3IBOA

Pseudomonas aeruginosa e2q/h83q/t126h-azurin re(phen)(co)3
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
b'AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLHLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Relaxation dynamics of Pseudomonas aeruginosa Re(I)(CO)3(alpha-diimine)(HisX)+ (X = 83, 107, 109, 124, 126)Cu(II) azurins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transport protein
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3iboA00
2Q5BA 2XV0A 4HALA 2ZWNA 3MBWB 2XYBA 1ASPA 4DPBX 1HAUA 1GS8A 1KCBA 1JXDA 3QQXA 2I85A 3V9EA 4UF7C 2BP0A 5AZUA 1MZZA 1NICA 4HCFA 1SF5A 1TEFA 1EHKB 1NDTA 3UACA 1ADWA 1IKOP 2PP7A 1A8ZA 4A2HA 1E5YA 2IDTA 1W6WA 1M56B 2ZONA 1KV7A 2VN3A 4DP1X 3WNJA 2OV0A 1ASOA 3QJUB 3T6WA 2PP9A 4QLWA 1J9QA 1KYAA 4A67A 2HXAA 1V10A 3T71A 4F7KA 2VSMB 1E67A 2GC4C 2H47C 2IH9A 1RKRA 1CUOA 3OMIB 2YXWA 4BXSV 2I7OA 3CVDA 4ENZA 1WA2X 1PAZA 2YXVA 1JZFA 3QJTB 1V55B 3WKQA 4E9RA 2VM3A 5D4JA 1F56A 2DYSB 1ASQA 2EIJB 3AG4B 1ET8A 1V54B 4G7RB 1WS8A 3BQVA 3SBRA 5AFAA 4DP5X 4BWTA 2BW4A 2H5UA 1WAEA 1W8EA 3UADA 1JOIA 2DWTA 5B1JC 1L9OA 1CURA 2AANA 1ZDQA 1AACA 2XXFA 3QJVB 2MTAA 2WO3B 2UXGA 2ZOOA 3IBOA 5B3SB 2UXTA 3D12B 1IUZA 3X2QB 3EH5B 3FYEB 3TBBA 3OD3A 4Q89A 4TXVB 1L9PA 2YQBA 1OCZB 3UGEA 2IDSA 2NRDA 1SNRA 2E86A 1BQ5A 4A68A 3TBCA 3ZX1A 5I5JA 2IAAC 1PNDA 1VLXA 1L9TA 4YSTA 4Q8BA 1OCRB 2EINB 4KOBA 3X1GA 2YARA 1BXVA 1AZCA 2PPDA 4CSPA 3ABMB 1XMEB 4KNUA 1JZEA 2ZXWB 4AZUA 1R1CA 2UXFA 4M3HA 3NT0A 4YVUA 3FQ1A 1BEXA 3UAEA 3FQ2A 1J5CA 1BXAA 3H56A 1CYXA 2TSBA 2UXVA 1ET5A 2AVFA 2FT7A 1GS6X 1TKWA 2UX6A 1SF3A 3NJJA 3NJFA 6PCYA 2MRYA 2FTAA 1ET7A 1UATA 4PAZA 4G71B 2IDUA 4DPAX 5B7MA 2QPDB 1NIAA 4KO5A 2AZUA 2PP8A 3IE9A 2BZ7A 5B1AB 4DP4X 2IWFA 1AS8A 5B1BB 2QDVA 2EIMB 3NJKA 3WG7B 1GS7A 3ASNB 5AKRA 3DTUB 1NIFA 3U25A 2AZAA 4A2EA 4BXVA 4AI7A 1OV8A 5I6OA 1MG3C 2B08A 5D4HA 4YVNA 3S8FB 1JXGA 3X1EA 3V9CA 4GY4A 4JHVA 2P80D 3PAZA 4DP0X 2LLNA 1AIZA 1PY0A 4GYBA 1AS6A 3T6ZA 2HX9A 4KNTA 4E9XA 2DY2A 2XUWA 4GXFA 3H4FA 1PMYA 7PAZA 2PPFA 1A4AA 1A4CA 2PPCA 3PAVA 2I7SA 1PZCA 4UANA 2DV6A 2BWDA 2EILB 3C75A 1AS7A 2IWKA 4DP9X 3H4HA 3MX0B 1PLCA 1M57B 1MZYA 3FYIB 2PLTA 1JERA 1TEGA 2OCCB 4A2DA 5E9NA 3AW5A 4MFHA 4KO7A 2FT8A 3JT2A 1KDJA 5I5MA 1ID2A 2HRGA 2HLEB 3AG1B 3CVBA 3FU8A 3ZBMA 5I28A 4F2FA 5I6NA 1J9TA 5B1JA 5I6MA 2QT6A 1FFTB 2FNWA 4BDVB 2VMJA 3OMNB 2IDFA 2J5WA 3PXLA 2B3IA 2BZCA 3EF4A 1QHQA 4YSQA 1ZIBA 2DWSA 1L9SA 1FWXA 1XB8A 2XV2A 4KO9A 4N4YB 3T6XA 3FPXA 1AZUA 2BWIA 4YSOA 1JXFA 1N68A 2YAOA 4HZ1A 1BYOA 2HX8A 1NIDA 1PZBA 1T5KA 2XU9A 3FT0A 2R7EB 2XWZA 3PLYA 1ETJA 1AZRA 4DP2X 1JZGA 3HEIB 3TASA 3AZUA 1N70A 1ZDSA 5A7EA 3SBQA 2QPEB 2BO0A 2IWEA 3BVDB 4KNSA 4DP6X 2FQDA 5LDUA 4YSSA 2QDWA 4YSRA 2GC7C 3FSWA 1WA1X 2J55A 1NPJA 1MG2C 2Q9OA 3ASOB 2PCFA 3AY2A 3NSFA 2TSAA 1PF3A 1WS7A 3X1FA 3WIAA 5FC9A 2IH8A 1AOZA 2PPAA 3SQRA 3ABLB 3EH4B 2GIMA 4YSAA 3OMAB 4L0PB 1B3IA 4W1TA 2XVBA 3AG2B 1BAWA 3GXUB 1AAJA 4RH4A 1OOWA 4E9WA 1ILUA 4YL4A 1SHWA 4N8UA 2RACA 4BDVA 1BQRA 4G7QB 3NSCA 3WI9A 2XLLA 4G72B 1SDDB 1KDIA 1IBZA 2FT6A 4F2EA 5B1KA 4AKOA 2GI0A 1JZHA 2H3XC 2N0MA 4M4RB 3SBPA 4PCYA 1NWOA 4YSDA 3NJHA 3PAUA 1XB3A 1CYWA 1PLBA 6PAZA 2JKWA 1PLAA 1X9UA 3FSAA 1OCCB 4AKQA 1ILSA 1HFUA 2R7EA 3RYMA 3NJLA 4FAAB 1PNCA 4ZK8A 3WNIA 3ERXA 4JHUA 4HAKA 3NP3A 1BXUA 1GSKA 2UX7A 7PCYA 1A65A 4HCGA 2W8CA 1AZBA 4YSCA 1A3ZA 1SHXA 3G5WA 3FU7B 3EH3B 5F7BA 1OCOB 4KOCA 1SFHA 5TK4A 4AKPA 4QKTA 1NPNA 4UAHA 4HCIA 3EHBB 1HAWA 4YSUA 1RZQA 5PAZA 3FSVA 4A2FA 4WKXA 2BHFA 1NINA 1PZAA 2CJ3A 1XB6A 3NP4A 4GP8B 1BQKA 1FA4A 1JVLA 5TK2A 2YAFA 4A2GA 3NJGA 2EIKB 1SDDA 2X87A 4X4KA 2WO2B 1L9QA 3DKHA 1GR7A 3AG3B 3TU6A 2XX1A 1GY2A 2XV3A 2A3TA 1CC3A 1SFDA 5PCYA 4JKNA 2Y1AA 3QJSB 4WTQA 1AQ8A 4K9JA 1W6LA 2YAPA 3S8GB 4E9VA 2FQFA 4NAJA 2HRHA 4HIPA 1ZV2A 1KBVA 2VSKB 5I6PA 2CUAA 1DZ0A 3QJRB 4HHGA 2GSMB 1IC0A 1TU2A 1IBYA 2JFCA 3N2JA 1RCYA 4DP8X 1OF0A 1JZJA 1NIBA 5IY5B 5EHFA 3T6VA 3HB3B 1OE2A 3NJNA 1J9RA 3FU7A 3NJMA 3WKPA 4E9SA 4YSEA 3IN2A 5B7FA 2BP8B 2YAHA 3JTBA 2X88A 3QJQB 5I6KA 1NZRA 4E9TA 1SJMA 4G7SB 2VW6A 1AG0A 1DYZA 4KO6A 5F7AA 2WSDA 5ANHA 2YAEA 2IDQA 2XX0A 3NSYA 2YAQA 5I6LA 3OM3B 4E9QA 3S3CB 1E65A 5I26A 1AG6A 4BWWA 2CCWA 3CDZB 3NSDA 2DYRB 3GDCA 2VM4A 1EZLA 4E9YA 1JZIA 1X9RA 4P5RA 1J9SA 3CVCA 3CG8A 2W88A 3S3DB 1GYCA 1MDAA 2VW7A 4CSZA 1AANA 2CAKA 4BK5C 1WA0X 3IEAA 3NJIA 3OQRA 1OE1A 3X1NA 3GYRA 2BP0B 4HHWA 4P5SA 2FJSA 2J57A 2AFNA 4A66A 2OJ1A 3FPYA 3N55A 2YAMA 1RZPA 1A4BA 2GHZA 1AR1B 1J5DA 3KW7A 3FU9A 3ZDWA 3KW8A 4BWUA 3UABA 2GBAA 1NWPA 4NB7A 3T9WA 2FQEA 4YSPA 3FS9A 2J56A 5D4IA 1E5ZA 2CALA 1KBWA 3X1BA 2CBPA 2PPEA 2JXMA 1JVOA 1OE3A 1YLBB 3ABGA 1NTDA 2BP8A 2HZHA 3S3BB 2FQGA 3NYKA 1M9WA 1BYPA 1GY1A 3PPSA 4GP5B 2HX7A 2XXGA 1AZNA 4W9ZA 1GW0A 4AX3A 1KGYE 4DPCX 8PAZA 1E30A 1L9RA 3FQYA 1ZIAA 5B7EA 5I5IA 2VW4A 1KCWA 1QNIA 2BW5A 3UAAA 1NIEA 3CDZA 4DP7X 3IN0A 2P80A 3TA4D 1URIA 2FWLB 3L45A 3DIVA 4GP4B 2GB2A 1PCSA 4FA7B 1ZPUA 4NERA 2PCYA 3FSZA 9PCYA 3CZUB 4EF3A 2Y69B 3ZIYA 4G70B 3QPKA 3PCYA 3ABKB 1QLEB 1I53A
