3LZOA

Crystal structure analysis of the copper-reconstituted p19 protein from campylobacter jejuni at 1.65 a at ph 10.0
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
159
Chain Sequence
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
molecule keywords P19 protein
total genus 33
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzoA00
2O6FA 3LZOA 5I0YA 3LZPA 3LZRA 2O6DA 3LZNA 5I0XA 2O6EA 2O6CA 3PJNA 3NRQA 3LZLA 3PJLA 5I0WA 3NRPA 3LZQA 5I0VA
chains in the Genus database with same CATH superfamily
2OMBA 1BZ9B 4DESA 2EIZA 3IJEA 5B38A 1NKOA 4IRZH 5C07D 1HNYA 5AYQA 2E7HA 2B2XL 3Q5YA 1ONQB 4Y9EA 3QUMA 4XAWH 2YXMA 2ED7A 3N55A 3TV8A 4NUQA 3HC4H 5I8EA 3MJ8B 4H1LG 1U3ZA 5E9DA 3ATDA 3VMPA 5IM7B 2VW7A 4QY8B 3PF2A 2DQHL 1THCA 3BGMA 3C87A 3MLTA 4ES9A 4NRZB 4U3SA 4WO4C 3MN8A 4Y2DC 4K15A 1HHIA 3ALWA 3CK0H 3MUZ1 3O8XA 4QHLB 2QT6A 1K9TA 2VWEC 4YNYA 4L8CB 2A9BA 2FWLB 3T2QA 2DQGL 3H9SD 4WQOA 3WXVH 1NGYB 2N7AA 2XN9E 1YG9A 2VDMB 3EOAB 2YPLB 1ILSA 6PCYA 4XOBA 5EUKA 4K3DH 4UQ9A 5T5FL 3QISA 2NDFA 3UYRH 4FNQA 3SKMB 3IETA 4Z7OB 3RWHB 3Q8FA 3L4YA 2EUWA 3X1FA 3QIUB 2X4NA 1BXVA 4NZTL 2IV9A 5TDPB 5FA4A 4PJCF 1P84K 1T2XA 4L3CB 4Z7VA 2RH0A 4P3DB 1CXHA 4F9PC 3TV3L 4DP5X 2EH8H 3LQAC 4KO6A 3L3IA 2FL5A 5HPOA 5DMIL 3FN0H 4TYUA 3BZDA 4XPHL 3MCLL 3NFNB 1KELL 5DVLA 1U3HD 5AAPA 1BZOA 4DN4H 1T0NA 3K80A 3LPGA 4LSVH 3HG4A 3MNVB 1JDAA 5KN5A 3G5WA 4DEPB 1W80A 3UMTA 3ZKMD 1INQB 3JYCA 4Z3IA 3IMSA 1K8IA 3NMEA 5LBSA 4G8EA 3OSVA 3C9NB 3CVIL 3GEFA 4FL4C 3D12B 5E6SB 4ZO8A 2V3EA 3MLRL 4HETA 4E41E 4OD3H 4YHYC 4KJPC 5TQ0L 5I15H 4BSVB 4JY5H 3GS7A 3KWUA 3F04A 4K3JH 1A4KB 4HKXA 2ZOUA 1DR9A 4G80A 4FTDA 1NBCA 4NPYB 5E6IC 1FP5A 4NX0A 2R4SH 4FZ8H 3NA4A 2B15A 3BVDB 4QRPA 5SWSD 3VFWA 5DJDA 3W1ZA 4MGXA 5B1JA 3NPSC 4LHUA 5B7EA 3LIZA 3WMPA 2E56A 2WTRA 4PJFF 2ZONA 2VITB 2P5WB 3NSJA 4AGLA 1TVHB 3IDMB 3DXAD 2CIKB 5CBEA 4A7SA 2WUBL 1ETZB 2Z92A 2W81C 1P9MA 3D18B 1I7UB 4NRYA 4LCCB 3WFCL 4X8GA 4FFWD 3BW9B 3HZYA 4L3EE 1MSPA 4KKNA 4LLVB 5KVDH 3SY6A 3BD5A 4D3CH 1CFQB 2ZP0T 3CCHA 1D5XA 1PZ5B 4YBQC 5HDBB 3D4CA 3SE6A 1D2OA 3BUQA 3DPBB 4MLSA 1S5IL 5CEYB 3SDCC 4NT6A 2ZUQC 3F12B 4IU3A 3THML 1DJYA 1WZ1L 2HXAA 4AKQA 1J8HA 1S9YB 1T5KA 4WEBH 4AYGA 3MXWH 4HKBA 4O58H 2ZT9C 2WXRA 3UZEA 1PSKL 2DBLL 4NQEE 2H2PC 2DEWX 2FT7A 4AVHA 3MLXL 1N2RB 1PF3A 1RKRA 5C09E 3PWVB 3ZO0A 5BV7L 2Z0UA 4WSKA 3FSAA 2YKKA 4ODHL 2YMOA 1BEYL 1XGRA 5HYJB 3FYEB 4UCFA 4KKAC 1Y0LB 2IAMC 2O5YH 3ZKXB 3LPPA 5TDOB 3O4LE 1LK2B 2BWDA 4PV1C 1IUZA 1W0WB 2BSED 5D2NC 2EDQA 4POZC 1EEUA 1IAIM 2C8NA 1N3NB 1XF5B 4HCRL 4M6NH 1U8NB 3BGFC 1AGCB 4JZJB 4M4PA 2Q10A 2XZAL 3M1OA 4QTIH 4KK8C 5I0XA 3LNHA 4JY4B 3U30C 3GHEH 3EZ8A 1R3IL 1H15B 2D0HA 3GSRA 4F7CA 3WUZA 1G4RA 2XQBH 4E42B 3MRJA 3U1SL 4HUVA 5EZOL 4UF7C 4HSQA 2G3NA 4DVBA 4UILH 4RA0C 1LO0L 4PJ7F 3ARXA 2F19H 4X9BA 1RZKH 4JQIL 4U05A 4GMTH 3BP4A 4CJ0A 3Q8BA 3TJHD 2BNRD 1NEZA 2QJDA 2VXVH 3MACH 3TPKA 3LQAL 2NYYD 3AXLB 2XQYA 4PW4A 4W6YB 4CSSA 3H2QA 2OXGA 1H5BC 1L7IL 3TTYA 3AADB 2F5AH 1GW0A 1HIMH 3FRUB 5KS9F 1YEIL 3MLSL 1G6RL 3IVKB 1KB5B 2Y5QA 3O3UN 1GZHC 3MREB 5C0CE 4ZMWA 1H9DA 1T5WA 1A6WL 4LMQI 3RA7L 1OQOA 2KMWA 1MWOA 1JPEA 1JHTA 3ULAB 3Q44A 1PIFA 4EF3A 2IANA 1FFPB 1X5MA 1QFOA 2N4IA 3QHZL 4YSOA 1YN7B 2OSXA 2NY6C 5EH1A 1QLRA 2AK1H 3VWJB 4W6XB 5EZLB 1BQSA 1QZ1A 1WLHA 2VDPB 1IVTA 4XHJD 4PJ5D 4WWOA 5KVGL 1X7QB 3F01A 1JHKL 5D5MA 3DSFH 2ZKHL 3MJ6A 4QCIA 5C07E 3Q2NA 3S3PA 4KNQA 2AXFB 1N8OE 1ZHLB 2D03L 2FVNA 4EZKA 2ODHA 2XHNA 1R24A 2XVBA 4AVIA 5GS0C 2VZSA 4OCLC 4G8GD 1XDTT 2A83A 1JF5A 1GAFL 3ELQA 2A74A 3UAJC 4W68A 3X1GA 3KBHE 5ACMA 4YEEA 2NY5L 3KPOB 4JGMA 3SZ6A 4Y4KD 4R3SA 2E7LA 4OJEH 1JFQH 2WAQA 3R7RA 4LCWB 3PNWB 4NENA 1WIUA 4LFHG 4ZUWB 1MG2C 3QIBD 1O7SA 4NQDD 1CGVA 5FYKU 1TTRA 4MLIA 4U1MB 1HCYA 2F7PA 3QC6X 2IQAA 4HIJA 2P47B 1ZEAL 1JK8B 1NCGA 3NFSH 1CF8L 2YBRA 2XPZA 1AQKH 4IIQA 5TFSL 3MBXL 1A3RH 5ISZB 3PV6A 2FH8A 1U91B 4JM2A 2XXGA 3IFLL 1IJ9A 1U8KB 2VYRE 4JW3A 4NFCA 1IC7L 3FFDA 2BH0A 3MCG1 1BWMA 2BVPB 5GGUB 5L4IA 3UTOA 4PY7A 1KJ3H 4L29B 5DGRA 1CR9L 1Z5YD 5LGHH 1VKXA 2I24N 2NY2B 2XPGA 3LB6D 4N5ED 1YUHB 1J48A 1P4BL 4QKXB 4PS3A 1HEJC 4N2HA 5I73C 3EYVB 2PTUA 3P4OA 4QRTB 2PABA 3V5HB 2PETA 3EJYD 2WGNB 2R0WH 1G7PA 1OLLA 5J3HC 1VIWA 4OJCA 2WQVA 2XOTA 4I1RA 2A6DA 4J12A 4E9VA 2VLKE 4M7LT 2ZXDA 2YD0A 4PR5A 4RMBA 1HOCB 4XXWC 5I1HL 2IPUK 5E9AA 2FEDD 1A66A 5DO2D 4WO0A 3KNBA 3FN0L 2ENJA 3OGCA 1PD6A 2ZCLL 2Y06H 5MENA 4MQ7A 1XH0A 4NO5B 2J8OA 4Z7OF 1NGPH 4DZ8B 1I1FB 2K78A 1I8IA 4ERSL 3MV7A 4F5CA 2A6DB 4C4BA 3CVIH 4ZSOA 5J4MA 3A4EA 1CE6A 2MCG1 4OJYA 4NT6B 3V0IA 4N20A 5EU6D 3HPLA 4X4XA 1NWOA 5JORB 2AABH 4NZDA 5TQ0H 2OM5A 3KPRA 3U30B 2ZSVB 4KTEL 2BSDA 2X0UA 3P0VL 2ENQA 3OZLA 4ZXBC 2R2BB 3M17B 3ZHKA 5JPMB 1AD9B 2BP8A 5DS2A 2P7TB 4JO1L 1P7BA 1TJGL 1RZJC 1OKEA 4Z3FA 4AEHL 5FX3A 3MRLB 3G6JE 5F6IB 1Z5HA 3MRBA 4OCYL 2NR6D 2CG9X 4P48A 4N0FA 1CWVA 4XP5L 2KHAA 3QYCA 4J3VA 1ZE3C 3GSWA 3DVIA 3ATFA 1C5CH 2NY4C 4JG0L 3V9FA 1I3GH 2WM0A 1ES0B 2FLMA 1FZKB 1QWUA 4FQ1H 4WFGD 3TJEL 3AG2B 1PW3A 2EDFA 4EI0A 4TM9A 4XMTA 4RVBA 2UWEF 1EJ8A 