2AEWA

A model for growth hormone receptor activation based on subunit rotation within a receptor dimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
205
structure length
189
Chain Sequence
SSKEPKFTKCRSPERETFSCHWTDEVNLGPIQLFYTRRNQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNAMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Model for growth hormone receptor activation based on subunit rotation within a receptor dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords Growth hormone receptor
total genus 32
structure length 189
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aewA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aewA01
1VGKB 5GGUB 1TTGA 4PJ8B 4WVRA 1I1FA 4CU8A 4RGOL 4WFEE 4APQB 1MRFL 1XF2B 3TH2T 5EUOF 3PGDB 2LU7A 1NCDL 4MJ6A 5HGDB 5KSBE 3JWDH 5AD0B 3L3GA 2VSDA 3VWKB 2E6QA 1T22B 3OF6A 1YNLH 1RVFH 2C3VB 3I6LD 4OM0L 1IMHC 1U3HC 4TNVK 1KC5L 5J0BA 2ZG1A 1PBYA 5E2VL 2A6KA 4FQJL 3T0XA 5TQ0H 4FOMA 5EUKA 3D25A 4H1LA 1LWRA 1R3JA 4JFZL 3WFDL 3DV6A 3FONA 1RUQH 3DV4B 3KJ4B 3U7WL 2F58H 4PRIB 2CRIA 1CE6A 2F5AH 3ZDZF 2XRAH 1CXLA 1NBZB 5CP3H 5I0ZA 2BNRA 4F7EB 2JK5A 5FB8A 5D7LD 1GPOH 3EHBC 3O6FB 1SEBB 1U91B 3A6BL 4AIXA 8FABA 2R0LL 1NUFA 1A9BA 1MUJB 4FXKA 2HH0H 2JIXA 3QIBA 4XCYB 5IW6A 3IDJB 3BKYL 4O00A 3MOAL 4HWBL 2FHCA 4M5ZH 4MAYD 3NFPA 2P7TA 1ZA6B 4XCFL 1QVOB 4N5ED 4YUEL 3OXRA 5FYKD 1ES0A 4NQCA 2YXMA 4OGAC 4GBXA 2P8PA 3NA9L 5EC1A 4GRLA 4PJDA 4PY8I 4NQXB 3VXSD 4L1DA 3BSZL 1BD2A 4Y2DB 2DQFA 1CLZH 2A83A 2NXZD 3I2CH 1T1XB 4MDJB 2ADIA 2J5LC 1RY7B 2BNUB 4IS6B 1Q0YH 4OB5H 1FLRL 4HZLB 2GJ6D 3UYPA 3BKCL 3HUJE 2R2BA 1K8DB 3L3HB 2XZAL 1B9ZA 2DWEA 3O3EB 3MREB 5C09B 5FDWA 2ZCKH 3JWOC 4D9QD 4EIGB 4U1LB 4UUJB 2QQNH 3GSUA 4Q6YA 5ICYA 4KRPD 4LQ1A 1RZJC 1W0VB 1NGQL 1Z9MA 5DK0A 4UAOB 3R0MA 2ATKA 4LAQH 2ARJB 3AS2A 4AEHL 2FJGB 3EKCA 5FECA 3MLPA 4Q9QH 5JNYA 1MFEL 1IEHA 4ZUVB 1KCVH 4WW2F 5ESVA 3PJSA 3R1GH 3TPUB 3NACL 1WBYA 3DNKA 3ULVD 3S97C 1KTDA 5LQBL 2P5EE 3KPLB 5GS0H 3CFIC 3AXLA 2IBZY 3WKML 1F3RB 2QSCH 4Y5XC 3UTTE 1G0XA 4X7SL 4HQQH 4Z7UA 3EJZD 3E3QC 3ISWA 4P5TB 3MUGA 4PJCF 4ZOEA 3TIDB 1AO7B 1GJIA 1ZT4A 5C0BB 4AMKL 4JPWL 2BERA 2H2SD 5DJ2B 1A1NB 1EO7A 3CDGB 1ADQA 1IGML 2BVOB 2NLJB 3OR7B 4LVHC 2BVUA 4TULH 1E6JL 2BRQA 2XY2A 3OKYA 1HYRC 5FO7B 4D9LH 5AYQA 1OT1A 2ZUXA 4X6BB 3DUSB 2F54B 3LZFL 1YJDH 4XPBL 2AJZB 5CJOH 4PJCA 4WEBH 3PQYE 3MJ8A 3IDGB 2X4TA 1BAFL 4KKLD 2WBWB 2CLVA 2CLZA 2MJWA 5IKCB 5AUMA 1T1ZA 1AO7A 3MSPA 3RWFA 4ZFZA 4YH6A 2N1KA 1NAMH 1GGYA 1IGCH 3MBED 2HTKD 4OD2B 2BVQA 3MRKA 3MACH 3O0RH 2AJYH 5HGDA 2C7UB 3HMWH 1MHHB 5J1SC 1MHPH 1H3UA 5FYJE 3U1SH 2X40A 2X4SA 4XPHH 1XIWB 4XX1G 1DQLL 3TZVB 2CK0H 4YBQC 1NFIB 3N85L 4R7DA 4J4PD 3K8MA 2O61A 1DLFH 1DL7H 1DBJH 3MV8A 5C3LD 3W2DL 5D5ME 2R1YB 2R2HB 3FO2A 5CP7B 1S5IH 1BJMA 2RQ8A 4NC1C 3SE4A 5ANME 3KPRD 5I9QB 1SM3H 3MLZL 1MFCL 5C0AB 2C9AA 4Y4KB 5IBLC 5GRWA 5DVOA 1FLTX 2CGRH 3SE3A 2OX5A 1ZGLA 3VCLA 1HDMB 4GSDL 3TH4T 2YKLL 4YDIL 1NEZA 4RNRB 2R4RL 4WWID 3FO9A 4W4OA 4CVXA 3FQTA 4HKXB 4GUPB 3NBNA 3ZE1E 2VXQL 2NY1C 3MNZA 1F2XK 4QWWC 3RL2B 5JIIA 2YD2A 2JB5H 3PXJA 1NC2B 3NCCB 4YHZH 5TF1L 2R1XA 4PUBH 3QO0B 1BQLH 2XQYK 3H0TB 4R8WL 4U7KA 3FCTA 4KRMB 3ABZA 4OUUA 4PBXA 1OP9A 4DUXA 1ZT4B 5C0BA 4KROD 3QRFM 1AXTH 2MMXA 3C2SA 4D94A 5T3XE 2R2CA 4KY1L 3HI1B 3HC0A 2NY5L 4Z7QF 2QQKL 2ZJSL 4NCDA 1KTKE 4YHYC 2BOCB 4HFWB 1QBBA 4PJGF 2ZUQC 3HAEH 3S4SG 4YAQB 5DMKA 3BE1L 1NGPH 3THML 2ZPKH 3FOLA 3O6FD 5GIRA 4X9BA 1RU9H 3S37H 3O3DB 3MA9H 4L3AA 1KCSH 1M05A 1P5UA 3QQ3A 1BX2A 3I50H 3G04B 1CZ8H 4QRPB 4M6OL 4B7IA 1DEEA 3X14A 1H15A 1R6VA 2VDNL 4Y19E 1QD0A 2Y6SC 1D5XA 5SWQB 5F7DA 4NC2B 1TNNA 2EXWD 5DZNA 3SY0A 4GW4A 1QRND 1ZSDA 3EDJA 5IHZB 1ZA3A 1KPRB 1WAAF 1AR1C 1B4RA 3VGAB 4Y5XA 3KPRB 3OTTA 4PJIB 3WUWB 6FABH 4HGWB 5CEXB 3UJIH 2I9LA 4BK5A 4P9HH 1XGQA 1YA5A 1KYOJ 3ZDYF 1RIUH 3BIKA 2HG5A 3LS4L 3N1GC 3CLFL 4HIEB 3RWFB 4JQIL 3ALWA 2AJVL 2ADFL 4DAGH 3SDXA 3OG6B 4M00A 4WRLA 2Q76A 2V7HB 3EFFA 4KJPD 1WC7B 4JFFE 4M1DL 2IPUG 1X4YA 4RGNB 2H9GB 2EDHA 5HBBA 3DTXA 1C7SA 2EDYA 4YNYA 2V2XB 4LQFL 4MJ4A 1FNGA 4FMFA 5GS3A 3RQ3A 3CFKA 5DDHB 3VFOA 4DN4H 3V5HA 1IGYB 4PP2A 3BP6B 3GSWA 3KHQA 1Q38A 2YD4A 5JQHC 3V4UL 2HT2D 4X8JA 3MRGA 3ES6B 4HFUL 5DD5L 1BIIB 1F4YL 4L8BB 1FE8H 4YXLL 2OR8A 1CF8H 3HR6A 1S7QB 2PXYA 3JTTB 1A4KA 3SGEH 1DBAL 4F3FA 3WIHL 6FABL 5MI0B 1SY6L 5EUOE 3I3DA 3MBXL 1B88A 1KXTB 3D85A 4RRPA 1X5YA 1IQDA 4ZG1A 2OYPA 5EO0B 1AI1H 4R4NC 5D8JL 1FNAA 3DSFH 3MLTA 4K3EL 2VDNH 1Q9WB 3VGGA 2DYPB 4KTEL 3EJZC 4OCLC 4PJHF 5IOPA 3BVNA 1AGFB 3QEHB 4TTDC 4M7JL 3D2UB 4L8BA 3BUTA 4RMVA 2VLKD 3HMXH 3V5DA 3V5KA 1WBXA 2X10A 3VXMA 3TWCH 3BUYB 4ZAKB 1F6AB 1I7RA 5E9DD 2GQHA 4XPFH 2NR6D 4L4TA 1FSKC 1BQLL 4P3CH 4YXHH 3AMKA 2LAAA 3GSVB 1TITA 2EXYD 4PRBB 1TCMA 5TF1H 1CICB 3GK8L 1GZQB 4FQLL 5GZND 5BRZD 1BQUA 2WIIA 4LU5L 1MLCB 1MJJB 4NZDA 1DSFH 2QL1A 4PTTA 3V9FA 4MNHB 3K1KC 2DI9A 3CIQA 2HKHH 4RIRA 3RJDA 3VFWB 4POUB 1NLBH 4IDJL 1QR1B 4B53A 4QRRE 3VWKC 1F13A 4FS0A 1ZHKB 2YPVH 5FV1L 4OD1H 5DXWA 1RJCA 1WEJL 2G2RA 3BUYA 4JY4A 1MH5A 4HMCA 2G75A 3BEWB 2AEQL 5DWUL 1I9IL 2DTML 