2AEWA

A model for growth hormone receptor activation based on subunit rotation within a receptor dimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
205
structure length
189
Chain Sequence
SSKEPKFTKCRSPERETFSCHWTDEVNLGPIQLFYTRRNQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNAMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth hormone receptor
publication title Model for growth hormone receptor activation based on subunit rotation within a receptor dimer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 32
structure length 189
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aewA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2aewA01
5FYLD 4KTEH 1NCCL 4JRXE 3QUYC 3OX8A 4WY7L 2FIRT 3S37H 8FABB 4NQSA 3P3YA 4BKLB 4ESKA 1GHFL 4OSUL 1F4YH 1IQWH 3QUMB 2XN9B 1DFBH 1I7TB 3OKDB 1BD2E 2UVFA 1I85C 4OCNC 3MBEB 2DLIA 5HI5D 2AQ3A 1CFBA 5KVMC 5CCKH 4WNQA 3NH7H 4I8DA 3WHE1 4NN5C 5D96B 1WIPA 3OG4B 1FFQA 5ETUB 4ENEC 4D8PA 4PJBB 2B1AL 4K3EL 3QDJB 5E00A 1EFXD 1JZ2A 2VLLA 4NUJB 1MWAL 4MQ7B 4FFVC 5E6IC 3N0PB 3O3UN 5D7JD 2J6EH 3WV0A 2ICWJ 1NAMA 5ITFB 3F12B 3KYNA 3RGVD 4GMSL 4YHKH 5FA3A 5GSVA 1ONQB 2DQUH 4HBCL 4G9DA 4XMKH 5HGDA 2NTFB 1EHLL 2RAMA 3HI6L 2R2CA 3L7FA 1K4DB 1BOYA 4Z7OE 3DURA 3BPLC 2HA1A 2ZUQB 4QOKE 4IOFD 3CDYA 4NQTA 5ACZB 1UWGH 4I4WA 3P73B 1NGQL 3B8YA 3C5ZA 1NANH 1NANI 4WHCA 2FH6A 4U1SB 3ARDC 4JRXD 2BFVL 1WUNT 2EECA 2XZAH 4QXUL 3OBAA 3RJQB 3WFDH 3ZHKA 4LLVB 3MACH 4LSPH 3RX5A 5FKAB 4WCYL 1I8MB 3K74B 3UBXB 5D7JA 3TM6A 4R6UA 2NNAA 4ONGL 2NY1C 1BD2D 4J7RA 3D85B 3RGVA 3A6OA 3FB8A 4JM2D 3TT1L 1J1PH 3AROA 2H1PH 4FQ1L 2YXFA 4P4KA 1J0YA 1K2DA 1VESA 4HWBH 1KT2A 2BCKB 2YZ1A 3FFCA 5LGHL 4TSBL 4QXGL 1U6AL 5EOQH 3GSWA 3LN4A 4LFHD 5GRWA 3U46A 1I7ZB 4ZOAA 2V2WB 5IUSA 2ZP0T 3BAEL 4HK3J 4PIRF 4MJIE 3KYOA 1NUNB 1VFUA 4Z7VE 3IJHB 4GMTL 2DI8A 3KXFB 5FYLL 4OTXH 3T0EA 3C2AH 3S3SA 3BFOA 3DLQR 4NKDA 5CUSH 3BZFA 4NRXB 1JVKA 2XZCH 4GW4B 5DJ0A 2AV1B 4X6CE 4D0BB 3MNVB 4FXGB 1PVHA 3HRPA 1RMFH 1ZEAL 3I02A 3SGJA 4QOKD 4JDZA 1P6AB 2JCCE 1OM3L 4JFPB 1DE4A 5AD0A 4JFYA 5E2WH 4MDJB 1V7MH 5FUCC 2V5RA 5C0AA 3AUVA 3ZKQD 3INUL 4PTUA 2VDPL 4YGAB 3RY5A 1FC1A 4HXAL 4QT5A 3FO9B 2P42B 3TJHD 4ODXA 2JB6A 3VI4F 1ZHNB 2AAVA 5EUOA 3FCTA 5I1JH 2HRLA 4LFHG 3DX9B 5T1LA 4M7LL 1IGTA 1EIBA 1U93B 2NX5E 4PJHE 5B8CA 1D6VL 4K8RD 3SJVA 12E8L 1EAPA 4QOKA 1D5MB 1P7QB 4QY8B 1ZS8B 1UB6A 1I1AB 1CICD 3NAAH 2APTA 1T21A 2BP3A 4QRRE 4U1LA 3QI9B 2H2PD 2G75A 3MLVH 4JB9H 2BVEA 1NLDL 1NDMB 4JM2F 4A2LA 1H0DB 4FQXD 5HHOB 4MJID 5EU5B 1TVBB 2P5EE 5DD1L 4NM4L 5EB9A 1WQVT 1FJ1B 1CD1A 5KS9E 1H5BA 5BZDA 1A7RH 5HYJA 1LO2L 4WW2C 4C4KO 1FDLH 3B9EA 1PX3A 2GJ6B 5ICYA 4WTWA 1DN0A 1IC7H 3OJDB 1CTNA 2ADGB 3QDHA 5C9KA 4X7TA 1GPOH 3NIFE 3KLDA 5FA4A 4FQXA 3VA2C 2BNRB 5DVOA 1EJ6A 3FKUS 4F57L 1OTSC 3HZKA 3WD5H 1EPFA 3V5HA 4Z7OF 3L95A 2X9YA 5E2JA 1RUPH 3OX8B 3EHBC 4F2MB 4DQOL 3AS0A 3ARFA 2YBRA 4NQSB 2NW2A 2DIJA 4L4VE 3BKJL 2NX5D 5DMGD 4J3TA 3WIIH 3RAJH 4BSVA 1ZLVH 5F7WC 4HS8L 3W0WB 1ZGLP 1DANU 4LASH 4Q7DA 1JYXA 3OTTA 3K1DA 4QRRD 4WUUA 5I8EA 4Y16B 2HTLD 2MJWA 4GAYA 1S9YA 1YEEH 3GMNB 2QHLA 2BDNH 3E6HA 5BZWB 4ORGA 2P5ED 1MCNA 4OLZH 3F7RA 3MRCA 3MUHL 3K2UL 1YEIH 3WLWC 2NY0D 4DUXA 2XTJE 4OF0A 3CX5J 2BSTB 1GZQA 5DO2C 2NX5A 1OL0A 2ADFH 4S0TD 1JP5A 1A3RH 3F62A 4OCWL 4MZ2A 4TNWK 4LSQH 4C58B 4O02H 3VFPA 4QRRA 2FJFA 3H8NA 3C09C 4G9DB 3FN0L 4R8WL 1VEPA 3EYQD 4U1IA 5HGDB 2BNQA 3DURB 3TBTB 3WJLA 5BXFA 3BKCL 1CLZL 2D31B 3W11D 4X6FB 2R1WA 2RB8A 2VQ1A 2W0KA 1WSST 4YDLC 5GS0C 3C87A 2HKHH 4UINL 4IRZH 2AK1H 1P2CB 4PREA 4N9OB 1CE1L 4JM4L 5JW4M 5BCAA 2NNAB 1T22A 1HYRC 1F42A 3E2HC 2XFXA 2A73A 2AS5M 2W9DL 4KGLA 5D1QA 4BUHA 3UMTA 1SBBA 4NQXA 3DNKA 3ZKMC 4P4KB 1G7IB 2Z4QA 2A77L 1N4XH 1NAKL 1ZGLM 4LMQE 1KBGH 2IPKA 3FFCB 5I66A 4KZDL 1UM6H 4L8SB 2DKSA 4Q58C 3U46B 5DQJA 3N9GL 3TBYB 2OJEA 1FLRL 3QUXC 2DLEA 3GJEA 4OUUA 4YEFA 3BSZL 2XTJD 3RIAF 3UC0L 4L4VA 4R3SA 4ZTPL 3LB6D 3T0EB 1KJVA 5TQ0H 4DGYL 3BZFB 1M7DA 4XPAH 3EFFB 4OCXH 5DJ0B 1T0NA 4P9HH 1IGIH 2Q86A 2DLHA 3BRGC 3KPRB 5CSBA 3NTCH 4MJ6B 5KS9F 5ELIA 2IJ0C 1B0RA 3HZYB 5CHNA 5C1MB 4LQ1A 2P44B 5F7EH 2DM7A 4JFYB 4NWUH 5FM5O 5EG6C 2F8VA 2EIZB 2A83B 4OCRH 4WU7A 5B4MD 3VE0A 5C7XL 1EHXA 5C0AB 3NIFF 3MBXH 4QT5B 1AGFB 5C86A 4ODXB 1G0YR 5LJYH 3LQAL 1GSMA 3FCTB 5EUOB 1EAJA 3MLZH 1J87A 5T1LB 3O2DL 4HC1H 1C5BL 1IGYA 1KNOA 4TNWF 2VLRE 2R39A 3RU8L 1T21B 2G60L 2YUWA 3R0NA 4N5UA 4GO6B 2G75B 4M7LT 4NN7B 3GNML 2IH1A 1T66D 4HWUA 3KDMA 2BXYA 3ULVE 1DQLL 2W59A 3HNSH 4XBPB 5IMLA 4YK4C 1HKLH 4U2YA 1QFWL 4OIIH 4KVNH 4LLUB 3FO2A 4NQDA 5BV7L 2FSEA 1DBMH 3EDJA 2R4SL 5JUEH 1H5BB 4KMQA 3DHMA 3S35H 4H25B 4P3CL 3G5YB 3TV3L 3CIQA 4PRIE 1AQDA 2EDFA 4RFOH 4Q6IA 4YDVA 5ICYB 3LSOB 2NTSP 1ZA3B 1DN0B 2BOCA 1R3KB 4D9QE 1UA6L 5KW9H 5FA4B 5DF0A 1NMCC 5ALBL 1MI5A 5DRXA 2R29L 1V05A 1WF5A 1XMWA 4LEXH 4QCIA 2V2TB 3TLRA 5E1HB 4XRCB 5F93C 3IDUA 1I9IH 3HZKB 4JDTH 3DROB 1X5ZA 4OCLC 1HDMA 2R0ZH 2C3XA 1AY1L 1FZKB 4LLDB 4OQTH 1RZJL 2N7AA 5E08H 2FHCA 3O6ML 3ARFB 4J3UA 5E2TL 3QUZC 3TFKD 4UV7L 1FFOA 2VLRD 5E7BA 1WCBA 4BSVB 1YEGH 1X5JA 4P3DB 4KROD 