1REIA

The molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCQASQDIIKYLNWYQQTPGKAPKLLIYEASNLQAGVPSRFSGSGSGTDYTFTISSLQPEDIATYYCQQYQSLPYTFGQGTKLQIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin(part)sequesters antigens
molecule keywords BENCE-JONES PROTEIN REI (LIGHT CHAIN)
publication title The molecular structure of a dimer composed of the variable portions of the Bence-Jones protein REI refined at 2.0-A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 107
sequence length 107
chains with identical sequence B
ec nomenclature
pdb deposition date 1976-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1reiA00
4ZTPH 1RVFH 1JRHI 3OAZK 2CIIB 3QNZB 4I0PB 5DC4B 1PDKA 5HHOD 4X80L 4HK3N 4Q9QL 3ULUE 3T08A 4PG2A 3QCVH 3O8XD 1KB5B 2FLBT 4WUUE 3FHQA 3PWLB 5I30L 1V3KA 5HY9A 1NL0L 4MQ7A 1HNGA 2XA8L 3ARYA 3NCCB 5ITFA 1Q9LB 3WIHH 1YMMA 4PJ8D 3SQOH 1YYML 2XXCB 2X1QA 4N1EA 5IW3A 1I3GH 3UTZA 2C3WA 1RPQA 5JUEH 2IG2L 1Y6MR 5CJOL 1WBYB 5SWQA 2NR6C 5ENWA 3MLRH 4D9RD 4G9DB 1G7PA 1LNUA 2PYEB 5FGBA 4MAYB 3H9YA 3QQ4A 1SJHA 4Z0BH 4Q97A 1T0PB 1T2JA 4G8FB 2Y36H 4OKVA 4HWBA 2DS4A 5CCKL 1XF2A 4HKBB 4I2XA 3ILPA 5J1AA 3HB3D 5DA0B 4MXQD 3WO4C 2Z31D 1OAQH 2Q7YB 4JQXA 3S98A 2DWDB 3PNWA 3A67L 4AM0A 4QCIB 4ZPVA 1UCBL 1JHKL 3CXHK 3LS4H 5H37H 2XZAH 1I4FB 1EGJH 3HHRB 3IDYB 3SJVD 4X7CC 4PLKD 4KZDH 5KVFL 2FHBA 2FATL 3S7GA 2NY7L 4FXGB 1QLFA 3SCMA 5C7XL 4QOKB 1BWMA 1FBIH 4U0RB 1MRDL 5GGSB 1TQBC 3D0LA 5D7JB 1IARB 5IR1A 5MERA 2DLFH 2QV2A 4LSSH 1Z6JT 1F97A 3O9WB 4OLWL 3EO1A 1AC6A 1RIUL 3KJ4B 5HHPB 5IVXE 5BRZE 2W60A 1T1XB 2DQIH 5F7YC 2FBJH 3SDAC 4ALAL 1NCAH 4P57A 3H0TA 4HAFA 4LQFH 3AY4A 5SWZD 1S5HB 1AGDA 1NCDL 3F7YA 4X7FC 1IFHL 4GAGL 5KSAA 3IT8D 1ZGLM 1IAII 4HH9B 4YE4H 5LCVL 2NLJA 4IDJH 1NGXB 4PJ5D 2ZCHL 1EZVX 4XC3L 1X6LA 3GSNL 4WHTB 1E28A 2V5MA 5FM5M 5T1DH 2W0PA 3GO1H 2AJVL 3I3DA 4K2UH 3QJHB 4G6JL 4XP9H 2DBJA 1U58B 4YAQB 3OF6D 4NUGL 2Q6WA 4TSAL 5FHAH 4MA3B 4Y19B 5SWSD 3DVNB 3AAZB 5JHDE 3QEQB 3QDMA 1EHNA 5CSZB 3O6FA 2JF1A 3T1FA 5KG9A 3RJDA 5JOPE 2H32B 4KRPB 5E00A 2BVEA 5IMLA 2R2BB 1PYWA 5DK3A 3RJQB 4MA1B 5DMIL 2OP4L 2X4TA 4UTAL 4Y4KB 1QSFA 2QEJA 5A43C 1HXMA 3HZYA 5K9QG 5I8OL 4Y2DB 4AT6B 1XF5A 3QUYC 4F7CB 5A1AA 5C0GA 1YNLH 1FFOA 5GHWL 4HAGA 1JGDB 3UX9B 4JFYA 4YR6A 1QRNA 4J8RB 4KAQH 3HZMA 5C08B 3MCKB 1IMHC 1FN4A 1OQXA 3D69A 1YEKL 2YBRB 3OJMB 3ARFA 4XXCA 5F6IB 4WY7H 4LRNH 3Q5OA 4C4KT 4YHML 5C0AB 5EZJA 3U4EB 2G9HA 1VEOA 3VMNA 1TETH 5DJ0A 4NKQB 1QTYT 5C0CA 4OCRL 1WZ1H 4LCCB 2C9AA 3HMXH 4QHMB 1MI5D 5AD0A 5KVGL 2WQ8A 4KI5D 2GJZB 5GGRY 2MSPA 4PJIA 3DRTB 1AI1H 3GM8A 3H3PL 1RK1B 1KIPB 2D7TL 1KLUA 1MFBL 1DN2A 2VDQH 3L3HB 1OAKL 1S78C 4OM0H 4AG4L 1N64L 2BK8A 4W4NA 4Y5VB 4BQCA 1NC4B 1A8JH 2D7PA 3FFDB 5FK9A 4DGIL 2C5DC 5JLZA 4DZ8B 1T7ZA 2KQMA 4KJPD 3B9KB 3PF2A 5MEQA 3AXLB 3C60A 4IOSD 5DR5H 5CIPH 4PR5A 2Q8AH 1UADC 4LHJB 1H8NA 4I4WB 2NZIA 4WJ5B 3B5GA 2APVA 2DJUA 2YD8A 2UUDK 2B0SH 1CDCA 3AROA 3QI9B 4WFFD 1RI8A 3CCHB 5D70H 4HKZB 1FC2D 1K8IA 3KPSE 4YDLC 4FG6C 5GRJL 2NY6B 3CX2A 5CEXB 3O81A 2OK0H 5DRZA 5GS0H 5DJCA 3HMWH 2R2HA 1HILB 2W9EL 1RJLA 5EOCL 2P5WB 3FN0H 5KANG 3VA6A 4E41A 5IHZB 5A40E 1AR1D 1S7QA 5BMFH 3WS6A 1S8DB 2XN9B 1OAUH 2ILLA 3QDAA 1KT2B 5DUPL 3LKOB 4NOBA 1UQSA 3WFEL 4NO5A 4LHQB 5JPMB 2YPKA 1D6VH 3WE6B 3GDBA 4OT1L 3M1BB 1BBDL 3BYYA 3SE3C 3FOLA 4ODWA 3P73A 5C9JB 1AP2A 2XQYG 5C70A 3P30L 3F62A 5BW7A 4KTDH 1XR8A 4H20H 3MNWA 5E2TH 4NQTA 3WFHB 3SO5A 3NABH 3KYAA 1MH5B 3QH3B 4JZJC 3Q3GA 2QQNH 2V9TA 4WUUB 4HD9A 1QR1A 1B88A 3E0GA 1FNLA 5EUKB 1ZLVK 4JANB 4RAHA 1EO8L 1FNFA 1T83A 1AD9A 5KN5B 3KR3L 1OGTB 3RIAK 3M17A 1SJEA 2GY7B 3C9NB 4PY8I 1J05B 4ZQKA 3P11H 5E8OB 2FB4L 3P9MA 4PJGE 4FFZH 4PGZA 5JXEC 4Y4FB 4XPTH 5CHNB 3MPCA 4OIBA 4J12A 3KYKH 2QR0A 2Z35A 1WISA 1Z3GH 4XCEB 1NBVL 2EDKA 5DA4A 4JZOA 1NMBL 5BQ7A 1SM3L 4NO0B 3OKDB 4LGRB 4P5TB 2MJWA 4I2XE 4XPHH 1U8PA 5D72H 3MV11 2YPVH 3BJ91 15C8L 4AL8H 5TE6H 5KAQF 2CDEB 4HIIA 1OT1A 4N0YL 1IM3A 2ZWLT 5DQ9B 4FFYL 2H1PH 5IESH 3RUGA 4LLMB 5I1CL 5CJXC 5D7KE 1SMAA 3BO8B 3BVNB 2EYTA 1QSVA 3KPRA 4ZO9A 8CGTA 2Y23A 4G8IB 1FYHB 1KXVC 5KSBF 3X12A 3L3JB 1A4KA 5FYLL 2GCYB 2LU3A 3QO0A 3EIFA 1B6UA 4QY8B 5GRYA 4DTGH 4KI1A 5IVXB 3NBNA 1EO5A 1JPSH 3N9GL 4OZIF 3DTXB 2H2PD 2PO6A 3CK0H 4JO2L 1NAMB 2F5AH 1IGJB 2V7NB 4JM2B 2CGRL 5IHBA 5DMGC 5HDLA 3MACL 5E6ZA 1RUPH 4Y2OA 4Z8FH 3QIUC 3BH8A 5F1OB 2HFGH 3CFJA 4M7JH 2BY1A 4I48A 3JTTB 4XCNB 1QFWH 3IDXH 3BKCH 3V0AC 1HIML 4Z5RA 2FO4A 4MGXA 4YC2B 3SQBA 4KK8C 3UJJH 5TF1H 4FQ1H 4OD1H 5I18L 3WN5C 3O3UN 3IDUA 4NM8H 1JNJA 1FYTD 3QIBD 2IQAA 2WAHA 1U42A 4AEHL 4N0FA 1MJ8L 1XGQB 4ZFGH 3QDME 2DN7A 1R3HA 4W6YB 1BAFL 1CZ8L 2DQCL 2EKSA 2HJFA 3VH8B 3AB0B 4FMFA 5F89B 4BSJA 1T20A 2CJUH 2YPLD 4BZ2H 2JJWA 3KPNB 1Y18B 1XF4A 3OAUH 2JJSC 3MBEC 4M6OL 1HH6A 1OGAA 2OR9H 2VXUL 2W91A 5DJYB 1CYGA 2J8UF 2HTKC 4M7KH 5ICYB 5J6GA 5C92A 3SKUD 1QSFE 1CGSL 3IRPX 1L0XA 2KUTA 1EMTH 1YDPA 2E7LC 4OCXL 3ARBD 4IRSB 3GGWB 4UT7H 5GS2D 1XCTA 1LO4H 4JFED 3BQUD 3BP5B 3K8KA 4C83A 4DEPB 1FL3A 2AEQL 4YXKL 4BFEA 2JIXB 1BF2A 4PG9A 1CL7I 1QFPA 2PCPA 2MFNA 5I1IH 3C8KA 4ODVH 3VCLA 