1YEEH

Structure of a catalytic antibody, igg2a fab fragment (d2.5)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
EVKLQESGAELVRPGASVKLSCKTSGYIFTSYWIHWVKQRAAAGLEWIARIYPGTGSSYYNVKFKGKATLTADKSSSTAYMQLSSLKSDDSAVYFCVRWGFIPVREDYVLDYWGQGTLVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Catalytic antibody
molecule keywords IGG2A FAB FRAGMENT (D2.5)
publication title Structural convergence in the active sites of a family of catalytic antibodies.
pubmed doi rcsb
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1997-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yeeH02
4MLSA 5D7IF 1AD9B 1CD8A 1T04A 2AJSL 2F5BH 3MA7B 3WBDA 4JPIA 2UYLB 3EYQC 3PHQA 3BQUB 3SDAA 2P24B 5IIEA 4NQEE 2DQEL 1M71A 2X9YA 1NAMB 3BUYA 3ZYIA 1WCBA 4UB0H 4PJHE 2WWMC 5I8EA 1K4CA 5JPNA 1B2WL 1OAUL 4CU7A 5ILTL 3P0VL 1CFSB 2UWEF 4UTAL 3ZLQC 5C2UB 4KAQH 4AEHL 2P46B 2EDOA 3ECBA 5JQ6L 4I2XE 2OJEB 1KLUA 1FFPA 3L7FB 5JORA 3TO4B 5A2KH 4LCWA 2B5IC 2DBLH 2WLZA 1J9CT 4NYLA 4NQUA 1YEJH 2DQHL 3M1BA 3WMSA 2IADB 3IS0X 1CI5A 3FO2B 2HJKA 2F5BL 2BVOB 1CTOA 5FYLH 4G6KL 2Q3AA 1U3YA 1OGAD 2GIYA 2X4PA 4HKBB 4L8BA 1G7PA 4H5SB 4XPFH 5EU7E 5D2LF 4UB0L 4U6YA 4WY7H 3QUYD 2X4RB 1K2DA 1T6WA 3QULB 5EU4A 2DQTH 3MLXL 2XFXB 1ZEAH 4RRPA 1QSEB 2J1KA 2NY4B 2ZG2A 1TJIL 4LFHD 2VDML 4KAQL 2W65A 4JQVC 4LSTH 4WW1B 3DTXB 3NACH 1JWMB 3DGGB 4KTEH 5FYLE 1KTLA 3ORJA 2R8SL 4JGUA 4E41B 3LS4L 1TZHB 1FFNA 4D9QD 3IDJB 3C2AH 4CVZA 5F7WC 2NY3C 2YPLE 1YEJL 3UYPA 3C6SB 4LVNC 3AAZA 3TN0C 1CFNA 4XAKE 3O3DA 5E99H 1G7JA 1FJ1B 5E8DL 5FYLL 3UC0L 3PDGA 2DLGA 4XCCH 1U8HB 5IEHB 5BRZB 2K9UA 2BOBB 4HIIA 4JDVB 1T21B 4XPFL 1X44A 4D8PA 1T4KB 1MCOH 2XWBB 4WY7L 4L4VE 1HHIB 4M5ZL 3QEQE 4L4TB 2W9DH 1A6AA 2DQTL 4HUVA 2WAHA 1ZEAL 2FIKB 5DFVC 4N9GA 2AXJA 3SDAD 1MQKH 1JFQH 3B2UD 1IRAY 2APWA 2QSQA 3NACL 4HJGA 4KTEL 4ZPVB 4GW5B 4Z95L 4WNQA 2VUYA 4LBEA 4JB9L 1B6DA 1GXEA 5C0GA 4OQTA 3QO0A 2HH0L 4FNLL 4KPHH 1ULVA 4NKOB 3GMOB 3GMPB 1ZSDB 1XGPA 5E99L 2DQDH 4I3RH 4YHML 4U3HA 4XCCL 2XRAH 3OGCA 3G6JE 4LCWD 2X4OB 1L0XA 3OJDB 1MCOL 2GUOB 3VWJA 1LMKA 5JZ7C 3L3KA 2H1PH 4FQIH 4POZD 3ZHDA 3ZZ1A 2F74B 1JWUA 4Y8DC 4G8GB 4HKXB 2W9DL 2R2BB 2DLFL 2RGSA 5ETUB 2H32H 5DZOA 5CJQH 2DI8A 3TCXA 4XMLH 4GG6A 3BYYA 4Q6YA 2O26U 2IMMA 1MQKL 1JFQL 2PXYC 3NFNB 4K9EH 1ORQB 5FYJD 2HRLA 1FFOB 4M8QB 3ZMRA 2P1YA 3B9KA 2ED7A 4IIQC 1R5WA 2XOTA 4G7VH 3FFCB 2ADGA 3ZDZF 2YOCA 4C56B 3QDJA 4KUZH 4NQDE 5D2NA 5AYUL 4OIAA 3K4DA 1FH5L 4IJ3C 5FGCB 1JMZA 4R6UA 4P2QB 1KTKE 4KUCD 3SDCB 5IJVB 7FABH 1W8NA 5LBSH 3I9GH 4X4MA 2YPKB 1QSZA 4I3RL 2OZ4A 4DGIH 2XRAL 5GIRA 2EIDA 1SYSB 4PJCF 2V5YA 2H1PL 3X14B 3TIEA 2FX8H 1YPZE 2NW2A 4HZLA 1QR1B 4CU6A 4MQTB 1B6UA 4UAOC 2Z9TA 1F00I 4XCFH 4F80A 1FAIH 5CJQL 4P59H 4K9EL 3AY4A 4PJ9C 5C09B 5L7XL 3LQZA 3GSXB 3RL2A 5IB1B 5LAXB 4YFDB 4G7VL 4WI7A 4QT5A 3D3VB 4RAUA 4KXZI 1UH4A 3WL9A 1QYGL 4X7DC 2WINB 4N9OB 3DROA 1AD0B 5C0CB 3SDYH 3D2UB 4HUUA 2BNQA 7FABL 3VH8A 4KDTC 2NX5B 1GGCH 1YQ2A 5C3TA 5DJYA 1U3HC 1BFVH 5CBEA 1FYTA 5HHMD 3L5WB 4HEME 1UWXK 5BZDA 1OAZL 1QSFB 3HI5H 3FB6B 1B0GA 3PWLB 4J3VA 5TQ2H 1VKXB 2OS7A 8FABA 2ADJB 3OJMB 2H26B 1ERNA 4LSSH 1E4XL 4PRAA 5I30H 1RFDH 4PJFA 3VWJD 3HG1A 4I4WA 3V9FA 1W72L 5MHSD 2YBRA 2VLKE 3VI3F 1NBQA 5D7JA 4GSDL 3X3GH 2EDXA 3D0VB 5SX5H 4EQ3A 4WU7B 5JW4Q 3P30H 2YUVA 3SDYL 4U1MB 4MJ5B 4F3FB 1GGCL 3QDJD 2G75B 3QI9C 3QAZB 1IAII 1BFVL 2Q8AH 2ERJB 4E42B 1QOKA 1W2KT 2Q87A 5JUEL 5C92A 2QSTA 3WUWB 4YBLC 4GAYA 3IFLL 3HI5L 2NXYB 4K2UH 1XIWC 1VFAB 5TQ2L 1I8KB 2YS4A 4GW1B 3RNKA 2YSSB 5IOPB 3IAPA 3S3JA 1JTOA 5E6IB 5I30L 1RFDL 5AYQA 1ZLWK 1MCHA 1NGXA 4PP1D 4XNMB 1IVLA 1P4IH 3ARFB 1UB5A 4S0SD 3O11A 4QXTA 2OYPA 5DUML 3ULSA 4XAWH 3TIDB 3X3GL 3UTOA 5F9JB 4CMHB 3P30L 5E8NA 5JW4R 4X7SH 3HKFA 3QYCA 3DXAE 3UTTE 4MXWL 1FZKA 3IJSA 1XGRA 5I66A 3I50H 5D1XA 4QRQB 2GCYB 3L95A 3PXJA 2JB5H 2BNQD 4K2UL 4JCLA 1IQDA 1RAMA 2R69L 5H8DA 1OB1B 4OF7A 4K7PL 4HIJA 3HR5B 3OKLB 1FYTD 4JY5H 5JLZA 4QYOA 4ZD3L 1CXLA 1BD2D 5SWQA 2JK5B 4X7FC 3K2UH 5C0DA 4G42B 5I2IB 4MA1C 3HNTH 1QLFB 3JV4A 1WC7B 4XBPA 5B38A 5HSFA 3DX9A 4PJ8C 1LP9E 4X7SL 2X1WL 3HG1D 2J6EH 5C08B 1U91B 5JOPE 3GM0A 1HZHH 2E9BA 4Z7OF 1I1YA 1YMME 1NMCB 1KOAA 5FA3A 2O5XH 5D7JD 2E6QA 5JQHC 3LSOB 5FUCE 3WIHA 2ZCHH 4TNVK 4KK9D 2VAAA 3GKWH 3I50L 1ORSB 3S5LA 5TDNB 3GK8H 2JB5L 3P3YA 3RPIB 3OZ9L 1YEDB 4Z76A 4O9HL 3B2VH 5CEYA 2AJXH 4HGWA 1PQZB 1P53A 1I7TA 2IPUG 3U6RA 3QWOB 5F88A 1X4YA 2Z35B 4JKLA 3K2UL 3IJHA 5HJ3B 1BREA 1RU9H 1XCTA 2XXCB 1U8LB 2XACC 3HNTL 4W6WB 1EVTC 3Q3GB 2EIBA 43CAB 3QT2A 4DVBB 2NMSA 3VCLA 5FM5O 4G6AC 1OTSC 4I5BA 1PYWB 1HYSC 5I1AA 4FQCH 4EIZC 1HZHL 4JGMA 3MV7E 3SE4A 3QJHB 4R96A 4NN5C 4PRHB 5AG9A 1P84J 2ZCHL 1EMTL 1JUFB 1HHJB 3QDMA 3GKWL 4PJAA 5IUSA 3BD3A 1H3GA 4I0KA 3O9WB 3CAFA 2VLMD 3SKOB 2RBLA 3B43A 1V8HA 4JPWH 4U4BA 3B2VL 2AJXL 1AHWA 3IDGB 5JPMA 1ZT7B 5HYSG 3AS1A 4PGCB 5CLWA 1JGLH 4Y4KB 5FO9B 5FK9A 5CIPA 5D1XD 5D6CB 3BRGC 1RU9L 5C2BH 1MFEH 4ZUUA 2YZ8A 3PIQB 4XNUL 5L88H 3FRUB 2QKIB 4TQEL 1I1FA 4KMQA 3VRLF 5SX4H 1FO0A 2Q8BL 3QFDA 1JVKA 4NQCE 1ZT1A 3IGAB 3TLRA 4AH2A 1G6VK 4HFWB 4LMQE 4ODBD 5BV7L 5FO7B 