3LZOA

Crystal structure analysis of the copper-reconstituted p19 protein from campylobacter jejuni at 1.65 a at ph 10.0
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
159
Chain Sequence
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 33
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzoA00
3LZNA 3NRPA 3LZQA 3LZRA 5I0VA 5I0WA 3LZLA 2O6CA 3NRQA 2O6DA 3PJLA 3LZOA 2O6FA 3PJNA 5I0XA 5I0YA 3LZPA 2O6EA
chains in the Genus database with same CATH superfamily
1GPOL 5DJXB 3GRGA 3VYNA 4AKPA 2VERN 4P3CH 4A2FA 1ES0B 2JB6B 1T89A 2ENYA 3TV8A 1P9MA 4BFIA 4Y8AA 2ADJB 5AKTA 4YZWA 3D0AA 5AVRB 5DJ2A 4KV5E 4YOKA 3TTYA 2IAMA 2RALA 5J1TC 4UV7H 1Z0NA 5HY9A 5KBLA 2DMBA 2ISDA 3NP3A 4M1GL 4NZDA 4OLWH 3ARBD 4N4YB 4NZTL 5KYXB 1JYXA 4AGMA 3GKZA 3CVBA 2EIZB 1AH1A 1DSYA 1YMMA 4MNGE 3QCTH 1OVZA 1OGAA 3L2MA 4XNMA 1P4LB 4MD5B 5L2JB 2P45B 4FQXA 2AITA 4Z7WA 5EU3A 1HOCA 2V7NA 3DYOA 2DQTH 3NJXA 2Y1AA 3OMIB 2A77H 3QEUB 15C8L 2UZIH 3FCUB 1PQZB 4P04A 3HS9A 3DOSA 1AXIB 3PGCB 2F08A 4WHYG 2B4CL 4WGKA 1D9KD 5TF1H 4G80A 5LDSA 3IDJA 3HVNA 2OW6A 5F88B 4FZ8L 3FSZA 2EC8A 2UZXA 1JGIA 4LLWA 1S9YB 1QP1A 4YO0B 4NZJA 1KEMH 2CHXA 5D7IE 1IAIL 1AOHA 5DUPH 4R7XA 1UKSA 5DUML 3ZYOA 4KAQL 3RGHA 3H53A 5FHBL 1JUFB 1NMBH 1RVFL 2QELA 1JVLA 1DVFB 1WTGT 1YEKH 2HRPL 5AOMA 1ZLWH 5E03A 3K74B 1R19A 5JTWA 5LAXA 3ZU8A 1TNMA 3X14B 2Q1EA 4PD4K 1L7TL 5BS0E 4QNPE 2FJFB 5KSAC 1WC7B 4KQ4H 3BISA 3ZE2B 5K9KA 3K6OA 5GGVY 3DPBB 1IZJA 3H2PA 5IEHA 2WLMA 1WZMA 5ID1A 5DYFA 1C8PA 3Q3GB 4PJIB 4X80H 1H0DA 1MI5A 2JJUA 1LEIA 5FYKU 3FFDB 2UUDK 4NOBA 4N2IA 4YDMA 1Q4NX 4YHKH 4UOW1 5KBNC 3DV6B 1NZRA 3ZGIA 3BMVA 3HZ3A 1U4FA 1HWGB 3B1TA 3N40P 4KY2A 2QGBA 5F1NA 1WAPA 5I5IA 4OGXL 2NT0A 2QTEA 2GTWB 1QR4A 2XFXA 2ZQKA 4GIAA 2IPTH 4XAWL 3U79A 5HBBA 1E7VA 1QRNB 5KG9B 4R4FH 2H5UA 3HFMH 3TA3D 2V7HA 2KDYA 4QIRA 3VFUB 3WJMB 1IVLA 5D72H 1WCBA 3L9EA 3BZEB 4L9LC 4ZAKC 4PJ5A 4YBHA 3TIEB 3PWVA 1CD1A 1YAZA 1U92A 1ZDSA 2A3TA 3D3VE 4WFFE 2Z6FA 2ZPKH 3FTWA 3I9PA 1YNKL 5SWQA 2MCG1 4NWUH 4YAQA 4YDVA 1QD0A 1F02I 2SEBA 4P5RA 3T77B 4OD3H 1YYML 1RZ8A 1RUPL 1AO7E 3WIFB 3ZIMA 1TQBB 5C7XH 4HISA 2YD8A 3A23A 3NIDE 3RWJB 5KN5A 4JPIB 3E6HB 4UT9A 2ZYSA 4AL8H 2VJ8A 5DRNB 2QQKL 2F54E 1J8RA 3WCYA 5F7WC 2O6EA 1R3IH 4N9GB 3FUFA 4HOWA 3RDJA 5D1XD 1HZHH 4B9PA 2DDQL 1U8KA 4FQLL 3T6VA 2EDQA 4TSCL 3FPXA 2Z7UA 3UO1H 5IKCB 5MERA 2CKBA 3PQYE 1HDMA 3H7BA 4LHUA 3WUWG 3VGAC 4KVNL 2MQ3A 3CC5B 1A6UH 1Z3GH 2EDJA 5KVFL 4MJIE 1GTNA 2XQYG 1DVUA 4P9ML 5DK0B 4CVXB 2UWEF 3ARFB 3DX8B 1U6AL 2BERA 1E27B 3S7GA 3QRFM 3EFDL 3BPCB 4GI8A 1MJJA 1R46A 2C3HA 4Z7UB 5GGRB 4PTTA 1B2WL 3DOHA 3PCYA 1B4TA 1J0HA 1K8IA 4HFWA 5FCSH 1QMUA 3RGBA 1NCBH 4B9GA 1Q0XL 3FCSB 3PY9A 4NPYB 4NUGH 1HQ4B 1QSEB 4MDJB 3QYNA 4M5YH 2K70A 1SHSA 4JY5L 3MRPB 5C71A 3U30B 5ITBH 3VX1A 3JV4A 4ZTOH 3X11B 4LU5H 3GGWA 1RURL 3MQIA 5GGVH 1HH9A 4LDOB 5EBWA 1MRCH 2LAGB 3ARQA 1NCJA 3LEXB 4NWTL 5KVFE 1MCNA 1XL6A 1H5BC 2BM3A 2JVUA 2KS0A 2VR7A 2X7LB 1OSYA 5E1AB 1ZGLA 1XGUB 1IZKA 1MJ8L 5E8NB 3WNKA 5C0RL 2OX5A 1E90A 1V10A 4LLYB 4ABUA 5C0NC 2YKLL 1AG6A 4XH2B 3VFSA 2F19H 2OR9L 3KXFE 1FHGA 1P7BA 4WI0B 1NBYB 2VDLB 2W9EH 3EYUL 1M71A 4GO8A 4NKOB 2APWA 3SGDI 1MVYA 2OMWB 4KXZI 4Z7VE 3VI3B 4HCRL 3D2UA 1EX0A 3SDYH 3A22A 2O6PA 2WHVA 5C3LD 2DMCA 2IFFL 3LY6A 3FB7B 1BEYH 4X8CA 5GS0D 4IBYA 1OGPA 2EDLA 1G9MC 4WO4A 1IC7L 1FH5H 2ALWA 4P46D 3O45A 1JXGA 4XPFH 3CFIC 3I75A 4Y4FC 5GGTH 5EZOL 1EJ8A 1NFIB 4K9JA 2IC2A 4K0OA 4BZ1L 4JPSA 3DV4A 5DEFA 4IKJA 3G5XA 2ZOLB 4QRRD 4R90H 3P3RA 3NRQA 3EYOB 1KYOJ 1J8HB 2GTZA 5IB2A 3RGVD 1J10A 2DKUA 3HG1D 5IJDC 3D34A 2BOCB 1G9HA 2YPKA 2NZ9D 3A6OA 1SXCA 4F5CE 1U8HB 1AXTL 4W93A 4JGMA 4LSSL 4NDMB 4G5AA 5EU5B 5A40E 2ERJC 4NM8H 5HTSA 3UC0H 1FIEA 5CGTA 3S9DB 1F4WL 3SKNA 1AZNA 1OM9A 5EEZA 4BA0A 4QRQB 5BV7L 1IAII 2VZOA 5BZWA 1S3RA 2P26A 3DETD 2YRZA 2YBGA 5EZPA 1R9FA 1BMWA 5AUMA 5HI5D 4ODUA 3REVB 1CB4A 1QSVA 5I2IB 2R56H 5DUBA 2NY5L 5L4FA 2XWDA 4FTVB 5I75B 3ERXA 2FJHB 1XXFC 2W65A 4HS8L 3VWKA 2IGFH 4C59B 3QDJA 1JHLH 1MCWW 2DQJL 1FN4A 3VX0A 1B3JA 2OR8A 1FFNA 3PL6B 4OB5L 4M5ZH 1B0GB 1NUFA 3QE5A 3IRCA 1AFVL 3ATAA 4O58H 5CZRA 4PRHA 2FO1A 2R8SL 3N06B 4KQ3H 3ULVD 3S34L 1YN7B 4R7NA 5GJSH 3WENA 1W6WA 3C08L 5JXED 4WFGD 3ZDYF 3MAWA 4O5LH 4AEFA 4ANXA 4W6XB 2CRZA 3GK8L 1XAUA 3LHAA 2FHCA 3CMGA 1UJTA 2EDDA 4OLUL 3K0WA 3BKML 4JAMB 5KSVB 5BXFB 2X88A 1NCUA 4U1NA 2VM3A 2WWMC 1KPRA 1J9QA 2PPDA 2QFPA 4IBLT 1KB5A 4XCNB 2AEIT 3TJHD 5EC1B 2ZJSH 3OQRA 3H6JA 2XWCA 4X5WB 4P2QE 3RZCA 4G8GD 1RL1A 3WV0A 3RI5K 4AZ8B 3JUYA 3U36B 1P5UA 2XG5A 4BHUA 3AQDA 4B9ZA 4PJAB 4ZXBB 3VXNA 2F8IA 4WTQA 1XCTB 1DVFC 5E1IA 3T1FB 3P69A 3G9VA 1A1NB 4DVRL 5FDYA 1MCWM 4JDEB 1MHPH 2I7SA 1DFBL 3D09A 4RRPM 4XN8A 4MX7B 4PAZA 1YO4A 1Z66A 3HR5A 3Q0HA 3VXOB 3FCTA 5ACLA 4P2OD 6FABL 4PV1C 4B27A 3ZN6A 3GC3A 4JFFA 3PIQA 2CLVA 1RUML 1S78C 3TASA 3LZLA 3U7WL 1E5BA 4P99A 2IGTA 4GFTB 4BQ6A 1K6QH 2MOVA 3WD5L 2Q3AA 2DI7A 5SX5H 1JWSB 5E24E 4NGHH 4NM4H 4GUQA 1FBIL 3O3AB 1CZ8H 2WGXA 2H3NA 4NO5B 2WINA 4AENA 4ELKA 4LSRH 5FFLA 4ZPVB 3QUML 3NCXA 4K7FB 1DQIA 1Q1JL 5JOPD 1AVAA 