chains in the Genus database with same CATH superfamily
3IDXH 2H26B 3LEVL 4YXHL 5TFSH 3TIEA 4EKXA 4LVOB 5JORB 3D0LB 4ZAKD 4UF7C 2BP0A 2C4FT 3OXSA 4I48A 5AZUA 3ZT7A 4HCFA 2CD0A 5E1IA 3QO0B 5I1GH 3QEHB 1ZCRA 3VQMA 3NCYP 4ZFQA 3UTTD 3RY6A 2WOYA 4ZAKC 3OWEA 4L5FL 4IK7A 2ALWA 1QATA 1KNOB 5F9WB 4JFPA 3TWCL 3BUYB 5C2BH 1FV1B 3GXTA 1R0AL 4MASA 3QUYC 4DP1X 1W8NA 3NIFE 2EC9T 4O2FB 1DQQA 4JG1L 2P4AB 4FKHA 1AHWC 4OCLC 3D3VA 2W65B 2LAAA 2VDML 5INDB 1E67A 5FYKU 1QTYT 3BVNB 4NWUH 3WUWG 4ZFGL 4NZRL 1CUOA 3BP7A 4Y2NA 4BXSV 2H8PB 2I7OA 4UI2A 3ROOB 2CKNA 4X5QA 4KQ4L 1ACZA 1DN2A 5K59F 5T1LA 1J0IA 3GSUA 3S2CA 4IHOB 2E75C 4RGOL 1V54B 1VSCA 2XXCB 4V1DE 1A21A 3H9SB 3TBWA 2BW4A 1I1AB 3EDDA 1LGVA 3RWIA 1AGDA 4KRNA 3WXWH 3ZKMD 5B8CB 5I1CL 1DVYA 5T3XE 5DU7A 5CD5C 3ARUA 1RZKC 4WHDA 2MCPH 4M7KH 5DJ6A 3N85H 3BRFA 2OR8A 3GS7A 3ARBD 5AVZB 1HHGB 3ZKMC 1AE6L 3S48A 1KJ2B 1AR2A 5D96B 4OCWH 4XNZB 3ARBC 3EUUA 3MLUH 4JPIB 4EBQH 2C1PA 3P9LB 3SSGA 3ETSA 2FDBP 2OP4H 3QHFL 2PCXA 4YHYB 3ESUF 1OIOA 35C8H 4A68A 5E1AB 5KSBE 3AM8C 2HKHH 3QWOA 5GGRA 1ZT1A 4HOXA 2IPUK 2DMCA 3F64A 3R06B 2VE6B 2EUVA 2HWZL 2JI3A 3LRGA 3H9YA 2EYTA 4UYPA 2QQNL 1T80A 2IAMD 4CSPA 3QXAA 3KJ4B 2VJXA 2DQFA 3OKEA 1R5VA 4MS8D 4IRJC 4OD2B 3NGBC 3UZQB 3V9FA 2HKFL 1J9CT 3UOAB 2IAMC 5JXAL 1U0QA 3LNIA 2IMNA 1KGCE 1P53A 4HUUA 4UIMA 1V05A 1R3HA 3WS6A 5FKPA 5JW3H 1ZA6B 4UU9B 1N5YH 2YEZB 4PSPA 5E8OA 4AY0A 5J6GA 4Z3TA 4Z6AT 3IYLW 1MI5A 3QWRD 3UDWC 4QRRD 5GRJH 1ET7A 2IJ0C 5C6TH 1XGPA 3U46A 2QPDB 5D2LE 1CPUA 1NIAA 3WTVA 1I3GH 2PR4H 4CADA 1HL5A 2V7HB 4JJ5B 4JKPH 2VISB 5A6LA 3EDKA 2BZ7A 3BKCH 3MCKB 5B1AB 4HAGA 1UT9A 1XO8A 3O2VL 2ZPKH 3LHPL 3E9UA 1GZPA 3D25B 4JRYA 4G7YL 1DBBH 2DOCA 3KPLB 4G8AC 1CR9L 1IGJA 1BPVA 4YPJA 4AI7A 4WLCA 5I6OA 5HDBB 1P1ZB 3ECVA 1IC5H 5A2JH 1S9KC 2JV6A 1X7QA 1MF2L 2JK5B 2Z7WA 3VI4B 2AXGA 1KPRB 1KY7A 1EJOL 2VKWA 1MCKA 4ZTPH 5E9DD 4MCNA 4M7LL 1Q0YH 3QUYA 3FQUB 5GHWL 3MGTB 3G9AB 1HHHA 4DEUA 1M2VB 3I85A 3O6FA 5I6XB 2AJ3A 4YDJA 3VMOA 5L0QC 2OXHA 1AHWA 1K72A 2YKKA 2HTLD 4YK4B 2D8KA 1IBHA 4ELMF 1UA3A 1E4XI 2D7TL 4R5TA 3H4HA 5FYLD 3QZWB 5I5RA 3D2TA 2VDLH 5LJYH 5ENWA 2HTLC 1Z9LA 4GG8B 4GQQA 1TEGA 3ZSSA 4AL8C 2R23B 3OKLA 4KKQA 2OL3L 3B5HA 1JYNA 4JHWL 5E94B 1U8PB 5AYUH 4HWBH 1TZOA 1MCEA 2P8MB 1U21A 2JIXB 3ISWA 5FO8B 3FU8A 4LHUA 4QMEA 3GJFA 3CZFB 1Z0MA 2K70A 4IDLA 2L7QA 2OMVA 1MFNA 3NVQA 4O5LH 2VDQL 3FMGL 2FNWA 2JJSC 4LLWB 4Z7QB 1SEQL 3US1A 5KAQG 1IIIA 2H26A 2WLNA 1USZA 3B6SB 4IQHA 1L0PA 1FWXA 5JORA 1S7TB 2DPKA 4PB0H 1OCWL 3TT1L 3B9AA 1QLEH 3T2QA 1GIGL 3QO0A 3FZUC 4YQXL 2ZYHA 4PB9H 3GLAA 5HYFA 1WLHA 4PJFA 2CR3A 3QEGL 1B6DA 4UV7H 4POYA 2DLEA 2ZUSA 3UC0L 4JFHD 3VE0A 3FCGA 2IANE 3LKOA 4G80B 2GJ6B 1A22B 2H0FA 5I75C 4RAUA 2M83A 5CJOL 4YSRA 1JNNL 1KTCA 1A7NH 2Q9OA 3PF2A 4AL8L 4IRJA 5FYLL 2YD4A 2YLHA 3UJJL 3NSFA 2TSAA 3OTTA 4UOQA 5EU6B 1QRNB 2H8PA 3ROOA 4J3SA 1AQMA 1Q9LB 1YUKB 1V3JA 3VFRB 3ZVVA 4EKJA 5T5FL 1OSPL 2HH0L 3SOBH 1MCWW 3H2WA 3L1GA 3OMAB 4G1EB 4UOW0 4WU7B 2AABL 3UTQB 2I69A 3KS0J 1KGIA 2XVBA 1AXTL 1OOWA 3UDWA 3O11B 4E9WA 3RPIA 2ZXAA 5DA4A 2VWEC 1JV2B 1SYSB 4GLRH 1I1AA 4O58H 3HC3H 3NSCA 4QHPA 2HVJB 3HHMA 1BF8A 3QWRA 4Y2LA 2DQUH 4QHNB 4QRRA 4LP5A 2J6WA 2Z92A 3UYRL 2OJEB 5CINL 1IBZA 4PR5A 1W0YT 2YMXH 4AEHH 3C5SA 5IHZA 2N1KA 1HQRB 4KPHL 4EDXB 1KJ2A 3UYPB 1QWHA 4X9BA 3GZOA 4GNKB 1A9EB 4MKTA 1OCCB 1TLMA 3RYMA 5F7HA 4NQEB 2V5YA 1DSFH 3FN0H 3AB0B 3P9LA 2R0KH 3PP4L 1UYWL 2FX7H 3HZMA 3V4VL 1XWVA 5E1AA 4AEEA 1YPZF 4IJTA 1NEZG 3OZ9H 3GT6A 5IBTL 2AXHA 3BGAA 5J1TC 2L7EA 1HINH 3EH3B 3LRSB 1I3UA 3D48R 3IRZA 2AEQL 4YE0A 2BSEA 5K9OA 4MWFA 1WVZA 4X6DF 5IZ7A 3IK2A 3UZQA 4NC1C 2I9TA 5E23A 4UM8A 1E8WA 2X0WA 4M5YL 4A2FA 2Z1PA 4DGIL 4WKXA 2XQ0A 4UU9A 4UT9A 2LE9A 3MRHB 3MLSH 4JLRB 2DI8A 4BZYA 5CLTA 5C0FB 5FLVA 2EXYC 2EIKB 1CFMA 5G4OA 3U4EB 4PV9A 4HWZA 1CFSB 2Y4SA 5CU5A 1WAAF 3HS0B 3D39D 5JIHA 4PU2A 3LXCA 2XX1A 4JJ5A 1R9FA 4Y1AB 2VISA 3Q13A 5ACZA 1KXHA 1MFUA 3MCKA 5TDOA 2Y1AA 2PXYB 1YMMD 4NQDE 1AQ8A 3D25A 4MBRA 1CE6A 4MCMA 3VYNA 1R5WB 4Z7NE 5K9QG 2P47B 3QHTC 5JHMA 2NNRA 2J73A 4AT6B 5CP3H 4L3EB 1R3LB 1N9PA 1IC0A 4TLSA 1IBYA 2ZSVB 3ARFD 4AMKL 3GMNB 4Z77B 1MRDL 3PS6A 3L1EA 4BQCA 1OF0A 5GRVK 4OCNC 2OS7A 2JK5A 1U8LB 3QZNA 1NL0H 4MJJA 3BUBA 4IKLA 2CSPA 2FBJH 3ZW3A 3D4GA 5LDSA 3NFSH 3VD4A 4YSEA 1KTJA 3QJQB 4GFTB 2WM0A 3IMVA 5I8KH 1U8QA 2E9WA 1AY1L 3FQUA 4K5LA 3TM6A 2YA2A 3MGTA 5F7AA 5J1SC 1DL7L 3QJZA 4HZAA 4OFVA 1I9RL 2NX5D 4KKCD 5ANHA 5LAXA 1Q8MA 2XX0A 4A63A 3VA2C 2YRZA 3E9TA 4YEFA 3S3CB 4P3WA 5HDQL 4M6OH 3HBGA 4LCIL 4TS6A 3QZWA 1QFUL 4IBZA 1CFVH 3SCMD 3REVA 2FECI 1U8KB 3QR1A 3GEWB 3O0RL 2XY1A 4GG8A 1YMHA 4PJCB 4PW3A 3TA3B 4F9LC 2Q86B 2X4SB 5IGXL 4NPKA 3MBXL 1S7QA 5DK0A 4Z8FH 3C9NB 4LL1A 3CVCA 1U8PA 4PBXA 3CIQA 5J5EA 1MHPH 3GSNH 1FZOB 1KIUA 1X7SA 3LCYA 5TF1L 1WA0X 2AXFA 3IEAA 2AJYL 3ZTCC 4OLYH 3OAZH 4XVUC 2ZAHA 4XNXH 4LLWA 5IMKB 1SXBA 1VRSA 3MOAL 4HWEL 4LU5H 4U49A 1MIEH 3B9KD 4RETB 1OAZH 3GIZL 1CFNB 5HDLA 1ZWIB 4YGAB 4NBZB 1P6WA 3KBPA 4PJ5E 4MA8L 2JQZA 3EF7A 2CBPA 5BUAA 1DBJL 1X5AA 2JKXA 1M71B 3B9KC 3GMOA 4LL4A 4OLVH 4R26L 4Z0BH 1EEYB 2NUPA 1G7HB 4H8UA 