4KROB

Nanobody/vhh domain ega1 in complex with the extracellular region of egfr
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
128
structure length
116
Chain Sequence
QVQLQESLSCAASGRTFSSYAMGWFRQAPGKQREFVAAIRWSGGYTYYTDSVKGRFTISRDNAKTTVYLQMNSLKPEDTAVYYCAATYLSSDYSRYALPQRPLDYDYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/immune system
molecule keywords Epidermal growth factor receptor
total genus 16
structure length 116
sequence length 128
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroB00
4LSVL 1MCDA 5I1GL 1RK1A 1NMCC 2QSTA 4XPBH 1TQBB 1P6FA 2E7HA 4PPTA 1ZLWK 5HI5D 3MV8D 1IBGL 4XP9H 1KEMH 1QHPA 2ZG1A 1I8MA 4KTEH 1IM9D 2C7UB 1FAIL 2UY6A 4NRXA 4NQSB 2ZCHL 5CJXC 3AS0A 2UVEA 1A6ZB 1RY7B 1AGEA 3EOYG 3EJJX 1JVKA 3VXPA 2CH8A 3QULB 2NY3C 3MLRL 4FFVC 4YFDB 1NEZA 4F7TB 1EAPA 4ZXBA 2P8LA 2EO9A 3QNXB 2DS4A 1NDGB 1AC0A 1HKFA 4MA7H 4GT7A 4JQVC 1WQVT 3H42L 4JGUA 5HGGS 1AGEB 3MC0A 4LARL 1MHHA 1N6QH 3P30H 4KTDH 4Y4HA 2RFXB 3QA3A 3MJ6A 4WI7A 3AM8A 3SCMA 1U8JA 3X3GH 4Z7QF 4PTTB 4MJ4A 1X6NA 3VXSE 3PL6D 3MCG1 4NKIL 1TCMA 4MNQB 1XR9A 2PO6B 4XP1H 2CDEB 3H7LA 1MAJA 4JFYB 4P2RA 3HCVB 3BZFA 1S7TB 4PJCA 3CFJB 5GGTA 4DTGH 4HHAB 2DQIH 3TVMC 3ARDB 4KWUA 1JFQH 4ACPA 1S9WB 3THML 3LKNA 3JV5A 4FQXC 4KZEH 2H3NB 1ZS8B 3NIDF 1OM3H 2GY7B 1HXMA 4HUXA 1J87A 1GZPA 2KDGA 4H26B 4Z95L 1EHLH 4JFHE 1ED3B 4L9LA 5FXCH 1M05A 5SWSE 4X4XB 5EC1A 1OD9A 5C08E 1U95B 1S7SA 3MODL 3L5XL 4OTXH 2VLLA 4RZCA 5I8CB 2AK1L 4JRXE 4N0FB 5ANMA 2PTTA 3U4BL 4Z6AT 1BZ7B 5EBWA 2V2WB 1D5BA 2DBLL 1Q9KB 5DF0A 4XCCL 1Y6NR 3ARSA 3NCJL 3DX6B 3JVGC 1HCFX 1YEJL 2OSLB 1G7IA 2EYRB 4NCDA 3BEVB 3G5ZA 4LCCA 4EZMA 5DD1L 4JFZH 1EEZB 4CMMA 2IQAA 4ODXA 1YQVH 2D03L 3VW3H 3LH2L 4XMLL 7FABH 4U3CA 3DO7A 1NUNB 5JXAH 1F4WH 4OIIH 4GSDL 5IB2A 3UBXG 4OZ4B 4ZSOA 4G8GB 1KCUH 2YD9A 3IU4H 3M1BA 2B20A 3GZKA 5IW6B 4YE4L 1ZLSL 4PJ9C 5EZLA 4N9GB 2C9AA 3MGOB 1IM3B 1OY3B 1D6EB 5T1DL 1DR9A 1MCEA 2AK4A 2NY4C 3WE6A 3OQ3B 5I1LB 4RMSA 1UM4H 2K1MA 4O2CA 5ADOH 3HFML 2N7AA 4OKDA 3ECBB 3P73A 4CVZB 1NBVH 5ANME 2EE9A 3L5WB 4TVPD 5GGSB 3K3QA 2RCSH 2W1NA 4FFWD 1F11B 4WEBL 3W2DH 2VISA 1I8LA 4F33B 3I6LE 1YEEH 1T3FB 1F90H 2AQ2A 5HGDA 5J06A 4R3SA 1S5IL 3U0WL 5IEKB 4XMLH 2A6JB 5CJOH 4PP1D 3DX8A 4DK3A 3JTTA 5IF0B 2GUOB 5F9JB 4HIHB 3DWTA 3JWDH 5IBLC 2EE3A 3WUZA 1RZGA 4H1LA 1NBYB 2DLHA 2LABA 3HI6L 1DBKH 3G5YB 4QRPB 4APQC 3S88L 5FOJA 2MHAB 1HN1A 3KJ4B 5DVNA 1ZMYA 2BNQB 3QUML 2AI0L 2NR6C 4OCWL 2VL4A 4QOKE 5D7IA 4TTDC 2F53A 2EKSA 4JDZA 4MHHI 1YN7A 3QNZA 4YHLL 1IC4L 1QRNA 3DYMA 2FHBA 4GRLC 4NZRL 5D5ME 3RZCC 2BNRD 2FBJL 5GJSH 1F13A 1KB5A 4HULB 2VWEC 4KQ4L 3KPOB 2W0PA 5EO1A 4HIEA 3WBDA 3MLVL 5E6YA 3TO2A 3B5TA 4K9EC 3ARBC 4MHHG 1BVZA 4J6RH 4NKMB 2F19H 3QNYA 1VEMA 4OT1L 3C5SA 4JCMA 5EU4B 5DFTA 2QHLA 4KKAC 2KUTA 1NSNL 4YQXL 3K8KA 4L4TD 1FP5A 1YEHL 4KKCD 4LCWE 5D93C 1CGYA 5FUZH 1JGDA 1JGEA 3VFPB 2OZ4A 2XFXB 4PLJD 4OCWH 2AI0H 4PGDA 4X7FC 2YN3A 1JZ8A 3P9LB 5MENE 1WCBA 2DTML 4LGPB 1UKQA 1N59A 1CICA 5E99L 4L3EB 3DX7A 5C6WH 4I48A 1J10A 4CKVX 1U8HA 2VZUA 5FK9B 3QJFB 1DVFA 4YGAB 3OPZH 2IAMA 1KENH 4URTB 1G7PB 4NQDB 4X80H 4Y4FB 5HHVH 5C07E 1FRGL 1RPQA 4NYLA 4XI5D 1NFDB 1Q38A 4MD4A 2X4OB 1OP3H 2XYCA 3FB5A 3WJJA 1XCQB 5E8EB 2CUIA 2FX9H 4NQSA 4LLMB 3QHFH 2C3VA 3V0VA 3SGDI 1GC1C 3C6LA 5EFIA 1KLGB 5F8RC 3OKNA 3VRJB 4D0BA 6FABH 4M93B 1UEMA 2QJDA 1E28B 4LEOB 4ZO8A 4JKMA 4EJ1C 2C1OA 1E4WL 1X5AA 2FIKB 3RWJA 5HBBA 5J4MA 5CHNA 3QCUL 2FYYA 4L5FL 1NUDA 4J3UA 5KSVB 1RUAH 1AHWB 5F9WC 5BZDA 1RZIA 4KC3B 1WK0A 4N0UB 3SKNB 2ADFH 1X3DA 3G9AB 2AJXL 1MCFA 4YHNB 2FIKA 1CYGA 3HG1B 3NPZB 3TIDB 5TF1H 4HKXB 4YHZH 2YEZA 1R3LB 3HNSH 1MVUB 1NJ9A 1H3GA 2IWGA 4QHMA 2D9QB 4XVSL 3QNZB 2YA2A 4PG9A 3HRZB 5IBUB 1UM5L 3NZHL 3TZVC 2FO4B 4U49A 4H25A 1DSFL 3CFIC 4IDJL 2WUBL 3N06B 1IBGH 1ZEAL 2BFVH 2BSRA 2NQCA 3LKOB 4D9LH 1UGNA 2B5IB 1XZ0A 1KIPB 3JZ7A 4Q9QL 5FO7A 3D6GA 1NLBH 2XZCL 4JHAL 3WLWC 2J8HA 5D5MB 5T3ZL 5AD0A 4ETQB 3MLSL 5GIRA 2AABL 1CDHA 2AK4E 3LKNB 3WJLC 5K9KA 1OAKH 4LLMA 2A2QT 5C0BB 3E3QE 4J3VA 5CJBA 3GHEH 1U58B 1IKNA 4H8WH 5E9DB 4QRQB 2NLJA 3QAZB 3MRIA 3DNKA 4HQQH 1IGYB 3C2AL 4TPRL 1MAKA 1S3KH 3LS5L 4XBPA 3ULUE 3CU7A 1A21A 3NCJH 1MF2L 2MMXA 5GS3A 4IBLT 3TYGL 2DQDH 3ARFB 3KVQA 5IJKA 4RFNB 1ZANH 1ONQA 4BH8B 4HMEA 1KGCD 3FT2A 5I9QC 1R5IA 1RMFL 4WTWA 2OP4L 4Z9KB 4I18C 2IQ9H 3VXQA 3HPJA 1G1CA 4MB3A 4PYHA 1ZHBB 1UYWL 2O61A 1FPTL 3QJHA 4M5YL 4Z0XB 5DUBB 3SE4C 5BQ7B 5I0DA 3B9EA 4QF1A 4M6NL 4RBPK 4FP8L 1NH6A 3UXFA 1IKFH 2OM5A 4G80B 1U8MA 2CDGB 1BQHG 3L3DA 4JREB 3ZKXB 1A9EB 3GHBH 1IRAY 2VAAA 4CJ1A 4PJIB 1FZKB 1EDQA 1XGTA 3EAKA 3MJ7A 3H9SE 5KAQF 1A7NH 1T21A 4PJEB 2EYSA 3RWDB 3B8YA 3VWKA 2FHCA 2F54E 2UZIL 1NAKL 1U8PB 2JCCA 4FNLH 4RBPH 2VLJE 4FXKB 2YPLD 4NCC2 4KVNL 1I9IH 3VJ6B 3C5ZD 5I9QB 4G7VH 1VHPA 4RMTA 4NO2A 5A16A 1YY9D 2IFFH 4NDMA 4XHJC 1AXTL 5JMOC 1BVLA 3RVVC 3C9NA 2HFEA 3ARDA 3AY4A 3HS0B 3VXRD 1AFVH 3GUTA 1FAIH 3AU1B 4OM0L 2P8MB 5EH1A 1NCCL 3BHBB 4LLQA 5HYEA 4PRPE 2AERT 4LCYA 4MJIE 3V4PL 3V52L 3FQWA 4K2UH 4EI6B 5HHOA 1O5DT 4X6CA 4S2SB 1DBAH 1NGWA 4OUUA 5D96B 4YDJB 3K46A 3U0TB 4E41D 