3QWQB 3T3MB 3DRTA 1CT8B 4V2CB 1S3KH 3ESNA 3FONA 5JOFA 1HOEA 2H32H 4UQ2B 2PYED 3VWKB 5K59E 1MNNA 2YWYA 3I3DA 5C9JB 4B9JA 2QV4A 2IPUG 3BDXA 3QORA 4O58L 5E1GA 1UWXK 4MA3A 3ARGB 4WIQA 5DK0B 1ACCA 1UXMA 2H0FA 3DOSA 3NABH 5T3ZE 3GD1C 2BVOA 4KOCA 2BVQB 3LDBB 3NCCB 2FT8A 1NCOA 1PTZA 2XV3A 2Y4SA 3B34A 2YQ2A 2CIIB 3JWNE 2LU5A 3BQUA 2BSRA 4ODHH 1CQKA 3ZSSA 4PAZA 4I18C 3H7LA 4JZJC 3N42F 1PG7W 3BGFB 5IVXF 1P53A 1FG9C 3O6FB 4S10A 5F9WB 4OVVA 2ZX8A 2QHRH 5F7LB 1E5CA 1S7WB 5GRWA 4CN6A 1GGUA 4B0MM 5BS0E 3TESA 1WAPA 4JFEB 2E4FA 2GIYA 1PY4A 2VTFA 3UIYA 2VC2B 4N85A 4QWWD 4DVRL 4M3HA 3US0A 5JZ7D 4A7QA 3DX8B 5HYJE 4QMEA 1DVYA 5DC0A 3LKRB 4Y4HB 1S5HB 1TVDA 1OPOA 3MV9B 1QEWB 5HSFA 2FWUA 4DHLA 1MI5E 1QHOA 4PJXA 3HE6D 4LHUG 1KIQA 5KANI 1P1VA 3CSBA 3MLWH 5FW8A 5I2IB 2E86A 5EZOH 1N68A 4L8CA 1EAOA 5C2UB 2WB7A 4XMPH 3V7AE 1I1AA 3AVEA 3AG1B 1LO0H 3O8XB 4GAFB 4OFPA 4W70A 2DF3A 1AHKA 2HT2C 3MLVL 2CJSA 3GXPA 2XIIA 5IBUG 4JJOA 4LLMA 4A6YA 2DKSA 4HFWA 5HHME 5HDBE 2ISDA 4BXSV 4MVBD 4DUVA 2F5AL 2V2XB 2N1KA 2JCCB 5F71A 2KT6A 1R34A 4HSAC 4RESB 5TF1H 5ICYB 4GRLA 2ZWSA 3VRIB 3CLEH 1QFHA 1UEMA 2AZUA 3NFPA 4U1LB 1TKWB 2Q5BA 1C16B 3O81A 2P5WE 3D2UA 2V9QA 3HKZA 4YDJA 4LEBA 4NPJA 3DUUB 4GAYA 1KJ2L 4TUKH 2QVMA 5F7MC 2BCMA 4ZDHA 3X14A 5D55A 5I1KH 5CEZL 3SY0A 1LEIA 3NH7L 2NLJA 3PXHA 1ILUA 2G9HB 3NJGA 4IRJD 3M1BB 2D8KA 4JFZL 2D4FA 1HZKA 1UD3A 4Y1AB 3FTGA 2ZXEB 1DEEB 3MRHB 4R4ND 5HGHB 4KHXH 4E41B 5HD8D 4MHHI 3VG9B 1PG7L 4XI5D 2H3NB 3BH8A 4JDEB 4MD0B 2AEPL 1OVZA 5T33H 2B3RA 4X5RA 3APMA 3EKCA 2NY0C 3U2SA 5HI5C 2FWOA 4UM9D 5IVZB 2GFBB 1R5VB 3KXFD 1JGIA 2YD1A 5FYLE 4J5VA 3V5DA 2AQ2A 4PCYA 3APDA 1IBBA 5FYJL 3I74A 3VFSA 5K33A 5A2LH 3INOA 4GQPH 4KQ4H 32C2B 4HS6A 3FTGB 3GSUA 4S1QH 1X4ZA 4L4TB 4PRPE 3KM1A 4LOVA 4EN2A 1XZ0A 2DQCL 2R8SH 1KZQA 1DJSA 3OZ9L 4WU7A 5HHQB 5IB2B 1SYSB 3E9UA 5FM5M 1UJ3B 4GSDL 2D2OA 1NOAA 3NFSL 4Y9FA 2X5PA 3LKSB 5FO9A 2Y7QB 3KPSE 2VDPL 1WHOA 1CLZL 4P9MH 4OFYD 3VGAB 4BE6A 4YBQD 1C5DB 3FCSA 4CMHC 1NICA 4AM0Q 3O3DB 2BMKB 4JFPA 5AFAA 5LG6A 1NZRA 3B4NA 4KI5C 2LR4A 2BINA 4GRLB 2EQDA 1O9ZA 2A9NL 2YAOA 4F2MB 5FECA 1FNEA 1KLUA 3HI6H 1IJNA 3FHAA 5BRPA 5E6IA 1CC3A 1HCVA 4Y2NA 2P8LB 4QO1A 5C0BA 2MOGA 5CZKA 1TTBA 2Q7YA 2FR4A 1EZUA 4MYWB 2ADFL 4H8QA 4JM2F 1FZMB 3AU0A 1DLHA 2G0KA 4O00A 4GO8A 4EDXA 1HEHC 2WQXA 3TBSB 4PEEA 4PJXB 4MQXC 4N0UE 2JELH 2JJTC 4OIFA 1DEDA 5FA3A 4D8PA 5MHSE 2AZAA 4N8PA 5CUSH 2V5SA 3HBGA 4WU5A 3ESVF 1P5VA 1VJSA 2YZ8A 4E5XB 2FNWA 5IG7A 4KX8A 1JD7A 2ESVA 4O4YH 1KLUB 3SO3B 1PZDA 3ZKMC 2EIMB 3QUZA 3WNOA 2YN5A 1TZGL 4QRAA 3S35X 3VGEA 5BZDA 1GZHA 3GIZH 5FDWB 3D05A 2B0SH 2P46B 3IBEA 4N2KA 1DHKA 1RZ7H 3WL9A 2NY7L 3IGLA 2NY3B 1GCYA 3DIFB 5F1NA 4RRPG 2P24B 4KFMA 5HXMA 3GXTA 3TFBA 4YLBA 1DQML 3KE0A 3TBSA 1OT1A 2QZ5A 7CGTA 4G43A 1E50A 1ZWIB 2WZ0A 2F7QA 2F7OA 3N44B 4ZNCD 4K94C 5TPWH 5BVPL 4XP1L 3ENEA 4B53A 5AW2B 2JCWA 2Q86B 3BVWA 1HN1A 3QDAA 2GI7A 4PW3A 5E8PA 1EPFA 3QEHA 1AG6A 1C5CL 3CXDL 4HSCX 4NC0B 4X5WB 5D71L 2XFXB 4ODWB 3DJTA 4Z77B 4FQ1L 1QSED 1MREL 1XTLA 5J6GA 5DVKA 1O75A 3GO1H 1N7MH 3QWOB 4JEGB 5I18L 3MUGB 2AMGA 1NWPA 2PO6D 4YHIA 1HINL 4JFPB 3QEQA 5DO8A 4TSBH 4N0FB 4H26A 2CUMA 4DN3H 4FHJA 1KFAH 1CGXA 5FM8A 3MRBB 3SKOA 1A3ZA 3WFBH 1D3CA 2BS9A 2P5ED 1VHPA 1SXZA 3FFCE 1B6DA 5AZEL 3OAYH 4FEMA 1V7ML 2AC0A 1DVFC 5EIIB 1D5ZB 3SGEH 2FQEA 4J2XA 2Z0BA 4RAVA 5CJXA 2QLVB 3TIDA 4J27A 1IKOP 5F9JB 1NEZG 1GW6A 3TPUA 4FKEA 1LXMA 1DVSA 1OAYL 1M71B 1O9WA 32C2A 5ICZB 5EF3A 5F8QC 1BOGA 2WXOA 1NUDA 1FYHB 4U1LA 4MAYC 5CR8A 4L1SA 3BFQG 1YEWA 2F58H 5DXWA 1EV2E 4XNYH 1W0VB 4NKIL 4OJFL 1LD9B 2WKOF 2XBTA 3ARRA 1Q9LA 4WUUA 1B4LA 2FO8A 3W11D 2L7UA 2WVUA 3QDME 3MRIB 1WBZA 3ZO9A 1BYNA 3QCTL 2X2IA 4LLDA 1D5MA 4XMPL 4S2SA 1FZJB 1XGQB 2VL5A 3W82A 5D7IB 1C7SA 2H6PB 4MASA 5I1JH 5JYLA 5M95B 1HXKA 1ZA6B 2EO9A 4FLRA 4WJ5A 4MB4A 4FYRA 4PGZA 1WA2X 5HI4C 4S1DC 2UZXB 5KAQF 1KT2B 3O9WC 1XF3A 3L7EA 4OGYH 4RFNB 4BQBA 4PGBB 3LKRA 1CTNA 1T2QL 3HS0C 5C70A 1INDH 4PS4H 1MDAA 2F8OA 4LSPL 2YGVA 4FQQB 1OAQH 5DYOB 1T1YB 1TZOA 1BIIB 2D3LA 1MCKA 1FVDB 3M45A 2QKIA 3QJOA 4JN1L 3V0VA 4F57H 3RGVA 2GTZB 4FYTA 1NFKA 5JHMA 1JZ3A 2XC8A 2J8UA 4ETYA 3DUHA 4TNWF 4TQPA 1U9KA 3ZTNL 1QEXA 2DY2A 1ZHBA 4YSPA 1WWBX 4ADJA 2AV7A 4GW1B 3K6FA 1M7IB 3NH7H 1PD0A 3SYAA 4NNYA 2FHBA 1ZLWH 5J57B 4IIZA 4TUOA 5DHDA 4O02B 3LQMA 2VLRB 2V5TA 3KPLB 3ULSB 2K3TA 3LIUA 1LM8V 2IIJA 3DX2A 4V1DD 3WJMA 3WEBA 1F3RB 1NCDL 2I69A 2YC1B 3K2IA 3KGSA 4NAMA 3RNQA 3VO0A 4HVBA 1PAZA 4NP4L 4LBEB 5DZJA 3QUYC 2EICA 4JFED 4FABL 3U9PL 5L2JA 2FWSA 4M5ZL 4HF5L 5J8OA 2JJVA 2VLJB 4N2DA 5AVYB 3JWOL 4TPRH 1IGIH 4KDTA 3UTTB 3WLWC 2WBJA 5CU9A 1J88A 5D1QE 1AP2A 2CM6A 4DW2L 5IHHA 3PWPB 1LE5B 4S1QL 1HXMA 4XTRC 3I3EA 1HH9B 3UEZA 2ICWA 2OMUA 2DEYX 2UX6A 4HPHA 1K85A 2VB5A 1QUNB 4XO5A 1GZPB 2X9WA 4OD2B 1Q4NX 3LD8C 1WWWX 3A67L 1J5DA 1EANA 3BAEL 4LSUL 3FT2A 4TSAH 4DKTA 1JP5A 4QTFA 3TH2T 1OSPH 1U8PA 4DOHE 2CHWA 3V0DA 1TQSA 4YDZA 4O9HH 4OZGE 2X3CA 4Q9RL 2VXTH 3DRTB 1TQUA 4APXB 2A9NH 3IVKA 5J06A 1LK3H 5JR1L 4M7LH 1MWAH 4PJAB 5H35B 1CMOA 1I8IB 3IMWA 5DD6B 2CDGB 5DR5L 3QUHA 