3IBOA

Pseudomonas aeruginosa e2q/h83q/t126h-azurin re(phen)(co)3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relaxation dynamics of Pseudomonas aeruginosa Re(I)(CO)3(alpha-diimine)(HisX)+ (X = 83, 107, 109, 124, 126)Cu(II) azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
molecule keywords Azurin
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3iboA00
4Q8BA 1TU2A 3EH5B 4DPAX 2OV0A 8PAZA 1ZDQA 3EH3B 1SF3A 1SDDB 5B1AB 2PPAA 1GS6X 3UABA 1L9OA 2A3TA 1J9SA 2IWFA 1GYCA 2HXAA 3ZIYA 2IDSA 3C75A 2XXFA 2X88A 3NJKA 2BO0A 4YL4A 3FPXA 4E9SA 1WAEA 1BYPA 3S3BB 5I6OA 4BWTA 1HAWA 2NRDA 4G7SB 3SQRA 2BZCA 2BW5A 2DYSB 3FSVA 4G72B 1SHXA 2JXMA 1AZUA 4YSUA 2GIMA 2I7SA 3FT0A 1PZCA 4UF7C 4GXFA 4KO7A 1W6LA 3OMAB 2XVBA 4A2DA 4PCYA 1CURA 1BXUA 2FQDA 4UAHA 1GY2A 4AKPA 1L9SA 4YSOA 1QLEB 1KDJA 4F2FA 1VLXA 3PAUA 4M3HA 2QPEB 3GXUB 2UX6A 4BXSV 3TBCA 2MRYA 1FA4A 2FQEA 4KNUA 2UX7A 1W8EA 1GW0A 2P80D 2P80A 2YQBA 4BK5C 1AQ8A 2ZWNA 4KOBA 1WA2X 3TU6A 1KV7A 2FJSA 2XYBA 1YLBB 2QT6A 2J56A 4DP7X 1EHKB 3X2QB 3IEAA 2BZ7A 4BXVA 1A65A 1GS8A 2PPCA 5A7EA 1GR7A 2H47C 3ASNB 1W6WA 4A66A 4GYBA 3WNIA 1XB3A 1NPJA 2BP0B 3NJGA 1KGYE 1A4AA 2I7OA 2WO2B 5I6LA 3CDZA 3L45A 3UGEA 3QQXA 1PLBA 2FT6A 1ZPUA 3D12B 1J9QA 2TSAA 4KNSA 9PCYA 4E9WA 1AR1B 1JXFA 4P5RA 3NSFA 1MDAA 3NJIA 2UXVA 3ZX1A 1V55B 1TKWA 1IBYA 4MFHA 1AZBA 3EH4B 1PY0A 1QHQA 2VSMB 4JHUA 2AFNA 4PAZA 4F7KA 1JZJA 2GSMB 4E9VA 3CVDA 4BDVB 1MG3C 2WSDA 2GC4C 4YSRA 1XMEB 2X87A 4E9TA 2HRGA 1AS7A 5E9NA 5TK4A 3V9CA 3QPKA 2VM4A 1IC0A 1MZYA 4FAAB 3FU7A 3CZUB 1KYAA 1AZNA 3G5WA 3CG8A 2DWSA 1AIZA 3PLYA 1CYWA 1E5ZA 1L9QA 1NIBA 2LLNA 4DPCX 3AG4B 1PCSA 1OCOB 3T6ZA 4HIPA 1OCZB 3PAZA 1SF5A 3WKPA 2DWTA 2YXWA 2J5WA 1PF3A 2IWKA 4BDVA 3S3DB 2CCWA 1RZQA 4K9JA 1R1CA 1FFTB 1CYXA 1KBWA 3UADA 2GHZA 1NTDA 1E67A 2CBPA 2FQGA 3FS9A 4HHWA 3DTUB 4X4KA 2IAAC 2XX0A 1RKRA 3NJLA 4ENZA 1AS6A 5LDUA 3FPYA 3ABMB 4DP2X 4GP8B 4W1TA 4A67A 3NJHA 1XB8A 2BWIA 2XV2A 1AAJA 1A8ZA 3UAEA 3WG7B 1X9UA 1JOIA 4Q89A 3SBRA 5D4JA 2FWLB 4ZK8A 1EZLA 4YSEA 1A3ZA 3MX0B 1BXAA 1J5CA 4G71B 4JHVA 3PPSA 2RACA 4AI7A 1NIEA 2IH8A 4DP0X 2GI0A 2VW7A 5PCYA 1ADWA 5AFAA 1AZCA 4GP4B 3NP4A 3EHBB 2Q9OA 3IN2A 2B08A 2VN3A 2YAPA 1PNDA 4JKNA 3ERXA 2HX8A 2PPDA 1WS8A 2PPFA 3ABGA 3V9EA 1T5KA 3QJRB 4KOCA 3PXLA 2VMJA 4AZUA 1GSKA 4GP5B 6PAZA 1PLCA 4HAKA 1PMYA 1L9PA 1L9TA 2BHFA 3FQ2A 1GY1A 3T6XA 4KO5A 1DZ0A 2ZXWB 1IUZA 3FU7B 1BQ5A 2UXGA 3AG2B 2UXTA 2IWEA 1SFHA 1SJMA 4DP6X 1RCYA 3X1EA 2HX9A 3IE9A 2ZOOA 1OF0A 3NP3A 1ID2A 1E65A 3T9WA 1V54B 5IY5B 4CSZA 1OOWA 1KDIA 1KBVA 2VW4A 2HX7A 1NZRA 2FNWA 4E9XA 3WIAA 1JERA 4L0PB 2Q5BA 4UANA 5I28A 5PAZA 4AKQA 2B3IA 2YAEA 3QJUB 1SNRA 1E30A 4NAJA 1OCRB 2R7EB 1JZGA 3T6VA 1DYZA 2E86A 1FWXA 3HB3B 1AOZA 3SBPA 2ZONA 3QJSB 1NIAA 1ILSA 2PLTA 1N68A 3S3CB 1CUOA 1I53A 1NINA 4BWUA 4N4YB 5B1BB 2I85A 3ZDWA 2BWDA 2OCCB 3QJTB 1ZIAA 1JVOA 3CVBA 3H4FA 1NWOA 3N2JA 3FYIB 4G7RB 4YSTA 4QLWA 2PPEA 2R7EA 4HCGA 5I5JA 1HFUA 3AG1B 1ETJA 2IDTA 2IH9A 1OCCB 3OD3A 5ANHA 1BQRA 1J5DA 1JXGA 2GC7C 4WKXA 1NPNA 3KW7A 3KW8A 2FT8A 3ABLB 1JZHA 3TBBA 5TK2A 1JVLA 1ZDSA 2YAMA 2EIKB 2J57A 3DKHA 1HAUA 3MBWB 1ILUA 4E9QA 1AS8A 4HCIA 2FTAA 5EHFA 3EF4A 3TA4D 1KCBA 2WO3B 2H5UA 3CDZB 1AG6A 1ZIBA 4YVUA 2XV0A 2N0MA 1A4BA 3ASOB 3FSWA 4W9ZA 2YAQA 4EF3A 4A68A 2W8CA 2JFCA 2QDWA 5F7AA 4CSPA 2AZUA 7PAZA 1NIDA 3NJFA 5AZUA 3RYMA 3BQVA 4YSAA 4YSSA 2YXVA 2XV3A 1RZPA 2Y1AA 2VM3A 3IN0A 1JZIA 3ZBMA 5I6KA 4YSPA 4RH4A 2BP8A 4F2EA 1IKOP 5I6MA 1J9TA 5D4HA 4A2HA 2QPDB 3FSAA 4E9YA 1OE1A 3OM3B 4KO6A 1M57B 2YAOA 1SHWA 2XXGA 3T6WA 1NICA 7PCYA 4AX3A 1PZBA 1SFDA 2CALA 3ABKB 3AZUA 4A2GA 1KCWA 5B7MA 3NJMA 2HLEB 1AZRA 1XB6A 3X1GA 2IDUA 2XWZA 2AZAA 4DP5X 3OQRA 1UATA 2CJ3A 3X1NA 3NSDA 4GY4A 3WI9A 3NSYA 3AW5A 1E5YA 3JTBA 3JT2A 5I26A 2AVFA 4HZ1A 3X1FA 2PP8A 2UXFA 4HALA 1GS7A 2VSKB 3TASA 3FYEB 5D4IA 1BAWA 5I6NA 4DP4X 2EINB 3CVCA 4WTQA 1AG0A 4KO9A 1JXDA 2DV6A 1B3IA 2DYRB 4M4RB 5B1JC 1BYOA 3H4HA 5FC9A 2PCFA 3FQ1A 4DP1X 1OE2A 3UACA 2FQFA 1M9WA 4E9RA 3H56A 4NB7A 5B1KA 1M56B 4NERA 1ASPA 1BEXA 2FT7A 1L9RA 4YSDA 3IBOA 1ET5A 1PLAA 1ET8A 3NT0A 4A2EA 1TEGA 4YVNA 4BWWA 3QJQB 2BW4A 2DY2A 1ASQA 2XLLA 4P5SA 3WNJA 1PZAA 3PAVA 1TEFA 2YARA 4DP8X 1J9RA 3FU9A 3OMIB 1A4CA 5AKRA 4DP9X 3AY2A 2IDFA 1IBZA 1SDDA 3SBQA 3BVDB 3GDCA 2CUAA 1NDTA 2CAKA 3X1BA 3U25A 2BP8B 3PCYA 2AANA 1JZFA 2IDQA 4G70B 4DPBX 4TXVB 3NSCA 3S8GB 1OV8A 2YAFA 4AKOA 4FA7B 2MTAA 4HCFA 3WKQA 5B7EA 2BP0A 3HEIB 2JKWA 3NJNA 5I6PA 1V10A 2EILB 2HRHA 1MG2C 1WA0X 1AANA 3T71A 3GYRA 1WA1X 1ET7A 5I5IA 1BQKA 2QDVA 1F56A 2H3XC 3N55A 4QKTA 3NJJA 3FQYA 2EIJB 5B7FA 5I5MA 2PP9A 3FSZA 1BXVA 1JZEA 4N8UA 3AG3B 2PP7A 5F7BA 1PAZA 3NYKA 1AACA 5B1JA 2PCYA 2YAHA 2GB2A 4G7QB 4A2FA 2Y69B 1QNIA 1MZZA 1URIA 1ASOA 2VW6A 2XX1A 4KNTA 4YSQA 3QJVB 6PCYA 2OJ1A 2HZHA 1OE3A 2W88A 2EIMB 1X9RA 2XUWA 3OMNB 4HHGA 1ZV2A 4YSCA 3FU8A 3S8FB 1CC3A 2J55A 1PNCA 2XU9A 3DIVA 1NIFA 1NWPA 2GBAA 2TSBA 1N70A 5B3SB 3UAAA 1WS7A
chains in the Genus database with same CATH superfamily
