3IBOA

Pseudomonas aeruginosa e2q/h83q/t126h-azurin re(phen)(co)3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relaxation dynamics of Pseudomonas aeruginosa Re(I)(CO)3(alpha-diimine)(HisX)+ (X = 83, 107, 109, 124, 126)Cu(II) azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Azurin
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3iboA00
1WS7A 4BXSV 1J9TA 5I28A 2BWIA 2FQEA 2OJ1A 1JZGA 5B3SB 2H3XC 1BYOA 1NIEA 3TA4D 4TXVB 4KO6A 1WA0X 2H47C 3N55A 1QNIA 1AZBA 5I6PA 3NJJA 1JXDA 1SF3A 1CYXA 4JHVA 1A3ZA 1JVOA 2FWLB 3NJGA 2AZUA 2XVBA 1ADWA 1JOIA 2FQDA 1ILUA 2ZOOA 4YVNA 3FSZA 4GY4A 1NICA 2X87A 1AZUA 1SFHA 2IDTA 4AKQA 2VSKB 3ABMB 1XB6A 3CVCA 1FA4A 2BZCA 2R7EB 2E86A 3H4FA 1QLEB 1ET8A 4PCYA 1J9QA 1IBZA 1W6WA 1BQRA 3NSCA 3QJSB 1ZV2A 1EZLA 4P5SA 5D4JA 4E9YA 4KO9A 1SJMA 3NP4A 2HX8A 2UX7A 2BW4A 1AZCA 3H4HA 2DWSA 3QJRB 4L0PB 2TSAA 3EH5B 3ZIYA 3ASOB 1JZJA 3CZUB 1KCWA 1L9SA 2XXGA 1WA2X 1NIDA 1EHKB 2GC7C 1L9TA 2VSMB 3SQRA 1NDTA 5B1BB 1YLBB 2MTAA 4BWTA 3N2JA 3S8FB 1I53A 5B1JC 2GB2A 3BQVA 5AKRA 5I6KA 2EINB 2HZHA 3DTUB 5E9NA 2UX6A 1UATA 1ETJA 2WSDA 1GY2A 3OQRA 1ET5A 2CALA 2XX1A 3FS9A 1GY1A 1GYCA 4G72B 4F2EA 2YXVA 4G7SB 3ASNB 1AZRA 1NPJA 1A4CA 4EF3A 4HCGA 1OE1A 1E30A 2IH9A 5I6OA 4Q89A 4NB7A 2OCCB 3NT0A 4YSCA 2CJ3A 2BWDA 3KW7A 1N70A 2QDVA 1JZFA 4A2FA 2GBAA 5I6NA 1R1CA 4RH4A 5B7FA 1M56B 2RACA 2UXFA 3CDZA 1IBYA 2GC4C 1E5YA 4ENZA 2X88A 2XUWA 4M3HA 1DZ0A 3QJUB 4GXFA 5B7MA 3CVDA 1OCZB 1RZQA 2UXGA 1SDDA 3ERXA 3DIVA 2HX7A 3FYIB 2PP9A 1M57B 3OMNB 2BP0A 3GYRA 2JXMA 4WTQA 4M4RB 3T6ZA 2IDFA 2YAQA 1DYZA 1SF5A 1J5DA 2R7EA 3HB3B 1PLCA 1MG3C 1TEFA 4W9ZA 1J9RA 4NERA 3WG7B 2XX0A 2J57A 3GXUB 4NAJA 1KV7A 2VW7A 4HCIA 3T71A 4FAAB 1A65A 1AS6A 2QT6A 1URIA 2DYRB 3AG4B 1GS8A 2AANA 2WO2B 5I6MA 2CBPA 2H5UA 4G71B 7PCYA 5B1KA 1KGYE 2VM4A 3CVBA 3PPSA 4YSAA 1L9QA 1B3IA 2DV6A 1IUZA 2IWKA 3UABA 5TK4A 2FTAA 1HFUA 2XYBA 1PLBA 2FQGA 1ID2A 4N8UA 4KNUA 1OE2A 3FQYA 1JZIA 1JXFA 1OCCB 2Y69B 4HZ1A 2FT8A 5TK2A 2WO3B 1W6LA 3NJIA 1GS6X 4PAZA 4G70B 1A4BA 1PZBA 5EHFA 1A4AA 2W8CA 3CG8A 3EHBB 3FSAA 3QJQB 3FPYA 1AS8A 4HHGA 2QPDB 4HHWA 3ABGA 3WI9A 4YSEA 4BWWA 8PAZA 2AZAA 1KCBA 1FWXA 2J56A 2JKWA 3NSDA 3OMIB 3ZX1A 3QJTB 1AQ8A 2HRHA 4E9XA 4E9SA 6PCYA 1AAJA 4E9QA 1KBWA 2CAKA 1ASOA 2IWEA 1MDAA 1V55B 2A3TA 2OV0A 2Q5BA 3MX0B 2J55A 3PLYA 1V54B 1BEXA 2EIJB 3HEIB 4E9WA 1W8EA 3C75A 3PAVA 1WS8A 4HALA 3IBOA 3KW8A 2YARA 4BK5C 2IAAC 1MG2C 1QHQA 2PPFA 3NJKA 3T6XA 3S3BB 4A2DA 3X1GA 4A2GA 3SBPA 4YSSA 3UAAA 3TBCA 2CUAA 3TASA 4YVUA 2ZXWB 2XV0A 2PP8A 1AACA 2Q9OA 3IEAA 3X1FA 3GDCA 1BXUA 1N68A 3X1BA 3QJVB 1AR1B 3FU8A 4GYBA 2ZONA 2UXTA 1PY0A 3JTBA 4A66A 1NINA 1AG6A 1T5KA 2BP8B 1HAWA 1XB8A 2IDSA 1RKRA 2YQBA 4YSRA 1PNCA 1NZRA 2PCFA 3ABKB 2VN3A 3FYEB 1TU2A 3NYKA 4G7RB 4F2FA 1J9SA 2EIMB 1AZNA 3EF4A 4W1TA 2NRDA 1KBVA 1V10A 5B7EA 2EIKB 3AZUA 2XV3A 6PAZA 3IN2A 3EH3B 2N0MA 1BQKA 3H56A 1PAZA 5FC9A 4YSDA 5PCYA 3NJNA 4DPAX 1X9UA 1MZYA 1PF3A 1RCYA 3NSFA 3NJFA 2Y1AA 3SBRA 1RZPA 3ABLB 4AZUA 1PCSA 2GIMA 1JZHA 4GP5B 2P80A 3PAUA 4HIPA 1NIAA 1A8ZA 3RYMA 5D4IA 5I6LA 2PPAA 4X4KA 4BDVA 1SHXA 3AG1B 3WNIA 1PZCA 1AIZA 1TEGA 2PP7A 4UANA 4KO7A 4HCFA 2GSMB 1ASQA 1OCRB 5F7BA 3T6VA 1GS7A 2QDWA 2QPEB 4ZK8A 3TU6A 3L45A 4Q8BA 4E9VA 1ZIAA 4DP0X 7PAZA 2YAMA 2I7SA 1ILSA 2VW6A 1KDJA 3AW5A 2ZWNA 2HLEB 4YSQA 1NWPA 1CYWA 1TKWA 3FT0A 3T6WA 3FU7A 3OMAB 2YAOA 3FQ1A 4YSUA 5I5JA 4YL4A 2IDQA 2AFNA 2BP8A 1HAUA 2DY2A 2PPDA 4FA7B 1IKOP 3S8GB 2PLTA 4AKOA 2MRYA 2VMJA 3NSYA 1X9RA 1NPNA 4MFHA 1J5CA 1PNDA 2YAPA 4BXVA 4AX3A 3FSVA 2HX9A 3V9CA 4DP7X 2LLNA 2XV2A 4HAKA 2IH8A 2I85A 4CSZA 3AG3B 2PPCA 3ZDWA 2BHFA 4GP8B 1JVLA 5ANHA 4A68A 2B08A 3AG2B 1BQ5A 1XB3A 3FU9A 1AANA 4KOBA 3WNJA 3NJLA 2B3IA 3MBWB 1OOWA 1CC3A 1E5ZA 1GR7A 2YAHA 1ZIBA 1SNRA 3WKPA 4AI7A 4KNSA 1AS7A 1JERA 4JHUA 5D4HA 4AKPA 1L9OA 4DPCX 4KNTA 9PCYA 4YSOA 3D12B 2FNWA 2FT6A 2FT7A 2XLLA 5AZUA 1CURA 3JT2A 1E67A 2P80D 3SBQA 3FPXA 5B1AB 3TBBA 2FQFA 5I5MA 1ET7A 4CSPA 1JZEA 4UAHA 1ZDQA 2YAFA 3FSWA 4A67A 1BYPA 1PLAA 2VM3A 3U25A 3EH4B 1SHWA 4DP9X 1MZZA 3QPKA 4F7KA 1WAEA 4QLWA 2YXWA 2HRGA 2HXAA 1WA1X 4A2EA 1L9PA 2XXFA 1ZDSA 3BVDB 4KO5A 4DP8X 1NWOA 1BXVA 2EILB 3V9EA 2J5WA 1ZPUA 1F56A 5I26A 1GSKA 1KDIA 1OCOB 5LDUA 3PCYA 4WKXA 4YSPA 4E9TA 3X1NA 4BDVB 1VLXA 2FJSA 1JXGA 5IY5B 3FU7B 1ASPA 1PMYA 1OV8A 2DYSB 2PPEA 2XWZA 3DKHA 1NTDA 3IN0A 2BZ7A 5PAZA 1AOZA 3NJHA 3WKQA 2VW4A 2YAEA 5B1JA 3UGEA 4YSTA 1BXAA 2I7OA 3OD3A 1L9RA 3FQ2A 1XMEB 1E65A 1NIFA 1BAWA 2BW5A 4DPBX 1AG0A 2AVFA 3ZBMA 4UF7C 3UAEA 4E9RA 5A7EA 3S3CB 3QQXA 4G7QB 2DWTA 2W88A 3X2QB 5AFAA 1SFDA 1PZAA 4DP2X 4DP1X 3AY2A 3T9WA 3NP3A 3IE9A 5F7AA 5I5IA 3X1EA 3S3DB 1GW0A 2IDUA 3CDZB 4DP4X 1KYAA 3OM3B 4A2HA 2GHZA 1FFTB 2CCWA 4GP4B 3WIAA 3UADA 3UACA 2BO0A 2PCYA 4BWUA 1IC0A 2TSBA 4DP6X 2UXVA 1CUOA 1OF0A 3PAZA 1M9WA 3NJMA 4QKTA 1SDDB 2XU9A 1OE3A 4N4YB 2JFCA 4DP5X 4P5RA 2GI0A 2BP0B 1NIBA 4JKNA 4KOCA 3PXLA 3G5WA 2IWFA 4K9JA
chains in the Genus database with same CATH superfamily
