3LZOA

Crystal structure analysis of the copper-reconstituted p19 protein from campylobacter jejuni at 1.65 a at ph 10.0
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
159
Chain Sequence
b'GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
total genus 33
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzoA00
3LZPA 2O6EA 3NRPA 3PJLA 3LZRA 3LZNA 3LZOA 3LZQA 3NRQA 3PJNA 5I0XA 5I0YA 5I0WA 5I0VA 2O6DA 2O6CA 2O6FA 3LZLA
chains in the Genus database with same CATH superfamily
3QH3A 5A2BA 4UMSA 1WBZA 3HVNA 3R8BB 1TQVA 4OT1H 4GG6E 3IDJB 1UZ6F 5BV7H 3RDTA 1UM6H 4IEFB 2A83B 2E8YA 1U8QA 2X4TA 2RD0A 3OR6B 3S35H 1HWWA 1ZXKA 2MIZA 3MBWB 3LKNB 5IFJB 3CDYA 5GRUH 5I8OL 2DDQH 3QIUB 3NCYP 3J07A 3QIUC 4JO1H 3HI6H 2WHVA 3O3EA 4LPTA 3W5MA 1IGFL 1R5WB 2ZG2A 1RK0A 5E6YA 3PPEA 4LHUA 4YDKL 4H0LC 2W9EH 3L48A 1NEPA 5DD1H 2VSMB 35C8L 5CLWA 1M05A 2R2HB 4TL5A 4JN1H 4QHKJ 5K5YA 2G30A 2E6PA 1CF1A 4MWFB 3CPLA 2B1HH 2ZKYA 3VRIA 3ROOA 2J1WA 4DKDC 1XL6A 4IGBB 3MV9A 3GXFA 4IGBC 1VKXB 5CJOH 2WIIB 3VD9A 1T3FB 5E6IA 2IVFC 3ZT5A 4XX5A 1NGQH 1OAXH 4U1KA 2VZ3A 2JXMB 3L3OB 2J8UA 2HKFL 1R17A 3L3OC 2EUZA 1FFQA 4M1DL 3QQ9D 2ORBH 3VM7A 3UTOA 2HXAA 5JPNC 3D85B 3HVDA 4MJ5B 4Z7VA 5E4OA 1MNUH 3G5VA 1W0YT 1RJLA 1WFTA 2IC2A 2PXYD 3VXUE 2YN5A 4LOUC 4YDNA 5D7IB 3OPUA 3T0DA 5IB3A 1IGJB 3JWNE 5KWYC 5TJWK 3CVHH 1HSAA 4C59B 2J44A 3QZWB 1J8KA 4LLDA 4QY8A 2L7QA 5E00A 5D2NE 3IFOA 5EU5A 5HYSA 3B3BA 1U92B 5EU4A 1FF5A 3QR2A 4XO3A 2J71A 4AIOA 2UY7A 3OMIB 1VCBC 4ZMXA 5ABDE 2VDQH 2OP4H 4HC1H 3B2VL 3KHOA 2VSCA 3TPUB 2FEEL 2V5MA 1ZRUA 3QJFA 4OZIA 2Q7YA 3U6RB 3MUY1 4WENB 5GISL 4HUXA 4AE1A 1AGBB 4BBWA 4HFUH 3AU1B 4I0PB 4LCWB 4QXWA 4GLRH 2BZ7A 1J7VR 4ENED 2E0PA 5A16A 1F4AA 3SDCB 3A47A 3SDCC 3SN6N 3C8KA 2GK2A 2Z6FA 2J73A 4FG0A 1FNHA 2HUHA 4OTXL 3DX7B 2DBLL 5JQ6H 3UO1H 1BBJA 4FKKA 4DCQB 2FLMA 2A9ML 3VXPA 3Q8BA 4XE0A 2F7OA 3F7VB 5HI5D 5AYUL 3ZE2B 1BECA 4K7PL 1J1OH 1RZGA 1T04B 4IBVA 5EUOF 5F1SA 4YXHH 1U2HA 1G7QB 3D05A 4P23A 5J11C 3H0TB 1EA9C 4H2CA 2LGNA 4XPGL 5E94A 3DGGA 5FIEA 2MQCA 2OTWA 3ZO9A 3BAEL 2DL2A 1C5CL 2FD6H 3BPOB 4PQXA 4XMPL 2YD6A 5DRWB 5FGRA 5I1AA 3BPOC 1A7RH 2EDRA 4M43L 5GGRA 2DLGA 3RTLA 4WHYG 5CZRA 1KPUA 3BKJH 4LHUD 5EO9B 1N18A 4AUUA 2UZIH 3S3PA 4XCYB 4CN1A 4F3FA 1L9PA 2CCVA 2WXJA 1KYOK 1OAZL 4DZBA 5BUAA 4FYTA 5F97E 4C4BA 2DMKA 5IW6A 1UACL 4UTBH 1AHWA 3X14A 2IADB 2CMRH 1U91A 2D3JA 4I18B 3RGVA 4TSAL 5CINL 1YEEH 4B97A 4I18C 4N2EA 1JZ3A 3L3HA 4HPYH 4YSUA 4JHUA 3L95B 4AIZA 3MV9D 2ADJA 4ADIA 1INEL 2IANB 2C7UA 4MZIA 2G60H 4P49A 5E6ID 4OR1A 5FHBH 2BY0A 3RWGA 3GBNL 4E9QA 3UYRL 3MR9B 4HCRA 3CX5J 4Q56A 3D18B 2WXQA 4WHYH 2HB0A 3ZDYF 2HLAB 5K59E 1JGDB 5AD0A 3PV6A 2WINA 2QJDA 5LLIC 3QA3A 2K70A 4NC0B 4ZG1A 3C6LA 1IVTA 3CZFB 3MQIA 2XN9B 4KMLB 4EEEA 4UINL 1DZBA 4DKFH 1S7RA 1A1MB 5L2JB 2NX5A 5E1GA 1EO8H 1T7VA 4K5LA 4L0ZA 3U1SL 1R3HB 2KZKA 5F8RC 4JPQA 5DVNA 1PU0A 3BWZA 3LZQA 3O6FA 4N2AA 3WLWC 1CO1A 1KGCE 1RJZA 4OD2A 4U6YA 4B9ZA 4QWWC 5I1JH 3ARSA 3GTVA 3FOMA 2HN7B 5EUOB 4A55A 2KERA 2OPCA 2YC1A 4FQQB 3FQRA 3FYEB 3FTUA 3TOPA 1FO0L 4G5AA 3NPZB 3WNIA 4DNLA 4N90E 2R2EB 1QHPA 2XZAL 2ITCA 5EZOL 4W81A 5D72H 4HS6A 5DC4B 3UAEA 3GBEA 4XBGA 3VFPB 1ETZA 2B7DT 4WI0A 1E6OH 4FQIH 1T0MB 3KLDA 1U8LB 2X6BA 1DUYA 1BZ9A 1CICB 2BX5A 1CICC 1NDGB 3ATAA 3G5XB 4EVNB 4NQVA 1HC1A 3VFNA 2BSCA 1N6QH 5EC2B 4Z5RA 1FNFA 3H6AA 5H37A 1TF4A 3H2QA 2DLFH 3SYQA 1O9VA 4XXWC 1BJ1J 3C2AL 4P23D 2X6MA 5D8JH 1F56A 5LN4A 4FFVD 1RZFH 5TK4A 3SZ6A 5T5FA 5LXGL 3M7OA 2MHAA 4Y9CA 3GXMA 2VDLH 4BZ1H 2FH8A 2PO6D 3FMGH 1NIAA 2KLTA 4P5MB 3GMPB 5AUMB 2MCPL 3ZDYB 5FLVA 2A2QT 4F5CA 5L2KB 4JN2B 4OZGF 2DYRB 3BSZL 4MJ4A 3V4LA 2V2WA 4LCYB 2FT7A 2I07B 1HCVA 3D4CA 4MGXA 1BAGA 1Q9LA 5IEKB 1K6QH 5AEAA 5DJAB 3VMPA 1JDCA 1WCBB 4G83A 2CJUL 3P2BA 1QLEB 3MKKA 4NGHL 3IMUA 2R15A 5DZJA 1MI5D 2QPEB 2EH8H 3NJLA 2VLRD 1GY1A 2EEXA 5C0CB 2A9CA 4R90L 2NY0D 2CE6A 1H15B 2EKSA 2Q76A 3E80A 2DL9A 3ZYZA 3QUMA 4JQIA 3L9BA 5H94B 1R0AL 5JW5B 2QELA 1DN2A 2X1QA 1FNEB 4HKBB 1QP1A 1IT9H 4WTQA 2EDWA 1RZJL 4W9LC 2QQKL 3HFFA 1AC6A 3MRBA 2CRMA 2YBRB 4KJYB 5IGXL 4HJEA 5H2BA 3MMEB 4PV9A 4QRPA 4G43B 1OCWH 3MAWA 5T1LB 5DJ2B 5LAPA 2E4TA 1TEGA 1UB6B 3HMWH 4LCIH 3I2CL 4WY7H 4DH2A 5DDHA 4YJZL 3MA9L 1NLDH 3OQRA 2FB4H 3O6FD 2OQJB 5CLXA 5JHDE 2YSTA 2H32H 4Z7QF 4O2FA 4NPJA 2XCMC 3P0YH 3QW9A 3U36A 4KJPC 4DP8X 5LGHL 1DQML 1RZIA 2VDNH 2C1OB 4UNVA 1OAQH 3U2SB 5EA0H 2X1WL 2Y07H 5EBWB 2I32A 1UUNA 3QQ3B 4MQTB 1R3IH 2YD4A 4X4MA 5TFSH 3OMNB 4JRXD 2ZXWB 4APXB 2X4QA 2NZIA 1PNCA 3VUAA 1H3PH 2FX7L 4KGLA 2RJMA 3TEZA 2VH5H 4GRWF 4U3XA 1QO3B 1JD7A 3REVA 5EUKB 1I7ZB 1FFNB 4HT1L 4HQQH 5HHQB 4GT7A 4JL2A 5AW4B 5C0NC 4NOFA 5TQ0H 5L7XL 2WGXA 4ELMA 3HN3A 3RNQA 2WXKA 1EZVX 4YQXL 4TQEL 4OZGB 1JHLL 1U3YA 3G08A 4A7QA 5DHVB 4DKTA 4XNMA 1NL0L 1A65A 2BCMA 2ZCLL 5T3ZE 5MEPA 3CJJA 3Q44A 3QZMA 2XIIA 3CLEH 3ZO0A 1KC5L 1TSHA 4G1EB 2O30A 3MRNB 3SYPA 3OJ2C 2IH3B 1BOYA 4Q6KA 3QIBC 3TO2B 3MLWH 4HUCA 3OB0K 3E0GA 2WWOA 1GZQA 3QZBA 5E95B 1QR4A 1GYUA 2WTRA 4Y7OC 1J0ZA 1NBQA 2VQTA 3DHPA 3KYAA 4U2ZA 2EVJA 2G5BA 3BSGA 2IBBA 4KKPA 