4KROB

Nanobody/vhh domain ega1 in complex with the extracellular region of egfr
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
128
structure length
116
Chain Sequence
QVQLQESLSCAASGRTFSSYAMGWFRQAPGKQREFVAAIRWSGGYTYYTDSVKGRFTISRDNAKTTVYLQMNSLKPEDTAVYYCAATYLSSDYSRYALPQRPLDYDYWGQGTQVTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system
molecule keywords Epidermal growth factor receptor
publication title Structural Evaluation of EGFR Inhibition Mechanisms for Nanobodies/VHH Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 116
sequence length 128
ec nomenclature
pdb deposition date 2013-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4kroB00
2CGRH 3WEXB 1LO0H 4EN3A 4G9DA 3T0BA 4Y5YC 1CD8A 4APQC 5C08E 1FNFA 3T77B 2AXGB 5E03A 1K4DA 1A3LH 3KJ6H 2JTDA 2EEAA 4ZXBA 3ILPA 4Y2DB 2EYRB 1KCRL 2AABL 5KN5A 3QT2A 1AC6A 5CJQL 1NSNH 3ZDZF 7FABH 5IOPB 4HS6B 1M7XA 4JFEE 4JZOA 4K7FB 2MKWA 1EA9C 5BW7C 2OYPA 4UU9B 4Y88A 1LP9E 1Z9LA 1AJ7H 4KV5F 2XACC 3V6FA 1Q9KA 1WAAA 1W8OA 1F02I 4G8GD 4OAWB 3NFNA 3ZDXE 1NMBH 2SEBA 3ULVE 2AK4D 4RRPA 3U30B 5HYSA 1OD9A 4MAUL 4X6BA 5GS1A 4P2CG 1AQKL 4MA7H 1FL5B 3I9GL 4PJAA 3CVHH 4ODXB 1UQSB 4PRBB 3WDHA 4JDTL 3GSXB 1JTOA 1XH3B 2XKSA 1ZLSH 2Z93B 4JKLA 4ODWB 3SE4A 4WJ5A 2VYRE 4J7RA 3O9WA 4LOUC 3RWIA 5F7HA 2D7TH 3LRGA 2AP2A 3D5OF 2XYCA 1NCBH 2QQQA 3TO4C 1OAZL 3Q48A 3EDDA 2NY0C 1M71B 4EVNB 5HTSA 1T1YA 5DO2D 1INDH 1QO3A 2XN9A 3RKDD 4LDOB 4XI5C 1AGEA 2P24B 4MX7A 2MHAA 2ORBL 4Y4KA 1L7IL 1PJ9A 4KKLC 5EBWA 4TUKH 3FCTB 3CFEA 2XTJE 3PL6A 4QHNB 5HPMB 2EIZB 1QBLL 4ZUSB 4S1RH 1BQLH 4PJGA 4HT1L 4OCSH 4S10A 3I75A 4M7JH 2OSLA 2CDGB 4X4XA 1FNEB 2V5SA 2WP3O 2P4AB 3RPKA 2DMKA 3C08L 4YDIL 3OGCB 3TPKA 3V4VH 2OTPA 5BOZG 3O2VH 2FBOJ 2EKSB 2YD6A 2AERT 3GMNA 3QDME 4WTXA 2C4FT 1M05A 1TJGL 3KPLA 1CCZA 4ODTH 3C6SA 1E4JA 2V5MA 2LVEA 4RMSA 1XMWA 2R2CA 4LPXA 3LZFH 3MROA 2GJZB 4EDWH 5GRVL 5BXFA 1LDSA 2J1KA 4RAUA 1XZ0B 4RISL 3VXUE 1RIHL 3ILQC 5E8NA 2QADB 3STLB 3ZE2F 3BT2L 4NC2B 4TSAL 5DMJB 5FM4A 4WFGE 4G3YL 1U36A 2X4RB 2NX5D 3SGJC 4NNPH 4KGJA 4OUOA 4PS4H 2E27H 5GIRA 1QPPA 3O0RH 5IB5B 4L3EA 4M1DL 1INEH 5TF0A 3DMMA 5I1KH 4JRYD 3P40A 4WU5A 1VA9A 3L3JA 5DZNA 2VDMH 1Y6KR 3SE3A 5JW5A 1JYVA 5JIHA 1FCCA 1MUJB 5E08H 3DTXA 2IFGA 1YY9D 2BDNL 4LEOA 5C09E 4POYA 2J6EA 4X7CC 4YE4L 2R2BB 3C5ZA 4HWBH 1JRHL 4LRIC 5C07E 2IC2A 1Z3GL 5CBEA 5HY9A 3WE6A 1QLRA 4JFDD 1UJTA 2F54B 1AY1L 2IH1B 4G6MH 4HH9B 5K9OA 4RFEB 1TZGL 5EU6B 4KVCH 3SO3B 1KSRA 1C1EL 4JO3L 1M7IB 4U3HA 1AO7B 5E6ZA 3T09A 3KJ4B 3F12A 3AGVA 2JIXA 5I9QC 3JTTB 1KG0A 2KBGA 5ICZA 4JZJC 2I25N 2IANB 4U7SA 2D9QB 3BGMB 1T22B 2E6JA 5DI8A 1A7QL 2P44B 4UQ2B 3FQNB 4ISVB 2BY2A 1NCWH 2YUWA 4LLDA 3SGEH 3HC3L 1P7QB 5DEGB 5DD5L 1VGEH 2Y06L 2FHFA 1TZHB 2X42A 1MCRA 4GXVL 2DM3A 3E8UH 4NJ9L 5FGSA 3QISA 4HKBB 3GSOB 2E9WA 2W1NA 3QDMA 4JANA 2YD7A 1X9QA 2AEPL 3P2TA 2FJGA 5DRNA 4EN3D 4MVBC 1DDHB 3U0TA 3WLWD 1NMCB 2VLKE 3D18A 2YN3A 4BZ2H 5H35A 1ZHLA 3D85B 2NTSP 1J8HB 3MRLA 5GGQH 2NXYB 4ELKB 3FHQA 1KT2A 3LKRA 4ZXBD 3R1GH 5F88A 4M02A 2FGWH 3VXUA 3FMGH 3QUML 3KWWA 2V2TA 5DK3A 4NOBA 3BPCB 1CGSL 2BK8A 4U6VL 4BELD 1WWBX 1FO0L 4Y19A 5I8OL 4NBYB 3TNMB 1AR1D 3P11H 5EZJB 4PJ7E 4JO1H 5F9JB 2B0SH 2VDLH 2HFEB 2JCCB 4OTXL 4DW2L 5C09A 2AJVL 1T21B 4PG9A 5IR1A 3TT1L 2XNAB 3QUZB 3RL1A 2FSEB 5CEZE 2H45A 2P8MB 1NGYA 1OQOA 1MJJA 3O9WD 1S7WB 5EA0H 4LSSH 1SBBA 3VGFA 2DI7A 3DYMA 4PJAF 1IC5H 1YDPA 3IETB 4CVUA 2R1WB 1A6ZA 5I75B 1YYML 2XN9D 3MV7E 4LQFH 3C60D 4GW1B 4K9EH 5HI4C 1AGDB 1MCFA 4CJ0A 2I07B 4XCYA 4PD4J 2DKSA 3DV6B 4FFVD 4LKXA 5IP4A 5L0QB 2B2XH 3NTCL 4YHYC 2XKNA 3PL6D 1VEPA 3FTGA 3V6OE 4PRHE 1O5DT 1X5ZA 4HD9A 5I6XC 3H9HB 2DDQL 4U7KA 3QDAA 3WUWA 1Y0LB 4P48A 4Y1AB 3RWEB 2BCKB 3WS6C 3EYOA 2OR9H 4YHNB 3PP3H 4D8PA 1RHHB 2YPLA 4OUUB 3RRQA 1KIPB 5IB1A 1T66D 1PEZA 4XB7A 2O5YH 4PJGF 5H94B 1K8DA 3QYCA 4ZAKB 1BGXH 3QUYC 4TULL 4CVXA 3VFRA 1AXTH 4W70A 4F7EB 3SKOA 2YRZA 4I9WD 3K1KC 5A2IH 1IAOA 3EYFA 1J1XL 4P46C 1ONQB 5D7KE 3U1SL 5ID1B 3HNSH 4GKOA 2AS5M 2WANA 3HB3C 4XNZB 3CCHB 1U8NA 2NY7H 4PG2A 2X4QB 3GHBL 1YEDB 4F58L 2VXVH 1UZ6E 2Y07L 5EC1B 1NFKA 2PYEB 2A73A 2HFFA 4KVNL 3VFSA 3O6FA 4L3ED 2PKDA 1XGYL 1PGRB 3DMMD 4Q9QL 5HHNA 2ATKA 3C6LB 1GYAA 4HBCH 4XBEH 1IAKB 4P2YA 1CFSB 4PJCE 1RJYA 1J0KA 1LO2H 2BRRL 5TFSL 4I3RH 3EOTL 4LAJH 4RGNC 2VISA 4Z76A 3KXFE 3BJ91 4LEXL 43CAA 1SYVB 1OTUC 3NIGE 4LU5H 3C5ZD 5EZOH 1MJ7H 3HNVL 2O5ZL 1DEEA 1F4YL 5HI5C 2MKLC 4Y5YA 3LKOB 4APQA 4QOKE 4LLUA 3VRJA 3L7EB 1NBVH 3DUUB 4ZUVB 5EFIA 1QSEE 4XWGL 4MB4A 1TJIL 3WD5L 2EH7H 2JIXD 4N0UE 1UM6L 2VIRA 5JOPE 3K2UH 3T0VA 4MA3B 2Y23A 5E2WL 5BW7A 1F8TL 3NA9H 4QTHB 4HV8A 4R3SA 2OQJA 1FYHB 1U6AL 4MCZB 2XY2A 4R4BB 1D9KC 3V6OA 1FH5L 5TE6L 5KVDH 4PRHA 5FYLL 2ADJA 2FIKA 4XP9H 3QUXB 2AQ3A 1CDIA 1FLTX 4JG0L 3EHBD 4MJ5A 1HXMA 4G80A 3LDBB 3UEZA 2ZOKA 1KTDA 5E2JA 3T0DA 3QDMD 3NCJL 1T1XA 4YC2C 4H5SA 3SE9H 3QPQD 2XZAL 1HH6A 3O2DL 3TO4A 3Q6FA 3BI9X 3SDDC 2EKJA 4BK4A 4XPFH 2VMFA 3QDJA 5J9PB 3VXUD 2ENSA 4MXQD 4QRPE 4Y7MA 3PGFH 1F3DJ 3MLZH 1M4KA 2JK5A 3O6MH 1YPZE 1BFOB 3DWTA 3PGCB 1YNTB 1MOEA 2IQ9L 5J8OA 5JMOC 1QUNA 3ZKXB 2VQ1B 