2AEWA

A model for growth hormone receptor activation based on subunit rotation within a receptor dimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
205
structure length
189
Chain Sequence
SSKEPKFTKCRSPERETFSCHWTDEVNLGPIQLFYTRRNQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNAMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Growth hormone receptor
publication title Model for growth hormone receptor activation based on subunit rotation within a receptor dimer.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 189
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aewA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aewA01
2YEZB 1YY9D 4G6AC 1DBKH 3AUVA 1V3JA 2YN3A 1AGFB 1MREH 5SV3A 1JWMB 4WHDA 3B9KC 5DJ2A 1F2QA 2K7QA 5EBMA 4IRSA 1R3LB 3QXTA 5C0AE 4PJBA 2NYYD 4KI5E 4M7ZC 2CIIB 1N6VA 2F8XC 4OIIH 5I2IB 5FA4B 1A3LH 4NKIH 1TVBB 4FQ1H 1GGCH 2WLYA 2NY7H 1TLKA 4L4TA 3MRRB 4LGRB 2XPGA 2QV2A 3SBWC 3HI6L 3IRPX 4NQVA 1S7TB 4JFFB 4E41B 3VH8B 3WFZA 1VGEH 3PL6A 1V7NH 2NY0D 2W9DH 1KN4H 4ODHL 1N6UA 1YMMB 4ONOA 1BBJB 2F54D 3D9AH 1T0MA 4P4KB 2QSCH 3I9GL 3QI9B 5EO9B 4Z7UE 4HBCL 1B4JL 4I18C 2ZSWA 4WUUB 3LEYL 3UTSB 5DWUH 1GHFH 1AQDA 3GSUB 1PYWA 1KTLB 3SKNA 1PQZB 1GGBL 1PX3A 2IH1B 4JREB 2ADFH 4AH2A 2ADGB 1X7QA 1HHGA 3W0WD 4LVHC 4P2YA 1RUML 2B2XL 3HMWL 3SDDC 2EXWC 2Q76A 5DJCA 3WXVL 3BH9B 2AQ2A 5C2UB 2GK2A 5GGUB 5GGQH 2OP4H 2YUVA 4YH6A 4KMTH 1OAXH 3ZTNL 4HULB 3L5WA 2QJDA 4D0DB 2J7LA 4H1LA 5DA0B 5CEZD 5HDQH 1I3GL 5HYEA 1FH5L 2CO6B 5EN2A 1A1NB 1EV2E 1NEUA 4QF1B 5I9QB 1EX0A 5LKNA 3OKLA 1EHNA 2HWZH 4R7NA 5JDJA 4Y8DC 2FLRT 1AD9A 3RVVC 4GRWH 4WHCA 3CLFH 4GO6B 3IDXH 1UKTA 5ITFB 5EU3A 3PGCB 2LFGA 4D0BB 3KPQB 1ZVYA 3IETB 4S1QL 3MTRA 2GW5A 2H2SC 3BT2L 3SGDH 1X6LA 5TE4L 1I1AA 8FABB 3L3JB 5E5RB 4LU5H 3SN6N 1UCBL 3DURB 4L8CA 3DHMA 5EOCJ 1NGQH 4MWFA 1AGDB 2KZ1B 3QUYC 3EJJX 3S5LA 3I6GA 4ELMF 4N0YL 4ODSL 3SKJH 2WIIA 3JTSB 3E8UL 4WEMB 3MLVL 1KB5L 3RDTD 2ZUVA 1WCBB 2NY0B 1ZS8A 3BP6A 1SJEA 5L2KE 1D5BA 5F9JA 1CI5A 3FO0H 2F54B 4ZUTB 1DANU 5IB4B 1KUMA 1GZPA 4EI5D 1EO5A 1W72L 4XBEH 1NC2D 2G9HB 3ARQA 3B43A 3VJ6A 3OG6B 1KC5H 2VABA 1CGVA 4BUGA 1IT9L 5IIEA 4Z78B 1T2JA 4W70A 4XNYH 5EUOF 2HT3C 5ALBL 4OZIE 2Q8BH 3P40A 5K9QG 1Q9KB 4UIKH 1QSEE 5C07E 3E6HB 4P9HC 4M7LL 4WEBL 1YC7A 1F90L 5F88A 3VWKB 4K94C 4LK4A 1A14L 3VXPA 5L2JB 1JYVA 2FGWL 2RJMA 4OCRL 5F7WC 5BS0A 4YPGB 1T7YA 3O8XC 5D96B 4NQDE 2F9BT 2VDPH 1ZHLA 3FN0L 2C4FU 1LVEA 4Y88A 3V9FA 1LK2B 3GI8H 4JG1H 4Y5YA 5DYOB 1EBPA 1HH6B 3SQOH 2R1XB 3HNSH 5DK2A 3SY0A 5SWZE 3RGVC 2W65B 2D7TL 1S9YB 3JWDH 4I0PC 3CZFB 3C2AH 1INQB 3KYAA 1NCNA 3O2WH 3NZHL 1MCEA 5D72L 1YEJL 2I5YL 1UCTA 4QXGH 1JIBA 1X5JA 2R23B 4M93C 4F8QA 2W9EL 3KPSE 4BYHA 1L7IH 3P30L 3QIBA 3VI4F 4NM8H 5GS2D 1A22B 5GRYA 1ACZA 3WFCH 3FB5B 1EEZA 2FATH 3U1SL 4FMKA 1JTTA 3WE6A 3DPBA 2HN7B 5FB8B 5HI4D 3WO3B 3O2VL 2DI7A 1S7VA 5DI8B 3HG1D 2ED8A 2HRLA 3DO7B 3S36L 1Q1JL 3MXWH 3OJDA 1FFRA 3HAEG 3VXME 5AG9A 3L3OB 4YIQB 4AL8H 3NIGE 1RUPH 15C8H 1BHGA 5ESVB 5I76A 4EI5B 3ULVF 3OB8A 3P9LA 1NC2B 4WNQB 4YHLH 4KGLA 4PJXA 4MJ2A 1D5IL 4H5SB 1NDMA 4MA3B 4CW1A 5A16B 4AENA 4Z5RB 4L3ED 4UILH 5JDSB 2CLVA 4TULL 4EVNB 5BVJA 4A6YL 3RTQC 5JZ7D 4JZNB 4RMTA 1IKNC 1RURH 3MGOA 3EDFA 5CIPH 2XN9D 3WJJA 4RZCB 5F3HA 4OB5H 3RL2A 2WWKT 4KI1A 5IVZA 3FFDA 4NKDA 4PJHB 4Z77A 5I8KH 1LEIB 3BP5B 1E27A 1WC7A 3EFDL 4LKXB 3ARGD 4IOIA 4LPXA 1U93A 2G75B 43C9B 4PS4L 1JZ4A 3QQ3A 3KPMA 1B2WH 5H94A 5F9OL 1EHAA 2JCCA 1NCWH 5JW4N 3TT1L 2DYPD 3GRWH 5TFSH 1OSPL 5EZIL 4UDTB 1ND0A 4PP2B 3CFEB 4M8VA 4W68A 4Y4HD 4Z7VE 3JUYA 1EGJL 1D6EB 4P4RB 1GVIA 2O61A 3FQXA 4IOSD 1T5XB 4JKPL 4HS8L 4GG6E 1OLZA 3GMMB 3THML 2J2ZA 3OTTA 4OD3H 3EO0A 2EYRB 1RSFA 4UUJB 2P45B 3HZYB 4FZEL 3CH1B 1MHHB 2WBJD 4PGJA 4B0MM 4ZODA 1MF2L 2F15A 1REIA 1ZOXA 3DYOA 4POZC 1FO0A 4NQCE 5T33L 2VH5L 1KJVA 3T2NH 3CK0H 4JRXE 3HG1B 4QHNB 1WFNA 5E5MA 4ERSH 3DVNA 4HK3J 4Y4KD 2VO5A 1F4WL 5FO9B 1RIUL 3P9MA 3WLWD 3IRZA 4FFYL 4LCIL 5K9KA 1I4FB 1KEGL 4PTTB 1CTNA 4JDVB 1S7WB 1YN7A 3IFPB 4Y1AD 4LSSL 2XQBH 3E3QC 4U6VL 5DS8B 4XAWL 5C0ND 1LO5B 4JO4H 2LV4A 4NRYA 4AEHH 4YBLC 4L3EB 4YK4C 3MBXL 4IRZL 2F53D 1P53A 4PJCE 2QR0B 4M43L 4JE4B 1VACB 4QHLA 4G9DA 2XN9B 1NBVL 4R4BA 3HN3A 3U9UB 4JZJA 2A73B 3DX9B 4LOUC 5DEFB 3BPNB 3HI5L 1KLUA 3ARGB 4LVOC 5IMMB 3EKCA 2ARWA 1ZHNB 2C1PB 2OTWA 3ARWA 3NN8A 3VXMA 1QOKA 1J86A 3ZE2E 3ZT6A 3TT3L 2X4PA 1J5OL 1U3ZA 4GQPH 2NXYC 1IAKB 3RGHA 4Y2DC 4DKEH 3PQYA 4F7MB 3UAJD 5F6HI 3LKSB 4K8RD 2DYPB 5D71H 3BMVA 2D4FA 4Z6AT 3HB3D 2XXMB 4OZFH 3NBNA 1F8TH 1PZ5A 1BMGA 3JV4A 2FECL 2R9HC 5FCUL 2GSIA 1LEGA 2FHCA 3T4AA 1XF4A 2L4OA 3BUYB 3L1OH 3ARDB 1EJOL 2E5EA 2EH7H 2OI9B 2EYTA 3UX9B 1RUQL 2ZPKL 4JY5L 3UMTA 2DJ4A 3FO9B 3IDNB 3DX8B 1K9TA 1RIVH 3QNZB 3AB0B 1Q0XH 1EH9A 2WBJB 2R2CA 2GTZB 3IDGA 3MV9E 1DL7H 2UZXB 2WNGA 4UTBL 3N85L 1T83C 4ZXBA 2D0GA 2P49B 4NCDA 3G9AB 3OBAA 4I48B 4MJIA 3SKOB 5IEHA 1DEEB 4TVPL 3VRIA 3PGDA 2GK0A 2AS5M 2Z91B 4TSAH 3LEXA 2PR4L 1MHEB 3PWLB 1W0VB 1MFDH 3UBXB 5GGVY 4B50A 4UV4L 3L6FB 4RQQB 5LVEA 4QRTB 2DWEA 4UNUA 4GG6A 5AZEH 4Y1AB 4ODVL 3TNNB 3NVQA 2N4IA 3D6GA 