5CSZA 2D7PA 3O81A 4WUUB 1OAZH 2DQHH 5GRYA 4JPIA 1QRNE 3U82B 2N56A 1QD0A 1XCTA 3NA9L 4ZODA 4XPBH 3ULVD 1IT9H 4LVOC 3FAXA 4ORGB 3BIAX 3O45B 4HGWA 3F7VB 3WN5A 2JK5A 3B9DA 3FQWA 4HWEH 1IM9B 2YN5A 4ZD3H 1LEKB 1VGEL 5I18H 3UTQB 4WHTA 4LARH 2EH7L 4PRID 1IFHL 1RUQL 5SV4A 4X99A 4XPGL 4F37F 4ZUUA 2AJVL 4OBSA 4LAQH 1XR8A 4B0MM 1ADQH 2AABL 2AK4B 2HH0H 3NMEA 1ZT4B 1MCOL 4U1IB 4D9QD 2BNQB 5ADOL 2VLJA 3NCJL 1BLNA 4TVSa 1NQBA 3G5XB 3HI1B 2A74A 3B5TA 4M03A 2VITB 3ZSTA 1FBIL 2R1WB 4JZJB 1JRHL 5FXCH 3REVA 2E7HA 2JJVA 4ONFH 4DOHE 4X80L 2Q8AL 3DUSA 3TH2T 4Y2DD 2MHAB 1J8KA 5E2UH 3QXWA 5AUMA 1R3LB 2FB4L 2NXZC 3ABZA 2GSGB 1KC5H 4PRIA 5HXMA 1IL1B 2P45B 4O2CB 2E7LC 1OP3H 4LSRH 2E9WA 5CMAB 3G6AA 4OGAD 1JI2A 2FX9H 4U2ZA 3UTSE 2ADJA 1MREH 4OD2A 1P84J 1QRND 1NFIA 2Z4QB 4UILH 2WBJC 4HFUH 2E9IA 4DEPC 4HS6A 1U8LB 4HKBA 1MHCA 5I74B 4IJ3C 2J4WL 3EYOB 1PY9A 1HH6B 1CZ8L 1MQ8A 3GSVB 1YMHA 3ESVF 4YR6A 2YK1H 2C7UA 5KVEL 1WZLA 3FT2A 3O9WC 5A43C 1QFUH 1IGJA 5CD5C 3O6KL 4HPOL 3RPIB 5GGRY 5DGRA 1KJVB 1S7TA 4PJFB 2BRQA 4WJ5A 4MJ5A 3RDTA 3ULVF 4KRPB 3ZT6A 1NUGA 4TTDD 1T0NB 2YPLA 1SJEB 2JELL 2B1HL 3O3BB 2DLGA 3O3DA 3CMOL 1B0RB 3OL2A 1P1ZA 4M5ZL 4NJ9L 3CH1A 1SBSH 2Y4SA 2HJFA 4O2EA 4I9WE 4R2GC 5CEZH 4JQIH 3KPOA 1Z9SA 2D7QA 4M62L 2FYYA 1LP9B 1SHMA 1KIRB 3B83A 3PL6B 3BPCB 1J0JA 4PV8B 1U2HA 1BBJA 3FT4A 1A6ZB 1E28B 1P7KA 5CILL 1YMME 4RISL 4DAGH 4RX4D 3VXRE 3CVHB 4WY7H 4P2OC 4KK8D 4AK1A 3BWUC 1TDQA 1X6LA 4GBXD 1GHFH 5J6GB 1IGYB 1QSFA 5FHAL 3UTSD 1TZGH 5T3XE 1XF3B 4RAUB 5EN2B 5D5MB 3Q2CA 4GH7B 3Q6FA 3MRRB 1TQCC 3ZKSD 3U30B 4LBEA 4P2CG 2YD7A 4Q9BA 3HI5L 1T2JA 4RBPK 1NGWB 1S7RA 1UZ6E 2AJYH 5KN5B 5BRZA 3RTQA 5F88B 1NGXB 4IRJB 4QXTA 1JN6A 4NP4L 1CK0L 4LNRA 2B1AH 4WO4B 4NYLA 2X70A 1KIPA 1F45A 4ZO6A 4XMLL 5KSVB 1SEBA 3BP4B 1YJDL 1E4JA 3BE1L 4RFEB 2MQ0A 4HUUB 5EBMB 5J13B 4U33A 2I5YL 1AR1D 3SKJL 4I9WD 4RQQB 1Z2KA 2BOCB 1JYWA 1JV5B 4HBCH 4RMQA 1EHLH 1HWHB 3E6FA 4P9HC 3HI6H 3MCG1 5D8JH 5DRXB 3LKPB 3ARQA 5DA0B 1NGQH 1A9BB 1B0GA 5DUPL 5EIIA 5C0BB 4M4PA 1CFQB 1YMMD 3M1BA 4TUKH 3Q6GL 4JAMB 5MERB 3VXRD 3NFPB 5GGVH 3G5VA 4QXUH 4Z7WA 3MNWA 5DVLA 3EFDH 2XPGB 2FX7H 4WCYH 5CJOL 4PP2A 3CLEL 4GW5B 1FFOB 5T3XD 4KI5C 3CXHK 3LEXB 5EZIL 1YYLL 5DUBA 3TT1H 4Z18A 5CSZB 1DDHB 3QIWD 4TYUA 2AJSH 1DBAL 4NUGL 4YHPA 2Z8VC 4TSBH 1TTUA 5DJXB 1CFNB 1U6AH 4QXGH 1E4KA 2QQNH 1FORL 4PRHA 3WN5B 2JK5B 3VXRA 1HYSD 5GZNC 3FQWB 3BAEH 3BZDA 4CVZB 1N3NB 1OOAA 2X89D 1OT2A 5T1MA 2GK2A 2XKNB 3U2SA 1VHPA 5LGKA 5FYLH 4F7TB 1FNEA 4MCZB 2H32H 3QO0B 1TENA 2CXKA 2XN9E 1CGXA 5L9DL 2ZUTA 2PW2B 2EDOA 3U9PL 1XR8B 1N0LA 1X5HA 5HYIA 4LP4A 3SDXB 3PDDA 1ZEAH 3SKMA 2JIXA 1OGTA 4Z7WF 3TO2A 4NJAL 2OYPA 2A74B 4H8WL 1OF2B 2H3NB 1KXTB 1B90A 1IEHA 25C8L 3BT2L 4PRDB 1C16B 4M48L 2VDPH 1SYVA 3EDKA 3QDJE 1DQTA 3MNZA 1IEAA 1WTLA 3C9NA 3KHQA 3OJMB 1MVUA 1MCEA 3I9GL 2HT4D 1KB9J 5I1DA 2CKBH 4OFPA 2H9GB 4M7LH 2C1OA 4CKVX 3CDGB 3MRKA 4WEUD 3G6AB 4LK4A 4M1CD 4KQ4L 3BUTA 5I8CA 2NY2B 1I3UA 3QIBB 3SKOA 2YUZA 4YPJA 5DJ8A 2VABA 4NKIL 4X7SH 4H1LG 3QJHB 4HS6B 1MHCB 4U4BA 1Q9KA 3V6OC 2BVOA 4B50A 1FL5A 1CQKA 1X5IA 2UUDK 5DFVD 1NLDH 1RVFL 4YR6B 2C7UB 1MFEL 2HYMA 3FT2B 4G8IB 3NPZB 3GMOA 1IGJB 2ADIA 1CI5A 1T1ZA 1R5IA 2XV6B 2O5ZH 4KJWC 2MCPL 4GAGL 5EULV 1UZ6F 4LVHC 1ACYL 3DECA 4MJ5B 2XN9D 2W0LA 2GW5A 1NDGA 2CIKA 4KHXL 4Q97A 4GAJL 1LO2H 2YPLB 2QLVB 5EORL 5T3XL 4AEHL 3MYZA 4LSDA 3O3DB 1P1ZB 2EC8A 1JGEB 4HUMB 2HJFB 5C8JA 4I2XA 4O2EB 5IB4A 5HD8D 5MP6L 4RRPG 4I48B 2FYYB 1CT8B 3TBWA 1T83C 3H3KA 2A2QT 3FT4B 3QDJD 1DVFC 4F7EA 4NC2B 5DJDA 4JO3L 1NEZG 5IK3A 3CFDB 2QJDA 4EN3A 2ATKA 1M05B 1E27A 1AD0A 1ZT1A 4DQOH 2APWA 2OS7A 1QG3A 1WWWX 5EZOL 5DRWA 5JO5B 5C07A 3SDDC 1TITA 4L4TE 2Z31B 3CFKA 4ZOCA 1T0MA 4EBQH 2PTUA 4HK0A 3I6GA 1WFTA 4U7MA 3C2SA 1WZKA 4LBEB 4M61B 4PJGA 3SHSA 1QFWM 4XP9L 4QHNB 4FA8A 5BOZG 1U41A 1VADA 1S7SA 4G7VH 1XAUA 3AMLA 4AZ8A 4QXTB 4ZPTA 1ZHLA 3N06B 2ARWA 3VD9A 4OLVL 1XR9A 4JCLA 5D2NA 4LLQB 4J3XA 1DLHB 2VO5A 2X70B 1KIPB 4ODUB 1YNKL 2E6QA 2X1QA 3LCYA 3QDMA 5A2JH 3STLB 4OCWH 3WSQL 4Y1AE 5IW6A 4JQVA 3L7EA 4P46C 1N0XH 1KULA 2VLME 1FG2B 5SX4H 1MF2L 2GTWB 4S1DD 5ESQA 4D3CH 3RVVD 5KTEH 4K8RH 1MY7A 3FN0H 2A6KB 4R8WH 3E6FB 3BVNB 3W9DB 1G0DA 1N64L 3QG7L 3ARGC 4HUKB 4AEIL 3QEHA 3BKCH 4MDIA 1CLZH 5CINL 5HDOA 4XP6L 2PCPA 3GHEL 1KB5B 3MV7A 5DYOA 1B0GB 2OJZL 4XX1E 4UIMA 4UINH 3G5VB 3LKQA 3T0XA 3BMVA 1XF4A 1NGZA 3MNWB 3DXAA 1CE1H 3QUML 4JM4H 4EUPA 4L4TD 1CU4L 4JHZA 3CSYA 3QQ4A 5EDXA 4HBQA 2W9DH 1Q1JH 2J12B 1R3JA 3UBXG 1YEJH 2HVJB 5EOTA 2Z93A 4N0CD 4AQ1B 2A77H 1ZVSA 1NAKH 1DLFL 1DEEA 5EZJA 4AL8H 4YXHL 4PRHB 5J1AA 3N9GH 3QHZL 2XWJB 4A6YA 1BWMA 4WENB 4HDIB 2H2SD 3BSZH 5C0EB 3UC0H 2Q7NA 1AI1H 2UV3A 4FMKA 5ALCL 4N0RA 1A3LL 1T7VA 9CGTA 4L4TA 1F13A 3KAAA 1QQDB 4K7PY 3SQOL 3VFRA 4DGYH 4WFEE 4AJ0A 4Y1AD 1MHPH 1WICA 2VLMD 3BEVB 1I1AD 4BZ1L 1W72B 1AJ7H 2Z9TA 1PSKH 4JN1L 2JIXB 2VWEC 1LO5A 4L29B 1ETZA 1A5FH 5DK0B 5J9PA 1S5IH 4LCCC 3PHOA 4NWTL 2BVPB 5C7XH 3QXUA 1K6QL 3RL1B 1OCWL 1OSZA 4OLUL 5IV2A 3TVMC 3MRGB 7FABL 1IEAB 3VFSA 1MVUB 5D70H 3LQAH 4O51A 4Y1AA 3MCLH 4XXCC 4HG4J 3O2DH 2RFXA 1C5BH 4YE4L 2FHBA 5IMOB 