1R5IA 3JZ7A 3SPCA 3NPZB 3OG6B 4Z9KB 2XACC 4L5FE 3Q8CA 4JQIA 4IHBA 3CTTA 1U6AH 2R2CA 4KKRA 1WD9A 3SODB 1MCLA 4UQCA 5D7IE 4EZMA 5EZIL 3JTTB 4MKMA 3ARDD 3B9KD 1TCRB 4Z0XA 2ZPKH 3V6FA 1A3RL 5K39A 1DQML 2C4XA 4NDMB 4Y1AD 3WUWB 2PTVA 4RRPM 1R0AL 3RKDC 3MYZA 4HJ0D 2AITA 5MI0B 2NW3A 4HIIB 5EU5B 3VXUB 4A6YH 5F3BA 4P46D 4YXLH 2JJWA 3V6OA 4AGNA 4YSUA 3GSWA 2MQGA 4R97C 3PS6A 1LK3H 2AI0L 4LHUG 1VESA 2Y06L 3FT0A 1CLYL 4UF7C 4KO7A 2WHVA 4U1GB 1XF5A 3PGCB 4JY4A 4X7TB 2DEWX 1BZEA 2H7WA 2DLEA 4U0QB 2ZX6A 2SEBB 2E6QA 2YUXA 2F5BH 2VN5A 4O51B 1NQBA 2C8NA 4GBXC 4NQVB 4PJBE 4U33A 4WU5A 4Y19B 4AUYA 4YE4L 3PREA 1JGUH 1L9SA 4NAMA 1BV8A 4N2FA 4WI2A 3PHQA 3GXIA 3RWIA 1GA2A 5CR1A 3SDDC 2V37A 3ES6B 4DO5A 1NCCL 2W95A 5A3IC 1R3IH 4EDXB 4X6EA 2BIPA 4N2MA 4L48A 4D9QE 3D0LB 2JMRA 1FYTB 2XJKA 3G04A 2EDEA 4H4NA 3TV8A 4JRXD 4GMSH 2W1NA 1NC4B 3IFOB 2IBZY 4N2NA 2O30A 1DQLL 2X7LA 1NKRA 1KCUL 1MQ8A 4GQZA 1UJ3C 5HYJD 5BVPH 3ARBC 3DA0A 1HH6B 3LKSB 5JW4R 4JO4H 4OI9A 2EXWD 2CRIA 4W6YB 2UUDK 2H47C 1ORQB 2Z3FA 4AXWA 2EVIA 1GJUA 5D1XD 3C6LD 1R3JA 3MJ7B 1I8AA 2D0FA 1P1ZA 1QTPA 3VNYA 2E27H 2RR3A 4F20A 3TT1L 4OFDA 3LXUX 5I76A 4PLNC 2WAHA 3BFQG 3KJ4B 1RZFH 3E6FB 2V5SA 3NJIA 5CEYA 1IEAB 1JV2A 3K0YA 5AUMB 3T5WA 1ZLEA 1AZBA 4K3JH 3TJHC 2VSMB 2OKMA 4PJEA 1S7TB 2V8MA 5E99H 2IC2A 3V6FB 3OR6A 3CVDA 2B2XH 3H42L 1N4XH 5J06A 2XT1B 1UCBL 5AYUH 3HUJF 4M8QB 3QZBA 4IMLA 2Q86B 3MUHL 5E9NA 2J8UE 2ICEC 5HHOE 3V9CA 1T89A 4HKXA 5LXGH 2AEQL 3BRGC 2CJSA 1B4TA 1CGXA 1WPCA 3MV01 4KI1A 2P5EB 3BHBA 3GI9L 5CGYD 8FABA 1I3RA 1XGRA 1N6QL 1NGWA 3GB7B 1DBKL 3BH8B 2D31A 4QTIH 1SJXA 2AQNA 3PAZA 4UILH 4M4PA 3MUJA 1W72B 4ZXBB 5BV7H 3MRCA 3VUAA 3HA0A 3WOVA 1FH2A 5D93B 5DEGA 5E6RB 3B37A 1I4FA 2NW2A 5EORH 4N8VB 4WUKL 5DUJA 4KKBC 4BQ6A 5EOTB 5FUZL 4JAMA 4LLQA 4GAYA 1TZIB 2WLLB 1NBVL 3MNMA 3W11C 3IGFA 5I8OH 1R5WB 2CR0A 4RA3A 4N1HB 1NSNL 3G5ZB 4A37A 4XP6L 4DNLA 4WHTB 4Z95L 1S7VB 4NCC1 1SOXA 4KFMA 1B4JH 4V1DB 3B3BA 3UP6A 3F84A 4XN1A 2AGJL 4LLUA 3QWRA 1UD5A 3ZVVA 3ZQWA 1S7RB 1CYGA 1ETB1 1QVOA 2X4PB 1PIGA 3DUSB 4YSEA 1A3QA 3SE6A 1PD6A 4FXGA 4KK6D 3V4UL 3GMPA 4BFFA 4F93B 1X7QB 4XVOA 3Q43A 4Y2DD 3RIKA 1KWKA 3TP4A 3DX8B 1RJZB 1F02I 4X6CE 5T1DL 1ZWIA 4KUCF 1AXTL 2GBVA 3D85B 5D2NA 2WZ0A 4Z5RA 3V4PB 4NQEA 1Q8MA 2K70A 1KB9J 4UMSA 5DDHA 3MZTA 5JORA 1THCA 2Y25A 2YAPA 5K9OA 2XN1A 5BOPA 2NY5C 2Z31C 3MRHB 2O72A 3O3EB 2AK1L 4IMKC 3UROR 3GMNA 3L3OC 1BZ9A 4OLWH 5E7BA 4YFLF 3H3KA 3L9RB 3WIFB 5I16A 5FUOL 2V2WA 1XSJA 3FQ2A 4FD0A 3UTTB 3RA7H 2VQTA 4HUWA 4HK0B 4L5FH 3HNVH 3NFNB 3MRMA 4NN7B 2ADIA 3H9YA 3S36L 2FATH 2O6CA 2XWBA 1DQLH 4W93A 3EGDA 3X1EA 1DQVA 4OV5B 1MHEA 4ZX6A 3D25B 1RJLB 2ZOOA 3IBEA 4UOW0 4WGWB 5ACMA 3ZTJG 4XNYH 1EEZB 3E8VA 4NLAA 1S3RA 4HCRL 4HJUA 5E5RB 3NIGF 3OWRA 4CMHC 4DGIH 3E3QC 1WAPA 5J6GB 1FO0B 5ECGA 4NZUL 3HAEG 1FNFA 3BWUC 4PJIF 2CD0A 1JRHI 3TYFB 4BIKA 1TVBA 5IFAL 1EEUA 3EYOB 1CB4A 1I3GL 1U8NB 2OA9A 1B9KA 3F7KA 2FX8L 2WYTA 3P4MA 5DJ8B 5FOBA 4HEME 5IMMA 1NINA 2VM9A 3FUMA 1B88A 4FXLA 4HS6A 5JYMA 3PGFH 4M5YH 3ZJAA 4ONFH 1AGDA 2V7NB 3EFOB 4BUQA 1RUMH 1F2QA 1U8CB 1JVOA 2Q87A 3MZGB 4JFYB 4ZAKB 1KJMA 1TYEB 4XXCC 1VJSA 3FTSA 4OQ1A 4R7XA 3RDTA 3ARFA 3N2JA 3WTXA 1PDKB 5D1XC 5FO9A 2YQGA 1NMAL 3N91A 1KT2A 3ILDA 3OKOB 5DMKA 1H9VA 5EF2A 1X5XA 2R7EA 3V9FA 1IRAY 4XMZA 3GBDA 4XOAA 3IRPX 4FFVC 1LE9A 1BD2A 1A6AB 5ANHA 1CD0A 4FMVA 3V52H 1NPNA 1UB5B 3GXFA 4NM8L 3KLHC 3SE4C 4X80L 5J13B 4LB8A 1IGCL 2HFEB 4FZ8L 5FA4B 2R9HC 1EHLL 1NGZA 2Z9TA 3BGAA 3KWWA 4QEGA 5IVOA 1RFDH 1OP3H 1MFAH 4ADGA 3IM1A 1NLDL 2Q8BL 4R4FL 3VRIB 1TOXA 1F58H 5D1QB 1UTDA 2PXYC 3EBHA 5F7LB 5GIRA 3BP6A 3CIAA 3POCA 4HCIA 4PJ7B 1ZLUK 1JZ6A 2QV2A 3V4VH 1BZ9B 1DEDA 3CBJB 4BINA 3RLSA 3HPJA 4OF0A 1ZIBA 3BGMA 3NK3A 2V2WB 4NO5A 2A74C 3ASOB 3WL9A 1PZDA 5BRPA 4NP4H 2DJSA 2VDRH 4H25A 3KYMA 1U92B 3D87B 5F7AA 1A9BB 2AZUA 2KZ1B 3HBZA 8CGTA 2Y7LA 3FFDA 5DRWA 5E1GA 4MNHA 4U1MB 1B4RA 2WINA 2Y1AA 4PRAB 2VM3A 5F89B 4FQLH 2I27N 3T1WA 3N41B 3C8HA 2BP8A 4JX0A 2NY0D 3KNBA 4FQ1L 4JFHE 1RH8A 2QPDB 4U6VH 4Y5YB 3CFMA 3VMOA 3WFZA 1TQTA 1M57B 2ZCZA 1KBGH 4OLXH 2OMBA 4FC3E 2ZAIA 5EUOF 2XPZA 2BVPB 3RTQD 2WLIB 3EKCA 5GGSY 4J7RA 2WB7A 1XB6A 3DVNB 1U8NA 3OQRA 1EBPA 2H32H 3IWVA 2ADJB 3V2AR 3O45B 4FMFA 1X7SA 3TFKD 4M61A 4PJGB 4KUZH 4Y4HB 4FEIA 3P73B 1P4IL 3GRGA 3GC3A 5E4AA 4OD3H 3ZT5A 3FDWA 2EINB 2WJ5A 3FO9A 1UH2A 4QRBA 2QHLA 4UOQA 3RFZA 4HJJH 2X9WA 1KFGA 4HETA 3Q48A 4JDTH 3VGHA 4L8CA 4MS8D 1UXSB 1BYOA 2OMVB 3FKUS 3H4HA 2FWOA 3RQ3A 3SOBL 4LAQH 4CJ0A 2WUCL 2VKWA 5LGKA 5JPNC 1OT2A 4PJAF 2C34A 3H8NA 2WQUA 4OJAA 1MCBA 2WUBH 1NLBH 3A47A 3VXMD 4JFFA 5IHWA 4XBPA 4I0PD 2BMKB 4LNRA 5DJZA 1RZKH 1YYLH 1SMDA 4PR5B 3WY1A 2B9BA 2V2XA 1NC2A 3U48A 3C5JB 1KXVA 3BUDA 4TKWA 2KLTA 2L3BA 4AV4A 1J9RA 1PPIA 4HQQH 4KZ0A 2YJQA 5GPRA 4CA4A 4D9QD 4MJ5A 5GSVB 3GMMB 2WAQA 3GMOA 4DKAA 3WHXA 1KJVB 4D0BB 2ZF9A 3EOAB 4HXBL 3P3RA 3UBHA 2A74A 2ZKHH 2LAGB 5E5MA 1OXYA 1VERA 1JZFA 4NHUA 1WISA 5C0AE 2AJYH 1QUNA 3L4WA 2NY1B 1A21A 3B7SA 1QLEH 6TAAA 2C9SA 3Q3GA 1VENA 4G8GD 4HCFA 1QRNB 5FYLE 1A6PA 3VA6A 1G9ML 1ZRUA 4OLEA 1TITA 3U9WA 4F57H 2JKWA 1FHGA 4HUVA 1JYNA 1JD9A 1NEPA 3WY4A 2MPAL 1QZ1A 2P8LB 