4KROB

Nanobody/vhh domain ega1 in complex with the extracellular region of egfr
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
128
structure length
116
Chain Sequence
b'QVQLQESLSCAASGRTFSSYAMGWFRQAPGKQREFVAAIRWSGGYTYYTDSVKGRFTISRDNAKTTVYLQMNSLKPEDTAVYYCAATYLSSDYSRYALPQRPLDYDYWGQGTQVTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epidermal growth factor receptor
molecule tags Transferase/immune system
source organism Homo sapiens
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
total genus 16
structure length 116
sequence length 128
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroB00
4HC1A 4NN5B 1ZHKA 4A6YL 1KBGH 4LLQB 1MVUB 2C3XA 3A6CH 2BFVL 3ARYA 3BIKA 3ZHDA 3GSRA 5FA3A 3VXUB 3A6OA 4P5TB 1AP2A 5BVJA 5JLZB 1KJVB 4GW4A 5IHUH 2D7NA 4IIQC 5HGGS 1Q9WA 1TCMA 2F58H 3MREB 5DRXA 1A9BB 4LKCA 1LP9E 2UWEA 5B4MD 3TIDB 3PWPE 2DQGL 3CMOH 4X7SH 4XVJH 1S7WB 3PGFL 4C56B 5LQBH 2V9QA 3MV8B 3NH7L 1WAAE 1B4RA 2ZSVA 1NCCH 4S1RH 5TDOA 3DETC 4KQ3L 4LMQE 5HGDB 3G6AB 2A83B 4ZAKD 2BOBB 2WP3T 2DQCL 4G80B 4G9FB 3TZVB 3BZFB 4E41E 1ZOXA 4JFXB 3WHE1 4TULL 3MLWL 3EYSL 4H0IA 4JRWA 3KJ4B 4OGXL 4ZUWA 2K7PA 3ZSSA 2ZPKL 4PP1D 3PQYA 1HSAB 3H2WA 3ULUH 1NFKA 2Q76B 3X3FL 4NM4L 5MERA 2IWGA 3DO3A 3ESVF 4IHOB 1CVRA 4HMDA 3WO4B 4TSCH 5KS9B 4CMMB 4CVXB 1BJ1H 2KPNA 5B8CA 5IVXF 4N8PA 4S1DD 4IM8A 1EAPA 1CXEA 4PY8I 3PWNB 3B6SB 3IU3A 3BVNB 1UB5B 3KWWA 5J13C 3U9PH 1WFUA 3A67H 32C2B 1D9KB 4U6VL 4XZUA 5D6DA 5GISH 5DDHA 3KXFE 4KJWC 2ZCLH 3TLRA 4P9ML 3DRQB 4HF5H 4R7NB 4BSVA 4KK8C 1G7PB 2C26A 3DIFA 1J0YA 5EOTB 2EDLA 4K71C 4U6YA 3AGVA 1SJHB 3GHBL 2PYFB 4MNQA 3E6HB 1XCTB 4KH2A 5IHZA 4PY7B 3QG7H 3NTCL 3H0TA 1X6NA 2Z31A 5I1IH 1DUYA 4GBXD 3LSOA 1ADQA 3GB7B 2EYTB 3LRHA 5L6YL 1WFOA 5BS0B 1FFRA 3DX6A 3V0AC 1RJLB 4FTVB 4CU8A 4PUBH 2XTLA 3VFMB 1CQYA 2D4DA 3QJHB 4NO3A 3BD5A 3FQWB 4RAUB 1TDQA 3T0BA 4Y7MA 2IBZY 1X3DA 1ZHNB 2X4NB 3KYOA 4NWUL 3C5ZA 3LQAH 5FKAA 3B3IB 2IAMB 5SWZD 4L1HA 2W60B 1RK0A 2AK4A 4QHNA 3DBXA 3MOBH 5DLML 4TSBL 3MRCA 3FQUA 4XMLH 3KPMB 3TV3H 1IM3B 2HVKB 5I75B 4GXVH 2NY6D 5DJ8A 3GSVB 3FB8B 3E6HA 1D9KC 4AL8L 1MCIA 2YS4A 2EEBA 4F33A 2YN5A 4MSWA 5DD3L 4GBXC 2KQNA 2YRZA 4DGYL 5J1TC 5JPNA 5CWSB 4ZPTB 1JGEB 3TBTB 3VFGH 1NUGA 1AGCB 4HX1B 5FUCE 1LHZA 4P2QA 3W9EA 3ZE1F 5C0JA 3U2SA 3BKML 3FHQA 3VXSA 4OQTA 5E2TL 1KN4H 5KG9A 1EAPB 2B0SL 3ILQD 1FNEB 1YPZE 5INDB 3QHTC 5T3XL 3E8UH 1DQDH 5B8CB 4HK0A 4N5ED 4M7LL 4G6AD 2P5WD 1HI6B 3WXWH 4NOBA 3ULSB 3WE6B 1U8NA 2V2XB 3ZHLA 5D7LE 3CX5K 1A21A 1OPGL 4LLWA 1IGIL 1SBBA 2VWEE 1I1RA 1RUPL 3CCHA 3TO4B 5DD6A 4FFYL 4Z78B 4PJIA 2AJ3B 3MLZH 4KHTL 3OG4B 3GUTB 5KS9E 5KVDH 1YY9D 4UT7H 4QT5B 5DVMA 5FGBA 4TVPE 4M7ZB 1F3DH 2X1PA 5C08B 2DDQH 1PX4A 2VC2H 1NUFA 5EIQA 5DMGC 5FIEA 2ZPKH 4MS8C 1ZS8B 1WITA 1YPZF 3O2WH 3VG0L 1FFQA 2VL5A 3MOAL 4RFOH 1X5FA 1KCLA 5DK0B 3WMSA 3DMMB 4QGYA 2AJZB 3DV6B 2JJTA 4ZNCD 4E42B 1KPVA 3BPNB 2EIBA 1WZ1L 3LEYL 3TYFA 4FG6C 3GMPB 3O11B 5ADOH 1J10A 4YWGH 3TBSB 2VUYA 2WMPA 1AD9B 3BZDA 4MMXC 3MRDB 1S3KL 2H32B 2BSTB 3CFKA 4YXHL 1PY4A 1PY9A 4BM7A 4TVPL 4MXQC 2NLJB 1E4WL 4QF1B 1UCBH 2YC1B 1KENL 3O4LE 1HEZB 4JFDE 1PG7W 5B39B 4MJ6B 4WENB 3BRFA 4JO3H 1DN2A 4E0RB 3ZKQD 2MHAA 1EAJA 1U91A 3VXPB 2YRPA 4N68A 1K4DA 3UTTB 4BZ2H 3KPSE 1IAKA 3ARDC 5FYKH 3SQBA 3NZHL 3VXME 4UU9B 1L0XA 3U30B 5MEND 1R5WA 2CKNA 2GSGB 1OTSD 2QQLH 3QUYD 2BOBA 5KOVC 5I30H 1XGUA 5JOFA 5M94B 1EJOH 1FYTA 4QCIA 5DMKA 5BXFA 4L8BA 3WXWL 2Y7QA 1D5BB 2P45B 4WUUA 4APQD 2EC9U 3MRDA 3GRWL 3TA3D 1QHPA 1Q9OB 3MUHL 4RMUA 3IDYC 3GGWB 4JZJA 5CUSL 4OZIF 3HLAA 2E7CA 5D7IF 3WDJA 1DQML 1EVUA 3UZEA 2VQ1A 3CFEB 3RDTA 1PEWA 4P2OB 1G6VK 3BEVA 2X10A 1WWAX 3I2CH 1HXMA 2XXCB 4XXDA 1XGTA 1M7DA 1E4KC 3ROOB 2A6JB 5T1LA 1XFPA 3QIWC 1T20B 3W9DA 1TNNA 5T1MA 4UOJA 4I3SH 5I1HH 4FZ8L 2G75A 4WU7A 4X6EA 3TPUB 3QUMA 3KHQA 5K9JL 5EZJA 1T6WA 4ZXBA 3MJ9H 3F6IA 3WHXA 2AW2A 5EZIH 1LNUA 3IKCB 4XAWH 3SKJH 4YK4C 4PJBF 4CBPA 4HDIB 2F9BT 1KCRH 4GRLD 1UJ3A 3K2UL 1QR4A 5GPRA 3RY6A 1NCTA 2EKJA 4QTHB 2QTEA 4Y5YA 3QO0B 4LRIC 1AGBA 4NO2A 4R90H 4XP4H 4RGNB 4XRCA 4R2GC 1V7NL 3S4SG 4OKVA 1JWSA 2GTWB 1QRNB 2W92A 3KPRB 1MJ7H 3LKSA 2GUOA 3AREB 2JJSA 3HZYA 3R0MA 5I76B 2FYYB 3QDJB 3IDIB 2R56H 2DB8A 4JM2F 3IAPA 4XPFL 3NAAH 3ROLA 3W2DH 5LAXA 1IL1A 4IMKC 5BZWA 1CGTA 1XGRA 5ITBH 3U0WH 1G9NC 4LCWE 2QL1A 1MLBB 1R3IL 4QOKB 4I3SL 3F5WB 5I1HL 3FFCA 3IDNA 3VRJA 4KUZH 1Q72L 4M93B 3GIZL 4FXKA 5ESQA 1DLFL 2X4PA 5IWLC 3VD9A 3OAZK 1R24B 3TBVA 4KUZL 3ZTNL 3C08L 5JXEA 3GIZH 1X7QB 3MJ6A 2KBGA 4AK1A 2HT4C 4JKLA 3QUZC 2AKRA 4XI5D 5HPOA 4Z95H 2VL4A 5C3TA 4XPBL 3EJYC 5CIPH 1RK0B 3TWCL 1SVCP 4OJFH 5DJAA 1ES0B 1JUFB 3LV3B 4AQ1B 2IG2H 1AXTH 1HH6B 4KMLB 5DC0A 3PQYB 5L8KB 3P30L 3RZCB 2LABA 3LHPH 3L95B 3LN5B 3R4DA 4LCIH 1BVZA 3LS4H 1F3JA 2XZQL 4TQEH 3G5XB 4XCFH 4MQ7A 3VCLA 3OG6B 4CADB 1Y6KR 2DQFB 2YOCA 3V52H 5IHUL 3ZDXF 4LP5A 1A1NA 4NQEB 1IC7H 4YXLL 4ZMAT 3HE7A 3PJSB 3Q3GA 4MJID 3EYOB 5DQ9A 5D7KD 3LB6C 5FOBB 4K8RH 4KK9D 1Z0MA 1N26A 3QIUA 5CKAA 2ESVB 3P77A 4Y4KC 4D8PA 3GMNA 4JPVH 4XAKD 1AQDA 4GW4B 2AVGA 5L8LB 1U8PB 1KPRB 2C4XA 2VDMH 2DLFH 1SYVB 3VFNA 2XXMB 2A6IA 