3LZOA

Crystal structure analysis of the copper-reconstituted p19 protein from campylobacter jejuni at 1.65 a at ph 10.0
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
159
Chain Sequence
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transport protein
molecule keywords P19 protein
total genus 33
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzoA00
3LZLA 3LZOA 3PJNA 3LZRA 5I0YA 2O6CA 3NRPA 3LZPA 5I0XA 5I0WA 2O6FA 2O6EA 3LZQA 3NRQA 2O6DA 5I0VA 3LZNA 3PJLA
chains in the Genus database with same CATH superfamily
4JM4L 4UCFA 2ZXGA 4FQIL 3NSCA 3VFWB 4WSKA 1IKFH 1ADQA 1XR8A 2MCMA 3TVMA 2VM9A 4M62L 3NCYS 1WA2X 1BAGA 4LHUG 4PJBB 3WTYA 3DECA 4WI7A 3VFUB 2DQMA 3PGCA 2VKXA 1A4AA 5IJKA 2EXWC 1ZHKA 3EG9B 2XFXA 1T5WB 3DARA 5ACZA 3IAGC 3QEGH 3UPRB 2JKJA 1V7NL 3K0WA 4Q6KA 4NO0A 3MRBB 3LKRB 4Z0BL 4APQC 5BOPA 3SJVA 1NIDA 4WSGA 1GOGA 4OIIH 4XNDA 3QQ4A 1QEXA 1NTDA 4FA6A 2B4CL 2K0RA 3N1MC 2JB6B 3ECWA 4PQXA 4TLKA 2ARJA 4P4KD 1AVAA 2Z8WC 4YHYC 4E9VA 2AKRA 2VLKB 4C8XA 1S7XA 4IEFA 2HVJB 1P7QD 1G5AA 5KUKA 3BPCA 1E8ZA 4EUPG 3MBEB 1YQVL 1H3UA 5BRZD 3KGUA 4YDKL 1B2WH 3DGGB 3RUGA 4G72B 1NAML 1QI5A 1T66D 2J8UF 1QRNA 3JV6A 4ZW3A 1UZGA 4Y9CA 1IZKA 4EZLA 3UROR 1T04A 2BERA 1YNTB 3GMRA 2LAAA 4X9BA 1IM9B 3TPUA 2EDLA 3UIZA 1RUMH 2COVD 4M61B 4Q4IA 1D6VL 3LQAL 3AQZA 1JPGB 5AKSA 3TBYA 1AGBB 3MJ9A 3WSQL 1KJ2L 4FFZH 2AJVH 4FS0A 3VGBA 3BPLB 4W9EC 1MCWW 4YE0A 4A7SA 4DEWA 2Z35B 3OHMB 4M9PA 1TKWB 1MF2L 2IFGA 4CC1A 4NO5A 5JXAH 1E2ZA 1N0LB 2DBLH 3Q6GL 1A02N 3FQTA 1JK8A 3GNML 4GRMA 4F33A 2EDJA 5C0IA 1X44A 1K72A 4E9QA 5GSVB 3HAEG 2VW4A 1T22A 3MHZA 3CFDA 1U8QB 2XXFA 1NMCB 1C5DB 5HHNB 3BKYL 2CO1A 4P5MA 4WI8A 4C4BA 1R5IA 4GW5B 4RESB 3VI4E 4X5WB 2VABA 2C1PA 4FCAA 2GHZA 2DM2A 3RVXC 1KCVH 2V0AA 4NKOA 4OFIA 1KGCD 3FT2A 5BZWB 1A7OH 1WH0A 3QJTB 4ADJA 2G9KA 2ATKB 2H26A 4UF7C 4WJKB 5FUOL 5LBGA 4YSEA 1GTFA 4WW2F 2VR3A 4IMLB 5KYYA 2ZCLH 1AKJD 4DZBA 3WTVA 4XO8A 4UUJA 4FNUA 2UVFA 3MNMA 1KXTB 2BC4A 4I3GA 4EZMA 1ODAA 2EEBA 4I0PB 3MV9E 4GUOA 1RZFH 3A4AA 4A2HA 3VXOA 2OX5B 3BSHA 3FPYA 3D4YA 2OR9L 5D2LE 5AL8A 2JQMA 3MBXL 3CVHL 2XNAB 2XVBA 3LS4H 4P5KA 5C0CA 2CO2A 4GEIA 1U6AH 1HK6A 1JZFA 1D5MA 3QQ3A 4OJFL 2X88A 3ULVC 3DGDA 5EEZA 3NEEA 1T5WA 5K9KA 3AJ7A 3FSOA 3DETD 3L7FB 2OSLA 5I19L 4FLQA 1OAYL 3P4MA 4N6QA 5A7EA 3AREA 3RIFK 1MREL 1C5CH 3SDCB 4MA3B 2A9AA 2JI3A 1RK0A 1OTTD 1QR4A 2BSDA 5GGQL 3TBBA 4TV3A 1T2JA 3PABA 1G6RL 5DT1L 2EECA 4NS0A 5L6YH 5MEOA 3G6JA 4FXLA 5J89A 3D85B 1TEYA 2A77H 3QUMH 1TTGA 1A14H 2YA2A 4YWGH 4K07A 1YEKH 5H35A 1HILB 3HG3A 4DKFH 3MBEA 1CLYH 3ARYA 3GMLB 3AXLA 4XCCH 5DQJB 2Z7WA 4UU9B 5KSUB 3K6IA 4HYTB 3VFVB 4F27A 3UZVB 2MQGA 1AHKA 4E41B 1S3RA 5ISZE 4E5XG 4HVBA 3VFRA 2X4UB 2IWKA 2KS0A 3H4FA 1YMME 4MLSA 4YSDA 1WZ1H 3ZVVA 1RZGA 4DCQA 2UZIL 2MWCA 4F7EB 1PSKL 3ZN6A 3QYNA 3V4VA 4Y2OA 5CU9A 4YGVA 3SPVB 2DEXX 4MQSB 5BUPA 1ZAGA 2XLLA 3Q1SH 3GSOA 4AYBA 4Y89A 4IBWA 2WXJA 4MJ5A 4QKXB 4WW2C 3KWUA 3M1CA 3U36B 3K2MC 2Y36L 7PAZA 4M8VA 3ME0A 2EYTB 2XBTA 3AY2A 4H40A 4LRIA 3SBRA 1JNNL 1SFHA 2EZ0C 3BVNB 5EH1A 1OGAA 4LEXH 4M7ZC 3BQVA 4XXWC 3EJYD 3FMGH 2Z93A 4ORGB 1WRFA 1JRHH 3GIZH 2KYIA 3C6SB 5FB8B 1QPPA 1Q9WB 1MAJA 3DI2B 4O2FB 3NCJL 3AAZB 3KPMB 4OJEH 5BVJB 2NUPB 5CEZD 4GT0A 1WUNT 1T1XB 2BOLA 2FX8H 1N6QL 2EO7A 3RVUC 4GUPA 1ECZA 4XPHL 4JZNA 4PJBF 4W6YB 5JW4Q 2ITDA 4JRWA 2BNQD 4NUGL 5DMGC 4GSRA 1OCOB 3WY4A 1WLHA 4W9LC 4X9GA 1EGJA 5KVMC 1OOAA 3BKCL 4X6FB 4YUEH 5ILTL 4IIZA 4MB1A 5G4NA 3EH1A 1YPZA 3D2UA 1DLHB 1Q9OA 4NKMA 4PYGA 3U0TA 3IDMA 3RWCA 1OPGL 4PJDB 1Q0XL 3CZEA 3MXWL 1BCIA 4YXKH 3TCXA 5EF2A 1XR8B 3TVMB 4P2QA 3TT3H 3WLBA 1UWEH 2AVFA 3IWVA 3LKOB 4YZFF 2VR9A 4L3CA 3UG5A 1ZIAA 4BK4A 3Q44A 5IVXB 4FCHA 3Q2CA 1W9XA 1P6AB 3IMTA 4AZUA 5AYQA 1G1OA 4GQPH 4HT1H 3VACA 4HAGA 3WEXB 2E86A 3WFHA 1FH5L 2DH3A 2L7UA 3ELAT 1NJ9A 2KBGA 2X05A 3SDYH 2NX5B 2XN9E 3MGOA 2BDNH 4NPJA 5JOPE 4OV5B 1RHHA 1KF9B 1SLWA 1RZJC 2HG5B 1OEZW 1QA9A 4RZKA 4X6DE 3WKQA 1X7QA 4HFWA 3RZCB 4F1ZA 1O9ZA 2FO8A 5DMKB 4OQTA 3ZTDC 1PZ5B 4EI5A 2GC4C 4UYPA 2XXMB 4AQEB 1BYNA 4N0UE 1UWXH 3UAJA 4I0PC 4LSRL 5HI4C 2O5ZL 2AGJL 1P7HL 3P0YH 4ZS7H 5AW3B 3X13B 2ZQKA 1O9VA 3NCBB 1G9ML 5EU6E 3SDXB 4JJ5B 1MJ8L 1AQ8A 5DA4A 2N59A 2ZYRA 1JHLL 2EIMB 1ET5A 4GAFB 3DIVA 4OCYL 4NC1C 1BD2D 4M8RA 4HIQA 4IS6B 3OF6A 4KK5C 3UYPA 1RZ7L 2J1KA 5D5ME 3VD9A 4U1GC 4NI6A 4Z7QB 5CIPA 5JW5B 5HDBF 1DVTA 2OQJA 4H2AA 1A3ZA 5DJ6A 2OXGB 4GBXD 3DV6A 1DYZA 4DGUA 3L4TA 3LIZL 1TUPA 2R69H 3TJEH 1B0RA 1QSED 2B20A 3BYTA 3Q8FA 4AYFA 1TDQA 3O2WH 4M7ZB 2O61A 4CL7A 5A40E 3B4NA 4YSUA 4H0HB 2QV4A 4R2GB 2R56H 2Q5BA 1QBLH 2CO4A 1DE4B 2AEPH 1N0LA 4KGJA 4MYPA 1RPUA 1M7UA 1YNLH 5D2LF 4A66A 3SDXF 4LPVA 5GGTA 2WCPA 1OTSC 1DVXA 4FZEL 1MFCL 2B2XH 5TDOB 5IW6B 1P2CB 1KPRB 1JV5A 3Q43A 4NQSB 2YA0A 4O2FA 1ZWIB 3BRFA 4RMSA 4FQ2H 4HWZB 3NFSL 3KDMA 4GXFA 1V5JA 1U8PB 3I74A 3GKZA 3ZQXA 2XQYG 4LPYA 1JZ8A 4DPBX 3WMQA 5GZOA 4QT5A 4QLWA 1JTTA 1WAAF 5FK9A 5KN5A 4P5TA 2C3GA 4NZ8A 4F8PA 3JYBA 4I8DA 4FKEA 1IVLA 3MLSL 3N85L 1A6VL 3X17A 2OMYB 6PCYA 1FZKB 1BXAA 4G9FE 5DXWA 3PQYA 3JXAA 1F6AB 2BSED 5ESVB 