2WBJB 1S8DB 5B8CA 4KKCD 2YUZA 4JAMB 1PFCA 5IW3A 1VGEL 3HG1A 5EIIB 2PW2B 1VGKA 2VQTA 4KUCD 4Y4FD 1ZVYA 3NABL 4X7EC 3N85H 3VWJA 3F58L 3T2OA 1PKOA 5GIRB 4HGKC 1VFMA 2CK0L 1PKQA 4I2XA 4EXPX 4TOYH 2A1WH 2OR7A 3OKKB 1NGWB 3O8XB 4P2RA 5IG7B 3U1SL 4K3DH 4XAKE 4POZD 3FL7A 1ADQL 3GJFB 1V3KA 1L7TH 3JUYA 3CX5J 3U6RA 5M95B 4F7MA 4ZFGL 3VXRE 5E03A 4N8VG 3HUJF 1CU4L 3UBXA 2CXKA 2VLLA 4XP9H 3WKNA 4GH7B 5JOPD 4QTHA 3F12B 2E9WA 1GOFA 5MP6L 1G6RH 3S96B 4JKPH 4C58B 1JFQH 2B4CH 3FZUD 1QOKA 4Z78B 1J0HA 2UWEB 5DRZA 5C0AD 4GKSB 4GG8A 3MNZB 3UO1H 1JE6A 1EJOL 1PKQB 3QCUH 4GKNA 3BI9X 4JHWH 3MXWL 3LS5L 2CXGA 4LSQH 2WQ8A 3BXNA 3QIUB 5GSVB 5HYJA 2F5BL 2B1HL 2HRPL 1EH9A 2J6EH 1T0MA 3NTCH 2SEBB 5I18L 1S8DA 2DI8A 1WCBB 4CAGA 5HYJD 1JHLH 3P40A 4G9DB 1DCLA 4NN7C 1PSKL 1X44A 1T83A 1BWWA 4D0DB 1ORQA 3BFOA 2E27L 5E6IA 1QBMH 1G9MC 4DEPB 2J4WH 5DLML 5D9SB 5FCUH 2EZ0D 2ICWB 5E7BA 2QSCL 4KJYA 3TZVA 2Y4SA 5GGUA 4D9RE 3PV6A 4AENB 2AK4E 2I9TB 3RGVB 3GJEA 3BGFC 1YNKH 3S9DB 4P2YA 4L3EB 5F3HA 2ID5A 4HK3J 1K4CA 3QNZB 5F9DC 3NACH 3QUXC 5D1QA 4NQVA 1BEYL 4K7FB 5HI3D 1NCCL 3HZMA 1X5LA 4ALAL 1MFEH 3OKOA 2WNGA 4Q9QL 2WAHA 1T89C 2A77L 4RFNB 1P7QD 4KK9D 1HWHB 1I1YB 2NY1D 3IDXL 2H3NA 2QQNL 1BFSA 2ZCLL 4KKNA 1EHAA 4DQOH 1P4LA 4PRDA 1OL0A 3P11H 1RZ8A 1EEYB 4QKXB 3FRUA 4Y2DC 5DJ8A 4WNQB 7FABL 3VXOB 4J8RA 5F71A 1G7QB 4KHXH 4O4YH 1K4CB 3QNZA 3TNMB 1FLRH 3VH8A 1Q0YL 3V7AG 3HN3A 5C0DB 2IG2H 2EIEA 4NKMB 5C0GB 4U49A 3VWJB 2ORBL 4TPRL 5MEOB 3L5IA 3RVVD 4BSVB 2JCCE 3HR5A 1I9JH 5T1LA 1INDL 3G6DL 1S7TA 3ZKMC 4EN3D 4JFYB 2DI7A 3ZKNC 4PLKD 4OJFH 5DJ0B 3C6SA 1XGRA 5E8NB 1L0YA 3JBG7 3GKZA 5IF0B 1JNNL 4FTVE 4WO4C 5FHAH 2FZ3A 3OKMA 5MENE 4NCC2 4XCFH 2YRLA 3CU7A 3PWPE 3QHFH 4U1IB 4LP5A 4EOWH 1FG9C 4G8GA 5F88A 5E9DA 1KLUA 5KTEH 5L8LB 3QIUA 3MOAH 4H0IA 1J5OL 1A9EB 4PJ9B 3MV8E 4NCC1 1GGBH 2DLTA 4LSSL 3UTSA 4RFOL 5FGSA 3C8KB 5JIPA 1Q72H 4KJPC 2OL3A 2VLMD 4NYLA 2D7NA 1AD9A 5GRVK 1UCBL 4PJGE 4QCIA 4XZUB 3LMJH 4XCCH 4JANB 5GRXG 2R23A 4KTYA 2IMNA 2YN3A 2YD9A 5D6CB 5F9OL 3OAYH 3SJVD 2QADB 3CH1A 4WTZG 2LU4A 4E41B 4Z7OE 3WFDH 4Q0XL 1FYTD 3NFSL 4QXWA 5IB5B 4FABL 2FYYA 3IRZA 4PJ5A 3RDTC 1CICD 4JN2A 2PUQT 3CLEH 4WEUD 4ZFOB 4MNQA 4TPRH 4FFWC 2FRGP 1UEMA 2CDFA 2R0WH 3ZYZA 4PJ5D 5ADOL 2ORBH 4X6DE 2XZQH 5IWLC 1BOYA 4WUUA 4GBXC 3MOBL 3MGTA 4LMQE 1T04A 3MV9E 4OIBA 4KHXL 1I8IB 2EH7L 1NL0L 3JWDL 1EGJH 2I26N 4NGHH 4X6CE 3KYKH 2BSTA 2ITDB 1F4AA 2L4OA 4IM8A 4JGMA 5C0EA 3GMNB 4JO1H 4P46A 4NO5A 2OR9H 1F11B 1ZT1B 3TYGL 4LSPH 1HK6A 2NY0D 43CAB 5IB2A 1MCWW 4PJCE 3FQTB 4HKXA 3RGHA 1CYGA 5HPMA 2D7TH 1M7IB 2BSSA 4NQCE 5IEKA 4ZDHB 3T2NL 2DJUA 1YPZF 1GZPA 1SY6A 1V8HA 1G7MA 1PG7X 2W0FA 1NMCB 3WJLC 3DGGB 4WUKH 5KVFH 3U4BL 1BVZA 1FRGH 1W72A 4IDLA 1FC1A 4LK4A 5AEAA 5I8OH 3GSNB 4J7RA 1LE9B 4Y1AD 5A3ID 3GKWL 3S6CA 2C3VA 3WDJA 4D3CH 3WFZA 1F90L 5EULV 4Z7OF 4U1LA 1XGRB 5E8NA 3CZFA 2EIDA 1I1AA 1DTUA 4YEEA 1YMMB 4ZXBB 3UTPE 3D0VA 1WBXB 5FUCC 2CKBH 1A3RH 5FCUL 1F2QA 1YEDA 4LCUA 5INDA 4QNPE 1XCTA 3NAAL 1HHIB 3RDTD 1HN1A 2R2BB 1V05A 3PV6B 5DZOA 4FFZH 1EXUA 3T04D 1NBVL 4M6NL 1C12B 4ODWB 1ZLUH 5ISZD 3QQNA 1NFKA 4NO2A 4MMZC 1AFVH 4FQXC 4QRPA 4LLMB 1ZS8A 2NY4C 3X3FL 4E9LA 2CRZA 3VXTB 2NMSA 3ARPA 4JFHE 1FL6B 3MCLL 3RZCB 1T7VA 3SE9L 4Q9CA 3KXFA 4HPOH 3HAEG 3IKCA 5K9QG 3SDYL 3VFGL 4YDKH 4NP4L 3VW3L 5FYLH 4HCRA 4QT5B 5D7IF 1T1YB 4PGDA 5C0IA 1L6ZA 3ARBA 4R2GB 4NSKB 5HHVL 3O3AB 3MV9A 4I77H 3AB0B 2GUOA 4EDXA 4LCYB 4Z5RA 3V6OC 2VXUH 5DD6B 2DAVA 2B4CL 1XR8A 5CMAA 1KB5L 5CGYD 3EYVB 1J05A 3I02A 5A40E 4AM0B 1G7QA 4LLUB 4G7VL 1JPST 1OM3L 1U8OB 4BH8A 1I9RL 4Y4KD 5EO9A 5MHSE 4WI6A 5D93B 1WIUA 4LLDB 3MV7A 5CHNB 3GNML 2IMMA 4P23B 3EO9H 3KPMB 3S8WA 4YFDB 3VGAC 4OBSA 3HFML 3TN0C 3F58H 3RFZC 4JRYE 5FGCB 2OP4L 4NJAH 3LEYH 4YPGA 3NABH 3TBWB 1VGEH 1U8QA 3DVGA 3WCYA 1FV1B 3V7AE 2X89D 1D3CA 1KBGH 4AENA 2AEQH 3O6LH 5DWUH 4DZ8B 1U8LA 4OLZL 1OSPL 4APQC 1CE1H 1M7XA 5BVPH 2BVYA 3QA3B 1AKJA 3E8UH 3V6FB 1K3ZA 5HI3C 3DMMD 3K2UL 1F3DH 4XPGH 3ROLA 1NLBL 4JDVB 2GYSA 5C08B 5DURB 5F7NC 3CVIH 1GCFA 1WICA 2OCFD 5T1LD 1ZANL 4ODSH 4XMLL 3DYPA 3SDDD 1B0GA 1H5BB 2Y36L 1UCTA 4EN3A 4LU5H 3MBEB 3ULUD 1CD9B 2XKNB 3GRWA 3IDMB 3VFSA 4OD3H 2X9YA 5IIEA 3S96A 4BQCA 4KJQC 3QUXD 2XXMB 1P6FA 4OF3A 4PJ7A 3KPQB 4B50A 2V5YA 3T77A 1KCUH 4JREB 1Z5LB 3AB0C 1CFTA 1HKFA 1XGUA 2Z8RA 3SDAC 1XF4A 3REVB 1UH4A 5EZLA 2F53E 1ZT1A 1RIHH 4CVUA 1JZ8A 2QV2A 4O2CB 4F7TA 1UVQA 2O5XH 1CDJA 4G5ZH 3L3JA 3BMWA 4WTZA 3OB8A 3QDHA 1OW0A 2XTJB 4XBPB 4LCIL 4MAYB 5E95B 1E28A 3WFBL 5HHMD 4C56D 3IU3B 2EDOA 5BXFB 2A6DB 4NSKA 5D8JH 2C1OA 4KQ3L 4XB8A 4GJTB 4Y19B 4K3HA 2EYSB 2WINA 1MREH 5EN2A 3EO0B 3B6SA 1SY6H 5E5MB 1RSFA 3OAZH 4NQED 1DBAH 3WLBB 3LPGA 1VDGA 4LASH 3C2AL 1MLBA 5T3XH 3TF7C 5E7FA 5D1XA 4ZQKB 1T1WA 2DIBA 5E2JA 5KS9A 3V4UH 3ZT6A 3VD9A 3CCHB 3QDGA 4Z7WE 4ELMA 3HS0B 3BQUB 2QSVA 2G9HA 2VZ1A 1TIUA 1EA9C 2VO5A 3ULUE 4ISVA 4WDIB 4JEGB 1FC2D 4OAWB 2GJ6B 5CUSL 3HPLB 4U05A 4H5SA 2P48B 1JGUH 1LEIA 4QRQB 1HHJB 4KPHH 4NYLB 2X5PA 5IQ7H 2DQUL 2DYPD 1MFDH 3ARBC 3J8F7 5DR5L 3TO2B 5I74C 4LKCB 3GSNA 4XPAL 4ZAKA 4D0BB 2ERJC 3EGSB 5IBUB 5KSBF 1R5VA 3V4VL 5L88L 