3K80A 2EDNA 2Q7YB 4WWKD 2B1AH 2PO6D 3SKMA 3I3BA 5I17A 5JNYA 5F7DB 2AS5M 4KI1A 1W0YT 3MGAA 1YEHH 2FD6L 2YKLH 4MAYC 3PWPA 4GW5A 5B3JF 2FIRT 2BDNH 3MRQB 5I75C 4L9DA 1LO5B 1GOHA 1MFBH 3QIUD 1OGAD 4D9QD 2W9EL 5CZVL 1LO2H 3GMOA 4UV4L 2NX5A 4NNPL 4YR6A 1AGFB 2DQJL 3SGEH 4UT6L 1OTTD 5TQ2L 4NKDA 4YHPB 3FO0H 2X9XA 3S3PA 3VGBA 1H9VA 5FKPA 2WSKA 4ODWA 1QSEB 1WBYA 1MHPH 1WGOA 5BZWB 4ONHA 5D7IB 1Y18B 2P5EB 2MPAL 5DI8B 2V5MA 5FFLA 1LEIB 1FNLA 3I75A 3KLHD 4LARH 1AJ7L 2B5IC 4WW2C 3V5KA 3VFTB 1KCUH 5B3JE 1OD7A 3QR2A 5HD8C 3TO2B 4C58B 3QUZD 2HYMA 5D2LA 2ENYA 4PUBL 1TETL 4ZYKB 5KSUB 4CMHC 1HQ4B 2HVJB 4TUJA 5GGRY 1OF2B 3TN0C 1A3LL 2KL6A 2DL9A 3QZWB 1JIBA 3U30C 4XPGH 3VMOA 4H5SA 2YZ8A 4LU5H 2FSEA 2VZOA 5FYJD 1S9YB 1T1ZB 4MD4B 5HY9B 3J7HA 2EYRB 2F5BH 1NBYB 1TVHA 1I3UA 4GXUN 1FZOB 1NCCL 1A64A 4PREA 1I9EA 4GS7B 1NGYA 3QIBB 43C9A 2Z4QB 5GGSA 1CDCA 2OTUA 1T0PB 4LP4A 3NCYS 1S7QA 2R2CA 3PABB 4TUKH 1FYTD 1GOGA 2GJJA 4PJAF 5IESL 1ZT7B 2Z93A 1OB1B 2VLJB 3L5JA 4PRAA 1TETH 3CSGA 4PJCE 3U82B 3I50L 1A2YB 4Z7VA 5FHAL 4HS3A 4NPYA 2X70A 1FG2B 4K3JL 3F7YA 3VXNB 1S7TB 3AUVA 5DJYA 3WIIH 4GKSA 2DLGA 2VXTH 4JB9L 1P5VA 3DHMA 1M05A 1A0QL 4HSQA 1YEFL 1VACB 3MMEA 3MRPA 3U9PL 5DD0H 5I1JH 3BMWA 3U48A 2FO4B 4A2LA 3VFPB 2P5WE 3TT1L 4ODSL 5JHDE 2NW2A 3L6FB 4XMKH 3IDXH 1V3JA 4G9DA 1WLHA 2FLRT 3G6DH 5JHLL 3ARBC 4ZQKA 3V6OA 4XPTH 1LO5A 4P5TD 3GMQB 4IRSB 1FRGH 1MCEA 3ARFC 5IW6A 2F8OA 2COQA 3MNZB 3ULUF 1CFNB 1XGQB 2X70B 4QRPE 3G6DL 1A7OH 5INDA 1KIQA 4RFNC 3MJ7B 4WUUD 1T7YA 4APQA 3S5LG 3O0RH 1VESA 4C56D 2H45A 1JRHL 4PRAB 3V79C 1EVTC 3T3PF 3DECA 1G6RA 3FRUB 4Z0BH 4E42A 1H5BA 5F96H 3MACL 4F58L 1ACYL 5JMRA 2CR6A 4M93C 1T21A 1YEIL 4ZAKB 1LGVA 3D69A 4JGJA 1KPRA 4G9FD 3TZVD 2LQRA 4WV1C 1EA9C 3ZE0F 4L3AA 2VSDA 2ZG3A 3LKOA 2CJUH 5L7XL 4C54A 1QQDB 1NBYA 1TVHB 3U7AA 43CAB 5ICZB 2DM2A 5D1ZD 2PTVA 1UACL 5LGJB 3G6JF 4JANA 1KTLA 3BZ4B 4QRRA 3BYTA 3MV9B 1K5NA 3GHBH 2N7AA 5HHOA 1ADQL 3EFFA 3ARZA 4NKMB 5D5MF 3AXLB 1ERNA 3HZKB 3RGVA 3MRJB 1IQWH 2V2XA 1VGKB 3B4NA 2Q1EA 1D9KD 3O9WA 5HI4D 3DX6B 4IOIB 5I6XC 3IYLW 5J06A 5FYKD 4XGZA 1JHLH 1WIPA 3CVHB 4TSCL 4ZO8A 5F7LB 4CW1A 1IRAY 1HYSD 2C4FT 5CBEA 4YHKL 1GPOL 4FZEH 1NANH 1Y6NR 4NWUH 4OGAC 2WQRA 2G9HA 3HAEB 4UQ3A 3EAKA 2NCMA 3GRWH 4EN3A 4MYWB 1R5VA 2H9GA 4DK3A 5EPMA 5GJSH 5BS0D 1J1PL 1HYSC 5A16A 1I7RB 3UTSA 1NJ9B 5JIHA 4YBLB 1UKQA 5I8EA 1NGWA 4R4BB 2QQQA 4NNXA 4PRPE 5FDWB 2AK4B 3MV9E 4AY0A 2IPTH 4PJHE 4U1MB 4M48L 2IAMD 1DQJB 1KTDA 4WEBL 3KPMA 5ERWA 1AQKL 5ETUA 3X17A 3IU4H 3BKCH 3HG1E 1FZMA 5IFJA 2AV7A 3RWJA 1YEIH 2NY6B 3SO3C 4X6DF 5E9DB 1CLYL 4HPOH 2EE9A 3L5XL 4WRLA 5LCVH 5HHOE 3UC0L 3GJEB 1AD0A 5CFHA 4WI3A 3C6SA 1MLCB 2J12B 2LTQB 4FQQA 4GG6B 4JGMA 3ET9F 3FAWA 1JN6A 5D93B 1M7XA 1EPFA 1KGCE 1T6VN 3K3QA 4LF3B 5C2BL 1QQDA 1T3FB 4Z77B 3FT3B 3D39E 1YYLH 2DWEA 4OD3L 1MJ7L 1A02N 1BX2A 1QLFA 3HI6H 2JJSC 1G7PA 4V1DA 3QWOB 4Y5VB 3WCYA 1RJYA 1IEBB 3UO1L 2P5WB 4I18B 1ZSDA 1IGYB 3T0VA 3BPNC 3NZHH 3NGBB 3G5YA 3GI8H 3C5ZD 1F6LL 3DX9A 1U3HC 4LL9A 4U6HA 1II4E 1F4WH 4JG0H 3QYCA 4JPVL 1R5IA 5KSVA 2C5DC 4FXGB 5DMGD 1DBBH 3TO4D 4FABH 3AU1A 1H5BC 1YNLH 4UAOB 4FZEL 4G6FB 3FMGL 3TM6A 3RI5K 3VWJD 4OI8A 3GK8H 4TNWF 5BV7C 3O8XD 1H3XA 5KS9A 3NFNA 1A6WL 1JF1B 5C08D 4ERSH 5D1ZA 3HMXA 4LPYA 2X4PB 3IXAA 1YEDA 2R0KL 4YGVA 2ZNWA 5GGUB 2EYSA 3SE4A 3SE8L 3DMMD 1S7UA 2BFVH 4MA1C 4BA8A 2XRAH 2BY0A 1RZGB 4JO1H 1U91B 3RA7L 4AEEA 3IDIA 1I9JH 1YDPB 3MRMB 2XIDA 1RZJH 3LEVH 4Y5VC 1WQVT 2X1QA 5DS8A 1OP3H 4WNQB 3IXTB 1VFBB 1XR8A 2DQIH 3HC3H 2DDQL 3D39D 1MUJB 1YEDB 4XNUH 4M4PA 2VDOH 4JDTH 1N5YL 4XC1L 3MOAH 4RFOL 3PUCA 4EBQH 1WBZA 4XBEL 5F44A 5GSRA 1T0MA 3OBAA 4WWKC 2J5LB 2JLLA 4MNQE 1SEQH 5GRUL 3HNSH 4DN3L 5CIPA 3IFPB 3MLPA 2I9LB 3BXNA 1L4IA 1U92B 2Q87A 2ZSWB 2X4TA 4G42B 4YHZL 2OR9L 2AJYL 5DJ8B 5K9KA 5IVNA 2WWKT 5MENB 1BREA 1MIML 1ODAA 3QUYB 4NRXB 3VI4F 4QHNB 4X5LA 4P23C 4Y4KB 5I9QC 1IEBA 5GGSB 4LDLB 1Z3GH 3O6KH 3HC3L 3LRSA 4EVNB 1MFBL 5GZNC 4M7KH 4FQXD 1A6TB 3BGMA 3M1BB 1AGEB 5C92A 1UA6L 5IB5A 3MJ7A 3QUKB 2YUWA 4GRMA 4BZ2L 1WC7B 5KOMC 5D8JL 1VSCA 3WJJC 5HY9A 5C09B 4HV8B 4HH9B 4L3EE 1BQHG 3K2MC 4Q74A 2WV3A 2UYLB 2RFXA 4KKBD 5C0CA 3FRPA 1CL7I 3L5XH 4XTRD 5DJYB 3C9NB 4RFEB 4P2OD 4U1GB 3MO1A 5EZIL 1JGVL 3NA9H 3FT2B 1GC1C 3MV01 3K2UH 4J3WA 2R1YA 1RHHB 3GDBA 5CJ8A 3TO2A 2AK1H 5F7KC 2VDRL 1CFVH 2Z93B 5FV2A 2IGFL 3FL7A 3X12B 1LK2A 4C55A 2OMBA 3EDDA 1FO0B 3KYMB 2NX5B 4YR6B 1T7XA 2B4CC 1ZT4A 2NX5E 4FQ2H 4HFUL 5GS2D 4LPUA 32C2A 2IJ0C 5DT1H 1UA6H 4MDJA 4G7YL 4E0RA 2X09A 2CMRH 5EBMA 1BOGB 4YQXH 2WUCL 4U0QB 4NRYB 1T1YB 2APTA 3OF6A 1V3KA 1Z5LA 1R5VB 1S7VB 5E00A 1N5YH 1LK3L 5IR1B 2J2ZA 5DRZA 1E4JA 1UB6B 3WS3A 5I15L 1QRND 3KPRD 4K8RC 3RY5A 3CSBA 2O5YL 4RIRB 1CG9B 4N1CA 4Y5VA 1CGVA 1K4CB 1AXSB 4OZIB 3LKPB 3WJLA 1FNFA 4Q97A 2CLRB 3U36B 1BHGA 4E9LA 5HVHB 1LO4H 4OCXL 1OW0C 1AI1H 5EU7E 4P5MA 1XF4A 4MX7B 3UBXA 4HXBL 4NC1C 2DYPA 1BWWA 3SKMB 3G5VA 2MQ0A 2NY4D 2NYYD 2XI9A 2EE6A 3UDWA 3ULUL 1QSFE 1ZTXH 1F6AA 1L7TH 1TJHL 3RWFA 3JXAA 2PYFA 3PDDA 4ZYKA 2DQFA 1C12B 1IGFL 2ZCKL 5FYLL 4NWTL 1FV1A 1C1EL 4LSRH 1AC0A 1N64L 1R3IH 4QXUL 3QEUA 4Z0XB 