4PJDA 2VWEC 4NN6B 4K3HA 4AKPA 2CMRH 5DO8A 1WBYB 2ZP9A 1OVZA 3I85A 4HMDA 2YFNA 3DOSA 4LCCC 4U4BA 3TEZA 4O02H 2ENSA 1XQ4A 2P5WD 1I9JH 2CCWA 4QTIL 4S0TD 1JWSA 4N6RB 1NL0H 1D5RA 1MCFA 1GC1C 1J0HA 4AJ0A 1R3KA 3VFNA 3MLUH 4N87A 3GK8H 1NANI 5GS2D 2PPCA 2F54E 4JPQA 2PW1B 4KY2A 4KO7A 5T3ZD 1J48A 2AHIA 4G7YL 4X6CE 2I60H 5GQBA 5L2KE 4V2CB 4AITA 2WNXA 3GMQB 3QHFH 5E6IB 1MH5A 1VKXB 3SKNB 4AQ8C 4TSCL 4NNPH 1ETJA 2C5DC 1PAMA 2AJYH 2VXUL 3F12A 4H4NA 4PCKA 1XMEB 1RZKC 2FSEA 1KGYE 3P9MB 4GO6B 1ZLWH 5EU7C 3QRBA 4ZMAT 3L1OL 5DA0B 2X4OA 1M05A 3B3IB 1AFVL 4PJGF 1EZVY 5CCKL 1LEIA 3HNTL 3KJ6H 3AQYA 3E3QC 1R5IB 4GW5A 2ZPKH 4C57C 3DXAB 1G87A 4MNQD 2GYSA 3T0EB 5EU5B 3UH8A 4H25A 5BRPA 4BUQA 1W72A 1NCOA 5F9AC 2ROXA 3EZJB 2CNZA 5G5DB 1NICA 2BY1A 4G71B 2E9WA 2YIHA 5F3BB 2E4FA 3BUQA 1F4YL 1LO0L 4LSSL 4F7EA 2C4FT 1A4JA 2XTSA 2YKKA 4QRUB 4Y1AB 1VFMA 3NN8B 1QOKA 4Z7UB 1MG3C 5SWQB 4IOFC 1JGLH 2FEDD 3DUSB 4M7LH 3OX8A 2J43A 1FNSH 2WKGA 3EOYG 4PJCE 1BQKA 1BG1A 4BQ9A 2VDPH 4E41E 1I7ZB 4JO2H 1K4CB 1JYNA 3GSOB 3NACH 4TPRL 1HYRC 3L4XA 1DCLA 5CEXA 1DJZA 1BPVA 1F4XL 4M8UA 2IQAB 4DN4L 1N6UA 4HC1A 5L0QC 1QNZL 2R8SH 2ICEB 2W07A 2MEJB 5DHEA 5MENA 4OF6A 1PDKB 4YE4L 4LSUH 2A6JB 4QJ4B 1KC5H 2B3IA 2V9RA 3ZPDA 2GJRA 4TUJB 2DQCH 3MMEB 5D55A 4K23L 4ZUWB 3UO1L 2HVBA 4FHKA 5A1AA 3LMJH 1DO6A 1IBDA 1J8HA 2OYLA 2VL5A 4FG0A 4R3SB 1PJWA 3U4AA 1UWGL 4C4UA 2CJSA 1KLGB 1RUQL 3GHPA 1YEIL 4A2GA 4MMXB 4F2FA 5EIVA 1E30A 3LKPB 1MJ7L 4N0CD 1VFBA 1NC4D 1U8LB 2I9LB 3O8XC 3CPLA 3P4OA 4IJ3C 1QRKA 4WGWB 4YHYB 1C12B 1EJ8A 2OMWA 1AGEB 4XTRD 4LPUA 1CU4L 4OLYL 1NEPA 5A6LA 1CLZL 3QIUC 4YFLF 2HLAA 5DRWB 43CAB 1E6JL 1HKFA 3AW5A 3BZ5A 1UOWA 1AYRA 4ZW7A 2AANA 4CN6A 4HHAA 1YMHA 1HE7A 2W92A 4G8EA 1CF8L 5CZRA 3EGSA 3AT8A 1R3HA 1HL5A 2IDUA 3UABA 5J1AA 2IALA 3IDXH 4UZGA 3GUTB 2Q10A 4JRXE 1JWUB 3IMRA 5F7FA 2VR8A 1WIOA 3VO0A 4ZO7A 1T7ZA 5ICZA 2G2NA 4HBCH 1ZK5A 2ARWA 4PJGA 3UJIL 4ZAKC 3MA9L 5LN4A 4MD4A 3GC3A 3V4PL 4GLRI 1F90H 1QO3A 3EXLA 2LAGB 4FQLL 4KC3B 4U31A 3VJ6B 3QI9A 4KTDL 3DROB 3G5ZB 3FW6A 3IF1A 5LDSA 5J9PB 2NTFA 3O3DA 1E5ZA 3K5SA 1E3ZA 4Y4HB 4NQDB 1QHOA 1BFVL 2OCCB 2FAUA 4QY8A 3V4UL 1AAJA 4MAZA 1OAZH 3MRGB 4HWEL 3MRDB 4Z76B 4XMPH 1CDYA 1JL8A 3IDYC 3QIWB 1I8KA 4N2DA 5EN2A 4L8BB 1EEUA 5E2JA 4N1CA 4YPGA 2KLRA 1LD9A 3B9KB 1DDHB 2I7OA 1LDPH 5LN8A 4GG6F 3RVWD 2R29H 3NVQA 1F58H 4LDLB 1KIRB 1JPFA 3L5IA 2CUHA 5JORA 1TCRA 2JCCB 4UT9H 1UM5H 5E03A 3TN0D 4JHAH 3TESA 5CSZB 2MFNA 2AZAA 4KNQA 4DF9A 2R27A 2YR3A 4GP4B 2Y1AA 4M7KL 4XO4A 1XR9B 5IVOA 4ANKA 5EBLB 4M93C 4X6FA 4UANA 4P4KC 4GRLA 3VX0A 2YK1L 3LNIA 4FXGB 5FGBC 5IEKB 4IIQA 2HH0L 1I7ZA 2R0ZH 4ODWA 4BFEA 3WFDH 1SLVA 1URLA 1B0GB 3MJWA 4DH2A 3U0TB 1J0YA 4HAKA 3FDWA 2Y6TE 1CGUA 4LSVL 3Q2VA 1QSVA 4JDVA 4NI3A 2BINA 1U58B 2D7PA 2J5LC 4PAZA 3JSSA 4J3BA 4AM0Q 5JW4N 1A66A 5DT1H 1SBSH 1NFKA 1OGTA 1FORL 1BEYH 3BQUD 4N8VB 4Y9GA 4IJTA 4Q74A 1FNEA 2HN7B 3SE8L 1GH7A 2P43B 1OV8A 2ZYHA 2AXJA 2E7DA 1QSFE 1RI8A 3PS6A 5F88B 5E9DA 5TE7L 3SCMC 2H6UA 5FS5A 3CSBA 1MJUH 2IC2A 1B0WA 1MRFL 2Y06H 2WLYA 3HG1D 4A68A 1O6TA 4L3EB 3CVHB 1ZA3A 5HDBB 4FI6A 2KZBA 2O26U 4U0RC 3PXJA 4Z7QF 3OZKA 3MQIA 1AXTL 1HHIB 4Z3EA 1X7QB 3LS4L 1HH9B 4HFWB 3T71A 1LP9A 2HTLD 5AWNH 4F2ME 4AIZA 2DEWX 5C71A 4Y0GA 5CD3A 1X5MA 3E8VA 2YSSA 3O3AB 2BCMA 3ALWA 4UNIA 1AGDB 4WFED 4EDWL 4FFTA 5KVDE 4KKCC 3EYOA 1MAKA 3B7UX 3D9AL 2WXMA 2KERA 4IK6A 4MB3A 1XB3A 2YAEA 4XB8A 2DWDB 4Z7AA 2Y2YA 1UM4L 4W9CC 4HHAB 1T7XA 4LVOB 4YDVB 4JFYB 5J11B 2E56A 2J71A 1AY1L 7FABH 1OIOA 4G8GE 5ECJE 4KJWC 2B1AL 3VXPB 3P2BA 2A0LD 2ZNXA 4QGTA 1CFMA 4FRWA 4ZFOB 5L6YL 3RAJL 2ZSVA 3DUUA 4S1QH 3HI6L 4TL5A 1ZPLA 2IPKB 4MJID 1I3GL 3U1SL 3W56A 2X7LB 3DRTA 1KNOB 3E9TA 2Z8VC 4LOVA 4PSRA 3WKYA 1O0VA 3M07A 4ODHH 3PE9A 4EI5B 3MV7A 4UT6L 4PV9A 2QDWA 1LO2L 3CTTA 5FO9B 2X3CA 5C0DB 1FSKC 3H9ZA 4N2OA 5JPNA 1QFOA 2ZKHH 1M2VA 3HLKA 3OR6A 1FE8L 1FPTL 3ZOAA 4XC1H 5BRZB 5AOZA 2DLFH 2ZWYA 5E8EB 3OWEA 3C60D 3TO2B 1SOQA 2CBMA 4N2NA 4QDGA 2VDRB 1U8KA 1GAFH 1G6RH 3FQWB 2B14A 2L7QA 3A67L 3FSVA 3O3BB 3F5WB 5DD1H 1ZGLM 3WKML 1WWWX 4PRBA 1GZQA 4PJCB 2M83A 2DICA 3MYZA 5I8OL 3LN9A 4IRSB 3QYMA 5KJRL 1MIEL 4G5ZH 2CRZA 3FFCA 3CMOL 1NAMB 4PCYA 1OF2A 5F3HB 5ALBL 5AW0B 3QXUA 4UB0L 1JNNH 4OGYH 3P4MB 4LB8A 1MQ8A 4RGOH 4JFOB 4XO3A 1EO7A 4LVNB 5C86A 4OCSH 1J5DA 1OQXA 1ZOXA 4JJOA 4ONFH 3RWGB 3T0EE 3F00A 5C7XH 1J8RA 2H3XC 3FYEB 4PTTA 4QYAA 3ARFC 2VDNH 1VRSA 4NM4L 5AFAA 4U7KA 4YEEA 2NZ9D 4QXWA 3KEHA 2ZUQB 1N6QH 1KPRA 3OHXA 4JZOA 4I3SH 3LV3A 2ZOUA 5CHNB 5DLML 3A47A 5I1JH 4AVHA 4V1DA 4PB9L 4NZRH 4LSRH 3T4AB 4D7PA 3KYMA 2ITCB 4Y5YC 3N41B 3I6KA 4TQHA 2FK9A 4ODSL 3U79A 4LCWD 2GJ6A 5FX3A 5CIPH 2IH8A 2EIBA 4LMQI 3P0GB 1NGXA 5F2FA 1R1CA 2NTSP 4KZEH 4JL1A 3MJGX 2X4QB 4NAJA 4FN0A 3P40A 2GUOA 3ZQ9A 3N40F 2MNUA 3SY6A 1O5DT 4KXZI 1E50A 1U36A 2CBPA 3CHRA 2RGSA 4EAEA 3CFDB 3BP5A 3VH8G 2Q76A 5FFOA 4U1SB 1G43A 4W4NA 5KG9B 3TNMA 2FJUB 1F00I 5DHMC 3GJFA 1P7BA 4BFIA 1NLDL 2WMPB 1VPOL 5EOQL 3TEXA 4YQXL 4ETQB 3NP4A 3ZDWA 4AYDC 1R24B 2HRPL 4BZ2A 3WUWA 3QW9A 2FWSA 3GFUA 4B9YA 2W0FB 2N0MA 3TO4C 3NIDF 3NCXA 1CD9B 1HAWA 