5TQ2L 4YQXL 1PZDA 1MHHB 4YR6B 1AHWA 2AERT 3QEGL 4XNXL 5IQ7L 1PKOA 2ICWA 4JFZH 4LCWB 2EUWA 1U58A 3AS2A 4W1TA 4ODVH 3HE6B 4HUCA 3ECQA 4ZO9A 4DHLA 1IJNA 4BRVA 2DIBA 1TQBC 2VDKB 1J9RA 3HZMB 4MNHA 2IQAA 1ZE3C 2JCCE 2LR4A 2EAEA 3BYYA 3QDMD 4JO4L 4NQCD 4I3SL 1ZT7B 3G3LA 1U3HA 1TKWB 3QHTC 2AV7B 5D1QD 3MTXA 5FYJH 3UIYA 1IBHA 1RZ7L 2BCKA 1A4AA 3BZ4B 3UOAB 3SY0A 3P0YL 5HYSA 4LQFH 5L8KB 3M8OH 3S5LB 2CDEA 4YWGL 1DBML 3KVQA 4UWQB 5IWLC 3JWNH 3P9MB 3BW9A 4KHTH 5HGDA 4GG6E 1TUPA 3EXLA 4MAYA 1W72A 1I7ZA 4OCLC 1KEGL 3P77A 4K3JL 4WJKB 4YN3A 4AGQA 5KYUA 1MY5A 3L4ZA 4YSUA 2FAUA 1X9QA 4HZLA 2MQGA 2ZUSA 3ARFC 4WV1B 1LP9E 3VXMB 1FV1A 2OL3B 3O4LD 1XEUA 4UQ9A 1HYRC 3ZTDC 4FQ1H 4KKPA 1OCWH 5AW2B 4AJYV 1OE2A 4K2UH 4FEMA 5JR1L 4QRBA 4J4PA 4AX3A 4ATTA 4XMLL 1C5BH 1JSYA 3ARUA 4XR8C 2BDNH 3ZHFA 3U30C 4AYSA 1JHKH 1LEGA 3C5ZA 2NSXA 1KYDA 1ETB1 3WS6C 1BJ8A 3MCYA 3X1NA 3AQZA 1JN6A 2PW2B 3KE0A 5BQ7B 5IR1B 2UVEA 2BJMH 4OSUH 3SYCA 4F7EA 1P1ZB 5I8KH 1ZANL 3DVNA 1E4XH 4XMPH 1R5IB 3BJ91 4TLUA 3UPRA 4PRAA 4UIMB 5ERWA 1Y1UA 3ZT7A 4DKDC 1MRDH 1KIRA 4OY9A 4XMUA 3ZQXA 1KIQA 2VOTA 1H6EA 3D85D 4PB9H 2DKSA 3U9UB 1OP9A 2ALAA 1B9ZA 4L8BA 4MRBA 2C5DC 3MLUL 1F4AA 4TRPH 2YRPA 1YNLH 5DJZB 4G8FB 3HAEB 3MGOB 1H3GA 3IM1A 4GW1B 3P54A 3F85A 1YC8A 2AANA 4YXLL 3EBHA 3N1PC 1MJ7H 4JM4H 1FC1A 3MV9A 5FA3A 2YXFA 3I2CH 3PDOB 2X2HA 1FVEA 2IVFC 5LWYH 4ZMTA 1TETH 3VFNA 2R23A 5EUOF 3QQXA 4J3BA 4P5KA 2IDCA 5BZXA 3DPDA 5CJQL 2J8OA 2VQ4A 3LQAC 3GDBA 4G6KL 2JXMA 4KKBD 4PJDF 3VXRB 4PJ7B 5GZOD 5JORB 4Y89A 4U4IA 5E4IA 1GKEA 1B0RB 5B8CB 3DXAA 1OTUD 3LCYA 4HHAB 1T1WB 4GQ9L 1MW0A 5F6HI 2WC7A 5F71A 1CXHA 5D7KD 4OLZL 3O8XD 3E2HC 1IB5A 5DD5H 3AY4A 2O61A 5AOIA 4M7JL 3WBDA 2X1XR 3MXWH 4U1MB 4GT0A 4QYOA 1A6AA 3Q8CA 3FQ4A 4HFUH 2ODHA 1DBKH 4M8VA 1XH3B 2EVHA 2A38A 3VSUA 1JK8B 2FE0A 1HK6A 2X4PA 2AXGB 2N1KA 4OGZA 1AQMA 4R5XA 1UB5B 4OQTH 4X6DB 5I75C 1EHXA 4Y1AB 1M56B 5GRUL 1I7UA 1I85A 2CUMA 4BCXA 3PL6C 2CE6A 1BFVH 1MG3C 3MRRA 5HYJB 1CVSC 3V52H 1JPFA 4QTHA 2X42A 3LS4L 5CEYB 3C6LA 3EH1A 4NKIH 2WSDA 1F42A 3S8WA 5D4IA 4JY6A 2DQIH 3PJSA 5D1XE 5ENWB 4KTDL 1T1XA 2OZNA 1X9LA 2DN7A 5BJTB 5K9OB 2C9SA 5CGYD 3WN5B 1EHKB 2BVYA 4KI5D 3RUGE 3QUXB 2APTA 1CLOH 3ESUF 1OAQL 4KJWC 5KW9L 4Q9RL 3X1BA 1BXXA 3S98A 1NGXA 2CGRH 3AS3A 2IQ9L 3V10A 4XPHL 2B77A 4U6HB 3ZTJG 4PBVC 5EOTA 4FQJL 3QWQB 5DHYA 5AD0B 1FO0H 2IV8A 4APXA 1JS4A 3GNMH 4G3YH 5C0DB 1TZGL 5E6RB 4B96A 1ILUA 5CZKA 4APQA 3EJPA 3NFSH 2OAAA 4MCNA 4PGBA 4ZXBC 1ZLUK 4AUJA 3DVIA 1KJMA 1L9MA 2I26N 2D3JA 3HUJA 4OLYH 1GGBL 1A02N 2QKIA 2ARJA 3VSQA 4UTAH 3SDAB 4IRJB 1JZ3A 4I0PA 3FB5B 4G6JH 2OK0H 2V5RA 2CCLA 4CN6A 5EV7A 4PJFA 2VZVA 1ECZA 5GS0L 3ZTEA 3SDDB 1YCSA 3MR9A 2AK4A 3KWWA 4WWKD 2OTUB 2AW2A 3DX6A 5EEWA 1WT5A 3FUDA 4M6NH 1BYPA 4X5XB 1PGRB 1A14L 2BHZA 3N85H 2X9WA 4UQDA 1LDPL 2VQUA 1ZDQA 3UROR 5FO7B 1UURA 3GHEL 3G5ZB 3ARDB 1NMAL 2I60L 1IGTB 2DTMH 1KT2B 2MTAA 4F33B 1KIPA 3PGFL 1Q72H 3ZE1B 5A6LA 2ZD0A 1R3KB 2ZP8A 3SKJH 2GHZA 4L5FH 3DX9A 5DJYB 2XIBA 1H6FA 1UUSA 4ECNA 1QTSA 2WB1A 4PWJA 4A68A 3KJ6H 2LLGA 3L5JA 3MJ7A 3HE6C 3IGFA 1O6VA 2A9MH 3NZUA 4ACTA 3CQQA 1G9MH 1UWGH 5SX4H 2Q3XA 1OT2A 4CJ0A 3HC0B 5BNXD 2RCSH 3OKEA 2C3VB 3FXIC 2FBOJ 2IWGA 2D4DA 3IBEA 3N41F 4YH6A 2P5EA 1DSFH 1EPFA 3RX8A 3T2NH 3JZ7A 3WNNA 4YSAA 1LO3L 3B2MA 3HG1E 5F9JB 1F1GA 1MNUH 3SYAA 1IC4H 1VACB 3EJYD 1LVEA 1UA7A 4MAUL 3TL5A 4DCQA 3ULVL 3IDNB 5FECA 4AIOA 3NACL 5TDOB 3UAJD 2JCWA 1UQSB 3UDWC 4EDXA 1ZVHA 2EDBA 4Q9QH 4BK5C 1ASQA 2O26U 3RTQB 4LLQB 3KYNB 5HHXL 4HUWB 1LXMA 3NIGB 3DJZA 3N1FC 2GABA 4TNEA 3ZZSA 4BZ2H 1W16A 2ZX6A 4NZUH 4O51A 4WV1C 5AVWB 1FLTX 3HIZA 3GMRB 4JFXB 4B9FA 3LN5B 1IUZA 3W5NA 1MCPH 5H4YA 4X6BB 4PYHA 1XGRB 4Y2LA 5AYUL 1MCBA 1ICTA 2YGOA 3OWRA 1Y18A 2X4RB 4BFEA 2CDGA 2HVBA 4LBAA 3F12A 3IKKA 4PJBB 3MRNA 4Y2DA 3ARGC 2WVUA 2WN2A 3DHPA 4FMVA 2H6PA 3ULVE 4HIEB 1UVQB 1VFUA 4WFGE 3UTZA 3QJTB 1FORL 3CZNA 3FO1A 2JI2A 3BZDA 4LARL 5HYSG 2YD6A 1GOFA 4QHKI 1S5IH 2CLRB 4QAMB 2WQVA 4JE4B 4OCSL 3WNPA 3SQBA 1XB6A 5B38B 3UZEA 3R0NA 2UX7A 4EN3B 3V4PB 4M8RA 1Y1DA 4BFGA 1F00I 1PDKA 4QRPB 1E4WL 4YDKL 3BUBA 4G8GE 3GXUB 4MQXD 3TBTB 1R5WB 1QVOA 2IAND 3D0LA 4PGDA 2I7OA 3V5DA 4XMTA 5IHZA 2ZCHL 4UAHA 3C2AH 4FMKA 2NUPA 2DWEB 4G6ML 2BP0A 3LPGA 5E9DB 5GGRY 1MF2L 3ABZA 4W4OC 2OLDA 3GMNB 1KCRL 2MCPH 3W38A 3V9EA 1RUKH 4BWUA 4R96B 1YPZE 3ECBB 3HS0B 4WU7A 1UGNA 3P2DA 5L9DH 2A6KB 4PJ8B 4WHCA 3AWEA 4JQVC 4EZMA 2OSXA 4PJEF 4G1MB 5EF3A 3UTTB 3HNSH 3NCJL 3ZKMC 4EIZC 3H56A 1HINL 3OLDA 1ASPA 3LNGA 1DQDL 2Z8VC 4FNLH 3ZKNC 1LO5B 3AMLA 1IT9H 3K3QA 4MMXB 4YXHL 2EVGA 1CXIA 3U9PL 1OLLA 1JNNH 3AGVA 4Q6IB 1I8LA 2ZUYA 4TULL 1RULH 1HT6A 1X5GA 5B8CC 4Z7IA 3ZRFC 3IETB 3D52A 1YEHH 3D18B 5T3XH 2WM0A 2W91A 4LSUH 5AB9A 1M6OA 5F89A 4W9JC 4LSPH 1CTNA 2XTJD 4M61A 4QO1A 5CEZH 4A67A 4F3FA 4X7FC 1CQKA 5LBSA 5JOPE 3CFNA 2YAPA 2P4AB 4AEHL 1BD2B 1JK9A 4BDVB 5I76A 1CDYA 1R34A 4HC1L 1UUNA 2OTWB 2VXTL 1I7RA 1QWHA 1SYSA 4NP4L 3GFUA 4PGEA 2BINA 3TM6A 2X70A 3WNLA 4HT1L 4W9HC 5D7JA 2HH0H 4NQCE 5CSZB 1N8ZB 1ZE3H 1W0WB 3HBPA 3OKNB 4IYKA 3J27A 5D1QE 2FWOA 3OAUL 3HG2A 