1YEEH

Structure of a catalytic antibody, igg2a fab fragment (d2.5)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
EVKLQESGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRAAAGLEWIARIYPGTGSSYYNVKFKGKATLTADKSSSTAYMQLSSLKSDDSAVYFCVRWGFIPVREDYVLDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural convergence in the active sites of a family of catalytic antibodies.
pubmed doi rcsb
molecule tags Catalytic antibody
molecule keywords IGG2A FAB FRAGMENT (D2.5)
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeH02
4Z78A 1SEBB 1A47A 3K4DA 5EUOA 5DJDA 1I85A 2BOCA 4HEME 4PJ7E 5EU6B 1NFDE 3DHJA 3LH2H 4ZXBA 4PB9L 3HI5L 4YHML 1TETL 1IM3B 1XR8A 4GW1A 4KMTL 3WN5A 4X5XA 4LLWA 1OP3H 4HGWA 2N1KA 5EPMB 3EO9H 2AI0L 4H1LG 3KNBA 3WFHA 4Y1AD 4MDIB 4UT9H 1UKTA 2G5BB 4MJIE 5IW6A 2WSKA 3WFEH 3KPSD 1VFAA 2EH7L 4K3JH 4HCRH 4KVCH 2AK4A 1FE8H 1W0VB 2JB5L 1LO4H 3B9DA 2EZ0C 5B3JF 1XH3B 1W8NA 4CJ0A 3MMEA 1KXQE 1NL0L 1DBAH 3H9YA 4GAJL 1FVEA 4L8SC 2DM2A 3UBXG 5CBAA 4MA8H 4Y2DB 1I9JH 4GRMB 2AV7B 3N9GH 2DQHL 3G6JA 4X6CB 5IHZB 2X4RA 1AD0B 2LVCA 2X09A 1U3HD 3A6CH 4BQ8A 3OGCB 1JZ2A 4YDKL 3DX9A 1JGDA 1NDGB 2APFA 5JLZB 5DS8B 2ZCLL 1L0QA 3STBA 4JCLA 3DVGB 4HF5H 3L1OL 1BQHB 5IFAL 4HFWB 4ZUTB 1BECA 1RZFH 4LF3A 4RCAA 3GMLA 4QHUA 5GGVL 1NKRA 3MRRB 3WL9B 3FCTA 1H5BB 5I1DB 1FJ1A 4GMTL 2AGJL 2VSCA 4KROD 3L3JA 4M93B 4I2XB 3EOBB 3EW3B 5C70A 1HH9B 2QADD 2VDLL 1BVKB 1JGEA 4DVRL 5FXCH 2WANA 4MA3B 3UJJH 4LSPL 3HNSL 3B8SA 1JCKA 2NX5D 5JA9A 4O4YH 4I18C 4X80L 4YEFA 1H3PH 3MQIA 2B8OT 1EMTH 1BJ1J 2MCG1 3NCEB 2HVJB 4O5LH 4P23C 3D18A 4NQDD 2Y25A 2V9RA 2EDFA 3OF6A 4Y2DD 3T0ED 2CMRL 4HUUA 4PJ5E 3QQ4B 5BZDA 2OJEB 2OXGA 3A0OA 5D1XD 3MACL 4Y1AB 5D7SH 4P3CH 3LDBC 2R2CA 3MUJA 1ZANH 4PBXA 1EHAA 1YECL 4O58H 4JRYB 4QRRD 1VACA 5JO5A 1NCWH 2MWCA 4NKOA 4QGTA 1LEGB 4WI3A 3WDIA 5KSAB 3F5WA 3AFLA 3MLVL 2ICWJ 1R5IA 2FHBA 4ZAKD 3SDYH 4DTGH 1C5BH 2MCPH 3SDDD 5H35A 4OLWH 3QUXA 2JELH 4XBEH 2EEBA 2NMSA 5KG9B 4U49A 4Z7WF 3RI5F 1VGEL 4PUBH 2A6KB 4W70A 3GSVB 5J13B 5BV7C 4G8FA 4W4NA 3VXPB 3HAEG 5EZJB 1TJGH 5JORA 2R69L 3MV7E 4OBRA 4HJGB 1XZ0B 3D0LA 3Q48A 4P3DA 1ES0A 4OFDA 1B2WL 2F53B 2ZCKH 4R96A 4N5UA 5IJKC 1KB5B 4UOW1 1OW0C 5DD5H 3S8WA 3RWDA 3H9SD 3V4PL 3DPBA 4CNIA 2VDOH 3CUPA 5MI0C 4HD9A 5IG7B 1FC1A 1P4BL 4BZ2H 1YEGL 2GSIA 4RGNC 1JRHI 2CKBA 4X6EA 3TH2T 1T04B 5EORL 4OCYH 4K3HA 3VDBA 4XBPA 1OLZA 5B39B 1RHHB 4N1EA 3JV5A 4XNYH 4EZMA 1H5BC 1T2XA 1KBGL 5DZOA 1HZHL 3A67H 1RUPH 3BP6B 4W68A 1BFOA 3RIAF 2FH8A 5GGVY 1R3IL 3HC3H 5AYQA 4IMKA 4LLQA 3LKRB 1A7PH 3KPOA 3UTSD 3VFRB 3F12A 1J10A 2AJYH 4L4TA 1JWUB 1DQQA 2GTZA 4ZUTA 5I17A 1XAUA 4FFZH 4OZFG 4R3SB 3QEUB 3NTCH 2APVA 4U1NA 1T89C 1BBJB 3MCG1 1INEH 5KJRL 1CLOH 1G7IB 5HSFA 3TF7C 3U83A 4BZ1H 1QEWB 2VWEE 4KV5F 4LPWA 2O5ZL 2HP4A 1XR9B 2XTJB 5FECA 5ICXB 3ROOB 3O4LE 5EOCJ 1MJ8L 2YUVA 1BREA 5F1NA 4P9HC 4Z7WA 3DX6A 5BS0A 3A6OA 2RB8A 1FFRA 1GJIA 4HUWA 4WHYG 3MBEA 3FRPA 5D6CB 5C07D 5JPMA 4G5ZL 3D6GA 1V7ML 4I3RH 4OM1H 4UQ2A 4ERSL 5IW6B 5EN2A 5B38A 4D9RE 2EYTA 3WLWD 1QBAA 3QIWD 1IC4H 2EICA 5EPMA 1NEZB 4MS8D 3QUXD 3ALPA 1M7DA 5ANMA 5GSRA 1IGTB 4CN6A 1DDHB 1I9RL 1JHLH 1KENH 3AB0C 4MJ4A 5DMKB 4U1IB 1FAIL 3VXME 4APQB 5KVGH 3H42H 4LSUL 3DX7B 2P44B 1PG7X 5GQBA 3PV6B 5DWUH 3NOIA 4HBQA 4YE4L 4G6JH 3K1DA 4LLMB 2DOCA 4F9LC 3S4SA 5D1QB 1T21A 4OIAA 3ILPA 1U41A 3UTQA 4JJHA 1HHJA 3PWVB 1VFOA 3QUZC 4TPRL 3P4NB 4G9FA 3WE6A 5EU3B 5FDWA 1X44A 1CXLA 3QG6B 4S1DC 2E7HA 4OSUH 2VERN 5ENWB 5E08H 5DD3H 5FA3A 1BWMA 1SYVB 5CUSH 3FOLA 4QXUH 2WQ8A 3QUYC 1HH6B 3QJHB 3RAJL 1RURL 1T2QH 4OCWL 4FXKA 1V3LA 4Z7VB 4EEEA 1AFVH 1TZIB 2X4TB 1T6VN 4KJQC 3T8XB 1NLBH 1YY8A 3G5XA 5CGYC 3O2DA 5ISZD 3IXTB 2C3GA 5ADPH 2HT3C 4RFEB 1F6FB 4LCYB 5E2JA 5F3HB 4YHMH 4KI5F 3BPCB 4NQTA 4Q0XL 3ZYIA 1LP9E 4Q6IC 3NGBC 3QFJB 5FUZH 4FMKA 3TJEH 4GW4B 1A0QL 1QLFB 1ND0B 3QDGA 2VLME 2PW2B 3FB8A 5C2BH 4KI5C 1KB9K 5KANI 1JPST 5EOQH 1W72H 3QWQB 5EBLB 43C9B 5D71H 1BD2D 3RFZC 4GKNB 4IRSA 1MHHA 2YC1B 1OSZA 3BW9B 1RIUL 3PWNB 4R0LA 3T77A 4YXHH 5SWSE 4PLKD 4TTGA 1X4YA 4ZTOL 1CL7I 1UWXK 1U9KA 4M9PA 5ILTH 1I7TB 1I9JL 1BOGB 1EJOL 5IW1A 5ACMA 3A6CL 5JQ6L 3BP4B 3QEQE 2B4CL 1FYHB 5D7LA 3ZSSA 1RZKH 1BM3L 5JW4N 4IS6A 2I5YL 4Z0XB 4JFEA 3VGEA 1J87A 1A2YB 1RZKC 4JRYD 1KPUB 5F89B 2NY2B 2D7PA 2W9LA 2YD1A 2FYYB 4RAVB 4MB3A 4OUUA 5SWSD 1QP1A 4OUOA 2FIKA 1QFHA 3DX8A 5C0FA 5DJ2A 3QNYB 3NFNB 4MLSA 4OV5B 2BVYA 5FFLA 3I2CL 4WHDA 2WM0A 2GSGB 4JPWH 4YFDB 3RVXC 4IIQB 4D9LL 1JNLH 3JTTB 2AQ1A 5IHLB 5L0QB 1P4IL 3L3OA 3GRWH 1TCRA 1CU4H 1TJIL 2VOTA 4JFZL 4PJBE 4Z0XA 1QPPA 4FQ1H 5KSBF 1DBBH 2DQCL 2NX5B 2H1PL 5EU4B 3WYRA 4QOKB 1UJTA 1ZK9A 1AGEB 4XVJL 1KJ2H 5E94A 3DV6B 4KRMB 4K3EH 3MLXH 1JWMA 5ECJE 4E0RA 2R2EA 4PY7A 1K4DB 4IOFC 4PJCE 3B9EA 1H15B 5DHVA 43C9A 1MRCL 5LGJA 1B90A 2VR4A 2FECL 2JK5A 5I71C 4U6HB 3DROA 1BBDL 3VXNA 1NC4B 4XC3L 2JLLA 2NY3C 5ISZA 4Z5RA 3PWPB 1DBML 3BWUC 4NZUL 5GRUL 1R24B 3CDFA 5FYLD 2BZDA 1UYWL 4LARH 1MH5B 1F4WH 4PB9H 4G9DB 3TZVB 4KK6D 4HWBA 2DQGH 4OLXH 3GBLA 4XAKD 3S37X 2BP3A 4FZ8L 1RJYA 2C4FU 3HE7D 3M17A 2NY6D 3T4YB 3U0TA 2NZ9D 3QDJE 1RUMH 