3IBOA

Pseudomonas aeruginosa e2q/h83q/t126h-azurin re(phen)(co)3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Relaxation dynamics of Pseudomonas aeruginosa Re(I)(CO)3(alpha-diimine)(HisX)+ (X = 83, 107, 109, 124, 126)Cu(II) azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3iboA00
2PPAA 2NRDA 5B1JA 2Q5BA 3T71A 3WNJA 1OF0A 4M3HA 3NJGA 4P5SA 1ET8A 2CALA 3PAZA 1X9UA 1OCRB 2BWDA 2YARA 1GYCA 2BW4A 3ABLB 1JERA 3EF4A 4YSUA 1NTDA 3FU7A 4F2FA 2PLTA 1ID2A 2HRGA 2W88A 2J55A 3EHBB 1NIDA 4AKPA 3ABKB 4YSTA 3ABMB 5FC9A 1ZIBA 2VSKB 2I7OA 3IEAA 2FT8A 4KOCA 3RYMA 4MFHA 1EZLA 4BWWA 2HX9A 4G70B 3OM3B 1BEXA 4GP4B 2FT7A 1OCCB 5F7AA 4N4YB 1KGYE 2HX8A 4F7KA 1AZUA 4DP6X 4AI7A 1OE2A 2GSMB 2YAQA 2MTAA 2JFCA 3MX0B 1KDJA 1T5KA 3TA4D 3QJTB 1CYXA 4DP9X 4KO7A 3UGEA 2R7EB 2PP7A 1GS8A 1KBWA 4NERA 3UACA 1WAEA 4M4RB 2PCFA 3FYEB 1WS7A 3G5WA 4G7QB 4DP2X 4E9TA 4YSPA 4QLWA 3T9WA 2VM3A 1PZBA 3BQVA 1L9QA 5E9NA 3N55A 2UXVA 3PLYA 3X1GA 4L0PB 1HFUA 2BP8A 2UXTA 2VW4A 4AKQA 1NPJA 1AAJA 1NIEA 1BXUA 1L9PA 3NJNA 2DYRB 2WSDA 2VM4A 1JZGA 2IDFA 1J9RA 4A2EA 2UX6A 1NIBA 3ZX1A 2BHFA 4W1TA 1RZQA 2IDQA 2YAMA 3UAEA 1JVLA 2YAOA 5I28A 4DP0X 2EIJB 5B7EA 9PCYA 1J5DA 1PMYA 4KNTA 2J5WA 3QJRB 1AZNA 4NAJA 1IBYA 2AZUA 2B3IA 4WKXA 2IDSA 3QJVB 3PXLA 3UADA 1XB8A 1OE3A 4QKTA 2Y1AA 5F7BA 5I6MA 4A2DA 3SBPA 1EHKB 4A2GA 4WTQA 3FSAA 1AZCA 5AZUA 4HIPA 2UXGA 3WIAA 5B7MA 4A68A 1BQRA 2GHZA 1L9OA 3ABGA 1CUOA 3IN2A 2HZHA 2X87A 3X1EA 3IN0A 2IH9A 2FTAA 2VW6A 2XVBA 5I6LA 2PPDA 1BQ5A 2GB2A 2DWTA 4GY4A 4E9VA 5B1KA 1PLCA 3V9CA 2OJ1A 1MG3C 2YQBA 5PAZA 1WA2X 1SDDA 3S8GB 4BXVA 2R7EA 1QLEB 3NP3A 1URIA 3EH5B 3NJMA 4G72B 7PAZA 1PLBA 2XWZA 4CSPA 1ZV2A 2PPFA 1PCSA 2DY2A 1N70A 3DKHA 2XYBA 4DP4X 3FYIB 2J56A 5B1JC 5B7FA 5I6PA 2PP9A 1JVOA 4DP1X 3QJSB 1ZIAA 3MBWB 2HRHA 1BYOA 1ET7A 1TEFA 2DV6A 2B08A 2TSBA 1A8ZA 3FQYA 1L9TA 2CCWA 3GDCA 4N8UA 4DPCX 2YAPA 1AZBA 3EH3B 1WS8A 4YSRA 3FSVA 2GBAA 1A4AA 1KV7A 3T6XA 3V9EA 5I5JA 4AX3A 1SFDA 1TU2A 1DYZA 3NJFA 3ERXA 5I26A 1JXGA 2BP0B 1SF3A 2AVFA 3H4HA 2JKWA 3CDZB 5I6OA 4HCIA 5B1AB 3UABA 2FQGA 3JT2A 4AKOA 3L45A 1W6LA 1JZHA 4YVNA 2QT6A 4E9WA 8PAZA 4BXSV 3AG2B 3CVDA 1JOIA 2QDVA 4BDVA 1XMEB 3NP4A 1ZDQA 2HLEB 1AANA 1WA0X 3SQRA 2WO2B 1KDIA 1BYPA 1E5YA 3PPSA 5A7EA 2OV0A 4HAKA 3NSYA 2YXVA 1PZCA 4K9JA 4KNSA 3WKPA 3X1NA 2W8CA 5TK4A 3X1BA 3FU7B 2YXWA 4ENZA 1ET5A 4ZK8A 2FJSA 2XXFA 3CZUB 1W8EA 4KO6A 3PAUA 1PAZA 4P5RA 1IC0A 2RACA 5I5IA 5I5MA 3C75A 2QPDB 3FU9A 4UF7C 4AZUA 2AZAA 1SFHA 2PP8A 2ZWNA 3AG4B 3FQ1A 4E9XA 1AR1B 2CAKA 1KYAA 1NIAA 1ADWA 1WA1X 2IWKA 6PAZA 1FWXA 2XX0A 1ZDSA 4FAAB 4G71B 2DYSB 5B1BB 3S3DB 2FQEA 4GP5B 1AOZA 1RKRA 1NINA 1IUZA 2HX7A 3AZUA 1MZZA 2OCCB 3CVCA 3FQ2A 3ZDWA 1GY1A 3PCYA 3T6VA 2JXMA 1ASPA 2H3XC 4DPBX 1SNRA 2VMJA 3S3CB 4BK5C 1CYWA 3KW8A 1AG6A 4JHVA 4A66A 1HAUA 1AZRA 5AKRA 4DP5X 4E9SA 5I6NA 1W6WA 1JZJA 3TBBA 1X9RA 2BZCA 3CVBA 3WI9A 4HZ1A 1TEGA 1SF5A 1NPNA 3QJQB 2IDTA 1IBZA 2EILB 3S3BB 2GC7C 1E65A 2IWFA 1F56A 3D12B 6PCYA 1M57B 2BZ7A 1A3ZA 2IAAC 3AY2A 3DIVA 3KW7A 1VLXA 1KBVA 4JKNA 3WKQA 2P80D 5ANHA 4E9QA 1AQ8A 2Q9OA 2BP0A 4JHUA 3SBRA 3NJIA 4A67A 1PLAA 1IKOP 1OCOB 3U25A 1MZYA 4YVUA 3HB3B 4G7RB 3T6WA 3AG1B 4YSSA 4YSDA 3X1FA 2EINB 2FWLB 4HCFA 3NJHA 1DZ0A 3FU8A 4G7SB 1TKWA 1ASQA 4F2EA 2ZOOA 1A4CA 1JZFA 4YSOA 1A65A 2I7SA 3OQRA 4X4KA 3HEIB 5D4HA 1R1CA 3OMNB 5LDUA 2PPCA 2YAFA 3EH4B 3FSZA 3T6ZA 5B3SB 3OMIB 1KCBA 4DPAX 3PAVA 4BWTA 4TXVB 3ZIYA 3ASNB 3H56A 2QDWA 3AW5A 1OCZB 3NJJA 4HALA 2A3TA 4A2FA 2IDUA 5I6KA 1NWPA 1J9TA 1BAWA 3FPXA 4BWUA 1E67A 2CUAA 2H5UA 2H47C 3NSCA 2BWIA 3WNIA 2XLLA 3DTUB 3UAAA 4UANA 2Y69B 5IY5B 1SHWA 1OE1A 2XV0A 2XX1A 3IE9A 2PCYA 1NZRA 1B3IA 3S8FB 4KOBA 1ASOA 1JXDA 1AIZA 4UAHA 3H4FA 3SBQA 2CBPA 5AFAA 4Q8BA 1AS8A 1BQKA 1RCYA 2CJ3A 1SDDB 5PCYA 2P80A 1PF3A 1MG2C 3NSDA 1GY2A 1OV8A 2XV2A 4CSZA 2IH8A 4HCGA 1GS7A 5D4IA 3TASA 2FQDA 4GXFA 2LLNA 2PPEA 1L9SA 2WO3B 2FNWA 4KNUA 2FT6A 2HXAA 1PY0A 2GI0A 1HAWA 1BXVA 5EHFA 1ILUA 1MDAA 3ASOB 3CG8A 3QQXA 1PNDA 3NT0A 4PCYA 3WG7B 1JZEA 4FA7B 4HHGA 1AS6A 3NJLA 3FT0A 4DP8X 1BXAA 1JXFA 1QHQA 1V55B 2GIMA 4PAZA 2X88A 2UX7A 2EIKB 3BVDB 2AANA 2VW7A 5TK2A 4RH4A 1NDTA 1J5CA 1N68A 4GYBA 1AS7A 1NIFA 2XUWA 3IBOA 4YL4A 5D4JA 1AG0A 3JTBA 2I85A 2ZXWB 2ZONA 4HHWA 3FSWA 3NSFA 3NYKA 1E5ZA 1PZAA 1FFTB 4A2HA 4KO5A 1E30A 2BW5A 1YLBB 2YAEA 3X2QB 1V10A 4Q89A 1KCWA 1GR7A 1A4BA 1AACA 1ILSA 1L9RA 1V54B 7PCYA 2VSMB 1SJMA 2YAHA 1ZPUA 2TSAA 4YSEA 2EIMB 2GC4C 2BO0A 1I53A 3ZBMA 1XB3A 4BDVB 3OD3A 2BP8B 1GSKA 2AFNA 3FPYA 1CC3A 2VN3A 4YSAA 1GW0A 3QJUB 1RZPA 1UATA 4DP7X 1CURA 2N0MA 1NICA 4E9YA 2XV3A 2DWSA 3QPKA 3GXUB 3CDZA 3OMAB 4KO9A 1SHXA 1OOWA 1JZIA 2J57A 4NB7A 2IWEA 2UXFA 3TU6A 2XU9A 1PNCA 2MRYA 2XXGA 3FS9A 1NWOA 1M9WA 4EF3A 1ETJA 3N2JA 3GYRA 4W9ZA 3TBCA 1J9QA 4YSCA 1J9SA 2FQFA 2QPEB 4E9RA 1M56B 4GP8B 3NJKA 1FA4A 4YSQA 2E86A 3AG3B 1XB6A 1GS6X 1QNIA
chains in the Genus database with same CATH superfamily