4AIXA 3DMMB 4HKJB 2UWEB 3B5GA 1PJ9A 4Y5XA 3FONB 3RU8H 4B7IA 1BPVA 3PIQA 1XGUA 1T4KB 5IWLC 2FO4A 2VABB 3RX8A 2G60H 4UT9H 4KJYB 1KUMA 4D0CA 2BVOB 1AO7E 3C5JA 1BECA 3ARED 3MV8B 5IBTL 4MA8H 5H35B 1KGCE 1DQLH 2P1YA 1RHHA 1WBXA 2CKNA 1YQVH 2ZG3A 2DYPD 1EV2E 1QFWI 4BH7B 3CSGA 5BV7H 5KSBE 5JDSA 2DQDL 2R4SH 4WFED 2CIKB 4NZJA 1N26A 1V3KA 4XX1G 2H26B 2VXTL 2P48B 3V4PL 4GSDL 3WXWL 2D0GA 4Y16D 5C9JA 4C55A 3H0TA 1I1FA 3ALXA 2EDWA 4I3SL 2YD1A 1CBVL 3O2WL 2FJHB 5C8JB 4XMPH 1LK2A 2BRRL 3OXSA 3NN8A 3AREA 1UA6H 3ZL4L 4FQPA 3ZDXE 1RQ5A 1DBBH 2W9EL 4F7EB 5IK3B 3ZE0F 4EN3B 1MFAL 3IAPA 4JFZH 1KJ3L 1E27B 4Y5VB 1AY1H 1ZT1B 5HSFA 4U05A 5IMKB 3HRZA 2IFGA 3O6MH 3VD4A 3RWDB 3KVQA 3SDAD 3QH3A 5E2TH 3X3FL 3OWEA 5DRWB 2VDQL 5DVNA 1T0MB 4UOW0 3R8BB 2B5IB 1G0XA 3QXDA 3IU4L 4HK0B 3I6GB 2IMMA 5C71A 4LDEB 4OFYA 5D1XB 1JI1A 4N0FB 2I9LB 4JFQA 4PJGB 1CXFA 3SDCB 1SQ2N 3U7AA 1NCAL 1KGCD 1HHGA 1QR4A 1VADB 2DRUA 1KOAA 2B4CL 4ONHB 4P9ML 3HE6D 4ZPTB 4JY4B 1ZHLB 1JWSA 4M7ZB 1F3JA 5BS0B 5D2NB 2D03L 2YR3A 1EDQA 3DX6B 3PP4L 3SDAA 5IESL 4P4RA 5IQ9A 3HR6A 3UPAA 3QDMB 4QLRA 1IFHH 1UKQA 1RUQH 2FECL 3ZDZF 4GG6E 5EWIL 1KLUB 3MQIA 3PWJB 5AWNL 4XPGH 2AJVH 5J56B 3AM8C 2CJUL 2FBOJ 3EGSA 2AABH 1XGYL 1MCOH 2P5WA 1AO7A 1M7XA 1WC7A 2AW2A 4K7PL 4LMQI 4QF1B 3QEHB 4MDIB 3HE6A 3ES6A 2OI9B 4Y5YA 4JM2C 1FBIH 2PCPB 3MV7B 1G9ML 3CFEA 4HV8B 2KKQA 1EMTL 4ZFOA 3LKQB 4R97C 1NEUA 1NBZA 1A6WH 2NPLX 1XF4B 3DXAB 3IDIA 4X0KB 3KPRD 3LDBC 4L3EA 4EUPB 3FN3A 2IH3A 2R8SL 3QQ4B 4MCYA 4I13B 1G6RA 1ZTXL 4K3HA 3OQ3B 1R3JB 2BMKA 2C3VA 2A6IB 2AKRA 3P9LB 5EOTB 4ZNCD 4ZUWA 3BD5A 1QHOA 2G5BB 5DRNB 1A21A 5EZJB 3O6FA 1NFDB 4KDTA 4XNYL 2VDKL 1OP5K 1CZ8H 3FQTA 4YBQD 1ZT7A 4QHLA 3BRFA 4A6YB 5KVEH 2YUVA 3V4UL 4HPOH 5JW5B 2DQEH 3VFTA 3BZ4B 2VERN 3HE7B 4ZFFA 1K3ZA 1AHWA 2EE2A 3IS0X 4KKNA 4L5FL 3T0BA 4APQD 3BD4A 5CD3A 4N5ED 1RJZB 2JELH 4ZQKB 5KSBF 1CIDA 2B1HH 3TJHC 4DKFH 5TDPA 4XPHL 4M5ZH 4NJ9H 2X40A 4CNIA 1MNUL 3DTXB 4BSWB 1ETZB 5J9PB 4M62H 4CMHC 4H0IA 3PHOB 4LGPB 2VR5A 3ULVH 4RAVB 3IDJA 2DM3A 1NL0L 4N9GA 2CPCA 5AYUL 3P4LA 5CILH 3WFEL 3VFSB 1GGYA 4RISH 4F8QA 3ZDXF 4O51B 1GRWA 2ESVA 3QJFB 4WRLA 1T04A 1YNTB 4P5TA 5MEPB 4PG2A 2AK4E 1B4JL 1RURH 2Q6WB 3PIQB 4NBZB 3VWJD 3VFNB 4M7JL 3WFZA 4QRQB 4ZDHA 4R4FL 4QEGA 2VISA 4NHUA 3C5JB 2NLJA 5JTWA 1WITA 3BH9A 4NQEB 3QA3B 4OB5L 1U58B 4KTDL 4NP4H 2Y06L 5LAXA 3O8XC 1J1XL 3MJ7B 5IB5A 1U8IA 3O6LH 4F3FB 4OQ1A 3TPUA 4DZ8B 3RWJA 3MLRL 4F33A 4XMLH 4Q0XL 5T1KB 4JJ5A 3IFPA 1MFDL 1YJDH 1ZWIA 3BE1H 5E5MB 3H0TB 1I1FB 4IBLT 1T1YA 1JWUA 3SKJH 3MA9H 4GXUM 4GG6F 3GSRA 4F7PA 4ZG1A 5C0CA 5AAMA 3QUKA 3N1GC 2AVGA 3TA3C 1F02I 1G9NH 5IMMA 3BN9C 3QEGH 5GSRA 4MD5A 1IM9D 5GS1A 4NSKA 4P23D 3MGTB 1IC4L 5DUPH 5HYQB 3ARZA 2YN3A 2Z91B 1TCRB 2FZ3B 2XIDA 1T1WA 2XWTB 3Q6GH 1T5WB 2HTLC 4LHUA 3MOAL 3WYRA 3IETA 3JV5A 3RNKA 4MQTB 3HRZB 1M7IA 1DUYB 2WQRA 4G9FE 2EDKA 3AC0A 4KAQL 5CJOH 5IR1A 2AK4D 3GI9H 3T2PA 3CLEH 5JPMB 2EDYA 3FB6A 2VDML 3LQAC 4X83A 1HSAB 5EZIH 2QV2A 2OSLB 3RI5F 4P3WA 3QHTC 3QNYA 4KZEL 5DD6B 2WLYA 4HPYL 1DBAH 2QQKL 8CGTA 4BZ2H 5J0BA 1LP9E 1KJ2A 4ZXBA 1MFBL 1A4KB 1MCPH 4GRLB 3L3GA 4KK6D 2V2XA 5D7SL 3P0VL 4POZD 3NIDE 1FORH 3FRPA 2ENSA 3ZTNL 1JWSB 4PJ8A 2OL3B 1D5BA 3EYQC 4YHLL 1MJ8L 2Z92A 4P4RB 4HEME 5J6HB 2FJGB 5KANI 1WIOA 5B3JF 1JGUL 2BX5A 5D5ME 5BV7C 5E8EB 2ZOLA 4P2QB 1WC7B 5E8NA 1IILE 4B7LA 3TWCL 1HSBA 1GL4B 4NJAH 2DKUA 4J1UB 3ES6B 1CLOL 1JPFA 4H8WH 43C9B 2IAMD 4OF6A 5GZOC 1JTPA 1QR1A 25C8H 5LVEA 4DKEH 1KCSL 1QBAA 2OBGA 1J05B 4M48H 4ZFOB 3KLSA 4KRPD 3OAYK 4LDOB 3EO1A 2Y5TB 2Z35B 3I50H 3KPSA 1NPUA 4PJ5B 4G9FD 4C56E 3I9GH 4NO0A 5IB2B 4L3EB 3EYFB 2X4OB 1ND0A 4ZO7A 3SEPA 3CDFA 3HUJB 1UJ3B 1ZLWH 3ZO0A 4MA7H 4QHKI 1OGAB 1RZJC 2XTJC 2XZQH 4RBPH 4HIEB 4EDXB 4HH8A 4HSQA 1RFDH 4V1DA 4ZUWB 4GUPA 4UDTB 4CVXA 5DS8A 2V6HA 2CRMA 4K3JL 4R7DB 3PL6D 3WE6A 3TO4B 3HMXA 5C0BE 1INEH 1VPOL 2EO9A 4IMKC 1KEML 1RVFH 4Z0XA 4JHWL 1K8DB 1X4ZA 1MFEH 4LDLB 4PS4L 4X5XA 1PYWA 4XVSH 3MZTA 1E6JL 1TPXC 5F7HA 4Y4KA 3VFTB 4Y88A 4J4PA 1F8TL 3T08A 5DHXB 4G6KL 1ACYH 4LCIL 4OI8A 4KHXH 3IGAA 3RZCC 5CD3B 3C60C 3WNOA 4ZYKA 2WSKA 5EORH 3OHXA 5T3XH 1AQKH 1R3IL 4KJQC 3SE9L 5F7FA 3NZHH 4P2YA 4AQOA 4HIIB 1Q72L 1T89A 2YA2A 4H20H 1JK8A 5CWSA 2VUYA 5IROA 2J5LC 4FNLL 1Z9OA 1B9ZA 4X8JA 4WO4D 1CDCA 5T5FL 4JO3H 3P11H 4M93B 4W6XB 3N1MC 4C56D 4OZHB 1EA9C 4XVUD 1T66C 2CDFA 1FSKC 4UV4L 4MHHG 1UXSA 3EJYD 4MA1C 5EZOH 1U8HB 2WWKO 3SGDH 4H1LH 3SGDI 3SDXE 1JNNL 2NMSA 32C2A 1CG9B 4OCSH 4MX7A 3J8F7 4YC2B 15C8L 3JV6A 2YXMA 3IJSB 4ZDHB 3UTTA 3GSNB 5C0BD 2DQCL 1D5ZB 3T4AA 4XP9H 3OAZK 3QCTH 2B20A 2K7PA 2DIAA 1FYTE 4S1RL 4OLVH 2QTEA 1LP9F 4MXVE 4POUB 5LAXB 3L3KB 1U0QA 2BVQB 4NQUA 4XNZB 3TN0A 3IVKA 4XGZA 3V6FA 4WGWB 1GAFL 4JFEA 4XB7A 2BC4A 1KN4L 3IFPB 1YNKH 5GHWL 1IAMA 4WFFE 1IC5L 3WSQH 3UTZB 1EEYA 1ZHKA 3OB8A 4CMMA 1F90L 1D9KB 4MA3A 3DETD 4I18A 2C1PA 4C54A 5BVJA 3HKFA 3JUYA 1N64H 2W1NA 4AEIH 3RFZC 4LNVA 4EVNA 5CINH 2VXVL 4XP6H 1QFOA 2LTQC 2YZ8A 3GHEH 2CK0L 3SOBL 4KROC 2OJZH 4LRNL 1QO3A 1T1WB 4U0QB 5TE7H 4LHUB 3CVHL 2PF6A 1T2XA 2UYLA 5FGRA 3UO1H 1KPVA 2EDRA 1HIML 2NY3B 3GIVA 1HHJA 5IHUL 4R90H 3G04A 