4WKZA 4QHLA 1JYNA 2BY2A 2AXWA 4FL4C 1J48A 1T5WB 1UA7A 4L9LC 4TPRH 3MGOA 1YNKL 3IMBA 5EUKA 3KPRD 1I8LA 4RDBA 4IRSB 5GQBA 43CAA 2XY2A 2ZSVA 2G3MA 1NGXA 4KY2A 3P3YA 5IB1B 3Q9QA 3WUZA 1RPQA 1LEIA 1XH3B 4PJ5D 1G7MB 2IOIA 3KH3A 3T2NH 3K2UL 4NRYB 1BOYA 1EFXB 4MQXD 5FFGA 4E42B 2HN7B 4MAUL 3RL1B 3T8XB 1ORQA 2DJSA 1YSOA 1G0XA 5HHOE 3HI1B 3K72B 1AKJB 4UQ3B 3D50A 4JGMA 5I0VA 3FO1A 3OHXB 3AQYA 1JNHA 1B2WL 4ATTA 2J8HA 2QADD 1Q9LB 4GXUM 3IDMB 1DEDA 4NKOA 4XE0A 1IGJA 5CWSA 1OL0A 4NZUL 5JXEA 2G0LA 3VI4A 4J3OG 3QJSB 2ZG3A 2V2WA 4E9YA 1U2CA 5DLLA 2OMWA 2DWSA 1CG9A 4NENB 1ZRUA 1OZUA 3U0TB 3R06B 5L2JA 2Y3AA 3DECA 3P9LB 4CGUB 3U0TA 3QUHA 2L7QA 5L2JB 4XOEA 5IHZB 3MNWA 1MNNA 3GLDA 1KCWA 2AAAA 4M5YH 1EGJL 1NBVL 3IDIB 2XC8A 4U1SB 3BZDA 1NIDA 2XKNA 4WW2C 5GGUA 5GSRB 4ES9A 3W2DH 4FI6A 4H1LB 5F1IB 3DX2A 2XKNB 4QRFA 1SQ2N 2FE0A 1GW6A 4GRMB 1ORSB 4KV5F 4U1JA 4YXHL 4AT6B 5IVXF 4JO3H 2ETWA 4N2MA 2YS4A 1BOGB 5J57B 5DC2A 5E9NA 1HS6A 2XFGB 4OGXH 2WSDA 3U46B 2ZX9A 5FKPA 4EVNB 1EXUB 2VQ4A 4NM4H 3UAJD 1XH2A 4RZCA 4U49A 4Q7DA 1JDDA 4PW4A 3D85D 4DGVH 5ADPL 4KKAD 1DQJA 3VXOA 4IRSC 4QD2E 4L9LB 2AK1H 4TQEH 5IFAL 1II4E 3B3IB 4IMLB 3ARDC 1KYOJ 2A9AA 3HN5A 5DFAA 5I6NA 1MY5A 3MBED 3QWRD 2K7PA 4M1CC 3VI4F 2CG9X 4CN1A 4DGIH 1LVEA 4DN3L 4JO2H 3D0VB 2ED7A 3WIHA 5AW9B 2F61A 2MQ0A 3NPSB 1QFHA 3NDZE 4KGJA 5B7MA 4HKBA 1JFHA 3DYMA 3SHSA 3WS6A 3CHPA 1YEJH 1SDDA 3QEGH 2P48B 4P2RA 3SIKA 2V7HA 4AQ8C 3A3YB 2D7OA 3O9WC 4IK7A 2ZKYA 3HG0A 3LN5A 4POZC 4WAFA 2G5BA 5MENA 1BXXA 2I5YH 1EERB 3VG0H 1T4WA 2PF6A 2O61B 1T1YA 3Q2WA 1PLCA 2VLKB 4PGDA 1FO0L 3CFDA 3ZKMC 5HY9B 3GSWA 2VW7A 4XZUA 5KSBB 5C6PB 3NCWA 3CHQA 4UCFA 4C56B 2AANA 1P84K 1YEHL 3VYOA 1FVEB 1W2KT 3SE9L 2DS4A 4QRUB 2X4TA 4JR9H 4AEHL 1XZ0A 3DX4A 3TESA 4PVMA 4OZIF 1QBLL 4DVBB 3X13B 1NMAL 5ITBH 4JQIH 5TGBB 3RFZB 4X5XA 4ZQTA 4Y2DD 2VDPB 3VFMA 2JJWA 3MRGB 1QLRB 3IMTA 4MD0A 4PRPB 3MRIA 2FX7L 2XN9A 2YMOA 1U8LB 1FAKT 5ICUA 4IBUA 1HEZA 3IS0X 1Z3GL 1S7WA 5C0CA 3PF2A 5GZOA 4G11A 5CHNB 1GS6X 3SDDA 2XZQL 1GGUA 2J4WH 1OANA 2P8LB 2H26A 2RIKA 3CG8A 4Z3JA 5JW4R 4JPSA 1GH7A 1I3RB 3HLAB 3M1OA 4JPQA 1L6PA 4HHGA 4NN6C 3DUSB 5KYNA 5E7FA 2H9GB 3MO1B 3WXVH 1PZ2A 1RZJC 3VJ6A 4WWKA 2APWA 3DXAB 1SQMA 4YO0B 5MEPB 4L5FE 4H1LA 4WI2A 4JK0D 2IADB 4ACTA 2VUYA 3VXUE 3ZSSA 5DT1L 2P28B 2X70B 1KIRB 2R4SH 4AH2B 1BM7A 2B59A 1MDAA 3B5TA 3RZCD 1IFHL 3O8XA 1LK2A 3WFBL 3DWTA 3RKPA 1V54B 5KG9A 3ELQA 1FC1A 2IH3A 3QB7C 1X5YA 5IM7B 1IKNC 4P99A 1JWMA 2NZ1A 4R96B 2FZ3B 3VFRA 2E59A 1QOKA 1K8IA 1XCTA 4H2AA 4IRZL 1IGFH 1PD1A 4HFWB 4PJ9B 4X4MA 2W92A 3JWDL 3RWCA 1JZ5A 1J0JA 3HPLA 3OZKA 3P77A 1IE4A 3QXAA 4ZYKA 1G7LA 5INCB 4XODA 2CK0L 2OL3A 3VB9A 3CFNA 5KOMC 2XZAL 4GSDH 2XKUA 4KTDH 5IKCB 1EAJA 2DQCH 2FEDD 2VLJE 3FU8A 4N0CD 4X6CF 1MFMA 1YY9D 4UM9A 2C4XA 4FXKA 4U6VL 4NZTL 4YN3A 5GZNC 1BD2E 1F6AB 1OY3B 4X6FB 3BH8B 4Y1AA 4PWJA 3VFNB 3HI1A 3K72A 3KXFD 4L4TB 1OP3H 3VXSA 3LH8A 5DSCB 1UOVA 1FFOB 2I9TA 3ABKB 3QZLA 3KBEA 5T1DL 5C7ZA 3KE0A 4ZFOA 1UA6L 1IJ9A 1U8CA 2Q6WA 1AZNA 3HNVH 4LLQA 3BYTA 1S46A 3CFCL 4M48H 4W1TA 3QSKB 2EIKB 2FL5B 3IN2A 5DYOA 3OLGA 4HF5H 2XBZA 1PX8A 4HKJB 2QBWA 1A7QL 1C9SA 1TJGH 2JELL 4J4PA 4X4ME 5D1QD 1BJ8A 5K1NA 4HAGA 2VR8A 4QRUA 4U1NA 3VXRD 4XP4L 2CM5A 4IOSD 5HHPB 4O5LL 3SYPA 3BPCB 2A73B 5IFHL 5GSRA 1A6UL 4ELMA 2AEOA 5DFVC 2AF2A 4V1DB 1MLBB 4MX7A 1Y07A 1TFHA 4PRHA 4GW1B 5TF0A 4YX2H 4ZMTA 5D4IA 1SVCP 4EN3A 4LRNL 3UPRB 2I9LA 1GOFA 4PCTA 1JP5A 3FQWB 3ARPA 5HYJD 1TEGA 3FFCA 1DBBH 2CPUA 3KLDA 1XIWB 2PP7A 4BRJA 1L6XA 1DLHB 3U36B 5FO8B 5IQOA 2C9RA 2XZZA 2VQTA 3CFJA 3FFCE 4DCQB 3TU6A 2C3WA 2ZXGA 5ANMB 2KZ1B 2RFXB 3V5DB 3BWZA 4QR7A 3CZLA 3OKOB 4NNXA 4F1ZA 4HUVB 5CBEB 3QQ4A 3CXHJ 4V33A 1PD0A 3D0VA 4FYRA 5DJ6B 2N7SA 4K15A 4JPWH 1FL6A 5M95B 2L0DA 4K9EL 3FCGA 3HAEH 1FYTB 1GHFH 5AW8B 3T6WA 1F3RB 4MQSB 1QHPA 4YSUA 3ZL1A 2Y2YA 2IDQA 1WCQA 2C9VA 5FV1L 4RISL 3B4NA 5AVXB 4PWGA 5GRUL 1J5CA 5J1TC 5EU3A 3MLTA 3TVMB 4XWOC 1MFAH 3QHFH 3SQOH 1BAFL 3HS0C 2P7TB 2XV2A 1JPFB 4HV8B 2ADIB 2NY3C 5G4MA 1S4IA 2VC2B 4ZFOB 5HXMA 1F90H 1IGIH 4GXVH 2P5EB 1HE8A 3FFOA 5K5YA 3HRZC 4DO4A 1EO7A 1XB3A 2OK0L 2CMRH 3QNXA 5D1XB 3GBMH 1SBBA 2VXVL 1DUZA 4FCHA 5F2FA 1GR7A 4M8RA 4FXKB 4UAOB 5J9PB 2CLZB 2DH2A 5L7XL 5D4HA 5F1NA 1KJMA 3H9SD 3W9DB 2HTKC 1XZ0B 2XWTB 3HE6B 4JFWA 4EUPA 4CVWA 2KZKA 4AENB 1A7NL 1BD2D 1CXFA 5HDBF 5AZUA 4QDGA 5HHVL 4W68A 4M9PA 4MX7B 4O2FA 1AE6L 1JNNH 5I30H 3FPXA 4FABL 1FZJA 5HYQA 1KFGA 2J3SA 1JZEA 4J39A 3M07A 4PLNC 2YPLB 1DQVA 4HPOL 2FO8A 4QCIB 4KROB 4NC0B 4TLKA 2VM3A 1FPTH 5I1DA 2CUHA 3HMWL 4N8VG 1DVFD 3ARGB 2C1PA 1E5AA 3JYBA 5E8EA 4I1RA 3DRQA 4FJ6A 3O9WB 4G6FD 1MZZA 1A4KA 3SYOA 2W0FB 1Y18A 4PV9A 3QYNA 2Z3FA 3GF8A 4JDEB 4H8HA 3N04A 1CBJA 2ZAGA 2BIOA 2H32B 3SQBA 2YSSB 3ULVF 4D0CB 4NGHH 4X99A 1XGZA 4AITA 3DBSA 3F6LA 2VLLA 3HA0A 5EFIB 3SQBB 3D8MA 2Y2WA 3SDXE 2FWSA 4GMTL 1GAFL 3DX8A 5HVWA 4MJ5B 1A7PH 1UURA 1L5GA 5AW0B 2VW4A 4PVBA 4ORGA 4OZHA 4NT6B 2WXGA 4LP5A 4KKNA 3EFFA 4KKPA 1WBXB 1E65A 2YRBA 3MRKA 4J4PC 1AE6H 4OF3A 2WK2A 5MHSD 2VISA 4GG8B 4MB1A 2HCZX 4PJGF 4OGQC 1A66A 1BZ9B 2VIRA 2HLFD 3D0LA 3DNKA 3GJFA 4KJPD 4YIQB 3AB0B 4A2MA 3L4VA 4QLRA 2CO2A 3WIFA 4HOWA 4EQ3A 1NFDA 