4P57A 4ZTPH 1N7ML 4ZFOB 4JFDA 4AM0B 4JFEE 4HGMA 3V5HB 4ONFL 2BX5A 1LDPH 2DIAA 1N3NB 1P53A 4XPBL 2ADJA 3CSPA 5KSAB 3ZE0E 4JO1L 3CDYA 4WY7L 1AXTH 5E5RB 2RBLA 2MKLC 4QT5B 2JCCF 4K7PY 5IB4B 2R1XB 5BMFH 1IKFL 3NCFB 1MHPH 1FVCA 15C8L 5DR5H 4XCEA 2F53D 1I1YB 3QUZA 2OQJB 3GSNH 1DQDH 2YD6A 3PABB 4NKMA 2YC1B 4DAGH 1SYVB 1DEDA 3Q3GA 1SBBA 3TIEB 2Y36H 4KQ3L 1JMXA 1OGTA 1EUTA 4LBEB 2P43B 3RVVD 2BVQA 2BRQA 3GSQB 1RZKL 5IB5B 2W65A 2NY7L 5C0CD 3B9KD 1TJHL 2IBZX 3WL9A 2ARJQ 3CX5J 4RFEB 5E2UH 5MP6H 1CBVH 1AHWC 4U6VL 2F8VA 2Z8WC 3C8DA 4PJAA 1Q0XH 1AQDB 1CWVA 1Z5LB 2PTTB 4PRHD 5EB9A 1LP9E 1T66D 1FFPA 3LV3A 3T09A 2FLBT 4C57C 2VR4A 1YMHB 1A5FL 4MAUL 3RL2A 2YA0A 1KPRA 2Q7NA 1YPZF 3JWOL 3MPCA 2ADGB 3NZ8B 4U3XA 1TQCB 3WHE0 1Q1JL 1OD7A 3V79C 4XXCA 5DRZB 3MBEA 4MMXC 2XTJC 4RAVB 3KXFA 3M45A 2K7PA 3ARDD 4ERSL 4Y1AA 5BVJB 2OR8A 3LV3B 4X4MA 3BQUB 4X0KA 2WBJB 4NZUL 3GSXA 1ZWIA 3FOLB 4X5WB 3T65A 1DQJA 5CIPH 4Y2OA 4GXUN 3R0MA 3UBXB 4E41B 3GSVA 1Q0YL 4LSUH 4XCFL 3MNVA 5JW5B 2OP4H 5D7JD 3O2WH 4L4VE 5FAAA 4P2RE 3D1MC 1TZIA 1ZK9A 3ZKSD 4ZO9A 2Y9RT 1D6VL 5C08B 3RGHA 2VLKB 1FYTA 2DICA 2EDWA 3IDXH 5BMFL 4OKVA 4UILL 2FX8H 3QIWC 4Q6IC 3HRZA 3SDDB 2V7NB 3IS0X 3TO4B 5CLTA 1HHHA 4GKSB 3MNWB 3FT4B 1S78D 5EN2B 2BZDA 2OCFD 4XXDA 2NY4D 5D96C 1WZ1H 4UV7L 3EDFA 4FTVA 2EDOA 3DYOA 3MUZ1 1S8DA 5MI0B 4F3FB 1QQDB 2UWEE 3MV7A 4HC1H 4G6JH 3C08H 3VCLA 4FABH 5JIHA 5FCUL 5EULV 1DBAL 2Y5TB 2XN9B 3PNWA 3GGWA 1BQLH 4KPHH 2ICWA 4ENED 4LLQB 2YUZA 3ZE1F 3V9FA 5JDSA 1FJ1A 1VA9A 3ZKND 4KI5D 5TH2B 2XN9E 4GLRH 3MLZH 5IKCA 1MRCL 4QNPE 4EOWH 3CFCL 4YGVB 1AO7A 2L7UA 1KFAL 3F5WA 4FMKA 3TN0C 3HC0B 5EORH 3PGFL 5KSAD 4I9WD 1G7MB 1YY9C 2XOTA 1VGEH 1K4CA 1GGBL 5CP7B 3WNLA 1J7VR 1FFRA 3KLHD 3ULUC 4OZIF 5SWZB 3QWOA 4YGVA 2Q7YA 4TUJB 2G2RB 1NCUA 2XNAA 3G6JA 5BQ7A 3QUMA 2HT3D 1L4IA 3MMEA 4HZAA 3LAFA 2VLKA 3DO3A 4L29A 1YN6A 2ZUTA 4F7PB 1YUHB 3SY0A 4MXQD 5BW7A 1BOGA 4I2XB 4PGDB 2VDPH 4G80A 5KVGL 3RWHA 4G7YL 4UIKL 4BH7A 3BRFA 4TULH 3BP4A 1A9BA 4OT1H 2AJUL 2DYPA 2DWEA 3OR6A 3F58L 4IRZH 2A1WL 1XAUA 1TZHA 2BCKA 3FOLA 4PBXA 4L4TE 4FZEL 5FKPB 1L0QA 2FL5B 1SMOA 1MRDL 2VXUH 4HUNB 5SWSD 1J0HA 5ITFB 1GYAA 4U0RC 1TFHA 1YEDB 1ES0A 1U8LB 4P3WA 1OGAD 2H8PA 2OTWA 1HK6A 3RZCD 1PSKL 3D85A 5I76B 3O4LA 1NEZB 3B83A 4F7TA 2B4CH 4JY5L 3OR7B 4ETYA 3MUJA 1T89C 4LRIC 5JW4M 1JNJA 1P7KA 4J6RL 5D5MA 5F3HB 4JO3H 4M7KL 1LEGB 4HJJH 5KSBB 4Y4KC 5GS1B 5CUSL 4KV5E 3GRWL 2EXWC 3MNVB 5T5FL 3OKEB 2DD8L 1VFBA 3NCEB 1C7TA 5CEYB 3DBXA 4Z7WA 4LSQL 2OZ4H 2EIDA 1CFTA 2I07A 1P2CB 1J0JA 5EBMA 3MXWH 3DVFA 1J11A 4G9FB 4NJ9L 3V0WH 4ZUWB 4R4BA 4HIHA 5F7KC 3RRQA 1CD8A 1TENA 1OP5H 4FQPA 4AY0A 5BZWB 4RNRA 4YBLC 4YXHH 3HZKA 1EVUA 4Q97A 2W9DH 4PJ8C 1RQ5A 3HPLA 4TVPL 3UAJD 1R3IL 2BVEA 4D9QD 5H35B 1BGXH 3O2DH 3QUYC 4BQ6A 5C0IB 5DZLA 4P59H 2AJVL 1YQ2A 2P48B 5HI4D 4ZG1A 4ZQKA 1LGVA 3BH9B 1MUJB 4PD4J 4ISVA 4OCXL 2Y06L 1D5BB 1IZKA 1U3HA 1DE4B 3VFSB 4MA8H 2JJTC 4PRPB 5HYFA 3UPRB 1LHZA 1IJ9A 1FH5L 1K2DB 2APWA 5CINL 4LGRB 1S78C 2SEBB 1E4XH 3O6KH 3QUMB 1QR1A 1KCLA 4NT6B 1PG7X 1T1YB 3WFCL 1JGUL 2C26A 2A0LC 4XGZA 3MXVH 3QFJE 3GSNA 4WUUD 5JQ6H 5M7QA 2VLJB 3HB3C 1I3GH 2IQAB 1K4CB 3LOWA 2DQEH 5HDQL 4I0PA 1AC6A 2BDNL 2VSDA 4K07A 4M02A 2ZNXA 3W9DB 5FA4A 1WJ3A 1YMHA 4XNYL 5CZKA 5GGTH 5BOPA 5A16B 1GPOL 2ZNWA 3MXWL 3PWLA 2F54D 3VI4E 4C83B 5GZOC 4J4PA 1XIWC 4LF3A 2HTKD 4JFOB 3SEPA 1OARH 4JGMA 4QLRA 4R96B 5EA0H 1NLDH 2VC2L 3HI1B 2BNRB 3GMPB 5JZ7D 1NCWH 3FB5B 5INCB 5MEQA 3T3PE 4PRIE 1J05A 4DAGL 5F6IC 3MNZB 3QEUA 3BP7A 1R0AL 2PXYC 3OXRA 4XMPH 1IAOB 3QWQB 4NM8H 4WI3A 4QTIL 3TO4D 2FRGP 1IGCL 3BZFB 3SGJC 1ZT1B 4NHUA 3OKOA 5IP4A 3MNWA 4W68A 5C70A 1W0YT 3MLZL 4O58L 5ACZB 1KC5L 4RAUA 2DQHH 1LD9B 2Q20A 3EYVB 4P5TD 5IT2H 1Y0LB 1PAMA 4KTEL 3BPLC 1C16B 3JWDC 3FQNB 1RUML 2I9LA 5ENWA 5JR1H 1U8IB 4KKBD 1EO8H 3EO0B 4KK9C 4CMHB 1CGWA 4XPFH 4MMZC 5DC4B 4NQVA 4FQCH 2FSEA 3L3HB 1NCCH 3BHBA 1M4KA 4KJPD 3GMNA 2AV1B 2NY6B 1FZJA 1OT1A 5F7MC 2A73A 3QWRD 3JV6B 2YR3A 1JGVL 3G5VA 1BF2A 3O45B 2WWKO 2P7TA 3VH8G 4U1IA 5FHBL 1G9NC 2C4FU 4KVNH 4JFQA 2CKBB 2DDQL 2QR0B 4LKXB 2VLRA 3FONA 1CXKA 3F5WB 3AREB 5FCSH 3D0LB 1HDMA 1XGRB 4PJHE 2Z92A 2UZIH 2DKSA 4P46D 4WRLA 2ENSA 2YHGA 4JRYA 4HH9A 1QFWM 4H0HB 4A6YL 5IW6A 1ZGLP 1BIIA 4EVNA 1PKQE 4C58B 4ONHA 3AS3A 2X4TB 1M71B 4ZSOB 3KPRD 1NAMB 3EJYC 4KUZL 5SWQB 1CI5A 3CMOH 1ADQL 4C4KT 4N0UA 1M7IB 3FO9B 2BNQD 1CLOL 1MCWW 1U8KA 3GRWA 2NTSP 4FQ2H 4JJHA 4IS6B 4P2OC 5E2VH 4CVZA 1CICC 4KGLA 3L9RB 3BRDA 1RHHB 3RVUD 2UWEB 5L88L 3M1BB 2AK4B 3WE6B 4X99A 2O5YH 4DCQB 4XVJH 3MUHL 4OCLC 4Y4FC 5I1GH 1V05A 4LAJH 2EICA 7FABL 2XZQL 5T33H 3SGJA 1Q9WB 5JORA 5EC2B 4WHTB 1DUZB 4UTAL 3MRFB 4Y1AD 4UT7L 4G9DA 1RZ8B 2PXYA 3B2VH 5KSBF 1VADB 5LBSH 4OZHA 2UWEA 1M7XA 1NFDE 1T83A 4QHKJ 5JO5A 2ZUVA 1R3KB 3U6RB 1DDHA 2DL9A 4G8FB 1PQZA 4F57H 4U6TA 3ARXA 2B1HH 2FH8A 1N8ZA 5CIPA 3RA7L 1PG7W 1RUKH 3T2PA 5HHME 3G6DH 1W72H 1XIWA 2PCPA 4KMLB 2BMKB 5JHLL 2LAGB 1WWWX 4MDIB 4C4KO 1XF1A 3D3VB 1F2QA 3TV3H 1RZKC 1AO7B 4K3DL 2ZP0T 1DQMH 2ENYA 3LRHA 4CMHC 3CFEB 4OAWA 1KIPA 4JR9L 1BLNB 3EOBB 5CSZA 3S34H 1Q1JH 1FNFA 3VWKD 4PRHB 4LPTA 