3QUMH 1WAAE 1P7HL 5FO7B 5J3HC 1CU4H 3MV9B 1FN4B 3B9KD 3FB6B 1LQSR 2R23B 3UTOA 1Q8MA 1UB5B 4YXKL 3R06A 3AY4A 2MOVA 5ID0B 5JW4N 3FRUA 2XZZA 1FVCA 1EXUB 3S5LG 2OR9L 3R0MA 1DLFH 5EU7E 5HI4C 1FYTD 4MNGB 4TQEL 5IQ7L 1I3RB 4YXHH 3RWFA 5F9DC 3QHZH 4AMKL 1D5BB 3KG5A 5E94B 5AG8A 5MENB 1AGBA 1U91B 3MODL 3KPQA 5TH2A 1PZUB 1A3LH 4L1DA 2VLKB 5FM4A 3RRQA 5I1IL 4WFFD 4YHIA 3SQOH 5MHSE 1DUZA 2NY2D 4K2UH 3B9KA 3QIBD 5EU3B 4Y2DC 1XGPA 1IQDB 5BW7A 5KSAA 4U1JA 4I0CC 2ZOLB 2DDQL 4NFCA 4JN1H 1HSBB 1YJDC 5TQ2L 5BMFL 1FFRA 2PO6D 1EJOL 4OGAC 4NWTH 5BJTA 1XF5A 3MLXL 1UADC 2APFA 3D2UA 2IANB 3TH4T 5MEQA 2DQIL 3WIHL 1JYNA 43CAB 3AS3A 5C2BL 4JG0L 3EO1B 7FABH 1XT5A 3TZVD 1WIUA 2DJSA 3AAZA 3WLBA 3BO8A 3NPSC 3EYSH 4HIJB 3UBXI 2YOCA 3KJ4B 3LKNA 3VFWA 3S3PA 1KCUL 1X5KA 2BOBA 4YE4H 3JWNC 4K3GA 5JW3H 5CIPA 4HIHB 5IOPA 3LIZL 4ALAH 1LO3L 5JHLL 1FL6A 4GUPB 1WFOA 4X8XA 5L2KB 3LKSB 2W60A 3LKRA 4JO4L 3WE6B 4TTDC 2PO6A 1MRDL 2XNAB 1QOKA 3WO4B 1ZSDA 4L9LA 3QIUA 5TGBA 5LWYL 3TZVA 1PG7L 2ZSWA 5EZLA 3WXVH 4PRBB 5MHSD 2Z31D 3DBXA 5LBSL 5B3NA 2DQDH 1FNAA 2VE6A 4M5YL 4XVJL 3V4VL 4MZ3A 4MXVF 5C0JB 5CBAB 5K59E 1ZGLB 4JPKL 3V4PH 3PV7A 5INDA 4I3SH 5IB3B 2KH2B 2CK2A 1CBVH 4ORZC 2UZXB 3O2WH 4KK8C 5ICXA 2EIDA 5K9KB 3ZMRA 5KVFL 2BRRH 1ZA6A 5FHBL 5HHNA 1MLBB 4K23H 3FTGA 3NCBB 3QUYA 1MSPA 2WP3O 4PJ9B 2Y7QB 2NY5L 4H8WC 1KJ3H 2N4IA 3I6KA 2UZIL 4OI9A 2HVKB 3IDNA 1UXSB 5DK2A 1FZOB 3LD8B 4PJDA 3K4DA 1I85A 3NGBC 2YD9A 2X1XR 4YBHA 2MFNA 3IU4H 3VRIB 2WQ8A 3W39B 2HN7A 1OW0C 2EYRA 1VCAA 3WUWB 3UTTB 3GB7A 3T4AB 1MAML 5HGHB 3DGGA 4ODSL 5JOFA 2B4CH 3PQYB 4M43L 5F3BB 2EXYD 1JPGB 5ESVA 1JZ5A 2D03H 2ENYA 2BHYA 3ECBB 1X5XA 2BNUB 1HXYB 3SGEI 3TN0B 4AENA 5E6IA 1N2RA 5IESH 2EDQA 4XBEL 1PBYA 4KXZH 4JFEB 4ZNEE 5J8OA 4KXZI 2AQ2A 4KTYA 5FM8A 3PWPB 2UWEE 3ARBC 5I17A 2X4QA 4KJPD 2FECI 1S7WB 2QKIA 2Y07H 3TCLA 1ZHKB 3IDXH 4CMMB 2CJUH 1JUFA 4XCYA 2C1PB 4ISVA 4UAOC 3PUCA 3MV8E 3LEYL 4PD4J 1OLZA 4EVNB 3QULB 1NGYB 4PJDF 1OAUL 3ARDA 1U8JB 3C8DA 1G9MH 1EMTH 4N8CH 1J88A 2KPNA 2PYFB 3H9YA 1WZMA 1VGKB 2LFGA 3SY0B 1KPVB 3DYMA 1NKOA 5IHZA 4ZFGH 2R8SH 1HHKA 1UACH 3SKNB 1HYSC 1BHGA 1U8NA 3DARA 4NZRH 3VFOA 1ZTXH 3TBSB 4KV5E 4RGOL 3I84A 3WHE0 4GFTB 1KCLA 3R06B 3K46A 2HFEA 3FRUB 5DJ2A 1U3HD 3QWQB 4WI9A 2C5DC 4ELME 3CFCL 4XHJC 2QHRL 2CDEA 5ENWB 4CDHA 4XNYH 2VDKH 4FS0A 3CFIC 3RWFB 2OM5A 5F9JB 3BH8A 1ZOXA 4XCFH 3V4UH 3MGOB 4MYWB 1KG0A 5TJWK 1REIA 3QXAB 2MQ3A 3DMMD 1QEWB 2J88L 3RUGB 4HJ0D 1R3HB 4ZAKB 2D7OA 1XGPB 4MJ4A 4Y19B 3WHXB 3Q0HA 4OLWH 3P30L 1G7LA 2GITB 3TC9A 3H6JA 4LPYA 4XPHH 1T1XA 2HT4C 3MV8D 1J10A 2BY1A 3D69B 1HZHL 5K59F 1A6TA 1A7OL 1KB5L 4IIQC 2LE9A 5DEFB 4U6XB 4GRWF 5BS0E 3UTPE 3D2UB 3HG1A 4WW1A 5MEQB 1T7XA 5F7UA 3TNNA 1GGBH 3VDCA 2NY6B 4JPVL 4WI3A 5AYUH 3WFEH 3GJFH 2AQ1A 3PGDB 3BO8B 1PKQA 5L8LB 3O11B 5DHYB 5DFVC 1RJLB 3LKNB 3VFWB 2BOBB 3CVIL 4JREB 4HS3A 2GSIA 4JVPA 1B4JH 4X6DB 3OKNA 5CIPB 1Q9LA 3KYKH 5ANMA 3BGMB 1FL6B 5FK9B 3BQUD 1XZ0A 1M4KA 4M7JH 3GSUA 3LKRB 3WBDA 4R4FH 2RJMA 4LIQL 3MO1B 1RHFA 3MBEC 4MLSA 2IADA 2XQBL 3PWNA 5A40E 4L9LB 3QIUB 5DZLA 5CZXD 3S97C 4OB5H 5IG7B 3B8SA 4KTDH 4UQ3A 2Y06H 5HD8C 4PG9B 4WW2A 5EZLB 2IFFL 3EJJX 4Y4HB 3P0YH 4O00A 2VE6B 3MLRH 2Y6SD 5H8DA 3ILPA 1W72L 5EU4A 4PRNA 3BIKA 1MFDH 3ISWA 4KC3B 3SDCD 2IQAA 1A1MA 1ZA6B 2XY1A 5DVMA 5FO9A 3V2AR 1OAXL 1Z5LA 5TFSL 5DEZA 3RVUC 5BS0D 3UTPD 2OLDA 2ZUQC 5E8DL 1IC4H 4JKPL 1UGNA 5JXED 2BY3A 4BH8B 3MOAH 2F19L 3PNWA 3MRHA 1OT1A 4QHUA 4P99A 5A2IH 1NC2A 3VFGL 1HQ4A 5D7LA 1WLHA 4MSWA 4Z5RA 1UH3A 4QYOA 2X1PA 1ZXQA 5ICZA 3K3QA 1OP5H 2KZWA 5DD5L 5K9OA 4KZEH 3KPTA 4HPYH 2GQHA 5JZ7D 1MFBH 1O7VA 3DGGB 5D7SH 1XIWB 4W68A 3P0VH 1UXWB 3OKLB 3T04D 4S1DC 3VFVA 3GMRB 4ELMF 5ISZE 4G6AD 4YHLH 1MJ8H 3IDMA 3R1GL 4X98A 1UKTA 4AENB 4LU5L 2E9BA 1S9WB 4YIQA 4G80B 3CU7A 3PABA 3TYGL 1PW3A 2A6JA 1BJ1H 4OF3A 3NACL 1CIUA 3RQ3A 5JHDB 2H6PA 1JGUH 2X10A 5DQDH 4JGUA 3VXSA 4X9FA 4WGVB 5GRXG 2W65A 3T1WA 1QSEB 5FCUL 3GM8A 3TWCH 4MB5A 1BJ8A 3UZEA 3A0OA 1CLOH 4H26A 4NQEE 3BHBA 4GKNA 1LK3H 4XNQB 3STBA 3CZFB 5FFLA 1RU9L 3OGCA 1KCSH 4N0CC 1TJIL 2BHZA 2YMXL 1MFNA 4X4XA 2NY1B 5AZEL 2KQNA 5IHZB 4TUOB 1IZJA 1BJ1J 2H2SC 1H3UA 2XXMB 1QBML 1LWRA 1N6UA 4D0DA 3WFHA 2JTDA 3OR7A 2HFEB 5GGUA 1LE9B 2MKLC 2HG5B 2AEIT 4TNVK 3QUXA 2DQGL 5KOVC 1I1AC 4RMSA 5ID1A 1VPOH 5DZNA 3GUTA 4ERSL 1EVUA 3BH8B 3EDEA 4JHWH 5ISZD 4PS4H 4I0PB 5M94B 1KG0B 2FLRT 3P4NA 3L1OL 1HNFA 4MMZC 3MOQA 2B4CC 4I1NB 1F8TH 4G6KH 1G7JA 4ODWA 4R0LB 4LCIH 4HZLA 2BY2A 3VI3E 1UYWL 3IKKA 5E4EC 5FO8A 1BM3L 5CLTA 1DBJL 2HLAA 4KRNA 1R3IH 3DX8A 2J6EA 1L7IL 3SE9H 1T1XB 2G9HA 3AU1A 4UOJA 4Z76B 4E5XA 4DFIA 1H3TA 1UH2A 1MY5A 5L6YL 4XCEA 4L4JA 1L7TL 2EE6A 1CXKA 3RY4A 5IFJA 1IM3A 4NQED 3RWIA 4K71B 1OAQL 4FNLH 3H7BA 3X14B 2Y9RT 3TNNB 3AS1A 2AJ3B 3S4SB 3ZDYE 4PV9A 5D7KE 5T5FH 5T1KD 5L8KB 3OKMA 4FXKB 5K93A 1UEYA 4WHYG 1GZPA 4RWHA 3HFMH 1G9MC 5K9JL 3ROOA 3BPNB 5L0QB 4Y8AA 1S5HB 4HS3B 3OKNB 1GGIH 3O41A 5ANMB 2OMBA 4P2QE 3C6SA 1XZ0B 3U1SH 4NKQB 4OV6F 1NSNH 2NY7H 3IT8D 4U1MA 4N8VA 1UCBL 4NO5A 4M8VA 5JIHA 3GKZA 4HWBA 2O5YL 2DQCH 4A6YL 2EC9U 4Y16C 3REWA 1IEBA 3H3PL 2P24B 1A4JA 1MCLA 