3QCTH 3OKKB 2C7UB 3WU1A 5FK9B 2OMXA 4ZT1A 2EDJA 1JTPA 4NWTH 1N67A 2GI7A 2CK2A 5F7AA 2A1WH 2V3DA 5JHAA 3BRFA 4DGUA 2XWTA 2ZT9C 3HE6A 4P2QD 5B21A 1AY1H 3FJTA 4AH2A 1TJIL 2BMKB 5FYLH 1DJHA 1F90L 1IGIL 1NM9A 3H85A 4HV8A 5BQ7B 2GAZB 4NQDD 3VWJD 4DP6X 5CCHE 3SQOL 2DYPA 2W81C 1MFAL 5E51A 1JYWA 2Z35A 5H8DA 4K8RD 1SY6L 4YBQC 3VFRB 5AB9A 5AW3B 2Y07L 2GI0A 4U31A 3RWEA 1KB5B 4LL1A 5A3ID 4L4VB 2KDYA 3VE0A 4OZFG 4IBZA 4RGMB 4JANA 4XN8A 1OAXL 4HJEA 5FGCB 1WDAA 3HMXH 3UAJA 2CDEA 3CHRA 2KZWA 3CLFL 3GSNL 3FCBA 4HKZA 4QYAA 2Y7SA 4XE5B 3VFUB 4I77L 1BG9A 3QUZA 1JXDA 2X4RB 1SXCA 2IF7A 2FWLB 3W0WD 1SJEB 4P46D 5EG6C 2W07B 4L48A 4L29A 1M71B 3ESPA 4YHYB 4L3ED 4P05A 4FXGA 3ARYA 2H1XA 4FXLA 4UQ9A 1HL9A 4IJTA 1DLHA 2X0VA 1NC4A 3KPMA 4FJYA 4RBPK 1DQTA 2R7EB 3O3BA 5BXFA 2DWDB 3QEQB 2OXHB 4Q6IA 1QPXA 1VFBA 4N9GB 4MZ2A 3MRIB 1IBZA 3VD5A 1S9WA 2O6DA 2BY0A 1M7DB 4N2IA 4KI5F 2G5UA 5BVPL 1PLGL 4W9CC 3R8BB 1HOCB 3FTZA 3AXHA 2C3VA 3UO1H 4UOW0 3S5LG 5HYFA 2DTSA 4WJ5A 4OGZA 4GXVL 5F3HA 5CZVL 2HVKB 1ACZA 5GSVA 5CXPA 4N25A 1USZA 2BIHA 2H0FA 1LEGB 3ZHDA 5T3XL 5LQBL 3CSTA 1XCQB 1EVUA 3ZTJG 2IPKA 3O4LA 1RU9H 3QJFB 4ORGB 4TVPE 1U8PB 2E46A 5B8CC 2OW7A 3BZEA 3Q2VA 4ZO8A 1OM9A 3RRQA 3CFCH 3DTUB 5DDHA 3MCYA 3HNVL 4DIXA 2WCGA 2L7JA 4K9EH 4OY9A 4JPWL 1JGUH 3ORJA 2ZCZA 1KLUA 4QWWC 4F7EB 5CEXA 1FO0A 3MV11 3O11A 3S98A 4OT1H 2G3NA 3QUZD 4B96A 3CDFA 1QLEL 4OLYH 2DI8A 2ITCA 4LKCB 3GNML 4YNYB 4IEFB 2VITB 2ZOLB 4HZAA 1HHGB 3DROB 3KW7A 3OWEA 2JKXA 4B9IA 1JPSH 1YJDC 3TCTA 5ESQB 1M56B 5LGYA 4PJAB 2UXFA 4GSDL 1ODAA 5EA0H 1DBBL 5C0ND 4CN4A 5J12C 1PDKA 2A5UA 2EUVA 3OG4B 4JZNA 1CFTA 5HDWA 5HHME 4LCYA 4IKIA 2X38A 1TQUA 1IGFL 4JGUA 4H5SB 5DHYA 2WN3A 1KUMA 5LGHH 3RTQA 1JG9A 3BP4B 1HIMH 3B1TA 5L0QB 4HETA 2HRLA 1O5PA 5T5NG 3OKMB 4KUCD 4IW4C 2IIJA 1U8IB 5IJVA 3QFJB 4F3FB 2VLMD 4O2CA 3MJ7A 4KRLB 4XNBA 4CADB 4K7PY 1G6RA 3WFBH 4AYMC 2P9RA 2XX0A 1TJGL 2YPLD 1KSRA 4X9IA 3V0AC 2FNBA 4JM2F 4NLHA 1UD4A 1BVLA 5AWNL 2YEZA 1H8SA 3V4VA 3SKUD 5IG7A 5D7SL 1I7RB 3GI8L 1D3CA 1QSFE 4D9QE 1NSNH 4KKZA 5F88A 3QQNA 3D07A 1OSZB 4XMPL 2YSTA 1YNTA 1VKXA 1IUZA 2HSIA 4FI8A 4S1QH 5DS8B 4NN5B 4YWGH 5F7KC 4NYLB 2Q2LA 3BWUC 3NIDF 4PPTA 3TBVB 4MLIA 2IANB 5DMKA 1TT6A 2P42B 3JSSA 4HZ1A 1S2EA 3LD8C 3J7HA 3M1BB 4K23L 4JCLA 2F8VA 4QAMB 5L6YH 1R3HA 4XXDA 1T1ZA 2OMZB 4X4XB 4HD9A 2DQCL 3BWUF 4YS4A 1G7PA 1ZVHA 4JQIL 4KTDL 5M7QA 1YYML 3QUXD 2XZAH 5HJ3A 2DM3A 3ZKND 2P5WE 4IRSD 1ZHKB 1KV3A 3MRDB 3TJHC 5D7LA 5EIIB 4EMZA 5GRYA 2F7PA 4XTRC 3OB8A 3HVDA 1FWXA 3KPSE 3Q6FA 2J56A 4PLJD 3B3IA 5D6CA 5DD3H 5C0EA 5DUBB 1RZ8A 1MW3A 1KGCD 5AZ2L 2WZ5A 2A7BA 1K85A 5HGDB 2AJSH 3IU3A 4HJ0C 1EZVY 2M2DA 2ZP9A 4L3AA 4Z0BL 4V2CB 2ZOWA 4HS3A 2NY2B 3VG0L 2MNWA 43C9B 2GCYB 2PO6C 1B0GB 5C0FA 1JZ4A 2J73A 4KXDA 3S3BB 3KLAA 5H2BA 3X1GA 1U3HC 3GXNA 3JV6B 4NJAH 1U58B 4ONOA 1YEJL 3QEGL 2VL5B 4EZLA 1TTBA 2H1PH 1S9YA 3QIBA 1KGUA 3GKZA 5CP7B 3L6FB 5HDOA 2X4OA 2XVLA 3SDCB 1KY6A 2V7NA 4XXCA 2DN7A 1VAHA 3TV8A 4KROD 4HMCA 3ESVF 2Z0UA 2XZQH 3WJLC 4YUEH 1J87A 1BM3H 4DGIL 5KVEH 2Q86A 1Z3GH 2X3CA 2OJEB 3OC8A 1G7HB 1X5GA 3QWNA 4W6WB 4K73A 1BBDL 4P4KD 4I9WE 5BUPA 1EX0A 3T4AB 1HZHL 3NQIA 4I18B 1SRDA 4Z7VF 4BFFA 2DKSA 1S5IH 1OSZA 5DS1A 3F58H 2RTTA 3HNTL 2PCFB 5D1XE 1IM9A 2FCBA 1ZHNB 3CBJB 3P73A 4EI5D 3ZY7A 4ABWA 4MNHA 4JG5A 3SY6A 1SN0A 3EXLA 5HDLA 1YEWA 1T89A 1INQB 4XHQA 3V4UH 5JA8B 4GFXA 1LD9B 1BQKA 2HG5A 3L7FA 3IJSB 3UO8B 1THCA 1WT5C 4JL1A 4S1RH 4J3TA 1MZYA 5TJWK 4XB8A 1OOAA 3I9GH 1JI2A 3HC0A 2MOGA 1U6AL 1WGVA 1FNSL 2P3YA 4HIJA 4OGAD 4FFYA 3WFDH 4FOMA 1PCSA 2EDOA 2YEQA 3MREB 5F7EH 1AGCA 3PAUA 2HPOA 2W38A 5D9SA 2DOCA 1NCAL 4KITB 4HS8L 4QXTB 2VDRB 1OTSC 1DVTA 1PGRB 1USQA 3P4NA 5HYQB 1BIIB 5E94B 4DKFH 4YHZH 5DC4B 5KG9B 1ACCA 3NEOA 4XPAL 3QO1B 3UTZB 4UANA 2O6FA 4WSKA 1NC4B 3KPMB 4X9YA 2F1EA 5F7BA 4DKEL 2ZX5A 3OKDB 4ZXBA 3IDGB 1U3YA 4CILA 1BMGA 3PPEA 5HGAA 3CN0A 1QWUA 5I1EL 2ZOLA 3K5RA 3VD1A 2CRMA 4HUCA 1T1WA 2NXZC 2QKSA 4XO8A 1MIEL 3TCXA 1UYWH 1ILSA 1FVDA 5ESQA 1YQ2A 2ROYA 1A6AA 3EUUA 1R0AL 1A9BB 2H6PB 1LE5A 1MI5E 4X6DB 3RLSA 4HWUA 2CO6B 4KPHH 1AD0A 3ARWA 4J3OF 3KCPA 4Y5VB 1ZLUH 4GUCA 1J1OH 1QATA 2JJUA 4LNRB 3QXVA 5D70L 1FDLL 2YXFA 1A1OA 4MFHA 4XO3A 2WVUA 3KXFA 4LLUA 4AXWB 3K1KC 4U2ZA 2CGRH 1CD0A 2GAZA 5E2JA 3QUMA 5EWIH 2OYLA 4CSZA 1SYSA 4UM9D 5EU4B 2K3TA 1UB5A 5JOEA 2EE0A 3MA7A 4FQHA 1A6ZA 3B2VL 4PRHE 1V3JA 4GXUN 5HYEA 1X4YA 3MNZB 2BINA 4X80L 1G1KA 3SDCC 4XPHH 5FK9A 4I48B 3LKPB 3F8UB 1X44A 1C08A 1GIGH 2VR6A 4KVCL 2JWYA 4Y4KD 3RFRA 1YECH 2FX9H 1B90A 1A6PA 2XWDA 4I0PC 3JXAA 4UBDC 5IHHA 4JFZH 1JZ6A 1BFSA 3EYQC 2FGZA 1HHIA 5HYJA 1MN4A 5DHVH 1HEJC 4JVUA 1NJ9A 3FQTB 4YSOA 4F1SA 2CJUH 3ZTDC 3OR6A 2VLRD 2CKBL 2H8PA 4OLVL 3OKLB 1QSED 2HKAA 1BWMA 2QQLH 3TYFB 1UOWA 4CSPA 4DFIA 1KPVA 5FIEA 2ZPKL 3T2NL 3EYSH 3L1EA 2YAFA 4QMEA 1PLAA 4UNUA 4BSJA 5D2LA 2K0RA 2YGNA 3SZ6A 4H44C 4YXLH 3SPHA 2UV3A 4RFOL 3ESUF 4M9OA 1KCUH 3RVVD 3UYRH 2OYMA 4G6KH 1QFUL 1UH3A 3PYCA 4R7XA 3EOTH 2WKGA 2OMVA 1ZT7A 4Z7WA 5E03A 1H6EA 4ISVB 5E4EC 4NQEA 1CXEA 4AEFA 3QYCA 5T3ZD 1WWBX 2BSSA 4QJ5B 2GG1A 1DJIA 1TETH 