4U31A 3CLFH 1GGTA 2DDQL 4IOIA 4XMKL 4XNUL 4P2QD 3QEHA 1O7SA 4MX7B 3KAAA 4MD5A 4HZLA 2G9HB 3UJIL 1AHWB 4HCRH 3TJEH 4Y4FC 4LSRH 2YPKA 4CMMA 3QFJE 1TETH 5I71B 3VFVA 4PJHE 4ODBD 1YDPA 4PTUB 4IIQA 3I3BA 4NDMA 3PWJB 1RUML 4QRQA 4XNMA 4QXTA 2K7PA 2MPAH 1I7ZB 5C0CB 4XVTH 1TPXB 2CDEB 3KHOA 1CZ8L 1WFUA 1G0YR 2D31A 1MCPH 2FECI 3TC9A 3U0TA 2GITA 4QHMB 1DVFD 2VABA 1A02N 1T03L 1YUHA 1T1WB 4LLWA 5IB1B 4M6ML 1QBAA 3TIEA 4PJHA 4L4VD 2NY5H 5TGBA 5JHLL 4Z8FH 4HUXB 3BQUD 1F4HA 5KOMC 1OSZB 4W6WB 2OJEA 4I2XE 4LVOC 3O4LB 2XWJB 2GT9A 4TTDD 4PTUA 1YQVH 5IFAL 1YN6B 3H9ZA 2VQ1A 3W9DB 5CSBA 4YHMH 5B22A 5E6IC 4PJFA 5D5MF 2H6PA 5IB3B 4HIXL 1J1PL 3O81A 4WO4B 3MRGB 3B2VL 1R5VB 3TV3H 2X44D 3VXPA 1HQ4A 1J8HA 1RK1B 1GHFH 4GSDH 5BZWA 1RZKH 3MLRL 3QIBC 2VXVH 4YDLC 4WEMB 2CGRL 3MRFA 4UOW1 2EDNA 1AGDB 1R3JB 1IT9L 2R9HD 1QFWH 3RIAK 3CD4A 2YMXH 2Q76B 4JHZA 1TDQA 2HKFL 4I9WD 1F3JB 4PREA 1BZ7B 2XN9A 1IC5H 1DL7L 1DLFL 5C9JB 2C3GA 2AQ3A 2X4UB 3C08L 4ODTL 5D1XB 4ZQKA 3GHBH 3L9RB 1T4KA 3D3VB 1DBBL 4BA8A 3I6KB 1BGXH 2GTWB 4J12A 2FH8A 4Z7VA 5DD0L 1AC6A 5DC9B 1AKJD 2AGJH 2GJ6A 3I9GH 2X7LB 4XNZB 4GMTH 2BOCA 3RY5A 2OZ4H 4JY6A 3G6JB 2QHLA 1QUNA 5E08L 2J2ZA 12E8L 4O02H 1KN4L 4K9EC 5GRYA 2X1OA 2FEEI 1VHPA 3DARA 1YNTB 5FO8A 1H8NA 1CG9A 1KNOB 2F53A 3QWOA 1IGIH 3LPFA 4NKIH 5HDBF 3SE8L 2VTFA 3B43A 3CSPA 4CN1A 4RA3A 4Y89A 3D0LA 4HPYL 2FD6H 1AGCA 4L3EE 4IRSD 1MCRA 4WV1C 4WO4D 3BIAX 2CJUL 3HI1A 2DLIA 3LKSB 1R5WB 3WL9B 5IGXH 3OBAA 2DN7A 2A6DA 5DUML 1S7RB 2EDWA 2X4TB 5DEGA 4D9LL 4ZO6A 3UBXB 3FO1B 1AD0B 3FAXA 5C0CE 3AM8A 3KXFE 3WO3B 1KG0B 1ZVHA 4U1MA 1U8OA 4P2RB 1CT8B 4ZYKB 3GIZL 1CDUA 1VEOA 1T5XB 5HYSB 4HAFA 2ADGB 1CGWA 3PIQB 1AR2A 1JYVA 8CGTA 2XWTB 3LV3B 4YDLB 1NCNA 2DQHL 4G9FB 4HPYH 3MRLB 2A0LC 4JZJB 1MAKA 5F6IC 4QHUB 5JORB 5F7UA 4FRWA 2P5EA 5I75B 4HUUB 5EBMB 5GS0L 5D6DA 3L7FB 4S0TD 5DTFA 3CX2A 5FO9A 2IGFH 5C0CA 2FJFB 5FKPB 1OGAD 1YMMA 4ZXBA 2ZOKB 1RZIA 4HWEL 1KIRA 3BH8A 4MVBD 2FIKA 3BJLA 2ESVE 4TUJA 3TBVA 4DOHB 4GMTL 4GOSA 3LRSB 1V5JA 3UZEA 3NN8B 3OB0K 2OS7A 3OGCA 1BZ9B 1A0QH 1J1XL 4JY5L 3L95B 2IH3A 2XKUA 4NQUA 3C08H 4ODTH 1Q0XH 4K07A 4CU6A 2VAAB 4CUCA 2XPGB 3M07A 5BQ7B 2CH8A 3TYFB 4L4TB 4I3RH 3MRJB 1A3QA 3KDMB 4ZXBC 3B5TA 4NFCA 4P5TC 4Y16C 4P4KB 4ONGL 4PRAB 1S9XB 5GGQL 3A0OA 2IFFH 1GHFL 3TO4C 4D8PA 2AVGA 3BD4A 5DJYA 3RNKA 4U7SA 4IS6A 2Y7QB 3EW3B 3VI3F 2F54A 4DKDC 4J3WA 5E2WL 1ZLWH 1GL4B 4HIXH 3QCTH 4MA8L 2NNAA 4MNQB 3FQWA 1Z3GH 4OKVA 3SOBH 2DTSA 1C5BH 5LG1A 2E6PA 1U95A 3ULVF 5J3HC 1OGAE 1A1NA 3CDGA 4BFGA 2ZWLT 4V1DE 1I8IA 3Q6FB 3MROA 4EUPH 5HYSG 4Z9KB 4JN1L 1U6AH 4O2FB 4PPTA 5BZDA 2UZIH 3WLWD 4IMLB 4M5ZL 4ZPVA 3MRQA 3TA3C 3BKYH 4ZUVA 1DQDH 1I8KA 1MEXL 4OLVH 4DN3L 3KVQA 3SKUD 1BIHA 3EOBB 4OV5A 3P0VH 2R0LH 2IANA 1S9YA 4K94H 1RJYA 4O2EA 4Z6AT 4ZUWA 5DSCB 3FB8A 4XMPL 3VFVB 1HILB 4YX2H 1A6TB 3DROA 3RI5F 1SEQL 1JWMA 4FQIH 3BT2L 2P8MB 2FNBA 4LCWB 4MD5B 1A9EA 4N9GA 3DX7A 1MFAL 1A7OH 3SEPA 3BPOC 2W07A 5DJDB 3QEUA 4YDVB 2X05A 3U7WH 5JDSB 4JDTL 1A6UL 1JWMB 4NRYA 4JFZH 1N5AA 2VITA 3GBLA 4FQJH 4ZS6D 3QH3A 3WNPA 4MQXC 1P69B 4OV5B 3CFCH 3QRGH 4JFYA 1GSMA 3FT3B 1YYLL 4H88L 2VWEE 1MFDL 1EPFA 4XWOC 1OGTA 5HDOA 1YNLL 1UYWH 1S3KL 4GG6E 1JGUL 3HCVB 1OAKL 3IJHB 1H15B 4Y1AB 4S1SL 3BZDA 1NEUA 4LVNB 5JW4Q 1GC1L 2XWJA 1PD6A 3PWNA 3MLTB 3O3UN 5IR1A 2Q1EA 5BJTA 3EYQD 1H3PL 3LCYA 1A3RL 5TDPA 4MCZB 3VGFA 3ARYA 3EYSH 2Q8AL 1C5DB 5T3XL 3B9KC 4DUVA 3QEGL 4R4ND 2X4NA 3H3PL 4KK8C 4NZTL 4K71B 4ZOAA 1PEWA 3FN9A 1KJ3L 5DJ6B 5F1NA 2QADD 1CL7I 2DLFH 2DIAA 2NPLX 3QG7H 4HSQA 1PVHA 4PRHA 1ZA6A 1UJTA 1WIPA 3QI9C 4KVNL 4KQ3H 1EDQA 3UTTA 2NNAB 4GAFB 5EU6D 4D9QE 3PWUA 2XPGA 4MNGA 3O4OC 1CIUA 1FZOA 2FB4H 3NA4A 1WWWX 3MNWB 3WHE0 2FL5B 3EYOA 1AIFA 3KPSA 3MYJB 2IPUK 1ZGLP 1SEBA 2ICWJ 1SYVA 1MCJA 4OI7A 1XIWD 4JFFD 1P7HL 1BQHA 5CJ5A 1VSCA 2XKSA 2FX8L 2K7QA 4N8VA 1KIPA 1TVDA 4OD3L 1INQB 5LJYH 3HC4L 4LF3A 1VENA 4NO2B 5ESAB 2DQIH 4ODSL 3ALPA 3HR5B 4N0YH 4KJYB 1T0PB 4I0CC 1MHEB 3WJJC 3UROR 5KSAB 1C5CL 1CL7H 2ZCHH 3QDJD 4RGNC 2VE6B 1J11A 3EUUA 4ONOA 4LEOA 1HOCA 1LDSA 4G8IB 3C6LB 5GHWH 1K8IB 4LVNC 4OSUL 3CZFB 2EIZB 1LEGB 1BFVL 3DETD 1ITCA 3MLYL 3B6SB 2H41A 3INUH 1RFDH 5D4QA 1KG0A 3V0AC 1OLZA 1DP0A 4GRMA 5ECJE 2A9MH 3CDFA 3P2TA 1GGIL 2I60L 3HE7A 2UUDH 2BMKB 3M1BB 3E2HB 4MWFB 4NO0A 5EPMA 4NHUA 1G7MB 4HEPG 4MSWA 4ODVH 3UPRA 1ZLSH 3AAZB 3OF6D 1B6UA 2YPLE 3C5ZB 4AIOA 1DUYA 4O5LL 3HFMH 1YECL 1SHMA 3LKPA 3OHXA 1M7DA 3FHAA 1WFTA 4KROB 3BJ91 4GKSA 4M43H 3MRIB 3HC3H 1H0DB 4AL8H 2F9BT 2ED7A 4NQDA 2HJFB 2FHFA 1GGIH 2HVJA 5CBEB 1JPFA 1A7NH 1I9RH 4LHJB 1MRDL 1NGZB 5LGJB 1BFVH 4OLYL 2Z8WC 1L7IH 3F5WB 5ELIA 1YMHB 2V5TA 3FT4A 4PJGB 4QT5A 5D9SA 2X41A 3HE7C 2N7BA 2X7LA 2VZUA 5JHDD 1EFXD 1CL7L 3O8XA 3PABB 2C1PA 3VWJC 2XOTA 4DZBB 1UM4H 1FSKB 3L5XL 5IEHA 5F3BA 1I4FA 2PTTB 5FYLL 4YWGH 2GSGA 1ZVSB 4F7PA 4NZUL 2C5DC 5MEPA 4OI9A 3OKLA 3V6BR 4LHQB 5KSAA 2GI7A 5C7XH 3GSOA 4RRPG 1KJ2B 4E0RB 3JUZA 4EVNA 4MXWH 4KMTL 1RZFH 3G5VA 2MSPA 4L8SB 5I71C 4BFEA 2E8YA 3QJHB 1NUNB 1FORL 1C08B 4WI8A 4YHKH 4HT1L 3S34L 1NBVH 4JM2C 1EO8H 4FP8H 2YD8A 5GPRA 2Z91A 3LIZL 5I8KH 1BECA 1J86A 5C07E 4XP1H 