3WSQH 1IGFL 2RFXA 5JUEL 3BSZH 4XPGL 1GC1L 4I0CC 5D1XD 5ACZA 4HZLA 4AT6B 1YC8A 1P69B 5D6DC 5ADPL 2AJYL 3VFMA 1RK0A 3DIFA 1MNUL 3MMEB 1I8LC 1QQDA 5D72L 4N8VA 4LBEA 3S35L 4YR6B 5D2LB 2R56L 1X5LA 1LK3H 3QWOB 4JZNB 1U3HC 1K4DB 1OAZL 3IXTA 3VDBA 4XVJL 5AEAA 3H8NA 1A6ZA 2ZCLH 2I26N 3UAJC 1RUAL 3BKCH 3FCTA 1P4LA 1WC7B 4GW4B 4DVBA 4M7JL 1FGNL 6FABL 3O0RH 1HQ4B 3QI9C 4M6AA 8CGTA 4WWKC 4PJXF 4E42B 3QDGA 2XWJA 5DJZA 1IEHA 3CSYA 4GXVH 5SX4I 4JCLA 1JRHH 2DIJA 2BJML 4JPIA 3ZL4L 4WU5A 2HJFA 2VZOA 2PF6A 3HNVL 4LAQL 3T3MF 3D5OF 4TSAH 4OLZH 2ZJSL 4XP4L 3C9NB 5BO1H 1A4KA 3V4UL 5DJ6B 2FJGA 3C8HA 3FMGH 2YD3A 2JELL 1H15B 2ERJB 5EOQL 4M6OH 1RIHL 5FA4B 4X6EB 4Y4KA 1AFVL 1D3CA 2HJKB 1DLFH 4Y5VB 2R2HA 3M8OL 4S1RL 2Z8SA 1A7QL 2JJVA 1TVHA 5E4EB 1P4IL 3UJTL 4JQXC 2E7MA 1JYXA 4XP6L 3SQOH 3D3VD 4JQIL 3OF6D 1Z9OA 1ZGLA 1Z0MA 2JCCB 3WXVL 3HAEB 4XNXL 4MLSA 3ROOB 1JV5A 4FQXA 2F54B 4MXWL 4ODUB 4J3SA 4H8WL 1NJ9B 1JNLH 1F02I 1SYVA 3H6JA 3LCYA 5JO5B 5D71L 1D5XB 4YHNA 4NUGH 3VFRB 2DQTL 1MRFH 1A14H 4NJAH 4Y19A 2YWZA 5BW7C 3T1FA 4Z5RA 3X12B 1CDUA 1DJSA 3IAPA 4HZLB 3VRJA 1WSST 2IPKA 4Y5YA 3GMMA 3N1QC 1F3RB 4PJ5D 3PWPE 3RHWF 3P11H 1LO2H 3QHTC 4MJ6A 5K9OA 3IU3A 1I7UA 4H8WC 5HYSB 4WTXA 5C7XL 1ED3A 4NC2B 5EPMA 1FPTH 4PJDA 1T0PB 4JQVA 2EYTB 1YJDH 3IVKB 1RMFH 4M61A 3OKLB 3GSUB 3MRPB 4EUPA 2A73B 4Z7WF 2DI7A 3TN0A 3HMWL 3EJYD 4YXLL 4I48B 2ICCA 2WBJA 4WW2F 2YZ8A 5TDOB 5IQ7H 3GSOB 4YWGH 4F58L 5MEOB 1A3RH 1G7PA 4NQDA 4Y4FA 2YC1A 1DBBH 5KTEH 4QTHA 5AAWA 4BSVB 3AS2A 1HILB 1RIVH 3ULSB 4H88H 3S36L 3GHEL 2EEDA 1TVBA 5EOCL 2PN5A 2VDQH 5E4EC 3C5JB 3LIZL 3RL2B 3BDXA 3T0WA 4P3CH 1IC7H 1JWUB 2OR9H 4HFUL 4RGND 4I5BB 4XAWH 1UZ6E 3PXHA 5CBEA 4M3JA 4WTZG 4TVPH 2WAHA 5CINH 3MJ7B 1TTFA 4WUUB 1NCAH 2VN7A 4P5MB 2VITA 4MCYB 1OAXH 1A14L 1DBJL 5C3LD 3S36X 3SQBA 1NMCB 4QGYA 4WDIA 5AUMA 2RQ8A 3GNMH 4LGSB 2Y06H 3ILQC 3B9KA 1QG3A 1JTPA 5T1LA 5DJAB 4A2LA 2R15A 2J7LA 1VKXB 1HKLH 4M1CD 1VENA 2PTVA 4NKDB 3DV4B 4F9LC 1J9CT 4LNVA 3ULUL 4HPYH 3KPOA 1U3YA 3QEQB 2E7CA 5C0JB 3S96A 4Z7VE 3RGVD 5EOCH 2HLFD 3S3PA 4E5XA 1LD9A 1T2QL 4U1JA 2LQRA 4TNVK 2H9GA 1QBLL 3RIFF 1HINH 4R97B 4TSBH 3E3QC 5IVZB 1HCVA 3E6HB 4Z7UE 2ARJB 2C3XA 1F3JB 4QRPD 4I8DA 3F7RA 3OV6A 1A4JA 3GIVB 2YSSA 5ALCH 3IYLW 2BSSA 3V0AC 3QDMB 3KYMA 3MBEC 4Z95H 1EHLL 3QIWD 4E5XB 4EI6A 4KKAD 3LN5A 3IF1A 4OJFH 1JBJA 3W0WD 3MV7B 4V1DB 2DLEA 1JYWA 5FGCB 4G9FD 5DWUH 4FZEH 3T0XA 2APVA 1YYLL 4G43B 4L3EA 4TVPE 4J8RB 4OF8A 2G5RA 4RA0C 1MWAB 2LFGA 4V1DE 2MSPA 5GSVB 3MOAH 4X6FB 3E1F1 3SDDC 1OSPH 5C07B 2NY1B 1BFTA 3ARPA 1JPFA 3BFOA 3BVNA 1OTUD 1S7WB 1CT8B 3ZKXC 3DXAB 2VITB 4I18B 6CGTA 1D5MA 1J1OL 2Q8BL 3K1DA 5DSCB 4AG4H 4ZNCD 1KSRA 5DD3L 4TOYH 3ARGC 3S37X 3EYSL 3EGSA 3FT2B 1N5AA 4CDGC 2D7PA 4U1KB 3VFPA 5HYJB 1KNOA 2YS4A 1HNFA 2ZUYA 5EO1B 3CLFL 2W0FA 4J4PC 5C07D 3ULSA 1G7JB 1MFNA 5A2FA 1HHIB 2J1KA 2NTFB 4FQLH 5FO8A 5IMOB 1BBJB 4KRPC 2WINA 4UDTA 4Q9RH 5KVDH 4X4YA 4OCMC 3RU8L 1AE6H 4PJHB 3CXHK 3BN9C 4XBGA 5DHYB 5J11B 1F4HA 3BXNB 3TBTA 4B7IA 1DE4A 1PLGL 3BEVA 4LCCB 5DTFA 5D7SL 5J13B 1GC1H 5DI8A 1OW0A 4JRXD 4P5MA 5E1HB 1CK0H 1INQA 1IGTB 2Y7QA 1BD2D 2D7MA 4LCUB 4QEGA 3HZMB 4M1CC 1UACL 4HH9B 5ALCL 4OV6F 3ZDYE 3B2UD 1YC7A 3C08L 5DA0B 4Z78B 3C5JA 3EOTL 2P49B 2Z8VC 3B6SA 1BMGA 3BZEB 3OAYH 4GBXD 3FAWA 3RVTD 2H45A 3RIAK 4JO4L 1I1FB 3UTSE 4EOWL 1YPZA 2VZ3A 2A9NH 3MCKA 4P9HC 1HSAB 1VGKA 1A7QH 4POYA 1OLLA 1F6AA 1A6VH 1QFOA 2G5BB 2VXQH 5KZCD 1B3JA 4F7MA 2GAZB 1WFUA 1VFOA 3UJIL 2L4OA 4NRYA 2DBLH 2A9MH 1S5IH 3G6AB 1C16A 4MNQD 1OSZB 2V2XB 1ORSB 4JVUA 4R6UA 1FNGB 4LP4A 3EGSB 2VIRB 4UQ2A 5IM7B 1CR9L 5KSAC 2HFFA 1QA9A 4XNMA 5ADOL 4WFHD 1R5VA 2N4IA 3MLXH 1AY1L 3FFCA 5E08H 4R7DA 5GGUB 2VXVH 4AIZA 5LQBH 1KCRH 4MA1B 3PWPB 1LP9A 2LU7A 5E1AB 1I8KA 4WEMB 1K3IA 4HPOH 4FOMA 2HKFL 3MX0A 4L1DA 5F1OB 4BSJA 5E2TH 5GZNC 5LCVL 3HG1A 1S7WA 1ZHNB 1R3HB 4I18A 1MIMH 2JKXA 2GYSA 3DGCR 3LN5B 5J13C 1G9MC 2X89A 4LRIA 2H32B 3S6CA 1CR9H 2X40A 3WIIH 4Z18A 3KYNA 2ERJC 4IJ3B 5HHQA 4KKLC 4ZPTB 5FGRA 4P2OD 1CFSB 5GHWL 1EXUA 5J1AA 2XNAB 5JHLH 4U1SB 2R39A 5C09A 1JZ5A 1A47A 3S3SA 1RZFL 3GJFK 5GGRA 3ZT7A 2HMIC 4WFGD 3F7PC 1B0GA 4NQCE 3B9KC 4C56A 4TPRH 5MI0C 3T4AB 5CGYC 4LSDA 2UVFA 1V3KA 3DVNB 3K7UA 2CUMA 4PJ5B 3GMRB 1U2HA 3P0VL 4QXUH 3QEHA 1K2DA 1MCNA 4X5XB 5IIEA 3LEXA 4YDKL 2AJSH 4EBQL 1ZV5A 5GGSA 2UUDH 1UQSA 4IJ3C 5CFHA 3A6OA 2BVTA 2ATKA 4LVNB 5JNYB 3T0EE 3I75B 4ONFH 2VDLH 4XTRC 5I1JL 3D39E 2Z8RA 3TZVA 4WFFD 1T5XA 4Q9QH 1FJ1B 3ROLB 4YFEA 3ULVL 1OCWL 3L3DB 1ZEAH 2BFVL 4O5LL 4OLEA 4D9LL 3VXRB 3BUYA 2YPVL 3B9KB 1HH9A 3TVMD 1K6QH 1NGPH 3FRUA 1KTRL 4DGVH 5GS0H 4LSSL 3BEWB 2YD4A 5DUBA 2IGFL 5HI5C 1O7SA 2WBJC 3QUKB 1UM6L 2HTKC 4WV1B 3TZVB 2LVCA 1ZHNA 4G3YL 4M00A 3BZ4A 4NBZB 4OM0H 5FOBA 4UUJB 2XZQH 1UH2A 5T33L 4JDVA 3UTQA 1QSEE 4WU7B 1FNGA 3P4NB 2Z35B 4W81A 3OJ2C 1TJIL 3OAUL 2ZOLB 4MNGB 1T22B 5INCA 4I77H 3PWPD 1KJMA 4Y16B 5FUCE 4FFYL 4U1GB 4F9LA 4Q0XH 4XPTH 5JLZB 5KANI 1JK8B 3BI9X 3CJJA 2QQLL 1CDIA 2VYRE 1S7UA 3OXRB 1R5VB 3QULA 3FMGL 3RWEA 5BXFB 2FWOA 1NQBA 3C6LC 1I9RH 5ID1B 1FGVH 1RJYB 4OLZL 3ARWA 4RAHA 2LTQC 4NFDA 2P5EA 3WJJC 