3F5WB 3FB5A 4HXAL 4Y9GA 4B7IA 4KFZC 4C4KO 3QI9B 1CR9H 5DLML 5EUOA 5D7IE 1ZLSH 4DEPC 5I73B 3LQAL 2K6YA 4KH9A 4UNTA 2DYSB 1I7TA 1DBML 5BZZA 4P06A 4HKXA 3TT1L 2LU3A 3ZTNH 3RVTC 1YEFL 1G9HA 3GK8L 5FGBC 5D2LE 1NMCB 1KN2L 2H2SC 4H8WH 4DCQA 4MD0B 4HBCL 1PEWA 5DD0H 1EO8H 1H3PH 5IMKB 1RUAL 3GJEA 2A0LC 2ZWKA 4A63A 4EIZC 1T7WA 5DI8A 1H8OA 4U1MB 1CO1A 3PG2A 3FKUS 1NAMA 2Y72A 4BKSC 5SX4I 1UCBL 4MGXA 4DK5A 4QRBA 5ICXA 3QZPA 2HVKA 1ODUA 2ICWB 1A7OL 2Z7YA 1QRND 3GBLA 4Z7QB 4FKHA 5FDWA 5IB3A 1ONQA 2DWTA 1IC4H 1MOEA 2VXQL 5J89A 3TPKA 3OAYH 1PZAA 2AJUH 3X3FL 3UZEA 4AQAB 3RHWF 4DUVA 5SWSA 5B4MC 1FZKB 2P8PA 2PYFA 3B9KA 2A83A 3NCBB 4BA8A 5AB1A 3GMQB 5ICZB 4AYFA 2YD9A 4MA1B 1ZY9A 1MWOA 1NCWL 1T1XB 4EI0A 4B9ZA 3CFBA 1FF5A 4NOBA 3ZHLA 3MGTA 2DIAA 5BS0E 4E0RA 3IJEA 2NNCA 3FB6B 4R7LA 1SDDB 2BDNH 5C07A 1LL1A 2R1WA 3GHBH 4NKIL 4P46A 3G5WA 5AUMA 3PWVA 1EJOL 2KT6A 1U91B 4JCMA 1FRGL 3V0IA 3MCLL 4L3EA 3HPJB 3OL2A 4FYQA 2QFPA 3ZKNC 3DDFA 1I3UA 3QDJA 3VTTA 3MBEC 3KHOA 5FUCC 3UP6A 4ZMAT 3ULVE 4TVPD 2VKWA 4QT5B 4PIRF 4F7MA 2F7IA 2VZVA 1WFIA 4JRXE 4OZFB 4JZOA 7TAAA 4UQ2A 1MCRA 4JO8A 1AHKA 4HUUA 1Q9WB 5ISZA 4R7VA 2BSSB 5JR1L 1UM5L 1JV2B 4KJWC 4XAKD 4Z0XA 4MNGB 1NICA 1QRNE 2ZX8A 3S0PA 4HUKB 3VWJA 3ARBB 3JV4A 4KFMA 4YHMH 1T83A 2V9UA 3AAZB 2P5ED 2QSQA 5F7FA 5LCVH 2CO7B 1A0QH 2WUCH 5IMLB 1HDMB 1BQRA 4CDGC 4BA0A 4KO9A 2IH1A 2Y0SA 4I7ZC 4OQ1A 1UM5H 2AERT 3D39E 4R8WH 1MF2H 1QLFA 4GLRH 4YGVA 5T33L 2WXRA 3H9HB 3P9MB 3ZIYA 2Z91A 4WI0B 3BT2L 4M03A 3US9A 3D0LB 5HHMD 4ORZC 3SDCD 4UTBL 1GC1H 3ATDA 3P9WB 4G9FD 4U1NB 4S11A 4WUUA 1LO0H 1MFNA 5DFVD 5SV3A 3G08B 3MV9A 5D72L 1J0YA 4YO0A 1E4XL 1EEZB 5DK2B 3IFOA 4X6EB 3ZE2E 1XL4A 4MWFA 5KS9B 1EJOH 2L7EA 3H0TB 4NKMB 2EEDA 2N7AA 2EDTA 2E9IA 4E41B 1QNZH 3KJ6L 4B9FA 3INUH 5AKRA 5B3JF 3NZ8A 1BGXL 1XR8A 2AEWA 2C26A 2P7TA 4GKZA 1HQ4A 3OAZH 4OCSL 5C08A 1ZVSA 3GO1L 4N0UE 1GY1A 3TONA 3MA7B 3M6DA 1HQ4B 3D69A 3UFIA 5C0GB 1OM3L 3CXFA 5L88H 2PYEA 1VEOA 2Q1EA 5FEBA 1QBML 1A4CA 3NJXA 3VGBA 2C9SA 5EF3A 4PBWD 5K9JL 2ITEA 4K2UL 3AVEA 2JI1A 2AQPA 1AXTL 3QPQD 4QGTA 3CZJA 2Z1PA 3TO4A 1R1CA 2O6CA 3LPFA 4MCYB 1DVFA 3HS9A 4URTB 4G8FA 2QQQA 4ZFZA 2MCPH 4LBAA 4LCCA 4XVSL 2Z6FA 4NEHB 5M94B 4XNZB 1KGJA 3EJYC 1E5YA 4MJHA 4DPRA 1HH6A 3IJYA 4BGDA 2FO4A 4G7VH 1MJ7L 5DQ9B 3BKMH 1SMAA 4F57L 4N8VB 3LHPH 3DIVA 1K8IB 1XCTB 3HC3L 1NCJA 4P3CL 1FBIH 2I07B 4K8RH 1FJ1A 2JXMA 4WTQA 3PHAA 1ZHLB 3ZTNL 4M4RB 4P9MH 5C7XL 3L3OB 1PSKL 2BRRH 4G3YH 4GRLB 4M6MH 8CGTA 2ZUQB 3BAEL 5E1IA 2PN5A 1R4XA 4MXQD 2J57A 2ARJA 1U8MB 5IBTH 1XEUA 1SHSA 2FL5A 1A65A 1M7DA 2NX5A 3AQZA 1PYWB 4LSRL 4R6UA 3GSWB 1IL1B 3G6JB 3GMNB 4UT9L 5F0PB 5FB8B 3ISWA 4JZOB 4AE1A 4D8PA 2Q2EB 5I6MA 1TXKA 4YDIL 2GBTA 4ALAH 3R4DA 4J3SA 3RFZC 5JOFB 4H8QA 3VQ1C 3W82A 4JFEE 5FAAA 1QFUH 1B6DA 5E5MB 4YXLL 1BFTA 3UABA 1CE6B 4KHXH 2DB8A 5LN8A 4ZODA 4PRPA 2X4SB 3SOBL 1I7ZA 1FN4A 2XG4A 4LOUD 4TNWK 4ZDHA 3VNZA 3R7QA 4ZBJA 1IIKA 2DTML 3QDMA 5GRJH 5JIKA 5EHFA 1I3RA 2PWHA 3HLAA 3UAFA 1VZHA 3BUYB 1AOHA 3BKJL 1LQBC 4PMFA 4C58B 2FX9L 2EYTA 1M2OA 5GGSB 4KVCH 3I6GA 4JRXB 3FOLB 1CVRA 3B34A 3MLZH 1RJLB 5IQNA 2WMPB 3VFSA 2CAKA 4OF6A 1N19A 2BX5A 35C8L 2DJUA 1V55B 3E3QE 4U4IA 5CLZA 1NGZB 1NOLA 1BX2B 2IH3B 2WXFA 4KC3B 43C9A 3U46A 3EGSB 1XIWA 3O2WH 3MOQA 2X4QA 5EO1A 3ZKMD 1RUQL 3OKNA 3QG7H 4PRPE 4HWBH 1X6LA 4BM7A 2WZ0A 2NY4B 3L3OC 2R2HA 4JN2A 3MMEB 4QTIL 4QO1B 2V7HB 4ZO7A 4Y5YB 4K55A 3MMEA 5EMYA 4CVXA 2H7WA 5D70H 1X6NA 5I19H 3BFWA 3C5XA 3HG3A 4FNLL 1ZHBA 5DC0A 4LGSB 4IBSA 2PP8A 3QFJA 5D1XC 5LBSL 4BSVA 1QUPA 3X1FA 3BSZA 4RX4D 3QDJE 4X2UA 3ZTJH 1WPCA 2EYRB 5KYYB 1NDGB 4LLWB 5JDJA 5ID0A 3AROA 3BP5B 4GT7A 3K2IA 1RZFL 4L4TD 4N1CA 5TPWL 5DD6A 3EH1A 2BP8B 5DD6B 2AXHA 1OTUD 4XP5H 1NANI 1RKRA 3FT3A 4NN7B 5I0DA 5IQ7H 3WENA 2XPGA 3N43B 3EG9B 5HYSB 5BW7A 1I7UA 1IBGL 3HG1E 2O5YL 3D18B 1PG7H 5F70A 1MRDL 3TEXA 4FFTA 1C1EH 4H7VA 1PIFA 1NFKA 1JRHI 3QUMH 1N0XL 2NRDA 5D7JD 2J1WA 5E2UL 1GA2A 2IFFL 4PRBA 3IJ8A 5BOZG 1E9QB 3LYRA 3VA6A 1I1AA 5HGHB 2DH3A 4JY6B 3U2IA 4JY4A 1RCYA 1Y6KR 5J1SC 4JQVA 1NEPA 4B95C 1MCWW 1J8HD 4J3OH 4S1RL 1T89C 1NANH 4C56E 1WZKA 2QVFB 1Y6NR 4AT6A 2WMPA 4XNYL 1MJUL 1G9NL 5D9SB 2KS0A 1X5FA 2VERA 4X4KA 1K3ZA 2NY5H 4FQCH 1HQRB 4D0DA 1UT9A 1PAMA 3IU3B 4YJZL 2XNAA 2NCEA 4AEIH 4F7TB 5J06A 4Q0XL 3A24A 4DKAA 5GPRA 3F58L 3WHXA 5D96C 3EO9H 3A6OA 4OZIA 1SXSA 1OAUH 1SY6A 3SDXF 5C0DA 4FFZH 4K5OA 1YMMB 4P48A 2LVCA 3EJYD 3MOBL 2WBJB 4E9LA 2ICEA 3D33A 1QFOA 4AYID 3FOLA 2I7SA 1CI3M 3LZFL 1OB1B 5DJYA 5F7YC 5I1IL 2HLEB 4JRLA 5I1LA 3TEWA 1A6AB 3MRRA 1PKQB 5B1CA 4PG9A 3DX8B 1CMOA 3NFPB 4NO0B 5ESAB 1A02N 1FGNL 2KKQA 4X98B 1XV8A 1N2RA 1MREH 4IIQB 1JPGB 2AFNA 4X6EA 2EXWD 2RJMA 4NJAL 2PLTA 1SBSL 3BHBB 1MELA 4FGMA 3NSYA 2VDMB 4MXWH 3FN9A 1HCYA 1S6NA 4W9LC 2ZJSH 4AX3A 3MV8A 4HAKA 2ZKHL 2I85A 2IO5A 3QCUH 2PPCA 3NQKA 5ILTL 2O5NA 4E0RB 1C12A 3ZE2B 5L2KB 4RGMC 4ACPA 1UHVA 4N2EA 5EN2A 3L1GA 2FLMA 3BMWA 3VRJB 3KNBB 3VXNB 1NFDB 3U2SB 4G6JH 3BEWA 5C6TH 2DQEL 2NY5C 3EDKA 2NZ9D 5AOLA 3ALPA 4CSTA 5I17A 4QTFA 4CVZA 5AVUB 4UT6A 1NJ9B 1EWHA 3FQTA 4HWEH 3AMLA 3FO0H 1QG3A 