3MYJB 3S8WA 4JY6B 4EN3A 2AGJH 2DLIA 3SDCC 1U3ZA 4HWZB 2MOVA 2VO5A 1OWWA 3TYFB 1A22B 3O2WH 4KKAC 5E8PA 4K94C 5E4EB 3NCFB 4UUJB 4WDIB 3SGEH 1AIFA 5ID0B 1UACL 4DVBB 1KB5L 5F44A 2DQDH 1GGUA 5EB9A 3OWEA 5C0CE 3QQNA 3D9AL 3BEVB 3BKYL 1BD2E 4Z18A 1EFXD 4H5SA 3BIAX 3B3IA 5J1SC 1CLYL 4MXWL 2VERN 1TTGA 4QTIL 4BZ1L 3ZSSA 5T1KD 1BPVA 2X4UA 3HZVA 4P23B 1DEDA 3B6SA 2CLRA 3MRRA 2PNDA 4RA0C 1FZKA 3VXRA 2D7QA 4LEOB 1UZ8B 2V2WB 3OZ9L 4XCYB 5JW3L 1CBVH 4M3KB 1MLCB 2VTFA 2IADA 4ONGH 3OXSB 3PV6B 5KSVA 2XWTB 4NZRL 5GRUH 4Z78B 2OSLA 4NGHH 3WFBH 1R3KA 4I18B 3VGFA 1XIWC 3Q6FA 4J6RL 5CEYA 5EBWA 2DM2A 3C08L 1A0QH 1OF2B 5FYKL 2YSSB 1P7KA 2IWGA 2QADC 3KPSB 3MRCA 2A74B 4RFOH 1SBBA 3MODH 4JQVA 2WINA 1CLZH 1P53A 4HF5L 5ESVA 3TO2A 5BCAA 3ULVF 2DQJH 4NQXA 2GSGA 4PGDA 1EVUA 3VDAA 2HA1A 3SY0B 5CSGA 5K59F 2VABA 2X4PB 5J0BA 2VUYA 2DB8A 4Z77B 3SO3C 1J1PL 1IQDB 1PVHA 3VDCA 4S1RL 1JPTL 1DUYB 1F8TH 1G7LA 1UZ6F 2YD5A 2VXVL 1VADA 5DD1H 2AJXH 5GS3A 1IT9L 4FP8H 4NFDA 5KS9E 3B2VL 1XAUA 2QLVB 1RZFH 1DQMH 3VWJA 4MSWA 1WC7A 5E2JA 5HTSA 3U1SL 5DFVC 4XXDA 1MPAL 1CFQA 5SX5K 5HYEA 4ZNCD 1C12A 4OQTA 2FSEB 6CGTA 5A2KH 3RVWC 3JWDH 2W0FB 4QXUH 1TMCB 4JFZH 3X14B 5GZNC 2FJGB 4D3CL 5DMKB 4ZUWB 2J8OA 2R4SH 2XRAH 4OCWL 3LIZH 4G7VL 1FLRL 3T0AA 3U4BL 1LE9A 4EZMA 4G3YL 3SE9L 4YO0A 4J4PC 5HY9B 4MQ7B 1UXWA 3FQRA 3W11C 1CLOL 4OJFL 2ZKHL 3RP1A 1YMMB 1A14H 4HV8A 4LCYB 1OLLA 1PFCA 5KZCD 5CZKA 1DL7H 3UTZB 5JHLH 2IPKA 3KGRA 4PJGB 3W2DH 3LQMA 5SWQB 4TRPL 4AIXA 1N6UA 5ENWB 4KVNH 4XMPL 3ZE1F 3VFRA 1G7PB 1LNUB 2ORBH 1GIGL 2UZXB 3VFUA 3I50H 3QQ4B 1SJHB 4PGBA 3UTQA 4LIQH 4MA8H 3WUWA 1ZT7A 4OKVB 2Z4QA 1OAZH 4GG6A 1SY6L 4JFDD 4RGND 3WFDL 4DW2H 3O2DL 1KN2L 3CLEH 3CFDA 3GHBH 4I2XB 3ILPB 2YZ8A 5TE7H 1FQ9C 5J1AB 3PIQB 4LCWA 3MUJA 5IP4A 5J11B 1FVDA 3O8XC 5GJSL 4YX2L 4ZAKD 3M07A 4NWUL 4N0UA 5HYSG 3KPTA 5E9DA 3PNWB 4OIIL 1RURH 4AM0B 4OLUL 5I6XC 4ZPVB 4JO1H 4PJ8C 2CMRH 1VKXA 3BKJH 2W65A 3ARDA 1QBMH 1IC4L 5CLTA 1FJ1A 5HDBE 4WUKL 3RUGE 2HFFA 1A9EA 4YHLH 2AEIT 3FO2B 4NKIL 3W9EA 1QLFB 4M6NH 3SCMB 3KPRE 3D0LB 5MERB 3QISA 5IR1B 3FONA 2E27L 2KKQA 3KJ6L 3GFUA 4FQHA 3VI3E 3EO1B 1F4XH 1S5IH 1GPOH 1Z0NA 1KCSL 4Y89A 4OZFG 2N1KA 4KWUA 5LWYH 4LLWA 2W60B 3HB3C 4I0PD 4MXQC 4P57B 3SKNA 3H0TB 3JV4A 3WUZA 4QRTA 2Z31C 4AMKH 4CVZA 1AGDB 3F7YB 2ENYA 2H6PA 4P4KA 3RVTD 1BVLA 2XV6B 2FJHA 5FGRA 5I1JL 5EIIB 3TT3H 3F58L 5KSAB 3K80A 1JGUH 3QCUH 2AJUL 2XG4A 4XNXL 4XNUL 1YN6A 2NLJB 3G5VA 1Z0MA 3DOSA 4PLKC 1ACYL 1WICA 2AV7A 1MELA 1RHHA 4P99A 2G75A 1T0MA 5TH2A 5CUSL 4OB5L 1E28B 5KVEH 5FAAA 2CK0L 4JG1L 4FOMA 2YD3A 3ORJA 4QEGA 4M61A 3N1QC 3FQUA 3QXWA 5C8JA 1YQVH 4OCYH 4L8CA 2VNCA 3WHXA 1MNUL 1W8OA 4JRXA 2PYED 4IBLT 4MAYD 2Q6WB 1OP9A 1VFMA 1P9MA 1Q72L 4HC1H 3ZMRA 3QDMB 2HFEA 3O6FB 3ET9F 3T1FB 3FT2A 5KG9B 1HI6A 2EDHA 5IMKA 1A7PL 4NT6A 1A47A 5C3TA 5F96L 1F13A 1CDJA 5IMLB 5L8KB 3V5DA 1FIGL 2X4TB 1QSFB 3NCYS 3CDGA 1OGAE 2JJVA 3HZYB 3JWOH 4F8TA 1NC2A 4D0CA 4EXPX 1XF5B 4DUXA 1FDLH 2O5ZH 4UQ2A 5E1HB 3QHZL 4K7PX 3P3YA 5C0GB 1FGNH 3MXVH 3OJVC 4JJ5A 1LE5A 1NFDA 1GGIH 1FFOB 3NZHH 4D94A 4JFYB 4KHXH 3HZMB 5C0FB 4L9LA 4IRJD 2X6MA 1DLFL 2VR4A 1FN4B 3TT1H 4K23H 4MJ4A 1INEL 4QOKD 3D69B 5D7JD 3EGSA 3E6FA 4O51A 5MI0B 3ARFB 3JV6A 2KQNA 3O9WD 3O11A 4W81A 3CDFA 5EZJB 4XVJH 4OD3H 3N1GC 1OPGH 4KK5D 5DJ0B 3NH7H 2DQEH 1EBAA 3S5LA 5C0CB 1XEDA 2NW2A 4PBXA 1BD2B 3S37L 3MR9A 4FQJL 1F4WH 1JFQL 1DZBA 2D7NA 1TNNA 5B3JE 7CGTA 1JK8A 1F6AA 2LFGA 2Z8RA 2FEDD 1KLUB 2VOTA 5EO1A 3DX7A 4N5UA 3OKLA 2X1XR 4ZTPL 1RVFL 4LSTH 1LP9E 3EOBA 1RZ7H 3NFSH 1KG0B 5FK9B 4OZFH 1U2CA 5E08H 2LTQB 5JLZB 4GRLC 3PHQA 2VLLA 5MEQB 3C60B 4Y19D 1HHJA 4PR5B 1J0JA 3QEQD 4V2BA 4P9MH 4DK3A 3VFVA 2FBOJ 3IDNA 4NKDA 3WIHL 5FUCC 4KRPD 3SQOL 4HIJA 2FIRT 4M8VA 3RGVA 4CMHC 1I3GL 3GNMH 4OQTH 4Y4KD 4MZ3A 5JUEL 3AS2A 3DUHA 1J10A 4Y2DD 1HHHA 5DRZB 3MLRL 1LO3L 5DGQA 3KPOA 1UT9A 4Z0BL 3CGTA 1RJLB 2Y36L 3CVHA 4OBRA 3G6DL 4NRZA 4R97C 4H25A 5C08D 4Y8DC 3K8LA 1S7QB 3IU4L 1WAAF 4PRNA 3ARSA 4I13B 5EOTA 5F7FA 5KS9B 3U0TB 4EUPG 3FJTA 5FKPA 3OKNB 1M7IA 1GH7A 4NO5B 1OAQL 3OKEA 3CUPA 3S6CA 3I6KA 2VR9A 3LS4L 3FOLB 5HGDA 3QUMA 5C0AD 3P73B 3V4UH 4RDQG 3WIFA 2XZAL 5ANMA 1AP2B 1EGJL 5EFIA 3VGGA 3STLA 5HHNA 4LOUD 2BVPA 2W1NA 4KZDL 1XR8B 3MNWB 4TUKH 4PRPE 1FBIL 4MXVE 3DNKA 3Q1SH 3EFFA 3V9FA 1FFQA 2DLFL 3Q3GB 4LSSL 2IC2A 4LKXA 1QR1B 2IANA 4ENEC 4M00A 2IJ0C 3QUZA 3QUYA 5L7XH 1CTNA 3ZDXF 5TF0A 5EBMA 1YEGH 1MVFA 1NC4D 2DQIL 3MRPA 1AD9B 1NCAL 3FRPG 3WD5H 3KXFA 4JHWH 4LQFL 4PJHF 3IJHA 3S5LG 3U7YH 1GRWA 3DVGA 3B9KD 4LLVB 1KXQE 4FTVA 4MCYB 4JHZA 3GBMH 4K9EC 3NA9H 2HVKA 1HQRA 5D7LA 2OCFD 4YE4L 3DGCR 3P9MB 4IDJL 4U1GC 4KI5F 1DBMH 5GPRA 4XNQA 2DQTH 5FV1L 4HUNB 2QR0B 2Z35B 3EYFA 3ZYZA 2AJSH 4AIOA 4JZOB 5T1DL 3MA7B 3CXDL 4TVPE 4MLIA 1PSKH 3GO1L 4PRDB 5BQ7B 4GG6E 3BUYA 2NY6D 5JMOC 4XP9L 4U1JB 1DQQA 3AS3A 5HVHB 2VZSA 1U8PB 5FHAL 5JIPA 5F7UA 4LCWE 4M5YH 3TV3L 4Z7UE 2P5WD 4N0UE 9CGTA 5E9DE 4JLRA 4HIIB 2D7OA 2YS4A 1BMGA 1IM3B 3MLYH 4P4RA 1RZJC 2XN9D 4LSDA 3RUGB 3MQIA 2EYTB 4G5ZH 3MOQA 3C6LA 4YXLH 3KPRB 4U1SA 4X4XA 1PZ5A 4LGPB 4R4FH 2FD6H 3X12B 1A4KB 1YNLL 3QO0B 1MJUH 4L8SA 