4LESA 3KYAA 3X1EA 2A9NL 1AZBA 4MD5B 3D85D 1R19A 3OXRA 1AHWA 4LBEB 2K78A 4Q6IB 4QRSB 4J3OF 5DZNA 3ULUH 1BQLL 2BWDA 4AC2A 2HKFH 1DVZA 1T1YA 3OAUH 2CO7A 2Q8AL 1TFHA 4FQ2L 3MOBH 1QAWA 5GGRY 2I5YL 2O5YH 1WTLA 4Y9FA 3U46B 2Y5QA 1AJ7L 3QNXB 5KSAC 1J9SA 2UZIH 3WKPA 2XVGA 1F1GA 4JY5L 4NCC1 4IOSD 1J10A 5DZOA 1LO5A 3J07A 3QUKA 3DJZA 4WUUB 2A6DA 3D25A 4GSUA 3IF1B 4Y5XB 2HXAA 1S3KL 2FQEA 4OZHB 3NIFB 3RWCB 5BW7C 4IRZA 1OE1A 3HHMA 5AZ2H 5KYXA 4G11A 1CGXA 1A3RH 1YUHB 3FFCB 1FNHA 4YS4A 3O2WL 1YNTF 1WAPA 1DQQA 1G9MH 3O4OB 3PRZA 4JMXA 3TV3L 2OA9A 2GAZA 5C9JB 5A2IH 2BVQA 2EIZA 1OGAE 1WCBA 3FO2A 4M6OH 5D72L 2MTAA 4RBPK 4P23C 3UMNA 1KN4H 4K3EL 2ZUQC 2XZAH 3BFQG 1MELA 1N12A 1N2RB 4M56A 1EHLH 1QI4A 2PN5A 4PLJC 2YPKA 1MWAL 5E99L 1IC4L 1PG7H 1A1MA 1TZIA 2WVVA 2WZ6A 4LLQB 4U0RB 1I7UA 5DTFB 1F4WL 5I8EA 1Z9PA 2YPLA 4B9PA 4Y5VA 1E42A 2X4UA 3DGCR 1FC2D 3CG8A 5FO7A 2K70A 3U4BL 4JFDB 3UERA 1AR2A 3VM7A 2C9VA 3TWCH 2V8MA 3MRNB 4TSBL 3CFEB 2DB8A 5BO1L 4NJ9H 4BA0A 2M1KA 2B08A 3DA0A 5IJCC 3NEOA 4B9FA 8CGTA 4AJVA 1OW0C 4ZOCA 5I16A 4CKQA 1D9KC 2AXFA 2Q7YA 5IBLD 4YR6A 3RZCD 2A7BA 5EBMB 1XIWB 1QUPA 1PYWA 2XWBB 1QO3B 4U1HB 1JD7A 4O02L 1U4FA 4QRAA 3CXFA 5JLZB 3CN0A 2IGLA 3MROA 3NTCL 4KOCA 3I6GA 2EC8A 3UAJD 3L5HA 3GI9L 3NJMA 4U1SA 5ICUA 4W9ZA 4KDTA 2HFEA 3DX2A 5DHYB 1T03L 1JGLL 1OTSD 4N5ED 3NIGB 2UXTA 4F58H 1UH4A 1N59A 3L54A 4D0CB 4U0QB 2XXCB 4L8SB 2EDXA 1FLRL 5EMYA 4YK4B 1NIFA 2HJLB 4AYSA 3FFCE 4XZUA 1QLFA 1E7VA 1E4HA 2FBJL 1CL7H 2PCPA 4XNMA 5E23A 2ENJA 4EI6A 3V5HB 1KB5A 2OCFD 3FCBA 3L3OA 1Z32X 1UD2A 4YBQC 4BWUA 5AVRB 3QQXA 4NHUB 4MX7B 5D71H 4AZ8B 4N5UA 4XP1L 3VXNB 1PZ3A 5IROD 1S7XB 4IEFB 3D52A 2C9UA 1I9JL 5T1DH 5B7MA 1KNOA 1G94A 3AZUA 3CDZB 4IHOA 4OFQA 4GXVH 2FUTA 4HWNA 4CADB 3RTQA 2GEQA 4AYEC 1VHPA 2XN1A 3PXLA 2OJZL 2X3BA 3L4WA 3C75A 5CEZE 5GS3A 3V0DA 2CE6A 4XNZB 4OF8A 5HPMA 4X80L 1DANT 2BHZA 3VSQA 4AQ1C 3LAFA 3SBWC 2XZQH 5B38B 4ZODA 4HH8A 4OZIE 4UU9A 3KPSE 3DHJA 5DF0A 4CGTA 5CSZA 1ZGLB 4AGOA 2V5YA 4N28A 3BZFA 3D51A 2AEPL 5SWSA 1I1FB 4FTVA 5JHLL 1PY0A 3HRZA 3LPOA 4M1DL 2HCZX 4AMKL 4U6XA 4DPRA 1KLUA 3Q3GB 2WSKA 5B3JF 2ZAIA 4PUBL 2VN4A 2I07B 2WY3B 2AS5M 2JI2A 2W1NA 3MX0A 4M6NL 1UA3A 4RAHA 1JF1A 2XWCA 1MPAL 3LMJL 4NPYB 5HHNA 4LVHC 2E5EA 3DOIA 4HJJH 4MASA 5CMAB 1K8IA 4KV5F 1NM9A 3S5ZA 4P9HL 3Q05A 4I4WA 1NQBA 5IUCA 1B6UA 5C09E 3VD0A 3AGVA 5T1KA 1MJ7H 4OM1H 2W81C 3B3BA 1DL7H 4JFQA 3DV6B 4BCYA 1UT1A 2EXTA 2GCYB 3HHSB 4ZAKD 3A24A 1TQBC 2NUPA 4UUJB 4HUWB 2L4OA 2DW5A 5ID0B 4Q7DA 4LSDA 3NZUA 3NABL 1Z5LA 3ZL4H 4R97C 3BT2H 3VFOB 2MJWA 2VJ8A 5F1IA 5KSVA 3QS2A 2DBJA 2KZWA 1K5WA 4RDQG 3ME0B 1AQDA 3VD2A 3GTNA 3MBWA 2DQIH 5GRVL 2C3XA 4ZG1A 1RUQH 2WNGA 4LHUB 2Q3AA 3Q8BA 4AH2B 5CZVL 5KYWB 2QMJA 4I89A 1H3VA 1PZAA 2IQ9L 3NSDA 3VDCA 3QUMB 2QSTA 4JHVA 3MLRH 2CK0L 4EPSA 3ZR5A 4QRRA 3L4CA 4ZD3L 1R33A 2XZCL 4J5VA 1YYML 1NAKH 3MV7E 2ICWI 4MB5A 1OF2B 1QTSA 2DEYX 3G6AA 1D5BA 4H88H 3VQLA 2IPUK 4P9MH 4DIXA 3SDDB 1QYGL 1AFVH 2VJ0A 3SE8H 3K5RA 5FYKH 3WS3B 4F7PB 2D31A 5J11C 1NEZA 2EE2A 3B56A 1XSKA 1ID5I 1O6SA 3UX9B 3GTVA 1KJ2A 3GRGA 4MA7L 4W70A 2RFXB 4LHUD 2VITA 1KPVA 5G4OA 5JUEL 1O7DE 1QFUH 2R83A 2ZCHL 4JVWA 3NDZE 4A04A 4PH8A 3FHQA 4KTGA 1FYTD 2QLYA 2OV0A 1P4IL 3CHPA 5JMOC 3S35X 2DL9A 1GL4B 5D1QC 2W0LA 1X7SA 1B2YA 4I85A 2NY6B 3MRQA 3DPDA 1AY1H 3DSNA 5E2TL 3FQYA 3QIBA 1N0XL 4JY4B 1GY2A 2D9QB 3HNSL 1Q0YL 5CGBA 2R29L 4MS8D 2VXQL 2ED8A 2BSTB 4CNIB 1DZBA 1PZ5A 2Q76B 5I26A 1KGUA 1SBBA 1YRKA 2WN3A 2Z93B 3HLAA 4ORGA 5F9JA 4ZFZB 4HOMA 3K2UH 4QRPA 1CD1A 1JCKA 2APSA 3RWHA 3TM6A 1MHCA 1N9PA 5I0YA 1T22B 2NDGA 4QAMB 2RJMA 3U1PA 3MO1B 2BRRL 4WRLA 4GW4A 2EYRB 2X89D 1U8OA 5KAQG 3SGDH 2IWEA 3GRWA 3EFDH 4C4KO 5DRNB 1FNGB 1XCTB 3TCLA 3KPRD 1BQHG 1UOLA 2EC9T 4HV8A 4KVPA 1RULL 2V2XB 2CU9A 5HY9B 3NRQA 2ZOKA 1GJUA 3KEDA 3RYMA 3N04A 3FT4A 2ADGA 1VAHA 3CVBA 1JZ3A 1RU9H 1JZGA 3C60C 1G7QA 3AT9A 3EH2A 3QXDA 2P5EA 2IDSA 4PY8I 1LQBC 4XXDA 1FL5B 1QFWH 4Y5XA 1JFQH 3BVXA 3QDAA 4ICXA 1X4ZA 1RLWA 3LS5H 3Q48A 2PTTA 4HLZH 3UJIH 1KCWA 1SY6L 1YC8A 2AK4A 2RACA 4CVZB 4L3FA 4D9LL 1T0PB 2C3VB 3OM3B 4K8RC 5HYJB 2XV0A 3ZKSD 1IGTA 2A5UA 3FQXA 1N59B 1D6EA 1EFQA 1KLGA 1ZHNB 2WGNB 5E1AA 1RHHB 3DVGA 4JFXB 1H9VA 1ND0A 1KWGA 4ZSOA 4ZTPH 4L8CA 1QLFB 1HOCA 3M8OH 1WD8A 1XVSA 5KVDL 2MCPL 6FABL 25C8H 3IJYA 4P5TB 3Q8AA 3HZKB 2VZUA 4OLZH 3WJLC 1I85C 4QTHB 5DD1L 5DMJB 5DZLA 3CMGA 3RAJH 2A74C 4MNGE 4RVBA 2E76C 4Z7VE 2N7SA 2UZXB 3S5YA 1DJHA 4PCTA 3T2NH 4L3ED 3NSXA 2JJTA 5BS0E 4YNYA 1ZXKA 4CC4C 3AT0A 3PXHA 4OCXL 4TOYL 3AXLB 4M1CC 3ABLB 3O11A 4OM0L 5EU7E 1NCWH 3VG0H 1KG0A 2UZPA 3EO1B 4QHPA 2A0LC 4PJEB 1Y18B 1YEIH 4PR5A 2VISA 3UIYA 2H6PA 1MIML 3IMVA 4HA1A 2OQJB 1IAOB 4DCQB 3MGAA 1UQSB 5D1ZI 5FWRA 3V6FB 4B9IA 1M7XA 2WTRB 1HNYA 4ZMOA 2VDOB 5EO1A 5CCGE 2NY3C 3TEUA 1I82A 1TCMA 5CJOL 3G5YA 4LLWB 2JXMB 4ODUB 1SMDA 3GS4A 4WWKD 3N43B 2XA8L 1IAMA 1BREA 1A4CA 3O6MH 4HZ1A 3RL1B 3FYIB 4U4IA 4BK5C 3WIAA 3EOAA 3UC0L 4G6KL 3DX7A 5JDJA 1MEXH 2EKSB 5F93C 4WY7H 2F1BA 5E6UB 5HGHB 1R0AL 3HG1E 2HFEB 5DHYA 1EA9C 2HTKD 1BQLH 2X3AA 4XN8A 2ZUVA 3BLBA 1EEYB 5AUMB 5BNXD 1XCXA 