1XF1A 4N0FB 4OZIE 1MCRA 4W70A 1ED3A 5CEZE 2HMIC 3S37L 2Y4SA 4YDVA 5CS7A 4DW2L 1T83C 1DEDA 1NC2A 1T83A 1CFQA 4Y2DC 2XWBB 5J11C 2NY1D 4WI7A 4EI6A 4P3WA 4MX7A 3HI5H 1SEBA 3RNKA 2R23A 4AIOA 1J05A 4Z7NE 4JFZL 4JY5H 3IVKB 4LARL 2X4SA 3MBEB 1QLRA 2IH3A 2X4QA 3T2PA 3FQTA 4HG4K 2OJEA 2ESVD 5B22A 3WS3B 3P73B 4IRJB 4OIIL 1I1YB 4RGMB 4U6TA 1NCNA 5IQ9A 3O6LH 4JFEE 4YIQB 4PJXA 4IRSA 4K7PX 2ADJA 3CZJA 1INEH 2BXYA 1SEBB 1RJZB 5HYFA 1C5CH 1BOGA 5E24E 1NBZA 2YPVH 5EC2A 3LY6A 2AQ1A 1KLUB 3ULVE 1HK6A 3O6LL 2NY5L 1NANI 5IB1A 3PHSA 3C60C 1IM9D 5A2IH 5IB2A 1GJIA 4X5WA 3QCTH 3HMWH 1A9BA 2V17H 4HJ0C 1A6UL 1CGXA 2VXSL 1R3LB 4M8QA 1CXFA 4JPWL 2GUOB 1KEMH 4FQ1H 2R0ZL 3D0LB 1OGAB 4UDUB 1FBIL 3EDKA 5I76A 4UNUA 4CMHB 1QLEH 5F93C 1GOFA 5DVOA 5IJKC 4M1GL 4UTBL 2VXSH 1WBXA 2ICEB 3MLUH 1U58B 1SQ2N 2PYEA 5T5NG 3QFJA 3UJTL 1KSRA 2D3VA 1ORSB 1L0YA 3SKNA 5SWZE 4DUWA 4YHML 4PLJD 4ACPA 4HT1H 3VRIA 3QRFM 4LLUB 2VLRA 2P5ED 2W65B 1LEGA 3OR7A 4O51B 1GSMA 5MHSD 3VFVA 3GIVB 3UAJD 4F7CA 3HUJA 1ONQB 1YEKL 4N9GB 1P84J 1O7VA 4I4WA 5DQJA 3SGKC 5MENE 3SPVA 1OLLA 1UWGL 2JIXB 4U3XA 4JHZA 3RVUD 1FZJA 5KSBB 3RL2A 2BHZA 1R3HB 1ZLWK 3L1OL 4JREC 1BF2A 3P0YH 3I6GA 3GO1L 3MLXL 5EBMB 3WJJA 5JIPA 2NZ9C 4TUKL 1UWGH 3OF6D 4KV5F 1FLRH 2Z0BA 4AEIL 5IBUG 3X12A 3ZKXC 2DMBA 4MAUH 2AEWA 4P2RE 5CP7A 4X6DA 1DBAH 4ZSOB 1A7NH 4X6CA 3UAJC 3O2WL 4X4ZA 1GHFL 3ALWA 3QIBD 5JA8B 2FYYA 3QDJA 4OUUB 3MJ9L 2YEZB 3GK8L 3STLA 4HH9A 5LWYL 2VISA 5IBTL 1OP5K 1FYTB 4KI5F 1DN0B 1UVQA 1R3JA 1IE5A 4JFDA 4Y5XB 1JNLL 4OLUH 4TSBH 4ENEC 3SN6N 4XPHH 2OZ4L 2VLJD 2BMKA 5GIRB 4JQVA 1SY6A 4HIJA 1ZVSB 2XACC 3OQ3B 1V7NH 2YUZA 2VLME 4Y16A 1C8PA 4LSVH 1I1AB 1KIPB 2BHYA 2BVEA 2R9HD 5GGUA 3FRPG 3KXFD 4KK5C 4CUCA 1MCSA 4GAYB 1T1XB 2DJSA 2FHCA 3VXTB 5BJTA 4FFZH 1LEGB 3GJFA 2G75B 4K94C 1IKFL 3ARGB 1WCBA 2AGJL 4U1KB 1AC6A 3Q0HA 4BQBA 4CVZA 5ACZA 1O0VA 1FYTE 35C8L 3DVGB 3RVXD 4HFWA 5E2TH 1QFUL 3W39A 4QHLB 1HIML 3MX0A 2PR4L 1NCBL 5T3XH 3MRHA 4WFGD 3OB8A 3LH2L 4OM1L 4Y5XC 4Z18A 1ACYH 5I1AB 3FQXA 4R96B 1HQ4A 2HVJA 4TUJB 4BELD 4NKOA 5CJXA 3V6FA 3VXTA 3JV6B 3WNLA 4D0BA 4IRSD 1AQDB 2AERT 1E4WH 2YRLA 5DD6B 4UDTA 2FB4L 5LBSL 3RWGB 1A6WH 1MFCL 4EXPX 3G9VA 2VLKD 4G8IA 5F6HI 3UTSE 4WUUB 1IEAA 3BUYB 3WEXB 3WHE0 1DEEB 2BMKB 2E6JA 3P9LB 3FOLB 3JTSB 3CFDB 1MJ8L 4U1SA 6FABL 3FT3A 3HG1B 2ZZUT 1WISA 4XCFL 4UMGA 4OD1H 3O9WC 2OI9C 2YUXA 3STLB 4YPGA 3WNKA 4KDVA 4CADA 4NUJB 3QDJE 5C0EA 4DK6A 1FFOA 2VWEC 3VXSE 1QBMH 3FONA 3WIHH 2QEJA 1ZGLP 1QYGL 3MJ9A 3PP4H 1KN4L 4D0BB 1LILA 5D1ZB 4Y4HC 1W0VA 5ADOL 5E6ZA 1KPVB 1J9CT 3G9AB 5J6HA 3FQXB 1KG0B 1MF2L 3C08H 4M9PA 1W72B 2H41A 3MV9D 5T33L 2AP2A 1X7QA 4LSSH 1MAJA 2BSTA 4XWOD 4PJIE 3JWDH 4QXGL 1GGIH 2EDQA 5C08A 4U6HB 3L7EA 5DJZB 3TZVC 4F2MA 5A16B 1PSKL 4JR9L 2FBJL 5C0AA 1PAMA 4RFNB 5BJTB 3MR9A 4LCYB 1DCLA 1S7SA 3QQ9C 3IRZA 4S1QL 4UT7L 1BWMA 4OT1L 3U6RA 3QJHA 3AB0B 1F11B 4Y1AE 4JM2D 3T4YB 1Z6JT 3WLBA 2H3NA 4M61B 2CDFA 3RWEA 3VFSB 5E8PB 4DUVA 2HP4A 5C07E 5C86A 1MLCA 1NLBH 4ALAH 1E6JL 4F15C 1NEUA 3H8NA 4R0LB 1DQQA 2WQ8A 3WL9A 1CLYH 1I7UA 2HFGH 4DOHE 3DSFL 4XP4L 2MPAH 4GW1B 1CGSH 2R2HB 2AK4D 1EFXD 3UYPA 2DAVA 1CE6A 4Z7WE 2WP3O 2WIMA 4Z7OF 8FABB 3BESR 1WAAF 2Z8SA 1DBJH 3NIGE 1TJHH 2CLVB 2XRAL 4HUWA 5DEGA 2CDFB 4B5EA 5E9DD 3UX9B 2D2OA 2YD7A 1SJXA 2JB6A 9CGTA 3DO7B 1PQZA 2Z35B 4BZYA 2XN9A 3OKDA 1XH3A 1SYSB 1XF3B 2LU7A 2VKWA 3QUML 4PGEA 1ONQA 2FATL 4E5XA 3D69B 4WHCA 3IB4A 1OWRM 4KROB 1JZ2A 3LCYA 4GRLC 5IB4B 2PR4H 1H5BB 2IAND 5TQ2H 4P59L 4JFPB 2HKHH 1QRNA 3KDMA 4JFOA 3MRIA 3C9NA 3ETBF 1OSPH 2NYYC 4PRIE 3P4OB 5HPMA 4JZOB 1B4JL 1QEWA 5TQ0H 5JOEA 5EA0H 2XZQH 4I0KA 2E7BA 3C5ZB 3UPAA 1W0WA 1WAAA 3LAFA 5IW1A 4PJEB 5C2BH 1OM3L 1RK1A 1QVOB 1YEEH 3QSKB 2IPUG 4U6XA 4U3HA 3CLFL 1WWCA 5F9JA 1C5CL 1CDIA 1NDGA 3V6FB 1CLOH 5GGRA 4G6FD 3DRQA 4PJ5E 4X80L 3VWJB 2BSSA 4KK6C 3O8XB 4NFDA 2IFFL 5L2KB 1U3JA 3IF1A 4JVUA 4J6RL 4M5ZL 1XCTA 4P9MH 3W39B 2VDML 3VFWB 4DGIH 4OCRL 3IGAA 5BQ7A 1VKXB 2ZSWA 5L8JB 3JWOL 1UXWB 1BM3L 5MP6L 1A4JB 1IARB 4XPBH 5DJCA 4FN0A 5FA3B 3VXUA 4D0DB 2JKXA 3BT2H 4X6BA 3BWAA 4YGAB 4OFDA 1RZFL 1CWVA 1CFBA 4YH6A 3LHPL 2PNDA 1J1XH 2QSTA 1UB5A 4ERSL 1MIEH 4WHYH 3D39B 4KC3B 4PLKC 2BVTA 4HUMB 1M6OB 4MNHB 1U8OB 3O2VH 1FNHA 4NT6B 3O8XC 4H0GA 4PS4L 5ECJE 4H1LH 1I3GL 3T8XB 1PG7L 5EIIA 4CMMA 4CVXA 4HS6A 4PTUB 2VZVA 4L8CB 5F9JB 5I66B 4YBQD 1Z9SA 2XKUA 4OZ4B 4NC1E 4Q58C 3FOMA 4LOUC 5KS9F 2LVCA 5F1NA 5EORH 3RGHA 4NC2B 1MCJA 4U1LB 2B4CH 4ZUWB 3NA4A 1VACA 3MMEB 3S88L 1K4DB 3TFKC 5HDQL 3RJDA 3EYUL 2ADIA 4KRLB 4OM0L 4N0RA 4YBHA 5ID0A 5E2WL 3U0PB 4LVNB 4UNTA 4PGJA 4QNPE 3RWIB 3SDXE 4Y4KD 1FFPA 1U95B 2YEZA 4HQQL 5MHSE 4FQXB 4KUCD 1AHWA 3RX7A 4JVPA 2ITCB 3KR3L 2ZJSL 5EO9B 4DN4H 3D3VA 5H8DA 1ZT7A 1XF4B 1F90L 2V5YA 5KW9L 5C09D 2AQ2A 1NFDF 2BDNL 5FA4A 4ENED 1SBSL 2XZAH 4LMQI 3VXRD 4MA7H 1VENA 1G7MB 3ZKND 1DLHA 3VXRE 4RZCA 4UV4H 3MC0A 5F1OB 4X83A 3P40A 5D7JC 2DM3A 5TE6H 3IDUA 3LKQB 4NJAL 3WIFB 2Z4QA 3SCMA 3QWOA 4N0YH 3IF1B 3I02A 3HI1B 1P4BH 2I24N 5DJDA 5DSCA 5E0QA 1RI8A 2D7QA 4ZUTB 1FZOA 3DVNB 4YHYC 3OKLA 1I8KB 4FFYH 2NZ9D 3L3OA 2NX5D 3L3KA 5IHBA 1JGLL 5JNYB 2PN5A 5E8EA 