4KAQL 3UO1L 5C86A 2F8XC 5I8KH 3MRDA 5EUOF 5DEGA 3ULUD 1F3DJ 4LHUG 3EYVA 2EH8H 2YKLL 3L3GA 4P9HC 4WUUD 1Z9OA 4WY7L 1S9YA 4EUPH 4OGYH 5DFTA 5L88H 4LRNL 2AK4A 1R5VB 4UILH 1O7SA 3BH8B 3CFJB 1FE8H 1TETL 4I48B 4LCIH 3UDWA 1WZ1L 3HMXL 4Z5RB 3CDCA 2FO4B 3ALWA 1QPPA 4IMKC 3PDDA 5DJ2A 2Q7NA 4ORZC 3QDJA 4QRRE 2IBBA 2FGWH 2HJLA 3AREA 3L5JA 2IBGA 1AI1L 1MRCL 3MLZH 4Y4FD 4JRXE 2LVCA 2VDQL 3SE3A 4NFCA 4OM0L 1I7TA 4LVHB 5GSRB 3DO3A 5F8RC 1KIUA 2BRRH 1R3HB 2H2PC 2EKSB 2HJFB 2XOTA 4P5TD 5DO2D 5E2WL 2PTTA 3MRKB 5KSBA 1XF4B 4G6FB 2EDLA 1HH6B 1OGAB 3EW3B 3QXVA 5DR5L 5J6GB 2Q8AL 4F37K 3RZCA 1OTTC 2ERJB 1CIUA 1ZLSH 1CT8A 1FAKT 1YDPB 1YY9D 4PYHA 5JW4N 3TNMA 4OZIA 1KULA 1Q1JH 2B0SL 2P8PA 1LO2H 5DK0A 35C8H 1NFDE 2EZ0D 1XCTB 2N7AA 4NP4H 3MGTA 5D70L 1FNEB 4PG9B 2UZIH 3VXUA 2OK0L 3C8KB 3VCLB 4Q6YA 5GS0L 4EN3B 2YXFA 1U8OA 4BSVA 4RCAA 4R2GD 3ZKND 3HMWL 2ICWJ 3KYOB 3FN0L 5E8PB 5BRZD 2Q86A 3STZA 2X2YA 4TNWK 1AIFB 3G5YA 5BMFL 4XCFH 4IOFD 3UZEA 2WW8A 4JM2D 4GAYA 1X44A 5IBUG 4BUHA 1D6VL 3G6AA 4GW5B 3WLWD 4H5SB 3B3IB 1NANI 3BESR 4X6EA 1K4DA 3HZVB 2BVOA 3BQUC 3B6SB 2CLRB 4HIEA 4PLJD 5BZDA 4KTDL 3MRRB 3W5MA 4H20L 5E24E 3SBWA 5E2TL 4QT5A 2NY1B 5LG1A 2J8UA 2ITCA 3NABL 3KDMB 2AJ3A 3CVHH 4NJ9H 2W07A 3DX6A 1J0ZA 3HN3A 2IADB 2QQNL 5H2BA 5H35B 1I1AA 4Y0GA 5JHDD 5KSVB 2H3NA 1OAXH 3MJ7A 1FO0L 2OSLB 5C07A 4L3EA 5DQDH 3VD9A 1GXEA 1R3KB 1I8IA 4KXZI 2DQHL 3Q6FB 5CEYB 3O0RH 3I75A 1S7RB 2UVFA 3KAAA 3RTQA 4CKVX 1LILA 1MCPH 4U1NA 1YEJH 3QUMH 1P7KB 3MRCB 4UDUA 3V6FA 5D2NA 2WINB 5CWSA 4QXWA 3TESA 5ESVB 2A6JA 2P8MA 4U31A 4FFZL 3TO2B 5KAQG 5IVNA 4XPTL 4NQXB 3U82B 4PGDB 3KYKL 3GJFK 4IRSD 4LMQE 1Z3GL 1QG3A 3F7RA 2VABB 2JIXD 1R5WA 3S35L 1DBBH 5BZWA 2QSTA 1UB6A 4AY0A 3W5NA 1G7LB 2YMXH 4OFDA 3VI4F 4XPHL 5LKNA 1VADB 1MCWM 5D72L 1S7WA 4GOSA 2YPVL 4N0CD 4MSWB 3VWJB 4AL8L 1WC7B 5TE6L 1HZHH 4K71B 2Y6SD 3RWHA 4GW1A 4XXDB 2AJZA 1CFQB 2W59A 1C12B 1JE6A 3R06A 3HE6B 2H1PL 5IESL 5ANME 3MLXH 2RHEA 4PRPB 1A7OH 4QYOB 3MUGA 3KPPA 1B4JH 4LSRH 5EA0H 5JR1H 4P46A 3NFNA 1A3LH 1KJVA 4YO0B 4DTGL 2VJXA 2FR4A 3MRNA 1JPSL 2XKSA 1OARH 3FQRB 2E7LA 3L7EA 4XX1G 4JFHE 1ZT4A 3QSKB 3CK0L 2F5AL 2RJMA 3HC4H 5EZLA 1IAMA 2HVJA 3KXFE 5B38A 2YA0A 4HK0B 2IPKB 1KPUB 4I8DA 2APTA 1X4ZA 3TNNA 4NCDA 5GGTH 2HFGL 1GGYA 4M7JL 3VFRB 1QFWL 1OTSD 3IDXL 4N8VG 1B9ZA 1RMFH 3VFUB 4PGBB 4R0LA 3WUWB 1ZT7B 3MCLH 2Z4QB 3LS5H 3KPSD 4GG6B 1PEZA 2ZUQB 3UJJL 5TF1L 4Y5YC 4FQ1L 4OD1L 1S9WA 4NM8L 4IHOA 3CFDB 3CFEB 4LCWB 5CGYC 1FVDB 4OFYD 3QR2A 2AQ3A 4N0UB 1CDBA 2P5EE 3MLWL 5E9DB 5F9WC 2I25N 4ZFGL 4OKDA 3LKRA 4CVWA 5ETUA 2FEEI 2W65B 2CJUL 1ZE3C 3CIQA 1FJ1B 5J57B 3OAUL 2OR9L 2HFFB 1A9EB 4M7KL 1HDMA 2V7HA 4LVNC 1VFBA 2E6QA 3W9EB 1JHLH 3ZE0E 2EXYD 2ICEA 2HKFH 4UT7L 2ICCA 1LO4L 2WBJA 1XIWA 4RGNC 1ZA6A 1B0WA 4HBCH 1IM9A 3L6FA 4LLWB 5I1IL 4ODVL 2AGJL 2WANA 1P84K 3SKNB 3JV4B 3JTSA 4QRTB 4ZAKC 4CVZB 5F93C 2H6PB 2FJHB 5L0QC 3O2WL 1U8MA 4WTWA 5I0DA 1GL4B 2AK4E 4DKFH 1YN6B 3G5VB 1GOHA 3SEPA 3EYOA 2AV7B 2DQDL 1RHHB 3JXAA 2G75B 1T0MB 5TH2B 4PY8J 5CILH 1RULL 2NX5A 4QRRB 4ONOA 4M61B 2NY5C 4NC2B 4ETQA 3FQUB 5C8JB 4L8CB 3L5WA 3QDJE 4R3SA 2J6EH 4JRXB 1GCFA 1DANU 1S7XA 2AQ1A 4X7DC 2J7LA 2HFEB 3FT2B 4I0PC 1HI6B 3PGDA 5IMKB 4NUJA 1NGQH 5C0BA 4NT6B 4PY7A 3THMH 1CBVL 1KEGH 3RVTC 4WHYG 1A02N 4ONGL 3T2NH 3V5DB 1JN6A 5GGUA 5KSBE 3QG6A 5B38G 1P5UA 3CDGB 3MLVL 1KLGA 4NGHL 3WFBL 4DUVA 1NC2B 4D0CB 1TJIH 4JJ5B 1LE5B 1J1XH 5D7KD 4M9PA 1NFDB 1A0QL 3GBLA 3CLFH 4OZIE 4NNXB 4J4PA 4BA8A 4RFOL 3MODL 4L9LB 2IFGA 4IMLA 1CLZL 3T0EE 1I3VA 4MAYC 4NPYA 4QRQA 2DQJL 3EGSB 1FNSH 3E6FB 3JV6B 2HFTA 2Z91A 4CMMA 4M6MH 1FORL 3O11B 4D0BA 3GSVB 5JOFA 3CXHJ 4PJ7F 3HPJA 1F8TL 4XX1E 3U83A 1A2YB 2NW2B 5DD1L 2AJXL 4FP8L 5C6PB 2F19H 1KTKE 1RZFL 3MR9B 5HHOA 3MUZ1 5KSAD 4CNIA 2LAGB 4M03A 3JSSA 1KIQA 2NXYD 1JK8B 4TTDC 1F6AB 4HUMB 3HUJF 3IDYC 1FL6B 3OJ2C 3JWDL 1NPUA 1KEMH 5EO1B 4QXUL 2YD9A 3AM8C 4PJ8A 3DX7B 1NBQA 4IRJC 4JFZL 5HI5C 4RAUA 1Z5LA 4U0RC 5T5FH 2R4SL 2XRAL 3GJEB 2JJTC 3EOBB 4YDVA 5D7JC 3U0PA 5D93B 3O4LD 3HFMH 2J8UE 2X1OA 3LIZL 3ZKXB 3O9WC 1FL5B 3PHQB 2DKSA 3BN9D 2VLLB 2FX8L 1HHJB 4HEME 3KJ4C 1RJCA 3QDMD 4WO4A 2R29H 4P5MA 3O6FD 4PV9A 5J12B 4KK5C 3VFVB 4LCUA 3IDNB 4L3EE 4NKDB 4NWTH 4NZUH 1A14L 3QRFM 5E8NB 1DL7L 3RGVB 1ZGLA 5IQ7H 3DUSA 5JHLL 5DI8B 3W2DL 4PPTA 1HHHB 1X5ZA 1T1ZA 5D2NE 4QHLB 3RIAF 2ORBL 2DI9A 3GMRA 5I1GH 2FEDC 5IJKC 3AGVA 3KPOB 5I8CA 5B39A 4LIQL 4MA8L 12E8H 2IFFH 3ESVF 3CVHB 4QXTA 1OAZL 4NRZB 4DW2L 4H25B 1BVKA 3SJVA 3CLEL 2VXTH 3GHBL 5TE7L 4PRNB 4WGVB 5EOTB 1MHHA 3OJDB 5FKPB 3CU1A 1M7IB 3ARFD 4GRMA 5EBGA 3OKEB 3UYOD 3WJLC 4WHYH 3CUPB 1RURL 3I6KB 4AENB 2ZG3A 4JO1L 4YDIH 3T1WA 4KRPC 3ULVH 1ZHBB 3QUMB 2CMRL 1Z2KA 5E8DH 3WIFB 5HPOA 2JB5H 3BKJL 5ANMB 2EDNA 4X83A 1QBML 5D4QA 4MA1C 5EFIB 3ULSA 5C0CD 3STLB 5IHLB 1ETZB 4Y4KC 5HHNB 2BVPB 4NNPH 1BD2D 2YR3A 4Y2DC 4YHLL 1KIRA 4U6TA 5SWZA 2OTUA 1UH3A 4K94H 4M6NL 4GKSA 2OYPA 3EFFB 4JPKH 3K8MA 1S9XA 3UPAA 4BZYA 4LKXB 1UWXH 2IANB 1J0YA 1F4XL 3QUZB 4ODUA 1S5IL 1G7IA 3QUYB 1GPOL 1T5XA 5LWYL 5EBMB 2Y07H 1YNKL 3UMTA 3QPQD 4A2LA 3KXFB 4FA8A 5F6IC 4I3SH 4OGXL 3WNNA 4AMKL 2VWEC 