1NLBH 1EGJL 1I1YB 2SEBB 1R47A 3OKKA 5E94A 2FB4H 1JHKH 4L48A 4LLUB 3NAAL 5HHOE 5DJDA 4NQEA 1OP3K 2ZXAA 2QFPA 1VLXA 5FM5O 4G80A 4RX4A 2AXFB 3S6CA 5DEFB 1U3JA 3QR0A 1QG3A 4GRWE 5F3BA 1XAKA 3GBEA 5HDWA 3VB9A 3IMBA 4HKBB 4UIMA 3HN8A 4PLNC 1OAXH 4G7RB 1RUAL 3ULUD 4HDIA 1UXWA 2VL5B 5KSAD 4DEPC 4RMTA 5EUOF 5MHSE 1NMCC 3ARSA 3V95A 4AGQA 3DX3A 5IMLA 4CDGC 1ONQB 5EPMB 3VWJD 2O5XL 3FPXA 5IT2L 3VMOA 5IW1A 3NIDB 3FTYA 2J12B 4HZLB 4HX1B 5C0BD 2CNYA 1L6PA 3MV9A 3QDJD 4M4RA 2YUXA 2NLJB 3DRQB 4HD5A 1G1YA 4DP2X 4W81A 3ETBJ 4ZFFA 2PO6D 4GSDL 4OLVH 2FRGP 3ZZ1A 3CDYA 1E28A 1G6VK 2WCSA 2WQ8A 1ZHNA 2B9AA 3ASNB 4GLRH 4P07A 4RMRA 5E6RB 4OT1L 3BD4A 4BGLA 1Z7JA 3L6FB 1DQIA 4K9EH 3RPBA 4OLWL 1U6AL 1E5CA 3CBRA 3OV6A 1B2WL 1C08A 1WS7A 3BN3B 4N2HA 5JR1L 1ORQB 2UV3A 2ZJSH 5BMFL 5DMYA 2YC1B 1KB9K 4YSOA 2OSYA 3V7AG 5JZ7D 1JDDA 1M05B 3B3IA 1QTYT 3FF7A 3EYUH 5G55A 3QWRD 1KULA 3EIFA 1M4KA 1F8TH 3VI4A 2YD3A 4PJ9A 1QBML 3TH2T 4NRYB 5DQDL 1WA1X 5C0AD 3VRJB 1I8MA 1A6ZA 4GFXA 4DP0X 5EEXA 1U3HC 3F01A 1BXXA 3X1FA 4RGOL 2VDLB 4HU2A 3CBJB 3C9NA 5ALCL 2PXYB 3H0TA 2J56A 1BZ9A 1JDAA 1XH3A 2BVOA 2RH0A 3EAKA 5SWSB 2G3XA 4NRXA 5IMKA 4Z7QE 3G6DL 3OLEA 4JQIA 1CLYL 1EK3A 2BXYA 2LLGA 4YXHL 3FB7A 2FT8A 3D0LA 4HALA 1N64H 1RIUH 2AI0L 1IC4H 1PG7L 1GS6X 3VD7A 4MS6A 1CDCA 4NO5B 5D1XC 4YHMH 1SJMA 1SFDA 2VZVA 2ORBL 2KLSA 4JDEA 1EUUA 2OXHA 1OD7A 3QDHA 3CBKB 5C9KA 3FO9A 3P0VH 3FUNA 5AAMC 3PYCA 2D8KA 4BKSC 2ENYA 2DJMA 5GS0L 1UD5A 2FECI 2GITB 4WI2A 3WXWL 4QOKE 3L5XH 1I3GH 3U1SH 3A6CH 4GO8A 1J1XH 4QRPB 3CZLA 1U58A 4KY1H 1KLFA 4X0KA 5TDPA 1RERA 1BBDL 5KZCB 4AKOA 1I8KB 1KN4L 4K3EH 3D06A 4IQHA 2GY5A 4G80B 2RTTA 4MB4A 3U30B 4D9QD 3CZNA 3O0RH 3U9PH 3J2PA 4YBQD 3TOPA 3VWJA 3ZUNC 5I8KL 4DP8X 2AJSH 3Q5OA 3K2IA 1SEQL 4QT5B 4ZT1A 5AW4B 3ALXA 5D1QE 1AGBA 3PFQA 1T0NB 1LE5A 1VPOH 3WS3A 4F7PA 3NH7L 4U1KA 1X6LA 1JNLL 2HPOA 1MCQA 3B9KD 3ZDYF 5GGVY 4B0MB 1ONQA 1KT2B 3GJFK 1MLBA 2EIZB 1OY3B 4MDJB 1TYEB 4JGUA 4M6ML 4HZLA 4LQFH 1OARH 1H15B 2NNAB 3PREA 3VFSB 5CXPA 3U6RA 1LNUA 5L8KB 4PGJA 3B2DC 5C07A 3ULSA 4F57L 2C7FA 5E4IA 5I15H 2VDLL 1DJXA 5A2FA 3T3PB 1XGUA 1WZMA 1FFRA 2ZP0T 3C2AH 3HR5A 1X9QA 5CINL 4HKXA 4NM8L 3VXMA 3X12A 1T2QH 5D1ZD 5I2IA 3QG6A 4YDIH 1DHKA 1VZIA 2YXMA 2OP4H 2ZSVB 2TRYA 5C0CD 2X12A 5DFWH 5TQ0H 2EKJA 2X10A 1RY7B 2X41A 5DLMH 5J13C 2WXOA 2CA4A 3E1ZA 4WUUD 5BS0B 4K5NA 2HZHA 3K6DA 3KPSB 2WWKO 1UKTA 1LTXA 4DPAX 4MLIA 1UOKA 1ZMYA 2GK2A 3GM8A 1U3HB 1FVCB 2DQJL 4NZRL 4P99A 4AEEA 1HCYA 1JERA 4X9IA 5DQJA 4R7LA 1MFEH 4KFMA 1NGQL 4LL9A 3PWVB 5D71L 1ZCRA 1NFDF 4Z5RB 5I1IL 1AZUA 1BG9A 1DANU 5JHLH 1IL1B 2F53B 5T1DL 3DDGA 4PIBA 2XNAA 4P5KB 5C0CB 4EO5A 1WICA 4HLZG 3L9RB 4GO9A 3FTZA 4RIRB 1RZGB 5E5MA 4BFBD 1EZLA 5I75B 4NXSA 3IU4H 4U1MA 4OCRH 1EVTC 2W60A 2Z31C 3B9EA 4N0FB 4PJEA 2Y72A 1LLAA 3MGTA 1KXVA 4OY9A 4BKTC 1YSOA 2VR6A 3KZ8A 5HVFB 5JXEC 2GW5A 4DAGL 4JREC 1PKOA 1OHQA 3W37A 3WBDA 4N2LA 4YPJA 3ISWA 2XV3A 4MAYA 3NCJH 4AZ8A 4I1NB 5EU6B 4YSPA 1P1VA 3FO9B 5E1QA 1CK0L 4H88L 2ZSWB 3GSXA 1FZOB 3K80A 3VXUE 5KS9E 4N2MA 1IQWH 1ZT7B 3MV01 4JVPA 1G9NH 5IB3A 1YY8A 2P8LA 3D4GA 2NXYD 4LCIL 1BD2B 4ODVH 3RDTB 1OT2A 5CKAA 2B59B 3FOLB 1RJLA 1YG9A 2ICES 2I7SA 1GZQB 1A6WL 4PJCA 4NO2B 1AQKH 1BSIA 1FO0A 4KVCL 1KJMB 3I9GH 2YOAA 2H32B 1IILE 3LN5A 4KK5D 4LLDB 3CAFA 2IPTH 5CD3B 5JUEH 2PWFA 3UACA 4N9OB 5AW5B 1OTUC 5IROA 2LTQC 3C8KA 5F7HA 1CWVA 3SGDI 3B7RL 1H3PL 3O45B 4ODXB 5CZVH 5DYOA 4N8VG 4JKPH 4H8QA 1CCZA 2B1HH 2VO8A 2AQPA 5DZPA 1A2YA 3P02A 4OZGA 4UOZA 3VXMD 4ZD3H 1Q9KA 3TZVB 1XZWA 3H42H 3CSTA 3II3A 4OKVB 5HI3D 2ETWA 4R5XA 5MERB 5CM1A 2YUVA 3QCUH 3OQ3B 4RAUA 3FU6A 4MJ4A 1AR1C 5D2NB 3RHWF 5H4YA 2Y7NA 4AYID 1R3HB 4CW1A 3RVVD 2H8PB 4M6OL 1NIBA 1WGOA 1H6TA 2MQ3A 5FECA 4MMYA 5EA0H 3KYMB 4XN7A 1KBGH 4KOBA 1FAKT 3HPJA 4G3YL 4JDZB 5HSFA 1AG6A 3WL9B 3W0WB 3MJ6A 4PV1C 4ZS7L 2G2PA 4O2EA 4YIQA 5IJVA 3WS6A 1SOSA 4Q2ZA 2JJSC 3EJSA 4L3AA 3F7RA 4HFUH 4ILDA 4N4YB 1MFUA 3BP7A 4I9WE 2IJ0C 4QHKI 4J4PC 5E8EA 4HF5H 3ZTCC 2DY2A 3NJGA 4YHPA 3SKUD 1YEGH 2CCLA 2AEIT 2VLJB 5AVYB 1QSFB 3GMNA 5IFHH 2BSRB 3II2A 3DVNB 3VQMA 4K2UL 4K7PY 3H3BC 3O3DB 4Y4HA 3WO3B 2DYPA 4L0YA 1IGCH 4LU5H 2C1OA 2K8QA 2QMKA 2ZYIA 4JFFB 4YSRA 3UPCA 3GKWL 4GG8B 1SOXA 1NAMA 1T80A 1C1EH 2X44D 3UPAA 1XF5B 3P3TA 5L8LB 3AROA 2NNCA 4BZYA 5DWUL 1CXEA 2Z0BA 3GSNB 3TYGH 1R6VA 2X1WL 1UACL 3FB7B 2H5UA 3SYQA 4G8FB 1MAMH 3C5ZD 2ICWJ 1T1YB 2Y9RT 3BW9B 3ARVA 3LH2L 1EWHA 4TLTA 3WFCH 4ZXBA 1WC7A 1TO5A 4J1UB 3VXOB 1F4YH 4ZTPL 2BVEA 2ZKYA 1J0IA 1NGPL 1CL7L 1S7VB 4KK9D 4OGZA 3CPUA 4M43H 2QQQA 1O6SB 5IHZB 4K73A 4WENB 2YPKB 1E8WA 3HNSH 3N06B 3NOIA 2GT9B 2DI8A 3HE7C 3IJSB 5A2JH 3SPJA 1GCFA 1TYRA 1S7SB 1JXGA 3HS0A 3IMWA 2TAAA 4MZRA 3B1TA 1U8PA 3B1UA 3JWNG 5I1AA 3SO3C 1NMAH 4XN4A 2A83A 3HUJA 3BZEB 2UVEA 2IAAC 2WTOA 4Z7WE 3VXSB 2J8UA 1FN4A 1JV2B 1LJMA 1TTRA 1XH0A 1OK8A 5DJ6B 5LWYL 2VDKL 5K9OA 3BP4A 4MS8C 4L4TA 4CVWA 5DRXA 5C2UB 1PD0A 4H2CA 3AB0C 3QUYA 1Q0EA 2WQUA 2JKTM 3IETA 3Q6FB 1J5CA 2EDYA 4RFNC 2F61A 4JG9A 4OI7A 5FYKL 4RMBA 1S46A 5C6TH 1P2CA 2ILLA 1L7IL 1H3XA 2NXYB 3LNFA 2EDFA 1QBBA 1EERB 4HUWA 1PX3A 