1N5AB 4WJ5B 3UAJD 2H26B 3ARWA 3WJLA 3H7LA 3WIIH 3TGXA 1G7PA 3F6IA 3QI9A 4KDWA 3FT2A 4X0KA 3QIWC 3LHPH 1ETZA 1JRHL 4KVNH 1MIEH 4MA3A 5TE4H 3U6RB 5HVFB 3QG7L 3PWUB 4KVCH 5KVFL 3RNQB 3BGAA 1YEHL 1SBSL 2EH8L 4C55A 4GW1A 3OKKA 3IFPA 1UM5L 3QXWA 4QY8A 3VD4A 1F4XH 1X7QA 1CR9H 1J88A 2D7TL 5ALCH 3IFLH 1HSAA 4Y2DA 5CWSA 4OLWL 5C92A 4U6VH 1JWUA 4U1SA 4P2QB 1K6QH 3D18A 2OR9L 5J4MA 1YQ2A 4JM4H 2UVFA 1QSEE 3VRJB 5I6XB 3K8LA 1P7KB 1EIBA 3KPSE 1JWUB 3GGWB 4NGHL 3VMOA 4PJBE 1QEWA 3HRZA 1LO2H 1U8PA 3O4LE 1RUKL 4ZFOA 3VGEA 4OQTL 3TBYB 5EO0A 3WV0A 3MRDA 2ATPB 3SJVE 1KTLB 1HOCB 3TCLB 4PJHB 4CU7A 2VRAA 3QFJB 2Q8BH 5CZVH 3CNKA 4CL7A 1BJ1J 3MMEA 3MZGB 2HFFB 3GMOB 5DUPH 1I8LC 4KAQH 3WNMA 3QUKB 3BDYL 1BBJA 1VACB 2VISB 1AP2A 3U4EA 1XIWC 4KK5C 3TO4D 2G2RB 5E99H 4CJ1A 2QQLL 3PP4L 4UBDD 2LABA 4WFHD 1HHKA 4AEIH 1G9NH 1KIQB 4WU5B 3S35H 3DOSA 3O6KH 3BT2H 3LDBC 1KT2B 5C09A 3V6OE 1MOEA 3SKMA 2MFNA 1UACL 3KPRA 3UJTL 1G7LB 3QUMB 5HVGB 4XMPH 4WDIA 1Q72L 3RKDD 1JWSB 3MNWA 3N9GL 4YPJA 5IFHL 3QBTB 5GRUH 3ZL4L 4KKAC 4LOUC 2EDQA 3QISA 3DECA 3QIWB 1KJMB 1M6OB 2X70A 1MEXH 1XF3A 4OLVL 4DN3H 5E70A 1ZVSA 4OTXH 4HS8L 1GRWA 2NXYB 5L2KE 3MJ9H 5AYUH 4NKDB 2UZIL 3UDWA 4IRJD 3MUHL 5KANG 3TESA 1E6OL 1OTUC 1HZHH 4H5SB 2C1PB 5I1CL 4Y5VA 5J1AA 4NUJB 1CD1A 2DF3A 2GJ6E 1JNNH 4GRLB 5FHAL 3DWTA 1FAIH 4AZ8A 1ZWIB 4TNWK 1P7KA 4OJFL 4ZS7H 4GKZB 4PRNA 5I15L 5ENWB 5MEPB 2VH5H 5I1EH 1IE5A 2IBZX 2PXYD 3D3VD 2ATPA 4X6EA 5D5MA 5I9QC 4CN6A 2WWKO 3ME0A 2C3HA 5SWZB 3SJVA 3WS3B 4KU1A 1MRCH 1RIVH 3OHXB 2DL9A 4OFDA 4FQHB 4MA3B 5E9DE 4UBDC 5TDOB 5CFHA 3STZA 4YQXL 5JPNB 1H9VA 5HGAA 1XH3B 4A6YA 4UIMB 3KPQA 5KVGL 4MWFA 4NO0B 1WZLA 2MQCA 1TJHL 2RBLA 2R0KL 4KV5F 1OQOA 4QCIB 3IS0X 1UG9A 3MLSH 1AJ7L 3BOVA 2JK5B 5FB8B 3CSYB 3IDNA 1FAKT 2VLKA 2E7LA 2ZCLH 1TQBC 1CDCA 4BFBD 2F54D 1LHZA 3ZMRA 5IMLA 3QPXH 1R3KB 2V2XA 1LMKA 2YC1B 1JZ3A 3V95A 4DKFL 1FBIL 4L3EA 5F3HB 2V17L 5FO8B 5EUKB 1MQKL 4NRXB 5JW3H 3EJYC 1BEYH 5HDBE 4Z7VF 4EXKA 4JM2F 3QUYC 2HN7B 2E7LC 4I3SH 1HI6A 4I18B 5J11C 3U36B 2X4PA 1KIRB 1IILE 4HIIB 4M5YL 2ARWA 3NPSB 4WGVB 3WN5A 2VLRE 3LSOA 5EOTA 2J4WL 4RA0C 4G8EB 2FCBA 2R56H 5IMKB 1QBML 2E27H 1XF5B 3R8QA 3ARXA 1CGVA 3D87B 5FYKL 1CQYA 1QFUH 4HWZB 3ZHLA 5I1LB 5HHNB 2XN9E 1EZVY 3MV9D 3LV3A 2NY1B 1Z0NA 1I9EA 3VXUD 1QTYT 2WMPA 2FATL 4PG9A 1MY7A 1CS6A 1DUZB 5MI0C 3M17A 4G80B 1AE6L 4JRYB 2FEEL 5D1ZA 5FGCE 3ZT7A 1FGVH 2VLKB 5IGXL 2IAMC 5E8EA 5EU7E 3FO9B 1EHLH 3QQ9D 3UO1L 3H9YA 4HXAL 3VWJD 4PRAA 4Z0BH 2AV7B 5J12B 5LKNA 4TSCL 1P2CB 5MP6H 1R5IA 5E2TH 4UQ3B 4K9EH 5KSVB 4MD0B 3KNBB 1YEIL 1IGJB 5F7MC 3RDTA 4XP9L 2D4FA 5BQ7A 1BM3H 1FZJA 5E08H 2OL3L 1K8IA 2R1YA 3OJDB 3KPTA 1L7TL 3VXTA 2OTWA 1ADQH 3RPKA 5CSZB 3RAJL 2D0GA 3FB5A 2AK1L 3IFOB 2ZSVA 1IZJA 1GXEA 3GI9H 5DD0H 3CPLA 35C8H 4X9GA 3S7GA 3LOWA 3KWWB 1NMBH 2H32H 3QWRA 4ONFL 1DANU 1XF5A 2X4OA 2NXZC 5J89A 3T0EE 3ULVL 5IHUH 1IC5L 2IPKA 3BEWA 3M45A 3WN5B 4C57C 2V5MA 1WZ1L 5KVDL 4JO3H 1CXIA 3WDIA 5F7HA 4UDUB 2CIIA 4DCQB 2DTMH 2XA8L 1FNGB 5FA3B 3VFPB 1KPVA 3MJ9A 1G9EA 4OLUH 3MCKB 4WWKD 1X5ZA 4P99A 1E0OB 1JI2A 2YPVL 2ZG3A 3DMMA 3MUY1 1G9MH 2H1PL 3GRWL 3OQ3B 5EO1B 4PGZA 5FECB 1NJ9B 3PQYD 4LSTL 5B4MD 4Q2ZB 4PJCB 2HYMA 1I1AB 4GQ9L 4LSVH 5EWIL 3AY4C 2X89A 1QA9B 5GGTL 3TO2A 4ODXA 1P9MA 4HKJA 4RMUA 1DSFL 3QDMD 3IDYB 1M1SA 4GFTB 4WFED 1FYTB 1HHJA 1PX3A 5CJQH 1DQQB 2BNQD 3A67H 2HFGH 4IJ3B 1UXWB 3P4MB 2ADJA 1AXSA 4ZO8A 3H42L 4LPXA 4JRXE 3H7BB 4TYUA 1N5YH 3JV6B 3TBTA 1UWEH 1YN6A 2DKSA 4M6MH 3QQ3B 5EA0H 4PY8J 1TPXC 4W6XB 3QUZA 5E2UL 1LEKB 3RBSA 6CGTA 1MELA 2D3VA 5MEQB 2BVOA 2NLJA 5ERWB 1NDGA 5IVXA 1FZKB 2OMNA 4RGMC 3F65A 2AXFA 2Q86A 3RHWK 4PBWD 5KBNC 1T6VN 5IBTL 1A7PL 4DFHA 3VRJA 1S7QA 1TZGL 5A2IH 1CLOL 3S98A 3TPUA 1SVCP 1A2YB 1TVBB 4P5MB 1KACB 3ARGB 4F33A 3QEQE 1N3NA 1TETL 2NZIA 3MJ6A 4OZ4B 4X6CF 2H8PA 1B2WH 4KROC 2AKRA 4F57L 3WJJA 1RJZB 3U9UA 4JB9L 4N1CA 1JHTB 3HPJA 4KK6C 4YXLH 1NC2A 3SKJH 3PP3H 4B7LA 3MLWL 1WWBX 4LIQE 4XCYA 2VDOL 4QLRA 2XIDA 1P4IH 1ULVA 4YXKL 2FBJH 1CQKA 5GZNC 4Y4HC 4NN5C 3ULUC 2VZTA 3LKQA 2Z31D 2VL5A 2G60H 4RBPK 2DQUH 4LCCC 4PV8A 4LQFH 1F8TH 3GJFK 1XR9A 4KPHL 4GXVL 3LKOB 4P59H 4KQ4H 2CIKA 4GXVH 4M1DH 4WTWA 2UYLA 4FQPA 5C8JB 4JQVC 5T3XD 2PYEE 1HQ4B 3ILQD 2D7PA 4JQIH 5C3TA 2VISA 3PUCA 5DEFB 2HP4A 3MV8B 4XCNA 2VDOH 4XWGL 5E8PA 3RZCD 5E6ID 5JOEA 3EYFA 2VSCA 4DKEL 1CGYA 1CIDA 1KLUB 4LASL 5D1XC 3R0NA 1NDMA 3DROB 3GMQB 2Y07L 4HWNA 2VQ1B 2Q86B 3OJVC 1DJSA 3DLQR 2GSGB 2BHZA 3PWPB 3G04A 3QNYB 2ITCB 5DMGC 1PQZB 2MHAA 4JM2B 1WIOA 4HUXA 1NKRA 4MQ7A 1A7PH 1N64H 3RWGA 3PGFH 2DQDL 4M6OH 3IJYB 5I2IB 5JZ7C 1OTTC 5DQJA 2VLJB 2Y06L 4LSDA 3HC0B 3SDXE 2LFGA 2XQYG 4F3FB 3JWOL 3EFDH 3D69A 3MROB 1T3FB 1OCWL 4FZ8H 4U1SB 4WI7A 4K2UL 4QRSB 5HYQA 4TSAH 1UT9A 3W82A 4NNXB 2BOBA 2EDJA 2XZCH 4L8CA 3IXAB 1KCUL 2NTFB 4J8RB 1AGCB 5JXAL 3VFOB 4BH8B 3QUYD 4N1HB 5IW6B 1DUZA 3M8OH 2HT2C 1R5IB 1QZ1A 2HFGL 1JGLH 4PJIF 2AERT 3N1FC 2AJSL 3BWAB 2Y36H 1FQ9C 3TBSB 4W4OC 2JB5L 3UTPD 1ZHLA 4RFEB 1EUUA 4GQ9H 4LSVL 1UJ3C 2DJ4A 1HE7A 3ARDB 3IF1B 4HS6A 4YDIH 4PLJD 1U3YA 5EOTB 2Y25A 2GJZB 3EJYD 2CIIB 3B3IA 4JLRA 4GAGH 4KHTL 1I85A 