5EO9B 3R8QA 1DQLH 4Y19D 4BZ1H 4XVSL 1A4JB 1KULA 4OGXL 3VA6A 2CMRH 2FJHA 1N8ZB 1VFMA 5IBTL 1EAPA 2G60H 1UB5A 5C09D 3P0VH 4PJBE 1WCBA 2CK2A 1NGZA 5AZ2L 4FQ2H 2CLRA 1MHPL 4LPWA 1RZJL 3AVEA 5DD0L 4OCLC 5C07D 3JV5A 1BQHG 1YJDH 3K0WA 4OFIA 1IAMA 5D1QB 3SJVB 2DLFH 2IWGA 4KPHL 3KPTA 2HT4C 2DWEA 4DGIL 3U0PA 3PWLB 5GGRA 4AY0A 3HZVA 2VDRL 5T1KB 3GB7A 3NPSB 2P1YA 1DUZA 1YMHA 4AMKH 1KC5H 2AJSL 4K3HA 1ZANH 4GAGL 4OQTH 5CZXC 4XPBH 2X4UB 3RVWD 2F53B 1H8NA 4N0UA 3SGJA 4X5LA 5HVFB 3ZYIA 2ADFL 3RBGA 3I02A 4HMEA 2DQHL 1QG3A 3MYJA 5EG6C 4X80L 5I73C 3WIHH 4L4TA 2ZG1A 3MRKA 3GI9L 3TJEH 1JPSL 3DETD 4MA1B 2R2EB 4JFZL 2GITA 1WBYB 2ITCB 2VSCA 4P9HH 2YPLD 1ZEAL 3O6LH 1P6FA 1AP2A 4K3DL 3WJJC 4LRIA 5CHNA 1FZMA 4NKMA 2NY6B 5E6IC 5DJ0B 3MMEB 4QHMA 1L7TL 4TQEL 4X6CA 1Z0MA 4H20L 4Y0GA 1GXEA 3DV4B 3VFNA 3QIUC 5FDYA 3NACL 5GPRA 1XIWB 3OXSA 3MR9B 5CUSH 1DSFL 3MRJB 1PBYA 5D4QA 1X5IA 2NQCA 1BIHA 2VZSA 5EBMB 4JZJA 1YPZA 2AJYL 3NAAL 2BVQB 2YBRB 5ESVB 4FQCL 1UXSA 2Q8AH 5EDXA 3F5WB 2O61A 2EIEA 2ZSVB 1KN2H 1OSPH 4OCRL 3T8XB 1TFHA 3QNZA 3BKCH 5DHXB 4C56E 2DQTL 1ND0B 3EJJX 4PTUB 1JNLH 4X9FA 3PWPB 4YXHL 3GMPB 2MJWA 3QWRA 3DARA 3QJHB 4Z7VE 4PJBA 4TNWK 1DBBL 1JZ4A 4XP5H 4R90L 4I4WA 3BKJH 3CSYA 3CVHB 1CE1H 1JPTL 4APQD 1T7VA 4BQ9A 5ERWB 5H2BB 1RZ8A 1A6VL 3PIQA 3QG6B 1KYOK 4TVPL 2Q6WA 5KSBF 3PHSA 4UDTA 4HFWA 5E2UH 3EOBA 4MSWA 1G7QB 4JVWA 1IAIL 4LCYA 1CLYH 1AI1L 2YEZB 1IEHA 4FS0A 3FQWB 4OZHB 4DN4L 1AIFB 3ZT6A 4XCEB 2Q76A 3PWVA 5C1MB 1MCWW 1JGEA 1UZ8A 1FVDB 1A9EA 3HTLX 3P4MA 4K2UH 1RIVL 3U9UB 5I8KH 1F58H 1DQQB 3CXDH 2X4TA 2XQBL 5MEPB 1J0ZA 5ALCH 4XPAH 3VXNB 4O4YL 4PRHD 4ELME 1UWEL 1ITBB 4RGNE 3HG1B 1A5FL 1JHTA 3QBTB 5T1MA 1OLZA 3X13A 3H9SB 1QOKA 2DM4A 1QYGL 4UT9H 4HFUH 4AIZA 2HVKA 4O5LH 1HEZA 1MPAH 1GZPA 3VE0A 1E28B 1GCFA 4YDVB 5DQJB 4LOUD 3UPRB 2FX8H 3W9EA 3OX8A 4F80A 3I3DA 3JUYA 1CBVH 3TO4D 2NXZC 5HGDA 1GPOH 3QDJD 4MNGB 1JMZA 4HCRH 2FBJL 4RAVB 4XI5D 5DJAA 5GGTL 3ZTNH 3MRRB 3BE1L 3IDUA 1G9ML 4KKLD 2KZWA 4OCXH 4TTGA 1J88A 2ESVB 1I9IH 3SDCC 3LY6A 5D6DC 4U1SA 5TE4H 3QXWA 3P3YA 2ZCKL 1RIUL 2CR6A 4LLQA 4HHAA 3QQ4B 4QKXB 4ETQB 3WS6A 5IV2B 1EBAA 5JXAL 2BY0A 5C0RH 2BFVH 3GIVB 4OJFH 1OTSC 1S3KL 2WIMA 4JHZA 4U2YA 1KB5L 3QWOA 4K7PH 1VDGA 5AUMB 3EBAA 3EJYC 3FONA 4U1LB 3BH8A 3KDMA 1OAXL 3CFBA 5T3XL 3QO1A 4NO5B 3GJFH 1ADQL 2CRYA 3A6OA 3DLQR 3GMMA 5FYJH 1R6VA 2B5IB 4M7LH 3MNZB 5MEQA 1FAIL 1OM3H 3UZEA 5IBLD 1H3PL 1NMAH 4M1CC 3ILQD 2RFXB 1SY6L 5CD3B 1A6UH 1EJOL 5JOPD 4PTTA 3KPPA 2QKIB 2Z8RA 3V0VA 3MRPA 3I6LD 3BIKA 5HHOE 1JPFB 4LASH 4TRPL 1NLDH 3D48R 4HK0B 4L4TD 1RZGA 4OCWL 4P5TA 2FD6L 5F7LB 2WZPD 2OZ4L 4G6AC 4KJQC 4LF3A 2AEIT 5F44A 4CVZA 5JLZB 5I2IA 5DF0A 5D7JC 1MCBA 2YRLA 1ZGLP 1JMXA 5C0FA 2XWTA 4HUVB 4RNRB 1ZLUH 5FYKU 4LCWA 2OXGA 4U1KB 5CMAB 1LK3H 3PWJA 4JRXB 1JF1B 1G7MB 1YN7B 4PRPE 4Y16C 2WIIB 4I3SH 2GJ6E 5DUBB 3L5WA 3AB0C 1VERA 1Q9WB 4NFDA 3JUZA 2A9NH 4HIIB 1K5NA 3P4LA 5D6CA 5IMOA 3TIDA 1N5YL 3DROB 1D9KA 3BKMH 3I85A 2Y36H 1IKNC 4KI5F 3ELAT 3MNVB 3LVEA 3T0EE 4YIQB 1LO3H 2V7HB 4PJEE 4WW1B 2P45B 1H0DA 3MRGA 2VC2H 1GZQA 1CDGA 3QWRD 5KSBB 3UTZB 1SYSA 5KSVA 3UCRA 35C8L 4P59L 1T2QL 1FE8L 1XGQB 1U92B 4TNWF 1J7VR 5A3ID 3RI5F 4EI6A 1EEYA 4MVBD 2F19H 3TBSB 4NZUL 5CLWA 3O3DB 5E6YA 1H5BB 1V3JA 3FQRA 4OD2B 1UKQA 1VEOA 4QHLA 4FTVE 4MJIE 4F3FA 5DXWA 3SDDA 4S11A 1T5XB 5DVOA 2NY2C 3FT2B 1XR8A 4J1UA 1NCUA 4IRSB 4KJWC 1XF1A 2DMBA 2EDRA 1G9NH 5CP7A 1E6OH 5FHAH 1K9TA 5IVOA 5CZKA 3W5MA 5DK2B 3UDWC 4BH7B 1U8IB 2UZIH 3H0TB 3U7YL 5A16A 5I8EA 3P9LB 2AXFA 4D9RD 4R4FL 3S35X 1KJ2L 5GGRY 1WEJL 2OTWB 4LSUL 3GI8L 4JO4H 4O58H 4MJ6B 1GGYA 1RK1B 4U1HA 3H8NA 4JFFE 3FQTB 1DQJA 2VLJE 5B3JE 4X7SH 1ZA6A 1QFUL 2GKIA 2VITB 5HVGB 1OAYL 1PY4A 3N1MC 4NN6B 5IFHL 6FABL 4ZTPL 1EGJL 3GRWL 4G7YH 3VFMB 1TXKA 5D71H 2R8SL 1C12A 4LGRB 4JN1L 1WBXA 3LEYL 4FABL 1J86A 4L9LB 2OP4L 3AFLA 2P8PB 3NH7L 4KGLA 2AQ1A 1EMTL 1KNOB 3MRBB 5TQ2H 4HXBH 3BQUB 3OKEA 2BOBA 3I50H 4ZO8A 3FB7B 2YKLL 3G6JE 3TCLA 1F3DH 5F7UA 4YBHA 4LCIH 1RI8A 3GK8H 4UV7H 4PLJC 1PG7H 3H9YA 3MJ6A 4G8IB 4PRAA 3UBXG 1NC2A 1LK2A 2ZJSH 4NGHH 3QAZC 2AJXL 1T2XA 3S4SG 1MIMH 4LLAA 3FO0H 5FECA 3WJJA 5M7QA 1IMHC 3RPIB 2CUMA 5E6IA 4HUMB 3GMLB 4P2QB 3L3OA 1MHCB 2X41A 5C0CA 4F2MA 2ICCA 3QEQB 4E41B 5FUOL 3BGFC 5EBLB 3KLHC 3QIUA 2W60A 1GGTA 5GISL 4D0BA 1S7XA 3D39B 2XOTA 3LQAH 4OBSA 1J8KA 5F93C 1HN1A 4FTVA 3QXTA 5IM7B 1JHKH 4ZPVB 3MGOA 4HK3N 3HB3D 4YAQA 4QHUA 1RULL 1A6AA 4CMMA 2R15A 1BD2B 2P43B 4MAYB 3SOBL 4M3JA 1EZVY 2X89A 3B2VH 5F3BB 1R3JA 4LAQL 1NKOA 5ACMA 1BM3H 1JRHI 2VL4A 1CDUA 1BQHB 1XR9B 4P5TD 3IVKA 1IGCL 2LU4A 3BXNB 5CLTA 4Q6YA 4RGND 1XF2A 5JNYB 5MENB 4QTIL 4X98A 4RGOL 3VFVB 3GKZA 2R56H 4GMSL 1OTUD 3RTQA 2ZPKL 1CGVA 1KBGH 3RWFB 5HI5D 3GMRA 3B4NA 4OF6A 5F1IB 4OFDA 4RA0C 5I16B 2UWEF 1KUMA 3RBSA 2NY5L 2HTKC 1KCVL 2EYSA 1KXQE 4LSVH 1RJLB 1DN0B 3O3BA 5MI0B 3O45B 4TPRL 3VRLF 1R0AH 4WY7L 5IGXH 4NYLA 5E8PB 1A02N 5E1AB 5EC2B 1VKXA 1QVOB 4IDLA 2B4CH 5EPMA 4MQ7B 3OL2A 1IL1A 1IZKA 1D9KD 4RFOL 3L1OL 5CGTA 2E7CA 1RFDL 3TJHC 5D7LA 1OARH 4FP8H 1U8LA 5FGBC 5ACZA 2VL5A 3REWA 3ES6A 5IB3A 4J3TA 3ZMRA 4YWGH 1PAMA 5DHYB 2E8YA 3GUTB 4AJ0A 