1LMKA 4P2RE 4X7TA 3REVA 4MCMA 1KJVB 1Z9MA 3PPSA 2HKAA 5D7IB 3ZGHA 3ZKNC 1OE2A 2FT7A 2QTVA 1HH6A 1JHKL 2X7LA 3DRTB 3MV8B 4QAWA 3VFOA 4R26L 3VI3E 1IT9L 1ASOA 4PV8A 5HHPA 4YDKH 1GC1H 4U3HA 5EBMA 3L3OB 2VDQB 3UTOA 4WLCA 1XGYH 4DGWC 5GISL 1KUMA 2OW7A 4O9HL 2ZXBA 4GXUM 4UQ2A 4PMEA 4GQ9L 4XN5A 4IK7A 1LWJA 1SM3L 3SYAA 3N9GL 5FF6A 4ANXA 4QRPE 1FFNB 1OGSA 2HX9A 2YZ1A 3C5JB 4E9WA 6FABH 4L05A 2ZONA 1HOEA 4ZO8A 1YYLL 2XJKA 4HPOL 1A9BA 3ZDYE 4AW4A 4OLZL 3Q8CA 3NABH 1GY1A 3F7PC 8FABA 3M6DA 3H54A 5G5DA 4PLKD 5A3ID 3NJJA 4P46B 3NACL 3PJLA 2X89A 4TPRH 2QSCL 3IM1A 3P73A 2DYSB 4LL1A 5C2BH 1YEDA 2X09A 3FUHA 5LJYH 4JCLA 5C70A 1L6ZA 1WIPA 1CGSL 5SWZB 2OI9B 5D5MB 3UP1A 4GW1A 3BIKA 4QCIB 1CVSC 3KWWB 1TLMA 5IB4B 4N0YH 3EGXA 1ZPUA 5GIRA 1E90A 3NRPA 3UO1H 5D96B 5IWLA 2VSKB 4W93A 1I8LA 2OL3H 4JO5A 4NGHL 5T33L 2XZCH 2QSVA 3AABA 3PAVA 4IU2B 4NUJA 3WELA 2AEOA 3U82B 4G6MH 4L4VD 1I8UA 5IHZA 1NH6A 2PUQT 3L9BA 5FUOH 3DX6A 3O6ML 3TA4D 4NQVB 1G7LB 2R4SL 3NJNA 1N7ML 2OYMA 5I6PA 2KDYA 3IJSA 2YJQA 4RZCB 4JEGB 4KXAA 3VRLF 1TNMA 1XWVA 4UOW1 4B5ZA 3SGKA 4AENA 5FR3A 3QDGD 2Y3NA 5DJZA 4AVIA 3RWIB 4A63A 2FHBA 4FNQA 1FV1B 1X5JA 1LK3L 3ATDA 5L2KB 4AQ1B 1KY7A 1DZ0A 2FYYB 2JVUA 1ZV2A 1VA9A 4L1HA 4H0GA 3RFZC 2JXMA 4MFHA 1FBIL 3O8XB 4NZTH 5LAPA 4QHLA 3IAPA 3G5VA 1CIDA 2OJEA 1N64L 1P4LB 2DWYA 2GIXA 4K94C 5JIIA 3HZ3A 1XGPB 1MRCL 1NGWB 3MKGA 4CMMA 2VMEA 1I1AC 4KXDA 2Z8SA 1I1CA 3GSVA 3OJDB 2YD4A 3EDDA 3KS0J 2XXGA 2Z6FA 3VXMB 1OANA 4HG4J 1BAWA 1HSAA 3BT0A 2D03L 4X99B 4AH2A 4IBSA 1JFHA 5D9SA 4AIOA 4I5BA 4NHUA 1CBVH 2IO5A 2F7OA 4X5WA 3LEYL 4HV8B 4DVRL 3SZ6A 3Q06A 3WLWD 5HY9A 4Z78A 1HSBB 3K2UL 3ZE0F 5B8CC 3N55A 1S9YB 1QBMH 5GS2H 1XCWA 4H1LG 3ZT7A 3SOBH 1DSWA 3DYOA 3W0WA 2NQ3A 3INOA 3FB8B 4UTAH 4JM2B 4OLVL 2QGBA 3T8XB 4RRPG 1AHMA 3PWPE 1AO7A 4PG9B 3VWJC 3AACA 4GSXA 4HCRA 5GJTL 4OCMC 3U46A 5I66B 2G5BA 2JIXB 1SJEB 1KXQE 4OF0A 5I1LB 1NEZB 1PSKH 2OZ4A 3U9WA 3KYOA 2C3VA 2GJPA 4K5PA 3TVMD 2HLAB 3S3SA 2G2RB 1A9BB 4DOHE 5JR1H 4KKCD 4MJJA 1ACCA 1ZGLA 3OLGA 2WSDA 1VFUA 2FTAA 3HB3D 1DDHA 5AW2B 4Z7OE 3R18A 3SJVB 1CLCA 3DNKA 3KDMB 3WFDL 4NQXB 1GYVA 2C1OB 4JFFA 4R7NB 5AVUB 4ZZFA 2E3VA 2YEVB 4WFGD 3TGXA 5FO8A 2XU9A 3AXHA 4F9LA 2EVJA 1A25A 5D7JC 1A3LH 1CDIA 2GSIB 5IVZB 4OLUH 4QCIA 1GKOA 1NUDA 2NY5H 1NLBL 3U1QA 1QATA 4FXGA 3B37A 1ZRUA 4PY8J 5D4QA 3VQ2C 5C9JA 5LLIC 3RUGE 1RURH 3DDFA 5IUSA 5DFVC 1JZDC 1BVNP 3PABB 4PY7B 4L1SA 1IEAA 3O11B 2BZDA 2B39A 3CHXA 1TQTA 3TN0A 2F53D 4MMZB 4J1UA 5ECGA 5BXFB 2EH7L 4Q14A 3E2HB 5ICYA 3M8OL 5KVDH 5J3HD 3ZT5A 1CD0A 3OGCB 1WA0X 4PS4H 3E6HA 3QIWA 5EN2B 1ET7A 3DPBB 4Y5YA 4LF3B 4JB9H 4YPGB 4XMTA 1GRWA 1FUNA 4XPAL 2QVMA 2D7TL 5BZWA 2LV4A 2GFBA 2PP8A 1BZ9B 4NCDA 1PAZA 4G82A 2V2TB 4XGZB 2PYFB 5IMMA 4J2QA 3L5XL 5DC0A 1TR7A 3N1FC 5JIHA 1BOGB 3U6XS 3CH8A 1TLKA 5E8PB 2BP5M 1JV2A 3W57A 4NOFA 4N8PA 3L95B 4JJHA 4Y19A 3V6ZB 3BP6B 2F68X 3RWFA 3REWB 2YGPA 1WCQA 3KPRB 4S1QL 4XMLH 3QJZA 1QACA 1TVHA 3FQ1A 2NY1D 2K6YA 3LXCA 3BGMB 3G08A 3S8GB 4WHDA 1ET8A 4RGNB 1ZE3C 4ODHL 2NZ9C 3O0LA 2KHAA 3ATEA 2VE6A 1IM3A 1NCDH 3T6XA 1LO2H 4EIBA 2XN9D 1BZOA 1PPIA 4G6FB 1OGAB 2Z31D 4X8GA 5E08L 3ULAB 4FABH 4LEOB 4RRPA 1HYSC 4JO4H 1GW6A 3WFZA 5FB8A 1F3JA 3J7HA 1QEWB 2HRHA 4HJTA 3WU1A 1G9NL 1C7SA 4GIPD 1WBZA 1WHOA 1MCIA 1QMUA 1D6EB 4OIFA 4YHLH 1P5UA 2Y1VA 4MQTB 1CGVA 2V37A 1Q9LA 3SO5A 3BGFB 2A99A 3L9EA 1M56B 3MRRB 1AQKL 1UG9A 1IGIH 3PDDA 5HHOD 4Z3GA 3GO1H 3FS9A 4JRLA 1DVFA 1HEZA 4YXHH 2VOTA 5ESAA 1FGVL 4PRHE 3A0OA 1MHPL 1H3PH 1CFNA 3UBFA 2UWEF 2CIIB 1UKQA 3D18A 1EHAA 4JLRB 2X9YA 4X5RA 5GGRA 5JQ6L 3X2QB 3HZVA 3WGVB 1IBBA 3TJHC 3JWNC 3PL6C 3S2AA 4XHQA 3LH8A 4YMPA 3WAKA 3MRBA 1MFMA 1OTUD 3GS0A 2IV8A 5IVXA 2QHLA 5T5NF 4OD3L 2YQ3A 5I1IH 5DVMA 3WTWA 3LD8C 1Y07A 3SGEH 3DO4A 4JKWA 2XICA 1Q1PA 4PGDA 4PW3A 3ARDD 2NY7H 2PYEA 4PRHA 2CDGA 2IGFL 5FEBA 3QUYB 1NA8A 1YUKB 2H6OA 1ETB1 2RB8A 3FQRA 2Z35A 2C9PA 4ANWA 1M9SA 3AG1B 1MHCB 3MUGB 3C5SB 4HC1H 3UZQB 1EXUA 1ZTMA 2W9EH 5I73B 1NFIB 1IGYB 1YPZE 3MRKB 3VE0B 4LIQH 4JM0A 3IJ8A 3EZ8A 1UT9A 3SE3A 2ZD0A 2XC8A 3ECBA 2VISB 4I3RH 4KMQA 3S35L 3QULB 1PIGA 5DJDB 3AUVA 1HQRB 4M6MH 1OSPH 2PF6A 1XGQB 4JFZH 3ZTEA 4JUSA 4MD4B 4WFHD 5CR1A 1ID2A 3I50H 3WENA 1N6VA 1YEHL 5CIPB 1TJHH 4PJ7A 4R6UA 5DC2A 3EBIA 4QXGH 4IMLA 3CFCL 4M5ZH 4LLYA 2FYYA 2YO3A 1WPCA 2OTUA 1IE4A 3ARGA 3P30H 5FF6B 4TVUA 5DWUH 4KDVA 3FO0L 1AZZC 1CFQA 2C9XA 2H9GB 4AY0A 2DJSA 3VWKA 2DLTA 2J73A 4RGND 1W0VA 3CZSA 4ZUUB 3U7YL 1NWOA 2JB5H 3MJ9H 5IW1B 3RX7A 4UZUA 3LRMA 1JE6A 1N5AA 3HRPA 1JPFB 2LW3A 1MOEA 2EDRA 2ZG2A 1G4RA 4JZNB 5D1XE 4JQVA 2RMNA 3ZZSA 1DQMH 3PWUA 4D94A 4LRIC 3KPPA 4WI6A 5ADOH 1BA9A 2R15A 4PBVC 3F58L 1MHEB 4C83A 4N85A 5GS0H 1E4KC 1Q9LB 2N7AA 2EDMA 1SDDA 5KSBB 5LUMA 1Z5HA 3L6FA 4OW6A 4YSSA 5EBGA 5KANI 5HYFA 3SKJH 1HVXA 4PJFB 3UAAA 2VC2L 3QK0A 1BBDH 2PLTA 3DX8B 5C3LD 2ZXDA 5KJ7E 5D70H 3U6RB 2YXFA 2YD8A 4PI2A 3LKOA 1TJGL 3D85A 2Z4TA 3I02A 3D2UD 1FZKA 4R84A 1FIEA 4Z7UE 4I88A 4YVNA 3UGUA 3GBMH 4P46A 2CIIA 4JE4B 4XPBL 3RVVC 3W39B 4IS6A 3HFMH 3HCVA 4KHTH 2BVPB 1JNLH 2DQHL 3KM1A 3RNQA 1M3IA 2ZUSA 3US1A 4TQPA 1EDHA 