5EU6E 4K9EH 4GAJL 5I15H 2ZUWA 3CGTA 2GITB 4D3CH 5CSBA 1NCDH 5E2WH 1EZVX 4NZTL 4UB0H 5C0AB 3VXNB 5FYLE 4LVOB 1VEPA 1XF3A 3DV6B 4PJAB 1FIGH 3BDBA 4P2YA 5EU7C 2ED9A 4L3CB 1OAUH 3D3VE 3VFRA 3H3BC 5C0GA 3R4DA 2X9WA 5HI4C 2ZWLT 4YLQT 4ETQA 2B1AL 3VFWB 3O9WC 2H26A 3OKDA 4N5ED 5J9PB 1KUMA 3UMTA 4FZ8H 4LSTL 2BOCA 3NIDE 5HYSA 2VLRE 4LSSH 1KEGH 1JP5A 4XC3H 4LVOC 1SEQH 1CFVL 2HTLC 3UTTB 1I3RA 4OD1L 2DMCA 3BKJL 3AREA 5J1TC 3VMNA 4FQHB 2C1OB 3O6LL 1DBJH 5F72S 1EFQA 4Y2DB 5T3ZH 1AHWA 3E8UL 3MRBB 5HGBA 1GPOH 4GMTL 2HT2D 3FQTA 3QEHB 4HT1H 3DRQA 4LSQH 3LIZH 4Z76B 1JYNA 4D9RE 4XAKD 2O5ZL 3IJYA 1RZFH 3SDXB 4YHYB 1AJ7L 2W0LA 1UM5H 2DQFA 1UWEH 3FO0H 4RWYL 3HUJB 1X4XA 5DJDA 2PR4L 4DUVA 2VAAB 5TF0A 3MJ9H 1CDBA 4UBDC 3MV9D 4OD2B 5HXMA 5I1DA 1JK8A 1NC2B 4ZFFB 3R8QA 4FMFA 3P77A 3MV7D 1WWBX 2PYEE 4IHOA 3U9PH 5E8PB 3MREA 4XVTH 4K8RD 2XRAL 3PP3H 3BZ4B 4DGIH 2NXYC 1L7TL 5DD3H 2D7TH 1KG0B 1NC4A 2BSTB 4ODSH 4PB9L 3TPKA 5IG7A 3OL2A 4M03A 1CDCA 5D1XA 1KCRL 5IBLD 3MLYL 4S0SD 2WUCL 4E41E 3PWUB 4LIQE 4HKJB 4UU9A 3SGEI 4J2XA 2NPLX 3AY4C 1LEKA 3UTPD 2NW2B 1A7RL 1BLNA 3EOBA 3O8XA 5CSZB 5EU5A 3QRFM 1TCRB 3VFGL 4HUWA 4BFIA 4WWKA 4PV8B 5JOFA 4DQOL 3QI9A 3VXUE 4I2XA 5A2KH 3AB0B 3TCLB 5T3XH 3UROR 5I18H 1UB6A 2WV3A 2AJZA 2QQNL 4V2CB 4Y8AA 4L8DB 1FFQA 1S7RB 3TH3T 1LO5A 1MCPH 2OYPA 3S5LG 5EBLB 3BD3A 5D2LF 2EKJA 5TQ0L 2VLJD 1GOGA 1F8TL 4J3WA 4Y8DC 1DN2A 2NY6D 2C3WA 3EYUH 2DQFB 4KJQC 1T0MA 5CP7A 3FZUC 4ZFZB 3QBTB 1WF5A 4OIBA 5CMAB 1J12A 3V7AE 2NXYD 3WL9B 1WLHA 3FQUB 4OLUH 5H37G 1A7PL 4GKNA 1LVEA 4NJ9H 3TEUA 2A38A 1X5ZA 4BZ1H 4HS6B 3QEGL 5ILTH 4UTBL 1RJZB 4XC1L 3VGFA 3BX7C 3UTTD 3SE4A 5TDOA 5E9DD 4TSBL 5I16A 1DP0A 1FNAA 1RZ8A 4G9DB 3O4LD 5C09D 3AMKA 5KAQG 1IGCH 2FBJH 5GJSL 4OF7A 1X5KA 5J6HA 4ZYKB 3WFEH 1QTYT 1Q9WA 5JORB 4Y19B 3AM8C 3EHBD 2X6MA 3H9SB 3NACH 1GIGH 4NP4L 5GGSY 4Y4HC 3QCTL 4ELMB 1DN0B 3W39A 5B8CA 5CBAB 4IEFB 5TGBA 5GSRB 4FQ1L 1EAJA 4POZC 1N6UA 1XCTB 3G04A 1MCCA 1MLBA 3CDGA 4IM8A 4MJIB 3FB7B 4U6HA 2WSKA 4E41A 4OGYL 1EEZA 5IHZA 1YEEL 2NY2B 4PS4L 3BH9A 2VR9A 4JVPA 3I02B 1NDMB 5DJCB 1MJ7L 4ZS7H 3C8KB 3CAFA 2XTJE 5D72H 2R8SH 1NGWB 2G5BA 4OUUB 3PJSA 3TJEH 4M1GL 5CD3B 1AGDB 1AKJD 1J8HD 1EX0A 4WNQB 5JXEA 2E9BA 2FECL 1P2CA 32C2A 4FQXB 4F80A 3ARGD 3S37L 4EN3A 2XKNA 3BWAB 4MVBD 1XGQA 3HFMH 3RVWC 1QEWA 1C5BL 1ZSDB 1S7TA 1EGJH 3F7QA 3MUGB 3FFCE 3P9LA 4OFPA 1HE7A 2WLZA 2CR6A 5CS7A 5GPRA 1L0XA 4MNQA 2W59A 2ITCB 2Z31A 1GGBH 4C56E 4AEIH 1W0VA 4XWOC 3REVB 1PG7H 5JXEC 3B9DA 1QSVA 5EPMB 1S7SB 2H1PH 1AO7D 5IESL 4YE4H 3RTQC 3LQMA 4PJCB 4S10A 1PFCA 1NUGA 4G6AD 3VXOB 2X7LB 3IDYC 3ULVE 1BWMA 5JXAL 3P0GB 1K4DA 4DVRL 5KN5A 3EFFA 3NMEA 4W6XB 3VDCA 3HNTL 2P8PB 2ZUXA 5C0ND 4F57L 4NFCA 4JRYD 4S1SL 4OCYH 1R3HA 3NACL 5DK2B 3VFTB 5T1MB 4OZIB 5B8CC 4MAYB 1BM3L 3QQNA 4F8TA 2O61B 4JPVL 3VGBA 4APQD 5J89A 5MEQB 4PRDB 2I60H 5CHNB 3LQAC 4NUGL 2ZUUA 4MSWA 3BPOB 4JHZA 4R0LB 2P24A 4L29B 4AH2B 1BQHB 2NYYD 3H9HA 2XACC 3QXDA 5GGRB 2R1YB 4U2YA 3TN0D 4P3CL 1MFDH 2ZPKH 3D25A 1XGPA 2R2HB 3EDDA 2YD5A 3IETA 2QQKH 5DEZA 4RMQA 2AGJL 1S9KC 1BECA 1MLCA 4KK8D 3PQYA 2A83A 1JHTA 4C83A 2ITDB 2B8OT 3CSBA 4HJJL 4JFOA 3MRBA 4B7LA 1PX4A 2HWZL 5I75B 1UQSB 2G60H 3HUJA 1PQZB 1WUNT 1TLKA 1Q72H 2CUHA 4UI2A 2DQJL 2B1AH 3SDXA 4K7FB 3IFOB 4BQBA 5F7HA 4Z7WE 2LV4A 4YFLI 1Z6JT 2V9RA 1XF2B 3X3GL 5GIRB 3QHZL 3TO4A 5DMIL 3BGMA 1G6RH 3TBYB 3O6ML 4JFFA 4UB0L 3GMLB 2CKBH 3O3DB 3HG1E 5FA3B 1LO3L 4LASH 5IHLB 2IANB 3QDME 5L9DL 4NGHH 4X8JA 1LK3L 4P0DA 2F58L 2D31B 1D5XA 3QAZC 5IVXA 3U7AA 1TQCC 1XGQB 3O8XC 5I15L 5C0RH 4MJIA 3UTZA 4OI9A 4XCNA 3NA9H 4FFWC 4NJAL 4WGWB 2IADB 4LLYB 4DGVL 5GS0L 4LOUC 2HVJB 4R8WH 3WKNA 4UDTB 5AWNL 5T1LD 1SY6H 2E6QA 5C2UB 2PW2A 4M6NH 2F5AL 5HYQB 3Q5YA 3QIBD 3DHMA 3BQUD 5C09E 4ZUWA 5C0IA 3LN9A 1J86A 4XX1E 1YA5A 4P2QE 2NZIA 4LPWA 2EDLA 2VL5B 4G3YH 1JF1B 2OLDA 3V6OA 4AIZB 4JFHD 4JFDE 2ICEA 3HPLB 5DJ8A 4ISVB 2DF3A 1U6AL 2BVPB 4XP6H 1BJ1H 2YUXA 1RHHA 5F8QC 1UCBL 1CT8A 1X44A 4KROD 4BSVA 4YBQC 3TBWB 1K6QL 1P7HL 3DV6A 3P4OB 2NMSA 5TDNA 1WTGT 4WFHE 3PWNA 3S7GA 4Z7VF 4TSCL 4PG2C 1ZS8A 2NXZC 2ZUSA 4G5ZH 4JAMA 1RVFL 3ARGA 4PJBA 1CU4L 3FQUA 2R4RL 3QI9D 1G6RB 2XWTA 4OZFG 2VUYA 2XICA 3OX8B 9CGTA 2CK0H 2X4TA 1KPRB 1AGFB 2X4OA 3S4SG 3I2CL 2EXYC 4G8EB 3VFUB 5MEOA 1HI6B 1T6VN 1JWMA 5JA8B 3Q6GL 4RRPA 1A2YB 1DEEB 4KXZH 1B2WH 1N0XH 1LNUA 4KJYB 2AXJA 4NBYB 3QFJD 5ESVB 3FO2A 3DX7B 4RMUA 3STBA 1PDKA 4KHXH 4X6DA 2WUBH 1AXSB 1FO0A 1QNZL 4F9PC 1HNGA 1C08A 2ZZUT 1LEGA 3GDBA 4GG6A 1BPVA 4JY4A 4X4ME 2Z91A 3GJFH 5IEHB 2CDFA 5FM5M 2HRPL 4ZFOL 4C56D 5I76A 3D2UD 4JM2A 1C12A 4MNHB 3KHOA 4YDJA 3CFJA 5GZND 1S7XA 1T89A 5DQDH 3BDYL 3GJFA 4UT9L 4PJBE 2FB4H 4GQ9L 5GQBA 2ADJB 1F4XL 2BNRA 3GMPA 2QSCH 2ED8A 1K3ZA 3OHXB 4ELMF 3BD5A 3U82B 4M3KB 4ZODA 2DM7A 4OD3H 1UG9A 5DUPL 5LGKA 4BZYA 3IFPB 3UTZB 4KHXL 4ZDHA 1UKSA 4YHKL 2YMXL 3D3VA 4LPCA 4HW6A 4ZUSA 3NA4A 1OL0A 5LVEA 1WV7T 2XPGA 3ARBB 1YYML 1AY1H 2E3VA 4KRPD 2Y07L 5FKAA 4DK6A 4JFEB 1U2CA 3IKKA 3QWRA 1J1PL 2QQQA 4K8RC 5I8KL 1W0VB 4XP5L 3FHAA 4PJIF 4Y16C 3HE7D 3MREB 4JRXB 1DANU 4PJGA 3OMZA 3F65A 3OJDB 1BQSA 3F12A 4AEFA 3QFDA 