1YEEH

Structure of a catalytic antibody, igg2a fab fragment (d2.5)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
EVKLQESGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRAAAGLEWIARIYPGTGSSYYNVKFKGKATLTADKSSSTAYMQLSSLKSDDSAVYFCVRWGFIPVREDYVLDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A FAB FRAGMENT (D2.5)
publication title Structural convergence in the active sites of a family of catalytic antibodies.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeH02
1KN4L 2MJWA 5I71C 2XIDA 5K9JL 2A73A 2VDQL 4AIOA 5EC1A 3ULUF 1NFDF 5D1XC 1OCWH 1U3HC 1QFWI 3OHXB 3CDYA 4MHHG 1IGML 35C8H 2ATPB 4GLRI 1YY9D 1YYLH 2P8LA 3VW3H 1H3WM 2AJSL 5CHNA 4PJXF 1D6EA 3IJHB 4FMKA 1XGYH 5A2JH 3N06B 5IF0A 2OP4H 2NY1C 1A14L 4UT9L 3OKNA 5DJ2A 3O3BB 2HJFA 5MEPA 3B4NA 5EBWB 3FRUB 3L3KB 1VEOA 4G9FA 4RBPH 5J1AA 4YFDB 3UPRA 3QWOA 4OCSH 4I18C 5T1KD 3OXRB 3QIBD 1D5BB 1JTOA 1PYWA 1U6AL 1AY1L 2BP3A 3BEWA 2C1PA 1BD2D 3QPXL 3C09C 1S9YB 2UY6A 5DC0A 2R1WB 1JZ6A 3PE9A 4PTUB 3UJIH 5F7WC 3TBTB 2IQAA 4YZFF 1NEUA 1G0YR 1FZOB 3H6JA 3BO8A 4N0CC 3VFMA 1KBGH 5ESAB 1MRCL 2PCPA 3OGCB 4U33A 3UZQA 1RIUL 3QUXC 4LBEB 5IW6B 3RZCB 5F7DA 1MHPL 4G9DA 3V6OC 2BFVL 1AIFB 3R8BB 1XGQB 1TITA 2AJYH 5FHBH 1IFHL 4JO3H 3ECBA 3CVHB 3FB8B 4N0UA 3SBWA 3QXAA 3IDYB 4PBWD 1G6VK 3MFFB 4PJ5D 1MAJA 1P4BH 3K2UL 4LL9A 4GG6B 5IEHB 2JJTA 2IGFL 12E8H 4HIXH 4OLVL 1ZA3A 4LPCA 3SGEH 2N7AA 2YEZA 2XI9A 2IQ9H 5FCSH 2EYRA 4YPGA 2A6JA 5CILH 3RWCA 5FYLH 3R8QA 5I1KH 3GK8L 4PV9B 4DKEL 3P9MB 4WTXA 3MRPB 5TQ2H 4QTIL 4LLWB 3AM8C 4OGYH 3WJLA 1TZIA 5CSZB 2UWEE 1MCOH 5JHDE 1MEXH 1HXMB 4RMWA 5D2NE 1VFBB 2YMXH 4LSPL 5E6YA 4XP1H 4I4WA 3KPPA 1UKTA 1INDH 1I1YA 4OCYH 4X6CE 4J4PA 4NQEB 3VJ6A 3RVUD 2DTML 4P2RE 2B0SL 4CU6A 2X1WL 5C70A 2NY6C 4X80L 3VXSA 2IF7A 1FL6A 1EV2E 4Y2DB 3WIHA 2FZ3B 2AJXH 5CLWA 3LPGA 1O5DT 3L3IA 3TA3A 4Y4FD 5C0FB 3RFZC 4OLWH 1MFAL 3GSNH 4JY5H 3MLPA 1LE9B 5F88B 3CUPA 2R56H 2BJML 4X9FA 4ODHL 1R3HA 1CICB 3GKWL 3VG0L 4Q9RL 4H88L 2GTZB 4OFYD 3U83A 1JPGA 1HWGB 1JPFA 4OLEA 4J12A 3TT3H 4Q9CA 2BCKA 5GSRA 2R29H 2VDNH 3PHOA 3SJVA 1NEZA 1BQSA 3CH1A 4PGBB 3SY0A 4PJIA 2ZCLH 1BGXH 1IKNC 5CFHA 1BQHB 4KJPD 4WW1A 2R0LL 5CD5C 1DLHA 1HK6A 1NMBL 5IK3B 1U36A 1NUFA 3NIDE 4XNXH 1PQZA 3OB8A 2DM7A 4MDJB 2DD8L 3HMXL 5ILTH 2OQJA 4R2GD 4XP5H 5C6PB 1EBPA 5H94A 2I60H 1PLGL 3RQ3A 1QHOA 3F7QA 4YWGL 5KSVA 2WMPA 4U1KB 3MJ9L 4ODSL 4NQDA 4NQED 4BK5A 6CGTA 1FSKC 4YXLL 4KI5C 2YPLE 3U4BH 1XF3B 4MAYC 3U0TB 4M61B 4Y2DD 4LHUB 1FCGA 1XCTA 3BZEA 3N1QC 2QADD 4M7JL 2FHBA 5EU4A 2FATL 5IB3A 3SDXB 1CWVA 3LRSB 4FZ8L 5MI0C 1MLBB 4YHOH 3ARUA 2H2PD 1RIVL 2FGWH 4JO4L 5GGRY 5KVEL 5FO7A 1E28A 1PZ5A 4PJ8D 4XVSH 3T8XA 1RJZB 4PGCB 4G43A 2G75B 1EVTC 3HG1E 4UOW0 1CICD 5CZXD 3O9WA 4Y5XA 5E5RB 3L3JA 2YD3A 3MUGA 4LDEB 3FT4A 5DVNA 3BZ4B 1S9VA 5IOPB 5EOTB 1S7TB 4DN4L 3TN0B 1UEMA 2LV4A 3I2CH 3MLZL 3S5LG 5T1MB 2ADJA 1UKQA 4HPYH 3U0WL 4YHIA 1IGIH 4JKLA 4FHBD 4WWKA 2QR0B 4JPIA 4HIHA 3QXUA 4KK6C 5DYOB 3X14A 1CLOL 1ES0A 1F4YL 5A2KH 5DD0H 4E41D 5EWIH 1C12A 5GGRB 2X4TA 4PJEA 1PKQE 1VADA 5EO9A 4M62L 5EOCL 3TC9A 2VITB 1IAOA 1ZV5A 1I9RL 2KBGA 2Z8RA 1DP0A 2R1YA 4FQHA 3L5IA 4HH9A 3V4PH 5K9OB 4XCEA 1A1OA 5EZLA 3SGDI 2AEWA 1LO2H 1WBXB 3D85A 4JM2D 3MUHL 2GSIB 2W38A 2YUWA 3QO1A 3QWRA 5DHXB 5HHPA 5JQ6H 4XXDA 5DQDL 2P4AB 3VRJB 2XXMB 4FQIL 4G3YH 1J1PH 5EA0L 4C83A 4JPWL 1IAKB 3KDMB 3L1OH 5D1XB 4ZFZB 1QBML 1YECL 1A1MA 4ZMAT 3NOIA 3HNVL 1AQKL 5J1TC 5ISZE 1E4KA 2PYEE 5CIPA 4XMPL 4FQXA 3D25B 4MAUH 1RK0B 4Y5YA 1UJ3B 1SM3L 1SJXA 4Q0XL 1J10A 5DUML 3OWEA 4D0CA 1N4XH 2VISA 4G80A 1FIGH 2NY1B 1P84K 4BFIB 5CJBA 2J3SA 1XF2A 1VKXB 1UC6A 3MYJB 4OQTH 3ARSA 4JZJA 5I19H 3A6CH 3SCMD 4JFDB 4FXKB 2EE6A 1R5VB 4U6VL 4KK8C 3BWAB 1W72A 2NW3B 2R1XA 2OTWA 3K4DA 1M71B 1CE1L 2JB6B 4D9LH 3I3DA 2E7LA 3CC5A 3C09B 3H3PL 2VDPL 2W9DH 1RZ8B 1BMGA 3S37H 3RP1A 3PDOA 4W4OA 3TPUA 1CL7H 3MV9E 2VLJB 1MVFA 1MLCA 4GG8B 5C0AA 2X41A 3QUXB 5HVHC 2IBZX 2CDEA 4R9HA 1NAMB 1F6LL 4MNHB 3MRBA 3EYOB 5LXGL 1DVFD 1UFUA 2DQIL 4MD5A 3F7VA 4GXVH 1CBVL 4N68A 5BQ7B 1VHPA 4Z77A 5ITBH 5M7QA 5KS9B 4Z95H 2ZPKH 3RPIA 4EBQL 1D5IL 3B5TA 4ZPTB 1B2WH 2RB8A 1EO7A 4JDZA 1IAMA 1ZOXA 4OZHB 5F7UA 2J8UA 1RPQA 3GI9H 1I9IH 3T4AA 1ORQB 2C3XA 2O5XH 3VXRD 3DBXB 4MVBD 3GMMB 4PRAA 3AY4A 4XZUA 1AXTH 1SJHB 2EYTB 3NAAL 1MCSA 4AT6B 3PGDA 2BOBA 1BJ1H 5JMOC 4HQQL 4AENB 2ZUYA 1RUAL 2MCPL 1RUMH 4IOFD 4JFDD 2X4SA 1IC5H 5IR1A 3P11L 2NY6B 1NFIB 3BHBA 1VFAA 1DBML 5HYSB 4X7CC 2Q87A 3VE0A 1WCBA 3FN0H 4O51B 4CN6A 2A73B 1ZHLA 4PJBF 2BRQA 5KN5A 3MRFA 1PGRB 4L1HA 5JO5B 2ILLA 5DVKA 3HI6L 1LQSR 1MOEA 2F53D 4Z7VF 5F97E 2XICA 3C2AL 2P5EA 1S9XA 5GIRB 2JJSA 4N0YH 4AQ1B 4PY7A 3NVQA 2E7MA 2IPUK 4HG4J 3OV6A 2D2OA 4OLXL 4DW2H 4X8XA 3CJJA 5DA0B 4G5ZH 2WWKT 4MA3B 3RVWC 3H9HB 4QXTA 3RWHB 3BP7A 5DJ2B 3KYKH 4P0DA 3HAEB 5J1AB 3UPRB 2WV3A 3MGOB 3O0RL 4PJAF 4FABH 1PYWB 2PF6A 3OSKA 3AS0A 4DZBB 3TBSA 2C1PB 4NT6B 2NXZC 4P3WA 2V17H 1I8LC 4NN5C 4WHYH 5IMOA 3TO2B 1BFVL 1IARB 1CLYH 1HKLH 5L88H 1QFUL 1P53A 4LKCA 1NH6A 2XWBB 4GUPA 4Z7OF 5HHXL 3IYLW 3JWOC 1E4XL 4LNVA 2ADIB 5HGBA 3OB0H 1N6UA 1OAKL 