3VCLB 1SDAB 4HUVB 3HRZC 4X7SH 1SNRA 4LXFA 2V33A 5I82A 1N8ZB 1NKOA 4FOMA 2AABL 3ZE0B 4C56A 3H55A 5HYQA 4ANUA 3VXRA 4LCIH 4O58L 2GSIA 1ITCA 1OAJA 1FJ1B 5B8CB 4I18A 2DQCL 1REIA 4AEHL 3E6FB 15C8H 3U4EB 3HI5L 1EXUB 4M1DH 3HE6C 5B1CA 1IT9H 4JDEB 5EU4B 1VFAB 2Y7OA 3L3KA 3RBGA 3ULVL 4LQ1A 3RX5A 3POHA 5D93B 4YDLC 4ATTA 3D33A 3GZPA 4XHJD 3KL3A 3T09A 1W72L 1UD6A 2R69A 4EBQL 4JKPL 1SYSA 5C97A 3L3DB 4JY6B 2VLKE 5TDPB 4HJJL 3E6HB 2BOBB 5FHBH 1KY6A 4HUNB 3LPWA 3U7AA 3FCSB 2XTJD 5C0ND 2B8OT 4UTBA 2X1PA 1SY6A 1PLGH 1WHPA 5DJ0A 2JH2A 4JM2A 4BIKA 4K3DL 3CQQA 1HHGB 5DRZB 4AXWB 4XCFH 1KFAL 1NFDE 1QVOB 5FGRA 4GBXA 3SDDC 4NKIL 4N0RA 1AIZA 3OJVC 1XF2A 5SX4I 4G8FA 1E65A 3UTTD 1FNLA 4KK9C 2A74A 2OTWA 1JHTB 1YDPA 2FH8A 4L0PB 4JBSA 5PCYA 3AC0A 4TLUA 1XGRA 3IFNL 3ETSA 4OUUB 4WKZB 1TVHB 5B1JC 5TE4L 2XACC 3UBXI 5FGBA 3WE1A 3PF2A 3EYSH 4DVBB 1CICD 4EVNA 1RZKH 2J44A 2BNUA 2NNAA 3QHZH 1QPXA 2E9BA 1ZJBA 4U2ZA 3N44B 4FAAB 2P52A 4U1NA 2LR4A 3H9SE 1D5XA 2WXNA 3PLYA 3NA9H 3TNNA 3O41A 1BMWA 2I27N 3X3FL 5K9JH 1EV2E 1M7IA 3D39A 1X5AA 4FNLL 4HS8L 1JCVA 2K45A 3WV0A 4W9DC 1AD9B 2APFA 4LSQH 1IC1A 1YC7A 2JIXA 2VGLM 4FQHA 3U0PB 4AC4A 3KWTA 1YYMH 1QLEH 1UHVA 4UT6A 3C09B 5K39B 4ELMB 1NCNA 1V7NH 4L37B 4OI8A 4J3SA 3O9WD 5HPMB 4LEBA 5BS0A 5DMIL 4MMXC 5F72S 4HXBH 3EKCA 2X9ZA 3I6GB 3KPTA 3QE5A 1HJBC 1Z0NA 1UM5L 4BJLA 2UUDK 1JG9A 1ZKAA 2NCEA 4TVPE 1MRDH 4PJ7E 5FO8B 3ZSSA 1UGKA 3CX5K 2E7LA 1IB5A 4FYSA 5DR5H 5CLYA 3GQFA 4KKAC 5IVZA 4FFZA 2AQTA 3AG3B 2ESVD 4LOEA 2ZAGA 4M3KB 1W6LA 3ZKND 2FYVA 3VTMA 1IJ9A 4BH8A 2HTLC 1AOHA 2HT4D 2HVKA 4P5RA 5FYLD 4PJ8D 3TJPA 3VD5A 3MLTA 4MAUH 1PZBA 3QCUL 1U2YA 1URIA 4KKLC 5FKPB 3W9DB 4A67A 1NCAH 3T2PA 1TSRA 4I87A 5TD4A 4N26A 5JHDE 4KU1A 3KMDA 1DQLL 4HUUB 1I1AD 5IOKA 4ELKA 3V6BR 3CFKA 4DK3A 3ARPA 3UP6A 4AEIH 1N5YH 1NKRA 1B6DA 5DK0A 5HHMB 5B3NA 3HMWH 4ZTOL 2NW3B 3ZL4L 4MRBA 4KKZA 2X2HA 3LKNA 3DYMA 1A9EB 5FFLA 3BT2L 1QW8A 5DQ9B 2OZ4H 5DD6A 5L88H 1CLVA 1FFNA 3O2VL 4KUZH 1CDBA 4D3CH 4Z76A 2TSBA 3SDAD 1FBIH 1SLUA 4NZTL 2GCYA 5I1DB 4XC3L 1J8HE 2Z7ZA 2ZUUA 4NZFA 3UPRA 3JTSA 2VUKA 1E6OH 4HSCX 4Z95H 1P5UB 5AVZB 4TRPH 3T77B 3SY0A 1LGVA 3D9AH 4S2SB 2MPVA 5D8JL 4G7VH 3ZE2F 3D4CA 3BVDB 1HHGA 1ODUA 2ZX8A 3RY6C 4JRXA 1RH8A 3HC0A 3MLRL 2BWQA 7FABL 1EJOL 4AV5A 3RGHA 5IG7A 3SQBB 4DQAA 4JFPA 4OF3A 1DVFB 4G9FD 3S2CA 4G7QB 2F6AA 1IM3B 4CBPA 2A6DB 3D25B 1XGRB 3V0VA 1PTZA 2WLHA 5D6DC 3ZTJG 1F6AA 1AP2B 5TPWH 1HHKB 3FBKA 5AZEL 3DRQA 2F7IA 3VWKB 1KWKA 2XY1A 1OLZA 4OJDH 1BD2A 3HJEA 3QZMA 4JN1H 4U33A 4IKKA 1EFXD 5K93A 3RIFF 1RJLB 1WP6A 3OF6D 3VH8B 1CR9H 1RMFH 3O4LD 3OJ2C 1SLXA 5IHUH 5FOJA 1K6QL 1MDTA 4KJYB 4DETA 3D39B 2RR3A 1KYFA 2LU4A 3LS5L 5AALA 4QXTA 1YQVH 1WCBB 3QUZA 3LZLA 2QVTA 3SDXE 4NCC2 1NAMH 2Y2TA 1BLNA 1ZA3B 2FWUA 2IBGA 3T0AA 4Z7OB 1WZKA 2FIKA 2WD0A 5ESAB 2EIDA 5FDYA 1OL0A 4NWUL 4B96A 5E7BA 4OFVA 1A7BA 2LFEA 3DV4B 4IDJL 1TZHB 2ESVA 3JV0A 4NRZA 4R4ND 4U6YB 1NBVL 1DUZA 3W5MA 4Q9RH 2NY1B 4S1SH 4FC3E 3BX7C 2WAQA 2A9CA 2W8CA 1CB4A 1LEKB 1WBYA 1T2XA 5ESQB 1NFIA 4XOCA 4YHOL 4HUXB 4WHTB 4XBPA 3QZWB 1G0YR 4OF7A 4IYKA 4KJWD 2JK5A 2MH4A 3MZGB 1L7TL 3KBFA 1IAKA 1J12A 5GJTH 5JXAL 2WVTA 2OL3A 3BE1L 3QG7L 3QJFB 1QWHA 2EXWD 3FTUA 3WLWC 3CDGA 4WWPA 1EBAA 2YPVA 4HUMB 4Y4FC 3TXAA 3BCDA 4O2EB 4A1RA 1OP9A 4FQXA 4AQAB 2EUZA 4W6WB 1UH2A 4NDMA 2K4AA 3CUPA 1BJMA 5SWQA 3HAEA 1BQRA 3EOTH 2V3FA 5KSBF 1DQDL 1UJ3C 4M5YH 3QEGL 1AYOA 3MRDA 1DP0A 5J6SA 3A3YB 4N9GA 1ZDQA 2ZOLB 1S5IL 5JIKA 3UGEA 3OR6B 3PDOA 5F1NA 5SWZD 4KZEL 1XEUA 4JDTH 5ICXB 5ID1A 2LE9A 2ZNWA 4WY7L 3A6BL 1QSFD 3T0EA 2PABA 4NHCH 2XWXA 2CJTA 3RFRA 3QCTL 3DKHA 3MCLL 4ZDHB 2F5BH 2ZX9A 2GT9A 1EAPB 4DUVA 1MHPH 3WIHL 1EGJH 3LTVA 1BFOB 4NZUH 2IH1A 3KLLA 1G7JA 2YXVA 4Y9BA 3OLIA 4HS6A 5B7FA 3DHPA 4OJFH 4MQ7A 2J8UB 4KI5D 3QPXL 2YSSB 1NSNL 5AD0A 4QRRE 2XHNA 3O4LA 3RL2A 1YMMA 3LN4A 1MW2A 4X42A 4FABL 5ISZA 4JO4L 1GIGL 2DWDA 4WI4A 1C5CL 4R5TA 4ZFZA 1OT4A 4PTTB 2BO0A 4CVZA 1UXMA 1ZT4B 5KSUA 1ZHKB 3GMPB 4ZO9A 2H1XA 3VYNA 3L3GB 5AVSB 3QDMD 3QUXD 5I5MA 4ZUSB 2VM3A 1MF2H 1O7SA 3FNKA 1Q94A 4JKKA 2ROYA 1K2DB 5LAXB 5D93C 3MXWH 4YXKL 2J6EH 2CR6A 2YRPA 2A83B 3HUJB 1E9OA 5E9DD 5HGAB 3F7VA 4Z7NB 2Z7YA 4K8RH 1CE1H 1GZPA 3OR7B 4PREA 5E70A 5K9QI 3K0YA 1CXLA 4U3XA 2X6BA 1AZCA 5E08H 5EZOL 1L4IA 4X4KA 2VIRB 2XIIA 1OAUL 1N3NA 4DGIH 1AXSA 3U36A 3C6LA 3BC9A 4FQHB 4JFYA 2EDEA 3VFWA 4C4KT 3K6FA 4EIUA 4HK0B 1RFDH 2WYTA 4HJ1A 1PKQB 4UV7H 3VGFA 3D09A 2Q3XA 4BZ2L 1FFQA 1M6UA 4PD4K 1UYWL 2DBLL 5D72H 43C9B 2XN9B 2BSSA 3UDWC 1A1NA 2D2OA 3CSYB 4L8BA 3GSNA 2YKLL 2D7QA 1K4DB 4GKNB 3KXFA 3HVNA 4GUPB 2F53E 5JORB 4YAQB 1KELH 1FCCA 1TKWA 3I9IA 4Z7VF 5IF0A 1AANA 1QPKA 2NY3B 3LEXA 5KVEH 5HGBA 1TVBA 3GIZL 2Y1YA 3BCFA 3PIQB 2ODIA 4JZJB 3FUEA 4JPVH 3VI4F 2XVLA 2XKNA 3KW8A 3LQZB 3BH8A 2YD0A 2A3TA 1DQTA 1H8OA 4I0CC 1M1SA 2H3NB 4OD2B 2LOEA 2E4TA 4HIXH 4F91B 1P84K 4NQDA 1DBAL 1X5FA 3QC6X 3QEQE 1IZJA 3GIVA 4DEUA 1ADQH 1AQMA 2X9XA 4NQCB 4JFZL 4DK6A 3MFGB 3OXSA 4WTZA 5I6KA 1IC5L 1T7WA 3CZFA 4OTXH 1U3HD 4UTAL 3DJSA 1H3WM 3M45A 4OZFH 3T4AA 3IE9A 4ZX3A 3I6KB 2NNFA 2IH3B 1J0ZA 3H7BA 3I6SA 