5IJVB 1D5XA 1IM9D 1AC0A 2Y5TA 5C07A 1MQKL 4KJWD 5IUSA 1KV3A 3I84A 3LRSA 5F1NB 5BQ7B 3RDTD 1OCRB 4Y19D 1CD0A 3GTVA 3KPLB 4MHHI 2I60H 1FF5A 3QSKB 1QATA 3BKYL 4LVHB 1CICA 5D2NB 5GSVB 4GSDH 5D1QC 4UTAL 4FG2A 5DC4B 1NGQH 2NY0C 4FQHA 3ZHLA 5ELIA 7CGTA 1FORH 3US0A 1C9SA 4OGZA 2AEQL 3RTLA 2XV6B 2FD6H 3BZFA 5DVLA 4N1HB 4TVPE 2PN5A 4D9RE 2XTJB 3D48R 4Y5XC 3GEWB 4PYHA 1QMUA 1A7PL 5F7AA 5E8DH 2KPNA 3JWDC 2E6JA 3QUMA 4ODTL 4TF4A 4G9DB 5ECGA 3ULUF 2IC2A 3I6GA 1QSFE 3ULUE 1GC1C 1NC2A 3UTSE 5JXEA 2H4EA 1TSRA 1HZKA 3TCTA 2JKNA 4ZXBC 4FJZA 4WI5A 2R1YB 4M7JH 3DGCR 3RTQC 1NCUA 1U4FA 4L4JA 3C5ZC 2OYPA 3SDAA 3T04D 1WAEA 3B7RL 4OCWH 1PTZA 2PNDA 4GH7B 5LBGA 3FYEB 1YMHB 2EDYA 3O6FB 1JWSB 1Z6JT 2L3BA 2UXVA 3AAZA 2AJXL 2VLJA 3OSKA 2X4UA 2ZUYA 3U6XS 4UQCA 2LHAA 1CG9B 4NKQB 1FV1A 1XZWA 5TQ2H 2BP8A 4DF9A 1UD6A 5J0BA 2G2PA 2HLFC 1HS6A 1FYTB 4GBXD 1L9PA 3NJNA 1XDTT 1T0NB 2X9YA 4Z76B 2GJ6B 2ED9A 2I60L 3DXAE 3WS6C 4OM0L 1B9ZA 2DLTA 3QG7H 4YHIA 5EH1A 2DMBA 1RI8A 3GNML 4Z0XA 1NGQL 5I1CH 4LL1A 4YNYA 1VACA 5CR8A 2CNYA 4HPHA 4HUCA 4P5KB 5L6YH 4HH9B 4I3GA 3L3IB 1ZHKA 1DQQA 1GIGH 1Z9LA 1G0XA 2YAMA 1TFHA 4JFHD 4WTZG 3UAEA 4NHCL 4MS8C 1VAHA 1ED3B 4DEPB 1FI8C 2EYSB 4AQEB 5ANMA 5SWSE 5I16B 1Q0EA 4ZW3A 4LCYB 2VLKD 1NGPH 4PFEA 4UIMB 2J1KA 1TTCA 4FNRA 4KRPC 4M7JL 3SYAA 1VKXA 2WVVB 4YEEA 3PHQB 4OCWL 1XB8A 1EFXB 2EDRA 4IGBC 3LZNA 4N0FA 5CEZH 5IHZB 1QWNA 4QKTA 1Z5HA 2X70B 1JGEA 1HIMH 3G5VA 3KPSD 1P7BA 4D0BA 5FYJH 1H8OA 1I3UA 3FFCA 4L3AA 3UTTE 4S1DD 4AC2A 5CEXB 3FRUB 4JGNA 2NY5H 4KVNH 3ARBA 1MWAA 3BJ91 4M1GH 3FZUD 4ZFOB 4ELMA 2A77H 5DYOB 2RTTA 1MHHB 1KGIA 2NOYA 2YUWA 5DUPH 2I07B 1YEEH 2GITA 5ISZA 1EUTA 1KBGH 3V9CA 3T2OA 2K70A 3HG1D 3QG7L 4OQTA 4PJBB 1JGLH 2QKIA 2IBZX 2V7HB 5D1XE 2OI9B 5I1CL 4CAGA 4FQXB 1QLEB 4ZMYA 1CLVA 1MCSA 1URIA 2JV6A 3PL6B 3BWSA 1KCUH 4JB9L 2CBOA 4L1TA 5L6YL 3KPRA 4BFIA 2VISA 3HHRB 3H3KA 1M7IA 3DMMA 1G9EA 3OC5A 5CILH 1PJWA 3F58H 3TO4B 3EFDL 4PHXA 1KFAH 4OZFG 3RNKB 1KTRL 4K8RH 1HXYA 5FLUA 5TDOB 3U0WH 1XXFC 1BJ1J 4G9FE 2H7WA 2JSFA 2GJJA 4JZJB 4FYQA 1G6VK 3QJSB 4G8FA 2ARJB 5D96C 5CEZL 2AXJA 3QXDB 4PRIE 1A6PA 2Y0SA 2YUXA 3E9UA 3NZ8A 4WI7A 1XF2A 3PDOB 2P7TA 5JPNA 1HIML 5IESL 5IREA 3L3OB 1CICC 3TCLA 4K3EH 1NFIB 2YA2A 3M17B 3Q2VA 5HGBA 1F4HA 5DURB 2ALWA 3AREB 2A9NH 5F7DA 5KYYB 3H0TB 3FSVA 1BHGA 4AWJC 2CMRH 5I1AA 2Y7SA 4ZPTA 2MNJB 3FTXA 3VXUE 2NY5L 4NJAH 4M1GL 3MRHB 4HJGB 3I9IA 1OANA 2A77L 1SF3A 1UTDA 5DUPL 1YEEL 2JKWA 5CP3A 4ABVA 4QRUA 2C7UA 2UYLA 4O02A 3R8BB 5JXEC 1SQ2N 1ETB1 1ETZA 2PO6A 1IV8A 3SDAC 5ILTH 1RUMH 3CVDA 4HFUH 1IMHC 2DYPD 1E90A 3NCFB 3NP4A 2NQ3A 5D5MB 2X10A 5HHQB 5A3ID 3F58L 1HNYA 4S1QL 1KFAL 1SY6A 4X5QA 2GJRA 4QXTB 1SOXA 2FJGA 1NKRA 3TJHC 1QKZH 3OB0K 5L88H 3H6JA 3WJLA 4EMZA 1U8LA 2WUBL 1KBKA 1RHHA 5AYUH 5L2KA 1NGZB 4QT5B 2E6PA 3QUXB 4DTGL 3D1MC 5HD8C 4HLZH 1EA9C 4PYGA 1KY6A 4HJ0D 4PLKD 5EPMA 5EMYA 3U79A 4LSQH 4MAUL 5FO8B 2P1YA 5DJXB 5FWQA 2GAZB 3P54A 3HFMH 4UB0L 4N0RA 4WO4B 4OT1H 1A6AB 2XWCA 4IRJB 1Z3RA 1AQDB 1E4XI 2R4SL 3F62A 2HP4A 4GUPA 5CGMA 5AOIA 2JKTM 3TNMA 5I17A 1KYAA 4JQIL 2H45A 3FONB 4NQDB 4XX1E 3KWWA 3IMRA 2HTLC 2P5WA 5EZLB 3VFVB 3VXMB 3N42F 5IHUL 4PJFA 3E8VA 3AZUA 4GSUA 5L8JB 3KXFA 1Z3GH 3PYCA 2CO3A 3T6VA 4YLQT 2FGWL 4U33A 3NIDF 2KQMA 3NIDE 5HVFB 1EZVX 1OTSC 2CRYA 4Z1PA 5HJ3B 5ENWA 3LQMA 5ILTL 1DTUA 1JZJA 2AK4B 2NNRA 2DMKA 1TEGA 4QEGA 5DCCA 4EE2A 5DVMA 2BFVH 1IBZA 4M8UA 2F58L 5CXPA 4YO0A 4ODSH 4ZFOL 2EILB 1RZGA 3L5XH 2GC7C 5E9DD 3U9WA 1M4KA 2NDFA 3MRBA 5D9SB 2J2ZA 3Q0HA 3QIUB 4LEXH 4JHAH 43C9B 1FNLA 5E99H 3AUWB 2WLZA 3RA7H 1I8MB 5C0AA 4A7SA 4L18A 2HRPH 3CFQA 4HD9A 1FCGA 2HG0A 2WWMC 3ARBC 3CH1B 5HJGA 5LNEA 4ICXA 1QLEL 4E9QA 1YN6A 4LKCB 3ZKMD 4RRPM 5L0QC 5IB1A 1MZYA 1KF9B 1C7TA 3LRKA 1S7TB 3VH8A 1XVSA 3X1FA 3KBPA 2ZSWB 4OT1L 3SQBA 2QKIC 4EVNA 3RKPA 3CH8A 4PS8A 3QEGL 4XO9A 1SXAA 2DM2A 2ZOOA 3LN4B 1RLWA 5FUCC 5IW3A 5D7KE 3DMMC 3ULVH 1YQ2A 4P23A 3BDXA 3QEQA 3N1GC 5I8CA 3GSXB 3SJVD 5E8EA 3WY1A 2YAFA 4A2MA 5EIVA 1ACYH 3IFOB 1UWXH 3P4OB 2E46A 4P2RE 1SYSA 5C70A 5DGQA 1B4TA 4ZUVB 3VDBA 3Q05A 4BH7A 2N1TE 4QRPA 4PJ5A 3ZZLA 1MRDH 1Q4NX 5BXFA 4CW1A 4GPVA 1J9TA 3G6DH 1HCZA 3IS0X 4FFWD 2Z0BA 4BUHA 4HPYL 5SWZA 5JPNC 3JBG7 3WNIA 2PCPB 3K5RA 4OZGA 2VSDA 5FGRA 4J3TA 4JHAL 1J8SA 5EU7C 5E99L 3FTSA 2LU3A 5IY5B 2ZWKA 4CU7A 4OM1H 3RA7L 5JLZA 3IE9A 3RBSA 2HRPL 4JRYA 3TTSA 1ZLVK 4HQQL 4PCTA 1DSWA 3IRPX 3GHBL 1ZSDB 2BVPB 4KK5C 4QHMA 5F9OH 4CKQA 1DVFB 3H9HA 5JMRA 2CBPA 1JMZA 5C6PB 3ESUF 3MO1B 4JJ5B 3CC5B 4N26A 4UQ3B 1PF3A 4K9EH 5E6SB 2EE6A 1OV8A 2IH8A 1U8PA 2PO6C 4O2EA 1HT6A 5DMJB 5DR5H 2HFFA 3SKUD 4GXFA 4JMNA 5ACZB 5KBPA 2P5EB 2YZ8A 1X5KA 3O2DA 3MJ9A 1KIPB 3BSZA 4GS7C 5FS5A 4JQVA 4LNRA 3QNZB 2XG5A 4ZUSA 3VXNB 3L3KB 3WMQA 4EJ1C 3QYNA 1IE4A 3ZN6A 1QTYT 2XG4A 3HOGA 5FFOA 3T3ME 4WU7A 3V6ZB 2OPCA 5C0JA 3WJLC 3LNHA 3PNWA 4WUKH 4TTGA 2V7NA 1F3JA 3BWAB 1G6RB 4U1LA 5DZLA 4OGYL 1U8CB 3GK8H 1FDLL 3PJNA 2J4WH 3RU8L 3KEDA 4RSVA 1BQSA 3M7OA 1NJ9B 1I3GH 1OD7A 2KZKA 5EIQA 5ICUA 4X98A 4N8PA 4TNWF 2YK1H 1JHTA 4WWID 4KZDH 1AYRA 4Y1TA 1VHPA 3S9DB 2APVA 2NXZB 5TF1L 4U2YA 4AUUA 3GSUA 3U6XA 3VQ2C 4A1RA 1N0XH 2H6PB 4BZ1A 4HWBL 4NQXA 1B0GA 2XTLA 2ZTBA 4XWOC 4LB8A 4J8RB 1J8HB 2VSMB 4P4KB 5DA0B 