3DVGB 2FNBA 2ZUTA 3C60D 3TT3L 3CFKA 4K8RD 5D8JH 3OF6A 1JGUL 4PGCA 4WENB 5B22A 3QCUL 2HVKB 3ULVE 4R6UA 1HQRB 4KQ4H 1ZLUH 5E95B 4LARH 5D7IE 2XACC 4OLYH 3EAKA 4LCCC 4LOUC 4XNQB 4AYFA 1A6ZA 1WAAA 3EYFB 5KVEL 3A6OA 3KHQA 1UZ6E 2XI9A 4W4OC 1YQVL 4OCYL 3ZZ1A 3HPLA 3BUYB 3VJ6A 5FKAA 1IGYA 4XWGH 1OCWH 1DQQB 4OLZH 1U8IA 3FFCA 4AK1A 1BHGA 1I9JH 2P5EB 1T5WA 1MWAA 2ICWA 5EU5A 4HC1L 3FTGA 4Y5VC 4MD5A 4U1MA 4JLRB 4X98A 5KOMC 1T03H 5D1ZA 3D18A 3FOMA 3S88H 2A6IA 3WKML 3B9KC 3SE4C 4LRIC 5IBUB 4MJ5A 2UYLA 2IF7A 3C6LB 1AC0A 3VDBA 5DYOB 3JWOL 1GGCH 3WNPA 5IFAH 1PZ5B 1FDLL 2O5ZL 5EU7E 4NFBA 1FGNL 3MXVL 1XF3A 4YEEA 3BH9A 3EFDH 1GGIL 5I19H 2HRPL 1DBJH 3E8UL 4IRZH 3NZHL 4IIQC 5TQ0H 4L8SB 4KHXL 4PJHA 1MCQA 2CO7B 2NY6C 4K3DH 1DN0A 1ED3A 4X4YA 3TT1L 4K23L 5A2IH 5I66B 3MRDB 5AZEH 2ZPKH 4M62H 5DEGB 5IQ9A 4HPOH 4KC3B 3EYVB 3L3GB 2DJ4A 4YDLB 4P2RD 3ZE1E 1S9YB 1E6OH 2GEEA 2AK4B 4FZ8H 4XVJL 3UC0H 4OD3L 5TGBA 1OPGL 3TLRA 3NH7L 2DQEL 3RKDD 3O3DA 3SGJC 5KOVC 4M8QA 2BNUB 1F4WL 1UCTA 3QDJB 1T2QH 2NX5E 3AREB 3T65A 1F42A 1CVRA 1BJ1J 1PX3A 3T2QA 1GYAA 5IB5A 25C8H 4PJAF 4YGAB 2Q8BH 1I7TB 3NCYP 3GI8H 1MCKA 4IJ3C 4LSTL 1DUZA 3ULUC 3NFSL 1RZ7L 1UH2A 2ZOLB 5FB8A 5E08L 2PTTB 5C0BE 4I5BA 5KSBB 5E4IA 2BC4A 1T7YA 2X4SA 5EZOH 2IBZY 4MA7H 4HFUH 1JZ4A 3FQWA 3RZCB 3FB5B 4P9ML 4M48H 4HFWA 1KTRL 1U8KA 3TNMB 4OZIB 4G8GA 5EUOA 2P8PB 5DK0B 4HWUA 3UAJD 3GNML 4OQTL 4XPFL 1GOFA 3KPRD 3T0EB 1OL0A 1I1RA 3V8OA 2O61A 3HI5H 8FABB 4Y4FC 4TN9A 2D2OA 3U6RA 1U9KA 4BSVB 1UC6A 2VQTA 3G5ZA 4A6YA 3REWB 2X09A 2YWYA 1KC5H 2CD0A 2X42A 3EO0A 1XH3A 3STZB 1H3VA 1OSPH 1WT5C 3NCMA 4P5TC 5T33H 1FAIH 5DO2C 3G5YB 1MCCA 3TPKA 1H15A 4GAYB 32C2A 1AY1H 4LP4A 4NO2A 1YY9C 4NO3A 1FGVH 1MAKA 4X9BA 4Y1AA 4LK4A 4X6EB 2EZ0C 1K4DB 3TYGL 2BVOB 4ZMAT 4NSKA 2GQHA 4JQIH 4HIEB 1LMKA 5BZDB 4JG0H 4QT5B 4TUKL 2YRZA 4MB3A 2BOCA 3S37X 2J8UB 2ITCB 3HC3H 3K2UH 3G5XA 3Q1SL 3ZKNC 3DX6B 2AXFA 1ZXQA 1JRHH 5H2BB 1I1AB 2H3NB 3MJ7B 1E6JH 1KCVH 2Y25A 1TVHA 1F3DH 4L3EB 5L7XL 1YEGL 4Z7VA 1EDQA 5GRVK 3I75B 1ORQA 4JM2C 1JWUA 3DROB 3WD5L 3RTQB 4JHWL 3U7YL 3T0BA 4G6FD 3WLWC 2E7MA 1TZGH 4U1NB 1OGAD 4YZFF 3WMSA 2B5IB 4UDUB 3GBML 5DS8A 3NA9L 2F9BT 5D2NB 2E5EA 2ADGA 3NFPB 1C8PA 2A6JB 2P8MB 1DBML 1PKQA 1ZAGA 1TXKA 2DQTL 4PLJC 4UIMA 1WTGT 5DGRA 5GXBB 2YRLA 4HS3A 4YC2C 2AJSL 3GZKA 1MCOH 3I02B 1FNGA 3I3BA 3V6ZA 1PSKL 1R5WB 5BZWB 1UB6B 1BZ9A 3EDDA 4EN3D 5K9KB 1Q0YH 3LD8B 4JR9H 1S7WB 4M5YL 3MJ9A 5ICZB 5ITBH 1UH4A 2EDYA 4FQQA 3RWHB 2BSED 4GW1B 1RIVH 2AJZB 1RV6X 3R06B 3MLYL 2IBZX 4PRAA 5EC1B 1BGXL 4G5ZL 2HLFD 1FPTH 4YXLL 1EX0A 3IAPA 1F3RB 1MEXH 1NJ9A 2EDFA 3KPPB 3MUGB 3B2UD 4R4FL 5EPMA 5SWZE 2FD6L 4IRSC 3BDXA 4P46B 1N59A 3NFNB 5IOPA 3ZYOA 4DEPC 5DHVA 1MJUL 2B20A 1KJVB 1RZIA 2CPCA 2AXHA 3NZ8A 3MJ6A 3QEUA 2J3SA 2FR4B 5IVXF 5I8KL 4QTHA 2ATKB 2BNRA 1MWAH 4KMLB 3L7EB 1RZKC 1ZT4B 4L3CA 5EZLB 5HD8D 2EH8L 4Q0XH 2HVJB 4N0CC 3W39A 4L8BB 5C0EA 4JM2F 2DJSA 4NQDA 5DJ8A 2Y6SC 3CFIC 4OGYL 2DRUA 5D7IB 5L88L 4X9GA 1UVQA 3TNNB 3QIBA 2APFA 4UILL 1FE8L 1E4WH 1IAIH 4LCIL 4LU5H 2V2TA 4G80A 4YLQT 4NRXB 5GIRA 2JKXA 4R0LB 4YFDB 1WAAE 4FQCH 1X5YA 1S9WB 1M71B 4IHOB 4YK4B 4P23C 1A5FL 1H3UA 3MLZL 3FAXA 1KJ3L 1UA6H 3FFCE 3IFLH 3BPCA 1F11A 2Q87A 4CAGA 1J8KA 3ARBA 2BRRL 5LQBH 2XQBH 3GIVA 3GMQA 1FHGA 2DMBA 1N26A 4J3SA 2BSSA 1KNOA 3C09B 4QRSA 3P4OA 4Y16B 4BH7A 1TTFA 2V7HB 4F8QA 4I18C 1VFBB 1S7UA 3U30B 4M4RA 4JDVA 2CRMA 1OTSC 3WL9A 1FCGA 2X9WA 1JTOA 3HE6D 1Q1JL 2ICEB 1LO2L 1ERNA 2NY0B 35C8L 4NP4L 3FCTA 5LAXA 2WBJB 2VDMH 1XIWB 1ZA6B 1FV1A 1IM9B 4PRPD 3L6FB 2UZIL 1KENH 1ZTXH 5F9OH 5FUCE 3UYRH 4AIZA 4GLRH 3KPMA 3L5HA 3NIDF 1YEIH 3D2UA 3V6BR 3CX5K 4KI5E 5FO9A 4D0DA 1L4IA 1EAPA 1U8MB 5A16B 4AEFA 4XCFL 3EYOB 5E0QA 5ESQA 5FO8A 3G08A 3OHXB 3T3MF 4JVWA 2AP2A 4C54A 2FIKB 4JRYD 5ISZA 3T04D 4QGTA 2NX5B 3VXSD 3HR5A 1RSFA 3EOTH 3QT2A 3L5WB 2EXYC 4R3SB 3GK8H 1F6FB 2ATPB 2AK1H 1S7XB 4YNYA 4TVPD 5H94A 4X9IA 2FCBA 4W6XB 3GRWA 3PGDB 4K9EH 4A6YH 1NCWH 5C0BB 1CFTA 1MCLA 4PY7B 3CVHL 1CQYA 4NJ9L 1D6EB 2VE6A 4PG2C 2VLRA 4LCWD 1JN6B 1OAXL 5GGUB 2BY2A 1TCRA 3DRQA 1KLGB 3MNVB 5E9DD 3TBVA 5DDHB 3TBSA 2QL1A 3O0RL 1GOGA 5I71B 4WRLA 2A6DA 2YA1A 2DIBA 5CBAB 4FXLA 1MFEH 1YEJL 4G8GE 4B50A 4JGMA 1HWGB 1N5YH 4UBDD 1LDSA 1YECH 1K3IA 4IMLB 3OX8A 5FGBC 2VB5A 4QRQB 3ZHKA 1UKTA 1RZJH 2Z91B 4CMMB 1GHFH 2C4FU 3PWNA 1VENA 3PP3H 4D0BB 4PTUA 2OXHA 1DBBL 4CJ0A 3HPJB 4EI5A 3LRSB 2X70A 5J11C 3ZHLA 1DLHA 5ABDE 3BWAA 3Q5YA 4Q2ZB 4DJMA 3OB0H 5HHOB 1NFIA 4CNIB 1I9RH 2A83A 1HZHL 4BQ9A 2JJUA 3BZ4A 4MB5A 3PJSA 3O41A 5D7SH 1KIQB 1U95A 4Q9CA 4NKOB 4Y1AE 4LBEA 4NBZB 5L6YH 2RFXA 4P9HH 5I6XB 2FZ3A 2Z9TA 1DQDH 1QFHA 4QRRD 1A7OL 3DYOA 1Z5LB 4UT9H 2R0ZH 4YDVB 3U0PB 1ODAA 1B4JL 5DXWA 4JRXD 5EA0L 1DVFA 5JR1L 1IGMH 1A3LL 2FL5A 3OAYK 4UNUA 4P5MB 4WO4B 1FP5A 5IB1A 1OARL 4OUUA 3N50A 4XNYH 3MJ9H 4Z0XA 5CEZL 4Z7VE 4J23A 4JFDA 3HC4L 3DUSB 5KSAC 3BP7A 2V9RA 3LV3A 1ZWIA 2FDBP 4JFPA 2NXYC 5GGVH 4JDZA 5GGTL 4LKCA 1NC2D 1T1ZB 3U4AA 3HZKA 4ZAKA 3VXMA 4AH2A 4PJGF 4TUOA 2EDBA 1MQ8A 5I8CB 1CXKA 5DF0A 4DCQA 4PJ7A 5B39B 4OQ1A 1PKQE 1WTLA 3OAZH 4HKJA 3MCLL 4NKMA 4UIKL 3LS5L 4QXTB 