3EYOB 3ABZA 4FP8H 3C8KB 1N5AB 3AMKA 1IEBB 1F8TH 4MNGA 5K33A 4CDGC 4PLNC 2Y9RT 5CUSL 4ZUTB 4UQ2A 5GGSA 1I8IA 5LGKA 4JHAH 1GSMA 4U05A 4CVXA 2PR4L 3DIFA 4LOUC 1B0RA 1IKFL 1OPGL 1VFOA 1JGLL 5KS9E 2B1HH 4YNYB 3U7WH 4LKCB 4KKCD 3FOMB 5C2BL 1MFEL 1N8ZA 4ZMAT 2KH2B 5L88L 4J3WA 2PYFB 5BS0B 5HI5D 5AAWA 4PFEA 3PWJB 3FT3A 4U2ZA 4GRWE 5E9DA 3I3DA 2OL3H 1DEEA 1INEH 3P4NA 1FSKC 3MLYH 4FP8L 2NXZB 1T0NB 2NNAB 1X6LA 5SWSB 3D6GA 3WJJA 4JRXE 3QIBC 1YN6A 2X05A 1JK8A 4JHAL 1W0YT 1EHXA 1CGUA 3P77B 5FKPB 4U6HA 4TVPH 1QLEL 5FCUL 3NCBB 2GI7A 4EN3B 5DXWA 4P23D 3QDMD 3GHBH 5LXGH 2B1HL 5KSBA 1S78C 4JFYB 4U1IB 3GMQB 3LN4A 5I1DB 2HA1A 4JREC 1GC1L 2XNAB 2AKRB 4PJIE 5BVPH 5FOBA 1JYVA 5J12B 3DV6A 1G7LA 4ESKA 2A9NH 3ULVD 4LSQH 1MH5A 4U1SB 4Y19E 1HQRA 4JKPH 2YA2A 2D9QB 1MWAB 4KHXL 1KEGL 3VXOB 4CW1B 5CZKA 4QWWC 1ZA3A 2CIKB 1MFBL 1PX3A 3T04D 3LKOA 4WFEE 3ULUE 5J1TC 2YD6A 2NZ9C 3ZT5A 4TVPL 4L3CB 5FYKU 4K07A 4C83B 4Y89A 3E6FB 1ND0A 2OTPA 5LXGL 5DO2D 3DBXA 3MNZB 4NKMB 5IEKB 1S9WA 4QHMA 4HXAL 3WNKA 2IQAA 3ULUL 1Q9OA 4ZFOL 1DUYA 1TVDA 4EEEA 4ODTH 4F2MB 4HS3B 3UROR 1BVLA 3BPLB 4GMTH 5BVPL 3TF7C 3FAXA 1FC2D 2Y07L 4EI6A 3LKNA 1VFBB 4LSQL 4S2SB 2C4FU 3EHBD 4U6XB 2KZ1B 1IAKB 2YZ1A 3ZYZA 4AT6B 3O8XC 3NAAL 4KZEH 4HDIB 4HH9B 5SWZE 2HVKB 4NZDA 5E9DD 5CBAB 4NQSB 1A02N 2EDQA 4R7NB 4G9DA 2VLJA 2FJFB 4PRDA 4JM2A 3U4BL 1HI6A 3NPZB 3PV6A 2ORBH 5JNYA 3MLWL 2GJ6B 1FQ9C 1UXWA 1ZVYA 4P9MH 1AFVH 4NRZA 5IR1B 4OZFB 1CIDA 3H9HA 5T3ZE 1DQLL 3BWAA 4ODTL 4J3TA 2UWEE 4Y2OA 2FL5B 1FIGL 4GMTL 1S5HA 4MMXC 3BD5A 4P5MA 5I71B 4S1QH 4M6MH 3VFGH 1J18A 3VXRB 1K3IA 2Y06H 1HWHB 3TH4T 4PJ5B 5BQ7A 5BCAA 1RZGA 1V3LA 4YX2H 3TA3A 1Y6KR 2CQVA 1YEFL 4F9PA 4LHUB 4XBGA 4IOFC 3MUGA 3REVA 1CE6A 3TNNA 5LQBH 2WWKT 5EZIH 4M7LL 3MQIA 1T1XA 3UBXB 4H26A 4YXKH 1NFDA 1BFSA 2EDDA 3ARZA 1ZE3C 4PJBE 1FNLA 3KDMA 4NJ9H 1HH6A 4LDEB 1SJVA 4RBPK 3TT1L 2RAMA 3MGTB 5GGUA 5GISH 3NZHH 4P2YA 4EQ2A 4JFQA 1G7QA 4KK5D 3OKNB 1LD9B 1YUHA 3OTTA 4QHNB 4XZUA 3RY6C 2J7LA 3HZMA 1G7IB 4M6ML 3VFGL 3HZYB 1NAKL 1A1NB 2V7NB 4R0LC 4P4RA 5DMKA 3V6ZA 4AENB 2A6KB 2A74A 2GSGB 3NA4A 3WLBB 3TYGL 1GL4B 4HWBH 3KS0H 2VN4A 2B8OT 1MFCL 3V6OE 2P43B 3MV8B 2O93L 1DANT 5EZIL 1UFUA 1QRNA 1GOGA 1S7VA 4YDLB 1CZ8L 3I6LD 4HLJA 1QBAA 3DI3B 4YXKL 3KYNA 4UZGA 1K4DB 5HI4D 1TETH 4PR5A 4PPTA 3VFUA 4DOHE 3QHFH 2DIBA 4L8CA 1E4WL 3RVUD 1Q0YL 4P57A 4N1EA 5GISL 2BY2A 3K8LA 3NZHL 4PGBB 4ALAL 1RZ8B 2VLJD 3HC3L 3RL1A 5E94B 4JM2D 1I8MB 1DDHB 3ZE2F 4M1CD 2DWDB 2W0KA 3FQTA 4LLYA 1OWWA 4PYHA 3ZKSD 3GI9H 1FG9C 5ESAA 1NGZB 1S5IH 4XPTH 3SE9H 5KJRH 5KSUA 4FQQA 4HWBL 1AD9A 4LVNB 1HHGB 2XWJB 3FFDB 3KXFB 1LO5B 3P2TA 1VERA 4BSVB 3MA7A 1WBXA 3TN0B 1MNUH 3EGSB 2UYLA 2JCCB 3BQUA 2P24A 3TA3D 4AIZB 4DQOL 4TTGA 1TETL 3MUZ1 1NAMA 5IWLA 4JN1H 1BWWA 3QHFL 3SGKC 1CYGA 4WIQA 1B4RA 5CD3B 3UAJD 5B39B 4TULH 2X1QA 1CFSA 3SE8H 3H6JA 1UA6H 3T2PA 4HKJB 1N6QH 1CL7H 1GZQB 4BYHA 4UNTA 3SDXB 2YWYA 3GO1L 4NT6B 3ZDZE 5D96C 2OJEA 5FYKH 5J1AB 3GI9L 1LVEA 2BXYA 5ICXB 4RDQG 3CK0H 3BAEH 4XNZC 3L7FA 3ZT7A 4TPRL 3EFFB 4GUPB 1S5IL 3S7GA 4PP2B 5KJRL 4I3SL 2IADA 1A1MB 3LD8C 1CLZL 3N0PB 3FO2A 1OTTC 1VCAA 3OPZH 2BVOA 3OF6A 2UZIH 4XXDB 4PLOB 5E24E 1AE6L 3RBSA 4ZNEA 5F9WB 4HKBA 5KZCD 4X6EB 5DD1H 4H5SA 1NJ9B 3V52L 4N1HB 4JN1L 1O7SA 3QISA 4TNVF 3TO2B 2X4RA 3EJYD 1YY9D 3BH8B 3QULA 1A6VH 4Y2DB 4BK5A 4TULL 2BNRE 3SE8L 4IEFB 1RUPL 1CD1A 1CL7L 3BGAA 5E2UH 4QRPD 3OAZH 4WW1A 3OQ3B 1JWMA 2PXYB 3DGGA 2PTVA 3RWFB 4IIQB 3CK0L 4LSRL 4E41A 1TZHA 3BAEL 3IDJA 4X7TB 3BGMB 4UTBH 3C6SA 2R0WH 4XVJH 2NPLX 4CUCA 1KCRH 3CX5J 2UZIL 1FJ1A 1OP5H 1D7FA 1BQHG 3I6KA 1U8HA 4NC1C 5DDHB 5IEHA 5BRZA 4JDVA 1KJ2B 2BOBA 5DD1L 3WO4C 1T21A 1T4KA 3WFEL 2XWBA 4H0IA 3G5VB 4JR9L 3BRFA 1A6VL 1GZPB 4L4TA 2YXFA 4MVBD 2FIKA 1ADQA 4NBYB 1ZLVK 2DOCA 3JXAA 3BQUD 4UAOB 2W0LA 4AJ0A 5E2UL 4CVUA 2ATKB 2VSCA 4X98B 2C7UB 1I9RH 4H1LG 1MCCA 3V4UH 5GS3A 1LO0L 4ZPVA 3DJ9A 4G6MH 2P8LB 4UTBL 3GRWH 1LO4L 3MRGB 1DQQB 3E6HA 5C0AA 1V3KA 4XVJL 3SJVB 1KCRL 2CDGB 4NKOA 3GMPA 1BOGB 4ERSL 1G9NH 1ZSDA 2J8OA 4G7YH 3S37H 4R3SB 2EC9T 2G2RB 3MPCA 1GHFH 3MRNB 1G7MB 4NO2B 2IH3B 1MQ8A 3KNBB 2X4OA 2BVQB 3NIFF 1MY5A 4JFEA 3SO3B 3OJDA 4OCMC 1LK3H 2MHAB 2V5RA 3VFOA 2ZCLH 3MJ7B 5HYJE 3RTQC 2F74A 5ICZB 4G8GA 4HKXA 5ETUA 1UT9A 3OF6D 4MA8H 2PYEE 1RZIB 1BQSA 5C1MB 1JNNL 2A9ML 4OCLC 3NFNA 4WRLA 3IDIB 1FFOA 4M8QA 2OMBA 1I9RL 4M61B 3FFCA 3V4UL 1HSBB 4NWTH 4QRRA 4ODUB 4HPYH 3WEXB 4C56A 4G6ML 4OLEA 2NY4D 3C87A 3GRWL 1S8DB 3ME0A 3SDCA 1FVEB 5IJVA 4H25B 2BCKB 3IFOB 1ZGLP 3S37L 2YPKA 3AXLA 4E41D 1GHFL 2F54B 3H9SB 5SX4I 4UIKL 1SYSA 2FEEL 3QI9B 1LK3L 3MJ9H 3H3KA 3X14A 3LQMA 3VXQB 2DKSA 2OK0L 1IKNA 2DMKA 4MA8L 4UT6L 2GITB 3CVHB 2KL6A 1N2RB 1XIWB 4NO0A 5BRZD 5C09A 1YEEH 1EFQA 3OG4B 2HJFB 3GSXA 5IB1A 3K2MC 1P6AB 3R06B 43C9B 3D69B 2X4UA 2H45A 4L4TD 5A3IC 4HPYL 2LAAA 1ZLUH 5BMFL 5ISZB 4PJGF 2WINA 4WTXA 1G9NC 4FTVE 1AD0A 5C0CA 3D2UA 4Z7OE 1ZT4B 4D9RE 2NX5A 2A1WH 5MI0C 4LAJH 4XP9H 3EOBB 5CD5D 5L6YH 5C0AD 2OR9L 4WUKH 3L5WA 4XGZB 3V7AE 1QSFA 2UUDK 4M48H 3FB6A 3PWLA 2DQIH 1VKXA 2ADJA 3MCG1 4KRLB 2H26A 2P45B 2QQQA 4JFED 1YEEL 4L9LC 5DYOB 4LQFH 