3LZOA

Crystal structure analysis of the copper-reconstituted p19 protein from campylobacter jejuni at 1.65 a at ph 10.0
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
159
structure length
159
Chain Sequence
GGEVPIGDPKELNGMEIAAVYLQPIEMEPRGIDLAASLADIHLEADIHALKNNPNGFPEGFWMPYLTIAYELKNTDTGAIKRGTLMPMVADDGPHYGANIAMEKDKKGGFGVGNYELTFYISNPEKQGFGRHVDEETGVGKWFEPFKVDYKFKYTGTPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords P19 protein
publication title Structure and Function of P19, a High-Affinity Iron Transporter of the Human Pathogen Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 33
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3lzoA00
3LZNA 5I0WA 3LZRA 5I0VA 2O6DA 2O6EA 3PJLA 3LZQA 3LZLA 3PJNA 5I0YA 3LZPA 5I0XA 2O6FA 3NRPA 3LZOA 2O6CA 3NRQA
chains in the Genus database with same CATH superfamily
5DI8B 4BXSV 1QBMH 2BNRE 4MKTA 1KLFA 2DQEL 4PMFA 1ET5A 2XZCL 2BDNH 3L4ZA 4JQIH 4KTDL 1HHJA 4ODSL 4JO5A 1HHGB 4Y1SA 1M6UA 3GXUB 4K7PL 3RZCC 1E9OB 2GSGA 4WUUB 1CUOA 1BM7A 2D0GA 4AKQA 4WAFA 3L9BA 4OM0H 5H8DA 4GS7C 4PTTA 1SXNA 3OPZL 4ZXBD 2R56H 4Y2DC 2NZ9C 1MJ7L 3CQPA 2ZG1A 3QFJB 5DEJA 4AIEA 4AUUA 3MFFB 4K5MA 4B9ZA 3D34A 1HCYA 1I9RH 4Y2OA 1JXKA 3QT2A 4FABL 1T4KB 1ONQB 4PI2A 1RCYA 2B14A 4P46D 2A0LD 3BEVA 1HYRC 1XCTB 2J55A 5DVOA 4L4TD 1S7QB 5GJSH 2DLFL 4WQOA 4HPYL 1RULL 2XZZA 3LKSB 5I1KH 2Y07L 3HUJA 1XSJA 1JSYA 2WSDA 2V5SA 5A16B 3EJYC 4YVNA 4F9LA 1H5BC 3RWEB 1LEGB 3E7JA 4JO2L 4DZ8A 5F1NA 3MR9A 2Y5TB 4YDIL 1CL7I 3LS5H 4HIXL 4I48B 1IGJA 2AMGA 5KSAB 4KRMB 1G84A 3CVHL 2JK5A 4PJ8C 4Y4FC 4YDJA 1NUNB 4JPWH 2C4XA 2C4FT 3O8XC 4EF3A 1GIGH 1VFAA 4JUSA 4WFED 5DEFA 3OHXB 4KKCD 2X4UB 2XN9D 4DGIH 1XF2A 4QXUH 4AJ0A 1MWAH 2Z31D 4RZCB 1NOLA 5KVGH 2JI1A 5C0RL 3UCQA 4ZMAT 4NHUA 3BN9C 5CP3H 5GJTL 1R3LB 4NC0B 1MW1A 2NY0C 4B9GA 1A9BB 2X4NA 5ENWB 5FA4B 4LLQA 3ZMEA 3FFDA 4PJ8B 4PRIA 5AZ2L 1KN4H 2XZAH 4YEFA 5F6IB 4OF8A 1Q9KA 2B0SL 1YYMH 3IXTB 3PWUB 4UQCA 4R90L 2UZYA 3MV9E 4W4OA 4YNYB 2DWEB 5IW6B 4KK5C 4KGJA 3BH8B 3VG9B 2IFFH 4W9FC 3F58H 2QR0B 3IJHB 4G8GD 4XMPL 1N59B 3M17B 4E42B 1ZVHA 3NJXA 4M4RB 3EH5B 4NZJA 1LD9B 4ABUA 4ESKA 3WTTA 5EC2B 5IEHB 1DQMH 3WS6C 3WUZA 2XTJD 