1FRGH 4LMQI 4NN6B 5FF6A 1ZE3C 3QB7C 1QNZL 3ZDYF 1RZIA 4GBXD 3BP5A 4G7VH 2NY6D 2A6DA 3NIFF 2VQ1A 2B39A 1C16A 1N8ZA 3QXAB 5T5NF 4F7PB 4H26B 3H9SB 3B6SA 1K2DA 1FH5L 5C09B 1ZLWH 4ORGA 4YO0B 4PLJD 2H1PL 1JGVL 3U79A 3Q1SL 4YPGB 5MI0B 1LILA 2GK0B 2VZVA 3RWCB 4QXUL 2AS5M 3V0VA 4WUKH 1X5YA 3BZFA 5I15H 3DWTA 3MA9L 5IHZA 4U7KA 2CKNA 3RAJL 5DHYA 1MQKH 4FQLL 4PJDE 1G84A 1AJ7H 3NFPA 3PWUA 3MNZB 3KPPB 2DQDL 4G9FD 4YXKL 3MREA 5E2TL 2QQKH 4D3CH 5CJOH 3IKCA 5HI4D 1AP2A 4PJGB 4ELME 1X5ZA 3JUZA 3V0WH 2R0ZH 2R8SH 2EDNA 2LVEA 3EYQC 3QEQA 4BK4A 2BNUB 3L3IB 3TA3B 4BFGA 3FN9A 3UTSE 1G7MA 2GTWB 3EYFB 1FZJA 3FFCB 4N8PA 4U1MA 3UTOA 2EKSA 5K9QI 3MRRA 2G60L 3CUPB 2P42B 4LDOB 3VH8G 2GUOA 2VLLB 2NW2B 3E3QC 4LOUD 2VE6A 3AB0B 3AREA 2XXCB 2BMKA 3FRPG 3L3GB 4M4PA 2C1OA 3LKQA 1BWWA 4XPFL 3ALXA 5DVOA 3BP6A 2BCKB 4ZUUB 4HWZB 1J86A 3BEVB 3U82B 4JG0L 1MRFL 2E7BA 2MSPA 3P4OA 1EZVY 1TZHB 2VXTL 3PWVB 3SY0B 2V5TA 3PGFH 4JANA 4F80A 5CEZE 4DUXA 3H7BA 5GGSY 1JHKL 4RWYL 4HUMB 2DYPA 1T7ZA 1MJUL 4L8DA 5IFJB 4XI5D 5ESQB 4WJ5A 5GS2H 3I9GL 3ARWA 5ID1A 4Q2ZB 5GGUA 4JFOA 3BOVA 2WAHA 3DXAE 4JFEA 4HUVA 2AXHA 3TNNA 5TH2A 2FD6H 1NCBH 4NQDB 2MPAL 4J4PD 5GS0D 5ALCL 1P5VA 1XH3A 5TDPA 4EI6B 3LIZH 4R3SA 1NCWH 1KLFA 3SE3C 1EXUA 3VXSD 4ZOAA 1WIPA 5KSAA 5TE4H 4LNRB 1NC4B 4HUWA 4KK6D 4U1HB 1RZJH 3KG5A 5D7LB 4L4VE 4RIRB 5GZOC 1RFDL 3N0PB 4H20L 3TA3D 4L5FH 3LEVL 5FB8A 1IMHC 4KKNA 4OAWB 3BKJL 3VFUA 3QEGH 3T8XB 1N0XL 4U3CA 4CAGA 3Q0HA 5ELIA 1DQTA 1WEJH 1SY6H 4DCQA 4Y5XB 1KEGL 2X4QA 2UUDH 3S34H 4ZOEA 3MUGB 5EZIL 1KIRA 1F11A 3T09A 5KSBA 3AC0A 4RAVB 3BAEH 4ZS6D 4TTDC 3WS3A 3VRLF 5AYQA 3NTCH 1ZWIA 4JG1H 3SJVD 5GRJH 1QSFB 4YHIB 3N85L 1R3JA 5E2UL 5TPWH 1F6FB 1IC7L 4YHPB 3ROOB 2BHYA 5SX4I 1CFVL 1KTLB 4N5ED 4JPIB 1CN4A 3CFKB 2K3TA 4OI8A 1ES0B 4WU7B 4EI5A 3P30H 4G7YH 4ZFFB 1JZ8A 1ZT1B 3MGAA 1IAOB 1I3VA 3HFMH 3QFJB 1G7JB 3RUGB 4XNUL 5IVZA 1R3KA 2FO1A 1XGRA 1QLFB 4H25B 4JN2B 3C8HA 3GSXA 3OJMB 1A47A 4NQDD 3QO1B 3X12A 5SWQA 3VDCA 5CGYC 1W0WA 3O6ML 3RWDA 1HYRC 4MA1C 5GRYA 5DT1L 5I1EL 4YDIH 1XGUB 1NC4D 3W0WE 3LZFH 3LQZA 5CIPB 1LD9A 5B4MC 1OLLA 4Y5YB 4LLYA 3HE6A 3QULB 1A7OH 4LIQE 2GCYA 1U2HA 3DVNB 1JI1A 4POZC 1KJMA 2C7UA 2CRIA 3VFNB 2VZSA 1HNFA 1HYSC 1WCQA 1YMME 4PJCE 2W0LA 5JW3H 2RAMA 3I6GA 2ZSVA 3C5JA 3RVVC 1KPVB 3QUKB 2DBLH 2XQYK 2DLIA 1RZFH 5EIQA 1UWGL 1WICA 5DVLA 4NHCL 4P9HL 4NN5B 4KQ3L 1DUYB 4KAQL 4NRXA 1EUTA 3GSWA 4JREC 3MRLA 4WWKD 3PDOB 1UVQB 5AG9A 1XR9A 4UDTB 3KPLA 1G7HA 1S5HA 4XXCC 1NLBH 3EIFA 3KJ4C 2YD2A 3HC0A 1S78C 3QHZL 4PRBA 1G0XA 5EPMA 5AZ2H 1OTSD 5FM5M 4R7NA 5I30H 1T04A 3QFJD 2CDEB 1QLEL 2YRZA 3DX7A 5KZCB 1LWRA 4M8VA 1CDHA 2HFGL 2BDNH 3NN8A 5CP7B 3MRBB 3D85D 2B2XL 4JDVB 2LTQC 4OFVA 1S7VA 3IRZA 3QWRD 1URLA 3VXUE 4OD3L 3WHXA 2WWMC 1WFOA 1YNLL 2VDOL 2C3VB 1OVZA 1CFQA 1MCNA 4RDQG 5DO2C 5HHQB 4L8SC 5FAAA 5TF0A 1X4ZA 4FQXD 1GJIA 4I3SL 5DZLA 3BSZL 1JZ2A 3ZDZE 4O9HL 2FJFA 1Q0YL 1QA9A 1J0YA 3DLQR 4JHAL 3DO7B 3D87B 4ZXBC 3UAJC 3TV3H 4WWID 4YDVA 3VFOB 3LN5A 2DQHH 1WLHA 1MHCA 2X4SB 4PG2A 4JQIL 3CFJA 1MJ8H 5JOFA 5M95B 2ZCKL 2IC2A 1VFAB 1IC4H 3CH8A 4ALAL 3Q48A 1JGDB 3ZYIA 4UNVA 5B38B 5K9QG 2HJLA 1AQDB 3OPZH 1HHKB 1A7QL 3QNXA 4QWWC 1BIHA 1Y6NR 1FBIH 3DOSA 3OAUL 4TVPE 4QF1B 4Z7WF 2IPKA 4HX1A 2WK2A 5C0AD 3T0AA 3LS4H 1G9NC 2OS7A 4MLSA 4P57B 2DLEA 5CEZL 4HPOH 1N64H 3B9DA 3CFIC 4BZ1L 3KVQA 3L6FA 4QXTB 3TPKA 2DF3A 5ADPH 1CLCA 1MF2L 4OTXL 2CRYA 5L8JB 1DEEA 3ULVF 4FFYH 1UENA 3JV6B 1LO0L 2UWEA 5JHDA 5D2NA 1IQWH 1AGEA 4HUNB 5AZEL 1LO5B 1UM4L 4X6CA 5J9PB 1OT2A 2NY0C 3T3MF 4PUBL 1M7IA 1MPAH 4I9WE 5J89A 1WT5C 5FOBA 3P4MB 2O5ZL 2FEEL 5DJ6A 5FUOL 3TYFB 4LKCB 5SV3A 5JLZB 4HKZB 3JWDL 4ODTL 2V5YA 2HH0H 5BV7H 4WUUE 5I1AA 4DFHA 2Q8BL 2DQTL 2YRLA 1OGTA 4GS7C 1FG2B 4ORZC 2GT9A 3STZA 2B5IB 2HKFL 4E0RA 1KN4H 1KTKE 4JFQB 5F9OL 4P2QE 1KB5B 1N8ZB 1ULVA 5KBNC 1IGMH 4NO3A 1K2DB 5ICXB 3MCKA 1KFAL 2AJSH 4RZCB 2QHLA 2P5ED 4F33A 4NQUA 5K33A 3G5YA 5EZOL 3EHBD 2DL9A 5HDBE 5IB1A 4I0PC 1A14H 1UH2A 4ODUA 4UT9H 4L9DA 1BIIB 4PV8A 4TVSa 4BSVA 1RK1B 4IRSB 3NFPB 1Z2KA 3SDDC 3M8OH 1YEFL 1EEYA 3MREB 1U6AH 1AP2B 1AY1H 1JNLL 3UP1A 3VGAB 4O2FB 3H8NA 5F96L 3CLFL 2PW2A 2H6PA 4CVWA 4AG4L 3EYVB 4L3EE 5JUEH 2YPLA 3SGKC 1Z9SA 1I8KA 1FZJB 1AE6L 3DTXA 2EDBA 1RIUH 4MX7A 4LP5A 1MHPH 2BFVH 3PP3H 2B4CC 1UXSA 4E42A 1JWMA 2R2EA 2VE6B 3EJYD 4QT5A 4X7TB 4LKXA 1IFHH 2BMKB 3MLYL 1MFEL 3K0WA 1ZTXL 1L9MA 3QWQB 2LU7A 1AGDA 4W70A 3RWFA 4BKLB 5HJ3A 3DUUB 3MUJA 4MA1B 4FQ1L 3K2UH 2J4WH 5ANMB 2ZOLB 4OLVH 2FGZA 1AFVL 3ZHKA 4DKEH 4MB5A 5C0DA 3HC3L 4QTIH 1G1YA 2EDOA 4LRNL 5IQ7L 5FECB 4WI2A 5HHOE 3KJ6L 3VWKC 4LSPH 4B50A 2YPKA 1BOGB 2X2YA 2ZUUA 4X9IA 1U8JB 4IRSD 2DTMH 3KPSB 3TNNB 2B0SH 1XZ0B 5CCKH 1LEGA 1PKQA 2I24N 3BVNB 4WDIB 4X80H 3VFVB 3LKSA 1HQ4A 4DUWA 4UV4L 1L7TH 1S9WB 4JREB 4PRHB 2F54B 1P4LA 5KSAB 4PD4J 3IFNL 2CKBL 3MOBL 3QEQD 4OUUB 1JRHI 2COQA 5J3HC 3VFPA 3IJYB 4NNXA 2VDLL 4V1DB 4EXKA 4YHKL 4J3WA 1EX0A 4P23A 5IROA 3WFDH 5E8OB 3GKWH 2XTJC 1R3LB 3VG0H 5C0IA 2ATKA 5ISZA 4Q9RH 1J0HA 2PYEA 2LTQB 4OD2A 3C87A 3SGJA 2X4QB 3KLDA 3RL2A 4JHZA 5E8EB 5KSBB 4KZDH 3LS5L 4GRWB 2YZ8A 1GOHA 