4G8GD 1A64A 2XZAH 3U9PH 1KB5B 1QNZH 5C0IB 1WT5C 3D0VA 1V7MH 3VWKC 4MA1B 4WU7A 5CKGA 3VGEA 2BZDA 4PJDB 4D0CB 4U1MA 1TMCB 4Y4FB 1XEDA 3FFCD 3V5DB 3MZTA 3C08L 4QRRD 4TSBH 3ESVF 4C56D 4XP9L 2G75A 3EDJA 1NLBH 3FZUC 1P84K 4E42A 4HK3J 2HFFB 3DHJA 4M6AA 5I9QC 3SDCD 3WUWA 4M48L 3FO0L 3S6CA 1VFAA 2HWZH 3BP5B 2DQIL 1I8KA 2NY0C 5KOMC 4GW1A 2A6DB 5A2LH 3VXUB 1U8IB 4PG2A 5IOPA 1QD0A 1CFTB 1A14H 3MRHA 5E6IA 4K3HA 5HGAB 1KXQE 4XNMA 3ARFA 1JGEA 3SDDB 1M7IA 2HP4A 4LQFL 2JJVA 3U9PL 1QNZL 5GXBB 3CSYB 5CJOL 3TIDA 3VGGA 4UQ3B 3IKKA 4NN6C 4NCC1 4NO0D 1NUFA 5F9JA 2HFEB 5C09D 4QXWA 4XP6H 5D72H 5E4IA 1OM3H 1WGOA 1KJMB 1T83A 5IFAH 4NRYB 3OHXB 2OCFD 5F9OH 1WZLA 2R1YB 2YN5A 4HWNA 1UWGH 4NN5B 2PF6A 5CILL 5C0CD 4Q9BA 3D2UD 4QRQA 1UKSA 2GCYA 2R2EB 1G9EA 5FYJU 5C86A 4HUMB 3VGHA 5EWIH 2GW5A 2HWZL 4LP5A 2NX5D 5I1HH 3MRBB 3NCJL 1OB1A 1KG0B 2HLAB 5HXMA 1K6QL 5ADPL 5TQ0L 5T1KB 2JK5A 2VRAA 3B5HA 1QSFD 4G42A 1CICB 2ADFH 4EZMA 3OGOE 2K1MA 2HT2D 1QLFA 1WC7A 2E7LC 3C09B 1CXFA 5L2KB 3WFCH 1T89A 5D72L 5ESQB 4S1RH 5C08A 1OM3L 1U91A 5IFAL 2KKQA 1BBJB 1I3UA 4BFIB 3LSOA 4NBXB 2QL1A 4AEFA 4ZXBC 3PWPE 1ORSA 5DJ0B 5F96H 1AQKH 5TDNA 5D6DC 2BY3A 3F12B 3RPIA 5EWIL 1YEDA 5F7DB 2V17H 4QTHB 4XWOC 1PQZA 5A16B 3W11D 3QWOA 5E7FA 2Z35A 3B6SB 4U6VL 5EC2A 1GGIL 5HJ3A 1UH2A 1ITCA 2NXYD 2ADFL 1U8LA 3Q3GA 43CAA 1EHAA 4DVBA 1RJYB 3WFCL 5E6ID 4ACPA 1PW3A 1PYWA 1L7TH 5GS2D 3ARFD 4NQXB 5HVGB 5HHXH 3QJHA 5GRZA 5LGHL 4WTZA 2BRRL 4BUHA 3T2NH 4N0CC 1O0VA 4PRHA 1YMHB 3S8WA 1FSKB 4ZO7A 1JUFA 1HHJA 1J0ZA 1J1XL 3O9WA 5F96L 1GYAA 3SKOA 2D9CA 4BFEA 1S7QB 4RFNC 3QIBB 1YNLL 3IDGA 1ZT7A 3QG7H 4PGCA 1NGYB 3DURB 4PIRF 1IILE 3V0VB 4BQCA 5FO9A 2CLZB 1C8PA 4LVEA 1NCUA 3PIQA 1EAPB 3FRUA 2QKIA 5EO0B 3EYUL 2A38A 2I9LB 3IGAA 4JREB 4MHHG 3DMMB 4ZODA 4HFWA 5FO7A 3EYOA 3DNKA 5HHXL 1NMAH 4OTXL 3C8KA 3T2NL 3PWUB 3RIFF 1JYXA 1N5AA 1IEBA 3IKCB 4JFOB 4ZUTA 1QKZH 2V9QA 4XTRC 4WHYG 5F7MC 4JO4H 5C08D 2Q7YB 1WUNT 1BPVA 2FB4H 1I9IH 1UQSB 3I2CH 4PB9H 3FO1B 1P7KB 5I0ZA 3EYFB 1Q1JH 4FQ1H 3QPQD 4YQXL 5J0BA 1E27B 2DLTA 1OF2B 4YNYA 2IMNA 4YK4C 3CSPA 3VDAA 3V4VH 3FOMA 5C9JB 2LQRA 3EYSH 3SEPA 4OM1H 3BKYL 2PYFA 5BS0A 1XR9B 4NFCA 4L3EB 4N8VG 3ZYOA 1EJOH 1IM9A 4WHTB 1NMAL 1T0NA 2DD8H 2NNAA 2EDEA 4LSVH 1CL7I 5SWSA 4FQLH 1QKZL 1I85C 3KYMA 4JO4L 4MAYB 5K93A 2OR7A 1D6EB 3P77A 5EO1B 5FKPA 5T1DH 1KLGB 3TWCH 5FHBH 2FB4L 1BQLL 1I9IL 3I2CL 4R9HA 3KPQB 1Q1JL 4FQ1L 3SN6N 4PRHD 1CVRA 1T2QH 4R90H 4EN3A 3TBVB 4S10A 4U1HB 3QUYC 3O9WD 3U7AA 3V4VL 4JFYA 4U1IA 1OP3K 4ODSH 3GMQA 1J0IA 3EYSL 1F3DH 5GRYA 2EXWC 4OM1L 5I1DA 4JJ5B 4M7ZC 3SBWA 5JIKA 2XNAA 3U0PB 4HK3N 3KJ4C 1VEOA 1RIVH 4N0UB 2WMPA 1EJOL 5FYJH 4U1SA 4P3DB 1TFHA 1A4KB 2JIXB 1MWAA 2DD8L 4WUUE 3VXOA 4LSVL 3QJFB 4CW1A 1SY6A 2CR3A 5D8JH 4FQLL 2CIKA 5CFHA 3HMXA 5GZOD 2GY7B 1QHOA 5T1DL 1ZLWH 3S36X 2RHEA 4L3CA 5KVDH 2VH5H 4C83A 1HSAB 2FGZA 4R90L 4RA0C 3E6FA 3DOSA 1WIUA 1D5ZB 1U8MB 5DT1L 4NKMA 3CVIL 1IT9L 3OJVC 5IEKA 3FN0L 4ODSL 3HPJB 3UTZB 2G5BA 2EDTA 4F2MA 4HS3A 2WSKA 3SDAC 1ZHKB 3EJZD 2H6PB 4NM8L 3B2UC 2YC1B 5DJCB 1RIVL 3ZE2E 1VFBA 4S2SA 4GO6B 2EDHA 2FJGB 2VSDA 4GRLC 4U6XA 1G9MH 1IAKA 5KG9B 5L2JB 1L4IA 2FDBP 4AT6A 4KV5E 4YLQT 4HDIA 5BS0D 4N68A 3OAUH 3JUZA 1UADC 4HH9A 2HVKA 4OFPA 4ZUSB 3L5HA 4NQSA 1JGUL 1CDGA 4Y88A 5DR5L 5FA4A 4R0LB 3ARQA 1IM9D 5CSZB 4R7NA 5GS1B 3KPRB 1Q72H 5KVDL 5T3XE 4X5WB 3LMJL 4QKXB 4LLQA 5HVFB 2FJFA 1AO7E 1AKJA 2J88H 5SWSD 3MRLB 3S35X 3WHE1 1T7YA 5J89A 1HOCB 4YEFA 1E4JA 2N4IA 4OQTH 4XCNB 2XTLA 4G3YH 2GJ6A 5TF0A 2DBJA 3D25B 5IR1A 4OZFA 1OARH 1A7PH 2Y23A 1MPAH 5T3XL 4JANB 2FL5A 2WP3T 4EN3D 2FEEI 3W0WD 2B4CC 2X40A 4U7MA 4BSWB 4PRNB 3OXSB 2DRUA 3VXRA 3BYTA 4MQ7B 3B8YA 1P9MC 5EUOF 4PJ5A 3OAUL 1WIPA 3W9EB 3BPCB 3DX8B 3RZCB 5HHME 3LEVH 4IM8A 4X6CB 5IVXF 3T4AA 4LHUA 1YYLH 2EDRA 1Q72L 2OM5A 1FBIL 3WS3B 4GFTB 5TH2B 2J88L 5D7KD 4OIIH 3UBXA 2EE3A 1XF1A 2UVEA 2EE9A 3UPRB 4KTDH 5ANME 4G3YL 1IL1B 1QUNA 4U1NB 1NDMA 3MGTA 1CU4L 1OARL 1MPAL 2OZ4H 4QHNA 3OKNA 1DL7H 5BO1H 3NCEB 1G9MC 3KHOA 1G7IA 1XR8B 3VGAC 4CJ1A 2JE8A 3HZYA 5C0NC 1A1NA 3Q5YA 2X4TB 4N8CL 2GSIB 2V7NA 4X5LA 4JDZB 2OTWB 3O41A 5D96B 2CK0L 4ZSOB 4XNZB 1BFOA 2A6KA 2EYSB 4AENA 2GSGA 3LEVL 2RFXB 3WLBA 1T0MB 3GEWB 4CRPA 2HKHL 3BIAX 3CX5K 1CG9B 1YYLL 2M26A 3LD8B 4OUUB 2X4SB 2N1KA 3MV8A 3CUPB 3O4OB 5ACLA 5DEGB 2P42B 3F7QA 3GBMH 4FFVD 4GQ9H 3L3JB 1K4DA 3KGRA 4G9FB 5HY9B 4BFGA 4OF3A 1Y6MR 3S88L 1KCUH 3RGVD 2Y72A 3EYVB 1RZ8A 1CXIA 5E94A 1AKJD 2OZ4L 5DEFB 4A2LA 2MTPA 1UCTA 1DL7L 1I8MA 4LEOB 1KCSL 2Q7NA 3MOBH 1DDHA 2DWDA 2GJ6D 2PW1A 4DN4H 4URTB 1AGDA 3KLSA 2DQUH 5L0QC 1RZJH 1NGZA 4OZGB 5FDYA 4PBVC 2HT3D 5CCKH 1RPQA 1HHGA 2XWJA 3B5TA 3FFDA 3WSQH 3KXFA 1LO5A 4BSVA 2BNQE 3VXRD 5D2NC 1PLGL 1LHZA 4KFZC 3EGSA 3LPGA 4KVCH 4PJ5D 3BKMH 2X6MA 3OWEA 4GQ9L 2DI9A 4AIZA 3MYJB 2A77L 3WO4B 4ELMF 1A9BA 4MB4A 4PJ7B 4LHUD 2VL5B 5E1HB 4Z7VF 1KCUL 5B39A 2E7HA 3LKPB 4YBHA 3SKJH 2V5TA 2HT4C 2PO6B 4LU5H 3DRQB 4PP1C 1M7DB 1SVCP 3MOBL 4PJXE 2CD0A 3EYQD 4AIXA 5IMLB 4JCMA 3IDYC 4NT6A 4IBLT 4DN4L 5J1AA 3LIZH 3LS5H 4ZOEA 5ICXA 5TPWH 3EFFA 3AY4C 2DQUL 4GUPA 2W9EH 5DD6B 5FXCH 4PP2A 1EGJA 4X6DF 