2IMNA 1NBZA 2DD8H 4Y4HB 2FLRT 3O4LB 5D5ME 1Z9OA 4QRRB 3MUGB 4XX1G 3UYRH 5KS9B 1CFVL 4NQVA 1TJHH 1VEMA 3SDDD 3P77A 3QHZL 1FL3B 3MLYH 3D0VB 2IAMA 3SDXF 4WCYH 4FXKA 3M1BA 1FIGH 4EBQH 4JCLA 1JGUL 1AGCA 1XF5B 3QCVL 1P4BL 5FA4A 5B8CC 1I9JL 1BAFH 3KPSB 4RQQB 3TH2T 3WV0A 1DVFA 1U8QB 1S7RA 3OKNB 1PQZA 4TUJB 5D6DA 3SDCA 5KTEH 5FB8A 4PRIE 4ZFGH 5L9DH 1LO5B 1T6VN 3OXRB 4HAFA 3ZSTA 2HT3C 5D2NE 3RX8A 1VPOL 3UJIL 1BVZA 3LV3A 5L2JA 1BPVA 2Z9TA 2DI9A 1K2DA 4ZG1A 1FSKC 2FEEL 1TTUA 2DN7A 2HT4D 3H3KA 3FZUD 4M8QB 3OZ9H 4F7TB 3MV8B 1CXHA 3CFJA 5E2TL 2COQA 3QRFM 1IT9H 2AJUL 3CAFA 4G8EA 2CR3A 5CZXD 2GI7A 4OIBA 4BFBD 4C55A 4KMTH 3VFTB 3U36A 4WUKL 3UJJL 4AIXA 4X5WB 1F2XK 5LAXB 3QHFL 3DX6B 4YH6A 3ARBC 4WWID 5E8EB 2MOVA 1C5DA 4Z78A 1R3KB 1QSZA 1KPVB 5I18L 1X5FA 2B7DT 5TE7L 5IW6A 2X1QA 1NC2D 4RRPG 1CLOH 2HKFH 2Z35A 2D03L 5DJYB 5HYJE 3FN0H 1C08B 5D7JA 1SBSL 2P48B 3FO1B 2W0FA 2EXYC 4KTYA 4OI8A 3RUGF 2GK2A 3HRPA 2IPKA 3WIIH 3OPZH 1NFDF 4MMZC 1JL8A 1QD0A 1QFWI 4P2OB 2BNRB 4M03A 2X9XA 1FAKT 3QIUD 1HQ4A 2VXTH 4W4OC 4JY6A 4Y16A 1EO5A 4RZCB 3S35L 2KDGA 4FTVD 4XCFL 2DQFA 3KR3L 3QFDB 3ULVH 4IRZH 3H9ZA 1AGBA 2IBZY 1JHLL 3TO2A 1LEIB 1AKJB 1H3GA 3NIFE 4H8WC 5IMLB 3UO1L 3ALPA 1WFUA 2CGRL 1LO0L 2B1AH 1JGVL 4K7PY 3QRGH 1M7DB 5HHVH 5SWZB 3MRDA 3MOAL 4XNMB 1IKNA 1DE4B 1WWCA 2FWOA 4MWFA 2BZDA 3Q1SH 2HJLB 5ISZB 2C3VA 5ICYB 2ICES 2R9HC 1J1OH 1DP0A 1NSNL 3VXPA 4U1GB 4WDIB 3RTQD 4N5UA 3MRFB 4H1LA 1L0QA 4F9LC 4M00A 4WGVB 5HJ3B 3ZDYE 4N90E 1AJ7L 12E8L 1UJ3B 1YY8B 4P99A 4I2XA 4U7MA 3B2UD 1KB5B 4PP1D 5KZCD 3F7VB 1HYSC 2VUOA 3I3EA 5BJTB 3CDFA 5C0IB 1L0YA 1N2RB 4YHZH 3T0XA 5IEHB 3F8UB 1RU9L 5GGVL 2R0ZH 4Z8FH 4BSVB 1U93A 5DD3L 2HTLC 3M07A 1QSFB 4L5FH 5I1AB 1ZLSL 5L8KB 3O8XC 3U4AA 4F7CA 4MDIB 3RNQA 1XCTA 3TBVB 4AT6B 2NNAA 2YD3A 3UDWA 2L4OA 2D7TL 3PNWB 2Q7YB 2OX5A 4CMHB 1NL0L 1NCBL 4GJTB 4N8VA 3WUZA 2NW2B 4PB0H 4OV6F 3SE8H 3AROA 3LD8C 1INDL 1BFTA 1MRCL 2HG5A 2EEDA 1MFAL 2CDFA 2DQDH 5GS0D 4OLVL 3V6ZA 5GJTH 4NRYB 4PBVC 4X7TB 3SGDH 3CFKB 4KQ3H 4NP4H 1N4XH 5DFWH 3SDXB 2ITDB 4OCMC 3W39A 5LCVH 4S1RL 1P7KB 4OCSL 4CAGA 1NEZA 4XXDB 4M7JL 1GHFH 4WW2F 3W0WB 3HUJB 3GJFB 2NXZD 2X4SB 2NZIA 3QQ3B 3VGHA 3TGXA 3QUKB 1KXVC 1FRGL 2IAMD 3V4VL 4WIQA 3O2VL 3VXTB 4X6EB 3R06A 3BZEA 4YGVB 1QLFB 5D72L 4DCQA 1FYTB 1HSBA 4QY8A 5LGHL 1DVFD 3VI4E 3NVQA 4ODTL 4L1HA 3SDCD 5MERB 1ZWIA 3B6SA 3S5LG 2YPVL 3L3HA 3LZFL 4NQTA 4R7DA 2JJSC 3DGCR 1OB1A 4PLOB 4PJFE 1TVBA 2E9JA 1OTSD 4PB9L 5KG9B 4OZFA 1ZS8A 1FVCA 3BFOA 4NNPL 3P9MA 3EJYD 4PS4L 3U82B 5EU3B 1H15A 3SO5A 1INEL 4PYGA 1DQDH 1OL0A 2QQKH 5I1KL 2W07A 3H7LA 4LIQE 3H7BB 5IUSA 3QXAB 2VDML 1GGBH 2EC8A 2W91A 4ONHA 1IQWL 2I24N 1NAMB 4M1CD 4PJXF 2FH6A 1A3RH 1IEAB 3KG5A 4HWBL 5CBAA 1OSZB 3P0YH 2F8XC 2C7UA 1OD7A 5GGSY 3QI9C 4F8QA 4U0RC 1E4WL 5DJXA 4GKSB 2C1PA 4G6ML 3RUGB 4WO4B 5E5MA 2A77H 3VDCA 1TETH 4G6AD 4KJQD 5HI3D 1J0YA 1JJUA 3CU7A 3DXAE 3OSKA 4UBDC 4ZNCD 2C3XA 2FR4B 3QH3B 5FXCH 1EZVX 3WFCL 3OAYH 5GSRB 1MWAH 1N3NA 1WVZA 1PY9A 5FKAB 2HH0L 3OKLA 4YR6A 1NCWL 4Y16D 5IKCB 1VADB 1VGEL 1H9VA 4Q74A 3E8UL 3DUHA 1FNAA 1CD9B 4ZDHA 3QJFA 1YN6B 2AK4B 3UBXB 1IKFH 1ORSA 2R4SL 1ITCA 5SX4H 1EVUA 2MMXA 3S4SB 5EUOE 1KCLA 2CIKB 1H3XA 3BP5A 3ME0A 5CEZH 4MD4A 2H2SC 5GGQL 4NM4L 2G75A 1WZLA 15C8H 3WUWG 1A6WL 1T1WB 5FGBA 5I1IH 5KVMC 2FGWL 3PQYE 3TN0C 4Z7UA 1KF9B 3FMGL 1FFOA 4D94A 3VD5A 1PX4A 1T7ZA 3GNMH 3K4AA 3KYNA 2V2XB 1URLA 3IJYA 4X9IA 3U7WH 5GGSB 2X40A 5EULV 4R2GC 3RU8H 1R5WA 3MRQA 1FZKA 4M93B 5KAQG 1KIQB 1OQXA 4OZIB 3PP4H 3VGGA 3NGBC 1HXYA 4L8CA 1RZKC 4LLYA 2OCFD 2B20A 5AD0B 3GDBA 3VXMA 3GBNL 4Q6IB 4NC0B 2ED7A 1U8PB 3JWDC 4R7NA 5B8CA 1R3LB 4ZUUB 3E6FA 2JB5L 4XXCC 2V6HA 1HHHA 4NSKB 2AV1B 5CEXA 5HDBE 1KJMA 5E0QA 5AYUH 3TESA 3BN3B 1ES0B 2CK0L 4LLVB 5I66B 1IC5L 2KZ1B 1ZGLB 2X1OA 4PBWD 4YBLC 4IS6A 2ICWB 4LQFL 4ZD3L 4S1SH 4WW2B 1VFOA 3M8OH 4PREB 3QCUH 4FA8A 1KB9J 4KU1A 4L8BA 5HYQB 1AXSB 5FO8B 2P42B 3FKUS 2O26U 4KDWA 4CNIA 3OGOE 1H3VA 2CUHA 2RQ8A 2A1WH 1FORH 3EO9H 1X5JA 4Y5VB 3T4AA 1VGKB 1D5ZA 2VE6A 4JRYB 1CFNB 4PJDF 2OR9L 4WHYH 4YHPA 2AV7A 1N6VA 1FL6B 3TZVB 5IB2A 1UYWH 3VW3H 1LP9F 2O5YL 1FZOA 5JHDA 3EO0B 1IBGH 1G7LB 3CZFA 3W9DB 1M6OA 3HI1A 4OF3A 3ARBA 3LKQB 3PXHA 1AXTL 5D70L 3G08A 2Z4QB 4ZSOE 3NN8A 4Z0BH 5FGCB 3EYVB 3B9KC 2IH3B 3ULVF 2GSGB 4PLJD 4YPGB 5D1XB 3ZE1F 3WN5A 3HNSL 4AG4L 4AL8L 2BNQE 2NY7L 4ODVH 3LN4A 1HE7A 4YZFE 5I76B 2VXVL 4X6DA 4XP6H 3ROOA 5LGJA 5CIPH 1JF5A 2VUYA 5E8DH 3S96B 5ADOH 1EO7A 3KLHD 1S9YB 4OFYA 1A7NH 1V7NH 3D3VB 2XXMB 4YXLH 5J6HB 4XBEL 4Q9CA 1U95A 4K94C 3VFOA 1QFWM 1B0GA 1ZT1A 4JQVA 3STZA 1BVKA 4I3RL 2OJZH 4NUGL 4J3OC 1XGUA 1UA6H 4JM4H 1W72A 4HWEH 2NY1D 3GSNA 3F6IA 3MLRH 2YN5A 1ZT4A 3WL9B 2JB6A 4HDIA 4OLWL 1U91B 1Q94B 3FB8B 5GS3A 2CKBA 1T4KA 1NBVL 5IK3A 2BY3A 1MCPL 4DGYH 4EN3B 5EO1B 2IBZX 2VKXA 5SWQB 3D9AH 1K4DB 4GOSA 4UZGA 3X17A 3KYKH 2ZZUT 3DGGB 3LCYA 4ZXBB 2BVUA 4I77H 4POUB 1Z5LA 3UTTA 5B38A 5KN5B 3CMOH 4F9LA 4JFOB 4K7PX 2YS4A 3NA9L 2FZ3A 4R97B 4NQCA 1G84A 3BGAA 1T04B 5EIIA 2CXGA 3QB7C 4Q2ZA 2APXA 3C09B 4IOIB 2HTKD 1FVEB 4XP9L 3IJSA 3V6FB 2A74B 4JN2B 4U3XA 2DM2A 4LRNH 3ZYJA 3NFNB 2JJUA 5DJCB 