1F58L 4TVSa 2Y06L 1J0IA 2DBLL 4LEXL 2D0FA 3C5ZC 3SDXA 4HFUH 3WIIH 1AIFA 4X8XA 2AJUH 1VPOH 1I7ZB 2HT2D 4EUPH 4PJ5A 5T3ZH 4AH2B 5FYJE 2BVUA 3ARDA 3BXNA 3MOAH 4OCNC 5C07E 2G75A 5D4QA 1PG7W 1ZVHA 2R9HC 4JRYA 4BQCA 5EU5B 3UZVB 4I0PD 3WHXB 3WXWH 5IIEB 2AJVL 1XGPB 2HRLA 4NO3B 4AEEA 3VA6A 3S9DB 5KSBA 4NZUH 1ZHBA 1KEGL 1R5VB 4X9FA 5A2KH 4I18A 1NMBL 5IVZB 1T66C 1NDMA 3FRUA 2P47B 1UB5B 1A1OB 4PG9B 2AJYL 1TJHL 3WUZA 4Y4HA 2H2PD 1NEUA 1UM4H 2IANB 3DO7B 3VRLF 4EN3B 5K9QI 4OGYH 1JIBA 2VQ1A 4JAMA 4MAYC 4NDMA 3HMXH 5T5NG 2BHZA 4MJ6B 5HYFA 3GMNA 5CZVL 3IFNL 3VGBA 2YD2A 5LGHL 3CCHB 4NNPL 4QTIL 1S7WB 1U92A 3W11D 3FTGA 3TM6A 3AREC 4ZS6D 1E4XL 1TFHA 4PYHA 3MRLA 3OKNA 1QSFA 2BERA 5F9JA 5J6HA 4YDIH 3L6FA 4UIKH 3P4MB 1QR1A 3MRRA 1WC7A 3NA9L 1P53A 4J1UA 5C92A 1N7MH 4JFYA 3GMMB 1PKQB 4CADA 4GFTB 3FHQA 4N9GA 5CINL 4O58L 3PUCA 1ZSDB 2Y6SD 3MLXL 4LKCB 1G84A 1LO0L 3MA9L 2ATPB 4EOWH 4UB0H 2YPLD 3QEQD 1T7YA 4LCWE 4WI6A 3BJLA 4OAWB 3VWKA 3VXMD 5CJQH 1G9MC 3G6JB 5C0RL 1VGEH 4M8VA 3W0WD 1AE6L 3FB5A 3RBGA 3TZVC 4X4XA 1UH4A 3D3VB 4HSQA 1PQZA 2XPGB 5IVXA 2FEDD 2V2WB 5GHWH 3U9PL 4YHNA 1IGCL 1NFDA 1U8NB 1YYLL 1FQ9C 4LHUG 2FCBA 2VRAA 1YNKL 2HTKC 3DRTB 3OKEB 3U0WL 3MUY1 5GRWA 5D93C 4XCEB 3U46B 1KLUB 5DJ6B 1XR8B 2JJTC 3IF1A 1LILA 4O2FA 3P0YL 2E5EA 5I1LB 5C08D 4IEFB 5HYQA 4NO3A 2GHWB 3RBSA 5JW4Q 3O6LH 2DMKA 3HE7C 3FO9B 4OKVB 5KS9B 5E8PA 5J1AA 4M1GH 1YQVL 2HJKA 4HKBA 1U8MB 2VABA 5L9DH 1CICD 1EEZA 3BP7B 4PV8B 2PW1A 4WUKL 3QNYA 3GM8A 2DQIL 4TULL 1N5YL 1S3KH 1FFOA 3DTXA 5HPMB 1FV1A 1K6QL 3GSNL 5EOCH 2NY0D 4LHUB 1T6WA 3S96A 4RGNE 3G04A 1NAMA 4MXQD 4K2UL 3RDTB 4ETQB 2F8XC 1QSFE 1CLCA 5H2BA 3BAEL 1NBYB 3PP4H 3R0MA 3DYOA 3K81A 5KSAA 1CGYA 1WITA 3L5IA 5D71L 1DQMH 5IB1A 4OIBA 5DMGC 1CYGA 2NY1B 5I75C 1HHHA 2VISB 3ESUF 3O2DH 5DUPH 3T4YA 3OAYK 4ONFL 4NQEA 1T0NA 1OT1A 2IG2L 4UQ3B 4P4KC 2WZPD 5HYJB 3VD7A 3TYFB 1AO7D 1UCBL 3VJ6A 3TPKA 3X13A 5BZDB 3KWWB 4TSAH 1A7QH 3HPLA 5DGRA 1MHHB 2YC1A 3VGGA 4UOJA 4MQ7A 4OLUH 4LSRL 5CD3A 1FFNB 5DJ8A 4MXVE 3BVNA 4O2FB 1NUFA 1XFPA 1JN6B 4J7RA 4CBPA 2Y4SA 1JWSB 5DC0A 5KTEL 1I9RH 4C56D 1KIPA 1NGXA 1MRFL 1XF5B 1JFQH 3IKKA 3S34H 2HAZA 4GRLD 2FX7L 3SDAC 2A0LC 1HCVA 2HMIC 1U3JA 2D31A 2X44D 5A43C 4I2XA 1P7KA 3SE3A 1IL1B 4XC1H 2KZWA 4LVNC 2VDPH 4AT6A 5GISL 2X4TA 1TMCB 2NY4C 4HUKB 3B2UD 4X5LA 5FKPA 1E6JH 5LXGL 3GHBL 4KROB 3BUYA 2BRRL 1P7QB 4F57L 3OGCA 5C0JA 5E2WL 4DGVH 4HZLA 8CGTA 4FQJL 3DRQA 3JWOH 5IHZA 2FEEI 3ZSTA 2NY7H 4XXDA 4R2GC 5DJ2B 3IJYB 2W92A 2IFGA 3P4NA 3G6DH 3QO0A 5F96H 5F7EL 5IV2B 5D70L 1EO8L 2GCYA 1PW3A 2CUHA 1NAML 2R4RL 1W0VA 4K8RH 4JO4L 3V7AG 4Z7OE 3UTTA 2FEDC 3MRFB 5L7XH 3Q5YA 4AMKH 1SJXA 5D1XC 4V2CB 1GGCL 5JHDB 2MHAA 3L7FA 2J88H 3LZFL 4U1IA 4HPYH 2JCCB 3DXAA 4I0KA 3IU3B 3RU8H 3ILQD 3PGCB 2WIIB 1AR1C 4UDTA 5TE6H 1XCTA 2OJZL 4V1DE 4KRPB 1FL6B 1J8KA 3WFDH 3BW9A 3T77B 2YA0A 4J3XA 5JUEH 2DS4A 2P48B 1ZT7A 2VDRH 1A9BB 1QNZL 3OKMB 4YHPB 1NBVL 4HFUL 3HAEB 1W0YT 4PD4J 2Q8AL 4Y5VA 4NWUL 4XNXL 1FNSL 4XP9L 4HBCH 3IJYA 4TSCH 3RWFA 1KF9B 4DKDC 4WV1C 5E8NB 2ORBH 4LLVB 4JO2L 4KKAD 3HKFA 1DANT 3QUZB 1HZHH 1TTFA 5I76A 1OGAE 2GFBA 4M5YH 2SEBB 3TLRA 1HDMB 3S5LG 4WRLA 4JRXB 1AY1H 2ICEA 1I7ZA 4HKZA 3GSUA 2Q87A 5ACLA 3E8UH 1A6WL 4P2OB 3EDDA 3MRIA 4X6DA 6FABL 3VFSA 4OCRH 3BIKA 4F80A 1ZEAL 5GJTL 3RWHB 4KK8C 4MMXC 1A4KB 1BD2E 4K9EL 1E4KA 2CLRB 2LVEA 2RAMA 4ORGB 5HDBF 3CJJA 3MUZ1 5IM7A 5BOPA 4G9FB 4MQXD 3S5LA 1KC5H 4MGXA 3QIWA 2J7LA 5HHXL 1K8IA 3NN8A 1DE4B 4HC1A 2IFFH 3ULUL 5HHOB 1AQDB 2Y07L 2F8OA 1DSFH 2P24B 5CJOL 3KYKH 5TFSL 1JF6A 3RWDB 2OCFD 5DJAB 3TJHC 4QRRA 3U1SH 1D5MB 3HZVB 4UQ3A 2JK5B 2X1XR 4P57B 1U93A 4M62H 4R7NA 2JF1A 2LAGB 1UVQA 3DXAE 3SKMA 4JDVA 1PBYA 4U1LA 4JQVA 3BN9D 3OL2A 4P9HH 1YMME 2GJ6A 2OYPA 5GS0L 3DGGB 4XC3H 2H32H 5H8DA 4PGEA 4KHTH 1XEDA 2CDEA 3G6DL 2FBOJ 4Z95H 4RDQF 4JQIH 5BS0B 2DWEA 5FEBA 1XF4B 1IARB 4PJXE 4S2SA 4S0SD 3FN0H 2PTTB 4LEOB 3JWDH 4NC1C 2UVFA 2R4RH 3I6KB 3M8OL 4ZOBA 1F3DJ 1JUFB 3ULUF 4KTEH 1FNAA 4O2EB 5SV3A 1EK3A 3SHSA 5IT2H 1UH2A 5L2KD 1VACB 4YHLL 3VA2C 2I9LB 1IGIH 2P8PA 3GBNH 2CLZA 2NCMA 3LV3A 2J6EH 2GK0B 3HUJF 2A83B 1LNUA 4Z7WE 4KJPC 1KCRH 2DLFL 3BZEB 2BNQB 3S37L 4Q6IB 1KELH 3NFPB 5TQ2L 4EJ1C 3U0WH 2DN7A 3ZKQD 3FONA 4Y4KB 1B3JA 2FWOA 3MLTA 3U9UB 4ZUVB 3KPLA 2Z8RA 5DJYA 1NANH 5DR5H 3PIQA 1DBJL 1L7TL 1S7XA 5EC2B 3DSNA 3VXUA 1YQ2A 3WIHH 2WP3T 1EAPA 4S10A 4NZDA 4H5SA 4Z18A 1IAOB 2DQCH 2RGSA 2VLKB 1U93B 4EI5C 1UZ6F 2ZOLA 2EYSB 4KZDL 2F19H 1KIRA 3N9GL 4YLQT 5F1KC 1JGEB 3SY0B 4RNRB 5CIPH 1JI2A 5HJ3A 1I7RB 3V5KA 5J06A 1N0XH 1OT2A 5IHUH 2ARJB 1KB5A 2Z4QA 3V2AR 3D85D 5IQ7H 3QFJA 4DGIH 4HG4J 4MD0B 2AK1L 1BEYL 4JFOB 3RRQA 1ZLSL 1WISA 1JZ4A 1OAQL 3ULUC 3B6SA 3BAEH 5HGHA 3L3GB 1A6ZB 4GMSH 5ACZB 4JPVH 3WDHA 3SGJC 4HLZG 2E27L 4KRNA 3VFSB 3LQZA 5D5MB 5DVMA 5DVLA 5JOFB 4QCIB 2KKQA 1GCFA 1YY9D 2A6KA 2QSTA 2HVKB 3DSFL 1RZJC 2CXGA 5BV7B 4U0RC 4MNGE 4FG6C 3O4OB 4JHZA 3SCMA 3L5WB 4AEIL 3CCHA 2VLKE 2Z8SA 4FXKB 2P4AB 1SY6L 5E6IA 4BM7A 2UWEE 2G60L 3ZDXE 4CVZA 4YDIL 1C5DB 2V7HB 3QDJB 5EU6E 3VD4A 5BMFL 4ZO6A 2BNRA 2P5WA 2ICCA 3C5ZA 1G6VK 4IOIA 1F6AA 5GS0D 3HA0A 