3O3DA 5EUOB 4PJEB 1E5BA 1GJWA 4TNEA 1BP3B 3H9ZA 3QZMA 3F12A 4K9EL 5M7QA 1IEAB 1A6WH 1YYLH 5FYKE 1T66C 2DI9A 2NLJB 3KNBB 5F1KC 3LQAC 5ES4B 5C0RH 3K6SB 2UWEA 5F3BB 4NQQA 1I7UB 3SPGA 4JREB 1S9WB 3HI5H 2LAAA 4HDIA 5J1AA 4ELKA 3FC8A 5MI0B 2DWSA 1M2OA 3TPUB 4WUUE 2NY3D 2IV8A 3CFEB 3RDTB 3ZHNA 4AT6B 2G30A 3J2PA 5K9OA 4G82A 1RV6X 2CDFA 1XGUA 4YXKL 1JZIA 5I73B 3MGOA 4NB7A 1H5BA 4LVNC 5IBUG 2NCEA 2EKSA 5IMOA 3ARFA 3TTYA 4QTIL 3QK0A 4MMZC 3TBCA 4E5XB 5F44A 1QO3A 1ZA6A 1X7QB 2J4WL 1U58B 1JTOA 2YEVB 2QADD 1FA4A 4W9LC 1I3GL 3QWRA 5DHXB 4UAOC 4FTVD 4GG6B 3GXMA 1TCMA 2V9TA 3ECWA 3KE0A 2YK1L 4KZDL 1TSHA 2YMTA 4ZFGH 1BD2B 1MFVA 2O1AA 1ND0B 5HI4C 4I2XE 2IH3A 3PAZA 2XBTA 2FYYB 2Z7WA 4KTGA 2CLVA 5KSBB 1IM3A 4PGCB 1MJUH 4LLAA 4P23C 1X5HA 5DJ6B 1UVQB 3UTSA 5BZWB 2BCKB 3NPSC 1ECZA 2OTWB 3LVTA 4I85A 3S3SA 4DN3H 3REVA 4JY5H 5E1QA 4FC3E 1ZGLA 3FUFA 2YUZA 1OP3K 2WWOA 5D6DA 1DQML 2ENJA 4AQAA 1WUNT 5C6WH 3K5SA 4K94C 4MCZA 4D0CA 5GGVL 5C0RL 5J6GB 1R3LA 4GP4B 4D94A 4ZJ9A 4N4YB 5BVPL 2N01B 3DSFH 1E9QB 4OIFA 2KLRA 3DLQR 2HMIC 1INDL 3HI5L 4QUOA 5ITBH 1DSYA 1YJDC 4XB3A 5BJTA 4TNFA 2X9WA 1ZT1A 3IDNB 4RMWA 2CM6A 1GS8A 2EDEA 1RZJC 1BFSA 4L4TB 3D06A 3DXAA 3CZFA 3VXTA 3IGAA 1IAOA 1AHKA 1OEZW 2C8NA 2AEWA 3CHSA 3T2QA 5D71H 5KANG 2AXFB 2DQTH 3KAAA 5EU4B 3WFBL 4POZD 3EBHA 4S0SD 2NCMA 4QTFA 1K72A 2W0FB 4QR7A 3PWVB 4RAHA 4P48A 1AGFA 4ZFGL 1A6ZA 3CFIC 5EN2A 1G1YA 1SEQH 3A6BH 1HL8A 1KACB 2PTTB 2YXMA 5I15H 5SWSA 1G6RL 1MJUL 2H3NA 2VLKB 4PV9A 5EBMA 2ZOLA 5I8OL 4JQVC 1UM4H 1G94A 1ETA1 5HYSB 4XMKH 5DRXA 4JY5L 3TBYB 2BOBA 4YHOL 2RR3A 4JHBA 3VQLA 5B4MD 4PBDA 3KPSB 4I1RA 2QQNL 3ESMA 4H0HB 5IEHA 1JZ8A 3MLUH 3ZZ1A 3B5HA 1QUNB 5K33A 1ZHNB 4B97A 4C54A 4ZMXA 3UTTA 1YPZF 4WNQB 3G5XA 3DSFL 1YPZE 1MFMA 1GMIA 3E0GA 2BHZA 2D4DA 5T3XD 3MGAA 1QEWB 3MMEA 3MNZB 2RMNA 4GW1B 2YQ2A 1QRND 3MNVA 3H1ZA 3HG1B 4XC1H 4AK1A 4GRLD 1GTNA 4IS6B 3VXRD 4XTRC 1TF4A 4JUSA 5D1XA 3S34H 2P44B 5D71L 3WFHA 3P9MB 1EJFA 3FTVA 2CO2A 1AZCA 4YJZL 4JZNB 1Y18B 3O0LA 2IPTH 1IAMA 1WJ3A 1NGXA 4J4PC 5BOJA 4LRIA 1JK8B 2IH1A 1QYGH 3V4VA 3JWNG 3BP5A 2Q2LA 3O0RH 4HS6A 1SEQL 3FAXA 1T7XA 3A6BL 4GG8A 1ZHLB 2X2IA 3U4BH 2DWTA 1QI5A 1KJ2B 5AW7B 2Y7LA 3LOWA 4HU2A 2HH0L 4J27A 4HD5A 4JFWA 3WTXA 4HOXA 1VERA 2JK5A 4XMKL 2UY7A 4ZQKB 4OU3A 4NBXB 2FECI 2FWUA 32C2A 3K4DA 4HOZA 2R29A 1H5BC 3P3YA 1EV2E 1E7UA 1QZNA 3NJMA 1QUPA 3ARFC 3MLUL 4NHUA 3HS8A 4OW6A 2X42A 1MCEA 2VDMB 4NQCD 5GJTL 4OJEH 3ARPA 2L0DA 5AW4B 4QCIA 4DP4X 4EOWH 5FYJE 2AERT 5CMAA 3VXUA 4KUCD 4RMBA 1A6VL 3Q6FB 4RISL 3LXBA 2HKFL 1U3HB 2AGJH 1MHPH 1GZQB 1XAUA 4UZGA 4XC1L 5GGTH 1HL4A 1DQIA 4J3OH 3WDJA 1TJGH 1DDHA 1CDIA 2NY4C 2BDNH 3Q5OA 5SV3A 3S34L 4FA8A 3KYNB 4HISA 4XN4A 3KJ4C 4LCVA 1AO7E 1MJ8H 2DYPB 2ZX7A 4XN8A 4ZMAT 1AZBA 1CCZA 1XAKA 5D6DC 5MERB 5I6XC 5FM5M 5TGBA 3BP7B 4DIXA 1XGPA 3O9WA 4ILDA 4URTB 4XH2A 5IW1B 5LUMA 4EZKA 3HZKA 3T3PF 3U4BL 1KLUA 4AXWA 3T3PE 1LE9A 4D8OA 4HCIA 5I5RA 2DAVA 5JR1H 4E41E 1VGEH 3ZT6A 2W60B 5FB8A 2AABH 1F3DJ 4MQXD 5HHME 2ICWA 1KJ3L 3AG2B 2N7SA 1A9EB 1I8LA 3HLAB 2H2SD 4O58H 5I0XA 2LT9A 1AANA 5HHOD 1OB1A 2Q0ZX 1YEFH 4ODWB 4EOWL 4HAKA 3RZCA 1HK6A 4J3BA 1Z9SB 3NCJH 4Z23A 1T0MB 1GHFH 1PZCA 2YXFA 1TJMA 4Z7WF 4Z7WE 2AGJL 2AMGA 1HC1A 2ITCA 1HDMB 1IC7H 3IJHA 5JOFA 3FU7B 2JKRM 2FJSA 1K2DA 2LOEA 3KGRA 1BZ8A 4OTXH 2VDMH 2BDNL 5HDWA 4ONHA 5DK3A 1CLZH 1MJ8L 1YEJH 2DQIL 4OZ4A 3ZTJG 4WGWB 4HGKC 4ZTPH 5JA9A 4U6VH 1RJZB 2CA3A 1M7DA 4LCWB 4ODXA 4NC2B 3S3DB 5KYWB 4FLHA 1X5YA 4XCYB 1K9TA 1WTLA 4ZUUA 5C0IA 4UOQA 4NO3A 2YKLH 4PLJD 1ASPA 1G7IA 4NO5A 5DZOA 3VE0B 1SDAB 2P8PB 4WHYG 4PJBF 2AABL 4Y9FA 4PJBE 2NW3A 3MV9B 4TNVK 2BNRD 2XN9A 1N8ZB 3GJFH 3GLEA 3W9EA 1X9RA 4Y2DB 3IDMB 4MZRA 1UA6L 4UT9A 2HRLA 3QJQB 4XP4L 4O58L 1OP5K 5D1XC 4QKXB 1OGAB 5AVTB 2JKJA 5EEWA 1YEFL 2WAQA 3QHFH 1KJ2L 3GSVB 3LPWA 2Y1VA 2CHWA 2QEJA 1CFTB 2GY7B 4M6NL 2OSWA 1BQLH 3GMQA 1CLOH 2GPZA 3MX0A 1H3XA 4LRIC 4MASA 5GHWH 2G3MA 3GS4A 4R4BB 3HG0A 1GMEA 3FF8A 3A6OA 4DHLA 3D52A 1HWWA 25C8L 4OFYD 4P2RA 4Q2ZB 5EV7A 5C09E 4J2QA 1Q9KB 2WGXA 1C5CH 1TTGA 4OTXL 4NRYA 2VDML 4Z3TA 4P2OD 1UJ3A 5E08H 1VA9A 1OTTD 1CLZL 1YEJL 4N0CC 1KYFA 3EYUL 3SO5A 2O61A 3ZGHA 1DVSA 2WZ6A 2XXCB 2N7AA 4IU2A 1MHCB 4ZTPL 3DDGA 4U6VL 4YSOA 1XCTB 1PEWA 2WXKA 3CFJA 3JT0A 4PM1A 5FFGA 4QRBA 4XPHH 1LQSR 1QTPA 2R1XB 1I8UA 5LGHH 3FK3A 4HK0A 2R0ZH 5FKPB 1JNJA 4JDVB 4AVKA 1PY9A 4YDZA 2YKLL 2YWZA 1DFBL 4C4KT 1AHWB 2Y7OA 3AWGA 3ARWA 3PAVA 2YEZA 5E8PB 4AGOA 1PX4A 1JFQL 4KK6D 3WS3A 4P05A 4GO9A 2A4ZA 2AQPA 1UM6L 2H3KA 2LU7A 2OTUA 4ANWA 1UC6A 4M1CD 3N40P 2XJKA 1KIUB 1G84A 2BWIA 1B0WA 3SYQA 1U95A 1LO4H 3QHFL 1YY9C 2Y69B 3VXQB 1QI4A 3VWKD 3B2VL 3EBAA 1FL3B 4PUBH 3VFOA 3W39A 4F7PB 2YR3A 2B77A 1F11B 2K6WA 2E27H 5EEXA 4LLWB 3BE1L 3ETBF 3O9WC 3ULVF 2PW1B 2HWZH 3ROOA 3ULVE 1UD5A 1U8IA 5F7FA 1HHGB 3DO7A 3CVHA 3SDXB 3OKNA 2KZBA 4KY1H 5IM7B 4AH2A 1RJLB 4GSXA 1C5CL 4LLUA 4PGDB 4OCRH 3QDGA 4CJ0A 4XGZB 5I8KL 3FQTA 5KYUB 3DX0A 2ARWA 3MRIA 4F27A 1FNSH 4DKEH 2FIKB 5DWUH 3ENEA 4GXVH 1FIEA 4BQCA 3T1FB 3SIKA 1RH8A 1RL1A 1I8LC 2BC4B 4G80A 2D31A 1LDPL 3SGEI 5D4QA 