4N0FB 4WGWB 5F6IC 2SEBB 4LARH 1UEYA 3I84A 2Q7NA 4GMTH 4EJ1C 5GGUA 4GXUM 4X6BB 5F9WC 4MA8H 5DMGC 5BCAA 4I1NB 1QQDA 1EXUA 5K9KB 1FPTL 2KL6A 4WJ5B 2DQJL 3IDMA 3RWGA 2WWKT 4MCYA 2QJDA 3L3DB 1N64H 2NZ9C 1V7ML 3FT4B 3O6ML 1MLCA 1T1YB 5IEKA 1QO3B 4C59B 1DR9A 1KELH 3C60B 1AGEB 2X9YA 4MX7B 2MHAB 1DQLL 4BZ1L 2G9HA 4NO2A 3X11B 5EBWB 4UQ3A 3BZFA 2D7PA 3NZHH 1ZHBB 1NC4A 5DQ9A 1BLNA 5LXGH 4M5YH 2CMRL 4I0CC 5C0AA 4CN4A 1II4E 3EZJB 2G60L 4X4XB 1ZHNA 1C5BH 2AXJA 3P0VL 3VXMD 4D0CB 3BRDA 1GOFA 1P1ZA 3QFJE 5DMIH 4RGMC 3JZ7A 1OP5H 5EU7C 2EDFA 3GMNB 1LE5B 5FYKE 4GSDH 4R4NC 1M05B 3LHPH 5FKPB 4HZAA 3KPLB 3AXLA 3UJTL 2JJSA 4DK3A 4OZGE 2Z31C 2FYYB 2VDQH 5C08B 1D5MB 1KC5L 1CGYA 1WLHA 3GHEH 1ZANL 2QTEA 4GLRH 1U58A 2VZOA 1E27A 2VLRE 4RAUB 2IJ0C 2YD1A 3B3IB 4POZC 5C8JB 5E8OA 4TSBL 3UTQB 4NT6B 1QFHA 4OIAA 5KAQF 1W8NA 4NQDE 3WIHL 5HGHA 4JFEB 2VZVA 3CFDA 5E4EC 5GIRB 1LP9B 4FFYL 1B9ZA 3IXAA 5DR5H 4D9LH 3HMXH 4L3EB 2VZ1A 3AUVA 1MFNA 1A6TA 3ARFB 4WU5B 5D7SL 1DLFH 3JWDH 4Z77A 2I26N 3OAZH 4N5EC 3O6LL 4ENEC 3L5HA 4V1DA 1LEKA 5H8DA 4LEOB 3UXFA 4PJIE 2YPKA 2XQYG 3QI9A 5JHDD 3C5ZB 2EDEA 3HCVA 1DANT 1XAUA 1FDLH 4NBXB 4DEPC 5CBEB 5EWIH 4PJ7F 5KSAC 2ZUTA 5J1TC 1K4CA 4H25A 5CUSL 3ZYZA 1GH7A 1TTGA 4YNYA 5K9OB 5E00A 2WP3T 4JKKA 4OKVB 4PGEA 5CEYA 2YMXL 2EXYD 3F12B 3DNKA 3IDIA 2JIXB 4JM2F 5CWSA 2Q8AL 4QXTA 1KG0B 4HWZA 4JQXC 4PP2B 3WNNA 1KN2L 1UCTA 4YHOL 3T1FA 4S1QH 1TQCB 3V79C 4OFYD 4Q9BA 2R23A 2E6QA 2EECA 1KPRA 4JPVH 3DX8A 5BV7B 4JE4B 3U2SA 2HFGL 2HT2C 2XTJB 3MUZ1 3MLTA 2PW1A 3S5LB 3O4OB 1D6VH 4DJMA 2ICWI 1CXLA 5ESQA 4LLDB 2B1HL 2YZ8A 4GG8B 3TH4T 1SM3L 3OKKB 2V17H 4PV8A 4YK4C 4XP5L 3D6GA 3BKJL 5ETUB 1CE1L 3QEHB 5BRZE 3L95B 1FNSH 3QDMB 1YC7A 5CJOL 3Q5OA 1NLBH 4O51A 3D18B 5CCKL 1KCUH 5H35B 1ZHLB 2BHZA 3UC0H 2O93L 1KT2B 3LKRB 2VDPL 3CFCH 4HJJL 1OP5K 1B2WH 3UTTD 4RFNC 5F88B 3VXUB 4OZHE 5I15L 2CD0A 5FO7A 5LWYH 2OM5A 1OCWL 4WEUD 3KWWB 4NQCD 4WUUA 5FOJA 3BDXA 3BPLC 4NQDA 1JFQL 4XPAL 4ZOAA 5F1NA 5T3ZD 3GZKA 3IFPB 4GRMA 4YQXH 4M43L 4GBXC 4UT9L 4HFUL 1EDQA 4ZOBA 2APTA 2VZUA 3F7QA 2HTLD 1J0HA 1UZ6F 4HKZB 4KK8C 2WW8A 5C09B 3F7YA 1YYLL 4G5ZH 2VXUL 4NUJA 3U0WH 1WK0A 5IR1B 4XVUD 3G6AA 5DJ8A 5C07B 3WHE0 5B39G 1LQSR 2WBJC 1WSST 4PJCF 4BM7A 4AYFA 3MV9A 1NGYB 3OAZK 1MJJB 5SWSE 1FBIH 5HXMA 4HCRL 3SKMB 3NIGF 1EFQA 1G6VK 5GS2H 4ODSH 5SX5H 1A22B 4OCXL 2BC4A 1IM3A 3VWJC 1I9IL 1LD9B 5TE4L 1BX2A 2CRZA 2ESVE 4LKXB 3RZCA 4LCCC 4KHXH 2BSRB 4PJ9C 5IMMA 1GC1C 4NQSB 4S2SA 1H8OA 1UXWA 5C0AD 2BFVL 3D0LB 3O6KH 4OJFL 5C0RL 1DZBA 4MD0B 1VSCA 3MODH 3WUWB 5F7KC 4F37K 4AH2B 2L7UA 4XNYH 4D8PB 2VR4A 5FDWB 4X0KA 3SDYL 3QQ9C 4ONFH 3UTOA 5IVXA 1CVSC 3CPLB 4UUJB 4HUUA 4L8SA 1C16A 3B9KA 2YD8A 1K8DB 1OM3L 1DBJH 4U6HA 2FEEI 2RJMA 1DLHA 2VLKB 4Z9KB 1A1OA 2AKRB 1A3QA 2W9DH 3GGWB 1A6UL 1IAOB 3HC4L 3IF1A 3BHBB 3LS4H 3BDYH 5HDQH 4IDJL 4NOFA 1UB6A 1OWWA 4ZUWB 4LASL 3OR6A 1NLDL 4P3WA 1YQVH 3HPLB 4IMLA 3MREA 1CZ8H 2A6IB 2ATKB 1IC4H 2YC1B 3BSZH 1OGTB 1EEZB 3GSQB 4V1DD 3VDBA 4RBPH 2VISB 3OV6A 4FQQA 3UPCA 2O5XH 3QI9D 5IHLB 1N0LA 1KEGH 5DJDA 1V5JA 1LK3L 3ZKMC 4TSCH 4J6RL 2W0LA 5CP3A 4JM2B 3KYMA 1LO4L 2H26B 5FGRA 1Q9LA 3L3IA 3AU1A 5EFIB 1FNGB 4KZEH 2DLEA 4UBDD 2VR5A 5C0NC 1NAKH 3ARDA 2QSTA 5TJWK 1JZ7A 4PIRF 2A9NL 2M1KA 4LNVA 4BUHA 4Y5XC 1JZ6A 3MV7B 5AZEL 2VIRB 5KSUA 3NCCB 3LKSA 1UFUA 3I2CL 3LRHA 2J4WL 1IGJA 3BKML 2Y36L 1B0WA 4HV8B 1N0XL 2OQJB 1RV6X 4GG6A 3SKJH 4NZJA 4GAYB 5SX5K 3VFWB 4PRHB 2VC2L 2ADJB 3TIEB 2A9MH 5IB4B 3WS3B 3CGTA 5TDPB 4NNXA 4OD1H 3D25A 4MXVE 1HXMB 3WJLC 2D7MA 2F19L 1PYWA 3MNWA 3V5HB 3HZKA 5INCA 5I71C 4ZFOB 4NQXB 2PW2A 3CSGA 5J57B 4FXGA 4F7MA 4H5SB 5JUEH 4JFHE 4KQ4L 3VCLB 1Q9OA 3BMWA 4TTDC 3HRZA 2AEQH 3Q6FB 5E24E 1JPGA 5BO1H 1T0NA 1X4XA 4ORZC 1JYNA 3QDJB 3QPXL 1VFBA 1B0RB 1E6OL 4KJYB 4XVTH 4JLRA 5FHAL 1YZZA 4R2GD 3VXOA 1HK6A 1CG9A 4M61A 1UACH 4GRLC 4WUUD 3ZKQD 2MFNA 4NQDD 1I7ZA 2UZIL 4K8RC 4PLKD 2Z0BA 3RVTC 3BVNB 5I30H 1BVLA 2IPTH 1H3WM 4GKNA 3BESR 3RNKB 4P9ML 3BPOB 3WNPA 1NCDL 5DT1H 5C0DA 3ARVA 1T5WA 1FO0A 1AH1A 3INUH 4PJCB 3VMNA 2OMBA 1CXEA 1EAPB 1SJXA 3KXFB 1UB5B 5F96L 1Q8MA 4ZNEE 1FIEA 2CLRB 1KB9K 4X7SL 5E5UB 3TFKC 4XH2B 1DBAH 2VSDA 5KVEL 2XWJB 1MCSA 2DTSA 2YUXA 4HEPG 1YEKL 1A64A 1KN4H 5J12C 1BZ7B 1T20A 3MV9D 5J7CC 1JYWA 3OTTA 4I13B 4QOKB 4RBPK 4WFFE 5A2JH 1X6LA 2Q86B 2DWEB 2B39A 4XCCH 3U0PB 3IDGA 4NPYB 1QSEB 2WQRA 2BNUB 4U1NB 4K23H 3C8KB 1DUZB 5JW3H 4BH8B 3U30C 4U6YA 1MREH 4IIQB 4HXBL 4N0UB 3LB6C 2MCG1 5D2LE 4XWOC 1J0IA 5HGAA 5CIPB 3RZCD 3MJ7A 4LCIL 5EN2A 3GK8L 4UV7L 4AEHH 4MQSB 1SEBA 4L4TB 4NGHL 4XMLH 1A47A 5EORL 3V2AR 1MIML 2HN7A 3FOMA 3V4UH 5F3HB 3FO0L 1NANI 5H37H 1WBZB 1HIML 1UH2A 1D5IL 2APFA 3IJHA 1AGFA 1I4FA 4JHAH 1RUAH 1AP2B 4HGWA 5CHNB 3OKMA 4ZTOH 4G42B 2ICEA 3ZL4H 4ELMF 2J8UE 3B9KD 3LQAL 2DQEH 4FG6C 5KSAA 2YOCA 5IFAH 3X14A 4YFLI 1JHKL 1OAQH 4XC1H 4S1DC 1SVZA 4LKCA 1DQMH 2VABA 5CD5C 4OCYH 1EAJA 4Z7NE 4G9FE 4L4VA 3K80A 2W65A 3X3GH 1EV2E 4JQXA 1TZIB 4ORGB 4QRPB 2G5BA 3B2VL 2F5AH 4Z7WE 1YPZB 5GRJL 1DJSA 5J56B 1BM3L 1HI6A 4NHUB 3MBXH 2HYMA 1WZ1L 3IT8D 3PWNA 1X6NA 3IS0X 1KJ3L 3T4YB 1JPST 2EE2A 1HCVA 2V2WA 1CR9H 3WFBL 3MX0A 1ZGLM 