1X5IA 1I4FB 1FN4B 3WS6A 1FBIL 5IT2L 3MLTB 2FJGB 1KJ2A 3QJFA 4DVRH 4DZ8B 4XNQA 1N26A 3CK0H 2A6IB 3ARFC 3ZTJG 5E70A 5DHVH 5KZCB 2R2BA 4NP4H 4Y19E 1A7BA 4HX1A 4Q74A 3RZCB 3ZE1E 4H5SA 2VO5A 3FQRB 4I5BA 1S7XB 5J12B 2XKSA 1RHFA 3F8UB 3JV0A 4JKWA 5F70A 3TO2B 3UP1A 2JB5H 4YHOH 2FEDC 5BS0B 3RY6C 4WO4C 2GKIA 1NAMA 1NCWL 3QG6B 3QQ3B 4KUCD 3QJHB 1DBML 3T3ME 4M9OA 3VXSD 4K94L 1U8KB 1BD2B 2EO1A 5I1HL 1C08B 4WI8A 1YPZB 4KRNA 2CRIA 1AH1A 4NM8L 5FECA 3F7YB 2P44B 4OZHF 4AJ0A 4FQLL 5I1AA 1LO3H 1RU9L 3B6SB 4Z0XA 4H0GA 4PS4H 1NCNA 1R3JA 4XH2A 1K5NB 4P2CG 4F7MB 1HHGA 2N56A 2AEQL 5MEPA 4RDQG 1MQKH 5DJ2A 3P40A 1WBYB 3ZKNC 5SWZD 1XH3B 5L0QB 3EO9L 3NVQA 4JHBA 4K94C 4JPKL 3SO3C 4NHCL 3WFBL 1OAQH 1JGVH 4F33A 1G7QB 1EH9A 3VXUB 5IW3A 5I73C 4XNUL 5F9WB 1MIML 3VFGH 4JQXA 3BZDA 1PJ9A 5IF0A 2I07B 3L3OA 2I9LB 3VMPA 4EEEA 5DTFB 3C2SA 3WIHA 5C0BE 3CX5K 2ZPKL 4CUCA 2NY2D 1N8ZB 2IADA 3UX9B 1CCZA 1CXFA 4NQVB 3L5WA 1NCTA 3FQRA 1XR9B 3GI9H 5EIVA 2E6PA 4JFPA 1S7VA 1OP5K 3TWCH 1Q94A 4M5YH 3LB6D 2GW5A 5EU6A 4LQFL 2NY6C 4KJQD 4HAFA 3AROA 2DTMH 3DXAA 1T20A 5L2KE 3VWJD 1GSMA 4LDOB 3T77B 3X17A 4XCYB 1EHXA 4MLIA 4G6KH 5KSAA 5MHSE 4OZFH 4YK4C 4DOHE 1LP9F 1M6OA 3VXMB 4KRPB 1FIEA 3IFLL 5ICZB 3ULUH 1BJ1J 3BRGC 1FQ9C 4M93C 5FYLH 4CN1A 4ZOBA 4PRHE 4JFDB 4AM0A 3OKKB 1MELA 4MXVE 3BAEL 4OFYA 3RPIA 1A6VL 4U0RB 2VDQL 4X4ZA 3N50A 4PJXA 1LDSA 3CVHL 4PJ9D 2IH1B 3IFLH 4XI5C 2CLZA 5T3XL 3SDYH 3WFDH 5BOZG 5DURB 3BGFC 3QUZC 1IFHL 4PG2A 4QGTA 1GGCH 4YDIH 5C8JB 1MLCB 2AABH 3ZHDA 4QYOB 5F88B 4P48A 4LEOA 2Q1EA 1HHKB 2RB8A 4DZ8A 4TUJA 4LHUD 1F90L 1L7IL 4N1CA 1FG2A 3D0VA 3FZUD 3RPKA 1H3VA 4UQ3A 4YC2B 3OR7A 4IOFC 2VZSA 3QUMH 5KG9A 3FB8B 1IL1B 5CP3H 2AJ3A 2DJ4A 2HLFC 3Q6FA 1T7VA 5E6ZA 3C6SA 2KH2B 1E27B 1F58H 1YDPB 1YY8B 2MNUA 1ZAGA 1OW0C 1ZLWH 1RZJH 1OPGL 4XNZB 2KZ1B 3WFCH 5I17A 3DETC 2J8UF 4JN1L 1QRNE 1NEUA 4WDIB 5DUPH 3TJEL 1BJ8A 5CJOL 3MACH 3DGGB 5GGVL 4CBPA 1JGLL 4K71B 4ZPTA 5DMYA 2GTWB 4XBEH 1I9JL 1MQ8A 1RURH 5CBEB 4JY6A 3D25B 3ZYOA 1QOKA 3MRCA 1XR8A 5TE6H 4DW2L 5F7EL 5I1EH 3OKOB 3MLUL 4OKVB 4M62L 2BXZA 4PRNA 5DZOA 2QBWA 2GSGB 3MRLA 2NY0D 4GRWH 2I27N 4PJFB 3TO4C 1P1ZA 3QUXC 4MS8C 4HKBB 4BQCA 5A3ID 4UT6L 5FFLA 2NY4B 1BAFH 1TZGL 2RHEA 2KQNA 4LHQB 3QO0B 1G0XA 2AKRA 1I8IB 4L8SB 3SDDA 1S7QA 3OJVC 1MFEH 4Z7WB 3LKPB 4O2EA 3LN4B 3W0WA 5CILL 4S1RH 3GKWH 3UTSA 3RX8A 2EH8H 4OQ1A 2ZSWA 1PW3A 1T2XA 2X09A 4S1DC 1V5JA 4AEEA 5E2JA 5C0CA 4P2OA 2OZ4L 1RIHH 2X7LA 3DSFL 5F89B 2DM2A 5CP3A 2JE8A 1E4JA 5F7LB 3UYRL 3IU3B 1B0RB 1H0DB 3DOSA 3LSOA 1ZVSB 2CLVA 4G6MH 4K3HA 3UZQA 4Y5YB 1OOAA 5ISZE 2EYTA 2ARWA 4LPUA 3ZL4H 4MCZB 5H37H 1IC5L 2WBKA 3MTRA 2YKLH 5IB2B 3B3IA 1MCPL 3WFHB 2HT3C 4HXBH 3G5XA 4HV8A 4Y4KD 3DMMB 4Y5XA 1ODAA 2E7BA 4BELD 1CD9B 2QLVB 1PZUB 4KQ4H 2OL3L 3GBNH 4F7PA 3QG6A 3QQ3A 5IV2B 3RWJB 2F5AH 4PRID 2AJUH 3WJLA 2H2SC 2WK2A 1CGUA 4PY7A 3P4MA 4GKZA 1JPST 4LL9A 5KVEH 4ZAKB 3RTQA 3HN3A 4R26H 4PRIB 2XTJB 1HYSC 5F6HI 1OWRM 1EJOL 1OWWA 2VUOA 3MLYH 2BNRE 2Z31C 4NHUB 4Y4KB 4KROB 4DN3H 3PV6A 3OB0H 2VB5A 1K9TA 4M7JH 1Y18A 5KVFH 4R2GB 3D18B 4NQCB 2QQLH 4HUUA 4YWGL 1L7TH 4JZOB 4UQ3B 1J0ZA 4G8IA 1L9MA 4I0KA 4EN3C 4D0BB 2FCBA 3MCKB 5DJYA 4Z7UA 2VNCA 5M94B 2CJUL 1M7IA 2GCYB 1YDPA 3W5MA 1CGVA 5AYQA 5EUKA 1B0RA 2QSVA 3SKUD 1F4XH 3GI8H 1YJDL 4PJXE 1G84A 1U8PA 3CFCH 5DLML 1PKOA 3GM8A 4F2MA 1JNHA 3MA7B 1X5GA 2XXMB 5CJQL 4ZUVA 1EMTH 3ARBA 3S9DB 1XFPA 3RKDC 5F1SA 5KVFL 5HHPB 5HDLA 2COQA 3LKPA 5I73B 4JJ5B 1J5OH 3MRKA 4YNYA 2VDNL 5F3HA 3RKDD 5FYKH 2X70B 1N4XH 3UTQB 1NFDF 2D9CA 3PWPA 2EDRA 2GJ6D 2NY7H 1NDGA 4BUHA 2VE6B 3OHXA 3CDCA 2XA8L 4AIOA 3LKRA 1IZJA 5JLZA 2VXSL 4CNIB 4M43L 1RK0B 5C08A 1IARB 1UB6B 3ARZA 3NFNB 1DL7H 2FX8L 1NGQL 4JFZL 1AD0B 3KDMA 2KL6A 2HRPH 4WI6A 1DQDL 4LVHC 4ZNEE 3D85D 2BSED 3SE9H 2E8YA 3QXDB 5I30L 5M95B 2J8UA 2R2BB 3LS4L 4KVCH 1P5UA 4BSWA 2X4PA 2IPTH 1WICA 3RTQD 2AV7A 3MV8B 1MPAL 2HFTA 3RP1A 2WIIA 5B39G 4MQXD 4ELKB 2V2TB 4UAOC 5CSGA 1AD0A 5IFJB 2BP3A 3G5XB 4GUPA 1MREH 1QHOA 3A67L 1W0WA 2WBWB 3ILPA 4F8QA 2CQVA 2YPKA 4MX7B 5DVOA 1CD1A 5EWIH 5FYKL 1MH5A 1NKRA 4YC2C 4HLJA 1FL3B 4H20L 3MZTA 2R0KH 1TIUA 5JPNB 3VXPB 1IGYA 4OBRA 3X13A 5BO1L 4KMTL 5AWNH 2X4NA 5D70H 1NFKA 1KB9K 2A74A 4G5ZL 3TBWA 4I1NB 3QUYA 1CE1L 4M1DH 4PREB 4NO5A 4PJ9A 4MQSB 3C6SB 1EBAA 4IOIB 2FH6A 4PJ8A 2R0WH 1PLGH 3L7FA 4W70A 2IFFL 2R0LH 4MWFA 3MLXL 3QHFL 3V4VH 1U91A 1U8OB 5B22A 5DHYA 1QUNA 5I1KH 4NWTH 1H5BB 1KN4H 3NCYP 1EFXA 3KJ6H 3RY4A 5TGBB 3INUL 2IMNA 3LEVL 4DCQA 2MOVA 1INQB 4YJZL 2EDTA 3DVGB 5D1XC 2J6EH 3WLBB 3HMXH 4H20H 1HHJA 1SJHA 2FNBA 2A9ML 4APQA 1S9VA 2KKQA 1BD2A 4JDTL 4BM7A 4KTYA 3U7YL 4PYGA 3VCLB 1ACZA 3CZFB 4MD0A 3DXAE 4HGWA 4NO3A 1T20B 2AAVA 4L3CA 4ELMA 3S4SB 1XGYH 1QLFA 3T8XB 4BQ8A 5IHZB 3ZT6A 1P4BH 3AXLB 4KVCL 1FO0L 1X9QA 3L3IA 1S7VB 4L9LC 2DIBA 4XPAL 4HS6A 3S97C 2AEWA 4ZFGL 5JPMA 2IALB 4PJGE 5D6DA 2VDKH 5HI3C 3HB3D 3QG7H 1U41A 3I3DA 1FNHA 3FO9A 1MFAL 2NY1D 5T1KD 1KIUA 1BREA 2RR3A 4EDWL 4WI4A 5I16B 4HBCH 2VLKE 4ODTH 2HFGH 4OV5A 3FTGB 4MNGE 3X13B 2EDQA 5DVKA 1IGML 1FN4A 4XWGL 4GS7B 1AGFA 3VXNA 4YHPA 1FZJB 4MXVF 4NRZA 3KPLA 5DYOA 1MJ8H 