0A 4LCIH 3D06A 5B8CA 3NGBC 1OGAB 2XXGA 3ZKMD 3CN1A 4KX9A 3BSZL 4X5RA 3T4AB 4JFYA 2HT2C 3T2NH 1UA7A 3BJLA 2X1PA 3OJVC 4RNRA 4S1QH 5FYJL 3VNYA 1RUPL 1PLGH 4FFZH 2NR6A 2B9BA 1IKFL 2OMXA 4OCXH 2VZSA 3DX2A 1ZHBB 1TJGH 3KYNB 1F5WA 4XWOC 2UZPA 3T77B 1JMXA 1FCCA 5C0AB 4U6TA 5IM7A 2AAVA 5CSZB 4B7LA 4BKLA 4PTTA 1M1XB 4HT1L 4MZ3A 3EJPA 1KLGB 4MNQE 4AMKL 1H8SA 1P6WA 4RX4D 4Z1PA 5ES4B 4TLTA 4JANA 1EEYA 1MJJA 5TDPA 1XF3A 3HA0A 3QUMB 4F57L 4QAMB 3MUGB 3AXIA 4BZ1L 5BVPL 3KYKH 25C8L 3OKKB 3US9A 1B3JA 4WFHE 3RFZB 5DHVH 4XXCA 4IBVA 1OF2A 2LVEA 2DMHA 3QNXB 1KXVC 2Q8AH 5BVJB 4D9LL 3ESVF 2FQEA 3HB3B 3TFBA 2J2ZB 1F6AB 4FYQA 4KTEH 1MPAL 1KYOJ 4YE4H 1T7WA 1J5OL 5LN4A 4ODVL 2CBOA 4LLQB 1FO0L 4P5TB 4PJ7F 3SIKA 3VE0B 2JI2A 5J9PB 5DUPL 1YDPA 5LGKA 2D9CA 1WT5C 1RIHL 3QEHB 3EYFA 4KKBC 4QLRA 2NDFA 1CE6A 5I18L 2KT6A 4TNEA 1EZVX 3GZQA 4WW2B 4CDHA 2ZJSL 2R1WA 3QPQC 1E3ZA 1EZSA 5KBNC 1RV6X 5LAPA 4NZTL 5HYQB 2AS5M 1YEFL 4EQ3A 2QR0B 4M6OL 5HBBA 2CDGA 3DX6A 4K5MA 5CZKA 3E9TA 1RUML 3T3PF 4RAVA 2IPUG 2ARJQ 3V9EA 3WEXA 1NEZA 5ADOH 3LIZH 3QZLA 4YDIL 3WO4B 4P2RA 3NZUA 5E23A 4R97B 1ZHLB 2EE2A 3LS4L 1HXMA 4HKZB 1AGEB 4XP5H 3NFNB 5E2VH 1YHPA 3VFGH 3BP6B 1MI5B 1YECH 3FO2B 3NFPA 2CR0A 4Z0XA 1J12A 1K2DA 3O0LA 2YJQA 4FKEA 5T1KB 5D1XE 5HYIA 5JORB 2GBUA 4KBPA 3JWOL 2G3XA 4RBPH 5AW1B 5AYUH 2AQPA 3RRQA 3S35L 4DP5X 4Z77A 2CJSA 1DANT 4Q74A 3GMPB 1HZLA 1SJHA 2XWJB 2EVFA 1RIVL 3UPRB 5HVWA 5JHLH 1NDMA 1OY3B 4PN6A 2NXYC 4U3CA 2Y5EA 1WWBX 3RGVD 4BQ6A 1TOXA 1BXVA 1X5YA 1QFWI 3FT2B 4JR9L 3RX5A 3TBVA 3V79C 3JTTA 1EHLH 4HUVA 1JWMA 1RSFA 3HR5B 4RMRA 1F00I 4QRSB 4QPEA 1SZNA 3O6MH 1NBCA 2AABL 4HETA 5KVDE 4GXUM 3L3DA 3O9WA 1AZVA 5CEXA 5JPMB 5I5IA 4HULB 1PG7L 3GTTA 4DERA 4F7CA 1ETA1 4HFUL 2Z9TA 4G2AA 3HS9A 3OHMB 4IEFA 3ARGB 2L3BA 3NJHA 3NJFA 3GNML 2EE6A 