1VACA 1W72H 4F8TA 5JUEL 4QJ3B 2G60L 5GS0L 4GW5A 5FYLE 4FQJH 3SBQA 4PRIB 4PGJA 3EZJB 1MFCL 5KZCD 3L16A 1ZANL 3MAWA 1TO4A 3TNMA 3SCMA 1MLCB 4X6CB 5C0CE 4H40A 1ZGLA 4PLKC 3PV7A 3ETBF 4A6YH 4ZMQA 1S7QB 3QDGB 2M83A 3K5SA 3HKFA 5KVGE 5IVNA 4DP9X 1KZYA 4QXUH 3PGFL 4LVOC 4HEME 1AI1H 4HFUL 4ZUUA 2Z31B 4HZLB 4JDEA 4OU3A 3VDAA 5DK0B 4K7FA 4X7SL 4YLBA 4KUZH 2VMCA 1DVZA 3OKEA 4I1NB 4BKLB 3OSKA 4PWHA 3CH1A 4YHNB 4P4KB 4YBLB 4JHAL 3GHPA 1BJ1H 4RAUA 4XOBA 5CFHA 1KT2A 4O2EA 2OL3L 4I3RL 2CE6A 5EBWA 3REVB 2Z8RA 1J5IA 1FL3A 4PS3A 5A3IC 1CDBA 1KF9B 5IY5B 3ARSA 3S34H 4FQXC 1OSEA 5AEAA 4UT7H 3GWJA 5PAZA 5AG8A 3DVGB 2YA1A 3LN4A 1EEYB 5JYMA 3Q7JA 3WY1A 1DJZA 1P5VB 2P52A 4YSTA 1DVYA 5D2NC 4HPYL 1NCDL 2ZUWA 4PP2B 3O45B 2AK4B 3HW7A 3OKOA 1J1PH 1D7FA 1QP1A 1U8QA 1NCGA 1U93B 3N85H 4DPBX 1VGEL 2NTFB 4BZ1L 5CGYD 1QABA 2VDNL 3MNWB 5I1CH 3K80A 5DQDL 2YRPA 3OB0H 1A3RL 2A99A 2VXSH 1R3LA 3E1F1 2JQAA 5E4OA 3HAEG 3HB3C 3BWAA 3AT0A 1A9EA 3UDWA 3WUWG 3APMA 1VA9A 2IALB 2CO1A 2EH8H 2HKHL 4ZX6A 1L4IA 1L7IH 2WV3A 4EXPX 2OMXB 3UZVB 1TYRA 3FCTB 3KWVA 4GQ9L 3STBA 4FG4A 2N56A 3UTQA 2E47A 5ALCL 3O41B 1XL6A 4NAQA 2ZIDA 3C6SA 4ELME 3VB8A 1CFSB 3B6SA 3UADA 1RK7A 2Y25A 5FKAA 3UACA 1UB5B 5BJTB 4MXVE 5AVTB 4AGMA 2J8UB 2HFGH 2XU9A 4N4YB 3HLKA 2X89D 4OW6A 3PE9A 3NA9H 3UGXA 1YN6A 1B4LA 3QNYA 4LLYA 2YOCA 4NQDE 4AV5A 1TNMA 2JCCA 4ODXA 3VFTB 1CLCA 1NGXB 1WAPA 4FFWC 3BSZL 4RCAA 3QDMD 2C1PB 1V7ML 5CU9A 4AM0A 4JRWA 4ZUUB 5B3NA 1H3XA 2FBJL 2Z65C 4Z7VA 4L8SC 5SV4A 5FUOH 1NEZA 2BIMA 1RIUH 2OJEA 5GJSH 3RVVC 4YVNA 2BXZA 2C9QA 1JGLL 4ZNCD 5IW1B 2IDTA 1J8HB 2IOOA 2UWEF 1C5BL 3ABMB 1QZNA 5FO9A 1QRKA 4C4UA 2J25A 4G5ZH 5HJGA 4H8VA 4LEXL 3OKDA 3WEAA 2ZNXA 3C5JA 3K4DA 3L4CA 4NQEE 4BZ2H 1IKNA 5BUGA 2OSXA 3HI6L 3ZE0B 4PGEA 5E95B 2NXYC 4U1LA 5CILH 2NZIA 1UACL 1XF5B 3VCLB 2IANE 2BNRB 1H6FA 2IGFH 5CIPA 1Z5LB 5TQ2H 2R23A 3SB3A 2E7BA 4HOZA 3D7PA 4TVUA 3CLFH 2AQQA 1VEMA 2GVYA 2WZAA 1KGWA 2JB6B 5LG6A 4OV5A 3OHXC 4LNRA 2XOTA 4P5MA 5CJXC 3IXTA 4FQXD 5HBBA 5CLTA 2NYKA 3T09A 4G9FE 4BWTA 1DJWA 2Y07H 1O6SA 1MIML 3L2MA 4IGBD 5I6KA 3BDBA 1UWGL 1LMKA 3RA7H 4CBPA 4JHWH 4BK4A 4F7EA 1P9MA 5I8EA 4ZRGA 3MI6A 3TO4D 1KFAH 4ZTOH 1T80A 5D6DA 4WHCA 1ZVSB 1TJIH 2CWRA 2BJML 1NL0H 4P49A 3RIKA 4CRPA 9CGTA 1X3DA 4UT9A 1AGFA 4JFFA 1AGBB 3TJHD 3FB7A 3BT0A 5KVGL 4Y19D 4JDTH 2IGTA 4HK0A 4XN1A 5I15H 2OTWB 1P84J 2NY4C 3CXDL 1GPOH 4Y16D 5CLWA 4OLWL 3CSYA 2ICEB 3QCTL 3TWYA 1DL7L 3VFVA 4E36A 5TE7H 3ULUL 2AJVH 3LEYH 5E9DE 4OFPA 4XT1C 4NC1C 4XN5A 1G0YR 3LXCA 4U33A 2WAQA 5DD5L 4AW7A 1IVTA 1OALA 2WBKA 1EZUA 4HLZH 1CFSA 2BM3A 4IOIA 4M3HA 3RDTA 5DMIL 3UTSB 2IXQA 2VQUA 5FWQA 4NI3A 5JIPA 3OMNB 2XWBB 4P5KA 5BZWB 5EDXA 4LCWE 4JM2A 4IRJA 3V5KA 1QHOA 3MNVB 4CVUA 5DJDA 2VKXA 2WHVA 2YGPA 2JJSA 3MJ7B 5E5RB 2WTPA 1G7LB 5INCA 5JO5B 1NFIB 3EGXA 5KSAB 1IBBA 1SYSB 5EU4A 4S1SL 2W91A 1JWUA 4OZIB 4NP4L 2W65B 3PNRB 3T71A 4JMNA 4U6HA 3FUEA 2DYRB 1W0VB 2EXYC 1DVQA 4RRPM 1HH9B 4R3SB 3U2SA 4HUUB 3IT8D 2H5UA 4G71B 5CJOL 5IFJA 2O5ZH 2WBJD 4PJFF 3QJXA 5HI4C 3LRSA 2Z4TA 2WC7A 2Y3NA 3MC0A 1Q38A 4HW6A 3G7TA 4YC2B 3HMWH 1LK3L 2E6QA 4KQ4L 1DJYA 4XC3L 1FPTL 2ID5A 1U8KB 4QIRA 5DJCA 3WKMH 1EJFA 2XN9B 1KB3A 1DANU 1PY4A 4Y19B 4HS6B 3NOIA 2HJLA 3EJCA 5GGTH 5DEGA 3PQYB 5DMKB 4PLKD 4BQ6A 4TUJB 3AJ7A 1INEL 3Q8FA 5DD1H 5F3BA 4PJ5E 3LKNB 1NCOA 1B4JH 2P5PA 5GZND 5JZ7C 2LFGA 4FJZA 2Z8VC 2NY0D 3UX9B 5I1DB 4CMMB 5FF6A 3RGVC 5F7HA 4HHWA 3QZWG 4MAYC 4EN2A 3VFWB 4TQIA 2EDMA 2Z92A 4M8UA 4B3EA 1ZPLA 3HUJF 2JKWA 3F7VB 3WN6A 4P2QE 4DHLA 4MRCA 2NTSP 4NO5A 5C08E 2QR0B 3O2DH 1ORSA 4HIEA 4XH2A 3FMGL 3CFKA 5CUSL 3QUYC 3BAYA 3UG5A 4OCLC 1TLKA 4E9WA 3ZSTA 4FX5A 3F04A 3L1OH 4GUQA 2YARA 4U0QB 1AQMA 1WIPA 1Z2KA 3GPSA 2MKLC 3KLSA 3V8CA 4G9DA 1JF6A 4NZFA 5F0JB 3RWCB 4EZJA 4YSSA 2YUXA 5CR8A 2LLLA 3KYKH 3LEVL 5FFOA 5KAQF 4YVUA 3DYPA 4A1RA 2XV0A 2YLHA 3QUMB 3QZBA 2O61A 3B7TA 3BPNB 1TVDA 1RZGB 3G5YB 3H2QA 3GSQB 1IC5L 1TQSA 4JFSA 3MRRB 1AQDA 2ZONA 3MA9L 3K6IA 1QR1A 4P4RB 3ULUD 2O5XL 4GRWB 4R7NA 2VR9A 5JMOC 5E1GA 2HFTA 5AVVB 3LZQA 4AUJA 4PS4L 1MFVA 5CCKL 2ESVB 4QRAA 5BRZA 3QH3B 1AR2A 3DV4B 3ALXA 3K8LA 4DVBA 4Q2ZA 2F53E 3A21A 3SSGA 4EUPG 4EIGB 3V4PA 1FFNA 2C9UA 4WO4D 1LP9A 5JW3L 2NUPA 2VO8A 1HJBC 4N6RA 3TBVA 5GGVL 1HEZB 3CVHB 2DMCA 4KROC 2R0ZH 2PXYB 5EPMA 3CWGA 1YC7A 2BOBA 4NZRL 2X2JA 2ICES 2YUWA 3Q01A 4UQDA 3Q05A 3ULVH 1X9UA 4LMQI 1PF3A 2E56A 4WUUB 3DC0A 4G5AA 1D5BA 1SM3H 3PJSB 4O9HL 4ZD3H 4JLRA 3ABLB 2R2BA 4FE9A 3VXUD 4AZ8A 4GP5B 3OLEA 3BGFC 3TJEL 1A4JB 5I6LA 1RUKL 4PRHB 3LNEA 5J6HA 1RZIA 3BXNB 3QDGE 1E4WL 1S7SA 1F0LA 1QSFA 3K0WA 3LV3B 2FJHB 1IZJA 3D39A 4ICXA 3ARQA 2CSPA 3QAZC 5INDA 5FECB 3O3BB 5JPNC 3C8DA 3LEXA 2ZAHA 4NCC1 4J4PD 1S3RA 3EOAA 5C0BA 3SO3B 4OJEH 3KPQB 4J12A 2OTWA 2F5AL 4KKLC 1ESOA 4BKLA 1IGMH 3AADB 4LCIH 3K71B 3T1FA 1MHCA 4JN1H 3CGTA 1WUNT 5IUCA 4QXGH 5CCGE 3N1FC 2A9NL 5BCAA 2B2XH 1SZNA 1GOHA 4OM1H 1M6OA 5KYYA 1A9BA 2H6PA 2CK0H 3QUZC 1UD6A 2X1WL 3MRMA 3V7AE 4HSCX 1F6AA 3JWDH 4R7NB 1MCCA 2YD1A 3GBNH 4MAYB 1EFQA 3EJZD 1R3KB 3PNWB 3MLRL 2VMJA 4ZSOE 3B2PA 4M1DL 2IQAB 4IBVA 5I73C 2NT1A 