1NKOA 3SZ6A 4ALAC 3UX9B 2WCSA 5B3JE 1DQTA 2VDML 3EOAA 1DBJH 5CR1A 1V3LA 1E2VA 2H1XA 3I02A 2BY3A 3WN5C 2UYLA 4POUB 3QUXC 4U31A 4LLAA 1T3FA 2IFGA 2GJRA 2YJQA 4MA7L 5L2KD 1FG2A 3QO1A 4Z0BH 4FFZH 3NT0A 1S7RB 1K5NB 2Q10A 3QG6B 4YUEH 2FNBA 4QNPF 4RFEA 2F5BH 3ARTA 3O4LE 4UOZA 2BY0A 3H3PL 1I3RA 3DMMB 5J1SC 3LNHA 5EZLA 1NCIA 1GZQA 1RZKC 3UBHA 2WN3A 1AD0A 2AJSH 3GKWL 2HTKC 4QCIB 3VM7A 3SDAC 4IRJC 1RZJC 3VE0A 5MEND 3OPZH 4OLVL 3AWFA 1WPCA 4CU6A 3L4VA 3PF2A 3DC0A 4IK6A 4EEEA 3LN9A 2OQJA 1NCCL 2NY0B 4OF0A 5IVZA 4P06A 4AGLA 3SDDC 2CO3A 1RIHH 2PO6B 5D5ME 1YY8B 3WS3B 2JIXB 2WNWA 3HNVL 5TDPA 2J5WA 5DSCA 2X6AA 3B8YA 1MJUL 4TPRL 1N12A 5JDSB 4EF3A 1KULA 2VO5A 1JPTH 3FHEA 1NGQL 2CPUA 4MA3B 4XBGA 5FM8A 1XGPB 1EO8L 1U8CB 2GUYA 3ARDC 4AJWA 4UYPA 4B5EA 1JD9A 1ZEAL 4IRSA 4J3OD 4LSQL 3S6CA 4CMHB 2FATH 2VDLH 3NQKA 2OJEB 1DQLH 4NHUA 2WW8A 5K39A 3TPUA 1HX0A 5T1KD 3CX5K 2BNRB 3BUIA 1A9BB 2WTRB 3ML8A 3X1EA 3RVUD 1LE9A 4P2AA 2GIMA 5D7IA 1EDYA 3GIVB 4OM0H 3V7AG 4BUHA 3EDEA 1S7SB 4NP9A 4QHMB 1BQHG 1I3GH 3ORJA 5BZDA 1UXMA 3TWCL 5FKAA 1B4LA 3GJFB 3WXWL 5BS0A 3I9AA 5IHUL 3GRWH 3TEWA 1NBQA 2ZOUA 1OK0A 4Z95L 5FUZH 3RYMA 1FNLA 3LKRB 1FHNA 1NUGA 1MH5B 3EZJB 1EWHA 3CIQA 4OZGB 2NR6C 3PREA 1KZYA 4H2CA 4Y19A 5K1JA 5KVGL 1R1CA 1FG9C 1HAUA 3HNTL 5C0BD 3FU9A 3TNNB 4ZX5A 4AT6B 5D7KE 4IMKC 1IQDA 3TBYA 4BXVA 5CEXA 5IQOA 5BRZD 4HUVA 4UM8B 2WWOA 3IAGC 1KCUL 4KBPA 5GGUA 1SRDA 1A1OB 2WXNA 3B9KB 3P4MA 4O2EA 2FJSA 2XIDA 3RTQC 2E3VA 3SPHA 4M7LH 4U3HA 3ZL4H 5HP5A 2NXYB 4HWBL 2FBRA 3EJQA 2HJLB 2X2JA 4JJOA 5HI4C 1GZPB 2A6IB 5DS8A 1IEAB 4JFDB 4X5RA 2VIRB 3SPGA 5IB5B 5KBKA 1HZLA 3BKJL 4KO9A 4MQTB 1OIOA 3DA0A 3VA6A 4ZMXA 3D3VA 3ZDZB 1CGSL 5KVGE 2C1OA 3VWJA 5DQDH 5D8JL 2DM7A 3ESNA 4UOQA 4ZD3H 1VJSA 1AO7A 3JTBA 2WBKA 3GSQB 5DFVC 3QXAA 3LVEA 2GCYA 4FA7B 4PGCA 2H9GA 3BXNA 2PF6A 3OC5A 4U0RB 2DQMA 4WEBL 5DJ0B 1ZV2A 1NJ9A 4GKSB 5IJKA 2CG9X 1KTJA 4D0BA 1WIPA 5DGQA 5M7QA 3BDBA 1HSAB 4YHIA 3WKYA 4M48H 4DTGL 4KI5E 1J05B 2F54A 5F9AC 3TEZA 4JKMA 4Z7VF 5DC0A 3HN8A 1X3DA 3WJLC 4EN3C 2O5ZL 5IF0A 1M2VB 5DFTA 2X6CA 4Z7QF 2R7EB 1N6QL 2HTLD 3ECVA 2BFVL 1JGLL 1AGFB 2WXMA 4CL7A 1N7MH 3PP3H 2C8NA 3Q8AA 4XMKH 3P02A 4PMEA 4DGVH 2BX5A 2A73A 3A6BH 4MJIA 4ZW7A 1UD8A 1NOAA 1PY9A 1OAYH 4G7SB 4K7PY 4L4TB 3RVTC 2UY7B 1UD2A 1R17A 1TO4A 2X9ZA 3HS0C 3QZBA 2FRGP 3QORA 4PJ8C 5IREA 2LTQB 4P4RA 1XR9A 3MLTB 3Q2CA 4BFOA 4CBZA 4OCMC 1YUHA 1ZXQA 5CMAB 3V0AC 1FAIL 1WA1X 1YNTF 4A7UA 2L4OA 2WLLA 5F6IC 3QO0A 3GMOA 2F53B 3BVNA 3AXLB 2EP6A 3F2LA 4MMXC 2EXSA 3ROOB 4A7QA 3RFZA 3VFOA 1U8OB 2DBLH 3MUZ1 2X4UA 3FF8A 4Q6IC 2D7TL 4N8UA 5B1AB 4JKPH 4ONGL 4OZHE 3IWUA 5IBLD 3II3A 3NZ8A 3V9CA 4BFIB 5I16A 5DJ2B 3IN0A 2D03H 2IAMB 2GITA 2ORBH 5HY9B 3AC0A 4KY1H 4HJTA 2DOCA 2JF1A 5E2JA 3FU5A 2PTVA 1PX4A 3B4NA 2ZKYA 1B3IA 1YMMB 4HKZA 4Z0XB 1OGAB 3FTVA 4XNMB 3SOBL 4AM0Q 4C4UA 4FQXB 3RDTA 4Z7VA 4Z7WB 5EU3B 1KJ3L 3RVVC 2N01B 1HOCB 2V7NB 1GYUA 3MBXH 3JWDC 4KOCA 1Q0YH 4FLRA 4AQOA 4NQDD 3DO7A 3P0VL 2VDKH 3WYRA 1JGVH 3GMQA 2YA1A 1ZVYA 2FGWH 2TSBA 2XZQH 4CADA 4G80B 4OTXH 3GHBH 3IDJB 5FV2A 5FR3A 2BOLA 1JMZA 3MNDA 1WISA 4NNXA 2X38A 4BKSC 4UNUA 3V95A 3V6ZA 3QUZA 1F8TH 2UZXB 3FK3A 2J25A 4LLWB 1P4IL 3WIHH 3PXLA 1IEBA 2NYYD 1JZFA 3UGUA 5BVPL 4PUBH 5EOCL 2KDGA 4QRAA 4UNIA 5KBMA 3VMOA 5DF0A 4HCRA 4IBZA 2YMOA 4UT6H 4X7DC 1F6FB 4F5CA 1WQVT 5LAXB 4OCWL 5GZNC 4FFWD 3BN9C 4GINA 4KK9C 1RKRA 4LVOB 4R7DB 1NDTA 5AVZB 5ES4B 3QWRD 4LKXA 3DMMC 4XN4A 5K9KB 1GR7A 4W70A 1YEIH 5IEHB 4N0UE 5D6DA 4J3UA 3FFOA 3QPQC 5ID1B 1LD9A 3M7FB 3Q48A 1FA4A 3GMMA 1MI5B 1LEIB 3K4ZA 1JVOA 1C1EH 3IJHA 4MFHA 2Z65C 2JKTM 4LL1A 1OAJA 5E8DH 4K7PH 4BZ1A 4L3ED 2ZNXA 4JO3L 1NWOA 1A7NL 1TTGA 3CZSA 4E41E 5F1NB 3SBWC 1SBBA 5IW6A 3QUKA 2XFXB 1UCBL 2PO6C 3BD4A 2APSA 2ED8A 2AVGA 3CE1A 5LXGL 3K2KA 4BFFA 3ZKSD 4ZX3A 1ONQA 3ASWA 3MCLL 2F1BA 1WCBB 1MEXH 1JZJA 2YFNA 5E5MB 4PJ5B 2QJDA 3I9GL 3NIFE 1CD1B 2NQCA 5T1MB 3W82A 4EUPA 3A47A 3SKOB 4E42B 5SWQB 3VFGL 4YAQB 4YDVB 1YMHB 3BO8B 3ETSA 5CBAA 1RZ8B 4LEXH 2IOOA 1OAKH 1BZ9B 3RNQA 1SXBA 4CMHC 4UQBA 4YHOL 4LOEA 4QTFA 4P2QA 5KN5B 1JPEA 2JCCF 1G6VK 4CSTA 1S2EA 3T65A 3ZYJA 4BD4A 1NM4A 5AZ2L 5EORL 4PEEA 5F7YC 3AXHA 5EA0L 4NJAL 3HAEH 3TA4D 1EAQA 1O9VA 4J8RA 5C08B 2EYSA 3Q2LA 4PY7A 5F1KC 1T03H 2OMUA 4PS4H 4LMQE 5MERB 2CKBB 4PW4A 4YHZH 3BDYH 3MRQA 5EIVA 4AYDC 5E6UB 3H7BB 4LHUB 5E6IA 3L3OC 5I66B 1NFKA 1EDQA 4GG6F 4LLVA 1I9JH 4LKCA 4M1DH 2MCAA 1E30A 3PHSA 3RVWD 2WXOA 3TF4A 1I1RA 3QRLA 3CFDB 1P7QA 3HC2A 3P2TA 2AQ2A 4ZTPH 1HXMA 1FE8H 4KK8D 2BNQB 4K9EH 1LEKA 4PRID 4MXQD 2G3MA 4P4KC 1HHJB 2XTJE 4FXLA 4Z5RA 1MJJB 4ZFFA 4PREA 3KR3L 3B9KC 4W9IC 4ZMNA 1BF5A 5CIPH 4HPHA 3VFMA 2CIKA 1K8IB 1WLHA 2PPFA 4HFWB 1L9PA 3NPSC 3D8MA 4AV0A 5CCKL 2FB4H 1DJGA 1P84K 3WFDH 3FQYA 4KKLC 5AVXB 2BIPA 3WDHA 4WI6A 4HAGA 3B37A 2OM5A 3QQNA 4MBRA 5JIIA 3JV4B 4OVVA 5JW4R 3GGWB 2YARA 4MVBC 4X8JA 1HH9B 4ONFH 5EBWB 1KYUA 2MSPA 4YHLL 1KXVC 4MHHI 4PS7A 4KO6A 1ZGLB 1OEZW 2AJXL 2Z31D 1A9EA 1G6RL 4PJGE 2OX5B 4JHWL 4L1TA 4U0RC 4Y16D 2JCCA 2PYED 3VFSB 4XNBA 4YSRA 5DQ9B 4ALAH 2IIJA 1UM5H 3LV3A 5MI0C 1TJIH 1M71B 