4OUUA 2DQTL 1OGTA 2DQHL 3OR7B 1NAKH 5I1CH 4RAUA 2VH5L 3GI9H 1A6ZB 5KW9H 1U8HA 4JFFA 4WHTB 2R1WA 4Y4FA 4AM0B 1A22B 1DFBH 3EYVB 4PGBB 1DBKH 4NJ9L 4HWZB 5CCKH 2DJUA 2X1XR 5JQ6H 2BP3A 1AY1H 4YHNB 2FGZA 2YPLA 3EJYD 4X6CF 3PDOA 4QHMA 3C8DA 3I6GB 1WZ1H 3DUSA 1FGNH 4I9WD 4JFPA 1BZ7B 5KG9B 4NSKA 4MJIE 5C3LD 1E0OB 3DX8B 4AIZA 4XVSH 5DUPH 4M5YH 5F71A 1LDSA 2AI0L 4HW6A 4OZFB 2YXMA 1NKRA 3T0WA 3C5JB 1KIRA 3FQNB 3MPCA 1LDPL 4DQOH 2CLZA 4ETQA 5D1XA 4H0HB 3VDCA 4QRSA 4M6ML 4X7SL 2QV2A 4KI5E 3TBYB 3KYKH 2NY4B 4M9OA 4AENA 5I16B 2G5BA 1E28B 1U8JA 2KQMA 3EJZD 4G8EB 4UBDC 1BZ9A 4NZUL 3D85A 3SY0A 2ORBL 3KS0H 1R3HA 3RNKB 3VMNA 3EIFA 1VB9A 2NLJA 4OBRA 1TJIL 2CLVA 3I6LE 4O4YH 2P8MA 4LNRB 1VFUA 2YK1H 1JMXA 1LO4L 3RL1A 3QULB 1TTFA 4JFQB 5E95B 3PP4L 3HPLB 3FONB 1KLGA 4PB0L 3K4AA 2F5AL 3O45B 2ZUUA 1CXKA 4EDXB 2EH8L 2ITDB 4M7LT 4ELMF 2NY1B 3BGAA 2YSSA 4RX4D 5EBWA 2VZUA 2QLVB 1NGPL 3OJ2C 4X5WB 4UILL 3VD7A 5F7UA 5FOBA 3MBED 3ES6A 3PV7A 4WNQA 3QRGL 3WLWC 4D8PB 2EDEA 4RA3A 1JZ5A 1U8IB 2NY7L 3U0TA 2DLIA 1G7HB 3U46A 1T66D 4HGWB 3LS5H 3V6ZA 3TNNA 1JWSB 4M62H 2BNRD 4PY8J 4IRJD 4HWBL 3S35X 2JCCA 1I8LC 4WUUE 1S9XB 1MHEA 1AFVH 2Q7NA 3QQNA 5IVZB 2DBJA 3WNNA 1AIFA 5FEBA 1IJ9A 3B5TA 5C08E 1CT8B 1EXUB 1LE5B 3V5DB 4L9LA 1Y0LA 4K7PH 1IM9B 5ERWB 2APFA 3SDYL 1K6QL 1YY9C 2R0LH 4R6UA 3I85A 4LHJB 1I85C 5DVLA 3RP1A 1M4KA 5BZDA 2F8VA 3B2VH 1CDUA 4QWWC 1CG9A 2UZYB 3DX9B 3HAEG 3DUUB 1MAMH 4ETQB 3KYKL 4PJGA 1YNTA 1ZKAA 2NTFB 3VD4A 3B2VL 3ILQC 4FG6D 2AJYH 4KXZI 5DLMH 5GSVA 3HS0A 1SY6H 5DUML 4NRYA 3EJJX 4GKZA 5GGQL 3S34L 5LJYH 4ODVL 5FYKU 3HMWL 2VISB 5TDOB 2QKIA 5D1ZC 5CEYB 3S36X 3DTXA 3AREA 1UG9A 3HNVL 4GG6E 1IFHL 1QBBA 2W0FA 1V7ML 4OZHE 2UWEB 4HDIA 3FFCD 5DFTA 4XVUC 4Z76A 2BNRE 4EUPB 4QTHA 2JIXD 4HKXB 3MRJA 3QI9A 4KJPC 3O45A 1N3NB 1KCVL 4YK4B 3C6LC 5C0IA 3TBWB 2IF7A 1GHFH 1TJGH 4EBQL 4R96A 4IOFD 3BW9A 5IJKA 1UFUA 4KJYB 4NO0B 4IS6B 4N90D 3WHXB 3JTTB 5IBTH 5B8CC 1SEQL 2XV6B 5ETUB 3MODL 3VJ6A 1B0GB 1I7TB 4KRPD 2CSPA 1T04A 3T4YA 3LQAC 4ZUTA 4PJIF 1N7MH 4G42A 5I18L 3BPCA 1P2CB 2I5YH 2JCCE 3HZMB 4LIQE 2FEEL 3IFPA 5HHMD 2OSLA 1IGJB 5CZXC 4OCWL 3MXWL 3UYRL 4I3RH 1MI5A 3FO1B 1YPZA 4NQCD 4UV7H 2GJ6A 2FX8H 3D3VB 3BH9A 3M8OL 5DMIL 1AR2A 1T1YA 4AT6B 4QKXB 2XZZA 4HLJA 5GZOC 4H8WL 3QPXL 4D0CA 4LDOB 1DJSA 1JV5A 1I1AD 3CJJA 4HBCH 3QO1B 5C0DA 4QRPA 4OFVA 3KXFB 4K7PY 5ADPH 1P7QD 1ZA6B 3OKKA 1F3RB 1NFDE 5H35B 2P5EA 1FO0A 2AV1A 3ARGD 3E8UL 4Y4FB 3GBMH 5GS3A 1AGDA 1WC7A 5EA0L 5HI3C 1AI1L 5L9DH 1KT2A 2XWTA 3U7YL 4HXBH 4TUOB 5E08L 4XPAH 4UNVA 3QCUL 4PJAE 2JJTC 1KJ2L 4OLYL 3RIAF 4I3RL 5C8JA 3BP7A 3ZDZE 1XZ0A 5HHXH 4ZODA 4DAGH 4FRWA 4MJ6A 4G7YH 4HJGB 4AEHL 4OF6A 3SO3B 1BIIA 2VLKB 3OR6B 2GSIA 2EYSB 5FUOL 4HKZA 2DM4A 3FB5B 4M1CC 3VI3E 4U05A 1RUKL 3BAEL 1QD0A 1FC1A 3U4BL 1CFSA 3UC0H 1IC5H 4U1HA 2ZUQC 4JE4B 1NGZB 3HG1D 4H26B 3BIKB 3THMH 5F3BA 3BWAB 1PLGH 3RBSA 3WFHA 1WF5A 3CK0L 3ARQA 4PJFF 1CI5A 2NY4C 1HSBB 5EU3B 5JPNB 4DN4L 1UKSA 3HRZA 5L2KA 3FZUD 4C4KO 2GT9B 1RU9L 1S3KH 1N4XH 3LKRA 1X5LA 1G7HA 3G08B 4LCUB 3EO0B 3ZDYE 1N6QH 4H88H 5F89A 5EUKA 4HWEH 3R8BB 5FGRA 2IQAA 2P8LA 3PWPD 4YDIH 3LQMA 2VIRB 1CK0H 3ZMRA 3NACH 4DKFL 2VSCA 1OF2A 5KVGL 1F8TL 3T04D 3HRPA 3MLVL 5DMIH 1QNZH 2AEQL 3U1SL 4LCCB 1HNFA 5J3HD 3VFPA 2FX9L 4PV8B 4DCQA 1CQKA 1JF1A 1R3JB 2E8YA 4GAJH 4P46B 3RRQA 2XA8H 3T8XA 1ES0A 1JUFA 2HT2C 2HT3C 4ISVA 1YN7B 4PJXE 1D5IH 1K8IA 3M17B 3QUXD 1BVLB 3KAAA 3D0VB 1O7SA 4PJ8A 2QKIB 3DVFA 2YWZA 4ONHB 3BKYH 4MAYB 4JM2B 3JV0A 4CJ1A 3MODH 4JY5L 4UTAH 4KTDH 4WGWB 1JHTA 1OM3H 1P9MA 3TBYA 1Z5LB 2DYPD 1DQJA 2DICA 3MLUL 4NM4H 1CK0L 4R2GD 4GRLA 3JWOC 3C60A 4OFPA 3A6BH 1A1MA 5FYLD 4DAGL 5BRZE 4NNXB 3EDFA 3T0ED 4EQ3A 3U1SH 1JPSH 2APBA 1U9KA 1ZANH 4PJ8B 3CVHA 3ELAT 1Q1JH 2E9BA 1EFXB 4UT9L 1FYHB 1S9YA 4P23A 5I1EL 4XWGH 4FQXC 4OCRH 1LEKA 3DSNA 2ZUTA 3DUHA 4G8FA 1SJEA 1VGKA 1OSZB 4IHOA 1MPAL 3FB6A 1B90A 2ATPB 3RHWF 2I27N 5C0RL 3OXSB 5K9JH 5D1QC 5KSUA 4NDMB 3V5HA 5B38B 4R4NC 3ARBB 1OARL 1UJTA 4P0DA 4RISH 1KBGL 5FB8A 1KCUL 4JZOA 5TF1L 3R8QA 1ZEAL 4IIQB 3H0TB 3NVQA 3GSOB 1BGXL 4LBEB 5SX5K 2VMFA 2CR3A 4KROD 4U1MA 3QG7L 1I8KA 3Q48A 2IANB 2A2QT 4B41A 5GGVY 1MCDA 3UDWC 1CTOA 4Z7UF 3QB7C 1HSBA 3GSNL 3S8WA 3IFLL 1RZ8A 1ZT1A 3DGGB 3KJ6H 1KACB 5FO7A 2A6DA 3I6LD 4JANB 4G8FB 2VOTA 4NKDB 5D7IE 5DTFA 2FJFA 4FMFA 1Z2KA 3SDXB 5C7XL 3CMGA 2BC4A 5BOZG 2YD6A 3G08A 5C0AB 2DMKA 1DDHA 4WCYH 4KQ4L 3P11H 2WBKA 1S7XB 1AFVL 1JGUL 4Q7DA 5DA0B 1ETZA 4WVRA 5A2LH 2H2PC 2Y36L 5E8OA 3GMQA 5E94A 2OL3B 1DQLH 4HGMA 4ODHH 4F37K 4ZTOL 4Y8AA 5DHYA 1F6FB 2ADGB 4DFHA 2A74A 4G43B 3CAFA 1KIUA 2FBOJ 4G6JH 1ZLUH 5C0EB 5L2KD 1EGJA 2ADIB 3NBNA 5AYUH 4RMTA 1UWXK 5ANMA 2WUBL 1QRNE 1INEL 4ZXBC 3F58L 4TOYH 2P43B 3IXTA 4KY1L 4HUXB 4ZTOH 1QA9B 2V6HA 4YHIB 4EI6B 1KNOB 3AMLA 5KVEH 3A6CL 3LEXA 1CICB 2HWZH 5I66A 1XZ0B 2AJUH 4ZQKB 1Q0YH 4LSDA 3MV8A 2R4SH 1HYRC 3QXUA 4MCYA 2DRUA 4KQ4H 5EORL 3BZEA 4Y1AB 2DQDL 3SDCC 3OGCB 3SEPA 5GJSL 3AXLA 3HZKA 4HXAL 1FNGA 3OXRA 1BJMA 1V3MA 3I6KA 3BUYA 5IEHA 1INDH 4RBPK 2XKNB 3D25A 3MUGB 4XNQA 2VDLL 2IQAB 1KELL 3UPRB 1XCQB 4W81A 1KYOJ 5H35A 5DC9B 2X7LA 3O6ML 2RIKA 4PJ9C 