2J3SA 3IFPB 1WBZA 4KXZH 5DLML 5BQ7A 2GJ6D 3RDJA 4FJ6A 4JFDE 2RCSL 3BKCH 3MBXH 2FR4A 2Y7QA 3M8OH 2AVGA 2E74C 4FZ8H 1MWAH 2CA4A 1QASA 1AGBB 5AW1B 4AEFA 1TVHB 5ID0B 4PJXE 2F53A 2X7LB 5E2TL 5SV4A 1EAPB 3TTSA 3AJ7A 4W9JC 3QVAA 5I1EL 2K45A 1JZ5A 4ZFOA 1TYJA 4FFWC 4KQ4H 3IMVA 2MCPL 4BRVA 1HS6A 3F83A 2WD0A 4J8RB 3CSTA 4P57A 1KTDA 3NEXA 4PIRF 3ZKQD 4JK0D 2ZE0A 4A2FA 2I9TB 3P77A 3JWOH 4QRPD 2QVFB 2Y5EA 3V4PH 2HZHA 2FX9H 4IHOB 4GRLA 3NTCH 5DURD 3DECA 2IGFL 2QEJA 4LZKA 2CDGA 3OXRB 2OMNA 4X9HA 4F5CA 2V9RA 1CF1A 3WSQH 4ERSH 2A1WL 3QJFA 5ESVB 3DIVA 1A1MB 1BZOA 5IVNA 1DVFA 3BVNA 3GNMH 4RSYA 4URKA 4QYOB 3ET9F 4NI3A 1USZA 2O5XH 2DQHL 1PZ5A 3GZPA 1UGKA 5AUMA 1S9YB 1TZGH 1YY9C 4O5LL 5AB2A 1K9TA 4HIIA 5EU5A 3QNZB 4MNGE 4PRBB 5DT1L 1JF6A 3F58H 4IU2A 1ZLDA 4DGWC 5H35A 5I8CA 2A6IA 4JGUA 1L7IH 5E8EA 3PIQA 4N87A 1QEXA 2KS0A 1O9ZA 5SWSD 1GIGL 4LNVA 5T3XD 4FL4B 5T3ZE 1N64H 4YBQD 2FHCA 3ZHDA 4X80H 5KSUB 4F8TA 1CGSH 1TT6A 4UQBA 4QRPB 3WJMA 1A7OL 4G72B 1IGCH 2OR7A 1SHXA 4YBLB 1XV8A 4LLWA 1HCFX 4RISH 3BZEB 4LK4A 1CPUA 2I7SA 3TIEB 4RAHA 3EFDL 4R5XA 2C3XA 2OTWB 3C60C 3MRQB 3ILPB 5IKCA 3P2BA 3ZE1B 5BRZB 1WVZA 3D50A 3T4AA 3WFCH 4XZUA 3K6SB 3JWDL 1OM3L 4P5KA 3QFJE 3WN5A 4F15B 5J57B 3TYGH 2Z34A 2QPEB 1RMFH 4MWFA 2A83A 2ZP0T 2I25N 4FFYA 4JJ5B 2UX7A 4OZFB 4WHDA 5LG1A 4WLCA 3VWKD 4LFHD 2CO3A 5DRNA 5DZLA 4BK5C 3V4UH 2VOTA 3FQUB 4JKKA 5KYYA 1JF1B 2AQSA 4EZJA 3V0WH 3BKJL 2EIZB 2JXMB 1T0OA 4XP9H 5J11C 3OKNB 3V0JA 4QO1A 1D6EA 4JM2D 4RMUA 3O4LB 2VWEE 4P2OD 4WW2C 4YFLI 1IC4H 3BRFA 4UNTA 2NY6D 1VAHA 3TWYA 2OMYB 1U30A 1YNKH 4I0PC 5DS8B 4WUUA 2ZCKH 2Y7NA 1PG7W 4PGJA 1UZ8B 5C0CD 4K94L 3ZUCA 3HE6B 1P4IH 2ZXGA 2COQA 1KBKA 4G6JH 4H1LB 4NGHL 2AXGB 3NZHH 4K3GA 3D2TA 2XWTB 5DO8A 3VWJA 4DO6A 5E4IA 1MJJA 3FT3A 3ZX1A 3NAAH 3CUPB 2XKNB 3L3JB 4X9FA 3VQLA 1T21B 1F97A 1KGIA 4I3SL 4HC1A 4TTDD 2HJFA 1OTTC 4I18C 5E1HB 4HSCX 3SCMC 4WCYL 5DD1L 3VA2C 3FQWA 4I0PB 1NGXB 3FB5B 4F7MA 4MD0A 4U1SB 4Y1SA 3H0TB 4LLQB 3N40F 1K2DA 1A2YB 2ZNXA 3PU7A 4FYSA 4G7VL 1IAKB 2CIKA 4UT6H 3VD5A 4DPCX 4UNIA 3AG4B 4HISA 4HDIB 1GTFA 4OZGB 1PLGL 4L3CA 5E7FA 2A4EA 3QCVL 5F7DB 3S36X 4HWBA 3V6ZA 2HJKA 4HUUA 1F4XL 1BOGB 2X38A 1AQKL 1IAII 3NMEA 4GSRA 4AGLA 5LUMA 3TN0C 3L3GB 5HJ3A 3HMXA 1IBFA 3FS9A 3LRKA 4HAGA 4NIYE 2BFGA 1F3DJ 4PY7B 4NWUL 1ACYH 1AS6A 2H9GB 1YEIL 4Q6IC 4P05A 4YDVB 3RHWK 4I9XA 1K8DA 3DX8A 1ERNA 3PJLA 4NLHA 3NBNA 2AQPA 3VTMA 3VSVA 3U82B 2FO4B 2R0ZL 5KVDE 4IOSD 1KIPA 4OFYD 5KUKA 2ARJA 4PV9A 2ICES 3N50A 4RRPG 5T1LA 4J2XA 3DOIA 5EWIL 4I77L 3QUXA 3BAIA 3C60B 4WI4A 3E38A 3ECWA 2BOBA 3B1UA 3F3HA 3VFWA 3ZMEA 3CVHH 4F7CA 2O6PA 3MX0B 3DYMA 3IDMB 1HXMB 4B9YA 2HLFD 2BNRE 3L9RA 5DXWA 1JYXA 1A4JA 1IGFL 2E7BA 3UTTA 3NIFF 1U3HC 3OKKA 2VR6A 3HB3D 3GGWB 4HK0A 1E3FA 2XG4A 3NP4A 2I32A 2FX7L 3K3QA 4GIAA 2VN3A 5DYOB 1PZ2A 3OLIA 4MXQD 4NFDA 2ADGA 3CHPA 3A6BH 2PXYA 1MHEB 4KI5E 3WNLA 4HWZA 3Q8FA 4KOCA 5JW4M 4AZUA 3A5VA 1INDL 1LWRA 4R5TA 2OI9C 3W0WD 3O8XB 3IJHA 3T4AC 3HW7A 2JI2A 1F6AA 4DKDC 5HYSG 3FRPA 5DJDB 4KO5A 1JN6B 1YY8B 4TRPH 4DVBB 2X4NA 3M1OA 3FONB 1R5VA 1TEYA 1XIWB 2W9DH 2VDKB 4CGUB 2FJUB 2PO6B 3UC0L 4IGBB 1OT1A 4P4KA 3E9TA 3LKPB 1K2DB 4JFFE 4QR7A 4R3SA 2W60B 3CXDH 1SN0A 5FGBA 4ZFFB 4XVJL 1GGCL 4L8SC 1OOWA 3N9GL 2VW4A 4JHWH 4N6RA 5DMYA 5JPMB 2VDQB 4RFOL 2AABL 5F9AC 3VXRB 3QUMH 2JE8A 5ID1A 4OZGA 5ALCL 3KYNB 1FZOB 1Q72H 3PXHA 2B3IA 2H45A 5I76B 3QCUL 4AIZB 4CW1B 2JCCE 2H2SD 1R6VA 1G9MC 3OKOA 5ANMA 1MHCB 1XGTA 3QA3A 3STLA 3MXWH 4OVVA 4K94H 1A7OH 5MEPB 3ZE0B 2BVYA 4M6NL 4L2YA 3K2IA 3S3CB 3AT9A 1QNZL 4BWUA 5JHDA 2NQCA 4R90L 1OGAD 4DZBB 2I9LA 2L4OA 3MRDA 4YDIH 1ZGLP 1MIEH 5I1AB 5C09D 3QIWD 5J8OA 1XF3A 2AJZA 3EGSB 1OTUD 3FB7A 1UWXK 4MS8C 2O6DA 4CGTA 4PUBH 4QTHA 4JPIB 3OAWA 4BH7B 3ZPDA 4V1DD 8FABB 2FEEL 4MQXD 3BE1H 4KZEL 2EDMA 4CKQA 2VN4A 1U8JB 3FB6B 1PD1A 4BQCA 4BCYA 1J8SA 1TXKA 2WXHA 2DN7A 5LQBH 2EZ0D 3NSJA 4PRDB 2WVVB 1MRDL 4XZ4A 5KBMA 2HMID 5JQIB 1H0DA 3CSBA 1G0DA 3BEVA 1ZDSA 2DMBA 3TVMC 5SWZB 2HRLA 3LN4B 2WLLA 1TZIA 4CVUA 2J57A 1FFNB 1WYJA 2VQ1A 3RVXC 4RFNB 3ZK0A 3ATBA 3CQQA 2F5AL 5I1KL 5FCUH 2CJTA 2Y7MA 1JZ7A 1RAMA 1JTPA 4M00A 5F9OH 4ODWA 4KKQA 3NFNA 1AQMA 4FXTA 5TFSL 2GUYA 4P4KC 3EF4A 2GUOB 3W38A 3ARWA 4U6TA 2YD9A 4S1RH 2EABA 4LEBA 3ATDA 1NFKA 1V27A 3MLVH 4ISVA 4J3SA 2OMZA 5BVJB 4R7VA 4A68A 3IMTA 4S11A 4YDLB 4ES9A 5HHOD 3AWGA 5EWIH 3U1PA 4YSSA 3IN0A 3GS0A 4ZFZA 5C71A 3GTVA 5JQ6H 1MVUA 1DEEA 2P42B 1J88A 1DLHB 1SEQL 35C8H 1WFTA 2C26A 2B4CL 1MWOA 4RZKA 4F2MB 1YDPB 3BVWA 3DPBA 5DDHB 2IMMA 2Z64C 1VCBC 4KO6A 4TUOB 4MD4A 3UZEC 1SHWA 5IQOA 4YJZL 4I3SH 1N59B 2PXYD 4ZUSB 3ABKB 4CVWA 3ZUNC 4JFED 3KYOA 5E95B 3NJMA 2O1AA 1TJGL 5CWSB 1C16A 3I6LE 2APFA 4LEOA 5DMIL 3RWCB 3T04D 1Z9NA 3DIFA 4OCRL 5C3IA 2HG0A 1CS6A 2Y23A 4PJAB 4WGKA 1MLBB 1X6LA 4P2QD 4PSPA 5I18L 1A6WL 3RWHB 4EIUA 4NJ9L 3HAEH 4AM0Q 1AKJB 4HZ1A 4O2EB 1DN0A 3VXTA 2PWEA 4MDRA 3W81A 1A7RH 2A73B 3RUGA 3GBNH 3VI3E 1HK6A 2YN3A 3KVPA 4WW2F 2QVIA 3QIBD 4WV1C 4JZJA 3QRGH 5AB9A 4DZ8A 1B3IA 1Z0MA 4K23L 1T2QH 5FC9A 3IFLL 4C59B 3SDAC 2OP4L 1SMOA 1YEGH 2EE0A 3QUGA 2F7OA 3KJ6L 4G8IB 