3TEUA 3IAGC 3IFLH 5D7IB 3IDGA 1D7FA 4S1RH 4CU7A 4UQ3B 3UYOD 4PJ5E 3EKCA 4ZMAT 5I16B 2CLZA 3PWVA 3QCUL 4UIKL 4EEEA 2DWEA 2EYTB 3HUJE 5F7DB 1RUML 3VGAB 1GAFH 2ZG1A 1RZKH 1KN4H 5GHWH 1F3RB 1FG9C 3EO9L 3FB7B 4PRNB 3BIKB 4S1QH 5EU4B 2HFGL 3BIBX 4JY6A 1LHZA 1OVZA 4YDJA 2VXQH 3TT3H 4MWFB 4U49A 4IHOB 1F90H 2W0PA 3K8KA 4GRLD 5F6HI 2IQAB 3P40A 5JR1H 1AP2B 3OAYH 3T8XB 4M3KB 5C6TH 4CU6A 4NDMB 1KELL 3H7LA 4YDKH 2PYEA 1EO5A 2VXVH 3QQNA 3WEXA 4UTBL 3DVFA 3GMPA 2CK0H 4LOUD 3SOBH 5D7KD 4MHHI 3I2CL 2X7LA 5EC2B 2VN7A 2IBBA 2DLFL 4IOSD 3QUZA 1CXEA 3VRLF 3MRHB 1JF5A 1ACZA 3GHBL 2VH5H 5D93B 2UY6A 4HCRH 4QHUB 1HIMH 5B38B 5IHUH 3QO1B 1HQ4B 3QQ3A 3SN6N 4LVEA 4P2QD 1FV1B 4HFWB 3H9SA 2YSSB 2VIRB 5F8RC 1FHGA 4YXKH 3L9RA 2V5TA 3KJ6L 1K8IA 2OR9H 1MIEL 3G6JB 4EI5A 4JFOA 3V5DA 2YA0A 2UVEA 2I60L 4TQEH 5IQ7H 3IDYB 3VG0L 3HB3C 2GFBB 4L8SC 4PJ5D 2HMIC 3Q3GA 3DPBA 4U6HA 3IDMB 4OZHE 2YUXA 1I4FA 4WIQA 4X98B 4KKBD 3MODH 4EDWL 1ORQA 3PABB 2A6JB 2EICA 1OGAD 3P77B 4MNQA 1JNLL 2NY4B 2G2RA 1T03L 1U8KA 2H6PB 2EDEA 5T33H 3T0EC 4KK5D 3V0VA 2FR4A 2VZTA 2V17L 3EOYG 2WBWB 2VRAA 3TO4D 3EO0B 2VXSL 5I71B 2DDQH 4HK3N 1U95A 4PLJC 1H15A 4JO1L 2ARJB 1NLBL 3QEQA 4UNVA 4ZUVA 5BMFH 1QZ1A 3VWKB 2PTTA 1EJOH 4MD0A 1MCHA 1PEWA 3MLXH 5CD5D 2KBGA 3TIDA 3OGCB 4CUCA 3MLSL 5I1CL 2QSTA 2DQIH 3L3HB 3QDGB 4X4XB 2E7LA 2WINA 3ULUL 4YBQC 2AEQL 2FCBA 4TSCL 3QFJA 3VD3A 1KCUH 3ORJA 2P8PA 1URLA 2ICWB 4Y4FB 3HLAA 3PJSA 2WBJA 3MCKA 1X4XA 1ES0A 1P5UA 3LIZH 1LO3H 5JHLH 4D0DB 4HUXB 3LAFA 5SX5K 3WFHB 5I2IB 4R2GD 1KV3A 3LZFL 4APQC 1RZ7L 3FHQA 5L7XL 3KPMB 1IAIL 3O9WA 4YDIL 3RA7L 2OL3L 3VRJA 2J1KA 4K3DL 3MR9B 5EO0A 4NN7C 5LWYH 4AIZA 2CGRH 1P4BL 4WUKH 3FL7A 1PG7H 2ICEA 5F6IB 3VXUA 3VXQA 4HMCA 1AXSB 4NHCL 4JPWL 3KWWB 3MV9E 3JXAA 3OZ9H 4H0HB 5LBSH 5DLML 3IRZA 5TF0A 4M5YH 3V4VH 3H9HA 1QLRA 4WTZG 3DRQA 5DQ9A 2X4RB 4JPKH 3DIFA 2PR4H 1MRCL 5ITBL 2G9HB 3HUJF 4LKXB 5J89A 1EBPA 4K9EL 3KPLA 4M3JA 4MNGE 5IFJB 4P59L 5FHBH 5C0RL 1K3IA 1TJGL 3RWIB 4DZBB 4ZFOL 1AGDA 3H7BB 2D7NA 4XNUH 4XZUB 1QUNA 2HJLA 2HRPL 4C59B 4Z7UE 4NNPL 5MENE 3MUY1 4J2XA 3LKOB 4P2OA 4XH2B 2NY5H 4ZUSB 2XI9A 1UWEH 1GZPB 1LVEA 3U4AA 2ZPKL 3WS3A 1N59B 5DC9B 2VZUA 5HVHB 1BEYL 3MYJB 4JLRA 1D9KD 4LL9A 5AG9A 4Z95L 3CU1A 3PWLB 1L4IA 5LQBL 4DJMA 2R1XA 3MROB 1TZHA 4XB8A 4O58H 1VFBB 4V2CB 4U1MB 3MZGB 3D9AL 1FNFA 4NPYA 1FRGL 4X4MA 5DJYA 3MLYL 4UI2A 1MAMH 2XA3A 1HINH 2IANE 3REWB 1A4JB 4M43H 3MLPA 2W92A 1VFAA 3SPVB 3DV4A 4XPTL 3MOBH 2GJZB 3IB4A 3GEWB 2CLRA 1J5OH 1G7QA 2E5EA 2BERA 3CH8A 3MV9D 1W0WA 3GKWH 4QRTA 2VB5A 2DWEB 1H3VA 4L8CB 2PXYB 2WW8A 4XBEH 4BQCA 1RZGB 4XC3L 4PJ7A 4OZHF 1P9MC 1UQSB 5L2KE 1BBDH 4LRIC 2WUCH 4G8FB 2B2XL 4J8RA 1MCIA 2VZSA 2A9ML 4PJIE 2FO1A 2LQRA 4U1NB 5CGTA 3LEYH 3VGGA 1HILA 3T77A 3F5WA 2HKFL 3S35X 1OAUH 3WJLC 5MEND 3GMPB 5GZND 1S7QA 5KG9A 3O3EB 1VACA 4ODHH 3WIFA 2X7LB 4NCDA 1C08A 1D6EB 4JZJC 4JKMA 2V7HB 1LD9B 4NRYB 1RUAL 1XH3A 4NQCB 3PHQB 2VAAB 1Y6MR 4M8QA 3MRNB 4POZC 4BFIA 5HYSG 3WUZA 4BZYA 3BDYL 3QQ3B 2X4NA 1VENA 4MAYB 3L3IB 2X44D 2GT9B 1YYML 3FO1A 1C5CL 5HYEA 4HC1A 4RGOH 2AP2A 2GUOB 3GSNL 4F7CA 4AY0A 4JQXC 3EZ8A 3BKML 1A02N 2IAND 3M07A 1CXLA 5CSGA 2QHRH 3EYVA 2QADB 4EI5B 4JFOB 5I1EH 4PJ7F 4Z9KB 2ZSVB 3PDOA 4RMVA 4G7YL 5I74C 3FZUD 5TDOB 3GSXB 2EDLA 1I4FB 5DD0L 4AM0B 3VFUB 1JWMA 3D3VB 5I73B 3FT3B 3G5ZB 2J88H 1IGCL 3UAJD 1CGTA 5L2KD 2FR4B 2R69L 3OKEB 4KRPC 3F7QA 1KIQA 3P30H 5E0QA 1DQDL 5E1AB 4LEOA 3QZWA 1H15B 1TETL 3EDFA 4FTVE 4NGHL 3O4LB 4M9OA 3QEQB 4KI5F 1HZHH 2AEWA 1A7OH 1YDPA 2B0SH 2DB8A 1KB5H 4OLYL 3RVTC 4QWWD 4WDIA 4MD0B 1MHEA 1HH9A 1WK0A 4QXWA 2JKXA 1KPRB 3TIDB 3SGKC 4JPVH 4KJWD 5E24E 1CVRA 3PL6C 4RSVA 4ZSOE 1AKJA 4U6YA 2ZCKL 3PWPE 1Z9MA 4OQTA 4Z7UF 1BFOA 3T1FA 1KLGA 3QFJB 4GQ9H 5E7FA 4F8TA 3CVIH 1UG9A 1CDIA 1YPZE 1U3ZA 3O0RH 3V6OA 2BVYA 3V0WL 5EO9A 4LF3A 5B21A 2DM2A 5EPMA 3QRFM 2M26A 2XWBA 5LGJA 5C08E 4KUCD 3U30C 3VRJB 1NJ9A 3NIGE 3NCCB 4PJ9D 3V8CA 5EO0B 3C6LB 2F5BH 5IJVA 3TIEA 5CEZE 4E41A 1RV6X 1BQHG 4IRJC 3VXQB 3GSQA 2IFFH 4DFHA 3V52L 4HKXA 3GMLA 1CDJA 4FQ2L 4OZFB 4BYHA 4WO4C 2YEZA 5DQ9B 5HDBE 1W72H 1LEIA 3I3EA 1CE6A 2F54A 1UENA 1LDSA 2V7NB 5LKNA 4XVUC 4FTVD 1ADQA 4WFGE 5J13C 2QSQA 4NZTH 3EJYC 3KPLB 1T83A 5JOEA 2W0FA 3W2DH 1OB1A 2R0KH 1BX2A 1DVFA 1DP0A 1OAXH 4NQVA 2AXHA 3RVXD 4TN9A 3U9UB 3MJ9L 1AFVL 5E8DH 5GGRB 4GXUN 1GGTA 3AGVA 4S11A 3LS5L 4WWKA 4PJIF 3S34L 4DTGL 2X2YA 2HFFB 2F19H 3PWPD 4FQHA 1KFAL 1EEUA 1DL7H 3SDDA 1TNNA 1QLFA 3RUGE 3WS3B 5I8OL 3NCMA 2OTWA 4Y19E 1KEGL 2NR6D 4P5KA 3HCVA 3BZEB 4PY8J 1YUHB 4UQ2A 1FVDB 4P46D 5DRZA 2O61B 4XAKE 4FTVA 4KWUA 3D25A 2X1WL 5SWQA 2JE8A 3OKKA 4U31A 4OT1H 2ZCHL 4YHOL 1FGVL 5C08D 4NO2B 5HTSA 5DJYB 1JFQH 4OZIA 3VXOA 2XY2A 4JFDB 2FRGP 1MCFA 3SE4C 3WUWG 3X3GL 4PJXE 4L3CB 3C5SA 4NKOA 4ZSOA 1AGCB 3QWRD 3ZE1F 1OP9A 2EDDA 3BOVA 2ITCA 1G7QB 1W0WB 2A38A 2OTPA 4QRTB 3E3QC 4KUCF 3WKML 3H9ZA 4UNUA 3TYGH 4JGMA 4P46A 3NACH 1YPZA 4PJCE 1H3XA 1K85A 2FIKA 3HZMA 2YC1B 1OLLA 2IALA 4FABH 3DVNA 4R96A 3MV11 5FUOH 3ARGA 4PJAA 4NFDA 4ZTOL 5FCUH 4N0UA 1OAYH 3EBAA 1HILB 3T77B 4Q9CA 2C26A 3V6ZB 1S7QB 1A7NL 1HE7A 1VACB 2W9LA 3WIFB 1S7VA 