1ZT4A 4C56E 5JW4R 1LO3H 4FZ8L 4XVSH 4RRPA 2XNAB 4CU8A 1N3NA 3QHZH 4PY7B 2F53B 4P5TB 1FGNH 2QQLL 5C0BA 2BRRL 3GHBL 3R0MA 4OV5A 5FDWA 1FFQA 2WBWB 3LVEA 4HZAA 3D18A 4ONGL 4ZTPL 4Q97A 4OLUH 2HTLD 5T5NG 3O3DB 2R1WB 3NCCB 2J8UE 3P4OA 4NQCA 4O9HH 3RJQB 3H9SA 5IMKB 1HXMB 1Q9LB 1A6VH 4XNQA 4KXZH 5DLMH 1A4KB 4WY7L 2CQVA 4G9FA 3K74B 4HKZB 4PGDA 2DM2A 5KVEL 1U8NB 3QWQB 5DMYA 3T65B 4N1CA 3SDXB 1UB6B 1P9MA 4IRJD 5GPRA 1A6TB 4F33A 4P9MH 5GISH 4N9GA 1F11B 2H8PB 3UJTH 1SYSA 2CDEA 4YQXH 1MJ8H 2XZCL 3B9EA 4GUPB 1JNJA 4UT7L 5CJ8A 1J88A 4M62H 4LSDA 1N5AB 1JL8A 3WIFA 5ANME 1SBSL 2M8XA 1BFVH 3IXTB 2YA1A 5B38B 2VDNL 4G8GD 3RZCD 2FBJL 3DUSA 3LY6A 1GAFH 2NX5B 4X99A 1S8DA 1CWVA 1UJ3A 1MJUH 4JJ5B 3E2HB 4KVNL 1KXVC 4KZDH 3AXLA 2IADA 3GMPA 1FNLA 3MRQB 5IHZB 5DJ8B 4NSKB 1ITCA 1DBAH 2ICWI 4XCFL 2QHLA 3C6SA 3S36X 3MREB 1A7OL 4M6NH 5HGAA 3T0AA 1JF6A 5T1KA 2HFFA 4GRLA 2ZUQC 4Q6IB 5FGBC 5EOCL 3QP3A 3UZQA 1QKZH 5IJVA 5D7JB 4D0CA 2ENYA 2V7NB 3DHJA 2C1OA 1FNEB 4LDLB 1MWAH 3A67H 3O3EA 1XF3B 4JANA 4OF3A 4UAOC 1M05A 4JM2B 4QOKE 1AGEB 1G6RB 4WI6A 3WUWA 3VXOB 4OKDA 4R7DB 1G7LB 4R3SB 3MV8E 3MLXL 1XGTA 3S35L 4PJ9C 4HS3A 3WNOA 4RAVA 2OL3B 5HHXL 1JMXA 1TFHA 3OXSB 3DUUB 3MV9A 1C5BL 1QLRB 1I85C 4M7JH 1UFUA 1EGJA 3MFGB 5DMGC 1CR9L 2FJFA 7CGTA 4QRRD 4P57B 1JGDB 4PY8J 3WLBA 3RPKA 3H6JA 4HIXH 1HHIA 1YECL 4YZFF 3PJSB 1EFXA 1TZHB 4HJ0D 4P2QE 2FEEI 3TWCL 1N8ZA 2FYYA 5ESQB 3FONA 4P59L 2I07B 3GEWB 5GXBB 2A1WH 3ULUH 3HTLX 4EBQL 1RVFL 1CF8L 2XA8L 4IRJB 1IARB 1PG7H 2FO1A 4GRWE 2CJUH 1F3JB 1RHHA 5FXCH 4PV9A 4MNGB 4X5XA 5AUMA 5EOQH 1JMZA 1CLYH 3QIUB 4MD4B 5E8EB 1KNOB 5F7YC 3VFSB 2I9LA 3T0VA 3VXRE 5M95B 4LLDA 4WO4D 2DQCL 3K7UA 4G8GB 3RZCB 4OJFH 1XCQA 4ALAH 4JGJA 2A6JB 3BPLC 5C09E 1EZVX 4YJZL 4MNQE 5I1JH 4QRSA 1WUNT 4MSWA 1BZ7A 3W9DA 3ELAT 2BSTA 5AD0B 3SPVA 5DDHA 4TUJB 1VFBB 5MERB 1JN6A 1XF2A 3RIFK 1HDMA 3MR9A 1U0QA 3KJ6H 3IT8D 3TO4D 3HPLB 4BSVA 1AKJA 1FAIH 2IQ9H 5E9DE 3IDYC 1Z3GH 3MV11 4LCCB 3REVA 1AQKL 4JO3H 2HT4D 3MLTA 4DGYH 2I60H 3TC9A 1OTTD 4NQEE 5A3ID 1JZ8A 4AEEA 2DQEL 3CCHA 1BEYH 5HHVH 4OT1L 4J3XA 1FVCB 2FB4L 5DTFA 3SEPA 2YBRB 1RPQA 3HZVA 3BZ4A 5IB1B 5BXFB 5C0IA 1JPTL 1SQ2N 2XQYG 1A5FH 3DETC 2ZSVA 2D7OA 1RULL 2J88H 4GW4B 4QRRB 4GAGH 5F8RC 4X9BA 5C6PB 4LMQI 4FQPA 4KROC 4X98A 1YNKH 4YDJA 4FQHB 2ADJB 5FO7B 4QXWA 2F19H 4IRSC 1XGYL 3FB8A 4OZFG 5CJOL 5ERWA 2Q3AA 3BJLA 4HJGA 4C55A 3HCVA 1J1PH 4LCWD 5GRVL 5HSFA 4LQFH 2NW2A 5I19H 2HFGL 4HWBH 3BAEL 3KJ4C 1VHPA 5E1HB 1NKRA 5GS3A 3M17A 3MYJA 4YXHL 2A6KB 4GKNA 4WW1B 1NMAH 2HJFA 4PPTA 3HC4H 5DHVA 4FMFA 4AQOA 3INUH 1EERB 2YXFA 4FQCL 4M5ZL 1XGUA 3RY6C 5IFJB 3ISWA 4P2QA 1A6UH 2VZSA 4ODXB 2WINB 2NNAA 4Z76B 5J3HD 1C16A 1FRGH 2XYCA 4IIQB 5DD6A 2YA2A 4RAUA 3F12A 3K8MA 2VLRE 1WFTA 5I1AB 5DVOA 1JPSL 4YEEA 1M71A 3M8OL 4PLJC 4ZYKB 3G5VB 3G6AA 1A4JA 1QA9A 3GSQA 1I8IB 1P7KA 5L8JB 1FFPB 5ADOL 3IFNL 3QEHB 4XNXL 4HXBH 1Q0YH 2Y25A 2F74A 4HIHB 1ONQB 4MJ4A 4CDHA 4ZFGH 4F7EA 5C0GB 5C09A 4RDQG 5KAQF 4B41A 4M48L 1BJ1J 3C09B 4ZS7L 3PF2A 1ZXQA 3T3PF 1MELA 1CT8B 1XR8B 4B7IA 2X9WA 5D6CB 3P11L 1LD9A 1CU4L 2NZ9D 1TQBB 5EU5B 3BDYH 1GPOL 2EO9A 4JQXC 5C6WH 1MFAH 1XIWA 5E9DA 5IF0B 1KBGL 2AXFA 3BP4A 3C9NB 4X4YA 4G8EA 5IHUL 4XNMB 3RWGA 1I1AC 1JI1A 4NO3A 4JFPA 4MAYB 2VXTH 5TDPB 3N1FC 1ZA6B 4JFED 1YPZB 3QO0A 4DVBB 1DUZA 2P5WD 3FB6B 5HPMA 4FXKA 5C7XL 1NCUA 1I7ZB 4LARL 1HYSC 3FTGB 4HKXB 1PKOA 5KW9H 2BDNL 2H1PH 3F6LA 4KKAD 3UPRA 5C70A 5L8KB 4NNYB 4PYGA 5E95B 1X44A 4KJWC 5C71A 2PKDA 4UDUB 4UT9L 2YD1A 5ID0B 5HJ3A 1MEXL 3DX6A 2NY1D 5L9DH 4PG9B 5D2LB 2YPKA 1PKQE 4K8RH 1S7RA 4KI5C 1IBGH 1CS6A 4Q9QH 1VGKB 3LMJH 5CCKL 2BMKB 3OR6B 1ORQB 3W2DL 1BX2A 4LBEB 3IU3B 4EUPB 3ROLB 1OY3B 1F42A 1IEBB 3H7BA 1AI1L 1DLFL 1G9NH 1ZT7A 2VDLL 5GRJH 5DZLA 1N5YL 1WCQA 5GS0C 4N1EA 4M1DH 1WZ1L 1U8LB 4XRCA 3TIDA 4WFFD 3BHBA 4XZUA 2IBZY 3PIQA 3S35X 2GITA 5D1ZC 1CLZH 1C8PA 5HHQB 4HCRH 4JFFE 1S7XA 4EXKA 1F45A 1A7RH 4S11A 4XAKD 5CMAA 1CL7I 4OQTL 1CFBA 4JHAH 3ZL4L 5DMKB 1AHWB 1IKFL 1FL3B 3F62A 2AXHA 1ZGLM 1IC5H 2RR3A 4RFNC 3WNMA 4ENEC 3MRPA 1X5XA 1YMME 3MFFA 2YPVL 1V5JA 3CX5J 1ZSDB 2HVJA 2VLRA 2CLRB 1C5CL 3QG7H 2G60L 4WDIA 3ARUA 4WUUE 3UTSE 5IT2H 3WFHB 1U8QA 3CSYB 4F7PB 2QADC 5DQJA 4PGEB 3QXDB 4MQ7B 5B8CC 5EZLA 5DD3H 3RWFA 3X3FL 3K46A 5JW5B 2OL3H 5IG7B 1SY6H 4JFEB 1J0ZA 1IC1A 1B0GB 1BBDL 2P5WB 5ILTL 2KQNA 4OM1L 1KCLA 3T08A 3MRKA 1TPXC 4OFPA 5IJKA 4HWEL 1KTDB 3RA7L 4C57C 3S3SA 4ZUSA 3PABA 1ZT1B 1NSNH 1FHGA 4PJBF 3D0VA 3TBYA 2FH6A 4OFDA 5DFVD 2NY4C 4GW5A 5FHAH 2Y6SD 3B5TA 3V5KA 3ES6A 5DD0H 3NCMA 2XKSA 4PTUA 1HHHB 2NY1B 4JFYB 5J12C 1AJ7L 1MOEA 4LEOB 4F80A 2A74A 3C8KB 5FM8A 1K8IA 4MDIA 2OLDA 4HFUH 3JV0A 5DR5L 5HD8C 5SWSD 2IFFH 4X6CF 3UYRL 1CICC 3WJJC 4JRYA 3VD7A 2VL5B 1ZTXH 4WGVB 5DMIL 1FZJA 2B4CL 3JXAA 1CFQA 5TE6H 1X9QA 2UYLA 2KBGA 3O3UN 4R9HA 1MCKA 4ODUB 3LZFL 4U1SB 3L3HB 1NLDH 1P84K 3MJ8B 1CDHA 2CRYA 1RZGA 2XY1A 3DI2B 3QFJD 1MJ7H 1RK0A 4X80H 5GZOC 3NPSC 1LO0L 1LP9A 5DJXB 5IW6B 1JGVL 5TDNA 2FWOB 1N59A 3T77A 1X6NA 3O41B 3LQZA 25C8H 4NQSA 4OLYH 2VXVL 2F54E 3WJLA 1QFHA 3UZVB 2YPLD 1JWMA 1NMCB 4QHUA 5F1SA 3MMEA 1U8PA 3MGTB 1UM4L 