1ED3A 2PPEA 4LP4A 4Y19B 1CN4A 3PP4H 4LOEA 3DJZA 1KYDA 1TVBA 3GS0A 1LO4L 1UJ3C 2Q8AL 4Q6IA 3DX1A 3QXWA 5FW6A 3L48A 4UIMB 2D31A 2NUTB 3CSGA 2N3JA 4PJGA 3MRKB 2AQRA 3L3HA 3PL6C 3QJVB 4W6WB 1LQBC 2JELL 1QFWL 3NCYP 4WV1C 4XOEA 5DFVD 5GRVL 4KUZL 5GZNC 1D5BA 5AOJA 2P52A 1A0QL 4KXZI 4YXKH 1R0AH 3QFJD 5CUSL 1H6UA 5KUMA 5JDSB 5EN2B 3C8KB 3MV8D 3RL2A 2GBAA 4G1EA 1IEHA 2Y25A 2VM9A 5BMFL 1J0ZA 2IMMA 3PWJB 4O4YL 4AYMC 3C60D 1MCOH 4TLKA 1A3QA 1TO4A 3AT0A 1FH5H 1GKOA 4XNXL 5E1HB 4YN3A 5EORL 5BRZD 3SEPA 4WW1A 3WJJA 1YY8A 1MFCH 5F7KC 3O0RH 4DGYH 1SDAB 4Q6IB 5F7DB 3PWVA 4ENZA 2RIKA 3KD4A 4P2QD 3OGCB 4PG9A 5MENB 3LRKA 4KKBC 1DQMH 4LPCA 3DO4A 2XBDA 2CKBL 2DN7A 3LKOA 3NZUA 4AW7A 4OV5B 3GMLB 3HE6C 4F33B 1N10A 1EJOH 1AHWA 1DBMH 2JI1A 3N3EA 5TPWL 5BVPH 4XP9H 4RGNE 5HHPB 4FI8A 3EHBC 3RP1A 4U1HA 1E9QA 5E8DL 2Y5TB 4OLVL 4B96A 3WIHA 3RWEB 4U6XB 3UTSB 3CXDH 2QADB 4LRIC 3BIAX 4HIPA 1OGAE 4QJ3B 1AMYA 1MREH 3GKWL 2FT6A 3FT2B 3ML8A 3RDTB 4Y5VC 4ANUA 5D7LE 2CJ3A 4F9LA 5E8NA 4HAFA 1N7ML 3D33A 4FNTA 4M02A 5ANMB 1HINH 1WFJA 2EIEA 3OKMB 3VXMD 4W9HC 3SKNB 4FXKC 4NWUL 4DN3L 1TVHA 4MZRA 5CBEB 2Z3FA 3L54A 3WFBL 3PP3K 2DLEA 1MCWW 1TNMA 3T2OA 4KX9A 3QORC 2VLLA 5C6PB 5D7JC 1RUPH 1V7MH 1CGSH 4FJ6A 1NSNL 1MEXL 1OW0C 3PLYA 3FAWA 3N0AA 2BSSA 4JRXA 2D7TL 3VWJA 2X70B 4F3FA 4FP8H 3AWGA 3I9IA 4M6MH 3RVXC 4LCWA 1UM6H 2UYLA 5C0GA 3W56A 4KNUA 4ZMPA 5I6XC 3L3OC 2KI6A 1GGIH 2AEWA 3TOPA 2OL3B 2QV2A 1CIDA 1JMXA 1K8IB 3QZPA 3MA7B 2EUVA 4ZS6C 2P48B 4FXKA 3MNVA 3PL6A 4WV1A 5IVXA 3UG4A 5F7HA 4DKEH 4X6CF 3MOAH 4M6OL 4R0LC 2DWDB 1NIFA 3BPNB 4LSDA 5ITBL 5FFGA 4XNQA 5IB1A 4C47A 1RUKH 4LL1A 4KZDH 2G2RB 3QZWG 3I6LD 4NUMA 3UIZA 3DK2A 3Q06A 3BIKA 3EFFB 4XBPA 1VCAA 4Y16C 1JGLH 1J1XH 1SY6H 4TS6A 4LQ1A 5LBVA 3B5HA 3B2DC 2ZOKB 3UTPD 2E0PA 4TQIA 3C6LD 2X1WL 5EB9A 4UINH 2NW3A 2ZXBA 3UO1L 3IETB 3PXJA 1U30A 1A2YA 1UFGA 3K0WA 3QNFA 4LSRH 5GS1B 2OJ1A 4PU2A 4LSPH 2WWNA 3BN3B 4XMUA 4ATTA 3HBQA 2NY1D 3DOHA 4OIIH 4GG6F 1A7BA 1WBZB 3Q43A 5KJ4A 4JN1H 3EGXB 4F57L 3KPNA 3R19A 1HFUA 2VL4A 2J56A 3N06B 5AW1B 4AEIL 4IBSA 2WJ5A 3RWIB 5HYJD 1LDSA 1AXSA 2OA9A 4HBCH 2ZUQB 4UOW1 1A6ZB 5DQJA 3I9GH 2YK1L 3BEWA 2GBTA 2OI9B 3F7VA 3BO8B 5EZPA 3QRGH 3AS2A 5E9DB 3ZKXC 2A38A 1E40A 3MNMA 4XPFL 5DHXB 4A38A 4M29A 3C5ZB 4NQTA 3O3AB 3FTWA 3K2KA 4F7MA 4HWZA 3NJMA 2A0LC 3OV6A 3QQDB 5F88B 5TH2A 4R4BA 4RAVB 3LB6C 4HISA 3H8NA 1O6TA 4NP4H 3EYQD 5BVJB 3QCVL 1BOGB 2WIIA 3UAEA 1NGQH 2VZTA 4MZIA 3L4TA 4X6BB 3DA0A 1NFIA 1ZSDA 3CFJA 2CUHA 5I19L 1GKEA 4M1DL 1J12A 3CCHB 1QRNE 3MLUL 4MNQA 2I07B 1SM3H 5FYJU 1UZ8A 4MDJB 1USQA 2BERA 4GG6A 1LK2A 1L3NA 4JFOB 2YSSA 2EDKA 3CZGA 5CLZA 4ABQA 3KLKA 3ZR5A 4PUBL 5IFAL 1IQWL 4PWEA 3UTZB 5I1EH 1HYSD 5IFJA 5D7HA 1G9NC 2GBVA 4FG6C 5KS9E 2ODIA 1E67A 3OKKB 1I8AA 4PJEB 2IDQA 5KYUA 1N2RA 4MTMA 1XAKA 3EG9B 4WHTB 1ZT4B 3QWOA 4C56E 2Q86A 5BW7A 3DECA 1PQZB 3PQYA 4LSUH 2BLFA 1P5UB 3MRQB 3JT0A 4Z8FH 1QOKA 2NNXA 2ATPB 1UACL 2B39A 3T1FB 4C83B 5I16B 1P4IL 4ODVH 3TBTB 1PZ5A 3VQ1C 1YJDH 4OLEA 4Q6IC 4P46C 5IIEA 1F4XL 4GXUM 1FJ1B 4AC2A 4B9CA 1M2VA 3D30A 1INQA 4S0HA 3BH9A 1XD1A 5EFIB 4PTUB 3OG6B 3BIBX 4JFFA 4CC0A 4H7VA 2W65B 4X2UA 2Q8AH 2DLFL 3UYPB 3UP6A 1NBQA 2KZBA 2DB8A 2P43B 2TSAA 3GZKA 5DJ2A 4GKNA 4ELMB 1IT9L 3II3A 4N2FA 1V3LA 1FHGA 1RHHB 5F0JB 5IW3A 5LXGH 4MJIA 2ZX7A 3RUGA 2W65A 1JNNL 4JRYD 4KUZH 3LOWA 4K5LA 4DAGL 3G6JF 2CLRA 1EDYA 4Y7MA 3VXTA 4KROB 3P9WB 2KERA 2GSIA 4X6DF 5A16A 2LTQB 3JVGA 4PRHD 5I30H 2KH2B 4XBEL 4HWUA 1EO8H 5L2KE 4GFXA 3UTQA 3SOBH 2X4UB 4POUB 4E9RA 1SMDA 4Z7QB 2JI2A 1C7TA 2OW7A 5AB2A 4TQHA 3UOAB 3QI9D 2Q9OA 1BF8A 3ZJAA 5K9JL 4ODTH 2FIKA 4Y4FD 3RGVC 4DGYL 2NOYA 3E0GA 4N9GA 1AKJB 3N85L 2IV8A 4U3SB 1JPTH 1QQDB 2W60A 3QWRD 2JE8A 4GT0A 5F96L 4DK6A 1AZRA 2YPKA 2VERN 4QRUA 1F90H 4L4VA 5I8EB 2HJLA 4H88H 1G7HB 1D6VH 3B83A 4U1KB 3FU7A 4ENED 3WY2A 5A2CA 1F8TL 1Z9LA 4G70B 1NUNB 2X4NB 1N6QH 3SD2A 3EYFB 2JJUA 3CFCL 3H55A 3ML9A 1VFAB 2APSA 3L1OL 1AR2A 2KL6A 4MKMA 4NQQA 1V10A 4ODXA 3FHQA 5JW4M 3GKWH 4B3EA 1BLIA 3KEDA 4PJFB 3H7BB 4QXWA 2JKJA 5GRXG 4MJ4A 1K3ZA 3IRPX 4Y19D 3KCPA 3UTPE 4PREA 1S9XB 5CWSA 1G1KA 2C7UA 1XD0A 3MA9L 2BRRL 1TTGA 5E4EC 5FOJA 2XETA 3WLBA 4QGYA 1M3JA 1EUUA 3OXSB 4OQ1A 3I6LE 3RB7A 1PQZA 2FRGP 4RWYL 3HRZC 5JPNC 3V4PB 5IVZA 5GZNA 3BKML 1ID5I 3OKEA 5FPIA 3O3AA 4R5TA 1CGSL 2DM3A 2QTEA 2FDBP 2H26B 4JGUA 4JKMA 1REIA 2D7TH 5FB8A 2IG2L 4JQIA 5L2KB 3GDBA 3F2LA 3QFJB 1IC4H 5EIIG 4F7PA 3DHMA 3BOVA 3IDXH 4UYPA 5EF1A 5CJXC 1J5CA 2DAVA 2VQ1B 4GAGH 4BM7A 5B38B 4KXBA 1JCKA 3FSVA 4EXKA 5J7CC 5JW3H 1LE9A 2FUQA 3LRHA 3VFUB 3F6JA 3FCGA 2NT0A 3WIFB 3DROA 3EF7A 1PY9A 2CO6A 4WUKH 2BFVH 3OKDA 3RIFK 4ELME 2NQDA 3WY1A 1T7XA 1XIWA 2Z7YA 4BE5A 3D2UB 1IGCH 3AB0B 5AAMA 5ALCL 1G84A 5AVXB 4KTYA 5CLXA 4L1HA 4PRIA 1HC1A 4PP2B 3NTCH 4RAUB 2J8UF 5GS3A 3C5ZA 2YD2A 2FSDA 1NDMB 12E8L 5TQ2L 2MOQA 3H2WA 3RLSA 1QRKA 2ITFA 2AJYL 5I0YA 3VXME 1V54B 3BEWB 2VM3A 1FYTE 1F5WA 2OSYA 4M4RB 2K6YA 3SDCA 1OAZL 3U4BL 4OZFB 2PYEB 1WFOA 2HRLA 3KS0H 4TRPH 2DWDA 3UO1H 5IHBA 1DFBH 1UC6A 1JXJA 4LSRL 2Z7ZA 2E8ZA 4HHGA 3L9BA 3RAJL 3L7FA 4C56B 1NL0H 3MA7A 