5C9KA 1SOQA 2BNRE 4W9ZA 3PGCB 1IFHL 2NTFB 3IETB 2GY5A 4WNJA 3M8OH 4V11A 1YEIL 3UPAA 1QX1A 3DETD 2GJ6A 3OC8A 4G42B 5BUGA 3C8HA 2BVPA 4HX1A 5T3XD 1EANA 4HSAC 5DRXB 4F24A 3BZ5A 5EIQA 3NOIA 4EI5B 1K5NB 2R4RL 3BMWA 4C83B 4EE2A 4FA7B 2AKRB 4NERA 4NM8L 5CNHA 5DEFB 1ZOXA 2YMTA 3FO9A 5EU6A 1QRNA 3R7RA 1QFHA 5SWZA 1RIVL 1RK1B 1Q9LA 4M5TA 1MH5B 5TE4H 1JJUA 2A9NH 4G6AD 3ABKB 1Y07A 1LQBC 3O8XD 5IBLD 3M7OA 2QEJA 4YR6B 4B9IA 4G43A 1E2VA 1KCBA 3NRFA 3PDOB 4WI0B 5GZNA 3KPQA 2WXPA 4G6AC 4KQ0A 1JV2A 1SYSA 3KXFD 3O8XC 5CUSL 5IBLC 4OD3H 3MFFA 5JW4R 1TVHA 1A1OB 4RCAA 4QHNA 3UACA 4KXDA 2WLYA 1W6WA 2AJZA 2XN9B 4PJXF 3O4LB 2R0WL 3B2PA 3BN9D 4EUPH 5IBUB 3STZB 5F7DA 1TTCA 1U2HA 1OT4A 4AYGA 3LB6C 3AQZA 2PP9A 1TCMA 4YJZL 5DLLA 2B77A 4J3OD 1KGCD 3EJQA 4LCYB 1S7UA 3BN9C 4NQEA 3WDIA 1OOAA 2OULB 1QBBA 3ESNA 4PRBA 3VTTA 2BVYA 1J8HB 2C3VB 5IVXB 2PTVA 3PXHA 2D2CC 4H88H 1PDKB 3MACL 1OGPA 3VXME 1JG9A 1R47A 5BW7C 1VB9A 4RWYH 3SJVA 2V7NB 1ZLWH 2VM3A 1N5AA 3Q2NA 5I1KH 2YS4A 4M02A 3C60B 5FF6A 3U9WA 4OZ4B 2ICEB 5T3XL 3LRSA 1J8SA 2ZNXA 1M9SA 4XT1C 2NY3C 3BKJH 1AC6A 3QORD 5IF0B 4P07A 1H5BC 3P2DA 2X0VA 2Z6FA 4FJZA 4I2XE 1QW8A 4XP9H 1D7DA 3MLRH 3VGGA 1OW0A 4OJEH 1H9DA 4HBCL 3QORC 1HX0A 4JFZH 4NFCA 3EOBB 2ZKMX 2Z4QB 2XOTA 1QD0A 3NDZE 3TNNA 4ODWB 4P2AA 3HE6A 4BQ6A 3L2MA 2FL5B 3NA9L 4XP1L 3STLA 4X6FA 2L3BA 5DURD 4FL4C 3U4EA 1CGTA 1L9PA 2YQBA 2NSXA 5FFGA 2KT6A 2R2EB 3MNVB 1BFVH 1BECA 3QUMH 3MJ6A 4XTRD 2QKSA 3I6GB 3TBCA 2X2UA 4ODHL 5I5JA 4TPRL 1HCFX 2OCJA 3NK3A 4M8UA 4JDEB 2CCLA 5E95B 1OCRB 3A0OA 2Z4TA 3F7VB 4L1BA 1T83A 4JS7A 5F0JB 4XTRC 3LIZH 3OB0H 3BP4B 2DMHA 4MB4A 1CU4H 3M46A 1F6AB 1HL9A 1QMUA 3SQBB 5BS0D 1R3LA 3CBKB 4BINA 3DSFH 7TAAA 1HS6A 4Z77A 3CIAA 2ZCHL 3A67H 2D3JA 4WFEE 3CX5K 3FBQA 5TE6H 3CAFA 2L4OA 2RQEA 4JFXA 5F93C 3UL4A 2H2PD 1X5XA 1EO7A 5HHQB 3VX1A 4UDTB 2AVFA 3EYQD 1E4XH 4V1DA 2DMBA 2FTAA 3S3JA 3G5XB 5HHOB 5CZVH 1C1EL 1UATA 4WFFE 4PAZA 3WY4A 3FUEA 1BZEA 4PJHE 3PWVA 2FYVA 4QGTA 2AZUA 2PP8A 3MNZA 1A3LH 1TVBA 1UOLA 3OGOE 4RIRA 1ZHKA 1BFOB 1T20A 5DJ0B 2E6QA 3NJKA 2X4SA 4K23L 4X8JB 2YIHA 2YPKB 3MCYA 4Y4HB 5IFHL 3C9NA 2UZPA 4MA7H 2R29H 4WEBH 3KJ6L 3VCLA 1FZOA 3QG6B 3AABA 1NFDB 4G83A 3IMSA 1NCDH 4NGHL 3HMWH 3N43F 3ZKQD 3RTQC 3VACA 5CM1A 3QO1B 5EUKB 4GY4A 1VZIA 5J12C 1HZHH 3DJSA 1I31A 3GTVA 3O2WL 4OCSL 1DEEB 2GBVA 1XSOA 1X5GA 2KI6A 4NBYB 5D6CA 1KJVB 1S4IA 4NUJB 3WTSA 1HJBC 3EO1B 3K2MC 5CEXB 1SY6H 4JFEE 2VERN 1UACL 1DO6A 4QRBA 3W1ZA 3CDFA 3GRWA 2BWDA 2EILB 3DXAE 3KWTA 4HHAA 4MXVF 2WO4A 5EORL 4KKAD 5BMFH 1VKXB 3IKKA 4OVVA 4XXDB 3KWXA 4R96B 5BW7A 5CSGA 4X9YA 4YAQB 4UWQB 4EIUA 1SN2A 3WFBL 1IC1A 3TPKA 1PY4A 3AW5A 1G7MA 1HI6A 1T66C 4KKAC 5DRWB 3Q3GA 3P4NB 3U6XS 2YRPA 4QJ5B 1ZHBB 3CQQA 4DPRA 4GW5A 2OK0H 1E6JL 4FXLA 2J8UE 2WWKT 2V3FA 5I0YA 3MRPB 4LLAA 1H5BA 4EI5A 4HSQA 4C83A 5MERA 1WWCA 1ECZA 1A6ZB 5F6HJ 1WD8A 4WK2B 4BDVB 2VXSL 5I16B 2YXMA 1RK1A 1MH5A 2CLRB 3F6IA 2VZSA 3OLIA 4OIAA 4BZ1A 3G5ZB 4PD4J 5CHNB 2XA8L 1VACB 4HEME 5BOJA 2H45A 2EE6A 4N4YB 2QSVA 4WI0A 1FNFA 4DO5A 5HXMA 4UT6L 5JPMB 5CZRA 3MRRA 5HGAA 3TFBA 3EXLA 1JZ3A 1NGYB 4HZ1A 3TYFB 1MPAL 5FO9A 5CBAA 3PWLA 2HX8A 2JTYA 4JVUA 4UILL 2VDOH 3BH9B 1FIGL 3T2NH 1ONQB 5D7IB 1ZE3H 2JTDA 4ODVH 4OJFL 2XN9A 5EG6C 3SDDB 2QVIA 3O4LA 3TASA 4ZO9A 5I1IH 3IVKB 4WW2C 2B1AL 1KIRB 1A6AA 4HIHA 4M5ZL 5DZNA 2VQ4A 3K6SB 1B0RB 5AOLA 4Z7OE 2WXNA 1JYXA 1TO5A 4XXCC 1A6UH 2J55A 4WWKB 2BFVH 3UTZB 1M1XA 5FPIA 1UH2A 3NIGF 1I1RA 4PG2C 3WE1A 2C3VA 4HIQA 2VLRB 5DS1A 3EFFB 3HG1E 3N9GH 4HS3B 2IH8A 2F5BH 4KAQH 1BSIA 3UIZA 1KTLA 3D1MC 1C08A 3C60A 3F01A 3TEYA 1HHIB 4U1JA 4JM2F 3CFNA 4FZEL 2VDKH 3ZE2F 1FIEA 4LBEB 3RWCB 1MREL 5IF0A 3L8QA 1CLOL 3QI9C 4NQDD 3NH7H 4ONFL 5C2UB 1QFWI 1QAWA 1D5BB 3KM2A 2MQ0A 4X7SL 1BFSA 3M17A 2G9KA 4UV4L 3F85A 2A9ML 4I88A 4MJHA 1U33A 4PV1C 5FA4B 3E6FB 5GJSL 1D5IL 4HG4J 4K3DH 1P4BL 2OLDA 1P7HL 1JNLH 5EFIB 1TJHH 1I8AA 2ZP9A 4JANB 3FSAA 4OKDA 2UZXA 1ZSDA 4N0FB 1BBDH 1RK0A 3MNVA 2AF2A 2FX8H 3LQMA 5HDOA 2LOEA 1ZHNB 3RTQA 3SKMB 5JIPA 2JKJA 4RZCA 3VMNA 4A37A 2VLLB 4JVPA 1XDTT 4OGQC 3FUMA 3VSUA 1A1MA 4DKFH 4PN6A 2YKLH 5KVEE 4MJ5A 4JDEA 3NFPB 4NIKB 2Y1YA 2IANA 4YDIL 3F7VA 1VPOL 4GW4A 3TCXA 4MCYB 5F7EL 2DM2A 3BP4A 3NAAH 1EEUA 1OWRM 1SFHA 1UH3A 5C0CB 3WXVH 2QKIB 3WSQH 2GBTA 4DTGL 3VX0A 2KUTA 4KK5D 2OYMA 1INDH 4QLRA 1G9EA 3TEXA 4AQ1C 1SMAA 1Z5HA 3R8QA 2VZUA 3IDIB 3L3HA 1DFXA 4ZZKA 3BAEL 3WBDA 4D0CB 3FONB 3FTZA 4MQ7A 5E2WL 3RNQB 1OAXH 3NP4A 4KK5C 5DUPL 4FQJL 4YZFE 1LO3H 1RXLA 1XZ0A 2W07A 4G59C 5DMKB 4JQIH 3TH2T 4DZ8B 2OX5B 3AAZB 4JFQB 4MAZA 5I76B 3GHPA 2OMBA 4P2RE 3G5XA 5HHOA 5F7LB 3PAYA 5SWSB 2NXZB 2B4CH 1U2CA 4FJ6A 2VLJB 2I24N 3G6JE 4MHHG 3VO0A 3HA0A 5KUMA 1EXUB 1BFOA 4DK3A 1BQSA 1YEHL 1GGBH 5DJ0A 2FBRA 3Q2LA 4X8JA 4WUKH 5HHNB 2YPKA 2R0LL 4Y4HA 3HS8A 1RURL 5B3JF 3S4SG 1E90A 3QG6A 3PREA 1NFDA 2VC2L 3DOSB 3O6KH 2EVJA 1AI1L 2NY5L 1IBFA 3MA7B 5EUKA 1A3QA 4P04A 1MLBA 1D9KB 1N10A 5CSZB 4Y19D 3Q2VA 1ITBB 2BP8B 2X88A 8FABA 4HKJA 5BPPA 2EEBA 1CTOA 4IU3B 4P8QA 3MRFA 4WW2A 2RR3A 3X12A 5F9OH 5L9DL 4JZJC 2DH3A 2WWOA 4DQOL 4HUWB 5CEXA 4B9PA 3MGAA 2YAQA 5CZXD 