4GKSB 1YQ2A 2EE3A 4OFYD 4YJZL 5H94B 3BDBA 4H8WC 4YHMH 2BVOA 3ISWA 4Z7VB 4NBZB 4X9FA 1OT2A 4R4ND 4U1JA 2PW1A 1HDMA 4WDIA 5LXGL 2DF3A 1HCFX 1TJGL 3HI1A 2HJFA 3C87A 3O2VL 5FYLH 4MWFB 5KJRH 1DBML 4FQPA 5JPMB 1KXQE 4F7PA 2MMXA 5GS0D 4U6VH 1UENA 4YC2B 4ODBD 4C83B 3TT3L 5EUOA 2P8PB 3BQUC 2X5PA 4JGUA 3EKCA 4XWGL 3VRJB 5D2NE 4Y1AA 4MD5A 3S4SA 1JGUH 2X6MA 1ZVSA 1FSKB 4YBQC 4BK4A 4XCYA 2C3GA 3MRGA 4HWUA 3VXRB 2DIJA 5CEYA 2W9DL 3TVMB 5GS1A 1QKZL 4RISL 4V2BA 5DMKB 4K8RD 1PEZA 3LQZA 3MYZA 4JQXA 4KZDH 4CN1A 1DBAL 12E8L 3LKNB 5BVPL 1DANT 2BJMH 4RRPG 2FO4A 4YC2C 1YECH 4YFLI 2W59A 4K2UH 3BX7C 5FUCC 2X4OA 3UTQA 1GH7A 3Q1SH 4ZDHB 2JF1A 1UM5H 4JJHA 3C6LA 1PKQB 4XPHL 1NBQA 4PFEA 3VXNA 2JB6B 4MSWB 5KZCB 3KHOA 4BK5A 1ZLWH 3MTRA 4FFVD 3LQAL 1Q0XH 5JW4N 4C83A 3PGCA 3M1BA 4M6MH 3QAZB 4OCYH 3QCUH 1IGYA 3DARA 1WZMA 1P1ZB 3MCKB 2Z92A 1UXSA 3DBXB 3BN3B 2D0GA 3OX8B 1DZBA 3AAZB 3HN3A 2A6IB 3KYNA 3CFEA 3RDTB 2EO1A 5C0CD 5BZDB 4TTDD 1RZJL 3JWDC 4H20H 4M03A 2DBLL 4M3JA 1VADB 5EZOL 3RY6C 1TJIH 3I3DA 4PJGE 4YUEL 4X98A 2BVPA 4R0LA 4EZMA 4LAQL 5KTEH 1IGTA 1WWWX 2YK1L 3CFJA 5DUBA 1IBGL 3T2QA 4YDJA 4F3FB 1Z0NA 3L5WB 4XBEH 5ICYB 4HJJH 3IFOB 1JNJA 1CZ8H 1FFPB 1U95A 5B38A 4IDJH 3CIQA 5SWQA 4NBXB 3LPWA 4ODWB 4PBWD 3WLBB 5C0IB 5EBWB 5JXAH 4WI8A 3G5XA 1U42A 2VXVH 2I9TB 4HWBA 3PHQA 2O5XL 1TITA 2DD8L 1AGFA 5DHXB 4HBQA 3U46B 5M7QA 3OKYA 2WINA 5DUMH 5AEAA 2C3VB 2EXWD 1FO0L 4AG4L 5DQ9B 1D9KA 1S9WA 3MUY1 2C3WA 4P9HH 1YUHB 3KPPA 4LCIL 1QKZH 3GSQB 1EEUA 3TJEL 5H37G 3VH8A 4J4PC 1I1YA 3SCMC 3PL6B 1IQDA 5D2NA 2XY2A 1F3JB 3TCLB 3NAAL 1S7RB 1N59A 2KZWA 2NTFA 4OLVH 4F7TA 2Z8RA 5T3ZE 2APXA 5T5FL 4DVBA 4RSVA 4ZUUB 1KB9J 4JZNA 4MA8H 5I74B 3IDGB 1BP3B 3GMPA 4TN9A 2BNRB 2YA2A 3H42H 4BSJA 2IC2A 5I8OH 5J4MA 3GM8A 2PF6A 2Z35A 1M7IB 3E1F1 2K9UA 4EDWL 2DD8H 4GT7A 4MZ3A 5EDXA 3VXMD 4YO0B 2OS7A 3CFIC 5FUZL 3FHAA 2J1KA 1R3LA 2YPLB 1RPQA 3S35L 3AM8C 4N8CH 3B9KB 3P9LA 5KSAA 3STZB 1I1FB 4QTIL 5CZXD 2BSSB 3EYVA 4OGAD 1ZWIA 5DFWH 2XKNA 4FFVC 2SEBA 1MRDH 1NEZG 4MQ7B 4ELME 1REIA 5I1GL 2ED9A 3K4ZA 4YDIL 1A6ZA 1QVOA 3TO4C 1F2XK 1JP5A 1FHGA 5KTEL 3DUSB 1ZMYA 4JO4H 1ZA3A 3UTSD 1L6ZA 2G60L 4C57C 1JWUA 1FG2A 1MRDL 4NNPH 5CEZL 5EUOF 4QRUA 1MSPA 3MZGB 1M7IA 5HPMB 5HDQH 4AMKH 4JPIB 5IGXL 1KNOA 4AM0A 4M1DL 3RIFK 7CGTA 2GK0B 3F7VB 3SGKA 4LSSL 5E2WH 1JPFA 5FYLE 4KROC 2DQUH 5C9JA 4WFGE 5FDYA 5MP6H 2VXVL 3GBML 1R24A 1AXSA 1D5XA 5IBLD 3WJLC 4M02A 3EZ8A 1QACA 4WV1A 4HIIB 1XGPA 2VDQH 4IMLA 3VFUA 5INCB 3FFCB 3HE6C 5CMAA 5I73C 3KPOA 3TJEH 3RVWD 1YUHA 3KPPB 1MEXL 4LFHG 3HZVB 1DUZA 4LLDA 1NLDH 5K9OB 4NO0D 1IAII 4YUEH 5J6HB 4QRRD 1VHPA 3QQ9D 1KEGH 4Y0GA 8FABA 4JN2B 2X9YA 4XBGA 1H3TA 3ZLQC 1EBAA 5FCUL 3FT2A 4KRPB 4WFEE 3MGOA 2Q76A 4JDTL 4MAYA 4WEBH 3VFTA 5JW3H 1HZHH 1OL0A 3V5KB 1EO5A 3RWHA 4U1LA 1OSPL 1H8OA 1XF2B 2OXGA 4JPKL 3ARSA 1ULVA 1MCNA 1BZ7A 1T2QL 1S5IH 3HZYB 4ISVB 1SMOA 5EZJB 4DUXA 5HHMB 3O6FD 4E41A 4UZGA 2HG5A 1QSEA 4PJCA 1OVZA 2BERA 2VERN 2M2DA 2BVPB 4NQCB 4Y4HD 1VDGA 5D7JA 5DVNA 3RNQB 2O5XH 3D3VD 5HDBE 1P4LA 5TE4H 2OR9H 7FABH 4PGBA 1MOEA 3KPLB 2FBJH 4C56A 4N1HB 4NCC2 4N9GA 4GRMB 2A0LD 1RULL 3D48R 1J7VR 3QEQE 1FDLL 1HHJA 3CVHH 2IFFH 5DRWB 2OYPA 3NGBC 1P7QB 1CXLA 4WHYG 2W65A 2AXHA 4O51A 4XBPA 5HVGB 3W2DL 2D03L 4PG2A 5SX5H 4Y4FD 2ZUQB 1EMTH 1F00I 3PWLA 4RQQA 4OZHB 2EXYD 4L29A 1T1ZA 5FYJH 1AKJA 4OCSL 2CKBB 4U1JB 4LOUD 2IPKA 2HKHL 4JM4L 1C08B 1QFWI 2DQUL 5F6IB 4WI5A 5DJXB 1IC5L 5CSZB 5CJBA 1FORL 3MUGA 3QJFB 4YX2H 1B4JH 5TQ0L 3U0PA 5JOFB 1FBIH 4Q2ZB 4LSTL 1CDHA 3L3DB 4PJDE 3MRFA 4AIXA 4R7DB 2O26U 3GSXB 1T22A 1FSKC 1H3VA 3MLYL 2E9WA 3ULVC 4LSPH 5E6ID 4XI5C 5GS0C 2Q86B 2KUTA 1KV3A 4V2CB 1N8ZB 3BEWB 4H88L 4NQEA 1HXYB 4HS6B 4YXLH 4P46C 2KDGA 3FO0L 4CN4A 2AJ3A 4FOMA 2DTMH 3BH8B 4XVJL 1FJ1B 1CIUA 4DTGL 4KDTC 2ZUVA 5D96B 3MBXL 1MCWM 2GY7B 4WO4A 1IAKB 4KV5E 4NJAH 3N1QC 5HVHC 1MVFA 3IDMB 3NABL 3IXAB 1A4KA 4I2XB 1I8IA 5TPWL 3TC9A 1KPUA 1MY5A 3PWPB 2DL2A 3FAXA 5IT2H 1PDKA 4LVOC 5EOCH 1WWBX 4LQFL 5A43C 4QXTA 4MMZC 2GQHA 1FE8H 3QPQC 2R29H 1MI5B 4P46D 1A6AA 3HUJB 4X8XA 4Z0XA 1H15A 4GO6B 1KN2L 4D9RE 3QUXB 2BNUA 1QLFB 4Z78A 3OXRB 4L3EA 1KIPA 1RZKH 1U2CA 1ZT1B 3DGGA 2APVA 3C2AH 4Z7WB 4MAYD 4A2MA 3RWFB 3WO4C 3PG2A 3TT3H 5AZEL 3KPLA 2Z9TA 1JGDB 4PJFB 1MY7A 1S78D 1D5ZA 1H3PH 2VAJA 4H5SB 5E03A 2QHRL 2IANA 4HC1H 2JB5L 1RZKL 5EFIA 2A73A 1HZHL 2ICWI 2DYPB 4U1GC 2IAMA 5K59E 4BFGA 2CDGB 4R2GB 4CJ0A 5IESH 4M8VA 4GRWF 5DK2A 2DQCH 4N8VG 5F6HJ 4TUOA 3T0EB 1U2HA 4KFZC 3RWJB 3MLWH 3SDDB 4PJ8D 3REVA 3RFZC 1AY1L 5GRXG 3NN8B 2QSCH 3UYOD 3BDYH 3SBWA 2HT3D 2HT2D 3HNVH 3TPUA 1MQKH 4LPCA 2F54E 3RVTC 3PHOA 2DQEH 4XXCC 1FGNL 3JV5A 1DL7H 1LMKA 1WJ3A 4FQCL 1OSZA 3DETD 3AMKA 4KY1H 5FDWA 3K4DA 4XVSL 4Z7QE 4UTAL 2VITA 2IGFH 4WWKA 1KTKE 4C59B 1NFIB 4XPGL 4D0CB 4TNWK 2FJGA 5HD8D 4U33A 3ARBD 5EO1B 3O81A 5I8EB 2ZUWA 3ARRA 2CMRL 4ZXBD 4QRSB 1CE6B 4LCWA 4B7LA 2QQNH 1SYSA 1XIWC 4ODTH 4QRTA 4ZFOB 4BFBD 3OAZH 5FXCH 5C2UB 4HKBA 3DX8A 3B6SA 3IU3B 3QQ4A 1SY6L 1BVLA 5I15H 1A7OL 4NO3B 4Z77A 4JFYA 3TNMA 3WFCL 4XVTL 5ISZE 2B1HL 4JPWH 2XTJC 3G04B 3RVVD 2GTWA 1XGYL 2XWBA 2ZG2A 4J2XA 1EHAA 3B9AA 