2L0DA 4Y8AA 1C5CL 5EIIA 5KSUB 3CU7A 1CDCA 1NGPL 1D6VH 1FO0L 5IBLC 2VLME 4XVUD 1R3JB 2CK0L 3LQAC 3W9EB 3LB6C 4X7DC 5IT2L 2R0LH 3OBAA 2EZ0C 1HSBB 4Y19B 1NMBH 4WI7A 2DYPD 2EECA 2DD8H 2OR8A 1T83C 5E9DE 3HMXH 3CLEH 3DMMC 4ZYKA 1YC7A 1PLGH 1G7LB 4XC1L 4YWGH 1NUGA 3GMOA 4PJ9A 5IVZB 1IRAY 4TVPL 4E5XA 3MJ9H 1CXEA 4ODSH 3GSVA 1KELL 4YGVA 3MV9A 4JFED 3KPSD 4YXLH 3VFTB 1KXTB 2EH8H 2X44D 3MODL 4YDJA 3X12B 5EFIA 1QFWL 3L3HA 4RISL 2WUBL 3DVFA 4ONOA 5DLMH 3RHWK 4M7JH 2ZUWA 3VG9B 3IDIB 4JY4B 3MLRL 4X5LA 5KSAD 4PRNB 2FATH 1TXKA 3U2SB 5GSVB 1J0IA 3LMJH 3LQZB 4M9PA 4NBXB 4FZ8H 3ZMRA 5CZVL 2FO4A 4XCFL 5CBEB 3MJ6A 4HBCL 1RIVH 4JO4H 1T6VN 3B5GA 1I3GL 1NUNB 3I3EA 5KJRL 5DC9B 4OCNC 2V9TA 4QRUA 5KVMC 5J6HB 1RD6A 4TULL 2C7UB 3RHWF 5C0JA 3CD4A 1W2KT 3DRQA 2P45B 3PABA 4PRDA 4DN4H 2RFXB 1L6XA 2ZSVB 3MLZH 2D0HA 1SVCP 4ZPVB 1I8MA 2WM0A 3FO1A 3L7EB 4UV7L 5DVMA 15C8L 3HN3A 4HJ0C 4KDVA 4NRXB 1CGUA 1F4YH 4Y19D 2D31A 1OF2A 3OR7B 5D4QA 5FO8B 2BNQE 3HLAB 1S7XA 4F9PC 3IDJA 1RZKL 1S5HB 4UMGA 4X6EA 5EOCH 3SKNA 4Y1AB 4IRZL 1I9RH 4EI5D 1EAPA 3AROA 2NZIA 1QZ1A 1RURL 4GS7B 4JJ5B 4R7DA 5CAYB 4CVZB 1V3KA 3B9EA 2IAMA 3RTQC 5DQDH 2QTEA 4FQIH 4X98B 5E94A 5IKCA 1DBAL 3FFDA 5EA0H 4JPWH 3NCYP 1WF5A 4XPHH 1UZ8A 1YECH 2HFEB 2DQGL 3B8SA 3FN3A 4EUPG 1CFQB 3HNVH 4S1RL 1AQKH 4CVUA 2CD0A 3FO2A 3H2WA 1NGXB 3NABL 4XMPH 4OB5L 1TQBB 3I02A 4IS6A 4NSKB 5D70L 5DDHB 2HP4A 2Z91B 4Q0XH 1CIDA 4IDJL 2DQFB 5DUMH 5FKAB 1ZSDB 5DUPL 4I0PB 1FAIL 4Q97A 5JW5A 4U6VH 1U8HB 4DUVA 5LVEA 1YUHB 1A6PA 3PWJB 5D2LE 4MJ5A 4YIQA 4N1EA 3CFJB 3EAKA 3MNVB 3S35X 3H3PH 2VDPH 4EQ3A 4J3XA 4Z0XA 2F9BT 4TNVK 2G5BA 4L8CB 3BIBX 1FC2D 1LO3L 1XGPB 5JIIA 1YQ2A 3Q6FB 4ZTOL 4PJFE 1B4JL 5HD8C 2HAZA 3O6FA 3DSFL 5C0GB 4EXPX 3UDWA 4NC1E 2ZWLT 1CZ8H 4K3EL 5LXGH 4OI9A 5JOEA 3LKRB 5TDOA 2DQIH 4ZO9A 4TNVF 4OFPA 3QUML 1Q9WB 1GGUA 5C3TA 2KQMA 1DEEB 4GW4A 1IE5A 1RJCA 4EBQH 4TUKL 2VO5A 1H3XA 4YHZL 2AEQL 4PBVC 5F3HA 3ZKQD 5CEXB 4Z7UA 5J7CC 5D2NB 4PJDA 3T0EC 3WSQL 2V2TB 3LRHA 5DJ0A 2VYRE 5D7IE 4Z76B 3GSNB 5IQ9B 3UROR 3VWJA 1K4DB 5FOBB 2FBOJ 3VWKB 3EOBA 3NCJL 4RA3A 5DJ6B 4HQQH 2FSEA 2XRAL 2P8MB 1RUAH 3EDKA 4A6YL 3NPSC 5I9QC 4F8QA 3P11H 4MXQD 3UTSA 5HI5C 5ERWA 4J3UA 3JV4B 3MZGB 1H15A 4KJQC 4WU5B 1GAFL 1VFOA 3DX8A 2WLZA 2EDXA 3HI6H 1T21A 4LMQE 3QRFM 2QBWA 4O2EB 4OZ4A 2WUCL 4YE4L 4QRTA 5C0EA 3MCKB 5L0QC 32C2A 4DKFH 5L7XL 4OZIE 1EPFA 1FNHA 4F33B 2AAVA 5IESL 4OLXH 1BQHG 4BH8A 4TQEH 4MJ6A 4R4BB 1QUNA 4ODUB 4NHUB 2OTPA 3BT2L 4BSVB 4BSJA 2YD7A 1UA6L 4JM2F 3TGXA 3G6AA 3QR2A 3O0RH 2OJEA 4M1CD 2JTDA 4ODWA 2GI7A 4LK4A 4DVRL 3DXAA 4R4ND 1DN0A 3MR9A 1BFVH 2PW2B 3VI4F 3A6OA 1U41A 3GMNB 4UU9B 4LHUG 2D0FA 1QFUH 4NUGL 4KVCL 3QO0B 1ZEAL 1T4KA 1D5XA 1XMWA 3MPCA 4XRCB 3DMMB 3VXTB 2X42A 4HT1L 2C3GA 4NQSB 5HHXH 2PUQT 4WHTB 5T3ZE 1EEUA 1E4XH 4ODXB 1OAKH 3IU3B 1UXSB 4MJIB 4A2MA 4LKXB 1QNZH 2Q7YB 4CW1B 3RWFB 4HZLA 4MD4A 3DROB 5HJ3B 3UBXB 3TJHC 1MUJA 5E1AA 3G5ZB 6FABL 1G9ML 1IGCH 1JGVH 3Q1SH 1VEMA 5DGRA 3STLB 1UM5L 4TSBL 2NYYD 4QXUH 3WS6C 2JCCE 1U8NB 1JF6A 4QRQA 1GGBL 3PL6C 4QHNA 3MXVL 3ARDC 2WINA 3MA9H 1F3JA 3RAJH 1F6AA 1YPZE 1LO4L 4WIQA 3RVTD 5IJVB 4Z9KB 2DQDH 2JK5A 4YXKH 3QJFA 1EHLL 1MIEL 4KV5E 4OF6A 3UXFA 2FH6A 4LGPB 1R24A 4TYUA 3NFNA 1A6TB 1EAJA 4U6XA 1MFNA 2LU3A 5HY9B 1DZBA 3GIZL 3SE4A 3D3VA 3SHSA 3GRWL 1R3IH 1EMTL 5EO1B 2PO6C 5F8QC 3JXAA 4ZOBA 5HHMB 4P3DB 4N1CA 4PRIE 3GDBA 2YPLD 5E24E 2G60H 2CGRL 3O8XC 1PY4A 2UZIL 2HTKD 4FXLA 1E27A 5ABDE 4PJ7E 4P23B 5FOJA 3MX0A 5E03A 4DEPC 2BVUA 3U9PH 2ATKB 1QEWA 1XF1A 1AGFA 3HNTH 4N0FB 1S7SB 1J7VR 4G6AD 1FVDB 1N3NA 2CLVB 5FA3A 1QR1A 3WFHB 2IPTL 4JG0H 1MRFH 1NBZB 3U4EA 4L4TB 2J6EH 4YDLB 3QI9A 2CUIA 4PJCA 2G9HA 1JHKH 3T1FB 3H0TA 2XWTA 1DJSA 4OZFH 1MJUH 3GFUA 2ZNWA 2IALB 3I9GH 3RX5A 1A7BA 4NQVB 1SQ2N 4L8BB 2XOTA 5D8JL 3O9WC 4KKBD 5E7BA 4GMTL 2IFFH 5FM8A 4XHJC 2MPAH 4MNGA 4P5KA 4YGVB 2AV7B 4X6DB 3W81A 4W6WB 1UZ6F 1IGTB 4DK6A 3H42H 3L3HB 2OZ4L 4NKMB 2YKLL 1V3MA 1RFDH 4HGKC 2CKBA 2A1WH 1RJLA 5EU5A 4K7PL 3VXUA 4YBHA 2BHZA 4UZGA 3BPOC 4R4FL 2DQEL 2GEEA 3X13B 3BKJH 4ESKA 2ZUVA 1N0XH 3OAZH 4NZDA 3S3JA 4P23D 4Y4HC 3VXNB 5C6WH 3GMQA 4J23A 2R0WL 5ISZD 1QRNE 2PYED 3GB7B 2VDKL 3KS0H 5DMYA 5EZIH 1GVIA 3QUYA 4C56E 4B41A 1CGSL 3RWEA 3U48A 3C60A 3SKUD 4PRDB 1DQMH 2NX5E 2BVPB 3B9KC 5EBLB 2HT3D 1LP9F 4ZS7L 3F62A 1MAKA 3FO1B 3T0EB 2Y72A 1KTRL 3GMRB 3N85H 4LCCC 1H8OA 5E2UH 1IC7H 4FG6D 3S5LA 5HYSG 1CFVH 2FIKA 1DN2A 3DIFB 2X4PA 4L1DA 4NFCA 3GIVA 4KROB 4OKDA 1OF2B 1NL0L 5F7YC 4MDIB 5EU7C 5ID0B 2AK4E 4P4KA 1N5AB 1T20A 2APXA 1U8LB 1ED3A 5I9QB 3UYPA 4R7DB 4PJ9D 3ULSA 3HI1A 2RBLA 3DGGB 3WXVL 3MMEB 5IVXB 3MV9D 2PTVA 3BZDA 4LPTA 1FN4A 1X4XA 3QT2A 3FFDB 4HUKB 4B5EA 5MENE 4X4XA 1KJVA 3NCEB 4Z18A 1CU4L 5DT1H 2CIKB 5I1EH 5ECJE 3HAEG 2OI9C 5L0QB 1MFDH 2F5AL 5EC2A 1GOGA 5EUOE 3OB0K 3IXAA 1U95A 4P5MA 4CGTA 4NO5B 5C8JA 3E2HC 4MYWB 1JV5B 1IM9B 2XN9B 5GZNC 4JJHA 3KGRA 5DRZB 1F90L 4U05A 3BN9D 1OL0A 3RU8L 3FQNB 3I6KA 1ZLWK 5TFSH 1A22B 2ARJB 4XNMB 5BS0E 2WQRA 2Y7QB 3BGAA 1DQDL 2Y6SC 1NJ9B 1UKSA 3GM0A 1BPVA 4HSQA 4KMTL 3QHFL 4NQXA 4JQXA 5T3ZL 4PR5A 1UWGH 4NHCH 3Q3GB 4P9HH 