3WLWC 3X3GH 2DQGH 3BFWA 3S36X 4ZMLA 1UUSA 4XGZB 3KPOA 1IARB 1RFDL 2CK2A 4PG9B 4R96A 4GSXA 5E03A 1B9KA 5CZXC 4YAQA 3S35H 2OMUA 2RALA 2WTRA 2ZUQB 1T2JA 1OP5K 3BAJA 5DRWA 3GSVA 1P7KA 2YUXA 4BK8A 5IFAH 4UTBA 3KWWB 1MJ8L 1PBYA 3CD4A 4ZW7A 1E8XA 1AANA 3GMQB 1BOGB 2WY3B 1GXEA 3QI9A 5ABZA 3TF7C 1BQHB 1KCKA 2IPTH 1AMXA 3CUPB 1BDYA 4QCIB 4D8OA 1QRKA 2FJSA 5FX3A 1FORH 4P23B 2EIDA 3VFPB 1JMXA 3BEVA 5EO0B 3RWHA 2XETA 5EZOL 4TUJA 3CFJB 5HGBB 3IMRA 2GHZA 1F4YL 3BCFA 4YLQT 5J9PB 3E3QC 1P6AB 2FQEA 4Y9BA 4FFZH 4Q14A 4W4OC 1TNNA 3BFQG 3BT0A 5CN3A 3CN3A 1D5ZB 3X1BA 4MJ4A 5J4MA 1NGYA 3O41B 4H0HB 5JPNB 3NYKA 1E9QA 3QQ3B 3QUXD 3SE8H 3FDWA 4TNEA 5D7IA 1U3HD 5ESAA 1CCZA 1LNUB 4KZEL 4X6BB 4C56D 4DVRH 4BFRA 2ZXEB 2N1TE 4JL2A 1AOZA 3QUXC 1SJHB 1JFQH 1MCPL 3F6LA 2XBTA 4XX1G 5D7EA 2IPKB 5LBGA 4AQOA 4DIXA 1D7CA 4EPSA 1E27A 1QSEE 3PGFH 4UUJB 2X4UA 3IN0A 1QEWB 3VMPA 1VF5C 4N0UB 2EDFA 3HZVB 2H6PA 3RKDD 4XNUL 1NJ9B 3GSQB 2GAZA 3APMA 5LQBL 2PCYA 3Q7JA 4NN7C 1X6NA 3FSZA 3IU4H 5D6DC 4AQ1A 2VLRA 4AV4A 3EFDL 1HEJC 3VGAB 4HS3A 3KVQA 2CKBA 5I8OL 1WBXB 5D7KD 2AK4E 4ZT1A 2ICES 5GSVB 4FFVC 3MFGB 1T89A 3TEZA 1Z7JA 5LUMA 3IGKA 3RP1A 1YQ2A 4GRLD 3BX7C 4X2UA 4TUKL 4PJDB 1OTSD 2J8OA 3DUHA 3QH3A 4MZIA 3FH7A 3GZPA 3HNSH 1TEFA 4OY9A 4IGBD 4U1GB 1O6VA 3LXAA 5JDJA 1Z9SB 2DF3A 4XC1L 4NZUH 4KHTL 3N44B 1JZDC 1SZNA 1OAKH 2N3JA 3CN4A 1GOHA 2WKOA 1WBYA 2UWEE 5FM8A 1E28B 3DDFA 2BS9A 4IGBC 4GSRA 5EU3B 5F3BA 1P5VB 4BKTC 1MELA 3VXPB 4FG6D 4QO1A 2IFGA 3NCYS 1AO7D 2BSSA 4OF7A 1PZ5B 4PJ5A 1M42A 4NJAL 1DVXA 3VTAA 1UWXH 4I8DA 4P3CL 5LXGL 1IT9H 3HNVL 5TF0A 3HIZA 4FG6C 3SKMA 3BISA 2VLLA 2BNRA 4EIGB 5JMOC 5DZOA 2QVMA 1WISA 1NUFA 4WFFD 2X4RB 4QTIH 1S5IL 4I1RA 3WJJC 4ZSOE 4MCYA 1I4FA 4OKVA 3AG4B 5C0GB 4XMUA 4ODXB 5C0CA 3DJTA 3G5VB 1U91B 5D7SL 2ZCLH 3IF1B 1CGWA 4A7GA 1WAEA 5FYJE 3BWUC 3V0IA 4GEIA 5B1JC 3WNPA 4HJIA 2EO7A 1M4KA 2APWA 2OI9B 1DJXA 4JO3H 4LPUA 3RHWK 3CK0H 3VFWA 3VWJB 4D0CA 2KLRA 3RNQA 4MNQB 4MJIB 3BSGA 2CUMA 3ILPA 3JV5A 3G08B 4LVHB 3U9UB 1LDSA 5CR1A 4DZ8A 4TQPA 2OX5A 2DTMH 3KDMB 2O5NA 3DV6B 1NQBA 5SWSA 1A64A 2Y24A 3ET9F 5IK3B 4OZGF 1EGJA 4F7EB 4S1RH 2NZIA 3D8MA 2WV3A 4CVXA 4FDWA 4KH2A 4R4FL 2KQMA 4KV5E 2EINB 5HHNA 4N0YH 5CCGE 1KN4L 5IJCC 3MRQA 2LABA 3GO1L 4OGXL 4W4OA 3DROB 3IPBA 4XO3A 4WK4B 2R0ZL 3AT8A 5IB5A 5HGGS 2BNUB 1JGDB 4IKNA 4L8CB 1KCVH 1XF3A 3MA7A 4XWOC 3ARRA 3PNRB 1YECL 4FTVD 4HKBB 3O6LL 1FAIH 2AEPL 3K72B 3VXMA 3KZ8A 1IC4L 4E0RA 1HL4A 3L4XA 1EAOA 4L9DA 3SO3C 1HK6A 4MQSB 5CJBA 2A9DA 4HD5A 5CXPA 1ESOA 2R2BB 3NJFA 1D5MA 1XFPA 2BSTA 2ZOLB 4HUWA 3MTRA 5FAAA 1G6VK 1O6SB 2Y3AA 4JG5A 4QRPE 4X7FC 3HB3D 2W80C 5DRZB 1HU8A 2NY1B 5D6DA 1CWVA 1TQWA 5L2KB 5CJQL 3P3UA 4QHKI 5M7QA 4F33B 1TZIB 4UMSA 2F7PA 2CBTA 3IDNA 4OD1L 2QDVA 3HB3C 2WVVA 3MJ7A 4P4KA 3SE3A 2NDGA 4EVNB 3FCTA 3F58H 1VJSA 3FQTB 5IEHB 4YHML 1OV8A 1UD3A 3ARDC 2B08A 3F7LA 5AEAA 4Q6YA 1B2WL 1CICB 3CUPA 4XPBH 3D2UD 3SO5A 1H6FA 5DFAA 3SQOL 5EEYA 4D9QE 1WCBA 1E42A 2NXYD 2QVFB 4IIZA 4P23A 5DD1H 5A2LH 3FFCD 3VFPA 4BSWB 3PAZA 1UB6B 3VXSB 5EO0A 2WD0A 2WLHA 5HGBA 3CFJA 4HZLA 1KOAA 4WNQA 3LD8C 3GK8L 1P2CA 2FLRT 3D9AH 5TQ2H 4MNGB 5IM7B 3RUGE 3UYOD 4E9XA 1URZA 2NXYC 2XUWA 5E4EB 2CHZA 1YCSA 3MO1A 1KBGL 3GS0A 2DD8L 1W2KT 5F44A 1A5FH 3QIBB 3O41A 3U36B 4Q74A 2K3HA 1J05A 4X9GA 2P45B 3FH5A 3QQ3A 1UA6L 1M57B 3HG5A 1OD7A 1BLNB 2IGTA 3V7AE 3KHQA 5HSFA 1LNUA 3QP3A 1M05A 3GPEA 1FI8C 3QZLA 4MTMA 4UCFA 2GKIA 3L3KB 4XCYB 5BVJB 1SMDA 5E9NA 1AGBA 3JT0A 1QBML 3WJJA 2VXTL 3W0WB 3DURA 2VR3A 5K9JH 2YN5A 4JFFB 1GZQB 4Q97A 3KR3H 4BA8A 2A6JB 3GFUA 3MJ9L 4HWNA 3HZVA 3AUVA 4PJHA 5ID0B 1NJ9A 2VDMB 4UINL 5B1JA 3GSQA 4NWTL 2WXMA 3OF6D 1PKOA 4RBPH 3OLGA 4OJYA 3NCEB 4KXCA 5T5NG 1W80A 3VW3H 1FFNA 4O2CB 5D5ME 5KVFH 5IHWA 3Q8BA 2DWSA 1IM3A 1G6RL 1JPTL 1DQML 4Z95L 4WO4C 2Y25A 1QFWH 1N0XH 4ZUTB 1L5GA 5GJTH 2HVKB 3GHEL 4J6IA 4Z3EA 3QS3A 4PJDA 4YSOA 4AZ8B 4HJUA 5T1MA 1MJ7L 2JKSA 2X0UA 4E36A 4AJWA 1KFAL 4Y4FC 1Q1JH 1DVFD 1O9WA 2MEJB 3JYBA 2AXWA 3RX9A 1RJYB 3O9WA 5AB1A 5EA0L 3F8UB 2XVLA 4UB0H 5E4AA 4F2MB 1P5VA 2VMEA 1UM4H 2B8OT 2IWEA 1F41A 4K55A 5MI0C 1BQHG 4JFEA 3WDHA 4F8PA 4HLEA 2W0PA 3OR7B 1PZ5A 2XN2A 1NPJA 3LQZA 3UTPE 3DXAA 3AY2A 5LCVH 1C7TA 2FJFA 5E8EB 5FUCE 3ZQXA 5FEBA 2YA1A 3UTTB 2C4FU 4JM4L 2BH0A 4P2RD 3QDJE 1Y6KR 3SQRA 4C4BA 1SJEB 2X4RA 3QZBA 5EH1A 5JYLA 3EGDB 1N8OE 2FR4A 2I07B 2Z31B 4RH4A 2BP3A 4ODXA 1M2OA 2J8UA 3HI6H 3LRLA 2DKMA 3G5VA 4A7SA 3IGAB 4KHXL 4G7QB 5KOMC 3W2DL 3LZNA 4FE9A 5DD0H 3JWOL 1AXSA 1AP2A 3QDGB 1J0HA 4QHLB 4ZMYA 1YC7A 3NCJH 4PCYA 2R15A 4MJIA 3LKRB 3ZL1A 4EAEA 1DBKH 3WEOA 1L7TH 3G08A 4UM9A 1P7QD 4HEMA 1P5UB 4AIZB 5D4QA 3KLDA 3ARDA 5E6SB 3QPXH 1W91A 3DV6A 2UV3A 2RJMA 1G7LA 2CR0A 3FU3A 1FO0B 5D9SA 5E70A 5IK3A 4CN1A 2A4EA 4IRZL 4F7EA 4V33A 4GW1B 3QNZA 3KE0A 3ATDA 4GAAA 4FXKC 3P3RA 1HC1A 4Y2OB 2Z93B 2X6AA 3LS5L 4EO5A 3ARBB 3X17A 1ORQB 1N2RA 1A2YB 1A7QL 1YNTB 3FU7B 3L3OC 2XKUA 4P2QB 3T04D 3TT3L 1S7SB 2HRPL 3QIUC 4DW2L 4F8OA 4X80H 2DIJA 3S97C 5GRUL 2VDRB 4CAGA 2WUCL 1GYWA 1HWGB 2BNQD 3HG1A 4X0KB 4DKAA 3P4OA 3FXIC 1BV8A 5B1CA 1NAKL 4BFGA 4WNSA 2F8OA 4PGDB 4Z7UE 