2X4OA 4NQUA 3HNTH 5C2BL 2A6DB 1MCHA 3WXVH 2WUBH 2QADC 2QBWA 3DOSA 4PJBB 2P7TB 3T3PE 3WFHB 4I4WB 3CSYB 4KROC 3RL2A 1HH9A 2H1PH 32C2A 3Q3GA 1RZ8B 2Q6WB 1CFQB 2H8PA 4XHJC 4HFWB 4XC3H 5H37G 3EOBB 3ARDD 5IGXL 5T1LA 1J05A 2EE6A 4ALAH 3N1GC 4M6OH 1G7JB 4XCNB 1G6RH 1E4KC 4YDJA 3PWVB 2J5LB 3P4MB 1A9EB 3RVUC 5DZLA 1GRWA 2X4TB 4GBXA 1BZ9A 5ADPH 1X5YA 3L3KB 1TLKA 4HJGA 3SO3C 3RWCA 3MUHL 4YWGL 1FG2A 4V2CB 3OJVC 3KJ4C 2DD8L 5DMGD 4FQHB 2CLZA 4KTDH 4AIZB 2HVKB 1NDMA 4N8CH 3VE0B 1QP1A 2WBJA 3ARGC 1IRAY 1TJHL 5F6HI 4E0RA 3IB4A 5DMYA 3W81A 2C3HA 4WCYL 5IQ7H 3MQIA 2NZ9D 3AM8C 4HPYH 1FIGL 2BERA 3KPMB 3TWCH 3VGDA 1Z0NA 4YFEA 1BAFL 1NBYA 1M1SA 3EO1B 5DJAB 5FM5M 3P4OA 4G9FA 3O2DA 4OFVA 1NGXB 5DYOA 1KV3A 4N9GA 4QNPE 1BMGA 1WFNA 2VLLB 4PJ9A 1UH4A 1JN6B 4U1SB 1IM9A 1NMCC 3IYLW 2QSCH 1A4KA 4OT1L 3NFSL 1IGFH 1TCMA 2NY4B 4FQPA 3MBEB 3AS0A 3N85L 2NXYC 4KTEL 4C56B 3TP4A 1UM5H 2EIBA 1A1NB 4Z7VB 3FONB 4MB5A 3FFDA 4ONGL 3EGSA 1D5BA 3CFBB 3OZ9L 4LVOC 2BJMH 2DQCH 4UINH 1CYGA 1IT9L 2PXYB 3GMMB 3HR5B 4PJEF 4PY7A 2XFXA 1CD0A 2AQ2A 1CTNA 2YSSB 5KJRL 1UVQB 5E2VH 2X1XR 4TVPE 4POZD 2R1XA 4PGDB 5BS0E 2H6PA 2WINB 4QRSB 3KGRA 5HHME 1BFVH 4KKNA 3V0VB 3DO7A 2P5EE 3MJ9H 3QUZC 5C0BE 3ZSSA 5D1ZB 2HKFL 3QEUA 1RZGB 3FN0L 3OR7B 4P5TB 5B39B 5TDOA 4J12A 2J88H 3G5YB 1HHJA 3QNXA 4OIIH 4RGNB 5F9OL 3MACH 3THML 4DOHE 4FZ8L 4Q9RH 2R4RH 5GSVB 5I2IB 3BW9A 3OPZL 2QHLA 1VFUA 5I75C 4YHKH 5FA3B 3HA0A 2E3VA 4LSRH 4A6YA 1FV1B 1WWAX 5D7IA 4LSTH 2VXTL 2XWTB 5C3TA 2HKHH 5KSAD 1P2CA 3H2WA 2P5WE 4Z7QE 5L0QC 1FCGA 3GIZL 2VRAA 3BIAX 4IRZL 5AG8A 2UYLA 1CICB 2HRPL 4G6JL 5HGGS 1RHFA 1HNGA 4HKJB 4W6XB 4XNUH 1ZTXL 4L4VD 3GMOA 3OJMB 3QRGL 2EC9U 5HHVL 3BIBX 4H88L 2HJFA 5DURD 1K5NB 1NEZG 3D2UB 5IMOB 4ZAKC 1LMKA 1Q0YH 4GFTB 4XNQB 2Y5EA 3GO1L 3T08A 4XTRD 1N7MH 5F7DB 4HIHB 5K59E 4KK9C 1RUQH 1EX0A 3MRGB 1GZQB 1T2JA 1F90L 3C2AL 3WJLA 4XNZC 5KSVB 4PV9B 4PJHE 2IQAA 4ZUTB 2GSIB 4JPWH 3BYTA 2ARJA 5AEAA 1HYRC 1EEYB 2NY3C 1NDGA 4YC2B 4G43B 5T3XE 3FQRB 1D3CA 3VA2C 4QHLB 3QO0A 5J0BA 2VAAB 5K9QG 4Z8FL 1Q38A 3C6LC 5MP6L 4F3FB 3G9AB 5T1LD 1BQSA 4CJ1A 2Y5TB 2NPLX 3BH9B 3R4DA 4UV4H 2BSTA 5DJ2A 3DX7A 4EOWH 4J1UB 4P5KA 1CFTB 4P4RA 2IFFH 2BMKA 2VAJA 3OAUH 4N9OB 3CSPA 5FUCC 5CP7B 3IU4H 4I8DA 2P5EA 2K7PA 5HHOB 4ERSH 2W92A 1U3HB 4KKCD 1U8HB 3EFDL 4K07A 3T77A 4GBXD 2AXGA 4JJ5B 4QXWA 5A16B 5BVPH 5IWLC 5I8EB 3E0GA 4KZDH 3V8OA 4FQXA 2D4FA 3EOAB 5GJTL 5L2KE 2EYRA 5ANMA 1T03H 3MCLH 4KK8D 3REVB 3MLVH 4EUPH 3F7PC 1I3GH 1OVZA 4NP4L 3GKWL 5FYLD 5ID0A 4HS6A 4U1HB 4K7FA 4Y8DC 3ABZA 3R0NA 4UU9A 1GHFL 1W2KT 1DQJB 2WBJD 5I17A 2ZUSA 4EI5B 2Y72A 3IDNB 4OM1H 4M1GL 4PRPB 5DGQA 3MRNB 4XNXH 4D3CH 3QUXC 2UZXB 2GJ6B 4G9FD 3VGAB 1FL5A 2PETA 1QKZH 1WBXB 3LDBC 4PGZA 4ODXA 1UQSA 4PRBA 5LKNA 3GSXA 1XH3A 4UT6L 2PCPB 2Z93A 4PJ9D 4ODWA 2BOBB 1ETZB 3GSWA 5IJKC 3QIWB 3TCLB 1IM9D 4UB0H 5DD1H 2ERJB 1BREA 5M94B 5L8JB 5A43C 5FCUH 1CVRA 1L0XA 1MJ8H 4PRAB 3T0EB 4DUXA 1LK2B 1M71A 1LILA 2OK0H 5C0GB 2LQRA 2YXFA 3QQ9D 2RCSH 1QRNE 2GUOA 2P24A 2XXCB 2QQKL 3RGVB 4LSQH 5F89B 1VHPA 4L9DA 5B4MC 5BZDB 4QHNA 3ZKXC 4O9HH 3ZE0E 2EIZA 4GRWE 5HPMA 3QIUB 2W60B 3HE6C 4LBEB 4ZUSA 1S7XB 4O2FB 4K55A 2AK1H 4FTVB 1U3JA 4MJIB 3FHAA 1FNEA 2ZWLT 3P0YL 3E6HA 4EUPG 4YAQB 2WBWB 2MCPL 4CN1A 1D5XA 5ILTL 3OGCA 5D5MF 4MNQA 2PO6A 4CMMB 2EKSA 1NEUA 1A7PL 4KUZL 5J6GA 4ODBD 1B4RA 1SY6A 1A1MB 25C8L 4BKLB 1UH3A 3EYUL 5D1QC 1TETL 1S9WB 4X7EC 3K3QA 2GJZA 1BIIB 3DVIA 4Z6AT 4KV5E 1RZFL 2F9BT 3NPSC 1PSKH 1XF2B 4X98B 2CO7B 5KANG 4R8WH 3RTQB 1MWAL 2BVEA 2EDHA 3ZKMD 2X4RA 4DVRH 4JFFB 2VLJB 2KPNA 5IB5A 5KZCB 3Q6GH 4OSUH 4OGAC 1HHGB 1FZJA 2BSSA 1CDBA 5C0ND 4X4MA 4G8GE 1L9MA 2EYSB 1IKFL 4MA1C 3O3BB 3SEPA 4YHLH 4ZPTB 4NFCA 1HOCA 2W0PA 1E4KA 3PABB 5E94B 2R2BA 4UTAH 3QCTL 3SCMC 4ZS7L 3UP1A 3X3FL 2E8ZA 1A7OL 2NY6C 4LCUB 5EPMB 2PYFA 4YDLB 15C8L 1U8MB 2RHEA 3QEGL 3G6JB 2F54A 2IH1A 4HH9A 2CUIA 1XIWC 5EU6A 1U8LB 3GNML 1DQTA 3PGDA 3FT3A 3U4EB 1AO7A 1EHLL 1T6WA 2VL5B 3HR6A 3FQUA 3JTTA 2Z92B 1YNKH 2IANA 2VXQH 3BGMA 1T22A 3ARGA 4DQOL 4W81A 2ZUVA 1D7FA 1XGTB 4G6FD 3FQNA 1G0XA 4TTDD 1W72L 4NQVB 3AM8A 4H8WL 4P57A 3GSNL 3M45A 3MLUL 4AZ8A 3NZ8A 1RK0B 3ARTA 3VFPB 2IAMB 4FXKB 3M1BB 5BS0D 2D9CA 4HKBA 3ZHDA 5C0EB 5FA4B 3GSOA 2X10A 3VXQB 4JG1L 4K8RD 1YEGH 1DVFB 3IFLH 2P5ED 3RVTD 1S7RB 5T5FH 3WKMH 4LDEB 5K9JL 4PLNC 4XAWH 1K6QL 3CUPA 4I5BB 4S1SL 2XG5A 3OKDA 4FQXD 4JQIH 2I9LB 2AI0L 4PJ5E 3LMJH 4K71B 3WCYA 4FQIL 5C0JA 2H3NB 3KPRE 4I18B 4I3GA 3LV3B 5T3ZL 5L2JB 3BISA 3BPCA 2NX5E 1ZT7A 1K2DB 4EQ3A 5BVJA 1I9RH 5DRXB 1P6AB 4F9PA 4ODUA 3GJEB 2GFBB 3CFJB 5FYJU 3TNMA 5EZJA 1OF2A 1UYWL 1YEJH 8CGTA 3ZDYF 3RWJB 3WFDH 3B5HA 3LB6D 1T21A 4XWOD 4XGZA 1DL7L 2ATPB 2M8XA 4DTGH 2XNAA 4Z0BL 2DQGL 2KH2B 2FSEA 2P8MA 1H3TA 5HD8C 5FOBB 3ESVF 4Z78B 1X5XA 4JFDE 1IARB 2Y7QA 1RUKH 4NWTH 4FQJH 4H0GA 3WO3B 2Z35B 3IETA 1CD1A 1J12A 2R1WA 1UM4H 5F7FA 3HS0B 2D7QA 5E8DL 4GW1A 1AGDA 2I07A 3LSOB 4M48H 3RA7L 5LBSH 3DV6A 4G7VH 4YXLL 1N6QL 3IDJB 4XBPB 5D5MB 3MTRA 5EZIH 2VWEE 1WWWX 4P23A 3HPJB 4S1DD 3RDTD 4JM4L 3H9HA 4IRJC 1JK8A 4Y1AA 2WUCH 2BCKA 5IW3A 3MLRL 1ZSDB 4OLXH 2QHRH 3TO2B 5DMKA 2IG2L 3DVNB 4MNQD 