2NQCA 1RU9H 1N8ZA 3W82A 5CJXC 4G8EA 1DSFL 1XH3B 5DC4B 4TPRL 3D39E 4ZFZB 2YMXH 5I1HH 5AYQA 4ZAKD 3JZ7A 4Y19D 1RI8A 1F11B 1U8PB 3MMEB 1WZ1L 4U1GC 5AZEH 3VXME 4OCYL 5CEXA 1FQ9C 1NBVL 4XAKD 1VKXB 2NY5C 1J8HE 2V5YA 1QBMH 3EJZD 5GIRB 4PUBH 2X4SA 1Y18B 1DZBA 1CLYH 1NMAL 5DXWA 2ZG2A 2HAZA 3QWOA 2NY2C 3QIBC 4UTAL 1NMBL 1U8MB 1FCCA 3SCMB 4OD1L 1YPZF 2NY6D 3SO3B 3T65A 4ERSH 2GAZA 5KVDL 5ACMA 4PJAF 1UZ8A 5C09B 1RK0B 5DMKB 3L1OH 5DURD 4XCCL 3EOBB 1N5YL 1JHTB 3RHWF 4GW1A 4DGIL 3RGHA 2CIIA 1L9NA 4UDUA 3CGTA 1UYWH 1MWAA 4LLYA 3T2OA 1BM3H 1DBJH 5SWSA 1T7ZA 1CDBA 1L7IH 2AJXL 4LEOB 3L3OB 3QZWB 1NBQA 2VL4A 3MFFB 4LCCA 5HDBF 5L6YH 4PRAA 1L7TH 4PJXA 4C83B 4LSTL 2WUBH 3LS4L 5CJ8A 3B43A 1BVLB 3TVMA 3KR3L 4LHJB 1QSVA 2K7QA 3D39D 5I1KH 5C0GA 2EDNA 4IRSA 4PJCA 4XXCA 5IM7A 4U6YB 3VH8G 5D2LE 2E8ZA 3VXMD 4P0DA 2R2EA 5GRVK 2WIIB 2EYSA 3LRSA 1XF1A 1J8HD 4HLJA 2HWZH 4LCYB 5IWLA 3FOMA 4PJEA 5KJRL 3JVGC 1IAIM 1QSEE 2D7TL 2Z31C 3RWGA 2DD8H 3X12B 4JR9L 3DUHA 2ORBH 1HI6A 1UCBH 1YEFL 5LGJB 2YRZA 3BEWB 4AT6A 2O5YH 4G6ML 1NJ9B 1BGXL 1SVCP 1OQOA 3H3PH 2XOTA 2WV3A 3S8WA 1LEGA 1YY8B 3VGHA 2NZIA 5A1AA 3UPRB 3QCUH 4UIKH 4HKXB 4PJXF 1J8HA 1FGNH 1XF2A 3GK8H 1RUMH 5J7CC 2YEZB 1BZ9B 1BQLL 3FQRA 2H32A 3EO9H 3EOAB 1CE6B 3CJJA 4QRPE 4I3RH 1FH5H 1NC4D 1HOCA 3F58H 4PJCF 1XIWD 1EERB 4JFFE 3CPLA 1OB1B 4OM1L 1BX2B 5E9DE 2DWDA 3IYLW 1KELH 3ETBF 4WHYH 5D1ZB 1RK1A 4UTBH 5GRJL 5DEGB 1FFPA 3MRPB 4PJEF 4IS6A 1KCRH 4WWKB 2DLFH 3GMQA 2Y1VA 2AV7A 2VDLL 3SDDB 1JMXA 1QLFB 2CR3A 3GHBH 1NCUA 4NZUL 4X6EB 5CBEB 1L0YA 1U9KA 2EXYC 4UU9B 5K33A 5MI0B 4XVTL 3ROLB 5ACLA 1EFXA 5DGQA 1QSED 1NC4A 2CKBA 4L8BB 5L2JA 1BAFL 3D25B 5SWQB 2GK0A 4IMLA 3CMGA 1TVDA 2XT1B 2Q3AA 3V79C 1RZIA 3H42H 3QFDA 4DWHA 5F3HA 5F7MC 4OBRA 4KJPC 3VXOB 1MIEH 2FD6L 3UX9B 5GPRA 2QR0A 3MC0A 5I1GL 1K4CA 2I60H 2J8UA 3C5SB 1RZ8B 3OV6A 2ITCB 4OFIA 5FKPA 3ULSB 3MXWL 2R2HB 5TE4H 4JRXA 3AM8A 1T03H 2FIKB 3HZMB 4S2SB 5B39A 2ITDA 4QRPD 3V5KB 1NGPL 2V17H 3VA6A 1TXKA 5DVKA 3U4EA 1T3FA 4W4OC 3GGWA 4S1SL 1BD2A 4JFFD 1N5AA 4JO1H 4JM2A 5C0FA 5E9DD 5F1NB 3MUZ1 4CAGA 4XBGB 1NLBH 5DT1L 1CGSH 1F6AB 5IEKA 1S7XB 4I0PD 1CWVA 5D7IE 1TZIB 1Q94A 3UDWC 4M7KL 1YN6A 3KYMB 5B39G 1G6VK 5GRVL 4G43A 1FC2D 3MLSH 1FO0B 5FDWA 1U3HC 5DHVH 5H2BB 4CN4A 4QNPF 3E0GA 2VL5B 1F4HA 3BYYA 4RDQG 4YFEA 2P8LA 4S0SD 4DW2L 2AEQH 3I3BA 1DR9A 4TSCH 4QRPA 1MEXL 2J8UF 3MA7A 1YN7A 4YNYB 3T3ME 5HHXL 1UM4L 1GJIA 3LPWA 3W9EB 5D2LF 4YFDB 4MXWL 2ERJB 3DMMC 1YEKL 3KS0H 4HJ0C 3B3IA 1EO8H 3DVIA 1RZ7H 5L7XH 1CVSC 4PY7B 3WCYA 1IAII 1B6UA 2OL3H 3T65B 3HR5A 4K3DH 4GKSB 2DQJH 1A2YB 3OAUL 3QEUA 4KFZC 1HHIB 4RZCB 2BZDA 2HJKA 4RDQF 1Z3GL 3D0VB 1WWCA 4NHCH 4JPWH 4OLXL 2Y5EA 4XWGL 4P2RB 4UDUB 1FZMA 4OKVA 5I1AA 4M1GL 3QPQC 3BXNB 4OAWB 1DEDA 4HWNA 4L8DB 4LSVH 4PYGA 1ULVA 4IOIA 4PGJA 4DVBA 3F6IA 2YPKA 5I15H 3SKUD 3X11A 4PRAB 1WBZA 2F53E 3P2TA 4QGYA 2V9TA 2FNBA 4XTRD 5GQBA 4P59H 3RWEB 3CFJA 5GJSH 1CICA 1KF9B 1C7TA 1R5WB 3AB0C 3BQUC 2HRPH 3EZJB 3O8XD 3OXRA 4NNPH 5DSCA 5TDNA 3FQNA 1KTDA 1TMCB 2A6DB 4DGVL 4IRSB 1WTGT 1QBLL 3E1F1 4MJIA 3FB5A 4Z7VA 3Q5TA 2R2EB 4Z78A 4EN3C 6FABL 2J8HA 4FQJL 3S4SG 2VDRH 2ZPKH 4LCWB 3GMMA 4Y5VC 1BEYH 5CZXC 7CGTA 5IKCA 4FQLH 5LQBH 1JGDA 2CSPA 4X6CA 1YEHH 3QNZA 1W0YT 2CDGA 3D0LA 1QKZH 2B5IC 4JHAL 1HI6B 2FBJH 4YHYC 2Y6SC 2NZ9D 3D9AH 3TA3D 5E4IA 5FYKL 5E03A 1MUJA 1RSFA 3BN9D 5D1XC 1FRGH 3MLYH 4HKZA 1IC1A 2JCCA 1IAOA 3TYFA 3K2MC 4CU8A 3O8XA 4Q9QL 3QDGE 3SDCC 1FFNA 2IEPA 4XPTH 4I5BA 1R0AL 4M4RA 4HQQH 3GI8H 4JRWA 4WNQB 4M7ZC 1G9EA 3HS0A 5D2NC 2YD5A 5E5UB 1B3JA 5D9SA 4Y2OA 3K8MA 3IU3A 4EIGB 3FQRB 4XC3H 2H32B 4D8PB 1DQJA 5GJTL 5JXEC 2OK0L 5I19L 4JANA 5E00B 2VLLB 4PJHA 1HOCB 2F53D 4Z7VF 3P9WB 4M6NL 1JIBA 2A9MH 1NAMB 4G6JL 1CFVL 3KYNB 2HKFH 5IBLD 5FA3B 5FGCB 5GSVB 1RK1B 1FFPB 1O5DT 4IS6B 4MB4A 3L7FB 2OI9C 1R24A 1X5AA 4X6CF 3GMQB 5KZCD 1RUAH 2NY4D 5JZ7C 4PP1D 2P5EA 4I4WB 4JFHE 4N1HB 5ECJE 3C5ZB 5FGBC 5I1LA 3LQZA 3QRGH 3S96A 5KS9A 3DRTA 2JCCF 2AGJL 1OSPL 4LLAA 1S9VA 4XP5L 4G6AC 2CKBB 1YYMH 5EH1A 2HP4A 2OMNA 3O2DA 2GTZA 5B38G 2R4RL 5D7JB 2I27N 3KPNA 1RZIB 3GSNH 1NH6A 5F3HB 3RGVB 3FB8B 2MNUA 3ARSA 1NKRA 4JRYE 3T3MF 3JTTA 5GZOD 2VYRE 5JW4R 1A7QL 3QDGD 1K4CB 4ACPA 1K2DB 5EOCL 5J57B 1KT2B 1PZ5A 2XA8H 3M45A 4OM0L 4D2NA 4PJHF 3IXTA 5DD0H 5IT2H 3GSWB 3LN4B 4Y4FD 5F97E 3WFBL 4EOWL 5FAAA 3V9FA 3KYOB 3HE7C 5IVXE 4GKOA 4FFYL 5IB1A 2R69H 5TF1L 2AEPL 4CRPA 1YEDA 3THML 3U4EB 1T3FB 4NKDB 3VXPA 2EDTA 4XP4L 4YHML 1JTOA 5H94A 1TETH 4JM2B 3U7WH 5F44A 3B6SA 4NCC1 3WO3B 2MKWA 3Q1SL 1O7SA 2ZOKA 2EH8L 3MREA 3I02B 3SO5A 3DV6A 2BK8A 4G43B 4JDZB 1T0PB 2K9UA 1MJJA 4JFHD 1DE4B 1WVZA 5AD0B 3UJJL 5T3ZE 2E27L 3JWDL 1JMZA 5TE6L 4CW1A 2OTUA 4R26L 3RZCD 3C60D 4PTUB 4NFBA 4N90E 4YAQA 1YN7B 2JB6B 4JVUA 4KJQD 3L6FA 4PGEA 2CRYA 5F9AC 4RFNB 3GRWL 4PGDA 3V0WH 1IGTB 1TJHH 4TUJA 4JRYD 1J12A 4IMKA 4MXQD 2F9BT 2F5AL 4UOW1 5B8CB 3SJVB 4KI1A 1EAPB 4QOKB 4XCNA 5DMYA 1UB6B 1QHPA 4NQCE 1BP3B 2NXYB 1OTTD 4RMTA 4U1LB 1BVZA 2LU3A 3TNMA 3RZCA 1JF6A 2YPVL 5HPMA 3EW3B 4D9LL 3V52H 5CEYA 2XKSA 3JBG7 3GFUA 3VU2A 4UNTA 4PRPE 5JOPE 4NO3A 4WFHE 1CD1B 2BVUA 3RVWC 3X13A 