3L5JA 3P4OB 1H0DB 3WO3B 2I24N 4TSAH 3PP3H 1CBVL 4XXDA 1U36A 2BX5A 5IROA 5GGVH 5J06A 1MI5E 4KVCL 5F6IC 4C55A 1ZAGA 4X6EA 2AVGA 1G6RL 1NJ9A 3CDGB 3QFJB 2GK0B 4PY8I 3TO2A 5FM4A 3MLVH 3VG9C 1H3TA 3BH8A 4MSWB 5JW4N 1MCNA 4Y2DA 4OGYH 4JFHE 1HQ4A 3MV8D 3RTQB 4MB3A 5I1GL 3MGAA 3SKJL 1A21A 4LU5L 2FBJH 2L7UA 4NDMA 5HDLA 4IMKA 1UGNA 4D0DB 4GKNB 4JFFB 3T0VA 4PRBA 4OLUH 5EFIB 2G9HB 1QACA 3RWFA 1RZJC 3IF1B 3LS5L 4IIQA 5FO8A 4XRCA 4JO1H 2HKFL 2P8MB 2CH8A 4X7TA 1H3PH 3T09A 2W9EL 3BGMA 1E6OH 4YWGH 4LCCC 2RQ8A 5D1QA 2Y6SC 3BKJL 3NIGE 1FVCB 1CXHA 2LU7A 5D7JC 5C7XH 5K9QG 4OZHF 3VD3A 5CINH 4KK9C 4OCNC 5DDHA 1KJ2A 2YWZA 2RIKA 3MLVL 5F7NC 3G5VA 3IJYB 3SE3C 1Z9OA 1GZPA 3KXFD 4YIQB 4QHKI 3WFHB 1HXYA 2PKDA 3WV0A 2FBJL 4WU5B 4XVTH 3WIHH 1R3JB 5LCVH 4O2FB 2C7UA 1JWSB 2VIRB 2NCMA 2VLRB 4XCEB 3WDIA 3TBWA 4QRUA 2P8LA 3KPSE 1H3PL 1E6OL 3MRGA 4PRPD 1DQQA 3VI4F 3MJ6A 3GIVB 2CDGA 3AREB 4GH7B 4K3JL 1BQHB 5ALBL 2D7NA 3MRCB 3IDNB 4BUGA 3HUJF 4R3SA 5C7XL 32C2B 4NO2A 2G2RA 3JSSA 2A6JB 4KDTA 5I6XC 1TQCC 3RGHA 2BVQA 2MHAA 4NC2B 5M94B 3MJ7A 5ICZA 1T66D 2YN3A 3BO8B 2ITCB 3RAJH 1RZIA 5B3NA 1X9QA 4M9PA 2P4AB 4XVTL 5T33H 3G6AB 5D1XC 4HJJH 3IDIA 3WIHL 4Y4HC 1BIIB 5LCVL 2X5PA 1BLNB 1F45A 4M61A 2BJMH 1HSBA 4Y2DD 4ODUA 5JZ7D 3WEXA 4ZOBA 1AP2B 3T0AA 4A6YB 1HDMB 3NCFB 2AK1L 3NVQA 1T22B 1MF2H 3VWKB 1FVEA 4M3JA 5CIPH 4H25A 1BF8A 2BCKA 3ULVH 4TYUA 3ROLA 3WKNA 5C0EA 1YEHH 5C8JB 2F54A 5JW5B 3CU7A 5F7UA 5D1QD 3PGCB 3QI9A 1AC6A 1FO0H 1SYVB 1EFXB 3FJTA 1LEGB 3VXQA 4XNQB 4ZFGH 3RAJL 4N0FB 4EXKA 3ES6B 5I9QB 5BOPA 2GITA 2MJWA 3CVHA 1CFQB 4HHAB 5C07E 3I02A 1S9YB 1N2RA 1XIWA 4FXGB 1BX2B 3RUGB 5T33L 4BZ2H 2NY0B 1W0VB 4KKCC 2HJFA 1H9VA 1BWMA 3R06A 43C9A 3D69A 3LRHA 1I9JH 2DTML 3VFWA 2IC2A 5ISZA 4CADA 4X4YB 4K55A 3AFLA 4OCYH 2V6HA 4OCRH 5E5UB 4MNQE 3FQUB 1MF2L 4NN6B 4X8XA 1U9KA 1T03H 3BZFB 4C54A 5JMRA 3ULVL 5E6ZA 1QLRB 5CMAB 1ZT4A 3TZVC 4PGJA 1YEHL 1VPOL 3TJEH 3EOBA 4MDJB 2WW8A 2LABA 1AY1H 4UT7H 5I1LB 1CIUA 1FO0L 2NY5H 4XGZA 4LVHC 4X8JB 4YDVA 4ZFGL 1ZS8B 3RY5A 4BM7A 1UENA 3L6FA 3OKOB 4P23C 5JW3H 4K7FB 5T5FH 1HEZA 5DMYA 1I9JL 1AHWC 1KB5A 3U48A 5C0IA 4DTGL 4OCYL 4KRPB 2VZ1A 1TDQA 3C5ZD 3ULVC 4PJDA 4D0CA 2XTJB 1T03L 4Y4FA 4NKDB 2D0FA 1C1EH 3V5DA 2EH7H 1KN4H 4WI6A 4YHOL 1ZA6B 1H3VA 4ONFH 3WD5H 3TJEL 1IEHA 1DVFA 3V6FB 3GB7A 2J4WH 1TVHB 3PABB 4HFUL 2BVTA 2HFFA 1YECL 4CNIB 5ELIA 2ZG3A 1GGYA 4U1KB 4ZXBB 3LCYA 5JDSB 1TVBB 2R0ZH 3B8SA 4PG9B 3BP5A 3BI9X 4OBSA 4LPUA 2F54D 2A6DA 3VXUA 1U8IA 2DL2A 5DO2C 1CFTA 2FHBA 1NFIB 2FX7L 4OFIA 5JW3L 3EBAA 3MFGB 3QI9D 5HGAA 5KSBE 5T5FL 2P5EE 3SDDA 4PUBH 1JNHB 3CSYA 4NQEB 5JOEA 4BKLB 4UQ3A 3JTSB 2AGJH 1FLRH 2E9JA 4Z7UF 1JHTB 2HFEA 2YMXH 1XF4B 2R1XB 4P5TA 1C1EL 1KJMA 4NRYA 3OHXA 4ONFL 3WD5L 3WXVH 5DGRA 2NY5C 2J4WL 4MJIE 3IDUA 3RVVD 4I2XB 4PJEF 2R2EA 2EH8H 4WV1C 1Z0MA 4KKAD 4RFNB 1X5LA 1ZVHA 3MRBA 2JLLA 3WJJC 1WEJH 1KG0A 2HLAA 5D7SH 1LO3H 1YEKH 5T1KA 3T0EE 1CICA 5DK2B 4TOYL 1KENL 3I3EA 1U3ZA 2AGJL 5CEXB 3VGFA 1FLRL 1GAFH 1I1CA 3QQ3B 1K8DB 3EO9L 4XMPH 5L2KA 2YMXL 2DLIA 4H8WC 1FPTH 2NZIA 3KJ6H 4KVNH 3S4SG 4EI5C 2AJUL 2IAMD 3ARDB 5FOJA 3FB7B 3MRDB 1FDLH 4AMKH 1FL6B 1BBJA 1FZJB 3WXVL 4RMSA 3BZEB 3QH3B 1X5JA 3MACH 3D85B 4D9LH 4P49A 1UZ6F 4OV6F 3RWIB 5DJ0A 4BELD 4Y4FD 2EH8L 1A4JB 3F12A 1KIQB 5F7DA 4HAFA 2YPLB 4QTHA 3ZDYF 1UEMA 3EOTH 5A16A 1WEJL 1DVFD 3AS0A 4WO4B 3CC5B 4JG1L 1YEKL 4YGVB 4IDJL 3MTRA 3RIAF 4F57H 3L5XH 2AK4A 1X5AA 2IALB 3WFBH 1NSNH 4KK5C 3VXUD 1RJYA 4L4VB 3MBEA 3BOVA 3QEQB 1PKQB 3KJ6L 4KVNL 4S1DD 5SV3A 3SDDD 4NQXA 2FHFA 1FDLL 3U2SB 4QY8B 1AR1D 2HAZA 2ZCKL 2VJXA 2WBWB 1YMHA 2XKUA 3MACL 1MFDH 4OF6A 4D9LL 2N7BA 1XZ0B 4OUOA 4HLZG 1U2HA 2DQFB 3FO9B 2P7TB 4KGJA 1CGWA 4G6AD 4P5TD 1S7QA 5DJXA 5BJTB 1XGYH 1D6VH 1HYSD 5KBNC 4PRIE 2V9TA 4LEXL 1NGYA 3DURA 3V0VA 4KI5F 4E9LA 2HFGL 2CLVA 2CLZA 5DLMH 3RVUC 3LDBB 4YFLI 4F57L 3C5JA 5IB3B 3C8DA 2DM7A 3WFBL 1NSNL 2QR0B 4XVUD 3DVIA 3HNSH 5EO0A 1ZK9A 5DA4A 3X13B 4M7ZB 5IHZB 4LAQH 5T1KD 4HS6B 3DMMA 4PGZA 4GAGH 2AERT 3KJ4B 1GGTA 5IFJB 1CICD 4X6DA 3DPBA 4N90D 3RWHB 4GKOA 3PWUA 3IKCA 1MFDL 3AB0C 2DYPB 4JFOA 5L2KD 2FO1A 3Q6GH 3QCTL 2Q7YA 3MRFB 5HYSA 2CUHA 1IGJB 4NQDB 3CDFA 2OXGA 1XGYL 1D6VL 4XPGL 1JTTA 3NH7H 1WBZB 2NY1C 1UQSA 4R4NC 3U30B 1P7KA 3EYFA 5DZLA 2QLVB 3O6KH 1QRNE 1E27A 2OX5A 2B2XH 3JWOC 5LGJB 4JG0H 5DLML 3SGEH 4F9PC 1OL0A 3G04B 3CIQA 1SMAA 5C9JA 3T1WA 1ZKAA 2PUQT 3RKDD 1MRDH 3HNSL 5SX5K 3GGWB 5DVKA 4GG8B 2QQKH 1EVUA 1DBMH 2JJSC 4L3EA 4LOUD 5EB9A 1YPZB 1EBAA 3SDAB 5IIEB 5C0BE 1XGUB 1M71B 4DJMA 3QDGD 3V79C 1NAMH 3BUYB 1WCBB 3V7AG 5I8EB 4WHTA 2AK4D 1HE7A 2YD8A 5EUOE 4GRLB 4KJYB 3R1GH 2VR9A 3MBED 2DICA 3Q6GL 4MAYA 5I15H 1D6EA 5EO1A 2CXGA 4X9IA 2CJUH 1PY4A 1NFKA 3NH7L 4K7PX 1LDPH 3TBVA 4U1HA 2B2XL 1UB6B 4JG0L 3WS6C 3EJYC 1YY9C 3M1BB 2M2DA 4U2YA 3ZKQD 3NZ8B 5HDBF 1J88A 5I17B 2E3VA 1MRDL 3EDEA 4N8VB 4HV8B 4JJ5A 3EO1B 2XN9A 3STLB 3JBG7 1Q9LB 2X4PB 3GMRB 1OOAA 1F11B 4L8BB 4N0UA 3DI2B 4JO2H 1JF6A 1RHHB 1NAML 4P3DA 4KHTH 4XC3H 5FGBC 1S78D 1A4KA 2JIXA 2F19L 3QUXC 4FRWA 3ZKMD 4LRNH 3RQ3A 3R1GL 3TM6A 3QJFA 1MAKA 3HUJA 4CAGA 3E3QC 3STZA 3QXVA 3DMMD 