3K1DA 4KQ3H 4WUUA 1LEIA 1CXFA 3MRJB 4KAQH 3DUSB 5KOVC 4B7IA 4HCRL 3MV8B 3FQXB 1EJOH 3KPTA 1H3TA 4KROD 4JCMA 4P2QA 2AQ1A 3G04B 1P9MC 4X5WA 3IVKA 3DUHA 3O6FB 1QLEH 1QQDA 1TZGH 2HFGH 3F7PC 1KN2L 4UINL 2B2XH 3GSOB 5TDOB 3BDYL 5J11C 2IAMD 3HHRB 2VDRL 4NYLA 3AS2A 1VENA 4JFHE 1YNLH 2VDOH 2R9HD 3JVGC 4M8QA 2WIIB 4GW4B 1AGBA 4Q6IC 5FKPB 5EZJA 4AMKL 5F3HB 4Z7UB 5HGDA 2ICWB 5BMFH 1ZANL 1UWXH 3ULVL 1IGYB 3RGVB 5HHNA 3ARDB 3VD3A 3C5SB 4K07A 4BQ8A 1Q0YH 4MNQB 2R15A 1IM9D 4GW1B 1DBBL 4JHAH 5FYJL 1NBYA 3ESUF 4HUUA 4M6ML 1I1RA 1NANH 2WSKA 2BSRA 3RKDD 3V5HB 1KSRA 3OKMA 5I2IA 2YXFA 4L3EA 3V52H 4JQIH 1P7KA 3O41A 3MRCA 1U8PB 2XZZA 5JZ7C 2ZCKH 3PHSA 3EOAB 4ALAH 1JGLL 3O3AB 5MERA 2GAZA 3TEUA 3FONA 1A7QH 1LDPH 4S1DD 2YXMA 4CJ1A 4JLRB 4QXGL 3OAUH 4QRTB 4AL8L 4LDLB 4PJIF 32C2B 3O8XB 1OWWA 4LSVL 3DURA 4LASH 4U1LB 5BXFA 2IH1B 3WNMA 4DEPB 1WTLA 4JQVC 3O6FD 5EDXA 4BH8B 2FJGA 5CEZH 3TFKC 5BV7C 4BZ1H 1WITA 4ISVB 3ZT5A 4KWUA 3BN3B 1MF2H 4OTXH 5J0BA 2O61B 2FL5B 4N9OB 2FJHA 1LO0H 2XA8L 4WVRA 4CVXB 5HHOA 3HRZB 1NMAL 4KTYA 4MWFA 1OW0C 2D4DA 5AZEH 2XV6B 4NM4L 4OD1H 2D9CA 4PUBH 3RGVD 1D5MA 5I66A 2UUDK 1LE5B 3C8DA 4K3JL 1F4XL 2H3NA 2O5ZH 4KVNL 1I4FB 4UTBL 3VWJD 2DWDB 3JWDH 5GRWA 3K8MA 4J2XA 4C58B 5GGTL 2Q8BH 2DQTH 1YEKL 3QZWB 3V6ZA 4A6YA 2KKQA 1KB9J 3CSBA 4EN3A 1D7FA 2HKFH 2IEPA 3UTSD 1RUPH 5F9OH 2HVJB 1Y18A 2CDGB 2NLJA 1JN6B 4LLDA 5I8EB 5DI8B 1DANU 4GG6E 4U6HA 3QXTA 4J3VA 4MQ7A 1MCPL 3TWCL 1KFAH 2V7NB 4KKCC 5IG7B 2BHUA 3NH7L 4EDXA 3EJJX 3TVMB 4KDTA 4QRQB 5DEFB 5EZOH 4Y4HB 4K7FA 1LK3H 4PJEF 2WINB 3AREC 5C7XL 1AI1L 2JJUA 4JEGB 1F6AB 4RGNB 1DQJB 5IHBA 3HRPA 2A6IB 4RMUA 4AH2A 3HE7A 1FNEA 4KKAC 5HYQB 5CKGA 5CEZD 1CD1B 3S36X 2BY1A 4F15C 2VIRA 2CMRL 1BZ7A 2HN7A 3DI3B 1YEFH 4GKSB 5ETUB 3B9KB 1G7PA 2WBWB 1JNLH 4ZAKC 5E9DA 5F96H 3MRQA 3K3QA 4LCCB 3V4UL 1DQQA 4XWOC 3IF1B 3REVA 2W1NA 1G7IA 3DI2B 2OR9L 1SMOA 3GJFH 3D3VB 3DXAD 4AG4H 1DFBL 2RCSL 1A5FL 2FCBA 1EH9A 5ICZB 3QFDA 4MD0B 3RDTA 1AE6H 1A7NL 1KNOA 3DJ9A 2PETA 2R39A 2XZAL 4M1DL 3VXPB 1KEML 2NCMA 5JIPA 4G8FA 3DV6B 5E5MA 4EIGB 3MLYH 1MFEH 1QEWB 4MQXC 3V5DA 1U93A 1ZHNB 3VH8A 3H3BC 3WN5C 3QAZC 1N3NB 4FXGA 4RQQA 3FRPA 2A0LC 1B0GA 4JY6A 4K2UL 4FQ1H 2W9LA 4PY8I 3UTQB 1JWUB 5DJZA 5CJXA 4LCUA 2OI9B 1C5DB 2V9RA 5J13C 1LK2A 3OGOE 4O5LL 1FV1B 4KRNA 3E2HB 3HC3H 3H0TB 1ZHBB 1TCRB 3TVMD 4LRNH 1ONQA 3BGFB 3KJ6H 3TCXA 1Z5LB 1N7ML 2YSSB 3MRGA 4RGND 4IMLA 2Z4QB 3IDNA 4OLZL 1M7DA 3KPMB 3RZWA 2BNQA 5LG1A 1H5BC 4S1QL 2R2BB 4MNGB 4P5KB 1MWAL 3DX6A 1ZVSB 4UV4H 4HLZG 4LSTL 3TCLA 5EO0A 1CQKA 1U58A 3IFNH 3TZVC 2CKBH 1S7RB 3BIKA 3HZMA 4URTB 4QRSB 3D3VD 3IJSA 1D9KA 3GRWA 1OSPH 1RJLB 5EU5B 2J8UF 2VDLH 2PTTB 1MJJB 4YHKH 2FEDC 1I3UA 1Y6MR 5JOPE 2HT4C 4MSWB 1Y0LA 1U8IB 3SDCC 3QQ4A 4K8RL 4W6YB 1YY8A 5J11B 3L3OB 4HFWA 4M3JA 3QEHB 1A9EA 3OKYA 1KIPA 5DHVA 2BVYA 3LS5H 1ZGLA 2ZUQB 5CEYB 1C5CH 1SBBA 5I76A 3OJDA 4ZODA 1NGPH 3FB7A 1FO0H 5HVGB 2CLZA 3QI9D 3QXDA 3E1F1 3HR5B 2FIKB 2HLFD 1IM3A 1VACA 5D2LA 3B9VA 5E56A 3HE6C 5A1AA 5B38G 1U8QA 4H1LH 3JTSB 4LVOC 2FHFA 5DD6B 4P4KB 5FEBA 1ZVHA 5IEKA 4XC1H 4TVPH 4YNYB 1XEDA 4C4KT 2W0KA 1C8PA 1JI2A 2MFNA 3TO4B 3VGGA 2Q8AL 2KDGA 3T2PA 4PJFA 3QCTL 1QFWH 4RISH 1A21A 2WUBH 3NA9H 2I5YH 4ZFGH 3QH3B 5BCAA 4U6YA 5DD3L 1QOKA 2VUYA 3CSGA 4OBSA 2XY2A 4UNTA 3LKOB 4IRJA 4EDWL 3B83A 3WLBB 5ITFA 3OXSB 3DETD 4F58L 5CZVH 5EC2B 4KRPC 4XCFH 1CDBA 3CNKA 3I3BA 5C86A 3VXUD 4WW2C 4P5MB 4GFTB 1I3GH 2VDMH 4U1JA 2DTSA 3HMWL 3BXNB 4TULH 1U92A 4G6MH 4JVUA 5D7IA 3C6LA 1CDJA 4HAFA 5MEQB 1OTUC 4PG9B 4L9LC 3U0PB 3QUYD 1CTNA 4J3TA 3C60D 5JW4M 1QO3B 4UV7H 2HLAB 4KMQA 2ED9A 3UYOD 5T1DH 2AJZB 2VOTA 15C8H 1R5WA 5IW3A 4WUUB 1LEIB 1YN6B 3KNBA 2EKJA 3CVHL 1FNSH 2BNRE 2F15A 4I3RL 5E7FA 2D7TL 2AI0H 1N6QH 4JFPB 4P46C 1OSZA 2VLJE 2H2SD 1FVCB 3WJJA 4IRZH 1AD9B 4P5TB 4YLQT 5D6DA 2EDQA 3G9AB 3GHBH 4AQOA 3IGAB 4X5WB 1ZLVH 1NGZB 2YN5A 3V6OE 4P4KD 4N9GB 2XKNB 4CL7A 1G7QA 1UYWL 1A1NA 2Q6WB 1CK0L 4HIIA 4TVPD 3TO4D 1DBAH 4OZIA 5E08L 1HHHA 4NCC1 2DQGH 5KS9E 1I8IA 1HQRB 1SJEA 2ADFL 4S1RH 4HKXA 3KPOB 3KYNA 4HS3B 3NABH 1SBSL 1JNNH 1F97A 5IMKB 4OZHE 3PP3K 4HK0A 5D70H 4KU1A 4QCIA 1YEGL 2BVOA 4P2OA 3RY6C 1IT9L 4IDJH 3LV3A 1MH5A 1I9EA 3L95A 1GGTA 5DUPH 3C9NB 3ABZA 2WWKO 1FLRL 2UY7A 4KC3B 3SGEI 4IOIA 4JKMA 2CXKA 2EDJA 3E0GA 3THML 3HPLB 4ZAKB 4I9WD 1P7KB 2EO1A 2PYFB 3MRCB 4OCRL 2K1MA 4U2YA 3MRIA 3TYGH 1JL8A 5MERB 2C3HA 1PSKL 4WUUD 3CFDB 1UCBL 4OGAD 4X5XB 4PGEA 1LO3H 3QCVL 1JRHL 1VB9A 3KXFB 4ZTOH 3SDAC 1B4JH 1S5IL 5KG9B 4DWHA 4P2QD 3DURB 4P5TD 4UBDC 3DSFH 4OSUL 5E0QA 2PXYA 3DV4B 3O6KL 4PB9L 4TUOA 4OFKA 2EIDA 3LD8C 4MQTB 4K3EH 4YHML 3DHMA 1S3KL 3L5XL 5I1CL 3PHQA 2B20A 3U46B 1FFPB 3WN5B 2JCCA 5BOPA 3DARA 4P3CL 3QUMH 4DVBA 3B2UC 2PNDA 3TNMB 5BJTA 4YHZH 1T22B 2AEQH 2JELL 5JDSA 1YPZA 4KRLB 1XGTA 2AEPL 2JJVA 3WSQH 4QHUB 4RAHA 2JIXA 5J13B 3TBWB 1NDMA 2VABA 5DF0A 2QL1A 1IAIL 1CG9B 2W0FB 1YMHA 3GJEB 4G8IB 1G6RL 5D5MB 5F1IB 4YFLI 3NCJH 4JE4B 7FABL 1SYSA 4A6YH 3Q5OA 1FZMA 1NSNH 3RWJB 1QFPA 3NCFB 4ZUSB 1H5BB 3GSUA 4L3ED 4KI5E 4PRIA 5B3JF 2B1HH 1KCVL 1T7YA 2Q20A 4NO2B 4AM0B 4PJ7A 2A9NL 4MXWH 