1RZFL 3ZE1E 1TVDA 4J4PA 1PAMA 5MI0C 2CIKA 4M3KB 3S96B 3EGSA 4P3DB 3TBTB 1NGYA 4R8WH 5E94A 3VXUD 4ZTOL 1I9IH 1YEKH 3PNWB 5KVFL 2RFXB 2R69H 4WI3A 1KIPA 2R2BA 3V4VH 4N8PA 5EBLA 3A6BH 2YZ8A 1INDL 3PWPD 5J9PA 1F4AA 2VL4A 1ZEAL 1Q94B 3Q5YA 1D9KD 5E2UH 1OGAA 1EEUA 4QY8B 4XPFH 3CX5K 5HHOD 3MBEC 1A0QH 4QYOB 5FOBA 1P4IH 5CEZE 1GZQB 3DIFA 3HLAB 3N0PB 3D87B 3FFCD 5I1EH 1RZ8B 4BUHA 2MHAB 3MRJB 1U3JA 3QEUA 1IM9A 1MFNA 5F44A 5CD3A 5CGYC 2VXUH 2WUCH 4U4BA 1K8DB 4OZHA 3BZFA 2HLAB 4R4FH 5ACLA 1PY9A 3SGJA 4HKBA 3QO1A 3U36A 2FDBP 1WIUA 4G8IA 5SWSB 1QFPA 1FG9C 4QRQA 4JO1H 5DK0B 2VDRL 5EULV 1IGTB 3BZDA 3QAZB 2DQGH 1FGVH 4OUOA 3IAQA 1OLLA 2GI7A 4Q2ZB 3B4NA 4KRMB 3GO1H 1T66D 1AH1A 3MCLH 2Q6WA 1KN2L 2VZTA 4WWKA 3U4EA 2UUDH 3DVIA 1VPOH 3CUPA 3OQ3B 3B83A 3TCLB 4DN3L 4G6AD 5LQBL 3CLEL 3MCG1 3QFJB 4X9HA 4ELMB 5DEGB 3P0YH 4XPHH 3B9KD 3JTTB 4NJAL 1CE6A 1WEJL 3HZMA 1NCDH 5I8OL 1D7FA 1C1EL 5DRNB 4F57H 4I77L 5DUBA 4I4WA 2YPLB 3ULVD 1FZOA 2W60B 3GI9H 3GJFA 1XAUA 1BOGB 1T89C 5E4EC 3V0WL 3HMXH 2DLIA 5EUOB 4DN4H 5ESAB 3VXUB 4EZMA 4ZPTB 5JR1L 2R56H 4XBPA 5HYJA 2G5BA 5FGCB 3BW9A 1PG7W 3PWPB 2HJKA 2OTUB 1OD7A 4ZXBC 1D9KB 1CLOL 1YEEH 5EORL 1L7TH 5HHOB 4OBSA 4NP4L 4W81A 2XT1B 4NO5B 4TN9A 1ZWIA 1CLCA 5F6IB 4QGTA 1YJDH 3JV6B 3DSNA 1BZ9A 1Y18A 3FFCB 1NCAL 3HZKB 5D70L 5JOFA 1ED3B 1HWHB 1CGSL 3VFMB 1H3TA 4U1MA 1CXFA 1NCCH 4C54A 3H9HA 3FO1B 3OGOE 2BOBA 5KANG 4OQTA 1S7UB 2H32H 5AAWA 3VRLE 3F7YB 5JNYB 4FG6C 2UUDK 4OCMC 3UTOA 4WFEE 4ETQB 2AJVL 5A2IH 2ZOLA 1A64A 2F5AH 3BESR 3RX7A 1IAIH 2X4NB 4PJXF 1LE5B 3KGRA 3Q1SL 1QRNA 3H42L 3RVVD 3O9WA 3F5WB 4AIZA 1S7SB 3D1MC 3IS0X 4G80A 2WZPD 1X4YA 2IH3B 3CFBA 3LKQB 3FO2A 3B9KB 4TSCL 3V0VA 1IGJA 2DKSA 3IDMB 3O6KH 3HG1E 4XCNB 2X4SB 1U8MA 2H2SD 4XMLL 2EDBA 5L6YL 3SO5A 4M7ZB 3MROA 2AEWA 2YC1B 4BZ2H 1HN1A 1I1FA 4EUPH 1LE9B 1FZMB 2Y4SA 1KPRB 4ZSOB 4OQ1A 5DRWA 3GGWB 4WHTB 2AABH 3RY5A 1RJCA 3QUYD 3V2AR 4ELKA 1MFEH 4D3CH 5C0FB 5DT1H 2JCCF 2NXZD 3IGAA 4U31A 5DVNA 2XN9E 3MODH 5BZDB 5FDYA 1MRFH 1ZHKA 4CADA 2QKIA 4JN1H 5F7DA 2FNBA 1MLBB 4U49A 2VLLA 2MJWA 3RNQB 3OAUH 5D9SB 3ILPA 4JCMA 3OKEA 4I18B 5CUSH 1G7HB 3B2UC 1FSKC 4LSRH 5CEYA 4GRLC 4OLWL 2P8PB 1J1XL 3DJ9A 4XPTH 1BVLA 3MOBL 2HT3D 5K59F 4P2OB 1WAAE 1C5DB 2ITDB 4LLMA 3QQ9C 1O0VA 3K2UL 5F9WC 5FUCE 3FOLB 3FQTA 5HVFB 1MRDL 1AE6L 3H0TA 1VADA 3PGFL 4YBQD 1OAUH 4OIBA 2W0PA 1TJIL 1Q9OB 2H6PB 3VFWA 1D5XB 3T8XB 3IDIA 3WO4B 3QCVL 3BP7B 5IR1A 1NAMA 4CJ0A 2VAAA 5E8PA 4LRNL 3SDAD 4GW1A 3O8XD 1CXLA 1DE4B 1QR4A 5GS1C 3CVHA 2PXYB 2V5RA 1F13A 3DTXB 1UB5A 4JKLA 5I1HH 2WW8A 3LPWA 3BEWA 1MAKA 4X83A 3RP1A 1DBBL 1G6RL 3LH2H 3RGVD 4YHML 2YR3A 1MIEH 1OSZB 4I0PD 3OF6A 3UTPD 4DWHA 3MRBA 4KVCH 1IEHA 1QSFA 2C3VB 4QWWD 2FHFA 3LKNB 3CDFA 3WDIA 1Z9SA 2AEPH 4Q9CA 1Q9WA 2GFBB 2JELH 5F9AC 2FSEA 3MLZL 4FABH 4NZDA 1EMTL 4PB9H 3BKYH 4PP2A 3X11B 4G43A 3G6DH 4FQXA 4FFVC 4PRBB 1TETH 4U6TA 3VCLA 3BPOB 5J1AA 2UY7A 5TDOA 5DZOA 3NCYS 3W82A 2WP3T 3O3AB 4MHHG 5GIRA 3FZUC 2DJSA 1UH4A 4BFIA 3QUYB 1KENH 2DLHA 3NFNA 5L8LB 2F53E 1AIFA 1CE1L 1QNZH 2NXZB 3UC0L 3V6FB 4N0UE 1P1ZA 3ILQD 5MEND 1AY1L 3VG9B 1EZVY 4DGIL 2CKBH 3STLB 3K1KC 4XP5H 4I0CC 5ACMA 5TPWH 1GGIL 2ZCKH 2ZUSA 4OLXL 3ZKXB 2BXZA 4N0CC 2V5MA 4HKJA 1UZ8A 3DXAD 3TNMB 1AXIB 1T21A 1IL1B 2ATKA 5E03A 3Q2CA 2BCKB 3SDXE 1VFUA 2VZOA 2HKHL 5DO2C 4MCZB 3BKCL 2P24B 3VA6A 3JBG7 3QUMB 1JZ3A 1FORL 5FYJL 3TM6A 2AGJH 4YDVA 4LCUB 4HK3N 3WFEL 1S5IL 3C60A 2VC2H 4HQQL 4DAGH 3L5XH 4P3CL 4KTDL 3SDAB 4ZMAT 3QQ4B 4BQ6A 5IHBA 2CGRH 5ISZD 5CILL 2Z9TA 5DEZA 3L3KB 4O2FA 2NZIA 5D2NA 5FF6B 4OGAC 1QVOB 2NX5E 1FE8H 3ECBA 1A6WL 1K5NB 3MV7B 3SGEI 4FQLL 3B9DA 3G6JE 3O6FA 3RGVB 4CMMB 5T3XL 4WU7B 4ONFH 5FKAA 2VDQL 3OXRB 3FT3A 4ORZC 5J13B 2EDEA 5GSRB 3OJVC 2FBOJ 4CVUA 4UU9A 2V17L 2FR4A 3WMSA 3QG6A 3S9DB 3I75B 1L9MA 4LASL 4R96A 4WI2A 4TOYH 2NY5L 3GB7A 3O4OB 5I75C 5IWLA 5DVLA 2X1PA 1URLA 2R1YA 1KB9K 4O58L 4OAWB 1EFQA 4OLZL 4POZD 4R0LB 5C08D 5HBBA 4GAJH 3MLRL 1SJXA 3SQBA 3HE6D 4X7TB 4YFLF 5MENB 2XZZA 1AXTH 2DQJH 3DX7A 4M9OA 2BY3A 2R2EB 2WSKA 3BWAA 1KF9B 3C5SB 1I8LA 4EXPX 3MRCB 5KSVB 1CXKA 2EIDA 4P0DA 2R4RL 1CGYA 4NOFA 3DXAB 4LCYA 1ZV5A 3ALPA 2W9LA 1TJHH 2HKFL 4LL9A 4KK8C 4LKCB 1DQJA 12E8L 4JB9H 4YGVB 3GBLA 4PUBH 3WIIL 1T1WB 1JV5A 5BV7H 2HVKB 4MNGE 1RZKH 4LOUD 3PV7A 2HMIC 1A2YA 1R3KB 1TJGL 1MQKH 3MLSL 2D7NA 2IQAB 4N0UA 4QXTA 3C08H 4QEGA 4YFLI 4XH2A 4H20L 1HSBA 2EDNA 5ISZB 2ZUYA 5BZWA 2IG2L 3WIHH 1AO7D 2EZ0C 4JPIB 4Y2DD 5DHXB 1XGRB 1U95A 1HH9B 5DUPH 3U0TB 4HUUB 2NCMA 1AGCA 2PYEA 1CD9B 1XIWC 3CC5B 4WTXA 3VFGL 1H5BA 1UM6L 1K4DB 2R9HD 4PJFE 1J8HD 3QNYB 5CP3A 4XCCL 5BMFH 4X8JA 3FB7A 3RPIA 3VWJA 4K71B 4MDJB 4XWOC 4HUVB 1WBYA 5E8OB 4K7PL 1F11A 5GGTA 2VXQH 1EAPB 5DVKA 3EZJB 2BHYA 2ZKHL 4P23C 5D93C 5JXEA 4JN2B 3MUHL 4RMWA 3QHTC 5J11C 2O5XH 4J23A 4OUUA 4HMEA 3QCTH 4LRIC 1DBJH 2Y36H 1D5ZB 3CX2A 5JXAH 4J3TA 1YEIH 1DSFH 4FQJL 3QWRA 4NKIL 3HE6B 5KSAA 2Z0BA 3G6JA 3REWA 2Q87A 5JUEL 3BZEB 2AKRB 5HDLA 4QRRE 3BSZH 3GHEL 3QIWA 1FLRL 3NIFF 2BNUB 5L7XL 4Z9KB 3R06B 5CJQL 3P0VL 1V7NL 1OGTA 5TF1L 1KN4L 2WQ8A 4DK3A 4EDXA 4YK4B 3LDBB 5CP7B 2FH8A 4LSVH 4UOW1 4Y19D 3QJFA 