3RPBA 2FT6A 4Y5VB 4XPHL 5LGHL 3NTCH 4JO3H 1S5IH 3RZCC 4WV1A 5AW8B 5IVZB 3P0YH 5F9DC 5A16A 3TT3H 3FT0A 1XZ0A 2BWQA 1BXAA 5E8NB 1FP5A 3QUZD 4FD0A 4DUWA 2X88A 3HKZA 3UTPE 1A2YB 3K71A 4RH4A 2UV3A 4A7VA 3HZYB 1AS7A 3WEOA 3T2LA 5D7JB 5IV2B 4HHWA 4NM4L 3GRWA 1E2WA 2D0HA 3B9AA 1F6LL 1Q9OA 2ZNWA 3DX7A 3Q8FA 1DR9A 3M1BA 1V3LA 1F1AA 2BMKA 4Q9CA 3G04B 5KVGH 1I1YB 3ILPB 3QAZC 2GIYA 2J25A 4I87A 2E27L 1AFVH 5TH2A 1MXGA 2NY3B 5EBWA 1AACA 3HPJB 3L9BA 5GGRB 1LE5B 1DCEA 3RDJA 1EZSA 4C56B 4WI8A 4KY1L 5E6ID 4JKWA 1JE6A 5KS9F 4JM2B 2EIMB 3X3FL 1TPXB 2DWDA 4UOW0 3BOVA 5KS9E 5CBEB 1XGRB 2NW2A 4K7FB 2A0LD 2WQSA 1FNSL 1KFGA 1PG7X 3PQYD 4KJYB 4GXVL 2ORBH 5DWUL 4DKEL 2QADB 1D9KB 3KYKH 3G6AB 3FO2A 2LTQC 1FSKB 4FTVB 1DL7H 5J13C 2L04A 4NZFA 2B1AH 5IOPA 3T8MA 1NDGA 4YWGH 3NTCL 4KKBC 1WBYA 3WLBA 4I2XA 5KBMA 3P0YL 1ZLWK 1CXHA 5CGYC 2DH2A 4ANKA 1N12A 2E7BA 4UOZA 1OF2A 4YDIH 4FI7A 1BVKB 1M1XB 3WY4A 3QIWA 4JM4H 4QGYA 2KDGA 4N8VA 4AEIH 2KDYA 4YSCA 2LFEA 4F2ME 2QPEB 1MCFA 4HLEA 1T3FA 5L9DH 5TPWL 2XICA 1T1XA 2VO5A 1BDYA 1RZKC 5EC2B 1UJ3C 3IMUA 3ZIMA 2JCCB 4HK3J 4MZ3A 4PBXA 5E7FA 2XFXB 3D09A 4P5MB 4NUGL 5KANI 5KVGL 5HHPB 1KCRL 3ZJAA 4WDIB 4LDEB 2BW4A 1CDUA 2P28B 3DX6B 4ZMTA 5DHVB 1CE1H 2H32B 4XPBH 3ESNA 1KN4H 4P4RA 1RUQH 3QUKA 4Q9BA 3V8OA 5DA4A 4BK8A 1X5AA 2CIIA 2K45A 1OW0A 1XEDA 1G7HA 1OGTA 1R46A 1U6AH 5KYXA 3K6IA 1VRSA 4LFHD 4QDGA 2ICWI 4TUUA 2FT8A 3MLPA 2ORBL 4XHJC 4AYFA 3KDMA 3QH3B 1C5BH 1S6NA 4H0GA 4NKOB 3SKJH 1KGWA 2O6EA 4HUUA 3QEUA 4BKLA 2I9TB 3RVTC 1DL7L 5AAWA 5AKSA 2WXPA 5TFSL 3V0VB 2DMHA 2Z6FA 1BCIA 3WE1A 5AVRB 4YWGL 1OE2A 3REWB 1L6ZA 2X9XA 2YRBA 3KS0J 1FFOB 3VI3B 4YXHH 4TQPA 4NERA 3UACA 4S0TD 3VGDA 4ZSOB 1AGEB 4YDIL 1FL6A 1WS7A 3PIQA 4G43A 4JM4L 2EIZB 1JZ7A 4YSPA 3HC0A 4AEIL 4ACTA 4AZ8A 4FZEL 3AJ7A 3NUKA 4NDMB 5L9DL 4Y8AA 2NXYD 5DQ9B 4I13B 3SCMD 4MX7B 1LK2A 3F7VB 3PLYA 4YH6A 3VXSA 4AJ0A 1OHZA 3O11A 1A3QA 1J1XH 3US1A 1HEZA 1VESA 3LD8B 5C8JA 1NPUA 2WMPA 1YAZA 1YPZA 3SSGA 4F7TA 4LCIH 4ZMVA 3O6LH 1OXYA 2A6JB 1IBFA 1MI5D 3CDYA 2GEEA 4XPBL 3ES6B 1KN4L 4Z3GA 2D7TL 1T83A 1M3JA 3GKZA 3IJ8A 2V17H 4WV1C 5HHVH 3BD3A 4PJEF 4XRCA 4A04A 2E56A 4ZOEA 4J3VA 4BJLA 4M7LH 4WTXA 1B6DA 1C5BL 3EOBA 5FGCE 1DBKL 3DV4B 5J9PB 2EUWA 1BZ9A 3OWRA 1L6PA 1KIQB 4GAGL 5ESAA 5EOQH 9PCYA 5D7SL 5DHVH 4YHYC 1C8PA 1I7RA 1DSFH 2H32H 3ESPA 1LLAA 4XPGH 2NQDA 3T0WA 2LU5A 5DRWB 2B3IA 3WNNA 3ZKXB 2F53E 4YXHL 2ROYA 4Y19E 5BQ7A 4IRZH 3GJEB 1OE3A 3X13B 3KPLA 1L7TL 5C9JB 3AABA 1QI3A 1AP2B 4FLQA 5GSVA 1ZSHA 1E3FA 3S96A 2WXHA 1IEHA 1A4KB 1F8TH 4ZUWB 5AUMB 4KX8A 5G5DA 5B7MA 1EHLL 2BS71 3EJYC 3WLWD 1OL0A 2KHAA 4H7VA 4GG6F 4GG6E 2DBLH 1U0QA 2GFBB 3QFDB 4UV4L 3DGGB 3VACA 2COVD 1X7SA 2JQMA 1BQUA 5FW6A 3OGCA 3GSQA 3MJ8B 1T04A 2XOTA 5DLLA 4DK6A 3KR3H 3NBNA 2AJ3B 1NGYB 4GEIA 1HHJB 3V0EA 3PWPD 2PMZA 1F0LA 5C6TL 2HCZX 3EYFB 4M7LL 3QIWC 2DBJA 1NC4D 2B9AA 5CN2A 3U7YL 1KN2H 2APTA 1JWSA 5T3XH 5H2BB 1SXCA 4LF3B 1CG9A 2OMZB 1DSFL 4JANB 1TYEB 2ADGB 1R3JB 1TQBC 3CPLA 4XOAA 4JPKH 3C8KB 1H6TA 2E7HA 3TEZA 1P7QA 2EQDA 5BS0D 3PWUB 4Z76A 2GJ6A 1E8YA 3CSFA 1TG8A 4Z95H 2MPVA 4KWUA 1BIHA 3HZ3A 3VUAA 1KB9J 1A0QH 3ZQXA 5JW4M 1OW0C 2H1PL 3LKRB 1F8TL 4ORZC 3WTTA 2GBAA 3OJVC 3QZWG 5HHOB 4UT6H 1KEGL 4PJAE 4UQIM 1K4DB 5KTEH 1LNUA 4HUWA 3L3IA 1DLHB 2DQFB 1A1OB 4HPOH 3SEPA 2R27A 2ZWSA 4CNIB 2Z93B 1ED3A 5AAWC 4JE0A 1CFSA 4H4NA 5BO1L 4JKPL 5I16A 5I0ZA 2C9VA 5ADPL 4UIMA 1BZOA 4MB1A 3W2DH 2XBZA 1U33A 4E9WA 5CJ5A 2EXYD 3KR3L 4P3WA 2APXA 1S5HB 1S46A 2FWOB 3BISA 3QYCA 2QTVA 5IHZA 1G7LB 5HI5C 4J3OF 4IMLB 1RY7B 4HX1B 4BK4A 1J0YA 3HJ0A 4QXVA 1KLGA 2F5AH 3IETA 2ZOUA 3O4OB 4LRNH 1ZGLM 1E8XA 4CUCA 4G7VH 3UO1H 2AJVH 3ATAA 4WFFD 2R1WA 4Y1AD 1ACXA 1E5AA 3KPPB 1MHHA 3PXJA 2WAHA 2R83A 2EVFA 2ESVE 3R7QA 1U8KB 2XXFA 4NQEE 2X0WA 3SDCD 3T4YB 4PJBA 2QPDB 4XN5A 1T83C 4OFIA 2V7HA 1A0QL 5LAXA 4N3UA 2W38A 4FQXA 4QOKB 4L8SB 1BFOB 4UT6L 3PL6A 4H5SB 4R83A 1SZNA 5KTEL 3IF1A 3LZPA 4HPOL 4Y2LA 4G71B 5F2FA 5K9KA 1HQ4B 1GGCL 1S8DA 2FQEA 4KMQA 3CVCA 3L5WA 4JN2A 1UH2A 3RNKA 3P4NB 5EIIB 4WEBH 1CYWA 2VXUH 3Q2LA 1LYQA 3W2DL 3AB0B 4L5FE 4X9GA 1DVZA 4IJTA 4U31A 3OMZA 1W6WA 2JKIS 2OJZL 4JZJA 5C09A 3GBEA 2ARJA 2WYTA 4P2OB 1AKPA 1M3IA 1IO4C 5AD0A 2AEIT 3L3OA 4LVHC 1L9MA 4HIIA 4X0NA 1E65A 4LRNL 1NFIA 5T1LB 4IBWA 3LN5B 1EEQA 2FO4B 4K7PH 5KYYA 1A3ZA 1YEGL 3CSYB 2AJVL 3AY2A 4QNPF 3VG9C 4JDEB 2LV4A 3O45B 4HXBH 2W92A 4K3GA 3S36L 2OLDA 2XTJC 1NUNB 4LSSH 2VERN 1IC1A 3RI5K 4FHBD 4A67A 2B2XL 2DEXX 3K46A 4NUJB 1B4JH 2DIBA 4OZIF 4ZW5A 1D5MA 4G7RB 2GIXA 4OZIE 3OHMB 2VDOB 4AQ1A 2ZXDA 2C3GA 5D1ZD 3VRIB 2NY5C 1FVCB 1EZUA 3SOBH 3WU1A 2B4CH 3RPIB 1LL1A 1WZKA 3ZYIA 4BIKA 3GT6A 2PWHA 3CLFH 4AQ8A 3HLKA 1EGJH 1JZFA 2B0SH 2ZX8A 4U1IA 4ADJA 4BSWB 1FFPB 1TOXA 4BH8B 1J0KA 3VWKB 1UB6A 5DDHB 2G4GA 5T1DH 3JQOB 4FCHA 3DRTA 2MH4A 1TITA 2V8MA 3UBHA 4D8PB 1Q9WB 3OJ2C 4LNVA 3ZIYA 2F5BH 4NNPL 2IV9A 3U46A 1HEHC 4QT5A 2QR0B 4PGJA 2EXWD 2IPUK 4A2FA 5JIPA 3OAZK 5E00B 3RVUC 4ZFFB 2Z65C 3IS1X 1WICA 4K8RC 1C8QA 3IDIB 4J3XA 4PS7A 3NA9H 5DJXA 1WC7B 3T4AB 4WO4A 4KHTH 1LVEA 4IRJA 1AQDA 5FA4B 2YHGA 2OP4H 