1GAFH 5TGBA 3KLAA 3TZVB 3H9SE 2PKDA 4OZGB 2D7PA 1T0MB 5C09E 2WUCH 1EZVX 3OTTA 4YE4H 4YEFA 1CD8A 1RJYA 5L7XH 5LGJA 1JE6A 4DN3L 4JN1L 5IESH 1V8HA 3SDCB 5I1HL 5SWZB 2IG2H 1TFHA 3WYRA 2A74A 5L2JB 3NGBC 2XZQL 2RHEA 2AGJL 4NZJA 3WE6A 1VCAA 3OR6A 3BT2H 3FB6A 1FNEB 2X4NA 3TIEA 3NIGE 4WI5A 5FCUL 1BZ7B 2A2QT 2DQJH 1TPXC 4PJGE 4YBQC 4N5UA 4NRZA 4EVNA 5HHOD 3S7GA 3EJZC 2GJJA 3W5NA 1E0OB 2X70A 3VI3E 5MEOA 4GAGL 1IEHA 3WLWC 3CFEA 3QDME 1EEZA 4KVCH 1C7SA 2ARJQ 1ZEAH 1JK8B 1SYVA 3FFCE 3W11C 4HT1H 3SE8L 1KNOB 4NOFA 3MOAL 4CMMA 4NOBA 3MRMA 1ZA6B 4LLMA 3UBXI 3CSYA 4ZUWA 1AR1D 3O2DL 4V2CB 1ITCA 5AEAA 1XCQA 1IILE 1BOYA 5SV4A 2NY2C 4NBZB 3V5DB 4EN3D 2YR3A 4Y5VA 2I9TA 4U1NB 4F7TA 5IWLC 5I74B 1B0GB 3R0NA 3P73A 4ELKA 4ZNCD 6FABH 1G9MH 4U1SA 2WBJC 1QRNA 4NRYB 1ACYL 1UM5H 4TSBH 3GHEL 4Y4KA 5H2BA 4XCNB 3RWIA 4C56A 4P9ML 1V7NH 4WW2B 2EO9A 4G42B 5F7FA 5BVJA 1BZ9A 1P1ZB 3SKJH 4HG4K 2NX5A 3MXVH 5H35A 1WAAE 4PP2A 1ONQB 1LO4H 3PQYB 4L29A 4XNQB 4H5SB 2IADA 2ZUXA 1AR2A 3V6FA 2VLMD 4L9LB 1NBVL 3HE7D 2O93L 4FQCL 4YEEA 1CDIA 1OARH 1MIEH 2AVGA 1EHLH 4NQDE 3BPCA 2BVEA 4ONHA 4X6BB 2AK4A 4JDTL 1C08A 2ZCHL 4FZEL 5E9DD 3FT2A 1NAML 5EO0B 2ZP0T 1LMKA 3GRWH 1EMTH 3BIKB 5D7LE 4P46B 2X1OA 3V9FA 2QQLL 4JAMA 5MENA 4XPTL 2CGRH 5FYKH 1A2YA 5E4EC 2V5SA 2UZIH 3RDTD 3EO1A 5EH1A 2XYCA 1W8NA 1NFKA 1U8KA 3B8YA 2X9WA 3ALWA 3E6FA 2P8PB 1NUDA 5SWSA 4Y7MA 1DE4B 3IDGA 1FNFA 1KUMA 1CL7I 2OJZL 3AXLB 4HFWB 5GS3A 4LLVA 4HULB 2CUMA 2X7LB 4JZOA 2IPTH 4DFIA 1HINH 1GSMA 5ICYA 1T03H 4PTTA 1NLDL 1KOAA 1QSFE 5BS0A 1DANT 1IM3B 4PJHB 3MRDA 4FFVD 2Q1EA 3MA7A 5DRWA 1H3PL 4I2XB 3WHE0 2H32H 2VLKE 5D8JH 3BJLA 3CK0L 4GMTH 4NKDA 4WGWB 3QFJE 5EBMB 2KH2B 4XBGB 3RUGE 5IEKB 1S7UA 3WNLA 2APFA 2BY0A 2VN4A 4ZUTA 5HGGS 1VESA 2BNQD 5IB2B 3MO1A 4PJFB 5CUSL 1MWAA 1A6VL 1E6OH 3GI8L 1JUFB 4U1GC 1DBJL 2OZ4H 4MXVE 1Q9LA 2DWEB 4IOSD 4NKOB 1Q0XL 2FECL 2YKLH 2UWEF 5HI3D 2ZOKA 3KWWA 4OLYH 5I0ZA 3K7UA 3SDAB 2DLGA 4K7PH 5C9KA 1J8HB 1D9KD 4R4FH 4MMZC 4X6CF 5JW4Q 5DJAA 2DQEH 5TDNA 5L9DL 4HIEA 5D71H 1EHAA 2GSGA 4U1JB 5AD0B 1AHWC 2Y36L 3F5WA 1YDPB 2R0WH 3MRKB 3OKEA 2VDKH 1U92B 1CGSH 3ZO0A 3WDHA 2YC1A 5DK0A 1I7RB 2OSLB 4ZS7H 2VXVH 3N1PC 3FT3A 3PNWA 3MBEA 4PGJA 1RZGB 3NA4A 5INCA 4D0DB 1BREA 3B2VL 4RMVA 4O4YL 5ESVB 4UUJB 3RVXD 3CX2A 2MHAA 4GKNB 1NL0H 2WQ8A 1OSZB 5CSGA 3QPQC 4KPHL 2VKXA 1QSZA 2E8ZA 3QHTC 4RAUB 4P59L 2AW2A 3QCUL 4PJXA 4XCYB 5DZNA 4G8EB 2ATPA 2FYYB 3GSQB 1CYGA 3QUZC 3WXVH 1G7QB 4KK9C 4OQ1A 1IEBB 4OUOA 1QTYT 2DMCA 1BWMA 4YUEL 4M7LL 2APTA 3IJHA 1CU4H 3IFLL 3NIDF 1IBGH 1I8IB 1FVEA 4UQ3B 1VPOL 4P9HC 1F3DJ 3BRFA 2N7BA 1T2JA 2F5AH 3O3BA 1FORL 1AKJB 4IRJD 3FRUA 3L3KA 4EUPA 5GS0L 3EO0B 3OXRA 2EEAA 4NWTL 3LV3B 1D5BA 3L95B 1AD0B 5C0BE 1K5NB 1TVHB 3NCYS 5D1QA 1F90H 5CINL 3RU8H 1S9YA 1DLFH 2BSED 2B1AL 1X5HA 2CPCA 5C2BL 3D0VB 3TBTA 1DQDH 1FZOA 3GSRB 5BW7C 4KMTH 4M7KH 1TPXB 3LOWA 5T3ZH 4XT1C 5ESAA 1F8TL 4LHQB 4MB4A 4HK3J 5IW6A 3RZCA 1AIFA 1NGQL 4X7EC 4HCRH 4HAGA 1XGQA 3ZKMC 3CDGB 5TJWK 3EFDL 4GQ9H 4AIZB 4GRMB 4K71C 3CVHA 3UBXG 4XAWL 1BF8A 3FB8A 2YA1A 3RL1B 3WNNA 3C08L 3VMPA 4HEME 1P69B 3MFFA 3K4ZA 2C3WA 5IEHA 3E3QE 4XP4H 4GG6A 2PXYB 5E8PB 1J0ZA 3GKZA 3M45A 1KN2H 4UINH 2ICWI 3BDYH 3PHQB 4HWUA 4PV9A 2VDRH 3MBXH 5TQ0L 3KYMB 1BQLL 3P9MA 3MRPA 1ADQH 4DVBB 4LLWA 1A02N 5A16B 4AMKH 4GQPH 5JXEC 1VFBA 1XGTB 1A7PH 1ZANH 4YHLL 3ULVH 5IVOA 5JR1L 4EIZC 2AERT 3ULUC 5CJ8A 3ARGC 1HSAB 2KZ1B 5FYJH 1DBBH 3U36A 4IMKC 2E3VA 4M6MH 1T3FB 2FZ3A 1SYSB 4QLRA 2QQQA 2VXUL 3CAFA 2DDQL 4HS6B 5D7JC 5C0CA 1QPPA 5C0FA 1DEDA 1X44A 4PS4H 4CBPA 4YR6B 2ICEB 1BFOB 3VFSB 1LE9A 3GMPB 5HYEA 1WZ1L 4HC1H 3QIWC 5TGBB 2VAAB 1CICA 1U9KA 3QDJB 5DD1L 1O7VA 2GTZA 4QXGH 3ZE2E 1WFNA 4AL8H 4OZFB 1UGNA 1KPUB 4LSVH 3OQ3B 5E4EB 4UTAL 4JPKL 2J88L 3P9LB 4F2MB 3BPLC 3BUYB 1FL3B 1PG7X 3JWDC 3IETB 3U1SL 5I6XC 2PXYD 3HNSL 4PGBA 1EO8L 4ETQB 2YUZA 5EIVA 3OR6B 1BQHA 1NBQA 3BD5A 4HMEA 3VXMB 1BX2B 1HCVA 3WBDA 1OAZL 1RU9L 1JZ4A 5IK3A 4PIRF 2XA8H 3O45B 2YK1L 1NMAH 4MDJA 2LAAA 1FFNB 2C26A 3UPAA 1T5XB 5J6GA 4OV6F 2A83B 3OAZK 5EUKB 3RWGB 2JIXD 2R2CA 2V7HB 4R26L 2AJUL 1ZLSL 4U1KA 4KY1L 1F4XH 2QHRH 5E00B 3U4AA 4KVNH 4UTBH 4FNLL 1XF3A 2J1KA 1KT2B 4MCZB 3U0TA 1L6ZA 4M61A 4CMMB 4LHUA 4NC0B 5GGTH 1T0NB 1A3QA 2GFBA 1YEKH 2VXSH 3CSYB 4ZUWB 1W8OA 4LVEA 2DLFL 1I1AC 2FDBP 1WTGT 3LRSA 43C9A 1MLBA 2EE2A 4S0SD 4Y5VB 1DDHB 4X4YB 1HILA 1MFBL 1HOCA 2CIIB 4PGCA 1MCDA 4RWHA 5E70A 5ANME 3S9DB 3TWCH 4U1SB 3HB3C 3VU2A 4PREB 4JVWA 4Y4KB 3BZ4A 3NH7H 3BDXA 5IOPA 1Q1JL 3DYOA 3TN0A 2NTSP 5HSFA 1AHWB 5T1MA 1GPOL 2DQCL 5C7XH 1AI1H 4PP2B 1FAKT 4MGXA 2VC2L 4ZTPL 4L29B 1NAKL 2QR0A 3V6FB 5DYOA 2CMRH 4Z7QE 3P77B 3KPSE 5D7KE 1C1EH 5GGRA 4BQBA 2K7PA 3O4LB 3JWOL 1CXLA 3V4UH 2VITA 1CFNB 5INDB 1FNLA 3FT2B 2OR9H 5EU3A 3C8KB 4AZ8A 4HXBL 4PRHE 2F54E 4XC3L 1WC7B 1WBXA 4CU7A 3G08A 2RCSH 1A5FH 3N1GC 3VRJA 2X4UB 1A7NH 1IAKA 1J88A 3KDMA 4WHYG 5D1XA 4ZFZA 3VRIB 5T3XE 1U3HA 2XZAH 4V1DE 4M1DH 2DJ4A 5IVNA 1KEMH 1KIQB 4K94H 1U8KB 3QUZB 2HT2D 2NNAB 3FAXA 3O2DA 4NKQB 5SWSB 3IDGB 5GJTL 3D25A 1RK0A 5GQBA 1UJ3A 4HV8B 5E6IC 4K2UH 5KSBE 1WFUA 3C6SB 4KKLD 