2V17H 1Z9MA 4JE4B 5KW9H 1S7RA 4PJ8B 4M6MH 3PP3K 5B38G 4EUPB 1HIML 4GAGH 3D48R 1JNNH 1MJUH 1BZQK 1HXMB 5F97E 2HKHL 4ALAL 1GZPB 1FG2B 3ARBD 2Y1VA 5LGHH 5I30H 4KK5D 1SVCP 4YDVA 3AREC 1FNEA 2J6EA 5IHUH 5IKCB 4PP2B 4UDUA 2ADGA 3NZ8A 3WXWL 3KYOB 3W82A 1MH5B 1CFQB 4PJ8D 3CH1A 3ZTNH 2P4AB 4U3HA 3M17A 3O3AB 2I5YL 1FFOA 5E8OA 5EBGA 3P9MB 5KVMC 1GGUA 4WWKB 5JOFB 5SX5K 2AV7B 2D0FA 3O9WA 3VD9A 4KHTH 5GJTH 4XCEB 4OFVA 5IB5A 4MSWB 5D1ZC 3ARYA 4WFEE 4LQFH 3TWCL 4XRCB 2J12B 5T1KB 2HN7B 4JFYA 4P2RB 1XR8B 2Q6WA 3M17B 5T1DH 2ZKHL 2DTSA 4XMKH 3MQIA 1YUHA 4KDWA 2VXVL 1Z3GH 2D7NA 3ZSSA 1BOYA 3BH8A 3WN5C 5HHNA 4JB9L 2Z91B 4GG8B 2J5LC 2VQ1A 5CGYD 1HSBA 3QDHA 5IESH 2VIRA 4UQ2B 5TE4L 2R8SL 1IFHH 1YNLL 4YDIL 2VWEE 1WVZA 1AXSA 1FO0B 4Q2ZB 3UYPA 3V0WL 5IVNA 3QIWA 4Q6IA 4PJIE 1HEZA 4K7FA 3FFDA 3GUTB 1ND0B 4H1LG 3L3OB 3GSWA 3CMGA 1DUYA 1DVFD 5DQ9B 4U7SA 5LGHL 3RWFB 5J12C 2AJVH 4P46C 1R3KA 2HKHH 2BSSB 2YD7A 2CO6B 3BAEH 2XKNB 3BWAA 4JO4H 5KVEL 5K9JH 4PRAA 4LF3B 1I3VA 5HHVL 3GSUA 1PSKH 3MRPA 4PGZA 4YHIB 4GG6F 2GFBB 1QSEB 4G8FA 1KN2L 4XCYA 2ITCA 3MLWH 3HLAA 3VA2C 4IIQB 2C5DC 5FF6A 3WFDL 1PEWA 2HVKA 4FRWA 5BS0E 5HHQB 5DK3A 1S8DB 2EDDA 3NTCH 2HFGL 1IAIH 1ZT7B 5LGJB 3QXTA 3DECA 1EZVY 4NWUH 1KB5L 2JJUA 3MLWL 4IMLA 3ARTA 4P9MH 4P99A 1FVEB 5AZEH 4YX2H 5C0CE 3ULUF 4PJXB 4JEGB 4UNTA 3PWJB 3NN8A 3GIZL 3MRDB 5D2LA 5BVPH 3B3IB 5E9DE 3TIDA 3EDEA 4HWBH 1BP3B 2NY5H 3DIFB 1MWAH 3CLFH 3CVHB 3VFWA 4M62H 2EZ0C 1IC1A 3VD5A 4PIRF 3PGDA 1ROWA 2C3VB 3P4MB 2CK2A 2XV6B 3LSOB 4GKZB 4I13B 4OGZA 4X4XA 1J1OH 2J6EL 3RI5F 1RU9H 1A1OA 2JB6B 3VWJA 3R06B 4KAQH 1SJEA 4RZCB 4G8EA 5I8CA 1CQYA 1GHFH 3E2HB 2EXYD 3DARA 1BBDL 4P9ML 3RNKB 4OSUH 3SKOB 3MRQB 4PB9H 4JFXA 4X5WA 4S1QL 1S9XB 4G42A 4MQTB 1KEML 1CFBA 4JZJB 3LQAL 3BN9D 1HHIA 3I3BA 1KN2H 1T1XB 3IDMB 3PGCA 4PJFF 4J23A 1J0YA 3EKCA 4N1HB 5E00A 4U4BA 4G6JL 2QSCL 5DJ8B 4HKZA 5DJXA 3IDIA 4Y4HB 3ARDC 2J2ZA 5ISZB 2FL5A 3V7MA 1GGCL 5TDNB 3QYCA 4M7ZB 3MRNB 5EZLB 2VERN 2VLKD 2P42B 2JJTA 4QHUB 3T0ED 4X7TB 3QRGL 2GT9A 1TZHB 3T8XA 2WWKT 43CAA 3KPNB 1IAMA 3LPFA 2NW3A 3RVTC 1UA6H 4U7KA 4CJ0A 3VMOA 2M2DA 3MV7E 2LU3A 1ZLSH 5J57B 2FDBP 3VWKC 4M6OL 3ROOA 1D5ZA 4PJ7E 4WW1A 4QRTB 1UADC 3EYQD 1H3PL 4X6BB 3VI3F 3KLAA 1JWSA 4ZAKD 2FR4B 1YEIH 4QRSA 3UDWC 1UWXK 4NNPL 2HTLD 4RGMB 2ESVD 4UIMA 4N0UE 2EDFA 1J05B 2BJMH 4CU6A 5HYJE 3TBYA 4ORGA 3D0LA 4NZDA 1HHKA 5D8JL 4LLUB 1WBZB 4A6YB 1U95A 5KBNC 4Y7MA 3SDYL 5L8JB 5JDSB 4CW1B 3HC0A 3GO1L 2YBRA 4LEXL 2JJWA 2R4RH 4PR5B 3TYFA 3H3PL 2DQIL 2PCPB 3SJVD 1KEGL 5CCKL 1X4ZA 3R1GL 5FYKU 2QHRL 3JWDL 2RJMA 1OVZA 5I8OL 5KTEL 1FYTD 1FAKT 5J1AB 2FJFB 4OZFA 3HC4H 3PQYE 5LJYH 1ZSDA 3CFKA 3G6JE 1G7LA 2NR6D 4KH2A 3EDKA 4WU5B 3K80A 3OXSB 1EHAA 1HZHL 1P84K 2DM3A 3F62A 3EYFB 4TNWK 2ICWI 2UYLB 4KK8C 3WNKA 4CVXA 3TT3L 1V7ML 2GJ6E 3BPOC 1FZKA 3P11L 2DMBA 3SN6N 2CRYA 43CAB 1YNTA 2VH5H 2O5ZH 5AYUL 5F3BB 1U92A 4Z76A 3C5SB 4OZGE 1WCBB 1QBMH 3R1GH 3WIHH 5JHDD 1D6EA 15C8H 3AMLA 1SBSH 4L4TA 4N90D 1OT2A 4OLWL 1OSZA 4OZGB 2IF7A 4APQB 3X14B 1MRFL 2ZCHH 1FNLA 1JWSB 2FR4A 4MNHA 4LSPL 1RZ7L 1RJZA 1QR4A 4IHOB 4JRYB 3KPRB 5B38A 4N5UA 1G7QA 5H94B 3GSVB 4K3GA 3CVIL 1EFXD 3MLRH 4KK6C 5T3ZE 1K8IA 1FYTE 4XNZC 2R2EB 2HJLB 4JQIH 2Y23A 3WNPA 3U36A 3RIFK 4NQDE 3CK0L 1FYHB 5E56A 3L3GB 2NXYB 1N5YH 3MRJA 3QRGH 2F53B 2H3NA 4YDLB 2APBA 4XZUA 3KLHC 3VFNA 5DJXB 3VH8A 4K71C 1KV3A 4MD5B 3GMNB 5JIPA 1JF6A 5BZWA 1DBMH 5MENB 2EIEA 4HBCL 4IOFD 3BP5A 3NOIA 1JPSL 3U36B 5E2VL 4Z5RB 4HC1L 5E8NA 4HKXA 2YRLA 1A6PA 3HG1D 3BGFB 3QUZB 1NDMA 5DJCA 3JV4A 4LHUB 1E6JL 2NW2A 1DLHB 1VADA 1RIUL 2DQUH 1ADQH 4PUBL 4U6XB 4X7DC 3H7BB 3U4AA 1KJ3H 2ZOLA 3AUVA 4MNGA 4PJ7B 3RZWA 1FCCA 3LKSA 4HJGB 4M1DL 4P23A 5B4MC 3CD4A 4P49A 4JPWL 1CZ8L 4X6CE 5ESAB 1DVFC 1LWRA 1GGTA 1MUJA 3QP3A 4JDTH 4H25B 5HJ3B 3OG4B 4U1KA 2ATKB 3MRDA 2IH3B 1U9KA 5I1EL 3ARFD 4OM1H 4H5SB 4QT5A 5GGRY 1MWAA 1MCOH 5EUOE 2IPUK 3T1FB 1F3DJ 3NFNA 3TA3D 3PG2A 1BBJA 4N8CL 1NLDL 2VC2H 3L3JB 43C9A 3NAAL 1I1YA 4HEME 2BVOB 1D5MB 1YNTB 2Q7YB 1Q9KA 1SMAA 1XF4A 3FJTA 4OLYH 4ZOEA 3QIBA 2XZZA 3MOAL 3PP4L 5FV1L 4M4RA 3DUHA 5EZIL 1I4FA 3TH2T 4MJ5B 1DVFB 4WFED 1OB1A 3CCHA 1GAFL 3JWOH 3VXSB 2OX5A 1CE6B 3HI5L 2OK0H 3OXSA 4I4WB 5AYUH 3KYOA 1K85A 1Q8MA 3GI8L 1TMCB 2YD1A 1L6XA 3HZVA 4WIQA 3SO3B 4HG4K 4GRLA 3REWA 4Y0GA 2VDOL 3PDOB 4QXGL 4Y5YC 5D1ZD 5DJ0B 1A4KB 1UENA 4AH2A 4LIQH 1KPUB 4YFLF 4ODHH 5DDHA 1AXIB 1MCOL 4PY8I 1QSZA 3PDGA 2ADIA 4OGYH 5BCAA 5JHDA 3UJIH 5JIKA 3FT4A 5J6GB 4OLXL 1RUKL 2PO6A 2YRPA 4DKFH 3K2UH 3NABH 4NO0D 3TF7C 4U1JB 1FZOA 3QDMA 2ZCKH 4XVSH 1GGYA 5IWLA 3QDAA 5F88A 4WUUA 1QSFB 1KCSH 1IAKB 3KAAA 2AJXH 3DHJA 3MRCB 4WHTA 5E7FA 3LZFL 3SCMD 2CIIA 4M8QB 3MGOA 3BP6B 1A0QL 1T21B 3HE7B 1FFNA 3BE1H 1LEIA 3EO1A 3C60C 5DFVD 2J3SA 1AP2A 2O5YL 3QA3B 3I2CH 4LLDB 3VFOB 3DV4A 1J1XH 3ARQA 3KPSE 3QNYB 5J9PA 3VA6A 4WW1B 4X8XA 3V8OA 1YEFL 1W72A 3VXTB 4I3RL 5I17B 1I7ZA 1Z3GL 4IRJB 1QPPA 1Z9LA 3ARVA 4OGXL 4RGOL 3KYKL 5E1AA 4WEUD 1IC5H 3T08A 4JDZB 5MENA 3T0BA 4R3SB 2EC9U 1I8MB 4ZS7L 1KACB 3S36H 5D5MF 3X3FH 1VB9A 2OXGA 4OSUL 5GGQL 2YPLA 4AT6A 5L7XH 3TFKC 5D2LE 2Z92B 3RY5A 1U8OA 