2LU7A 2QSCL 2I9TB 2YA0A 2RB8A 2MQCA 4X6FB 5TE7H 4L8SA 4UB0H 2GTWA 4FXGB 3QH3B 1FNGB 3I6LD 1HWGB 1RV6X 2BERA 4RFEB 4K3DH 2D7QA 4YHYC 3LD8C 2H3NA 3L5IA 4LVOB 4NKMA 4TNVF 1HHJB 1YDPB 3JSSA 3MUGB 1HQRB 3BN3B 5K9JH 3O2DH 4JY6A 4U6HB 5E6YA 1U8KA 1FNSH 4EOWL 5EIQA 4WWID 2BNRA 3LQMA 1AO7B 2BJMH 2CK2A 4Y2DB 4YO0B 5BVPH 5DFWH 3QJHA 3GSRA 4OGXL 5CBEB 1KCUL 3TF7C 1JNNL 2ZNWA 1OAXL 2H26A 2OX5A 5E99H 4P2RA 2DMKA 5LJYH 4NHCL 1KXTB 4GAFB 3IAPA 5C0CB 2X41A 3FT2A 4UIMA 3QPQC 2Z93A 1NGXA 2YMXH 1JYNA 1R5IA 1Z6JT 2RBLA 5KVGH 1MHPH 4G7VH 5GJSH 5ICYB 5CSZA 3W9EA 1G7MA 4DVRH 2P42B 4IOFC 1ZLWH 4YX2L 3EO1A 5E70A 1EPFA 2JIXD 3UZEA 4LHUG 1IE5A 5KOMC 3RVWD 4EDWL 2UV3A 2EE3A 2V2TB 4JDTH 3O45B 2A9MH 4F37K 3CFJB 1GGTA 4X0KA 3FT4A 2MQ3A 3CXDL 2FO4A 2IPTL 3FRPG 2XZQH 4PJFA 4YR6A 1ZA3B 1BFSA 4E5XA 4YNYB 1NBZA 4RFOH 4FFZH 2V6HA 3T0EE 4IMLB 2VUOA 5IB2A 3WV0A 5BRZB 4QXUL 4Y19B 2Z4QB 4PGCB 4PJ9D 1KIUA 4HUWB 1K4CA 5DRXB 4U1LB 3DSFL 4P5MB 3B9AA 5DMGD 2BRQA 3PWUA 1EHLH 5TH2A 4JPWL 1QPPA 1YPZE 2F58L 2XZAH 3I3BA 5DGQA 3DECA 3CFKB 2AQ3A 2O5YL 4XGZB 3VGDA 3NMEA 4X7SH 5HHPB 5EIIA 1ZVSA 3QB7C 1BD2D 5IK3A 1OAYL 3GBNL 4DZBA 4DCQB 2G2RA 1A3RH 4JDZA 5JORA 2A77H 5IKCA 1GRWA 2PW2A 3LRSB 4P9HH 1KCRL 1KIRB 1T0PB 2FJGB 5GGSY 4HGWB 4K94H 4LLUB 1ZLWK 3JVGC 3GJEA 2ORBL 4JFQA 4U1GC 4EIGB 2BVYA 1U8JA 4KGJA 4BFBD 4ZPVB 5IMOA 1LDPL 2AJSH 4RGND 3NACL 2JIXB 5KZCD 1CG9B 2DDQH 3PP4H 1QYGL 5CZXC 5DURD 5JO5B 3HNVL 3JUZA 1G7QA 1JPGB 2DKMA 3U79A 4MD5A 3QUXD 5JPNB 3MNZA 4D94A 3SDCD 3HAEA 2J12B 1F6AA 1HIML 4LLQA 1QBAA 5AWNL 3GMOB 4WI8A 3RRQA 3UTQA 4UAOB 1T4KB 3UROR 1S3KH 3V4UL 2GUOB 3P3YA 2HG5A 4XP4H 1OF2A 3KLDA 5FAAA 5D1XB 3V6OA 5A2JH 2X89A 4PJ9B 4RGMC 4EEEA 4DTGH 1I8IA 1GC1L 4Z7QE 5EC2B 3U6RB 4GOSA 3EYUL 3BGMB 4KK6C 3NFPB 4JFEE 4K9EL 4F7CA 4F3FA 2P5WE 2VXSL 4OI7A 4M6ML 1E4XH 1QACA 5I9QC 4IRSD 4MQXD 5JW3H 2BVPB 4OB5L 3ARSA 4ZFZB 4JJHA 4HPOH 3FRUA 4HLJA 3MACL 1BD2B 4F58L 2P8LA 2IWGA 1FNFA 3D5OF 3T0EA 5EO1A 4U6XB 4L4TD 1SMOA 1J12A 1I9RH 1P6AB 4LSQL 4JRWA 4BA8A 4JKMA 2WWKO 1I9JH 5GRZA 1KT2A 5HGBB 4K7PX 4ONHA 3IFOA 3MO1B 3PL6D 5EOTB 2DQFA 3TH4T 3ZZ1A 5MHSD 4NJ9L 3FQRA 4FNLH 2DMCA 2PW1A 4JY4B 2R0WL 3BPLB 4RGNB 1GGYA 2DLGA 1WWCA 3MRMB 1ACYL 5DURB 4HKXA 5SWQB 2RCSL 4WFFE 1OAKL 3KDMA 2X9XA 5KVDH 3QUXB 2F8VA 1WZKA 5C0DA 3SDCB 4XAKE 2NW3B 1L0QA 4PLJD 2P8MA 3OAZH 1M6OB 3IDYB 3GSXB 3I50H 3QZWG 5D1QA 3VA2C 2OTPA 5E1AA 3IU4H 5D7KE 2BVOB 1LMKA 5E2TH 4HXAL 2VE6B 4WIQA 3VWKC 3EW3B 4JAMA 5LGHH 2VAJA 2O26U 3RVTC 5IB3B 4AEIH 3IS1X 1HOCB 4XHJD 5TGBA 4CVXB 4AT6A 5E08H 4ZUWB 1CDIA 3C5JA 2XQBL 3O9WC 5D96C 5FYKD 2HH0H 2X40A 3JWOL 4LHJB 5DJ2B 5EBMB 3V0AC 1S9XA 35C8L 4IRSB 3ZHDA 5B3JF 2DQDH 3IDJA 4PJBB 1YYML 1A1MA 3F6IA 4MLSA 1E0OB 1U58A 5DD5L 1I1AD 5EBGA 4QT5A 1YEGL 2Z35A 3BJ91 4L4TB 1HINH 2XPGB 2D03L 2B1HL 4NQVB 4NZRL 3TP4A 1I1YA 2OSLA 5JA9A 4BQCA 3D85A 1LP9F 3KXFD 4EI6A 3GSVA 2GAZA 4ZOBA 3PL6B 1HYSD 4R26H 1MCWM 4OCNC 1FIGH 1T0MB 4X4XA 5GJTH 1P69B 3ME0A 1L0XA 2E7HA 3U7WH 1N0XH 4P5KA 3DGGA 3X3GL 2ZSWB 3L1OL 3E6FA 5LXGH 3TN0A 1AQDB 3ULVL 4PREA 1R5VA 3VGAB 2EH7L 4J3SA 1IFHL 1PYWB 3OAZK 4KI5D 5J6HA 1T7VA 3SKNB 3MOAH 5FUOL 1YQVL 3QFJE 4ELME 2Y5EA 4AH2B 1X7QB 4M6OL 5IB5A 1HHGB 1FLTX 4RX4A 3CJJA 1DL7L 4KRNA 5ALCH 2Q76B 5DJCB 4PJ5A 5C0RL 4OI8A 3BYTA 4PJAA 2DQUH 5BS0D 4LAQH 4OIAA 2YPLE 3EO9H 1MH5A 1YYLL 5GS0D 3L5WB 1D5MA 4H1LB 3QDMA 3WSQH 1Z9LA 5EUOE 1M7IA 4HK0A 1MFDL 5EN2B 5FYKU 5MP6H 3VXUE 2Y5TA 3OKLB 4R7NB 4JM4L 4NQTA 5FGCE 4KH2A 2MOVA 1BGXL 4OCWL 1AD9B 4NWUL 1I3UA 4ENED 3OKKA 3PWPE 4OZHF 3SE9H 3FCTA 2WBKA 5EU3B 2EDJA 3RAJH 1DR9A 1XEDA 4U1IA 1JBJA 3MJ9H 5J06A 1EAJA 5HHOE 2QEJA 5I66A 1FAKT 3G04A 2ZG1A 2A0LD 4KJQC 4FQXC 1CVSC 3QBTB 4YXKH 1CD1A 2QADD 1I1AB 3FFCE 3LPGA 5ITBH 4LEXL 4BJLA 2AQ1A 2VDOH 3BFOA 4O9HL 3T4YA 5JOPD 2R0ZH 1DQDH 4L8CB 1T1XA 3MJ7A 4MWFB 1Q72H 5DLML 4OI9A 4M7LT 2ZJSH 4ODWA 2YXMA 4NNPH 3I6GB 3S5LB 3VGGA 1H3VA 1PLGL 2WIIB 5IM7A 1CK0H 1I7UA 3NOIA 4LPUA 5IESH 4ORGA 3WL9A 1ZS8B 3BP6B 1SJEB 1D5BB 5F9JB 1SVZA 4B7LA 5FO8A 3KPPA 4FQIH 2NY4D 3U0WH 1GZPB 5IBTH 3M07A 3MC0A 4M7KL 5AYUH 4QY8A 3VFRA 3VI4E 1YNTA 3VJ6B 4D9LL 2VABB 2FX7L 3QUZA 4GMTL 5IIEB 4X4ZA 4W4OA 3VD5A 5I17A 1FCGA 4HSQA 1XT5A 3AAZA 5HD8D 5LWYH 1IGML 1KYOJ 2JJWA 4HC1H 4PBXA 1XZ0A 5F88B 4HG4K 4LLWA 2AEQH 3VXPB 4M00A 5BS0B 5CIPA 3ULVE 5CS7A 3C60C 4ZSOE 2ICEA 4NC1E 1ZHLB 4P46A 5DA4A 4YDIL 5D2NC 2DKUA 2QQKH 4OTXH 1MWAL 2MPAL 4Y5YB 2DWDA 3ZE1F 5DK2B 4OLEA 3SY0B 4RFNB 3NTCH 2COQA 5E6ZA 5E2VL 1U6AH 3QUML 5I1LA 3G5ZA 4JPKH 3ZKSD 1UWGL 3L9RA 2IMNA 2QADB 3QIBB 4OGZA 4DKDC 4DKFL 3ARDC 2J4WL 3PDOA 1M7DA 1EEZB 4MVBC 3WE6B 4TQEH 3GNMH 1S7VB 1PG7L 2A9NH 3CXHK 3OJDB 5CAYB 1BJ8A 3GFUA 5ID1A 2NY4B 2JJUA 4PR5A 3CZJA 5I76B 2L7JA 5FUZH 4KAQH 3P9LB 2AAVA 1A7NL 5DMJB 1FL6A 4PJXB 1B90A 3MA9L 5CGYD 2KUTA 2GCYA 5J12B 2NQCA 1AFVH 3BDBA 1CL7H 1DN2A 1NDMB 4CW1B 5HHMB 2D3VA 4AENB 3P4MA 2CLVB 5I18H 3JV6A 3LEVL 3C5ZA 2BNQA 3OKDA 3DLQR 3MGOB 1SYVA 3Q6GL 5F7FA 3WN5A 3GMNA 5F3HB 3RL2B 3B3IA 4X7FC 5IVZB 4TUKH 3RWCA 3FFDB 4NKDB 3UO1L 4Z77B 1PDKA 3MRNA 1PZUB 4Z8FH 1E27B 1WC7B 4DGVH 4P5TC 1WT5A 1N7ML 4IOIB 