4L5FH 3SKOB 4NQXB 3S5LA 3SDCB 4P0DA 2W9DH 2EINB 4IBZA 1U92B 5DJCB 4LF3A 4AQZA 4GRWH 1E2ZA 4OLUH 3U7YL 3FT4B 2AI0L 1L9PA 4PJGE 1SYSA 4AZ8B 3D5OF 3RA7L 1LO2L 5K9OB 4FG4A 1A7RL 1IT9H 2VKWA 2R4RL 5IHZB 2C1PB 3NJLA 1A47A 3AROA 1U0QA 5AOZA 5KJRH 5T3XH 3TN0A 5B7FA 5GZND 1L9OA 3QAZB 3AABA 3RDTC 3I6KA 4NO0A 4EKXA 2GJRA 2Z91B 2GHWB 2WXOA 3KPRB 3RZCC 3LQZA 4PJCE 4WU7B 2P5EA 3MUUA 4MNHA 3ULUL 3OJDB 1S7VA 1N6QH 1JPGB 5E1AA 1CDBA 1EUUA 2BIPA 2XWTA 3MNWB 4KMTL 1GRWA 1TUPA 2RAMA 4L8DB 2ZYIA 5FR3A 2BMKB 5D1QB 4KDTC 1DBML 2OW6A 3AU1A 4DH2A 3RPIA 1U8KB 3W9DB 1T1XA 2Z7WA 4ZW7A 1N4XL 1MSPA 1NMBH 4OJFH 1G7PB 3FB6A 5I8KL 1THCA 1XIWD 2K8QA 2YD3A 1H0DA 1VAHA 1J0YA 1AYOA 4PGJA 2H2SC 4YC2C 1KBWA 4ZNEE 4MHHG 4OB5L 4BIKA 4L1TA 2IV9A 1OSPH 1QO3B 4HX1B 3ARTA 3UCQA 1P4BL 1ZTXH 4CVXB 4XNXL 3OAWA 3QZMA 3V6OA 3CSGA 3MJGX 2L7QA 4I48A 1EO7A 3HE6A 4X6DA 5AKVA 4MBRA 4MVBD 5AD0B 1L9TA 5KS9E 5KN5B 3VFPA 2YQGA 4PRHD 1L3NA 2H8PA 3D0LB 4EO5A 4PJ9D 4DVBB 4UIKL 4GRWB 1X5XA 4BQCA 3KAAA 4FYSA 4CSSA 5FK9A 4K3DL 3T08A 3S8WA 5DRWA 1KTKE 4XPHL 4LOEA 2MOVA 2VGLM 3V55A 3V6BR 3ZVVA 1LD9B 3TF7C 3C6EA 4YNYA 4TUKL 4FTVD 4JY6B 2NXZB 1PYWB 4OUUA 3W0WD 5KUKA 4JQIA 1GGBL 3C6LA 5SWZD 4ANKA 4NXSA 5ALCL 4AQAB 3SDXE 3WLWC 1X9UA 3ARED 5L4IA 2Y0SA 4ETQA 1ZPUA 2QQLL 5FXCH 4FA6A 3S4SB 4YDNA 2WC7A 1HWHB 4OZFG 1BFSA 3WY2A 1O7DE 4DWHA 4OFKA 3UG5A 1QBMH 3UO1L 4DW2H 5DD1L 4I5BB 4WI0A 4BH7B 1YUHB 2APTA 5IEKB 3OXSB 2HJFA 3KGTA 3KJ6L 4K7PY 1B2WH 4JCLA 4I9XA 5I24A 5DC9B 1NCWH 4MXWL 1IGFL 2CGYA 4FQCL 2VMEA 4YBQD 3MRNB 4NKDB 2A83A 4OIBA 1HZHH 2PO6D 2XPYA 4DKFH 2I9TB 4HAKA 2ZUYA 3MRHA 4M8UA 2F58L 2WYTA 3IFNH 4X4ME 3ZHKA 1TTUA 3L4ZA 2P44B 3QIBD 5EUOF 5ID0B 2ZX8A 1Y07A 5C0CD 1PQZB 1YN7A 3BSHA 3LB6D 3ZDZB 4FEIA 4PWKA 1L7TL 5E2UH 5PAZA 3FT1A 4AT6A 3ALXA 5MP6L 1A1OA 