5E1AB 3RB5A 3FONA 4GIAA 3S88H 4AE0A 4HXBL 1WHOA 1A6TB 3ZDZB 3VGAB 3VFVA 1BFVH 3VXMA 1ASOA 4RX4A 4LSSL 3ZMEA 3S8FB 2FR4A 2OMXB 3CX5J 4DEPC 3BAXA 1BX2A 5K1NA 5CBAB 2QLYA 3GGWB 1ZMYA 4APQD 2I24N 1ERNA 4HU8A 5DMGD 3JVFC 5HJ3A 2ZSVA 3SOBL 2B4CL 2YEQA 4DKFH 3ARDA 3TA3D 4GAFB 2IMNA 2LLNA 2ZJSH 1EGJL 4XMLL 3MRPA 2GCYB 5D6CB 3WN5A 5E9DE 4RZCA 4PCYA 4QO1A 1PNDA 5D9SA 5T1DL 1H3WM 3GTTA 1SN2A 3WG7B 43C9A 1HCYA 2APSA 3EYVA 1I8MA 4DP8X 3P40A 4JLRA 3ZKND 2V2WB 3CH1A 3BKMH 5E6IB 5IWLA 4PI0A 5E1IA 3VVWA 1MAKA 1TYJA 3CMGA 4OJFH 1YY8A 4LKCA 5KS9A 3ATEA 2GT9B 1AG0A 2Y22A 1KLFA 1S7TA 1W8NA 3PQYB 3MUZ1 4OIIH 3MRGA 5FYLD 3NA9L 3COOA 4O2FB 1KYDA 4UNTA 2WSKA 4U3CA 3TBVB 35C8L 2YSTA 1TYRA 2VIRA 2OI9C 2Z4QB 3HS0B 2OP4L 4FQXC 4K07A 4DQAA 2IMMA 2ZYSA 3PL6C 2BSRB 2DMGA 4RDQF 5JORA 3S88L 5E03A 3LB6D 4RGMB 3SJVE 5IB2A 5TDPA 1XXDC 2EICA 2R69H 3GIZL 3ZY7A 1R17A 2VL5A 4LK4A 3J07A 3IFOA 5HJDA 5CSBA 4KXCA 4BDVB 4C59B 2JQZA 3ARQA 4I4WB 1TNNA 4HAGA 2OQJB 1BAFH 2CA4A 1M2VB 4P2YA 2NSXA 3G9VA 3TJEH 4F2MA 4DKFL 4JZJC 4LP4A 4ZW8A 2Z7UA 4M8QB 2ZJSL 3RJDA 1R5WB 1WITA 2A73A 5EB9A 1KULA 3CX5K 4X6FA 3MXWH 3L3OC 1BJMA 2WXMA 2FSDA 4ONGH 1MHEA 1RZFH 4MMXB 3CDZA 2ZYRA 3BDBA 4LDOB 4NPYA 2QVTA 2VDOL 3DVFA 4HOMA 4X9IA 3QQ9D 3BKML 2BVPA 3GYRA 1AXTL 1E6OH 4GQRA 2OXHB 4LAJH 1DVFA 4LSPL 4OJFL 2BVQB 4HT1H 1OY3B 3WD5H 1CXFA 1M56B 2CIKB 3NJKA 3VD7A 2OZNA 4H8VA 2YA0A 2X3CA 1Z9PA 2AXGB 5DMIH 3MO1A 2J1YA 4JAMB 4F8OA 3CC5A 1GA2A 2AQRA 4P59L 4ALAH 4AQ1C 1U8NA 1FC2D 4I0PD 5DQJA 3T71A 3WNJA 4IKKA 2WW8A 4QF1A 5DS1A 3X14A 1JI1A 4AQ8C 1A7OH 5ACZA 2WLLB 5J6SA 1KIPA 2OW6A 3ABLB 2R69L 3VXNA 3FSOA 4QWWC 3FT2B 3MRMB 4LLDA 1PAMA 3QFJE 4NKIL 3SDXF 5TDNB 4A6YB 2TRHA 3MA7B 3SDXE 1X5JA 3V6ZA 1JNNL 2VSKB 1DANU 2UY6A 3PV6A 4I5BB 4QHNB 3BWAA 1BAFL 4GXUM 5CZXD 4CADB 3ULVC 2NXYB 3U6RB 3EJZD 1KTJA 1U8CA 3SCMB 4I77H 1XSIA 3HE7D 1LTXA 1N8OE 2F19L 2L8AA 2VQ4A 3V5HB 4NFCA 4L8DB 3T2PA 4U4BA 1DBML 5AALA 1I3VA 4HK3N 1F1DA 1USZA 1NJ9A 2EE2A 1R34A 2DI7A 3H8NA 3I75B 1VZGA 3U4KA 1E9OB 1L0PA 3TA4D 2MTAA 3WMSA 4WO4C 1FVEA 1RD6A 4IRJC 2XN0A 2O5XH 3TFKD 1WVZA 4ZAKB 4HBCH 1IAIH 8FABB 3BGFB 4UQDA 4RFNB 4ZX5A 3H54A 1E6OL 4QLWA 1FG2A 1MVYA 4E2OA 1EVUA 3WD5L 4KXBA 4P4KA 3RWJB 4LIQH 4PJEA 3BUDA 4OV5B 1A7QH 2QZQA 5DMIL 4BFJA 3BEVA 1OCWH 4KGJA 4ALAL 4QRSB 3X12B 3VWJD 2VW4A 3L2MA 2NLJA 2FK9A 4D0DB 3KNBA 4MA1B 5CGTA 4DGVH 2IBBA 2OKMA 3ARDC 1UEMA 1OWRM 1A7OL 3AQYA 1I7UA 3ECVA 4X6CB 4YZFF 3WN5C 1FZKA 4YZFE 3Q7JA 1IM9A 1CTNA 1KTBA 3FCSB 3L2NA 4K9EC 4L9LB 2F53A 2IDFA 4PCKA 1J9RA 4UNUA 3TPUA 4EUPH 3IDXH 4AT6A 3CFEA 4X7TB 1SJEA 3RDTA 3PXHA 2EH8H 4Y19A 3DRQB 1QPXA 4FERA 4W1TA 3VFPB 5IWLC 4E5XA 4PV8A 4UTBH 4DP0X 1VZHA 4MB5A 1U58A 2K7PA 1QASA 3AS3A 1KWKA 1PMYA 1Y6NR 2VLLB 4CRPA 1CF1A 4GG6A 1EJOH 2RD0A 3GIVB 5LG1A 4NAJA 2G5BB 4M7KH 2Z7YA 2O5XL 4M56A 4WKZB 3N41B 4A6YH 1ND0A 2AAAA 3MC0A 3MRDA 3GHPA 2ZOWA 2FYYA 3OB0H 3EBIA 1IQWL 1GOFA 3W37A 4L29B 2X4SA 4PGCA 5F7BA 5DJ6A 5FAAA 5JW5A 5BZWA 2BCKA 4FA6A 4LIQL 2BIMA 5A2AA 3EOTH 2EDLA 3PWPB 4W9HC 1A7QL 4R8WL 1OCWL 4J12A 4UYQA 2EDXA 2FJHA 1NC4B 3HTLX 5I0YA 1E2VA 1NL0H 3GPEA 3RTQD 5ICZB 4QHKI 4LEOB 2JIXD 4QRRD 1A7BA 5J6GA 2HUEA 3T65B 2PPDA 1CL7H 1BJ1H 1E9QA 2AK1H 1G7JB 3ZHFA 4H20H 2AEPL 1KXTB 2YQBA 2L7JA 3IDXL 4GBXA 4WGKA 3TBTA 3IDNA 4G8IB 3LRMA 5BS0B 2ZCKH 2EAEA 3BEWA 3RVXC 1UA3A 4FXKB 4OD3L 5GZOA 4L48A 5AAMA 1CF8H 5EUKB 5GJSH 1PLBA 2HLFD 3T0ED 1DVFC 4UTBL 4X4XA 4WNSA 2NX5E 3L4CA 4ONFH 5MEND 3V7AG 2QELA 2BVOA 2CO1A 1HSAB 5CLZA 1EJOL 2AQNA 4FABL 4M7KL 3PWVA 1X5IA 5HSFA 2PP9A 3B7UX 4OLEA 1MFNA 2VT0A 4A6YL 1UHVA 1VEPA 2EDOA 4F24A 5G2NA 1JF1A 3P2TA 3HC3L 2VLKA 4YIQB 1OAQL 3CZSA 3EOAB 3VU1A 4U1NA 4PD4J 4NLAA 2ODHA 2IAND 1PLGH 5HYSA 4XAWH 3NJXA 1JWMA 1YMME 4R96B 4ZTOL 3FH7A 3MLSH 5GGTA 1EK3A 4BFGA 3KPSA 1KELL 4D9LL 2QTEA 1TU2A 2QPFA 4OLYL 5E4EC 3O4LD 4J28A 1JYVA 4EIGB 3NA4A 3KBHE 3FHQA 4NSKB 1QUNA 4WJG3 1ZHNA 4IGBD 1CL7L 5F6HJ 4FG6C 1UXSA 1BZDA 2VLRD 3UBFA 5JHBA 4BZYA 2AK1L 2BNUB 4Z7QF 5CKAA 4Z7QE 5T3XE 4Y1AB 4GO6B 4G8EB 1QEWA 3MNZA 4HKBB 3IPEA 2QT6A 4GW1A 1QRNE 2WXLA 5D72H 4U1KB 5DEFA 1KT2B 3SDCB 4NQEA 2NXZC 2BSSA 4HGWA 4NENB 1CF8L 5GJSL 3VXRE 1CR9H 4ADGA 3AS1A 1ZDQA 2HLEB 4K7PY 4P4KC 3SKMB 4FX5A 2CUIA 5JIMA 1G1KA 4JZNA 1Y18A 3KPQA 4HZAA 2W0PA 4IOIA 3NACH 1ODUA 2VR6A 3I3EA 5DVNA 2VMFA 1HH6B 5AVSB 5K9QI 3UL4A 5E51A 3OKMA 3HPLB 3U1SH 5I75B 4YHLH 1W8EA 4HOWA 5IBTH 4JREC 3AS2A 3JV4A 4KJWC 3HNTH 5MI0C 2EXTA 3FU9A 1PLGL 2G0LA 3N3EA 3RDTC 2A99A 4XAWL 3A5VA 5KEZA 1O9WA 3D2TA 1AMYA 3MLSL 2EABA 2L7EA 2JKXA 2JI1A 4NQCE 4OKDA 4MDJB 4YDJB 4UQ2A 1T5WB 4PD4K 3A21A 4AIOA 1OT1A 3J27A 4Q52A 1CICD 1JV2B 1SNRA 1UD4A 1FNGA 3IYLW 3FQXB 4AVIA 3PJSB 5D72L 2OK0L 1GZQA 3A3YB 3F85A 1BPVA 2GTWB 2VH5L 4G2AA 3BHBB 1SF5A 4PVNA 1NPNA 2VC2B 1I3RA 3CX2A 4ZNCD 3QHTC 1HZLA 4IU3A 3HI1B 5K69A 3QQDB 4OSUH 3KYNA 3QDJD 4H8QA 2DYPA 3GJFA 2IADB 5KN5B 5MHSD 4MVBD 4PRPD 3NACL 1OHQA 2DKSA 2ENYA 2G9HA 3BP7A 1KBVA 2D4FA 4PJ9D 2EYRB 1S3KH 3I6KB 3T0AA 4JPQA 4UBDC 1IGCH 3MRQA 4YHLL 3WAJA 5AVQB 2QVFB 1RK0B 4BHUI 1OT4A 4D3CL 4HVBA 