2DLFL 5F3HB 1UWEH 3ZOAA 1H8OA 3F5WA 5LQBH 2V3DA 1QYGH 3EBGA 1WFIA 3L1EA 2DTSA 3JV0A 4JRWA 3D2UB 3QUMA 4FQ2H 5D1ZA 4YHPA 1ITBB 3FRPB 2W95A 4WTZA 2P52A 1JV2A 3DTUB 2NX5D 3MUGA 1T20A 5KAQG 3GYRA 3KPSD 1CIUA 3PV6A 3WE6A 4GG6A 4BE6A 5AAMA 1GW0A 4XNZB 2Y5TA 1XCQA 1BSIA 1ZK5A 1ZV5A 2QMJA 4U49A 5F2FA 5T5FH 4EO5A 5LNDA 3BOVA 3FZUC 1LP9A 1RZFH 4OIIL 3OGCA 2G9HA 1YEEL 3DV4B 1OTSC 1N68A 1QUPA 2FZ3B 2R0LH 5DEFB 5MENE 1IL1A 1NOLA 4XE5B 4LDLB 2LTQC 3G5XB 3ARBA 1RZJH 4OUUA 4L4VE 2GTZB 1FPTH 5IB2B 5C6TH 4IOSD 4YDNA 3VFTB 2DIAA 3JVGA 1HKLH 1EEYA 2YPKB 2ZG1A 2UXTA 5E5UB 5FO2A 3LRKA 1M4KA 4P23B 4WUUD 2C7UA 3ZDXF 4XX5A 1I8UA 4HS6A 3OAZH 5CSGA 3SKNB 5JW4Q 1P1VA 3N91A 2Y9RT 3EDFA 4DEPB 1QLFA 5BZWB 4FNRA 3BZFA 1ZXKA 5AUMB 3P9WB 1ZLSL 4ODUB 1T89C 3HOGA 4MYPA 1P9MC 2BSBA 3BYTA 1QNZH 5DUBB 2XYBA 4YHML 5DS2A 2IAMC 2FEDC 2JLPA 2IH3A 4L3FA 3QDJB 3WNMA 3OHXA 1FN4B 2Q87A 3W9EA 1FFNB 2FIRT 5SX5K 1MWOA 2AK1L 1KGJA 3MBED 1U8NA 1INEH 1GKOA 3GUFA 3BEVA 2VLMD 1KLGA 4GS7C 2Q8BL 4L1HA 2RIKA 2X2UA 4PRHB 12E8H 5IIEB 2EINB 1KJ2L 2N7BA 5A1AA 2IH8A 4FQXC 4R7NB 2W0FA 1SY6H 3NDYE 4PW3A 4PTUA 2CJTA 3PHAA 4LSTL 2VDRH 3P30H 1A25A 2Z8SA 2Z4TA 4KDVA 3A21A 2XPYA 3RUGF 1HEZA 5EOQL 4ZS7H 4DOHE 2EO1A 4XVJH 4NZ8A 4U1NB 2HX9A 1UH2A 5A3IC 4EZKA 1KPRB 3FFCB 5A2CA 4DW2H 2ZWLT 3N0AA 4ZFOL 4LMQI 1DTUA 3RZCB 5EEUA 2G5BA 4WAFA 5BRZE 1NBZA 4LFHG 4HLEA 1FP5A 4XVSL 3CFTA 3O81A 4G70B 5I1LA 3ARWA 43C9A 4KKZA 4ERSH 2A2QT 1A5FL 2VZ3A 2EXYC 5IFAL 1AACA 3E1F1 1G1KA 1ZPUA 3MDJA 1KC5H 3TA3A 3TNMA 5EBLA 1D5XA 3H2QA 1HSBA 1UM4H 3NJJA 4H8QA 4LVOC 4XHJC 5CJXA 3QFJA 4TUJA 4K7PX 3II1A 4NPKA 3RY6A 3HR5B 3ASOB 4Y5XA 3FCTB 3VRJA 1S7TA 2OMXA 4JFFB 3PIQB 2CLVB 5IJVA 4UIKH 2YPLE 4MWFA 5ALBL 2HCZX 3UJIH 1BJ1J 1KTLA 2F1EA 4PSRA 3DGCR 3H9YA 3V79C 3DOIA 1UT2A 3ZMEA 1FF5A 4GRLD 4NQED 3SE9L 2A6DB 1D6VH 1N5AB 2QTVA 1BXUA 4YVUA 3ULUD 3PNWA 2RJMA 5I1KL 4I13B 4IOIA 5DD0H 2LLLA 4DPRA 3FS9A 2H3NB 1MRFL 3IWVA 2WINB 4AENB 3DRTA 4ELKB 2WXFA 4Z3EA 1GCFA 5E2UL 3E80A 5D1XA 1UYWH 1KENH 2IH9A 3T3MB 1KPUA 1N6UA 3V4PH 4MXWH 3MU3A 1AHWB 4OLEA 1ILSA 3F05A 2ICWB 1U30A 1IARB 5CO1A 5CKAA 2F8XC 1E9OA 1EZLA 1R24A 4HJ0D 4LLDA 3KGRA 5GJTL 1KGYE 4I88A 1MAJA 3EGSA 2ZUQB 4MNHB 2IQAB 2ED7A 3GSWA 1RHHB 5GRJH 4IKLA 5TQ0L 3M7OA 2VH5H 3KL0A 3UCRA 5PCYA 1U3HB 5AENA 1JRHH 3F83A 2ZKXA 2GB2A 2AI0L 2HWZL 2ZWYA 3VNYA 4UMGA 1CLCA 3BAKA 4Z3TA 2DS4A 2FWLB 2DL2A 1K85A 1GYWA 2BCKB 4JPKH 5C09E 1JPSH 3SY0B 3JV6A 3IVKB 5HYSB 4CSSA 1CK0H 3I6KA 2K9UA 1TQUA 4FG6D 2CDEB 3CFMA 3JWOL 4KVPA 4S1DC 1YEWA 3LSOA 3UG4A 3W0WE 3BH9B 1KN2H 2AABH 2BVTA 2X6MA 3BW9B 3HI6L 2OXGA 5HGDB 4MAYB 1W72B 1I7ZB 4Y4KD 4F58L 3P77B 3LHPL 5DJDA 3FSWA 4GRWE 4XO5A 5KYUB 2XBZA 4HZLB 2BY1A 2J1XA 1FV1B 2FLMA 2G3XA 1OE3A 3KPMA 5CUSL 1AANA 1CURA 5GXBB 4UYQA 1OAXL 2DYPB 1KCLA 2WMPB 1EAPA 1WWAX 1NUDA 4KO7A 1D5BA 4NJ9H 1RMFL 3K6DA 3J07A 1CPUA 2DV6A 4ZS6C 4JW3A 4BKTC 1AKPA 4OLXH 1UATA 1NCDL 3D7PA 1LEGB 2FYVA 2CXKA 4ZUWB 1NGPH 4AYID 1CO1A 4NQDE 3MNZA 5BPPA 1JN6B 3JWDH 4DVBA 2G30A 1IAOA 3X13B 3APDA 3OXSA 4F7EB 1Q0EA 4P46A 2F2HA 2QSQA 4UTBL 5ANME 4HOXA 2HT3C 3GZQA 4YX2H 5LNGA 1ZY9A 3MGTB 1DL7L 1MFEH 4PRAB 5ERWB 4MB5A 3EJTA 4Q7DA 5KVDL 3OAWA 1KIRB 4A7TA 3AW5A 1NCAL 1QRKA 1KIQB 4WY7H 5JIQA 1ED3B 4N6RA 3IDGA 2ZUXA 2H2PD 3S3JA 1ADQL 4AYGA 1WZ1H 1ASOA 1DJZA 4OR1A 1NAKL 3HG1A 3Q2WA 4L8BB 3KL3A 4F7KA 5J4MA 4C47A 1G9EA 4LVHB 4OZFA 2UXFA 1DEDA 2KZKA 3Q13A 3MNMA 2HMIC 4R7VA 2K4AA 2AQSA 2UX6A 1ZD6A 3RRQA 1XTLA 2ZSVA 3T3PF 5IT2L 4WO4C 3VJ6A 5DMKA 2GIYA 3MV9B 2IDQA 1FVEB 1M3JA 4LPTA 3GIZH 4XCCL 4XP5H 3MX0A 3T0AA 3VFNB 2X2IA 3QCVH 2R23B 4LPVA 1F3DJ 3GO1L 1UOWA 5KVDE 2IPKA 4L3EE 1FNEB 1OSPL 2JXMB 4JVUA 3R0MA 4YXKH 2NY6B 5IROD 1KPVB 3SGEI 1XDTT 1EEZB 3DXAB 3FQRA 5KJRH 2I5YH 3WFBH 4ODBD 1I31A 5CINL 1JCVA 2NXZD 4NC1E 4NO2A 3O6KL 2O61B 3O0RH 4G5ZL 2K3HA 5JXEA 1B9KA 2EVJA 1TZHA 2E27H 4K94C 3W37A 3ARED 1A6AB 1LJMA 2HFEB 3T8XB 4DEPC 3OPUA 1C12A 1H8NA 3A4AA 4WTZG 1M1XA 2K3TA 2XKNB 3ZLQC 3RVXD 2V9UA 5I1HH 3FUEA 4HJEA 2VSDA 2P5WD 2CKNA 2Y36H 1S9KC 2X4PB 4OF8A 5AKVA 4GUPA 1INDH 1VDGA 5F1IB 5KS9F 4JZOA 2ENPA 3VWKC 4GW5A 4PJCE 1Q9WA 2IEPA 1F58H 1I7UB 2WSPA 5DZPA 3QG7L 2W80C 4ADIA 4JE0A 3MACL 1AKJD 1DLHB 3MRRB 1JPFB 2ADIA 4QTHB 4AQ1A 5ICUA 4TOYH 4PVMA 3HI1A 1YEJH 3C6LB 1HCZA 3PJSB 1CYGA 5B3JF 5JW4M 1HC1A 4G6AD 1I9IL 5KYYA 1JGUH 3SBPA 1T1XB 5IMMA 2CK0L 1YPZA 5I30L 4PVNA 3GJFH 3S48A 4IU3A 5PAZA 1BZ8A 1N0XL 1AJ7L 1PEZA 4JFTA 1A7OH 1OD7A 2BSRA 1NGXB 2E4FA 3BMWA 3MV01 4HJJL 2O5YL 4PYGA 4P2OA 4JDTL 1VEMA 5JW3L 1J48A 4A2EA 5EOTB 5DHYB 3CFCL 3RWDA 3RZCC 3TH2T 1JZDC 4APXB 1A6ZB 3QAQA 4U7MA 1KGWA 3Q6GH 1NDMA 1P5UC 3O6MH 4PRIE 4APQB 4D7PA 3QI9D 4N86A 4BKLA 4PGBB 4HXBL 2WK2A 4K8RC 1HHGA 1PBYA 4FLSA 3WAJA 3D0VA 1KJMB 4NLHA 3FTSA 2PP7A 5JO5A 3CUPA 1SMDA 5SWSD 2A9NL 3MPCA 2XY1A 1MKFA 1PVHA 3HUJB 1J1XH 4UT7L 3WHE1 5MP6H 3HMWL 2QKIB 2ARJB 8FABA 4I0PB 2E8ZA 3CHQA 5ADPL 3PWPD 3MLWL 1D5ZA 1RP8A 4TTDC 1P53A 4PJFB 4NAJA 1KN4H 3WXVH 3LZNA 1J8KA 3M45A 4P05A 4DGIL 2VZTA 4TQIA 4RESB 5I0YA 3MR9B 5D5MF 1VFAA 2AK4B 5D2LE 3KWWB 4YSPA 3ZHDA 3DX6B 