1WF5A 5E08L 4HXBH 1PCSA 1X5YA 4CVWA 3DVFA 4O5LH 2HKFL 1IGYB 1MCLA 2YPVH 5K1JA 2TRYA 2OL3L 1I1AB 1QWNA 1O5DT 3VFGL 2MQGA 5C0EB 3G04A 1WZAA 43CAB 2VKWA 5F9DC 1IM9D 5DMKB 3LAFA 3O45A 4N28A 3AAZB 5HJBA 3RUGB 4I48B 4XCYB 3TH4T 3BESR 2LHAA 1E9PA 5I9QC 1HVXA 3MGTA 4M03A 4IHOB 4Q58C 1MJ7H 4XC1L 2OJZH 2VNCA 3OMZA 5DJCA 4HXAH 4HLEA 1IQDB 1ZLWK 4G3YH 3KLAB 5AW3B 5AVTB 3RZCC 1EHKB 3LCYA 1CBVH 4PJDE 3BT2L 2V17L 1AGEB 4QRSA 3I9PA 3U4EB 1DBAH 4G11A 1Z9MA 1DQDL 3UO8B 1BZ7B 1U3HC 3X17A 5LBSH 1MCRA 1SYVB 1MLCA 1E8YA 3TBTA 2P26A 2QGBA 4G71B 2CJUL 3O11A 1JZ5A 5ECGA 1YQ2A 4EN3C 2A1WH 2F8IA 2IPKB 4PUBH 5IFAH 1RJLA 4HLZG 5IHUL 2OFQA 3FQUA 4ZAKB 5I1EL 1IC0A 4F9PA 1OALA 1QI5A 4UB0L 1L9RA 1J5OH 3KMDA 4GIOA 3SPHA 2XA3A 2CBPA 2HYMA 2Y0SA 3K6OA 1A1OA 3QW9A 4PJDF 3SHSA 2VN5A 2MCMA 1MUJA 2TSBA 3ZX1A 2M83A 2AEQH 3KPQB 3K6SB 3PAUA 1WC7A 5A2BA 1EMTH 3GJFK 3KGRA 1XIWD 3MZTA 1N64L 2YUXA 2GIMA 1PJ9A 4NUPA 3ARQA 2B5IC 2XY2A 2BZCA 1PU0A 2WINB 4YLQT 1UZ6E 2FJHA 4NERA 4BZ1H 2ZOOA 3JT2A 4FG6D 3S3DB 5DEFB 4Y2DB 4XN1A 1YVLA 4NOFA 4OQTH 4OKVA 1D7FA 3M17A 2CLVA 1SBSL 4W9GC 3OL2A 2C1OA 3RJOA 3UPRA 1QI4A 5GZND 1DQQB 1H0DA 4LF3A 4UV7L 2I60H 3UZQB 1CXIA 3OHXC 1G7QB 1YN6A 4DP1X 1JZGA 4HMEA 4DAGH 3L9RB 2YRPA 1T66C 2B1HH 4ZODA 4IW4C 1ZLUK 1UWFA 1FE8L 1IC5L 4FTVB 4AGQA 4Y19A 4MRCA 1YNLH 4Y8DC 3BN9D 1KXQA 1OK8A 5I30L 4RCAA 2WLKA 3IE4A 4QT5A 3A21A 2TRHA 3GHBH 1BMWA 1J05A 3IDUA 4OBSA 2OR7A 4LF3B 2DKUA 2Z31D 4V1DE 1Y07A 5EV7A 3BLPX 3BUYA 3IDNB 1RD6A 4IJ3B 4PB0H 3RBSA 2W0FB 4EI5D 2VO5A 3SGKC 4OZ4A 3ZE2B 2X9XA 1F4HA 4OM0L 1NCBH 2IXQB 4OKVB 2X4PA 3T8VA 4Z3EA 1UQSB 1BPVA 1JF1B 3VX1A 2XN9D 2IADB 1KB9K 2DLHA 3AWEA 2I26N 3A47A 3HG2A 4C4UA 4OJDH 5SX4I 1CFSA 5AOLA 3H6AA 4O2CB 4EPSA 2KZ1B 3W9DA 5E00A 5IMMA 4O2EA 4K8RC 4Y4FA 3JUZA 2D4DA 3EXLA 1X5GA 3MMEB 3UTSE 2IBZY 1AQMA 2FX8H 5A2IH 1OSZB 1SEBA 2NX5A 4HIJB 3EJSA 4MNHA 3C5ZC 4YZFF 2GG1A 2GUOB 1PLGH 4JM2B 4PI2A 5D93C 1VFBA 4U1MA 5DWUL 1OAUH 3ZDZB 1IGML 3CFCH 3MGAA 1I7ZB 2D7NA 5A6MA 5CSZB 3JTSB 2VLKA 4G42B 1RK1A 3PHSA 4PRHA 4U6HB 3HUJE 5AUMB 2BO0A 1KYOK 4MAYD 1NBYA 5MENE 3MNDA 2NNAA 1T20A 2W07A 1U8PB 1WG3A 4YC2B 4MJID 3A6CL 1JWUA 1RIUH 4JG9A 2UXGA 4ZO9A 4DGIL 1A5FL 3VD4A 2ROXA 2WWMD 5KUKA 5B7FA 1OE1A 3KPOA 4TSCL 1M7IA 2YEZA 3KVPA 2VE6A 4G6FB 2J21A 4N90D 5AG8A 2WTOA 3PWPA 1X3DA 5DQDL 1A22B 2CUAA 2JV6A 4V2BA 1E2WA 1LWJA 4P5TB 2DICA 4AZ8B 1P0SE 1XIWC 2VMEA 5C0AB 1CB4A 2NY3D 4NNPL 4W9KC 4WI2A 3RGVB 3ULVC 1IAIL 3DMMB 5ICXA 3V8CA 1HK6A 1E4WL 3EJZC 5FYJD 3SE9H 3ZZSA 1UH3A 2EDJA 2IANB 3V0FA 2HVKB 3CFTA 2Q2EB 3ORJA 5ALCH 1PVHA 4RLDA 4KO5A 3BKCH 4LASL 4LHQB 3ARFA 2HLFC 3E1ZA 43CAA 4HK3J 4ES8A 4BRVA 4DERA 5BOJA 2BSBA 2F08A 2P5EE 3MBED 1DJXA 2MHAA 4FFZH 4I4WA 4LPYA 4MQSB 5JUEL 3HC0A 4X7TA 1BFOA 2B7DT 4TUOB 1WH0A 2KDYA 4JFDA 3ROLB 4BJLA 3GMRB 3MBEC 4P4RB 5T3XH 1LMKA 4UV4H 1U36A 4QXUL 4ZS7L 3ZIMA 2V7NA 4KZEH 1A6AB 2WYIA 5C08E 4AZUA 2E9JA 2IDSA 4EOWL 2VZOA 3NBNA 4OFKA 4N6RB 2QBWA 1DFBL 4AX3A 1NMBH 5EZIH 1BBJB 1EJFA 1O7DC 3EUUA 4MNQD 4MNGA 2C3GA 2ADGB 4NO2A 1RJZB 3RPBA 1UWEH 4Y9CA 3MRJB 1FL3B 3Q2WA 4X6DA 3WDIA 4ZXBD 3MMEA 1UCTA 4E68A 1EBAA 1D6EA 1J87A 2EDHA 1QTSA 3U7WL 3VXQA 1LGVA 3F7QA 1L0YA 1TYJA 3DV4A 3K72A 5L9DL 2WP3O 3FT0A 3O2DA 3MJWA 5IQ9B 3DJ9A 2O1AA 4PGEB 3MR9A 5DLML 5EN2A 1H3UA 4HJTA 2YKLL 1V3KA 3ASOB 4FG0A 1N9PA 3VRJA 4YEFA 4OTXH 4WKZA 4PLNC 3ZY7A 2LFEA 5KSBB 1MRDH 4L3AA 4WWNA 2OR9H 5JXAH 1ZIAA 1Y0LA 2CD0A 2NUTA 4NUJB 3JZYA 4P3CH 1AS7A 5HYJA 1SUHA 1KTDB 3MJ9L 3T0VA 2CR3A 4ZUVB 2RFXA 5HGDB 5C86A 2X89D 1IGFH 5CN1A 3CC1A 1BREA 5EIQA 1CBVL 2VQ1A 1NUGA 2V17H 4APQB 3TBWB 1A7RL 1CK0L 4ONGH 5T3ZH 4FTVA 2VLRE 5IJDC 4ZZKA 2VR8A 2CRZA 5KWYC 5H35A 1SJXA 4LCUA 2VQUA 3S98A 1UENA 1GPOH 2N1TE 4P49A 5IQ7L 2CJUH 5F1KC 4XWGL 5DGQA 4HG4J 3SCMD 3VXUD 1BM3L 4ZUSB 1G43A 1A21A 4NHUA 3CZKA 1K72A 3T65A 2DRUA 1FDLL 2F8VA 5I73B 3NJHA 4N2BA 5CEYA 5B7MA 5FCUL 4G6AD 2FZ3A 2MQ3A 2VAJA 2RACA 1CU4H 1DYZA 4ALAL 3KJ4C 3SGDH 4N1EA 4ODXB 4R97C 4XXCC 2C4FU 5EO9A 3PL6D 1R5WA 1B9ZA 2VC2L 4LLUA 5JIKA 1MCPL 3N50A 2E4TA 2EC8A 1ACYH 3FT3A 2J57A 2IBBA 1A9EA 2DQFB 4G82A 3ZDWA 4MMXB 3DUSA 5GJTH 1HJCA 5D7IE 1TFHA 4BZ1L 2X6AA 1KCKA 3LX9A 1A9BB 5AALA 1XX9C 3V0WL 1I9EA 4V11A 5F3BB 3MRGA 3U0WL 4QRPB 3TYGL 2WO4A 1T4KB 4GQQA 3QDMB 3DIVA 3SQBA 4NFDA 3VXRD 2X2YA 2DZEA 3BDYH 3S88L 4G43B 5A6LA 3PFQA 1RZQA 3B2UC 5IV2B 5JIPA 1OCWL 4LCVA 4M8VA 1IM3D 3LYRA 3PG2A 4KJYB 3MRDA 1KENH 3HNSH 3DIFA 3U83A 4P23D 4YGVA 1IM3A 3KM2A 1XO8A 4WHYH 3L3OA 1BD2B 2RBLA 1HH6B 2EC9U 4R8WH 2VDLL 4AC4A 5L4MA 4AEEA 2CLRB 4UDUB 3V6OE 2K3HA 3VXRA 1KJ2B 4HGKC 3MLPA 5DJCB 4M5SA 1K6QL 2R69A 4WW2B 5LAPA 1M7UA 4NWTH 4Q56A 3SPIA 3MBEB 3VI4B 5DJ2B 3LPFA 4R9HA 3U9UA 4PCTA 3WTWA 1TQCC 4ZK8A 5HY9A 5C1MB 3ZMNA 4OM0H 4AMKH 4HWBL 4FKHA 1PZBA 4Y5VA 4MAYA 4U6YA 4B9YA 4FXGA 2QADC 3L5IA 1P7QD 2WSPA 1CLCA 1VEOA 3LRGA 3MDJA 5BO0D 1NAKL 2XICA 5KVEE 3OLEA 4UBDC 2HH0H 3TYFB 3DXAB 3X11A 3SYOA 2DI9A 1U42A 2PW1A 2X42A 4PW9A 3WUWG 4YIQB 3T1FA 3DYPA 3X1NA 2O6FA 1ZS8A 1H5BB 4QHLA 4QLRA 3U25A 3O6ML 1NAMH 4N9OB 4HK0B 3VXUA 4OCSL 4YXHL 3SCMA 4WHTA 