4JZOA 2Z8VC 3HFMH 1LK3H 1U93B 1DFBH 3GSNH 5E6IA 3BKJH 3VXMD 3QQ3B 3KPMB 2OK0H 5SX5H 1CD0A 3B5HA 4RA3A 4JO3L 3QISA 5H94B 3PQYD 2ATPA 2JCCB 2O93L 4N0RA 1UA6H 4H26A 2YSSA 1ND0B 3QQNA 4DFHA 1KELH 2O61B 3FQXB 1EIBA 3VWJC 1MJJA 4U6YB 3UAJC 1MFCH 4OZFA 4L9LA 5CFHA 5MI0B 1A5FL 5GRWA 2EDFA 1P7HL 3EO0B 3QEGL 2YC1A 3B5GA 3RWJA 2Q7NA 4MJ6A 5HTSA 2EC8A 1IAOA 2UZIL 3VGEA 1YNKL 1MAML 5JQHC 2OBGA 4ZXBD 4WHTA 4TTGA 3LN4A 3PWNA 1FO0B 4MJID 4KKNA 1KJVB 5ADPH 3SOBH 4YDLC 5I19L 2Z31A 1OM3L 1WFOA 3H3PL 5E5MB 4I9WD 4OM0H 3OZ9L 3DVNB 3E2HC 3VFNB 4OV6F 4FS0A 4I3SL 3P9MB 4PRDA 1RU9L 3MQIA 1B0RA 3TCXA 5K9KB 3QIWC 4XPGL 1K6QH 3NFSH 1YN7B 1I8MA 3VXNA 1ITBB 3U9PL 3MV7E 4NRYB 1T03H 3EDJA 5D7JC 4KHXL 5FM5M 1R0AL 4NO0A 2R4SH 4QO1A 3UTPE 4L5FL 4QHLB 2YN5A 4G9DB 4HMCA 1NH6A 4R4BB 3ARVA 4JM2C 4JZJB 5J57B 3QEQA 4PY8I 4PFEA 2VOTA 1GIGL 4YFEA 5SX5K 2IBGA 4NQCD 1CXIA 2GQHA 4KDTC 1KLUB 4PRIA 2HTKD 2ZOKA 3H9SD 2ID5A 1AR2A 2OTWB 1F4YH 1P4LA 3TIEA 4Y5XA 3NN8B 3VXMB 4G9FD 5BW7A 2X4PB 3UDWA 5GGRY 3PQYB 1BOYA 4IMKC 1RHFA 2QQQA 3QXAA 3JV4B 1PZ5B 1PSKH 3JV5A 5H37H 4G3YL 5CBAA 2BXYA 5MENE 1A7PL 4Y5VA 1IGCL 1RJLA 4NZTL 4XVTL 2Z92A 4YC2B 5IVXA 2GSIB 1LEGB 3T4AB 1XF4B 1V7ML 2ZWLT 4O5LH 1UACL 4IRJC 5A2FA 2EYTB 3W0WA 2C4XA 5E4EB 4U3XA 1HEZA 2YOCA 2EH8L 3DXAE 3QIUC 4H1LH 4KUCF 1J9CT 1QEWA 2W38A 3ARRA 3IDGB 1ZLUH 3WNPA 4ZD3L 3BDYL 4BZ1H 1MFBH 4ZXBB 2VR9A 4G6FD 4MJIB 5IEHB 3L3IA 1JGLH 1BWWA 1DQLH 4QTIH 3PGDB 2GK0B 3VRIB 3B2UD 5T1KD 3ORJA 2M26A 2VXTL 4GRLD 2DI9A 4FFWC 3LEXB 5GGVL 3S37L 5ISZE 5CGMA 4MXWH 2AW2A 5K93A 3QQ9D 2BC4A 4XP1L 2DWEB 4M6AA 2DQHH 4EQ2A 1ZT4B 1DDHA 1N3NB 1U91A 3B2VL 1E6OL 4DW2L 1RIHL 1MWAA 5C0BB 1U8OA 4UV7L 4F8TA 3K4AA 4IHOA 4JQVA 4OV5B 5FDWB 3MV9D 3D18B 3UJJL 1QFWL 4W4NA 1U8IA 1UADC 1IBGL 3P4OB 3QUMA 5DJ6A 2Y9RT 2F8OA 3ZO0A 4DQOH 1QLEH 1TIUA 3H9SB 1EFXD 4RA0C 3RDTA 4XNQB 1NEZG 5F7LB 4HF5L 3GKZA 1EBAA 4G9FB 4PGDB 3HS0A 2DLFL 1TXKA 3W5NA 4YHOH 1G9NL 2LU4A 5LGJA 4F33B 2LAGB 2NY5C 4N9GB 1NAKL 4HJ0C 5I1GH 1A02N 1SYSB 2CDEB 3VMOA 4S10A 2XKUA 4S1SH 4UQ3A 1JFQL 3G5XA 2E8YA 4M5YL 1GJIA 4UMGA 4YZFE 3WIFB 1ZLUK 4WRLA 1JK8A 3FZUD 5FOJA 5GS0H 1W0WA 3DUSB 3K8LA 4CN6A 1T1YA 3RBGA 4W6XB 4X99B 1S8DB 3BE1L 1UJ3B 1IVLA 3AXLB 2IADB 3GMPB 1T04A 1LEKA 4G6FB 1NBYA 3UBXI 3C6SB 1PG7X 2DTSA 1LO2L 5HGAB 5T1KB 2HFFB 4K7FA 4GRLB 2AJYH 1OWRM 3FMGL 4N0CD 3TVMA 5IJVB 1AKJD 4NN7B 4D0CB 2MTPA 1BWMA 1EA9C 4OSUH 2C1OB 2RAMA 1AO7E 2BSSA 4U0RB 2HRPH 4L8DA 3O3EB 4JANB 4GBXA 1FYTA 1M05B 4J6RL 3WUWB 4HBQA 5DO2D 3IJYA 3ESUF 1NSNL 4G5ZL 1XGTB 2R0KL 4HS3B 5EFIA 4RAVB 4TSBL 2APBA 1E4WL 5EWIL 5C0CE 3MV9B 5A3IC 1BAFH 2XTLA 2PTTA 3G6JF 2FJFB 3I2CH 4U1HA 3IKCA 3WLBB 1MI5A 1HHIB 5F96L 3VXSA 1EFXB 3EDKA 4OGAD 4JVWA 3MRIA 3RWEA 1A9BA 2MFNA 4WJ5B 1WBZA 5BO1L 1N8ZB 2FYYB 3FONB 4JHZA 3L5JA 2BZDA 1QBMH 4K3EH 3WKML 1JGUL 5IFAL 3X17A 5TE6L 3IJHA 2YK1H 2UZYB 4QOKD 3PXHA 1TQBC 3T0EC 1N4XH 1RHHB 3M1BA 4PV9B 4W6WB 4X5XB 5AUMB 3WXWL 3CC5A 4NFCA 4TVPD 4HWBA 4FQQA 2XICA 5B4MC 4X80L 1R3IL 2I9LB 4MAYC 4LLDB 3BIKA 4PLOB 3EZ8A 3NCBB 3SKUD 1XCQB 5BRZE 2ESVA 4Y19E 3ZYIA 2MSPA 4QRSB 2HLFC 2VSCA 4P2QD 1RMFL 4MSWB 1DBML 4ETYA 1BZ7B 3H8NA 3I02A 3W9DB 5DVMA 4ZFFA 1CGTA 2BSTB 3HI6H 3SPVB 4YFDB 1Z5LA 5DDHB 1A1OA 1JN6B 1XF2B 4Q0XL 1JF1A 4P49A 1HDMB 4HT1L 3MR9B 1UH2A 4BSVB 1AKJB 3VFTA 4ODHH 4Q74A 3REVB 4RAHA 2C5DC 5D1QC 3BQUA 4HPYL 1MCRA 2R15A 4Y4HA 3MLTB 1T0NA 5E2UL 3I9GH 3VFVA 4KK8D 1OTUC 2VWEE 1KJ3L 1UEYA 4HHAA 3CCHB 4S2SA 3NZ8A 4NRZA 1RJZA 1B4JH 3VXRD 3LEYH 4XMKL 4KRPD 1ORSA 5DTFB 4P48A 1S5HA 3HZVB 3VMPA 3BZ4B 2HMID 1GGBH 4WHYH 2E7LA 5C09D 4LFHG 1RUMH 2ZSVB 2B2XH 3HMWH 4I3RL 3T2OA 3NA9L 2AI0L 1NGWA 4PJFF 4NDMA 3WXVH 1RUKH 1RAMA 3QPXL 4KK5D 5FECA 4X98B 1O7SA 4YDJB 3QSKB 2OJEA 5C86A 4JPVL 1IGFL 5DC0A 3FB8B 3ZTNH 5ERWB 1AHWC 2OR9L 5E9DD 1I8KB 1XIWD 4HJGB 3HCVB 5E8NA 4YWGL 4Y4KA 1F4HA 2NW2B 3GO1L 1I3GH 2AXGA 1FH5H 2BX5A 2OM5A 3ARFB 4NQED 2EDQA 3AMLA 4XWOD 1I7RA 1CBVL 3M17B 2AJ3A 1VPOL 3C6LA 1X5GA 5DRZA 3MYJB 3T3PE 4DOHB 5DJYA 2J1KA 4P23D 4GKNB 3QUKA 1NUNB 1BQHG 3P0YL 5C0CA 2HJFB 3L3DA 3RUGA 4GXUM 5DHVB 5CJXA 1JZ6A 4S1QH 5I75B 4B5EA 5C9KA 4BFGA 4O2EA 1XGUB 3BT2H 4LPYA 5JHLL 5TE4H 4P2QB 5ABDE 3H3BC 4D9QE 1MIML 4HH9A 2WANA 2NNAB 2ZCLL 3C2SA 1C16B 3BDXA 4IBLT 4MA7L 4PBVC 1WVZA 3D39B 2YS4A 3O81A 5DD6B 5HVHB 1A6ZA 1ES0A 5K9QI 2VISA 5J1SC 5GRUL 4RAUB 4ODSH 3F12B 3MLVH 1KB5H 4NKOA 5DJAA 1G84A 2DBJA 2XKNA 1M71B 1FP5A 3S37X 2NY1C 3TFKC 5C3TA 2Q20A 4HGMA 1FJ1A 3HRZA 4P3WA 5GSVA 4HWZA 1A4JB 4UI2A 1QA9B 4ESKA 3GSQB 1P7KB 1BD2E 1W72H 5AG8A 1DUYA 1UZ6F 4KTYA 4KRPB 2F74B 4NPYA 1IT9H 5I1IL 1MAJA 2BP3A 1IC7L 2P7TA 5ALBH 5JW4Q 5EDXA 4F7EB 4M02A 3QDGA 4UINL 5C09B 5CD5D 2JB5L 1FG2A 3L5HA 4J1UA 5C0EA 4J12A 4M7LH 4WEBH 3WFDL 1F90H 4OD1L 1A14H 1LD9B 4HCRA 5EA0L 1F5WA 2FGWH 2VLRD 2IANE 3OWEA 3LIZL 4OCRH 4RGNE 5DJZA 1YZZA 3NCJL 4X9IA 5E9DB 1XIWB 4YUEL 2AXFB 3BP4B 4N90D 4X4YB 3CMGA 4XGZA 4G8EB 5F7MC 4PP1C 5I15L 1OQXA 3RWGB 4NO3B 3FN0H 1A8JH 4JFPB 5KN5A 1T3FA 3QPQD 5HHNA 4I13B 4YHKL 1FPTL 1IAIL 3OJMB 3QO0B 1DUZB 1NGPL 5HPMB 2Y7QA 4IOFD 2FJGA 4FXKB 2D7TH 3EFFA 5FYKL 5J11B 3NZHH 