5DO2C 3OR6A 1OGSA 4V2BA 1HAWA 1OTTC 3KPNA 4G7YH 2E4TA 5DWUL 5EO1B 4R4ND 1E28B 2GSIA 4O2CA 2PYEE 4J3VA 4LT7A 3LS5H 4NQCA 3FT4B 3F6LA 5D1QA 2Z4QA 4HIHA 4NENA 2X44D 3KL5A 2LW3A 5AVQB 1UM6L 4CU8A 2ED6A 4EDWH 1XO8A 2J55A 3DX9B 2NX5E 1ND0A 5LG6A 1ETJA 1MCSA 1AHWC 3CDZA 3F65A 3KPSE 3ILQD 3L7FA 2ZUTA 1O7SA 4KXAA 3MJ7B 4A04A 4E2OA 4YSQA 4HC1A 3UTSD 4JN1L 4B0MB 1O7DE 2R9HD 3KLAA 2ZUQC 4WSJA 1KXQE 1T7WA 1YYLH 1MWAL 2VSCA 3OKEB 1I9RL 1IGYA 1RERA 3O4LA 2EYRA 3QC5X 1U3HC 4NO0D 1HZKA 3QFGA 3VYOA 4M43L 1RD6A 1LNUA 1T7YA 2RMNA 3FT2A 4N6QA 3WTYA 3BAJA 1ZSDA 4CVZA 4IM8A 4DCQB 3WKML 4WUUE 4HCFA 5FECB 2JJVA 3DVGA 1QA9A 1DDTA 3OHMB 2IO5A 3PHQA 4EDXB 2N56A 1S3KH 3IN2A 2FX7L 1E5YA 4MAYC 1CL7H 2H0EA 1QBLL 2BVUA 2A9DA 4DNLA 1GC1C 4O51B 3Q2NA 2FT6A 2YUZA 2P8MA 5TE6L 1MOEA 4PWIA 1OCOB 3KGUA 4LOUD 5CJOH 1IO4C 5LGJB 1FYTD 1EIBA 1Y18B 2H2SD 1S46A 3GSUB 3MOBL 3EJUA 1YSOA 2DPKA 2CDGB 1QHQA 3SIKA 3F12B 4Z1PA 3BWAA 1X5ZA 3MRNB 4Y2DB 4DK3A 2VLME 2PXYA 3ZUNC 2H6PB 4J4PC 3LIZL 3D85A 1JFQL 3NGBB 3UTZB 3FO1B 3R1GL 4KX8A 4XC3L 4Z76B 3C5ZC 4KX9A 4WRLA 5DR5H 4AYFB 4TVPH 3F7RA 4TNGA 5ILTL 1J5OH 2XX1A 3FH5A 2C9AA 2WCGA 4H4NA 2X4QA 1VA9A 3SQBB 1JERA 3QZOA 4JG1L 2PP8A 3WL9A 3V4VL 2GK0A 5CN2A 1PDKB 3TYGH 2QGDA 1SUHA 3PHOA 1OV8A 1O9ZA 1QVOB 3D0LB 4PGDB 3V5DB 2C4XA 3ZL2A 5IHZB 2CSPA 3HB3B 5GZOA 1I82A 2P80D 2YMTA 3LD8B 5EUKA 3GJEA 4GEIA 3ZX1A 3ULUL 2BP0B 5ISZD 2JKXA 3O8XA 3POCA 3WTWA 2MNJB 4CC4A 4J6RH 1Z9LA 4LVHC 4GUOA 3WTUA 1VFMA 2G3NA 2MPAL 5DLMH 3ETTA 3C6EA 1XGTA 1BVKB 2J2ZA 3UJTH 5KBDA 3N50A 3TBVA 2QFRA 1UASA 2CD0A 5FCUH 2BLFA 3ASNB 1HOEA 1JVKA 2XQBL 3KVDD 3PWJA 3HHSA 3QPXH 4UU9A 4DZ8A 5TPWH 4K3EH 3DIDA 2NY6C 4DEUA 3MV8E 4NQEE 43CAB 5ESVA 3HMXL 4N8PA 1MCDA 4H44C 1A1MA 3ULUE 5AOLA 3VI4F 2J44A 3SODB 4YBLB 3AY4C 2R0KH 3WO4C 3MLXL 1M6OB 4ENZA 3QPKA 4QO1B 4M61B 1MQKH 3WY1A 5JMRA 4NKDA 4F3FB 5DHVA 3I3EA 4KXCA 3ES6A 4NQXA 4XNAA 3VXQA 5GS3A 2W38A 4OZFG 4GOSA 1TZOA 1CICD 3NESA 5DXWA 3QJOA 3T08A 4PB0H 2VAAA 4HWBA 1SYVA 5I76B 3CX2A 4NNPL 2WQUA 4Y0GA 1ZS8A 3JXAA 1PPIA 4AIEA 2NY4C 3MZGB 3R8BB 5KJ7E 4MDIA 4DGYL 1I7RB 1SYSB 4D9LH 4HIIA 1I85C 4PGEB 1WZKA 32C2A 2X70B 2ZKMX 2BP3A 2B1HH 2XN2A 5I19H 5D7JB 3FSAA 4A39A 2WD0A 4LNRA 3A5VA 4LAQL 4DK6A 5K93A 1F97A 4UT9H 3C6LC 2FWOB 3F7KA 1FIGL 4P3DA 1T1YA 4UV4L 1EH9A 2MPVA 4RMUA 1J1PL 4QWWD 4P2YA 2LU3A 4J1UA 3APMA 2ZXWB 5D9SA 4UV7L 3I02B 4GXVH 2UYLB 1ZT1A 4M3KB 1RZKL 1T3FB 2ZX5A 4OZIB 5DD3L 3OJ2C 2KT6A 5JA8B 1FG2B 1KFAH 3FO9A 1Y6MR 4PGZA 4EN2A 1FJ1A 1BZEA 1CGWA 4WWKA 3QIBD 5LVEA 3ATEA 3AT9A 4APQC 1I3RB 4RBPH 1RUAL 5I17A 1U8LA 4D0DA 1NUNB 2A77L 2VTFA 4KVCH 4MGXA 5EZLB 2D0GA 4OI7A 1GZQB 4OZHA 3KS0J 3RWCA 1FNHA 1AD0B 1XQ4A 1M3IA 3UBGA 4X4XA 2VZSA 3PV7A 3IGUA 3KBHE 5ESAA 5T1LA 4MA8H 1U91A 2QKIC 3I50L 2DJ4A 2JELL 3BPNB 4I0PC 5TF1L 3VE0B 5EF2A 4ZFGH 1X5JA 1HHHA 8PAZA 2BNUA 1UWXK 2VRKA 1MY7A 3US1A 3CU7A 4OM1H 4I7ZC 2OQJB 5E4EB 5AYQA 4MCYA 4OF3A 4IGBD 2CUIA 5B7EA 1V27A 3UEZA 5DUPL 5FFGA 2HVKB 4ELDA 5FC9A 3VTTA 4RMWA 5TDPB 1WT5C 5FUCE 4EI5D 1SVBA 1MFAL 4JRXD 4QTIH 2WNGA 4XBGB 1RCYA 2QT6A 2NY1D 3EO1A 1KGCD 1BVOA 2Y7MA 4CGTA 3B43A 1AZRA 1FL6B 4LCIH 2DQGL 3HFFA 1VGEL 4IRSB 4TLSA 3L3DA 5HHOB 4X80L 5K39B 3TPUB 4AV4A 7FABL 2IPUG 4CKQA 4JRYD 1FSKB 2PNDA 3UAJA 1LE9B 5CU9A 5D7IB 3RU8L 2XRAL 2VKXA 2GUOA 2R0WH 2DLIA 4OGQC 1LWRA 4XAKD 1N3NB 5BZDB 1BPVA 3O4OC 1RJCA 2CMRL 2IPTL 3EOBA 3HFML 5BS0B 2VXQH 4F8OA 3NJMA 5EDSA 3AQXA 5FYLH 2LQRA 2HLAA 4BXSV 5HI3C 5D72L 2DWTA 1VEOA 4N0UA 1MIEH 3H1ZA 2NSMA 4LIQH 4OGYH 4Y19B 2LU5A 5IBTL 3SKUD 4Z3IA 2WNXA 1P4BH 1TZIA 1DBAH 1TJHH 1IQDB 3TBYB 1L7IL 2CPCA 3NPZB 3Q9QA 1NEUA 4OD3L 5CEXB 3C6SB 4X42A 5GGUB 2NNRA 4MS6A 1HQRA 1JZ7A 3NAAL 3P4MB 2X10A 4O2EB 4QY8A 2EKSA 1BFTA 4K94H 4E41A 4AL8L 3V4UH 4R6UA 4M1CD 1G0YR 4I3GA 5EBMA 2P5WE 4FG0A 2ZYRA 3WKQA 1R3IL 5G4MA 5DS8B 2EZ0D 3U0PB 2UZYA 2BRRH 4KFZC 2R4RH 3ROLA 2NNFA 3O3EA 3D3VB 3BPLB 1YA5A 5ICZA 5AG8A 1BZ7A 2C1OB 4Y2DC 3A24A 4N0YH 3VWJB 3X3FL 4OJEH 5DURB 1C5CL 2EO9A 3EH5B 4ZAKD 1AO7B 2QGCA 5IB4A 3WFEL 3MA7B 1Z3GL 1Z5LA 3K2UL 3QXAB 4PJGF 2GCYB 3NIDB 2H9GB 3BXNB 4PGCB 5GS2D 3CSFA 1DQML 4FL4C 3GSVA 5DJ6A 2F58L 4NAMA 3FUIA 2FHFA 3RL2A 3IE4A 5K33A 4D0BB 4KKAD 1EHAA 2F54B 5C2BL 4F57H 4NRXA 4U1IB 3S3BB 2PPEA 3KPQB 3UZEC 4PIRF 3BQUD 5IF0B 5J5EA 4A7SA 5I1EH 3CH1A 4NUGL 3MBWA 5JUEH 3FT3A 2YPVA 3D39D 4W81A 1BZQK 4G8IA 3HB3C 4FABL 5ITBL 1AC0A 3VRIB 2OYKA 3CHOA 2W07A 4B95C 1DHKA 2FQEA 2HKFL 3BKCL 5IW1A 5F7EL 1S4IA 2A73B 1O7VA 5D2NE 5SWSE 3DJ9A 4K8RH 2FSDA 5GQBA 4B7LA 4N8VG 4FS0A 2B8OT 2PCYA 2WQAA 4XO9A 1G5AA 3PWPE 3ZKQD 4F37K 4G6FB 4P4RB 1XF4A 1XR9B 1XSJA 1MN4A 2P3YA 1YUHB 2PR4H 2WLLB 2ODIA 2QZ5A 5FGCB 1BA9A 3QO0B 4JGUA 3GMOB 1MCRA 3BVNB 3RFZB 4GY4A 3VFOB 1SMAA 4RGMC 5AW7B 2YEQA 3D5OF 2X4UB 1MFCL 2EE3A 4KO5A 1B0WA 1I8LC 3GF8A 4RMSA 3U1PA 4LCUB 2IG2H 3NZ8B 2MQCA 4I0KA 1V3JA 4TKWA 5LN8A 3MKGA 4YBLC 3RWHA 2GITB 1HWWA 3K91A 1A6VH 3L5IA 3KHOA 5JW5A 4MD4A 4PJGA 3GI9H 2IMMA 3CZGA 4TSBL 3UJJH 3OZ9L 5GISL 1NEPA 1CE1H 1HH6A 4HKZB 2VAJA 1VCAA 1ZGLM 4L4JA 3H9HA 5C0ND 2J73A 3JT0A 3RDTB 4Z7VB 1IV8A 