4OLZH 5SX4H 4M1GL 5CZKA 3RTQA 4C4KT 4PJIA 1AY1H 1BFTA 1SM3L 3MLZH 2R69H 4JHBA 1XMWA 1JHKH 1A7QL 2ZKHH 4N8PA 2EKJA 1HXMA 1WZ1H 4OZGB 5GSVA 3BGFB 2BSRA 3FN0H 1G6RB 4NO3B 4TUOB 2OP4H 1T7XA 1TJIH 1BF2A 1S7UB 3QUXB 2CMRH 1KENL 1UZ8A 3OJ2C 3AVEA 3S5LB 3G5XB 4TRPH 2AK1H 2W9EH 4M7KL 5DTFB 4N0UE 5FO9B 4F7CB 3MLXL 3NIFE 2ARJQ 2DJSA 2CIKB 1OP5H 5K9OB 2W0PA 3Q1SL 2C1OB 5SWSB 3ULUL 1YPZA 2NY0C 3Q0HA 4JFEA 3GO1L 1NAML 1R24A 4NRXA 4P4KD 2HA1A 3BXNB 1OM3H 3V6ZA 1YEIH 3PHOB 4U6XB 4WFFD 1NBYA 3WXWL 3GMPB 5HHMB 4AIZA 4C56B 3HLAB 5DUBA 1KB5H 2HJFA 1LO5A 4DVRL 1KJ2H 2PETA 1HEZB 3ZYJA 4X9IA 3WS3A 2GCYB 1UVQB 4YR6A 1R3IH 2OJEB 4Y5YA 4K8RH 5CIPA 1U93A 1BFOA 1QSFE 3E6FB 5J6GA 1ZKAA 3EZJB 2PCPA 1KFAL 1X9QA 2FIRT 2VDPL 3TCXA 2Z93B 5HHQA 1T0NA 2ZUVA 1CFVH 3QG6B 3S3SA 4NQXA 4MXVE 4YDKL 1T2JA 5D71L 2VXTL 4MXVF 1A2YA 1TVBA 4YO0A 3IFNL 1E6JH 2E9BA 4PRPB 2PYFA 3O2WL 3SE9H 2GITB 4NFBA 1YEEH 4GRMB 1RI8A 4LOUD 4LDOB 4UU9A 3S3PA 3QAZB 4ZAKD 5IB4B 1T89A 3QDMB 2XTJE 5EDXA 5I0DA 5ILTL 4DTGH 1UJ3B 1OP3H 4OGAD 2P7TB 2ZG2A 4HH9A 3Q2CA 1CGSL 3QDJA 3QNXA 2R56L 3E6HB 2HFEB 3HHRB 1JTTA 2CKBL 4HLZG 3GMQA 3GSQA 3MRPB 3F7YA 4M5YH 1N8ZA 1FL5B 2YD3A 2ADJB 5I66B 1W8NA 1YEDB 4LCUB 3RL1A 2P5WB 3SO3C 2G75B 4I3SL 1X4ZA 3PWJA 4L9DA 3FTGB 5EH1A 1XZ0A 1IKFL 1KCVL 3KLHD 3H3BC 1D5BA 5KSBB 1A47A 3UTTD 2FX7H 3L3DB 1FBIH 1LD9A 1MI5D 2AJXL 5ETUA 3VI4F 4WHYG 4G42A 1IEBA 2EE2A 5D7SH 3RWEB 2VDLH 1JK8B 3LKQB 3BVNB 3BWAA 1N6QL 3VFPA 3U48A 3UTQB 5T3ZE 2PF6A 2LU3A 2WWMD 4R2GC 4EI6B 5BV7B 5HSFA 3B5GA 1P84K 2GT9B 2IQAB 1ZLWK 1MSPA 4FTVD 4FQQA 4D0CB 1J0YA 1WTLA 1GYAA 2QLVB 4JJ5B 3QEQD 2KKQA 3MV01 4WHCA 3UAJC 3VGHA 3GSXB 1V7MH 1I8KB 4FTVA 1RIVL 2EDEA 2R0WL 3HE6C 4P5MA 3CLEL 4HUVB 5BZDB 3ROOA 3WHXA 1CLZL 4UIKH 3ZDYE 1RJLA 4PJ8A 5E0QA 5I1GL 5D7LA 1L6XA 4I5BA 5B39B 5I1EL 3VH8B 4OCYH 4ZS7L 1X7QB 4EBQL 2IF7A 1FN4A 4NKDA 1U8PB 5F9OH 4X9FA 4YUEH 1IGJA 4XCCL 4KRPB 5FOBB 2CO6B 5F21B 1KJMA 2X70B 3HLAA 5DUBB 1B6DA 4RGNE 4UMGA 1SJHA 1D5IL 2BVTA 1Y6KR 3I6LE 3WN5C 2QKIB 3PJSB 4Y4FA 4L5FL 3DO7B 1ZTXL 1Q9LB 3KPNB 2K9UA 3FT2B 1JN6B 3HNVH 3HE7D 1XCTB 2VC2L 5ETUB 4WGWB 4M7LH 2NW3A 5HI5C 2CDGB 1T66C 4TVPE 3KPPA 1URLA 3ZL4H 1J5OH 5IFHH 4LPCA 3QH3B 4M9OA 3RNQA 1P4BL 4MNQE 2Z91B 5EZLB 4PG9B 4PJ5E 5KTEL 1JPTL 1UACH 4MS8D 4CMHB 1Q9KA 5CINL 5C2BL 2H9GA 5HPOA 3KPRE 2A73B 4OGYH 4AEIL 5EO1A 1FFOB 2VL5B 3SQBA 3BX7C 2YA0A 1AKJB 5DF0A 4WU7B 4EBQH 4FQXB 4X9HA 1W0YT 1ZXQA 4YHIA 1PDKA 2WQRA 2XKNA 3B2UC 2VZSA 1NLDL 4NT6A 4ORZC 4HKBA 4WHYH 4HULB 1BD2E 1QNZL 3G6DH 1YMME 4G6JH 5E2VH 3QQ4B 3GSRA 4GAJL 3RVXD 1ONQA 4NM8L 2NY7L 4QXUL 3VJ6A 3GMNA 3TBYA 3MR9A 3NZ8B 2DRUA 4UTAH 4NQCD 4OM0H 3UBXG 5CEZE 3VG9C 1G9NC 3K8KA 5ISZB 5IFJA 1I7TB 5D7JA 2ZUQB 4PRPE 3BGMB 1I3GL 3CFEB 4ZTOH 5SWQA 5BS0B 1OAXH 3MFFA 5H37G 4PB0L 3TBSA 4R6UA 4RGND 1FV1A 3QNXB 4RGOH 1N6QH 5D2LB 1GVIA 1T5XA 4GO6B 3AM8C 1A5FH 2EDDA 4Y16A 1K6QL 5D7SL 3ARGC 4TVSa 1LO5B 3TVMC 3PHQA 1YMHA 3EYVA 4Z76A 2FX7L 4QRRD 4W6YB 2HTLD 4BSJA 1KGCD 1IM9D 2R23B 1RK0A 5DEGB 1QRNB 3MV9B 5HGBB 3W9EA 1WITA 1ERNA 4OCXH 3ZDZE 5HHQB 4U1GC 1AR1D 4I1NB 4X6DB 5DVMA 2F8OA 1YEKL 3C5SA 3RKPA 1D9KB 4Y4HB 2JJTC 2RAMA 3HNTH 2IEPA 2BJML 5A16B 2XTJC 4NQVB 4ESKA 2GY7B 4NQEA 2JJUA 3DI3B 3HZKA 3KXFB 4NM4H 1UZ8B 5C0JB 3DV6B 5FGRA 1MCLA 3V6OA 4YFEA 1S9WB 4KKCC 2YPLD 5ICXA 4IRJA 1QRKA 3ORJA 2PN5A 1LK2A 1CGSH 3KYOA 1FORH 5K9OA 1TENA 1EJ6A 1RZFL 1Z2KA 4A6YL 4KMTH 1XCQA 5I18H 4UDUA 2EIZA 3MR9B 5C7XL 2F5BH 4KC3B 5JPMB 5C6PB 5C0FA 5D71H 2XACC 2A38A 5CS7A 15C8L 4YWGL 4HS6B 5IVXE 3EYQC 2P24A 3LS5H 2YSSA 3ARTA 1KFAH 5JORA 1I8LA 4JFOA 4XI5C 2YZ1A 3QCUL 3TN0A 1EJOH 5JHDE 2DQGL 4L8SC 5F89A 1QSFD 1IL1A 1R0AH 3P4NA 1MLCA 1BREA 2OTWB 1PZ5A 3QEQA 5TDNA 2CKBA 3LEVH 3PIQA 1L7IL 5MENB 4OLYH 3BP7A 1SJEA 1I7UB 5GS1B 1GGUA 2XQBL 3CC5A 5FO7A 2F19L 1RJZA 4P57B 4ZNEA 1ZEAH 3HB3C 3Q1SH 3SGKC 3ULUH 5IMOA 2GTZA 4E5XA 3U4EB 2CUMA 1QHPA 2ZOLB 4K3DL 4WO4A 1JYWA 5HGBA 3MLXH 2F74A 5DC0A 3MJ8B 4UIMA 5FUCE 3PQYB 3RUGB 2MOVA 4EI5D 1KENH 5GJSH 1TJIL 1U0QA 4JFPA 4ZUSA 2HWZL 2DYPA 5C07B 4HIHA 1MVUB 4H25A 3C87A 3UTTB 3BYTA 5CGTA 1DBKH 4I3GA 1WZKA 1UM6L 4IOFD 5TPWH 3PWNB 3A6CL 2ZKHL 3WS6C 2ITDA 3NPZB 2EZ0C 5KW9H 1RFDL 1AY1L 3O4OB 2B0SH 4Q9RH 3WMSA 3QXTA 4KHTH 2GY5A 5GHWL 5DFVC 3NCJH 4KI5F 4JVUA 3D18B 3TPKA 3T0EA 1U8NB 5D72H 1A14L 2WBJC 2J88L 1CXFA 1HIMH 3V0VA 5I74B 2MHAB 4JM2A 3CVHA 3MLUL 5KZCB 1YYML 2D7MA 3GMLB 4JG0H 5HHXH 1RUPL 4FQLH 2APWA 1UENA 1B4JH 3BAEH 5FUOL 4J1UA 2HN7A 3BMVA 5J3HD 1NJ9A 3LKRA 4O51B 5HVHB 4ZUUA 3ARGD 4P3CL 3BDBA 4X0KB 1QQDA 4MJIA 5IW1B 4YXHL 1AHWC 4K3GA 2FGZA 4Y4FB 1UWXH 2N7AA 3TWCL 1U92B 3ARRA 2EDTA 3OX8B 5DJXA 1R3KA 2A9NL 1XZ0B 1IARB 4NO5B 1D9KA 2FB4L 5GRZA 2P5WA 5DRWA 3G5ZB 2Z31B 4KTEH 5DRNB 1GAFH 4HS3B 3MRQB 1BQSA 4DGYL 2E9IA 2Y5EA 3GSOB 3QDGE 5JHDA 1GZPB 2ZUTA 3V0WL 5JUEL 3PDOB 1AI1L 3T4AA 3BQUA 3SGDH 4WFHE 4GMSL 1VEPA 4V1DD 3OPZL 3PDGA 3RP1A 1KJ3H 1ACYH 5F1KC 5FA4B 2OSLB 2Y07H 3WFEH 1A1OB 5E56A 4DGIL 4XNZC 1FZJB 3QEGH 4N8CH 2WUBL 3DUUA 3X11A 1FO0B 4H8WC 3EYSL 4G43B 4Q97A 5DD5H 4DW2H 1IM3A 4KJQD 2CK2A 4MVBC 5JQ6H 4FXKB 1MUJA 3MZTA 3NH7H 1YEGL 