2N1TE 1CE6A 5AOLA 2GAZB 1FCGA 5B1KA 5A2FA 5DJYB 1AR1D 2XXMB 1Z7JA 2A6JA 2WYHA 2NY7L 3SQBB 1BEXA 3CAFA 3JV6B 2JJTC 2X2IA 1BZ7A 1C5CH 1E6OL 5DHDA 5HI5D 2JKLA 2IGTA 5B21A 2NY6B 3GJFK 3LV3A 1IC1A 1TEFA 2PWGA 3MMEB 5CGTA 5L9DH 5LN8A 3P54A 1JPEA 2C3VB 5AKRA 4D0DB 4DP9X 3FFOA 5E8PB 2L04A 3A67H 4U1NB 1CGVA 4QRQA 3CH8A 3LVEA 3KPRA 3SBQA 4OZFH 4Y4HC 3TIDA 1NBVH 2BDNL 1FFOB 4X6DB 2FUQA 2ZOTA 2B59A 3GINA 1WZLA 4LRNH 3MJ9A 4XNQB 4IRSD 2YGPA 2B39A 4XNXH 4UB0H 2R2BB 4LCWB 1UZ6F 3BW9B 5C0BE 2J12B 5IW6B 2JJVA 4K3EH 1OGAA 2JQMA 2LV4A 1TETL 4N2AA 3KWWB 1EO8L 1BFVH 4ETQB 4CJ1A 3G6JA 4OZHF 4PJCA 1MG2C 1SBSH 4JQIH 2ED9A 3T71A 1MRCL 1OAXH 1J0HA 2IAMD 3KYOB 3HHMA 4LRIA 5E6IA 5EBGA 5E6ID 4BH8B 4EN3B 1R75A 2WWOA 3N55A 5DEFB 5E94A 5C0IA 2EIJB 3G08B 2PP9A 3OHXC 1PBYA 2WXLA 4M7LH 4UTAH 2AJXL 1S3KH 1EVUA 1LILA 1XIWC 2TRYA 2NZ9C 4QO1B 1XF2B 1IVTA 1TF4A 2XPGB 1B0IA 4K3HA 1DQDL 1A7QH 4U1MA 2EDNA 4H26A 2GJJA 3AGVA 3H9SD 3MTXA 5GGUA 3SCMB 5AAMC 1MAML 2R69H 3P30L 3OMNB 2YGNA 2HH0L 4QGYA 1CJYA 3RI5K 1AMXA 3RY6A 4TPRH 1B2WL 4AY0A 1YG9A 3FQNA 1UKTA 1OQXA 4G3YH 4HFUH 4LQFH 2BINA 1TSHA 1ZDQA 1ZT4A 4LAQL 4ZMZA 1SDDB 3B83A 5B1AB 4AYBA 1HOEA 1Y18A 3H6JA 4I0PA 3TEZA 2WKGA 3S7GA 1OT4A 2IOMA 2OTWA 3MRPA 2GJ6B 3DWTA 3L7EB 3EYSL 1WTLA 4F91B 3D69A 2I60H 3NJKA 4N20A 4PLKC 2X3CA 2VGLM 4OCLC 4FNQA 3ZZ1A 3LN9A 4PVLA 3VD7A 2OJEB 2DBJA 4G7SB 5GS1C 3RNQA 1CFVH 4FQQA 4LCCA 5HHVL 5DCCA 3GI8H 2D03L 3QWNA 3QEHB 3C8KB 3L4UA 5FHBH 4HOMA 3O3DA 1MF2H 4W9GC 5EDXA 3ZR6A 1AI1H 3QZPA 4X50A 5C07E 1W6LA 4TOYL 1BOGA 2EDBA 1RZJL 4HJ1A 5IHHA 5BUAA 3AC0A 1FVDB 3MXVH 1YNTB 2BNRD 4K23H 4HXBH 2WMPA 1ULVA 1KXQA 4M4RA 3CFKA 5E8NB 4AKPA 5DD0L 1INQB 2UVEA 3GUTB 1LEGB 4K73A 3GUFA 2VLJD 2WLZA 3QEQB 2F19L 5KVDH 3BKMH 4MZRA 2F19H 4LO9A 4W9IC 2ITCA 4DCQA 3KL3A 4GRWB 3VRLE 1WIOA 5GS0C 5BUGA 2JB5L 1LD9A 1BZDA 4TV3A 3OSKA 3KE0A 3WN6A 4WTWA 4HX1B 2OMTA 5FM4A 2NQ3A 4N24A 3VX0A 1W0WA 3LZLA 2QQKH 4JFZL 5F96H 4APQB 1HXMA 4NCC2 5EIVA 4OJFH 1U4EA 3A67L 3ULUF 3VWJB 4JPKH 4OKDA 3X2QB 2C9XA 4MA7L 3F5WA 5A7EA 2FUTA 2KUTA 3BMWA 4GYBA 4XCCH 4I89A 1NEZA 2YJLA 3APDA 5A2KH 4GKNA 4R0LC 1WF5A 3WUWG 1YJDH 3OV6A 2FZ3A 2XQYK 3UGEA 3DTXA 4F8PA 2D0GA 4HIEA 4TYUA 3HMWH 1U8HA 4LU5H 3BVTA 3VMNA 4XX1E 5FV2A 4PTTB 1G6VK 5LAPA 5F2FA 5T5FH 3TTYA 4JRWA 5CCKH 1CVRA 4WW2B 1R3HB 3LN5B 1V55B 1M9SA 2DM7A 1T2XA 4GW5A 3KR3H 4FLSA 2XWJA 3WEOA 2BS71 4OLXL 5BXFB 1MFVA 2DQHH 3Q9PA 2BIHA 3W11D 4YK4B 2VXUH 2WSDA 3LY6A 5DF0A 3UIYA 4NX0A 5F6HJ 2IWGA 1TZHB 3D69B 3FH7A 4XPTL 5LNDA 1LO5A 4JO1H 5ERWB 1HWWA 1MW0A 5DUPH 1RLBA 4ZUWB 4N86A 3LEYL 4OFQA 2YSTA 3TGXA 1VZGA 2WZ5A 2DWSA 3CMOL 4U0RB 5CEZL 1MHPH 3CU1A 2EC9T 1R17A 4PW4A 4EXKA 5DQDL 1CLOH 3T6ZA 2X4OB 5DZPA 1KB3A 5FHAH 5C2UB 2J1ZA 3IGLA 4L9LA 4HBCH 3WBDA 2AQ3A 4L0YA 3VXMA 1MFMA 4XCNB 3Q2NA 1CYXA 4I0KA 1H8LA 1JNJA 2F8VA 3H9SA 4X4KA 5F3HB 3WY3A 2GBUA 4OLVH 4GAJL 3T77A 3T65B 2Z31D 1G7IB 1U91B 4M1GL 3ELQA 4CVXB 2YKKA 1EXUB 3SGKA 4XBEL 5ACZA 1DTUA 1KYUA 3O4LA 2F7PA 5B1CA 3DURA 3TBTB 1T83C 2P5EE 4U4BA 2FSEA 4JZOB 4PWEA 1Q9KA 4UTCA 1QATA 2RACA 4LDEB 3VG0L 3SY0A 4PHZA 2D03H 5E2JA 5EEXA 3FT4B 3DMMD 15C8H 2BVOB 5BZWB 4BZ2H 4P2QB 1ZK9A 4WEEA 3NDZE 4WK2B 4Y4HD 3RPIA 5IJKC 3FMGL 5HGAA 2ZUSA 5HDWA 1BM3H 3OC5A 2VMDA 4OT1H 2VYRE 3GSWB 3H2PA 3INOA 4KROD 3DPDA 3ERXA 1IGIL 4WTXA 1IC4L 1HNFA 2IPKB 3QJRB 1QLEL 5JIIA 1I3VA 4EI5A 4X8GA 3UOAB 4HU2A 1MCPH 5DJ6A 3IJSB 5GISH 3K72A 4K5OA 1EEYA 4P9HC 2W94A 5BO1L 3BRDA 2WXKA 1I9IL 1FC2D 3PYCA 5GISL 4A7GF 1TTUA 3BCDA 1D7BA 1DZ0A 1PX4A 2JB5H 3OB8A 3RGVD 1EFXA 5F7MC 3UTSE 3EJUA 1B6UA 4JNXA 2IOOA 2NY2C 3AG2B 5HD8C 2G9KA 3GKZA 1T7XA 2DEYX 3OKNA 4DP6X 3JXAA 5FOBB 2EJ1A 2WN2A 1RCYA 2CHWA 5DYFA 4LPYA 4H2AA 2HX9A 1YUHB 4P3DB 4WI0B 4X0KB 2JJSA 5GGRY 3PUCA 3TBVA 3TCLB 1YAIA 2NCEA 1E6JH 1V54B 2CLZB 2X5PA 1KDIA 4K2UL 3E6HA 1F86A 4O4YH 4OGQC 1HTYA 4HUXB 1NLBL 1JPFA 3F12A 5DD6B 4H0HB 1OAZH 2DM3A 2Q0ZX 3K2KA 2NY3C 4MQXC 3WO4B 4HV8A 5M94B 1HWGB 2Z35A 3OWEA 4X6CF 3L6FB 3GSNH 3IETA 3LNHA 4OGXH 3SKNA 4KDWA 2NW3B 2VN6A 4EIZC 3U1QA 4I0CC 1U3ZA 3KPQB 3MRJA 5D7JA 4UQDA 4NXSA 3KPMB 2ZONA 3TT1H 2C3HA 2HAZA 4N2DA 1X5HA 2VDMB 3MFFB 4HQQL 2XKSA 1P1ZB 2CGRL 4NYLB 1FH5H 5L8KB 2SEBA 1M7XA 1F0LA 1HJBC 5GGRA 3PGFL 4Y9CA 5K9JH 1T1XB 3T6QC 2IEPA 2Y7SA 1ZLVK 1M53A 3BD3A 4EIGB 2V5TA 5B39G 5DT1H 2VMEA 1NGWB 1F6FB 1SJEA 3ARZA 5EZJB 4Y16C 3PHSA 4Y7MA 4YSTA 4PJCE 2ADFH 4D7BA 4HHAB 4PRHA 5F1OB 5I5JA 3VJ6A 3VQ2C 4DPRA 5DEGB 4LLVB 3FCSB 2X4QA 5K1NA 3NCWA 2VZOA 4NSKB 3RIFF 3A4EA 1J5DA 1TIUA 3AS3A 1E4KC 4L0ZA 5I1GH 1S7SA 2ZUQC 5I2IA 3AREA 4OBRA 3PQYA 3QPQD 3SKJL 2AQQA 2WO4A 2HKFL 3TBBA 1JVLA 5E4EC 1A3LL 1DVZA 1FQ9C 1NCIA 2K3TA 3DX6A 4JG0H 4MAYD 2E7MA 1QFWI 1ILUA 2XZCH 3FRPB 3KEDA 2GFBA 1NDMA 4B9CA 1XSKA 3FB8A 1NCBH 3WEAA 1M4KA 1HU8A 4JJOA 1I7UB 1P7KB 3HUJE 4LF3B 4WUUD 3KWXA 3D18B 3PFQA 5FK9A 5FFGA 3TZVA 3S34L 2W60A 3N1PC 3T2NH 3MLRL 2NY0B 4BFRA 1XD0A 5AKVA 2E27L 1INDH 3L95A 4FF9A 1UM6L 3A3YB 1TTFA 4P99A 4E5XB 4MYWB 4HZLA 3T09A 2XV3A 1RZPA 3JZYA 2WTRA 4FP8H 3MODH 3B5TA 2HLAA 4BFBD 1N6VA 2XNAA 3PWUB 4F2EA 4N8CL 4P2YA 