3IU3B 5DA4A 4XXDA 3W3BA 4EIGB 2XHNA 3HKFA 5B1JA 3UTSE 1TOXA 1BEXA 4WI3A 1U2YA 3O0LA 5AW0B 1BG9A 3DO7B 3LZOA 5D7JC 2B2XH 5KVMC 3GMQB 3IPFA 1EMTH 4X99A 1N64H 3HR6A 1TDQA 1R3HA 3GS7A 1G6RA 3LNFA 3V6ZB 3QUZB 4J12A 4XMVA 4FZEH 3VD9A 5MENA 3N1GC 3RHWK 1Y6NR 1FGVH 1IEBB 3L16A 4L4VA 1TT6A 4M5ZL 1TMQA 4KNQA 4H1LG 4WK2B 3GBML 3QNFA 2NW3A 4LPCA 2FHBA 1URLA 1W72H 5GJSL 3DX7A 4GAJL 4JBSA 4LBEA 4FQQA 4ZMZA 5I0XA 1GC1H 4LKXB 1FYTE 3BT2L 3OAYH 4DZBA 3HC4H 2V0AA 1VZHA 1KBGH 4YBQD 2CDFA 1LD9B 3GMMB 3FC8A 4A2DA 1X6LA 5F97E 3IJHB 5E08L 3BPNC 3CJJA 4JG9A 2RTTA 5JNYA 5I73B 4YEFA 3NSFA 4UBDC 1RAMA 5T1KA 2GJPA 5E4EC 5JW4N 1TEYA 1M7IA 3FQ2A 3D05A 5IW6B 3QUKB 3VGHA 4QRFA 3HI5H 4G9FD 2XKUA 5K5YA 5B39A 4WTWA 3SYOA 1OPOA 3P3YA 3X2QB 1GY1A 1EZVY 4R8WH 5BV7B 3WAKA 1P6WA 3M6DA 4RWYH 4LDEB 4EUPB 2QPDB 1BOYA 4ICWA 2DIJA 1ZJAA 2H26A 2XXFA 1RV6X 3V6BR 4PPTA 3MLYL 5CBAB 2ARJQ 2OXHA 4X0NA 4IRSC 3RNQB 3CSTA 5CP7A 1LK2A 2XI9A 4FULA 4KK6C 4KGJA 4F27A 4P2QB 5ISZE 4Z23A 4XXCA 2EEAA 4ZOAA 2AC0A 3T65B 1FSKC 3LQZA 2OYMA 3FDWA 3MKKA 1U4EA 4V1DE 1K6QL 4ZSOB 4BSVA 4IBTA 2HYMA 1KJ2A 3U6RB 4KNSA 5DZVA 3EO0B 5BZZA 4YE0A 4U1HA 1LO0H 4J8RB 2W9DH 1E3FA 4NM4L 4E68A 1IKFH 2EYSB 4PY7B 2FK9A 3A3YB 4Z7NB 5DVMA 3MRQB 2VR4A 2FD6H 4KNUA 4LSRL 5E6IB 1SLXA 1IGJA 3DIVA 4P9HL 4LKCB 4XOCA 5T1DH 3F7LA 2C9XA 2JKJA 4XPGH 4GRWF 3GHPA 2WO4A 4GP4B 3DKHA 4ZFOA 4JFZL 1HXMB 3IXTA 5LAPA 5HD8C 5EU6D 2YPLA 4HCIA 4Z18A 2WKOF 2Y3AA 4Z5RB 5FGSA 4KUZH 4PREB 4ZFFB 1NBVH 4RDQF 2NY2C 4K71B 3VFMB 2Q7NA 3C5JB 2QQLH 4ABVA 2ATPA 3OLIA 2XLLA 3N42B 1KB9J 1IAKA 1C16A 1RHFA 5T3XD 1Z2KA 5HSFA 4H8UA 3OAZK 5FWRA 4X7EC 5CEZD 3GEFA 4TQEL 4ACPA 2K0RA 3NK4A 1YEFL 3M46A 4X8JB 1A0QH 3ABKB 4FYSA 1JE6A 3HKZA 3BPLC 4OV5B 4LF3A 3VWJC 2Y6SD 5HHNA 4GAAA 4JN2B 2HFTA 3T0ED 4XNYL 1E2WA 1XT5A 3CXHJ 4BK8A 1A8ZA 1CGVA 4FXKB 1A9EB 1JXKA 3K8KA 3Q8BA 4LSVL 1OM3L 3EYFA 4JL2A 1DJWA 1U8QA 4PG2A 3ZT5A 3DUUA 1NGWA 3GLZA 4DWHA 5IJKC 1T5XA 3VB8A 3ZTNH 4R97B 3LV3B 2P42B 5I0ZA 2WYIA 1V5JA 2J6WA 4CN4A 4OJFH 3F5WB 4FYQA 5JLZA 1A8JH 3K72A 4ZX4A 2VL5A 2OCCB 1QATA 5C0EB 1OCWL 4XBEH 5E94A 1UFUA 3JTSA 3QUMB 5C09A 4K2UL 3U2SA 5D1ZB 4YHPB 2X87A 2ZXDA 4PV9A 3GTNA 1JV2B 1EAOA 1IKOP 2WLHA 3MUGB 1T20B 1GY2A 2YOCA 3QNYA 3F3HA 3FSOA 3LN4A 3EG9B 5HGHA 3BSZL 3S3SA 4PLOB 3W0WA 4IJTA 2N59A 1XCQB 3JWNE 3R19A 2YD1A 3RIAK 5A2KH 4JANA 2ZXQA 4NYLA 3TT3L 3IFOA 1BZOA 1UOLA 2BJML 1LP9B 2C9QA 1JFHA 2W5PA 3OGCB 2G9HB 5E9AA 1J9TA 1O9WA 3W2DH 3ET9F 4P48A 4WCYH 5D96B 1IL1B 2WKOA 3QORC 1XGZA 3ARBB 1EUUA 2I9TA 4OUUB 5DI8A 3STLA 2G0KA 5IP4A 1MRDL 3P73A 1I75A 5AWNH 5E2TH 1EEYB 4ODHH 3S4SA 2C7UB 3SCMD 1QABA 2Y3NA 3RFZC 3PXHA 5F6HJ 1HILA 3CLFH 4HS6B 3G04A 3HPLA 5FUOL 5J3HC 1QLFB 3RJDA 4JRXE 1CLZL 1QSED 3BZFB 4NRZA 1YNLL 4NQDA 4R0LA 3WNJA 2ZCLL 4YS4A 2YEZA 1KGCE 1BLIA 3LPWA 1GRWA 3WGVB 6CGTA 4PS8A 1CXEA 2D3NA 3L3GA 2F68X 4FAAB 4X2UA 1MJ7L 2MCMA 5ANMA 4PJCF 1EERB 2E7HA 2IH3B 2KLSA 3MJ9L 5LWYL 1XGQA 1XF5A 5AOKA 5KVEH 1JZHA 1PZ2A 1TETL 2EYTA 3W9EB 4U3SA 1Y6KR 4X7TA 3EYQC 1U8NB 1UJ3B 4TNWK 4Y1SA 4CA4A 2EH7L 3SQRA 1KLGB 1CI3M 4M03A 4M4RB 1UACH 4X7CC 1N5YH 4JPVH 3C2SA 2E9GA 3RDTC 1MW3A 2W0FB 1KB3A 4Q4EA 4PTUB 4H13C 4XAKE 4YDIH 3HC3H 2WO2B 4RGOH 4CAGA 3CG8A 3WSQH 3T0DA 4YC2B 3DX3A 2D2CC 1ET5A 3N6YA 1HEZB 5H8DA 4IBUA 1FFQA 2NPLX 3MLSH 3L4TA 4H5SB 3ZE0F 2XV6B 4YDJA 5SV4A 1TEGA 2JWYA 3BD5A 4UTBA 2CGYA 1H3TA 1QG3A 1EZUA 4WJG3 1T0NA 3QUZC 2G5BB 3HN3A 3N55A 5E0QA 1NBZB 2PKDA 4L3EA 4OQTL 3U9WA 1WAAA 3MRDA 4GAGH 3V4LA 5I1LB 43C9B 4S0TD 1ADQA 2QVFB 3EOYG 1K9TA 1IBGL 1OP5H 5IHWA 4PY8I 2V2TB 1MHCA 2OMTA 4LSDA 1XXDC 1GJUA 3TNMB 1I8KA 2J56A 2YAQA 5EBLB 5G2NA 5ACZA 1HSBB 5HDQL 3U7AA 2DQIL 4HSCX 4AKQA 3QFJB 1V7NH 4TUJB 4WW2F 4ELMF 3WNIA 1PG7H 3K71A 3O9WD 4NXKA 4BSWA 5D6DC 1HCVA 1F6LL 4Y5XB 1IM3A 1E9QA 3VRJB 5D2LF 1VRSA 4GKZA 1S7TB 2OMXB 1BQLL 4K3DH 4ISVA 5IJVB 1U3JA 4MWFB 1KTLB 4PJCA 4POZC 3HZVA 2J8UB 3BE1H 3PAUA 4H88H 4W9CC 4CVWA 5I73C 1QI4A 4HQQH 4NO3A 1KIUA 1AE6L 3O6LL 4FTVD 1AGCA 5BO1L 3PNWB 1IRAY 4IOIB 1XIWD 1KCVL 1J0IA 3FKUS 3DRTB 5E1GA 5I1GL 5D1XB 3AT0A 5HVHB 4IMLA 4L8DA 4Y4HA 3SDXF 4EOWH 3EYSL 5BV7C 1KPUB 2F61A 4N85A 1GGIH 2O93L 5LCVL 1IX2A 2PMZA 2B1OA 2VM4A 3NJVA 4G6JL 3D39E 4S1RL 2OK0L 5GGSB 3MYZA 1ORSA 5DO8A 1E9OB 1R24B 2VMDA 3MRJA 4LLDB 3APFA 4XVTL 2DQEH 3DWTA 5KUMA 3QHZL 4A1RA 3EGSB 1MIML 2CM6A 1KXTA 3GSWB 5GSVA 2FH6A 4HH9B 4NN7B 1DLFL 2W59A 1MDTA 3TBCA 4PRIA 2YWZA 3OKLA 4J3OG 3CFBA 4M6NL 3ISRA 2IALA 4LRNH 5A16A 3N85L 4LE8A 4RETB 4UB0L 4ZQTA 3VD7A 4YL9A 4HIJA 1CFVL 1QKZH 3CBRA 1FL3A 1AQDA 5ABAA 1NGYA 3JV6B 3EH2A 1WFNA 5CZVH 3I6KB 4EXPX 1CMOA 2XVKA 3GXTA 3H3KA 5E6IC 2WTPA 3QDGA 2EDHA 1NEZA 3LSOB 4S2SA 3MODH 5LLIC 1YZZA 1RJZA 1NC2D 2OXGB 3WIIH 4L5FL 5CM1A 5DJDB 5KYNA 3NABH 1GGCH 4OW6A 4LHJB 4XVUC 5D2LA 4ABWA 4KTEL 2Z91A 4X4ZA 2EABA 4AG4H 1T4WA 3ESVF 2H47C 2B20A 1T6VN 4ZZFA 2GI7A 2PPAA 1EGJL 4NFDA 4Y16A 4F8TA 2W0PA 2XG4A 3KPMB 2PYEA 5B4MD 3ESPA 2V5YA 2RCSL 4K71C 2YK1L 3SKOA 2XVLA 5BRPA 2Y7OA 2CUHA 1BAFH 2QVIA 5LBSH 2UV3A 1EAPB 5C0JB 3UAAA 5ICYA 1D5BB 2Y5QA 3AFLA 1H6UA 2WQXA 