2OXHA 2PTUA 5CKAA 4LFHG 4UB0L 1T83A 1J9CT 5IVZA 1LO0H 4LMQE 3SDCC 3BE1L 3T0WA 4PG2A 3IU4H 4R7DA 3BSZH 5D8JH 2OK0H 2Y36H 4MJIB 4HUUB 3UP1A 3SGKA 4NN6C 3ARGB 4BSJA 5DGQA 1IEHA 4XAWH 3V79C 2GY5A 3QZWB 2W0LA 4IRZH 4HWEH 3O4LA 1ACYH 2OL3L 4CVZB 3L3KA 4XP5H 1BZ7A 2XIDA 5I1GL 3FB6A 1KCSL 5E7BA 1XGQB 4MLIA 4XPGH 5F7YC 5LCVL 4YE4H 3FB7B 1U8JB 1UB6B 3B9KA 3QDJA 4MYWB 5GGTH 1XCQA 3MRFA 2NW3B 3KPRE 4H88L 2YPLE 1KCSH 4OFYA 1INQB 4PJXF 4ZPTB 5C8JA 3EDJA 5I1DA 3V0WL 2X2YA 4DW2L 4UV4H 2Q8BH 4XWOD 4V1DA 4NKMB 3BIBX 3RKDD 3PDOB 3HLAA 2DTSA 3O2WH 4P5MA 5JOFA 4MD0A 3UJTH 2DTML 1DUZB 4HH8A 3QCUH 1K5NB 1CI5A 2WINB 4HWBH 1HSBB 3L3GA 4KAQH 1WZMA 5E1HB 2HT3D 4DUWA 4JHAH 4YPGB 1N7ML 1MH5A 3L5XL 1CFSA 3HFMH 32C2A 5DTFA 1DLFH 3MCLL 3QP3A 4Z7NF 5MEND 4HXAL 4QWWC 4ZFZB 4M7ZC 4WTXA 1IL1A 4FQJH 4PJGE 2NLJA 1QHOA 1I7RA 2VLKA 4OZHE 1ORQA 1KPRB 1DFBL 4PB0L 2AJ3B 4N8CL 1V7NH 3H9SE 1IKFL 5C08B 1OL0A 3H9HA 1RHHA 3CLEH 1RZGB 3KDMB 2ZOLB 4NWUH 4XNXH 1S9YA 1EUTA 5L8LB 3MR9B 2EE9A 4XGZB 3FQRB 5E56A 4ZAKA 5F70A 2Z93A 4H88H 3NVQA 2BNQA 3WXWL 2B39A 4J3WA 3MRKB 4BFBD 5DJDB 4G6AC 2R15A 4F58H 2AJXL 4LNVA 4CKVX 2FWOB 3MLTB 4LQ1A 3U9UA 3RU8L 3O6KH 5KJRH 3ZE1E 1HSBA 1F97A 1WBZA 4R26H 3O6FA 3NFNA 4P23B 1WAAA 4D3CL 4TVPD 5CCKH 1FHGA 4PRPE 3AVEA 2C3WA 4U3XA 4HPOH 5CP7B 5DSCB 4E41D 4OIIH 1G7HA 4CDGC 3G5ZA 2XOTA 3A67L 2X4SA 3EOAB 4H1LB 4NNXB 3WS6C 5JIIA 2PR4H 3WFBL 4X7TA 2AERT 1LO2H 4KC3B 5CILL 3RHWK 4GW5A 4M5ZL 3QNXA 3LIZH 1FFOB 3RZCB 1HOCA 4JY6A 4PY8J 3TVMC 4OZIE 1H8SA 3BKYL 3R06B 4HF5L 5CGMA 5HTSA 4FMFA 3VCLB 1U3HC 2NY1C 2W60B 5I75B 3GMOA 4O02H 2HH0H 5FB8A 1BF2A 1LHZA 3MNZB 2B4CH 2Q3ZA 5KSBE 2EKJA 4DUXA 1Z5LB 1EERB 1MCKA 4RWYH 4X99B 4PRPB 5TGBB 3U36B 4FQ2H 3KGRA 2CDFA 4C58B 4M00A 2FBJH 1F6AB 3WLWC 2D9QB 5HHOA 3RZCD 1CFTA 1RU9H 4PJEB 1A3RH 1ADQH 2BNRB 2K9UA 5C7XL 1R6VA 4XPFL 3EDFA 1OAXL 5BO1L 4N5ED 3MO1B 4P2OA 2V2WA 1T2QL 2NLJB 1QTYT 3OHXA 1FIGL 4RIRB 2UZYB 2EDBA 5C09A 2VDNH 5IOPA 1MELA 4LMQI 5HDOA 3VXUE 1G6RH 4N0CC 2SEBA 4XWOC 4P46C 2B7DT 3MLZL 3FOMB 4YPGA 4NJAH 1BQUA 3QUZA 4K23L 4JFZH 4KUZH 4HKZB 5FA3B 4WUKH 1IZJA 1DUZA 2XYCA 3U0PA 2IQAB 1HXMA 1WWAX 4QYOA 4Y1AE 3P9LA 4O02L 4JLRA 3K3QA 2EKSA 3KPSE 5JQHC 4G6ML 2ARJA 5FM5M 1Y0LA 5HJ3B 3RGVD 3UPCA 3TN0B 2GYSA 4ZOEA 1YMMA 1X5JA 5F7KC 1DEEB 2J6EA 5ESVA 4ZD3L 6CGTA 1TIUA 5HYSG 3QAZC 5DQ9B 2BDNH 1OQXA 3LS4L 4UV7L 5JQ6H 4MB4A 3MLSL 1Q9OA 3REVB 15C8L 2WAHA 3IU3A 2QBWA 3VE0B 1CG9B 3QEHB 4I77L 1DLHA 3TT1H 2VQ1B 4OCRL 1T80A 2YRZA 3LN5A 1EZVX 2AJZB 4NCDA 1J12A 1GL4B 3GSRB 3VGDA 1DN0B 1UXSA 3CPLB 5BRZD 1KB5L 3GIVB 2CLVB 3PDGA 4B5EA 3UMTA 2N7BA 4ZG1A 4YX2L 4HJJL 1E27B 2Y07H 2KPNA 1X7QA 3ARQA 2A9NL 3F7YA 3QCVL 3UC0L 4XX1E 3ARTA 3RWEB 4Y4HC 1CE1L 5KVEL 2MOVA 4MA7L 1Q94B 1ZGLA 4YBLC 1CXEA 1ZLVH 4WO4C 4Z8FL 1MY5A 1BZ9A 1SM3H 2XWJB 3ARYA 5F44A 4FFVC 5DF0A 2A9ML 4RZCB 1L9NA 5CEXB 2XWTA 1DBAL 2EE3A 3DRQB 5MHSE 1FE8L 3ALXA 4OV6F 1RK1A 3LQAL 2ZCHH 3LDBB 1P7QA 1YNTA 4BQ6A 5JHLH 1M05B 2OP4L 3MRNA 4H8WC 4OLZH 4LHUD 3C08L 4UTBH 4X6DE 1C12A 3WV0A 3MZTA 1J0ZA 1UGNA 1XF5A 4U1LB 1JYNA 3V7AE 5C9JA 5FYJH 1ETZA 3UTTE 5C09B 3V8CA 3WXVH 2DICA 1UEMA 1VEPA 4RWYL 3AY4C 2QQNL 3VG0L 4F7TA 4Y8DC 5HYSA 1GXEA 2DQDH 5DHYA 3NCCB 1A6WH 4CJ1A 1QSEE 3QDHA 4LVHC 3O8XB 3BGMB 4WTZA 3TZVA 2Z0BA 4Q97A 3FJTA 1I9IL 4G8EA 4YBQC 1EO8H 1UZ8B 3V7MA 1RQ5A 4CNIB 4TQEH 5CIPA 2Q20A 1JN6A 4OZGE 2XTJE 4TUJB 5F71A 3EUUA 2JJSA 4HKJB 1T5XB 4KV5E 3G5VB 2WQRA 4RISH 1FFPA 1D6VH 1BD2B 9CGTA 4JM2C 2XWBB 4NRZB 2D9CA 2ZUVA 1H15A 3GKZA 4N0UA 2CRYA 4M6OH 3O4OC 1I3RA 4IRSD 1UWXH 1WLHA 4TUKL 3LEVL 3AGVA 4PV9A 1U6AL 3MV9D 1BFSA 5EO9B 4G80A 1RIVL 5D72L 3SE8L 1A7RL 3O9WC 4HIIA 5T5FL 2V5YA 3SOBL 1WK0A 4HWEL 2GT9A 4YK4B 2YSSB 4MZ2A 3LV3B 5D7LD 5CEXA 4HXAH 2X4SB 2FJGB 3EOAA 2NXYB 3HZMB 3RJQB 4TVPL 4X6CF 4DGIL 2BJML 3KS0J 1G7HB 3BN3B 1UKQA 1INDL 5JO5B 1XGTB 2R1YA 1KJMA 5GGTL 5ITFB 1A6PA 4HUNB 5FYJU 4Y5XB 3T1WA 4JY5L 5D1ZC 4JO2H 4GO6B 5TF1H 1D5XB 4TVPH 5DEFB 5SWSA 1ZHKA 4PV8A 3DETC 3I6GB 3S35L 3TT3H 2DM4A 2XTLA 4PD4K 2W65B 1EJ6A 1WT5C 4XCEA 1S8DA 1WBXA 3IDYC 5IMKA 4LSVL 1ZEAH 1OGTB 4MSWA 4JG1H 4M9OA 4JO3H 4Z7VE 6FABH 2OTUB 3MZGB 3JWNC 1MLCB 1SVZA 4ACPA 4ZFOB 1T1ZA 1U8NA 1SJHB 3EHBD 5DJ6A 4HT1L 5JHDA 3MCLH 4KKAC 1FO0H 3HI1A 4NO2B 5DD0H 1XGRA 2I07B 4JFXB 5C08A 1YDPA 4D2NA 1AGDB 4U1JB 4HEPG 4BSVB 1HHKA 5IB4A 1HYSD 2XPGA 3BH8A 3FN9A 4ZFZA 1O7SA 4RQQB 5JXAL 3K46A 2VKXA 4MB5A 4PGDA 2EZ0D 2ERJB 2HT4D 1JPGB 3UEZA 1PKQA 5IK3B 2CJUH 3PGDA 1GC1H 5IMLB 5DO2D 3KXFD 1LO5A 5D7SL 5JXED 5DEZA 2H2SC 1Y18A 5IB3B 4OQ1A 1A6AB 3FT2B 4WHTA 3BRDA 2VXTH 4NT6A 3FOMA 4Z7OF 4M1DL 5IHUL 2VE6B 3MRLB 4XH2A 5CAYB 4P9ML 4NQDE 4NKMA 3T8XA 2FJHB 3DMMA 1WC7B 3PWUB 5DD1L 3V52H 1QFWH 4PLJD 4LASH 3V4UH 1EMTL 2VZOA 3L3HB 5ESQB 3WLBB 2FLBT 4HUXA 3HR6A 3PABB 3PJSB 2FJFB 4XPAL 2YD6A 4D0DB 1JP5A 4PRIA 1CICA 2EO9A 3RVWD 2VAJA 4NRXA 4DK3A 5HHPA 4PJCF 1QKZH 2W38A 3DBXA 4PRPA 4EN3A 4AEHL 4H0IA 1ZANL 4PJAE 4KI5E 2BOCB 2E9WA 5I30H 2COQA 2IPTH 5KSUA 1PLGH 2EIEA 4NP4H 2DIBA 4LVEA 3TNMA 2CR6A 4K8RC 4C4KT 2PXYD 4Y16B 2AABH 3CMOH 4QHLA 3PQYB 3GI8L 3H6JA 4F9LA 4CVWA 1A1MA 