5E2UH 3STBA 1CF1A 3SE6A 3UZEA 4G59C 1Q0XH 3QNFA 4DKFL 2MOGA 3OG4B 3FTGA 4AM0A 5K1NA 5I1CH 3GB7B 1D7BA 5H94B 5T3ZL 3RWIA 5C08E 4JPWL 5FWQA 2IF7A 4EN3A 5AVQB 5GIRB 4EOWH 1T21B 4JFHE 2PR4L 4OGXL 3V9EA 5BUAA 2GAZB 4PJAA 4KKBC 4R2GD 1FLRH 4XODA 3T0DA 2CKBB 1Y1UA 1E4JA 3KCWA 3WJJC 2X2IA 2HLEB 3OGOE 4M00A 1SQ2N 2EDHA 5D7SH 3AS1A 4X98B 1I9RH 3GJFB 5KW9L 4O58H 2VMJA 4RGNE 3MUUA 3ULVF 1SOKA 3BAWA 3KYKH 3GEWB 1TZOA 3Q1SL 1U91A 3ARFA 4I77H 1K2DA 3MTRA 4XGZA 5IMMB 2FSDA 2PTUA 2XQBH 4Z77A 2QVKA 2VN3A 2FJGB 2NR6C 2DQ6A 2W95A 1MI5E 1IKNA 3ZW3A 1GYWA 2J1ZA 1IAIL 3GRWH 3LVEA 4GKZA 1TFPA 2DKMA 3QULA 3A23A 2F2HA 4QOKB 5JOFB 5C0GA 1YVLA 3C5ZB 4PRIE 2F9BT 5K39A 4CSZA 5D7LA 3ZE2B 5GS1A 1QTPA 3GBML 1U8CA 1CG9A 3FQ4A 1NGZB 4LVNC 5CINH 1FLTX 5EORL 2HX7A 4JM2D 2WB1A 1MY7A 1PKQE 4GFTB 4B9KC 2LT9A 1NCJA 5LVEA 2EUWA 1UA6H 4WK0B 3R7RA 3EJJX 4YDIL 4ETQA 3V5KA 1XXDC 5IHHA 1PLGL 4XVTL 2WWNA 3ECUA 1P5VB 5TQ0L 2VLJE 4IHBA 2XT1B 4U1IB 3MREB 3SQOH 4MNQB 3BDYL 4HPYL 4BINA 1I7RB 4ALAH 2ORBH 1S9KC 4NO0D 4YLCA 4BH8B 4ZFOA 3IFOA 2IAMC 2JJUA 4DKEL 5T5NG 5I6XC 3HVDA 2WXRA 3OJMB 5C7ZA 1N5AB 4ZBJA 3SCMB 1UENA 4XMZA 1SF5A 3DMMA 3MA7B 4NQDD 4XZUB 3A6CL 3GDCA 1BZQK 5KVGE 4XPBH 3U9UA 5F3HA 5FK9B 4WW1A 2ADGB 4JDVB 4ZMYA 4LDEB 2L7EA 1LHZA 2WZPA 2XSKA 4XB3A 3CFQA 2KUTA 4Q0XH 5DK0B 2EYTA 1B4JL 1NCTA 4X50A 4JGNA 2H3NA 3OZ9L 4OD2A 1WC7B 2BFGA 2XN2A 1PBYA 2G5BB 1I1RA 1TZIB 4NQUA 3T0WA 5BJTA 5F0PB 1HN1A 1HZHL 4LSSH 4Q6YA 4X5LA 2ZOOA 1QFWM 2J1XA 2DQFB 4FFYH 4XI5D 1KB5H 4E41A 3K74B 1MJJA 3E1F1 2RA1A 15C8L 3P30L 1SMOA 2VAAB 3PWPB 3BH9A 4OAWB 4B27A 2A4EA 3LZQA 4WZ9A 3A4FA 4GH7B 4QXTB 3APDA 5CNHA 2J8UE 1NBZA 3MODH 4KO6A 4XWOD 4AIXA 3PHQB 4BFJA 4U1KB 3S96B 3ES6A 1SVZA 3GRBA 3FH5A 4XCYA 3TBWA 3MCKA 4ISVB 4PRID 5GHWH 3MNZB 1ZD6A 3ULVE 3T1FB 4XVOA 2E6PA 3G5XA 3DC0A 1MLBB 2R1WA 4ZX5A 1RZKL 3G9VA 5AAWA 32C2B 5D6CB 1ULVA 2RQEA 3PDGA 3GK8L 3RQ3A 3ZMEA 5L7XH 3N44F 4MCZB 2AJUH 4UQEA 4K15A 5DSCB 3I75B 4N2FA 4CVXA 5ITFA 3QJQB 2MRYA 4L3CB 2F15A 1FFTB 5C0BB 3ARED 5DUBB 4G9DB 1T1WB 3KYNA 4UOQA 5HDOA 3FONA 3CHSA 2R2BA 3HHRB 1NEZG 1JGEA 4QXUL 3BVTA 3RHWK 4K71B 4CKVX 2IGFH 5FA3A 2XTJC 2QR0B 3QP3A 1JYXA 4Q9QL 1SN5A 2FIKB 1XH2A 3GHBL 3MUJA 1PZUB 1RZIA 1INDH 1QX1A 4MA7H 2J8OA 4LT7A 3GMOB 5JPNB 3EYSL 3HNTH 1NL0L 3TBSA 1JBJA 3MLXH 4Z7UA 3WIIL 1E9QB 4HOXA 2OJ1A 2MKLC 2OMZA 4GRLC 4I0KA 4MDRA 4UNUA 4ZK8A 3IU4L 4MCYA 4X8XA 4QPEA 4Z9KB 4LAJH 1NINA 3P69A 4Y1AD 1ILSA 3LQMA 3X3FH 4G7YH 3TA3D 4HAFA 5L4MA 3OKKB 2ZP8A 1PX8A 1KACB 1NCGA 1GOHA 1A7RL 3L9RA 4A2EA 2R2CA 2HB0A 3SDAC 5MEPB 1H0DA 3LRHA 4WUUA 1N0XH 1U92A 5C07B 3ULSB 2GIMA 5I28A 3WN5A 1Q0YH 3O4LE 2WYIA 4HGMA 3V0HA 1IKOP 4GMSH 3NQIA 3VFGL 1A6VH 2R23A 3SCMA 3KPQB 5T5FA 3P73B 4LASH 5AVXB 1YNLL 4ZXBD 3NG5A 3PWJB 1CT8A 1AH1A 4Z0XA 1C8QA 3ROOB 1KCUL 3L5WA 3LNEA 3B2VL 4JN1L 4YZWA 4ZW8A 4ABUA 2EEXA 4P5TC 5AD0B 1DQQB 2P4AB 2WLZA 1BIIB 1JN6B 3KLHC 5EPMA 4XP4H 3W82A 3I6LE 4JZOB 5F7EL 2I9LA 1W0YT 3MRFA 3P4OB 2W0PA 4O51B 4BSWB 4JHZA 2YN5A 1J7VR 2CDGB 3TYGL 4ABWA 4LLMA 4J3UA 3HMXL 3K6OA 3CE1A 3QAZC 4W9HC 3UTSE 5IM7A 3GGWB 4PRIA 1UC6A 3IDJA 4LCCA 2Z0UA 4FL4C 2MCG1 1NCBH 2VDQH 1E28B 1MN4A 3STLB 3OXSB 1D7DA 3SKJL 4UINL 3TIEB 1WT5A 1KJMA 2VYRE 1FGNL 2CHZA 1J87A 3CN3A 4OLYH 4AEIL 3PGFH 1OZUA 3LKQB 1IFGA 4QIRA 5JW5A 3HMWL 4ZTOH 2I07A 5JHMA 4A7UA 4ISVA 5DHDA 4ZQTA 4GAJL 2JKRM 4X9YA 1XGQA 1T6WA 1X5LA 1GSKA 3L2MA 4LGSB 4P2QD 5IBTH 5J1TC 1NMBH 4MZ3A 1S7TB 1KBGL 2V2WA 4UNTA 1JNHB 1QKZH 1YNKH 3P77A 1OKEA 1K6QH 5E2VH 4ZPTA 5FYLH 1Q94B 1VB9A 1A0QL 1XH3B 4GUCA 1NANH 2YD5A 2P7TB 5EO0B 4YDZA 5HDRA 5CFHA 3S88H 4KRMB 4X99A 4IU3B 2FATH 5ACLA 1WFMA 1LWHA 4Y4FD 4HEPG 4A6YL 5D2NC 5EBWA 4EIGB 3F64A 5DMIH 4HXBL 3JWDC 5I9QB 2K6ZA 1A7QH 2WKOA 1A65A 3BO8A 2BSCA 5HHXH 1AXSB 3B9VA 4EI6B 3A6BH 4GQQA 4YDMA 1XCTA 5EOTB 5FGCB 3QORB 2L0DA 4YBLC 2B5IC 4MX7A 4BZ1A 2MQ0A 3P9MA 4OB5H 2BIPA 4PG9A 1KBVA 4D0DA 5EF0A 3DIFA 4MHHI 3VXUB 4UT9L 4JUTA 4N2IA 5C6PB 3SQBA 4R0LC 4LKXA 2XJLA 4OGQC 4BE5A 1KV3A 3D0VB 5GISH 1WK0A 2IG2H 4D8OA 2GSGA 3INUH 3T2OA 4FGMA 3CFBB 4Q9RL 4DW2L 3VXTA 1HESA 1YCSA 2WO3B 2WXGA 4P3DA 4FEIA 5HYSB 5ACZB 5CJ5A 3PWJA 1DLFL 4Y16D 3DSNB 3LXBA 2Z91B 4UYQA 3CZGA 1BZEA 2VN5A 4DP7X 2D4FA 3QNYB 4OZHF 3WDHA 4RWHA 1LDPL 4ZSOB 1IEBA 4IRZH 5BQ7B 4W9GC 5J06A 2ID5A 4MA1B 3QHZL 1FYTB 1BWWA 4YGAB 3UTSB 1X5YA 3CMOH 3QCTH 1U8MA 3TEWA 1ES0A 2JKWA 2DWSA 3NA9L 4OKDA 3DVNA 4N20A 2X4OB 4YDVA 2NXZB 1SHSA 4E2OA 4ONFL 1VFAA 3US0A 3LZFL 5JDSA 3LRGA 3SGKC 4BRJA 1F90L 1RL1A 1HTYA 2DI7A 4GRWH 2VDNL 4NM4H 5D96C 1R9FA 4M5YL 3KVPA 1CLZH 3V0IA 3WTSA 3BKMH 1RQ5A 4LGRB 4S1DD 3WNKA 4XT1C 1HKLH 5FKPA 3V6FA 1BFVH 2V2XA 1ITBB 1UD4A 1HNFA 4RDBA 3RURA 1FHGA 1U8LA 2EDBA 1CZ8L 2X38A 3ATAA 3ES6B 1A5FL 4U7MA 1ANUA 2FJHA 4C55A 2HTKC 2MIZA 1W0VB 2VDOL 4IMKA 4YDJB 3ZIYA 3HI6H 4WW2B 2WLNA 3ZIMA 1ACZA 4ZUTA 2IWGA 4L9DA 3HG4A 2VSCA 4JRYD 4WI0B 3LRLA 4KTYA 2Q86A 2A4ZA 4X9HA 5D7HA 1KYAA 3V4PH 4BELD 1AQDB 3L2LA 4I2XA 3Q8EA 4V2BA 3AS3A 1EEYA 5AUMA 3THMH 4PRBB 1T1WA 3AG4B 4NUPA 4XPFL 3D5OF 1S78D 5ICZB 3B8SA 4P59H 2G3NA 4F2MB 4JFXA 2YRZA 3MRCB 