1ZHBB 5ILTL 1CT8A 2EC9U 1E4HA 1OE1A 4GUQA 3NFSH 4OF7A 4R4BB 4IBUA 3IDXH 2X12A 3KWTA 5DR5H 5FDWA 3D6GA 3JTTA 3KDMA 4XP9L 5IB3B 1LO2H 4HZAA 1KB5B 2AS5M 1V3JA 3O9WA 4HJEA 3DV6A 3HPLB 43CAB 3FW6A 2CK0H 1W2KT 1AFVH 4XPAH 1M7UA 3V4PA 2D2OA 5KJRH 1LEIB 3DDFA 2YRLA 1Q72L 2AK1H 3ECBA 1YY8A 4DVBA 4OCYL 4ZNCD 3WI9A 3AW5A 3BGFB 2CIIB 4N9GA 4GG6F 1SPDA 5AVYB 4U1LA 5I74C 1NPUA 2HTKD 1FL5A 1JUFB 2PP8A 2NR6D 1GS7A 2GJRA 1VGKA 4D94A 3QI9B 4QXGH 4IK7A 3BO8B 5IB1B 5IW1A 4ZBJA 3NIFE 1E9OB 2F54A 2G9HA 4G5AA 4KO9A 2DLIA 4HPOL 1NGZB 4O51A 2XZQH 5JPMA 4MJ5B 3KPNB 3UAJC 2YR3A 4KKCC 2GSGB 2ZT9C 5F1IA 3VO0A 4ABQA 1G7PB 2C9AA 1FZOA 3UACA 2OJZL 2PWFA 3ARPA 4K3DH 1J0ZA 4K2UH 3SDDD 3U36B 4N0FA 4AZ8B 5HGBA 4PP1C 1RJLA 4N90D 3UCQA 1VFUA 2G3ZA 2CLRB 2ED6A 4XBEH 3QCTH 4OIFA 5E0QA 1FGVL 4J3OH 4JDEB 5DFTA 1BFTA 1BG1A 2FT7A 4GBXD 1EFQA 2ZNWA 2V17H 2FWSA 1NANI 1ET5A 4PRPD 3KYMB 1HOCA 1PLAA 1CXIA 3L9BA 3IXTB 4LMQE 5I0VA 2VERN 4PJGE 1KIRA 4FFZA 3ZMRA 3MBEC 3CZNA 4PEEA 3FN3A 1I1RA 3NCEB 2GT9B 4Y5VB 3RL1B 1DVXA 4G1EA 4ZQTA 1EXHA 3VFUB 4UCFA 5ID0A 3C5ZD 1JXJA 3GXDA 5JQHC 3BH9B 3LEXB 4XN4A 2NCMA 3VXNB 5AOIA 2Y5TB 2BSRA 1C9SA 5AVQB 5E94B 4QWWD 5C0IB 1DE4A 2J2ZA 3QG6B 4HUMB 2ZCKL 2EDHA 4B9PA 5BS0E 4KNQA 5DVPA 4K94C 3GT6A 2OXGA 4APXA 2DI7A 3C6EA 3SSGA 2ATPB 1G9MH 3OKDA 5I6PA 2X0UA 4ODHL 5FKPA 4TLKA 3EGDB 5IR1B 5FKAA 4Y1TA 4OZFG 2Q8AH 1A6ZA 3P4LA 1OY3B 2WXFA 3QS2A 4O2CB 3TBSA 3JV4A 4XNAA 3PWPE 1AKJD 5F88B 4QKTA 1EO5A 3TVMA 4C56A 4IOSA 1KCSL 1RZ8B 2DYPD 2G3XA 3FSZA 4JKWA 4X98A 5IMKA 1WCBB 4MNQB 4Z7NB 2QVMA 4KMTH 3CVIL 2PCYA 1HKFA 2CE6A 2IBBA 2YAHA 2NY6C 4JHAL 4LCUA 4G7VH 4XTRC 3LXBA 1I8LC 4X42A 5FYKU 5LBGA 1R4XA 1AZVA 1T4KA 3V5HB 1MCEA 1CL7H 1JIBA 4JJHA 3MRCB 1BPLB 4AJ0A 2EIMB 3LZQA 5JXEC 2D0HA 2P7TA 1QRNE 3Q0HA 4BFNA 5DJ2A 4S1DC 4XGZA 4ZMOA 5HDLA 1M3IA 2PR9A 4HS8L 5IBLC 3I50L 2OJEA 4D2NA 43C9B 1FI8C 1GOHA 3B9EA 5I9QC 2VLKE 4POZC 5I0WA 1CVSC 5HI4C 1V8HA 4OCXH 2V3DA 1KN2L 4I9WD 5DWUL 1J9SA 2N3JA 3CLWA 3ULAB 1H8OA 1T3FA 2BO0A 4FFZL 4JM2B 5KYXB 4EN3D 1GGYA 2XXCB 4Q58C 1RZGA 2LTQB 3LZOA 5SX4H 5AYQA 4M43L 2VXQH 5C8JA 4JR9H 4ELKA 2DYSB 4IDJH 4H13C 4ZS6D 3O11B 3QDAA 4IDJL 5C0CA 1SHSA 4WNJA 5E1QA 3BQUD 5E0FA 5JORB 1KOAA 3WEMA 1F58L 4RWYH 4UIMB 3GHBH 3W0WB 1DE4B 2J2ZB 3V7AE 5F7EH 1SYVB 1YPZF 1Q0YH 2XZAH 1D9KA 3AUWB 3E2HB 4QI3A 5JHDE 1ZMYA 2MQ0A 4FFYL 1WE5A 2J25A 4MGXA 1LWHA 3RIAK 3FFDB 5DRWB 3ISYA 2WUBL 2HT4C 3GXUB 3ZL4H 4Q2ZA 1AZZC 2NLJB 3BWAA 5FFLA 1BVZA 3FK3A 1MFBH 2G0LA 2J6EL 4RGOL 4CMHB 3ZDYE 1XDTT 3GXPA 3BFWA 2KBGA 4PJ8A 4H1LH 4IBTA 4QRRB 1BMWA 4GFXA 4XPHH 1S4IA 4PJ9D 4RMQA 4AQZA 4M6AA 5CCJA 4PRHE 4K8RC 3KCPA 1U9KA 2B59B 2QZQA 3E6FA 1I7TB 1GVIA 1JPGB 4JHWL 4BXVA 4OGYL 4OAWA 3TNMB 2Y07H 1IGIH 2AJ3B 3MAWA 5GSVA 5C6PB 1U95A 2BSTA 1AD9B 3QUYB 5IW6A 3HG1B 4ADJA 1CF8L 5T3XL 1OGAB 3R0NA 1N2RA 2Q7YA 2BWQA 4B5ZA 1XHHA 2DWEB 1PLBA 5DJ0B 2EXTA 3HBQA 3QFJB 4PMEA 1YC8A 2GTZB 1T04A 4GO8A 4YDNA 3IJ8A 1PG7L 2ZKMX 4Q4IA 4OU3A 2HTLC 5KOMC 3A21A 1NEUA 4MFHA 4P9MH 5EOCJ 5DFAA 5LXVA 2E3VA 2QVKA 4JFQB 4UQEA 5FF6A 1E6JL 2FVNA 3S4SB 4ODXA 3C6LA 4WFFD 2W0PA 1UWYA 4OZGF 4GIOA 3IJ9A 3PP3H 3OJ2C 3MUGA 2R0LL 2KYIA 1TVHA 5TK4A 1LO4L 4WJ5A 4Y5YC 2YRBA 5GGUB 3UEQA 4NPYB 1BECA 5IVXA 4CRPA 2MFNA 3TEUA 4DTGL 4EOWL 2VE6B 3NFPA 1NH6A 5FM5M 3RKDD 1S7VA 5I9QB 1LL1A 1VZHA 1OCZB 4R26H 1GCFA 4TQHA 1GZPA 4QOKB 1EZVY 4Y1AB 1TJIL 4BDVA 4XXWA 3KPMA 4Z3HA 1GC1H 4XB7A 4DSYA 3KLHD 2G0KA 1KBWA 4TF4A 2UZIL 4DVRL 4NHUB 5TF1L 5DQJB 4YX2H 1SGKA 3HR5B 3U7YL 4JZNB 1RHFA 2XX0A 3NIDE 1NAMA 5DZJA 1NA8A 3WIIL 1PSKL 2Z65C 2ZYRA 1S7XA 1QRND 4GP8B 3LKRA 2Y3AA 2BWIA 1IQDB 2X44D 5GSRB 5CZXC 4M6ML 2EYTA 5MEOA 3DUUB 3GSVA 4DOHE 2OR9L 1JOIA 5D55A 1SY6L 1IAIH 2EDYA 3IKCA 4OH2A 3WFDL 3SBRA 1AQHA 1AO7E 1AO7A 5F9WB 4AITA 4OKVB 5KBPA 3AS0A 1QX1A 5HD8D 1RHHB 2YS4A 3GSQA 5A6LA 3GLZA 5IF0A 1JN6A 1R24B 4OZGE 1MFAL 1JNHB 1F42A 5ICXB 3S35L 5LB1A 5EO0B 4WTZG 1JNNH 3WN5C 1HHHB 1B6DA 3PPEA 2B08A 3OKEA 2CNYA 4AGOA 3LH9A 4LRNL 5I6XB 5EIIG 4P3DA 3T0ED 4IU3B 1UEYA 4WU5B 3SE9H 4PWFA 5EUOA 5L6YH 4RDBA 3HJ0A 4QRUB 4I3GA 3KPSA 1PMYA 1L9PA 1J5IA 2EDDA 4RQQB 1JPFB 4L23A 2Y1YA 3ILQD 4TSCL 5D71H 2CGYA 3MJ6A 4FMKA 4YDJA 4KK6C 1BGXL 5FGCE 5ANMB 1EVTC 4UM9A 5D1ZB 5ILTH 2JKTM 4NN5B 4O2FA 2HLFC 1UASA 1FVCA 2ERJB 1TENA 4GXVL 4X4XB 3HS0B 3L5IA 5E2VH 1KJ3H 3TL5A 1XF3B 2AJZB 3EGSA 3FB7B 3LQZA 4AGPA 1AGDB 2V7NA 1N5AB 2HFGL 3TT3L 1PD0A 3RE0A 4EJ1C 4NO3A 1CD1A 1L6PA 1T7ZA 1JERA 4Y2LA 4YDVA 3UMTA 4RFOH 5FO8B 4L4VE 3SDCD 4PJHF 3PHAA 3KL5A 1UG9A 4ZPTB 1QP1A 1SNRA 5DMGC 4QRSB 3QHFH 1DBKH 1OCRB 1JZGA 2XRAL 3K1DA 3EZJB 2BX5A 2VXQL 2E86A 4HHAA 1CGSL 4J3XA 1IBGH 2GCYB 4NQSA 4UNUA 5H2BB 5TGBB 2ADYA 1IQWL 1GXEA 4XE0A 3N44B 5L2KE 5ALBH 1KJVA 2N7AA 4D0BA 4UV7L 4NQVA 1A0QL 2G2PA 2OCCB 4GO9A 1MCFA 1HSBA 3G5XB 3OQ3B 3JWNC 3WFHA 5MENA 1WUNT 4K0OA 5JOFA 5JXAH 3SDAA 1C8PA 1KEMH 5HXMA 4M1DL 2A6KA 1DO5A 3MRKA 2NY4D 5FYKE 2AEWA 5HGBB 3U36A 5IT2H 3CPLB 4PREB 3VFPB 1ETJA 2BS9A 2DQMA 4OJCA 3CLEH 1UACL 4PJ8D 2OAAA 2E9GA 1EO8H 4EUPB 1PG7X 1BZQK 3KW8A 2K9UA 4XC1L 4QHNB 3S96A 1FNEB 1G87A 1XR9B 