4V1DA 5D72H 1YEJH 2YUWA 3O6KL 1CXEA 4BELD 2GJJA 5D4QA 3UPRB 2W9EH 1O5DT 1F3RB 2HFEA 4YPJA 2MKLC 3WHE1 3I84A 1DANT 2Q7YA 3P30H 5HJ3B 3DX6B 1VFAA 5KJRL 2D7PA 2YPKB 1S7RB 1YN6A 4W4OC 3U1SH 1GC1C 1SM3L 5I1KL 1GXEA 2Y6SC 4RIRA 5B21A 3K8KA 2HT2D 4D3CL 4L9DA 1WZMA 3O2VH 1BX2B 3V7MA 3VDBA 1LQSR 4CU6A 4JRYD 1SEBA 2VRAA 2LU3A 1Q1JH 4K9EC 3MODL 2KZWA 4PJBE 4QTHA 4XB7A 3H7BB 3UJIH 1ZT7B 2AERT 5KS9A 3CDYA 2EYSA 8CGTA 3RWIA 3TIDB 4XRCB 1KEML 3BH8A 3BHBB 4L4TE 4KDWA 4XZUB 3QAZC 2A6IA 4EN3A 3PIQB 1MCNA 4P46C 1D5IH 2GITB 2YRZA 4YHYB 3LD8B 1IQWL 1S7XB 3CFCL 4PD4J 4A6YH 4XBGA 5CMAB 4F9PA 1XR9A 2C4FT 4X6CE 1EXUA 2NTFA 3VXQA 3UCRA 5MHSE 3MRPB 4XWGL 3MFFB 4HDIA 2HVJB 2OYPA 2YWYA 1WV7T 2VLRB 2UY6A 3EFDH 3EYOA 2D9CA 4WDIB 3K2MC 4NGHL 5JIKA 4PS4H 1U8QB 4MGXA 3KLHD 4HX1A 5DQJB 3V5HA 5EZLB 3RWFB 4RISL 2VDKL 2P1YA 2VNCA 3TT1H 4I2XA 3RI5K 1OSPH 5EZIH 4KPHL 2ERJB 4HMDA 2X4QB 3PXJA 4QLRA 1OGAD 3MRKB 3NABL 4JFFD 3U48A 3VW3H 4NBZB 5EZOL 4KVCL 5I74B 4JKPH 1CDCA 4HS8H 5CZXD 4ZUSB 1S9WA 3PABB 2JELL 3D0VB 3O6LL 3TBYB 1MLCA 3THMH 1YMMD 1CTOA 2PCPA 1FIEA 5TF0A 1QBLL 3G6DL 4GW5B 4HD9A 3V5KB 3ES6B 4FZEH 1KGCE 1DQML 2IANA 2QBWA 1EDQA 2RHEA 1IM9D 4PTUB 2H45A 3CSBA 3UTSD 2O5ZL 1RZ7L 1MF2H 2A74B 4X8XA 2DIBA 5F6IC 1K8IB 4MDIB 5FYKE 5JHDA 1KENL 1MPAL 1J18A 3I3EA 5T33H 2VH5H 4NIKB 4N5ED 3QRGL 3WN5C 4JRYB 2IF7A 3CNKA 5HGGS 3F7VA 2FIRT 1M6OA 1F4WH 1FZJB 2WP3O 43CAB 3JWOC 1CFQB 1QD0A 1AXSA 1RIUH 4FFYH 4LCIH 2UYLB 1WT5C 1KEGH 4WHYG 4PJGA 1JCKA 4WWKD 1YMHA 2R0LH 3N9GL 5E6IC 5FV1L 4LSSH 4KK6D 1UXSA 4U6VH 1RZGB 4PRPA 2H2PC 4XAWH 1CN4A 1QG3A 4WO4A 3K0WA 1RK0B 1T66C 3MBXH 4IRZH 3H2WA 1BIHA 1LP9B 4M43H 3MRHA 5TDNB 2DQIL 1OAQH 2XV6B 1NBVH 1N59B 3T77B 1AR1D 3LQZB 2VLJE 2PO6A 4NQSB 4PJAF 2XWBA 3HI5H 2XRAL 4LNRA 4QHUB 3MMEB 1U8PB 3VD4A 3D0LA 4XPAL 1MVFA 2CIKB 3VE0A 4U7SA 3EGSB 1NGYB 1SHMA 2ADIA 3TO4A 5E94B 4Z18A 3TT3H 1J5OH 3PV6A 2HJLA 5HYJD 1KIPB 2R2BB 4NUGL 3ULVC 5EBLB 5H35A 1R3HA 4OKVA 3TV3L 4U1GB 5J9PB 3HMXA 4NC1C 5T5NF 5IVNA 5C6TL 3KYMA 1KOAA 4Z7NF 1OGAB 5FCUH 2X5PA 1T2QL 3Q6FA 4FP8L 4LIQL 5BS0E 2Z31C 3BXNA 4QHKJ 5IBUB 1X5ZA 4GQ9L 1EJOH 4X6CA 3MPCA 5FOBB 4WV1A 1RUQH 2ZPKH 4JY5H 4LSUL 3EYVA 3DIFB 3PDGA 3AC0A 4BQ9A 4MA8L 4E9LA 5F7NC 1CIDA 3QEUB 1IM9B 5CD3B 3PWVA 5A1AA 4OZHB 3BZFB 4UTBH 4B53A 3N85H 1X5KA 4PG2A 1N2RA 4HKBB 3QO1B 3U36B 4P2OC 4LCWA 4G8IB 1HILA 2AV1A 1FO0L 1HNGA 2VITA 5C9JA 4QRQB 4TVPH 3KR3L 3SE8L 3CDGA 5CZVL 3VWKD 1U36A 3HA0A 1WGOA 5DHVH 1YA5A 4RGMB 2DQJL 2Q6WB 1INEL 2H32A 3RVTD 4UV4H 4OD2A 4WWKB 1MQ8A 5JOPE 3U4EB 3H7LA 3WO4C 1UM5L 3CUPB 1QFWM 4Y5XC 4ODVH 1QRND 3KLSA 4X6EA 1JHKH 2QQNL 3O9WD 1M4KA 2E3VA 3SO3C 4FZ8H 4PV8A 5JIIA 1CE6B 3WS6A 2ZUTA 2PXYC 2QQLH 3HZMB 3T0XA 2BRRH 4I3GA 1JPFA 4PUBL 4N0FA 3UPAA 4Y5VC 2SEBA 2J6EH 4ZTPH 5BV7L 3LRGA 5DUBB 5ACZA 4I4WB 3N50A 1FZOB 1M1SA 1XMWA 3GJFB 4PJXE 5F1NA 3L7EA 2FX9L 1J0IA 3OMZA 4WY7H 5HHME 5KVEH 4CAGA 4XBPB 5HYJB 3KPTA 2G5BB 3BW9B 3BPOC 3KLAA 1ZKAA 4PJ7E 2HJKB 4LSPL 2QSTA 2LE9A 4TRPL 4WFGE 3OV6A 3MX0A 1S7QA 4UT7H 5EBWA 2NXZC 4P99A 2CD0A 3LPFA 1ZWIB 1IRAY 1SBSH 2VLJA 5FYLD 3U4AA 2K3TA 1BZ9B 1Y18B 4KTEL 3RU8L 3VG9C 4HFWA 2CMRL 2VDNH 5JOFB 4Y4FA 5EO0A 2FBJH 3A0OA 4PJEE 4CDGC 2JCCE 4QKXB 2JF1A 4U1MB 1OPGL 4KVNH 1U2CA 1DBJL 3H9HB 3ZKXC 5D7LA 4N68A 2BOBB 4LIQE 4PGZA 4AZ8A 5EU4A 4JQVC 1A7OH 3KPNA 2V7HA 2X1WL 5EIVA 4IJ3C 2X4RA 5EOCH 4YBQC 2N7BA 1CFTB 1UJTA 4GAYA 3HUJE 3PE9A 5K59E 2ZOLB 2APXA 3BSZL 4KHTL 2IBZX 5MEOA 4TPRL 1QRNB 3SDAC 3O9WB 5F7EH 4AIZB 4XCYA 3MA7A 3P77A 2E6PA 2VSDA 4GS7B 4G80B 3SE3A 3CFBB 3MLXH 3FO2B 3OF6D 4WW2A 3V0VB 4LSVL 4PRAA 1IGJB 2E7CA 1QSFD 4GG8A 1U8MB 1KJ2L 5HHXH 4UB0L 1C5BH 1QZ1A 3MROB 4KJQD 4UZGA 4FQXD 5DQDL 1I1FB 5INCA 5T1LA 1H8OA 1V3LA 1YECH 4QWWC 4DEPC 5K9JL 5DRWB 4JHWL 4XHQA 4XX1E 3TWCH 1VDGA 2E6JA 4WFED 5J13C 1BLNA 1C08A 4P59H 2OR8A 4ELKB 1RVFH 1CF8H 2XA8H 3IGAB 3S88L 2J8OA 3OPZH 2R8SL 1ZHKB 4CADB 2QKIB 3O4OC 5E99L 5F7DB 1ZANL 3TZVA 4XVJL 2VLLB 4R0LC 3ILPB 1NFIA 3OKEB 2ITCA 2EIZA 4LHUA 5CEYB 3A6OA 3ILQC 2YMXL 3BKML 3KHOA 3TVMC 1BVLB 3HC0A 2CKBA 3B8YA 1MHPL 5GJSL 1KV3A 1TZGL 4LLMB 4DVRL 1Z9MA 1RI8A 4GBXC 2H41A 3PQYE 3FQTB 5LBSH 1X4ZA 2EDKA 3FRPA 4L29A 3H0TB 1VADB 1EO8L 1LGVA 3V8CA 4ZUVA 3VFWB 4YHZL 5HYSG 2A9ML 3IDIB 4XC3L 5HDOA 5IR1B 1NAMB 3C60D 2OJZL 1QO3A 3T0BA 2VAAB 1D6VL 1WLHA 4PJ7A 5E8PB 4GW1B 3IF1A 5J1TC 3MLYL 3P73A 2IAMA 3CVHB 1AQKH 4KUCD 2VMFA 1MNUL 1UB5B 4XNUL 1NFKA 3S7GA 3NAAL 5EC1A 3BEWB 3QR2A 1FN4A 3FOMB 3M45A 2FB4H 3FAWA 4MJIE 2VDML 3MRBB 1QSFB 4PJEA 1JPTH 3BISA 3GBML 2HFTA 1Q9WB 4I9WE 2FSEB 4OCYL 4G43B 2AJXL 1JRHL 4FQXB 4NUJA 1RULH 4M1CC 2C3GA 4D8PA 5IEKA 3TPKA 3VCLB 5J1AB 2GIYA 3WFBH 4JR9L 1PFCA 1H3UA 5TDOB 3ARDD 1HZHH 4K71C 4U6YA 5GIRB 4NKQB 1E28A 4MVBD 4BFIB 1XGYH 5CJOH 3NFNB 3HUJA 4X7SL 1AIFB 1IQDA 4RDQF 1X4XA 3PP3H 1G7PA 2HFGH 5C0BE 1YNLL 1P1ZB 1A3RL 4OGYL 1N64L 4YXHH 1EJ6A 5IVXF 3CSPA 3H9SE 5BQ7A 3HR5A 3HE6C 2JJTA 3IVKA 4K3JL 4HKJB 3VFNA 1IC4L 4G9FE 1UZ8B 3BQUC 4PJ8A 4O02L 5M7QA 1T21B 2ATKB 4M5ZH 3BMWA 2YD6A 3IKKA 3V5DA 5IOPA 2B20A 2GT9A 3U4BL 3WDHA 3LDBC 1OW0A 4P5TD 4YDVB 3OAYH 1CFSA 1OB1A 3D25A 