1QLEH 2CO7B 1ZT4B 3EJZD 3QCUH 5IROC 4QYOA 4LKXA 3HMWH 1C8PA 5CWSB 1CG9A 5GRZA 1YZZA 3KPLB 5DYOB 3LQAH 1F45A 5EO0B 4DN4L 1T22A 3RGVA 3PWNB 4M7LT 4W4OA 4RFNC 1RSFA 4HGKC 3QO0A 1ZLVK 4DN3L 5LG1A 1U42A 3AFLA 3IXAB 2YD2A 5JPNA 5HHMD 1UH3A 3NPSC 4H0IA 1GHFL 1MWAL 1ZA3B 2F9BT 5GGVH 5C0RL 1CD1B 1VFAB 1QBML 3SOBL 4J1UA 4G7YH 2R4SH 2F58H 2VDRL 1F4YL 1I7RA 1A1MB 2WANA 5AZEL 4YX2L 3IVKA 5EU7E 2GI7A 1MJ8L 2V17L 2W92A 3PL6C 4HUUB 4NC1C 4X80L 5C0AE 4Y2DC 3QO1A 3UZVB 2XXCB 1UYWH 4NN7C 4NKQB 3CFBB 5F44A 3WDIA 5IFAH 4M8VA 3QHZH 3PWVB 4HJ0C 2W65B 1EFXB 3ETBF 4PRPA 5CZVH 3RVWD 1MHCA 3U7WH 2DQHL 3BIAX 4JFFB 1HH6B 4OB5H 3VU2A 3EHBC 1OQOA 2V2XA 4B50A 4X4YB 3O4OC 5INDA 1CGSH 3E6FB 2Z0BA 4YPGB 4AMKL 5IJKC 3SOBH 5AZ2H 3PDOA 4PJDE 3D2UB 4LQ1A 3DUUB 2R0ZH 4QHNA 1T2QH 1KB5H 1FBIH 2GFBA 5HPOA 1SY6A 2BOBA 4LCYB 3WYRA 5D8JH 3I3EA 1NC2A 5DVLA 4B5EA 5ISZD 4LRNH 1RV6X 3A6BL 2HFEB 3OKMA 1A8JH 1IGJA 1T83C 2JK5A 1EEYB 2W07A 4ZXBC 5GGVY 1YEIL 2GJZB 3LQZA 1YEGL 3O41A 5IMMA 5LXGL 4P2OB 4U33A 3RBGA 2FWOB 3GSWB 3GBML 3U0PB 4QRRA 4BK4A 4YHML 4PR5A 3TYFB 3FN0L 4H1LH 5EG6C 3EFDH 5CJXA 2NZ9C 2MQ3A 1MCSA 4OZIE 4DJMA 1LE9B 4L9LB 3KYNB 1B6DA 4Z8FH 2FSEB 3L3HA 4EQ2A 2FJFA 1RIVL 4BFGA 1A1NA 2EDEA 4JG0L 5FYJL 1VPOL 5F7YC 2V7NA 4G8GD 4EKXA 3VFOA 4NT6A 1SEQL 4YBHA 1KLUB 1N2RA 5SWSA 1QO3B 4F7EB 5C86A 1UZ8B 3OAZK 2NX5E 3OAYK 1BEYL 3H2WA 4WJ5B 5ESAA 1A7RH 2OL3A 3TZVD 2PXYD 2VZVA 3BDYH 4ELKA 3OF6A 4GG8A 2DLTA 2EIZA 5HVHB 4HFWB 5F7DA 1I1AA 4BSWB 3LDBC 4DVBB 3P0YH 5L8KB 5ACMA 3EO9H 4PP2A 3WNNA 3I75A 5TDPB 2CDGA 5E03A 5JIIA 3PIQB 1F58L 4OGXH 4NN5C 3RKPA 3DX9A 5T1LB 4P2QD 3WCYA 4GRWB 5TE7L 1I7RB 3LS4H 4Z8FL 4KPHL 1HSAA 2XRAH 3DMMC 1KT2A 1G7LB 2LVEA 4KFZC 1KYOK 1F4WL 3FKUS 3BP7B 4XGZB 3IXAA 4GRLB 3REWB 3HE6D 4R4BB 4XHJD 1U8NA 5FIEA 3WFBH 4I9WE 4IRSC 3MRIB 1H3WM 4U31A 3VRIA 4XVUD 3VW3L 3KXFB 2MKWA 4U1SA 4MB5A 3MRRB 2AK4D 4LCUA 3GI9L 4EDXA 3NIGE 2ADIB 2HJLA 1T1WB 4P5KA 3BT2L 2CR3A 5DK0A 2V5SA 1V3LA 3E6FA 4J12A 4KZEL 4JGJA 5EUKB 2YD8A 3DRQB 1M7DB 2VDKL 4GRWF 4IRJC 5ID0B 4FQQB 5HHXH 4QHMB 5C0CB 1B88A 4HWZB 1CGSL 3RWEB 3TM6A 1SEBB 2MJWA 1DN0A 4XP1L 1N6VA 3B4NA 1N5YL 3WN5B 1IGMH 2HLAB 3O3UN 5DI8B 2A6JA 4QRTA 4K94H 2BY3A 4OLYL 3QIUB 1ES0B 4XWGH 2OI9B 4X9GA 1OP3K 1INDH 2EECA 4ODUA 4YHYC 1ZHKB 4L8SC 1AQKH 5K33A 5K9QI 1ULVA 4ZD3L 1AR2A 4ERSH 4OV5B 4Z7NF 3QUYD 4X9IA 1HXYA 2OQJA 4OGAD 2WMPA 2Z31D 1QR1B 5ESQB 3HI5H 1UCTA 2OK0L 1SY6L 5IB4A 1QA9B 1EHNA 2NX5A 1KYOJ 3MRGB 4FQ2L 5C0AA 1U93A 1ZHKA 2YUVA 4HK3J 4LDLB 4P4KB 4U1LA 4JG1H 5HJ3A 2AEPL 1Q9LA 2R0LL 1CZ8H 4NWTL 4P2RD 4EUPG 4NRYB 3ZDXE 3O0RL 3U1SH 1F8TH 4GAYB 3HR6A 2DLGA 3U0TA 1RZKH 4GMSH 4HUXB 4A6YH 4I0PC 1BIIB 1KJ2B 1QFUH 3U7YH 1U8NB 1BZ7A 3GSOA 4NO2B 4ZO7A 1UC6A 2EDYA 1IEBB 4G43A 1MCKA 1MQKL 4R7NA 5EU6D 1AQKL 2C3GA 2EYRA 5AAMA 5C0EB 2ESVA 3AU1A 1INDL 2AJZB 3V5KA 1N59B 4L8CB 1EJ6A 3TNMB 1DQLL 4ZFZA 4JPWH 3LKQB 5IW1A 1WTLA 2GSIB 5H2BB 3TP4A 4UINL 2PR4H 4BFIB 1OAZH 4R2GD 4DUWA 2CIKA 5ECJE 1GRWA 1JPTL 1MI5E 1S5HB 2K7QA 1KTDB 4LHJB 2XG5A 4L8DA 3EBAA 3M8OH 3NFPA 4IMKA 4ONGH 1GJIA 3I9GH 3MUY1 5TFSH 4JM2D 5FGBA 3MR9B 2OTUA 4HS8H 4PJHA 1UB5B 2HT4D 1UJ3B 5CEXB 1FZMB 2YPVH 2YN5A 4O2FA 1FL5B 4YR6A 5JUEH 2EDHA 5TDPA 5E08L 1A0QH 3KS0H 4OIIL 2O5XH 1FVCB 5K59F 4NUJA 4PBVC 1DL7L 5DRXA 5BV7C 1CLYL 4NO0B 4OF6A 3VI3E 4X6DF 2EH8L 3L95A 3G6DL 3ESVF 4TQEL 3L1OH 3WUWB 4JLRA 2QADD 2WW8A 4UILH 3IFNH 4CAGA 1EEUA 1UH4A 3BUYB 4QXTB 3KPTA 4NCC1 3MROA 1T7XA 1AP2B 4R7DB 1WZLA 5GGUA 1J0KA 1PZ5A 4FTVE 1IEAA 2H6PB 4JPVH 2IG2L 4LCCC 5TFSL 1KPVB 3QDJB 5HHXL 3HZVB 4NNXB 3DXAD 3JVGA 3B9VA 3MGTA 3VG9B 3P77B 4RA3A 4KKNA 5EZJA 4GBXC 3WUWA 2A77H 2D7OA 3FT3B 1NANH 5IG7B 3S5LB 2GTWA 1HYSD 4RISH 1AI1H 3TPUB 4X6CF 4PRPD 2I25N 1MAML 3O8XD 1H15A 1YYMH 1KCKA 2X2YA 1BEYH 4OLWH 3VFMB 4QRRB 3U0PA 2GSIA 5H2BA 4YZFF 5C0BD 2O5XL 4GH7B 3CH8A 4YH6A 5FUOH 1T0NA 3SDAC 1NCDL 4WHYG 4XPGH 1CFNA 2Y6SC 3ZYZA 4XB7A 3NFPB 5LCVH 3TA3B 1IE5A 1WBXA 2GTZB 3VXMD 1WBZA 3V5DA 4ODBD 2CD0A 1KIQB 4NNYB 3MA7A 4ONGL 1HSBB 1G9EA 2XQBL 4JG1L 2R69L 3CVHA 1QBAA 3RBSA 3O2VH 4Z7OE 1QFPA 5D2NA 4I3GA 3ME0A 5GRWA 3EYOB 3L5HA 3L3JA 1A6AB 43C9B 3PGDB 1I85C 3WEXB 2E27L 3RX7A 3SCMC 2CKBL 4NQEB 4RMRA 4DGYH 1OTSC 3HTLX 3OGCB 1XF4B 3V8CA 2FD6L 5C6TH 3FRPA 3WLBA 2FHFA 3O11B 5D1QA 5LQBL 4DUXA 1U6AH 5DD5L 2DQJH 5SWZE 3OZ9L 4RMWA 1QSEA 3SO5A 1HYRC 2DQCL 1BGXL 3VXUD 3L5JA 4WENB 1MY5A 4FQJL 4O02H 5MEND 3Q6GH 4KZDH 4PUBH 2HJKA 5C0GB 4ZTPL 4WHCA 4YHMH 4O5LH 4TNWF 1KXTB 4D8PB 4NO5B 1T1XA 4IRJD 3PQYD 3H9SD 1EO7A 3VRIB 1YPZE 2OTPA 4MA1C 3B9AA 2J4WL 3MZGB 1BQUA 1ACYH 3NZHH 1HDMB 1XGRA 2EC8A 4R8WL 1UACH 1R3JB 3SGKA 3A6BH 2EXWD 3BIKA 1UA6L 3NA9L 3DX8B 1FL3A 4HMCA 4JFXB 1QRKA 5DURD 2JJSC 2GAZA 2VDRH 3GRWH 3DVGA 1N0LA 4B53A 1RJYA 4JZJA 4MB4A 2W0KA 4HWZA 1I9IL 1AE6L 4LLWB 4WTZA 1A6TA 1QSFD 1TXKA 3VXUA 4JFEA 4EUPH 2ESVE 3MYJA 4YK4B 2JCCE 1U8HB 4R2GC 5SX5H 2R1XA 4F37K 4KROC 4HKJA 2DLFH 3NCBB 2ATPB 4J3OC 3EYVA 2W60A 3RQ3A 5GXBB 2JB6A 3VWJB 3RL1A 1B4RA 2R23A 4ZPVB 1GCFA 4UIMB 3NFSH 3L5IA 4WV1A 3W9EA 4AYFA 3GSQA 3KLAB 4WFGE 1EAPB 1H3UA 2KPNA 2FGWH 1U3ZA 2HVJA 