4GRWE 4JZOB 4C54A 4BFIA 1VKXA 5D72H 2NR6D 5L6YL 4ZO8A 1SVZA 4FXKA 1R5VA 2QEJA 1QRND 1YEEH 5HBBA 1QLRB 4O5LH 3QG7L 3QIUC 4I18A 5BS0B 3BWAA 3PWLB 4Y4KD 4C56D 5HYJB 4Y19E 1I7UB 1OHQA 3R06B 5LCVH 4U1IB 4FQPA 1M71A 3SE9L 2JB6A 3M1BB 2NX5D 1UCTA 4RNRB 2GKIA 1QPXA 2CLRB 3ELAT 1RZ8A 5I1DB 4P4RA 3KR3L 4Z8FL 3LHPL 1S7UB 2BNRA 3BKCL 1TTGA 4RFEB 1MWAH 1EK3A 1UWXK 2VLJA 4ZUTB 4GG8A 3QUXA 4PLOB 1JZ3A 2AKRB 2AK4D 3V6OA 2FIRT 3G6JB 3SOBL 2FHCA 4NDMB 1NAMA 5DJCB 3ILQC 4MNHA 4K71B 3WFZA 5ALBH 3VFWA 1P4IL 2ED7A 4J3SA 4PJDF 1XR8B 3QDGB 5DJAB 5DJYB 1UEYA 5KS9A 4B0MM 5MEND 2KL6A 4KK5C 3LDBB 4ZPTA 4R97C 4ELMF 4K8RH 5HPMB 2GSGB 4UAOB 3QJHB 4OZHA 5EOQL 4MJ2A 1LNUB 1ORQA 2Q76B 5SWSD 3DBXA 1F5WA 3AM8A 3GMMA 1CS6A 2NXYC 2DIJA 1SJHA 2EYTA 3FZUC 2F74B 3FKUS 2YUXA 1F00I 4AT6A 4LAJH 4AENA 4LQ1A 5INCB 1TJGL 1NFDB 5E99H 5BS0D 1KIUA 3ARFB 4H8WL 1UH3A 1F4HA 4M7LT 3ILPB 5HYSA 4QOKB 4Y1AE 4O51A 1WJ3A 1BEYL 5JO5A 5D7JB 3UTPE 3PJSB 4PJXB 3HZKB 3WKML 2W07A 4XMLH 3MTRA 2Q8AH 5GIRA 3QCTH 4JQXC 5EB9A 1TIUA 3RBGA 2EXWC 1HHJA 2OX5A 5DD3H 3EZJB 1IVLA 1UQSA 1FVEB 4XBEL 4MA3A 5H8DA 2NY3D 1QBAA 3H9HA 3RWHA 2V2WA 4XHQA 5IV2B 2J5LC 4I48B 4EUPB 4I13B 1FJ1B 3HAEA 3MNWB 4HUXB 3RA7L 3MGOA 4JFHD 5SX5H 4DGVH 3CXHK 3IU4L 5F72S 1OAXH 5I6XB 3CXDH 3CVIL 3HMWH 2ED8A 1CTOA 4YAQB 4Z0BL 4DZBA 1RUKH 1IKNA 4NT6A 5D1QB 4K8RD 3TO2A 2FX9L 3PP4L 1CGYA 1E4WH 5I8OL 2J8OA 1M1SA 4XAKD 1NC2A 3T65B 3TBVB 2H45A 2KUTA 3QZWG 4OF5A 2XWBA 4QYOB 1ZT4A 2ADIA 1HKFA 3MBED 5LBSL 3LVEA 4XWGL 5IM7B 1EBAA 3CVHH 5FYLE 4I3RH 2D7TH 3ARFD 4MAYA 5CSBA 4M43L 4DGYH 1SJVA 1RQ5A 4JKWA 4F7PA 3AMLA 2P7TB 3H9SA 2D3VA 4H26A 5FUZL 5C09A 3CZJA 4YO0A 1I1AB 4OJFL 1CK0H 2GK0A 4U2ZA 5D7SL 2FLBT 3D39B 3GJFK 3UEZA 5JMRA 1DQLL 3DX9B 3EOTL 5E08H 3ZT7A 3N50A 2A9MH 2ADFH 4JHBA 2AXFA 5A3ID 1T1XB 2DIBA 2LQRA 4F3FB 1SBSH 3GJFB 2EH7L 1IZJA 2D03L 2MQCA 2NPLX 3MNZA 4U4BA 4M5YL 2CQVA 5DD5L 3CX5J 2W65B 1K3IA 1IT9H 4GRLB 3S98A 3WXWL 2H9GB 2HTLC 4PJGA 3MXWL 1FLRH 1IGFL 3U36B 4YC2C 3EDDA 5D1QD 2YA0A 3THMH 3QDMA 3O3UN 4X4ZA 5C0CB 2BNUA 3ARBC 1DTUA 4LSRL 2P48B 5H37G 5T3XL 2GTWA 3EYFA 3FFCA 4OCRH 4W68A 2YZ1A 3KLHD 1PSKH 3HCVB 3MRNA 2VLLA 2NW2A 2VXQL 1TVBB 1UCBH 4ZSOA 3R1GL 4UIMB 3V4VL 3RZCD 3CPLB 3QCVH 3L3GA 1HDMB 1JRHH 3U7YL 3DRTB 5BVJB 4C59B 4WO4B 4RRPG 3M17A 1S5IH 4PJCF 3B3IB 3BW9B 4YHNB 2DRUA 4ZUUA 4HWZA 4OSUH 4MMXC 3BEVA 4YHMH 1S3KH 3L5XH 5I1CH 1TZHA 4DQOL 3PWVA 1B6UA 5DTFB 4P3CH 5E6IB 4CRPA 1LVEA 2QKIA 4OI7A 5FO9B 4HH8A 3UO1L 1WAAA 2Y5EA 1RMFL 5IFJA 5ESQA 4LF3A 4I5BB 1EGJH 1ZT7A 4Q2ZA 3QIUB 5J6GB 1GHFL 4G6JL 1BP3B 1IAIH 5L8LB 4GRLD 1F4WH 1PAMA 4N0RA 1G6RH 1BQUA 3UJTL 4D8PB 4EI6A 2DIAA 4P99A 1SEBB 4JB9L 3EFFB 7FABH 3S6CA 4PLKC 4CADB 2LVCA 4LNRA 1NC4A 2GFBB 1INQB 4U1HA 2EC9U 3MOQA 5D7LA 5GGSA 4RIRA 4MJIE 5C0CD 5FA4B 1J1XL 1KCVH 4Q9BA 43C9B 2A9NH 3HC4L 4OAWA 1GGCH 3ZDZF 1HILB 1HOCB 1HE7A 4UOW1 2R4SL 1MVUB 4EOWL 3DYPA 1XF5B 4OIIL 4WO4D 3ESVF 4DN3H 1IGJB 4JN1H 4RAVA 4U0QB 5I1HH 1CT8A 1OCWL 2YWYA 2ESVB 4R97B 1W0VB 1MFCL 4PY8J 2XZQH 2AGJH 1QSFA 1UT9A 2H26A 4LLQA 4YHPA 1CFSB 3RY5A 3PWNB 1KTLA 4FFWC 4IJ3C 4QEGA 1BM3H 2NXYB 5FCUH 3CFKA 1T66D 1GZQB 1JPST 1XGYL 4WU7A 2CJUL 2X4RB 2DBJA 2VLKA 1QP1A 3PV6B 4ZFFA 1L7IH 1ZT1A 3WMSA 2BXYA 2OLDA 1Z0NA 1G7JA 3QFJA 2AJ3B 3RUGA 1G9MC 4K3HA 5EU3B 4Q7DA 5I18H 1QLFA 4H25A 4JN2A 3LQMA 1KJ2B 3G08B 2ERJB 4I1NB 4BQ9A 2IANB 3P0YL 5HHME 3W9DB 5I71B 3I50L 2DKUA 1U3HB 2UVFA 3ZSTA 4NN7C 3U30C 3O2DH 1G0DA 3BQUC 1XGUA 3C2SA 4LHUD 5F3BB 2VL4A 1HNGA 3E8UL 5JXAL 2HMIC 5F7EH 2YD1A 3KPRB 1CDGA 3NACL 1A7RL 2I25N 2E6PA 3QULA 5JOPD 3BH8B 4UDUB 2M2DA 1OD7A 3DVNA 4L4TE 1ACYH 4TPRL 1ZLVK 4JO3L 3VFNA 2J5LB 4P9MH 4AK1A 4I18B 4L3CB 1A4KA 1JWSB 1KPVA 3ZKNC 4HXAH 3ZKSD 3QUKA 2ESVD 3TN0D 1F2XK 1I7TB 5DFTA 2IQ9L 4KJWD 1I8LA 1PY9A 5CILL 5FYLL 4Y16C 5JORB 1DUYA 1UZ6E 1NBVH 3CDCA 4FQCH 4P4RB 1UVQA 2BNRB 4UDTA 4OGYL 1OGAB 4ENED 3QNYB 1E6JL 1IQDB 1MHHB 3K46A 4JDTH 1MCOL 4X6DE 5IBTL 2B4CL 4FZEH 8FABB 4FTVB 1UB5B 1NAMH 4JKPL 4XP1L 1A0QL 1INDL 4QHMB 4HGMA 1K8DB 1UH4A 4WI8A 5HDBF 5KANI 3T08A 5CP7A 4CUCA 3OKKB 3VFWB 4JDVA 5KOMC 1A9BA 4M6NL 4XPTH 5J12C 3EYSL 5DFVC 3I85A 5T1LB 5D1XD 43CAB 2C3VA 2AJXL 2ZUSA 1U3HD 4DK3A 1T89C 1BVLB 1ZGLP 5BRZB 2EXYC 5HHQA 4OLWL 4ONFH 2OJZH 3WIFB 5KVDL 5C0NC 2MWCA 4M9OA 1I3RB 1GZPA 5C71A 2YS4A 2X1QA 5C0BA 3DO7A 3T0EE 1NLDH 1EJ6A 2NY1D 3E6HA 1PVHA 1N26A 1ITBB 3VFOA 3GMLB 3TT3L 4WRLA 3A6BL 3V2AR 2R4RL 4PJBB 1A6AB 2OK0H 2R23B 2F19L 1N2RB 3LAFA 1FFOB 1QG3A 4HF5L 4Z7VB 4YC2B 2HA1A 1GCFA 1FZKB 4XNZC 2I07B 1JGDA 3CK0H 3ES6B 1VGKB 3C6LC 1BVKA 1IZKA 5B38A 1AQDA 4XTRC 1NGYB 1HHKA 4O02L 3ARBB 1IEAB 3S97C 1YNTB 1YYML 2NY7L 4XNXL 2BNRD 4QF1A 5IVXE 4N0CD 4PFEA 5CWSB 2NZ9C 2VLJD 4MQSB 4Q6YA 1CGXA 1A6VH 5CUSH 5F89B 3VMNA 3GI8H 1JHTA 5HYFA 1DBJH 4QTHB 3TP4A 3GNML 1KF9B 3QUXD 1HHJB 2IMNA 1X5GA 1UQSB 4P57A 1DR9A 5D1ZC 2VR5A 1JFQL 4PJAB 3HAEH 5LWYL 2V2WB 3U4BL 4JFYB 1CGVA 5L9DH 4TOYH 3PDGA 5D6DC 2DJSA 3JV6A 3P4NB 5EU6B 3X17A 3LQAL 2Y36H 2XN9E 1H3VA 5CBAB 1LO5A 4ZDHA 4YHOL 5J9PA 2FGWL 3L7FB 1T1YB 1J1OL 4NZUH 4XVSL 5HGAB 5CJ5A 5AG8A 4S1SL 1NC2B 