4KV5F 1NBVH 2RHEA 1ZDSA 3GQFA 5GS1B 1MHPH 4F7KA 1CXKA 4UCFA 5DF0A 4F37K 4OD3L 1AGFB 4WGVB 1N12A 1UM4H 4X80L 2YC1A 3V0HA 1T1ZB 4NPJA 3DX8B 2FZ3A 5A43C 1SDYA 1DQJB 2FX7H 2B0SL 3UTTE 1A6PA 1NIDA 1OF0A 3CFJB 4F2MB 4KHTH 2HLEB 5ENWB 4HEPG 2CA4A 1CR9L 2YQ2A 3LH9A 1WSST 2VXTL 5IJKA 2GAZA 3P02A 1B4LA 1Q90A 2E47A 3RY6C 4KZ0A 2XTJB 4HQQH 3O6KL 2W38A 4LEOA 3L08A 1XBDA 5K5YA 4FQXB 4WKXA 3IGAB 4RGND 1DUYB 4JFFD 4N68A 4CRPA 1B4JL 1KENL 3UC2A 1AQMA 3CXDL 3GJEB 5EBWA 1NLBL 4UM8A 3E6FA 3ZKXC 2CPUA 3VWJD 4B60A 1QUNA 1CLOH 1MOEA 2D7OA 4YUEH 1SNRA 2WVVB 1CLCA 1I3RB 4Z7NF 5GGRB 3DJ9A 4Y5YA 4AENB 2GT9A 3PGFH 4A7GF 4UINL 2W0FA 3KM1A 2AGJL 5AQ0A 3FH5A 4N9GB 2L04A 5BS0D 3UBXB 2CJUL 5MI0C 4MKMA 4G80A 3FH7A 3DMMC 2V2XB 5IFAH 3IGLA 2KZKA 1KFGA 4XAKE 3STBA 2WJ7A 3WJJA 2ADYA 5JA8B 2HT2D 4JFPA 4TL5A 4U1LB 3MJ7B 3OKYA 3D6GA 4WUUE 5I1GH 3IMVA 2P49B 1K72A 2V37A 2AJXH 2XOTA 5DFVD 2FBJL 1IGML 4GQZA 3V2AR 1SEBB 1C08B 5I71B 1NGXA 2VDOH 4ZAKC 4YVUA 4TLUA 3PNWA 3CFBA 3OKMB 3B5TA 2BIOA 1DLHB 4KH9A 2COVD 5JW5B 5BQDA 3HTLX 1NCNA 1QNZH 4TQPA 5TGBB 3MLWL 1E9QA 2VN7A 5T5NG 5DS1A 3ARXA 1QWNA 3GO1H 4HGWB 1MCEA 4L23A 4U0RC 3RTQB 4B95C 2X6CA 4ONGL 4ODBD 3O81A 2PCPA 1S7UB 3G5ZA 2X2UA 1G87A 5FUCE 4XWGL 3MUJA 4X7CC 2KS0A 4LVOB 3MLZL 4XPFL 4G82A 2VLRD 4NN6C 4P2RE 3TH2T 2P3YA 4XNQB 1ZA6A 4NGHH 4HLEA 1VGKA 4L3EB 4KXBA 5IW3A 2VNCA 2A9DA 1HOCA 1TEFA 3L4XA 3NACH 2LE9A 4NZFA 4BFOA 1N70A 4WWNA 2OMVB 4R90L 5D5MF 5JHAA 4Q4EA 4H8WL 2WCPA 4AK2A 4QYOA 4HOMA 4CU6A 2HX8A 3IETB 4POZC 5AW2B 1C7TA 3D85A 3NZSA 1TZHB 4FTDA 4DN4H 3BESR 4WZ9A 5IQ9A 4ONHB 3H7LA 4B9ZA 2F1EA 4F20A 3PU7A 1Z5LB 4A7UA 2XCMC 1JGDB 3QPQD 3UL4A 4OV5B 4FG6D 2PN5A 2WO3B 3AS2A 1ZRUA 1U30A 3FCSB 4YHPB 3EFOA 4ICWA 3FRUB 1TNNA 4GP4B 1IC7L 4YHLL 1U8MB 3JWDL 3RY5A 2CMRH 2H3NA 4GY4A 5CJOH 