4PG2A 1FE8L 2Y6SC 2DWYA 5C9KA 3AG3B 1TU2B 3WDJA 1E28A 3WIHH 1S7RB 4IDJL 3JWOL 3QXTA 5ANHA 2HVBA 4K94C 4XGZB 3VXPB 1RPKA 3V4PH 4P57A 1NLDH 1ZXKA 2R8SL 5I8CB 4D8PB 1I8IA 1I1FB 1C5CH 2B4CH 4XPTL 2I60H 3ZMNA 3BPOB 3KGUA 2PXYA 2R0LL 3BEWB 2E9BA 3A0OA 5I16B 4PP1D 3D2UA 1IC7L 1U21A 3CFUA 3W39B 3WXVL 2BSTB 3V4LA 3WBDA 4G8FB 5IIEA 2EDWA 3BN9C 3I3BA 1I9RL 4FG0A 3D12B 5FYKL 3CAFA 4M93B 1SYVB 3N44F 4J3WA 2NXYD 4TF4A 1MCQA 1HNGA 2CBMA 5JHLL 2MQ3A 3SDDC 3VW3H 3MLYH 3A6CL 4HS6A 1K5NB 1ORQB 1I1YB 4S10A 1ZMYA 2LW3A 3ZDYB 1AO7D 2E7LC 3WTSA 1HYSC 4KMTH 3X11A 4WNQA 5HJ3B 1BQHG 2XA3A 3N40F 4CA4A 1H9DA 2OI9B 1NGYB 3SY0B 4AEHH 3MRBB 4F7MB 4JR9L 2EVJA 2GK0B 2PCXA 1Z9OA 2BFVH 3J27A 1E5BA 2HRGA 4RDQF 3LNGA 5LNDA 3IDXL 1ZDSA 1DJSA 2YSSA 2HT4C 2W0KA 2H6OA 5I26A 3O6FD 4XMKL 1OKEA 4L3CA 3DO7B 2LGNA 2V0AA 2VABB 4ZMZA 1VLXA 1KN4H 2DQGH 4EDXB 3CZFA 1UD8A 4PREA 5E5MA 4OCMC 3LMJH 2EAEA 2GSGB 2EIZB 4LPUA 4LSQL 2G75A 3GSOB 4TNFA 4XMVA 5CEYB 4B9YA 2WNKA 3MFFB 3UTSD 2EIBA 3TZVB 5F7MC 5LJYH 4EQ2A 1RIVL 1SDYA 1MFDH 4G1EB 5F6IB 1L7TL 1HL8A 1NMBH 3ECUA 2OMTB 5C09E 2HLAA 1VFMA 4WSJA 3QWQB 2ZSWB 2VJ8A 3BESR 4DQOL 1TZIA 2VIRB 3L13A 4YIQA 4DZ8A 5IOPB 1B0RA 1AG0A 4GG8A 1TVBB 3V0DA 4ENEC 3BI9X 5FXCH 2XI9A 4PCKA 5FF6B 1SLWA 4JO2L 4PGCB 1FYTE 3QQDB 1AH1A 3S36H 3EBGA 2EYTB 4I48A 3V0HA 5DJ0A 4DP1X 3H9SE 2HKFL 4KQ3L 1A2YA 3IGLA 2CLZA 3DBXA 2HFEB 3TYGL 4HVBA 2WLHA 3ENEA 4L9DA 3CLEL 5EIIG 3I75A 2OSYA 5B38B 3EYQD 2LFEA 1VHPA 3CDGA 4X9HA 1XGPA 2QJDA 5BRZE 1QPPA 1KTJA 4QHKJ 2B20A 5HHXL 5TF1H 3MLPA 4PJHB 3D69B 5BO1L 1LLAA 3MYJA 5DK3A 2CHWA 3B37A 2X6MA 1A14H 5MENE 2W1NA 1G9MH 4OJDH 2Q76B 5AW5B 4GRLC 5KJ7E 3Q5YA 1SOSA 1AGBA 1MRFL 5IJBC 1KB5A 3D2TA 5D71L 4N5ED 4PJ7A 3NFSH 43CAB 2VWEC 3DHPA 1M3JA 3OAYK 3UG3A 5IB2B 3MXWL 1FVCB 1EGJH 3C2AL 3Q3GB 4FD0A 4TSCH 4D2NA 4OCWH 1KNOA 3NJJA 4X8JB 2QQNL 5IZ7A 4B60A 5L4JA 2XTLA 1ADQA 3PXHA 4JM2D 3I85A 4XVTL 2JI3A 3ROOA 4F5CA 1KYDA 2WNGA 3IE4A 3VG9C 3EFDH 1ITBB 2ZWYA 3VXRB 1OW0A 2XN9E 3F6JA 2F18A 3TPUA 3LKOB 2XWBA 3OAWA 4PJDB 2GFBA 1QKZH 2YD4A 3JBG7 2AGJL 5IK3B 3S5ZA 4NZUH 2CXGA 4RMBA 3VGHA 1JSYA 3ZZSA 3ZUCA 1MCIA 2X4NB 3WIIL 2WN2A 5D1QE 1B2WH 2MHAB 3GMPA 3HG4A 1X5LA 3ME0A 3MDJA 5EO9A 1W6WA 2P26A 1XFPA 4FA6A 1ZV2A 4U1LB 2E27H 4LQ1A 1WBXA 1BQLL 3H9HA 3UMTA 3CSPA 1B4TA 1U8QB 4YLQT 3FRPB 4P2QB 4PJ8B 3CPUA 4DESA 3B7RL 1BREA 3S5YA 1T0NB 1EANA 4X6DF 4UQEA 5B39B 3QR2A 4FNUA 5TH2B 5AZEH 5K9KA 2PR9A 3CH8A 3W9EB 1K4DB 2FWOB 1LO2H 2VSMB 2NW3B 4X7CC 4F58L 4OQTA 1KB5L 2DDQH 4JPVL 1DTUA 1I53A 4ANWA 4XP6H 2AKRB 3ZDXB 2WLIA 1LO5A 2Q7YB 1WYJA 3RIAK 4L8BB 4OIIH 3WYRA 4AYSA 5F96H 5I6XC 4LF3B 5JMRA 3GMOA 3S48A 4FQ2L 2P8LA 1P69B 3DXAE 3KPRA 4HUXA 2P1YA 3T0VA 1HJCA 2MCG1 2L4OA 4M5ZL 2KUTA 2G9HA 2WOBA 1AZRA 1VPOH 2YD0A 1AQKH 4V11A 2ZAIA 4P3WA 4PJGB 4JW3A 2QLYA 1P5UA 5ANMA 2MOVA 1CXHA 3L3DA 4G80B 3V5DA 3K6SB 4NP9A 3EBHA 3V6OE 1GGCL 4UUJB 5SWSB 2YD8A 3U6RB 3DRTA 1BEYH 1UZ6F 1U95A 1T2JA 2PXYD 4M6OH 1QEWA 1I3GL 2RACA 3V0WL 1OD9A 2ODHA 3TL5A 4QHPA 4UV4H 3IU4L 3OJVC 4BFIA 3IXAA 2V8LA 4P4KC 3CZGA 1DZ0A 2DM4A 2ZYHA 3E6HA 3Q43A 4PJFA 1MCWM 4MMXB 2A77L 1TVHA 4RAVB 3TYFA 2UXGA 1KIQB 4WHDA 3C8HA 2E4TA 2OMYB 2Y9RT 2X6AA 3NG5A 5ICYB 1E8YA 2D7TH 4N0UB 1UOLA 3ARRA 2H2PC 5BVJA 5CBAA 2X6CA 3ZKSD 3QG6A 1DYZA 5IREA 3HCVB 3K81A 4F8LA 1XBRA 4H0LC 3IF1B 4O02B 4B6ZA 4C47A 3MXVL 5I1HH 2KL6A 1SXZA 4HCIA 4M61B 5BNXD 2OP4H 1ED3A 1SVZA 4PJIA 5GJTL 4EPSA 4G6MH 1UB6A 4XO4A 1BFVL 3ZDZF 4ZMXA 4XOCA 4X4YA 4BFKA 5JHDD 1N8ZB 3T3PB 4W9IC 3B83A 2XWXA 4FXTA 2FD6H 2VDQL 3G5XA 5DURD 3AS1A 4OF7A 1GXEA 1N5AA 4F91B 5JNYB 4ELKA 2JKNA 5D1QA 5CP3H 4J3OC 3PWPB 4GQQA 3THML 4C54A 2OR7A 1WF5A 4IHBA 4EXKA 1KEGL 1MQKL 1PQZA 2NSXA 1NKRA 3QUXC 4G1MB 5EF1A 2Q8AL 1XH0A 1KENH 4MMYA 1R3LB 4UU9B 1OTUC 2Y6TE 2Q8BL 3ZRCC 2G0KA 25C8H 3MJGX 1IAOB 4ONGH 4R90L 3WHE1 3K2KA 1O5DT 3QXDA 3HS0B 2DYPD 4U1IA 3FCTA 5KYXB 1GSMA 2IWEA 1JI1A 2NMSA 1K5WA 3DIFB 4DNLA 5FGRA 1F13A 4PB0H 3HEIB 3FTGA 1ACXA 3MV9E 1I8UA 4WHYG 4OD2B 2N59A 3GXPA 5CSZA 5CZRA 3G04A 5FYKD 4DOHE 4I1PA 2IAAC 1TCRA 1UT1A 2G2RB 2DWXA 4HG4K 4PMEA 4M7KH 1VFAA 3EYUH 5DHYB 4QRTB 2J5LB 1A1OB 3NIDB 1OHQA 4WTZG 2R9HC 1MRCH 3JWDC 3O81A 2OTUB 5KEZA 3L3HB 1QACA 4Z8FL 4PJAA 1KXTB 4Y19E 1O6TA 5IW3A 2UXTA 1QYGH 5KAQG 5D4QA 3L2NA 3MRQB 3CFIC 1IBFA 1S7UB 2ZX6A 3P4OB 4KMLB 1PZ5A 4QTHB 3WJJA 1U8JA 1JHKL 2HFEA 1R34A 4LU5L 2NW2B 5LBSA 3BSHA 2V9RA 5EEVA 2PCFA 3CBRA 5ESVA 3BGFB 3O41A 4ADJA 1U8CB 2Q6WB 3M8OH 3VX0A 3HCVA 3HI5L 6TAAA 1F1DA 1K6QH 2F9BT 1H3GA 3RKDD 1HSAA 2BHUA 1IL1A 3G6JA 4ENED 4L8DA 3QEQD 1DE4A 4KVNL 3WS3B 3VSUA 3O3EA 4Q58C 3EYOB 4GQPH 4KDTC 4ZUSB 5BS0D 1OSPL 2KQMA 1UASA 2IEPA 3C5SB 3NJFA 4AENA 5B8CA 3OPUA 1IM3A 1M3IA 2EXSA 2IOMA 3C08H 4WK4B 3LOWA 1X5IA 1A6VH 1T66D 2KH2B 2PWGA 2DEYX 2AQ2A 3GMMA 5FHBH 3RYMA 3X12B 4XX1E 2X12A 3D6GA 3QIBD 1CDUA 5C3LD 1SHXA 2Y1YA 3AG1B 3CHOA 1CU4L 3EJUA 1T2QH 2DQUL 2WWKT 4Y1SA 3BP6A 4FXGC 4A6YA 2GSGA 4HJTA 3WHE0 1DQLL 3AUWB 5JLZB 1VRSA 2MPAL 5FW7A 1R3IL 2ARJQ 3J8F7 2X0UA 2BNQA 1V3MA 2CIKB 5AD0B 2FUQA 1JK9B 3G5VB 3QC5X 5SX4H 1LDPL 1DVXA 4WWKC 