1BQLL 5K9KB 2ADGB 1I8LA 1E4XI 4H26A 5J6GB 5F9OL 4NJAL 5E2UL 2IAND 1U8OB 5F8RC 2DQTH 4KZDH 1GPOH 1NFIB 4HDIA 1CZ8L 1D9KC 4KKCC 1YNLL 5FAAA 1UA6H 3UZEA 4N0YL 3UAJD 5IT2L 5ESQA 1MUJA 5FGBC 4ODTL 5HGAB 2AV1B 4KXZH 2OZ4L 3H3BC 4ODXB 4WUUE 2BXYA 4GKOA 5IROA 3RWIA 1ZAGA 1U3YA 3EJZD 3KPTA 3ULVE 4P49A 3BH9B 4G42B 4J8RB 3P11L 4KK9D 3LQZB 1KIQA 3ULSB 4NZJA 4J6RL 3HS0A 3FT4B 2VUYA 3QULA 1DQDH 1EEZB 4ZNEE 3JWDC 2EYRB 4KK8D 1LEKB 5DVNA 3BWAA 4LKXB 4AZ8A 3VWJC 1A7QL 4B0MM 1Q0XL 2AK4D 4LGRB 4OIIL 3RTQD 1CXFA 4HPOL 1U91B 3ZL4H 4Y19A 4LSSH 1ZWIB 1KUMA 5DMIL 1QLEL 2NY0C 3GI9H 5E24E 1T0PB 1FL3A 1NLBL 3ARXA 4U1HA 4Q9QL 4MXQC 1N6QL 5LWYL 1OAUH 4X6DF 5D1XB 1F42A 4F15C 5JXEA 4GQPH 4WCYH 4M1CC 3Q6GH 3OX8A 2P5EE 1TZGL 3QSKB 4HJJH 3BGMA 2R0KL 4G43B 5JDSB 5GGTA 2A1WH 4IMKC 1J5OH 2LV4A 5JXAH 2ITCB 1YNLH 5DHVB 4GKZB 4UT6H 3QFDB 4NKDA 5I9QC 2NY5C 3MNVA 4V2BA 3TPUA 4G8GD 3UO1L 5C0NC 1JWMB 3PIQB 1TENA 4WO4B 2X89D 4X6CE 1AGBB 4R97C 4YHIB 4MAUH 4I0PC 4JANA 3FAWA 4DZ8B 5I1CH 5EU4A 4QF1A 3RVXD 3W81A 5E2WH 4DGVL 4C59B 1N5AA 3B8YA 5CJQL 2YD7A 5GRYA 4ZODA 2LAAA 2P8PB 4LRNL 4UILL 4NZRL 1OW0A 5IB1B 5D7LE 5GRUH 4I9WD 2A0LD 2J4WL 2JJUA 5F89A 2F74A 3VD9A 5AWNH 1OTSC 2FJGA 2GAZB 1Z0NA 3GSWA 5T1LD 3GSVA 4NN7C 5DQJB 5CEZH 3B2VH 1TTUA 1T1YA 2Z35A 2QEJA 3GJEB 3RPKA 2P1YA 1TZGH 1P5UA 1EXUB 1RZ8A 5E00A 5T3XE 1D6EB 4QHLB 1LO2L 4PJGA 1GOGA 3TNMB 3GM0A 1CTNA 5T1KA 4U6YB 3ZHKA 1G0XA 4N0FA 4DKEL 3MBEC 3C87A 4I9WE 3MRHA 1E28A 3REVA 2AXGB 4L3CA 3OKOA 4X4MA 4EXPX 1FG2B 4J3SA 1AO7B 1MVUB 3MLVH 4HKXA 5ESVB 1NCWL 2MKWA 5EBLA 4XCCL 2WWMD 5JW3H 3O6ML 4CRPA 1IKFH 2PXYA 5IVOA 3ULVL 3AROA 4U33A 1K8IB 3NN8B 2FJFA 1I9EA 4FQXC 2HG5A 2UY6A 5JZ7C 4M6ML 2QR0B 4UI2A 4K2UH 4JPIA 5IVXB 1VKXA 5K9JH 3OR7A 2L0DA 1OTUD 1X6LA 4NM8H 4K71B 4Z7VA 2Z31A 3MRIB 4X6DB 4OLXL 4F15B 4FNLL 4PGCB 2R1XA 4X7EC 3RPIA 4XP4H 3LRSA 1H5BA 4K7PX 2J1KA 3BDBA 4I1NB 4WFHE 2EIBA 4ZTPH 1GGCH 4G7VL 1FNSH 3ES6A 1Y6KR 3M17B 5F9DC 4POZD 2EIZA 3WHE0 3IAPA 4L29A 4F8QA 2Y06H 1I8LC 4L1HA 4RQQA 3OPZL 4DKEH 5D1QA 4MCZA 4HIXL 2CGRH 1ZGLB 5FYLL 3GIZH 1I1AA 4XPHL 2AV7A 3A6BH 3HMWL 4KTYA 3PWPA 4PGDB 3FTGB 1D3CA 5GGQL 3ILPB 3UTQB 5H94B 3VXNB 5HD8C 1N59B 4LAQH 2EYSA 3S4SB 2AXGA 3R8BB 3GKWL 5DI8B 1BLNB 5BMFH 1BPVA 1RUAH 4KI5D 4O9HL 4U6YA 2F5AH 4W6XB 4XC1L 1A7PL 5EBWB 1ZMYA 3TH3T 4MNQB 4MD5A 3KPNB 4HS3B 5FYKL 4GBXD 4N8VB 4QKXB 4FP8H 4L3AA 5EZLB 3VRIB 2Y23A 1Q9OB 4KDTA 1CWVA 3WUWA 5CBEB 1D5XA 1Z0MA 4TOYL 5BZWB 3IDGB 4PJHA 2V2XB 5EC1A 2E7CA 3GHEL 1T03L 1KJMB 2AEIT 3UTSA 3HNVH 4M4PA 4OZFH 4PJ9B 5HHVH 4G8IB 2FGWL 3MROA 5EO1B 1DCLA 1JNLL 2ID5A 2FIKB 3DX8B 4LSPH 1IC7H 4ENEC 5F7HA 1IC5H 4RAVA 3ZTNH 2MQCA 2WWKT 5B38G 4PJ5B 2DWEB 4IRJC 3RA7H 3BZFA 3HE6C 4HIIB 2DQUL 2VXUL 1CXIA 1UACH 2VLLB 5F7MC 3WO4B 1QYGL 5I15L 3MUHL 2VDNL 1A2YA 3UTOA 3DGGA 4WUUD 1AGBA 4RAUA 1M1SA 2UY7A 3SJVB 4EXKA 4ONHA 2V7NA 1EFXA 5I17B 3ULVD 2R29H 1HINH 8FABB 2R56H 2VXSH 4FS0A 5IOPB 4WI8A 5EO9A 2IPTL 2ZCLH 3SDDB 2NY4D 1HIMH 5EOCL 1HHGA 1NMCC 5CLTA 2R23B 3CFKA 4KJWD 1OTTD 1C5CL 3H7BB 1QLRB 2F54A 3L3DA 5CSBA 5A1AA 4XI5C 4TUJA 3SE3C 2ERJC 5E9DA 1AGCA 2ZKHL 5B39A 3TP4A 3JVGC 2XKSA 5BVPL 3SPVB 1T04A 1BFTA 1AE6H 1IAKA 5L2JB 5ID0B 3PHOB 5AZ2H 3UZQA 1SYSA 1B4JH 3MLWL 4NN6B 5HDQH 4JFDE 3IJHB 3MNZA 4PRHD 4GH7B 5IGXL 2P43B 2EDOA 4MCYB 4YNYB 4D0BA 2HFEA 1LEKA 1C1EH 4KRLB 2R2BA 4OM0H 4TRPL 1OSPH 5C0AE 1KTDB 3J8F7 3MV8E 4ISVA 4WNQA 1Q1JL 2AEPL 1KT2A 3RA7L 4JG0L 2R0LL 3PDOA 2OL3B 3ARUA 4XMLL 2ITDB 2BCKB 5E2TH 5TE4L 4X83A 1I1YB 1GAFH 1B0RB 4XNUH 5H2BB 4JZJA 4YO0B 1DVFC 4W6YB 1NCDL 1CQYA 3DVNA 2FZ3B 4RFNB 4HDIB 5TPWH 1T20A 1XGQA 2C3HA 4R90L 3RWFB 4H26B 5GGQH 3N85H 4FZEH 2X4UB 3WS3A 3LN4A 5ICYB 1JYWA 2FYYA 3IDYB 1WEJL 1RJCA 2YN3A 1VFBB 2XV6B 4YHPA 1I8MA 3VFGL 2XXMB 3ROLA 3D85B 5CILH 1BZQK 4OCXH 3U4AA 3V4VL 1DN0A 4BELD 4LHQB 4MA1B 2ICWI 3WHE1 2GQHA 1CDGA 2J5LC 5DUBB 4NGHL 1IAII 2EDWA 4LASL 3TO4A 4BFIB 1CD8A 5IJVA 3QRGH 5IJKA 1UXSB 4Q7DA 3V5DB 3DECA 4OKDA 1E4XH 5C09D 3I85A 4GG8B 3PHQB 2B5IC 3FFDA 4CDHA 2G2RB 3WLBA 1K9TA 1RY7B 2DLEA 1DJSA 3FB8B 3EO9L 3TA3B 1PQZB 1TVHA 3SGEI 1LMKA 5HVHC 3LSOB 2GTWA 1KLGA 4NYLB 2IPKA 2YWZA 3OV6A 1WFNA 2DTMH 4PGBB 3H3PH 3Q2CA 3L3JB 1B6DA 1NDGA 5JLZA 2IH1A 5E9DD 1G7IA 5GZND 3I9GL 2HWZL 3SKOB 2BNRD 3IB4A 4PJDF 2IQAA 2OS7A 3ZKMC 4CADB 3CFIC 5EBMB 2NTSP 4G6FB 1P1ZB 4TNVF 3DVGA 3OF6D 2X1WL 2VZ1A 4J12A 3MRMA 2CH8A 2BVEA 1DFBH 4PB0H 5HI5D 2EXYC 5CEYB 5HHMB 3OKNB 5HGBB 3RGVC 2NXZB 4JKKA 4XP6H 1B0WA 1PG7H 1P9MC 1SEQH 4X4ZA 3LVEA 1OD9A 2CD0A 1BJ8A 5F8QC 5FYKE 1S5IH 1JMZA 1YPZB 2VZUA 1NAMH 1D5ZA 1NCAL 2VLJB 1F13A 4BFIA 2VDLH 2KBGA 1E4WH 1NBZB 4WW2B 5IQ9A 2YRPA 5I1EH 4BQBA 4MAYB 1A8JH 2WWKO 1J0JA 2VQTA 3OJDB 4GRWH 2WK2A 1T1WA 2X7LA 1KTLA 3DUUB 2CDFB 2YZ1A 2Q6WA 3EJYD 3WNKA 1UB5A 5CGYD 3TN0D 2YRLA 1OAUL 1BIHA 1A1NA 3RUGB 3L7EA 4GRWF 3ZDZE 4BZ2L 4APQA 2DYPD 1LNUB 4AQ1B 2V5MA 4YC2B 1UENA 1FP5A 1MQKL 4C83B 4N0FB 3VH8G 4WFFD 4NN7B 1M7DB 5ANMB 2DQFB 4ODUA 2EDYA 2VIRB 5T1MB 5J9PA 1D6EA 1JPSL 1R3KB 1CGXA 4L1DA 1YEJL 2AEWA 4YO0A 3DARA 1EXUA 4R8WH 4XNYL 1JGVL 5EH1A 5KOMC 1RI8A 2YXFA 2HKHL 4AH2A 