5D7IE 4Z7WB 3P4OA 4QUOA 5C07B 3SEPA 4MJHA 1ES0A 1XGTA 1XR8A 1KUMA 1HL5A 4TVPE 1S9YA 1QATA 1HE8A 1VENA 4FGMA 4KZEH 1H9DA 5C0DB 4IIQB 2EIZA 4HFWA 3MFGB 2HMIC 1TPXB 4RMWA 5GJSL 5TDNA 3QP3A 1G9ML 2EC8A 1PKQE 4HHAB 5SV4A 1QNIA 3PWJA 4Z7QE 4LLDB 1ONQA 4PCYA 4C83A 1O6VA 2EADA 4ERSL 1OAKL 4P4KC 3FCGA 3OX8B 3LRGA 4GG8B 3MLPA 5DC4B 3QZWG 3E9UA 4K23L 1J5IA 4NPYB 4YO0B 4U1KA 1IGIH 2CLVA 2HWZL 2ZG2A 3O2WL 4KVNH 4P2CG 5J3HC 3RUGA 4Y2OA 4OIFA 1WFMA 3LYRA 1T7VA 2H45A 3G9VA 4K5LA 4N28A 2ZP9A 5BRZB 1Q38A 2G2RA 5EF1A 1R9FA 3LH8A 4E0RA 5HHVL 1UQSB 2K9UA 2P5EE 4TULL 3FSWA 4QI3A 4M6ML 1CFNB 1VJSA 4N2IA 3HS0C 3L1EA 4BQ9A 4BH8A 4HLZG 5F6IB 2ATKB 2X0VA 4ZXBA 3MHZA 5JYMA 3LKNB 1WZAA 3IBEA 3DXAB 2MNUA 4GUCA 5F7BA 6FABH 4F93B 1H9VA 4RIRA 5LAXB 4KROB 5DJ8A 4NQDB 4G83A 1B0GA 4IGBD 3MLSH 3MCYA 4PSRA 1T66C 2VQUA 5DHXB 1ITCA 2W92A 5E8PA 5KYUB 3UDWC 3BAJA 3CVHH 3LKPB 1QRNA 1WZLA 4QOKB 2EEBA 3HRZC 5GZOC 4IU2A 2K6YA 3CC5A 1SOQA 1MCHA 1L0QA 3QI9D 4ACPA 3O3AA 4TVSa 3VFVA 1KB9J 2FVNA 3MGTA 2WXFA 5C6TH 4Q52A 1VZIA 4YBHA 1X5GA 1EJ6A 1DVFB 3SDDA 3MTXA 4MCMA 3GLZA 3MGAA 2A9BA 4XOEA 1GCYA 1OW0A 1UD2A 3BSZH 4EIUA 1M42A 2XFXA 3FULA 2IQAB 4AIEA 5FYJH 1QI5A 5E1QA 1GC1C 2R2HA 3ZKND 4JY4B 2WGXA 4FERA 1GZHA 2H2SD 4UQ2B 1T4KA 4UQ3A 4ZUSB 5K1NA 3I50L 5DUBA 3SDAB 2PTTB 5EA0H 3ROLA 4RQQB 2YPLB 3DKHA 4C56D 5I1AB 4JPWL 1QSFE 3NIDB 3KCWA 4GXUN 4N0FB 5BZWB 8FABB 5DEJA 4HT1H 1XAKA 4PJFF 3C75A 5I6OA 3CCHA 3GDCA 4XN8A 2EJ1A 4XP6H 4XNAA 3WKNA 4E5XG 5T1MA 3TIEB 1P7QA 1MFUA 1UJ3A 1ASOA 2ED9A 3GMRA 3JTSA 1RZFH 3U0WH 4F57H 4BZ1H 5KYYA 4P59L 25C8H 2FHFA 1JZ8A 3F7YA 5DCCA 3NJVA 3CBRA 3MV8E 3SB3A 3Q1EA 3T1WA 2AK4D 3V9FA 3LKRA 3OHXC 3QDAA 4H26A 1UOVA 4PWIA 1CF1A 1AS8A 5GQBA 1B4TA 1MPAH 1J5OH 1HQ4A 4ODVH 4QJ3B 2X0UA 1P1ZA 1QEWA 1TQBC 2X44D 3HFML 4LL4A 