1TVDA 2W60A 5JUEL 4IS6A 5C0AD 4JY4B 1SBSH 2XZAL 5AUMA 5HHOB 3QPXH 2Y5TB 5D5ME 4FNLL 1DQQB 3WL9B 3UROR 2BNUB 1JNLH 4OLUL 5LGJA 2ERJC 2MHAB 4Q2ZA 4WFHD 3RY4A 4P99A 4J1UB 2X9WA 4X99B 1KTRL 4GQ9H 2CPCA 4XMLL 3DWTA 5HHNB 1IEAB 5C71A 3RWEB 1X9QA 5GISL 1A1MB 4NZTH 1MRCH 1UT9A 1FL3B 1HXMB 1Q94A 4HZLB 2AXJA 3FQRA 1CICD 3GI9L 5I71C 3QIWA 3CSYB 4LCYA 5JHLH 1YY8B 4HMEA 4POUB 4NKOB 3IRPX 2VXQL 1EO8L 5GGQH 2V7NB 5BVPH 1T0MB 1HHKA 5I1KH 1K2DA 4R8WL 4OLEA 4H25A 3RL1B 3LPFA 1OOAA 1NCBH 5CBEB 4X7TA 4Y1AD 1T5XA 5E8DL 2VLKA 4M1GH 4K55A 1P1ZA 5CJXC 2VZTA 1GGUA 1X5GA 3TJHD 1BFVH 4ONOA 2VYRE 5GRVL 4GKOA 2FWOA 1U8JB 3HG1A 4P49A 4S0TD 2LE9A 2UVFA 2I25N 1CT8A 1RZGA 4N1EA 3IS1X 3BP7B 3KPSA 3IDNB 2X4OB 1MHHA 2D7TL 5F1NB 1G9MH 3L3DA 2ORBH 3RWDA 3G6AA 1GZPB 3QJFA 3SDAA 1BFSA 1N7ML 4K9EL 2D7TH 3VA2C 5I1AA 1EUUA 3QDMB 1MVUA 1I3RA 4DKFH 3PV6A 1QBML 3SE3C 5FCUH 4MQXD 4FQHB 1FAKT 3QFDA 3L7FB 3LEVL 2VDPH 1QLEL 4P5MB 3WUWG 3UPCA 1J0IA 2KKQA 4NKIL 2VE6A 4JRXB 4WFHE 3QUKA 3PNWB 4CKVX 1ZVYA 2WIIA 3W5MA 1FFNB 1A4JA 3H9YA 5DRWA 3QXVA 2MOVA 3TVMD 2IH1B 1S7QB 3BFOA 5DURD 1RJYB 1HH9B 3QNYA 2VAAA 5DK0A 5E2VL 1CD1A 3RUGE 4QGTA 4PJ9A 4OFIA 2IADB 4NFBA 3NA9L 3GNMH 3PGCB 4JPIA 4X7DC 4DZBB 4LASH 4XXDB 2Y72A 2IAMC 4Z7QF 1U3HB 2ICES 1I3RB 2UVEA 1E4XL 3D1MC 3ZT7A 4EN3C 3L6FA 2LV4A 2NQCA 4PRDB 5EU4A 3HA0A 2DWDB 3N85L 5J3HC 4ZFOL 3M8OH 2XOTA 1C16B 4I2XE 5D2LB 4HPYH 5KZCD 1RK1B 3RGVC 3DMMC 5JA9A 5I19H 5C6WH 1B6UA 3VFMA 1QZ1A 5D7LA 3MGOB 4OZFA 4HD9A 2ICWB 5T3ZH 2E3VA 1YN6A 3JUZA 5IOPB 4PIRF 4M43H 4JM4H 1NUNB 4HUUA 3OGCA 1EJOL 4KDWA 5JHDD 3LD8B 5SWZA 4JDZB 4F37F 1XGUB 3RDTD 3TNMB 3OV6A 4XNYL 2PYEE 4LSTH 4LVHB 3WIHA 2M26A 5FKPB 5C0CB 3SGJC 3DYMA 5CINH 4P2QE 3QDGB 1WBYB 3TESA 1MHHB 4P57B 2Q8BH 4IJ3B 5SV3A 1UH3A 4CNIA 1N0XL 3H3PH 2IALB 4WV1B 4NZRL 4UB0L 1Q0XL 3QXAB 1EUTA 3WBDA 5E4EB 3RKDD 4OAWA 5F9DC 5KAQG 4N9OB 2P47B 4WW1B 2UV3A 3OKLB 2BK8A 4PRNA 5C9JB 1B2WH 3RL2B 5E8OB 2N1KA 4JY6A 4CL7A 1SHMA 5AG9A 5MENA 2R69L 1GGCL 4PJ7B 3FQUB 1CFQB 3MRLB 2ICEA 2VZSA 1JI1A 1TIUA 2OTWA 5DQDH 5F72S 3O6FC 1S9WB 4NHCL 5AZ2H 4OBSA 2X4NA 3SKUD 5GRUH 3E0GA 2IH3B 2FCBA 3P11L 4MJIA 4WY7H 3E2HB 2MTPA 4RGNC 5GGTL 3MV7E 4QYOA 5MEOB 4XC3H 3UCRA 5MI0C 5A3IC 5JW4Q 3PL6D 4MLIA 5T1DH 4L4JA 2VL5B 3L7FA 1CL7L 3HNTL 4LLAA 4WHDA 2HLAB 1LEIA 1LWRA 4I8DA 2WAHA 4PY7A 1GCFA 3G5VB 4QWWD 3QEUB 4JO1L 3EYOA 4FTVE 3W0WA 5EU6A 4MB3A 4XXCA 3IFNL 1L9MA 4OZIA 4GAJL 4HEME 3I2CL 2DTML 3SBWC 1JYVA 3DNKA 3OXSA 1BBDH 3VXMB 4BKLB 2ARJB 3MLRH 5MI0B 3QDAA 2WZPD 3MBXH 2NW3A 4BQ9A 2FIKB 3UBXI 2ZP0T 2YPLD 3P4OA 3B9KD 3LMJL 5D1QB 3O3AA 4S11A 3JUYA 4JFQA 3ZDXE 1VGEL 3X13B 1QSFA 3BE1H 4KTEH 4FQJH 2X05A 1OP3K 3QWRD 3R0NA 5JZ7C 1IM9A 5I74C 5IT2L 5IQ9B 3RAJL 1Q9LB 5EOCJ 5DHVB 5CLWA 2GCYB 4RIRA 4PJDA 5J6GA 1V05A 3UTSB 4F7EB 3VFNB 2X4QB 4CNIB 3WN5C 5JQ6L 5JXEC 3O41A 3ZYJA 5HHPA 4PV9B 4YQXL 5HYQB 3SKOB 1NMBL 3RU8H 2AI0H 3ILPA 3O6KL 5TGBA 1HN1A 1KUMA 5F9OL 5DUBB 1RUKH 4J6RH 4M5ZH 2YPVL 3GSNA 4G8IB 1ZHLB 3AROA 1D5IL 2MCPL 3UMTA 3ZKSD 4IIQA 4J3SA 2K7QA 4X98B 3UP1A 5JW3L 4TYUA 3BQUB 1IC1A 1RY7B 1D5MA 4OUOA 4L3EB 4PB9L 2EEDA 3HMXH 2E27L 4D9LL 1TTGA 5E8EB 4XP1L 1UKTA 1SJVA 4C56E 4GRWH 2HLFD 3L5WA 2ADFL 3B9DA 3BZ4A 4QRRB 3T65B 1MWAH 5IFAL 4NYLA 3VGHA 43C9B 5BOPA 3WNMA 4OZGB 1CGSL 4GOSA 2YUVA 4WI2A 4L4VD 1YECL 3VXUE 5I1DA 4ETYA 2HTKD 1UQSA 3SHSA 1EHXA 1NGXA 4ZUVA 3CC5A 3ZYIA 1KPUB 1NGPH 2F15A 4LLYA 3O6FB 1P5UA 1JPTH 1B6DA 2F53D 4GG8B 4P57A 4Y4HB 1KIRB 4RMSA 4H1LA 4DW2H 1TFHA 2EEAA 1PGRB 2HRPH 4KQ3H 2Y1VA 1KEGL 3NIFF 4KK8D 1AHWB 1JGLH 2VXUH 5GQBA 1IGIH 3Q6GL 1W72A 4I48B 3MLTB 3SDCB 4HZAA 1UH4A 3KPRE 3JWOH 1MFEL 3QIUC 2QR0B 2R8SL 3QPQD 4K3GA 3H9SD 3QO0A 4FQXA 1VEPA 3V8CA 4YDKH 4OF5A 2VXUL 1J5OH 3T77B 1T2QH 3HE7C 3F7PC 3BP4B 3QCVL 5E8NA 5C0NC 4ZS6C 3S4SB 2Q6WB 4OCXH 2YBRB 2R39A 1MUJA 2BY2A 3BISA 2MNUA 2HFTA 5AAWA 5HYIA 1H8SA 3RJQB 1KT2B 4U7SA 2E7MA 3TVMA 1HXYA 4OCLC 3DYOA 4F15B 2HMID 2NXYC 5DMJB 3CFDA 2AJSL 4HXAH 2HRPL 3MRGB 4P4RA 2AXGB 4KGLA 4PJCF 1KJMA 5HXMA 5HYJD 1RUQL 1C5DB 4GSDL 2JB5H 1OCWH 3LKQA 5F88A 2D4FA 3KG5A 2P8PA 2XN9E 5E6IB 5IB5B 4QXUH 5AD0A 5HGAA 5JW5A 4ELMA 3GIVA 3NH7H 4AT6A 1BQSA 5IWLA 1DQLL 4KK9C 3HLAB 4ODHL 3UPRA 2VH5H 5J0BA 3TFKD 4KVCH 1IAIM 3O2DA 2X41A 1F58H 1Q94B 2OTUB 2ZOKA 1G7JA 5K9KB 4MHHG 2WBJD 4RAVA 4XCNA 3V95A 1JMZA 3SJVA 2R2EA 3HR5B 2FEDC 3MNWB 1FNGB 1NGYB 1UYWH 3QISA 5BXFB 1BQUA 5GHWL 3RX8A 2VLLA 4PJXF 1Q38A 3D18A 4K9EC 1ZS8A 5K59F 1FAIH 3IJHA 5C09E 1YJDH 3RWDB 1R5WB 1S78C 3VGAB 3Q3GB 4XB7A 1HHJB 1HILA 4OM1H 2BSRB 3Q1SL 1QRKA 5IMLB 5CHNA 3ABZA 5D2LF 3GJEA 3BW9B 2I07A 5C07A 3KPSB 5JDJA 1YJDL 2C1OB 1NBVL 2GJ6E 4L4VA 5T3ZD 1MI5E 2YBRA 2XWTB 2QQNL 1UWEH 4N8CL 1F4AA 1A3RL 1MI5D 3NFNB 3GFUA 3IAQA 5ESVA 1BJ1J 4G9FE 3S88H 4JHWL 2R8SH 5F7WC 3RVTD 1KJ2B 4U1SB 4LRIA 3RTQB 3GHEL 3T77A 5JORA 3VI4E 3WN5B 4EEEA 1KEML 3FT4A 1OTUD 4X6CB 3K8MA 5GGVL 1IGCL 4JZJC 1E6OL 1OY3B 5C0JB 2ZCHL 4J8RB 2BXZA 4G8GA 3BYYA 3BKMH 2QSQA 3O2DH 4KJPD 5H37H 4LVOB 1A7BA 1BF8A 3ARUA 3VGAC 4IEFB 3WUWA 3H9ZA 5LWYH 2Y06L 2XNAB 3CXHJ 3DX7B 3HAEA 4UQ3B 1JBJA 3EBAA 4HULB 1IQDB 5CWSA 4ZPTA 2FJGB 