1JZ6A 3VG0H 2XN9A 5EO1B 1EA9C 5L8JB 4H5SA 4Z7WB 2A0LD 3WKML 3O3DA 1WGOA 3NCBB 3VFPB 3VFNA 5C0IA 2OMZB 4GXVL 2JWYA 2WO3B 1J1PH 3ZN6A 5I1IL 4PJAF 2Z31A 3IS1X 4YFLF 5CCKL 1KYFA 4MCMA 2X89A 3A5VA 4EEEA 2MQCA 4YLCA 4Z3GA 4OF8A 4ORZC 2VMCA 3T0EA 3BDBA 2BXZA 4ACPA 4MMZB 4JUSA 3CZFB 1CDJA 5KVEH 3OJDA 4X7DC 2OMZA 1SN5A 1RXLA 1ZA3A 2I9LA 4CW1A 3LQZB 5F3HA 2APTA 1IAIH 4RRPM 4N0UB 4LCIL 1G1YA 5FHAH 3RWGA 3TBYA 1INEL 2JQZA 4GXUN 2BCKA 2ATKB 3QQNA 4YE4H 1J0HA 1AGFB 4TLUA 3VFRA 3TH3T 4QHUB 3PCYA 4JFQB 4RNRB 4QOKB 2JQMA 4HFWB 2NQCA 4ZXBA 4JHWL 4PWJA 3APNA 1OCCB 3PS6A 3UJJH 4IKKA 4FKKA 5B39A 1TZHB 5I1GH 2X9YA 1CVRA 2G9HA 4TULH 3IAGC 4H13C 2XZZA 2C9SA 3TO4D 1WITA 3V6FB 1ZWIA 4P9HC 3QQ9C 3L6FB 4IJ3C 4HX1A 1NC4B 4UV4L 4QXUH 4ZS7H 4KZEL 4DTGH 2XX1A 3RX8A 2Z6FA 4PHXA 1RURH 1JZ7A 1BAFL 3OHXA 4EOWH 4X6CB 5FWRA 3IAPA 4MJ6A 2H1PL 1WFUA 3LZPA 1LO5B 3LH8A 4JFDD 2Z8SA 4F24A 5F1IA 4GI6A 5DT1H 3ZMEA 2VAAB 1UWEL 1H3TA 3RVVC 2AXWA 2DQUL 4Y9GA 1IC1A 3SDYL 3B7SA 3GTNA 3US9A 4OZFG 3ARFD 1UB6A 2FJGB 3HHSA 1I9IL 3APCA 4JM0A 2B77A 4NRXB 4D0DB 2ESVB 4PRPB 2DDQH 4FS0A 3NCJL 5HDWA 3HVDA 1P5VB 5IG7B 4E5XA 1ID2A 2XG5B 2QPFA 4FNPA 3FB8A 1TETL 3ASNB 3OAZH 1TEFA 1JZFA 1BXUA 1J8HE 5GGRB 1PIGA 2Y07H 4YR6B 2AVFA 3GSQA 1MRDL 1BMZA 3N04A 1DLFH 2VABA 2UUDK 1UB5B 3D50A 1V5JA 1DANU 5EU6E 2OL3A 4I13B 4LDEB 1XSIA 4UQCA 4Z0BH 2DIJA 1UEYA 3FF7A 5CD3B 1JUFB 4LIQE 5AVSB 1DJHA 5EC2B 4UTAH 3IFOB 4I7ZC 2BRQA 3BC9A 3MOBL 3S4SG 4IBVA 1HHHA 1A7RH 4XMVA 3Q0HA 5E2TH 1E2VA 4G8GB 4MA7L 1OARL 2QVTA 4IK6A 4XH2A 3FU6A 3AT8A 5L88L 3MOQA 5L4JA 4ZMZA 5HYIA 3CZSA 4AG4H 3DUSB 2HPTA 1DE4B 3G5VA 1BSIA 4L3FA 2Y6SD 1A9EB 4JN2B 2GAZA 2VWEE 4GKNB 1CTOA 3B7UX 3F00A 4GP8B 3TBVB 1BM3H 2VLKD 2B1OA 3CSFA 4UQ3A 4RSYA 2H2SD 5C6TL 2CA3A 2QELA 3VE0B 3I9AA 2FJFB 5ANMA 1QASA 4IIQC 2NX5D 4ZFGL 5MEOB 1MAKA 1T04A 2W80C 2YFNA 4F7EB 5FLUA 2VQTA 1TO5A 5DVMA 2ENPA 5I0WA 4FXTA 3WENA 3EH1A 4WGKA 1FO0H 5HHMB 3RZWA 2JIXB 1KXTB 4MXWH 5MP6L 2A2QT 4F8PA 3X1EA 5A6IA 5FW7A 3JZ7A 3LEYL 4K94H 4AW4A 5CJOH 4UUJA 1B90A 3ECBA 2EUZA 1LO3H 5BZWA 3C5ZD 4OF7A 3EYOB 4J3OH 1I8KA 1I1FA 3CDGA 2XA8L 4L2YA 4PQXA 3VJ6A 1ZJBA 1AE6H 4DKFH 5C0RL 3CVHH 5JQHC 3S8WA 3RVTD 2ZX6A 2XSKA 1IMHC 1U2CA 1EEYA 3MV9E 2IH3A 1P9MC 3GKZA 2F7IA 2X3BA 4GRLC 1JV5A 1IGTB 4B3VA 1YY8B 4RMWA 3TFKD 2AXHA 3RFZA 1E30A 5BS0B 1T03L 1MHEA 5ELIA 1AIFB 1NBZB 2BWQA 2CO2A 4BEIA 2NT1A 5KYWB 2WYZA 1BV8A 3STLA 1Q1JH 2EYRB 2R69L 2B59B 4YDLB 4DEWA 3EYVA 2VDKH 4MZ2A 2AHIA 4MJJA 3B8YA 4DUWA 1HJBC 5KSVA 1VKXB 5BOZG 2Z8VC 1P1ZB 4B9FA 3QRLA 4NQCE 1IEAB 1M53A 3BN9C 5SWQB 1E4HA 3DRQB 2MRYA 3SDAC 3MRKA 1M42A 1CFVH 2FBOJ 5D1XC 4U7SA 4AMKL 4PVBA 1BVZA 3BMWA 1WUZA 2YA0A 3F6IA 3N5AA 2NY0B 4JK0D 5K1NA 4LLMB 2BOCB 4P4RA 4IHBA 5GSVA 2OXHA 4NZUL 4ZMQA 5IJVA 2X1OA 2MCPL 1KBWA 1KGCD 2DM7A 3CSYA 2V8LA 1Q9KA 2P42B 3C8HA 3HAEA 3KLDA 2AS5M 5CD5C 3SPGA 1YY9C 3V5HA 1L9PA 1L6XA 5DHYB 4FQCL 2JTDA 1Z32X 1BYOA 1U3YA 4F92B 4M8UA 2ESVD 5FHBL 1AOZA 4YHZH 3N40P 3P4MB 2AQSA 3FUNA 3ZHLA 1F2XK 3W81A 1EERB 3LS5L 1JTPA 4ODSH 4ELKA 3BPLB 1GYVA 1X5ZA 2UZYA 2QADD 4OZIB 3UBGA 4ZD3H 3ISRA 3PV6B 3VVVA 2F68X 4I5BB 2QQNH 2X4TA 5E2WL 2GHZA 1KBVA 3OC8A 4AZ8A 4YL9A 4AENB 1NC2B 3QI9A 2GI0A 1T7VA 3SO5A 5LVEA 1PZCA 3MRDB 1T89A 4JMNA 5D9SA 4ELMF 5FAAA 3TLRA 1ZANL 2KBGA 3FSOA 1LHZA 4AGMA 2J55A 5F1OB 2HT3D 1U4FA 2VN6A 5CS7A 1NCCL 2X3AA 4UANA 2IALB 4R7DB 5KVMC 4JRYA 3SN6N 3SQBB 4B9GA 1A7NH 4XMLH 2JLLA 4D2NA 1ZKAA 4LCIH 3FONB 1B0RA 5JOFB 1P6FA 4KROD 3QNXB 4YE4L 2F1BA 2VLKB 2FX7H 2UXFA 4OFYA 4GW5B 3CE1A 2FSEA 1NIEA 1NLDL 2XWRA 1JBJA 3GSVB 4J3OC 4KTDH 3B5GA 1QSVA 4DPRA 1R17A 3VVWA 4OF3A 2P49B 1IAMA 4YXLL 2G75A 5ID1A 2ZUYA 4R0LA 4Y4FB 4H8WH 4FQIH 3KYOA 5GJSL 5TD4A 2YEQA 4DVBB 5INCB 5TDNA 1XF1A 2DQIL 1BIIA 2K45A 1LL1A 4DTGL 1J86A 3SDCD 4AIXA 1L3WA 5GHWL 3RIFF 5INDA 1CFNB 3OLIA 4B6ZA 3FB6A 3WFEL 4N2GA 5DF0A 4OV6F 1IFGA 4ZPVA 4MJ2A 4QXTB 3UC0H 5BQ7B 1BQHB 2A9DA 4UM9A 5CP7A 2DQUH 3U7YL 1FNAA 4MMZC 4PRID 1KB5A 4LSSH 5HHPA 4LFHD 4PGDB 3WKNA 3G6AB 2DWYA 2XZCL 3S4SA 4WK2B 1GZQB 1D7BA 1R1CA 2BIPA 2CKBB 2VDNH 2JMRA 2G3XA 4H0IA 2VW6A 2WK2A 4LCWE 3L3GB 1I3UA 1NEZB 4FQ2L 3RX7A 1T1XB 4JPQA 5GS1C 3BD3A 4X0KB 3TO4A 3MUJA 5A3ID 1SXNA 1RFDH 4PJHB 1B4RA 3KCWA 2VISA 2R1WA 5AVUB 2CM5A 3BKJH 2NNFA 3FO0L 4NKDB 1GC1L 4L0ZA 2CK0H 3EYQC 3FO1A 2EIJB 3PWUA 4K5PA 1U2YA 3D2UD 5EUOA 1T1ZB 5AKTA 2OX5A 1OGTA 2AJZA 4XNZC 3V4VH 4AH2A 4A1RA 2Y24A 4UTAL 3N1MC 5C07B 2OTWA 5DEFA 5BQ7A 4N25A 5GXBB 3N9GH 5IK3B 1I3RB 3IYLW 4H0GA 1U8LB 5BJTB 5GISL 3VM5A 5TE6L 4DP2X 1X5HA 3VTAA 4J28A 3SCMC 3FO1B 1I1YB 1VGKA 2YMTA 4KVNL 2WD0A 1SF3A 5AOKA 5DUBA 3T0ED 3OX8B 4YVUA 5FUCE 4HUKB 5HHVH 4DZBA 1KCRL 1TPXB 1MVUB 1SLUA 3ISWA 5DO2C 5C6TH 1DQLH 5D4HA 3P54A 4HHWA 3GSNA 1ML0A 4NJAH 3MUGA 5E4EB 5C0CB 4ZFGH 2FECL 2GCYB 3AS0A 3P9LB 4LVEA 5EWIL 3AQYA 5IBTL 4LIQH 5L7XL 4JFDB 3ROLA 3FOLB 3WHXB 4KPHH 2W88A 1F2QA 1DBBH 1QHQA 4P9HH 4U2ZA 3C6LA 5AZ2H 3STZA 3L4UA 3TEUA 5AB9A 1BJ8A 1MAML 1U93B 2HUHA 4YGAB 1EHXA 4JHAH 4YHLL 4WY7L 3NEOA 1P7KB 4L4JA 5DUMH 4Z5RB 5MEQB 2KPNA 3FB6B 1TIUA 5KW9L 2YAQA 3HJEA 3IFNL 