2BZ7A 5HD8C 1JPTH 5DUPH 3ECBB 3FCUB 2X87A 1GCFA 4AQ8A 3U48A 4KO5A 2X5PA 2YAPA 3BISA 4XP9L 5EHFA 4AE0A 3BT0A 3P0GB 3TWYA 4BCZA 5AW7B 2MNWA 3VTTA 5I75C 3DVGB 2ZJSH 4ENEC 5KBLA 2X7LA 4JKLA 1A0QH 5L7XL 3ARWA 2DQEH 4WJKB 2AQRA 4A37A 1Z9SB 4FMVA 4NZTH 1AIZA 3OAZH 4KAQH 2F8VA 3AM8A 3ZYZA 4C55A 2C7UB 3WHXA 4JM2D 3HG4A 1RUMH 3WTVA 2N3JA 2X3BA 1KJ2L 3CG8A 3SKUD 3T3PE 1YEHL 4AJ0A 1HKFA 3GUTA 2QV2A 4YDIH 4QXTA 4AV0A 4RRPG 4W81A 3IDNB 4KMQA 4TNVF 5CU9A 4WFHD 4ZG1A 1XF2A 4X6EA 4N2CA 1JGUH 3PWNB 4PY7A 3V8CA 4M5SA 5HHQB 3KJ4B 5EU6D 1W0WA 4JDZB 2ZXCA 4WO4B 1YAZA 2BP0B 2LVCA 2EVHA 2APXA 1C1EH 3JWOH 3CLEL 3TPUA 1KLUA 3D18A 3S35H 4H8QA 3EGXB 5HDBE 3U1QA 1SJXA 3D2UB 1X7QA 5ICZA 1CDGA 5E0FA 2EC9U 3IWVA 3GXDA 4K8RD 1RIVH 2GTQA 1BCIA 3Q8BA 2UUDK 2M83A 4H20L 3ZX1A 1ROCA 1VLXA 5KYWB 1YEEL 1ZIAA 1A6UL 1S7XB 3N55A 1PD0A 3RAJL 2GBVA 2XN1A 3S3CB 3T4AA 3SCMD 5HVGB 4CVUA 2P45B 1NZRA 2AABH 2YQ3A 1HCYA 1PG7H 5D2NB 5LCVL 4HZAA 3PWPB 1ZHBA 2JJWA 2I27N 3KYNA 1IFRA 5IR1B 3T77A 4YGVB 2VDNL 3BYTA 5C0AA 5CSZA 2BERA 1T5WB 3GNMH 4UT9A 4WI9A 5TPWL 1M1XA 1QX1A 4GFTB 5LO7A 2YLKA 5K59E 3DYOA 2OMWB 1KLGA 5AL0A 1RVFH 1T89A 3DUUB 1SRDA 3IK2A 1R3JB 3BC9A 3C8DA 4N2DA 5DSCA 4JFUA 2QPDB 1W8EA 2WHVA 1A9VA 1KJ2A 4IOSD 5DHYB 4P07A 4O00A 3QUMA 3MUGA 2AI0H 2HTKC 3OKKA 4IRSD 4IRZL 4ZPTA 3UTSE 3RWIB 1KGXA 3UTZB 3RA7H 3RFZA 1LO2H 5D1XD 4IS6B 1O5PA 4KY1L 3QNXA 3K2IA 4PJ8B 3FS9A 5BVJA 4IJ3B 3VVVA 1F6AA 2FECI 4JZJB 3EGDA 1DVUA 3ULAB 5ECGA 4G1EA 1NOLA 4QHLB 3WTWA 2NUPB 3ULUH 2L0DA 4LLQA 3E6HB 5FYJU 1WFIA 4XBPB 2H6PB 5J9PA 2X4OA 2F1BA 5H4ZA 3VI4B 3MDJA 3S48A 2ZCZA 4HF5H 4KMTH 5DMIH 2Q9OA 3QEHA 4KFMA 2PF6A 4KUCF 1DBMH 1EHXA 4UQBA 4XRCB 1SJEB 3ILQD 2GK2A 1VEOA 4WW2A 3CZKA 2IANB 3IDUA 1N4XH 4NIYE 3LNDA 1K85A 5DD0L 5I8KH 3ZDYF 3K2UH 4NUJB 5HYQA 2ZOTA 