1CDJA 1A6UH 2RD0A 3VD3A 4NNXA 2F53B 1DEEB 1ACZA 5E03A 2QQNL 2APSA 3EHBD 2J21A 4CADA 2CLVB 3F6JA 5EN2A 5G55A 2PYFB 2K78A 3DX4A 3ESMA 1G7IA 1JGLH 1U91A 4IOFC 5FYJU 4Y2DB 3ZTDC 2AQ2A 5KSBA 4FE9A 5ACZB 2C9VA 4XHQA 2PW1B 2ZOLA 3L3IA 5DFWH 2EEDA 3TO4B 4L1HA 1MLCB 4NKOA 2YAQA 4IS6B 1UQSA 4MCZB 2VR3A 1K6QL 4UOJA 2IDCA 2R69L 3P30H 4IBZA 4WK0B 1D5BA 4WFHD 7PAZA 4XH2A 3SKMB 1ESOA 4ODHH 5DLMH 3TCTA 4AIZA 5JW5A 1IGMH 3I9GH 3VGGA 5I6MA 2OSYA 1NGYB 2CR6A 1TJHH 2MH4A 3JTSB 3OM3B 4OD2B 1FZKA 4YUEL 5HGAB 4XCFH 4WNQB 4G80B 1F11A 3J27A 1JGEB 1PZBA 4OJFL 3DNKA 1CFQA 3MGTA 5HJDA 3MFFA 3Q2VA 5IW1B 1VEPA 4U7KA 3NN8A 5GQBA 3MV8D 4JGJA 2XWZA 3C9NB 4DP5X 2HFTA 2IPTL 4PRHD 3S0PA 1R5VB 4K5NA 1N26A 3I9PA 1E8YA 4PW3A 1CCZA 2PO6C 4GMTH 1MWAA 1RSFA 4X5LA 1HHJB 4JG5A 2H1XA 3KPSE 4IRJD 4N8VG 3U4KA 1UB6B 2WVTA 5FGBC 2EVJA 3WSQL 4Y2DC 3TASA 2WQAA 4ERSL 4IIQB 4TRPL 1BAWA 3OKYA 2MJWA 1WWCA 3TCLA 3QEQD 4Y89A 3GXNA 2YSSA 2YD2A 1CE1H 4PJIE 2VLJE 5I2IB 5IROC 1QOKA 5B1JC 3DO4A 4BUHA 3CFCL 4WWPA 3ZDXE 1EEZA 2FQFA 2QADC 3UTOA 4QRRD 4ODVH 2V3FA 1RLWA 1KENL 4NB7A 5MEPA 1V7MH 2B5IC 2IV8A 3QE5A 1M56B 4P5MB 4ZAKD 3LHPL 3NGBC 5I1HL 1N18A 1X4YA 4OIIL 5CSBA 1E6OH 4BKSC 1OF2A 2ITFA 4QHLB 2WQRA 2YEZA 1H9DA 4XVTL 4YE0A 3TYFA 5IJCC 2NUPA 3KYNA 3T0XA 1CFNA 1BIIA 4NZJA 1PZAA 4XWOC 2H8PA 3HAEA 4LSVL 5GRYA 5ICUA 1ED3B 3L1GA 1GJIA 1G7MA 3QNXA 1ZGLA 4L1TA 3LJ3A 5INCB 1MIMH 1X5KA 1D6EB 2XSKA 2BS8A 3V0DA 1UQSB 2BSSB 4MCZA 5AEAA 1M6UA 2JSFA 4IGBD 5J13C 1H3UA 1TZOA 2NZ9D 4QCIA 2YAFA 3PUUA 2E6PA 1UVQA 4X9IA 3AGWA 1B4JL 2ATAA 2UYLA 4R4ND 2YC1A 1VSCA 1ZA3B 2OMXB 4HU8A 1AGCA 2CO1A 4LL9A 1XCQA 3TA3C 3U7WH 1OPGL 1T4KB 3QDMD 4MBOA 3GRBA 2KL6A 3GKWL 1D5MB 3L4VA 3MJGX 1UWGL 3RAJH 1UOLA 3GKWH 3FQWB 3BWZA 2J5LC 4HIHB 3HC3H 1T22A 3LPWA 2QLYA 4A2LA 4J5VA 2ZUYA 1BXVA 3KMDA 4HGWA 1ZVSA 1S9VA 1SN2A 5LXGL 4XNUH 4TQEH 2ICCA 1W0VA 3CHXA 3SGJA 3QNZA 2O5ZH 3E8UL 1WWAX 4X6DE 4IBQA 3H9SE 2Z4TA 6PCYA 2O6FA 4LDCA 3ULSA 1I8MB 4LHUB 1NC4A 3IFOA 4LCWE 1X9RA 5IEHA 3BPNC 2R0WL 1TYRA 3WAKA 1M6OB 4OJEH 5F1KC 2OCJA 5IG7B 3NZHL 4N0UE 2XU9A 4O58L 4XMWA 1XGZA 1CDIA 3LRSA 4KQ3L 4NQCB 5A6IA 4LGRB 3S36H 4YH6A 2YD1A 5KSVB 4DGYH 5ENWB 3C5SA 5CJ5A 2VDPH 5K1VA 3C8KA 3CHRA 4MA8H 1S9XA 5IIEA 4DESA 3BZEA 3OF6A 5HHNA 3W9EB 2CDEA 4ODXB 4Q14A 5D7IF 1JD7A 4JO3L 4MD4B 1N59A 4WW1B 3MYJA 1GYCA 1D7DA 2D7NA 4ALAH 5CGMA 1FYTE 5JZ7D 1IC7L 4YEEA 3VXSD 2FEDD 2ZWSA 1YNTF 4LCWA 3EH2A 2V17L 5H4YA 4UU9B 4WTZA 1HYSD 4P49A 4DK6A 2W92A 3B56A 1AC6A 3H9HB 4WWNA 1AO7D 5CD5D 5HHVH 4HOZA 5EIIA 5JNYA 4HIQA 3G6JB 4GLRH 4I85A 4OGAC 5EOCH 1FAIH 2VH5L 1ROCA 5I75B 3QYMA 3EO9L 2BLFA 3KXFE 1NCTA 5LGHH 3U9UA 3NRFA 4UV4H 1PSKH 1E5UI 3BYYA 3UZQA 1ADQA 1WZKA 2VRQA 2FQDA 2ODHA 2Y6TE 4A39A 4C4UA 3FTUA 3W82A 3LXCA 3WJJA 5KEZA 4P23B 1I3RB 4HSAC 2P45B 3QIBA 4K7PY 5D7IB 1Y1UA 3T8XB 3LKQB 3VXME 5T1MA 3TFBA 5BV7C 1BG9A 1CN4A 2DQIH 4MXWH 3OAZH 4MZIA 1HYRC 2KDGA 3BAXA 4Z7OB 5HBBA 3O6MH 3X14A 4A7SA 5JHLH 3FQTA 1WFMA 1MREL 2OW7A 4ZS6C 3OGCA 3F7VB 3JWDC 5J1TC 1K3IA 1KV7A 3U30B 5IBTL 3MUZ1 2QTVA 1NFAA 1A4KB 4LHQB 1DUZA 1P4BH 3OG4B 4TTDC 4JM2F 4MNGA 4XMKH 2CXGA 3VFRB 3O9WD 1EGJA 3UBXA 4RNRB 1GR7A 4XCCL 5IVZB 3BPOC 3IS1X 1WICA 1M6OA 3QAZC 5IG7A 4YHMH 2WBWB 2HVJB 3ZE1F 4GMTL 5I6LA 2Y2TA 4NPJA 4RX4D 4RVBA 5EUOB 4XNQA 1PS3A 2PR4L 4FKKA 5JLZB 3SQOH 1MCHA 2D7QA 1HXYB 1MDAA 2R2HA 3LZFL 1VKXB 1DFBH 2DWDB 1PKQE 3CN4A 2YD3A 4XVUD 5DHYA 1IBHA 4GJTB 3DI3B 4JQIL 4AE0A 1TKWA 3H3BC 2XN9B 3OJMB 5K9JL 2AFNA 1P1VA 2CQVA 1ZEAL 3MV7A 3BX7C 4Y1AA 1GGCH 5ELIA 1P5UB 4BDVB 2BFVH 1UT9A 2BHZA 3SGEI 3SYPA 2R1XB 1I1YB 2X87A 2NSMA 4UIKH 5F3HA 5ESQB 5MHSD 2XFXB 5ADOL 3Q6GH 4RZCA 1K5NB 3FH8A 4WEMB 2B0SL 4TN9A 5KJRL 1KN4H 3CZUB 4KXAA 1IE5A 3S8WA 5HDBE 3ZE2E 1SYVA 3CG8A 1KPUB 4HKBB 3DHPA 1NDGA 1XF2A 2H6UA 1S46A 3WKPA 2WC7A 4QTIL 5I73B 4FQXB 3ULUE 3S3DB 4V2CB 4FABL 2CCWA 4JDZB 2ZWLT 1U8KA 5F3FA 4MASA 1PZSA 4ZSOA 2XCMC 3P0GB 3Q06A 3ARGC 2WXMA 5CUSH 2WLKA 2CBPA 4Y0GA 4PN6A 5AG9A 3UO1L 1N7MH 2FYYA 3GEFA 4AE1A 4GAJH 5BUPA 5FOJA 2H1LM 3LIZL 4QXUH 5J6GA 5AAWA 2IANE 1TTBA 2XQ0A 2BNQB 2BOLA 3DV4B 4KX8A 5GGTL 5BVJA 5D96B 4BE6A 3TH2T 3F5WB 1Y0LB 5I73C 5ISZA 3B5GA 3ZXAC 1UM6H 3AQYA 1ZT4B 5IM7A 4TLUA 3D2UA 2JK5A 3KPLB 3MLTB 1DCEA 4GH7B 3VGBA 4M62L 1TETH 1MFBL 2WBJA 4GAAA 4Z7VA 4H20L 4N85A 4P2RE 1OPGH 2PW2B 3DTXB 2SODB 3RX8A 3SPGA 2V8LA 1KBGL 4MQ7A 4R83A 2YKLH 1BFOA 2GI0A 3B7TA 4XO4A 1XXFC 3ZZQA 2DQEL 5TFSH 4DIXA 1U2YA 3GBLA 5LBSH 2J8HA 2C1OB 4UV4L 3R7QA 3DO7A 3F00A 4YXHH 3C6LC 3U4EA 4Q9RH 4KRMB 2ZG2A 3CK0L 2X28A 3ME0B 3MR9B 1JGUL 4YXHL 2NSQA 3RX5A 4EI5D 2ILLA 3QFJD 1AXIB 4PGBB 4UNVA 3ARYA 4GP5B 2AMGA 2FD6L 2BC4A 1QRKA 3KM1A 1VADA 5EO1A 5TH2A 1HKLL 3MRRA 4OD3L 3T3PB 2JQAA 1JRHH 2IWEA 1CG9B 3C5XA 1HIML 1GGTA 5GZND 3IE9A 3K4AA 3GSXA 3NP3A 2V7HA 3EJSA 4KKAD 2APWA 4G3YL 4LQFL 3VXUA 3WDIA 5I1LB 4NUMA 4YDZA 3WGUB 4XMPL 3HVNA 3RJDA 2HX7A 1HDMB 3VXQB 3PABA 4L0PB 5MERB 2CJUL 3D39B 5A6MA 5I28A 4MNHB 3S9DB 3QJXA 2IPUG 4FULA 4LLWB 5DK0A 4S1QH 4B9ZA 4X4YB 2D8KA 3H3PH 3O3EA 1X6NA 4FOMA 1IV8A 1XF1A 5DS8A 4LLMA 4Z7VF 1AOZA 1YMME 4Y7OC 