3QAZC 4Q6YA 1E4KA 1Q9LA 2HFGL 1P2CA 3NPZB 3SDDD 1HOCB 1WIOA 4QO1A 5TH2A 4OZHA 3WFDL 4BYHA 4MXQD 3KPTA 4X99A 1LDPH 1WCBB 4DQOL 4HIIA 4CGTA 3LS5L 1CE1L 3H3BC 1NEZB 1AGBB 1PX3A 4L9LC 4NO2B 4XRCB 3GO1H 3OMZA 5TFSL 2VC2L 3JVGC 5JO5A 1UJ3B 1FVEB 1JF5A 4MXWH 2PTTA 12E8H 4YDKL 5KVDL 3PDGA 4JKMA 1D3CA 1LE9B 4LNVA 3IETB 4RWYH 3GMNB 1AO7A 1R3KB 4OCMC 4LIQH 3B9KA 4ZXBB 3MFFB 4YZFF 2ERJB 5ENWB 3MRIB 3TVMC 1EEYB 3CFJB 1RZIB 3VFOB 1WZLA 1ZA3B 2DIBA 5GGTH 2H2SD 2P4AB 1BJ8A 1G84A 2LU3A 4PJ5D 1OD9A 1YMMA 3BGFB 3NFSL 3ILPB 5HGHB 2XTJE 4GMSL 1FL5A 4GH7B 5D70L 5HJ3A 3WFHB 5FO9B 3T4AB 5DJ0B 3RKDC 5J7CC 4O58L 4GKNA 5FM4A 3L95A 4KVNH 3CDYA 1KTDB 2V5RA 3MBEC 5EC2B 1NC4A 2R2BA 5HHOD 3INUH 2P42B 2FH6A 3GHEH 2OXHA 1A5FL 4JKPH 4DZ8B 5F97E 1XR9A 4HUWB 5DEGB 5J1AA 1YEEL 4PP2A 3GSQA 1FGVL 5KVGH 4IJ3C 4PJ7A 3RVUC 1W0VB 1PKQA 1RVFL 1ZT4B 3S3JA 2D31B 4KPHH 3SO5A 5C0GB 1XGPB 3P0VH 3GI8L 2H9GB 4NRZB 2VDPL 4F9PC 2R2HA 4LVHC 1QFPA 3MA9L 1J0HA 2P46B 2PKDA 4FQLL 4BFEA 2VLRE 1RHHA 3X3GH 4POZC 5DO2C 2WBJC 3FQWA 4PBVC 5J9PB 4R4FH 5IG7A 4UIMB 3BJ91 4HPOL 4QY8B 2H26B 5LCVL 4LGPB 3LH2H 5LGHH 4WUKH 2OMNA 4EN3D 4Y89A 4XNZB 1K8IB 5IKCA 3CSPA 4L8SB 2BVQA 3NCCB 1JNHB 4WU5A 4LHUG 1A5FH 4X8JB 1F11A 4PJHF 1EEYA 3UEZA 1HHHA 2YPKA 4QEGA 1P6AB 2ZG1A 1X4YA 3VWKC 2P49B 4ZOEA 3QQ3A 4TVPH 4WW2A 1EHLH 2VLJA 5IMKA 4XVUD 5DJZA 4AEHH 4F2MB 3UO1H 1ZAGA 4U31A 1V8HA 1NGZA 2EZ0D 4H26A 4K9EH 3LN5A 1KJVA 1NLBL 4KMTH 1T5WB 5DJ6A 4UT9H 3MRKA 3QIBA 3UJIH 2RCSL 3RBGA 4K3EL 3VXOA 4PLNC 5ESAA 4JG0L 5HI3D 2HTLC 3NCJH 4JFED 2GW5A 1CLZL 4PYHA 3H7BB 2RAMA 1ACZA 4G6ML 4XP1H 4EOWL 1I8MA 3C8KB 3H3KA 2V5SA 3G5ZA 5CD3A 1T21B 4AYFA 3MLSH 5ANME 3D85B 4MGXA 3SY0B 5MERB 5EO0B 2EDXA 1WBZB 3NIGF 5F1SA 3QZWA 3QDMD 4R90L 1GGIL 4ODXB 5E4EC 4NQDA 2FGWH 4AENB 1TZIA 3MYJB 1TQCB 3BGFC 1FNAA 2R23B 5F88B 1VFBA 1XR8B 4GRWE 4PGCA 3RNQA 5F9WB 1JK8A 1G1CA 2CGRH 2R29L 5A3ID 3T2OA 4JLRB 1KB5A 1T1WB 1C7SA 4JRXD 2RGSA 1FL6B 3FT4B 3GSUB 3HC4H 3L3IB 4R97B 3KXFA 3H6JA 3RZCC 4Z7WF 4XCYB 3RWIA 4ZTPH 5DURB 4GUPB 1FNEA 3J8F7 5F8RC 3WS6C 3Q5TA 2F8XC 4Y2DA 2ATKB 4NGHH 3CFBB 5JLZA 4TPRL 3FN0L 5HHPB 2R1WB 4DKEH 2B2XL 3PP3K 3ZDYF 2YN3A 5TJWK 1U3HD 2X4RA 2ID5A 2FR4A 3TBTA 1PZ5B 3HFMH 4MQXC 1C08A 3BKYL 3BP5A 2NY5C 3B5GA 3GZKA 2EO9A 5FM5O 1U41A 4QRPB 2J3SA 5GRZA 3K46A 3C6LD 3QUZA 4Z7VE 2AK1L 5CSBA 3D9AH 4HS3B 2BNQD 3CFCL 1TZGH 2CIIA 2NY3D 3ALPA 3AVEA 3ARVA 3F58H 4TOYL 1L9NA 2R0KH 4KU1A 5D6CB 5DTFB 3K0WA 3EHBC 3U4EA 3V52L 2NXZC 1QFOA 3HC4L 5DT1L 2A9MH 4W4NA 1ZE3C 1T5XB 1H8NA 2YA1A 4MDIA 4OSUL 5JHDB 1JL8A 2Q3AA 3B3IA 3O6FA 4WI9A 1DLHB 2LAGB 3MCKA 5IVOA 2GK0A 5HHXL 1YNKH 5GIRA 3CH1A 3FZUC 1AIFB 2VQTA 3QDGD 1P4LB 3OSKA 1MCOL 3I3EA 4A6YB 5DD0L 5HBBA 1LP9A 2UWEE 4ZFGH 3QUMH 4HIXL 1DVFD 4AMKL 1HWGB 3VG9B 3ARPA 4HLZG 4NYLB 3UTPE 4PGZA 3QDME 1JZ7A 2K1MA 2LFGA 4YDLC 1RUML 5C0FB 5JIIA 3ZTNH 4ZO6A 5B39G 1JYWA 2OR7A 2OP4H 4PJ7F 2B1HH 5D1XC 1NDGB 1A8JH 3MCG1 4YXKH 4XP5L 3HNSL 2CDEB 3RZWA 3I9GH 2ITDA 5GSVB 3VFRB 1PG7H 1GXEA 4ZNEA 4G43A 3GSNB 1JPGA 3D2UA 4QHUB 3VGFA 5BMFL 5KVMC 5LXGH 2GAZA 3O0RL 4MCYB 2XPGA 3KPNB 3UTTA 3VGDA 4XP5H 1JTOA 4JY4A 4K07A 4L3CB 1RQ5A 1FL6A 4L5FH 3MFGB 5F1IA 3GBNL 1P4IL 1ETZB 3OPZH 1BQLL 4X7EC 5C1MB 2YC1A 1UC6A 1S5HB 4LEXH 5DUPL 3QQ4B 2DI9A 3WD5L 3VFVB 3AY4A 5T1KA 4LGSB 3W11D 5KN5A 5ILTH 2ADGA 3HE7D 5DRNB 2NY7H 2OL3L 4K8RL 4QRQA 5FOJA 2AQ3A 1M71A 1J8KA 3L3JA 3QWQB 4N0UB 2DI8A 3SKNB 1W8OA 1TQBB 3IDJB 2A77H 3I9GL 5HGHA 1FN4B 4PLOB 1AR1C 3FQRB 1UXWA 4AIZB 2M8XA 3PGDA 4GXUM 5CEZD 2NXYB 4LCWD 1AJ7H 1CD8A 2Z91B 3KPRA 4PRIA 3X11A 1A1OA 3Q6FB 1T7WA 3BPLC 4JRYD 1ZSDB 5D1QD 4DGVH 3HC0A 2F53E 5F7MC 5IMKB 3OAYH 1U3YA 4JCMA 1NCDH 2FD6H 1MFAL 2HN7B 1F6AB 5JXED 5JO5B 1KB9K 1QUNA 1BFOB 1UCTA 3BQUA 1BEYH 4Q9RL 3NFPB 3GSRB 3QHFL 4PRDA 2NY6C 2W9EH 2WUCH 1TQBC 5CZVH 2X44D 4HWNA 3Q5OA 1FPTL 1V5JA 3QCTL 4I3GA 4L8SA 4N0CD 2A77L 1OAYL 4P5KB 5EFIB 3V4VH 3S97C 3MSPA 1HI6A 2GJZA 1A6UH 3K8KA 3DROA 2J4WL 5DJDB 2XTJB 4KKLC 5D9SA 3ROOA 2H26A 1FORH 5B3NA 2H6PB 5ISZB 4NUGH 1JWMA 3S34H 4KHXL 2EDJA 4BQ6A 3IDGA 2CUHA 3IKCA 4OF3A 5CGYD 4OKDA 2FL5A 5CCKL 3R1GL 1UEYA 2A74B 1DE4A 2ADFH 1S7SB 4GQPH 1F4HA 2IPTL 2I26N 2IALA 5E94B 5AYUL 1U36A 1OGAE 4KMQA 4QXWA 4D9QE 3F5WA 4R4BA 1DBMH 3BQUD 5IVXE 5HYJE 2H8PA 1IEHA 1XR9B 4L3ED 4Q9RH 2EDRA 5EC1B 3BP5B 3MROA 5D70H 2C3VA 1BVKB 5C8JB 4HIEB 4ODSH 1I3VA 1WVZA 4P4KA 3VFRA 3DRTB 1WEJH 2NY5H 3T4AA 3O3DA 1ORQA 3TV3L 2Z8WC 3INUL 5IOPA 4NBYB 4L4VB 4KHXH 1Q9OA 4LASL 1MLBA 3MJGX 4QOKA 5I1EH 4JHAH 1T4KA 5FO8A 4WTZA 2YMXL 2I5YL 2QSCL 4YDJB 1MPAH 5EUKB 1EGJL 3RTQA 2MQCA 3HI5L 3F7YB 2CDGA 1MCPH 2NTSP 5ENWA 2F53B 5T5FH 1HEZA 2O5ZL 4XNMA 3ULVF 4PGCB 2ED7A 1MQ8A 2ICWA 1DEEA 5E8PA 1BGXH 4N8VB 1RZJC 4JFDD 2CO7B 3SDCD 4NQTA 1JHKL 5KVEL 4IRJC 2V2WA 3OKEB 5ITFB 3CUPA 1NCWL 3C2AL 5CAYB 3H9SB 4WO4C 1B88A 1CLCA 3IT8D 1U8LA 3PNWA 1JYNA 3TN0D 4G7VH 4M5YL 1OHQA 3WFZA 3QIWB 4X4ME 5B39A 4HWBH 1X5IA 3AC0A 4P3DA 2X42A 2Q8BL 4PRPD 4LRNL 3RVVC 3N1PC 4X9BA 3V7AE 2ARWA 2C7UB 1CDGA 2IADA 4RAVB 3QFDB 4XCNB 4PJBE 5B4MC 1PBYA 4L29B 1MH5A 1EZVY 4CVZB 5ACZB 1CDBA 3Q6GH 5CLTA 3O4LA 1HKLH 