3S4SB 1YY9D 5D96C 3FFDB 1U91A 3RWEA 2YWYA 2DQJH 5T1MB 1MF2L 3Q6GH 1UXWA 5F8QC 3KLSA 4AG4L 1KPUB 3MA7A 1T66D 4JR9L 3UMTA 5HHOA 1VFAB 1AQKH 1S3KH 3T65B 1BJ8A 1YY9C 3L3JB 2G60L 3DXAE 2Q20A 3DSNA 3RGVC 4BZ2L 5D2LF 4DAGL 1CFTB 4ZSOA 1QKZL 2UY7A 3OWEA 4PJ9A 3AGVA 1IVLA 2KZ1B 3MLWH 1ZGLB 1JYXA 4JB9H 2FJHB 4MQXD 2ZOLA 4FZEH 4UV4H 1EO5A 1WV7T 5D2NC 1JV5A 3PL6D 4F57H 3MRPA 5E8OA 4L4VE 4JDTH 2F8VA 4EN3B 2A2QT 4RFNC 1JCKA 3PDDA 1CLOH 1TZGH 2IANB 4QRRB 2LTQC 3WYRA 4APQD 1QSFA 4ENEC 4YX2L 3V4PH 4DWHA 3T0EB 3SDDA 3HE6D 3RGVA 3I50L 4R7DB 4V1DA 4EVNB 3P30H 3FFCD 4NRZB 3FQXA 4LEXL 4K94L 3FZUC 3BZFA 4RAVB 3H9HB 4I18C 1MCKA 4Y4KC 5HYEA 3W0WB 3IDIA 5ICZB 5DO2D 2JKXA 5EZIH 2GK2A 2PW1A 1LO3L 1OP3K 1INQA 4KY1H 2VUYA 1CFQB 3ZZ1A 2VERN 3TA3D 1EEZB 1N5YL 2V2WB 3L3GB 3X12B 3VXUB 1UB6B 2WK2A 4QNPF 4IRSC 4DGVL 2DBLL 5C08E 5EBMA 4Y1AE 3A67L 4PRDB 1RJLB 3CK0H 3SOBL 2VR5A 4KWUA 1Z3GL 3Q5TA 4D8PB 1ORSB 1QO3A 5ICXB 1JF5A 2JCCA 4G9FA 5EFIB 3BPNC 1RMFH 3LN4A 3CH8A 5SWSA 3CFBB 4NNPL 2R1XB 5DMGD 3S88H 4NQEB 3NCMA 4FXGB 4WWKC 5DMYA 2IAMB 4UT6H 4Y16B 1UB5A 4PJAE 5F9WC 2DS4A 1OTSD 1PW3A 4KJWD 1FNEA 2AEPH 3PGCB 5B39G 3KJ6L 1OTTD 3MNVA 4KI5C 3CFBA 4XB7A 1BMGA 2DWDB 4NKOB 5SX4I 1S7UA 3F12A 3QUXA 4A2LA 2H3NB 3UPRB 1U41A 5DJCA 1TTUA 3LKNB 3MLVH 3SDAA 1RK0B 4I3RL 2R2EB 4RISH 1IBGL 5I75C 4R9HA 2HLAB 3SPVA 2DOCA 3W2DH 1A6WH 2Y5TB 3MBEA 3K80A 5IHUL 3RUGF 5D1QB 5E4EB 5HJ3B 1FJ1B 35C8L 3QDJE 4L3ED 1K9TA 5FK9A 4U1JB 4U1HB 3ETBF 3IAQA 3L9RA 5IVOA 5JO5A 3L7FA 4RIRB 4MQTB 1S7VA 3V6FA 2SEBA 3WNKA 3HCVA 4HWEH 3D9AH 1A4JB 2OL3H 4RFEA 1O0VA 1EBAA 3TA3B 3KPOB 1OVZA 4ZODA 2AEIT 4ZTPH 1FFOA 5HDQH 4BKLA 2J8OA 1OAQL 3SCMD 3O41B 3MRKB 5E1AA 5BV7C 5F9JA 4NQSB 1P84J 3TBWA 2YC1A 3SDCD 1X5AA 2Z8SA 3K1DA 1BAFH 2MCPL 4P4KC 1DVFC 3ARDA 1HXYA 3IF1A 1FIGH 5DFWH 4GRWB 4WEBL 1RUAH 4MJIE 1AE6H 5H94A 3UZVB 2W0FB 3VMNA 2LVEA 5L8JB 4JJHA 2DQTL 1BBDH 4CDGC 3RA7L 1FZOB 2P5WD 2R0ZH 2FATH 3HAEB 3NZHH 3WL9A 2HVKB 3MMEB 1CGXA 1IGMH 1T5WA 1NCAH 2OZ4A 1Z9OA 1J8HE 4X83A 3TCLA 2JLLA 4M93B 1WSST 2AI0L 4AMKH 1T21B 2DMKA 5DYOB 3ULUF 4EQ3A 2E7MA 1CFNB 2CJUH 1QLRA 3NIDF 3OR7A 1NEZB 3MFGB 3HZVB 1NC4D 1N3NB 4YHPA 4HLZH 3B8YA 3FOMB 2R39A 5FM4A 1J1OH 1IGIL 1MWAL 4WFGD 1IFHH 2W60B 5C0IB 2W91A 3RRQA 4O58L 5ID1A 2JJWA 4ZMAT 1QBLH 3EYFB 4FG6D 1KN4H 4RWYH 5IG7A 1I1RA 4R90H 4S1DD 4PRHD 5CWSB 4PJ9D 5D1ZD 3IJSB 4FFYL 4ONHA 2RFXA 1NKOA 1A1OA 4FQQB 4D0CA 4LEOB 1W72H 3QQ4A 3VFTA 4FFVC 4PJ8D 3QNYA 1BVKB 3Q5YA 2A74A 1KN2H 4Y1AA 3SGDI 3W0WA 5D1ZC 4DKFH 5IWLA 3NVQA 3U0TB 1WC7A 2P47B 3KS0J 3QPXL 1A6AA 1BIIA 4PJDE 4U1GB 5DRNA 2BDNL 5B38G 1LP9B 4R3SB 2NCMA 3DYOA 2KQNA 2BHYA 2NX5E 5FUZH 5ACLA 1JGDA 2APXA 2HKFH 4JHAL 1IAIL 2R0KH 2XZAH 4QHKI 4OZFA 2UYLB 3MLVL 4P2RE 3QIWD 3ARVA 1AGEB 3MYZA 5FYJU 5ESQA 3BKCH 4JZNB 1QFWL 2VMFA 1JPGA 3TH3T 1F6FB 4OB5L 3KJ6H 3MREA 4P46C 1H3VA 2OI9C 3MRRB 3EFFB 1ZHNA 4ISVB 3ARFC 5H2BB 4HKZB 3C5JA 3TA3A 4PG2A 3S88L 1VA9A 5F7EH 3TV3L 1JMXA 1VFBA 2CSPA 2W9LA 5EOQH 1HHKB 4MHHG 4MDJA 3QIUD 5CJ8A 5T5NF 4HC1H 4MDIB 5I15H 2QBWA 3S37X 4CGTA 5GS0C 1I75A 4NZRH 2DQFB 2AABL 2PYEA 3ILPB 1C7TA 3BRDA 4GG6F 5KJRH 1DQMH 3OR6B 4X4XA 4AH2A 1NMAH 3FFDA 4LSUH 5E5UB 3FT4B 2BXZA 3D85D 2W60A 4YFLI 4KZDH 1DLHA 2PNDA 2VLJD 1J0IA 1II4E 2PR4L 3MJ9L 4HWBH 4LHUB 2K3TA 3W5NA 4HS8H 5DJZB 4X4XB 5EZIL 4XXDB 2P46B 3WBDA 2HLFD 4OKVB 1FYTA 5EC2B 5EIVA 2OQJA 4HX1A 3CFKB 1MCPL 4L4JA 1UXSA 3H8NA 5C07A 1DBMH 4F37K 2DM4A 3UTQA 3UJTH 4KGJA 4XC3L 3VE0A 4XVTL 1GPOL 5GZOC 3QHTC 1RHFA 4OFYA 4NPYB 3EDDA 3B9DA 2XRAL 3I75B 1G6VK 1NCBH 5T33L 3B5HA 4QEGA 3IDUA 1H5BC 2IQ9L 1S5HA 3Q3GB 5DEFA 2Q6WB 3TJEL 1TZIA 4P4KA 3QIUC 5GRJL 4NC0B 4D0BA 4Q74A 1IGYA 1HXYB 1TLKA 4XMKH 1NCUA 1F4WL 2XY1A 3DURA 5L88H 4UV7H 3RJQB 4XCEA 1QKZH 5FDWB 1LEIB 2DM3A 5I17A 4KDTA 1S9VB 1YNTA 5DR5H 4ELKB 5C09D 5FIEA 2YN5A 2X4RA 4G8FB 4DEPC 4I0PB 2Y1VA 4ELMB 2Q3ZA 2H26A 4JKMA 3LEXA 3KYMB 3Q6GL 5B3NA 5I8EA 1NCDH 1A22B 1H5BA 1JNLL 4JRXD 3QFDA 1I1AC 1XGQB 2IALB 4N0FA 2A83B 3CUPA 3S5LA 5GGRB 3CSBA 5HJ3A 1D6EA 3JZ7A 1JPSL 5E6YA 2HJKB 4DW2L 5I8EB 3RWHB 4XP4H 1KPRA 3O11B 2FEDD 4TVPD 1EEUA 1L9NA 2WUBH 2BSRB 1HI6B 4KGLA 4BSVA 4FFVD 3IYLW 3I6GA 4JZJA 3KPMA 1ED3B 1YEHH 2EH8H 4Y19D 2NY4D 4P23D 4FQXD 4U0RC 4KVCL 1A3LL 3T1FA 5CEZL 5I76A 5IVXB 5F3BB 1S9WA 1B0WA 2PCPB 2NX5A 4XBPA 2OXGA 1E4XL 1UZ6E 3T0AA 1FNEB 1JRHH 4FQ1L 5D2NE 3PL6C 4R7NB 4I9WE 1U8MB 2IC2A 1MCNA 4L8DA 5L7XL 1KEML 4J6RL 3WIIL 2YWZA 2I07A 3EJJX 5I16B 2NX5B 5IVZA 2CKNA 3BPLC 2O5XL 5DJ2A 2A9NH 5EPMB 2GFBA 3JWNC 5BV7H 3ARBB 3ZHDA 2LAGB 2YZ8A 4JFQA 5IJVB 5JOFB 5JW4N 4MXWL 4G80A 4PRPD 3BN9C 3I84A 4KK9C 1MNUL 4QRTB 5GS1A 5TFSL 2HAZA 4E41D 3TT3L 3MPCA 4I0KA 1CG9B 4NZUH 5I1LA 5CKGA 3BQUC 1QPPA 3MLUH 1T3FA 1GC1C 4JRXB 4OZFH 1YC8A 3L5XH 1UM4L 5TE7H 4BZ1H 4LARL 2VABB 4JPKH 3VDAA 5JR1H 3CVIL 2JJSC 3GSNH 2J88H 2V5SA 4XXCC 5BCAA 1F42A 2LTQB 4MB5A 1KLGB 4PP1D 4YGVB 1I3VA 4PYGA 5E8PB 2BNQA 1OAUH 4X99A 4NQTA 4JG1H 4F2MA 4QRRA 1D9KD 1LNUB 1CE1L 1ONQB 3OMZA 4GBXD 3DURB 5ITBH 5C0NC 4NKQB 3U83A 4Z7NF 1KBGL 4Z7NE 4YGVA 4GAYB 1HH9A 4ZFZB 3A6CH 3MV7E 3KWWA 4HC1A 2XTJD 1DBKL 4LPVA 2X4RB 