4DN4L 2BHYA 4P46A 4FZEL 4MA7H 4PRHB 3LKQA 5EU7C 1A7OL 1L4IA 2VLJE 4L4VA 1IM9D 4MQXC 1V5JA 4XP1H 4L8SA 5J11C 1TQBC 4Z7VF 4OI8A 3U6RB 1KCUL 4LCUA 2HYMA 3CDGB 2JJSC 5CP7A 4IMLB 5HGHB 3FL7A 2HJKB 5C0GA 4LSRH 2NPLX 4UOW0 4P57A 3JV4A 2O61A 4OZ4A 5LAXA 1F90H 1IQDA 4RA0C 4M6NL 4WFED 4WV1B 1A1NB 3VFWB 4YWGL 5LBSH 1IAIH 1QSFD 1GZPA 2GJZB 4GMTH 2J2ZA 2X9XA 4KDTC 1S9VB 1KXTB 2LQRA 3UC0H 1KGCE 5J57B 5A16B 3MRKA 2L7UA 4YX2H 1QLRA 2F54B 3EBAA 3TPUB 3MLUL 4H8WH 3VDCA 4GKZA 4ELMB 3D9AL 4XBPB 2ILLA 3LAFA 1SJVA 1KPRA 3GI9L 5LJYH 5IM7B 2YPLA 1OHQA 1EAPB 3SGKC 1QZ1A 3H2WA 3IT8D 4XVSH 4X7SL 5D7KE 3SGDH 1K6QH 2H2PC 5DFVC 5TJWK 4EUPG 5KVFH 3HG1A 1X6NA 4M1DH 5C6TL 5CS7A 5JNYB 5L6YL 5J11B 5LAXB 2IADA 5CKGA 1FZOB 4N9GB 1PKQE 4DFHA 2GFBB 3M1BB 4KJPD 3S97C 4WW2C 5D7KD 1HE7A 1NGPL 1MCOH 2E7LC 4OV5A 3O2DL 4PJEF 4OZGF 4HC1H 4TPRH 4NWTH 4Z7UF 3UTSB 3G6AB 1ONQB 4OZIB 1Y6MR 3BX7C 3BH9A 3FO0L 4G42A 4J8RA 4PJHF 4WTWA 5LQBL 1U8JA 1GGYA 3V6OE 2RCSH 4P46B 3BYYA 5BVPH 1S7RB 4PJXA 4QRUA 1FGVL 1X5KA 2ZKHH 1G7PB 3MV8A 3LH2L 3V5HB 3CPLA 3CGTA 3ZTNL 5E6YA 35C8H 1DUYB 4GAGL 2E9IA 5DYOB 1NUGA 5D7LB 2DL9A 5I15H 1MHPL 3WO3B 1C08B 2CUMA 4GW1B 5SX4H 3CXHK 3NPSC 3IDNA 1MRFH 3FRUB 3VE0A 3ZYZA 4JJ5A 4P2CG 2Q3AA 2B1HH 4NHUB 3TNNA 1FVCB 2BNRE 3L7EB 2D7MA 3TN0C 1D5MA 5DA4A 3AREB 3QWOA 3C60D 3IDXL 1JPSH 1NGYB 3IFOB 3ARGA 2NTFA 5J7CC 2F53D 4A6YB 3C09C 1U3ZA 2VNCA 1NMAH 4HGMA 4QY8B 4XCNA 3LD8C 2ENYA 4RRPG 5E5MB 5DJCA 3D69B 1EHLL 1KFAL 3WSQL 2GCYB 3HC0B 5IQ9B 2CRZA 1FYTA 2CO7B 2ED8A 3FFCA 1A21A 3KR3L 4YHKL 5IROC 4U0RB 1YPZA 3RQ3A 1D5BB 3VG9B 3MOBL 4I3SH 4PJGF 3QQ3B 2C3VA 3VFPB 1AHWB 1EA9C 1H3UA 5INDA 3SDXB 1DQML 1CICC 4YHYB 3U7WL 4LPCA 3O3BA 4QHUB 3MRMB 1S9WB 1PFCA 2E7MA 2IANE 1ZVYA 1I1FA 2QR0A 5I1HH 3Q1SH 1EEUA 1JJUA 2XQYK 5KS9F 4OZGA 5DK0B 1NMBH 3SKUD 5E8DL 4NYLA 3K1KC 3NFSL 1G7QB 1WUNT 2IALA 1JBJA 1KIRB 5L2JA 1E28B 2QADC 4YIQA 1ZA6A 5AD0B 5HXMA 1AGDA 2G60H 3CSPA 3OJ2C 5KW9H 4P5KB 3CVHB 3L5XH 1KULA 1S7XB 4RMWA 4E0RB 2WIIA 4NHUA 3TJHD 3UDWA 3CXDH 1HHGB 1UM5H 2AAVA 4X5XB 5T5FH 5K33A 4GG6E 3VRLE 1DDHA 3STLA 3G6JE 2MHAB 3L7FB 4BK4A 5DYOA 8FABA 4HQQH 1CT8A 2C26A 1RUAL 4I8DA 1YEFH 3VFVA 5B3JE 4X7TB 1Q9KA 1INDH 3UAJC 4DJMA 3ILQC 2H3NB 3L1OH 3S4SG 2WUCH 2YR3A 3PXJA 3QDMA 2W0KA 1JV5B 4S1RH 1UYWH 4LARL 4XCCH 4WU5A 3DXAD 5DEFA 5HDQL 1TDQA 3VXRA 1NSNH 1E4KC 3EJZC 2D4FA 1H0DA 3F7RA 3QWRD 4NZTL 3QIBC 1T1XB 3S35H 4OUUB 3G6AA 1MCBA 2GJ6D 3BJ91 4MQTB 4M43H 1AC0A 3EKCA 1NGQH 1F6LL 2VABB 1IFHL 4N8VG 3ELAT 4JANB 1NSNL 2V2XA 3PGFH 1TNMA 1ZTXH 5INCB 2Q8BL 1MFBL 1QSEB 4AIOA 5I6XB 2FSEA 4JDVB 2IPUK 1MCIA 3E2HB 2C7UA 4MXVF 4ONGL 4PGEB 3WO4C 2GIYA 2PF6A 4LLQB 2GJ6E 3IDUA 4L3EA 5D7IA 3BPLB 3ARFB 2ADFL 3WCYA 3T65A 3BMVA 1UM6L 2VZTA 4Q74A 4PRPD 1U8LB 3SBWC 4X9HA 1A3QA 5C0DB 4XHQA 5DC9B 1NFDB 3LEVH 1QBML 4R4NC 3SDXF 4L8DA 4BSWA 1YJDH 2EO1A 5ADOL 5F9OH 2YEZB 3QI9D 5D1ZA 4OCXL 1F11A 4TSCL 3S7GA 2QSCL 5CP3H 3FB5B 2ZOKA 1IEBA 4FFWC 4PJFF 2HLFC 4JN1H 2FO4B 5I66B 4QXWA 3CUPB 1I1AB 5F7UA 1OAQH 4TNWF 4NQCD 4TUOA 4YQXH 2HFGL 1IGYB 3VJ6B 4KKBC 5HYSB 1H3GA 5JHLL 4XPBL 1T0NB 5GRJH 2NY7L 1DBMH 4AG4H 5AZ2L 4HV8A 4F33A 3SCMD 3UO1H 4GT7A 3QBTB 2H41A 2E8YA 3K8MA 3X3GL 1R0AL 4U05A 1G7LA 1S7VA 3QPQD 1Q72H 3BYTA 5I1GH 5T3XH 1QO3A 4LCCB 1A6UL 3NIDF 2V7NB 1SY6H 3ZMRA 4LPYA 4UNUA 1PY4A 1KTKE 1HH6A 2ZZUT 3DMMC 3G04B 3QJHA 4N1CA 3C2SA 4DGYL 4HCRL 2KDGA 2EEAA 5BO1H 3LKQB 5DUML 3DVFA 1P4LA 4LLVA 3QRFM 1U92B 5CFHA 3MODL 3VMNA 4K3DL 3QG6A 1Z9SA 4JPIB 1MEXL 4W4OA 3PP3K 4JQVC 3FB6B 3O11B 12E8L 1S9XA 1AD9B 3S3SA 1H3XA 3VU2A 3IU4L 3NCYS 4XHJD 5K9KA 4P59H 2C1PB 1LK2B 1JZ3A 2HLAB 1BZ9B 5T1MA 3HG1E 5J9PB 4Y19D 5D2LF 3QUMH 3ZHDA 3G9AB 3SDCA 1Q94A 5HYJE 2AJSL 2BVTA 3ZKNC 4PJHB 3NCJL 4DK6A 4Y1AA 4HKXB 1NGYA 4JRXD 5CINH 1QSZA 2VH5L 1PKOA 5I1LA 4MAYD 2VQUA 3R1GL 3CZJA 3DXAB 3ZYJA 3PWPD 3ZDYF 4PRIB 1IEAA 1V3MA 4BH8B 3D5OF 1EDQA 4Z76B 1I7UB 1BFVH 2G75B 1AKJB 4K94L 5B38B 3AU1B 4PR5B 3UTTB 4YHNB 1RZ8B 1BLNA 3FQTA 4JEGB 3B4NA 4PIRF 5DURD 2XA8H 1S7RA 1MOEA 3RHWF 4APQC 2QHRL 3DMMB 3PWUA 5CZXD 1DEEA 3ULVH 1RU9L 3MRQA 4KQ3H 4OFPA 4QCIA 4N0RA 3UTZA 4EDXB 2CXKA 1A6TA 3EOBA 1TPXC 4JPKH 4OAWA 3VWKB 3W5NA 4I0CC 4MCZB 2CQVA 1Y18B 3PGFL 3QUZD 3TO4D 3WL9A 5IB3A 2EKSB 4GRLB 4MX7B 3QPXH 4RFOH 1AR1D 3IFPB 2DQEL 4JFOA 4U1KB 5C3TA 4KJYA 4DCQB 1FZOA 3TWCL 3IKCB 1D9KD 5GZOC 1HKLL 5FIEA 1KENL 1LO3L 4X6BB 5D2NC 2IFFL 4HHAA 2XG4A 4MJ5A 2K1MA 4MDJB 1UM6H 1JGUH 3MV11 4IBLT 4JFFA 4NN5C 1FL5B 3WIHL 1IBGL 4KU1A 4Y2DA 1UCTA 5IFHH 3X14A 1UG9A 2FHFA 4F2MB 2D3VA 5I1AB 3WIHA 1WAAE 1XH3A 2W07A 3WIFA 1RVFH 1P7KB 2BFVH 4L3ED 3ARGD 2EDNA 1QSED 4KRPC 4FQCL 5IVNA 2JCCE 3TIDB 2DQTL 3PQYE 3NZ8B 1KIPB 4JY5H 4PJEA 4YXLH 4K8RL 4BH8A 1KBGH 2M2DA 3ECBB 3K8KA 1G0YR 4XWGH 5GRJL 3DV6A 1OWWA 3KPLB 5DC4B 2ZSWA 3DIFA 1ZLWK 5FGCB 1T7WA 4KQ4L 4JGJA 2BVQB 3O6KL 3D87B 2FL5A 3TFKD 1MJUL 1Z5LA 3BZEA 2EXWD 4C4KO 1DP0A 3P40A 3CU7A 4FN0A 4MQSB 2GK2A 4MQ7B 1AY1L 1SBSL 4Y5XA 4U6XA 1AXSA 4XNZB 1CS6A 1XGUB 1XZ0A 3BO8B 1FLRH 2O5YH 3VCLA 2P8LB 4GRWB 4OI9A 4HT1H 4LGPB 4K55A 3GSQB 5M95B 5ELIA 4AIZB 3KLHC 4HWBL 3WS3B 3C2AH 