2VLKB 5I15L 1IMHC 1RUAH 4XPAH 3OKDB 2DI7A 4BFBD 2D4DA 3GBNH 4FG6D 4K3EH 4Z7QF 4LPYA 4X4XB 1URLA 2VC2H 4LVOC 1FV1B 1HSAA 2PTTB 3H42L 1CXEA 2VWEE 1D5ZA 1U8MA 1IE5A 1MCDA 4X6FB 1RUMH 3BE1H 4BH8B 4MVBC 1FORH 1UG9A 2BDNH 3HPJA 1AGFA 3UTZA 2VOTA 4GKZA 2VR5A 5CZXC 4NUGH 1KN2L 4HCRA 1OWRM 1ZHKA 3IXAB 2H6PA 3MCKB 3K8MA 5D1ZC 1QSEE 1PD6A 2YC1A 3ZSTA 5HGGS 4HIIB 4JO2L 3HMWH 4XC3L 4KHTL 3RI5F 2FJGA 3QG6B 5L2JA 5KG9A 3I75B 3VGAB 1ZLSL 2DM3A 5TF1H 1ADQH 4L3ED 5E8PB 4ZUSA 2NY2D 3BMVA 4L5FL 1I3GH 1RUAL 4R0LA 4K3EL 1K9TA 5GS1A 3KPRA 2VC2L 4X5WA 1HILB 1DQML 3MRLA 5BRZE 3DUUB 4YC2B 4GAJL 3UTTB 4TRPH 4MAYD 3QO0B 4XCNA 1FORL 1OVZA 4Z7VE 3D25A 1CXKA 1DZBA 4JANA 5FUOH 3VXPB 1F4XH 5MEQB 3IYLW 3VE0B 3HMWL 5E4EB 4BSWA 4UINH 4J12A 4PRNA 4JFXB 4KJWD 4PJHF 1OAYL 2I60H 3OXSA 1RSFA 1QQDB 2XQYK 2Z0BA 4MQ7A 2R0LH 3PDOB 2NY4C 3X11B 1D5IH 2XN9D 2YUZA 2ZUQB 5TF1L 1ADQL 3W9EA 1CR9H 1YEGL 3BPCA 3DX8A 3RZCA 3G5YB 5L0QB 4XBEH 1MJ8H 4X6CA 1OSZB 2XKNB 4OLXL 4LRIA 4UIMB 3KYKH 1R5WB 2IFFH 2JIXD 4DGVH 2GFBB 3WS3A 4F7MB 2BMKB 1LP9B 2NTSP 1QFUL 3QDJB 5TH2A 1A7OH 4KK6C 1MSPA 1QFWL 3HCVB 3GIZH 2HMID 3V7MA 2NYYD 1YMMB 2NY7H 1U0QA 4GRMB 3L5IA 4U1NA 5J4MA 2JB6B 5C71A 5IW3A 1KNOB 1WFTA 4IOFD 2D0GA 3EOAB 4PY8J 5GIRB 1JBJA 2E7MA 1XR8A 3MMEB 5DVLA 2OXHA 4P4KB 4RMWA 2I60L 4NGHH 5FUZL 2X4TA 2GSIA 5E70A 1MCPH 4JDZA 4MA7L 4L29B 4ZSOA 2B7DT 3MRMA 4J8RB 2RFXA 2YD7A 1T0MA 4WFGD 4XBEL 4P2QE 3RL2B 4OUUA 1CG9A 2IFFL 5DHVB 1J8KA 4DGVL 3CUPA 3L3DB 5CD5C 5EH1A 1U95B 3MRPB 5DEGA 5D5MF 1A7OL 1KJVB 5LVEA 3L3JA 3E2HC 5F6IB 5FF6B 2VXQH 5C0RH 2I9TB 4G9FA 4WFFE 1A0QH 4HUUB 3KPRD 1ZHNB 3VG9B 3EYVA 4GXVH 5DEFA 3N1PC 1T2XA 2VXSL 3MRIB 4LEOA 5LWYL 5CAYB 2XICA 5CBEB 3N1MC 3BEWA 3D9AH 2WUCH 1CLYL 3L1OH 1BD2B 3RJQB 4QHKJ 2BHZA 3HFML 4NGHL 1D5MB 3D3VE 1QFWM 2VISB 5EO9B 1PSKH 1HKFA 3LKQB 1MCPL 8FABB 4FQPA 4OZGA 5CEZE 4PRAB 5IHUH 3H7BB 4LCCB 1EO5A 3D39E 1P7HL 1MIEH 4NQCB 4PJEA 5ADOH 3VFMB 4NSKA 1GJIA 3RZCD 3KAAA 3MYJA 3O6FB 3SDCC 1WITA 4PJ7A 3MRKB 4I9WE 1A0QL 2VL5A 1QSFE 3A6BH 1JPSL 3LKPA 5KANG 4OF5A 3HS0B 4RFOL 4PYGA 2PO6A 4Q6IC 3DRQA 3LVEA 2YK1H 1M7DA 3G6JF 3UX9B 3D9AL 2K3TA 2WUCL 2YUWA 5IMLA 1NL0H 3L1OL 4HWUA 4HIEB 2VABB 5F21B 4LPCA 5KS9B 2WIMA 5GGQL 1PSKL 1TTFA 3WDJA 5DD6A 3P4OA 5IHUL 1H0DA 5GS2H 1RMFH 1CLCA 5I73B 4MZ3A 5ADOL 3FHAA 4GRWB 1UCBH 3WXWL 3V5KB 2ZUTA 1VFMA 4XPBH 5JHDE 3CDGA 4U7KA 2LU4A 3ZE0F 3QFJA 2GK0A 5I6XB 1TQCB 5E8NB 4KGLA 1KPUB 4MSWA 1C5DA 2B0SH 4MMZC 2Y36H 3RTQA 4JRXB 3MLUH 4RGNC 3REWB 4K3GA 5F1NB 3U46B 1CGSH 4NM4L 4AEIL 2CUMA 2YK1L 1FNAA 3BMWA 4D0DA 5I66B 4G9FD 2JTDA 4GKNA 3ILPB 1AXSB 3VG0L 5EFIA 2G9HA 4RFEB 15C8H 4Y4HB 4WHCA 2HT2C 4F33B 3IF1A 2P8MA 3BW9B 2IPKA 4OZIF 4YR6A 1XGQB 4QYOB 4HWEH 1FVCA 3HI6H 4GJTB 1EEUA 1RMFL 3CFEB 1NPUA 3GSQB 3RNQB 4PJIB 5IW1A 1A1OB 1SVZA 4I0PB 3CFDB 2ZNWA 4Y19B 4I13B 3DX9B 3VDCA 1I3RB 3FB8B 1OAXH 5CWSB 5GGVY 3IJYA 2B0SL 3ARVA 4YAQB 3TYFB 4YIQA 2Y36L 3WFHA 3CSGA 3MLUL 5EPMB 5FA3B 2AJZB 1CGSL 2ERJC 1FYHB 4WU5A 1FGVH 1R3JA 4MJ6B 1U2CA 2VDQL 5I0DA 3DYPA 2VIRA 3S5LB 2EECA 4XCEA 1PAMA 1JCKA 3LB6C 4PG2C 3MV9E 3B9EA 5CEYB 3PG2A 5E6IC 2PO6D 4MAUL 3GIVA 3AREA 1BQHA 5C08E 5F9AC 3HI6L 3MRCA 3IDNA 3IJHB 1OSPH 3SY0B 4CJ0A 1XCTB 32C2A 1EZVY 2BVPB 1P1ZB 3ARGC 2A6JA 4QHUB 3TZVB 4NO5B 3VCLB 4XC1H 4OKDA 1OAXL 3NABL 1TJGL 4P2RA 3U1SH 1T83C 4NZRL 3BO8A 4MX7B 2ITCA 3OKYA 5FFLA 1TLKA 4LVHB 3FHQA 3KPOA 1JNLL 4H1LA 5D7IB 3G6AA 1FGVL 2VXTH 4P23B 1BIIA 3QFJD 1BLNA 3MLSH 3WNNA 3RTQD 4Z7UE 1KCVH 2IQ9L 1D9KC 4RAVB 3UZEA 3PV7A 4A6YA 1HDMA 4KH2A 4OCWH 1T22A 2KQNA 1FZMB 5I75C 3OJ2C 1MVUB 4D2NA 2UWEB 2ICCA 1NC4B 1OSPL 4YDIH 3BDXA 3DUSB 5DMIH 5C8JA 1C5BH 3QUMB 5JW5A 2P44B 4PRHE 3O2VL 4OT1H 4R8WL 3PGCA 1SYVA 4AK1A 1EFXA 1ZT1B 3FN3A 1LEGA 4XNQA 1NMCC 4AH2B 3ES6A 4HHAA 1CFQA 3VJ6A 5HYQB 1WWBX 1S9YA 4FXGA 1BX2A 3RUGA 4RGMB 5A1AA 2VXTL 3IU4H 1W0VA 3HB3C 3BVNB 3QB7C 3MLSL 5ESVA 4U0RC 3FMGH 3BDBA 4DCQB 4IS6B 4X4YA 2ADIB 4PJBB 5D2LB 5LKNA 4N8PA 4Z8FH 4JHWL 4OCWL 3T2QA 3CFJB 3FQUA 4POUB 3BZFA 4MS8C 5CMAA 5JOFB 3LEYL 1C5BL 2Z8WC 2PTUA 2FWOB 4OT1L 1M4KA 2QJDA 5I1LA 2ZUSA 4AY0A 5GJSH 1XH3B 3ARED 3FT3B 4X8JA 1F6LL 1ZS8A 1O5DT 3W81A 4I77H 4LQ1A 3QQ9C 3K1KC 4WV1B 4ZDHB 1QO3B 5B8CB 4UNVA 1XMWA 3C5SB 3O9WC 3IU4L 2JJTA 3FQXB 4K7FA 4P2RD 1JK8B 4JDTH 3K81A 2GTZB 4U6HB 5CP3A 1IC7H 4DOHB 2EXYD 5GGSY 2VL4A 2O61B 3TP4A 4J6RH 2E7LA 3MYZA 4WW2F 4NKDA 3CMOH 4LK4A 4G5ZH 4EI5B 1ZA6A 5J13C 4LGRB 4Z7NF 5TE7H 1CDBA 3V6FA 5I8OH 4IHOB 4WEBL 3PABA 2CO6B 5GZOC 1IAIH 5GJSL 1AC0A 3X3FL 4AG4H 4CNIA 1DLFH 3EAKA 3PWVB 4U1KA 5FOBB 3DV6B 4XI5C 1TVBA 5JDSA 4PG9A 3QRGH 5D6DA 4GW4B 5I16B 1L0YA 5D71H 3ARXA 4KI5E 4JQIH 3OAZK 2IH1A 1MWAH 1NFIA 1X4ZA 1ACYH 4EBQH 1EFXD 3FZUD 3WKMH 5I74C 3CDYA 3BX7C 1JNHA 3HMXH 3V6BR 4WWKC 4TN9A 4NQEA 3VXSE 4ENEC 4BKLA 1IC7L 3F58L 3JTSA 4PJHA 1JHTA 1TPXC 1ZTXH 4J6RL 1XF4A 2R1XA 4O00A 1R3LB 2R4RL 3CMOL 2R56H 4G5ZL 2BNUB 2XWTB 1OP5K 4DKAA 1MCBA 2LVCA 1YJDH 1Q9OB 1U93B 5CJXA 4TNWK 1IAIL 4I2XA 1DLFL 3QRGL 4JM4H 1ETZB 4UILL 3EO0B 4JQIL 1MWAL 1S7RB 4ZOCA 1RQ5A 1RIUH 1SY6L 25C8H 3CD4A 4RMRA 3WKML 4KKLD 5GGRA 2EDFA 4FMFA 