2W60A 4GBXC 2EINB 1IT9H 1PZUB 3NJHA 1XT5A 2HJLB 1JFHA 3KVQA 2E6QA 5GZOC 3L3JB 4IKNA 5AAMC 1TTUA 4G6AD 4UNVA 5HHOE 2I7SA 3JSSA 1TVBA 4LCUB 1RZ8A 4MD5B 4L1HA 1YRKA 3QJHA 4CMMB 1MWOA 4ODWA 4NO2B 3FKUS 4QJ5B 3CSGA 1T0MA 2J1ZA 4DEWA 1REIA 2XXMB 5KOVC 1HZHL 3LHAA 1KPUB 3CBKB 3O2WH 2F1BA 4LSUH 1DDTA 3F83A 5FCUH 1NUGA 3AW5A 4JPIB 1HDMA 2GBVA 3NJJA 4KQ4H 4BEIA 4TNWK 4ZW6A 4RGNE 2F08A 4APQB 4BWUA 1GJUA 2UVEA 3RL1B 5C97A 4ZO8A 1SEBB 4I89A 2FJFB 2PYFA 4M61A 5LBSH 1BOYA 4NKDA 3UAAA 1JBJA 1NCTA 1SHWA 5DJ8B 3KVPA 5CINH 5DJDB 1VCBC 5E9DA 4J3OC 1RJZA 3FF7A 3A6CH 3V10A 5JW4N 3LJ3A 1GGYA 4HJSA 4S1DC 5KYWA 3HAEB 1AIZA 1I1CA 2IG2L 4UIKH 1IGCL 4IW4C 4WO0A 2VC2H 3S3JA 4R26L 1RCYA 3KMDA 3FZUC 5PCYA 4B27A 2P8PA 4JY4B 3PU7A 3NSDA 1IT9L 3VYOA 2BNRE 3VGHA 1I31A 3FOMA 4O4YH 2X3BA 1I8AA 1CDHA 3IDMA 1GYWA 4K5PA 5DK2A 3UPAA 2H6OA 3TO2B 5I1EH 2CBQA 2GUOA 5KVFH 4BINA 1OP4A 2ADIB 4EXKA 3F64A 2WQRA 3LEVH 3NT0A 2B7DT 3TURA 1CFTA 3R19A 4QHPA 1EO7A 2IFFL 4HFWB 3O2WL 2DQEH 4LSUL 4UDUB 3SJVA 4R4BA 1CI5A 3P3TA 5FCUL 5G55A 2WWKO 5MP6L 3X14B 2XWBB 3CD4A 1V05A 3D39D 4KDTA 1Q9KA 1W0WB 3KGTA 2ZXWB 3RKDD 2BVYA 2VWEE 3NYKA 3JYBA 4U6YA 5C0CD 4MQ7B 1BQHB 1IFHL 3DX2A 3UIYA 2GTQA 3MRNB 5EZIH 3B7YA 3CQPA 4GEJA 3X2QB 5TF0A 4Z77A 1XCTA 3A6CL 2XZQL 2VDKH 1A64A 4KTEH 1V54B 5KJRH 4FQJH 3WTWA 3H42H 4ZMWA 4JDVA 3QXAB 4BGDA 1IGIH 1SJMA 3SDDA 2VC2L 4OVUA 1Z7JA 5CIPB 3QXVA 1F86A 3FB6B 3QWOA 3ZBMA 5E8PA 2CK2A 3TZVB 4G1MB 4O2CB 1FC1A 2B3RA 4I3SH 2QHRH 3CZGA 5FXCH 1LGVA 4HETA 2XWTB 4I0PB 3NQKA 3NIFF 5KVFL 3NIFE 2P26A 3LKNA 3HAEH 1VSCA 4FLSA 4M00A 3QWQB 2WTRB 3D8MA 5E1HB 3ZHDA 1UYWH 4XVSH 3BAIA 4F7PA 3T8XB 1O7DE 5A3IC 2DQEL 4XMUA 3CZJA 2AKRB 1FAIH 2DQJL 3QFJA 3F3HA 1MQ8A 2WLYA 5FYLH 2H0EA 4E9RA 3SDXA 3NCYS 2DDQH 5IM7A 1OQOA 4PGDA 3VFNA 1D7CA 1GGBL 4FEIA 2VMEA 1MFDH 3W9DB 5KYUA 3QRFM 4HJJH 2D0GA 1QZ1A 1RPUA 4K0OA 2WYHA 2FIKA 5EZIL 2ADYA 1WD9A 4HJ0C 4JFPA 3T1FA 5CWSB 1Q1JL 1WFTA 5AWNL 2JB6B 1ZPLA 1XGZA 4W9JC 1R5VB 1Z5LA 2M8XA 2WIIB 4PWIA 1HCFX 2E59A 4FQJL 3RWGB 1YNTF 3TN0D 4A7UA 3H42L 3ZDZF 2P52A 3ZDZE 4XWGH 4ATWA 2ED6A 2X4NB 3EGSB 1A6UH 3O3UN 4OF5A 2FIRT 4LOVA 4JGUA 1XF5B 5E8NA 5EBLB 3P2BA 3RP1A 3IEAA 3QNXA 1A2YA 5JYMA 4I3SL 2QHRL 5SX5H 4GW5B 2R9HD 4DZ8B 4Y4HD 4NC1C 4KKAD 3VWJB 5B22A 5JIHA 5IV2A 3DBXB 5C0GB 2OTPA 4GKSB 3VXPA 1NCCH 1JGDB 3QJTB 3OG6B 3PF2A 1UACL 4YPJA 4GLRH 1W2KT 5CIPH 4OI7A 4OCYL 4AVHA 5IFAH 2I27N 2CLRB 4OVVA 4QHUB 3BESR 5TQ0L 1FAIL 2JVUA 3HPJA 5GGRA 3MKKA 2ZF9A 5FYLL 1BM3H 2EEAA 1INEH 1JCKA 5L8LB 1AC6A 3P3SA 3FNKA 5HDBF 5HDBE 5CLXA 5EFIB 5DHEA 1UQSB 5HDQH 5L8KB 5CBEA 1XGRA 3KLLA 3FBKA 3FQUB 3B2PA 3ZKMC 3VG0H 4OQ1A 4AKQA 1J48A 3QA3B 5B3JF 5B3JE 3GHEH 5D1QB 4S1SH 1UZ8B 3RWCB 3ASWA 2WXOA 4U3HA 4Q7DA 3SKNB 1BBDH 2X4RB 1ZTMA 4D7PA 3UPRA 3OC8A 4ABWA 4XWGL 4B9GA 5HVHB 3FO1B 4MAZA 1A6UL 5AL0A 5FDYA 4FNSA 4RDBA 1KGXA 4RMVA 1JPGB 3TV8A 1TDQA 3BP6A 4JZOB 2ENPA 1M1XA 3QQNA 2IDQA 3CAFA 3ARUA 3L17A 1BMGA 4EDWL 5KAQF 4KDTC 3UAJD 1R3KA 4ZXBB 3RTQB 1N5AB 4XVJL 4FZ8H 3AT9A 2JIXB 2CE6A 1S9XB 3MLTB 5I2IB 4FFWC 2PETA 1ORSA 5A7BA 5M95B 4P5MA 3QJVB 1NLDH 3CFTA 5HHPA 5IFAL 1QVOA 5DFVD 1N64L 3IGUA 3QIBD 4WDIA 1JTPA 4XE5B 3RIFK 1OSZA 1HEJC 2OAAA 2NY1D 5FDWA 3SKOB 4IHOB 1INEL 4WTQA 4F8PA 3SDDC 4YFLF 3PS6A 1OARH 3EUDA 4WCYL 3T0EB 1AR2A 1YYML 4IRZA 2NY6D 2WCGA 3ABGA 3DHJA 4ZMOA 2HZHA 2X87A 3BPCB 4OCXH 2Q6WB 3IN0A 3VG0L 2NX5A 5CM1A 5MENB 2KPWA 2VW6A 3BPOB 2WXFA 3O6MH 3GHEL 5DHMC 4F1ZA 4S1SL 4EZLA 4Z7AA 5E6UB 1ROWA 3V0VA 2G75B 5HYJD 3NG5A 1F02I 3GFUA 5J12C 1RK1B 3REWA 3N50A 1NLBH 2PWGA 1JWUA 3L3DA 1S2EA 3NABH 4TUKH 3NP3A 4ZSOA 1AGEA 3E1F1 2IANB 1SBSH 2CHDA 5GS3A 1U8HB 5D93C 1NUDA 2VMCA 4YFDB 3UZQA 3GMLB 1YMMA 1N70A 2VKXA 5DQ9A 3DKHA 4L2LA 4KRPB 3O4LB 4FZ8L 3TPKA 4OGXH 1TZHB 1FH5H 5DZAA 4WJ5B 2YBRB 4IGBB 5AYQA 2WJ5A 1HYSD 2VLRB 1F13A 1HOEA 2ZOKB 4KX9A 1NLDL 4LPXA 1OAKH 1L0XA 3HW7A 3V95A 1MI5E 3QPQD 3VVVA 1O6TA 2OSLB 3MBWB 4FFTA 3CIQA 2QL1A 1F3DH 4OZHB 3BUQA 3P3RA 3MV7E 4FN0A 2B5IC 2LVEA 4TVUA 1LK3H 2XTSA 1XH2A 4WFED 1QRNA 4RIRB 3VFUB 4GRLA 3ARTA 5CJ8A 1T1YB 1OARL 3VXRA 1A1MA 4I18B 1AH1A 2W9EH 2X4OB 1DYZA 3VD9A 2EYTB 2IDCA 3O6ML 1ZHBB 3MUHL 3VFMB 2SEBB 4JDZB 1P4LA 1K5NA 4X6CF 4K5MA 4UT6A 4X6CE 3VA6A 4P9ML 2JJTA 5TE4H 3CCHA 5DRWA 3JV6A 2EDBA 4HZLB 3ZRFC 3NABL 4NAMA 4NP9A 4TUKL 2QDVA 4GW4B 3LY6A 4WI2A 4LP8A 4XBMA 3GJEA 1J7VR 4MJIB 3M8OH 4JJHA 2NY3C 2P8MA 3X13A 1KDIA 1AP2A 3HI6L 3MBED 4H8WH 3SY6A 4HIJA 1D5XB 1YA5A 5LNGA 4ODHH 3L95A 3NSYA 2HTKD 4Y16D 1A4KA 1MRCH 2Y5TB 3FTUA 5HDRA 5C07B 3IAGC 2R2CA 2BHYA 4NQCA 4F8NA 3OWEA 1YN7B 4N28A 1JHLL 5D96B 3S8WA 5IF0A 4IIQB 2WSPA 1U9KA 5TK4A 4J6IA 2GFBA 3V6OE 3QFDA 2VJXA 3R06A 3N41F 1CICB 3DGGA 4Z5RA 3ARFD 3HBGA 2G60H 3JWDL 2DLIA 1PAZA 3NAAH 4FQHB 5GS2D 4QIRA 1LK3L 3T0DA 3C75A 1KJMB 3CQQA 1GC1L 4X7DC 2W94A 3MPCA 4XVTL 4ZDHB 3MJ8A 2E5EA 3RJQB 1BGXH 4TQIA 3CLEH 2JWYA 2AJ3A 2E75C 1HHJA 4D9RD 2YD8A 4GAJL 1I85A 3VXOB 3EYFA 2DZEA 1FWXA 3QDJB 1UT2A 2GTZA 1VGKB 1LWJA 3I6GB 1AQMA 1UM5H 1AJ7H 5JDSB 1NC2B 1CXIA 1QSFD 2HX7A 3ULUD 5H2BA 4Z3IA 2V3EA 3R1GL 4LF3A 