7PAZA 1O7VA 2WBJA 4MASA 5G4NA 4ETQA 1TLMA 4FZEH 4PHZA 3KPTA 2EDNA 3HI5H 3Q1SL 4FQQB 4OKVA 1AGEA 4ODWA 4LCWA 1CTNA 1BA9A 1U3ZA 4RGOH 5D7LD 4LIQH 1DR9A 1F4HA 2YAOA 5AAMC 3MR9B 5EU7C 4UM9B 1KBPA 4HLJA 1A2YB 3BZFA 3OZ9H 1KACB 2BP8A 4W4OA 5GRZA 3UC0L 3UZVA 5DWPA 3H0TA 4NKMA 3BIKB 3MRPA 3SDAD 1S7VB 2VDOL 3BZEB 3MLSL 3NCXA 2LQRA 3GTNA 1KCVL 3U4EB 1N7MH 5FKPB 3Q48A 2D4DA 3U4EA 2DMHA 5DUMH 4KTYA 2OZ4A 2DQJH 4PJ9D 2JLPA 1MJJB 1OAZL 1GZPB 2PO6D 2V3FA 3D4GA 3MYZA 2OX5B 2IPTH 3CVHA 1C08B 1R3JB 1FORL 1XWVA 5AQ0A 1EHLH 3WKPA 1R3JA 4D9LL 1N6QH 3O3EB 2NY7L 1KXQE 2PYEE 1MCOH 4TSBL 3ZU8A 1ZSDA 8FABA 2EKSA 4C56D 4XBEL 3DPDA 2IBZX 5EDSA 3ULUE 1N5YL 3AWGA 3GIZH 2E76C 3TFKD 3IJYB 5F97E 5F7DB 2HN7A 2HB0A 3T65B 2I27N 1F02I 3T3PF 3ZE1E 4JUSA 4Z0XB 4K5PA 3VD7A 3LZNA 5DMJB 4UAHA 4Q9CA 5MERB 2R69L 4A7SA 1ZDQA 3SGJA 4JFXA 3I02A 3UTTD 3IFNL 1D5RA 4P2OB 4L5FH 1XF2A 3MGOB 1WEJH 3MJ8A 3BP6B 3NCMA 2QHRH 1CZ8H 1OK8A 1HL5A 5D7LB 5EIIA 1SOQA 2WINA 1QA9B 1MPAH 4JKMA 5DYFA 2ORBH 4QLWA 2UVEA 4RFNC 2J72A 3ILPB 4ZO9A 1NMCC 2QSCL 4A2EA 1YUHB 5TTRA 1PYWA 1SJHB 3GMMB 3B9KD 3RY6C 1UB6B 2CPCA 1F56A 2D0FA 3UXFA 4BK5A 1NFDF 4DVRL 1V7NL 3QXUA 5DEFA 5SWSD 5E4AA 3BEVB 4G43A 2AJXL 2OPCA 3W5MA 5C2UB 3KYMB 1ASPA 1PMYA 4U7SA 2XWZA 1Z5HA 1E4KA 3VWKD 2VC2L 4WUKL 12E8L 2KYIA 3L5WA 5TQ0H 4ZFOL 1IBHA 5IF0A 1QRNA 3GS4A 4JFPA 4EZMA 4UTAL 2RR3A 3JV6A 4R5VA 4F33A 3VQLA 2RBLA 2ZP0T 3QULA 4OZGF 5AOKA 5IQ9A 1QBBA 4M5SA 3HRZB 5E8NB 5DS2A 4C55A 5BOPA 5IWLA 3FQUA 2G5RA 4HXBH 3FHEA 4MD4A 3O4LD 3MOAH 3ZO0A 1JF5A 5KVDH 1FAIL 1E5UI 3KBPA 5ICXB 1IVLA 1TMQA 5SX5K 3HS8A 5E8PA 1OF2A 5BMFH 3EFOA 1HXMA 5AB2A 1SFDA 4GAGH 1XF3B 1UWXH 2JH2A 2ENQA 3MRCA 2PTUA 3VSTA 1PZ5B 3IMUA 3GD1C 3CVHH 1ZS8B 3B3BA 1VJSA 4L0YA 1OT1A 3LZLA 5D7KE 3RVWD 3TP4A 1FYTD 3H9YA 3MJ9H 3MRPB 1K4CA 3ZW3A 1C8PA 3NCJH 2B1AH 4WWPA 4A2HA 2Z4QB 2DI7A 4KDVA 4M3KB 2CUMA 3F6IA 4CW1A 1QSEE 3D34A 3VFOA 1J11A 4YHIB 1UEMA 2EICA 2NNAB 2VUKA 3S9DB 4L4VA 2B1HH 4ZAKA 4KJYB 4WKZB 3R8QA 2P8MA 3N42B 3PXLA 3W1ZA 4QRTA 5EZIH 3HPJA 2VXTH 2FQEA 1AJ7L 5JPNB 3PWVB 2WLKA 4N0YL 4JRYA 3WNOA 5B3SB 1A5FL 3SKNA 3TN0D 3QAZB 1RUML 3SDDD 4BSVB 4PSPA 4JHZA 3QIBC 4U6XA 1Z6JT 4FQ2H 4LVNC 4M62H 2X53A 2B5IC 1OSYA 1QFWH 1TQCC 3OLDA 4M61A 4YBQD 2ICWJ 2NDGA 1BJ1J 1Q72H 4Y5YC 4TQPA 4C56A 4U05A 1TZAA 1ILUA 2CQVA 4YMPA 4Y4KA 4FLSA 4LPCA 3WJMB 4AL8C 2AV1A 2WZ6A 3W56A 3S6CA 5EB9A 5CINH 2DRUA 2YC1A 3OKMA 3F12A 2OXHA 1OARH 3ARBA 3L7EB 3L5WB 3LIZA 3U4BL 3CDYA 4O02L 2X4NA 4WEUD 3HAEA 3WNLA 4J6IA 4QHKI 4IBQA 3STZB 3EFFB 3TBWA 1QLFB 2BS8A 1ZJBA 2AK4A 4MJ6A 1KCSH 1YDPB 4ZFGH 4PRBB 1XVSA 1WBZB 1S8DA 4AIXA 2E27L 2YFOA 3S4SB 4L8DB 2HP4A 4O4YL 1F4AA 3BUQA 1UWEL 3RU8L 3TCLA 5DMGC 3QDAA 2ZWLT 3FNKA 2VLLB 1F8TL 2XXGA 4URKA 3VFWA 1AIFB 1ZT1A 4WI3A 4DN4L 4JHBA 1INDH 5HYIA 2BIQA 1IEBA 3MROA 4S0TD 3HR5B 1FV1A 3U30C 5K9OA 2AGJH 3VACA 4ONFH 3FO9B 3D5OF 1NDTA 4G8AC 2H32H 3GT6A 1T2XA 3IKKA 3K4ZA 4XI5D 3MLTB 4RWYH 2F54B 3HG1B 4K3HA 2C4FU 3UP1A 4CAGA 4F7CB 2B39A 1AR1C 2OYPA 4G42B 4G9FA 4LHUA 4XVTH 3GUFA 3OQRA 4UDTB 2QQNH 3NCFB 5LAXA 5AENA 3SGDH 5I8OL 4G72B 1TCRB 2G2RA 2NNAA 5I8EB 5L4FA 3C2AH 5KN5B 3GRWA 1KXVA 4ONHB 2O93L 4NUPA 2DLFH 4ZQKA 1BSIA 2JIXA 2Y7NA 3WNMA 2EC8A 5L8LB 1P1VA 3S4SG 1W0YT 4PJBF 3UBXA 1ZS8A 4F5CE 5AAWA 1EA9C 1LO4H 4JFHD 3KGRA 1UM6H 3HE7D 4YHYC 2H2PD 3HIZA 3IXAB 4K3JL 1M53A 1VACB 3GBDA 1HZLA 1NBYB 3HE6C 3QUKB 4Y1TA 2H8PB 2KZBA 2F74B 5BQ7A 4S2SA 4AMKH 5I1JL 2A6JB 1XGUA 1RZKH 4PB9H 2XYCA 4RMQA 4S2SB 3CLEH 2CDGB 2NT0A 5J6SA 3V7MA 1YPZA 2BP0A 1VZGA 4QOKA 5IK3A 4NJ9L 4QI3A 3ZLQC 2F53B 1MVYA 3TWCL 1RK0A 2ADIA 2BVYA 2EYSA 3C6LB 3ULAB 4YR6A 4ERSH 4CMHB 3N9GH 1UA3A 3OGOE 2RQEA 4DGWC 4TOYL 1NOFA 4ZG1A 1A6ZB 4YAQB 5MP6H 4PRNB 4NAJA 4W93A 1F5WA 3SPVB 4OD1H 2FYYA 1NCUA 1UG9A 1NMBL 3E2HB 1GZHC 2JJTA 3MRQA 5IJKC 1NEZB 3PV6A 1JV2A 2VSCA 2ZUXA 4JM4L 2ADFL 4LBEB 3RWGB 4E68A 1OWRM 3IM1A 3O3DB 4M43L 2WXHA 2XTJE 4AIZA 4DJMA 1OAKL 4GG6F 4X83A 5I0XA 1TENA 3CFQA 3ETSA 4QRPB 2YHGA 2YJQA 4XMKH 4N8UA 5EZJA 5EZLB 4AVJA 2RALA 1YEGL 4MVBD 3HG1A 1YJDH 3S37X 2OSLA 1NBZA 3M17A 5MERA 3WELA 1W6LA 4Z7NF 2C4FT 1ZLUK 5IHUL 3PWLB 1A4BA 5FO8A 4L0ZA 5FPIA 1T4KB 1QASA 2IQ9H 1OQXA 3PU7A 1U8OA 3U7YL 2FB4L 3QRGL 5HGAB 2ESVE 2QPDB 2XA8L 4KK8D 3WI9A 2R2EB 1UGKA 2CLRA 1MW1A 3V5HB 2E9WA 2V3EA 3SN6N 2YR3A 3C60C 3KLKA 3OMIB 2COVD 3PS6A 3QIWA 3S36X 1MFUA 4MB5A 4HIEB 4XH2B 2F5BL 3DIDA 1R24B 4HPHA 4E9QA 3MLYL 2F15A 1IEAB 3L9RB 1R24A 4HQQH 2D7NA 3PLYA 1X5ZA 1ZE3C 4J27A 4HGMA 1D6EB 3ARBC 3BD4A 2NY6D 1EQWA 1HH6B 1JJUA 2K8MA 3MX0A 5FYKH 3PHOB 5FGCE 3KW8A 2J43A 3RGBA 3WD5L 3PUCA 3ZL4H 1JN6A 2DQ6A 4MBRA 4Z95H 3V0VB 1RZ7L 2LVEA 1D9KD 1CL7I 3FHQA 3RVXD 2R27A 5DJAB 3F7LA 1CLVA 1T0MB 2O6EA 3D85B 2ED8A 4OJFL 5IB4B 3GJEB 3MHZA 5CP3A 1DDTA 1NPUA 4GBXB 4WF7A 4FEMA 4AOFA 3T0EB 3CJJA 4UB0L 5DHDA 32C2B 4ZSOB 4EOWH 4N0FB 4JDZA 4XVJH 1LM8V 3GDCA 2V5RA 3FQNB 4R26H 3F7YB 1ICTA 1S78C 4N2OA 4JDZB 4NZ8A 4HYTB 2B9AA 3FQ4A 4Z7NE 1Q8MA 3NFPA 2MPVA 2X2YA 1MXDA 4NO0A 5TE4L 4EI6B 4I3SH 3FT4A 5E5LA 2BP3A 3BKYL 4PLOB 4C57C 1RUPH 1IILE 3H42H 4GB9A 2VR3A 4DK3A 