3UP1A 1DANT 1ND0A 1C08A 4OSUH 1R5IA 4RMUA 3M8OH 1BVKB 1CVSC 4MQSB 5DHVH 4YIQA 3KLAB 5TJWK 1A6VH 2WK2A 3BN9C 4NRYA 1WWWX 4GRMB 2AAVA 2ZUSA 3MNZA 3HUJA 3O6FC 4KROB 1LK2A 5CZVH 2OMNA 3OGOE 4R9HA 1KXTB 4LMQI 5ALCH 1QZ1A 4KK6D 1C7SA 4YHIA 3S35X 4GBXA 5D6CA 3ULSB 4HCRL 2EICA 1LO0H 2CIIA 5LGHL 3G9AB 1KIRB 2DMKA 3BN3B 5SWZB 1JHLL 2OTUB 4XAWH 5JIHA 3ARWA 1VEPA 5KVMC 2XTJE 2M2DA 1S9XB 3CH1A 2HKFL 2H2SD 3MLTB 5T5NF 3K46A 4PJDF 5GSVA 4KH2A 1G7IB 1T5XB 2BX5A 1JGEA 3OG6B 1FNHA 1WCQA 2BNRE 2XKNA 3T2PA 1NBZA 2ITDB 5MI0C 3ARFC 4XXCC 3QJFA 5GS2H 4GMTH 4ZUSA 4WTZA 4ZPTB 4IDLA 2O5XH 3CFKB 2YXMA 4JDTH 4NQDE 5AEAA 3DVFA 3ZKMD 4XPBH 4H0IA 5J89A 3WXVH 4DKFL 4FQLL 5IFJA 1REIA 4U6YB 4G8FA 4ODXA 1ZVYA 1Y6KR 1A6ZB 5E99H 3RGVD 3MC0A 5CILL 4HKBA 5MEOB 5F7HA 4KK9D 1WWCA 3V6OA 1H3GA 2HTLD 3QWRD 3VJ6B 5FKAB 1IGYB 1WUNT 2J6EL 3VFMA 1WLHA 1XT5A 4F3FA 1U8IB 3FFCB 2J5LB 1T5WB 1UFUA 2ICWB 5E5RB 3WYRA 3UTSE 5EU5B 3QXTA 2EDXA 4ELKB 3FTGB 3DV4B 4X6FA 4MD5B 4U1MB 1KCKA 4X98B 3QPQC 4O9HH 1NGQL 3ARVA 2R56H 2LTQC 3D18B 5D1ZB 5EORL 3THML 3FOMB 2RBLA 5I1LA 1KEGL 1MSPA 1GC1C 1VCAA 4IRJA 1WGOA 1M7DA 3C60C 4R4BB 3T2NL 4MJ5B 2UYLB 4K8RC 4M93B 1MAMH 1LEGA 4OBSA 4H0GA 1N6QH 2DQFA 5DJXA 3VA2C 1TJIL 1F3JA 3O9WA 5FUOL 4WI4A 3VXNA 1XF3B 1J1XL 3BH9B 3QG7H 3QWOA 5T3ZH 3CLFL 1VSCA 4F37F 5E6YA 3R0NA 4G9FE 4OF0A 1KPVA 1DN0B 4X4YB 2C3VA 2FLRT 5I1HH 1TDQA 1CL7H 5DVLA 1CDYA 1FNSL 3GRWH 2W92A 4J3XA 5H8DA 3QUZD 1Q0XH 4M6ML 2VC2H 2HLAA 4N9GA 3MYZA 5AYUH 1NUFA 5C6WH 1JZ7A 4JFHD 3WS6C 3BE1H 5TGBB 1KB9J 3ZTJG 4FQXD 4HJGA 3KXFD 3O3DB 3DURA 4M8QB 3BEWA 3SE8L 5IVZA 2F19L 1TZIB 5ISZE 1FG9C 4MA3A 3T65B 1H8SA 4Y19A 5T3ZE 3O3EA 3SDXF 3WJLA 2BHUA 4KJQD 4HULB 2DTSA 4HMEA 4ZFOL 5BW7C 1KEML 4OM1H 1X5AA 5IB5B 1CXHA 4QLRA 5I1DB 4FFWD 5T3XE 4XMLH 3D5OF 3GMOB 5T5FL 1DUZB 5I2IA 5DFWH 5HGAA 2Y06H 1H0DA 4Y4KA 5FB8B 3HFML 4I5BB 2CKBA 2BC4B 2P5ED 2X4SB 2P8LB 3DXAE 5HGHA 2VLRE 3TBYA 4OGAD 3FQWB 5B3NA 2R29L 1NGWA 1T83C 4HJ0D 1NGZA 4NWTL 4JKPH 1IBGH 3RKDC 4HFWB 4NZUL 1U8KB 4ZO6A 4G8GB 5C08A 5EUOB 4DAGH 5DZOA 4GAJH 5IQ7L 2EC9U 1QHPA 5CZXD 1A1NA 5HHQA 1JIBA 4DZBA 3C6LD 4F33A 1G9NC 2O61B 2D7MA 5CMAA 2PW1A 1DBAH 3KWWA 5I1GL 1N5AB 3G5ZB 1SQ2N 1JWSA 12E8L 2IFFL 2NYYD 3EO0B 5F1IB 1YUHA 1U93A 2VXTL 4QHMA 5A2LH 3V4VH 5HVHC 2XA3A 1GJIA 3BFOA 1H15B 4PJFF 5KS9F 5HI3D 2GJZA 3EDFA 3IGAA 3VRLE 4F7TA 5TDNA 2UUDH 4NO2B 4NO3B 2AK4D 1D5ZA 1OTUD 4PJAA 4YDIL 3ULVL 2MWCA 3MLSH 2L7UA 5E8DL 5BVPH 2JB5L 1EEQA 4Y1AB 2KZ1B 4KVCH 1QFUH 1CE6A 1U2HA 3UAJC 3ARTA 4Y5VA 2V5RA 4ZOBA 4D9QE 4NNPL 1QYGH 1L6XA 1YY8A 2BOCB 3QDJD 4K94L 5GQBA 4I77H 2FWOA 4KKCD 3SE4A 3ARED 3FO0H 3G5XB 1D9KA 4LRIA 3WBDA 5K9JH 1BQSA 4P3DA 4OCLC 3H9SA 3PE9A 1TVHB 3WNOA 2OJEB 4S1SH 2NY5H 2Y07L 4JE4B 4Z7VB 3V8CA 4O02H 1ORQB 4WW2F 1G0YR 1JWUB 4IIQA 4I3SL 5MP6H 5CEXA 1CQKA 3ZTJH 1FZOA 3MLUH 4OV6F 1MIML 2CDFB 5D8JL 5DS8B 1EBPA 1WF5A 1Y0LA 4BFIA 2BRQA 3RZCD 2PXYA 1B6DA 4KQ4L 2BERA 4LARL 2VZUA 5IVOA 4OLYL 3B9DA 3VXME 1PKQB 4UIMB 5TQ2H 3QQ9D 4HS3B 5IBTH 4OZGA 4PJ7E 3CFBA 3BHBA 3V6ZB 1FNGB 2I9LA 3VFWA 1BJ1H 3OKYA 3T0ED 1I8LC 1IGCH 1I85A 3BMWA 3QA3A 1BZ9B 4XWGL 1ZLVH 5EU4A 3QQ3A 1KCRH 2W0KA 4OLZL 4B5EA 1I9JL 3RU8H 4JZNB 4FQQB 2ICES 3DX8A 1T03L 5FOBB 3S88L 1F4YH 2WP3T 4LLQA 1V7NH 2E6JA 4Z7QF 1CDGA 3QH3A 2ERJC 3UZQA 3QUKA 1GGCL 5IFAL 1NJ9B 1QVOA 5JQ6L 5EUKA 3EFDL 1LEKA 5I19L 1N59B 1IZKA 1QNZH 1DBJL 3PWUA 4IRZL 3RQ3A 1C16A 5DHVB 3NZ8B 1RZIB 4UTBH 3QEUB 4K3DL 4QWWD 4QTHB 4EN3C 2BNRB 4GXUN 1RUKH 1AHWA 2ZPKL 4M62L 5AZEL 4L3CB 1J05A 4ODSH 1J86A 5FYJE 1JI2A 4WI6A 1YEEH 1I1AD 3W39B 2I24N 5C0EB 4NQDB 2E9IA 5IW1A 1E6OL 3BD5A 4N9OB 1HH9A 3QIBB 4FZ8L 3UC0L 3BI9X 2J12B 3ZTNH 3O2VH 5E03A 3RTQD 2HLFC 2V2TB 4G80B 4KDVA 1WT5A 3A6CH 4O2EA 4GJTB 3B2UC 1T2QL 4XPAH 3V6OE 1AFVH 4LPXA 4X4ZA 1B0RA 3UTSB 3IKCA 3D25A 3CSYA 4K3GA 25C8L 1N7MH 1AKJA 2Q8BL 4KU1A 3BPCB 1F11B 3GI8L 4WU5B 5I9QB 1JNNH 2I9TA 3ARBB 1NFKA 3UTTA 3DECA 2MHAA 1UWGH 2BHZA 3GIVB 3GMQB 4CVUA 5JA9A 1EUUA 5DHYA 3QB7C 2YD6A 2J4WH 2BSSB 1KNOB 3V7MA 5EZOL 2EYSA 4MA7L 4QRSB 3P4OB 2R8SH 4BH7B 4HFUL 3UYPA 1RAMA 4YBLB 1HK6A 1S7UB 2BSTA 1CLCA 5JQHC 3RRQA 3BT2H 4JDVB 3WL9B 1YYLL 4M48L 2EEBA 4QY8A 5BRZA 5JO5A 1OLZA 4G9FB 4KQ3H 3FCTB 1HWHB 1Z9MA 4JQVC 1FV1B 2CRIA 1VA9A 4OIAA 4JM2A 1X5JA 3HI5L 2H32H 4J3TA 2DL9A 1OQOA 4AIZB 4P46D 2WUCH 1MCJA 3KPMB 3KS0J 1KC5L 3D2UB 5J9PA 1XFPA 4OTXH 1OSPL 4HUKB 5T33L 1FAIL 1PW3A 2I26N 5F70A 4OZHE 2Y5EA 5LXGH 5ESQB 3B9VA 4X5XB 3G08B 3NVQA 3VWJC 4CU7A 2P47B 5ISZB 5INCA 5IF0A 1AY1L 3HR5B 4X5LA 3GB7A 3MZTA 1FGVL 3WCYA 5JHDA 2VKWA 3UJTH 3HE6C 1R3LA 4MHHI 1XGQA 5J6HA 3TJHD 4JCMA 3WKNA 4JQIL 3C5JA 5H94B 2GK0A 4JEGB 5F89A 4CJ1A 1NCTA 4JG0L 3BPNB 2ZNWA 1PGRB 4JM4H 4JFQA 3BDYH 1LP9F 1CFTB 2AKRB 3HC3L 4M6AA 3K2UL 4OF7A 2DKUA 5ICYA 2LABA 2NZ9D 2VLJA 1JRHL 2VE6B 3DXAB 4HHAA 4KTEH 3H3BC 2VLRB 4XC1H 4BK5A 3NCEB 1E6JL 1KCVL 4U6XA 3TBVB 1TCRB 3DRQB 3TBSB 2RCSH 4R26H 4RMTA 2VN4A 1EEZA 4IRSA 4ODHH 4B7LA 2A6DB 2OL3A 4ZS7H 4DGVH 5DD3L 1NUGA 5FCUL 1UEMA 3S36H 1TZGL 3F12A 3MYJA 1UEYA 4Y16D 4G42B 3OX8B 4LAQH 5EH1A 1CDUA 1D5MA 2VWEE 2NY0D 1N6VA 1QKZH 5DZNA 2FJFA 