5KWYC 1CTMA 3EJZD 2CBMA 4HX1A 1N10A 5CLWA 1FDLH 1H9VA 1MNUL 2Z7YA 5AVYB 1IC4L 4FRWA 3QXTA 1WEJH 1ZTMA 3MNZB 3E6FA 4L5FE 5E2WL 3VGGA 2CO7A 3DBXA 1PG7W 3DDFA 3KPSA 1B2YA 3GPSA 4DVBB 3BAWA 1IAOB 2VXVH 4BE5A 3Q44A 3OXSB 4U4BA 4P46B 2JKIS 4ZW5A 5K9JL 1DCEA 1LO2L 4QHKJ 1KXQA 4LCWD 1OWRM 3S97C 4BZ2L 3HE6D 4JFHD 2FQGA 1EZVX 2R2HA 4R97C 1VZGA 4KFMA 4N6RB 4B0MM 3IDGB 3QDAA 2VLJD 1YY9C 3QHFL 3HG1B 3ML9A 4OFPA 3WTTA 2K6ZA 2C9VA 5D1ZC 4WUUA 4N9OB 4OZFB 1JDAA 4N2EA 4U3CA 2XJLA 3GJFK 4N20A 4YGVA 4PBWD 4UUJA 5LO7A 5AAMC 3VJ6B 4A55A 5DMKB 1JOIA 1GHFH 1NLBH 4UQ3A 4J2XA 1TR7A 5G5DB 3U4KA 5IG7A 2HSIA 3MX0B 4IDLA 1S5IL 4YFLF 2ZSWA 2XA8H 4KJYA 1N18A 4G7VH 4XP9H 3DSNA 3LX9A 3P11H 1MWAA 1ESOA 1IQWH 2IPKB 5D96C 3SE8L 3QWOA 3ARBC 5AW1B 3MBEA 2QV4A 2KUTA 3FQRB 3SGJA 2VUKA 2VDQB 2ZF8A 2VLKA 2ZXAA 1OAZL 4GSDL 4AQ8A 3JVGC 3EUUA 4PW9A 4G9FE 5I15H 1QLEL 2BIMA 3C2AL 2NUTB 4NO2B 3ARXA 1TZHB 4HV8B 3VNZA 1DANT 2JB5H 3TYFA 4R4BA 3AJ7A 5AW5B 1C12B 1NPUA 2MCPL 1M1XB 1RUKL 3CDYA 4Y5VB 3BN3B 1A4KA 1RQ5A 1GPOH 2YMXL 3DHJA 3GUTA 4DP4X 4EI6B 4UANA 4GUPB 2GC7C 1SFDA 3D69A 4TL5A 3QQ4B 4GW5B 1Q9WB 1I7TB 3APCA 5TD4A 3GZPA 3IDYC 3OHXC 5D7EA 4AV5A 1NICA 1IT9L 4Z7OE 1BFOA 4DP9X 1NKGA 4YLCA 2Z0UA 2BIHA 4AQ1B 1CD9B 4YK4C 3HI1B 3R8QA 5F21B 4PRNA 3LIZA 5FF6B 1NFAA 2XDHA 4RDQG 2VITA 3MV7A 1UXSB 4AIZA 5T3XL 4UMSA 5KYYB 4FLQA 3S4SG 1HE8A 1YPZB 3TEUA 2AXFA 3N2JA 4YC2C 3H4FA 3QBTB 3KH3A 4IU3B 2ARWA 4R3SB 4BZYA 2BSRB 15C8H 4J7RA 1XTMA 4W4OA 1FFOA 3V4VA 3QFDB 4PP1C 4FKEA 2B4CH 1L5GA 2VDPL 3RWDB 4I1NB 2DMHA 5EU6E 1NDMB 1RFDH 1VEPA 4FJ6A 4HHGA 5DHMC 1NWPA 1IKNA 2Z9TA 4BKLB 3ESOA 4PS3A 3IFPA 3KWXA 3MV8A 4GRLA 4NQEA 1HHGB 4Z3JA 2J71A 3A4FA 3D0VB 1M7DB 3FH8A 5JO5B 1L9OA 1GOHA 3CUPB 4Q58C 2F7IA 3AS1A 3VXRD 1IAIH 1WIUA 5J13B 1XAKA 2OMNA 1SBSH 1XZWA 2MOQA 3G9AB 4J23A 5DUMH 4KAQH 3TA3C 5T3XE 8FABB 1RVFH 3QR0A 1KG0A 5ACMA 4XZUA 5CJXC 3TIDB 4F7CA 3P3UA 4M9PA 5CEZE 5DQJA 5BRQA 1D5ZB 3RY6C 3B56A 1DBJL 1L7TH 3S5YA 4QOKA 2WZ0A 1QSFD 2F7OA 4Y5XC 1LM8V 1OF2A 1T5WA 2GSGA 2HT2D 3DIFA 1Z9SB 2YEVB 4OFYD 2O72A 3VH8B 4F9PA 4YSCA 1SN0A 1VFAB 7TAAA 3ZMNA 5KJ4A 2WQWA 4RZKA 3T0EE 3OR6B 1MCJA 5E8PA 5AVTB 3KPNB 2IADA 5C9JA 1BVLB 1C7TA 4MJHA 2GSIB 4MKMA 2QBWA 3Q2VA 3HMXA 1U95A 3WY4A 5FOBA 2W0KA 5JYMA 2F6AA 4Y1AD 1MAMH 3IRPX 2Z4QB 4HIHB 5I0DA 4NENB 1OARL 4OGXH 5D1XC 5HVHC 1QZNA 5JA9A 1W2KT 4XAWH 2AJSL 1EO7A 4C4BA 5E7BA 5SX4I 1BW8A 3VRLE 1EBPA 1EXUA 1F56A 1ND0B 2RD0A 2VNCA 5GS1B 3OPZL 3CDZB 3QH3A 5E00A 2FWUA 4F7PA 1FNSL 3EAKA 4XMZA 2X40A 3CPUA 3MLVH 3QJHA 3ZDYE 4Y4KA 1I1YA 2ZOOA 3KLAB 3QUXD 1PTZA 2EIMB 4Z8FL 2HRLA 2IDSA 1YYMH 3Q5YA 1RUPH 4NN7C 3P9LA 2QR0B 4Y88A 2FH8A 1PD6A 1XMWA 2EYRB 4Z3HA 3ARYA 4BV1A 3KG5A 4EKXA 5LBGA 3R4RA 3DYPA 2CK2A 1LNUB 3FT2B 3H42L 3PUUA 5FYKL 3J2PA 3L9BA 4CVZB 1ZSDB 4YZFF 1KDJA 1Q9OA 3AUVA 2VDMB 2KYIA 2HP4A 2MHAA 1QA9B 3DVGB 3THML 3RIFK 2K8MA 4NERA 4QXTB 2VDLL 4WU5A 2DDQH 4UQEA 4FQLH 3PHQB 3WLBA 4TSCH 4N24A 4LGRB 3QUGA 3KJ4B 4NI3A 3NEEA 1ZWIA 1L0QA 1CGXA 1QSEE 1S7UA 1YECL 1QX1A 4KVNH 1Z5HA 3NQIA 3KWUA 2P8MB 5CP3A 4X98A 5KVFH 4KDWA 1E0OB 3SDDD 3NCEB 4P9MH 4PJ9B 1E7UA 3MFGB 1U6AH 3VXTA 3D1MC 3GRWL 3BWAB 3EFDH 2ZAHA 4NBZB 5HVWA 2PXYB 4LP5A 1W8OA 1B2WH 3D85B 1JIBA 5G4NA 5BQDA 4HIXL 2XVGA 2DQCH 1CFSA 5F1SA 1HNYA 2AKRA 4LP8A 5F9OL 1N2RA 2AJ3A 2X4OA 3BPOB 1OALA 3QJQB 5TH2A 3U6XA 1WDAA 1X4ZA 4KHXL 2YN3A 3L17A 3VI3E 4JY5H 2FDBP 5GS0C 2AQPA 3ENEA 1NEZG 2A83A 2X4QB 1RURH 1AMYA 3M07A 5FYJU 3TH3T 1OO2A 5H35A 4P46C 4C56D 3WL9B 2GK0B 2YD4A 3ZL4L 1U36A 2HPOA 1GYAA 3FQNA 3PHOB 5AYTA 4LCCA 4E5XG 3IBOA 1MJ8H 5C0RH 4XRCA 3TJEL 5EO0A 2VB5A 1A9VA 4JFYA 5IROA 3AG4B 5DD1H 3GJEB 2OR9H 2B16A 2J21A 1CWVA 4XO4A 2HLFD 3EYUH 2NZ9C 1B4JL 1N67A 3KWTA 1DSWA 1T83A 2KQMA 5K59F 3DK0A 4HCRH 1HN1A 2Y25A 3AREA 4P59L 4NEHB 4NBXB 2GHWB 4PBDA 1XGTB 2J2ZB 2IFFH 2VDNH 3CFUA 3MMEB 3DETC 4S1SL 4V11A 1QHOA 3IFLL 2OZ4H 5HI5C 2P5WA 3RTQD 1IAIM 1HFUA 3PWJB 3HHSB 4KTYA 2D9QB 4UU9B 3U4BL 1G7IA 4DZ8B 4RBPK 1T7VA 5CJ5A 2LT9A 2XUWA 4JVWA 5EZOH 4L37A 2O5XH 4P5MA 2C34A 3C75A 4S10A 5ESVB 3S35L 3LRGA 4FTVE 1AKJA 1RK1A 2BZDA 4NS0A 2AF2A 1WD8A 1GMEA 3ULVC 1F3JB 5JXEC 4GAYA 4NKDB 4EQ2A 2VW7A 5DHVB 1A2YA 2LU7A 3VW3L 1AXTH 4LSSH 3VXQB 1NLDH 1BXVA 5DFVD 4X6CF 2YXMA 5BV7H 2VZ1A 1DDHA 4KJPD 2VAAB 2MIZA 4MJ4A 1SYVB 3I9IA 4EUPH 1ZS8B 3TJHC 4MDIB 4XT1C 1TLKA 3QVAA 1HL5A 2NY5H 1W91A 4HIIB 1EQWA 32C2B 4EN3D 2BXYA 4Z78A 1IIIA 4HS8H 4OFVA 1H19A 3WMPA 3MUHL 2IXQA 3KPRD 2DQJH 1UOKA 2AQRA 4J6IA 3BP5A 4OB5H 5H37A 5TFSL 5D2NA 2Q7AA 1AFVH 3C60D 4P3DB 5SWSA 1T1YB 2R59A 3IFNL 2QHRL 2R8SH 3FCBA 4ZO6A 4IHOA 3S34H 4J1UB 2K6YA 2W9LA 2E59A 2ORBL 2RA1A 5D9SB 1VKXA 3SPIA 3PWPA 1QI5A 3GK8H 1ZT1B 2DLGA 4TN9A 4H0HB 5CWSA 4BJLA 3GBDA 4UNTA 2E6JA 4DKEH 1AY1L 2PWDA 4OLUH 3N1QC 3MZTA 3FO9B 4P2OC 2XWBA 3RKDC 3UBXI 4R26L 1FJ1B 1PJWA 4WWKB 2D31A 4GIPD 2E7BA 1RPQA 1NINA 1BREA 1NANH 2NLJA 3CNKA 2FUTA 2BWDA 4KKCD 5I17B 4D0DB 1Q0YL 4OZHB 3ZUCA 2FLBT 3FMGL 4X4XB 1EEUA 3F84A 4XXWA 5T1LB 5LGYA 3BVXA 5EUOE 1U91B 4PWKA 4XPBL 3B2XA 4PJDE 3ZHLA 2BNUB 4DVRH 3D9AL 2O6FA 3S36H 5JQIB 