2D8KA 2O5YL 1UEYA 2OMZA 3MACH 4PJ9B 4HF5H 2ADGA 4HXAL 1R3JA 3VGBA 1R9FA 2VZOA 2QJDA 3BVVA 3ETSA 4YC2B 5CEYB 3VI4B 5AKRA 2ZP8A 3DIFA 5J4MA 1JS4A 5BS0E 4AYMC 4NP4H 4MS6A 4P0DA 1JGVL 3M8OL 2VLJB 1IVTA 1HWHB 2X4UB 3V0IA 3HVDA 3LNGA 1FV1B 4H8WL 5B38B 4ODHL 1M57B 3INUH 3LKRA 5CFAA 4HIXL 1XWVA 3P77B 3DIVA 1IGYA 5HHOA 3AY4A 3WNLA 4L05A 2V37A 5A2CA 1K4DA 2J72A 1MEXH 1DLHA 2GBTA 2DQFA 2X2HA 3HNVL 4JKNA 4POZC 4CNIA 1NCOA 4KH2A 2Z93A 3DXAD 3SBRA 2GSGB 4XMZA 4NBYB 3I6LE 3OAYH 4KX7A 4Z0XB 2G60L 2DEYX 4L23A 1VFAB 1WQVT 4YNYB 5GGSY 1VACB 3GC3A 2KT6A 5I1DB 2ITFA 4CSTA 4PLNC 3BN3B 1DZ0A 2CU9A 2Q2EB 4KRMB 1DQQB 1TKWA 2XKSA 1S5HA 2FWOA 1JK9B 4B50A 3FCGA 3ZMNA 3OR6A 3P30L 4ZMQA 2K8MA 1RP9A 3MUUA 4FNLH 3ZZSA 3ECQA 1SJHA 1IBDA 4W9CC 1AJ7L 5I19H 5SWSD 5B4MC 3UC2A 2WBWB 1CJYA 4HF5L 4WI3A 1VKXB 3MJ6A 4F3FB 2Z34A 1QSED 3RILA 1OLLA 1II4E 4WFFE 1M7UA 3LD8C 3BP4B 1H9VA 4UCFA 4FYRA 1WP6A 3A22A 1RSYA 3KPPA 1Q90A 3Q8BA 3G5VB 2C3XA 4D0BB 4D7BA 5BOZG 1WZ1H 1X5ZA 4LT7A 3FFCB 5FM5O 2G2NA 4V1DD 4IKJA 3T4YA 1XIWD 2BNRA 3UTTD 2IXQA 2NQCA 3KL3A 5I18H 3FUIA 4LLVA 4TRPL 4GRLC 1SMOA 3INUL 4OLUH 5JA8B 2WBKA 3ARBB 1MWAB 4U7SA 3UYPB 4L8SA 4K3HA 2ZKMX 5IQLA 2X2YA 1BFOA 5JW4R 2X0VA 4ELMB 4M4PA 3KJ6H 2GITB 4XHQA 1G9NH 2CD0A 3DIDA 3HE6A 5T5FH 2QKIB 1RXLA 3G3LA 1ANUA 5D1XD 3P4NA 3FT3B 1KYUA 3NSJA 3PWNA 4OFYA 5EIIA 2JJTC 3KPRB 3L4XA 5HI3D 3ZKXC 4BFIB 4DGYL 3D39B 1M7IB 1GS7A 2MQGA 2Z64C 4ZS7H 2WYZA 4HUNB 5C0CB 1ZOXA 3F7YB 2WP3T 5CO1A 5E2VL 3D0VB 3N40F 4FNLL 4AQ1B 5I19L 1HXYB 5EZJA 3LN5A 3S7GA 3DSNB 1PD6A 4G9FD 2MCG1 1K4CA 2F7PA 4X7SL 4G8FB 2Q7YB 1XF3A 1QHQA 4JDEA 4N0CD 3O45A 1XF2B 2WC7A 1DQJA 2UX7A 3FOLB 4KXZH 4HWEH 4RNRA 4PRID 4Z0BH 4IHBA 5EN3A 1N18A 1BIIA 3TCLB 1F4AA 1NCDL 1NIFA 1U2YA 1WZ1L 2HB0A 2Z7ZA 3BAEH 4RWHA 3QUML 5D7LE 5H37H 5HGBB 3RRQA 4W81A 5I1AB 1KXVA 5LG6A 1L9NA 4ZPTB 3FTYA 4F5CE 2F9BT 4BZ2H 4A2HA 4F58H 4FNTA 2GW5A 5CCKL 3UG4A 3KJ6L 4FXGB 1I85C 1EXHA 2CDGB 3C6EA 2FH8A 1WRFA 1NBYB 4LDLB 3WJMB 5TE6H 4WFGE 3VWKA 4JEGB 1HU8A 3CXHK 2C7UB 2UYLB 4O02B 4KDVA 4QRUB 4X0KB 5DDHA 3SDYH 3AU1B 1MW2A 1B3JA 2VITA 5FWRA 2DQ6A 3UTOA 4XP6L 1ETZB 4OF0A 5GISH 2Q3ZA 3UJJH 5H4ZA 2WOBA 3EDJA 1HHHA 4Z7OB 3IXTA 1Q9WA 4JFED 4OH2A 4FQ1L 5F7KC 5IROD 1YY9D 3FPYA 3R4RA 2YWYA 5EF1A 1Z0MA 2QR0A 4ZS7L 1GCFA 2R69A 4HV8B 4G8AC 5D7HA 3LMJH 4P04A 1RZPA 4DP7X 4XVUD 4OFPA 4ZFFA 2C4FU 1G9MH 2Z8WC 2FJGB 4MQXC 3MJWA 1I7TB 4XVOA 3G5YB 5E6ZA 3U36B 3HNSH 3SODB 3T4AA 2H2SC 1MIEL 1U8LB 5FA4A 5JHDD 1RHHB 5LO7A 4LAQH 5L2KB 2FHBA 3TN0B 2K0RA 3AY4C 3VTAA 3H9SD 3S6CA 2UXFA 3TU6A 4DN4H 4DZBA 3QZPA 4B9CA 3JUYA 4HWEL 1YNTA 4Z0BL 2UZPA 4LLMB 3A24A 5EPMB 4P9HH 1MJJA 2OMXA 1KTKE 1TJXA 3BAEL 5T3ZD 2XIIA 1IB5A 2J71A 3QUZA 5AKVA 4AV4A 3FFOA 5CBAA 3ALWA 1PIFA 1LJMA 5I17B 5KJ7E 3VRJB 4MDRA 2ZAGA 1AMXA 3AC0A 3PABB 5AYTA 3WIIH 1QW8A 4BZ2L 1S78D 4WEUD 3NJGA 4BBWA 4QXGL 2P5WB 3OKDB 3IDUA 4PJ7E 2DM4A 4KY2A 2GCYA 3KS0H 2F8VA 3MRRB 5TE6L 3IMWA 4B96A 1F5WA 3O4OC 3PJLA 4KKLD 1TEYA 3IJEA 1RP8A 1MIMH 4H0LC 5BO0D 5GISL 3ABKB 5KZCB 4C8XA 3DVGB 4E42A 3LTVA 3LKQA 1ZIBA 3WV0A 4JFDE 3RYMA 4NOBA 5E6IA 1EDQA 1MWAL 2AITA 4PLJC 4G70B 1EXGA 3IK2A 1DLFH 4TQ8A 1OAXL 3MRBB 4WEEA 2J2ZB 2GT9A 4F7KA 1G9ML 1D6VH 1WK0A 3PQYA 4RQQA 4O2FA 4QI3A 3UMTA 4OQTL 2YAQA 2X4PB 2JFCA 1WYJA 4LVNB 1KDJA 2WLNA 4O02H 3CV5A 2QSVA 3HS0A 4LAQL 4TUJA 4L8SC 2CR3A 2K3TA 4DN4L 1DE4A 3D08A 4BUGA 1VF5C 4DP2X 2V0AA 1YECL 2Z92B 4P9HL 2VM3A 2BSBA 3VH8B 4UAOB 4UM9D 1J8KA 2AHIA 3SQBB 1NCIA 2CRZA 4LARH 4PJHB 1FNAA 4XZUA 1UOVA 1MCIA 1JZDC 4N87A 3CE1A 5GRUH 4DERA 2OQJA 5I1JL 5IB4B 1GYAA 3AB0C 3P9LA 3OLIA 3WFCL 2WBJA 4X5WA 4P23B 4Z9KB 3EGDA 5D7KD 2QQLH 4M8QA 4QGTA 1JZ6A 1R5WA 5E8EB 1OTTC 2VWEC 4PN6A 3ARRA 3EUUA 1B0IA 4KKCD 1QFPA 1EANA 2DWYA 2CBTA 4Y4FD 3K6DA 4BH7B 5LGJA 2RIKA 4CJ1A 4ZNEA 5GRXG 3C2AL 3CFBB 3IBEA 1B9KA 5D7IF 3E7JA 5D7IE 2NY1B 2Y7NA 1ES0B 3ML8A 1GCYA 5H4YA 2OXHA 1Z9MA 4EUPA 2BVQA 1PG7W 3APDA 2X4TB 4GI8A 3BKJH 5B7EA 4OZGB 2NY6B 4KK6C 4BFEA 1D6VL 2AXGA 2CQVA 4JAMA 3UZVA 4BRJA 1KXVC 2BOLA 4O02L 1AZNA 4DVBB 1N7ML 3DX8B 3BVNB 4M1CC 4F33A 2AV7A 2YLKA 5F21B 4UTBA 3A47A 5HYJB 3SGKC 1NBVH 2WLLA 4MD0B 4C4BA 5D2LF 5D2LE 4AEEA 3SBPA 1EMTH 1JTTA 3MSPA 3QZBA 3VWKC 3UJTL 3MRMA 3EJTA 1SY6L 1O7DC 2FL5A 4O2EB 2PXYD 3RWFB 4A6YA 4PJDB 2R56L 3LN9A 1FRGL 5B1CA 4I5BA 4LBAA 3CSPA 4CGUB 4Y89A 5C86A 3TIDA 3U6RA 4DOHB 5DI8A 4LNRB 1QA9B 5GZND 3WO4C 3V5HA 2VDLH 1CFVH 2W95A 5JIKA 4L8DA 3ZOAA 5KSUB 4MJ5B 1MG3C 5F9JB 2KI6A 1E9OA 3T4AC 3QJZA 2X1XR 3PNWB 1MFCH 3ORJA 2V7NB 1MI5A 4M62L 4FJ6A 2Q7NA 3HKFA 1J5OH 3L9YA 1QX1A 4PI2A 5I1IH 1PVHA 5C7XL 1NM9A 3MUGB 1J18A 3VGAC 2E7CA 4G6MH 4GAAA 4M6AA 4PREA 1QHPA 4OGQC 5F8QC 1T7WA 3TNNB 3BKJL 4KPHH 3QUZC 4OV5A 5CZVH 4R7NA 4IEFA 2PF6A 1DCLA 3P11H 4IKLA 4LMQI 4QRSA 5E95B 1QWHA 3ZDYB 2MQCA 3GSUB 5I6PA 4AGQA 4D0DA 4NBZB 4JVUA 1B0GB 1AIFA 3BSHA 4V2CB 3LQAL 4PJIB 4IDJH 1NBVL 1MCJA 3O3DB 5DD3L 4BD4A 4X6CA 3EDEA 4FXLA 2IEPA 2YD3A 3JZYA 3FCSA 5I0VA 4ALAC 1QFOA 2H9GA 3L7EB 8CGTA 2VCOA 2MNUA 5LQBL 2EUVA 2EDWA 1B2WH 5FYKD 3KLAB 3OPUA 1INQB 4KVCH 4IMKA 3MBEB 