3V0VA 1MCOL 2WBJD 3OSKA 4IS6A 2A0LD 2F54A 1ZVSA 4D9LH 4EI5B 4HIXH 2X70B 3LEXA 1DLHB 1Q0YL 1HYRC 5DEFA 1IGIH 3BWAB 1CI5A 4YHZH 2FO1A 3CH8A 4Q6IB 5ITBL 1L6ZA 5TPWH 1MREH 1NFIB 2A83B 4EOWH 2ZG1A 5E5UB 4O58H 3BZ4B 3PJSB 4YFEA 3O41B 1CK0L 5AZ2H 4PJAE 3FN9A 2X4NA 1IZJA 1A1MA 2KPNA 4LBEB 2RFXB 4EQ2A 4UBDC 4U3XA 4JFXB 2FX9H 1FPTL 2FZ3B 3PHSA 4O00A 2UVEA 1MEXL 4NQCE 5IB3A 3PV6A 3LEYH 4MXVF 1P84J 1NEZA 5H37G 1DVFB 1IKNA 2HKHH 5JW4M 3ROOA 2FL5B 2B4CC 3H9SE 5IB1B 4TULH 4OUUB 1MWAL 1JPFA 5TE4H 5C0BD 1H9VA 4Z0XB 5J56B 4YHNA 1I1FA 4L4TA 4XTRD 2VIRA 4JFDB 4QRUB 4Q0XL 3OBAA 5SX5H 3K2MC 3TH2T 2VLKA 4U1HB 4KMQA 3BP7B 3V5HA 3GSWA 3LV3B 2AXJA 4XVUD 4JFPB 2AXGA 3RWFA 4JDZB 4AQ1B 4LKCB 4AH2B 3HZKB 3VXMB 3ZKQD 4OZ4B 4TUOB 1E4WL 3ULUH 1IAIL 4JPWL 4YEFA 4LU5L 4DCQB 4PJXE 4PJ7B 4HKJB 1DUYA 1IL1B 3HR6A 4GMSH 4FQCL 3VH8G 1ND0B 2ZSVA 1C08B 1FVEB 3IDIA 4OZGE 1R5IB 1U8LA 4L1DA 4WV1A 2R1XA 4HJJH 4Z95H 4KKBD 4TSBH 1ZHKA 1INDH 3RL2B 3E3QE 1JZ8A 4NRYB 3AU1A 4PJ9A 2R9HD 2XT1B 1J9CT 1F2QA 3MNZB 1LK2B 4Z7UF 2MCG1 2XWBB 5LQBL 4R8WH 5DUMH 2XQBL 1F4HA 3REVB 4YHIB 4GBXB 4J3VA 1IAKA 2R69H 4XP1H 2P49B 5GGRB 4EEEA 1PG7H 3MV01 4HXAH 3D48R 2VR5A 4LLYB 2JK5A 1S7TA 3WS3A 3CH1B 5D2LE 4NN5B 4P2OA 5GSVB 2VDML 4L9LC 5HHXH 1JGEB 4LCYA 3ZT5A 1J8HE 1KENL 1ZTXL 5F9OL 3UYRL 1BJMA 2Y4SA 4DN3H 4YZFE 2XKNB 2C4FT 3K1DA 3NIGF 1NBZB 4PB9H 3EBAA 3MTRA 3QJFB 4PJGA 4ZUSB 1YEIL 1CFVH 1U3YA 2K3TA 3QXDA 2W9DH 1BJ8A 4WO4D 2EDEA 1PBYA 2YEZB 3FO1A 4KK6C 5IW6A 5IFJB 4QF1B 1CN4A 4ODXB 2DL2A 4LSUH 1QP1A 3PIQA 2GTWA 3EOTL 4JAMA 3O45A 3VE0A 3GK8L 3VFMB 4F3FB 2H2SC 1NAMH 1KGCE 2AK1L 1FZMA 1HSBA 3WNMA 3L1OH 3AS0A 4ELME 1A4JA 4X6FB 2DM3A 3GI9H 5I1KH 5D93C 4K9EL 4A6YL 1NCWL 3DHMA 3UTTE 3ZKXC 1C1EH 5I1LB 1QBAA 3FO2A 5FM8A 4IRJB 4H88H 1GSMA 1M7DB 1NDMA 2V2XA 2G2RB 4F7EA 1LEGB 2QTEA 5J12C 4KROD 3ZKMC 1PG7W 4MLSA 2EXWD 2AJYH 2H9GA 2DQFB 2KDGA 3LHPH 4PJDA 5DJXB 1F3JB 4YJZL 3VXNB 4ERSH 2ICWI 1KOAA 3RGVC 3QWOB 1MFEL 1NFDF 2ZNXA 4KK9C 1RUAH 1J0KA 3O6LH 1KPVB 3SKJL 1N5YL 2HTLC 3MMEB 2JB6A 1RQ5A 4G8EA 4B0MM 2RR3A 2ZG2A 1YECL 5JIIA 3IU3A 2C3VB 1X7QA 4ODTH 5EIIA 3M45A 4DKEH 4TOYH 3S9DB 2BDNH 4C57C 5LVEA 1U8QA 1RZJL 5JZ7D 1GHFL 3HI6H 3IFPA 1G7JA 3BKMH 3OTTA 4WCYH 2HLAB 2VDKH 4N9GB 4XP4H 1OP3K 4OZHB 1G9MC 3MJ8B 5HYIA 2NTSP 4HJGB 3MRJA 3DURB 3V7AE 3BEWB 4FABL 5IVZB 1RD6A 4JHBA 3O4LA 2OL3H 4XCCH 1OP5K 5CJ8A 1I9RL 4BELD 1UKSA 3L7FA 1MIEH 5D7SL 3U46B 1NANH 3O3EB 1RZKH 4QHKI 1WV7T 2QQLH 5L6YL 4P9HL 2BVQA 4U3HA 2E9JA 2EDWA 1RZ8A 2WWKT 1DQDL 3P40A 4CW1B 1CXEA 4UT9L 2R0ZL 1TJGH 5E2UL 5HGAB 1KN4L 5I2IB 1H0DB 3L3OA 1B0GA 1D7FA 2CKBB 3RNQA 2A77H 3FFCD 1IGML 3QUZC 3EJYD 5EWIL 2VLJE 5HGHB 3CAFA 3VGAB 3TBYB 1NGWB 1NGZB 3FQTA 1FG2B 2I5YH 2DBLH 4XNYL 3MJ9L 5D1ZD 4KXZH 3U9PH 5C0FA 1TITA 3CSBA 1SHMA 3BZEA 2E6PA 1A1NB 5I1EL 5HHQB 4GLRI 3K0WA 4DZBB 5JIKA 3FL7A 4F33B 5GGVL 2M8XA 5DD5H 3IKKA 5CMAB 2PW1B 4KJQC 3NIDE 3KWWB 4HMCA 1JWSB 5IM7A 4FFWC 1MFAH 1J1OH 1YUHB 4OSUL 1X5XA 1KBGH 3M8OL 1U93B 4N8PA 3T3ME 2VXSL 1BD2A 2F54E 1U8HB 1A6VL 1E0OB 3EZ8A 2C7UA 2FRGP 1MJ7H 3SDXA 4OGAC 3SN6N 1A21A 3IGAB 4HJ0C 4F2MA 4F7TB 5TDNB 4C55A 1D5ZB 4PJAB 5T5NG 3FQXB 5ALCL 2EDOA 4OCSH 1CICA 1CE6B 4NQEE 5DURB 2FH8A 5CZXC 1S7VA 3CSGA 1KG0A 1LO0L 3C6LC 5HVWA 4NQCB 4V1DE 1O0VA 1YY8B 2XFXA 4XAWL 2Q76A 5L2KE 3OKOA 2FWOB 3D39E 1KCUH 2NY2D 2P7TA 1D9KB 3RX5A 4P3DB 2NYYC 4L8SC 4NJAH 3H9SB 4EI6B 2JTDA 5EU6A 4HMDA 5KTEH 4Q9QH 3MOAH 3T3PF 4IIQB 1OW0C 2SEBA 3TH3T 5HI3C 4L4TE 1FZOB 4GMTL 3SKOA 1HEZB 3STBA 2O5XL 1OTUC 5DWUH 1YQ2A 2VLKE 1D5BA 4JDTL 1NGPH 1EHXA 1Y0LB 4BFIB 4HS8H 2PXYB 3UBXI 5LJYH 1YYMH 4M43H 4XPBL 3WXVL 4PJXB 2VZ3A 1FFPA 3UDWC 1YMHB 1AQKH 2P1YA 4G8GD 4QHUA 5E99L 3RI5K 3GJFA 4OZGB 3CFBB 2VDLH 1A3RH 3BHBB 4PJFA 3U0TA 2I9LB 4KKCC 3AREC 3VFWB 5KS9A 3BWUC 4LGSB 4NOFA 3OKNA 5DC0A 3QA3B 1FRGH 4HWEH 4GS7B 5EU4B 3QQ3B 2LVEA 4LEXH 3F7QA 3P9LA 3G6JE 3H9HA 4H8WH 5GS1A 5GRWA 4ZNEA 1IEHA 4EKXA 3F6IA 3DX8B 3S4SA 3E1F1 1MCHA 2DIAA 4X5WA 5A3ID 1JNLH 2R56L 3VXQB 2X89D 4LLQB 4UAOB 2KH2B 5K33A 4IJ3B 1MAML 5DEZA 3RZCC 1WWBX 2N7BA 3K74B 4HWBH 4JKKA 5D1QD 3QUKB 1N6QL 4UNVA 4M1GH 1QVOB 1IE5A 5M7QA 2EC9T 4P2RA 3ZE0F 5HYFA 3QQ9C 2PTVA 4Y1AD 3O3AB 1LEKB 3QG7L 4RBPK 3PWUB 4WW2A 3BDBA 1C16B 3UEZA 1RY7B 3IDJA 1MRDH 4U2YA 3T0EC 4XB7A 3LSOA 1KELH 1AHWB 1H3PH 1RUQH 4LLVA 4V2CB 5I1HL 4MCYA 1CL7L 2IPUG 3T8XA 3GRWL 2X4OA 2C3HA 2ZUXA 2ZZUT 6FABH 4HUUA 1ZKAA 5IW1B 2VC2L 1HH9B 1EEYA 2VQUA 4GQ9H 3VFPB 3C5ZD 3BE1L 1JV5A 1NCDH 3DYPA 5FGCE 3MA7A 3X3FH 4PRDA 3QEGH 2GITA 4O2EB 4U1JA 1P4LA 1F45A 4UV7L 1BIHA 1B0RB 3IKCB 3D25B 1P4IH 3RWEA 4OM1L 2Z8SA 3CSYB 2EIBA 3SBWC 3DYMA 4QWWC 1AKJB 1G6RB 2I9TB 4XMLL 5C6TH 1LDPH 3UTTB 3UZVB 2MHAB 4NUGH 2Y06L 1EAJA 5DHYB 43CAA 1I1AC 3QXAA 3DMMA 4E42A 1MRFH 4HT1H 2EYSB 4R2GB 2BSTB 1NLDH 4JKPL 1IBGL 4PJDE 3RTQC 1IQWH 5JO5B 5BRZB 5IMOA 2HH0L 3T77A 5CGMA 4GAJL 2B5IC 3LKSA 1TFHA 1U8JA 3TZVA 5D2NC 2XIDA 2XTJD 2JELH 3RDTD 4KUCF 2E7BA 1DBAL 3L3IA 4Y4HA 5I75B 5JORA 1TVDA 1R5VA 1QHOA 1A7QH 5J9PB 5AYQA 2G5BB 1YPZE 2MPAL 3MO1A 2BNRD 3P4MA 3V4VL 2FGZA 3LD8C 3BUTA 4PTTA 2XG5A 3E2HC 4YHYB 5BO1H 4ZODA 