1TCMA 5BZDB 5HYJB 4LCUA 4JRYA 4Z7NE 2YD3A 4KMLB 2H8PA 1UJTA 3KPPA 3HNVL 1CICB 3DX7A 1NBYA 4RIRA 2AJUL 4X7TB 3MJ9H 3ZSSA 5EA0L 4K55A 3IRPX 5DSCB 3OXRB 1VSCA 4FQCL 5ERWA 4JKKA 5T3ZD 1KTDB 2PXYD 3LS5H 4LPVA 4FQXB 3S34H 2VDNL 1UVQA 3FB5B 4P5MA 1CFSA 2YWYA 4G8GE 2SEBA 2O93L 4N90D 2Q3ZA 4QTHA 1KEGH 3V5HB 3TH3T 1IQWL 1EEQA 3HMWL 3L95B 4LQFL 1ORSA 4MGXA 4Z77A 4HUVA 3K1KC 4G6FB 2YBRB 2NW2B 2CDGB 1G7PA 1I9EA 3JSSA 5L8JB 2ZCHH 5HHQA 1INQA 1FGVH 5I0DA 3QCVH 4YPGA 1MUJB 5CCKL 1CCZA 4HKZB 1IAOB 4NQCD 5F89A 3NH7L 3MV01 4WI7A 3OF6D 2MCG1 3X3GH 2FX8H 5I8EB 4GRLC 4I5BB 4FRWA 4GAYB 1V3JA 2VZ3A 4I3GA 2N1KA 1S9YB 5TPWH 2GY5A 4MAYD 3E6HB 3HS0B 5J06A 1I8KA 1T20A 1S78D 1Y6KR 3HN3A 5J3HD 3IU3B 4PRPD 4RMRA 4LOUC 1JL8A 3MRCB 4LPTA 5GISL 5JOPD 2WBKA 1FVEA 3N1PC 3OB0K 4WFHD 1DQJB 3WDIA 1GVIA 4BQ8A 1GZQB 2NX5B 3MXVH 2VLRA 4Z8FL 1BFVL 3VMOA 4XMKL 4EIZC 2QADD 2APBA 4ZTOH 2Q76A 3HAEA 5FYJD 1JCKA 1A1OA 5IVXF 5HI4D 3VFPB 2JB5H 4HAGA 4QRRB 2EDBA 2FJFB 1C8PA 5CP3H 1A7NH 4K9EC 1AC0A 1R24B 3QG6A 5BXFB 1MH5A 2XZAL 1DSFH 1OD9A 3WFDL 4TPRH 4G8GD 5FB8A 2VQ1B 3BGAA 2IQ9L 1XEDA 3HAEG 4XT1C 3UEZA 1PLGL 3S96B 1CF8H 1YA5A 2NY0B 3DRTB 5KS9B 4OCYH 2C4XA 4EXKA 1P4IL 1NBVH 3CX5K 4HH9A 3S6CA 4PREB 5MEOA 4KKBC 3BP5A 1H8OA 1FNSH 4FQQA 4HLZG 1A7PL 1UJ3C 1T22B 1NMAH 3P4MA 2YD8A 3JUZA 1YQ2A 2XFXB 2A73B 2C4FU 5D1QB 4LSSL 4UTAH 2WLZA 5EOQL 4KK5C 1A1NA 1NMBH 4NQXB 3HNTL 3O3AA 2WZPD 3TO4C 4HJGA 1KYOJ 4OUOA 2IPKB 5I66B 4G8GA 2DBJA 5T3ZL 4WU5A 4PLOB 4LPXA 4FP8L 4OTXL 4Y2DA 5DQJB 3C2AL 1CS6A 2OJEB 5J1TC 4KY1L 3GJEB 4OUUB 2AJZA 4DGIH 3RNQA 2R15A 4L4VB 1J11A 3WS6C 5EU6E 1CDUA 4FZEL 4R3SB 1QA9A 1WFUA 5SWZE 4UUJA 1T2QL 2AJXH 1M7DB 3C8KA 1XGRA 1LO4L 2Q86B 4JFDE 3C6LD 4LSTH 1QRNA 2PW1A 3QNXA 2ZOKB 1F2XK 4HX1A 4MVBD 5CHNB 4Z7NF 4O2FA 1CD8A 4NRZA 4R7NA 2OXGA 4U6VH 2LAAA 4CW1B 1E6OL 3VE0B 4WU7B 2FL5A 1AIFA 4M93C 3TBVA 4OZGE 3ARTA 3U4BH 1NCBH 2GI7A 4PGZA 3OMZA 1NCCH 5KJRH 1SEQL 4ZPVA 2D7TH 4PG2C 4TUJB 4JR9H 4OSUH 1KNOB 3MLVL 1YEFH 3D6GA 5FYJL 1D5XA 4G6MH 3H3BC 3QAZB 4XCNB 2FEDD 4KGJA 5H37G 1Q0YL 2CO7B 2M2DA 3RY6C 2Q7YA 3BN3B 3TNMB 1TQBB 1U92A 2IH1B 2GCYA 3KDMB 1EEZA 1MCKA 5EIQA 1J0HA 4BQ6A 4X7CC 5EBLA 2IGFL 5IMLB 4RNRA 3QYCA 1FDLL 4RX4A 5EU6D 1HQRA 1I7UA 3HPJA 4HHAA 3FO2B 4NQDB 4LKCA 3ARPA 4NO3B 4OF5A 5SWZD 5DR5L 2FSEB 4K3EH 1Y0LA 4GBXA 5J11B 4OZFG 1IC7L 5F7YC 1MWAH 3UTSA 3IF1A 4JFDD 2H8PB 1AQDB 3RKDD 1TVHA 1D9KC 2KZ1B 2FWOA 4Q6IB 4YDVB 3FQUA 2WMPA 5FUZL 3MJ6A 1KXVC 2DMCA 3MRDA 5KANG 4WV1A 5GGTL 4GMSH 5E99L 5C09E 1MJUL 5ERWB 1AC6A 5IVZA 4CVWA 3L3DA 3SE3A 1MI5B 1UVQB 2VDLH 4QCIB 1IZKA 4ETQA 1I75A 4NZUH 3ARBD 2WAHA 3T4YA 3RAJL 1HDMB 4HUVB 2BFVH 5DJCA 1ED3A 2Z0BA 3LV3A 4XVTH 3T2NL 1OW0A 2NY3C 5HBBA 3ME0A 2DQFA 3MUGA 3WNPA 3K80A 3UJTL 1F6FB 4N0YL 4ONGH 3WL9A 1WCBB 1F3DH 1CQYA 1OD7A 5DJ6A 1AH1A 2Y25A 5KBNC 4FQ1H 2CLVA 2HLFC 3EIFA 5I1GH 3U36A 4JPIB 1XCTB 2D3VA 5JLZA 1YEIL 5LGHH 1CGVA 4OZGA 1YMMA 1I8KB 2P43B 3FOLA 2R2BA 4HGWB 2ADFL 3HC3L 3NCEB 4KKAC 1A3RL 1JZ4A 4EKXA 1ZLUK 2R56L 4GMTH 3FQXA 1NGPH 4WHTB 5CGYC 4MS8C 4MD4A 4XI5C 1KENL 1MCDA 4X99B 1Z0MA 4XHJD 1A1OB 4ZUUB 3FAWA 3QB7C 5J12B 4AH2A 3QIWA 4NCC2 5C09D 4M7KH 5L88L 2VKXA 2VLJB 4DKDC 1BLNB 1M1SA 4ELKA 1OM3H 3VFMA 3NZ8A 3REVB 4GKZA 3PGCA 3DUSB 3TJEL 3P4OA 4DW2H 2X89A 4PJBE 3GZKA 3INUH 1ZVHA 3OKOA 4OFVA 1MEXH 2EKSA 3FZUC 4HH9B 5AUMB 4HXAH 3BP5B 3KJ4C 4H1LA 4PRIB 5HHXH 2OZ4L 1XCQA 1HN1A 1XGQA 3T3PE 4G5ZL 4MXWH 2N7BA 4OZGF 1YEKH 1KBGL 5GGSA 1W0VA 4MQXC 1KN2L 3UAJC 3MLTA 3MRBA 2ADJB 1D6VH 1C12A 4OD2B 12E8H 4PFEA 1NFIB 1GGCL 1MLCA 1WWBX 2H45A 2A0LD 4HKBB 4U1KA 3WO4C 3PG2A 5BVPL 1BREA 4QWWC 1YMHB 1Z3GH 1DQML 5HVWA 5B22A 1MCJA 3QR2A 3V0AC 4XPAL 2DS4A 4OCXL 5DD1H 4NM4H 4CBPA 4M1GH 1QA9B 4K94L 1S7TB 5I6XB 4RRPA 4WJ5B 3RDTB 2D7MA 1QSZA 1FIGL 4IIQA 1EUUA 5F7EL 1JPTL 1X44A 3MBED 3MRMA 3S36X 1P84K 3ARVA 1NEZA 2PW1B 3MLUL 3QNXB 2MTPA 2BSSA 1KYOK 4HX1B 3VD5A 3CH1B 4NZDA 4RGMB 1Q9WA 1S9XA 2DJ4A 5JIPA 1DQQA 2CRIA 3KPOB 4X9BA 5CP7A 1QBLH 3VD7A 2FL5B 1AIFB 4PJ9C 1BBJB 4BKLA 4F57H 4NT6A 4X4YA 1P7KB 3KXFE 3PWUA 3QUMA 2Z8SA 2XN9A 5DFTA 1I7TA 1F5WA 3OKDA 3LD8C 4ZPVB 1KLFA 3L5IA 3BKJH 1I8LA 4JHAH 1OP3K 1QSFB 4LAJH 5D1ZD 5IHBA 3RVUD 1BQSA 1RIHL 1D5XB 3X17A 3VCLA 3Q6FB 4HS8H 5CLWA 1R0AH 1F00I 1S7RB 4KK9D 1DBML 1EEZB 5JUEL 3QDJA 5BRZB 3HHRB 5EBLB 3RTQB 3RVXC 3WDHA 1WCQA 3B2UD 3E8UL 4OGZA 4RNRB 1HCVA 1Z6JT 4NUJA 1JN6B 1ZANL 3TN0C 4MQ7A 4LNRB 3K2UH 1U3JA 3KLHC 4RFOL 4OF7A 4GBXB 2OK0H 5I19H 4NYLB 5ITFA 3F12A 4BSJA 3D85D 1EHAA 3UTSB 1ONQA 1SEBB 1G1CA 4KMTL 2NTFA 3W5MA 4M6ML 2NR6C 3MJ8A 5KW9L 1S3KL 5ACZA 4G6JH 1CFVH 2XXCB 3MRDB 4WV1B 2L0DA 4LEXL 1BIHA 4CL7A 2B7DT 1I9IL 1I3GL 5LG1A 4W4NA 4U1SA 3ZTJG 5HHOE 5C2UB 4LLVA 3NGBB 4W6YB 5EIIB 4ETQB 5HGBA 5FKAA 3M1BB 3KXFD 3T4YB 1IJ9A 3UBXA 2VSCA 2AGJH 1FNLA 1OSPH 2ID5A 4XP5H 1PFCA 1YEGL 2D9QB 3D85A 3BMWA 1V8HA 5C92A 4Z7WB 4PP2B 1EGJL 1BJMA 2R4RH 4PJBF 1OAZL 2DQHL 4CN1A 2GJ6E 2XYCA 4JEGB 5DJ6B 5DUBB 1IT9L 2JJUA 1A7QH 1I8IA 5HGAA 3T3PF 1I7ZA 2C9AA 3U36B 1BF8A 2V2WA 4YHPB 5JLZB 2BNRE 2LVCA 4ZD3L 4KZDH 3IJHA 2RIKA 5I18L 3KXFA 4LCWE 4LARL 3VXRB 4EJ1C 1AE6L 1FLRH 