1S7QA 1X5GA 2PO6D 3G5ZB 4OUUA 5C71A 5FHBH 1F6FB 1S5HB 4UIKH 5H94A 4ZAKA 1VESA 3V0WH 1ZVYA 2Y6SC 4NCC1 2EZ0D 1QLEH 3MRDB 4UOJA 3D9AL 4PRIB 1NGQL 4YDKH 2FWOB 2B5IC 1YC8A 2C3VB 4KRLB 1ONQA 4YEEA 4DN3H 4PJ5A 4WI4A 5D2NB 1PFCA 3VXPB 3DYOA 4PRNB 2ILLA 5JW4N 3S88H 1BJMA 2ZNXA 4CW1B 3NCEB 3KPRA 5JPNB 3FRUA 4M62L 2PYEA 4KROD 1U8OA 4XPGH 3TBWB 3E3QC 4PJFF 3T2OA 3LH2H 3TA3D 2N1KA 3G5VB 4XHJD 3BP4B 2HLAB 4LARL 3S34L 1IAKA 4U1IA 4IOSD 1QBBA 4HX1B 2Q8BH 1EO8L 1U93B 5CSZB 1SYVA 1UEMA 4PJAE 5KW9L 2GT9B 3D69A 2DQIL 5FYKH 3RVUD 5IHBA 4F7CB 1HZHH 3BZ4B 2NNAB 2XZQL 3LKOA 1ZV5A 2V5TA 1NCCH 1UWXH 4N0YH 3LIZH 1KCSL 3L7EA 1MHHB 5IWLA 3A67H 4S0TD 2F54D 4ZUVA 3VG9B 3K81A 3HC0B 4YUEH 5EU6D 2AJ3B 4NN7B 1AO7D 4PGBB 5DJ6B 5HYJB 5GZOC 2GIYA 4RX4A 4TN9A 2XN9E 5CJXC 3V6ZB 1KCRH 5CS7A 1C7SA 5C9KA 1AQDA 2AABH 2IAND 3WDIA 3MRCA 3ARGD 2VOTA 3NZHL 5CJQH 4OM0L 3W39B 5JZ7C 1G7PB 5LXGL 2E9BA 3FRPA 4R4BA 1NEZB 3LKPB 4UDUB 3TVMC 5IW1A 2QSVA 4PJGE 3IGAB 1ZLVH 3QUXA 1OPGL 2ZKHL 5DMIL 5T1DH 1YMMA 2FECL 4OCNC 3R06B 1CFBA 2VTFA 4DCQB 1HSBB 5JDJA 2FX9L 4MAUH 2OJEB 2V7NB 3MLWH 1AQKH 1CL7L 3HFMH 1BBDL 3I9GH 4ZOEA 5IBUG 5IVZB 1LDPH 4I0KA 5IJKA 1ZWIB 4N8PA 4JDTH 1H5BC 3L5JA 2NXYD 4I9WE 4X4YA 3V6BR 5EUOF 5J9PA 1A8JH 1ZS8B 1E6JL 1FVCB 1BFOA 4IRSC 4KRPB 1AHWB 1G7IB 2GYSA 2HAZA 1YNTA 2R0KH 5DR5L 4D9LL 1DUYB 4K9EC 1RZKL 5DHVH 4AEEA 2VQ1A 2ORBH 5EO9A 3HE6A 5DGRA 1KJVB 1L7IH 3FB6B 4L3EE 1A4JA 4CUCA 3PDGA 3JWDL 3HMWH 4ONHB 1QBLH 4JDZA 3TYGH 4J3UA 5CBAB 2NY1B 4FZEH 1FDLL 2QQNL 1QZ1A 5EWIL 4YDIH 3R0MA 3SJVA 5D1QA 1R24A 1SQ2N 3DURB 1MF2L 4NO0B 5E5MB 1TJGH 1IGYA 2JCCF 4NN6C 5T1KA 4TOYH 1A7RL 4GO6B 3MA9H 1UWGL 1X7QB 3GSRB 2CDEB 4IJ3B 1QA9A 1MCQA 3O41B 1OGAA 1S7VA 3LS5H 3T3MF 3C8HA 5HDBF 4UNTA 3V9FA 2A0LD 1UWXK 2K9UA 1RIHH 4L9LC 4JPVL 4K3GA 3BT2H 4XVJL 4TSAH 2HJKA 4G3YH 1N3NB 3BQUC 2YA2A 4FFZL 4YR6B 4P23D 4OV5B 1F11B 3TCXA 5I8CB 5MEOA 1AFVH 4M1DH 4Y1AD 4ONOA 2GEEA 1B4JL 3MPCA 3PV6B 4ZDHB 1MJUH 4E42A 1ORSB 1AXIB 5DUPH 5IIEA 5JO5A 1QACA 1FNSL 3SCMA 5AG9A 2BDNH 5DJ0A 5TGBB 2F8OA 4ZAKD 5TF1H 1ZLVK 4NNYA 2K7QA 2Z8WC 1JRHH 3DV4A 2ARWA 5GZNC 1Z3GH 3C5SA 1XIWA 3EYQC 4QYOB 2D4DA 5I1EH 1IGML 4HJ0D 4KK9D 1DBKL 2I5YL 3SY0B 4PJFB 2WLZA 3MRJA 3HE7D 1AY1H 4HKXA 4PJ5D 1FFOB 5LWYL 5DTFA 2LABA 1C1EH 4JO3H 2VQUA 4EUPB 3KPRD 3IJYB 4K94L 1UCBL 2YBRA 4M7KL 4HS3B 4MAYC 1VFAA 2BOCA 2NY3D 3F5WA 4DKEL 1I3RA 2ZSVA 4F33B 3T8XA 4Y19E 2V9QA 1A7QH 4YZFF 3DI2B 1NCTA 4L8CB 4AK1A 4IOFC 1YEEH 4JPKL 2EDLA 3PWPA 3NCYS 4G5ZL 3U0WL 1V3MA 3HC3H 3QJHA 4JFPB 3RY5A 3QG7L 2Y06H 1TIUA 3B8YA 3CSBA 5C86A 3E6FB 4GXVH 2WK2A 4NJ9H 5FUZH 4OF8A 3ARQA 3CVHA 5I1HL 5H2BA 3K46A 4KUCF 1KJMB 4W6YB 3J7HA 2AEPH 5DC9B 1G7QA 4LMQI 1EK3A 1F3JA 5MI0C 4IS6B 3DXAB 4RX4D 4MQXD 3FQWA 1AIFA 4KI5C 3L7FB 4RMWA 1FVDA 1MRDL 4GQPH 1HWHB 3P73B 3QUMH 2BVPB 1DQQA 3EYSL 4HQQL 3O6KL 3BUYB 3MODL 4U6VH 5DS8B 2OL3B 3T4AB 3AS1A 3LPWA 3VG0L 2FDBP 3HG1A 4YHPB 4XNYL 2AV7B 2IEPA 3L6FA 4UAOB 4PGJA 4W6WB 1YMMD 3H9SA 1MHEB 5IB2B 2Q87A 4ONFL 2YPLE 1IEBB 3LN5B 3AREB 1A9BA 5EUOB 4OTXH 1Y6MR 1DBJL 1E28A 3CZFB 2Q3AA 4Y4HC 4QF1B 4YDVA 5DQJA 3BD4A 3TT1H 4LGSB 2C3GA 3U46B 2W9DL 1YJDC 1IFHH 1UT9A 3WN5B 2GTZB 3LS4L 4G6KH 1W0YT 3PQYB 4J3XA 3WHXB 2FIRT 2XRAL 4RAVA 3VXRE 1CIDA 2JELL 3MRRA 1YQVL 3WFEH 1OTTC 2X4NA 5ESAB 1YYMH 5I74B 4HUNB 1MQKL 2QL1A 3T0WA 5LQBH 1I9EA 1WGOA 3HE6D 3N06B 5EU4B 3CIQA 3N50A 2EDQA 1MCIA 1IC4L 2AVGA 1F6LL 3EIFA 1U95B 3BSZL 4KKAD 3VFOB 3AAZB 3E1F1 3S3PA 4IRJA 3QQ4A 1G0DA 4CVWA 4ETQA 4QLRA 5E1HB 1PKQE 2DI8A 3N9GH 4NC1E 3IU3B 1WIPA 3ROLA 2IALA 1NJ9B 2DYPB 2DDQH 1KEGL 3ULSB 3BD3A 4P9HC 1VB9A 1INQB 3P30H 4U1LA 1ZT4B 3LPFA 4HDIB 2WSKA 3SJVD 5D1QD 1ERNA 2DICA 2FL5A 4HWBA 1T80A 2CKBB 4ZFZB 1S8DB 1IGTA 3CDGB 2D3VA 1RZ7L 1NAKL 4NJAH 2LAAA 5T1KD 1MSPA 2RFXA 4FXLA 2EDOA 5CD3A 1P5UA 2G2RA 1OGAD 1Z5LB 3DRTA 3QIBB 2QKIA 3LEXB 1WUNT 2FZ3B 4HF5L 4OZGF 4Y4KD 4QRQB 1JPFA 1FHGA 3SKJL 1QFWH 3GHBH 4F58H 4Q2ZB 4OGAD 3B83A 3IKCA 2E6PA 2X7LA 4XBGA 2A9ML 4KVNH 5LJYH 3GM0A 5DK0B 1Q72L 3WDJA 5K9QI 4Q9QH 1I7RB 5GGUB 1LNUB 1T1ZA 5TFSH 3RWDA 4MGXA 3SCMD 3EOTH 5B3NA 2NY6D 3TBTA 4HUVA 4RNRA 4NDMB 3QQNA 4V2BA 4C83B 3JWNC 5JUEL 5ELIA 3HNVH 5BZWA 4JRXA 1EXUB 1BOGA 2O5ZH 1JF1A 1F4YH 4ZSOB 2AEQL 1IQDB 1XIWD 3RWGB 3HLAA 4F7PA 2DBLH 4PJIF 1T7YA 4YXKH 3VD3A 1QFPA 2G5RA 2DL2A 2BNQB 5CJXA 3QDJE 1CN4A 1UACL 4XWGH 3VXRA 1TJIH 3HZMA 3O2WH 3WD5H 3HI5L 4HIIA 4U3CA 3BKYL 4QXUH 4OLEA 4NO2B 5E2WH 3DROA 4UQ3B 5CINH 3TVMA 1W0WA 5DQ9B 1BLNB 1U6AH 4YIQA 5C0AB 4MNHB 1HSAB 3KHOA 3PWPD 1PKQA 1FH5H 3BP7A 5KSBA 3UTZA 3BZDA 1DBAL 5I1GH 1KN4L 1U92A 3EFFB 4QWWC 5I19H 1UJ3C 4XMKH 2R0LL 5HHXL 4MD5B 4XCCL 3JV4A 1P69B 4OD2A 3AXLB 3ULUH 4PYHA 5E7FA 2C4FU 1JNJA 1T5XA 2XZAH 1E27B 3AY4C 3VI3F 4IRSA 4JB9H 3F65A 3BRFA 1AD9B 1YEIL 4AEHL 3I6LE 4IEFB 4M3KB 1S78C 3MXWL 3CFDB 5DK2A 4BH7A 3O3EB 1U8IA 2QEJA 4L4TE 9CGTA 3H0TA 3VH8A 4CMHC 2W9LA 1S9XB 5F7MC 4OZHF 3HG1D 2OTWA 4XVSH 5F7EL 1A21A 1RUAL 4V1DB 1RK1A 4RMRA 2YPKB 4P4KB 4HIEA 5IBTH 5IFAL 4MJ2A 4OLYL 5TDNA 1JGDB 1OAQL 3HCVB 4X6CE 3E2HC 3SQBA 1RZJH 1I7TB 2CSPA 4XRCB 4XC1L 3B9VA 3DRQB 1K4CB 1DQML 3PP3K 2N56A 