3GBEA 3O2VH 1XGYL 4YQXH 2FZ3B 2A77L 3TVMD 1ZVNA 4JG9A 2CO2A 3DOSB 2BWDA 2ZXAA 1JP5A 3I50H 4WI7A 3UTSB 4UQ3B 2B1HH 3VI4A 2VQ4A 5H37A 5HVWA 5GGTA 3PV6A 4X9BA 3CVBA 4XHJC 4GG8B 4PJ6A 4DKFL 2VZSA 2ADJA 3SPVB 2DQTL 2G3NA 1A9VA 2W59A 2Y5QA 3GJFA 4YHOH 3B4NA 5D1QC 4HCGA 2IH9A 3DJZA 2ZYHA 4WU7A 5ERWA 2WWMC 1BVLB 4NQDD 4MQ7B 1BQRA 2GC7C 4FFZH 4BM7A 2EYRA 5FGSA 4NFCA 4DEPB 4PGZA 4Y4KC 1MXDA 4TMPA 3G6AA 3OAYK 3SJVA 3CZKA 1JPSH 2IADB 2GTWB 3F62A 3LNIA 4OD1H 3MVSA 1FL6B 3JYCA 3SKJH 3N40P 1RURL 5KS9A 4JRYD 3N41F 1HAUA 2HJLA 2APBA 4GSDH 3DO7B 3VD2A 2HVKB 3HC2A 3RWDA 1RXLA 2XBTA 2IALA 4XWGL 1KUMA 4JPKL 4YIQA 1KYDA 2WXJA 3PV7A 4WF7A 5G4NA 3D52A 1H3VA 1KCBA 2WO3B 3HLAA 3B7RL 4PY7A 1XCTB 3HS0A 2F8XC 4HJIA 1NGQL 5EBWB 3SE9L 5D4QA 2VLRE 4ZX3A 1KCLA 2AV1B 2YUWA 3EO0A 4J4PC 1B9ZA 1KT2B 3VWJD 1DLFL 4WEUD 2B20A 3K4ZA 2IJ0C 2ZWZA 4Z8FH 2UY6B 3VDAA 1RQ5A 4AMKL 4ZDHA 2ZUWA 2X9ZA 5ICXA 4H20H 4RH4A 1S7QB 1J9TA 2IG2L 2YPLE 3QPQC 1OP3K 4GFTB 4FNTA 1NICA 2UZPA 2XIBA 2ZJSL 1JBJA 3O4LD 1T1WB 1QUNB 4AL8C 3A22A 4H0IA 4IU3A 1GMIA 2HWZL 3OJDA 3QQ9D 1A14H 3DVGA 2OS7A 3D2UD 1A14L 1IIIA 2L7JA 4JFOB 4KRNA 4NO2B 2OFQA 5KOVC 1HE8A 1XH2A 3LEYH 2CKBL 3LKNB 3MRLB 4HMCA 4ZXBA 3VCLA 2BRRL 1F1GA 4FHJA 1Z3GH 1MFEH 5C07D 1LNUB 5EFIA 5B4MD 4AEHH 1KPRA 3TIEA 4LQ1A 4WHTA 3JTBA 1NUNB 5JTWA 1KFAL 3RX7A 3MRKB 3U9PL 3JV6A 4Q74A 1RIUL 3EJYC 4HUKB 4XPGL 5T3ZL 3VWKC 5AD0B 5I6NA 1O7SA 3WKML 5ETUA 5TE4L 1OOAA 5FUZH 3AREB 1AG0A 1BBJA 2ENSA 4FL4C 4HD5A 2OZ4L 4KGJA 4TNEA 1HHKB 4M4RB 2DIAA 3QDJE 4MAUL 2GJZA 1URLA 2R1WA 2C3VA 2X1OA 4D0DA 2Z1KA 1BQLL 2ZXBA 4AVHA 2J4WH 5C09B 1KC5H 3CXHJ 2WUCH 5HHNB 4ZW8A 5L8JB 4WI0A 4X0KA 1KEML 3UTQA 1FV1B 3F7PC 2H6OA 3DUSA 4L8SA 2P47B 4HUCA 1OAZL 5H2BA 4NERA 3REWA 3I6KB 1FGVH 5I0YA 3HN5A 5I71C 1PZ3A 4WUUE 1ADQH 1A1MA 3QJQB 3SPJA 3D33A 3T8MA 1H3WM 2DLGA 4LSPH 1P69B 5I17B 5L7XL 3G5XA 5D7LE 4JHBA 5E9AA 1A4CA 4ZUVA 1GC1L 1KBPA 3AQZA 4P59H 2E75C 1CT8B 3GSNB 5F9OL 1UZ6E 2AJYL 5LBSL 5DUML 2ZKHL 4M93C 4U1IB 4QF1A 3NABL 3HE6A 4J4PA 2A6DB 3QFDA 4IIQC 5KVDL 5BS0D 4HUWB 4NBYB 3ARBB 4W9EC 1S7QA 2XJLA 4K5PA 4YLCA 5DJXB 1AVAA 1E4WL 1OSPL 3LKPA 3MLXH 4X6BA 1NDMB 4CADB 1BVKA 5F9JB 1IJ9A 3QQ4B 5I71B 1TJHL 4GG6B 2WPGA 4OZHB 5ISZE 4NQEE 1WFJA 2VDLH 5F7FA 3VGDA 1MCCA 2X09A 2AP2A 5HGDB 4L8DA 1BMZA 1MH5A 4HIXH 1F4YH 4PLJD 5EU7C 3D51A 2XDHA 2GSIA 3A6BL 3N42B 3MUUA 4X6DF 4Y8DC 1GZQA 1ECYA 1URIA 4X4MA 4YSQA 5C9JB 1QWUA 4DQOH 4QRPE 4QLRA 4MJ2A 4DGVL 2OMZB 2CBMA 3N1MC 4XI5D 5HHMD 3BSZH 4OF8A 4JREC 1EA9C 1P84J 5DRXA 5T5FL 4UZSA 1RZFL 1QEWB 1LE9B 3FAWA 5I8EB 5D1XB 2EICA 5CCKL 4MQSB 5DD5H 1MFNA 1FZMA 1C7TA 3O3UN 1N70A 4UBDD 2OBGA 2YEZB 4PU2A 3K6FA 4MCYA 1KIQB 3PL6C 1YEFL 5E6YA 3U0TA 3UTQB 4W9LC 4U1KA 3IDXL 1YEIH 1T2QL 3N43B 4XVJH 2YZ1A 4N90E 1CL7I 4X5WB 3RWEB 4ODVL 4YMPA 1KN2H 1H0DB 5ESQA 2WZPA 2HXAA 4MNQE 5KWYC 3C75A 5CP3A 2HP4A 3HHSB 5DQDH 4KI5F 4DH2A 3DO3A 5LWYL 4XPBL 4QCIB 2DD8L 3PGDA 1A8JH 7TAAA 4F7TB 1A9BA 2YBRA 4LVHB 3QUZC 1BBDL 5BQDA 2Y1VA 4M8QA 5G2NA 5B38A 2B5IB 1CMOA 1L4IA 1AY1H 2A6DA 3QFDB 1DBJL 4UT7L 3U1SL 1IC5L 3BVNB 3SE3A 3APMA 5FWRA 1Y6KR 3FBQA 4Z7QF 5DVOA 4YSOA 2VLKB 3PWPD 2YD6A 4HZLB 2WLIA 1ZCRA 4WO4B 1XIWA 2Z92B 1MFDL 4R97B 5JPNA 4LBEB 2MMXA 2MRYA 3GJEA 4AQEB 2C7UA 2VR8A 2ENJA 1GW0A 4UMGA 4BFOA 4UQAA 1WA2X 3CBKB 2FEJA 4HP5A 4LXFA 2F61A 4PTTA 1M2VB 3DVNA 4JHZA 1PYWA 2YRZA 4NN6B 3L3KB 4YR6A 3ZZSA 1FN4A 1CDHA 3FO9B 4MTMA 1TCMA 2Q76A 4U3HA 3WE6A 4LSUH 5KSVA 2OXHA 3V4VA 5JW4Q 1BSIA 3KPOB 5DZAA 1QD0A 1CF8H 1C5BL 3ZE2F 4ZD3L 3ORJA 2YMOA 2GEEA 3V0VB 1AGCB 4YBLC 4X5QA 1DJXA 3HI1A 5CM1A 3WNPA 5BCAA 2ORBL 5JHDB 3L45A 4KGLA 2UY7B 4J1UB 2ORBH 4HK3J 2R29A 2JCCA 5DI8A 1OP5H 1JCKA 3B9AA 3MACL 1MEXL 3BT0A 1QW8A 3I6LD 3MNZA 4P5RA 4PWKA 2ZKWA 2ICWB 4MMXA 2NXYD 1O0VA 3RZCB 5T3ZH 2YUVA 4QXGL 4O58H 5DTFA 1I9RH 4XXCA 1EBAA 3WHE0 2B3RA 1MWAL 2FB4H 4JFSA 4IEFA 1MW3A 1L9NA 4OLZL 1MG3C 4R7NA 4ORGA 3QRFM 1QBMH 2VDLL 1P4LA 2V7HB 1A6ZB 2QBWA 3EW3B 4M5SA 3BIKA 1F4YL 1C5DA 3APNA 3G9AB 5HHXL 1K3ZA 1HI6A 4JRYB 4PRIB 5F0LB 4BEIA 3LQAC 3S5LA 4KUCD 4G43A 3PHOB 3ENEA 1KYAA 3G5WA 4S1QL 5EZLB 3FXIC 1DVUA 2X2JA 3B5HA 4G11A 5CO1A 4AGMA 3QBTB 3HG1E 1J8KA 1EXUA 1OGAE 1XEUA 3QCVH 2BNRB 4HWEL 4ZPVA 1TR7A 2LAAA 2BY0A 4FG2A 3HRZB 4W4OA 4IKJA 2IAMC 4NQDA 4YHPA 1DVFD 2O93L 2DM2A 3MROA 1FG9C 1HCZA 4IQHA 4LVOB 3IU4H 4IRZH 1E67A 2DQDL 1FO0A 2C4FU 1QSEB 3DTUB 3ZYIA 2DQDH 2JKSA 4C83A 4UQIM 4OBSA 2HJFB 4PJ5E 2WNXA 2VR9A 4TVUA 25C8H 1W8NA 5L2KA 1SY6H 2XTJB 5IMMB 1U95B 3WG7B 3MRPB 4NQXA 2XFGB 3HG1A 4XI5C 3SBWA 4BK5A 1DP0A 1H8NA 2A99A 3QZWB 1H3XA 4XPBH 3I6SA 3A23A 1LP9E 4CC4A 2V5RA 4GMSL 2DDQL 4AI7A 3T0EB 5GRUH 3VFTB 1E9QA 5A16A 4Z0BL 5LHDA 1IT9H 2Q20A 3IWUA 4OUUA 4DP0X 2ZP8A 4POYA 5GJTL 1ZE3C 3ETSA 2VW7A 4O9HH 2FX7H 4YDLC 3HE7D 5J7CC 4FQXC 2DLHA 3PWPA 5D2LB 4UT7H 1VFBB 1PNDA 1U8JA 2KDYA 3FB6A 4KQ4L 2VR5A 1OALA 3MNWA 3NCXA 5CZXD 2JCCB 4X8CA 3STZA 2FBJL 3ZL1A 3GIZL 1JPTH 5KVFE 1YJDL 1OIOA 1EH9A 4F7PB 5DMGD 5F7UA 3ZE0E 5DJ2B 1X5YA 1T2JA 4BSWB 1BD2E 1GY1A 4MVBD 4TTGA 4OM0H 5A7BA 1EK3A 5HY9A 4FQ1H 2WB1A 2H0FA 2UXTA 