4M5ZL 5KZCB 3FOLB 4DP5X 4IIQB 4TOYH 1BMGA 4IIQC 1B0RA 2K8QA 3FB6A 3S36X 4CW1A 1JXKA 5JQHC 3P4NA 1QTYT 1L9NA 2F53A 4H40A 4MA3A 3LVEA 4GKSB 4FNRA 1T1WB 2IQ9H 3H3PH 1AQMA 4CC4A 4L9LA 2LE9A 1CFNA 2CRIA 3VFRA 1ZLEA 3CTTA 4MS8C 3SKUD 5DC9B 2APBA 1PZUB 4JPVH 5C0AB 3RYMA 2VDKH 1EQWA 4PJFB 5ESQB 1KN2L 2WANA 4W68A 4OSUH 5DC2A 4NLHA 5C0BD 5JW4Q 2BCKA 3ZKND 2V4LA 3RX8A 3FUJA 5GHWH 2D8KA 3SQBA 1ZLVK 1O6VA 4HKXA 3RX9A 2OMVB 2C1PB 1NOLA 2DQGL 1JE6A 1QSFB 4ZAKA 2PW2B 5MHSD 4JDTH 1OTTD 1LK3L 5FK9A 3N5AA 1MHEA 3G6JA 4ZS6C 3GXIA 3DMMA 4PR5A 1VZIA 5KUKA 1ILSA 3MRGA 1IM3B 4WFEE 4H8QA 2KMWA 2XVLA 4CSTA 4MMZB 4MMZC 3FT9A 5CNHA 3D2UB 1AGDA 1EEYB 4ODSL 1ZWIA 5D1QE 1Q4NX 4GRWB 4G9DB 3VWKD 1ZA6A 3GBMH 3PJSA 2OMYB 3EFDH 3MODL 3X1EA 1KTJA 2UWEB 4XOBA 1KFAH 1T6VN 2NCMA 3O3DB 1BFVH 5GGSY 4UANA 3GMNB 2R51A 2Y06L 3W11D 2X41A 2BVQA 3UIYA 1ZTXL 5E8PA 4LEEA 3TWCL 2JQMA 3EXJA 3MLXL 2Y7QB 1Z9PA 4K5MA 5CILL 3FT4A 5E4AA 2GKIA 3IKCB 3KCPA 3ZTEA 2ZX6A 2GJ6B 5GGUA 3MYJA 1RUKL 3ULVD 2YAQA 4P3CH 1GCFA 4LVNB 3MFFB 3EBHA 4HSQA 2E76C 4LVNC 5CGMA 5LGJA 3CUPA 3AZUA 4WO4B 3BIAX 4WO4C 5DRXA 3RWJB 3SCMD 4YWGL 2R0WL 1EZUA 4EPSA 3T6QC 2BP8A 3H3BC 2X6CA 1M7DB 5L8KB 4X6BA 4OM0H 1BD2D 4O58H 4KXDA 4IRJC 2VKXA 2FX9H 2HJFA 3WSQL 5E9AA 3MNMA 1NC4A 4HP5A 5DRNB 2WCGA 5B39A 4LQFH 5AZUA 1KG0A 4KY1L 4Y2LA 1P53A 1I1YA 3AB0B 3MV8B 3S37H 3SIKA 2M1KA 5AZ2H 3VD0A 3AB0C 5SWZD 4DGVH 5GZND 4W6YB 2OCFD 1ZE3C 3SE9L 1ZAGA 3IFNH 1D2PA 4ZSOA 3L4XA 4ODWA 4P59H 5FO8B 1N3NA 1JNNL 5FM5M 2QPSA 3FUMA 2KC0A 3IRPX 4XVJH 2OCCB 1V3JA 1QWUA 2AXFA 3LRSB 4HJGA 3KE0A 1MWAB 4NQUA 5BQDA 5L9DH 5DI8B 5E9DB 5C6WH 1OB1B 3D39E 1WA2X 2F58L 1AGCB 2WQRA 3CVIH 3EO1B 1WA0X 3ULAB 4IJTA 3TCLB 4E41B 1F3DJ 2F53D 2BM3A 1UA6H 4H1LB 1A4KB 3EH4B 1M9WA 2XPZA 3P73B 4QI3A 5IOPB 1ACZA 4OM1L 3K4AA 2ZJSL 2EH7H 5EO1A 3SDDB 1WV7T 4XBEH 1I3RB 2WMPB 5IMOB 1E8XA 4WEBL 3ULUL 4ACTA 4DKAA 3O41B 1Z9SB 3LH9A 4P2QA 4XWOC 3T6ZA 1N0XL 2Q9OA 1CG9A 3I6LD 3I50L 3T77A 3O3UN 1PTZA 1KXTA 2GEEA 2BSEA 2XWBA 4N2CA 4R2GB 4R2GC 3TVMA 1BQSA 3MCG1 4ORGB 2YMOA 2DM4A 4BFFA 3E6HB 1T83C 4GS7B 4G80B 1CPUA 4OF8A 3KZ8A 3TA4D 3DMMD 3B34A 4GS7C 4YR6A 5GSRB 4YHKH 5D7LA 1KUMA 1NIDA 3VACA 1CDIA 1V7MH 5F3BB 5HXMA 1N64H 3JV6A 4S11A 3LH2L 3KEHA 1D5MB 3CN3A 2G75A 4GT0A 5L88L 1G6RA 3LAFA 5ADOH 3MLRH 2Y7LA 2YD1A 1Q9KB 4F37K 3HRZA 2IALB 4P9HL 2X70A 4IOFC 4QXUL 2JWYA 2ALWA 2FECI 1JPGB 2CKBA 2XHNA 4HHAB 4ABQA 4QIRA 4OVVA 1KJ2A 1MCSA 3V4VL 4L8BB 1HOCB 1JPSH 4XP4L 3WFCL 1NPNA 3AW5A 5F8QC 3KPTA 1MJ8H 1XCTA 4P99A 3K81A 5SWQB 1P5VB 3AGWA 3OKDB 3LIZL 3VXSA 4GKOA 2V33A 4Z18A 1ED3A 1PL3A 3KPPB 2FQFA 3DJZA 2W88A 2H2SD 3BSHA 2PCXA 4Y1TA 5C0JB 2GSGB 3AS0A 3GNMH 5EIIG 3PL6A 4M5TA 5TDNA 1IAKB 3VFSA 4YX2H 2GB2A 2AV1B 4PD4K 4GSRA 3WEXB 4Q52A 1L7IH 5LQBH 2XN1A 2DW5A 5DR5H 1NFDA 1NGWA 1IEBA 1ZHNA 5IROC 2V5YA 2C3VA 3MRKA 1JRHI 4OQTH 4M4RB 1S9YA 3CIQA 3GEWB 5KBLA 4BFNA 3UADA 3WIAA 4WEEA 3KGSA 3FYIB 1N12A 4P9ML 1F3JB 5HHVH 5HDOA 4XP9L 2OULB 2AP2A 5C08D 4FYRA 3ZXAC 4C8XA 1HIMH 2CD0A 4G8EB 1FPTL 1P7QD 4WUUD 3K6NA 6PAZA 3D2TA 4WRLA 3AREC 4X9HA 4G6JL 1EXUB 4FGMA 3CHRA 1NFKA 4UTAA 2VXSL 3I02B 1YECL 2IWEA 4EN3B 2YK1L 4AG4H 4EN3C 3HG4A 2RHEA 4WQOA 4FNQA 4OI7A 3V5DA 4GW5B 4ZPTB 5DUBA 5J5EA 5C3TA 1ZKAA 3THMH 1H19A 2IPUK 3QXDB 1IAIH 3FQTB 4FD0A 4F37F 1BBDL 5EZLB 3MRHB 5F1NB 3S35X 5HSFA 5KAQG 1FJ1B 1LO3L 2HWZL 4OLUH 1CLOL 2NY6C 4XMXA 5AYTA 2BSED 1WC7B 3QEQE 4Y4HD 5F7MC 4AEIH 5GGTL 3L5XL 3WFBL 2ZG1A 1WAAA 1L9OA 4XMKL 5E6UB 2AJZA 2YXWA 5T33H 4JO2L 3FF8A 3KLLA 5HGAB 5BVPL 2A9DA 2HVKB 1OCOB 2XV0A 4X0KA 1MCKA 2XBDA 3O11B 4QOKA 1BQUA 3FB7A 4D0CA 4EXKA 1T03H 1MLCB 2KL6A 2H7WA 4KUZL 5E5UB 5HHOD 4GAJH 3SQOH 1KDIA 4AYFB 1NQBA 3SHSA 1WDAA 1TJIL 1GR7A 1G87A 1JK8A 2GCYB 4G6KH 1UZ8B 4XI5C 4LKCA 1IRAY 5F9JA 4LKXB 1I9IL 4UQCA 2OZNA 2VISA 5C6TH 2C9RA 4QO1A 5A2LH 5SX4H 2WZPA 4PJAA 3QEGL 5MERA 1FL3A 3S3DB 2JCWA 1U8HB 3FRPG 3GMOA 4J6IA 3L5JA 1JWUA 1X9QA 2UVEA 3FW6A 2V3DA 3N04A 1T0NA 2WBJC 4OB5H 1QZNA 1I85A 3QUKB 5F7NC 2XTJE 5TH2A 4AEFA 5EEYA 3NG5A 1M9SA 1XHHA 3IJSB 5KVEH 2E7LC 2TSBA 1JHTB 5KW9L 1CZ8H 1KN4L 1DVTA 2DI8A 4W1TA 4MX7B 3MOQA 5IB2B 1YNLH 2IFFH 1MFEL 2JKIS 3TBYB 5M94B 4UT9H 4YIQA 1EUUA 4S1QH 4AVIA 3C75A 1JGVH 1YJDH 1W8NA 1SOXA 4RGMB 3RFRA 4RGMC 2P7TA 3O3BA 4KXZH 3T65A 1QSED 2J1XA 4ERSL 5HD8C 1DEEB 4CMMB 1GGUA 1TKWB 4B50A 1JMXA 3IYLW 2NCEA 3IDXH 3DX4A 3WIHH 1ZLUK 3S88H 4N2KA 1N6VA 3IB4A 3TEYA 4N0UE 4AYGA 1GL4B 5GJSH 4UT7H 2I60H 4YSEA 2ODHA 1FH5L 4L1DA 1HEHC 4MJ2A 1F02I 1Q94A 3FQXB 3MBEB 3QO0A 3T6VA 3MBEC 4JBSA 3FB5B 3W0WB 2BOLA 3S9DB 2B0SL 5FKAB 3L3IA 4EO5A 2W9DL 4C54A 4DVRH 2DB8A 4M6NH 5DLMH 3BE1L 3IETA 4KHTL 1JHKL 1TSRA 4X7FC 3Q06A 4KZDH 2HTKD 3IGUA 2Z31A 3LRHA 1UC6A 4RAUB 4OFKA 3U30B 5ACZA 2NUTB 3U30C 5EWIH 3U46B 3WI9A 5JMRA 3JT0A 5FC9A 3BEWA 4ZXBD 2H1PH 1T1ZB 3GUTB 2ITDB 1EHNA 4MMYA 1S7UB 4W9GC 3UZVB 4F8NA 3N85L 4KZEL 3CDZB 3QUYA 5G2NA 3SPJA 3DK0A 4NN5B 2HG5B 3UAJC 2WQ8A 4NN5C 3HS0B 1U4EA 1MCJA 2VXTL 3HS0C 3NFPB 3X1BA 5IW1A 1HINL 2HVJB 5DWUL 1ZVSB 3GZPA 4KTYA 2I69A 4XB7A 5KVGH 2I7OA 4R96A 1BDYA 4WHTA 4AIXA 