4KPHH 4OCYL 4B50A 1A7BA 5DD6B 2XIDA 4R0LB 4DGIH 3CH8A 4J4PC 2VLME 5CEYB 2VDRH 1CE6A 4TVSa 4H26A 3RAJL 3UTPE 2AJSH 5E99L 5KANI 4YFDB 5CWSB 4QXTB 1GC1L 2FATH 3ECBB 2ICWJ 3MRBA 3T1FB 3BQUA 3OQ3B 4LVEA 4KXZH 2ADFH 3MOBH 3DX8B 5IBUB 2DQHH 1CR9L 3MLTB 4IRJD 2PW1B 4X80H 1JIBA 3WXVL 5J1AB 5L88H 1JPSH 4PR5B 5DEZA 2ADGB 4M6NL 1QSVA 3QFJB 1Z2KA 2EDJA 2VJXA 3QEQA 1QEWB 2IF7A 1JI2A 2Y6SD 1ZEAH 4K3DH 5CJ5A 4PY8I 3D39A 1O7SA 2DJ4A 4XC3L 5DRWA 5JQ6L 1L7TH 4HWUA 4OZGB 4TQEH 4NKDB 4H20H 5IM7A 1BBJA 4JY5H 2PNDA 3L3GB 3FB5B 3NACH 3SN6N 3OF6A 1G6RL 1KEML 2VLRB 3IKKA 1WITA 1BD2A 1DSFH 3O11B 5FF6B 1QRKA 2F5BH 5FO7B 2DLHA 4R2GB 4MAYA 1XCQA 1HDMA 4WUUB 2WM0A 3KHQA 5F3BA 4NQDB 2AJYH 3NAAH 2BHUA 1BQHA 2Q20A 4FQCH 3J8F7 3NGBB 1RMFH 4WO4C 3BXNA 4OCRH 4D9RE 1UKTA 5JNYA 3MGTB 4A6YL 3WXWH 1NCNA 3VFVA 4KTDL 5K33A 4M8VA 4YJZL 4N8CL 4YXHH 2R29L 4PJIB 2EIDA 2XI9A 1NQBA 3RWFA 4NUJB 3ARRA 2DB8A 5F1IA 1DBBH 4JRXD 5IQ7L 5E5RB 4P0DA 4HPYL 4R90H 1CLCA 3TWCL 1DN0A 2HMIC 3N0PB 3NABL 4YBLB 1MVUA 4NQEE 4TVPH 5GZOD 1PZUB 3V95A 4NN5B 3VXRD 5E8PA 5E1AA 5EC2A 4BQ6A 3KVQA 1IM3B 5GRZA 5JZ7D 4DN4H 2FO1A 4MQ7A 1BWMA 1WT5C 1G9NC 2NLJA 2QSCL 3RZCB 3TLRA 3TVMD 1IGFL 3O6FD 3SQOL 5DHVB 1DFBH 4LVHB 3HAEH 5IMMB 4S2SB 1JUFB 5T33H 3QXDA 4O4YH 2K3TA 5D9SB 1UWEH 5DDHB 1RZIB 3WO4B 2ZG2A 1A5FH 5L8LB 3C9NB 5DHYA 5DVNA 5DO2C 4X0KB 3BPNB 3HN3A 1QYGH 2BJML 3JTSB 4BUGA 3RI5K 2DQCL 4Y4HA 3UMTA 4UINL 3O4LA 4L8SB 1C16B 4LFHG 5BRZB 1UADC 4M93C 5KS9A 3BP6B 5F97E 4XZUB 1MCOL 4UNUA 4U6HB 2LVCA 4HIJB 1FL3A 3GBML 3FL7A 5EOTB 3IF1B 3NCMA 1BFVL 1OY3B 3BD5A 4K8RL 4IRSD 4Q6IC 1F4WH 1XF5A 4N0CC 4OQTA 3KPSA 4RQQA 4BSJA 4AENA 5GGTH 5FK9B 3OKNA 4TUJA 1IE5A 1G9MH 4XMPL 2EE9A 4UNVA 5HSFA 2RAMA 1F4XH 3JWOH 1TQBB 1FLRL 3RWHB 3VWKB 3OXRA 4OIIL 3WIHA 2WV3A 2ZCKH 4Q9RL 1RIUH 2UWEE 4YHKL 3ZHKA 4LSRL 1GAFL 5JDSB 4WW2C 1RURL 1XGRB 3DUSB 5JXAH 4FQQB 1UKSA 4MLIA 5IQ9A 1KB5H 2WWMC 3VRLE 2OR7A 2X4PB 4LCWE 3A6BL 5T3XH 1OAXH 4M8QA 5HHPA 3GSVB 3MV8A 4F7TA 3HAEG 3KYMB 2ID5A 1FJ1A 4Y5VC 1Q9LB 4KDVA 4OB5H 3L3IB 5SWSB 4PBXA 4XP4L 1ADQH 4U1JA 3LQAC 2IGFL 4NQEA 3ARDB 3MA7A 2NY0D 2QQLL 1CU4H 3TZVC 4O02H 1P9MC 4X99A 1H3PH 1X5AA 3MLSH 1QNZH 1NPUA 5LAXA 5KSUB 3LKSB 4BQCA 1EJOH 3MFFB 3BQUD 1Q0YL 5HDOA 5E8EA 5MHSE 1N7ML 1I3UA 1KPVA 5D1XC 5DJYA 5B22A 4OCWH 1C08A 2FD6H 2PTUA 2FNBA 5D2LF 2OZ4H 3ZT7A 4OZ4B 1HQRB 1MEXL 1JNNH 1T0PB 3DBXB 2VNCA 2QR0B 5I0DA 1PYWB 3MNWB 3QEQD 5INCB 4HLZH 2VDKH 4AQOA 4HMCA 3QUYA 2JKXA 4A2LA 5GZND 1EHXA 5JORA 2PW2B 3D39D 1L9NA 3EYQD 4RZCA 4F7MB 3PHQB 4UV4L 1Q9OB 2F15A 3QFDA 4HZLB 1S5IH 3HRZB 4P46A 1MVFA 1JPGB 4MHHG 1T0NB 3OF6D 5GHWL 3S8WA 1LEIA 3OAUL 43C9B 1BD2D 2J8UF 4BA8A 1MCLA 4JLRB 3U9PL 1LE9B 4MAYD 3U6RB 5C70A 2V9RA 3ULUF 4M7ZB 3SPVA 1M7DA 5SWZA 4NM8L 5DA0B 5BVPL 1I75A 3QUMB 2B4CC 2X1WL 1Z9MA 1MFBH 3JV6B 2FX7L 3MRIB 4EN3C 1BVLB 1N5YH 4GKNB 4IOFD 1T03L 2HJLA 2LTQB 4JFYB 5C0DB 5ICYA 1MIEH 1FO0B 2UWEA 4ZXBC 1JYXA 5J3HC 1PKOA 4WDIA 1Q1JL 3TT3L 3QA3A 1L6ZA 3TBYB 4R97C 1UJ3A 1YY8A 3MRMB 1YEHH 1T2QH 1FE8H 5BJTA 5AYQA 5C0IA 4MLSA 1N2RA 4XNXL 4D3CL 1NAMH 3MZTA 5IEHA 4WHCA 3PE9A 3IDGB 4BSVA 1QKZL 1WC7B 4XP1L 2VLMD 4KI5D 2PUQT 4U6YB 1QSFA 5I1AA 2ZUQB 4HCRA 5IESH 3UTPD 4XHQA 4DKFL 4LGPB 2KUTA 1ZVSB 4X8JB 4HLZG 4KFZC 4RMUA 3TBVA 3IDXH 4AT6A 5DD1L 1ULVA 3PNWA 3MJ7B 2Q7YA 4KC3B 5FCUL 1CL7I 2AEWA 1MJ8L 3SE4C 1F00I 1NFDE 3FO9B 1E4XL 2NW2A 1S9VB 2OK0L 4URTB 4NHCH 3U7YH 1U2CA 2H32H 2NW3B 2RCSL 1A0QL 4NRXB 2ZCLH 2BVYA 1KJ2H 1WEJH 4NRYA 4LSQL 3CFKA 4RMVA 3ZTJH 1I4FB 4P2RE 5IHUL 3C60C 3SDXA 4HGWB 2ITDA 4WNQB 4Y4HD 2XPGB 5C0CE 3OKMB 3O4LD 3EDJA 1S7SB 4FFVC 4L29B 2AGJL 4NKIL 4XXDA 5CILL 2AK1L 3S7GA 5KSAB 3X14B 2KKQA 3W0WA 3GJFA 2X4SA 2D31B 2GTWB 3JBG7 1QFUH 3QUKA 1OAYH 2NTFB 4J4PA 2VABB 5JR1L 5TH2A 4X6EA 2GAZB 1EGJH 3GRWH 1OTTD 1FYTA 1MLBA 3GMQB 3KPSD 4BFGA 5KS9F 1JGLL 3GJFK 1MFDL 2R8SH 2G5BB 1BZQK 4JN1H 2EYTB 3LEYH 3ZZ1A 2YZ1A 4J3WA 4P3DA 5MERA 4MDJB 1T66C 3C5JB 4BFIB 5CKAA 3LRSB 3NH7H 1SEQL 4Q58C 4JKWA 2Z91B 4LLMA 5CJ8A 1I8MB 2YKLH 2CIIA 3VXSA 4OD3H 2CLVB 4JO2H 2D7OA 5KG9A 2V2WB 4WFED 3TPUA 2X4OB 4F8TA 5JA9A 2RIKA 4QNPF 3QNYB 2DQUL 1CDJA 1PZ5A 2WQ8A 3V4PH 4DVRL 5EU3A 2XWBB 3Q6GL 3W82A 1U3YA 4PD4K 5EZLB 1DN2A 4F15B 3H7BA 3MV8D 5J13B 32C2B 5KBNC 3T04D 5FUOH 4YHLL 2HVJA 5I1JL 4UIMB 5F7WC 3ARFC 4NQED 3SE3C 5T1LB 1IEAA 4RFNB 1ORQB 4UTAL 1ZLUK 3ULVC 3KNBB 4FQLL 5HI4D 1KPUA 3ZTJG 3FQXB 5EU5A 1BFSA 2E5EA 2VN4A 1CLZH 3I6GB 1RULH 4ZO9A 4BSWB 3C5ZC 5D2LB 4UTBH 4GKSA 5TQ0H 4PJ8B 4DVBB 3RUGA 4WO4A 5D7LE 2ADIA 1NFDA 4LAQH 4MMXC 1BZ9B 4OF7A 4M6ML 1ACZA 2IMMA 3UX9B 5F6HJ 2VXQL 4MXWL 3OKOB 2EICA 3H42H 4GMSH 4P2RA 5GSRA 2ZPKH 2FJFB 1TQCC 3QUYD 5C2UB 2OI9B 4NZTH 2FGZA 2DTMH 2WBJB 5FKAA 2J8UB 4Z95H 4KHTH 5BV7C 4QCIB 5IKCA 1OT1A 1VADA 2XTJC 4B5EA 1CDHA 3O4OC 2XA8H 2NY5H 4P46D 2GCYB 4K3JL 2FHCA 1YN6A 3UBXA 1MI5E 1NFIB 1ZKAA 2Z8VC 3S4SA 4G9FB 3ZLQC 2PTVA 3EHBC 3IFLL 3TYFB 3Q5TA 4OLUL 1XF4B 4TPRH 4DZ8A 2CIKA 1XT5A 1WT5A 4Z7WB 4JJHA 5SWZD 5KOVC 2FHBA 4F57L 2OMNA 1P84J 4N9GB 4L8DB 1R5IA 2ZG3A 2E7MA 3P4NA 2E7LC 4PJ9B 1R5VA 3H3BC 1IM9B 5IT2H 1F6AB 1A4KB 3L1OH 3VFUA 3LMJL 1RFDH 2XT1B 