4NPYB 5DK2A 1IM3B 4PJCB 1LEIB 4NRXA 4EN3C 1JPGB 2ZZUT 2AXFB 5CEXA 2X4NB 5D70H 1K8DA 1QP1A 1ZTXL 2YD1A 2YD3A 5D7LE 4U1LB 3ARDA 5JNYB 3FB7A 3MRDA 2BNRB 2DS4A 1FNHA 1FL6A 2R39A 3K4AA 3T3ME 4Y8AA 1UXWB 1FZJA 1YJDL 2V2XB 2YKLH 3HC0A 4BZYA 3BZEA 3QH3A 1NMBH 1U8KB 5ITBH 4OZFH 4KRPD 1R0AL 3LV3B 3GJFB 3RWIA 4IRJB 5J12C 1S7TB 2XTJD 2AEWA 4ZO9A 1A4JA 1LNUB 3LEXB 2AV7A 3GSNB 1UM6H 1KIQA 4JM4L 1J8HE 2YPLA 1NEZG 1OCWH 4ZAKB 3WFDH 4MB5A 5FGSA 5DQDL 3RX7A 4WFHD 3GI8H 4LPTA 2NY1B 3CC5A 4Q7DA 4WO4A 3HAEG 4YGVA 1Q0XH 1RIUL 1I7RB 1DTUA 4Z7WF 4YDKL 2LV4A 3C60C 3DRTB 1IAIM 1MCLA 3S4SB 4LSPH 4I8DA 4L4VA 3QEQA 1GPOH 5IQ7H 1PKQA 1VHPA 2EDYA 3KDMB 2UZXB 1FVDB 4QY8A 2LE9A 3U2SA 3U36B 1SJHB 2YKLL 4NQED 5J6GB 1NMBL 4HT1H 1XZ0A 2APBA 1BECA 2DQFA 3FO9A 3KG5A 5HHNB 2Z91B 5BJTA 4NNYB 3BIKA 3IAQA 1OCWL 1NGPH 3WFDL 4FFVC 3GI8L 1EERB 3RVTC 4GOSA 4N0CD 5E08L 5KZCB 1ED3B 4P4RB 2W1NA 3V6ZB 3BFOA 3NPSB 4JFDE 1ZLUK 4F8TA 3TH2T 3RGVC 4UV7H 3UTSE 2QR0A 1ES0B 3ULUF 1WLHA 2XKSA 4RISL 3FT2A 1F42A 3BP6B 3X13A 5HYJB 1GPOL 5IQ7L 5IHZA 2PYEB 4QRPB 4DZBB 3VFUB 5IFJA 4OF0A 4P2OB 1NBVL 5MEOB 3RWHA 3EIFA 1A3LH 3WHXB 4HT1L 4LNVA 2DYPA 3QUXB 1JZ8A 5FHAL 2HT3C 2ZOLB 5I71C 3O4LB 3ARDD 4GT7A 3MRFA 2YD9A 3C6LB 4NQDA 1O7VA 4BQ9A 3BISA 4NKIL 5EA0H 4I3GA 1WBZA 1NGPL 2I25N 5GRUL 4HG4J 2DDQH 4XNYH 1AIFB 4F58H 4UUJB 3G04A 1MLCB 4FQQB 4XTRD 1JRHI 4KMTH 1FAKT 4UV7L 2YPLD 2EEAA 1D5BB 1EO7A 3GGWA 4N0YH 1ZGLM 1WBXB 4GG8A 2DQGH 1E4KA 2I27N 3O3UN 4TUKL 4WO4D 1YPZA 5JO5B 3QEHB 5D1ZB 1XGUA 4NP4H 3NOIA 2HRPL 2D7QA 5H37G 1A3LL 1IGTB 1OAQL 2DKMA 1JMXA 1HIML 4XP4H 4P3WA 4GRLA 4ZO8A 4KJYA 4K71B 5JIHA 5FCSH 4L4VD 1MJ7H 3QEQD 3GZKA 1PG7H 1UH3A 5EA0L 3KXFE 1WF5A 1TZIA 4FTVB 2JCCE 1UB6A 4OGXL 1IC4H 1HHKB 3QIUB 4F58L 1EGJH 4KMTL 2XT1B 3NZ8A 1ZXQA 5I17A 1CVSC 4M6NH 5JTWA 4N8VA 4HV8A 4YDLC 2E9WA 3EO1A 4K3DH 5IHBA 1W72A 3STLA 3FQNB 1Q9LA 3GMRA 1F11A 5J9PA 4NP4L 1RHHA 5DC4B 2VN7A 3LRSB 4PJBF 3SDXE 3H3PH 3WDHA 3UJIH 3RVWC 3S34L 3ZL4H 4UDUA 4M1GH 1ZHBB 5DUBA 1EAJA 2EXWD 1MJ7L 5EC1B 1P9MA 1CD1B 3FKUS 2R0KH 4NO3B 3QPXH 2VLKA 1PG7L 3OKDA 7CGTA 4X4XA 1FV1A 3TCLA 2PTTA 3KWWB 5D5ME 2DYPD 3O6LH 1FZOB 4X6FA 2DBLL 1CS6A 1U8NB 5FAAA 4NUJB 5DTFB 4BH8A 1EGJL 4NQDD 4M6NL 5HPOA 4K3DL 2FBOJ 1DQDH 3IXAA 3MCKA 1Q94B 3I6KB 4OFKA 3MNVA 1QR4A 1KJ2H 2XG5A 4C59B 1KCKA 3H3PL 3QG6A 4PV8B 3MFFB 1V7NH 3I75A 4QHLB 3ZL4L 4DN3H 1RURH 2F53B 4B41A 2GQHA 5E8PA 2R0KL 3GMLA 3A0OA 3QDHA 4LSTL 5CSBA 5H94A 4UDTB 1HILA 1NKOA 2CSPA 3DETC 2ZOKB 4GRLD 4DUVA 4X6BB 3O6LL 5IGXH 3C2AL 1T1WB 3DUUA 3UTTA 4MGXA 1T66C 3MCLH 4Y5YA 3E6HB 5C0AB 1N5YH 2SEBB 3E2HB 3CJJA 1OGTB 5IROC 1J86A 1R3KB 2FH6A 1I1AC 2J8UE 5F9WC 3VXPA 4R2GB 5MEQA 3VE0A 3OAYH 4JFEB 2E6PA 2VDLH 4Y2DC 4JFXA 3VFOB 4FQJH 3FQWA 1QQDA 3PDOA 1JGVH 3X11A 1RURL 4U6TA 4IMKC 4Y5VB 3G5YA 3HPLB 1K5NB 3SJVE 3PHSA 1OSZA 1QPXA 2XKNA 1F4HA 4UIMA 2JJWA 2GFBA 4QRRB 4F7MA 2BMKA 1LP9A 5IMMA 3CFIC 2HFTA 2XA8H 5D1QC 5IGXL 1JPFA 2C3WA 3HCVA 5EBLB 2OMNA 1EO8H 3ZE0E 3MCLL 1YMMA 5BZWB 4POYA 2VLKD 4GRMA 1N5YL 4XCYB 4KPHL 2M8XA 2H2PD 4M43H 4YHKH 2JB6A 2FX9H 2WK2A 1KNOA 2LVEA 3PWPB 1DBAH 3AXLB 2DQDL 2MOVA 2C3VB 3EOAA 3OV6A 5TDPB 3INUH 3QNXB 3MMEA 2VDLL 4QXGH 3GKZA 4P4KA 1T0PB 2AQ2A 4Q6IB 4FQIL 3MNWB 5F72S 4P3CH 3NGBC 1WFOA 4MD5A 3VW3H 4L29A 1J12A 3CVHH 5HVWA 1UVQB 5IB4B 4XMLL 4OZIE 4NO0B 4OD3H 3MRRA 4J8RA 3ARYA 1NBYB 5A2FA 4RZCA 3I6GB 1MRCH 2H2SD 5DHVA 2AEIT 2X4UB 3ALWA 2CKBB 3L3DA 3EDKA 4QGTA 1U95A 2L0DA 3MRPA 5C0ND 2XA8L 3CPLB 3H9SE 1NUNB 4KUZL 1KJVA 1EO8L 1JV5B 2OBGA 1NCAH 1G1CA 5FF6A 2I9TA 2IGFH 4APQA 3DO3A 4YHKL 5ACZB 1AQDA 3BXNB 1F5WA 2FX9L 1ZHNA 5LBSL 3I9GL 3MODH 2OJZH 5CZVH 2AJ3A 3SO3C 1DANU 4DGIL 3W9DB 2ESVE 4O58H 5EULV 3MRIA 3UTTD 4RGNB 5E03A 3INUL 1EHNA 4KKNA 4QXGL 1BD2A 1MJJB 1TITA 3O3AA 4IDLA 2FX8L 1D5MA 4P3CL 2VISA 2AXGB 5EO9A 3T0EC 3VW3L 5ISZE 3LKQA 3IRZA 4HBCH 4XCFL 1KTDB 2IJ0C 3C5ZC 3CVHL 1FAIL 2EDWA 1XT5A 1P4BH 4P59L 4FFWD 2BVUA 3T4YA 1CK0H 4OD3L 1TXKA 2BXZA 3CLEH 3H7BA 4LCCA 1EK3A 5B21A 4LSUH 2YD2A 4NQCA 1KB5H 4W4OC 3ZKND 3VFMA 2VXUH 1CGVA 3O6FA 5GGTA 1TCRB 3MX0A 3MRKA 1AGEB 1MFNA 3V8OA 2VDPH 4GBXC 2ZJSH 3QXWA 3WNMA 1TNMA 3SE3A 5HGBB 3HS0A 2OJZL 5CZVL 4HIHB 5HI3C 4GAFB 5JOPD 3UO1H 1MHPH 4O2CB 1TENA 1YMMD 4IMLB 3KPTA 4KY1H 4F8QA 3TJHD 1KUMA 2CMRH 4HIEA 4BSJA 2VABA 3Q1SH 4MD0B 3QRFM 5KS9A 3IT8D 5E8OB 4HBCL 3HNVH 4LSSL 1P4BL 1CK0L 1OAKH 3MRHB 2BK8A 1KELH 3CLEL 2HT4D 1S7WA 4KU1A 4P4KD 2D31B 1JGEB 3WFZA 1M7IB 5JW4M 2Y7QB 1KB5L 3UTPE 2EE6A 2F8OA 2VXUL 4OI9A 3V5KA 5EORH 4UOW0 1XAUA 3RVVC 4FXKA 3ARGB 3QQ4B 4KKAC 1KPUA 1NLDH 4HGKC 2VDPL 1HCVA 1I9EA 1UYWH 4JRXA 3VXME 3H7LA 3REWA 3U46A 5F1NA 1WZMA 1AJ7H 3UO1L 1MHPL 3ZO0A 3MV7D 1BIHA 2Q8AL 2LFGA 4Z18A 4KY1L 3K74B 4APQD 3ILPA 1AXSA 3T1FA 2FR4B 5TE4H 2CMRL 2VAJA 4RFEA 4Y4HA 4F33A 5EDXA 4NQVB 3JV0A 3CZFA 2EYRB 5GRXG 3ARBC 3BW9A 1M05B 3HNVL 1OAKL 2IAMC 2WBJC 1H15B 1KELL 1XGQA 4R97B 1WWWX 1D9KB 4KRMB 5HHOE 1P4IL 3RBGA 3CFEA 5I75B 2NTFB 3GSQA 3RNQA 4PJIA 1A1OA 3HZVB 4I0PA 3CFDA 4XAWL 4Y1AE 1KC5H 1VGKB 3Q5OA 4Y19A 1I3RA 3FB8A 4Y4FC 5CWSA 1IGIH 3DSNA 4X80H 5I1JH 2Y6SD 4WUUB 2MSPA 