3VH8G 4XODA 1N5YL 1HHHA 1YEKL 1GHFL 4QOKD 2A1WH 1B2WH 3REWA 4HIHB 3INUH 1ZIBA 3UZEA 1G7MB 4K8RH 3RFZA 3ARYA 3LPOA 4KHXH 1XB3A 1VENA 1XH3A 3ET9F 2J6EH 1S7QA 3FN9A 2B9AA 4PS7A 3R1GH 4MJIE 3P30H 5FGBC 1S7SA 2VL4A 2N01B 3K72B 1J0YA 3US0A 2WWKT 4P3WA 1FAIH 1M42A 2WZPD 1S2EA 2BIMA 3VB8A 2YRPA 5C07E 2HKAA 4PRDB 1LP9E 4KKLC 4R7LA 3T8VA 3W82A 4ZRGA 1U8IB 2GYSA 2Z35A 1TQSA 1NCHA 3BT2L 2EP6A 3R0MA 3HUJA 1SUJA 4A68A 2EXTA 3EFFA 2Z4QB 1UEYA 4URKA 2A6IB 4WK4B 1KEGL 4LSRH 1IGML 5AOIA 3TYGH 3TFBA 2QVMA 4GAGH 3EYUL 2HSIA 5E2VH 2JSFA 5JW3H 3VRJA 4CJ0A 3M7FB 3S8FB 1MKFA 5C09E 5I5JA 4BH8A 1AZVA 2QSTA 5I5IA 2CIKA 4QNPF 2AJXL 4RRPA 3BGMA 4BUQA 5IJKC 4G7QB 1MIMH 3OHXA 2ZOTA 3NCCB 4MNHA 4DK5A 1CC3A 2YFNA 4B0MM 2EYTA 1AQKH 2C9PA 3M17A 3OAYK 1G7JB 1MLBB 2QLVB 5T1MB 4OIBA 5LCVA 4QRRE 2KDGA 4APQC 2Z8VC 2ZCKH 2LU3A 3CZGA 4UOJA 2G2RA 1RUQL 4QEGA 4KK9C 2LTQB 5IESL 1AHMA 5BRZA 2LTQC 2WKOF 1LLAA 2OXGB 4H0GA 3ZTJH 1NAML 4GRLA 2P45B 1V3KA 4F9LC 1EERB 5EOCJ 4MXVF 3LEXB 5DJDA 2BNQE 1IILE 1BVLA 3NCXA 2YR3A 3GI9H 1WGVA 3DURB 3PJNA 2FJFA 1J8HA 3ATBA 5K9KA 2Y7OA 4C56D 5I16A 3QZWG 4GBXB 2LFGA 3QDMB 1FVDA 1T6WA 5B4MC 4XXDA 5ITFA 4IIZA 4NO0A 3U48A 1MUJA 4LSTH 3WJLC 3OKNA 4ZYKA 5A2FA 4I4WB 1NUGA 3QWOA 4EI0A 3A6BH 4BHUI 4ELKA 5IVXA 1JGLL 2ICES 1QNIA 3D52A 3BIBX 1YUHA 1OGPA 1W72B 4G7VL 1A6VH 4ADJA 1TZIA 3KL3A 1A3ZA 1SYVA 3A0OA 1D5IH 3FQWA 3MRFA 4WUKH 1U2CA 2CO7B 3QUXB 1PFCA 2P5EE 1UM5H 2F1EA 1YEWA 2X4OB 2WW8A 2Y22A 3MLUL 4G3YL 4OCMC 1MDTA 1DQQA 4XMLL 3IMWA 3VXRD 3LHAA 4O5LH 4QTHB 4RCAA 2ZUVA 5J6SA 2VRQA 4N3UA 1KBVA 1XR8A 3WKMH 1FNLA 4GIAA 3VM5A 1RURH 5DEFA 4KH9A 3C5XA 2EZ0D 3II1A 2GIMA 3PXLA 1H5BB 4ECNA 1AG6A 2AI0H 3QRLA 5BNXD 1H5BC 4X6EB 4YDIH 1CI3M 4ODVL 5SX5H 5IMMB 3AY4C 1GOHA 5DXWA 5IY5B 5FUOL 4NQDA 3L9YA 1AG0A 3WY3A 4CDGC 1RAMA 3APDA 4U1MA 1AXIB 1VFAA 3F3HA 4NZUH 2YRBA 5EORL 4WWKA 4Q9QH 3WUWB 3EJZD 4KROD 5C0GB 3Q5YA 1DR9A 4ES8A 4B9JA 5IMLB 1E8WA 1JF1A 4AQZA 3KD4A 4NUJB 1KGXA 3SJVD 3Q3GA 4YHZH 1GJWA 3MZTA 1AGFB 4HJ1A 3VX0A 3F01A 3HNSL 1MXDA 2QR0B 3FTZA 1HS6A 4X7SL 1FCGA 2A9NL 4X6CA 1FBIL 5CSGA 1FGNL 4OJFL 1CFTA 3NT0A 4EDWL 4XVTL 3MLSH 4PTTB 2CLVA 2PNDA 3D1MC 2HJKA 3QI9B 3QI9C 5ES4B 4XNZB 4N6RB 4XNZC 3FHQA 2AKRB 4QPEA 4S1SL 4QGTA 4Q97A 4JKPH 2KH2B 4DGIH 4W9CC 4EI5B 4OW6A 2W65B 5ANME 4EI5C 2HTLD 5T1DH 1SZNA 2DM7A 12E8H 4J8RA 5GSVA 4GRLD 1QR1A 3FSOA 2LAAA 4J3XA 5FGSA 5TF0A 3V0VA 2VUYA 2EIMB 3TN0B 3WDJA 1X5KA 4AC4A 1OVZA 3H9SD 3TN0C 1Y0LB 1LE5A 1A4AA 2JE8A 3JWDC 4MXQC 2YA1A 2P52A 3AXIA 4NHUA 4N8CH 4NQXB 4JDVB 1INDL 3T4YA 1J8HD 1B90A 2ADFL 4WZ9A 1RQ5A 3CFCH 3QDAA 3QUHA 4MASA 5I74C 2V0AA 3OM3B 3PU7A 3TCTA 3BP5B 4BFKA 5J13B 5J13C 3DO7B 4FMFA 1A1OB 4GQ9L 3V4PL 3OZ9L 4QAWA 4P4RB 1NGZB 2DQTL 4YGVB 4DAGL 5F7BA 3C60B 2DICA 4IS6B 4L4VA 3C60C 5JOPD 2XOTA 4N2HA 4I0KA 4FP8L 5HJ3A 1IAMA 2OLDA 5FDYA 2QDWA 4M61B 4AQEB 4KDWA 1XBRA 5IW3A 2FWSA 2YPVL 1EMTH 1EFXA 3HNTL 2D9CA 5HPMB 3L6FB 3O2VH 3IDGA 4M8VA 4B7IA 1A2YB 4PRIB 5DFVD 4I5BB 2J2ZA 2Z91A 3ZUNC 1PZ3A 4K9EH 4KBPA 4PJEE 1A3RL 2YQ3A 1OP3H 4NM4L 2MRYA 3EDKA 2PTTB 1W0VA 1ONQB 1WBXA 1Z0MA 4PW4A 4R7VA 2WCSA 4A6YH 1L0YA 1A6TA 4PHXA 4TUKH 1C12B 3DGDA 4UOW1 3VXTA 1ZLWH 4IU3B 4K3GA 4Q6YA 4GEIA 1JCVA 3IRZA 3DWTA 4TVPD 5HGDB 2F19L 2AJYL 4ODHL 4X9IA 4IU2A 1X5JA 5JXEA 1M7IA 2NY3B 1RUMH 5AG9A 1K8DA 5I8KL 4X99B 1MH5B 3LZNA 1NEUA 4MMXB 3QWRA 1ZS8A 3C09B 4MMXC 2BY2A 5F6HI 1WZAA 3C09C 2AF2A 2DLHA 4FLOA 5FWQA 2ICWB 4JDZA 3AJ7A 3V6OE 4ICWA 4JLRA 4XN8A 3R4DA 1NGXB 4NBZB 1MN4A 5DMJB 4Z7UE 4XWGL 3VXUA 4UIKH 5FYJD 4FTVE 2YAPA 1HHGB 4FQ2H 1JTPA 3O0RL 1TNNA 3QC6X 5CGYD 3L17A 5D2LE 1IBGL 3IJ8A 3TYFA 4JZNA 4P46B 2NY1B 2XICA 3D7PA 4P46C 2NY1C 3G6DL 2VUOA 5L6YH 4IHOA 1J0KA 4BH7A 3P0VH 2E9JA 1IJNA 4LEOB 3WNMA 1WFUA 1OPOA 2EUVA 1CGTA 2NR6A 4YXLH 3QRBA 2OL3B 2X4UB 3P3SA 2W07B 2R1WA 1QRNA 2V6HA 2PTVA 3F58H 1B88A 4DVBA 2X10A 4RDQG 4O02B 1LO0H 1IU1A 4F2ME 4DP7X 4F33B 3SDAA 3GYRA 5LBSA 3VAEA 5DURD 5GS3A 4OLWH 4WI2A 3QO1B 2LFEA 1DVFB 3QNYA 3WE1A 1DVFC 4ZFFB 2JK5A 2I9TB 4OH2A 3IU4L 4PWIA 5EBLB 2VXVH 5G4NA 4HIIB 1AKJA 2AABL 3QJQB 1I1AA 1QLEH 4PRPE 4NAQA 1MCHA 3VFTA 4KQ3L 4XNDA 4Q6IB 2ETWA 4KZCA 1T4KA 2Y2YA 4Q6IC 4FN0A 1QRKA 1BEXA 1X7QB 4EAEA 1KB9K 3K6SB 5HDWA 1CDYA 4QHKI 3IJHB 1ND0B 4HAKA 2CK2A 3DX1A 4TVPL 3CXDH 1CIDA 3VFVA 1ZT7B 2I5YH 4HUMB 1KZQA 4G59C 4PYGA 5I6NA 1AZRA 1SMAA 3ARVA 5IBLD 2P24A 4MNQA 1RVFH 4PRAA 4K5OA 5CMAA 1AXTL 4FC3E 2DWDA 2IAMC 2IG2H 3QXWA 1EEQA 3GSNA 2WXLA 3M88A 5L4JA 2EO9A 2ZOLB 1XGZA 2VDOB 2PPEA 4JMNA 1T2QL 3KLAB 4XBMA 2DQEL 1EFXD 1YPZF 5FYJL 5AWNL 4HJ0C 5DMIL 5ICZB 3RVXD 4KKBC 3FPYA 5EOTB 4FMKA 1A3LL 4N1HB 5IM7B 1S6NA 4MDJB 1S3KL 3VXMA 1TZGL 2JCCA 3TBWA 2ZWNA 5D7JB 2NOYA 3MV7E 3DHUA 5D7JC 1EJ8A 2D0GA 4X6DB 4LCUA 5E8NB 2OTUA 1MCCA 3ZDXF 5IG7A 1N9PA 4CVZA 1HL4A 1GIGH 1MZZA 1OQOA 4CSPA 5GGVY 1EEZA 1U8PA 2B1AH 2NW3B 4CVUA 1SYSB 1MCWW 1U8NB 4N86A 3QYMA 2V17H 1HU8A 4U49A 3OMZA 4J2QA 5T5NG 2AAAA 5JXED 3R4RA 4YXKH 4F91B 2VMDA 2BSTB 1P4IH 3O2DL 2EICA 3L4VA 2FHCA 3ARTA 1G7PB 3B9DA 3DVNA 5E8DH 1LO5A 1TPXB 43C9A 3SPIA 2CAKA 1TPXC 4KWUA 1S9VA 