4ZDHA 2VLKD 1C8QA 1DP0A 1QTSA 4JPVH 3RLSA 5F9DC 3O3DB 4S10A 5E2VH 4I1PA 3PWPB 5FDWB 4H8VA 1OGSA 5AZ2L 4K3JL 3T1FB 1FYTB 1FDLH 2ZOLA 5CP7B 2IAMB 3NJGA 4KH9A 3TN0C 1N7MH 2CG9X 4BFIB 4P57B 1U8HB 4K8RH 1L9QA 3RWFB 3RVXD 4BBWA 4YX2L 4L48A 4MA1C 3QG7L 5DMGD 4TSBH 4PLKC 1NCAL 3DUUA 5F71A 5BXFB 5L2KA 1GY2A 1MNUH 2I32A 5E24E 1KUMA 4R5XA 1FLRH 4WHCA 4I4WB 5I71B 1LO0H 5HJ3B 3RVXC 2RH0A 3S8GB 4MAUL 3J27A 5DMGC 4WO4A 1YNKL 1FL3B 4GJTB 4YEEA 3Q5TA 4MVBD 2PCPA 3NRPA 4BE6A 1CICA 3PRZA 1RZKH 4Y4FA 3ZMRA 3QWNA 3KYOB 1J9RA 4QTHB 1BVKA 1CDGA 3VXSA 4MVBC 1BAFL 4URKA 3ILQC 3MZTA 1PZ2A 5KYUB 3QNFA 3WIFB 2OR7A 3BKYL 3CFTA 1XV8A 5FKAA 2V2TB 2VLME 3ECBB 5HHME 3VB8A 3WHE0 1FGVH 1J18A 1KPVB 1B2YA 1A8JH 1FVEA 2NNCA 3CSTA 3U36A 5DUJA 1QFWM 3D0VA 3CDZB 3A6BH 5C6WH 2EC8A 5AW3B 3NIDB 5IJBC 4L8DA 4XCYA 3GXDA 5E51A 4PJGB 4FQ2L 2ZP0T 3L3KA 2Y22A 5E9DB 1JK9A 3RVWC 3BIKB 2R9HD 4FKEA 5CEYB 4G7VH 4LP8A 2MCMA 5DFVD 4OQTA 3W0WA 3MC0A 1YEKL 2R1XB 3D50A 4JFFA 2AHIA 1GZQA 4H5SB 3NJIA 1ACXA 5DFVC 1K4DB 2JB6B 3RDTC 5E08H 3U2JA 2X4NA 2R2HB 3UAFA 3FPYA 4JW3A 4Y88A 3MV7D 4RLDA 4A7UA 3WTUA 2QGEA 4PMEA 3ZDWA 1N67A 2ENSA 4BWUA 4BD4A 5J8OA 3CHXA 2W9EH 3HNTH 3L95A 4MGXA 3U9PL 3VGFA 1FNGB 2J56A 4UOZA 2Y06H 1YQVH 2HVKA 3SPIA 2XQBL 3THML 3MVSA 2PPEA 4UQEA 1XQ4A 1S3RA 4PVBA 1M9WA 4XBGA 1F11B 5DD3H 1PTZA 1Q9OB 2DQMA 5KTEL 1HKLH 2X6UA 1B0IA 2BIHA 3FN3A 5FCSH 3V4PL 4A6YA 4B60A 1TTGA 1EDHA 1KJ2H 2LLGA 3BSZL 4F2MA 2H7WA 5C9JB 2YJQA 3NUKA 3L3OA 5FYJD 2VW4A 1JI2A 3T0AA 2F7RA 2ITCB 4HJJL 3QIUA 1IAIL 1ZLWK 1ZLSH 2G5UA 4GRWB 3ZO9A 4YDKH 5LBVA 4BRVA 2HYMA 4PS3A 5E8EA 4TQHA 3HE7B 4PW4A 1ZPUA 4CRPA 5F89A 1MAKA 5I1JH 4WCYH 3ILDA 3UEQA 1V27A 3V4VB 4AOFA 3GLZA 5LLIC 2O5ZL 3EDFA 1BXXA 5H35B 4HMEA 1SJEA 1CS6A 3EGDA 1H8OA 5LG1A 1EWHA 2Z31A 2KHAA 3BPCB 3V9EA 2CXGA 1HDMA 3TN0A 3IGLA 3IGAA 4HCRA 1QYGL 2BZDA 4NDMA 2G75B 4OM1H 4HG4K 2IH3B 3H9HB 1ADWA 4UT9H 3ZYOA 3QDGA 3MRGB 5L8JB 5B4MD 4FMVA 3GWJA 1MFBL 4HXAH 1G5GA 3AWFA 3BUDA 3E2HC 1DE4A 3MN8A 4ICXA 4RGMB 4ZX6A 5DRNB 1JGLH 1H3XA 5K39A 3UAJA 1K4CB 1P5UA 4U0RC 5DXWA 1WAPA 3EUDA 4RGNE 3B1TA 1BZOA 3QFDA 3RWEB 3T71A 1R19A 3C5XA 1FO0A 4PWJA 1KULA 2P52A 4TUOB 3ZYJA 1M6OB 2K78A 2QMJA 4GW1A 4XN1A 4GKZA 4ALAH 3TESA 2AJUL 1B4RA 4FQPA 4Y2OA 4F58L 3TTSA 3T0BA 1KJ3H 2B59B 3QNXA 5FYJL 1ORQA 4QRPD 1F56A 4FOMA 4Q9QH 1KIPA 3BE1H 1T21B 3RU8L 1T2XA 1S7SA 1K2DB 1QSEA 2OR9L 2YOAA 1YVLA 3U1QA 3ISYA 4K2UH 4N2AA 1RJLA 3BDYH 4B9JA 2WIIB 2QGCA 2RD0A 3WE6B 3AVEA 4OCYH 3UTSE 4J8RB 4NLHA 2PF6A 1CURA 3CSYB 4U3HA 2DQTL 3HZKB 4CUCA 3QRLA 4X0KA 5CKAA 2JQMA 3OKKA 4IBWA 1RU9H 4HFUL 4BELD 3FRPB 4F7TA 4LEBA 2DM7A 2AK4A 3BH8B 1IUZA 3PWPA 4D9QD 3BGMB 1LMKA 5AW4B 3T1FA 1FYTA 3FCBA 2A77H 4K4KA 3MLYH 4B0MM 4FCAA 4P57A 1U8HA 1OCZB 3QCTL 4JFVA 3WMPA 1NCTA 2F7IA 3RDTA 5DJAB 3IDYC 4FQHB 1AFVH 4Z18A 4S0HA 2DQEL 2OXGB 4UQ3A 4F91B 5K59E 3ARPA 4I4WA 2UWEA 1UJ3C 1UGKA 1JXKA 3AU0A 5BZWA 2CR6A 2XRAH 4MLSA 1R3JB 2PPDA 5HDBF 1TNMA 2YD6A 4HK0A 4OIIH 1U42A 2ID5A 1JPGA 2ITDA 3QUZB 4N2NA 4DN4L 4M1GH 2MCAA 1R3IL 3VI4F 4WHYH 4M8VA 5CIPB 3VXQA 4FABL 4YVUA 2CPCA 2XZQL 3BGFB 1DFBH 2AQNA 3ISRA 1M7DB 3WIFA 3QQDB 4KJQD 5AW8B 2V2TA 4YWGL 1BBJA 1G7QA 2HFTA 2MRYA 4ZMTA 1MWAA 3ARFB 4CU6A 2AXJA 1KTDB 5AG9A 4KJQC 1OGTB 3VSVA 2UYLA 4FNLH 4R3SA 3HBPA 4KVNL 4XBMA 2G3XA 3PHAA 1NAML 1BHGA 3C6EA 3CCHB 3DK0A 5LN8A 3CC1A 3BIKA 4L1HA 3TYGL 1LJMA 5AALA 2FJUB 4RFOL 1QQDA 2NX5B 4XHQA 3CDGA 4TNWF 3HI1A 3ESOA 5I0DA 4H5SA 3KNBA 4X98B 5H37G 1S5HA 4GKNB 5JUEH 5CCKL 4Z7QF 3GMMB 3ZZLA 1NGPH 1RIHL 3KPRD 3SCMB 5KSAA 2X4TB 4W81A 1H3VA 3C5JB 3L1OH 2HX9A 4QRQA 3AGWA 4L4TE 2QV2A 2WWMD 3RY5A 4PIRF 1FNGA 3QYNA 1KWGA 2F5AH 1X5HA 3QDJD 3ARYA 1RIUH 2BJMH 4NYLB 1CE1L 5HHXL 5C71A 2WWMC 4AGLA 2XT1B 2FGWL 4ZUUB 5GGQH 4LPWA 4WTZA 1IGIH 1AGFA 4GS7B 5C9JA 1G7PB 4LDEB 4FYSA 2BWQA 4YZWA 5MEOB 4LEEA 5CLYA 2GJPA 3LZFH 1TQSA 32C2B 3VD5A 2ITCA 4LSUH 3FQNB 2X05A 5ISZE 1MCBA 3FQRA 2HLEB 1M3JA 2R1WB 4QRPA 3AG1B 2G30A 2Z0UA 3FT4A 4LLUA 4TOYL 5KANI 3IB4A 1SBSL 3HE7A 2CIKB 4URTB 1N6QH 1WTGT 2UUDH 4O00A 5H35A 1WE5A 2WUBL 1NDGA 3WJMB 2ZCKH 4LKXB 4N8VB 3MLZH 3LN9A 2F74A 3BPCA 2XV2A 3GSWB 3PE9A 1N64L 3WIIL 4ZBJA 2XI9A 3NBNA 3CMGA 4HUVA 3RJQB 2G75A 5DK3A 1X6LA 3H9HA 1S3KH 2BIQA 4E5XG 3ZZSA 1TETH 1Y7VA 2HUEA 1NCWH 3OAYH 4LSSL 4N5ED 3X3FH 4RDQG 4OFQA 5ELIA 4Q6KA 1M6UA 2BRRL 3RUGA 4PJ7B 1CT8A 4DETA 3GSXB 5GGTA 3OAUH 5DRNA 3KLAA 4NN6C 1C5DA 1A4JB 4N5EC 4UIKL 2PO6B 4XPFH 3RIFF 3SDCC 3FSWA 1WA1X 4ZQTA 3HUJB 1I1FB 3KXFB 3KL5A 2Z35B 4FA6A 1UXWB 1A7RL 3SBWA 4TUOA 4WKZA 4JL1A 2D7PA 1MAMH 2MH4A 1Q9KA 1AIFA 5D70H 5DFTA 5AYQA 4P9ML 1HQ4B 1BM7A 2Z8SA 3HRZB 2IDCA 1K2DA 3MHZA 4KRLB 1DHKA 2WLKA 1E9OA 1CYGA 4TRPL 4N8UA 5EOQL 3N1MC 3DIDA 1CF8H 5GS0H 4U6YA 2DWXA 3WE6A 3EO9H 5EN2A 5HVGB 5MENB 3CSYA 3HZKA 2BCMA 1OF2B 2NY2D 2OW7A 4FNQA 3ULAB 4HJ0C 4HIEB 1I9IL 3FOMB 2PYEB 5BO0D 1XB3A 1CYWA 1O9VA 3OJVC 4XP5L 3RVUD 3K5RA 4I0CC 4X5WB 2NY2C 5KOVC 1PLAA 3RNKB 4AQAB 3JBG7 4GIOA 2ZICA 4B53A 4ZW5A 3KPPB 3QR0A 5D1XB 1K3ZA 3HMXH 4FQIL 2Y7QB 1AQKH 4JY5L 4JHUA 5K1VA 2IO5A 5C09B 3LNEA 1BXUA 1MFMA 3WDJA 2CO7B 3J8F7 