2BSCA 2QR0A 1GY1A 1HSBB 1LEGB 4Z78B 3Q5YA 2HVKB 4OB5H 1R5IB 1P4BH 4RDQF 2H41A 2ZXGA 4S0TD 4B53A 2WTPA 1ZLSH 1USQA 2VO5A 1ZHLA 1S9WB 1O7SA 4RISH 3IJYB 2BINA 4HKZA 4PWGA 1ID5I 4EUPH 2F15A 1AGEA 3NFNA 3VYNA 3LN4B 4IHOB 4POZD 4UIKH 1TSRA 3BP6A 1EFXB 5G4NA 3FO2A 5JORA 1N8OE 3H6JA 5T1KA 3TH3T 1B9ZA 3W11D 4IRZA 1K8DB 1T3FB 4LOFA 5FDYA 3M8OL 1A4BA 3AQZA 5EBGA 2E46A 4MCNA 4ORGB 2VDKL 3OM3B 4LLYB 3GMPA 4TUKH 4XVSL 1EQWA 2XWJA 4JPVL 5I9QC 3UPRA 1U3JA 4XNBA 4AVJA 4R4FL 5F1OB 1GGBH 3KBFA 1L7IL 1JNHB 3FT2A 3LKOB 1M2VA 4FMFA 4N2GA 5FGBC 1UA6L 1U3HD 1V3JA 1AGDA 4U4IA 1JMZA 1SXCA 4QRSA 5HYSB 1I8AA 2QQLH 4M1GL 3QHTC 3G5XB 2OLDA 2IGLA 3WTTA 5JPMA 3EW3B 3GLEA 1OCWH 2WNKA 5DD1H 5FYKL 3AW5A 2FGZA 1OV8A 3R19A 3U25A 3KJ6H 4TTGA 2VLKB 1Z9LA 2VL4A 3ARGA 3NIFB 3QQDB 3RX8A 5IW6B 4PG2C 4MXWH 1IGFH 3SKOA 3QIWB 4FQCH 1OCZB 3O3DB 4NQXA 3SDCA 3UJJL 1OE3A 2BZCA 4X5QA 2Y1VA 1U92A 5DJCA 3WSQL 3VD1A 1DBAL 3FHQA 2LW3A 2NY6B 1F4YL 5DZNA 3LIZA 2YBGA 2NUTA 2AXGB 1EO8L 2XFGB 1N0XH 4GSUA 1AOHA 1EGJA 5J3HD 5K9OA 1XBRA 1L7TH 5CP7A 2C1OB 1IUZA 1SDDA 2C1PA 4Y1AA 3N1QC 5CLXA 5IHZA 1QYGH 5MP6H 1OCRB 4EUPB 2NZ1A 3FO0L 1NC4D 3MC0A 1IBYA 2JB5L 4OD1L 5JOEA 3QDMA 4OD3H 1FLTX 1F1GA 2Z91A 4X80H 4YAQB 4HC1A 3KPRA 4X98B 3FUIA 3IB4A 4PGCA 4WU7A 1FVCB 1KGCE 1OKEA 4OZHE 3OJDA 1JPGA 4IJTA 4QKTA 2B0SH 4L3CB 3AACA 3F7KA 3MNWA 1JGVL 5TFSL 4E41B 4W1TA 4L8DA 2BMKA 2JJUA 3L4VA 5B4MD 4JREC 4HS8L 1EEZB 3A3YB 1CR9H 2ID5A 4X9HA 4AM0B 1RQ5A 1U8KA 2VXTH 3W9DA 1QASA 4NJAL 3P2BA 5GRUL 4UNUA 1A6AB 1HYSD 3WEBA 1G7PA 4L18A 3O6KH 4PRPA 2VMDA 1T1YB 3GKWH 4PR5B 1BHGA 2WWKO 1JBJA 1B4JH 4LESA 1QO3A 4HX1A 3CXDH 7PAZA 4CVXA 1NLBH 1DDHA 5AW6B 3BPLB 5AD0A 5KN5A 3DIDA 1YEIH 2FJHB 1C9SA 4GRLD 3GSNH 3VA6A 2WYIA 4Y4FC 3OC5A 2O5ZL 5JTWA 3D0LA 5MENB 3BZ4B 4PRIB 4UINH 1DTUA