4U4BA 1FH5H 1V3LA 4PJBE 4NQDD 5INCB 2NW3A 1I8LA 5DLMH 3U79A 5IF0B 5HSFA 1LEIA 3GB7B 3O4LE 5JHDB 2OXGA 5HVGB 2Y72A 3MLSL 4YHKH 5BVPL 2BVYA 1LQSR 1WEJH 3DIFA 5SV3A 1R3LB 4KVCL 1QFUL 2NY4B 5J6HB 2BSRA 5GSRA 3OKKB 2YUXA 3C5JB 1QYGL 2GK0B 1I1YB 2QKIA 3OL2A 3DO7A 3AVEA 4G6AD 3MRKA 3NA4A 1JL8A 4I77L 4JFQB 3LN9A 3HS0A 3FO0L 3LB6D 1AH1A 4P46C 4KZEH 2VLJB 4HHAB 3UTSD 3SGKA 3VGHA 4U6XB 3C8DA 1PD6A 4S1SL 3BMVA 1EEZB 2NY5L 3LN4A 4O02L 1VEMA 2OL3B 4BYHA 4GW4A 1FNEA 4EJ1C 2HT4D 3ULVC 5MP6L 4OLXH 3MLUL 3F12B 4EIZC 5CD3A 3N1FC 1WVZA 1F58H 1T21A 4XBEH 3KYOA 3TJHC 3N06B 1D5MB 5TQ2L 4R0LC 5GRXG 2O93L 1GC1H 4G9FD 5IBTL 2FJFB 3V0VB 4K8RH 1T1YA 4IS6B 1A6AA 1HHKA 2F54B 3IS1X 1ZVSB 4YK4C 1IGCL 2NZ9C 5JDJA 1PKOA 4GW5A 3DUUA 3LEXB 1KCRL 5D5MF 5DEFB 3J7HA 3HCVA 3SDDD 4Q7DA 3RU8L 1I8MA 1YEDA 4KTYA 3D2UD 3SDXE 2Z8VC 2J1KA 4NZTH 3QBTB 2X4NB 4M1DH 2BXYA 2EDDA 5F8QC 5JMRA 1F4YL 1LP9A 1A1MB 3C09C 1V7NL 4Y16C 4V1DB 1XZ0A 5EU7C 3KDMA 3D85A 4I9WE 5CKGA 5FO7B 3U30C 5ISZD 1DSFH 2BJMH 3D39B 5IB3B 2PR4H 5T3ZD 3GJFH 5H35A 2EDTA 1MCBA 3U36A 1NEZB 2NY0C 1QNZL 1RJYA 2WBJC 1F90H 3LDBB 3HNTH 5I74B 3W0WD 3ROOB 5T3XD 1S7RA 2A0LC 3MOBH 3CX5J 3U9UA 4PGEA 4UTBL 1SYVA 5EU6E 4POUB 1JPFB 3KS0H 4K3JH 4P2YA 4HLZG 1RUKL 2A73A 4YHNB 3S3SA 1I1FB 4L4TB 4ODSL 2VIRB 1MFCH 3DXAD 3S34H 2VLRD 1YEEL 4PRIA 3PP4H 2VLKB 2GW5A 3V5HB 3BAEH 5E6ID 3GSWB 3RX8A 2AXGB 3RWFB 3K3QA 5D7IF 3ZTNL 5MEPA 1HOCA 3GSQA 3O2VL 1WITA 4OGZA 1QSEE 4AZ8A 5A2FA 2ENSA 4TVSa 4UV4H 4U7KA 1M1SA 3VG9B 4A2MA 3A6CL 2ZSVB 3IDIB 3PL6A 1M4KA 1U8LB 4WV1B 4NQUA 4XPAL 2R1XB 4PJFE 3T0XA 1LO5A 1XGYH 2CH8A 1ZHKB 1AFVL 3H42H 2QHLA 1TLKA 1JZ6A 4PJ9B 3AU1B 5FA4A 1NH6A 1N7ML 1QEWA 3HE6A 5EDXA 4ZNEE 4FFVD 3VXTA 4XAKE 1UWGL 2E8ZA 1J88A 2HP4A 4XTRC 2D4FA 1G9NH 4PP2A 3INUH 1FVCB 3B4NA 1NCCH 3RZWA 4PRPA 4EI5D 4R96B 3S96A 4QRPD 2J4WL 1IAKB 5IUSA 4TSCH 4QYOA 2I27N 2D03H 4XVUC 1R24A 2EE2A 2R8SL 3HNSH 4ONFH 3TA3B 2XICA 5I71C 3QHFH 4U3CA 3BT2L 1KLFA 2JK5B 1S7TB 5ICXB 4P2RE 4D9QD 4UNTA 3WS3B 4B53A 1UM4H 3KHOA 1U6AH 4KQ3L 4OI7A 4P2OB 2VUOA 3WO3B 4J7RA 4KKBC 4K7PY 5IWLC 1YEHH 1HN1A 3D3VD 3O2DA 4ZO7A 4JRYA 3VXSA 2EDQA 4HK0A 3DVIA 2R9HC 1KPUA 1DVFD 4ZUVA 5DVKA 1H8OA 2WUCL 5EO9B 1T4KA 2ED8A 2GUOA 3QXDB 4ZUTB 3FO1B 5IW6B 4WNQA 5FGCB 3ECBA 1F00I 4MQXC 2QJDA 5LXGL 1A6TA 1UJTA 3RWJA 3MUHL 4RAVA 5DTFA 4HUWA 3CFEA 1EERB 3VD3A 4D8PA 4NIKB 4DFHA 4UI2A 2GTWB 5DJDA 4OLVH 3UJTL 2OJZH 1OVZA 4JAMB 4Z7UA 3O45B 3VE0B 3VXMD 1OOAA 3PWJA 3ESUF 4ZXBB 4HLJA 1FZMB 4NC1E 4BQ6A 5F9JB 1HSBB 2KZWA 5FYLE 4MNGA 4JVUA 1A4JB 1ZT1A 3H2WA 2XWJB 1T2XA 4JM4L 4J3UA 1HINH 3BDYL 3LZFH 4Z7QE 3UPCA 4KTEL 4XC1L 3TF7C 1NDMB 4XBGA 1MJ8H 2V2XB 4HLZH 2HN7A 4F7EB 2VZ1A 4WO4C 3VWKD 4NBYB 4RSVA 4F9PA 2H9GB 4PJDB 2RCSL 3ZKSD 1WK0A 4R26L 4JHAH 4LVEA 4ODHL 4ZS7L 1SEQH 4DGVL 4WI5A 3H6JA 1KJMA 2V5YA 4GBXD 3S36L 1SEBA 2GKIA 2CIKA 2VZVA 2JB6B 4G8EB 5C09A 3MX0A 5IB2A 4F80A 1N0XH 4OCXH 3IU3B 4LAQL 1X7QB 3QP3A 2Y7QB 1RU9H 1U8QB 2B2XH 5E5MA 2NXYB 1QKZL 5DRNA 3IFPB 1G7JB 2GT9A 1JZ3A 3ZL4L 4D9LL 4DVRH 3QNXA 4HIXL 3EOAA 5FYJD 4XP5H 4QRRA 3MRJB 4PJBB 1IGIL 3EJJX 5HDQH 3CVIL 4KROC 4DKDC 4YHZL 3O4LB 2WMPA 5TPWL 1MREL 1J0IA 1IEBA 4EOWL 3P4LA 4O58L 2CXKA 5DJ6A 3L7FB 1ZGLP 2OM5A 5CP7A 4DOHE 2OS7A 5AZ2L 5HYJE 4TTGA 3BKYH 4H1LA 2BVQB 2FX9L 3OXRA 1RZ8B 4QTIH 4M02A 1NSNH 4TPRH 2P24B 3LEYL 3L3OB 3WNLA 1JBJA 1UJ3A 4WGWB 1B0GB 4XNMA 5HHVL 5JZ7C 2HKHL 3RNQB 3EDEA 4Q9BA 2J2ZA 3TVMB 3NPSB 3FO9B 3FQTB 4NNXA 4X9FA 3WUWG 1X6NA 5CJ5A 2K7QA 3MSPA 3BZEB 1C5DA 1HE7A 2X40A 4Z7WF 1VFUA 1JF1B 2HWZH 3I2CH 2ID5A 3PV7A 3F8UB 1VFAA 3TCXA 2YZ1A 3ULUL 3RA7H 3GSVA 3FB6B 5DZLA 1UENA 5IM7B 5DQJA 4GMSL 1A2YA 1A7RH 2D0FA 2AERT 4HJJL 4Z95L 1LWRA 4TSBL 3QHTC 1INDL 5BS0A 2J5LC 1KPRA 2C7UB 3TBTA 3H3KA 1ADQL 4LPYA 1QQDA 4S2SA 4YPGA 3SDXB 4F2MB 4OV5A 4S1RH 1FL6A 1VFOA 5D1ZC 2VISA 4R8WL 5DUML 4MVBD 2EECA 2VXVH 3K7UA 3H7BA 1LHZA 4O5LH 1CICB 3WJJA 5DMGD 5IBLD 4M93C 1MHEA 1S7VB 3W82A 2OR7A 2R69L 3EZJB 2CQVA 4XP1L 3GJEA 5J8OA 2ZUWA 1PG7L 4HXAL 5FYKE 2XFXB 2IMNA 1FL5A 2Q76B 3OKOB 4O4YH 3QCVL 2R0KH 2P7TB 1MQKH 4GG8A 1A3QA 1IAOA 1T66D 3O3BA 5EU6B 5HHXL 3RIFF 4B41A 5E8NA 1ZSDA 2L7JA 5EOQH 4F9LC 1X5KA 4LPUA 2ESVA 3P2TA 3CMGA 2WLZA 4HEPG 2SEBB 3X3GH 3VXOA 4PB9L 5DI8A 4KI5C 3QWRA 3C6SB 4HUXA 1NQBA 3GMPA 3SKOB 2WQRA 2ZCKH 4QHLA 4EIGB 3KPLA 4PRIE 1CFVL 1D5BB 2W9DL 3LKNA 5FEBA 1BQHB 3JUZA 4Y5XA 1QSEB 1P5VA 1XGUA 1FFPB 1HKFA 2EIZA 3HLAA 3TM6A 4QHUB 5E7FA 3GJFB 3I9GH 1EGJA 1ORSA 4BKLB 4LSUL 4KJPC 4PJFB 4KGJA 3OJDA 1BFTA 4GRWF 5T1LD 1GIGH 3WNKA 5DVNA 3ZDYE 1A7NH 1NAML 4AENA 3P9LB 1SBSH 4JY5H 1ITBB 2NQCA 3H9HB 5GS1B 3WFDH 4ZG1A 1ZHBA 5C71A 3L1OL 3VG0H 4RWYH 3HE7A 3GI9L 2MQ0A 5DD6A 3S4SB 5I1KL 1ETZA 4X5WB 2WLYA 2P44B 4RMRA 1C1EL 3AC0A 4H88L 4YHOH 3WV0A 3KVQA 4TVPH 3D6GA 5F3BB 3FT3A 2AJYL 3SPVA 3LHPL 4WHCA 4P2RB 1ZLWK 3IJYA 4ERSL 2ZUUA 1AR1C 1XGPA 3NACH 4LVOB 4ZOCA 4WW2B 4WEMB 5DURD 1OY3B 1RUAL 2FBJL 4FQXA 4RRPA 3IDJB 3ME0A 4NQCD 3LSOB 1ITCA 1DR9A 3A6BH 1CF8H 4ODTL 2N56A 1D9KD 3B8SA 3BGFB 3T8XB 1G6VK 2HAZA 4TOYL 3VGDA 4DKEL 4EQ3A 4JRYE 3VXSE 5BXFB 1V7MH 2BDNL 2X4OB 3LVEA 5KSUA 2BMKA 