2FK9A 5JLZB 3EYSL 1BWWA 4QRSA 3WFCH 1L7IL 3OKYA 4B6ZA 3GJEB 1HZLA 3DRTA 1TZ8A 2XQYA 1O0VA 3C5ZB 5KYWB 4P49A 1R3JA 4DO4A 3WD5H 2CDGB 2N59A 2X4OB 1VCAA 5FFLA 5DURB 2H1PL 3DTDA 4HA1A 2VABB 4XCCL 3MSPA 4X7TB 3QUZA 5LN4A 4MB5A 5EZJB 1RZFH 2Y2YA 5FS5A 3KYKH 2BMKB 1EAPA 5FW8A 1JK8B 1IQDA 4ISVA 1CLZL 4MCZB 3UGXA 4BGLA 4DKEL 4YFDB 4YDLB 1MVUA 4L9LC 4KUCF 1EJFA 3ZK0A 1U4EA 5DVLA 1SLWA 3T4AB 3IM1A 3GRWH 2YAFA 3VXTA 4JDTL 5BS0B 3R0NA 5DZLA 5AW0B 2WO2B 1O7DE 4APQD 3QA3A 3VI3B 2GJZB 4PJCF 4JK0D 3HG3A 5GSRB 1HHKB 1YPZE 2ADFH 1LK2B 3CCHA 1J5HA 5ITBL 3WHXA 4K9JA 3AGVA 5FGBC 1MRFH 3OXRA 3TZVC 4NKIH 5CO1A 3V6FB 3MBEB 5JIIA 3I9PA 5KANG 1KBVA 2UZYA 1CFQA 2YC1B 2ZWSA 2KZBA 4N1CA 4X6DE 2BM3A 4ENED 1PZDA 1IZJA 1AQDB 5IKCA 1NIBA 2N56A 5IY5B 4JO5A 5C7XL 3WEAA 4J8QA 4BZ1H 4LLYB 2KMWA 1R17A 1MCNA 3OLDA 4X8XA 4KXZI 3MRDA 3C5JA 3IRPX 3VSQA 1ERNA 4R7XA 2Y23A 4G7SB 4YNYB 4JB9L 2WPGA 3IDMB 4EQ3A 3MUJA 5IT2H 1QUNB 3V4UL 5IOPA 2AEIT 4K07A 3K91A 4F15B 4DAGL 3SDCA 1I8KB 4Y5XB 4F8QA 5I6LA 4OSUH 5BJTA 3LMJH 2ISDA 2RQ8A 2X6MA 4FQCL 4NJ9L 3C2AL 2RFXB 5JHLL 3QW9A 4ZUUA 1N4XL 3VM5A 2WCGA 3DX0A 3GDCA 3TF4A 1XGYH 2B2XL 3JV0A 1CG9B 4I9WD 2ROYA 1G7PA 4PREB 3X13B 5MEOA 1OL0A 4P4RB 4X9IA 1NMCB 3GUFA 5C0BE 32C2A 1J9SA 12E8H 5KG9B 3MYJB 2FHBA 4JO2H 4M43L 3GHBH 1PZSA 1E4WL 2W0FB 4QOKE 2R1WA 3CSFA 5C0RH 4CMMB 1HOCA 2X42A 3NZSA 3Q5YA 2FX9L 4H20H 3CVHL 4L4JA 5AVTB 4FI7A 2FVNA 1D7FA 4G5ZH 5E6IA 5F1IA 2AJXH 2CMRH 4AVIA 2ADIB 4N86A 4NO3B 1J86A 3IJHB 1A4BA 2X28A 1JAEA 2APFA 4NS0A 3WJMA 3ZO0A 4U3XA 2JSFA 3CJJA 4PRDB 1TTUA 4RGNC 1Z5LA 1WCQA 4U2ZA 3ARED 4RA3A 3PV7A 5D72H 1H6UA 3S35X 4BGDA 1YLBB 3MRCB 2HZHA 1VGKB 6FABL 4XMTA 1QSVA 4QF1B 8PAZA 1UWXK 3RA7L 3G9VA 1L3WA 1SMOA 3GKWL 3M1BA 5ESVB 4B9KC 2IALB 4NT6B 3KLHD 3UMNA 2VR9A 4PJ7A 3MGOA 3UERA 3UO1L 2FB4L 2X40A 3VH8G 2BVOA 2MHAB 2PO6A 4OGYH 1RZ7H 3KLHC 2P42B 4LCUB 1I1FA 2XPGA 2YGQA 4KK9D 5IVXF 2WQ8A 1YZZA 1UXWA 2Z35A 3APDA 4Q7DA 3S3PA 5CJ5A 4UBDD 5KVDE 4EF3A 1FRGL 1SHSA 5KBKA 1ETB1 2I5YL 4NZ8A 5FHAH 3V52L 3S96A 3WKMH 1QVOB 5TE7L 4L9LA 2EXSA 1HQ4A 3AS0A 3HRZA 2C9VA 1ASPA 4DPBX 1HIML 4R97C 1PU0A 4HS8L 2O30A 3ELAT 1NGWB 1NDTA 2XZAH 4D2NA 5DEJA 3TBVB 5MENA 1UWGL 4BFEA 4LARL 1IKOP 1OF2A 1OGAD 2IGLA 4WEUD 1MNNA 4Y2DC 3VD2A 1EZVX 1NC2D 3WNJA 3FOMA 2PYEA 3TZVA 4GBXD 2A9BA 3US0A 1BWMA 1BOYA 2WKLA 3QC6X 3RNKA 1JF5A 3P9MB 4AQAA 1QBLL 1CGVA 3V6BR 4GI6A 3KPPA 3I3DA 4WENB 2Y7QA 4GBXC 5C0EB 1G9NH 1PKQE 1ZXKA 4XVTL 3B7TA 5C09A 3ROLB 3UFIA 3M07A 4K3HA 1JTPA 4N8VG 1CVSC 1U8MB 4B9GA 4ENZA 3L6FA 2YOCA 4M56A 5DJDB 2W59A 3D85A 4OZFG 5KYXB 1MFDL 1EZVY 4GQPH 5T33L 2V9QA 4WV1B 2FHCA 4KTDH 3C5ZA 3S34L 2J1WA 5C0IB 1OAUL 3LN5A 5EOCL 3WO3B 3BQVA 4LBAA 5JO5A 1JN6A 2IOMA 7FABH 4X7TA 1LWHA 4ONHB 1TZGH 4TYUA 1UB5B 3FTWA 4X7CC 2VC2B 1S9YA 1HSBA 2A6IB 1QLFA 3MRJB 4PJXE 1KBBA 4DGVL 3SDYL 1JK8A 1HXMA 4PMFA 3H42H 2B5IC 5F21B 2EH8L 4QXUH 1ZLUH 5GS1B 2AQ1A 5HYQB 2N01B 4HQQH 1UFGA 4PRIE 4LDLB 2L0DA 3IDXL 3N42B 5TFSL 1AGCA 1S6NA 1XIWB 4UDUB 3BPNB 3F62A 4L4TD 4JO4H 4OBSA 2Y5TB 3F5WB 2FRGP 3QHZH 2E7BA 5IFJB 4KNQA 4HF5H 3I9GH 3POCA 3SGDI 3P0YH 5I1GL 4Q8BA 1W15A 4UTBH 5FO7B 1S7XB 3VQ2C 1WP6A 1BW8A 1Y0LA 3O4OB 4J3OG 4KOBA 2OZNA 3MBEA 1ZT4B 5IJDC 1NFDF 3VA6A 2YC1A 4G9FD 2YGPA 4FNUA 5C2BL 3TL5A 3BD5A 2ZKHH 2ZXWB 1WBZA 2BXYA 3ULSA 3CFMA 3INUH 4AM0B 4LLYA 3NT0A 3ARGC 1K6QH 3WLBB 4QAWA 2BS8A 3ILEA 5A16B 3MOBH 5I1HH 3O45A 3SE9H 3QQ4A 4NWUL 2G2NA 5L88H 3IDMA 3FCSB 2PWHA 1TKWA 1QUNA 1ODAA 3AY4C 2HCZX 4AENB 5C08E 3NMEA 1UT2A 1I8KA 3PIQB 3PV6A 4MA3B 5DHDA 2H0JA 3UTSA 1HWHB 2RFXA 1UOWA 1VFOA 3FU6A 5EWIH 3IE9A 4IJ3B 4Z78B 1RI8A 3FOLB 4YHIA 4Y19B 4XCNA 5HY9B 1WFNA 2WBXA 3NZHH 3WG7B 3M86A 1YEDA 1NIFA 4RBPK 5EEWA 3MYJA 4JEGB 5I9QB 4M7KL 2MCPL 2NYZA 3N85L 5DHVB 1CGSH 5DMIH 2W0FA 2LQRA 2C8NA 2V0AA 2XG5A 1DBAH 2EICA 3PL6D 2ERJC 4JQXC 4PS8A 1UC6A 3P0GB 2CKBH 4KROB 4KRPC 4OCWL 3CC5A 2ADIA 3MLUL 4DP0X 1AIZA 4AM0Q 4Z7NF 2BSRB 2M8XA 3IJHA 4P2CG 4R7DB 2V33A 1FFRA 2Z91B 1GGIH 4Y2DA 2OP4L 3TXAA 2E27H 4PRDA 3G7TA 35C8L 3ZTJH 2HKHL 5KBNC 3JZYA 3QVAA 4WRLA 2PPCA 4MDRA 4IMLA 1QABA 2ARWA 3UCQA 3VD3A 5D7IF 2H2SC 4NAMA 1PLCA 3P54A 2EE0A 5EBWB 1ZVSA 5A7BA 1MZYA 1SEBB 2X3BA 2IALA 4PP2B 4P5TB 4NUQA 4U1SA 4XZ4A 4J27A 2MHAA 3WNNA 1OPOA 5JW3L 3FQWA 1N5YL 1F42A 4NNYB 1VIWA 4HU8A 4UT7H 4J7RA 4XMPH 5GRJL 3OMNB 5C8JB 3ATAA 5AD0B 1U3HB 5C6TL 2ZTBA 4Y4KD 4C56B 3C6LB 3L5WB 1ZS8A 1QVOA 3TFKD 3WEXA 3B9DA 5T1KA 1I3GL 2PR4L 2C1OA 1WZLA 2VITB 4JKPL 5LGJB 3BKCL 3GMLA 1SGKA 3VFUA 4MXVE 2BWIA 4WU5B 3T2PA 2ZPKL 2X3AA 3TFKC 3ZDXB 1HOEA 5CD3A 3TBVA 5AWNH 5C0JB 1IC5L 2X6CA 1YJDH 3K6OA 5CWSA 1JGEB 4L4TA 2BO0A 3D0AA 1J1OH 4JVWA 4PUBH 4ZTPL 5LDUA 5DD6B 4Q9RH 2FUQA 4GRLB 2V9UA 4ZMOA 4F8TA 1BD2E 1EGJH 1Q0YL 5DJYB 3DK2A 1KENH 2ROXA 3MU3A 4TNVF 2XIDA 3ALPA 4IM8A 4CDHA 5C0EA 5IR1B 1PF3A 4P06A 4N9GB 3TPUB 4C4UA 3ROLA 3ARGA 1U8MA 5DQ9B 1MJUH 2Q6WB 1F6LL 5DJDA 2DLHA 4K7PH 3CN2A 1OEZW 5D1QD 4C55A 1FQ9C 5KBPA 2VDLL 4RX4D 3AY4A 5C0IA 1JWUB 1AO7B 5ISZA 3V0FA 3NEOA 4KGLA 2M2DA 4P5MA 2OMTB 4L29B 1O7DC 2CJSA 1UJTA 1J7VR 5D2NB 1FSKC 1EQWA 1M3IA 1UB5A 