1XTLA 3PWUA 4W4NA 4QDGA 4XCFL 3VXUD 1LD9A 4CBZA 1KIQB 3T0EE 5B7EA 2EDFA 15C8H 2QSVA 2FQGA 3O4LB 3S4SG 3TH3T 2R8SL 5DHVH 3FFCB 4JFDD 5DD0L 1UWGL 4QXGH 3TBVB 5I1HH 2VITB 3A22A 2H9GA 3QCVL 1SY6L 1X5HA 3LN4B 4OD3H 1GGIL 5CUSH 3HPJA 3IF1B 1QWNA 1TFHA 2JIXB 4HKJA 5FGCE 4PJXA 1KNOB 4AKOA 5GS1A 4GXVH 4IRZH 2NR6D 1XIWA 4HCGA 3BN9D 4Z0BL 4NQSB 4F1SA 1IO4C 1R5IA 4GUQA 1IM9A 2TAAA 1JI1A 1RXLA 1ZT1B 2A38A 3ARRA 4QUOA 3MRQB 2HCZX 4LZKA 3DDFA 5I17A 4PEEA 4N9OB 2D7MA 4AEHL 2YD7A 1U0QA 3QPXL 3MLTA 5SWSE 1P9MC 2PYEA 4ZX5A 2AJVH 3NA9H 1ZLDA 5EZIL 4L18A 1ZPUA 4OIIL 4Q74A 1YC8A 1UT2A 3WKQA 1DCEA 5I1EL 3V79C 4UT6A 3HZYA 3F6JA 3NEOA 5I0WA 1OZUA 4LDOB 1YPZB 5AKVA 2DH2A 1I1AD 3RAJL 4G8FA 5HDQH 4OLVH 3JUZA 1DQJA 4YHIA 2C9SA 3U7WL 4UDUA 5IK3A 3MRPA 4MD4A 5DS1A 5CKAA 2OZ4H 4NJAL 2H6UA 4MZ2A 5HDRA 2O5YL 4GSXA 3SKJL 2WQSA 4ALAC 2H26B 4MJHA 1MRCL 3V0EA 4Q14A 5KTEL 2QVTA 3EDFA 4ZS7H 1MHCA 1MQKL 5JOEA 2IPTH 1AQHA 1B4JH 3D07A 1J1XL 2R27A 2VXQA 4TQIA 3DBXB 1ID2A 3HZ3A 2EIZB 4J4PC 2CLZB 5GZOC 1TR7A 1XGPA 2CBTA 3KPLB 5INDB 3QDJE 4GRWH 4I7ZC 3H42L 2YIHA 1DJHA 1QACA 4TPRH 3OJDB 3ARZA 2AQRA 5JYLA 4KAQL 3S3BB 3T5WA 1C7TA 3IJ7A 5HI3C 3KYMB 1F97A 3UXFA 1E0OB 1WIUA 2XVKA 4JM2D 4X4ZA 1UQSA 4FI7A 1BG1A 1G1CA 1DFBH 4E9RA 3TGXA 3AACA 1NBVH 2VAAB 5IV2B 2WAHA 3OR7A 2W60B 4OLXL 4B9IA 1G7HA 2WXNA 5BXFB 5I73B 1TJXA 5CN3A 5I73C 3GIVB 5F9DC 1HVXA 2QZQA 3FONB 4OLEA 2CDEB 4L1LA 3HLKA 4ZOBA 5BZDB 4HBCH 4QAMB 4DFHA 3D3VE 2HJLB 2E27L 1V05A 2BK8A 3GB7B 4EIGB 3DETC 1I7RA 1VEMA 1F6AB 3FT1A 2VDRL 3HE6A 1MJJA 3LPGA 1TO4A 4F2FA 3X11B 1CTOA 2HRPH 2WXHA 1QW9A 2D03H 4YPJA 5GGVL 4LSVL 5A7EA 3C08L 4MQSB 4ETQA 1EX0A 3EJPA 1OAKH 2AXWA 2UZXB 1WUNT 4JRYE 4NQEE 1VGKA 4W9ZA 5L0QB 3VU2A 1B2YA 5IVXF 4OFVA 5L0QC 2FJHA 4H1LG 4PJIE 5LUMA 4YNYB 4DP4X 1NAKH 1ZE3H 2ARJA 4HMDA 4I88A 2IOMA 4M7LL 5EU3B 4X8JA 1U6AL 1GGCL 1HQRA 1JPTH 1AI1H 2YLKA 3MYZA 4PJBE 3JTSA 2WLYA 1AACA 2F2HA 1X7TA 1BQHA 2GT9B 3UBXI 5GXBB 1TZAA 1OV8A 2B4CL 1RZKH 3ILEA 5EOCH 3WXWH 5ADPL 5I2IB 3ZR5A 2R29A 1GYVA 2H3NA 3BESR 1MWAH 2JTYA 3CN1A 1EZVY 4WKXA 3A23A 5KVGE 5KS9A 2CHWA 3KPSE 1MFDH 2P5PA 1BP3B 2G0KA 3ZE0E 1LM8V 5ABZA 3RL1A 3BZ4B 1BFOB 4Z0XB 3P54A 6FABL 3QORB 3MJ9L 4H1LH 1BXUA 5DEZA 3QORC 4MB4A 4PUBH 5AOLA 3L4ZA 3VGGA 1MFNA 3LN5B 1MVUB 2YOCA 2C5DC 4YSTA 1G7IA 5DMGC 5IWLC 3N1PC 3BEVA 4GSDH 1KLGA 3GS4A 2IQAB 1C1EL 1PJWA 3OKKA 2CNYA 4R83A 4JZOB 4X80H 1B0GA 4AZ8A 3NH7H 1FSKC 1LE9A 1XF4B 4KO5A 1KYDA 5GJTH 4D3CH 4BCYA 3MRLA 3U4EA 4IBTA 1A7NL 2GJPA 1D5XA 3LZPA 1JN6A 5CLTA 4X6CF 1R3KB 4MDIA 1R24B 4OZ4A 5DO8A 2V7HA 4K3JL 1A9EB 3GMLA 1YEIH 3OB0H 2DQDL 3BD5A 3IMRA 1PZ5B 4NKIL 2WUCH 1PYWA 1R19A 1WPCA 2EADA 4X50A 3LHPL 2X3CA 4YE4H 1PIGA 3QK0A 1TQCB 3RWHB 1BM3H 5CGBA 1TQCC 3MACH 1F1DA 4J28A 4OJAA 5BPPA 4XN1A 4K07A 1TFPA 1WTLA 1D6EB 5IF0B 1CL7H 3OXSB 3Q8AA 3H8NA 5C3IA 1LHZA 3EADA 1CXIA 1FH2A 3T3PF 3VNYA 4XMZA 2ZOOA 1KTDA 4WU7A 1D7BA 2B16A 3UTTB 4QRTB 3EJTA 1CS6A 2D0HA 1NCTA 1CFBA 1MVFA 3STZB 1K2DB 2WQUA 1MXGA 5LAXA 5EPMB 4HPOL 2G0LA 5JLZA 4EDXA 2FHBA 3DOSB 1MZYA 3MGTA 3PWVB 1ZLVH 3VFWB 5IB4A 1JBJA 1Y18A 3RILA 4WNQB 1M7XA 1WBYB 4RFOH 5B1BB 2VLJB 4GMSL 4JFVA 4MQXC 4K5PA 2Y2TA 3DYMA 3OX8B 2R1YB 3ASOB 3MRMB 5ISZB 2BDNH 4YN3A 1FYHB 5IHZB 1GW0A 5D1QA 2ITEA 1LO2H 1VEOA 4RH4A 3JTTA 5BMFL 2IDUA 2RIKA 3VQMA 3LXUX 3K6IA 3MRRB 1EFQA 4G9FB 3CVBA 4FKEA 4HFWB 3BVDB 2R23B 2X2HA 4XMTA 4JG0L 5DTFB 2YRZA 4FQHA 5JHDD 3L54A 4MAYC 1JNHA 2P8MB 3BVWA 4FCHA 1UJTA 1WRFA 4FFYA 4OUOA 4IDLA 4GQRA 1Y7VA 4E5XB 4YHYC 3MI6A 1C5BH 4P2RB 3R06B 1VLXA 3AXLB 3V6FB 3I6GA 4HF5H 4J3VA 5CZXD 5D7IE 5ALCL 1X6LA 4J3OD 1J9RA 1FFOB 1UWFA 3WN5B 4JGMA 3V55A 6TAAA 3DX8A 1TYEB 3QFJA 4WSKA 3LRGA 4HETA 2Y36H 3SKOB 3E1ZA 1F86A 4ZFOA 3VFGH 1I8KA 1KLFB 1IGTB 3EYOB 2ADIB 5KJRH 3TJPA 2UUDK 1NFIB 2WBXA 4JHAH 1YY9D 3BIKA 4MA1B 3NK4A 5FV2A 3ZKMD 2B20A 4MA1C 5LBVA 1T21A 3L4UA 1QFWM 4JB9L 1YEFL 1UZ6E 1VA9A 3U79A 4P2OA 1EZSA 5T3ZD 2VIRA 1VFBA 4Y2NA 4IOIB 2AK4A 2XV3A 3IBOA 4LCWE 2CO4A 4G11A 2DQIL 4LEXH 4G7RB 5CIPA 1GGBL 3B8SA 1RMFL 4HXBH 5CP3A 5ACMA 1UG9A 1I9JH 2DWYA 1X5XA 3DUHA 3ES6B 3KYOA 4G8GB 4JPKL 3WS6C 2XWTB 2IDFA 3MTRA 4R8WH 3S36L 2O5XH 3LDBB 3BO8B 4WCYH 3IU3B 2VN4A 4QHLB 3LDBC 2WN2A 4DN4H 1DVYA 3BKML 5J06A 1L7TL 4HVBA 2Y1VA 1NCDL 2AGJL 2DRUA 2F8IA 5ENWB 3WEOA 1V27A 4KJWD 3LKRA 3VWJD 2EE9A 4JHWH 3FU6A 3O9WA 4FXKB 1WJ3A 3ARDA 3N41B 2FJSA 4NC2B 1O5PA 4Y4FD 1PG7X 1C8PA 4LRIA 4XTRC 3SGEH 1RULH 3U0TB 1JUFB 2F08A 3V95A 3Q6FB 2X42A 2NTFB 2XZQL 5FA4A 4ZUVB 1L9TA 5HDLA 4QLWA 4AGQA 1X9RA 4X6FA 4Y1AA 5J0BA 4WU5B 4Y8AA 1GOGA 2K3TA 3B9AA 1QBML 3LTVA 4HH9B 1EHLH 2ZXGA 1DQIA 1OB0A 3JVGC 5DUPL 5INCB 3NABL 4KRMB 1CE1L 4M7KH 2COQA 3QZLA 4ESKA 2UXTA 3G5WA 1ZT4B 1S7VB 1ZJBA 3TO4A 1HEZB 4WFED 1VESA 5DJZA 1Z9LA 3WHE1 1KPRB 5DK0A 4L0PB 3K2MC 4Q4IA 1KCVL 5DS8A 5D1QD 3PQYE 5JXAH 1I1CA 1Q0XL 4XC3H 2IWKA 5LGKA 1AD0A 3F8UB 2IANE 1VGEL 2Y7SA 3CSGA 4IJ3B 4PGDB 2EJ1A 2V5TA 1NCCL 1OPGL 3NIDF 4FJYA 1YYLL 2AS5M 4ODUB 4ZUUA 3UFIA 3W39A 1DUZB 3BUYB 4U2YA 4XN9A 5JW4M 3QHZL 1QEWB 1CF8L 2X4SB 2G9KA 3HR6A 3SOBH 3ZDZF 4XR8C 2JCCF 