4M8QB 4RGOH 1UC6A 3E6HA 2E6PA 3IETA 4Z7QF 3Q1SL 4IDLA 4N0UE 2GT9B 3H7LA 1QFPA 2Z35B 5ID1A 3HRZB 4ERSH 1OAYH 3GO1H 5KG9A 5H37H 3GSNB 4P2RA 4CL7A 3S96B 4CN1A 1QO3B 4LCCA 4CW1A 1CGVA 2DQFA 2IH3A 5HGGS 2OL3A 5DLMH 3SN6N 1MCDA 2YUWA 2H6PB 2X4QA 4R4FL 3TC9A 4WNQB 3RL2A 1INEL 1T5XA 2VC2H 2YD9A 4KJWC 5IBTL 4HKBB 4NQUA 4Y2DC 1DVFA 4YFLF 5GRVK 4OD3H 1FZMB 5I1HL 1YECH 3B2VL 1T1WB 2X7LB 3O6FC 5D2NA 5C0CA 4L4VD 3NZ8A 4K9EC 2PO6C 4MAYA 5D1ZB 5K9QG 2KL6A 4S0TD 3LEXA 1VESA 1D5ZB 2VZVA 2DBJA 3CFDB 3GJFK 3OXSB 4GXUN 1CICB 4QNPE 4UILH 4Q2ZA 4PS4L 5I8EA 1JRHL 5ERWB 3REWB 3QNZB 5CD5D 4RGOL 4YFLI 3BKML 1NCAH 5SWQA 4ZAKC 4Q9RH 3K0WA 4F7CA 4HPYL 4PJ8A 4ZS7H 3SDXE 4NQSA 1H3VA 1HH9A 4FFYH 4NRYA 4JFFB 4L3EB 1OAYL 3GO1L 1YY8B 2DL2A 5HYIA 1UWEL 5D7IE 5FCUH 3V6FA 2IMMA 3QFJE 2I9TA 2NX5A 5HYEA 2ICEB 1RK1B 2GW5A 3QDJD 3I2CH 3IKCA 2X70B 2NNAA 4NQCE 3QDGD 3DV4B 4JO1L 3UYRL 1O5DT 5DURB 4M6OL 5I16A 1ACZA 3IFPA 2DLIA 1FORL 5I2IB 4P46D 4Y4FD 3VI4F 1KJ2L 1URLA 4WDIB 3PWPE 3FT4A 3ZT6A 5JZ7D 4E5XB 2BVPA 3ME0A 1ROWA 4TTDC 3BIAX 1A9EA 5C0FB 4ODHL 1WFOA 3EYOB 3LSOA 4HS6A 1HKFA 3TJEL 4I3SL 3Q6GL 4K3EL 2BRRH 5EOTB 1CBVH 1W0WB 4LNRB 5FK9A 1F45A 2A6IA 4OZHB 2OQJA 3GMNB 1MUJB 2F19L 4CN4A 1TVBB 3IDMA 3PWJA 1UZ6E 2NW3A 2R39A 4J6RH 3F8UB 3NPZB 1GRWA 1TJGL 1BBDH 5CBEA 3WUWB 3DX7A 5HY9A 4UDTB 3C08H 4UTBL 4EI5B 4YK4C 4HXBH 4ZFGL 3KXFE 5A2JH 5J6GA 2D7OA 1RUPL 4POZC 5CJXC 3L3KB 4OTXH 4ZSOB 3KLAA 4ZUSA 4K3GA 5HPOA 4AG4L 4LGSB 1OAXH 3MREA 1IGJA 4IDJL 5DK3A 1BEYH 4L8CB 2B0SL 5EBWA 1T7VA 5HVGB 3O45A 4IIQC 1RV6X 4M6NH 3QEGL 3EOYG 2AVGA 4UQ2B 3P73A 5IB5A 1SM3L 1DBJH 4UINL 1Y0LB 2IMNA 4TULH 4KMTH 4OT1H 4UMGA 1ZHBB 4PJBB 5AZEH 1FC2D 1N2RB 4JLRB 3QO0B 2DM7A 3O41B 4KUZL 4QYOB 5CLWA 3LN9A 1D5IH 3N1GC 4YXHL 4LQFL 4FXGB 4LSQL 3HE7B 1NMAL 3GSXB 3PABA 1A5FL 2B5IB 3WUWG 4UT9L 5EZIL 4R90H 2OZ4A 2CKNA 1P7HL 3HB3D 2APTA 2R56L 2VXSL 3L3HA 4DFIA 2P46B 5C0BE 1JZ6A 4I48B 1I1AD 3RY6C 2LABA 4G9FD 3B9KD 3JV6A 1TZIA 2WBKA 1AIFB 4PJIA 1FZKA 2H9GB 2ZPKH 4PJFA 1KT2B 5ETUA 2OI9B 4O9HH 4PBVC 1WTGT 2V17H 2DMCA 1OWRM 4WI2A 5GHWL 3REWA 4P2OD 2EH8H 1MQ8A 2E27H 1ZLUH 1YNKH 1A64A 2XY1A 4YZFE 2JIXB 1GHFL 3WE6B 5GRZA 3LEXB 4FHBD 2XFXA 4DKAA 5F9AC 1AC6A 1RZFL 3G5VA 1MCJA 3Q5OA 1A6VH 4OD2A 4J4PD 4YPJA 4M48L 4XPFH 5CP3A 5A2FA 1MNUH 3SPVA 1LK3H 3AC0A 3GB7A 3GNMH 3WMSA 5IG7A 4YGAB 5E9DB 2IWGA 2A77L 3GBMH 3H7BA 3W5MA 4L4JA 1IM9B 4U1MB 5DHYB 3WFZA 4XPTL 4U6HA 1BHGA 1G6RL 3RY4A 3WNPA 1X5XA 4WEMB 4O5LL 5HHOD 3RZCA 4C55A 5L8KB 2HFFA 1NEZA 2BSTB 3NCFB 2Y7QA 4S11A 3VXUB 3EJJX 4HJGA 4WI9A 4MSWB 3ARDC 2EYTB 4ZTPL 3T3PF 2FIRT 2I24N 5J89A 3V5HA 3MRJA 4YUEH 2AABL 3CMOL 3JTTA 2QQLL 2RFXA 3OKLA 5C0EB 3QHZL 5M7QA 3BPNC 1NGWB 4G6JL 2A83A 4GBXA 3B5GA 3CLFH 2ZUUA 1CIUA 3FN3A 4PPTA 3QG7H 4KHTL 4CMMB 4GG6B 2CRIA 1MHEB 3C8KA 3N1QC 1BBJA 5IUSA 4M1CD 2DQDL 1KNOA 3NZHH 1KEGH 5KS9E 3CLEL 2IEPA 3RTQA 2DIJA 1TNNA 1ZKAA 5TDNA 1YN6B 1RIHL 1NC4D 3RVVD 1MCQA 3MR9A 4XGZA 4U6TA 4M43L 4PV9B 4QRQB 4YDVB 5DFTA 1SHMA 1F2XK 1CFVH 5DZLA 1FO0L 1ED3A 1ZTXL 3TEUA 4HIEB 1CFBA 1RIHH 1QFWI 2CDGA 1VEOA 2G5RA 3DLQR 1BQHG 2YS4A 4M03A 1CFNA 1L6ZA 1FZJB 2BSED 3BI9X 1L7IL 3HFML 5JIPA 3VWKC 1KC5L 4X6EB 1Z6JT 1X4ZA 3OMZA 5C0AB 3TBSB 2GSIB 5IEHB 2P24A 4D3CH 4GKSB 3VW3L 4F3FB 2VJXA 4F8TA 1MREL 3NA9H 4LAQL 4MJ5B 4RA3A 3FCTB 4U6VL 4RFEA 2AQ3A 3VFWA 5D8JL 4MJ2A 5AYUL 1FFQA 2FR4B 4QXGH 4HWZA 2F53A 3G5XB 4HLJA 3TCLB 2NY5H 1N26A 5I0ZA 5J4MA 2CLRA 1TQCB 5DO2C 1HWGB 4JM2D 3WNNA 2BK8A 2GUOA 3W2DL 5A2IH 5JXEC 3DI2B 3QUKA 1BM3H 1YEDA 2Z31B 3MUGB 4PJIB 3QAZB 2I26N 3V4VH 4GLRI 5IESL 4PTTA 2R0ZH 3RZCC 3P4OB 1YMHB 4ODXA 4X8JA 2NY4B 1VKXB 4Z7UB 3BPOC 4AMKL 3CFJB 4LCWB 4NM8L 2X4NA 1F3JB 1LK3L 2OM5A 3KYMA 4RMVA 3QZWA 1DQJA 5ALBL 1T3FA 1WBYA 2A77H 5D70H 5FDWB 2OJZH 1MFNA 4N0CD 4KAQL 5FYKU 3IFOA 1CU4L 3RVWC 1WWBX 1Z9OA 3RWEA 3QCUL 5IBLD 3LKOA 5E6ZA 1OARL 1KPVA 1FRGL 5KSBB 1ZE3C 3I75A 2D7TH 3GJFB 4K07A 2J8UB 1QLEH 3L3IA 1LE5B 4R6UA 3H9ZA 4V1DD 3AS0A 3GMOB 4YXKL 5KSUB 3HHRB 3I3DA 2X5PA 4IOIB 4L8CA 5JR1L 1C5BL 4JGMA 2D0HA 4EBQL 1GAFL 2V7HA 1NAKH 2NZ9C 5T3ZE 3HI6L 2JB6A 1WIPA 3EYFB 2YPVL 1CN4A 1R3HA 3NAAL 1MF2L 1QBLL 3MGOA 3VXSB 4F7PA 1Z2KA 3V8OA 4QLRA 4NQED 1PVHA 4QHMB 5E70A 1MCEA 3VI4E 2BMKB 1ACYL 4YGVA 1ZOXA 5ICXA 5MERA 3MLRL 2FBJL 3MBEB 3QUKB 5CSZB 4XTRC 5IGXH 3KPQA 3IS1X 5BW7A 5IV2A 2WLZA 2LE9A 4LF3B 1MFAL 5C0CE 3SJVD 1CK0L 1P1ZA 4YHOH 1FNHA 5FECB 4M1GL 4NT6B 2ATKB 3BDYL 4XMLH 2O5YL 1JNNL 3C6LC 1Q1JH 4CMHB 3ESVF 1F3DH 2ZUXA 4FQXB 5JW4M 1WCQA 4X6CA 3X3FH 1S78C 1MCHA 1HNGA 4I13B 4NQEE 4OTXL 5F6HJ 3D2UB 4M7LT 1JYVA 2MMXA 5I8CA 4KZEH 3QEGH 4K7PH 1NC4A 3MMEB 1T0MB 5D9SA 1QUNA 1FPTL 5DUMH 5ADPL 1K2DB 4FFVD 4ZYKA 1EO7A 5FUOH 2P45B 1W2KT 5BCAA 3VD3A 1T4KB 12E8H 5EC2A 3F62A 4MA8L 5L2KB 4F9PA 1N3NB 5CWSB 1CF8L 3EZ8A 1RUKH 2Z8WC 5J3HC 2XQBH 2IG2H 2C7UB 3NABL 5EIIB 2RHEA 1UT9A 1A7OH 5DFWH 2P5ED 4C56E 2YZ8A 5FB8B 5T33H 2CUIA 4HAGA 4QHNA 4HX1A 4YHZH 4XT1C 1KNOB 4BQ9A 2G9HB 4P9MH 3GJFH 3RIFF 4WW2F 1G9NH 4J23A 1NGPH 3JWDL 1YC8A 4U4BA 4C54A 1NCBL 4FABH 4JRYE 5DJ0B 3QULB 3THMH 4GG6A 1MLBB 4NQEB 5FDYA 5LGKA 3BT2L 