5BS0E 5CBAB 2VAJA 2X6MA 4LNRB 1ZMYA 4NJAL 5CLTA 4ZS6C 5SX5K 1JGEB 3QO1B 4NPYA 5HGAB 5I1AA 2VDMH 1F6LL 1IC7L 4JQVA 4GKOA 1ZLSL 1I7RB 2ICWI 3LRHA 2AKRB 1U8IA 3NIDE 5C9KA 1T2XA 1XR8B 1BBJB 1MPAL 3QPQC 2EO9A 2GFBB 1QO3B 1DN0B 4PJ9C 4G7VH 1NANH 3MLYH 4PJXB 5ENWA 4X80L 3LEVL 5C86A 4JG1L 4TSBH 1FVDB 3H2WA 4XBGA 3UYRH 2KQMA 5F70A 2WBJD 5FOBA 1U42A 3IJYA 5I2IA 3FRPA 3VFTB 4WI3A 4Z7UB 2Q3AA 1TXKA 5EU6B 2DB8A 2GJJA 4N0YL 2DQIL 4U0QB 5FA4A 3LVEA 1SMOA 4NP4H 3VW3H 3NCEB 4TN9A 3VFGH 4D9RD 1M6OA 4BM7A 1DFBH 2ILLA 3JV6A 4GG6B 2Q7YB 4H20L 3BPNB 4ZD3L 3GIVA 3ZKMD 5KG9B 2DD8L 4QTIL 3LQMA 3S36L 1N2RA 3BO8A 4Y5VB 4NWTL 1D6EB 4EN3C 4OFPA 3O3BA 1Z0MA 1DQQA 5HXMA 1H8SA 4K3JH 1JPGB 4R0LA 5DK2B 4PJAB 2J12B 5KN5B 1CE6B 4N0CC 1BHGA 1UADC 4MA1C 2VL4A 3IJHA 2V2TA 4YHIB 1AP2B 5EUOB 4BUGA 4H1LB 2FJHA 1KEMH 1SQ2N 3ALXA 4G8GE 5D6CA 1JK8A 3VRLE 5F89B 5JNYB 1JZ7A 4HUNB 1IEAB 4LCWE 4BK4A 5I8OL 2VB5A 3OXSA 5FHBH 1IC4H 2BRRH 2BFVL 3BIKB 4YHLL 4Z7UE 4NZTH 5DJ0A 2CDGA 2R29L 4IRSB 5F9JB 4HBQA 2B2XH 4OZIF 4PGBA 4LSPL 4TUKL 1FCGA 4F33B 4NZJA 5T1DL 5A2KH 1FL5A 5ITFA 1A5FL 2BSED 4JKLA 3KYOB 5F7DB 5KVEL 5GS0D 5J13B 1U8LB 3P9WB 1A6TA 4ERSL 4QHLB 3JWDC 4P2QA 1JNLH 4YEFA 3UJJH 4ZO9A 2OQJB 4F9PA 2XNAA 4JKWA 1NL0H 3JV0A 1CFNA 2YD6A 2VOTA 3C60D 3MOBH 2JJSA 3GEWB 4XXCA 4G9FD 3ZO0A 1YYLH 4PJGA 4X6DA 1IC1A 2AXHA 2PXYB 4QXUH 4NM8H 3PDOA 4UV7L 3NIGF 4PJXA 3OKNA 3TEUA 2HT4D 4HXBL 3RIFF 1EAPB 3OR6A 2XXCB 2Z31A 5CSZA 1PYWA 5C0GA 4PLNC 4EKXA 5HHOE 1IM9B 4I8DA 3MGOA 3UTSE 5SWZE 1J87A 4JDZB 1KCRH 4RAHA 2BNRD 1UKSA 1A7OL 5L9DH 1VPOL 2D03L 2A6IB 5EOCJ 4OGYL 5FDYA 1IAIM 1FNFA 5CINH 5TQ2H 3KLHC 4RNRA 4XC3H 1BJ1H 1JGEA 3QO1A 3MOQA 2J8HA 3JV4A 3AU1B 4XNYL 4M48L 4WV1A 1CN4A 3P0VL 3SKMB 4LSSH 1G7JB 5GGSA 2L7UA 3GZKA 5F7LB 1QSED 1YJDC 5FEBA 1E4XI 3RIAF 3B9EA 1Q94A 4KZDL 1WT5C 3I3EA 5JPMA 5L2KB 3C6LA 4EOWL 4Q6IA 1NMAL 1D6VL 3TZVC 4OIIH 4TVPH 1DQML 3VGDA 5KJRL 3KPOA 1HHGB 1C12A 4ODWA 3MBEC 3TN0B 1MJ7H 5CILL 1QFPA 3ZSTA 3CCHA 3QDGB 3FQXB 1GIGH 4HC1L 3DHMA 1LVEA 2Y9RT 4L4VA 5EOQL 1QG3A 3S35X 4X6CA 3T0WA 3LAFA 3IAPA 5E2WH 3CGTA 5HI4D 3WD5H 4XNQB 5DRXB 1I9JL 3SBWA 4UIKL 4S11A 5ANMB 3H6JA 4N8VB 1U3JA 1UQSB 2YA1A 5CLWA 5K9KA 3MGAA 2YD1A 5EBWA 4YE4L 4X8XA 1OTUD 1TZIB 5K9QI 4UOJA 3HE6B 3RVXC 3QJFB 5FF6B 2NYYD 5AZ2L 3QXDA 3G5YB 3VD3A 5A2JH 1YN7B 5KSUB 3TNNA 1U58B 5BRZE 4ZDHA 3NFNB 1U3ZA 1MCDA 1EFXA 3O8XD 3P11L 3STZB 5FUZL 5L6YL 5FYLD 3ARED 3BWUC 3SJVB 4EI5B 4JY5H 4O2CA 2XZZA 1T2QH 9CGTA 5ACMA 2AJXH 2I25N 3IDNB 4PJBB 4EQ2A 4WWKA 1K2DA 5BMFL 1EV2E 5HYQB 2EC9U 5D7KE 1X5IA 4HW6A 2I9TA 5EB9A 1NCCH 4LLWB 3MFFB 1RHHA 1G7PB 3FQNB 2XN9D 3BW9A 3C09C 2VR9A 3MV7D 2CDFB 5AWNH 4UILL 4O58H 1UH3A 4MYWB 1MWAH 5JMOC 1QPXA 2BY0A 3I6KA 3D3VE 3BP4A 2PO6C 1MFBL 3D48R 3EOTL 3BIBX 2CR3A 1N0LA 4M61B 1B90A 5HYJB 3H9HA 4EUPG 5B8CB 3T0BA 3ESVF 4LF3B 3PWLB 4H26A 3SHSA 4ELKA 3W39A 1Y0LA 3BZ4B 3HNSL 1W0WA 5FM5M 4UOW0 2P5ED 1Q9KB 25C8L 4WFFE 5ESQB 3HTLX 5HGHA 5MHSD 1CFVL 1HNGA 3O6MH 5DUMH 3ZE0E 3C5SB 1G7JA 5GGSB 5FYJD 5J57B 1VFAA 3FB6B 4R96B 1D7FA 4N5EC 1MCIA 3PWVB 4K8RL 4I4WB 3L5JA 3L3HA 3PNWB 1V3LA 2D4DA 3GB7B 3LKNA 3SDAB 4HLJA 1I1AD 1EERB 4CVWA 2MNUA 1GOHA 2DQCL 4ZSOB 2UV3A 4PB9L 1BQHG 1OAQH 5TJWK 4F15C 3OKMB 3BPLB 4HHAA 4ZTPL 5HHPA 4U3CA 1Z9SA 1MLBB 1CU4H 4OM1H 4RGMB 4U4BA 5H35A 2YHGA 3WUWG 4ZFGH 1HINH 1QFHA 2JB6B 4JFDA 1N59A 4L9LA 5T1MA 2E8ZA 3R8BB 1YEJH 4TRPL 2YD7A 4LGRB 3BW9B 3OZ9H 3SDCA 4PS4L 3WHXB 4YDJB 4MLIA 1TCRA 4U0RB 3FOMA 1CVRA 1CDHA 3FQUB 2J3SA 2D7OA 2DKMA 3FRPG 4AQOA 3C5ZD 5DT1L 3ES6A 5DI8A 2OTUB 1A6WL 1OAZL 4N0RA 3MRCB 2UUDK 2P45B 2WBKA 1NQBA 4WCYL 1OARH 4PP2B 4MDIA 1A7QH 4YR6B 5T3ZL 5HHPB 2J8UE 2R69L 1EFQA 3VXQA 5F97E 3H9SB 4NN5B 1YZZA 1IT9H 2CRYA 1X4XA 5IQ9A 5A3IC 3STLA 1DN0A 1AXSB 4QOKD 5D70L 3QUMA 3QJFA 5FF6A 4XVSH 4LRNH 2FJGA 5CEYA 5J9PB 4LVOB 1CXHA 1IGFH 4JO2L 4BFIB 3ZKSD 1FPTH 1KIQA 3GSVA 3WHE1 2ERJB 4RMWA 2UWEE 4WFGE 5KN5A 3WE6A 4KZEH 1OF2B 4S1RL 2AJSH 4LBEA 5LVEA 2H32A 3GK8H 5I1JL 1C08A 3CK0L 4F8QA 1JGLL 1EX0A 4LAJH 5CEYB 1PZ5B 3EDKA 3L3IA 1CXEA 3MUJA 3M8OL 4XPFL 1QRNE 4UT9H 2FLRT 4RDQF 3AROA 4N9GB 2FO4B 2XZCL 4XP6L 4GG6A 1JUFA 2C4FU 3VXRB 1ZT7B 5I19L 3JTSA 4FZ8L 5HI5D 4POYA 4TUJB 3ARFD 4M7JH 5MERA 4UZGA 3T0EC 4DZBA 1SVZA 4JRYD 2ZSWB 5DHVA 2FJFA 4LEXH 5JA8B 4KTDH 1B0RB 1WWCA 1Y0LB 4Y5XB 2IADB 4H1LH 5KG9A 3ARGA 4JFPB 3PGFL 2EDRA 4LRIC 4ZFFA 4HJ0C 4K3EH 2MPAL 4YDJA 1JTOA 4WIQA 4RX4D 4NN6C 5EORL 4X7TB 1LK3H 3C5ZC 3VFNB 3JVGC 4GQPH 2NTSP 1PZUB 4OCMC 4LSRL 1K3IA 1LEKA 5IMOB 4PJ5B 1DZBA 1UA6L 3GSWB 1L0XA 4P9ML 5CJXA 4UV4L 4LVHB 4Y5YB 3T08A 1U8HA 1F4YH 3T8XA 1RULL 3IDJA 1WJ3A 3TVMD 3V4VH 4OIAA 5EOCL 5I30L 3RNKB 4XPAH 5FGBA 3D39B 4YO0B 4WY7H 5BXFA 2NY2C 4FNLL 3L95A 5DEZA 3PWVA 2JCCF 4KI1A 4M9PA 3SGJC 1GGCL 5HY9A 5AAWA 4KH2A 1I8MA 3GI8H 4JFOB 4P59L 3NN8A 4JR9H 1GGCH 1H8OA 4M1CC 3F7QA 3FJTA 1CGTA 1D5BB 2RIKA 4G6KL 3ZE1F 2DQJL 3KDMA 3RWIB 2VITB 2EYRB 1NGWA 3F8UB 3ZKQD 5I30H 1DDHB 4KDTC 5EOCH 1HKLH 4YXKH 1P4IL 3RL1B 1IAKB 1P7QB 1NBYB 4HAGA 3FB7A 4KUZH 1RIUL 3LS4H 1NAMB 3L5WA 4P9HL 4N8CL 5D6DC 4PV9A 3RBGA 2OK0H 4X7DC 1X5FA 4F58L 3B4NA 1KJVA 