1UCBH 4NRYA 3HBPA 2R2BA 2YARA 2W80C 5JORA 1JFQL 2XX1A 3HFML 1YMMA 3L3DA 4OF5A 2CBOA 2H6PB 3WV0A 1MCRA 2UX6A 4AGLA 1S5IH 2EVGA 4NZRH 3W81A 3WKNA 1O7VA 4HLZG 1T7WA 5B7FA 5IJVA 1W8OA 1FQ9C 1CK0H 3HEIB 2IDSA 3QQ9C 2RBLA 4MLSA 2AERT 2VXUH 2UY6B 3MA7A 5DJ6A 2VLKA 3VI3B 2EVHA 4U6XB 4RBPK 4ZX6A 1Q9OB 4PRBB 2WLLA 3LKSA 5EUOE 2PXYC 4AZUA 1PZ2A 4HWEL 5LNEA 4JMXA 3GSRA 2BJMH 3FDWA 3I75B 4NNXA 3PHQA 4UIMB 1U93B 1O5DT 3K71B 1T22A 3LQZA 4LU5H 5FUZL 3DX9B 4O2CA 3CQFA 5CJXC 4ANXA 2ERJB 1FZJA 1LYQA 1CTMA 2ERJC 2VQ1B 3WIIH 3VVVA 4PJGB 4HLZH 1OD9A 3BVNA 1N4XH 2D3VA 4Q9BA 3GGWB 2J56A 4XP1L 3NACH 2ZSVA 4MXWL 1UTDA 3O81A 2OS7A 5CKGA 1OGAE 3D39D 4PJXF 4RDBA 3RPBA 1C8QA 2HH0H 5MENE 4BE5A 4F58H 1BVNT 1ORSA 3ETTA 3HHRB 4L5FL 4NIYE 3PY9A 1MDAA 1I3GH 3CVHA 4D8PB 5GS2H 4ENEC 1JG9A 5DUML 5J1AB 1S7TB 5DEGA 1XL4A 4DN3H 4LLQB 2FBRA 3QAZB 4IMLA 2W8CA 5E2TH 3QAZC 1XGTB 1L4IA 3EYFA 2FEDD 4E42A 5D1XE 4HC1A 3FCSB 2GTWB 2CZNA 4FQ1H 5HI5C 1JZ4A 2D3NA 4ABVA 1WBZB 3NIDB 4RQQA 3QEQA 1ECZA 2HT4D 3UCRA 1IUZA 4DIXA 1KELL 3WEAA 3S96A 3ZDYE 4J3WA 5D1ZI 1XGYL 5DJYA 3UTSA 1ET7A 2FSEB 5L2KE 1JXFA 1JXGA 2X4TB 5FYKH 1DN0A 3N6YA 4M8QA 1K4CA 4XVSL 3E9UA 2GAZB 4D9RE 4QXVA 5A6MA 3IXAA 4JGJA 4FA7B 5IR1A 5C6PB 1FO0B 1R3JA 1SEQH 1JV2A 4AK2A 1MCNA 1PCXA 4ZX4A 2CO3A 1RPQA 1EHKB 3QXAB 2OMUA 3SGKA 3ARFA 5C0CE 1M05B 1TZOA 4JQVC 3UYPA 4RNRA 5I1CL 5I1KL 4AV5A 2EEDA 1UB5A 3DI2B 1EUTA 2FL5B 3O2WH 3VRIB 1L6XA 3K4ZA 1OSPH 2KLRA 1Q0EA 2A0LD 1DJXA 1L0XA 4RISH 3AAZA 5T3XH 3DROA 4U4IA 2FECL 1E4XH 3FU7A 4LRNL 5IMKA 1JZDC 4NP9A 3UJJL 5BVJB 5E6IB 3ALXA 3QXTA 5DQ9A 3L3JA 4RZKA 5E6IC 5ICYB 4PN6A 3TA3A 4H20H 1U4FA 4JNXA 2FGWH 3ASNB 3FT0A 1DBBL 1OL0A 2APXA 2AC0A 2X7LA 4NQTA 4FHKA 4UTBA 1AQDA 5D5MF 3QQNA 3QWNA 4JAMB 4OUUB 5TE6H 1D7DA 2YOAA 4P4KA 4X98A 2EABA 2WGNB 5EULV 4TKWA 1RJLB 2JJSC 3GFUA 4XRCB 3BUQA 1ORQA 3KH4A 1UT9A 5C2BL 4NM8H 4JK0D 5F72S 3MX0A 2HX9A 4DQOL 5I66B 1HSAB 3ZMRA 4DOHB 1W72H 1G5GA 4QKXB 3ZBMA 2KDYA 2J88L 3HC3H 3MOBH 4F1ZA 3WKPA 3LZLA 1ZV2A 4PS4L 1JRHL 2AJUH 4YBQD 5EU4B 5FF6B 1MCQA 1ZV5A 3BD4A 3HAEB 1ZLUH 3WUWG 2IXQA 4HUKB 3S2CA 3PXHA 4HAFA 1ZY9A 1BIHA 2ZNWA 3DVIA 4NKDA 4XCEA 1S7WA 1LNUA 3QG7L 4QR7A 4NSKB 4HS3B 3W9DA 4PHZA 4WTZG 3WS3A 3E3QE 5EEUA 1VACA 1T1YB 3EO0B 3FRUB 3ZTNH 4UUJA 1XGQB 1FZMA 4JJ5B 4WV1B 4PCSA 4WV1C 4ANKA 2F8OA 2RH0A 4PG2A 1BOGB 1XV8A 1CWVA 1C5DB 5KS9F 4R9HA 3VDBA 2HMID 2EEFA 3S35L 3PGFL 1I4FA 2NXYD 3CDFA 2Y0SA 5GRUL 2BRRH 1RZJC 5FXCH 3VI4F 5I30L 5CZVH 4IMKC 4XPTL 3Q2LA 2K4AA 3ROLB 2GI7A 2ZYRA 1RIVH 2FATL 3ZQ9A 3CLWA 4LLAA 1E30A 4E2OA 5AVUB 1CLYH 4RAVA 4P23C 2Q1EA 1BWWA 5DD1L 4WFGE 3RB7A 1FFPA 2BVEA 3KBHE 5ALBH 2VMJA 1F18A 2M2DA 3CHPA 1QI3A 3OZKA 1WT5C 2ZD0A 2CBPA 3I9GH 5CFHA 2PO6B 4ODBD 1BSIA 3FPXA 3GRGA 3V52L 3WMQA 2PO6C 2CDFA 4RX4D 1QUNA 5KBNC 2D31B 4HK0A 5A2IH 3ZE1B 1U8OA 5JNYB 4F3FB 1IGYA 3QWQB 2XV2A 1PLGL 4PGCB 3NSJA 3DV4A 4RMBA 3ARFD 1PY4A 4Z7QE 3DIFA 1NCWH 1QSFE 2WN3A 3EW3B 3VXQA 4PTUB 2VC2H 2DQFB 4NENB 4YK4B 4M6ML 4YK4C 3UZQB 3H4FA 4MSWB 1FIGL 3RY6C 1JPFA 4BZ1A 5ICXB 5E2WH 5BOZG 1J05B 5E8EA 4LXFA 1MI5B 4YDJB 5TDOA 2FX8H 2UVFA 2F54D 3Q9QA 1NMBH 2IBGA 2VLRB 4FNLL 3ETBF 1T7ZA 3BYTA 2XTJD 4WI6A 5CP7A 3WD5H 5ITBL 2NY0B 3ESVF 4H8WC 2NY0C 1ETB1 3QA3B 2X09A 3WGUB 2R69H 1AE6L 1KB3A 5J6HA 1E27A 1Z32X 3IEAA 2DN7A 2N1TE 1B3IA 1LDSA 4L3EA 5F7LB 3UERA 3EOBA 4KI5F 1PZSA 2GJ6E 2ZKHL 1JAEA 3INOA 4O00A 3UABA 3BLPX 2D4FA 3UPRB 3ZN6A 3JBG7 4NBXB 4QRRA 3BI9X 4GUCA 2AQSA 4P5TA 4I1RA 4JFEA 4PCKA 3OAYH 3D8MA 1A7BA 2ZX9A 4B60A 3FK3A 2HFEB 4Q89A 1KJ3H 1QBLL 1HZLA 3ARBA 3KW7A 5CJQH 3U9UA 5DK2A 3O6FC 1SDDB 3H2WA 2G2NA 3V4UL 4M00A 5IFHH 4FQCH 1A02N 4HWZB 3T0AA 4GMTL 2BP0B 3DXAB 5DLLA 4YUEH 3U0PB 3EJYD 5TE7L 3VXNA 5I1LA 3MTXA 1Y07A 1BM7A 3DTXB 2EE6A 2FBOJ 3EGDA 3LH8A 2OXHA 3MXVL 5DHYA 2BNQA 4YVUA 5KYYB 4JRXB 5JR1H 5C8JB 3OKOA 3F6IA 3PABA 5BO1H 4NPKA 3CZJA 1VJSA 3DSFL 1ADQH 2ITCB 4QYAA 2H45A 3FUDA 3KLHD 4XX1G 3BUTA 3S98A 1HCZA 3KPOA 4R3SB 1XF5B 2H32A 1Z0NA 1A4JA 5ERWA 4F8QA 2EDNA 1AZUA 1VEPA 4HV8B 4BZ2L 4DQAA 3F83A 4WDIA 5EZJA 3FU8A 4N5UA 3ULUF 4NQVB 3VFNB 2F68X 4IRSD 5E9DE 5E1AA 1Q0YL 3KM2A 2UZIL 1AFVH 4ZDHA 3SPVB 3V8CA 4DEWA 4E41E 3GSUA 2W59A 4D7BA 4LSUH 2KHAA 3B3IA 3V0WL 3Q9PA 2A6DA 4LPVA 3SODB 2MHAB 1D9KB 3PGDA 2EE0A 2CMRL 1ES0B 2YPKB 4U6VL 3QFDB 1E5YA 2H6OA 5JHLL 1ML0A 2YPLA 5KUMA 3KMDA 2E74C 4HPYL 3AWGA 3B8YA 3KWVA 3QJHA 2V2TB 2KPNA 1RHHA 4XZUA 3GJFB 4MJID 2HPTA 5DJXA 4J6RH 1DVUA 1NGPL 2ZXBA 2V2WB 1S4IA 2OL3H 3IAQA 1T66D 3L1GA 4KX9A 3IXTB 3F64A 3GDBA 3K5RA 5C07D 3C2SA 2J4WL 3PAYA 5KYWA 4M5SA 3NFSL 5HHXL 4JPWL 5KG9A 2DYPD 4QHNB 4G5ZL 5C0BB 3ZKNC 4AUJA 3AUVA 3FF7A 2DH3A 1J86A 4R4BA 4K15A 1QFWI 3H85A 3Q13A 2IFGA 4O4YL 5K33A 2WYTA 4ZBJA 1OTTC 5C09D 3SGDI 2WBKA 1XGUA 3BP7B 4F7PA 3ZW3A 1PQZB 2VZTA 3NZSA 1NKRA 1A6AB 3ISYA 4F7MA 2A3TA 3IDYB 3IDYC 4QHUB 3CZKA 2JB5H 4J3SA 3VWKB 5KYXB 1I8IB 2MKLC 3VWKC 2Y24A 4PV9B 4QRRD 1HJBC 4WFHE 4M6OL 2EC8A 3QQXA 1KY6A 4Y5VA 1HE7A 4MQ7B 2VDOH 3W11C 1T5WB 2AQPA 1SJEA 4OFQA 3LNIA 4U3SB 1HHJA 1EGJL 2ZPKH 5CM1A 1X5LA 1F5WA 2PPAA 3WDIA 2PN5A 1DBAH 