2NY4D 3SKUD 2GK0A 5AD0A 4LKXA 4NIKB 1AE6L 2F2HA 2BP0B 4DKFL 4F20A 5CKAA 3QG6B 4NQCB 3I02B 1X9RA 4HPOH 4W9JC 3WS3A 3B9KC 1SMOA 1KC5H 4AQ1B 4ELDA 3ARTA 2IGLA 2NZIA 3CUPA 5DVNA 1P7QA 5KAQG 2A9AA 4LHUB 1NM4A 4AITA 4S1RL 4XXDB 3GJEA 4MRBA 3EYUL 3ZGIA 3B1TA 4A2DA 3O45B 2VT0A 1Q9OA 3JVGC 5I5JA 4L3CA 4Z7VB 3O4LB 1K5NA 3BAWA 2VMFA 3QQ4A 4WVRA 5CMAA 3HRPA 2H3XC 5FUZH 1W72L 1Z66A 4R90H 4ONFL 3HG5A 3EGDA 2NNAB 4JRXD 5E95B 4MSWA 4ZFOL 3TEYA 2O93L 1DQIA 2CUIA 3R7QA 3P2DA 4YNYB 3ECUA 4OM1L 4PPTA 4Y4KC 3BAJA 1N6UA 5TJWK 3IU4H 4P23A 2ZXGA 3DYMA 3TVMC 3SE3A 3LKNB 3D39B 2NZ9D 3NRFA 3W9EB 1CLOH 5EU7C 1OLZA 2WWMC 4RBPH 4KQ3H 3PQYD 1QA9A 2NNCA 4L3EB 4GYBA 1X5KA 3SSGA 4JHVA 2ZWLT 1HWGB 1A7OL 5TDPA 3SE4C 4HEPG 4ZW3A 1RZIA 5AW4B 1TZIB 1DN0B 4JY4A 3UYRL 1YYMH 3MV7D 1F4YL 4JFYA 5FHBH 3SPJA 3VSTA 4ATWA 1FSKB 4HW6A 5EU4A 5C0ND 4NN5B 3G5XA 4IBWA 1BVOA 1TCRB 1JVLA 1JAEA 3OXRA 2ETWA 3VFUA 1AQDB 4PRDB 1AD0A 2FQDA 4LLYA 5F21B 2XN0A 3LMJL 1T7ZA 2D73A 1XGQA 2VL5B 4G8IB 3LXUX 4PJ8B 3WNJA 5J11C 2J4WH 5BRZA 1I9RL 1KZYA 3I6GB 3MRIA 2YRZA 1LTXA 4JFQA 2DH2A 3GJFH 1J7VR 4ZNEE 5DS1A 4AYFB 4EBQH 4LSVL 4LP8A 1SOQA 4PRAA 3ZUNC 1XCQA 1I31A 1X5AA 5EU6B 1H0DB 1ZHNB 1EWHA 4YK4C 3V4PA 1F6AA 4JHUA 1NCCH 2XCMC 3Q6GL 4X6FB 2J2ZA 3WLBB 2VSCA 1J8HB 2VR7A 4JKPH 9PCYA 4E9XA 3AM8A 4FTVD 4L9DA 3T04D 1XGZA 4M6AA 3VCLA 3X3GH 2WBXA 3NN8B 4OD3L 2IOIA 2XZQL 4JKNA 2GC7C 3QBTB 3LEXA 1I9JL 1R3JA 2ESVE 1XXFC 3IU3B 1B3JA 2NLJB 1J8KA 1MY5A 2BJML 3FO2A 4P2QB 3NCFB 1NCAH 1ZIBA 5HI5D 1HL5A 2XVKA 1YNTF 3FOMB 1RIVL 3HLAA 5MEOA 2ZPKH 1DL7H 1SHXA 3GI9H 4RFOL 4YXLH 4UDTA 3UJIH 3ILPA 4URKA 4X8JB 1QLEH 1KGCE 4H8WL 2E7BA 4HFUH 3H1ZA 4X6CE 3WFCH 2V7HA 4MX7A 3VDAA 4L18A 1QLFB 1OD9A 1TEYA 5HGAB 5FUOL 4A7TA 4AEFA 2H0EA 5KVDL 5BZWB 3P02A 1ZPUA 4HS3A 2R0KL 1R9FA 4G8GA 4M48L 4BBWA 4I9WD 5DJAB 1FVCB 2QEJA 4PYGA 3O6LH 3T3PB 3THMH 5CFHA 1R3KB 4RGMC 2FYYA 3BYTA 1JWSB 1S7RA 3CHOA 4LSSL 1NINA 3KL0A 5EEUA 1SYVA 4WEBL 3V9CA 3QB7C 5TE7H 5DUPL 1KCBA 5CEZD 3WXWH 2DYSB 1DCLA 3ZRFC 5A16B 4QRSB 1PJWA 1HILA 3DPDA 3RE0A 3VXTB 2OYMA 3NOIA 3VE0A 1DVTA 4UZSA 3US1A 4HOWA 4NNXA 4YPGB 1YMHB 3MBEA 1MJJB 5DD5H 2IAND 4WW2A 1ZLSH 4CSZA 4JFEA 4IRZA 1CDYA 5LHDA 2JKTM 4NM4H 3AAZA 1W8OA 4N2IA 3VWJD 1S7WA 2IFFH 4Y4KB 1UB6B 2FJGA 3E6HA 3QS3A 5C7ZA 5EFIA 1HILB 1E7UA 4PV8A 4OLYL 4M6NL 4GO9A 5D4QA 3L3OB 4WDIB 3CZNA 4QTIL 4IMLB 3T4YB 3VA6A 1CFBA 2WCSA 3BE1H 4RMTA 5T5FA 3NSDA 4AMXA 1XQ4A 5I9QB 4HDIB 3RQ3A 2AJ3B 3VXMA 1W6LA 3EOAA 4MB1A 3QFDB 4XP4H 1E0OB 2BNRA 1WBYA 2BW4A 2NUPA 2XQBL 4N6QA 2WLLA 4IEFB 3PWPD 1DLHB 3VQMA 4TTDC 5IUCA 3QORB 1IGJB 1SDDA 3S37L 3VSVA 5EEYA 1RZKL 2CPCA 1ZMYA 4JQIH 3MI6A 1PEZA 4ZOBA 3SDCB 5IW6B 3MRGB 2R56H 4JGNA 5IBTH 3DSNB 1WAEA 2BWIA 5L7XH 2X6BA 2ENYA 1AS8A 3JWDH 3WKYA 3SDDB 3SBPA 2NY6B 1N59B 3EBAA 5AZ2L 2A6JB 1TPXC 1KYAA 4AK2A 2IF7A 4LP5A 5I8KL 5DDHA 5I1DB 4P2OB 2OJEA 4PJGF 3U48A 4IDLA 1RI8A 1CDBA 2BSEA 2ZCHL 2IFGA 4PJCE 3BISA 7TAAA 3N1QC 1DSFL 4KK5D 1Z5LB 2ARJQ 3S36X 2VIRA 5EZJA 2ZG3A 3UAFA 3QHZH 5D7JB 5E8EA 3BMVA 3MC0A 3KR3L 4FFWC 3CZEA 5FK9A 1UJ3A 2DJUA 3FU5A 3D51A 3OKNA 1KCLA 4JCWA 4U4BA 5DRWA 1S7XB 4DETA 2CO7A 2WSDA 1BCIA 1WCBA 2PKDA 4QHKJ 3L17A 4WUUD 3C60A 4X99A 4Q8BA 3FU3A 1FAKT 4G6MH 5C0FB 2DLTA 4NKMB 4JFUA 7FABH 1JHLH 3D4YA 4TN9A 3WMQA 3EOBA 4NI6A 3MV8A 3TX4A 2HVBA 1XCQB 3EYUH 3QFJA 2WN3A 4M43H 4RNRA 5CILH 1ADWA 5IREA 3S5LB 3SYCA 3K2MC 3H0TA 1JGUL 1TCMA 2PTTA 2P4AB 4EI5A 4WCYH 1SDYA 2DWEB 4RMRA 2WXPA 3SCMB 4EI6B 5J1AA 3V6ZA 5FUZL 3PDDA 1I85C 4TQEL 5HGDA 1FL5A 5L0QC 4ONFH 4TNFA 3Q3GA 2QMKA 3ATAA 3DARA 1T21A 3LVTA 1U8IA 3UBXB 2QQKL 3FT9A 4XNZB 1AAJA 4PJFA 4TOYH 3Q6FA 2I32A 3ESUF 4P5KA 2ZXCA 1DN0A 4XN7A 2PO6A 1A6TA 3HMWL 5LWYH 4NJ9L 3VD7A 3MRPA 3SJVE 1CLOL 3K8KA 1SRDA 3J07A 4IOFC 3HI1B 5JQ6L 2WVSA 3B7YA 3BP5A 5LAXB 43C9A 4N2NA 4E2OA 3HB3C 5C0IB 3EAKA 4PY7B 1XR9B 3CSPA 3NFPB 5ANHA 1RK0A 2LLLA 5D6CB 5CJ5A 4F58H 5JNYB 1FORH 1YCSA 5IB1B 1MJUL 2PUQT 3GXNA 2NTFA 2ADGA 4NO2B 2J6EA 2VUYA 3VXSB 3O2WL 3IPEA 3PL6B 1JPFA 4WV1B 5IVXB 3U6RA 3QO0B 4O51B 4QHKI 1JSYA 1U21A 3LKNA 5KTEH 2PW1B 1T66D 2WBJD 4Z76B 1U3HA 3GLZA 2HX9A 3TYFA 4XP6H 4EDWL 2DQEL 2YJQA 2CR0A 3UPCA 4NENB 4NHCH 3ZL4L 2LFGA 4KC3B 3WD5H 1BLNB 3WSQL 4YS4A 2GJRA 4JLRB 3MRFA 5CEXA 3M7FB 1WUNT 3CG8A 3MLYL 5DRZA 4XTRD 2HWZH 1E90A 2OMNA 3OJVC 2FO4B 1BQ5A 1SHMA 3NIFE 4X0NA 4R84A 5JQIB 5DJXB 2YGNA 4JQXA 3R06B 4AV0A 1FC1A 3Q6GH 3OR7B 1P4UA 3KWTA 3QS2A 2YD5A 5F7YC 2I85A 1OT2A 2HJFB 2ILLA 3PWNB 5D1ZB 3WS3B 3ZTDC 3HFMH 4Z7UE 5D1XE 5EPMA 4AKPA 3G9VA 5I74B 3ME0B 4DPCX 2DYRB 4P05A 5B21A 1RV6X 4JY6A 3MNZA 3ABMB 1DBKH 3P0VH 1P7KA 4ICXA 1J11A 3RGVD 3X12B 3D8MA 4PRBA 1PX4A 3RWEA 1BWWA 4W4OC 1UZGA 3AUVA 4KH9A 5FOBA 3UJIL 2ATPA 4M56A 1KN4L 4JJ5B 4TV3A 4UMSA 2OSWA 1IM9A 3TU6A 2AMUA 5GGRA 2ZCKL 3HUJA 4FNRA 2Q1EA 3PGFL 3QYNA 2AERT 5C08B 5I6LA 3LNFA 4AQ8C 4CVUA 5E6UB 1SOSA 5AUMA 4OGAD 1YEHH 1I3GL 1T83A 3R4DA 1DQTA 1E8XA 1R6VA 2X41A 3WFDH 1G87A 5CSZA 4M62L 4LE8A 4Y5XC 1AC6A 3WJLA 3P30H 5GPRA 3V4VA 1XXDC 2P5EB 4Q9QL 2W38A 3ZMRA 2ZX9A 1I1YA 1T7YA 1VGKB 1KB3A 3ABKB 4FG4A 4GB9A 1ZVNA 