4HKBA 1O6SB 1SFHA 4GSUA 1DJZA 2J8OA 5FFOA 2OZ4A 1UD6A 4QHPA 5E8OA 4MB3A 1BCIA 1E65A 1FVEA 2EKSB 2HWZH 2WKLA 2J44A 2AJXH 1D5IL 5GGRB 2HFFA 1A7NL 3ESPA 3X13A 1NGPH 3SE8L 5IREA 4B0MM 4NKDA 1A7PL 4S1SH 1T3FB 5C0FB 5JOFB 3WXVH 3CD4A 1SJEB 1I7ZA 5PAZA 1HOCB 2R2HB 1EZVX 5GS0D 1X5AA 4P3CL 4XE5B 5GS0H 2ODIA 1PJ9A 1MAMH 4X7DC 4ZRGA 3ZDXF 5MEND 1FBIL 4FI7A 3FN9A 2BY1A 2CO6B 3U9PH 4HOXA 4F9LC 2VDML 1IBGL 4K9EL 4N0RA 3MLWL 4NKIL 5KZCD 2VDOL 3ILPA 1HSAB 3CFKB 5E8NA 3LEVH 1BWWA 4Z77A 1I9RL 3ISWA 3KG5A 4GIPD 5J89A 3ARUA 4P2OC 3U1SH 1JNHA 4MA8L 1LE5B 4JM2C 2G5BB 5C0AA 1U3HA 5I1JH 2WBJD 5JXAL 2XI9A 4KX9A 4W6WB 1D7FA 1AYRA 3O4OC 3PQYE 1Q9OB 2Q6WA 5FF6B 2PWDA 4A7UA 5A43C 2LW3A 5I75C 1UENA 3M88A 3MV8A 4L3EB 4XNMB 4WVRA 2BSCA 4NKOB 5DRNB 1A25A 5E2WL 4GI9A 2N0KA 4J4PD 5C7XL 1ADQL 2OMYA 3RJQB 4UT9L 5DEFA 3CFEA 3AADB 2Z4QB 1XGUA 3L95B 5C2BH 3JV4B 4Q9QH 2HPOA 4LCWD 4DZ8B 5JPMC 2NXZB 4JFUA 5IJKA 1T5XB 3MBWB 2LFEA 3JBG7 1AQKH 2AK4B 4AGQA 4ZW6A 3HS9A 1J0YA 3CDFA 5D8JH 4H8HA 3RHWF 1UA3A 2FH6A 2CRYA 3P40A 4OFVA 2UZXA 3CDCA 1G94A 2A9DA 2IH3A 2HCZX 3BP4A 1MCKA 3NG5A 4NT6B 4HWUA 4ZMVA 4P2OB 2ZOKB 1TQSA 4H8WC 1J8HA 3AU1B 1T0NA 1Z9SB 1VFMA 4HIJA 4AW7A 4JFWA 1O6SA 4F57L 1ZA6A 2QKSA 1KXVC 4MLIA 3GMMA 1P4UA 4YHNB 1HKLH 4G5ZH 4DUVA 3L2NA 5MP6L 5GRZA 4WFFE 5I6KA 3MLYH 3RB5A 4OFIA 3PFUA 4U1NA 5L0QB 1H3TA 4X6EB 4G59C 3FSAA 1VHPA 5D4HA 1ZKAA 3C6LB 4XB3A 3KM2A 2YAOA 1SN5A 2WP3T 3LSOB 5FYKH 4UUJB 3MA9L 5TDNA 1DDHB 4HFUL 3VX1A 3HZKB 5B8CB 3CHOA 3K2MC 2CO7A 1TJGH 1QBML 3RWIB 3B7UX 5IF0B 2Z7WA 1CXLA 2FL5B 4JFEE 1TVDA 3EOTH 3OHXA 3L1OL 2AZAA 1KGCE 1SM3H 5IGXL 1BMGA 3NJVA 1Z5HA 2GUOA 4G8GA 3PJSB 1Q0EA 3IXAB 3BUIA 1U3YA 1HSAA 1JF5A 3RU8L 3VFPA 4NI6A 3P4NA 4XMLL 5BPPA 5IJBC 3HIZA 4L4TB 2OQJA 4MMZC 1CFTA 3FYEB 2AW2A 3I6KA 2ENYA 4DP4X 4MA1B 5JIHA 2QSCH 4JZNA 5CP3H 3WEXA 1OAKL 1TQBB 4LOUC 4P57B 1I82A 1ZJBA 4HKJA 2ROYA 5SWSE 1OAKH 3MKKA 3HG2A 3EXLA 5JHLA 4TUOA 1AC0A 1MFCH 1QFUL 5EEUA 4HEPG 3QDHA 2C9RA 1ZLVH 2NQDA 4AOFA 3EJJX 5FA3B 1OLLA 2QLVB 4RDQF 3E6HB 1GGIH 4GS7C 2P8PB 1R3IL 4HGMA 4UDTA 3JUYA 3H54A 2ZCLH 4IJ3C 5E1AB 1LGVA 5DHEA 1CXFA 2E0PA 4P3WA 4P3CH 3QHFL 1ZHKA 4HWBL 4M5ZL 4WKZA 5JYLA 7FABH 4XT1C 4NDMA 1F3JB 3PAVA 3D48R 3R7RA 5E70A 3AY2A 3ARFC 5EBLA 2IPKA 2VC2B 3T2LA 1ZLUH 2CAKA 5F97E 2F2HA 3R4DA 3X1BA 4Q0XH 2NDFA 1CR9H 3PWVA 3CHSA 4PJIB 1G9NL 4EI6B 5B39B 3IMRA 4HIJB 4Y4KB 2WCPA 4HOWA 1WZ1H 5GHWL 3EGXB 3NCCB 4HJGA 1BPVA 1QFHA 2XWRA 4X98B 5DS1A 1QTYT 2BY2A 5C0ND 5IMKB 4ZXBD 3FO2B 2GPZA 1O7DE 4EI0A 4WW2A 5J11B 5E2WH 4PFEA 3TM6A 4UQ2B 3BN9D 4P4KB 1CFSA 4GAGH 3LKNA 4AIEA 1N0LA 4FYQA 2CLZA 3SDCB 3TJHD 3WUZA 2L7EA 4QT5A 4JFTA 4CW1A 3X3GH 2YIHA 1BQKA 3KYAA 3RVWD 5EUKB 1OAXL 4M48H 4JPVH 3F12B 3FRUB 2WMPB 4B6ZA 3BUBA 1FHNA 4MMXC 3S88L 1KLFB 4DZBA 4NUQA 1PAZA 2HFGH 1YNLH 4ETYA 3ARQA 2CLVA 3W5MA 4N2EA 5AL0A 3NFPB 2BSDA 3EYVA 3LYRA 1MHCA 1XQ4A 3ALXA 3OAUL 5I5RA 2UY6A 2EIDA 4X5WA 3RNKA 2FEDC 4L9LB 2Z91A 4BH7A 3LD8C 5GS0L 1EDQA 1OB1A 1DDTA 1HEZA 5C0BB 2I9LB 2VUKA 4HHGA 1FL3A 4ILDA 1IVLA 4N2IA 4X7TA 1RIHL 1OAUH 1JI1A 1VZIA 2KZBA 4P46C 3T77B 5CBAA 1WS7A 3GSUA 4P4KD 2WYZA 5F9WC 2OTUA 5C0CB 3CXFA 5SWZA 1X5IA 2XWBB 5FYJE 3QIWB 3CBRA 3FFCA 3MA7A 2X1QA 4WNQA 4XPFH 1JGEA 4BCXA 4KVCH 3TV3H 1AHWB 3IMSA 2IPTH 3ZIYA 7CGTA 1F41A 3TN0B 4JQVC 5HVHB 5L4MA 3ESVF 1TQVA 3SD2A 3SY0B 2VAAA 3JT0A 4YL4A 1UVQB 2DKUA 5JXED 3F85A 4FG0A 4HWEH 2EEXA 1PZUB 5F7HA 4AEEA 1KELH 4U2ZA 5EEZA 2HRPH 2XQBH 4EDWL 5CS7A 2YFOA 1RUAH 4LLYB 1HH6A 1D5XB 3FZUC 1AI1L 1FL5B 1JUFA 3EDDA 4LARH 1UA7A 4LSSH 3HRZA 1SY6A 3PNRB 2FECL 3R8QA 3D3VB 3HNSH 3OMAB 4X6BB 5KSBB 5KVGE 1GGUA 3COOA 2FGWL 4POZD 4PJ8B 5TQ0H 4QRRA 2MNJB 4DQAA 4Z7UE 3QR2A 3X3FH 3EYQC 5KJ4A 3N1GC 4BZYA 2WLYA 4PJGF 2X6MA 4PJDA 4XCEB 5DA4A 1G9EA 4J6RH 3L3KA 4Q6IA 1U58A 3P4MB 2AHIA 3SDCA 4PP2A 4L8BB 5SV3A 1W80A 5ITFA 4FI6A 5KAQG 3M7OA 2B7DT 4DF9A 2GJ6E 4KK9D 5JA8B 1FA4A 1FNLA 2FQEA 2VWEC 3QJOA 3JTSA 4OD2A 2Q7YB 1AKPA 5K9KB 1ZK5A 1PY4A 3V79C 4N2LA 5L9DL 2CU9A 1HXYA 2FJSA 2AEPH 2DBLL 4KKCD 3WJLA 2XZCL 2W07A 3QZNA 1FFPB 5DI8B 5I19H 3NN8B 1E9QB 1PDKA 2VZUA 3UAJD 1MPAH 1TPXB 1ZS8B 3HN8A 3CFJA 3MO1A 1Q9WB 1YECL 2BZ7A 4MXVE 1A1NB 3VFUA 3HC0A 1SYSA 1U8LA 3M46A 3KPSD 4UTBA 2BP0B 5IFHL 3VU1A 4ZMNA 2YPVA 2P5WE 1B0GB 2LVEA 1CBJA 4X7SH 3BN3B 1FL3B 5IJDC 1D9KD 1EMTL 1N0XH 4NQUA 3HPJB 4NQSB 5TGBA 5I1DB 4HG4K 2YQ3A 5KSAA 3CHQA 4TSCH 4NRYA 3UFIA 3QS3A 5C0RL 2A6JB 1RULH 5L88H 1RZ7L 4LGSB 3GO1H 5FW8A 3WIHH 2CPCA 3EO1B 4AZ8A 3EH4B 4ZPVB 1QHQA 4GS7B 1G9NC 3RTQC 3MV7D 3LDBB 1GTNA 5HDQL 1N4XL 1JZJA 3G5ZA 2WNKA 3T2PA 1DCLA 1RJYB 3FT2B 4JO1L 3BIBX 4NQDB 5DEZA 5C70A 2GC4C 3EJPA 2JIXD 4LFHG 3UIZA 4PG9B 3WTWA 2JJSC 2VXUL 1LO0L 2CWRA 2HRGA 4N5UA 4OTXL 5DQJA 5AKSA 3CPLA 2NUTB 4PREA 4S2SB 5A2AA 4KY2A 5AALA 5EB9A 4IBSA 1AFVL 1NC4D 1WZAA 2CCVA 1QVOB 3OAUH 4GW4B 3CN1A 4QHNA 4LCUB 1UFUA 4A04A 3KZ8A 1HL9A 1YO4A 5D1XA 2X40A 4HIPA 5BV7L 2MCG1 5I6XC 1TTCA 4UT9A 5I24A 1WG3A 2MOGA 4NUJB 4BFJA 4JM0A 3EZ8A 4P2QE 3QARA 4HCRA 5EUOE 2IWKA 2F8IA 4WHCA 4JFXA 4XAWH 4XMUA 4ZUUB 3E3QE 4MAYA 5FW6A 4YXKH 5KYUA 5HSF