3OXRA 4LIQE 4ZFFB 2DDQH 1HOCB 3MODH 5GS1A 3MLWH 3VXMB 1EVTC 5KN5A 1MIEH 2B1AH 4AY0A 2R1YB 2VSDA 4HK0A 3WNLA 5GS0H 3QO1B 3HZYA 3H0TA 3MV9A 4XCYA 1KPUA 5DT1H 3P0GB 3S37H 2V9TA 3KJ6L 4LRIA 4XB8A 3I84A 1YN7B 1I1YA 3MJ9L 1DSFL 4OCMC 4ODUB 3T2PA 5C6WH 3ULUH 5EZIH 3D9AH 3E6HB 1UVQB 4IHOB 5CJOH 1I7TA 4HMCA 5D2LB 4NKOB 2J6EL 1Z3GL 5BVJA 4QRTB 3GDBA 3KJ4C 2F54D 4ZUWA 4D0BB 4P4RB 1WIUA 1MRDL 1BQLH 1ORSB 5AD0A 4G8GE 4X5WB 1AR2A 1M6OA 3RNKA 2PW2A 5DLML 4MD4B 3T1FA 3FQRA 4ZAKB 1QLFA 1XF3A 3S5LB 3HC4L 3RWJA 3X12A 3F7PC 4M6AA 4OLYH 5K9JL 1RZGA 2F15A 3WN5C 3MLRH 3M8OH 5FV2A 1BVKA 5J1SC 4DWHA 3GFUA 5GZOD 1OCWL 3TBTA 3QIUB 4D94A 1JF1A 3O3BB 4LSDA 5B4MD 3D39E 1EFXB 2UWEF 4P5TD 4OGAD 1I75A 1ITBB 1UM4L 4G3YL 2V2TA 2ENSA 2VTFA 2R8SH 5J13C 1OGAD 5TH2A 3BZFB 4Y5XC 4FFYL 3VFPA 3C9NA 2IH1B 3GMLB 5E8NA 4FZ8H 1P5VA 4KRPD 5FYLH 1NGZA 4QRSA 4JFYB 4FTVD 4P5MB 2EDDA 3FQNA 1F58H 1RK0A 2BVOA 2DWDB 4PJBA 2UYLB 5MEOB 2NW2A 3X11A 2XNAB 4PRNB 2Q7NA 1INQA 1HHKB 1OVZA 5EC1B 2EE6A 4L8BB 4A6YA 4S1QH 3GRWA 5FYJD 1BJ1H 5SWZB 3MLYL 2WBJD 1S7WA 3VW3H 1J05B 2A74B 3MGOB 3IDJA 2XG5A 5T3ZL 3CXDL 2GITB 1WT5A 3KLAB 3OSKA 4ZUSB 3T4AB 3AMKA 1J0KA 1FBIL 3AU1A 1TLKA 4TSBL 5GSRB 5T1LB 2OTUA 2VXVH 5GJTH 3GSRA 4XVJH 1SBSH 2NXZC 5SX5K 4M6MH 2YXMA 5T1LA 4Y4HB 1T5WA 3HCVB 4GAYB 1N64H 5LCVH 2ICWA 5KZCD 4S1RL 4UNVA 4JY4A 4JZJC 2UZIL 5EULV 3HPJA 5IMOB 1JK8B 1X5ZA 4Z7WB 1CE6B 3ZTJG 4JM2F 4MXWH 2X4PA 3PQYD 4IRZL 1XR9A 1LP9B 3PE9A 5L88H 1T20B 3O2VL 2IAMA 5JIHA 5FYKD 2P5WB 3C5ZB 1UJ3B 2NW2B 3X11B 4NNYB 3NIDE 3LB6D 3T0AA 3GMRA 4R3SA 3OQ3B 1HIML 1JWUA 3F7QA 4LIQL 3C9NB 4K8RD 4R4FH 3SKJH 3HUJA 4YDJB 4AYFA 4S1SL 5DD6A 4NJ9L 4JB9H 2DM3A 1KEMH 1YZZA 5DR5L 1KYOJ 4DOHE 3GUTB 3SE8H 2BHUA 1J1OL 1EBPA 3UPRA 1NGXB 3ZDXF 4OLWL 2MPAH 3WIIL 3TO2B 3MRDB 3KPRB 4YBQD 3QIBD 2BC4A 2XA3A 3FMGL 2DF3A 3CU1A 3K4AA 4R7NB 4ODWB 4ELMA 4HCRA 5DEGA 3NCYP 4JHBA 5F96L 5IP4A 2YMXL 1JTPA 5C0BB 3SE9H 4HKJA 1FFNA 4YHLH 1PX4A 5D2NB 3GI8H 4UDUB 2RCSL 5I66A 1MWAH 5AAWA 3BKJL 5EZOL 4DVRH 1OCWH 4QWWD 1KG0A 5IEHA 2JJTA 2AEPH 4U7KA 4AM0B 4NO0A 3VGHA 3QIWB 4HULB 4M48H 4OZ4B 3O3AA 1I9IH 4LDOB 1UJ3C 5D96B 2KQNA 5TE4H 1ES0B 1YEEL 3VXOA 5SV4A 2PNDA 2R8SL 3IGAB 1OP5K 3V6BR 1WZLA 2OTWB 4PJGB 1A6UH 1BAFL 3EFDH 2ZWLT 4RAUB 4OGAC 5CHNA 4OBSA 5JOPD 4UINH 4J4PA 2NQCA 4JGUA 2W0PA 5EUKB 3QHTC 4FFWD 4E41B 4WUUB 3QUXB 4KZEL 3P77A 3OB0K 4PTUA 2A9NH 3QCVH 5GXBB 1G1CA 5IVXF 2XWJA 3ZL4L 5IFHL 3HZYB 1CDJA 4X9GA 5J12C 5T5NF 2P8LA 3L9RB 4NSKA 3FQWB 4H20L 3EYSH 4JCMA 4Q9QH 4ZNCD 1UFUA 4XRCA 4PREB 1BMGA 1WZ1H 3ZYOA 4TYUA 4YDKH 2XRAH 4NKIH 5ADOH 2Y5TA 2F5AL 1IAIM 4Y4FA 1Z9LA 5JMOC 4RGMC 1JHKH 1KJVA 3EHBC 3QQ4A 5K93A 1KLUA 4QHKI 1RZJH 1KIUA 3VDAA 1T5WB 3BDYH 1RHFA 2E8ZA 3PP4L 1EVUA 5GGUA 3V4UL 1MHCA 3OJDA 1J8HB 2Z93B 5DD1H 3BFOA 2CK0L 3VXTB 2P5EA 3FT3A 2ITCA 4MNQD 4OM0L 5C7XH 4HZAA 1TQBB 1T03H 1G9NL 2RQ8A 4OSUL 3IDJB 4RMRA 1L0YA 3D3VA 4FTVE 1FVDB 5CUSL 3OX8B 3ZKND 5ITBH 2FGWH 1VA9A 2FGZA 4YIQB 3CVIH 4U1HB 1DANU 1NUNB 2GEEA 4YR6B 2WLYA 2O5ZH 3QIBA 3MLZH 3QDGB 1JGLH 2N7AA 5HI4D 1NGQL 1U91A 1PLGL 4NP4L 4RMUA 3QI9A 2QSVA 4U1KA 3D39D 4QNPF 5BQ7B 2PYEB 4FQXA 5DK0A 2MJWA 5IF0B 1U8QA 4DQOH 5LG1A 1IT9H 2XRAL 4NUJA 5D6DC 3DO3A 5AYUH 1NAKL 4U2YA 3WNMA 3KYNA 5IBUB 3UTZB 5L6YH 4JVPA 3F65A 4JRXA 1IGCH 2DQJH 5HGAA 2Z31D 5JIKA 1N6VA 1I3UA 1BX2B 1U58A 4FQXD 4H1LH 3GSNH 4JAMB 3UJIL 3GSXA 4NPYB 4GG8A 4NZTH 4FQIL 1RURH 2IANA 1I85C 3BOVA 1IGIL 3BPOB 3RWCB 4PRBA 3T2OA 1DVFD 1HQ4B 1I8IA 3O0RL 1BZ7B 1MJ8H 4KDWA 4Y5VB 4YQXL 5E5UB 3OKOB 5K59E 1YEEH 4LU5H 5GRVL 4TOYH 3HN3A 3AXLB 4Z6AT 3X3FL 1ZLWH 3NBNA 2ZG3A 2ZCKL 2P5WD 3C5ZD 3AXLA 3KWWA 4ZUWB 4HS8H 5GSVA 3VXSD 4EDWH 3EJYC 3KPRD 4R7DB 2VDOL 3MJ8A 3C2AL 4R8WL 2IPUG 2HT2C 1LK2A 4M61B 4JJ5B 3LKSA 3K8LA 4NRXB 2E9BA 4IJ3C 4NCC2 5AG9A 3O3EB 3STZA 1MPAL 1TITA 3CZFB 3C6LA 1E4JA 1KN2H 1VDGA 2VLRA 5FKAA 5KVGL 3JUZA 1ULVA 3OJMB 2QL1A 4WEBL 1YJDL 4L4TD 2F9BT 1BVLB 3PJSA 4M3JA 3RVTC 1F5WA 3PL6D 5MENE 2X6MA 3D25A 3AAZA 2HT4C 2J8UE 2Y9RT 2VDRL 4M7KH 5I74B 1MREH 3QI9C 4CU7A 2ZJSL 2HVKA 4PJ7B 3DTXB 3AS2A 4M02A 4QXGL 3GMQB 1G6RA 2VE6A 3P9MA 5ESAA 1YEDB 1N5AB 1NC2A 2HLFD 3MOBH 4HIHB 3LD8B 4OF7A 3BKCH 3MLYH 4QHKJ 3NIFF 2VDQH 2QJDA 2Y5EA 2UVEA 1MFEH 4TUOB 3O8XD 5KS9A 3TBVA 1CR9H 4DZBA 1CFQA 1YPZF 2FO4A 4G6KH 4RDQG 1CXKA 4HAFA 3IJHA 4XP4L 3SCMC 3BKCL 5D6DA 1MI5E 1NLDL 3MNVB 4PY8I 3X17A 1ZT1A 3OR6B 3QIBB 3WJJC 5ID0A 1QFUL 4Z9KB 2J4WH 1XIWA 4NBXB 1D9KA 4BYHA 5DJZA 3BP6A 1QRND 2ARJQ 1H3WM 4XPGL 1FVDA 1K4DA 1P4IH 5F93C 4NQVB 1X5AA 2ZUQC 3CFKB 4JFPA 5JPNB 3ARFA 5BXFB 2ED9A 3I3EA 3O3DB 5EG6C 4LOUD 1WV7T 1T0MA 1A3LH 4XMPL 2HKFL 3KPSB 2PXYC 4HLZH 32C2B 1S8DB 1WBXB 4KUCD 4ONHB 5DTFB 3T2QA 5IMKB 2APBA 3L3OB 1QVOB 3EIFA 3BWAB 4LKXA 2BRQA 4PJIF 5I9QB 4MS8C 4Q6IA 2CMRH 4NM4H 4HC1L 3KYAA 4XMKH 4K94H 4O2CA 1AQKL 2QADB 3RTQB 1NJ9B 3D0VA 3MFFA 5B3NA 2QV2A 2VISA 3HE6B 3HLAB 3O9WA 4J1UB 4OLYL 5CD5C 4N1HB 1EFXD 3QUMB 4LCUB 5BRZB 3RX8A 3VFNB 1NBYA 2I5YH 4OQTH 2BFVL 3BEWB 1A4JA 4ZO7A 3HG1D 5MERB 4J3VA 4ZO9A 4UV7H 4LHUA 5BZWA 1ODAA 4ZMAT 2ZG1A 3B9KB 1UB6A 4M7LH 2ADIB 2VN7A 5ID1B 