3K2MC 5I1KH 1ACYL 1ND0A 2EDXA 5DSCA 1LK3L 3OPZH 1EUTA 32C2B 5C0JA 4X4YB 4C83B 2AEWA 1V3MA 4U6YA 2MWCA 2WIMA 5J13C 2BNQB 3KR3L 3RWIA 4NQEE 3WFBH 3DRQB 4W70A 1ND0B 4Q9BA 2MTPA 3RIFK 3ZE0F 4HJ0D 4M7ZB 2XN9B 2ZPKL 1CXKA 3BE1H 3THMH 2DLEA 5FKAB 1VKXA 5ESAA 4PV8B 2ENSA 1LILA 1XGYL 5FV2A 1EVTC 1U95B 3QG6A 1RZGB 4NN6B 4PR5A 5I19H 3KPSD 4NKOA 5D7KD 5EUOA 4Z77B 5CJBA 5L8KB 2PXYC 1PEZA 4R26L 2BHUA 2EDBA 4R8WH 1EGJA 1HQRB 2I5YH 3FRUB 4I48B 3KPPB 4R0LB 2P4AB 4X5XB 2BOBB 1J05B 3PL6A 4C56A 1B4JL 3BAEL 3VXMB 5I1JH 1WBZB 3AAZA 2C4XA 4KZEL 1YYMH 5F9AC 4EDXB 4KUCF 3ZE2F 1K85A 3I75A 4K7PL 5ADPL 1AGBB 1ZANH 3ESUF 4X7TA 4XMLH 3D39E 4KK6D 4JO2H 4LSTH 1A14H 4J3OC 4LRNL 4YK4C 5D72L 4MJ2A 4Z7WF 1NPUA 4R7NA 3VXUA 5SV4A 4HMEA 4N0FB 4HEME 2B0SL 1ITBB 4BUHA 2P5WE 2XFXA 1KB9K 1MFCH 3WXVL 4L4VB 3W5MA 4DFIA 5T3ZH 5J8OA 1S7XB 1DLHB 5KZCD 5EU5B 1WBYB 3U7YL 2UWEF 1OAZH 4JY6B 5DS8A 3ARZA 5DT1H 4XBEH 2MCG1 5HI4C 4PGEB 5GJSL 3BPOB 3E3QE 3NZ8A 5K9JH 1DVFA 1MIMH 4U6YB 4YC2C 5IT2H 4LP4A 1FNLA 2B4CC 4XPHL 3RVUD 3VA2C 1FDLL 1F5WA 2Z8VC 1NC2D 2HTLC 2AV1A 4P9HC 1HINL 1PLGH 4YNYB 5HHME 4C56E 4HGMA 3CXDL 4OF0A 2COQA 5C08D 3ARSA 1NAMA 3L5WB 3GMMB 5DHVH 5FYKE 1FVEA 1NCWH 4K9EL 1MQ8A 3L3IB 2FX9L 1GZQA 1OB1B 4TSCH 3T2QA 3OAUH 4K23H 2NXYC 2FBOJ 2ESVB 3GMLA 1LDPL 1R0AL 1QSZA 4JPIB 4PJAA 4MQSB 1QP1A 3EOBA 5K93A 4CJ0A 1N2RB 3BO8B 3HUJA 2NW2A 3QULB 4OAWA 15C8H 2YRZA 2NQCA 1ZSDB 3P9MB 4OZGE 3EOAA 4KFZC 2NY6C 2P8MA 1J0KA 4BYHA 5B4MC 2XTLA 1TJGL 3PHQB 3MGTB 3O9WB 3HNSH 4A6YH 3D1MC 3O4LA 1U8HB 3V8CA 3OB0H 1S9YB 3K4AA 2MQ0A 5FAAA 1IZKA 4KI5E 1O7VA 3IETA 5F1IB 3X3GL 2NY5C 3QDMA 1MI5E 2ZUUA 3O2VL 4UQ2A 2VN7A 2Y23A 1U2HA 1ZV5A 1S9KC 3HZYB 4XH2B 3VDCA 4O2FA 3ROOB 4EJ1C 3VWKD 4IOFC 4L9LC 4X98B 4AT6A 1ES0B 4UILH 3EOYG 4D3CL 3RU8H 3GKWH 3E0GA 1R3LA 2P1YA 5IHLB 2M2DA 1ROWA 4IRZL 4JFXA 2WV3A 1H3WM 5EU6A 1T21A 5JA9A 1ZHKA 4CMHC 4WUKL 1OHQA 1A1MA 1I1CA 2VLRD 2F53D 5JTWA 3QIWA 1NSNL 5A2FA 3TO4A 4L29A 4LAQL 1N4XL 2FO4A 3RZCC 4S10A 5H2BA 3PWLA 4H26B 2LE9A 3QI9B 1CI5A 1LD9B 3CMOH 3BZEB 1KPVB 3DMMC 2AK4D 3LRSA 3P0GB 1KYOK 2QR0B 1TJHH 5DD1H 3KYKL 3F6LA 4G8EA 5I73C 4LPYA 5IF0A 1PG7W 3W0WD 2VZOA 4V2BA 5BW7C 4MGXA 3CUPB 3BP5B 1WAAA 5J12C 4HUWA 1WISA 4G9DA 3F7RA 3KLAA 3PV7A 5SWSD 4P3WA 5IB4A 4JCLA 4LNRA 4E0RA 4UTAL 2UVEA 3F7YB 2CRMA 3WD5L 3OKLB 4IBLT 1CWVA 5IROA 1QNZH 2DLGA 4BSWB 3NFSH 1FZKA 3TBVB 1NLDH 3NA9H 5FCSH 1CD0A 3UXFA 5JLZA 3BKJL 3IETB 1HHHB 1MJ7L 2H45A 5AD0A 4GG8B 4WNQA 1BLNA 1C8PA 1D6VH 1J0JA 2VDKH 5C2BH 1MJ8L 4JFQB 5IJVA 4M03A 1G7IB 4HJGB 2ZSVB 3C09B 3P4MA 5DURD 5CHNA 1WBZA 4RFOH 3AS1A 3HE6A 1I7ZA 1OLLA 4F15B 2BVPA 3BP6A 1NBZA 2VC2H 5EO9B 1ZK9A 3N9GH 1E4KC 2IQAA 2IAMA 4XNYH 1ZTXH 3D6GA 5J06A 4ZNEE 4ZOCA 5CEZD 1D5IH 3LD8C 4N0UA 3UCRA 43C9A 5HTSA 3SN6N 1Y18A 2BX5A 3S5LG 2AK4B 5EU3A 2D03H 1VPOH 3IGAB 2VR4A 1E4JA 2PW2A 4JFEB 2J1KA 4DVBA 1RUQL 1CTOA 3CFEA 4YBLC 5B21A 4UB0H 3O11A 5KSBA 3C9NB 1MFNA 5TQ0L 4HXBH 5HVHC 1INDH 5DUPL 1LEGA 1IGTB 4U2ZA 1LNUA 4X4MA 4XTRD 3RZCA 4FQ2L 2VKXA 2WP3T 1AH1A 3P73B 3C9NA 1SMAA 1XF3B 3DBXA 4G6AC 2IG2L 3SPVB 1MHEA 1FVCA 1UWGH 4O4YL 3NGBC 4PV9B 3TLRA 1JTPA 3PP3K 2X4SB 1A6ZB 2GIYA 7FABH 3FQRA 1MJJA 3P73A 3P3YA 3N50A 5DD1L 1G1YA 2W0KA 4ERSH 4D0DA 3IXTB 3MO1B 1FYTE 4J4PA 1Q94B 2VZ3A 4DQOL 4KXZH 5E5MA 2VDLL 5T1DH 2E7CA 4HFWA 1WAAE 3K4ZA 4U6VL 1N4XH 2BVPB 2XICA 3E2HC 3JSSA 4QXGL 5HY9B 1I8MB 1NSNH 2A77H 5CMAB 1F4XL 3O3EA 3ELAT 4Y7MA 5B3JE 3IAGC 2CLZB 2CLRB 4ALAH 1NGZA 5LGJA 4JREC 1IKFH 2VWEC 3WUZA 3D2UA 5DD3L 3HI5L 3OKNB 5FHBL 3LKSA 4CKVX 2R4SL 5CIPB 1VFUA 4PJFF 4KRNA 3RU8L 2FR4A 3D0LB 1V3JA 4JDZA 4IMKC 3GMRB 1J8HB 3RWDB 2XT1B 4NNXA 1MI5A 1Z5LA 1BD2B 1C1EL 4PRHB 4G6AD 4XP1L 1X6LA 5DFTA 3O2VH 3P0YL 2GUOB 5KSUA 5D7IA 5I8KL 1ED3A 4MAUL 4AT6B 1TCRB 1EO8L 4FP8L 3HE7B 4KJWC 4YHKL 3S34H 1KEGL 3K0WA 4DUWA 3S36H 3P4OB 2NZ9C 1JHLL 4IEFB 1HHIA 3SGKA 5SWZA 3BKMH 4ZD3H 1TJGH 2J6EL 2UZYB 2IFGA 5GGVY 3G08B 3O2WH 5TH2B 1GOGA 3UC0L 3TZVD 1DFBL 2FEDC 4IIQB 1ZHBB 4ZO7A 1CTNA 2LQRA 4LLMA 4PJ8C 1DR9A 3CFDA 2Y72A 1G6RA 4MLSA 4LSQL 2AJ3A 2AW2A 4OZFG 1LQSR 2HVKA 1A9BB 3WO4B 1R3IL 4I0PC 3FB7B 4RX4A 1IEBB 4G42B 5IEKB 3BD5A 3CJJA 1AQDA 5L2KA 1EZVX 1JGVH 4GLRI 2W9DH 1A7NL 1BP3B 5F96H 3GBML 4BFIA 3CXDH 1OWWA 1FFNB 4E42B 3VH8G 3DGGA 3ZKND 4AL8L 3HC3L 1ZHNB 1SBBA 5LGHL 2A1WL 2O5YL 2J7LA 4TOYL 2P43B 5LAXA 4LCCA 3DHJA 5IT2L 5LWYL 4O5LH 3S4SA 5K9JL 2CMRL 3QWRD 2VLKE 2ICES 1AGEA 1NGXA 3P9LA 4ODUB 2XWBA 4HX1B 3BH9A 3LDBB 4KK8D 2VLRB 4G8GD 3U7YH 4YZFF 4L8CB 3I02B 4J3VA 4MA7H 4Z7VE 1M71A 4NWUL 4OZ4A 1NGYA 1EAPA 1QLFA 3WXVH 1LE5B 3C6LD 3FQUA 3R4DA 3RI5K 2Q7YA 3HB3D 1P6AB 4M8QB 4OSUH 3KLDA 2BY1A 3SDAD 3N1QC 1W8OA 4WI4A 1F00I 2FH6A 1NH6A 1QLFB 4HDIB 3VU2A 4ORGB 1QLRB 5C1MB 3ILPA 3MRDB 5JR1L 4PJBA 4JPKL 4HK0B 1OD9A 3EBAA 2V5RA 4DKAA 3SBWC 1HEZA 4OQTA 4N9OB 1ZT7A 4IIQC 4XHJC 1XGUB 3TT3H 3C5ZA 3W0WE 2RHEA 3RY6A 2Z35A 2X1WL 1JWSA 1LO4H 3TNNB 3PNWA 4Y8DC 2BC4A 4R26H 5EBGA 4YHOH 2BMKA 3M1BA 5CJXC 4PGBB 3OSKA 2JJVA 4LBEB 1C16B 4K2UH 4L3CB 1W0VA 2J5LB 1XGYH 5DK0B 3M17B 3AMLA 3FO0H 1OCWH 3LH2H 4ODXB 1LE9A 1T5WB 3G5XA 3DV4A 5DMIL 3U4AA