2DN7A 2YD5A 4MA3A 4JN1L 3FRUA 4YFLF 1A6PA 4JFHE 3UJJH 1T1XA 2W91A 5IQ7L 5HYJB 5IVXB 2CRYA 3TO4A 5E2JA 3VFGL 4G8GB 3BO8A 3C5SB 4JM2A 5I19L 5ALCL 1HHHB 1NMCB 4JN1H 5CGYC 4Q9QL 5AZ2L 1BLNB 1CS6A 4B50A 2J8UA 4W68A 4NQSA 3DTXB 1JRHH 4OF8A 2N56A 1TQCC 2GJ6D 4Z0BL 1MFAH 4O2FB 1H0DB 5F7NC 3VDAA 2FB4H 5C0DB 4J23A 4LRNH 1FIGH 4I5BB 4PJIB 3RVWC 1IC4L 2WBJB 1CL7H 1M6OA 4MNHA 4YHPA 4PJHA 4X6DB 2VLJE 1HQRA 3MV9A 3BH9B 4PRPA 3U7WH 4LSUH 1FVCA 3BHBB 2EZ0C 4ZOAA 1MEXH 4NQVA 1W2KT 4KKCC 2B39A 4PTTB 2EIZA 1I8MB 5BVJB 4LGRB 1KB5L 5FV1L 4H20L 5J1AB 3R1GH 5CSZA 5FGBC 3KPSD 1N2RB 3QIBC 4FP8L 2JJWA 2R69H 1G6RH 5IMMA 4LK4A 4DKEL 5IIEB 4HUKB 4R9HA 2V2WB 1HHKB 5ITFA 3G6JB 4IMLB 2HH0L 3ARGA 5LVEA 3ARGC 3VG0H 3KS0J 4FQJL 3RTQD 1U8LB 4M43L 3QDHA 5D7SL 1K9TA 4G7VL 3V4UH 1N3NA 4LHUD 5HVWA 5DMYA 2DWEB 1I1AA 2HTLD 1X5ZA 5TE4L 4PJEA 2W0FB 2R0WH 4NN7C 1VCAA 1E27B 2HFEA 4M6NH 4OZGA 1CE1H 2Z31B 4OZGE 2VDKH 5FKAB 4YXHH 2A6KA 4QRRE 1KF9B 1QA9A 5L2JB 5LG1A 4MNQB 1UCBL 3NCYP 4U6XB 1JPSL 1NC2D 1T0NB 4I0PC 2AV7B 3P0GB 1YJDC 5F9WC 4NN5C 2EDYA 1OTUC 2Q6WA 3PXHA 3EJZC 4OLVL 1RIUH 1TNMA 3CXDL 1SM3L 1TVBA 1OP9A 5SX4I 3VA6A 1QNZL 2N4IA 1KCVH 2EDFA 2FZ3A 5IEKB 3ZZ1A 2XICA 4TSAL 5FGSA 3VG9C 1LD9A 5FGCB 1RIUL 3CXDH 4PP2B 5LGHL 1IILE 4FABL 1SM3H 3BVNA 4BJLA 3WXVL 4OTXL 3C60B 2R2BB 1DUZB 3GNML 1AHWC 2F19H 4GLRI 4OF0A 2JIXA 2VDQL 4RGNE 2X4UA 2AJXH 3EO9L 5DO2D 4MLSA 2CO6B 2CUIA 3L3HA 4D3CL 3MJ8A 1JGEA 1LVEA 3PHOB 5J6GB 3B8SA 1A3QA 1B2WL 1FVCB 3BHBA 1UM4L 1MFNA 2R56L 4XX1E 3GJFH 1EHNA 4TVSa 2VABA 5F1KC 1VFMA 4PJ5B 2AABL 4PD4K 1T3FA 2XKSA 5GRWA 1RVFH 5JDSA 2OI9B 5DD1H 3VH8B 2A83A 4XC1H 1OP5H 4HS8H 4XGZB 4ZFGL 2QADC 1U0QA 5FB8B 2BY1A 3F6LA 3NABH 4P23D 3TYGH 1D5ZB 3MRBB 3WIHL 5SWSE 5DZLA 2E9IA 4ZG1A 4N0FA 4UDUA 4I1NB 1U8QA 3TIDA 4RNRB 3P9WB 2B5IB 5D2LE 2ZOLB 1MHEB 1I75A 1MJJB 2PUQT 4EDXA 4JFXA 4LQFH 3WFBH 3W0WB 2SEBB 3BPOC 1MRFH 4RAHA 3PQYE 3U7YH 1N0LA 2CRZA 1QBLL 2DKUA 4RGOL 2UUDK 5IIEA 3SQOH 1ZLSH 3ES6B 3U7WL 4WFED 2WNGA 4PRIB 3X11B 4LSUL 3KWWB 3IFNH 3ULVL 5J56B 3N85H 5J89A 1EHLL 1QBLH 3LKOB 4RGOH 5C70A 1UADC 3VW3L 2JJUA 1IC7L 2QQKL 4EN3B 1F4XL 5D8JH 5FUOH 5T1KB 1NMBH 2Q20A 3MUJA 4NGHL 1GGTA 3CUPB 4XPFH 5IK3A 3WD5H 2FLBT 1INQA 4LEOA 3UJIL 5DHVA 5JMOC 4XNXH 3ARFA 3ALXA 3ESUF 2CK0L 1BIIB 4WO4B 3UZQA 5HDLA 1PJ9A 3IVKA 2P48B 3ARDD 3HFML 3FB7A 4G3YL 2FJHA 3HNTH 2F19L 4PJCB 3DSFH 3MLYH 4U1NB 2P7TB 5MEQA 3AREC 8CGTA 1P69B 4YHLL 4OJFL 3LD8C 3OKOB 1A9EB 3QCVH 1DVFA 5HYSG 2CLZB 2A1WL 1CD0A 4Z95L 2X1OA 2JTDA 3E3QC 1ZANL 4JDVB 4JFEB 4RRPA 2OLDA 5C0FA 2Q3ZA 4TQEL 4YHLH 3FO2A 2ATKA 3QA3A 4DVRL 1MIMH 1TCRA 4LCUA 3VWKD 4NCDA 3PDOB 1GGCH 1S7TA 3D85D 4QHMB 4UIKH 1ZLVK 5SWQB 2F58L 5DJXA 5CSGA 2FX9H 5TDPB 3IKKA 5K9OA 3H9HA 3VXQA 3UTZA 1AH1A 5D7KE 1AKJB 1X5JA 4I0PD 1JGDA 4UIKL 4WFFE 1IGTB 1GL4B 5FCSH 3RHWK 5JW4M 2RCSH 1A3RH 4R7DA 5K9QG 1Q9WB 1QSVA 4X6BB 4B7IA 3QEGH 2F54A 4ELKA 4JPKH 1CLZH 4KK6D 1INDL 4F7CB 3UBXG 5T1DL 3ULUD 5D6CA 4YXKL 3P0YL 1OQOA 4WU7B 4X6EB 1P53A 5JPMA 3ZE2F 4K71B 1U8MA 1YMHB 1J1OH 3EO1A 1ZV5A 4LPVA 2ZUYA 3VJ6B 5BW7A 2AXGA 2ITCA 3OJDA 3OZ9L 1AXIB 2PW1B 1CD1B 3KJ6L 4M7JH 4L5FL 3O8XA 5CD5D 5C6TH 1XIWA 5CILL 1KFAL 3OKMA 3ZE2E 5M95B 5HHQA 2NW2B 1TPXC 2PCPB 1J0KA 1I8IB 4S10A 4QRPD 3CCHB 4XHJC 4MQSB 3P4MA 4PJGF 2VTFA 2Y6SD 3C6LB 3KYMA 1OW0A 1WEJL 2BNQB 3EW3B 3LIZL 3WFDH 1AGDB 2NY3B 4L8DA 3T0EC 1CICC 5EO9A 3DOSA 3QDGA 4OB5H 4X4XA 3ARWA 4S1DC 3OKKB 1CDJA 2Y36H 3HMXL 1FJ1A 4YZFE 5F9AC 3S37H 3SJVD 3VD3A 5KSAB 2PO6A 4TPRH 3GMLA 4NQXA 3ARFD 2L0DA 2GITA 3FTGA 5E1AA 5TDNA 2XWJB 5DGQA 1GZPA 3SDAB 5E7FA 2ZWLT 2HTKC 1H0DA 2MJWA 3BPLB 5KSBE 4V1DD 3SKOA 4OIAA 3OJDB 3WKNA 4CN6A 2H8PB 4Z7UE 1UJ3C 1EIBA 5ABDE 5I1IL 4B0MM 3EDEA 1U8HB 3CZFA 3HCVB 1DVFB 5CGTA 3N50A 2BX5A 2UZIH 2VZ3A 3IS0X 1A47A 4KKAD 3S96B 1KN2H 3OKDB 5HGBA 3N9GL 4O2CA 5IJVA 1JHKH 1ZVHA 2C4FU 3AY4C 1U3HA 4PG9A 1G0XA 2DM7A 1WUNT 3MRRA 4GMSH 1FZJB 1KCSL 1OLZA 3CFKB 4PJ9B 4NQEE 3REWB 5ESAB 3T65A 1NH6A 3ME0A 2Z8VC 3VU2A 3TBSA 3O6MH 4RZCB 1BD2A 1KCSH 1LQSR 2ZCLL 4BSWA 3MRKB 5D4QA 4CRPA 3V0WH 1J18A 3H9SA 5TFSH 4DGYH 1ZGLB 5IUSA 3ZKMC 3P4LA 1MJJA 3IDYB 1RZ7H 5IQ7H 2O93L 3NTCH 3ZKXB 4ZO9A 3MRBA 4PB0H 4OGXH 4R26L 4NKIH 1I4FA 5DFVC 5I2IB 4Q9QH 3HE7B 3D6GA 3QDMA 4XP9L 5F96L 1QHOA 5IHZB 5FYJE 3VWJA 2EH8H 3VFOA 2XZCL 3O3BB 4CDGC 4UIMA 3X14A 2HKFH 3CU1A 2Y5EA 3CX2A 3IETA 4JHBA 4ZSOE 3SGDI 4KDTA 3PWUB 4LLVA 1U8QB 2EXWC 2CJUL 5D5MB 5L7XH 4BSWB 1DSFH 2VDNH 2NXYD 3QEQA 4LCWB 1GYAA 3QEHA 5GRVK 4FQIH 1MRCL 4JRYE 1H3UA 3O3DB 5F7YC 3REWA 3RZCA 4JRYB 2WM0A 2JE8A 4HC1L 1IGCH 1WFTA 4PTUA 5ILTL 1DANU 1EEZB 4NRZA 4HIHB 3CPLA 5E70A 5D71L 3L1OH 1ND0A 5KAQF 3IJSB 1HINL 4G8EA 3O3AB 4L9LB 3D39A 1QSEE 1JI2A 4HKBB 4FXGA 1KLFA 4ZAKC 1RD6A 1INQB 4LEOB 5ACLA 1SYVA 2UZIL 1FL5B 5DJCB 1FCCA 1XGRB 5I8CA 4W4OC 1WICA 2DLHA 2XTJD 5ISZD 1Q9KB 4OD2B 2FL5B 4KRNA 3O3BA 4HK3J 5CEXA 2JK5A 3T08A 4JDZA 1YMMB 3BRDA 4MJ4A 4WUKL 4Y5YC 4YDVB 5GS1B 1A7PH 5ICYA 4D3CH 2WANA 1FVDA 2ZKHL 3M17A 2HLAA 4UI2A 3WNPA 1X6LA 4HUNB 1JWUB 5ESVB 3MFFA 4PV8A 1ZGLA 1P7HL 1S9VA 4OI7A 5D72L 4WJ5B 3D5OF 3ORJA 1F58L 2O61A 2PXYA 2PCPA