1CVRA 1KXHA 4MCYB 1Z7JA 1MFMA 1DFBH 4S1QL 2AGJL 3I74A 1LK3H 2XYCA 3NFPA 1T2XA 5JHLL 3MC0A 3QR2A 2ICES 1DVTA 4DUXA 3UTSA 3LMJL 5F7AA 6FABH 1MCKA 4UT6L 1BD2D 2Q9OA 1EZSA 3DRQB 4LCWE 4WFED 1BM3L 2VXUL 3QQ9D 4JPWL 4JFHE 4OGAC 3EO1B 5FFOA 3RFRA 3WD5H 2VQ1A 2EIDA 4NO0A 4OBSA 1K2DA 1RUQL 2E86A 2GYSA 5D1QC 2DQ6A 2VLJE 3L3DB 4X83A 1FBIH 3BKYH 3GDCA 1TYRA 5FKPB 1C1EL 2B14A 5F44A 3BD3A 3S8FB 3QUMH 4K7PL 5E70A 5AAPA 1Q1JH 4QMEA 1A47A 4YQXH 2OYLA 1JTPA 3QEGH 3WI9A 4YPGA 5IBUB 3SQOH 2XJKA 4IRZL 2YXWA 1TFPA 2UZPA 3EOBB 5KOVC 5JMOC 2DL9A 2HLAB 3MRMB 4XC1L 1Q9LA 1FYTA 4PRDA 3BN9D 3IJ8A 4JM0A 5I1IL 5BMFL 2K7QA 4JO4H 1PLAA 1TZIB 3NCWA 4EKJA 3DMMD 1FZKA 2B5IB 3R4DA 1HE7A 1L9TA 1RZ7H 2JI1A 4LEXL 4UM9A 4Y2NA 5AL0A 4HK3J 3LAFA 1HQRB 2X4TA 4O4YL 2GJ6D 2YUWA 2J3SA 1XR8A 3MRIB 3P0YH 4QY8B 3KJ4C 5DVLA 5E9NA 3VO0A 4E41B 4HUUA 5EBMB 1DBMH 1ZT4B 5FGBA 4FG2A 3IE9A 1QFUL 5TE7L 5GGSY 1OF0A 1BVZA 4K3JH 2NY0D 5CKGA 3GLEA 4DP7X 1YQ2A 2UZYB 4C55A 2IWKA 2NDFA 3DNKA 5CILH 1T03L 4PS4L 3ROLB 3NIFB 3O3EB 4QHUB 5JIKA 4YHZL 3FTGA 1QAWA 1BZ7B 2XU9A 2P80A 2PXYC 1JDDA 4QXUH 4XWOD 4Y9GA 2Y69B 4H25B 3WUWA 1SEQL 3QRBA 5IB4B 1Z5LB 5EU7E 5JR1H 3S88H 3FSVA 3MRBA 4ZTPL 3GSVB 5DJ6B 2V5MA 1FE8L 4XMLH 2XQYA 3RL2B 3RWFA 2MNUA 3GM8A 1HHKA 1JWUA 4V1DA 4MMYA 3D4GA 1MFUA 4FXGA 2BNRD 2YC1A 3Q05A 2KI6A 4M6MH 5EIIB 3ATFA 3CH1B 4FYRA 3MBWB 1FLRL 4WGWB 3T6WA 1ZANH 3LPFA 1T4KA 4B9IA 2VR9A 4G8IB 4IOFD 4KKBC 5GZOC 2BP8A 1MDAA 2X41A 2BK8A 4OF7A 5IW1B 1OTUC 2CH8A 4HZ1A 4UDTA 1S7XA 4GQRA 2FO4A 3LB6D 4NCC1 3VXRE 4PJHB 4ENEC 3O8XC 1GSKA 4CC4C 4ADJA 1G7JA 1FYHB 2XTJB 2M8XA 4L18A 5IVNA 2EICA 4ORGA 1XF4B 3CZUB 1T04A 1NCWL 2ZCZA 1QSFE 1CICA 1UM5L 4MCMA 4ADGA 2R69H 2RACA 3D08A 2JLLA 4YXLH 3HHRB 1R0AL 1UWEL 4XOBA 1JF6A 3HA0A 1TIUA 3DX2A 2G0LA 3D33A 3OAYK 2NXYD 2ZUUA 1HI6A 3VFVB 4KKLD 5CJQH 5I1AA 1IIKA 1JGDA 4Y1AE 3D30A 5EOCJ 4JFDD 2EUXA 4DQAA 1HXYA 3RWHB 2WTOA 4GQ9H 2I07A 5JW5B 3TXAA 4MD4B 4PJGB 4OLZH 3WMSA 1XHHA 4FJYA 4M7JH 4A66A 5IEKA 1HH6B 5CGYC 1H5BB 3NBNA 1X7SA 3BCDA 1CGUA 3H9HB 4KI5C 3N44B 2DLTA 5JIPA 3NCYP 1OP3H 4XXDB 1J0ZA 1FPTL 1BBJA 5D71L 5FDWA 5DWPA 4IDJL 4PRPD 3SPCA 2BXZA 2YIHA 3JTTA 4ZMPA 1CG9A 2P8LB 3QIBA 3ABLB 4HJSA 4OD2A 1DVSA 1L6XA 2XZAL 5CLXA 4KH2A 1XBRA 3F6JA 2L0DA 4X99B 5GIRA 3GSRA 5I18L 4EAEA 4WEUD 1R3HB 1YEDA 2E76C 1G6RB 3LS4H 4OJCA 5DUJA 3ABGA 1USZA 5FM5O 3U46A 3IT8D 3BUYA 5MENB 2CWRA 2W60A 2P8PB 2GK2A 1AHKA 4E9WA 4KTDH 4L4VB 3K7UA 5I1CH 1W6LA 3LDBB 4IGBA 4W9DC 1RZIA 4Q9RH 5KW9H 1WUZA 1H8LA 4K5OA 2IQ9H 3DX7B 4WWKC 3FO2A 4XPHH 4AJVA 3F7VA 4LBEB 4FQQB 4EI5A 1GL4B 5JOEA 1V7ML 4PJEE 3BSZA 4DZBB 1XSIA 2F53D 2VDRL 1TZGH 3C9NA 2BSSA 2CDFB 5DZAA 3S36X 1IILE 4XVJL 3HVDA 1BIHA 3HN5A 5H37G 4KZEL 5IFJA 2VJXA 2YWYA 1ZAGA 4DW2L 1YN6A 1GGBH 4TYUA 1V8HA 3WTSA 5FW6A 5J6HA 4FP8L 5T1KB 3RQ3A 3TEXA 2P9RA 5HVFB 1EBAA 1M7IB 1XF2A 4RRPG 4JFOA 4W6WB 5B39B 1FCGA 1CFMA 1EDHA 1PAZA 3E0GA 1A21A 2XT1B 4C56E 1QO3A 3CSYB 1WGVA 1VGKB 4AITA 1SXZA 2N3JA 3TO4D 1KC5L 3N43F 1I1AA 3NA4A 3KD4A 4NBYB 4E0RA 4DOHB 1L9NA 2Z1PA 1A14H 4DKFL 4U6VL 1LDPH 2OXHB 5FA4A 3IS1X 3IDXL 2Q8AL 4JRLA 2OMZA 5CP7B 1LK2B 4CC1A 3MJ9A 2DZEA 3QUYA 3EJYC 3L4YA 3G6JB 5EZIL 3GHEH 4PLJD 1NMAH 2I60H 5FB8A 3UAJC 1J5HA 3UJIL 4HJUA 1AR2A 4ONOA 3PGFH 3BAYA 4BSVB 1U0QA 5F70A 4U6YA 4OZFH 1J1OL 2KH2B 1KJ2B 2OBGA 1M7UA 1D6VL 1BDYA 2D0FA 3VD5A 2AQQA 4U1HB 3VB9A 3BIBX 2BSTA 5DD0L 3MOQA 3WFCL 4PI0A 1F4HA 4U1KA 1DQKA 3B8SA 1D5IL 2AJYL 4ZUUA 2FUQA 1IGJB 4LLMA 3W1ZA 1KENL 2VM9A 3WE1A 4XHJD 4R5VA 4GMTL 2M1KA 2YD7A 1R5VA 4R84A 4XI5C 4ZFOB 2B5IC 3IXTB 3U83A 1I8MA 2VDQH 2YPLB 2ICEA 2WLNA 4OQTA 3SD2A 2IBGA 4MAUH 3ULVH 3A4EA 3R18A 4G59C 1N9PA 1C08A 3NACH 4X4YA 3ALXA 1W80A 3QYCA 3Q1EA 4BGDA 2ATPB 1JRHL 3VXUD 2D2OA 4PR5B 3QQ3A 5HHXH 4DN4L 4O9HH 3BQUA 2XPGA 3H6AA 2CNYA 1DP0A 4JPKL 2AS5M 2RAMA 3V8CA 3I85A 1XD0A 4MQXC 4DPBX 4XP6H 3D39A 1HWHB 4LF3B 3PWUB 3KPRE 4BIKA 2WYHA 3ZQWA 2ENSA 5HHNB 3VXSD 5A7EA 1KN2L 3O2WL 1I4FA 4N2OA 5DMIL 4EQ3A 3EYFB 1JV5A 2W88A 3N3EA 1U8QB 3NCYS 1YJDL 3DUUB 4GSUA 1NGWB 3B2VL 1T5XB 2ZAIA 4M29A 3MROA 1KYFA 5GRVK 5JLZB 2ITCA 3K72B 4LARH 4EIUA 3OQ3B 1HJCA 5DMYA 4BWTA 3ZSTA 3JTSB 1NDGA 1KBKA 1P6FA 5C09B 4Z3FA 3U2SB 5T8IA 3RBGA 4OCSH 2DM4A 5I74B 3DSFH 4U0QB 4WWID 5LCVA 1IGFL 3BP4A 3QNYB 1E4WH 3LN4B 4OLXL 5C08D 3W0WB 3E3QE 5HGHB 1OZTG 4FQCL 4XPTL 1FH2A 3QR1A 3ZGHA 3LKNA 2E0PA 4LHUD 2ZCHH 4GRWB 1DJIA 4JANB 4MB3A 4RGND 4S1DD 4NYLB 4XO8A 5FM4A 3IFOB 5IHLB 4D9RD 2NNAA 3FF7A 2A6JA 3MOAL 2ZCKH 4U1JB 1IBDA 4QEGA 4G6MH 3WKNA 2XTJC 4H0IA 2A74A 1FAKT 2M83A 1VESA 1KCRH 1MFEL 3STLB 3TT1H 1OOWA 2BNQD 4LEBA 1OP5K 3P73B 4GI9A 4IKNA 3SBQA 1UD5A 4ZOCA 3KDMA 4F8QA 4WY7L 3QEQB 3S4SB 4HGWA 3CU1A 5F0MB 1HILB 3NCJH 4R2GD 1HINH 1X5HA 1DQDH 3G04B 1BD2E 3PYCA 5IB1A 4WFEE 4NRZB 3K6SA 4R0LB 1NCTA 4Q0XL 2JE8A 2YEZB 2ID5A 4Z6AT 4R83A 3RLSA 3LZRA 4UQCA 5CAYB 3VQ2C 4JDZA 4L9DA 3L3GB 2R27A 2FECI 1G7LA 3IGAA 5ANMB 2HPTA 2MTPA 2ZYIA 2AQ3A 3UGEA 1XGQB 3GIZL 1OLZA 2EYTB 4Z7OF 1T0PB 2E46A 5A6IA 1WFOA 1EGJA 4X7TB 4B5ZA 1HHIB 2WXLA 3DJRA 3INOA 4AW7A 2HT3D 4JM2D 3KBEA 5SWZD