3CDCA 4YAQA 3TYFA 3MZGB 3WN5C 1UYWL 4NQCD 1DVFC 5EPMA 2AJZA 2GJJA 3THMH 2QBWA 2R29H 3BJLA 4WEMB 4LLUA 1RV6X 4ZFOA 3O6FD 4U0QB 4MJ6A 3QXDB 2O5YH 5JR1H 5TE4L 1MAMH 1F90H 1JNJA 1ZWIA 1G0XA 4U0RB 4D0BB 1A8JH 1Z3GH 4S1DC 4JY5L 1BZ7B 3SDDC 3RU8H 5EC2B 1AR1C 3SY0A 3CFCH 1F4AA 4Z7NE 2BVPA 1P1ZA 5EOTB 4QHUA 3TZVA 4MCYB 4NO5A 3UBXI 4JY6B 3O0RH 4P5TC 4X7CC 4J4PC 1IGIL 4X80L 5GSVB 3TV3H 4MX7A 2J6EL 1VA9A 2WWKO 4LASH 2ATPB 2PCPB 2GJZB 2O5XL 2EC9U 3CLFH 4GLRH 5D7IA 3THML 3IFNH 4P23A 5JR1L 3PHOB 3D5OF 4Z0XB 1F90L 4LLAA 3GK8L 1AO7B 4XVUC 4RSVA 5C6TH 1WAAF 4JRXD 1X5FA 2AV1B 4RAVA 1Z3GL 2XQBH 3V5HB 1FZMA 1CICC 3RU8L 1MVUA 2UWEA 2Z31B 4Y4HD 1NC4A 3CFCL 3DUSA 3U0WH 4G43B 3C09C 3QUMA 5FB8A 5DMGD 4I18B 4EUPG 5J13B 4PGEB 3O0RL 2BVYA 4TTDC 3TV3L 4FQCL 4PBWD 5DQJB 4LASL 1GCFA 4I0PD 5HYQA 2XY1A 5ID0B 2VZ3A 3CLFL 3DO7A 2MPAH 3IFNL 4Y19D 2B20A 5SV4A 3BVNA 3Q0HA 5KVEH 4F15B 3GMMB 1IJ9A 4IS6A 4M9OA 2EC8A 3RKDC 4DCQA 5I74B 2ADIA 4JPWL 2AABH 4PJBA 5D2LA 2VE6B 4HPOH 1BBDH 4WWKB 4OF8A 3C2SA 4WFED 3ULUD 2E5EA 3CFJA 2D0HA 4XH2B 4XT1C 4Z5RB 1TPXB 4RIRA 1YN7B 5JOFA 1CQYA 1HKLH 2WIIB 3U0WL 2DQJH 4ONGH 1N64H 3TC9A 4DFHA 2FWOA 3B4NA 3MBEC 1A47A 3LY6A 1KT2B 2JELH 1MCQA 1XH3A 3DVNB 2Q76B 3BZDA 3VMOA 3M45A 2LTQC 1IM9B 3MA9H 4WV1A 4ZDHA 5FEBA 1DJSA 1T5WB 5E56A 1QO3A 3TZVD 5B8CA 1F8TL 2QHLA 3C5SA 4LGSB 5FM5M 3BPOB 4LLVB 4Q9CA 3FQXA 3VFVA 4Z7WE 3V6OA 5KVEL 3KYMB 1A6WH 2EEBA 3W2DH 2GTZA 1X5KA 5SWZD 3MSPA 1BBDL 1DBBH 2WV3A 2M1KA 1OY3B 2O61A 2IFGA 5TGBB 1QHPA 3W0WB 3U7WL 3VFTA 3QZWG 1QVOB 3ETBF 3DVGB 3PP3K 3ZKMC 5CS7A 3AROA 4EI5A 12E8H 1HKLL 2DQJL 4ONGL 4LARH 1LK2A 1N64L 1G1YA 1QRKA 4IHOA 2JELL 3DMMC 3UEZA 4MLIA 2HTKC 2VITB 4QLRA 5T3ZD 4FG6C 3PWVA 1NC4D 2OL3L 1INEL 1IAOA 4F37K 3MA9L 4GW4A 4TVPE 5I16A 3QUKA 3MLYL 4OLWH 3IDXH 1KGCE 1WCQA 1ZMYA 4NOBA 2GT9B 1A6WL 3JV5A 3W2DL 1D5XA 4XB8A 1OD7A 2J3SA 3L3IB 3PQYE 1Z5LB 3NFSH 3C60B 1ZVSB 3GHBL 4WGVB 4N0UE 5ITFB 3KR3H 1R3LA 4JRWA 1PBYA 3MOQA 2BNUA 2OP4H 2XWTA 1BZ9B 12E8L 5KSVA 5KVGH 2G5BB 3RJDA 1U93A 2VLLB 4PJXB 4NHCH 5K59E 2NY2C 4HCRH 1UM5H 4N5EC 1AH1A 3GM8A 3IDMB 1CDCA 1I3VA 2A9NL 1WISA 4JKPL 1U8QB 1ETZA 3FONB 3EO0A 4HG4K 3L9RB 1S7RA 3OB0H 4MAYC 4M6OH 1PDKA 5FA4B 1MI5B 4NPYA 5DSCB 5F70A 1IM3A 1G0DA 4PJCA 1LEIA 4Y16C 4X5XB 1JPGA 1WQVT 2AXFA 2IANE 3RGVB 2X4NA 5I1IH 4LLQB 3NFSL 3A67H 1AKJB 4O51B 4KJWC 4U1LA 5LG1A 4YFEA 2BNRA 1N6UA 3H9ZA 2V2XA 3RPKA 5KVGL 1PX4A 1U8KA 4NHCL 3LV3A 3GJFA 3SHSA 4HCRL 4ZG1A 5DA0B 4IRJA 2DTSA 1FNSH 1NGWB 1S7TA 3BN9C 1RJLA 1IGYA 1LNUA 1FNEB 3LEXA 4PJGB 4QEGA 3GSNA 3MLTB 3PWNB 4EI5D 1UJTA 4ZAKA 1YQVH 2HMIC 5EIVA 4KZEL 2NYYC 1I7RA 4M6OL 1KXTB 4FS0A 4LGPB 5HGHB 4HMCA 3T4AB 2HG5B 3DRTA 3S4SA 2VYRE 5I1IL 4YPGB 4HH8A 2V7HB 2Y25A 3DYMA 4YHZH 2JJSA 2ORBL 2ICES 5GQBA 1FVDA 2RCSH 5DRZB 3S36H 4ZUVB 3U36A 1SJHA 4P9ML 1AFVL 5J6GA 1NDMB 4DGYH 2D2OA 5TDOB 4MNHA 4U1JB 1FNSL 2VZTA 5HHNA 1NEZB 2Z91A 5D4QA 4NNYA 3T65B 4Z77A 2AJYH 1YA5A 3KPSB 4S1QL 1ZOXA 4ETQA 3HAEB 5MENE 1B9ZA 2Y06L 4RAHA 3O41B 1MELA 3JWDH 4YX2L 1ED3A 1BFOB 1EDQA 3SKNB 5GS1C 3AS3A 3WS6A 3MRJB 1K85A 4YO0B 1ES0A 5LQBL 4QXUH 3BP6A 5EOCH 5HYJA 2W07A 4YHZL 4W6YB 5IB5B 2PYEA 4QRPA 1NCCH 2BSTB 4DZBA 1XGTA 4JVPA 1R24B 2RCSL 3GBLA 4M93C 3S36L 4C4KT 5I8CB 4NJ9L 4P2OA 5MEOA 3WHXA 4ONOA 5FGBA 4DGYL 5BOZG 1KTRL 3QUXA 3S35H 4JRYB 4ZSOE 2ZOLA 3O4LA 3SKMB 1P5VA 3C6LA 2BNRD 3UDWA 4HMDA 4KUCF 2PW1B 3B9AA 1MHHA 4M02A 1AIFA 1X5HA 1AGDB 4KV5F 3RZCC 3SOBH 4IRJD 3WIIH 1J1OH 4LRIC 4UUJA 1MLCA 1Q9KA 3T3PE 2F58H 4ZAKD 1D5BA 2NY1D 4R4ND 4ODXB 4MXVF 1CN4A 3PNWB 5JO5A 3IS1X 5DVOA 3QEHA 5D1ZA 3I85A 1NCCL 5C07B 1A9BB 3QQNA 5DJ6B 1H5BB 5HD8D 3E8UH 2QHRH 1IGTA 3N9GH 2FGWH 5AUMB 3S35L 4PRPB 5IVZB 2RR3A 1Y0LA 4DKEH 4FHBD 2FLRT 1L7IH 4NNPH 3ROOA 4JEGB 4WJ5B 5AEAA 4MWFB 3JWDC 4FTVA 2D7PA 4MNQB 5HDQH 3I84A 3SOBL 2ZUWA 4G8EB 3UYRH 4XPTL 3SE9L 1HHKA 3QIUA 4JE4B 2YUXA 4PJ7E 2F58L 3O4OC 2FECL 3SKUD 2WNGA 4HGMA 4OBRA 35C8H 1MNUL 3FQNA 1I1AB 5HPMB 5EG6C 3MBXH 2HLFD 2ILLA 3LRSA 3H0TB 1OLLA 3MO1B 5FYKE 2QHRL 4Z0BH 1WBYB 1HQ4B 4JPKH 5INDB 1ZHBA 3FQRB 1HK6A 5HYJD 5F8QC 5EC1A 1UA6L 1PZUB 1N6QL 4NDMB 4NO3A 4V1DE 2PYED 3QHZH 4BQ6A 1JGDB 4NNPL 4P2OD 4PRBB 1NANH 5FYKL 1KACB 3FL7A 3KWWA 5HDQL 2ARJB 5FO8B 1FZOA 3QUXD 4XRCB 1VESA 3O4LD 4MQXC 3UYRL 1U8NA 3K80A 1KFAH 3LPFA 4NUJA 5D1QB 5DTFA 3C6LD 3RX5A 3OPZL 35C8L 1Q94A 5IT2H 1L9MA 4J1UA 4PGDB 2P8PB 4JFFE 2XI9A 4PV8A 3MFFA 4IRSD 4QHLA 1G7HA 2PO6C 4JPKL 4LLMB 4NHUB 2F53A 1DEDA 1HXYB 2P5EB 3NGBB 4JFZH 5CZXD 2COQA 5D1ZD 3CGTA 1B4JH 3L3OB 4NZTH 4WVRA 1PEZA 4NOFA 1KPVB 4WTWA 4YFLF 5EZJB 4UDTA 1PJ9A 3TBWB 3QNYB 4QRUB 2ZOKA 1RHFA 1KJ3H 4A2MA 4X6BA 1T1WA 4Q0XH 1KFAL 2VXVH 3WUZA 2R0WL 2SEBA 1R5VB 4R7DB 1OGTA 2DKUA 1R3KA 1MOEA 4EXPX 1J05A 2DLHA 4MJIB 4FTVD 5CSGA 3DSFH 3WYRA 5IT2L 4D9RD 3QIUD 5HHVH 4LLDA 1F6FB 1EX0A 4HX1B 2VLRE 2Q6WB 4OCXH 4OCSH 5J3HD 4IOIA 1AI1H 2EEDA 4GLRI 3FB5B 4JFZL 3QNZB 3T0EB 4H1LH 4Y5VA 3C5ZB 1B4JL 3HPLA 1K5NA 1WVZA 5JA8B 4PJFF 2F8XC 4PJXF 2OLDA 3EZ8A 5IKCB 1RULH 2XA3A 1KIUA 4M7JH 4QTIH 5EBLA 1T3FA 1NCBH 5IBTH 5BZWA 1QZ1A 1R5IB 4XCYA 4A6YH 3KLDA 3PJSB 4P9HH 1G9NL 