4DEUA 5EBMB 2HFEB 5FO2A 3QQ3A 3BUIA 1C8QA 1TEGA 2GW5A 5EOCJ 4DZBB 3WXWL 1RAMA 1Z9OA 1RJCA 2ZUVA 4CAGA 4HUVB 2M1KA 3QXUA 3OAUH 1TFPA 3NAAH 3NABL 1AD9A 2BP8B 2ORBL 1NFDA 5FFOA 2Y2TA 5I1CL 5D6DC 1NCHA 5BNXD 5C0AE 4OZ4B 4EQ3A 1VPOL 3QZBA 3P3YA 2V9RA 4YHKL 5B1BB 3BUYB 3IDNA 5PCYA 5DD5L 3RI5K 1YEDA 4HCFA 4HWZB 5DJYA 3QT2A 4PJHA 5ECJE 1EQWA 1S7QB 6PAZA 3TJPA 1C5BH 2Y1ZA 3RVWD 1DDTA 4RMVA 3BXNB 1WS8A 5AVVB 3FPXA 1RLBA 4U7MA 3JSSA 4YMPA 2Q7AA 4I2XE 1YEJL 5DQJB 1MJ8L 5AYUH 5G2NA 4DVRH 2R1WB 2P5EA 2XTSA 2CDGA 3FUEA 1KSRA 4PV9B 5E1IA 3VXNB 2F53E 3F7PC 3L95A 2AK4B 2NNRA 4YDVB 3ZE1E 3BWAB 3L8QA 5DTFB 3K4ZA 4WF7A 4YDLC 2ZX5A 4HHAB 5HPMA 1IKFL 1OANA 2CKBA 2MTPA 2TAAA 4YAQA 1BQRA 4FMFA 1QSEA 1JG9A 3NGBC 1WAAA 1XVSA 3UACA 4GI9A 1NFDB 3ZDZE 2LU7A 2EKJA 2PXYB 3W37A 4FJZA 4GRLD 3NT0A 4I0CC 4PRBB 1KNOB 1QUNA 3TEZA 2VZUA 2EEAA 2WWKT 3KH4A 3AU1A 3VYPA 5JIQA 1Q72L 1KIRB 3OR6A 2DQGH 3WXVL 5JDJA 4JZNB 4OCRH 1VESA 4KTGA 4UM8A 3ROOB 5JZ7C 2HFGH 1DSFH 5JMRA 4NZTH 1RU9L 2HLFD 4LSTH 3WIHL 1BBJA 3VG9C 1I1AD 4EZMA 4CKQA 3VAEA 4GIPD 1FGVH 4MS6A 1V3MA 2XWTA 3KR3H 1Y6NR 5DS8B 4PBXA 3HI5H 5I1KL 2CHXA 1F1AA 4XVJL 2CGRL 2JFCA 4OLUL 3EH2A 5J5EA 2MNWA 4G6ML 1HDMA 4L4VD 4XWOC 5DMIH 3II2A 4JFZH 4RZCA 3MRRA 4MB5A 2OZ4A 5EBWA 1QNIA 2H8PB 2COQA 3QJHA 1GCFA 4FTVE 4U7KA 3DNKA 3LZLA 5FYKD 3QWRA 5CLTA 2ZXQA 3ARDC 4H25A 2WXHA 4NBZB 3ZT6A 4AJYV 1GOHA 3WEMA 5G4NA 3HG0A 4PJBB 4L1BA 3LH2L 1B0GA 3MNZB 5DHVA 5DJ0B 1TUPA 2O5XH 4G42A 4PRHB 4U6HA 3SDDC 4YBLC 3C75A 3LN4A 3NFNA 5I15L 2PF6A 3TS8A 5EULV 2XYCA 3U1PA 1HAUA 4MCZA 1MFAL 3E8VA 2R4SL 4FZ8L 5E0QA 4TOYL 3WHE1 1KULA 1ZV9A 3QORD 5E56A 2X4TB 3LV3B 3IDJA 4WI7A 5DMKA 1B3IA 1TSHA 2XQYG 1ZGLA 1L9MA 3LIZH 1ACZA 3DHPA 4G7QB 3RNKB 3UABA 1MZZA 5I74C 1ZAGA 1YRKA 1MNUL 1QSEB 1ZY9A 1ASPA 2HTLD 1G7IA 1GIGL 3L9YA 4PWHA 5D70L 3SKMA 4UOQA 1IGYA 3SBWA 1U3JA 4JFFD 1U8IB 2E9WA 1D5MB 3UBXA 4D7PA 2JKRM 2X6CA 5F0LB 1UXWB 2PCPB 1IRAY 3BWAA 1UFUA 3CLFL 3D07A 3BVXA 4G9DB 4LPVA 4JPIB 4PG9B 3PQYE 2BS8A 3P2BA 1S5IH 4ZMNA 1FLRL 2X6UA 4MA8H 1B6UA 3NPZB 3BPOB 1KTLA 2XU9A 4NN6B 2GUOA 5HHNB 4YPJA 1GGTA 3OAWA 4TVPE 4W9CC 3EO9L 3NZ8A 1RVFH 4ALAC 2OPCA 3BXNA 1X5IA 5JOPD 1GS7A 2M8XA 1ZGLM 4KKLC 2VDRH 3NSCA 43C9B 3IKCB 4FCAA 4CVXA 4NHCL 3KPRD 1YEDB 5A40E 1A6PA 3ULVH 5CIPA 3WSQH 3ETBJ 4XO4A 2XIDA 2LW3A 4J39A 3C60B 1S9WA 5K9QI 1E4XI 3OPUA 1MHEB 1WFNA 4J3WA 1ACXA 3OWEA 1JK9A 1ET7A 4KGLA 15C8L 4K0OA 3V4UL 3U82B 4YL4A 3P4NB 2Z91B 4YSEA 1N3NA 3KW8A 4MJIE 1JV5B 4XPGL 3RUGE 4PSPA 2JXMB 4IRJA 3HHMA 4EZLA 5KYWA 4LL9A 1XR8A 4GW4B 4LVHC 1FL5B 5MEND 1ZS2A 1Y1DA 3HFML 2NXYB 5TDOA 3RJQB 1BQLH 5IMLB 1EZVX 4XOAA 3EYSH 4JZOB 2BW5A 3EJTA 4XVSH 1LDPL 3L4VA 3A0OA 1UTDA 4EIBA 4APXA 1FF5A 1U8CB 5KOMC 3WS6A 3ZKND 3UPRB 2JIXA 4G8AC 5CGBA 2UY7A 4NZRL 3E8UH 3IKKA 2VXVL 3MACL 2DI7A 1Q0YH 4FULA 3PGFH 4PIRF 3Q5TA 4OSUH 5JW4Q 1YEHL 3IB4A 5GGSY 1D5XB 4OGXL 5AEAA 3E9TA 4GRWB 4OI7A 3DWTA 3VU1A 5EOTA 4N0YL 2GSGB 1CS6A 3RA7H 5AW8B 3ARFC 3BQUC 3BW9A 3HZYB 4QNPF 5I18H 5I5IA 4H4NA 3WFZA 5D72H 3CVCA 2VXQL 4RDQG 4JDTL 3QIBA 3LD8B 3EZJB 1ZXKA 2CGZA 2AK1L 1WWCA 4UTCA 4HKZA 1O7DE 1HHHB 4QNPE 4K23L 2WANA 2FEEL 3NAAL 5D2LB 5DD3L 3VFWB 4ZI8A 2J1XA 1LLAA 5I1CH 3KL5A 3SYQA 3TBBA 1CG9A 4BGLA 3VD0A 2HT4C 1G9ML 4MXQD 1U8QA 3FQUB 1YEKL 2K6ZA 1PLAA 4BSVA 4DPAX 5C0EA 2QQLL 2DMBA 3VWJC 1UXSA 4Y5YB 4UBDD 4XXCA 3UTQB 1GAFH 2FYYB 2BNQB 4GW1A 2VMJA 4N0CC 2AXGA 1KCSH 3ARWA 4QO1B 2XG5A 4XBMA 1G6RA 1YEJH 1MJ8H 3O9WD 4WWID 5AYUL 3TA4D 3C2AL 1CCZA 4RFEA 1JFQL 4YR6A 3PGCB 5IQMA 1S3RA 4QRRE 3PRZA 3F65A 4M4RA 5GS2D 2B1AH 2APFA 4IHOA 4F1SA 4LCWD 1ORQA 3K6DA 5E2UH 3SGDI 2BHYA 2H2SC 3LNEA 2X1XR 1F02I 3FZUD 4JX0A 1CD8A 4K4KA 1HL4A 4X8JA 2VMDA 1IBZA 2OZ4H 1QFWM 1U8MA 4AQZA 4YSCA 3D3VE 4N4YB 4AYID 2FHFA 1G9NL 3I6SA 4RAUA 4YHPA 4KRPC 4F2EA 2GY5A 5ADPL 3G08A 5DI8B 4WU7B 5EU3A 4HGWA 4LGSB 4OGYL 3FK3A 1IO4C 2NR6A 4ZW6A 1HL9A 3QDJB 1IC7H 1OCRB 3IPBA 3NEEA 5EUKB 3MRMA 3GSUB 2IOMA 4GS7B 5JA8B 1XBDA 3T2LA 1E4XH 1GS6X 1N5YL 3TT3L 4L9LA 3RTQA 4K5OA 1E7VA 5AYTA 1FRGL 1RU9H 2VLME 3T71A 4HUMB 1D5RA 2NY2D 5ILTH 3K2UH 2OMWA 4X7EC 4S0TD 4KXAA 2J44A 4GQRA 3FQYA 5F7EH 1YDPB 4KUCD 5EU6A 3ARYA 3ZTJG 3HI5L 4DPBX 3EFDL 3H0TB 3MVSA 4APQC 4D9QD 4BFIB 4ZZFA 3LQZA 1N4XL 5F3HB 3RWGB 4JDEA 4XVJH 1ZA3B 2RJMA 2I9LB 4CW1B 4DO6A 1QX1A 2E74C 2O4EA 2DMGA 5IEHA 4ZMYA 1JXFA 1C12B 5ICZA 4NI3A 2AQPA 2BCKB 3MRHA 4Z0XB 1UH4A 3QGVA 3IJEB 3HG1E 4LT7A 5C0FA 3NACL 4HWNA 4P2QA 4JL1A 1TJHL 2Q7NA 2CO7B 2R0LH 3S35H 2VM4A 4UTBA 4HOZA 4ERSH 2IVFC 5JXEA 1SXBA 2YLKA 2D3VA 2VSDA 1DBJL 3PNRB 3H7BA 1KG0B 1KB5H 2VIRB 4M5ZH 2FGZA 4HF5H 5D7IF 5EZJB 4HUCA 3IJSA 1M2OA 5IR1B 2CMRL 1VFAA 4MAZA 1IGIL 4UTBL 4XPTH 4K2UH 5DFWH 3CMOH 3OJ2C 4KWUA 4Z0XA 1JRHH 2R0ZH 4KNTA 3O41A 3VXUB 1JWMB 4I87A 3IKCA 4Z95L 4CVXB 1H3VA 4AEHH 4BFIA 1AG0A 4Z7WA 3BP7B 1OQXA 4JMXA 4YIQA 1TJIH 4QXGL 1FYTD 5BRZB 4JQXC 5KVFE 3A67H 4AKOA 1AXSB 1MNUH 2G5UA 2FD6L 1ET5A 5AVQB 2JTYA 3ILEA 2CALA 4BH8B 2F1EA 2EDXA 1R4XA 5DTFA 4Z9KB 4N2LA 1U3NA 1WBYB 2NUPB 4NM8H 3E6FB 3TJEH 5IFHH 5I6XB 3KZ8A 4AY0A 1D5IH 1FC2D 3VW3H 5F1SA 