1OAUL 3P4MA 2WLYA 3OMZA 3TYFA 5IIEB 5D6CB 5K9KB 5JLZA 4HKZA 3VGBA 3B2VH 2JJWA 2DN7A 1ZT4B 1AO7B 1U3YA 4LFHG 4P2OC 4XPGH 1FG2A 1FSKB 3MV8E 3NMEA 3MUZ1 3ROLA 3HPJB 4KTDH 3SE3A 4KPHH 4JFQA 1S8DB 4MAYB 1KB5A 1X7QA 4YHYC 4P59H 3QCUH 2DKMA 2IJ0C 5ICXA 2GIYA 4RZCA 5GS1C 1NDGB 4YUEH 3IFLH 1QFWM 1QD0A 3T0XA 1VPOH 2AXFB 1E4XI 3CFBB 4Z7UE 1J0JA 1BIIA 1FORH 4GKZB 5GS0H 1OOAA 1RK1A 4IRSA 3L1OL 2AQ2A 5L2KA 1NMCC 3AS1A 5DURB 5DMIL 5F6HI 1S9KC 3BH9A 4YBLC 3CMOH 4UILL 4O2FA 4MNQE 3WIHH 4F9LC 5CINH 2B1AH 4APQC 4IJ3B 4MAUL 2B8OT 3JBG7 2YA2A 1KYOK 1EEQA 5C2BH 5CD5D 2GJ6B 2QSTA 3QDMB 3VD7A 3EYVA 1XIWC 3FQUA 1NC2D 1F8TH 4HEPG 4OQTL 5I19L 3BKML 1RUQL 3REWB 1JF1B 1YJDH 5DR5L 1Q9KB 3LEYL 2NY4C 1NGQH 3R4DA 3MRNB 3FO9B 4ZSOB 3LN9A 4X7TA 3EFDH 3BESR 1AO7D 3ULVC 1HH9B 3G5XB 2P47B 4AEEA 4XAWH 5CP3A 4D9LL 3UTZB 1Z9MA 4KI5D 2FWOB 4CDGC 3M17B 1JP5A 4BKLA 4O2CB 5FV2A 4MAYD 3FL7A 3DUUA 4ZD3L 4NN7B 2EYSB 2W9DL 5ANMA 3GEWB 3KPQB 2ZOLA 3H9SD 4BQCA 5C09D 2AEIT 5TF1L 3H3KA 4FOMA 3WDJA 5TQ0H 2VLRB 2QKIB 4MS8C 4J1UB 2H8PB 3WO3B 1X9QA 5FECA 5FFLA 4HWBL 4LF3B 4YHLH 1ZT7B 1BOGA 1HI6B 4W81A 1OQOA 1U8JA 1OTTC 4GAFB 3RNQA 5JR1H 4OGXL 3KPSA 3DPBA 3T77A 4JFFE 1MAML 3M07A 4JRYB 1XZ0A 1C5BL 5F7MC 2Z31C 3BVNA 4WDIA 3VFVA 7CGTA 3QQ9C 5JPMB 2OL3B 5A40E 2Y25A 2OMNA 4Y16B 2ZNXA 1I9IL 1S9WA 1JGUH 5B8CC 4PRHA 2F54A 2VXUH 2DDQH 1YEJL 2O5XL 4LCWB 1FL5A 5J4MA 4XNYL 4LLUB 4XXCA 3F7YA 5GGSB 3QDMD 1AXTL 4TRPL 4XPBL 4OUUA 3O2VH 5HVHB 2OXHA 3IJYA 3FFCD 1WZ1H 4V1DA 5E8OA 1RUML 1R3LA 5DD1H 4QY8B 3TJEL 4Z5RB 2SEBA 4BSWB 2R0KL 4K7PY 2C4XA 3BKYL 4WFGE 3AU1B 3D6GA 4UTAH 5J12B 3T3PE 2ITCB 4JPKH 2J88H 3FN0L 3OX8B 5E8EA 1ROWA 3HZYB 5D2LF 5GISH 1CT8B 3U1SH 3MYZA 5KSUA 3ET9F 5E2JA 4ZUVB 1YEDB 1EO8H 4RGNE 3W9EA 2H26B 2PTUA 4LLQB 4N0YL 4H0IA 2P43B 3LKPB 1HSBA 4Y19A 5IMLB 1OAZH 1YC8A 3C5ZC 3ZT6A 3OJ2C 2YK1H 2E5EA 4ZXBA 1WQVT 4G5ZL 2VLKB 3WL9B 4NO0A 4X9HA 5JPNB 1UM6L 1G7LA 3F58L 3KYKL 2ID5A 4R0LC 4R26H 4KK8D 5F71A 4I3GA 3D3VE 1BLNA 2X9XA 4K23L 4KY1H 5BZWB 3VFTA 5C6TL 1B90A 4U3XA 5F6IC 1REIA 1FYHB 4XNZB 5EU7E 2Y1VA 4NGHL 2Y07L 4BYHA 3IDIA 4JY4A 1FHGA 5CIPH 2N1KA 4PRNA 3RBSA 2DLFH 3U2SA 2ZG1A 5L88L 5GSVA 5D7LD 4M02A 4D2NA 5D7IF 4XVJL 5CBEA 3LEXA 3EZ8A 3CFCH 1IC1A 4OM0L 4LLAA 3KPNB 1MFBH 1AXSA 1WFTA 5D1ZB 2CRZA 5I1LB 4FQ2L 5J6HA 4G7VL 2HVKB 1W72H 1WV7T 5I1JL 2AV1B 1Q1JH 4JHWL 5C08B 3PWPA 5B39G 2RFXA 1A4KB 3D2UB 3JV0A 4HDIA 1GPOH 4ZPVA 3SQOH 2DQCH 3L7EA 3PV7A 2VC2H 5DZOA 2NXZB 4K94C 1QSFD 5C0ND 3D69A 3D9AH 4POYA 5FDWB 1WT5A 3OR7A 4PP1C 5FO8A 3HLAA 3VDAA 1ZHKB 3UYRL 4QRRA 4MNGE 1N6VA 3RNKB 4Y1AA 4AY0A 2ZSWB 5F70A 4OZIF 1PDKA 2VLKD 1YEHH 3TIDB 4HXBH 4NZTH 4XC3H 3T2OA 4JJ5A 1S7QB 4CVZA 4X6FB 1EFXB 4X98A 1A9BB 3MLVL 3V0WL 3FOMB 4RDQF 2HFEA 4XP6H 3Q5YA 4XTRD 3ZE1E 4C4KO 3U6RB 3LN4B 1BJ1J 4HIJB 1HZHH 1YY9C 1RAMA 1NGXA 1Q9OB 4ZQKA 3MFGB 1TCMA 5GJTH 3PGCA 4WV1C 2JKXA 1FYTB 4NSKA 2XACC 1CF8L 5DDHA 1DL7L 2Z91A 2EC9T 2VN7A 4JVPA 2DQFA 5FKAA 1A3LH 1GZPB 1ZSDA 3U7AA 4I0PA 5C0BB 5IFHH 5L6YH 2HRLA 3RVWD 3E6HB 5FGSA 4F7CB 1U8HA 1NMCB 1YUHA 3PWJA 2VSDA 5C08D 3QIBC 1UB6B 3SE9H 4GO6B 3ZTNL 5FM4A 1GL4B 3MNVA 2AK1L 4Z7WB 4APQB 1YEIL 3PGFL 2NXZD 1BVKB 4BH7B 1GH7A 4L8CA 1A6WL 1XIWB 2AXGB 3BKCH 5ACZB 2QV2A 5F21B 2OTUA 3SGKA 4Z78B 1XGPA 3Q6FA 4UB0L 2ORBL 2BX5A 2JCCF 3MLUL 1JHTB 1WZKA 2NY4B 3IDXL 3SOBH 5FUCE 4LCYB 1Q94B 5C0GA 1RV6X 1NANI 4OKVB 1HHGB 3DECA 1YPZF 5KZCD 1P4IH 2YUVA 3LKRA 1KCRL 1FFQA 1DBKH 3L9RB 5FGBC 4WEBH 25C8L 1NCWL 3V8CA 2VRAA 3RRQA 1Q9WA 5DEGB 4Z7NE 3ZE0E 4M1GH 5TE4L 4KV5F 5J57B 4FQJH 1X6NA 2P49B 5CEXA 3UJJL 1TVDA 4M5ZL 2QJDA 5DJDB 2V2TA 4Z76A 5FK9B 1NGWA 3HZVB 4ZDHB 3GSNA 5IQ9A 3OKOA 2P24A 4JCLA 2GJZB 5DUBB 1ZGLM 1K4DA 3VWKA 3EO9H 4QNPE 5C0BD 2P8MA 4PJ7F 1CGTA 1TJGH 4HK3N 4ZO7A 1QYGL 3RVUC 1CE6B 1MCFA 4H8WH 5MP6H 3ROLB 3NTCL 2D9QB 3JV4A 3PIQB 4JG1L 5K9JH 2VDQH 3IFOB 5B8CB 1X7QB 1S7WB 1BEYH 4WU5A 2D7MA 4OZFG 3DSNA 4QGYA 4PRPA 3WKMH 1OY3B 4Y4FC 3EYQD 4O2EA 3MLXL 3IDMB 1J12A 3HUJF 4CJ0A 1LHZA 2UZYB 3GO1L 3G6DL 3WCYA 4XBEH 2WANA 3ZL4L 4R4BA 9CGTA 2GK2A 1MCCA 5F9WC 3ISWA 4NHUA 5HTSA 2ICWJ 2I9LB 1CCZA 2KQNA 3RA7H 3AAZA 5L2KB 3R0MA 3IU4H 2HRPL 3CVIH 3BH9B 1BECA 4Z0BH 4YQXL 3LZFL 1QSEB 3QPXH 1MIML 1T5WB 4KJPC 2M1KA 2FX9H 3PP4H 3DVGB 3FQWB 3GMNA 3MROB 4UU9A 3QO0A 1T83A 3FQUB 4XRCA 5DJXA 3VXTA 3DMMA 4R2GC 1MRCH 4NQSA 2UYLA 3CCHB 4R0LB 4WHTA 4ODXA 1I7ZB 5LBSH 3IU3A 4S10A 4U0RC 4MJIA 2IH3A 4LSUL 1YA5A 1B0WA 2Q7YA 4HKJB 3SKOB 2DBLL 1QR4A 4CW1A 1B4RA 3KXFE 1HEZB 4LIQL 1NCDL 4M6OL 3DROA 4Y2DC 2QADC 5FUZH 1FLTX 3UBXA 2GY7B 2IGFH 2YD6A 1ORSB 2N4IA 3G5ZA 4OJFH 3VXQA 3STLA 5GZOD 2VTFA 5D7SH 1JYVA 1KPRB 3GK8H 1DSFL 2H2PC 1U8NA 2HG5B 3EOTH 4JFZL 4PJ8C 1FGVL 5I30L 2XZCL 1CICC 1T1WB 1L0QA 4FQQB 5CZXC 1T2QL 3OKDA 2EH7H 2RQ8A 5IJVA 2D03H 1KLUB 5DD5H 4N8VB 3RNQB 4BFBD 3WXWH 1OWRM 3T77B 3MJ8B 5L2KD 4TTDD 3MXWH 5CD3B 1IGFH 2IBGA 5D5ME 2DI8A 4IIQC 3FMGL 1UADC 5K59E 1WWCA 2BZDA 1A6TA 5IJKC 1QSED 5F1NB 5HY9A 1AC0A 4L3AA 3FTGB 3F12B 1FL5B 5EO1A 1TENA 3ARXA 4LSRH 5DJ8B 5T3XH 3F7YB 1MFAH 3KJ4B 5EUOF 4U3HA 3V8OA 1X5FA 3P4LA 4P3DA 5IGXL 4U7SA 