4JM2A 4GS7B 2FEEL 4JHWH 2JB6B 1PEWA 5HI3D 5CZKA 5I73B 3VWJD 3DJ9A 4OCWH 3GSQA 1RUQL 4ZDHA 4ODSH 3BP7A 4Q9BA 3UBXI 2VXUH 4OKVA 2BY3A 4D9LH 1KCRL 2DLFH 3MJ9H 2Q7YA 1KFAH 3VFTA 4Y89A 3DETD 1OM3L 4I18B 3W39A 1KPVB 1IM9A 4YUEL 4NKQB 5TDOA 4HUVB 2OJEA 4Y5YA 2DIAA 3B9AA 3MTRA 4BH7A 1CE1H 4I0PA 4QTHA 1CZ8H 5E8OB 3HUJE 3U46A 5E6IC 2MQ0A 1Q9WB 1QBMH 5C0BA 3NCBB 4P5TB 1U8KA 2R1WA 2F58H 5C2BL 1A5FH 2A1WL 5GRXG 1CGSL 4DN4H 1BX2A 1U58B 1VHPA 5GGSA 5C86A 5J8OA 1WAAF 3T0XA 3SCMB 3G5YA 3NABH 5E8EA 1S9WA 5MEQA 4CU8A 4MA3A 4F2MA 3UPRB 2YUZA 1CF8H 2YD5A 2CIKA 2N56A 3KHOA 4PGCA 1BP3B 3EGSA 1TVDA 3BQUC 5ETUB 5FGSA 4GSDH 4PJ8C 5CEYA 5I19L 1SYVA 3S3JA 3EOTH 2VXQH 1EEQA 3P30H 1FG9C 3QQ3A 2X4OB 1EPFA 1HDMA 3BT2H 3GMPA 2EXWC 1FH5H 3TVMD 4CU6A 4IRJB 4ODSL 1U36A 2MFNA 1YYLH 1N8ZA 3SKOA 3RJDA 2R1WB 4GRLA 5CCKL 3VGAB 3KXFB 1LD9B 2PXYB 2IAMB 4Y16D 3K2UL 5GS2H 4BSVA 1MWAB 3MLUH 4GRMA 5FCSH 2MQ3A 3J7HA 4XX1G 2Q76A 4FQHB 4X7CC 2F53E 1TVHB 3T08A 2HKFH 1CCZA 4HIXH 4OLVH 3T0DA 3AUVA 4MZ3A 1S7TA 3S3PA 3TBYB 3GIVA 2H32B 2QHLA 4JKLA 3W0WA 4LCIH 4DEPC 4XPAH 3ZKMD 1UWEH 5FCUL 5I1IH 1AKJA 2JB5H 5JHDD 1RMFH 2YBRA 3AS3A 3BEVB 3MBED 3RGVA 4JFEE 2AJZA 2DLHA 4JRXE 3PGCA 1HCFX 1AQKH 5MHSD 5B8CA 3QDMD 4LLWB 5E94B 3ZE2F 5C2UB 1AGEA 1CG9A 2Z91B 1F8TH 3QEHA 4R2GD 4EI5A 2FD6H 3BQUB 3ORJA 2OMBA 4QT5B 3CVHH 5FO9B 2XZCL 4KKLD 3SGEH 4IIQA 1A4JB 2EECA 4IOFD 1NCCL 1Z9MA 3VFNA 2ZNXA 3OGOE 3O6FD 4LPUA 1ZS8A 4O51A 1OF2A 4XTRD 3C5SA 3MYJA 3U7AA 4EN3C 1IFHH 1HXYB 3I6KA 2D03L 3O11A 1HILA 3ARDB 3BXNB 3GZKA 3U0PB 4S2SB 2YSSA 4CAGA 5L88L 4E41A 2ESVB 2BOBA 3F12B 1G9EA 2YHGA 5C0EA 3FRPG 4DZ8A 4XB7A 3V9FA 4DW2H 1PZUB 1ZVSB 3SO5A 1OARH 4JO3L 4OF8A 3LS5H 3JTSB 4HJ0D 4F7MA 3EO1A 1FIEA 1FYTD 3FFCD 1UXWB 3EYVB 3B83A 3G5YB 2P5WE 4QEGA 4WTZG 3QUYB 4S1SH 1RMFL 3U0TB 1U42A 4NRYB 1EV2E 4EBQH 3TFKC 3LS5L 2WBJA 4HIJB 1U8KB 2DKUA 2R2BB 1EHNA 1K4CA 3W9EA 4XNZC 1HK6A 5IMMB 5KVMC 3WKML 3OXSA 1YEHH 3U36A 2ZOKB 4BH7B 3UYPA 2C9AA 1GZPB 4FQQB 3ETBF 5J3HD 3BVNB 2VLRD 3HAEH 5CMAB 4M7JL 1YEIH 1IQDB 5JOPE 4RBPH 2YEZA 4OZHF 3PDDA 1FZMA 4TN9A 5HVWA 1CFQB 4YEEA 3BZ4A 4OB5L 3ZE0F 1CFVL 4Z7NE 5F3HA 3L3DB 4QRTA 1UWGL 4LRIC 4UUJB 2EYRA 2FX8H 1ZGLP 3QRGL 1WFTA 4L9LC 3T04D 3T65B 5ALCH 3TA3C 4LVOC 4NFBA 4LSTH 2PO6B 3SDDA 4KQ4H 1G0DA 4HS8L 3ARRA 4EDWL 5IESH 4XP5L 3VMOA 1UXWA 1LQSR 2GI7A 4XVTL 1YN7A 5ITBL 2J8HA 3SJVA 4WI4A 2QHRH 2AXFA 4NO0D 1XF2A 2DDQL 4TVPE 1N6QH 2W9EH 5MI0B 3AM8A 1KTRL 3QJFB 4NQDB 1QRNE 2ESVA 5HPMA 4JDZA 3QQ9C 1IRAY 2ADGA 3I3BA 2HWZH 1PSKL 4WCYL 1H3PL 1NCDH 1OGAA 1JHTA 3QH3B 4PJDA 4XHJC 3F7YB 3F6IA 1JNHA 3ULVC 4JZNB 1CXHA 4XCFH 1QVOA 2DJ4A 2EE2A 3FO9A 3LQAH 3MNWB 1OAZL 4KFZC 1RUKL 2CIIB 1X4XA 3PV6A 1C8PA 2EC8A 2FECI 3D18B 3MREB 4XVSL 2HN7A 3DBXB 1IGML 1B0GB 4G6MH 1DLHB 5BXFA 4UNTA 5TQ0L 2PKDA 2DB8A 3UX9B 3MRCA 4G8GA 3E3QC 1QQDB 1ZHLB 1A6VL 1ORQB 4LCCC 3NA4A 3O9WD 4ODTH 4PRDB 1A22B 5D7JC 2FJHA 3F7VA 5J1TC 4HK3J 3TBWA 4XH2B 1CQKA 3LRGA 3RIAK 4W6WB 1ZA3A 4E5XA 4LCYA 2AKRA 3DX9B 1KN4H 1VGKB 4Z7UE 1LO5B 2FB4L 1BGXL 5CEZE 1ZSDA 3AY4A 4LKCA 4OI7A 4U1NB 4PGJA 3HTLX 1MVFA 2I27N 1MIML 4FQLH 1YQVH 5FKPB 1MI5B 2HRPH 2VLKD 3QHZH 3QIUC 1FVEB 4OJFH 3IXAA 1RAMA 25C8H 3RPIB 2UUDH 2AK4B 4N0YH 4NQCA 1L7TH 2EDLA 5F7DB 5L8JB 4EDXA 3F58H 4RGMB 4YXLL 3FOLB 3FFDB 2XY2A 5MEQB 1CFTB 1SMAA 1JWSA 5ILTL 4HGWB 1CBVL 3FQTB 1CLZL 2F5BL 3P2TA 2DQJL 5TGBA 3TO4B 4KVCL 1MCPL 1MLCA 3GIZL 1B6UA 3FKUS 5DUPL 1WZ1L 4JHWL 5GSVB 2BY0A 1CGSH 1KXVC 3MNWA 2X41A 1R5WB 5E2VL 1MCPH 3AREA 3Q3GA 4LSSL 5TDOB 1DTUA 2WUBH 4CVXA 1NCUA 1GHFH 3CH8A 3HB3C 3TNNB 1WIOA 5EA0H 4I4WB 5F1OB 3RVVC 1KN4L 1GSMA 4JFQB 2VXQL 4XZUA 3QNXB 1X5YA 2AK4E 3RUGF 2O93L 4KKNA 3NACH 1XF2B 1IQWH 5E00B 5DJXA 1JRHH 1A3LL 1NAMB 4OT1L 2JE8A 5CGTA 5DZNA 4ORZC 3IFNH 4QRUB 3CFEB 4KK5D 1LO4L 1JE6A 3DVIA 3LPWA 3HRZA 1MCCA 5C1MB 3MGTB 5DDHB 4PTTB 1A7BA 2AJSH 1BIIB 1K3IA 4OCLC 5HHXH 1QEWA 2HKHH 3BKYH 1QKZL 3EFFA 1A0QH 4XNQA 3F5WB 1JHLL 3SDAD 1IC7L 5IBTH 4F7EA 3B6SB 3G08B 3T3MF 5E8PB 5HI5C 4NHCL 5J1AB 3HE6A 3O9WB 1S7QB 3M1BA 5JW4R 5C0ND 4UTAL 3QEUA 2DQUH 3UBXB 3E0GA 3MC0A 1M4KA 1FFPB 2YA1A 5E1AA 4DAGH 5IVXE 5ICZB 1MCRA 2EDJA 1G9MH 2ZP0T 4OQTL 1QFWL 4DVBA 3V6OA 4J3TA 2DI8A 2W91A 2ZSVB 5TF1L 1QBLH 5DRNB 2EDHA 5C0AA 3TBSA 5FA4B 5JOEA 1I4FA 4XPBH 2OLDA 5IKCB 1FNFA 1K2DA 3IAQA 3TYGL 3S98A 4MA1C 1CFNB 2JELL 4JVWA 3I6LE 4P99A 2NR6D 2A73A 3O2VH 4LSVH 3VXTA 5IBUG 4K7PY 4HIEA 5C9JB 1YEKH 1RZ7L 5I8OH 1FCGA 4X4XB 3OB0H 3V0VA 3U48A 1C12B 1DQLH 2VLRE 4Y4KA 3RWGA 3B5TA 3MV8D 1EEYB 1IJ9A 1YN6A 4D0CA 3NFPA 1M71A 4PLNC 2FSEB 2WINA 1ZWIA 3I6LD 4MWFB 3JV4B 1BQHA 5FHAL 4M62L 2DAVA 2OR8A 2W9DL 1EHXA 3ZE0E 4KVNH 1U3HA 3C5SB 1E6OH 3LMJL 2X4RB 4HG4K 3HMWH 4NC0B 5T3XD 4ONGH 3RTQC 1PGRB 1YA5A 2PN5A 2ORBL 2VR9A 4WEBH 1F02I 5F9WB 2E6QA 2H26B 2BY2A 2BMKA 2QQLH 3OG6B 1BIIA 4TTDD 7FABL 3RY5A 1RIVH 5LVEA 3WKMH 4KWUA 3K4ZA 2K7QA 1UADC 3MRPA 1FO0B 1HQRA 3FO1B 1T83C 5H35B 3U4BH 4HS3A 2I60L 4GAYA 3PG2A 4ZUUB 2GJ6B 3QG7L 2HTLD 1UQSA 4JFEB 5FGRA 3KNBB 5SX4I 4XBGB 4LPTA 3L95B 2YBRB 3BEVA 2VLRB 5FKAB 3LKPA 3SKNB 1C1EL 1PZ5B 1A1OA 3IDIA 3L3IB