3U25A 3GRWH 4PW9A 3ULVC 2BNQD 3DSNA 3FO9A 1NFAA 3GSVA 3QZOA 5I8CA 3ZYOA 1Q9WA 5F7WC 5D70H 3LZRA 3SCMB 3ESMA 5DD3H 3SCMC 1ROCA 5F2FA 4MA7L 2Q86A 2DLFL 2IEPA 4ODXA 3TNMB 1OSZA 1TVHA 1BD2B 3WLBA 5E1QA 1XF2B 4ONHB 1NC2D 4F20A 5JZ7D 4WI9A 4MD5A 5MI0B 1RUPL 5MI0C 2RCSH 1FE8L 3NGBB 3IDMA 3ULSB 1T1XA 2VDLL 2OX5A 5SWZB 4RSYA 4PSRA 4UQEA 5A1AA 4R7XA 2J55A 5GZNC 2MFNA 2UV3A 3QCTH 3LS4H 3PRZA 3MLPA 3ETSA 2JVUA 3P9LA 3KS0H 4P9HC 2OK0H 1DE4A 1UD5A 4K23L 4RFNB 1DSWA 1BQ5A 4J1UB 4RFNC 3UTQA 4FI8A 2P5ED 1CL7I 4NZDA 4PGBA 4IOSA 1DLHB 3HBGA 3B6SB 3HZMA 1RU9H 3V4VB 3MJ8B 3VE0B 1MFCH 3A3YB 2Z64C 1BF2A 4PJEA 5GGSB 4R0LA 5A2JH 4YFLI 5IIEA 1QPXA 2G5BB 2QPFA 4MJJA 4A7TA 1DDHA 2YMXL 5IEHA 3V0IA 4PJ9D 2W1NA 2CO2A 2F53B 4NC1E 4MA3B 2PCPB 4GW1A 2VB5A 2CR3A 1T6BX 1W2KT 3GHPA 2J8OA 3CDGA 1J1PH 3HMXH 2IH1A 4JPSA 2D7TL 3AXHA 4CC4C 4HUVB 4U1HB 1QYGL 2EIKB 3UMNA 1N10A 2X4PB 4F9PC 3GPEA 3KPRA 3HLAB 4Y16A 5FW7A 3FO0H 1U2YA 4NRXA 1IT9L 3FTVA 2YD8A 3WNPA 1BEYH 4UQ2A 4LP8A 5DEJA 3ZDWA 1YEGL 3V6OA 1X7SA 2VDML 3H7BB 4OCYH 4R7NB 1UT1A 2EC9U 4FTVA 1KBGH 1L5GB 4QRQA 3HMWL 4MAUH 4EXPX 1YY8A 2OSLB 1NSNH 3OAUL 3LMJL 3OGCB 4GAFB 3G6JB 1COBA 1H8LA 4RGNE 3OKMA 3CFEA 1MHHB 1CFQA 3DMMC 4PYHA 1CU4H 3WFDH 2J1KA 4ALAH 4LESA 4AQOA 2F0CA 4GIOA 3FFDA 1N19A 3D4YA 5FA3A 2H8PA 3WNLA 3QQ4B 2YO3A 5BQ7A 3SD2A 3J2PA 4KKAD 3JZ7A 3KNBA 3PJSB 5BS0A 2YUZA 1OTSD 4W4OC 2NX5E 3WFEL 4HG4K 5JIMA 1H3PL 4ZTPH 1OE2A 3TEXA 5E8PB 1VADA 4LDLB 2CO6A 1H6EA 4N1EA 2ADYA 2P26A 3BJ91 4JZJB 1A0QH 2WLHA 1H9DA 4JZJC 4BRVA 3IPBA 3NJGA 3VCLA 5TQ0L 4K3DL 1U21A 5LBGA 1CI5A 4DP1X 4EBQL 2QPUA 3WDHA 5LGJB 3GMQA 4LCCA 1AXSB 3EFOA 4L48A 4C83B 1A25A 3V2AR 1U8KB 5GRXG 4F7CB 2CLRB 3AMKA 1OF0A 3LEYH 4X6BB 1J9CT 5J89A 3P9MB 2XRAH 2H2SC 3Q8FA 3SGJA 5D4QA 1FNGA 3VQLA 3HI5L 1BZEA 3OVUB 5B39B 2F7QA 2SODB 4M02A 3RPIB 3N06B 1YEJH 3PWPE 4PGJA 4MBOA 5HVWA 3WY4A 2BSRA 4QRBA 3RGHA 3FT3B 1E4KC 5DSCA 5F7EH 5D6CB 2C3XA 1HZHH 4HIJA 8FABB 2BHFA 2OYPA 3IVKA 1U95B 3LSOB 2JLPA 2CHZA 2QVFB 3BPLB 5AVYB 3BPLC 5DMKB 2IQ9L 3EYVB 4HCIA 5T1KA 3P3RA 5C08B 1OGTA 3NIFF 1RPUA 2AXFB 4WUUB 4JKMA 1P7QB 4YBHA 1T5KA 3BZFB 4JPVL 4PV8B 2B2XL 2VDKL 3DVGB 3E9TA 5CD3A 3MLYL 3TESA 2XXMB 4B6ZA 3MROA 4J2XA 2ZP9A 5GIRB 2FNBA 1XGRA 5H35B 4BFEA 5JHBA 4ZW7A 1S9XA 1MAML 2MQ0A 3B37A 1OT1A 1LJMA 2BXZA 3AABA 1X5GA 5EB9A 5GHWL 3UO8B 5DJ0B 4OLYH 1E8ZA 2B08A 4YDZA 5ELIA 3SE8H 1YN6A 3V8OA 1MF2L 3GSQB 1M6UA 4F5CE 3RVWD 1UWEH 2YFOA 4X0NA 2XYBA 6PCYA 3QCUL 1MAJA 3B7RL 3ZQXA 4TV3A 5FO2A 2VABA 2PWEA 4HZ1A 4XPHH 3FB8B 4LFHD 5JOFB 3TBCA 4BQBA 3D25A 4M9OA 3FH8A 3C8DA 5E6RB 4ZOAA 4BA0A 1QZ1A 4Y4HB 5EIIA 4Y4HC 5HHNB 2O93L 4GW4B 1MREH 4PWKA 2YGPA 4GKNA 3GBML 4GUPA 2QT6A 3EFDL 3FHAA 5LCVH 5KN5B 3IGFA 4FTVD 3NZHL 4K71B 1FL5B 4P5KB 4AYEC 3EYQD 1TCRB 4K71C 1NINA 1OAYL 3Q8CA 1QTSA 4UB0L 1EO5A 3RUGF 1MRFL 2YD9A 4A7VA 2LHAA 4FZEL 4PJ5D 5HHOB 3JV6B 3R18A 1Z5YD 1SHXA 5LNGA 4FQXA 2QHRH 4KOCA 1EBAA 1A9BA 2K9FB 3VW3L 3KGUA 4LHJB 2YQGA 4QRPE 2RFXA 5FYKE 2CKNA 3GZKA 4H25B 1NLBH 3HI1A 4OM0L 1CDUA 3ME0A 2DTML 2QHLA 5SWSA 2CBMA 5KVFH 5IREA 3II3A 1YZZA 4TN9A 3TIDB 4XO5A 3HZKB 1EO7A 3S2AA 4ONGH 1C16B 1ZGLA 3FH5A 1ZHKB 2DJMA 4LP5A 4RAHA 3WENA 2YSSB 4BSVB 3T8XA 4DK6A 3CSYA 4GP5B 2P80D 3IDIB 1UFUA 2NZ1A 4PRPD 4DGVL 1B3JA 4X4ME 1U3JA 1C08B 1H6UA 1G7LB 4PRHA 4BRJA 3CCHB 1ADWA 2V5RA 3H2PA 4P59L 2N56A 3CFDA 2BOCA 3ZHLA 1OD7A 2FIKA 1ILUA 3C5ZB 2R0ZH 4TNVK 4UM9D 3J8F7 4XVJL 5IB1B 4CDHA 1GZPA 1NGYA 4E5XG 1KTLA 4ELME 1IEBB 2V9TA 3HE7A 1CT8B 3MRKB 3W2DL 2PMZA 1QSEB 2BP3A 4JKNA 5DK3A 4I1PA 5CLZA 4V2BA 2ZWZA 1WZ1H 3IJYA 3ISWA 3LQMA 2LV4A 5FKPA 4KKQA 1TETH 1KCRL 3QDJA 1XQ4A 1TMCB 4JO5A 4FFTA 5T1KD 3OKYA 5D4HA 1UXMA 3KGTA 5CCJA 1KYAA 1CGVA 2XJLA 4FXGA 5IVZA 3OGOE 1IC1A 3RU8H 3D4ZA 3MV7D 4NO5A 1TTGA 3LKOA 2BVYA 3ZRCC 3N3EA 3ETBJ 2Z8WC 1OARH 1PZCA 1U3NA 1H8NA 4KC3B 1SXAA 3FRPA 3SY0B 1C7SA 4CKVX 3AU0A 4OLZL 3WIHA 3KYKL 3VFUB 2HTKC 3D3VA 5D6DC 1XZ0A 4ZXBB 1QW8A 4ZXBC 5AKSA 3WIFA 4TUOB 4YHKL 2DIBA 4OU3A 2G3NA 2JKLA 3B43A 3CK0L 4N6QA 3BZEA 3RTQA 5HYJA 5I8OH 4ZD3L 4B9FA 2AK1H 3PCYA 4ZUWB 2V9QA 4PRNA 1A1NB 4GIPD 2OR7A 5CBAB 1BPLB 1IGFH 3D34A 3T0ED 3LRKA 4A7GF 5CAYB 2ZONA 3DX0A 4YDKH 4PJIA 1FDLH 4QNPE 1WE5A 5AVVB 2E9IA 1NAMB 4QOKB 1WFOA 35C8H 4HLJA 4NPYB 3FB7B 4L4TA 1EPFA 4PJBA 4R7DA 1YYML 1KIPB 1UVQB 3K91A 3V9FA 4G2AA 1PKOA 2VLME 4LLMB 1KGUA 3RZWA 2A73B 4FQXD 2O5NA 1JPSL 5GRZA 3Q5OA 4RRPM 1Z1WA 4TTDD 4JL1A 3R7RA 4TNVF 4Z78A 2G5UA 6CGTA 2VISB 1AO7D 4LL9A 4AM0Q 2F1AA 2ZCZA 2J1YA 5MEQA 4PJAB 1IKNA 2GUOA 4UQBA 4ZMVA 5SWSD 1JVOA 1SM3H 3EH5B 4G70B 4DUWA 3FU5A 3Q6GH 4MXVE 5EFIA 2HKFH 1OT4A 4Y4KB 3L9RA 3IFPA 4WK2B 4XBPB 1LK2B 4WAFA 5HJBA 1W6LA 4WJG3 2GI0A 3QNXA 4PG9A 2A74A 3NJXA 2MPVA 4PJDF 4UAHA 5JDSA 2Q0ZX 2J6EA 3VD7A 3RGBA 3IDNB 2Y1AA 4OF3A 4OQTL 4B53A 4Y7MA 2OMTA 1DSYA 1O6SA 1NUFA 4LK4A 1WAPA 1EWHA 2BHUA 1CLZL 3NRPA 4WW2B 3MREA 4YEEA 2W92A 3DUSA 4WW2C 5ABAA 5IQ9B 4OCXL 5FM8A 1OP9A 5HHVL 4NQCA 5KSAD 4AV4A 4HPHA 1ITBB 3N1MC 1HIML 3IM1A 3O3BB 3B9KB 3HE7D 5IB5B 3VH8A 3T65B 1E40A 5FW8A 4NNPL 4NUPA 4AMXA 2FR4B 2W81C 4TSCL 