3G08B 4G7YL 4RX4A 4FN0A 3PWPA 3N50A 4WCYH 3ROLB 3GUTB 5C0EB 2C3VA 4GBXB 4ODWB 3OR6B 5TDPA 4KI5C 3QNXA 1V3JA 5HHVL 4KK6D 4Q6IA 4J3UA 5F3HB 3JV6A 1CTNA 2ZCLL 4R4FH 1ZHLA 3MNWA 4OCSL 5ENWB 4F7EB 3MRQB 1AI1L 5F93C 1UVQA 3I02B 5IB4A 1WSST 1AGCB 2X42A 2YPVH 1NBYA 1CFVH 3T8XB 3I6GA 2G5RA 3BZ4B 1RULL 3VFWB 2CKBA 2CPCA 4NWTL 1NUGA 2VZSA 3CPLA 4CADB 2F53D 1F3RB 1JV5A 3AREC 1X5YA 5IBTL 4H88H 4OFVA 4A6YL 1A6PA 3NIGF 5ACZA 3BXNA 2V5SA 3HHRB 2BERA 4KI1A 5HTSA 3OKEB 4G8FB 3W9DA 2E6JA 2J12B 2ZKHH 3RY4A 4P99A 4PRIB 2VNCA 3MJ9L 2J8HA 1MJJA 3BGFC 1T20B 1I4FB 2NW3B 4YDVB 5I1CH 5IFHH 2AXGA 2VZUA 1PVHA 3H9YA 5F1IB 4R2GD 4LIQH 2EXYC 2D7MA 3L6FB 1KTDA 4X99B 4LNRB 4NFDA 4W4NA 2YPVL 3ARBB 4W68A 2FZ3B 2IAMB 2B39A 2WBJB 1HEZB 1SEQH 3HRZB 3ZTJG 2EDJA 4ZFZB 1C08B 2DJ4A 2P5WB 1H3UA 5CP3H 2C9AA 5HDOA 5JDJA 4H88L 4P9HC 5F7LB 1TCRA 4E5XB 1AGEA 1BOYA 5F7KC 5HGBA 2A1WL 2WUBH 4HIHA 1NCDH 4K8RC 3WN5B 4CDHA 1IQWH 1V3MA 4PTUB 1DVFB 4O2CA 5L6YL 2AJSH 4K94C 2ZKHL 3GB7B 3SCMB 4IMLA 3RRQA 4J3OC 4WUKL 5E00B 5IFHL 5I1CL 4MD0A 3HE7C 1WAAE 4RX4D 3NA9H 3PWPD 5E8OA 3ARSA 1UACH 3ZDXF 1CE1H 3KYAA 2CRIA 1U3JA 2D31A 5ILTH 3K0WA 1SEQL 1X5ZA 3RDTB 2YRPA 3TVMB 2Y7QA 2XZAL 5IF0B 5C0BB 4AEHH 3Q6FB 1A7NH 3O2WH 1V7ML 3X17A 1MCJA 3ARGA 3QQ4A 5C0FB 3OX8B 5EUOB 4MCZB 4OJFH 2GYSA 4P5TB 4LHQB 2YEZA 1DP0A 2HYMA 4TSBL 4LCUB 2WUBL 4OLVH 5IVXB 1NCDL 1NLBL 1G0YR 2FRGP 4KKLC 2FR4A 3X12A 4PJAF 3ZSSA 1CGYA 4G6KH 5DURB 4NQVA 1HXMB 2IG2H 3NA9L 2EYRA 1UACL 1M05A 2FLBT 3PGDB 2JJTC 1CE1L 1A14L 4RGND 1H15A 1KF9B 3RWDB 1D9KA 3L3HB 3MLXH 1OTUC 3F7VB 3ULVF 1R3HA 2NTFA 1TJIH 3HZVA 4KRPC 5DJ8B 2VDMH 1A7NL 3LN9A 1VGKA 3O2WL 4TUOB 3LAFA 2XTJC 4G8IB 4KJPC 4UV4H 5F6HI 4FQXC 4XP6L 2D03H 2R8SH 4F9LA 3LS4H 4WUUA 4OJFL 3O6MH 1F97A 5EN2A 2MQCA 3QIWB 5F9OL 5F7EH 4OLVL 2HN7B 3D87B 3OSKA 5EBMB 1JZ4A 3RZWA 3BEVB 3QXDA 1UWGL 4QOKE 4I0CC 2DB8A 5E8DH 3UC0H 3S9DB 3HTLX 2WP3O 3ESUF 2IG2L 5I1HL 4R26H 1JN6B 3R8BB 4D0BA 4M5ZH 1UZ8B 1BZ7A 4EVNB 4RMTA 3CMGA 3HLAB 1VFUA 3QDGB 5EU6E 1RIHH 4P0DA 2AK4B 5EOTA 4MCYA 3LB6D 4QGYA 4UV4L 4JY6A 4ORZC 3MBEB 5GSVA 2D03L 3U9UB 4Z95H 4S1RL 1L6XA 3O6ML 4JB9H 2ATPA 2PCPA 4PREB 1Q8MA 1KV3A 2GJZA 5F7EL 5CJXC 2HH0H 1JZ3A 4FNLH 2LTQB 3ARGD 4MQSB 1QEWA 1RJCA 3PHOA 5E5MB 4Z0XA 1AQKL 4XWGH 3BT2H 1AO7A 4YHMH 5DJXB 1RZFH 2V17L 4R26L 2AV1A 4ELMB 5CKAA 4Z7VB 3V5HA 1PKQE 5CJBA 2DLFH 2CLVB 2A6IA 4ORGB 2Z31A 1FL5B 5KSBF 1RIHL 3C5JB 5EU7C 4YJZL 2Q20A 4G43A 4PLKC 5A40E 1J0HA 4I18A 1ZV5A 5B22A 4PGEA 1JYNA 3ARDC 1L7TL 1D9KD 2BSSB 5DQJA 5AYUH 3NN8B 4X6DB 1FH5H 3KLHD 3AGVA 1EV2E 5ID0A 4HUXB 4YBQC 4LDOB 4F7TA 4KJQC 1OGAE 4JY4B 2E8ZA 1UM4H 4XWGL 3K8KA 3BT2L 4WUUD 3GMMA 5HYSB 1JYWA 4ODHH 3MLPA 1RZFL 2VE6A 5IMOB 4WO4C 4WWKA 3QG7L 5ANMA 4BH7B 2FSEB 3CX2A 4XH2A 3EW3B 5DJDB 4GS7C 4Z5RA 1YNTB 1YN7A 1IEAB 5DRWB 4EUPB 3HB3D 2FECI 3BPNC 3LZFH 2WIIA 5DI8B 3D48R 5L7XH 3CH8A 5IG7B 1AR2A 1KT2A 4D9QE 4NCDA 4J3SA 1T5XB 3DVNA 2Q76A 2NY2B 5IP4A 1HWGB 3IU3A 5DHYB 1QYGH 4PTTB 5E8EB 4MS8D 1T5WA 5E2VH 4WHYH 5L9DH 2UY7A 1QFPA 3FT4B 5B4MD 3VFNB 2EKJA 3RWCB 4YHNB 4LLVA 1UM4L 3TNMA 4CVWA 4OZHB 4ODHL 1J0YA 4YEEA 3G5ZA 3O45B 4PB9L 3QQ9D 4Y16B 1OAZH 4M4PA 1INQB 2ZUXA 3LDBC 5F71A 5TGBA 3W0WA 2XV6B 5T3XD 4R4BB 4JM2F 1QVOA 2W0FB 3DVGA 1AO7D 3SGJA 2C3GA 3LZFL 1E4XH 5DRNB 3W39B 3QO1B 2XN9B 1W72H 2VITA 4TSCH 2APFA 3AM8A 2Z31D 1PFCA 4GSDH 2B4CH 3ET9F 5HYEA 3QA3B 3VFPB 5E2VL 5L9DL 2R4SH 3D39B 4LCWE 3HUJB 3STZB 2GT9A 4XMKH 3V2AR 1EPFA 2B1AH 3U30C 1NANI 4BJLA 3TWCL 3L3IA 5FHBL 2ICWI 1JZ5A 4XI5D 2ZSWB 3QZWB 1Z5LA 1T2QL 3ARUA 3C60A 5JUEH 4AZ8A 4ZTPH 1ZVSA 2HJLB 3IFLH 5ITFA 4ZFFB 5GJTH 4K9EC 1IBGH 5FYJE 1NFDF 4AM0B 1DUZB 1BZ9A 4D3CH 3NIDF 1AGFB 3QUZC 4AL8H 1E4KC 4GKZB 4YGAB 2VLLA 3O3BB 4PJXA 4WWKD 5DC9B 3TPUB 4ENED 3VXTB 1P2CB 4O4YH 5E5RB 5F9DC 3TGXA 4TSCL 3VFSB 1LE9B 2C3XA 3IDMA 5CP7B 5DUMH 3FRPG 5FYJL 2RJMA 2KQMA 1G6RA 3KVQA 2B4CL 1U8QA 3FONA 4MA3B 3IAGC 2R4SL 3L9RA 3B9KD 1S9XB 5TE6H 5D8JL 3IETB 4MXWH 1WJ3A 4XMKL 1MI5A 5DSCA 1I7ZA 2B1AL 3R0MA 5JHDB 3A6OA 4X5XA 3BIBX 2HTLD 3RGVA 2VH5L 1GGBH 1QFOA 2YXMA 4HW6A 4MXVE 4ZTPL 4O51A 2G60H 4L8DB 1S9VB 5GJTL 1IBGL 1HN1A 4OV5B 2EIZB 4D3CL 2R69H 1MCEA 4K7PH 4AL8L 1WZKA 4Q2ZB 4M93B 4ZD3H 1NCTA 5GZND 4O4YL 1NGWA 1DQJB 2V9RA 3CXDH 1FNEA 3T08A 4PJGA 3MLTA 3PWNA 1G9ML 3PL6B 4ETYA 2CIIB 5TE6L 2H2PC 4HC1A 1VEMA 5HGHA 3EDDA 2C1OB 3HN3A 2HG5A 1GIGH 3E1F1 1GGBL 5ID1B 4YPGA 1JZ2A 2V7HA 1LDSA 1K3ZA 2G60L 3HE6C 3ARPA 4JJHA 1X5IA 3OZ9H 5DFTA 4JVUA 4O9HH 4OQTL 4X9BA 5DRZA 1DR9A 4GXUN 3BKCH 4ZUVA 1KSRA 5MHSE 1SJXA 4P5KB 1A7PL 5TDOA 4QO1A 4W81A 3C60D 4U1JA 4GG6E 1NEZA 2Z4QB 3CXDL 4FOMA 2WLYA 3QEUB 3T65A 2H2SC 1AGBB 3MV9B 3KPSA 5ABDE 4CL7A 3HAEA 5DVNA 3QDJE 5D2NE 3VGDA 3MRMB 5A43C 2W92A 3SKNA 1CF8H 4UBDD 3MRJA 4YO0A 1J0JA 1GIGL 1EMTH 5DHVH 4I48B 4X4ME 4YC2C 2XQYG 5EIIB 4Y5YC 5I76B 5E1AB 4OIIL 3KPPB 1HNFA 5IB5A 2EYTB 2BSTA 3KPLB 3RVTD 1R24A 1MI5D 1OW0A 4KTDL 5I8CA 1NH6A 3BKCL 1CDIA 1U58B 3HZKB 4FFWC 4HEPG 5E4EC 4JRYA 4U7SA 3SKMA 4JFHD 3T2OA 1VENA 4XNUH 5BO1L 2X1OA 2OTUA 3BEWB 4TQEH 2FYYB 4Z7UB 3UTQB 3ZKNC 5T5NF 5EUKB 2Q8BH 3B83A 4YHYC 2ZUQC<