2K45A 2EH7L 2VLRA 2BIIA 4KJWD 2YFNA 4D3CL 5GXBB 5HVHC 2W9EL 1X5HA 4RVBA 2VN3A 3ARFA 3FYEB 3OR6B 4DQAA 2CBOA 4XWGL 2A9NH 1P53A 1WBYB 3BQUA 4JN1L 2AW2A 2FR4A 1WBZA 3NESA 3BIBX 5EF0A 3VH8A 3SDYH 3G6DH 3LKPA 2ZX7A 5LDSA 3LVEA 1TG8A 1ZE3H 4PJXB 3ZR6A 3VH8B 2GJZB 1KEMH 3HC0B 4HMEA 4F20A 2B7DT 5I18L 2LU7A 5AW7B 1IC1A 4J3OD 4ODSH 5B8CB 1BZQK 4KY1H 3AU1B 2HT3D 4ODUA 3U2JA 1A8ZA 3VVVA 3Q13A 5F71A 5JIQA 1J1XH 3FQWA 1YEEH 4MCMA 4FFVC 2VJ0A 4EN3B 4EBQH 2DQDL 3GUTB 4NN6B 2CRIA 2MNUA 4GRWF 4ZTEA 4WTZA 3SDXB 2YGOA 1UKQA 1BWWA 2XG5A 3P0VH 4PRPD 5TDPA 4N2KA 3KPRB 4HUXB 5G5DA 1ZLEA 4QEGA 1FNLA 2J88H 4L4JA 2H0PA 3BP7B 3MLXL 1MVUB 4XVUD 4CMMA 4ZPTA 1ZHKA 3MRDA 3PWJA 4HGKC 5CF3A 4NZRH 1RQ5A 3L45A 5KJRL 7FABL 1HHGA 4LCCC 5IVXA 1ZA3B 2EDFA 4BFBD 1OAYL 1Q0XL 4IGBC 5GGVH 5C2BL 4JPKH 4RAUB 4PM1A 3L4TA 2X40A 3K71A 2XBTA 1BW8A 2ZWNA 3KD4A 4POUB 3WMSA 3DGDA 4FQIL 1JRHL 3PABB 1J8HE 2NY6C 1YA5A 5T1JA 4IU3A 2MFNA 4LOEA 3WV0A 2Y1ZA 1X9RA 4MXVF 1KYUA 2DLTA 2OMTA 2FWUA 2A6DB 2PXYC 5FYKE 4Y0GA 2G9KA 2F7QA 4PYHA 3FB8A 3LH2H 2ZCKL 5KS9E 1N8OE 5E8DL 2BSCA 5L4IA 5F9OH 4PJXF 1MJJA 1E6OH 3FU9A 2KPWA 3BVWA 1U8HB 4DGYH 3NJLA 2FEEI 3MNZA 5AYUL 2WXOA 2HMIC 5I0WA 1CFNA 4AI7A 1UWFA 3NPSC 3POCA 1G9MC 1TZGL 1AS7A 4H26A 4U2YA 4UV7L 5DRNA 4DGYL 2CDFB 3PXJA 2ODIA 1AHWB 4UQIM 3VO0A 1E6OL 1EV2E 5AL0A 3SE6A 1OCWL 4FMKA 3L1OL 3W0WA 2A9ML 1JYVA 2QQKL 4P9HH 4AYEC 1ND0A 2PYED 3IMVA 4YHIA 1G43A 2WYHA 1LP9B 3LD8B 5C07E 5D7IF 5EU6D 2DIEA 1CVSC 3O2DL 1ACYL 3BAIA 1WZ1L 5DVNA 4A67A 3FSWA 2Y36H 4Z76A 1BYPA 1XTLA 3RE0A 4NPYA 1EAPB 3E80A 3ZKXB 3PWPD 1ECYA 3OF6D 4OTXH 1D5XB 4CN6A 4Z9KB 5INDB 2RAMA 1BZDA 4W6YB 3DUSA 4GMSL 1FSKC 4JVWA 4HISA 5JORA 2GK0A 4Z3HA 1LEIB 4KKLD 4M6NL 4UTCA 2BNQB 1JK8B 4OTXL 1NGYA 4Y2DC 2ZUQC 1S9XB 3QEQE 4YHKH 3RWFB 2VZSA 4BQBA 1YDPA 1DBAL 5DJZB 3SGJC 1KTRL 2G2NA 4BE5A 1NWOA 4P2QA 4Z77A 1A4JA 4KZEH 3HE6D 1Q0XH 1NLBL 1R5IA 4CC0A 4ZW3A 5E2VH 3SO5A 3WEXA 7FABH 3K2MC 4W9KC 4E9TA 4GKNB 4XMZA 3TA3D 3KPNB 4JFDE 4KUCF 5KSVB 1LK3H 2GCYA 3F12B 1KELH 3U36A 2JE8A 3IN0A 3CZNA 4HDIA 3FTWA 1BFOB 1OXYA 1IT9L 1Y7VA 3WHXB 1GC1C 3DUUB 2CHZA 2C34A 1CGSL 3SBWA 4OLZH 4U1JB 5CSBA 2IV9A 4JFYA 3HE7C 2F8OA 4XNMB 2WKLA 3ZRSA 4EJ1C 5IGXH 4PV1C 4AC4A 3KHQA 1F4YH 4NUGH 2DPKA 4IRJC 5JQ6L 2WLNA 4XPGL 1IV8A 3X3GH 2QV2A 4ZW5A 2HJFB 3HHSB 1FIGH 4UF7C 1ZTXE 4YDVB 2XRAH 3FZUD 3AGWA 1QSVA 3S3CB 3V6FA 1AGEB 2VERN 3EJZC 3CFMA 3LH2L 3MRFA 5AFAA 4WK2B 5I18H 1F1GA 2XKSA 1KY7A 5EC2A 4DP2X 4I0PB 4HH8A 4TRPH 3CSYB 3NP3A 4IIQA 2EP6A 3ILQC 3I6GB 3DRTB 2YD2A 5JHMA 2PTVA 3DVNB 2GEQA 2NW2A 5D7LE 2PW2B 3JQOB 3KJ4B 3C2SA 1AO7B 2ZKWA 5DMIH 2YD7A 1G5AA 3VFOB 4TYUA 4IU2A 2XZCH 3DJTA 1E2WA 4UNIA 4BWUA 2NY1B 2FHBA 5F7DA 2TSBA 4N0CC 1CUOA 3C09C 4P2YA 1N59A 4F24A 5LGJA 3ARXA 3QORB 4PY7A 3ULUH 3UJIL 3MLVH 2A74A 1A1MA 1XIWC 3ZGIA 2ZCHL 4PJ5B 2CA3A 1YZZA 4IEFA 4Z76B 4GT0A 5K59E 2ZOKB 1NL0L 1XT5A 4NNYB 5IB1A 1OTSD 1RURH 4OUUA 2O1AA 4MHHG 2NX5E 1QNIA 5EUKB 3EDFA 1MWAB 3VQMA 1AKJD 4PRNA 3CSBA 1MNUL 5DJ2A 4FP8H 1WTLA 1NDGA 1I9JH 5H94A 4LGRB 4Z78A 4UMGA 3ASWA 1TZOA 3UL4A 4ANVA 4TULH 4WI5A 1VGKB 1H0DA 3QIWD 4GY4A 1YEEL 2YQ2A 4FLOA 2FHCA 2FYVA 5I76A 5CFAA 2EDHA 4ODVH 4J1UA 3NN8A 3LQMA 2BVPA 3BFQG 1CGUA 3LKSB 1T3FB 2X28A 3UBXG 1G6RL 3WD5H 3BD5A 4J2QA 1Q9LA 1TQCB 1F11B 4FDWA 6FABH 4GI9A 2GUOA 2LLGA 4NO2A 4XMLH 3BAXA 3NSCA 1JGEA 4NQQA 5KBMA 5DUPL 3ZHKA 1AZCA 2D7MA 3H4HA 3EBIA 3AWEA 3AWFA 4G6FB 2BH0A 3EH5B 3FT9A 4MJIB 4FQXB 3FOMB 1O7DE 5E2WL 1WV7T 3JWNC 5GISH 2FIKA 3ZZ1A 4Y2OB 3MRLB 1M6OB 4H4NA 5ISZE 3QS3A 4DW2H 2XA8H 3SE8H 4HJ1A 2FB4H 5LG1A 4ZNEA 4IOFD 3MR9A 4XN2A 2H3NA 4KK9C 2DQFA 2GC7C 5JNYA 2RCSH 2WYIA 3E9UA 4TLSA 4PJXE 3VFGL 5DTFB 1DO6A 3M45A 1UADC 4PUBL 4JRYE 4YEEA 4HG4J 3D1MC 3BKYH 2VR4A 4GAYA 4K7PX 2B0SH 3LQZA 2GJRA 3LS5L 3RX9A 3FS9A 5CZXC 3ML8A 3G04B 1L0PA 4HWZB 4ZOEA 5EORL 2ITDB 3GEWB 3T0EE 3ZHFA 3VGAB 1DCEA 1KLUB 1NPJA 4KKBD 4FFVD 3R18A 3GSRB 1FGVH 3JTSB 1GKOA 3VGDA 4KTGA 4Z7NB 4YSCA 5FFLA 3RUGB 4WU5B 4AYBA 5J8OA 5I16A 3QXDB 4XR8C 1N70A 1CIUA 5L2KD 2GBAA 3DBXB 1ZTXH 2HWZL 2XIBA 4PJCF 5I1KH 3EHBC 3FUJA 5FA4B 5IROA 2KMWA 4L4TE 3GSNA 1SLVA 4ERSL 2VO5A 4ICWA 4BUGA 4D9RE 3PDOA 1JWSA 5F6IC 1ROWA 2E7MA 4YZFF 4JJ5A 2VLRB 1L7IL 3FYIB 1M57B 4MD5B 4N0UA 4EN3C 2P49B 2AV1B 1R3KA 3KVQA 3BYYA 4HJIA 4GINA 4PJEA 4CJ0A 1JNHB 1UWXK 4QYOA 5C09D 2J6EL 2CJTA 2YAQA 3V4PB 1J5DA 4X0KA 5HYSG 3U7AA 4TVSa 5JORB 1TEFA 1S3KH 3N44B 5J1AA 1VFBB 3F7YA 3ZT5A 5CJQL 4GQRA 2IQ9L 4AW4A 4XVOA 5MEOA 4BQCA 2CLVB 3QHZH 3W3BA 5ECGA 1URIA 1PS3A 4X4YB 3VXMA 4QUOA 1EZVX 1Q9WA 2CBPA 3T0ED 4MQ7B 4DH2A 2WQWA 2WCPA 1F3JA 5GGVY 4YSAA 3VG9B 3LSOA 2J5LC 4JCWA 2X2IA 1UUSA 2YWYA 2GKIA 4OF8A 1OAKH 4ZXBD 1O7DC 1G7IB 3GMRA 3UCQA 4FQ1L 2QSVA 1U8PA 3QUXB 4ES8A 1N6VA 3SCMD 3HN8A 1FQ9C 1JZIA 2C1OA 1K9TA 4WFFE 3DK0A 3QHTC 4N2NA 4JB9H 5BO0D 4KUZL 1E9OB 1DP0A 2WNWA 2FLBT 4TUKH 1N64H 1MHEA 5F3HB 1INDL 2H1LM 2H3KA 1V3KA 2HT2C 4N28A 4OM0H 3FQXB 4PRIE 1NBQA 2NOYA 4HIQA 2DQTL 1AVAA 1M1XA 1YY8B 2AZAA 3GBEA 5EF2A 2GSIB 1UWEH 3PFUA 3TO2A 1J0HA 1UWYA 2CIIA 1M1XB 3C60D 3F7VA 3ZKQD 1AQH