3BHBB 1NJ9B 4JFQA 4B41A 2BFGA 1YLBB 2GBAA 3US9A 3E8UH 4MNGB 2IPKA 1PIFA 1C9SA 5FYJU 4AG4L 5FOJA 4XNYL 3QDJD 1CE6A 1LDPL 1LMIA 5GISH 4PB9H 3IDUA 1DQLL 4WWID 4FNTA 3GF8A 3IDJA 5ECGA 3THML 5I28A 2XZCL 2X1OA 5AB2A 2CCWA 3V0GA 4TVSa 5IUSA 4GXFA 4F27A 3HIZA 3LQAH 4IEFA 4PMFA 5EBGA 4OTXH 2A83A 4WI5A 2DBLH 3TT3L 4KDTC 5LXVA 3OR6A 4LARL 3MNVB 1TTUA 3L81A 2BWQA 4W6WB 1BZ8A 3LKNA 3MBWA 4XAWL 4P5RA 5IFJA 1L0PA 3QIUA 5AYUH 2BH0A 4Z8FH 1LQSR 5E99L 5BW7C 4C56B 3NCEB 2EIEA 3L3KB 3HJ0A 3L1OL 3D3VD 1R5WA 1T7XA 1B9ZA 1CTNA 2CRYA 4HGWB 3L4YA 3UAAA 4O51A 5T33L 4ELDA 5CCHE 4QHPA 4X9FA 4PB0L 3RWIB 1U9KA 4CGUB 4PJHF 1WVZA 3X3GL 1JWSB 2R2HA 4XPGH 1GCYA 1X9UA 1T03L 3BAEH 3APMA 1G0XA 4P2QE 1C5CH 2V5SA 2DEYX 4XMPH 2F74B 4MWFA 4AOFA 4YMPA 4YSSA 2YGVA 1DDTA 4ISVB 2YA0A 4I3SH 4JRYD 4NQED 5DJ8B 4M43H 2BC4A 1JOIA 3JWDL 1DJZA 4IGBA 3P11L 1U3HD 1MWOA 4KQ4L 3ZLQC 1VKXA 1NBZB 1FLTX 2F5BL 2WIIA 4WFFD 3SBPA 1T3FA 3FTXA 4Y89A 5GRJL 3VXRB 1MCFA 1OAZH 4LIQL 2VDPB 3B1UA 4PJDB 1UACH 2JXMA 2HFFB 2WD0A 3L3OA 4ZUSA 5D71L 4AV0A 5EF3A 5LBSH 4OFDA 5D7LE 1QA9B 3MNWB 4H8PA 4TSAH 5CINH 4JR9L 5CU5A 3FCBA 3D85A 2CH8A 3FQNB 3FU9A 4MJ5A 2EZ0C 32C2B 4RETB 4YVNA 4HK3J 1INEH 5AAWC 1NBYB 1TVDA 3V4PB 1LWHA 5D7IA 3KPSD 2ADGB 4XNQB 1IGJA 4N0CD 3SYAA 2Y23A 4TYUA 3UYRH 1VPOL 2WXRA 1YNLL 3ZL1A 4NWUL 1BLIA 2DMBA 1NMCB 3QZWA 1NMCC 3AQDA 3EO9L 4XX1E 4UT9L 4M29A 1EANA 4KROB 1U92A 3D0VA 2CIIB 3B9VA 3EJZC 4KROC 1T80A 3EDJA 4UINH 1F58L 2IV8A 3GSNH 3VRJB 4EQ2A 3VXSE 3SJVB 3TPUA 4HHWA 3IDXL 4WWNA 3ISRA 2PPDA 3U1SH 1CFVH 4BDVB 3U6RA 3B5HA 3BGMB 4BFIA 4GB9A 1AGBA 3EGXB 3AU1A 4I0PA 4LCWA 1SXNA 1F13A 4CU8A 1ZK9A 3SDCA 4HOZA 5HP5A 1M2VB 3QSKB 1KV7A 4LOVA 3GO1L 3WFZA 2LLLA 3B2PA 3DX7A 1H3XA 1BG9A 2EE3A 4AY0A 3IK2A 2IGFL 3F7VA 2VMEA 3TTYA 2XNAA 1FO0H 4RZCB 2HTLC 4JO3H 4PJHB 2NNCA 5CCKL 1T04A 2XZAH 4GRLB 4AM0B 3AQXA 2YA2A 4GRLC 2FBJL 3CGTA 5EZOH 1Z3GL 3CVCA 1G7QA 2Z8RA 3H0TA 3RZCB 3BAJA 1FZKB 3CBRA 3H9SB 5EU7C 5E1IA 2CPCA 5BRPA 1F2QA 5CXPA 1I8UA 3FJTA 1J8HB 3HC4L 5DRWA 5C97A 3MBXH 5F7YC 2X28A 1SQMA 3VD1A 1TYJA 3B9EA 1SF5A 1EJOL 3SDXB 4XXDB 2X12A 5EO9A 2MH4A 5C7ZA 3TNNB 3C2AH 4XCYA 3V5KB 1PX4A 3V0FA 3W9EA 3HAEG 4UQ3B 1B2WL 2BY1A 1E67A 4JRWA 4O02L 5LXGH 1GYCA 2WQWA 5EEZA 5F9WB 2IADA 4YZFE 3O6MH 5F9WC 1P2CB 2YQBA 2MNWA 4KPHL 2OSXA 4I18A 4HISA 3LNGA 3RY5A 5TPWL 3H7LA 1ZSHA 3R1GL 3GKWL 2BVPB 1QNZH 1KCWA 2MCPH 2IANA 5B8CB 1JZHA 5B8CC 3BSZH 2R56L 3KPMB 2ENYA 3MRCB 1HX0A 5DFVC 1Z5LA 4GG6F 3MR9A 3QQDB 3CSBA 3QPKA 4CADB 4HZAA 3TJHD 4P57B 1JGDA 2ZYIA 1MCWM 2X3AA 3CXFA 4DHLA 2CJUH 2JV6A 4Z76B 2DQHH 2ENSA 3HAEH 1DSFL 3BDYL 3MV01 4NGHH 3U6XS 2CJ3A 1A7PH 1KACB 1OCZB 3CZFA 2XN9A 3F85A 4Y2DD 5A7BA 5AL8A 1JZ2A 4DO6A 4DGWC 1FZOB 4L1BA 5F7UA 1E6JL 1H0DB 3T04D 5L2JA 3O4LE 2R83A 1GVIA 4R90H 1JF6A 1R3HA 1QATA 3CC5B 3FULA 5K69A 1Y1UA 4QD2E 3L16A 4FG4A 5HDBB 5FAAA 4ANWA 1R0AH 3EJSA 4V1DE 3O45B 2G3XA 4IBYA 4CVWA 4XNAA 3IKKA 1G84A 3GLDA 1RZJH 1JNLL 2QQKH 1J9TA 2HN7A 5EUOA 2CJSA 2NT0A 5T8IA 5FO9B 4FQQA 5IGXH 4RBPH 5I18L 5CGYC 3UJTL 4UZUA 3VXOB 3MPCA 4DK3A 3NJKA 4ZUTB 3I2CH 3G6AB 4G8IB 1KOAA 4W9FC 4I0PD 4LCWD 2R2EA 1OTUD 3MA9H 5I6PA 2EIJB 2K9UA 2DKSA 2DEWX 4Q2ZB 1RFDL 3VFPA 4E9XA 5LGHH 2OMWB 1DQMH 3AUWB 3BRDA 5F96H 2KUTA 3H55A 3GI9L 1YPZE 4AVHA 4Y5YB 3Q7JA 1CICA 4OFYA 4Y5YC 3NEEA 3G5XA 1NDGA 2ZKWA 1JZ5A 4EVNA 2PPFA 3MUJA 1HYSD 5E4IA 2FX7H 5EC2A 2PR4L 3G3LA 1QR1B 2UXVA 4HG4J 1I8LA 1IFHH 2EEAA 4XXWA 4KKRA 4HT1H 2ZTBA 1O6TA 5DURB 5TGBB 5HVGB 5CEXA 1HHIB 3OKLB 5J9PB 2EINB 4NT6B 1PG7L 3IGKA 3VFOB 4IK7A 4WVRA 1PW3A 1LE5B 4LASL 5L7XH 5M95B 3ZDXE 1UURA 1AH1A 2YAFA 2X4NB 4TQEH 3T4YB 1JHLH 2Q2LA 4N5ED 5HVFB 2VR6A 4GG6B 1NL0H 4WUKL 2ZCLH 1S78D 1WS7A 4KTDL 1UM5L 5EEWA 3GMPA 1EXHA 3EZ8A 2MTAA 2WLIB 3U2IA 5L2KA 1H8OA 1XSIA 1KC5H 3A4AA 3NQKA 4JN2A 2YXFA 4XH2B 3FTSA 5IBLC 3S3JA 4LCYA 3D87B 4M5YL 2I07A 1CYXA 2HG0A 3D12B 2YKLL 4WGVB 5DYOB 1HL9A 5IEKA 3N2JA 5DJAA 2P8PA 1WCBA 3NJFA 5HJ3B 4N8VB 3MRIB 1EEUA 1S9WB 4M5ZH 3P69A 3PQYD 1BJ8A 1KBPA 4AQ1B 4AQ1C 2IAND 2OA9A 2AV7B 1OQXA 3RVXC 1FIEA 3EG9B 4CNIB 5C0CA 5KSVA 2Y1YA 2LU7A 3AM8C 1H15A 4PP1D 2AEOA 2ATKB 4PJ8D 1W0VB 5H94A 5IFAL 2I85A 5JW5A 1JZGA 4Q9QL 3BX7C 5FWRA 3VMNA 1KN2H 2E3VA 2V9RA 4HKBA 2FO1A 4XHJD 4BWWA 2D7QA 4WJ5A 1LEKB 1JDAA 1ZCRA 2WCPA 2HRHA 5HJGA 2YBRA 3BW9B 4KJYA 5I76B 2DQGH 4TSBL 1FFRA 3UH8A 2EDQA 2ED9A 4FFZL 4G43A 5T1LA 5JXEC 5DJ2A 3T71A 2DJSA 3SKMB 1UB6A 3WAJA 1M1XB 1LK3H 3PV7A 5D1ZD 5FHAH 3T8MA 3WNKA 1F45A 2OQJA 3HUJE 4JDZB 3QGVA 2NTSP 3FXIC 1SF3A 4DWHA 4JM2F 3CHXA 3OF6A 3RWDB 3U2SA 4ODSH 2C1OA 4NRZB 2XN0A 2Y69B 2ITFA 1J9SA 1HWGB 3QQ3A 2GTZB 3JWNC 4KNSA 5DT1L 4P8QA 4JFDB 3X3FH 4D0BB 4UQDA 4APXA 2D2CC 4QGYA 4RGOL 4ZMPA 1X4XA 1ZTXH 1URZA 5DRZB 1BWMA 1QO3A 5D2NB 3TWCH 5EUKA 1I7ZA 1FFNA 5D2NC 3QC5X 3MLXH 3PDDA 2GBTA 5CILH 3UC0L 3K4DA 2XWCA 2JJWA 2NR6C 3DLQR 3BN9C 1D6VL 2DKMA 1RUKH 3Q2CA 5E51A 2C26A 1K72A 5JTWA 4UU9B 1OGAD 1WGOA 1XAKA 4OZGA 3MLVL 2BVOB 3ZIYA 4DVBB 1TQTA 5DMYA 5MEND 5DHVA 1A6WL 3RKDD 4YWGH 2VDRB 1KCBA 2R0WH 2UZYB 3EUUA 5BRZE 3Q05A 3C6SB 4PBDA 2IIJA 4WI4A 4G1EA 