3CLFH 1DVZA 5AVWB 5JR1H 3DXAA 4M7LL 3X11B 1RMFL 1FBIH 3HN8A 4W4NA 4ZX3A 1GY1A 5CGYD 3AZUA 3B9DA 2RD0A 5FDWA 5J11B 4PGCA 4FXGB 4NO0A 2BVUA 4QRPD 3EO9H 2O61B 4Y4KA 3PY9A 3IDJB 3EFFA 3DMMC 4MWFB 1QRNB 2G2RA 2DS4A 5AQ0A 3CZLA 2YMXH 3GMPA 4GBXA 4WI9A 2FATH 1E5AA 3HNVL 4FNLL 3TNMA 1IBYA 3EDFA 4ZPTB 4YHOH 4QR7A 1A0QH 1NMAH 3QO1B 2G30A 4KJYA 1R0AL 1BF5A 5C0DA 1LYQA 4RFEB 1BQKA 3HE7B 4F93B 3TWCH 4HK3N 3ARGA 3FRPA 4WSGA 2AXGB 5DU7A 4PJ5A 2XWEA 3FUDA 4PI0A 5J9PA 3NCMA 4H25B 3QUKA 4YDIH 5E9DE 4U3CA 2X4UA 1KIUA 1YPZF 4HIEA 2HKAA 4FXLA 3HKFA 1UXSB 4MDIA 4U1SA 1X5XA 3MSPA 5EBWB 2R2CA 1ETB1 2WQRA 4JS7A 4PG2A 1EEQA 3M88A 4X7SL 3LZNA 1P5UA 2EH7H 4MMYA 3SKJH 1FNEB 3BI9X 3F62A 4KI5D 4W93A 4XPAH 4X80H 3QA3A 1LDPH 4BH7A 5B1CA 3H3PL 5IESH 2G60H 1VA9A 5B8CC 3FCUB 4V1DA 4XAKE 1OP3K 1YECL 1A9BA 5A2AA 3W0WD 2CRIA 4TQ8A 3T0XA 5K9KB 1QPXA 4L8SB 2BOLA 3H54A 3UYPA 4JPVH 1DUZA 4MMXA 1KN2H 4JFFB 3UADA 4DH2A 5ERWA 4UM8B 2L0DA 4HIQA 4QF1B 2W9LA 3ROOA 3FT3B 5DRXB 1PX3A 2D7PA 4QAWA 5F7UA 5HDQH 3T4AB 3FSWA 4ZUTB 4JFHE 2DLGA 1ADQL 3NJVA 5I1LA 1HI6A 4NQVB 3CLEL 4WI6A 4N0YH 4QTHA 5K1VA 4AGNA 4OD1H 5GGTL 3U6XS 4PJ8D 1WDAA 3KBEA 3MROA 4M93B 1Z3GL 3D7PA 5E99L 1QO3B 1HKLL 2BZDA 4JFWA 4PCSA 5IQLA 4IS6A 4R26H 2VUKA 3IFPB 2KZKA 1N0XL 2YQGA 5E9DD 4NWUH 2ZYSA 4AQ1C 1Q90A 1RJYB 4X9HA 4R5XA 4ZUSA 2XYBA 4PRHE 3ESPA 3QDGE 1QSFB 2NPLX 1KACB 2C9VA 5DMGC 2BNUB 4LU5L 2UZIL 4EI5C 1EHNA 2AFNA 2EINB 4MJ5B 1BZQK 3QULA 1MEXH 4PJEA 4AYFA 2XLLA 4W1TA 4XO8A 4DCQA 3G3LA 4FP8L 3ZZLA 4N8CL 3LKPA 4A66A 3AMKA 1N5AA 4WW1B 3SZKC 1TENA 5T33L 3H6JA 3RWIA 4ZOCA 5FGCE 4N1HB 4XHJC 3IE9A 3PUUA 4P2CG 3S4SB 4DGWC 1BBDL 4A2GA 1A6UH 1JZHA 3F7LA 2EVGA 4NUJA 3MXVH 2Z91A 4PGEA 5HYEA 3CFDA 5AW5B 1U8OB 1WPCA 1M6OB 4IRZL 2OP4H 2OMYB 2GBUA 2NW3B 1J8HD 2C34A 5IROA 4QOKD 4UNVA 5FKAA 4R4BB 2VZ1A 1H3WM 3KYNB 2ZOKA 3HC4L 4S1DD 3WN5A 4U1JB 4Q4IA 2CHDA 3KBFA 1KCVL 2HTKD 3GJFB 4L3EA 1CL7I 4FNUA 1RPKA 1RZJH 1OGAB 1ZLDA 3TO4B 5BOPA 1YNTB 3LTVA 4LKCA 4N6RA 4XR8C 3OMAB 4ISVA 4M7KH 1ODUA 2VDPH 5E2JA 4OF5A 4NQUA 5E4IA 1MWAB 4WFHE 1F3DH 5H94A 2MNJB 2R2HB 3ZDYF 4JPIA 1W8NA 3QEQD 2XXCB 4FLQA 5HBBA 1OTSD 3ABGA 2C7FA 1E4XL 2BOBB 3HI6L 1A6AA 2ZZUT 1QMUA 1CFTB 4IRSB 5JIMA 4GUPB 4J8RB 2EDRA 4F15C 2EIBA 5EN3A 4AXWA 1QEWA 1RUML 3WTVA 4ZPVB 3ZTCC 3DVNA 1F58H 4KMTH 1G9HA 1CD1A 4U1GC 1IAOA 2NW2B 3TV3H 4X4YA 4XOCA 3EFDH 4F3FB 1QR4A 3T3MF 3QRGL 1AQ8A 2OMUB 5C0JB 4BK4A 2M26A 4FQXA 3MCYA 2K4WA 4MCZB 3KVDD 4LQFH 3FU9A 4E9QA 3PREA 1U8HA 4DP0X 1NA8A 2AI0H 1YHPA 5EBLB 4AQ1A 1GGCL 5H4YA 5C0JA 3NJXA 4GG8B 2VZ3A 3VACA 4HC1L 4D9QE 3VMNA 5KSAA 3EDEA 4ELKB 2G5RA 2NW2A 2BPBA 4JE0A 3K81A 4M1DH 1TZGH 2OMXB 1X6NA 4N8VG 3MLUH 3AACA 2J43A 1PKQE 4EIGB 1NCIA 2H1XA 4PG2C 4UTBH 4XPTL 2H6OA 3QUZD 1FNHA 4GNKB 5EO0B 4B5ZA 3ULUC 3CMOL 4X4ZA 1MLBB 4HJSA 3ZKNC 1YC8A 3FTVA 1JWUB 2NXZB 3CSYB 3MBWB 1K8DA 2EDMA 4PJAE 2X28A 2B4CC 2JB5H 3HS8A 4LGRB 5GIRA 1QFUL 1N6VA 3II1A 4QWWC 4PHZA 3H9SA 1ZHBB 4FGMA 4ISVB 2ITCA 1XSOA 4YSTA 3FQ4A 5F7DA 1MY7A 1HAWA 3O8XD 1ZLVK 4Z8FL 1DDHA 4O2CA 4UAOB 5D71H 4IBUA 3MRLA 3IJYB 1I82A 1E9OB 4NM8L 4E42A 5IFHL 4K8RL 5C0BD 2OLDA 1QNZH 2P7TA 5AOMA 2RTTA 5FKAB 3CXHK 4E9TA 3OSKA 3GMOA 5E6ID 4BZYA 1YJDL 4B7IA 1TTFA 1FV1B 2I25N 3WO3B 1U6AH 1CFSB 1MFDL 4XCFH 2Z65C 3IMRA 4L8DA 3IGKA 5AB1A 2Y5TA 2HG5A 5B8CB 5D1QB 1LEKA 5C07A 2P5PA 4WJ5B 1F86A 4FRWA 4UT9A 4AH2B 2Q8BL 5D7IA 1MFEL 2J3SA 3VI4F 4BKLB 2MPAH 2X4RB 4F8QA 3AS1A 2DV6A 1IT9H 2PWFA 3PDGA 2XKSA 3RKPA 1V7NH 2FATL 3HNVH 4FNLH 3MTXA 4ZG1A 4NO5A 1I8LC 1BVLB 2P8PB 2IH8A 2WTPA 1O6VA 4JQVC 1YAIA 2CDEA 1RY7B 1OAYH 2WVTA 3ZK0A 4MJ5A 5LNEA 1DJIA 1WSST 2LTQC 1SNRA 4ZO7A 1J5HA 2EEBA 3B3IA 1C8PA 2AKRB 2PTTB 4EI5B 4XRCB 1EO8L 3S2AA 3G5YB 5E51A 2WQ8A 4FHBD 3ZPDA 2XZAH 1OTUC 5EDXA 2BHFA 4N5EC 3TBCA 5IJKA 1WS7A 3HTLX 2HG5B 3KXFA 2K9UA 5B8CA 4A7UA 3TPUB 2XKNB 1KXTA 2YAHA 3FQ2A 3QNYB 2V2TB 4LNRB 1O0VA 3QCTH 2A9ML 1JPTL 1M3IA 1XSJA 3AG4B 2WZ6A 1L9SA 1FFOB 3H3PH 2G60L 5E2VH 5IESL 2BVPA 5GGUA 4I1PA 2XWBB 3N2JA 2F19L 5HDOA 2FJFA 2ZSWA 1YECH 4LEEA 1CZ8H 2D7OA 5I8OL 5T8IA 1ETZA 2Z92B 3D18A 4KKQA 3CN1A 3ARBA 3B2VL 4KKPA 4U33A 3G5ZA 4YSQA 3ILDA 4NLHA 3S97C 3QEQB 4TUJA 1D6VL 5E6ZA 4OF0A 5I1DA 2XWCA 2OQJA 1HIML 3MV01 4IBZA 4GSUA 4H1LB 4J3OG 1ED3B 2YPLD 1QHPA 1NOLA 2Y36H 2GTWA 3EADA 4L1TA 4OI8A 1ADQH 1SLVA 5EG6C 4BZ2L 4J8QA 4OD1L 1J8SA 2A7BA 2ZKYA 5EU7E 2FEDC 4HAKA 4GRMB 4YDKL 5LUMA 4JL2A 4UT6L 1Z3GH 4HUWB 5E99H 1MCNA 1JXDA 3U79A 3ZTNH 5JHDB 4DFHA 2DM2A 1TTUA 4LNVA 1G94A 2PP8A 1A4JA 1KPVA 3RRQA 1KWKA 1BFVL 2GJ6D 3CU7A 3TWYA 3ULSA 3L16A 2F8XC 2IC2A 3ZVVA 5GS0L 1K2DA 4P46D 3MO1A 4R96A 1KJVB 3L1EA 5EBLA 1IC4L 2R39A 2D03H 3GMPB 4RGMB 2ICEB 2X53A 5E5UB 3VU2A 4YSDA 5I28A 2K9FB 2Y69B 3C5SB 1I8MA 4P5SA 3HE6A 4LRNH 1BBDH 2D2CC 4UQIM 3W2DL 5EA0H 3V5KB 4ZW5A 2DD8L 5JOPE 4P4KB 3STBA 5EF0A 3CIQA 1CE1L 1SLXA 2BFVL 4WUKL 1I1CA 5IB5A 4QRQB 4KZCA 4U6VL 3ZT5A 3RTLA 3QQ9D 4IQHA 4X9IA 3S3CB 1KY7A 2OP4L 4X7FC 4AXWB 4PJCB 2A73B 3LRSA 4XPBL 5H8DA 1CFTA 3TZVC 4P2OC 1RQ5A 1PD1A 4KJQC 1KCVH 4FERA 2WB1A 5L4FA 4FLSA 3C2SA 3BHBA 3MTRA 3BQUD 2ZIDA