3VFPA 3FT1A 5E6IC 2N1KA 1CFVL 4XT1C 1TUPA 1P7HL 2A0LC 4WUUD 3U9UB 2CDFB 2VLLA 2WANA 3JT2A 4QPEA 2IQAB 1H5BB 3GIVA 4MQTB 5DD0H 1MFCL 2G5BA 1JZHA 1P84K 3ARFB 2DB8A 3HS0C 5IMOB 4IBUA 1G7QA 1UFUA 1T2XA 4WKZA 3U2IA 1J5OL 2B14A 2BH0A 1CDYA 2Q7AA 4JGJA 3EJYD 4J3UA 4N9OB 2ZE0A 3MJ9H 1CFBA 3L4VA 4G6ML 5IQ7L 5KYNA 4XPFH 4K71C 1T0PB 3LS5L 1PL3A 4KPHL 2OV0A 1NMAH 4JO1H 3OAZH 3PWPA 2OMTA 1NC4A 3P11L 3VSTA 3GMPA 2XA3A 1O9VA 1OOAA 4HYTB 4NI6A 3D0LB 4QRRE 1QSFB 2WBJC 3UTSB 1QOKA 3D3VE 1TT6A 4XBGA 2NY4B 2HFGH 2AJSH 2LFGA 1RUKH 3MOBL 3B9DA 4HSAC 1Z5YD 3GJFK 3KJ4B 3QORD 3REVB 2RGSA 3VYNA 1ZGLB 1QPKA 2WY3B 1MCRA 5I5IA 3O3AA 5I5MA 4KHXH 1IILE 3V7MA 1YJDL 5D70H 1BV8A 5DJAA 4MA8L 3RVVD 1MCNA 3AG4B 3QPXL 3LKPA 4G8IA 4YBLC 5BS0A 4D0CB 1KCKA 4KVCL 1CDBA 1UH3A 1WEJL 1ZCRA 1R3LB 1RZJL 2CR0A 3K2IA 5EUKA 1KYOJ 2DRUA 4BZ1H 2PR9A 4S11A 5B1BB 4EZMA 5CKGA 4AIXA 4PSRA 2XQ0A 1OPOA 5BJTB 1HSAA 4A7GF 1NCBH 3T0XA 2ZKYA 4BKSC 4TL5A 5DD0L 1N6VA 3DXAB 2D2OA 4JHVA 5DHDA 1DBJH 2JTDA 4HBQA 3IGAB 5DJCB 1TZOA 2BZCA 3X17A 3GF8A 4ZW7A 3MJ9L 3UAFA 4XPFL 1FVDB 2GK2A 3B2XA 1NMAL 2JJWA 3BVWA 3E8UH 4ELDA 3BO8B 4TSBH 1A6ZB 5C71A 2CUHA 3B9KD 1QNZL 3SE9L 1NMBH 5SWSB 2NXYC 3UGUA 5JUEH 3IGFA 4PV9B 4ZD3L 2ZOLB 2P80D 4NSKA 2P42B 5GS2H 4XC3H 4JHUA 2HFGL 2VDPH 1RUKL 5CU9A 1QSEB 3ZLQC 1OCOB 1FO0B 5DRXB 3U25A 1ZT4B 2R4RL 2BOBB 3AG1B 4J6RH 5D70L 2NYZA 1X6NA 1KZQA 2FWLB 4HKBA 3U1QA 4U1KA 1KT2A 4V1DB 4NNXB 1XIWB 2WD0A 4NENA 4GINA 4RFNC 3MAWA 5AZEL 3UTTB 1AD0A 1EO8H 3V0WH 4NCC1 3ULUH 1NAKL 4BZ1L 2E9GA 5DEZA 3SKMA 4EIUA 3KPNB 2Z91B 3EH4B 5IT2H 1ZANH 4BE6A 3MLRH 2V5RA 1NCBL 4WI4A 3HAEG 3UBXG 1HWGB 3D50A 1DBJL 1DQVA 3H2PA 1WWAX 4XBEH 5F88A 5D1XB 2HJKB 5KVMC 2CUAA 1CFMA 3RWEB 3ZYJA 2JJUA 1F00I 2CHXA 3KWTA 5AOZA 3THML 4K3DH 1FZMB 5CUSH 3E8UL 4HS6B 5B39A 2FUQA 3D9AH 4KROD 4N2GA 4TSBL 4IMKC 4X5XB 5EA0L 3ZYOA 4GG8B 1NMBL 3TM6A 1R3IH 5JUEL 4C4KO 4L3ED 2NY2D 4XC3L 4G9FB 1D7FA 5LBSA 4AUYA 4ZX3A 2JK5B 2UY7B 4MNQE 3DJTA 3V52L 3WLWC 5FR3A 4PRIB 1JV2A 3AACA 4J6RL 1MG2C 5DMKA 5DZPA 1WAPA 3FQXA 4TVPL 2X53A 3TASA 3PJSA 1K8DB 2EDFA 4NHUB 4CBPA 5ADOL 4KBPA 3BHBA 3QUGA 1BQHG 4FFYH 3V0WL 2WO3B 3NRPA 4KNUA 4QCIB 2ZUQB 4QXUH 4YFLI 4UM8A 5D1ZA 1OAYH 4ZPVB 3ULUL 3MRFB 3HI1A 4F5CA 5D8JH 4NO0D 5FYJD 3QDJE 5GGSA 2I9LA 1DN0A 5IT2L 1ZANL 5H94A 3K2KA 1FO0H 1G43A 2X3AA 4PRPE 5INCA 4HIQA 5L7XH 2FRGP 4OF7A 4PHZA 2DLHA 3WELA 2EYRA 3VI4F 4XBEL 3I6KA 1HXMA 5C0ND 3VD3A 5E23A 4FQ2H 4P2QD 4GYBA 4JFEB 5EU6E 4YL4A 1KXQE 1RK0A 1GYVA 1AO7D 2V9UA 4WNJA 2A4EA 4K3DL 3DJRA 4N1EA 4XN1A 2IBZY 3D9AL 4R7LA 3O9WB 4JG5A 1KLUB 1RSFA 2VE6B 3NH7L 4AXWB 2RCSH 1D5ZB 1P1VA 4LCUA 2XIDA 4RRPA 4MD5A 3UP1A 5KVDE 3O3BA 4CMMA 1P7QD 4E41D 5FB8B 2FNBA 3U7AA 5DU7A 1I53A 1V7MH 4R2GD 4OJAA 5HHMD 1SOQA 1KPUA 4MJ6A 2KMWA 1A3LL 1CL7I 1NKGA 3MJGX 4ODVL 4JPIA 4FNQA 1OB1B 1VEMA 2J1WA 1R47A 5GRWA 3SPVA 4APQA 4FFYL 1IKFH 1DQTA 4QXUL 2LAGB 1TQSA 4FI6A 5D8JL 1T1ZB 1SEBA 2EXYC 4K2UH 3TA3A 2FJFA 3FU5A 2ZX5A 1FO0L 3N42B 4MLSA 1EH9A 3NIGF 4HJIA 3NIGE 2J57A 5EZOH 5JOFB 3HZMB 3I9GL 3MOQA 4FF9A 1Q72H 1HINH 1TTFA 3NIDB 1J5IA 3BQUD 1U92B 3RY4A 3QO0B 2O4EA 4AV5A 3CFMA 1J12A 4UYPA 4JFDA 2GSIB 3QW9A 1IGMH 2PWFA 1U4EA 4MMYB 4OF8A 3QAZB 3N85H 4MKTA 4PBVC 1R6VA 4QD2E 3CHQA 1M7DB 5KUMA 1J5HA 2BWDA 1MRFL 4YHKH 5DLML 4F2FA 9CGTA 2DQCH 4IBZA 3BX7C 4YS4A 4MB4A 3EDKA 1V7ML 4PRNA 5JW3L 3W9EB 3TBWB 4HFWA 4Y7OC 4UDUA 3VDAA 3WGUB 3TGXA 3LRHA 2IGFH 1J88A 1R4XA 2XWBA 1H3VA 2CGRH 3D39E 4K5LA 1J1OH 4LHUG 4RESB 1IKFL 4ZMZA 2HX8A 4AE1A 4XCEB 3CXFA 1XL6A 4XXCA 3SPHA 3W0WE 2DIJA 1AGDB 3GMQB 3OKOA 3MX0B 4RMRA 1T5KA 4MYPA 4FLRA 2VN5A 3MRNA 3N43B 2R7EB 3S37L 1DHKA 1PZDA 3QRBA 3C2SA 1JZ4A 4P2RB 4Y4FB 5T3ZH 4AVJA 5A2IH 1UJ3B 3WNPA 1L9QA 4ADIA 2KERA 5D7IA 1IC4H 4XBPA 2RAMA 1LHZA 3VSVA 2HVJA 5CIPA 3FB6A 3RVWD 4AMXA 2O5ZH 4GOSA 1IGML 3RIKA 3EH2A 4G1MA 4QMEA 1FHNA 4O2CA 1TTBA 4ODUB 1EZVY 3CFJB 4NZRH 4P57A 1QBBA 4BUQA 3NGBB 2HKHL 3IFLH 2DYRB 5D1ZC 1X3DA 2XWTA 4I0PA 4LCCB 4YHKL 4BRVA 1W15A 3PWJA 2DQCL 4F9LA 2VRQA 4NIYE 3BRFA 2JELL 2WTRA 3FO9A 3KYAA 3MU3A 3ATFA 3LCYA 1MAMH 3IXAA 2HLAA 2JI3A 4AMKH 3O41A 2HVKB 5FGSA 2OTUB 5D2LA 1MNNA 2DLEA 3IKCB 2PXYB 1VFUA 2B59B 1JVLA 2CGRL 1MCCA 1J1OL 1MFUA 2QV2A 1MCHA 3K0YA 1NFKA 1U95B 2BOCA 2NT0A 3EBGA 4YFEA 5LWYH 3IU3B 1VZIA 4UOW1 3VFOB 3W39B 2BRRH 1OT2A 3HE7A 3W9DA 2EXWC 5KBDA 1AYOA 1HYRC 2R0KH 2VAAB 1E8WA 1QAWA 1J0JA 1U8IB 3T3MB 2W80C 3OXSB 3CVHB 3DOIA 2Y1AA 3RWGA 2WIIA 4IOSD 4WQOA 4YEFA 5EOCJ 1DBBL 4YPGB 5FO7A 3FQTB 2WK2A 3T2NL 4M6ML 3W56A 3MRIB 1IC4L 2O5ZL 1B0RB 5AW5B 1XF5A 4G80B 5EBLA 3PFUA 5LLIC 3UMNA 1GJIA 1RVFL 2FTAA 1NCWH 4NZRL 5E70A 4NZ8A 2CUMA 3RE0A 2WTOA 4APQC 4A63A 4DZ8A 5IJBC 5DMGC 3VWJA 4WV1B 4JFYB 5A16B 4AYID 3MCLL 3TA3C 1XZ0B 5JTWA 1YNKL 1JGDA 3CFDA 3LZFH 1J10A 1MAML 4GSRA 3UTPD 5JPMA 2QGEA 1X6LA 2CLRA 4IOFD 1C08B 3W5MA 3NCCB 4HJUA 4QHUA 3U4AA 1ZV2A 1CU4H 2DEWX 2X4QB 2DY2A 1WT5A 3ZKNC 1Q9OB 4FL4B 1A7NH 2XYBA 3L5JA 5FKAB 5LWYL 1CE6A 2NZ1A 3B4NA 5EFIA 4OUUA 4WTWA 2BRRL 1R75A 4Q0XH 2Y6TE 3V9FA 3QDME 4QTHB 4WSKA 5B7FA 4HJ1A 4PRDB 5TH2B 3N9GL