4CU8A 3D39D 1VKXA 2GK0B 2Z35A 4QRRE 2CRZA 3PE9A 1WIUA 3VXOA 5GS0D 3U83A 3C60D 4UOJA 3B2UC 3RNQA 5I1DB 4XXCC 1XF5A 5DWUL 1OPGH 5CKAA 5DLMH 1RUMH 4M7ZC 1LEIB 2XN9D 3K1KC 3ZLQC 2BY0A 3FN0H 4NFBA 1FE8L 1WFNA 3T2NH 3WKML 3MV8E 4KI5C 3DMMD 3TA3A 3V5KB 4TN9A 3U0WH 4D0CA 4L3AA 4PRBB 4NOBA 2HWZH 4U1IB 3GMRA 4UDUB 1RZJC 1VERA 4XNYH 5DJ0A 4UOW0 5SV4A 4TYUA 3X11B 1XGUB 2CGRL 3E2HC 1IQDB 3CX2A 1QBLH 3UTPE 3IDJA 2ORBH 4HCRA 4HS3B 4JO2L 1JZ7A 2QKIA 2HKFH 2X4RA 4JM4H 4LEXH 1FSKC 1UWEL 3FO0L 4NQDD 4Y4FD 3MBED 5EZOH 2IAMD 1AGBB 1HEZB 1A6UH 5HVFB 1OB1B 3CCHB 3DLQR 4FXLA 5IFJA 1E4XL 4L3ED 3UO1L 5CEZH 1I3RB 2ICES 4GW5B 2EE2A 4NZRH 3P73B 1HQ4A 4BJLA 1Y18B 2VZTA 3W9EB 1A9EA 4FQHA 1DCLA 5HDBF 4CW1A 3IDGB 1TVDA 1MCQA 4HDIB 1CE6A 5E4IA 5LXGH 1BM3H 5TE7H 1JNLL 5EUOA 2PW1A 3GMMB 4PGBA 3FQXB 3ZE0F 2AQ3A 5DJYB 3TLRA 5CUSH 3S37H 3KPPA 4E0RA 5CJ8A 1ZT1A 3V2AR 5I6XC 1VFAA 4K23L 5IR1B 4OCSL 1IEAB 3IDXL 2X89D 3T65B 2ORBL 4JO2H 1LO0L 2R2CA 4QCIA 5ICXA 2F8XC 2JIXD 4KUCF 3HPJB 4GAGL 5F96H 1CL7H 2PTUA 2PYFA 3BGAA 3VDAA 3G6AA 5ITBL 1QLRA 4PFEA 1Q0YH 4LSUL 1ORSA 5DUMH 2XQYK 4N0RA 3ZMRA 5C0DA 4JM2B 3UC0L 3VH8B 2P5WA 1FYTB 5DGRA 4AIXA 1KB5B 4YIQB 1N64L 5E8DL 4HUKB 3O45A 1C5BH 3SJVB 1T1ZA 1C1EL 1FDLL 1TVHB 5HPMA 2ZSWB 3ZDZF 3SDDD 3BISA 1S9WA 5C1MB 2IBBA 4NBXB 5EBLA 4P4RA 4ALAH 1DLHA 4KHTL 1JF1A 2BOBB 4EN3B 1HIMH 5FYJD 4KRLB 3SPVB 4BK5A 2V9TA 5I1HH 1FL6B 4NKIH 2VLRD 1T7ZA 4U7MA 3BIBX 1CF8H 5C0AD 4XPHL 3U46B 3KYKH 4XX1G 1U8IA 4PJAF 4XH2B 4N8CH 3UC0H 1TJHH 5IQ9A 4MZ3A 1LEKB 3HRPA 3VD3A 3STZA 1PKQB 2Q8BH 2YUWA 3BXNA 5CD3A 3ARRA 3FQXA 4PV8A 4RRPG 1HINL 2DKUA 1GIGL 4PJDB 5DZNA 5A43C 2Y7QB 3O11A 5D1QB 1JHKH 3MODH 4HWBL 5IB1A 3FQNA 5TPWH 1TTUA 2A6IA 2X1PA 3G6JB 5D6CB 1OGTB 3GEWB 1OLZA 1XGYL 5HYJA 4JLRB 1HKLL 3D69B 3SY0B 4WGVB 1OF2A 2JELH 1E6JH 3V5HA 4PJCF 1CL7I 3K2UL 4U1MA 5FUOL 5IK3B 1RUPL 1IKNC 1DQQB 4I3RH 1E28A 3PHQB 5DXWA 1NMBH 2XWBA 5E6IA 3TGXA 3AAZA 5F7WC 5EBMB 3LPGA 2ZG2A 4PGBB 3ZO0A 5ID0A 3BGMB 2DJSA 3V4UH 2MCG1 2VDPL 1KFAH 2X4UA 2R1WB 2CKBA 5T5NG 5I8KH 4I0PB 3VI4F 1BVKB 1SBSL 4R90L 3P0VH 4KU1A 4LDEB 5C07A 5E6IB 4ORZC 2DMKA 2FEDD 5JMRA 1X7QA 3V0VB 3RPIB 2ZUQB 3I6GB 2P24B 5DRWA 3FFDB 3O6MH 4O51A 1ZHLB 1XCQA 4TUKL 1T3FA 4TQEH 3HCVA 2R69H 2VR5A 4PJEA 3DROB 3VRLE 3QIBB 1T03L 4P5TA 3SJVE 5A2JH 5EWIL 3IFPA 5ALBH 5GS1C 2H41A 2CLRB 4ZTOH 2A83B 4LSRH 3PL6B 1P6AB 4RQQB 4X6BA 1BFOB 3U79A 1CDGA 2AJYH 3MRNA 3H3PH 4W4NA 3CDGB 2ICWB 4L4VA 1HOCB 4LSTH 3KHQA 3BKCL 3CIQA 3C09C 3IJSB 3QDMD 4PJEF 5T1MA 4OZIA 5JOPD 4RNRB 3QNXA 3D9AL 1ZVYA 5SV3A 4WW2B 1HZHH 3W11C 4D9RD 3N9GH 1JTOA 2FJHA 5L6YL 4MXWH 1FC1A 2IAMC 1MHEA 2BMKA 5D93B 5IMLA 1QFWL 4MCZA 4UBDD 1SJVA 5SX4H 5E8OB 4POZD 1IM9B 5F1KC 4R90H 1QNZH 1QYGL 1NC4D 1RAMA 3SDCD 1GZQA 2Y25A 1H9VA 3IRZA 4D8PA 3E8UH 5DMGD 4HWEL 3C6LD 3U4EA 4WUUE 1C5DB 4G8GE 3O6FC 3F7YA 4MJID 5ACLA 3IJHA 5FO9B 2XN9A 1SJEB 1NAMH 3BQUA 3WD5H 3CXDL 1IT9H 4XPFL 2QL1A 2XWBB 4QRPE 2NLJB 4LCWB 4PJCE 4OCNC 4GRMA 5DQJB 4EDWH 1CN4A 1CU4H 5I1JH 2J5LB 3KPSA 4XNXH 1QFUL 4UAOB 2YPKB 4WW2C 1CFVH 2DQCH 5ITFA 3KJ4C 3CFDA 2MPAL 3DURB 1XCTA 2BHYA 2IGFH 1S9VB 1F2XK 3RZCA 2G75A 2JLLA 3MRGA 1Q9OA 4F7CA 1SVZA 4DKAA 1EJOH 2X1WL 4JN2A 3CFBA 4WWKD 3DX6A 3P3YA 4ESKA 1FV1A 3I84A 3SCMB 1TZGH 2XY2A 4C54A 4PLNC 3DGGA 5DFWH 3H0TA 4N9OB 1HH6A 1WAAE 1X5FA 4RMVA 3JBG7 3LKSB 3N1MC 4G7VL 5MERB 3T2QA 1F6FB 1X5YA 3INUH 4PD4K 3SDCC 1YN6B 2F5BH 3WS3B 4XWOD 4JN2B 4AL8H 1ZA3A 4MQXC 4P9HH 2NNAA 4EXKA 1KJ2L 2ZSVB 4YXKL 3SKNA 1BD2E 4AEHL 3VRLF 4C56B 1NBQA 5I19L 1CDJA 1A7NL 2J8OA 3O3BB 1FORH 3V5DB 3GMLA 4MNQE 2Q8AL 4U1NB 3DI2B 5CEYA 4P4RB 3CPLB 4FQXD 4D0CB 2N7BA 2X4QA 3QQ9D 2OJEA 1FG9C 1CD0A 3GBNL 4GUPB 4YBLB 1ZA6B 5D70L 4KKLD 3MV9A 3PF2A 1AGCB 4YO0B 5FHBH 1NAML 3VJ6A 1ITCA 2E7LA 1CXLA 1HWHB 5I8EA 5B39A 5FK9A 2LU4A 3LN4A 2JTDA 4I4WA 1NGZB 1CL7L 1MF2H 4ORGB 1MPAH 4NSKA 4WI2A 3BN3B 3T3PF 5ITBH 3TT1H 4QHNB 2XWJB 5DJZB 5DMGC 2QHRH 4ZAKC 2IH3A 3KWWB 5F96L 2NTFA 5FO8B 2BSTA 4FQCL 3DUSA 3TYGH 3EUUA 1XF5B 1N2RB 5SWSB 3VFTA 5I66A 2SEBA 3KPMA 1KELH 1JN6A 4K23H 1I1AB 4ONOA 4J3TA 4OCYL 3FB6A 5EO9A 4S1DD 1KT2B 1OAKL 5D9SB 1ZLVH 3P4NA 2R9HD 3MCLH 2G9HA 5D4QA 1NAKH 1CGXA 1U0QA 1ZLUK 3GJEA 4QHLB 5HDBE 5C0NC 2CMRL 3QDJA 5CD5C 4HDIA 3EFDL 3O8XB 3T0EC 3IRPX 2FLRT 3C5ZC 5E00B 4QOKA 5I2IA 3BPNC 5L88H 2XA3A 4QXUL 1T5WA 3J7HA 1NMBL 5ICYA 2G9HB 1IC4H 3FHQA 4HV8B 3KNBB 4XAWL 5IIEB 3MXVL 5JQ6L 4NN7B 4NO0A 4ZFFA 1AGBA 1H5BC 2PUQT 4XVUC 4YDLC 1J18A 1KLUA 2X4SA 3DVNA 4JG0H 3NBNA 4WUKL 3HZYB 3TVMA 3ZDXF 3IF1B 3PWLB 5E7BA 1MI5A 1NBYA 2N1KA 4NQCD 5T3XE 5E6ID 4O51B 2HAZA 3GBMH 2CGRH 2XPGB 1HWGB 1PY4A 3P2TA 1OTTD 4PJGF 1BIHA 4RWHA 1JUFA 2BNUB 2GJJA 1LO4L 2WP3O 5HGHA 5J3HC 3U7WL 5HPMB 1BWWA 3Q5OA 4LVHB 3ZTJH 1FE8H 3U6RA 3HAEH 4Y89A 4W6YB 4GMSL 1NBVL 1MI5D 1DFBH 5C0JA 4P4KC 3UBXI 1U58A 3D85B 1R3IH 3J8F7 4JKLA 4O2EB 5KVDL 5HGDB 4PGEB 5I1IH 2E5EA 2JIXA 5JPMB 4X5LA 3RIAF 3FOMA 4M6ML 1MFBL 2X5PA 4PJAE 1CXIA 3D2UA 1FRGH 1TQBC 1R24A 4BFBD 1OAYH 4LU5L 4I3SL 3K8MA 1V3MA 2L7JA 2PW2B 1F5WA 2WQ8A 4X9FA 4EIGB 2XG4A 3EYSH 5A40E 1D5IH 5D71H 3ELAT 4EI5D 1B4JH 4PRNB