2Z8WC 3IXTB 4PHXA 5TDNB 4CVWA 5HVFB 5AYUL 4HWBL 3RTLA 3NPSB 4KZDH 3MRJA 2QJDA 3PQYB 3U1SH 1DJZA 3EBIA 1G7JA 5I1DA 1H8LA 4LGRB 2ZOKA 5IW6A 1LE5B 3RI5F 5GS1A 4O5LL 1PLBA 2HTKC 5FO2A 5HYQA 2C26A 4W6WB 4FQ1H 3IJEB 2NCMA 1SHMA 4ZS6C 2EDBA 1X5ZA 4HIIA 3NIGE 4JQXA 1PG7H 1XIWA 3MNDA 4UDUA 3GJFK 1C7SA 4XCEA 4PB0L 1FFPB 2Y5TA 1RZGB 3F5WA 4WI2A 4KTEH 1QLEL 5IFJA 3LOWA 2GQHA 4ZFFA 3AWGA 1Y1UA 4PB9L 1EO8H 4PJ8C 2WP3T 1I7UB 1D5XB 3QCUH 3ZE2E 5LVEA 2LU5A 1EPFA 4WJ5B 5GGRY 3DPDA 3K6DA 1S46A 4MD4A 4YBLB 5BNXD 3LV3B 2FGZA 1T22A 2JCCB 5C0BD 4U1KA 3EJYD 3ZQ9A 3K71A 3S37H 4AM0A 2RAMA 2MOQA 1DN0A 1A7NL 4ZNEE 4B5EA 4H8HA 4TSAH 4JFSA 4GP8B 3LKQB 3V6OC 3FCSA 4PQXA 2FATH 5LNDA 4KKZA 1OHZA 4I0PC 4AENA 1PX8A 3UBXB 5IB1B 1HNFA 3LKNA 4HIXH 3PIQA 3HHSA 5DD5H 3CFKB 3SOBL 3P1VA 3DTXB 3AG3B 5ID1B 4MDJB 3JVGA 2I9LB 3EYFB 1RZJH 4FTVB 4NKQB 2A3TA 5F6IC 1DVUA 5DC0A 3VFVB 1TJIH 4O58L 3HC3L 3KPTA 5J11C 4HV8A 5IW3A 3OG6B 4WFGD 4PGCB 2DQUL 4G8GD 1AC0A 4HIPA 1ZV2A 1FVDA 1DSYA 1VENA 3DVGB 2A73B 2G5RA 3RY4A 2B0SH 2HKAA 2YMXL 3LKSA 4AEHL 1VERA 1WDAA 1EAQA 3HB3B 4Y16C 5IW1B 3L4ZA 5HI5D 2C9SA 1KT2B 4WZ9A 1MCOH 3WKPA 1FGNH 5D1ZD 2NNXA 5IMLB 1DSFL 1TF4A 3JTBA 1MLCA 3J07A 2R0KL 1NZRA 1NEPA 2FX7L 5DDHB 1TG8A 4IOIB 5HI5C 8CGTA 4TUUA 3ZQWA 1XL4A 3F12A 3NSYA 5D1ZC 4Y9EA 4QPEA 2VDNB 4RVBA 5IJVB 1TPXC 3OZ9L 1JZ4A 3GZQA 4UQIM 3LD8B 2R56H 1HINL 2CCWA 3QDME 5DF0A 5INCB 4N2MA 3DDGA 1YO4A 3FFCB 1YC8A 2QSTA 4YFEA 5AW1B 3WMQA 1XR8B 3MV8D 5B3JE 4P5TA 4BCXA 1HE7A 2GK0B 3CG8A 4S0TD 2JJUA 1WZ1H 4PLNC 5AVXB 2J1XA 4MQTB 1ZGLA 1AGEB 3AJ7A 2NR6D 2P3YA 5A40E 4WVRA 2DQCH 1OE1A 1RZIB 3MLSL 3NA4A 1OKEA 1N0LA 5E56A 4AIEA 5C8JA 1YPZA 4XMWA 1RZPA 4GO8A 2NR6C 2LU4A 3C6LA 3K8LA 2BY2A 3L5WA 1J5DA 3KW7A 3LZPA 4LLQB 2WQXA 4PRHE 5GZOC 2GBAA 2G5BA 1EJ8A 3CBRA 1KLFB 5C07B 4PJDF 4J5VA 3MLVH 1JZ5A 1INEH 2CALA 2HJFB 2DWDB 3VRJA 1P7BA 3ZOAA 2LV4A 2EKSB 5EUOB 4PM1A 1WC7B 2YR3A 2YPLE 2EUZA 2QZ5A 5HYJB 4PJ8A 2R1YB 3MV9E 4FFYA 1QBAA 3NTCH 1BJ8A 4NSKA 1NL0L 4TMPA 5HYSG 2FBJL 2YZ8A 3NFSL 2A6KB 4DP7X 4ZXBD 3WN5C 3K2KA 1URIA 5I8KL 5DJYA 1T5WA 1XSIA 2PR9A 4GP4B 3T3PB 2WINA 4PJIB 4AC2A 3HR5A 4E41E 4Z5RB 1DVFB 2J3SA 5DYOA 4ZUWB 1GOFA 1YN6B 4NX0A 1LLAA 4PRID 2F8XC 5IP4A 3PCYA 1IBGH 5JQIB 4M6OL 1JDAA 1OT1A 4ZO6A 2ZWNA 4PVLA 1CFVL 1S7RA 4I0PA 1GS8A 1JWUA 2OQJA 2WNGA 4QOKA 3BYTA 1S9WA 2OMTA 4XNAA 3I6KB 2JKLA 3VGHA 4U3SA 4HH8A 1EHKB 2XXMB 4NI3A 4OJDH 1NLDH 1MHPL 3GSNL 5KS9B 3B2UD 3PHQB 3ZHKA 1A66A 5BRZD 3DI3B 4JX0A 1KV7A 2WXHA 1INQA 2EXWC 3EYOB 4NZTH 5EMYA 4QY8A 4NXKA 5E6UB 5E0FA 4XNXL 2CM5A 2Y5QA 4OUOA 3ZGIA 4JRWA 4RSVA 3I2CH 5K5YA 3EJCA 3IJEA 4LU5L 4N28A 4EXKA 1KYOJ 1MIEL 5KSVA 1AKJD 4Y16A 1OAZL 1RKRA 1MCIA 2OZ4A 3SGDH 4F7TB 3TTYA 2AMGA 4P2OD 3MRBB 5EIIB 5C08D 2ZYSA 3WFDH 1V55B 1AXIB 3L3JB 1S7VA 5ECJE 4EBQL 4Q56A 4OLVL 4Z0BL 1G4RA 2HJKB 1QR4A 1P7QB 4LL9A 5DTFA 5I0VA 3UEZA 1MQKH 4WJ5A 3M8OL 5B39G 5ICXA 3RPKA 3KH4A 3W11D 4JFDE 1E8YA 1F3RB 2QQKH 4NO0B 4XP4H 5EO1A 3UADA 4RMRA 3NABH 1IGTA 5KVEH 2JCCA 4KQ3H 4N22A 4MJ6B 3QJXA 2WW8A 3FAXA 3W11C 1OP9A 1QKZH 2D0HA 1MEXH 3KGRA 4NRYB 4CJ1A 1SRDA 2CLVB 5ESQB 5BUPA 2LVCA 1H19A 3A4DA 3FUIA 5AW2B 4G1MB 1FZKA 3KVPA 3RZCD 5ACLA 3OD3A 1DJSA 4FEMA 3TO4B 4L0ZA 3UBXA 5TE4L 1R75A 2EDTA 4KZ0A 1GSMA 5B21A 3LXUX 3CFKA 5EOTB 4HEPG 1JPEA 4CBZA 2NRDA 2BVQA 3LS4H 4WHTB 3RZCC 5ID1A 4F27A 3P4MB 3EYFA 4JRLA 1SYVB 2BNQB 4LCWB 4WSGA 3P2TA 5D55A 3V95A 2WWNA 2K6YA 4OQTH 4OD3L 5DK2A 2A1WH 3DO4A 4X5RA 3BI9X 3TCLB 1JZ6A 3GQFA 2VLKB 4NQCD 4ODTH 4PGCA 3V10A 5GZOA 1BM3H 1IGYB 1QP1A 1XR9B 2DL9A 4LSRH 2J72A 5DJ8B 3MREA 1JZEA 3EZ8A 1XGUB 4IOFC 5IW1A 5E00B 5E1QA 1R3KB 4PV8B 2RHEA 4NQUA 1Z3RA 2IQ9H 4HK3N 1MFVA 5FA3B 4YOKA 5IMLA 4O02B 4BFNA 2K8MA 2P28B 5DDHA 4ZYKB 4IOIA 3G04A 4H88L 4BQ9A 5LGKA 3BWSA 3GMPB 3ZSTA 1FG2B 2AJSH 3BUTA 3CFDB 3BT2H 1EJ6A 3WN5A 2W94A 1QLRB 3ZE0B 2IXQA 3QDHA 5I1KL 2WHVA 2QPSA 4MD0A 4MSWA 4OZGE 4ONGH 4A6YH 4OF5A 3HW7A 2Y72A 2KZWA 1CXHA 5IMMB 1BFTA 4PJXA 5L2JA 1ETA1 5DQJA 5FUZH 4GFXA 2VUYA 3BKJL 1QI5A 3V4PB 1CXFA 4XP9L 4OZIB 4P2YA 3TBYB 1XR8A 2DLIA 3MLRL 1CTMA 1KCLA 1JWSB 1TMQA 3D5OF 4FULA 3U25A 2GK0A 3EH1A 4A2EA 1E4KC 4JFZL 4BXVA 1GC1C 2JCWA 2DYPD 3BDXA 3TVMD 5JW5B 4F7PA 2FIRT 4F7CA 2OCFD 4X4XB 5C92A 1JXGA 1RZIA 1KTRL 1OP4A 4P46D 4Z0XB 3QK0A 1ICTA 2P80D 3V5DB 2C9AA 1IAOB 3TVMC 2K7PA 2LLNA 2AEOA 2HG5B 1YYMH 3FTGB 1JHTA 43C9B 1BFVL 1H0DB 4Z7VB 3QUML 4L4VB 4LLQA 3AACA 3JTTB 2DBLH 2NLJB 3K74B 2X2IA 2GSGB 4HCRH 4GXFA 5GISH 1UWEH 5ITFA 3GUTA 5C07A 4GUOA 4XE5B 1VEOA 2XBZA 2V2XB 2ZUXA 4RSYA 3RB5A 1A4AA 5E4OA 3IDJA 3LIZL 4O2EB 4JDVB 2EKSA 5EUOA 1CU4L 1WC7A 3GI9H 1CF1A 3DSFL 3JTSB 1KXTB 3FYIB 3IGFA 2NZ1A 2WYZA 1NC4D 1FNAA 4RMBA 1SXCA 3A67L 2R1YA 3MV7B 1AKJA 1YUHB 4Y8AA 3VWKB 5HYJA 5TE6L 4GOSA 4W9KC 1MDTA 2F15A 5IMOB 2K4WA 4X5XA 1FO0H 4K0OA 3F6JA 1QI4A 3FK3A 1KG0B 3EJPA 3UZVB 4WDIB 2QT6A 1E4XL 3U4AA 3ME0B 1XGRA 4KDTA 5CZVL 1YN6A 5DVNA 3OGCB 2B3IA 3EF4A 3LEYH 1A3LL 1MRCH 4OZHB 2VDRH 3ETBJ 4WSJA 1IKFH 1UZ8A 4C4KT 2Z1KA 2KERA 1JXFA 1N68A 3I6KA 4FQXB 4QRTB 4HH9A 3F2LA 3RZCA 4JM2D 4U1LA 4MA7L 2R29L 4HKXB 4WEBL 3RB7A 