3H9SD 3HI6L 4HUUB 3BKML 1OD7A 2AEWA 3RY6C 2VDKL 1EEYB 5A3IC 4XP4L 2GJ6A 1JV5B 1CR9H 5D6DC 1EXUA 5D1XA 4K2UL 5B21A 2GITB 2OL3L 4XCCL 2AEPH 1P4LB 5JTWA 2B4CH 2P5EA 4RX4A 2PXYD 1MIEL 4KHTH 2B1HH 2LE9A 5AG8A 3EDKA 1RZKL 2DAVA 4UINH 4ZOEA 3RWEB 2QQLL 3IETA 5GGVY 1BLNB 5FA3A 3O4OB 4HZLA 4F7MA 5IMMB 1EK3A 4MNGE 3T4YA 1TJGL 4YFLF 1HSAA 43CAB 1NAKH 5DYOA 3TPUB 3QXAB 3DMMB 2A77L 1KTLA 4E42B 3VD4A 4YUEH 3FRUB 4RMQA 2I5YL 1TQCB 3TH4T 2YD1A 2IQ9H 3U9PL 1HXYA 5IMOB 3T77B 5IT2H 5I66A 3WHE0 3LKSB 1U8JB 3TZVB 3GKWH 3NIGE 3NAAH 5EN2B 1OW0A 5DD5L 2APWA 2X4RA 3QZWA 2BP3A 5C09E 3L3IB 4Y4HB 2C1PA 5A2JH 1T6VN 1QLRA 5JORB 4UB0H 2GFBA 1MFAL 4LQ1A 1NUNB 3UPRA 1J1OL 1T1WA 4NN7B 2YA2A 1J8HD 2I07A 5IV2A 1KBGL 3MO1B 3P4MB 2X5PA 2UWEE 2Y9RT 3HRZA 4PTTB 2BNUA 3O6KH 4JREB 2DYPB 4XB8A 1VB9A 1CDIA 1MJ7L 3TN0A 2NW3B 1LEIB 3LKPA 4DOHB 5CIPA 3W11D 4XBPA 2JLLA 3BZFA 5HYJB 3DIFB 5I17B 4RGOH 4WVRA 3BJLA 2BSRB 1FNAA 4LNRA 1PLGH 2BVTA 4LL9A 5FHBH 5C0DB 5JW4R 1U3HA 4HGKC 2QKIB 2QSCH 2ZOLA 2XTJC 2PW2A 3DO7B 2G60H 1QFOA 4WEBH 4P59H 4Z7OE 1JPGB 3HS0B 1KCUL 2YRPA 1KGCD 1T7VA 2VRAA 3ARGB 3FB5A 4XVSH 5ADOH 3QEHA 3IXAA 4NJAL 2APBA 1AKJD 2DOCA 5KTEL 4FN0A 4XPGH 3CPLA 3UTTD 3MOAL 3LN4B 4HS6A 2RAMA 4Z7VF 4GW4B 2GAZA 3T0EA 1KYOK 2C1OA 3WFZA 4U1LA 3VMOA 5CD3B 8FABA 5F3HA 5DWUL 3QIBC 1NGPL 4PRBA 4WI2A 4HS8L 4FQ2H 1T21B 4M43L 3REWA 1AQKL 1OSZA 2BNQA 4G6AC 2VDLL 1A3RL 3I6GB 1T1YB 1OAUL 4MX7B 1A6AB 3S3JA 1HHKB 3LB6C 1LO3H 2HYMA 4Z7NE 3HI1A 1FRGL 4HWEL 1N4XH 3DUUB 4LEXL 43C9A 5BS0E 1N2RA 3HCVB 4H8WL 3G6DH 5I9QC 4MD0A 1I8MB 1YEDB 3ARBC 3T0DA 1FO0A 3IU4H 4R7NB 1JNLL 2HT4C 4XP6H 1K3ZA 1WFUA 3MRLA 4JKMA 1LP9B 2FEEL 3N85H 1JPST 3OQ3B 1V3MA 1JZ5A 1XZ0B 4YBLC 3D85B 4HWBL 3RWCA 3BP4A 4GKNA 4CADA 1ZVHA 4M1GL 3U36B 1J18A 1G9MH 3QZWG 4QHKJ 4L5FH 4RISH 3AS1A 2NY4D 1RJYB 4M9OA 1XR9A 4RMWA 4PS4H 5MHSD 1AXTH 3U9UB 1ZV5A 3DROA 4PGEB 1O7VA 4ZTOH 1SYVB 4NBXB 3V5KA 1KELL 4C56D 3GMLA 1H3PL 1RUQL 1U36A 2A73B 3IYLW 4GXVH 2ESVE 3P0YH 3MA9H 3SDDC 3LMJH 2VLJD 4RDQF 1N8ZB 3P11L 4PRIB 1ZHLB 3UROR 4LSPH 4J3OC 3NFPA 2VZTA 6FABL 1AQDA 1NBYA 3BW9A 1KFAH 1CGYA 2R0WH 3HTLX 4GQ9L 2NY3B 5CINH 1IKFH 3MUY1 5MEPB 1HOCB 3GSQB 5CJBA 2YHGA 2W38A 3I02A 3X3FL 5IROC 1PX4A 4Y8AA 5D5MA 3QEGL 1KSRA 5K9KA 3Q6GH 4X9HA 3PL6B 5DD0H 1R3IH 2CUMA 1LO5B 4X8JA 5ICZA 4U6HA 1D5IH 4BSWA 4PJEF 2CUIA 3OGCA 3CXDH 1P4IL 5FA4B 4TNVK 4C58B 3BPNC 3VFGH 3R8BB 1QEWB 4N5ED 4WWID 3VXTB 5C6TL 1LDPL 5CS7A 2F54D 5EC1A 4PP2B 2D3VA 1W8NA 3S96B 3TV3H 4X0KA 5E6IC 1I7ZA 5GISH 1MRFL 4G43A 4HT1L 1R24B 4I3RH 4DQOH 1BZ7A 1VGKB 2AABH 3QFJD 4KJYA 1NLDL 2C4XA 5EO0A 1IQWL 4GT7A 4NQED 3JVGA 1CCZA 2ATKA 4K7FB 4M3JA 4D2NA 3WDIA 4V1DD 3EYSH 3T3PE 2R2CA 5CP3A 5L2KD 3D39D 1AE6H 1L7IH 2JELL 4L8BA 3BIKA 4JRYB 3VXPA 3VXSB 4IEFB 2GJJA 1RUPL 3AUVA 5D7IA 4ZUVB 3UO1H 4Z8FL 4XHJD 1T4KB 2GUOB 4FFVC 1A7QL 1WFOA 2JCCF 3X11A 1EHLH 4XI5D 4CVXA 2MQCA 2P43B 4JKLA 1JWMA 1WFTA 3BKCL 4APQA 4EI5C 4WNQB 4NRXA 3ECBB 2YKLH 4EVNB 1JTPA 3DX9A 5F6HI 4M7ZB 1A6TB 4GRLD 3RWJB 2GJ6E 4CU8A 1OWRM 4L4TD 5BO1L 4Q6IC 4RAVB 2F53A 1M71A 4HUWB 5DTFB 1FH5L 2VLKD 4D8PB 5DLML 2DQGH 2ZUYA 4CGTA 4FHBD 2E3VA 5DJDB 4JO3H 4Z7UB 4YHKL 1WEJL 3PWJB 5F7EH 2B8OT 4LNVA 3DI2B 5F7DA 3PABA 3LQAC 4MNGB 2BOBA 4BZ2L 1ZT1B 1VACA 1MRCH 5HGBA 1LVEA 1DVFC 4Y16A 4KZEL 1Q94A 4JPIA 4WWKB 4XNZB 3DSNA 4XBGB 4PJ9D 2HN7B 1ZEAH 1EMTL 1RUMH 3EUUA 3IXTA 2IEPA 5IEHB 5E2WH 1PJ9A 3NIFF 4GXUM 1KJMB 1NLBH 1I7RA 4OLXL 1CFNA 1SEBB 2CIKB 2X9XA 3BRDA 3IJSA 1E4KA 5BVJA 1IAIM 2NTFB 1F58L 4P2QA 5C09B 5IB2B 5ACZA 3TA3D 3IF1B 4XBEL 5DRWA 3RWIA 3P4NA 5AAWA 1K9TA 3IAQA 3LQZB 1GC1L 5E5MB 5A16A 2OI9B 1TNMA 4P2OD 3I6LE 5DRNB 4K8RL 2GT9B 2IAMB 3ZLQC 2UWEB 3OHXA 2FYYA 3MV7A 3QNXB 2FIKA 1BX2A 3EOAB 4LASH 1BEYH 3GEWB 4HPYH 4ENED 1MCRA 3T0WA 3VWKC 2QHRH 1MCNA 5FXCH 1M05A 3QNYA 3VRLF 1ES0A 1IEBB 5GZOD 5DJ6B 2ATPA 2EO9A 5CP7B 1AGFA 4NZTL 4GBXC 4M1DL 1YN7B 3E6HB 1JF6A 5GJTH 4U49A 4H1LB 1E27A 4OAWA 5F7NC 3OXRB 1D6EA 1DSFL 5GGSY 2BJML 2PR4L 3EOYG 5GRUL 3MRFA 1LD9A 1OAYH 1UJ3B 3MNVA 4XNMB 1G7HB 5DDHA 4ZSOA 4ZXBD 1R6VA 4NN5C 3RVUD 3QAZB 1F90L 3HAEA 2WIMA 3HNTL 1JI1A 1WFNA 3LKQA 3MOBL 5CBAA 4PRHE 2V6HA 5C2UB 5IIEA 4K3JL 4L1HA 3BPOB 1FO0H 5C0JA 4NN6B 1MFCL 4RNRA 2NCMA 3S34L 3PP4L 1W0VA 5IWLA 1C5DB 1DQTA 2DQHH 3BAEL 4LP5A 1VDGA 3KLHD 3DSFH 1GAFH 1FSKB 1TVBA 1NKRA 3F7VA 1YMME 1VFAB 2DDQH 3VFOA 1Z9SA 4UV4L 5DHXB 3WEXA 4E0RB 5DQJB 2GSIA 3LRSA 3V6OC 4QHNA 2BNQE 3RI5F 1XGYL 4Q2ZA 3H42L 1DQML 4HDIA 5EULV 4HW6A 5BS0B 1GZQB 3OAYH 1KPRB 5E70A 5TDPB 2XNAA 3TBTB 3VMPA 4S2SB 4YPGB 1QQDB 3JBG7 3S35H 4OV5B 4NKOA 4BUGA 2VISB 1UWEH 2M1KA 1G9NL 3H7BB 3GIZH 3INUL 2YK1H 1I9EA 1NCCL 5GRZA 1G0DA 1BZQK 1MHEB 4TSCL 4PD4K 2OMBA 2D03L 1JYNA 1UYWH 3ABZA 4TYUA 3QIWA 3HNSL 4E5XA 4ONFL 5CBEA 3LPWA 3QHFL 3ETBF 2GK2A 4MHHG 3RAJH 1V8HA 5ALBH 1UM4L 1U6AL 5BJTA 4GG8B 4MJ6A 1T22A 1IAOB 3O3BB 4RFNB 5CJQH 1ZSDB 4XWOD 1YEHL 4LFHD 5M94B 4Z7WA 2ESVB 2EIEA 3ROLA 3NN8A 4HG4K 3LY6A 4L3AA 3VXOB 3OV6A 4HUXB 2PYFA 3GMPB 4KVNL 3KPLB 4F7PA 1J87A 3LKNB 4MVBC 4YXHH 3TVMD 3I50L 2MMXA 4Y5XB 3WHE1 3IDGA 2BFVH 1XGUB 5IBLC 2EIZB 3HLAB 1KUMA