3C60B 4NCC2 3V6ZA 1UVQA 2ZP0T 3M8OH 1F00I 1TENA 3R4DA 4O2FB 4R90L 4XXCC 5D2NB 4ODBD 1MCOL 5I0DA 5ADOH 1KLGA 3IFNH 4GXVL 1I3RA 3ECBB 3ZKMC 1J0JA 2EC9U 3AS1A 2PYED 4XNXH 3O6FB 2X05A 2D4DA 3WIHA 2CH8A 3RIFF 4DTGL 3QHFL 3VWJD 5FKAB 3FT3B 4M48H 1UXWA 5F9DC 4ZS7H 3RNKA 4UU9B 5JXED 3AU1A 3P11H 1CU4H 2FR4B 4N8VG 3QG6B 3PP3K 3P4NA 4Z7OF 4R96B 1IZJA 3GB7B 2IPUK 5H2BB 2R1YB 1KCSL 1SEQL 1KBGH 1U42A 4AG4L 1OD9A 3BRDA 5IHUH 3TH3T 4F7TA 4FQ2L 2NX5D 2JJSC 5KSAD 4H0IA 4ZO9A 2VJXA 3ULUF 3QULA 5JPMA 4U2ZA 3QIWD 3DX7B 4WVRA 5C7XH 3BWAB 4RNRA 4L4VA 4LARH 3GM0A 2DTML 1WF5A 4X6DA 3QWOA 7FABL 3EYSL 2Q3ZA 4FTVA 2EDOA 2BDNH 3HNTL 4JFOA 4LCYB 5D7JD 5JQ6L 1FVEA 3GJFH 5E7BA 5HDBF 1F4XH 4OF0A 3OAYK 4F2MA 1DQJB 4UT9H 4J3WA 5A43C 4JM2D 1MEXH 2AV7A 3PHOA 3QZWA 1JV5B 5CHNA 1ADQH 1G9NC 2CR3A 1A2YB 3SBWA 3BUTA 3CSGA 4BFEA 1KJ2A 5A40E 4QXTB 4N0UB 3NIFE 5CCKH 5E00A 1TTFA 4OCSH 3W2DH 3S8WA 4ACPA 1G9ML 3D3VA 4XH2B 1HSBB 5F1IA 3ZT5A 5BZWB 1OQOA 3SE4A 2Y06L 1AI1H 1DLFH 4XP9L 4N8CL 2VDLH 1F02I 1U95B 3O2DA 3U0PA 4FXLA 5F97E 1N5YH 1KIQA 3U7YL 1WZ1H 1AGCB 2PYEB 4ZQKA 4P2RD 5E0QA 1OCWL 1H5BB 4H0HB 4APQA 5C0JA 1YEDA 1NCTA 3V95A 1R3JA 4X8JB 2VWEC 3FB7B 3RPIB 3VWJB 4O2CA 1WBYB 2B5IC 4OQTH 3ZL4H 4HUKB 5CINL 1GOFA 1QFUL 3QNXA 3SDDA 2E8ZA 3QIUD 4M1GL 3G5YA 4NOBA 1N6QL 3BX7C 2ZCHL 4OUUB 5T5FL 2CDGA 1C5CH 2G60H 3BGFB 2NY2B 4OFYA 1E4XI 4YDLB 5CEZH 3O4LA 2Y72A 2WWMC 2VYRE 5KSAB 4FFWD 3X3FH 3VGHA 3G6JB 5FYJD 3REWB 3RVWC 4XVUD 2YD5A 3VXTA 4FRWA 1BBDH 3QIWB 3GJFK 4EIZC 5GHWL 5ILTH 2CRMA 2JE8A 4OM1H 1T1ZA 1SJVA 4OZ4A 3TLRA 1FC2D 3AM8C 2N7AA 4HUMB 4JKWA 3LKPA 3S4SG 1OGTB 4BSWA 5I6XC 5J6GA 3RA7H 4EDXB 2V2XA 5B39A 1FIGL 2B1AL 3QJFB 4H8WL 5TQ0H 4L8SB 1KCVL 2GTWB 4G42A 5T3XD 1G0XA 2BSRA 5CEXA 1KPVA 1AJ7H 3ZSSA 2BVUA 5D1XC 4DOHE 1F3DJ 1MY7A 2H3NB 4TVPE 4NKMB 4RWYL 3MRFB 4JY6B 5DR5H 1U8KB 3UYRH 2DBLL 3RKDC 3U7AA 2BNRB 3LCYA 4OZGA 5DMIH 2DIJA 3QJHB 3GSRB 1GYAA 1WWBX 3E0GA 2H26B 4JVPA 4WJ5A 3LZFH 1WISA 4P2RB 3NH7L 4MJ5A 4PJDA 2OQJA 1A6AA 3TBSA 3D39E 1XCTA 3FT2B 4UIMB 3LKOA 1LO0H 2Z93B 1NGXB 1E6JL 1R5IB 1JGVH 1FDLL 4P2CG 4KQ4H 5CSZB 3W9EB 1G7MB 2N56A 2VXVH 2JTDA 5EPMA 5FM4A 3EO1B 4KKLC 1ULVA 3MJ9L 1UM4H 1RZFH 3T3MF 3DV4A 3O8XA 5FYJU 5T3ZL 4JO2L 3HPJA 3FKUS 2W91A 4ZTOH 1J0HA 4X0KB 1X5LA 4RGNC 3FT4B 4F9LA 5KVFH 2FO4B 2WIMA 4QRPA 3STZB 5FHBL 4XPBL 1INDH 1Q72L 4PJFB 2ZJSL 2FX8L 4ODTL 1RJYA 1ZEAH 2APWA 4YR6B 3QUXC 5D7SL 4E5XB 1NBZB 3RUGF 4I0PA 1XGPA 4J8RA 3SDCC 4Z0XA 2M1KA 4Y16B 5KSBA 5IB2B 4J2XA 2X89D 2CXKA 2DQTL 1ZLVH 1BQLL 3KYOA 4OCXL 1K4CB 1L6XA 4H0GA 2XA3A 5HI5D 3VH8G 1NPUA 3PWUB 5GS2H 3BN9C 5TH2B 2H9GA 1FFNA 1N0LA 2EEDA 1K2DA 1JNLL 5LCVL 3WS3A 2VDRH 1NBQA 4MCYA 1NMBH 3X12A 2OMNA 2AEQL 4YE4L 2PO6C 5EIIB 1ZVSB 3B8SA 1WITA 5IK3B 4DZBB 3QCUH 1KN2H 5L88L 2G2RB 4HIIA 3T0ED 4JDZB 1XF5A 1R24A 5JORB 4MQXC 5IKCB 2PW2B 3EOTL 4JFDA 3EBAA 4DN3H 5LQBH 3CLEH 1I8KA 3O3BA 5B4MD 2ICWA 3ARFA 3HI1A 3RTQA 2FZ3A 3GJEB 4MAYD 4NJAH 1WEJH 1IKNA 4WUKL 5AAMA 4JFQB 5E2JA 5I8OH 1F2XK 1U8JB 2VN4A 1CYGA 1C1EH 4JFXA 5IMOB 4OLVH 4I77H 4JPKL 2HLFD 1QFWI 3PL6C 4KUZL 2OMBA 1G7QB 1HQ4A 3V0WH 5DF0A 4MD5B 5INDA 1PX4A 1KSRA 1MCPL 1WZLA 5I1DA 3MNZB 4TUOA 2Q86A 5TQ2L 5JR1H 2BK8A 3U2SA 3HAEB 1F6AB 4LLQB 2C3WA 3VGAC 3O11A 5D1QD 5KANI 1ZLVK 3UTQB 3D39A 1CLOH 4TQEL 5IHLB 1OTUD 1GSMA 2HG5B 1OF2B 2A9NL 4NP4H 5T1MA 1TCMA 1H8SA 5T3ZE 2YHGA 4WI4A 4N90E 2CUMA 2EIBA 2ICES 5D70H 2CDFA 2YD7A 1CGSH 5BJTA 3STBA 1ZLSL 2FD6L 4F7CB 2B39A 3OX8A 1U3YA 3SJVA 4F3FB 1VKXA 5C08A 4NN6C 2FRGP 1U92A 3WS6C 2ENSA 2OZ4L 1X5AA 4XHJC 4G8FA 3VG0L 1LDSA 4JQIH 1CDYA 4TUKL 3FRUB 2P8LB 3QDJA 2E27L 5KS9F 2AJVH 2I25N 4RWHA 4K2UL 2VERN 4UBDC 3TPUA 1LK3L 3T0EB 5EO1B 1DFBL 4NT6A 2HP4A 3TJEL 2VUYA 3H42H 2KKQA 3BEVA 5KBNC 1KT2B 1KFAL 2FJHA 3D85D 4ONHB 4JVUA 1NJ9A 2FCBA 3IFOB 2DQFB 5E2WL 2RGSA 4IDLA 1YEHL 2VLMD 4JRYE 1DEDA 3FQRB 5B3JE 4XMLH 3EUUA 1AD0B 5DXWA 4BM7A 2PW1B 1RUAL 4Y0GA 1FNHA 3VFUA 5HYQA 1A7QL 2DS4A 1P6FA 3TN0D 3VD3A 3BD3A 1BJ1H 3GKWL 3KDMB 3R1GL 3SHSA 3DYPA 4Y4FC 3EOYG 5C0DB 1LP9E 4RX4D 4C4KT 3TFKD 5SX4I 1BVKA 2P8MB 5J89A 5H8DA 2C9AA 5ICXA 4AM0A 5D1QB 3B6SA 4PJ5D 3PWJA 5E1AB 2FIKA 3SOBL 3DGCR 1J8HA 3RL1A 4YBHA 3QDMD 4GSDL 4OLWH 1YUHA 1J1XH 4JAMB 1BF8A 5IFHH 4ZFOA 3MOBH 4G6JH 5F72S 3RZWA 2FEDC 1DQQA 5TGBB 4AT6B 3C5JB 1OAZL 2XACC 1AE6H 4NBYB 3MCKA 1T83A 4FA8A 4WW2C 3MXVL 1OGAE 1S9XB 4Y5YC 3QCVH 5SV4A 3W11C 3IDJB 1A1MB 4WCYL 4LRNH 2X1OA 4ZAKA 1T20A 4L8BA 3KWWA 4PP1D 1U58B 3HC3L 4O51A 5HGDA 3MJ9A 5D7KD 4QT5B 4PJGF 5IQ9A 1UWEL 3MZTA 1ETZA 2Z35B 4UOJA 3GUTA 3TYFA 4D9RD 1OTSC 2A0LC 4OZHE 1DBBH 1G6RH 1I1YB 2X7LA 2OSLB 3FAXA 4YHMH 2X42A 3D85B 4EI6B 3QIBC 3GSVB 2GAZB 1U2HA 5DJ0A 4QCIA 4PRHE 1UQSA 3MLZH 5EH1A 3TZVC 1VENA 1EMTH 4X4XB 3MLUL 2RQ8A 1NUFA 1NL0L 2X4QA 3MRLA 1HNFA 1FBIL 4P5KB 3DGGB 1X5FA 3E6FB 3TN0B 5IQ7H 4PREB 1R5VB 3QUZD 5J6HB 1TNNA 2QL1A 4IS6A 4Q9RH 5IB5B 4NM4H 2AK1L 1CE1H 4RMVA 2BFVL 3OG4B 3UC0H 1F58L 1J0KA 4BZ1L 4PJ5B 3ZDZF 1AY1H 2ARJQ 1B4RA 1HKLL 4PJAB 4DGIH 1A6PA 3GMRA 4M9PA 1MH5B 2R29L 1DQLL 5D7IE 1D5MB 3QDMB 1GGIH 3WEXA 4ZUUA 4P46D 2IAMC 1M7IB 4HK0B 43CAA 3AY4A 2Y5TB 