4NP4H 1VFBB 4IOSD 1A7OH 3PHQA 4GG6B 3HEIB 2FZ3B 2PABA 1NCDL 2P5EE 2IPUG 3HMWL 5MP6H 4JM2C 1MJJA 1DJYA 2FEEL 3KPMB 4WEMB 3SKNB 2YFOA 3BAWA 4OW6A 2NY0D 1HZHL 2FQDA 1EHXA 1ED3B 1CLCA 3I9AA 3DX7A 4HGMA 1CGUA 3ASOB 1PEWA 3M6DA 2NY0C 2CDFB 1SY6L 3DHPA 2WZ0A 3FHQA 4L1LA 1YNTF 3L3JA 2JVUA 1UQSA 4U33A 1ES0A 4PS4H 5BMFL 4GINA 2HJKA 3WL9A 1ADQA 3L5IA 1F3DJ 1ILUA 3P11H 2VMDA 3GMRB 2YD0A 5D7JA 4R6UA 3V8OA 1F4WH 1DANT 4NO0A 3H3PL 3WI9A 1QASA 3ZL2A 2OK0L 4WQOA 4MJ6A 1AZVA 3MCG1 1TTBA 4FNTA 4P05A 4F2EA 4H2CA 4G5AA 2GI0A 3C87A 4KJWC 3VDAA 1HE8A 5F88B 1XGTA 2CLVA 4NNPH 5ESQA 2KPNA 4XI5D 2L7UA 2OMWB 5I1LA 5K69A 1GMIA 1MWAH 3TO4A 2X38A 1F3JA 5H8DA 1MHHA 4BE5A 5EOTA 1PNCA 2XNAA 2X5PA 3G6DH 2HRLA 5A2BA 2OJZH 4P5KA 2WXQA 3QXVA 1Z6JT 3P4MA 3VXUD 4EN3C 4LCWA 2F6AA 3K0WA 2W8CA 1G0DA 1IGMH 4AGPA 1NAMB 5KVFE 4I18B 4XMLH 3T65B 3U0TB 1PL3A 3I84A 2R51A 2ZF9A 2VDOL 5KSUB 25C8H 3T2NL 4KOCA 4L1TA 1IGYA 3E80A 4YHKH 2HMIC 2PW2B 4XVSH 2IOIA 4OF3A 4XBEL 3MPCA 1BD2A 4L37A 5I1IL 5I66A 1YRKA 2ENJA 3GLDA 3HN3A 5EBMB 5J6SA 1BVNP 1XGUA 1RZQA 1TYRA 1MY5A 1MHEB 4JKKA 4PV8A 4AWJC 4A55A 1II4E 2IGFH 1A6UL 4N2OA 5T5FH 1I85C 2C9RA 2BFVL 4O02A 1BZ7B 1C5CL 3S2AA 2P7TA 2FO1A 1XGQA 2ZAGA 4XN8A 3SPJA 1C8PA 1KGJA 4UNTA 4TQEH 4GUQA 3BMVA 4ZYKA 4LSPH 3ZTEA 3KCPB 3P0VH 3DHUA 3N9GL 4KAQL 2F5BL 4H1LG 4A7TA 3FFDB 2GG1A 5F8QC 1WQVT 1QLRA 4YC2B 3PGDB 3A21A 5C0AE 5EIIG 3KYMB 2DIEA 4GKSB 5BV7C 3NIDF 2VDKL 2E8YA 3SY6A 5I8CA 5IMMA 3SB3A 4PJGF 2WZ5A 1YY8B 4KKRA 1RSYA 4AV5A 3NH7L 4RDQF 4OZIA 3NG5A 3UG3A 2O6DA 4NAJA 4GRWH 5DSCB 4NN5C 3VXNB 1BLIA 2MOVA 2YPLD 1RUPH 1UCBH 4PRPB 4K3DL 1YAZA 1EAJA 5H4YA 3WJLC 1JNLL 2B4CC 3IWUA 2VN7A 4KK8D 4HUMB 1TJHL 3C09C 5B38B 1D5RA 3V5DA 4JZOA 2Z8RA 2YBRB 4KV5F 1MI5E 4AH2B 1BBDL 2ZX8A 3FTGA 43C9A 2FX8L 3CPLB 4E9TA 4G6JH 4L4VA 4LOUD 3T3ME 3JTTA 2NLJA 2GSGA 1EVTC 1G4MA 5ANME 4POZC 4E41D 4FG4A 4DKFL 2V2XA 4YHNB 2LT9A 2YKLL 3Q6GH 1DLHB 2MMXA 3QEQB 1H8SA 3LTVA 4AYFB 4JN1H 5JZ7D 1I7RA 4ZPVA 1OAJA 3NAAL 5C97A 1F18A 3WXVL 3SEPA 3KPRB 2AW2A 4JRYE 2GUOA 4ZNEA 3WSQL 1CD1B 5KYYB 1G0YR 4YHLH 2FSEB 5GGTH 2QL1A 4Y9GA 3VFOB 3ZY7A 2XG4B 3VWKA 2ESVE 3FKUS 1INDL 2Q7AA 4FMKA 4I3RH 4GRWF 1MDAA 2G3MA 4NFBA 1SLVA 2P1YA 4BUHA 3JYCA 1GPOH 1KG0A 2HFEB 3BWZA 1LO3L 3OQRA 3FBKA 3IKCA 3EYUH 3VXRB 2QTEA 2TRYA 3U83A 2F1EA 1FC1A 1CB4A 3BVXA 3G5YB 4CILA 2FECL 1LK3H 3BW9B 1E2WA 3PJSB 4P3DB 4GQ9H 3B7RL 4HULB 1FJ1A 2B4CL 3OZKA 3EBGA 1VADB 5F97E 3MJ8A 1B88A 2NY6D 4U4BA 1GGBL 2BHYA 2XICA 4FYRA 4ANKA 4HC1A 4FQXA 4WUKL 2ZD0A 3SDAC 2TAAA 5DT1H 3R1GH 4DGWC 4KDVA 1BYPA 4GAJH 5BQ7B 2NY6C 4PY7B 1RQ5A 3IAPA 3T0ED 4EN3A 2OYLA 3RUGF 4YMPA 1A7PH 3KPSE 4F3FB 1HH9B 4YFLF 5E8NB 4GG6A 1E30A 1SXSA 2IWGA 3O6KL 2APSA 1DCLA 1LWJA 1QNIA 3P30H 2BX5A 1QZ1A 1A4KB 2YK1H 2ENPA 3UAAA 2GIYA 3MLTA 4S1QH 1NGZA 3GBNH 1UXSB 4IDJH 2MQCA 3L3DB 3QDMA 4Z3GA 5F9OL 2CDFA 2D0FA 2ICWB 9PCYA 3CZUB 5DHYB 4JHAH 1I85A 4F20A 2D4FA 1U92B 4EQ2A 3X3GL 2DQGL 3PUUA 1WGVA 5IHUH 3ZKXB 4J3BA 2QLYA 1OT2A 3BKMH 1IAKB 2ADJA 3BZ4B 3BLBA 1CDJA 4LFHD 3GMRA 3S35L 1TVDA 4QHUA 4ABUA 1SF5A 2VYRE 4IYKA 4F5CE 2IH1A 1I7ZA 3PY9A 4P9HC 2Z7UA 5GIRA 5FGSA 1PAMA 4PJBB 4X6CB 5IFAL 4U1IA 4HDIA 4LNVA 2VKXA 1A8ZA 1JF1A 3E38A 2IPTL 3GRGA 4PTTA 1UXLA 3L3GB 4PRHA 4RFEB 4JQIA 3QJUB 1BJMA 1FORL 2EVGA 3CHQA 4U1MA 5AOZA 4ZMNA 4BFKA 2P48B 2O61B 2MTPA 1AD0B 3QBTB 1NOAA 3WJLA 3QS2A 5KZCB 1USQA 5I8EB 4FFZL 5HPMA 2WOBA 1PZ3A 3V0HA 2NY2B 1T04B 2BOCB 3MV9A 3ZDZB 3K0YA 4CN6A 4DUVA 3H9SE 5KSUA 3SE8L 1T5XB 3PFUA 5LHDA 1P1VA 1RK7A 1RUKH 3C08H 4DGYH 1N59B 3BPOB 3QFJD 3SBRA 4DVRL 2ATKB 4DP5X 3WUWB 1MWOA 1IM9A 1JFQL 5I24A 4HOMA 4HLZG 4DFHA 1F1DA 3OKMA 1MHEA 2RIKA 3PGFL 3Q6FB 4F9PC 1RULH 4A7VA 3RFZC 4ZW3A 4FXGC 5E5MA 5D7LD 1T4KB 3Q1EA 2A74A 1IJNA 1C5BH 3D12B 1E9PB 3S9DB 3IU4L 3KCPA 4MD5A 1GGCH 4GI9A 4LRIC 3DI2B 1WJ3A 2J6EA 3PGDA 1GJIA 4S1DD 4XBPB 3VFSB 1KLGB 4MX7A 1VLXA 4XWGH 1LDPH 2YD5A 4NC0B 4R0LB 4CVUA 4L8SC 3HNSL 4S1DC 5F0LB 3CFIC 4NZUL 5DSCA 3FF8A 1GYAA 5D8JH 1OAKL 4WUUD 1YDPA 3GPSA 1J10A 2E76C 4PRPA 4UTCA 3H8NA 3SDAA 4QRUA 3PABA 1OP3H 4APQB 5F3FA 3LRMA 3QAZB 2HN7B 4HUXA 3PWJB 3CVHB 2YBRA 5IHHA 4OLUH 3UAEA 2DW5A 4J4PD 3Q05A 2HLAB 1F58H 1IT9L 2P5WD 2KDYA 2ZSWB 3RX8A 1NKOA 1YA5A 4YHNA 4J4PC 1DLHA 3QEQA 2X7LA 4G71B 2IDUA 4QTIL 4JFDA 2QADC 3W9EA 3AU1A 4YHOH 5DO8A 2ZCLL 3L3IB 5KYYA 3QRBA 2FSEA 1I9JH 1AS8A 2F53D 2PN5A 2XG4A 3SN6N 4W4NA 5IV2A 1GS7A 5HDBE 3Q06A 1F1AA 4JO3L 43CAA 3CK0L 1Z3GH 3QUHA 1JUFB 3U30B 3HZYB 1MG3C 1KCUH 4XRCB 5TDPA 5ADOH 5FW6A 1YYCA 3AUWB 3VI4E 2P5ED 2HFEA 1EFXD 3HR6A 2QBWA 4D0DB 1K5WA 2DTML 3OKDB 2X2JA 1KF9B 3SD5A 3VXRA 1LO5A 5HHPB 3T08A 5E8PB 3G5YA 4P3DA 3TH3T 2NW2A 5IWLA 3NPZB 3V7AG 2VM9A 2WMPA 4S1RL 4EDXA 5K9KB 1TITA 2Z8VC 7PAZA 2PPFA 3CVIH 3V4LA 4GLRI 2F54B 4GAYB 4PGJA 4PRNB 3QZMA 1AS7A 1JV5A 2CDEB 5MHSE 1UCTA 4N0YL 4YO0B 4CN4A 4DEPB 1PJWA 3R4RA 1U8IB 1ZA3A 5BQ7A 3HAEB 1JZ2A 3BAXA 4H26B 1JNHB 1HH9A 2PLTA 1UZGA 2FWOB 4PJ7F 4RRPG 3AQXA 5E8NA 1RZ8B 2ZT9C 3QPQD 2DZEA 3TIDA 1U8JB 1KCVL 1XF5A 3HJ0A 1NLBH 4NIYE 3EJUA 4M62H 2ENYA 3O3AA 1WT5A 1FAIL 1J1XH 1Q0XH 2H4EA 3HUJF 4OLZH