3MRNA 4H0HB 1BZ7B 2LU5A 4L23A 4IRZA 1I1AB 3TO2A 1SVBA 2APWA 3VFTB 1I1AC 4KY1H 1YNKL 5D1XD 4QXTB 5IHHA 4L37B 3VSVA 5G5DB 4DTGL 2VUKA 3FOLA 3KYNB 3LKPB 4IIQA 1BIIB 4MLIA 1XX9C 5FM4A 3SE9H 1EMTL 1HXMB 3ZR6A 3MRDB 4GY4A 4GJTB 5KVFE 4BE6A 1BX2B 3MJ6A 1JNNH 1M7UA 4NAJA 3S4SA 4GKSA 5GS0D 1T1WA 1WAEA 4K9EL 4QKTA 4IQHA 3U83A 2AEQL 1N0LB 5DS2A 2B4CC 3QISA 4D9RD 4PLOB 2PWFA 1ZVYA 2VERN 3FQ4A 5IVXE 3BZ5A 3N91A 3RLSA 1UM4H 5C0AA 1N67A 4PJFA 4M7JL 5ESQA 1FVEA 4A6YL 5GRYA 3HNVL 1O7DE 3HCVB 3ZT7A 3MKGA 2ZCHL 4EIBA 5F9AC 1MCDA 2OZ4A 2VM3A 4OM1H 2ZJSH 4K94C 3TBWB 3QJXA 4JM2B 1VSCA 3FSAA 1QSFA 4KK8C 2OR8A 4JM2C 3DO3A 4WEBH 3ULUH 3V6ZB 1REIA 5K1VA 1A64A 1Z6JT 2VLJE 1K5NA 1JDDA 5IG7B 1IM3A 2ED7A 3I50H 2B39A 4MMZA 2BRQA 1V10A 3IE4A 4ZTOL 3FQUB 4AGNA 5ISZE 3LD8C 5DCCA 3D2UA 1EEYA 2E47A 3CBJB 4LLWB 4G9DA 1EDHA 2W95A 2HA1A 4IKLA 2OMYA 1OE1A 2UWEA 2NDFA 1VDGA 1A6ZB 4M48L 3O3DA 5HHME 3GMNA 3P0VL 4NQDE 2OYMA 4L2LA 5EO0B 3ARGD 1FG9C 2N3JA 1BFTA 2GHZA 2VL5B 5CIPH 2VWEE 3SOTA 2Y7QA 1HHKB 3N1QC 1ZOXA 4XGZB 3G04B 1IL1B 3IKCA 4HWBL 1TTRA 3LH2H 3PGCB 2GJ6A 3FO2B 3FUIA 3ZKSD 4WI8A 4OF7A 5AKRA 2JELL 4HD9A 4W6XB 1SHSA 4XPAH 3ZZQA 2JQAA 1KT2B 3QIWD 4WO4A 4P9HH 1SFDA 4AQAB 1QBBA 2H9GB 1F90L 1OT2A 2O5ZL 4N2OA 3ABKB 4QXUH 3GEFA 3RVVD 3WO3B 2QQQA 1M7DA 5LWYH 3N0AA 4X6CE 5GS0L 5CSZB 1CLVA 3V4VH 1KJVB 3WN6A 2J1ZA 5DRNA 3V9EA 4XP4H 2DMHA 3VGFA 4ZMTA 1X5ZA 2NY2B 5A2AA 4X5RA 1KYFA 1IC7L 2VO8A 2K6WA 4P48A 3LIZH 4MCYB 5HYFA 3AG1B 4Z3IA 1YN7B 2XG5B 3QEUB 2NXZD 4GH7B 5FO8A 5HY9B 4CSZA 2AFNA 1F1GA 1UUSA 4K7PY 4X5WB 1HAWA 2O6CA 3CFJB 1RVFL 4JKWA 1H8SA 1OM9A 2ESVE 4GEJA 4HUNB 2GIXA 2QADD 4M8UA 3T3PE 4OF6A 3GINA 3N44B 4U1SA 1MW2A 2X9XA 4OCRL 3PE9A 1ZSDB 3LRSA 2MCAA 4NXSA 4BWTA 1MWAA 1J87A 5IK3B 4AKQA 5KZCD 1SBBA 5DI8A 3LZFL 5E9DA 1D5RA 2DAVA 5LG6A 1OB1A 1P84K 1OO2A 1T2XA 4H0IA 4N8PA 1Q8MA 3EO1A 3ABMB 4E41A 3TCLA 4NDMB 3A67L 4H1LA 1AGEA 4WFGD 1A4KA 1INQA 4KI1A 4P9MH 3T2NL 3P73A 5IOPA 3BKCH 1U8MB 3GRBA 4XO8A 1E4WL 3SDDA 3G5ZB 3KGRA 3UEZA 4G42A 3NDYE 1FPTH 1I3RA 3DECA 2WMPA 2EDXA 1YEHL 4L4VE 4OAWB 3P3UA 1DVSA 2FT8A 3JTBA 3O41A 4B7LA 3C5SB 2VXSH 4DGYL 1YECH 2YK1H 4NO3B 3GSOB 3WL9B 2BINA 2ENJA 2V17L 4KV5F 1MEXL 4ORGA 1QD0A 1M6OB 1OP3K 3BGAA 2LABA 1A5FL 3ZE2F 1QSFD 4NFCA 1T83A 4KTEL 5DZAA 4L8CB 3D9AL 4G80A 1BBDH 5E8DL 3BQUD 1DBJL 1G7HB 1LO3H 1ZLWK 3EOAA 1FCCA 1CLOH 4TM9A 3ZGIA 5C71A 5F3BA 2WJ7A 1KSRA 4H44C 15C8L 3L5XH 1D5MA 1M71B 3COOA 1JL8A 4BSJA 1X5MA 1Q9KA 2DKUA 2H2PD 4XMKH 3HRPA 2IALA 2IDCA 3BCFA 4JO2H 5BVPH 2WB7A 1JGUL 4YLBA 2GQHA 4N1CA 5CD5D 4WSJA 3QNFA 1RZ7H 4HHAA 1X5FA 1JPGA 4PI0A 2DWEB 4JRFA 4ETQB 4KUZH 5JPNB 2NUPB 4TUJB 4LLUB 4HIPA 1F00I 3L2NA 5FUCE 1JGIA 2GJ6D 2RGSA 4L8BA 1HOCA 5C3LD 2R4SL 3AITA 5CEZH 3Q01A 3QHFH 2W5PA 5FDWB 3GS7A 4J3TA 1E5ZA 2D73A 2XVBA 4NZJA 3UG4A 4X8JB 2HKHL 2WC7A 4Z3EA 1I9IH 3OKDA 3S34H 3ZMEA 1N68A 1I8MB 2EKJA 5JHDB 3QEGH 4OGXH 1BQHB 2WIMA 3KPPA 5EC1B 2E6QA 2ZQKA 4G7SB 5C0JA 5AW9B 3EJRA 1BF5A 4ZNCD 1UOWA 5TTRA 5IJDC 4BKLA 1QPKA 3QR1A 2AV1A 3WEXA 2QSCL 4KVNL 4RIRB 4ZO9A 2VJXA 4QT5B 5GGQL 5IROA 5EEVA 5CZXC 4J3OC 1QRNE 4M4RA 2WXOA 4LSPH 4W9HC 4U1GB 5KW9H 2JB6B 1KN4H 3QEHB 4U1GC 2IDTA 4H5SB 4KUCD 1IQDB 4NUGL 5DD6B 2ZOUA 1MFEH 4X4KA 4XN7A 4BCZA 1DJGA 1N7ML 1YY9C 4FQJL 3ZKMC 2MNUA 1HWHB 1JZFA 1UOLA 4G8EA 1KIUB 4LAQL 4KRPD 1TVBB 5E9DD 4HA1A 1M2OA 1E3XA 4ERSH 1EXUA 3UJIL 1CR9L 4AC2A 5F0MB 3P2TA 2F15A 1LE9B 4E41D 2O6FA 1FG2B 3I02A 4EN3A 5J8OA 4AW7A 1I3VA 4DPBX 4YDLC 3RDTD 1TLKA 1Q72L 2GITB 2AXGB 5J11B 4GW5A 1W16A 4ZPTA 3SDDD 5I15L 1JN6B 4G6MH 4OFPA 2C4FU 4MNQE 4GXUN 4U31A 3PDOB 3FQTA 5B1KA 3BFQG 5EZLA 3GMLB 3MRHA 5F1NA 3H9ZA 3GK8H 5I6OA 1FJ1A 5IHUL 2B0SH 3I3EA 2R9HD 4P05A 4Y2OA 4Y9BA 1X5YA 2W9DH 4OBSA 5F0LB 5FYLH 1WC7A 1TUPA 3AG3B 3KPQB 3BE1H 3VWJB 4KJWC 1PYWB 4KHTH 1JHKH 3I9IA 3VWJC 2FVNA 1LO4H 3L7EB 1YVLA 1GZHA 3ZDZE 3VXME 3U4BL 2HVKA 1CD1A 2JCCE 3IN2A 3QHTC 4Y4FB 3X1FA 4Y4FC 3O11A 5C0DB 4HDIB 3SPHA 3N85H 4KZEH 1W9XA 1KIRB 1NEZB 3TBBA 2R0KL 3ZTDC 3M8OL 3PPSA 4JEGB 4AYFA 3F04A 4UILL 2VXTH 4JFFB 4FABL 3CBKB 1HINH 3B83A 1KB5L 4Z7WF 2GCYA 3QVAA 1H3WM 5JLZB 3MGTB 3S3SA 1WFJA 2BFVH 3OLGA 2J5WA 4LKXA 4OZHF 2CDGB 1UWXK 1N5YH 4LP4A 1BCIA 1HILB 1GHFH 1YEKH 1YG9A 4JO4H 5DJCB 1QFWL 3D4GA 2FUTA 2ZXEB 4Q9CA 2BHZA 1DO6A 4YSRA 5D93B 1RZKL 3TFKD 1GAFL 1U8HA 5EOCL 5D93C 2P1YA 4U3CA 3WY1A 5D1QC 4BSWB 4E68A 1CBJA 4DETA 2VRKA 3FSWA 3QUKA 2DIJA 1NCUA 4TQ8A 1OWWA 2E7LA 2YXVA 3HB3D 4N2IA 4OGAD 1B0IA 4HJJL 3QJOA 4FQHB 4NEHB 1JHTA 1IBDA 2GPZA 2ZP0T 4JFZL 4MX7A 2ZNXA 3CFBB 3F7YB 5GGRY 1OM3L 5IB2A 2XDHA 3BT2H 3FO1B 3ZOAA 3BC9A 4PJXE 3TBYA 2NZ9D 4GKZB 2E9WA 4NB7A 1MVYA 4K0OA 3RIFK 1JZ6A 4RDQF 1JZ7A 1KEGH 1IGMH 2IBZX 1E7VA 5AQ0A 1CDHA 3FUFA 4U1NB 4X9YA 3ZQWA 3DTUB 4AMWA 3NH7L 3EYUH 3AC0A 1DEEA 4DOHE 4CMMA 1FP5A 1JZEA 1TKWA 4UV4L 3FN0L 2PYEE 3PFQA 4U6TA 3V0JA 2XXFA 2QGCA 2AJXH 2WXIA 3BIKB 2NNXA 4KVPA 1HZKA 3PWPA 1N59B 2R7EA 5AAMC 2VSDA 3FQXA 3MBEA 4JJOA 5DVKA 2O1AA 2QLYA 4PI2A 2P5WE 3W0WA 2GFBB 1YAIA 5FKAA 1GS7A 3VG0L 2FWLB 5TE4L 1RUQH 5IESH 4N24A 4WLCA 3SE3A 3ECVA 4OGYH