2B15A 4XC1L 4IKLA 3BAEH 1X4XA 4NKOB 2JB6A 2R1XA 2F5AH 4HPOH 1BFTA 2ZE0A 3HZKA 5A16B 5BO0D 2P24A 3KWVA 1F1DA 3ZLQC 1KB9J 1GW0A 3CDFA 4GI8A 3V4VL 4BZ2H 5EHFA 2XCMC 3WUWG 1KOAA 3KWXA 4F9PC 2VR5A 3ZDZB 5IMLB 4JAMB 4ATWA 1MRFH 2Y06L 4B9ZA 4FG6D 3MOAL 3B43A 1A8ZA 1HINL 1EX0A 3ZQWA 1E7UA 3VH8A 4WKXA 4PJFE 4L5FL 3RY4A 5AAPA 1YNTA 5DZVA 2BNUB 4DGIL 3MR9B 1FE8H 3NMEA 1CFSB 2BPBA 3WEXA 3WFHB 1YLBB 2WLLB 5EF1A 3U9UB 1M7DB 2DIJA 2DN7A 2E8YA 2V7HA 3DYPA 4LMQE 5CGYD 3GI8L 1A4KB 3JVGA 3N5AA 2ZUTA 4I2XE 2BNRD 1OAQH 3WKMH 5IV2B 4MTMA 2XG5B 2EEDA 2WC7A 2IBZY 3AITA 3E7JA 2K7PA 3MLTB 1MJUL 1MNNA 1JZ6A 1LEKA 3FQRB 2ZWKA 5EZPA 1ACYH 2ESVE 3WFEH 1CDJA 3ENEA 4KUCF 4XRCB 5LBVA 5IIEA 2EH8L 2FO4B 3L7EB 3QBTB 4HULB 4XAKE 2H0JA 3WJLA 5EORH 1IC7H 3UMTA 3G04B 1U2HA 3UTTB 1R24A 2HP4A 1HXYB 3D3VA 4JQIL 2NW3A 2Z64C 4EDWH 2E74C 4BUHA 5DI8A 4IW4C 3B34A 4ZI8A 2GG1A 3FJTA 3NFNB 3VGAC 5EZIH 3CLFH 4WJ5B 3ASWA 3VFPB 1L9RA 1KPUA 4HS3B 3N40P 4DZBB 4EQ3A 3RGVD 4YHOH 3QRFM 3S9DB 2D0GA 3O8XA 5TK2A 4E9RA 3BLPX 3QR1A 4KVNH 5DFTA 2JQZA 2VLJA 4J3XA 5IB4A 4EEEA 4F8LA 4OZFB 3O6KL 2AMUA 2B0SL 3QIUA 1ZDSA 5E2UL 4KH9A 3DJTA 3QDGA 4Z6AT 1ZVHA 2WOYA 3P3SA 1AQHA 1BV8A 2XQBL 5FV2A 3MNVB 3SE4A 2F1EA 4F8QA 4F37F 3GBDA 2NLJA 4A37A 4U1NB 5GGVH 2OP4L 4AI7A 4ERSH 1KN2L 4WV1A 4JZJC 3RGVB 1J8HD 2BIOA 5E5RB 3RPKA 3Q1EA 1A21A 5C0FA 1A7NL 2UY6A 3ZRSA 4LNRB 1UXWB 4OR1A 2FL5B 3TBSB 3HW7A 1IGTB 4ZMLA 1GPOH 3KXFD 4AENB 1I9RL 2IMMA 3FUFA 3O6FC 5KW9H 2WN2A 1XV8A 1KGCE 2IADB 5F6HI 4YJZL 5K59F 3OKLA 1FG2B 3B9KC 4FLRA 4FQ1H 1ZS8A 2WXHA 4KKBD 1QWNA 3D34A 5H94A 3SO3B 2FBJH 3N2JA 1QR1A 4XN2A 3MJ7B 2YGOA 1FFOB 3BHBB 2OKMA 5DS8A 1HNGA 3K71B 2XTJB 1RUPL 5C08A 2PXYA 1N10A 1YA5A 4XAKD 1RP9A 2FT6A 3OMNB 5C7XL 1RK0B 1CFSA 3K4DA 2WLLA 2XETA 2VSMB 4EI5C 1JPST 1GZPB 3OR7A 5T1LA 2GPZA 3QIBB 5SX5K 2RD0A 3TO4D 1A6UH 1L5GA 3GLZA 3OZ9H 2HJFB 3SBQA 1HYSD 3SGJA 4OFYD 5C0RL 2DDQL 1ETZA 3CN4A 1ILUA 2GJZB 1MCNA 3GMQA 3CH1A 3ZYIA 3RX9A 1U8NA 2Q7YB 4UAOC 4WAFA 2YD6A 3U4BH 5I6OA 1TTUA 2CGZA 2IGTA 2M26A 1HXKA 3HPLB 4WU7B 1ZLDA 4PEEA 2P80D 1JNJA 2MPAH 4NAMA 5JLZA 4BWTA 1MQKL 1BGXH 3IXTA 2ADIA 1QD0A 5DQ9A 1NIEA 2J6EL 5I1GL 1ZSHA 2EILB 2EDNA 3HG0A 4XO5A 4QR7A 2KLTA 1SN2A 1PG7X 4H26B 4K8RL 3VXQB 4TS6A 1KCSH 2GTQA 2OK0L 3TONA 4U6VH 4NOBA 1KIUA 2J6WA 3TCLB 4E0RB 4R0LB 1SVCP 3MOBL 1O7VA 1IFRA 4XMLL 2B1HL 4R7NA 1R75A 5D7IA 5IR1B 2BIMA 4BFKA 2XBZA 1F4WH 4NP9A 3DK2A 2ZOKB 2PCPB 4XNMB 2QL1A 3ARUA 1PZ2A 4KQ3H 4PVBA 5AKVA 3FU9A 1CL7I 2R29A 2WLIB 4GQRA 1RUKH 2YZ8A 1UEYA 2WNWA 4XX5A 3VWKD 2HUHA 5BO1H 1KTLA 3KPRA 2P8MA 3QZLA 4I77L 3QJHB 1N70A 2AK4B 2A74B 2OTWB 4CSSA 5FOBA 5F7YC 2HYMA 3B83A 4EQ2A 2WMPA 3N1PC 1I8IB 5A2CA 2P7TA 1KEMH 4QRTA 3AAZA 2ZSWA 2PMZA 3CFCH 4DUXA 4J3OD 3RVTC 3V0WH 4XMKH 1V55B 4V33A 5LG6A 1F0LA 4XWGH 4HKXB 2AV7A 1WBXB 4G83A 3KCPB 3QEHB 4FF9A 4LF3A 5F89A 4BCZA 2HWZL 5F0JB 1UA6L 1XXFC 4GS7C 4X80H 3GSWA 2JB5L 2H32H 3QORD 4PVNA 3ZHKA 1NGXB 3AM8C 4F24A 4QYOA 2BZCA 2VRQA 4MDJA 5I73C 4V1DE 2A6IA 4C54A 1A3RL 3K72A 3P2TA 4KBPA 5KVFE 3UTSA 5CFAA 3IJ9A 3V6ZA 2F58H 4PS8A 2CM5A 3QZWA 4XB7A 3V79C 3BJLA 4Z5RA 2GI7A 2BP0B 3EH5B 2G4GA 4ESKA 1OOWA 4PJHF 3UEQA 1CE6A 3EF7A 1FVEB 4S11A 1E8XA 4GYBA 3RLSA 3CVCA 4GXVL 4AMKH 3WS6C 5DJCB 4WO4A 5B3SB 2Z8RA 4Y88A 3VSUA 3G5YB 4LLWA 4ODUA 3OKDA 4HJ0D 5LXVA 1WFUA 2OMXA 3CZJA 3WFCL 4U3CA 3IWUA 1JWSB 4AL8H 1IBGH 4FQXB 4CJ0A 4DP6X 4HIEA 1ETZB 1LWRA 1LXMA 1ZLUK 2AV1B 4H8WC 1MY5A 3KJ4C 2W9EL 4HXAH 1VGKB 4J4PD 3WNIA 1U9KA 1FP5A 4JG1H 5TK4A 3TWCL 5DC4B 3BUIA 2WXLA 4FHBD 3EH4B 5TF0A 4A6YH 4Q2ZB 2XG5A 5AVVB 3MLWH 3AS0A 3C60A 1XEDA 2XDHA 4ICWA 1NMAL 5HHXL 3NPZB 5KEZA 5SX4H 3MODL 3D2TA 1JZ2A 5HJDA 5L9DH 3NCCB 5FKAA 1MCKA 3B2UD 4PWHA 4OB5L 1E5BA 1BBJB 3MGTB 4WUKL 2DRUA 1KBKA 4NRXB 5IMKB 5IR1A 3QJRB 3FFCD 1MWAB 1LO4H 3GM0A 1S9XB 3OPUA 5CGMA 4I1PA 4HJEA 2CHNA 4J6RL 3M1BB 3M1OA 4PSPA 4YHNB 5AKRA 1O5PA 1XF5A 2NCMA 2R2EB 3HIZA 4M9OA 5AW6B 3UTPD 3C8KB 3M46A 5EU6A 1OP3H 2OMTB 1W72H 4B97A 4H8PA 4HP5A 1IBZA 1CDHA 1DE4A 2WKLA 4N8UA 4L2YA 2YWZA 1M42A 2WXIA 3OX8B 4IBYA 4UQ3A 5I1LA 4X7DC 2CXGA 2H9GA 1XF3A 2ZXQA 2NRDA 1RKRA 3PFUA 4PJHB 3ZKXC 3B2MA 3S88L 4Y4KA 2YGNA 1KT2A 1HQ4B 2ADJA 2WWKT 4N2CA 4HIIB 4ZUUA 5EIQA 3V0VB 3VA2C 4CC4A 4D8PA 3RIAK 4PLKC 5HDBE 3QZOA 5A3IC 3FN9A 3HE7D 4X4ME 1JS4A 2HUEA 2FEJA 3HJ0A 2ZT9C 4XVUC 1RU9L 4BWWA 3X14A 5I8CB 4TQ8A 2DKSA 1MDAA 4KX8A 3VXRE 3T04D 2A73B 3S36L 3S48A 3VUAA 4ZYKA 4NN5B 4FQCL 5E9DE 1W8NA 3STLA 1JF5A 4S1RL 1SJHA 1DQKA 3B9DA 5FYLL 3CX5J 5I1AB 1SY6H 2DKUA 3SKNA 4PJIF 3QH3B 1MW0A 3RTQB 4NZJA 5DS1A 3VI4B 1YYLH 2BS8A 1PQZA 3OKLB 4YHPB 5F7NC 2A6KB 3R4RA 2QLVB 5EO9B 4MA1C 5JQHC 3AMLA 1DSFH 1XDTT 2Y5TA 4L4TB 2FLRT 3RTLA 4LAQH 1BQSA 1XCQA 2H0FA 2MCPH 2HX8A 1D2OA 2W80C 4N6RA 4BFOA 2R7EB 4G43A 4ANVA 2R2BB 3ATBA 4HUXA 4GINA 1MCSA 1R3KB 3VFNB 5EU5A 2BS9A 5A2BA 4KXBA 5ENWA 2CRMA 4F8NA 3IJ7A 3DLQR 2VDOH 1Z0MA 3PGCB 1L0YA 3JV4A 2VXQH 5I1KH 1OCZB 1YY9D 4NNYA 1E9PB 5F7DB 1ESOA 4XBEH 1NPJA 5TDNA 2EP6A 1GGBH 3JWNH 3RWJA 2QDVA 3Q3GA 5LGKA 2XQYA 3MV7B 3VG0L 1THCA 4GIAA 1L0QA 1ZY9A 4PRDA 4Y19B 3NZSA