4EOWH 4NRXA 1MCWW 5DI8A 4GW4A 5T1MB 3HA0A 3I75A 3MNVA 3U2SB 4FFYH 5TF1H 4ZTPH 3THMH 4PYHA 4ZAKC 1FNEB 1HWGB 2HH0L 4LVNB 4W6WB 5GGVY 4YHMH 1N7ML 4I0KA 1P7QD 4JFPA 3W0WE 5HHVL 3Q1SH 3QIWB 2BSRA 1MCRA 3QI9D 4MDJA 4HGMA 2EH8H 1KTRL 3EJZC 3SKMB 1MVFA 1OGTB 2P8MA 4OD3L 3TO2B 3LRHA 4A2MA 1KTKE 5HHOD 3UJJH 3OGOE 3QDAA 5TE6H 5JQ6L 1ZHNA 3DI3B 4GKZB 3PGCB 2NY6C 3ESUF 3P4OB 1UFUA 3DX9A 3OKOB 1SYVB 4LSRL 1U93A 3MNZB 3C9NB 1H3WM 1I1CA 1MREL 2GJ6D 3DSFL 1D5MA 1P7QA 3GRWH 1ZS8A 4JREC 5I1DB 5HGGS 4GG8A 1I1AA 2C1OB 1W0VB 5IGXL 3MRKB 3MRBB 4KRLB 2F5AH 3O4OB 5I8CB 2ZUSA 1NDMA 1U3YA 3SKOB 1H0DA 3L5WA 5DJ8B 2BNRD 1TVBA 2XG4A 4HF5L 1Q9KB 1HEZA 3L5JA 3QIUC 4LCWD 3K8LA 1FL5B 4U3HA 5DMJB 3GNMH 4UT7L 2YPVH 4D9LH 3GMOB 4OZ4A 2ADIB 1T1ZB 1QFWH 1R5IB 4Y4HC 4TULL 1KB9K 1NDGB 3OJDA 4P3CH 3W0WD 3TV3H 1ZV5A 4JQIL 2VQUA 3VI4E 2BSSB 2BNRA 3IXAA 3WDJA 3FFCE 1FO0L 2C4FT 4I2XB 2AJUH 1Q9WB 5EA0H 5IB4B 1ODAA 1DQQB 4FQCH 3U0TA 4XP1L 1UWXK 4DAGL 1QYGL 2JJTC 2VDNH 3TBWB 5ALBH 3BW9A 4F2MA 2MQCA 2R29H 1PQZA 4Q6YA 2EDHA 4NT6B 2DYPA 4X4YB 5DJDB 2ICWI 4NOFA 5E6ZA 3PWUB 2ATKB 3HMWH 4LQFH 3T0EE 2AERT 1TZGL 1AD0B 2VOTA 1RZJH 2AXJA 4Y0GA 3W0WA 2RR3A 1P53A 5C07B 3KPRE 4UV7H 4Y16A 2J8OA 3BYTA 3CFKB 1RY7B 4EI6A 3VXTA 3M8OL 1KIUA 3GMNA 3VCLB 2AJYL 1FNGA 1SY6L 3PGFL 5BZWA 3C5ZD 1XFPA 1XIWC 3NA9H 5C0AE 1S7SB 1BVKA 1KTLA 2BSTA 1W8OA 1XR9B 4FFZL 5EUOE 5GISH 4F9PC 1VGEH 1JJUA 4FMFA 4NC0B 2EH7H 4Z8FH 1BFVH 3BDBA 4P4KD 3MJ8B 3SJVE 2G5RA 3TBTA 5IW6B 5D8JL 3L7EB 2D31A 3FFCD 3LH2L 4X6FA 5ESQB 3HB3D 2HMID 2I07A 5ADOH 3NCJH 4TUKL 4U1HA 3U0WL 5GGVL 3V8OA 1P2CA 4ODVL 1A0QL 2CMRL 3LPGA 5DYOB 1JRHH 3EFDL 5HGBB 2FX7L 3GJFA 1JRHI 2IQ9H 5KSBA 4X80H 2Q8AH 1PLGH 3T0ED 4UIMB 5F70A 5FM5M 1P4IH 5HYJE 2FB4H 1NGZB 3PXHA 4PLJD 3DGCR 3O2VL 1G7IA 1A7PH 2AJSL 4GXVL 3CSYB 1X9QA 1BQUA 1E4XL 5IJKC 4LSSH 4L8SA 2QQNL 5F7NC 1I8IB 3HNTH 5HGAB 1J0IA 5HDQL 2Z93B 3TBYA 4X9GA 1RPQA 1ZVSB 4O5LL 5C0AD 1ZLSL 1NFKA 1DEEB 1O0VA 1OAKL 4TVPL 2FGZA 2J4WH 5T3ZH 1PDKA 2IWGA 1JZ3A 1SMAA 5J1AB 4FP8H 4I0PC 5FV2A 5FEBA 4KY1H 3A67L 5DI8B 3GIZL 3EFFA 3O6KH 3I75B 4R0LC 5T1LD 2PETA 4FZEH 3KPRA 3SE8L 2DTML 4L4TB 4MJ6A 3VFRB 1GYAA 1T2QH 3HZYA 3SJVD 1NAML 1LO4H 2NXYD 3NABL 4PGBA 2BSRB 2VR9A 4U0RB 4WUUE 3CMOH 4XWOD 2EIZA 2A83A 1V3LA 3HAEH 3D87B 2P8MB 2C3HA 1LO5B 2Q20A 1UEMA 2CRZA 4K71C 1AGFA 2NW3A 1E6OH 4QRUA 4NKMA 3IFOA 4HLZH 5IF0A 1OSZB 5IV2B 2CKBL 2X4UA 5HYJD 3ALPA 4CGTA 4GG6A 5JMOC 1SEQH 4APQA 3BPNC 4O4YL 4Y1AB 4FG6D 5L0QC 5CJBA 4GG8B 5FOJA 2RFXB 4X7SL 5CGMA 4H88L 5FHAH 2APVA 5F8QC 5FYJH 4Y5XB 2BNQE 4OFDA 4X7EC 1XGUB 3L5WB 2KL6A 1Q0YH 2FO4B 3UXFA 4YXLL 4XBPA 3P0GB 1HEZB 3HI5H 3OB0H 4D0CB 2O5ZL 3CZJA 4LLUA 2FATL 4XTRC 5E4EB 2IGFH 3BUYA 1RHHB 1WBXB 4G6FD 2JJSC 4H25A 3ARFD 4OZ4B 3G5YA 1CK0H 5C0DA 3VGAC 5DR5H 5JDSB 3LSOA 4J3SA 4HG4K 2OX5A 1ZA3A 2VMFA 4JVWA 1JGVL 1CGWA 1R3KA 5EUOF 5F71A 4GRMA 4WUUD 5C9JB 5E95B 3VWJA 5F9WB 5FUZH 2I5YH 3IXAB 5GGTH 2V2TA 1LK2B 1GIGL 3HZVA 4XRCA 5E99H 3OXSB 3NN8B 1MJUH 1YC8A 3AREB 3U0TB 3DROA 2NZ9C 3RIAK 4LLDA 1FZKA 3BW9B 3CFBA 3K81A 1JZ7A 1PQZB 3BI9X 2DYPB 3EAKA 2VC2L 3WJJC 5D93C 1T6WA 3VW3L 4PJFE 4EBQL 1IE5A 3JWDC 4P49A 3VGFA 3T2NH 2DIBA 1MQKL 5H37H 4P3DA 2QSVA 3GBNL 3QH3B 3VMNA 4NOBA 3UJTH 4N0YH 2BNQD 3QXDB 4EI6B 3VXTB 5F7KC 1YYLH 1FNGB 4PB0L 4G7VL 4ODTL 1W2KT 3O45A 2J2ZA 4JFQB 3F7VA 3R4DA 4NUGH 1CYGA 1OPGL 1IM9A 1HHGB 3IDYC 4P23A 4YBLB 1LEKA 3UTQA 1BVKB 2R1YA 4OZFH 1KTLB 4F58L 1P9MA 2EEDA 5IBLC 1QVOA 1F3JB 4XXDA 3HC3H 2HT2D 2IBZX 4LRIA 2R56H 1N0XL 2NY4C 3SDAB 4PP1C 5ADPL 4D3CL 2AK4A 5D1QD 5IQ9B 1OQXA 5KTEL 2E8YA 4K8RL 1ZT4A 2DQTL 1KENH 5F1IA 5L9DH 2DJUA 3TP4A 4PBVC 3G5XA 3U9PH 3HI1A 3ZYZA 5I71C 3EGSB 2VITA 4JZJA 4JN2A 5HVGB 2P4AB 2P5WB 1H8NA 1AO7B 3HC0A 2I07B 3BPOB 1E4WL 5L88H 3LQMA 2MHAA 4U1HB 3VWKC 1A6VL 2VQTA 1R3LA 3HE6B 2GJJA 2A9NL 4Y5YB 5F1OB 2GSGA 4L4VD 4M1DL 3RBSA 3GJFB 5KSBB 3CFEB 4KKLD 3TJEH 5I9QB 1EZVX 3BT2H 4NQDE 1IL1A 4O2CA 2VDOL 1VEOA 1Q1JL 1NBZB 5CMAA 4XNXL 3IDIB 4JQXA 1YEJL 2OZ4H 1CTOA 3FN9A 1SMOA 2IH3B 4G5ZH 4Y4FC 4GQPH 1CN4A 4J6RL 1G84A 4MCYB 4TOYL 1G6RB 3RVTD 1KN2H 1U8LA 4AL8L 3EYOA 4KQ4H 2BMKB 2C3VB 1HH6A 2AKRB 4LGRB 3GSVA 4WEMB 1GGCH 1MI5E 4NKIH 3RPIA 2IAMA 3RIFK 1AI1L 3O6FB 4OJFL 3FQTB 1ZT7B 2IG2L 5BVPH 4QHLB 4PJFA 1DQMH 3UROR 1GXEA 1MHPL 5F6IC 3ARYA 4G9FA 5F96L 1SJEA 2MCPH 4ZFFB 4GAGH 1JYVA 3O3BA 4K94H 1AJ7L 1AHWB 4E0RA 1PSKL 1T7YA 1FIGH 3UYRL 4GAJH 5D71L 3RP1A 2YRLA 4X9IA 1A5FL 1J7VR 1JPTH 1JE6A 3OJ2C 4PGBB 4AEHH 5E2VL 1S5IL 3IKCA 3MLUH 5TDPB 4QHKJ 1LP9A 3SGKA 1KIRA 3PL6A 3NOIA 3BPCA 3DOSA 4CNIB 4PV8A 4ZS7L 1A6ZA 1E28A 5MP6H 3K4ZA 4IRJD 2NW3B 1I9JL 3QBTB 4MXQC 1MRFL 5D70L 1OWWA 4QRUB 3E3QE 3CVHA 3IFOB 4NKMB 4NQDD 4BJLA 5IF0B 3IDJB 1AGEA 3MCLL 4N9GB 2X4UB 2DI7A 4HCRA 5J6GA 3CSPA 4F15B 1OTTC 3GBML 4F37K 4GG6B 5HVHC 1XF3A 4RAUA 5EN2A 5D5MA 4APQB 4WWID 1B0WA 2ESVB 1A64A 3MRRA 1T04B 4P5TB 2EZ0D 4UT9L 4PJFF 3D48R 2P7TA 1WGOA 1RIHH 3SBWC 3ZYIA 2ILLA 4MA8L 1NGWA 2X42A 2VLJE 2A1WL 5KN5A 1MI5D 5F88A 3JV4A 1NGXA 4IRJA 4RA3A 3WMSA 1YQVL 3WKNA 2VISB 4NHUB 1ZLUH 1KCKA 2NLJB 4YH6A 4WO4A 4YO0A 3BH9B 3BUYB 3E8UH