5FYLL 4KY1L 2GJ6A 4ZNEA 5HYJE 1CZ8L 5GGSA 3CMOL 2HKHH 5EUKA 1C12A 2IGFL 3OKKB 3BKCH 3FCTB 1FORH 5FYJH 4U1IB 2UWEA 4BK4A 1NEZA 1F6FB 3WFEH 5IBLC 2X4TA 1PVHA 1S5IH 4Z7WA 3RWDA 5I66B 3G04B 4P3CH 3RVXC 4KTDH 1NAML 4KJPD 5LGKA 1T5WA 2C7UA 1J1OL 5FGBA 1RY7B 1CD1B 3VFOA 2UVEA 4RGOH 3T4YB 1CQYA 3CVHL 1BECA 1T1XB 2OR7A 3MJ7B 4U3HA 1UYWL 1A6WH 4FQLH 4ODWB 4JHBA 5T3XH 5IM7B 1I7UB 1W8OA 5DSCA 5I71B 1B3JA 4ORGB 3WL9B 5D5MA 5I1GL 2VDQH 5FO8B 3KPPB 1I85A 3G08A 2CK0L 1JZ5A 3UTTA 2V17H 3L3GA 1XH3A 4JFZL 3VFRB 1YNTB 4K23L 4S1RL 3FQUA 3QUZB 4JCLA 1QRNE 4HEPG 2NY5H 3FQNA 4PJ8C 4GMSL 5F7UA 5I17B 4OLZH 3KVQA 5CLWA 2BNQD 3AAZB 4KZEL 3C8DA 4UT6L 1JWUA 1XZ0B 3MLRH 1IGIL 4LLWB 3BD4A 5C2BH 4G7YH 4XNZB 5LAXA 4HUXA 5KG9A 1OW0C 4AMKL 4E42A 4L3CA 5T1DH 2OZ4A 4Y8AA 3OL2A 5CIPB 2MCPH 2X70A 2ICEB 4U05A 5E6ID 3SDYL 4PRHA 4XMPH 4JZJC 4P46B 2R4RH 2H2PD 3GK8L 4Z0BL 3TESA 1W2KT 2X44D 2HKFH 1WTGT 2JLLA 3GSNA 2DWDB 4NZUL 4R2GD 3G9VA 4PLNC 12E8H 1JGEA 2ZG2A 3CGTA 4PJIA 1U9KA 3WIIH 4YXLH 4MD0A 3OKOA 5I1LB 3G5ZB 3QFDA 2DMBA 1TJGH 3MLSH 3UBXG 3L9RB 4UNVA 5FKPA 4H20H 3P4LA 3LKRA 5FYLE 2IG2H 1HSAA 4YC2C 1CIUA 1I3VA 3KPLA 2XG4A 5D7IA 1SVCP 1IM3A 4PIRF 3PDOB 1M7DB 4G6MH 3QXVA 1JHTA 4I5BA 4Q7DA 4HW6A 4OFVA 1JTOA 3VFGH 1UM6H 4WW2F 3TEUA 2Q1EA 2Z31D 4XCCH 3FJTA 4OF8A 1F97A 4MAUL 1NC4A 2XFXA 4K7PH 3HE7A 5ID1B 4LVNC 2AK4A 2LAAA 4PR5B 2ZKHH 4X5WA 3LB6D 1FL6B 4HJJH 1PGRB 2GCYB 3F58L 2P47B 3P4MB 5F1KC 4C83A 3P9WB 1IGYA 4NO0D 4P2OD 3C5ZB 2BNQB 3OKDB 4CL7A 1SYVB 1U3HA 1QSFE 4FQJH 3WN5B 3GMNB 2YD3A 3BO8A 3B3IB 4ZOCA 3RWCB 3QEQD 3MRNB 5JUEH 4MS8C 3GHEH 4JZOB 1FLRH 4PRID 5L7XH 5B38G 1H0DA 5CJQH 5E6IB 2P5EA 3P0VH 3CVIH 5EU6A 1ZVHA 5TF1H 2AJUL 1CFTA 5E8DL 3SE4C 2JJVA 2ATPB 4KQ3L 2PXYD 4KJYA 2HTKC 4R2GB 3RY6A 2ICCA 4H26B 4M61A 2EDTA 2PETA 2YSSB 2Y1VA 4LHQB 2BVQA 4MB3A 3DRTA 4APQC 3GIVA 5I8CA 2L0DA 1MJJB 1P9MC 4OZFB 5CWSA 1II4E 4L9LB 5JA8B 4PJ7F 1FFOA 5IP4A 5JLZA 1RZIA 2R2HA 3O6ML 3GSWA 4MXVF 5EZJA 2YRPA 4EOWH 1TDQA 1A7BA 3RWJB 1CGWA 3OR7A 4MJ6B 1RUKL 1IAOB 5F3BA 1RFDL 5EU7E 4OGXH 4XP6L 3ARPA 3KYKH 4ZDHA 1KCUH 1JNNH 4HAGA 1ZGLP 3LN4B 5I0ZA 3PWNB 1BQHA 5IGXL 4QHMA 4NHCH 1QHPA 1QQDA 1DN0A 4PJEF 2Z31B 3U83A 1YC8A 3WD5L 1UJ3C 1P4BL 5ETUA 4PRDB 4GKSA 1B0RB 5GGTL 2QHRL 5D2NE 1NCBL 1I8MB 3VXNB 4EKXA 4YX2H 4X7EC 3KPRA 3ARZA 2I26N 4UQ2A 4JQXA 4NN7C 3HUJF 4EDWH 4NO0B 4U0RC 1DTUA 3TYGH 3CXDH 3QEQB 4AEFA 2YWZA 4X9GA 2IPTH 3EOAA 4LPWA 4JGMA 1AP2A 6FABL 4PRIB 1OT2A 2ZOKB 4MXQC 4KV5F 2P44B 1P4LB 3KXFA 3TIEB 4Y5XB 5ICZA 1MCCA 2Q8AL 3SO3B 1H3PL 1RK1A 2EXYC 4QXUH 5FCSH 2X09A 3DSFH 2ARJB 3QXAB 4MZ2A 5CBAB 3MV7D 4G6KL 2C3XA 1R5WA 3FOMA 3ULUD 4Y5VB 1RJLB 5C0AA 1JHLL 2Z92B 5IVXB 4JPWH 2F58H 3DMMA 1JUFA 1J05A 1NLBL 2EDWA 1KULA 3LS4L 4LSTL 5IV2A 1JWSA 2PF6A 3W0WB 4O4YH 1HEZB 2O5YH 1BIIA 4M8QA 1QEWB 2VQUA 1OAYH 3GBNH 5MEPA 4WFHE 4GJTB 3TA3A 4EQ3A 5FIEA 1KCRH 3L3IB 4I0KA 1GGUA 3LN9A 5D1ZA 3PG2A 1OP5H 2XWJA 4F9LC 4Z7UA 4H88H 3TVMD 2C26A 2ORBH 4ZOEA 3DRQA 1DP0A 4YAQA 2V2WA 3A6CL 1OP3H 1HK6A 2BC4B 4GBXD 1FYTD 3ZDYF 1LDPH 3NACH 4BKLA 3ZDXF 1MCDA 1DDHB 1QYGH 5I16A 2PYEE 1U91B 2X10A 3DVGA 1JNHA 3HNVH 1BFOA 1MWAB 1XFPA 3IJSA 1T2XA 1U8OB 3CPLA 4IHOB 1Y0LA 2A83A 5B8CA 4PGBA 4IJ3B 4U7MA 1Z9OA 1HIMH 1UEMA 3TO2A 1U8IB 4LGSB 5AWNH 5DJ6B 3SCMA 5ENWA 4HIEA 1MI5D 3F65A 2K1MA 3VXSD 3RDTB 4X6DF 1QP1A 3V4UH 3HS0B 1B9ZA 3LAFA 3LN5A 4F37F 3V4PL 3UJIL 5LGJB 3VI3E 1QFOA 4U7KA 1GC1H 1B6DA 2XTJE 3EYUH 4M1CD 4UQ3B 4YDKL 3G5XB 3LQAL 4K9EH 2VXSH 3ARFC 1G1CA 4HZLA 2CLZA 4M6MH 4NFDA 4DEPB 3LRHA 1JK8B 1S9VA 4NQXA 1CICA 1W0WB 3KYNA 4ISVA 3UTZA 2W0FA 3R0NA 2ESVD 3MACH 4F58H 3GZKA 1T1YB 1CXHA 1OP5K 1NDGA 2DAVA 3S34H 1LEKB 1T04B 1JVKA 1PD6A 5H2BA 5L2KA 3IFLH 1NBYB 1TMCB 1SJHA 4UOW0 1OP3K 4LSQH 4UTAL 1LO4L 3EYFA 4K7FB 2X4UA 4ZO7A 5HY9A 5HYFA 1V05A 3TVMB 3LHPH 4NJ9H 2FHBA 3BQUD 5JW4M 2BNRE 2BSSB 5HVHC 2VLKE 4L8DB 2R0WH 4GBXB 1FYTB 3OGCB 4OZIA 3VW3L 1G9MC 2MNUA 1QSEA 5C07A 1QLFA 1ACYH 1LNUA 2F5BL 3IJYB 4LF3A 2YKLL 3GMQA 4P2RE 2RCSH 3SKMA 1OAKH 4J7RA 5EFIB 4IDJL 2WUBL 3V52L 5I30L 3KPOA 4CJ1A 1MCWW 3K81A 3RVUC 2PTTB 4KRPC 1FZKA 1PJ9A 1IJ9A 3EJZD 4U1HB 3IKCB 4NQDA 2PTVA 1MI5B 4BH8A 3GSOA 3VXSB 2AVGA 3RWEB 3MRIB 2CPCA 4NQUA 1A9BB 4Z95L 4HXAH 1A21A 1WBZB 3RKPA 3ZKMD 1Q38A 1YY8A 3MBEA 1T22A 5SWZA 4KK5C 3MLWH 3IJHB 1TZIA 5FA3A 3T2PA 2QTEA 3M1BB 2R0LL 3C6LD 4K3GA 4MYWB 5FYJE 1MCJA 2KDGA 1CFVL 2IC2A 4FQQB 1H9VA 2EKSA 4EUPG 3KPSA 3ZHKA 5C0CD 5I73C 5L0QC 1BZQK 3JWOH 2E7BA 1EVTC 1RZJL 1OAQL 35C8H 3BIKB 1YYMH 1DBKL 4OZGF 2ESVB 5IVOA 4X6BA 3FN9A 1MREL 5DD5H 1WTLA 5CKAA 1WBXA 1YEGH 2PYFA 3I02B 4ZFFB 5T3XE 2D03H 4H8WC 4GKZA 4PJDF 2B1HH 1Z5LB 1ZE3C 4NZRH 1A1OB 5TJWK 1JF1B 3FQWA 4OIIL 4U1JA 1A3LL 1KJMA 4FQ1L 1GGCL 2NY7L 3X13A 3VFTB 2NLJA 2NPLX 3BQUB 4DJMA 4Y4HB 1T0NB 3VFVB 3Q3GA 4Y2OA 1KB5A 3R8BB 4HHAB 4S2SB 3NZ8B 4NRZB 1RJZB 5F7HA 1VGEL 5GGRA 3X3GH 1JRHI 3ULVH 1ORSB 2W9DL 1S5HB 1IFHH 3ARBA 1BREA 4LGPB 1T89A 5BRZD 2VN7A 3D9AL 5FUOH 1NGZA 1YQVH 3QDGD 4DZ8A 1W72A 4PBWD 4M6OH 3D69A 4NNXA 5KSUA 3VFPA 5DWUL 5MEQA 1GHFL 1NGWB 2ZZUT 4NDMB 1K3IA 5C0RH 5FECB 2LTQC 5FGRA 3X14A 2OJEB 3MRFA