4QGTA 3KYOA 3TV3L 4D9RE 4OQTA 2BJMH 4FFZL 2VXQH 4ODHH 1ZS8B 2DQHL 3V4VH 3QA3A 4OZGE 4JM2C 4H88H 4K55A 4N0FA 3RTQA 3U7YH 4BM7A 2SEBB 3VA2C 3V7AG 1S7SA 2DL2A 1FVDA 2CLVA 4XP9L 5CGYD 1J87A 3WFHA 3EUUA 2I26N 5EN2A 5SWZE 1HIML 2EEDA 1NBZA 4L4TA 3FQRA 4L8SB 1FBIL 4DQOH 4WV1B 4Q74A 2X4OB 1LGVA 5DSCB 5B4MD 3T1FA 2Q86B 3MGTB 3UO1H 2LU4A 1MI5B 2IALA 3Q6GL 3WEXB 4NQVA 4OCLC 4L8BA 4ZXBB 4LSSL 4POZD 3SCMC 5DK3A 4NO0B 2WP3T 4HWBA 1GHFH 4G6JH 5ADPL 1HYSD 3OL2A 1TETL 4FFYL 4YX2L 4LRIC 1BLNB 3RVVD 3FAWA 5ADOL 5D7KD 2AV7A 4X6DA 1BD2B 1IQWL 1JF5A 2GITB 1IGTA 2EDFA 3QQ3B 4NKMA 4QHLB 1JTPA 4PYGA 3MACL 3OKLB 4PRHD 2F54D 2YWZA 1MPAL 4QHKI 3QEUB 1J1XH 5HGHB 2MMXA 5HHVL 4XPAL 2E9BA 2DICA 1S78D 3LEXB 3TM6A 3HC4H 1KLGB 5KVEH 3X13A 5T3XD 1K8IB 3VD5A 4B7LA 4V1DD 2L7UA 1T80A 1WK0A 1AXSB 3VXNA 1GC1L 2R4SH 5AUMB 1RY7B 3DVIA 3EDJA 2K9UA 1DVFC 3PUCA 3GB7A 4K9EL 2VERN 4KXZH 1U8OA 4PJ5B 3BI9X 1NCTA 2WWMD 3PWPB 2BVPA 1MFCH 5EBLA 4HDIB 3T0EA 5DO2D 3U0WH 3GMRA 5D93C 3PQYE 1H3GA 1KG0A 3DIFA 1UJ3C 2NY0B 3D69B 4MVBC 5C0RL 1CLOH 4RGMC 2CJUH 4QRRB 3IXTA 1MI5D 4M62H 4MDIA 1OT1A 5ID0A 2BY2A 1VERA 5SX5K 4ZXBD 1FNGB 1N5AA 3UAJD 4IOFC 4NO0D 2BC4B 1U8LA 3PF2A 3D1MC 3M8OL 5F1SA 3DGGA 4WNQB 4CN1A 3MMEA 5IVXA 2XFXB 3P0YH 1D5ZB 3I50H 3NZ8B 1GXEA 4NJ9L 3VCLA 1QBMH 4G8GE 3GGWB 2CIKA 4LEXL 4Y4FB 4QWWD 1CFTB 5JUEL 3E8UH 5JXAH 4ZQKB 3PGCB 3A67L 3NACH 1A7RH 3IAPA 4NO5A 1SM3H 1MNUL 1JV5A 1IM9A 2XN9A 4TPRH 5F9WB 5DRZA 1C7TA 3LKNB 2VH5L 4ETYA 1MREL 5DMGC 3FQNA 4OT1L 2ARJA 4XNMA 2R2HB 3SDDB 2Y7QA 1NJ9A 4JPVL 2J4WL 4PJHE 3PWPD 1CE1H 1A6ZB 4HS8L 4ZFOB 5ENWB 3Q3GA 4I2XE 4NKIL 3GUTB 3RI5K 3MRJA 1CDYA 4DKDC 1TTUA 3ARPA 3DUSA 3CZFB 4GG6F 3MV8A 5F93C 3FQXA 2NY0D 3O3EB 2OTUB 5B3NA 4WI6A 1E6JH 5IBTH 4R2GB 2B4CH 4QRRD 4HD9A 3G04A 1JGEA 5EBGA 4IEFB 2Z35B 4MZ2A 4JKPH 4Y1AD 4FS0A 1A0QH 4FN0A 4U0RB 3UTPD 2HFFB 3RI5F 5CCKL 2GW5A 3GSOA 4GBXC 4M6NH 2BOCB 1J18A 1J8HE 3EYSH 1K4CA 1CBVH 3BGMB 2QADB 1L7TL 2HWZL 2WIIA 4KTEL 1D5IH 5C07B 4PLJC 5FKPA 2ICWA 3WUWB 3WS6A 3VFRB 4D0BB 5KVDH 1IGYA 1J11A 5DMKB 1FPTL 3F6IA 1IKFL 1NGWB 4UQ2B 4WCYL 4WTWA 5E8NB 4PJ8B 3RGVA 5I16B 1U42A 3PL6A 4R90L 3WFDL 3OKOB 3ARDA 5IHUL 1BZQK 2P24B 3C5SA 2MTPA 3NAAH 3NPZB 4MNQA 4GW1A 4HHAB 5GRVL 4GT7A 3D0LB 4I0PD 2QSCL 3V5HA 2MCPH 2WW8A 1QACA 3A6BH 2R4RH 3MLTA 1H0DA 5KVFL 2FR4B 2XNAB 3SDDD 4KZDL 1N59B 2F19H 1U8PA 5HI4C 4C55A 4WHDA 4HF5H 4IIQB 1DBMH 3EOAA 2Z8VC 3O3AA 4JZNB 5DRXA 1D6VL 5DQJB 5GGVL 2EDLA 4O02H 5LAXB 2PO6A 4PRPB 4E41B 4JLRA 1YYMH 2NY7H 5FYLD 3C2AH 3O8XA 1CD0A 3CLEL 4CKVX 3GNMH 4AYFA 4U1LA 2IH1A 2XTJB 4LOUC 1B88A 4F57L 5BZDB 4JM2B 4NN6C 1JFQH 2MCG1 4ISVA 2EDDA 2Z93B 5LWYH 2EH8L 4EKXA 1Q72L 1G6RB 2O61A 1WBYB 3SBWC 2FL5A 3AAZB 5DLML 4CVXA 3LQAH 5C07D 2JJTC 3HRZA 4UIKL 1M6OB 3LMJL 3JUYA 1RHHB 5GGQL 2Y9RT 4JFFA 3S96A 1J1OH 3X3GL 4S1SH 1LE5A 1OAUH 1RHFA 3SDXF 4XI5C 3MV7E 1I4FA 3SCMB 3WJLC 2DWDA 5DJXB 3W2DL 1FDLL 4WFEE 3VWKD 4X0KB 4WY7L 3PXHA 1SY6A 2UYLB 1RI8A 4R96B 3QZWA 3S8WA 4J4PC 5GS0C 2IH3B 1I75A 1U91B 3S4SB 3DHJA 2DAVA 5KAQF 2HVJA 2CDGA 1JN6A 5I8EA 3ARQA 5DI8A 5IW1B 1FH5H 2VWEC 4NNYB 2H1PH 4PRPD 4H1LG 3TA3C 2DI7A 3D18B 3VXQB 5C1MB 1I85A 2V7NA 3V5KB 5IG7A 4MLIA 5J3HD 3TVMA 5DEFA 1HH6B 3G5VA 4Y4HA 5F1KC 2XTJD 3BP4B 2EDKA 3AB0C 3JSSA 2J8HA 1YJDC 1DVFB 2BK8A 1BBJA 2VL5B 3FB5A 1DQJA 3OKDB 4FQLH 2A6IA 3AVEA 5HYQA 1FGNL 1CD1A 3SPVB 4XPHL 5DMIH 4GKSA 4ZS6C 1XF4B 5E2TH 5ETUA 3B9KA 4UILH 4P49A 5DXWA 2X40A 2EICA 5D93B 4LCCA 3IF1A 1ZXQA 3K74B 3VXRB 5IBLD 1Z9OA 3LB6D 4N5EC 3QRGL 2EZ0D 4RGMB 1ACZA 1CXHA 3F65A 3WIIL 1GIGL 2EDWA 5ICZA 3L5JA 4MD0A 4XH2B 3BKMH 1RUQH 1R0AL 3DMMD 4LGRB 5DR5H 3KYOB 3LEYH 4M4RA 3VXPA 2V6HA 4MCYB 3QDJE 3DV6A 2XWJB 3O81A 3QA3B 4LPYA 4HWEL 5E4IA 2X05A 3JTTA 3RTQB 4MJID 2HYMA 2UVEA 2JLLA 1ZHNA 2DS4A 3F7RA 4XPFH 3EGSB 2DMBA 4ZD3H 1YN7B 2BSSB 2G2RB 4OCWL 3UTQA 1HHIB 1JWUA 3P40A 2F53B 4RRPA 5EN2B 5LQBL 3FQRB 3RY4A 1C5DA 1Z3GL 5TF1H 2VXTH 4V2BA 3ZTJH 1RZJC 1FV1A 1VDGA 3QXVA 4RWYH 3OZ9L 3VXME 1ZHBA 1TCRA 1WGOA 1CZ8L 2MNUA 4HWBH 1Z5LA 4OCMC 2YSSA 1WBZB 4Y5XC 2Z4QA 3KPMA 4OGXH 1MAMH 5I17B 2XPGA 1C5BH 2R2BA 5JHLL 2ICCA 5ALCH 1U3ZA 1ZVSA 3AGVA 2J2ZA 5KS9F 3X3FL 1YEJH 1S7RA 4HJ0D 4XNYH 4WWKC 4QRSA 2BSTB 1TJHL 4OZHF 4TRPH 4XPBH 4H20H 3INUL 3LEVH 4XX1G 3WNOA 1P9MA 3LY6A 1AH1A 5HHMD 2PTTA 1MJJA 4HKBB 1OTSC 4MSWA 3AFLA 1U8IA 2K7QA 4JRXE 3TJEH 5IBUB 4GBXB 2R0KH 1J05B 4KFZC 5DRNB 3L3OA 1KEGH 3VXOA 3RTQD 1LP9B 3BKYH 3QEHA 5C9JB 5D9SA 1R5IA 3CGTA 1U8OB 3BDBA 3JVGA 5EC1B 1WZLA 1XFPA 4Q6IA 5CEYA 5EOCJ 4XVTL 2OMBA 4OFIA 2P8LB 4L4TD 3W5MA 1E4KC 4DKFL 4NWUL 1MSPA 3ARTA 4FQXC 3HR5A 2FBJL 3HS0A 3BX7C 1KG0B 4Y5YC 5CHNB 3IFPA 5KVGL 1D6EB 5IF0B 4TQEL 3IXTB 3O4LE 3BE1L 3T4YA 3JTSA 2F8VA 5DD6A 1UM6H 3OKNB 3F58H 2HJFB 5MEPB 4JZJC 5DMGD 4XNUH 1JBJA 4G9FB 2FLRT 3NPSB 4YNYA 2F58L 3QWOB 4K23H 1IAIM 5C6TH 2OYPA 5E1HB 3TO4A 2Z0BA 1PFCA 2B7DT 4P2CG 2E7LC 3BEWB 4NGHH 3O6MH 2Y07H 3QH3A 4J6RL 2FB4L 3VCLB 2X10A 4HJJL 3BJ91 1V7ML 3ZZ1A 2IPUG 1I9JL 3VDBA 2IQAB 3LKOA 3WLBA 4W4OC 3OXSA 3W39A 3VD4A 3BO8B 4XVJH 5SWSE 3VFMB 5IHLB 4R6UA 1SMAA 2PCPB 3S35L 5HD8D