1T0MB 5CFHA 3CH1B 4AQ1B 3PF2A 4TUOA 2V2XA 4MS8C 3BEWB 1GIGH 5GGSA 3U4BH 5HHQB 1H3UA 2YUZA 4QWWD 3AMLA 4HS8L 5IHZB 1D5BB 3CLFH 4LCWD 3V5KA 3PUCA 4JPIA 2BP3A 2VR9A 2XFXB 4U1MA 4IBLT 3WFDL 2F74B 3QHZH 1U8PA 3DSFH 1QSFD 1KIRB 2H6PB 2CXKA 1ZLWH 2NMSA 4RWYL 1U8JB 4DAGL 4NSKA 2IPUG 1S78D 2AV1A 3QCVH 5DZOA 5JQHC 1FN4B 2HLFC 1ACYH 1KTLB 4L3CB 5FCSH 2VN7A 5L6YH 5MHSD 1KFAL 1YUHB 1YEFH 1RUKL 4NWTL 1ES0A 4LLVA 3QEUB 1ZGLA 5F72S 1T3FB 4I0PB 4WW2A 4CRPA 4PREA 2DWDB 4G7VL 3BW9B 5EO0A 4ZYKB 5D7IB 1VPOH 4DZBB 1CQKA 5DEFA 4ZODA 3I6KA 1CGWA 2CRIA 3TNNB 3W0WD 4Y5VA 2VO5A 1VGKA 5FYJD 4Z0XB 1PW3A 3C2SA 1FL6A 3GM8A 4J4PD 3TZVA 1P9MA 5E2TH 4LMQE 2I60L 1SJHB 2IPUK 5FHBL 1JWMB 1MI5A 3GMOB 3OWEA 4UIKL 3EO0A 2YD9A 1G7LA 3HUJF 1QLEL 3IXTA 3LKQA 4AM0B 4WUKH 3UJJH 2Z4QA 4J8RA 4RDQG 1J11A 3QHFH 3QZWA 4JKPL 2GSGA 4YPGA 5D1XA 1JZ5A 5D93C 3JSSA 5C6TH 1SJVA 1TVHB 4K3EL 4DN3L 3VXSD 1QR1B 1ZHKB 2IADB 2DRUA 4O2EB 5I76A 4ODHL 1CWVA 4B7LA 6CGTA 5ITFA 1FFNB 4TNVK 4PJXA 3T2NH 4XPGL 4O00A 3PDOA 3S96A 3SDAB 3LH2L 1P53A 4I2XE 3D3VA 3LQZA 5J6HA 1NDGB 4Y4FB 4G6FB 1XGPA 2FLBT 1YNLL 2YD4A 3TM6A 2HA1A 1Z9SA 2OTUB 2DIJA 4LNRA 4XCFH 2LFGA 3UPAA 3KR3H 2BSTB 5DJ2B 5BS0B 1X3DA 2UZYB 3WL9A 3FO2B 4KAQH 1U91A 4KY1H 2BMKB 1NCCL 5HHMB 3LIZL 3UO1H 3Q0HA 2P5EB 4U31A 3KPQB 1JGVH 1CT8B 2ZCHL 4WO4D 5C0BB 4YUEL 4JM2C 5EO1A 4OGZA 1I1AB 5SWQA 3MOAH 3HAEB 4IHOB 1ZLWK 3DGGA 1K3ZA 5F70A 3KPOB 4FQXB 5HYSG 4JAMB 5ANMB 3KAAA 1NGPH 4PJDE 3CXHJ 4JFOA 3RP1A 4DOHB 5ID0B 1F4HA 3FFCA 5E6ID 3V7MA 4P2RD 5C7XL 1U0QA 1VCAA 5F7YC 1T04A 5C0CD 3ALXA 3M17B 5J12B 3WHE1 4IOIA 2APWA 4Z18A 2H41A 1FVEA 1KYOJ 2DL9A 3BWUC 5I17B 2P5WB 12E8H 2XKUA 1MH5B 2A74A 2HMID 4JN2A 5T1DL 1D6EB 3V6OC 5HVHC 1MNUL 3STBA 5HGBB 5DJCA 4N0FA 3ET9F 1SJEB 2EDBA 3K4ZA 4PFEA 3ZE1E 2X70B 4R96B 1RU9H 5GGVH 2J6EH 4OF5A 4WI3A 3WNKA 3MLXL 3MLWL 4M5ZH 3HFML 1LDPL 5DD3H 3NMEA 4UOW0 2X89D 5K9KA 1HCFX 5I1CH 2E7HA 3GSWB 1A3LL 3KJ6L 2OLDA 3L3DA 2EDYA 1NL0H 3FT4A 1W0VA 1GGCH 1I7UB 1S7UA 1EUUA 7FABL 2R0KL 1MRCH 3C60A 1MFAH 2GUOB 2GK0B 1FNLA 1J9CT 4PJHB 4OLVH 2AJZB 1CQYA 3X11A 5BV7H 3V52H 2APVA 3HMWL 1ZHBA 3U83A 2DF3A 1LHZA 1I8KB 1NMBL 1OW0C 4Z7OE 3RDTB 3TYGL 2HP4A 3BPOC 5BMFH 4WV1B 5JPMB 4FZEL 5I1LA 3E6HB 4MA7L 4D0CA 5FFLA 5J11B 4N0CD 5F7NC 1D5XB 1FRGH 3CVHL 2Y9RT 3G6DH 4MNQB 3HZYB 2PO6B 2JLLA 4OZIF 2YWYA 5J6GB 1LE5A 1BWWA 5D72H 3BEVB 4QRTB 5IFJB 5FKPA 3ZKSD 5LGHH 2QLVB 4JHBA 4TOYL 1WZMA 3MA9L 5D7LD 2FYYA 5GRUH 5C08A 1D5MA 3RY6C 2YPVH 4BK5A 1NANH 3LS5L 3L9RA 1ZA3B 5IBLC 4ACPA 5L2KB 3B3IA 4PJDA 5C8JA 4PB9H 4QEGA 3RKPA 3UTQA 4IIQC 4NT6A 3QULA 1BJ8A 2WWMD 4TUKL 2CQVA 4JFEA 4JDVA 4KROB 1LP9A 1BQLL 1AFVL 4AEIH 4U33A 3TA3B 1FZJB 2BSSB 4GS7B 3ARFA 1MJUL 4RAHA 5DUPL 3TZVD 1IQWH 2A83B 1MI5D 1HOCB 5TF1L 2F58H 3LKNA 2PYFB 3BO8A 3EKCA 5FO9B 5D1XD 5I1EL 4NO3B 2EH8H 4FNLH 4JR9H 1E4WH 4EDWL 4LVNB 3WNOA 3O3AB 4OKVA 1LEGA 4Z7UE 3PGDB 3FT3B 4KI1A 1T83C 1TCRA 3FN3A 2X09A 2J12B 1TPXB 1X5LA 3B9AA 3FQUB 2E27L 4PP2A 1QRNB 4TNVF 3O0RL 3ARGB 3D3VD 3WFCH 4LLWA 2N7BA 4JHWH 4JCMA 4GRWB 4JGJA 3S5LA 1YEEL 1TMCB 4NKOB 2HH0H 5E08L 4P57B 1HINH 3NZ8B 4PRDB 4GG8A 3VXME 3OKKA 5EOCJ 5FUZL 5ETUA 2R4SH 4RDQF 2VKWA 3QEHA 3L95A 4QT5B 2E7LA 2C1OB 5A3IC 1KGCD 1T89C 3RIFK 4HPOH 4KVCL 3CUPB 3CK0H 5ITBH 4D9QE 1FGNH 3OKDB 4NM4H 5J3HD 1A6WH 3FAWA 2H32B 5D7JD 4JFQB 5C0JB 1MAMH 3FFCD 1KJ2B 4HUWB 3QDGE 1TITA 1ZT7B 4LVOB 3TC9A 2J5LC 3IFPA 5BVJB 3WLBB 1I1FB 3WIFB 4ODUB 1P7HL 3GSUB 2ZSWA 4G8GB 4ZQKA 1OF2B 2GW5A 3PJSB 1KIUA 4HKZA 1I3VA 4G8FB 3HI6H 2GY7B 4JGMA 1OP3H 3GBNH 4XGZB 5JHDE 2EEBA 2H9GB 1WAAF 1MCCA 1CGTA 5ICXB 5C07A 2JB5H 4D2NA 1IFHL 1FFPB 4BZ2L 2LE9A 4JGUA 4G6KL 4X5XA 5EUKA 3R1GL 3SKMA 2Y7QB 1JWSB 2CK0H 4RMQA 3WFEL 1CD1B 3KLAB 4X6DE 2XZZA 4ZD3H 1F2QA 5LQBL 1IAII 3L5IA 2H2PC 4UI2A 1S7TA 1PLGH 1LD9A 4JY4A 4CADB 3NFPB 4LPVA 8FABB 3MZGB 1KLUA 2BSRA 4JREB 2E7BA 4U6XB 4NQSA 3P11L 4JO1L 4P23B 1KOAA 3N9GL 2B0SL 3D0LA 2NY4C 4MD0A 2VDLL 3MBEC 1JK8B 4AH2A 2NY2D 1I1RA 1CGXA 4GW4A 3P30L 4KWUA 4KJWD 5FDWA 5DMKB 1S7QB 1T7WA 1QR4A 3CPLA 4UUJA 3T65A 1P4IH 4HXAH 4NJAL 5ECJE 5EA0L 4LSSL 3MV11 2PXYC 2VLKA 5D70H 5C08D 3EOYG 2AKRA 4RCAA 1IZJA 3GGWA 2J3SA 3DX9B 3UTSE 2DLTA 3BHBA 3UAJC 4HBQA 3HE7B 4K9EL 4PJ5B 3UTTE 4AG4H 4AL8H 5IG7B 4ZUWA 1QFWL 3KPRB 4NQCE 3S37H 3QDGA 2B2XL 4JFED 3HPLA 3FRUB 2NX5B 1DTUA 4U05A 1U8OB 2NY3B 4DFHA 2EDKA 1MWAA 5T3ZE 3R8BB 5D1ZC 4O2CA 1A14H 3P0GB 3RGHA 3MYZA 2A6IA 3ARFD 4P5TC 1GL4B 2YC1A 4U1IB 1OGTA 1EEZA 4PJ7A 3GSQA 3ULVD 5BQ7A 4NUGH 5JIKA 4D0DB 4MHHI 3OAYK 4J2XA 3VRIB 1RUPH 1CXFA 3D69B 1I8IB 1BGXL 1JV5B 3VH8G 1H8SA 4OLWH 4JM2A 1ZVHA 3HKFA 2H26A 1Z6JT 2DBLL 4YXKL 3ZDXF 5ALBH 1FNGA 1MCPH 4JFDB 2YWZA 1OP3K 4GQ9H 1CICC 1C5CH 1QPXA 3O2WL 2A6KB 3PHOB 4N1EA 4X6FA 1MCEA 4QRUA 3MV7A 4QXUL 1AQDB 1I1CA 5CINL 3MRCB 3MRHB 2BVTA 3IDYB 4JFXA 2I9TA 4W4OA 2P8LB 1P84K 2DJSA 2XTJD 4HBCL 2YHGA 4GAYA 5IW1B 3VFWA 1LO2L 3PWUA 4TYUA 5C0AE 3TIEA 5IB4A 4N68A 3WS3A 1Y18B 3DIFA 4HUXB 5AWNH 5I1GL 1U8KA 2BSED 1YMMB 4LU5L 5TDPA 5EZOL 1MJ7L 2FO4A 5I19L 3TF7C 3V5HA 4QHKI 5ACLA 4XMKL 1KLGB 1CIUA 3BRGC 3NCFB 5E56A 5DSCB 3ULUL 4QXGH 4ZFOA 1OT2A 4NQXA