3BPLC 3JV4B 4JDVA 1EAJA 2HT3C 3KDMA 4FXKB 4PRNA 1NCOA 2YA2A 1C5BH 3LRSB 3T3ME 2IDCA 1UUNA 3Q2LA 4Q2ZB 4QHNB 1X7TA 5TE4H 1J8SA 4I85A 4IBLT 5JTWA 1BG1A 1QNZH 1FVCB 4UQIM 3O0RH 4IS6B 2WO2B 3ZZSA 4AG4H 4H44C 4PAZA 2LVEA 1PLGH 4LOUD 3E1F1 4GRLB 3D0AA 1QOKA 1MPAH 2D03H 4A2EA 2A83A 1CE1H 1G7JB 2FX9L 2I26N 3PP3H 2AV7A 2B4CC 1UGKA 1NBVH 2NUTB 4HUXB 5BV7B 3NGBC 4U05A 4C58B 3GXFA 4KKZA 1N6QH 2ZOWA 2KQNA 4RA0C 4WV1C 3RVXD 4F93B 1Q9OB 3SHSA 1N64H 1W0WA 3K6FA 1JZ4A 5E9DB 3APMA 2KUTA 3ZDXE 4AYFA 1DLFL 3HB3C 2WVUA 5DMJB 5AYTA 1AZUA 4GAFB 4OQTH 3FHEA 3RIKA 4LF3A 5FFOA 3WE6A 3CPLB 2XG4A 5JDJA 5I8CA 1XGUB 1XXFC 3HZMA 4ZK8A 3JWDH 5L2KB 4APQD 2V6HA 5E4AA 4M43H 4X6EB 1S4IA 5IW3A 1B2YA 4LARL 3I6LE 4FQIH 4Q74A 5ALCH 2ENQA 4LL9A 4RWYH 5HPMB 2AJSH 4FG2A 2VLLB 1NQBA 5I74B 5HYFA 4X5WB 2Q3XA 3LZLA 2NY3D 4ZUVA 3OAUH 3RHWK 3DNKA 3KLLA 3K2MC 3N2JA 2Z0UA 3ISYA 2ARJQ 3NP3A 1PNCA 3MOAL 3GJFA 2CLVA 3QR0A 2PF6A 2YAQA 4HLZG 4JDEB 4K5OA 1CXFA 4P57B 4HOWA 2QSCL 3KPNB 4P5RA 5SWZD 3IMRA 5JXAH 1JGVH 1LVEA 5DGQA 1RJYA 2ZCHL 2QTEA 4FLRA 2O1AA 3HE7A 4DPBX 2O5YL 1CBVL 3HC4H 4WUUE 1NIBA 4UT7L 4JK0D 5E4IA 1EEZB 3LQMA 5DLMH 3SOTA 1QHPA 4HWBL 3HC3H 4CBZA 4YK4B 4ANKA 3K91A 3TYFB 4CVXB 3F7KA 4MAYC 4TQPA 4DVRH 2RTTA 4LVHC 4KK9C 5GS1B 3TEZA 3HR5A 3EG9A 1OLLA 2DI9A 3HPJB 4P3CL 4YHMH 5DO8A 4GEIA 3MPCA 3OZKA 3X13B 2HFFA 1YY9D 1ZGLP 4TV3A 2CBTA 1UZ8B 1D5XB 4BH7B 5J11B 5E8EA 3MLXL 1YEGH 5ALBL 4MAYB 1ACCA 4NQDB 4G9FB 3VA2C 3NACL 3GZKA 1MHCB 3UYOD 1T1YA 4BWUA 2AI0L 2RFXB 3L1EA 2CJUL 1MAML 1UXWA 4I18C 4OCSL 1GVIA 5JHMA 4Q9QL 4CVZB 3QRGL 2FBOJ 4HKJB 3BW9B 1SLVA 2KT6A 1FIGL 3LZQA 1RV6X 1MVUA 4KZCA 4KHTL 3DJTA 1A4CA 5D7LD 3RL2B 1ZSDB 5TDNA 5E08L 5DGRA 1O7VA 1IC0A 3LKRB 3RHWF 3FSZA 4UBDC 1D9KA 5KYWB 2H4EA 3FN0L 1BAFH 2YD5A 1RUPL 4U1IB 3O2DH 3GHBH 3DVNB 3BVUA 3G5XB 2APVA 3RA7H 2IPTH 3DTXA 3IRPX 3BWUC 3W56A 4HSAC 5A7BA 1CFBA 4GW1B 4U3SB 2H6PB 1TEYA 3C08L 2VE6A 3OXSA 5LGKA 1FV1A 2J56A 5IESL 1PZSA 1XGTA 5DS2A 5E1IA 1WO2A 2P80A 5ID1B 1TJGL 1KXQA 4Z7IA 2EDWA 4KQ3H 4OJFH 3F83A 4JO3H 1TQTA 1U91A 1NLDL 4X4XA 3A47A 5EIIA 3NJHA 3RAJH 2FGWL 3MRHB 4MASA 4P2OB 3OZLA 4LL1A 1SLWA 2CHDA 4JRLA 1FE8H 3BDYH 3OMAB 5DK0A 3HAEH 5DDHB 5HI3C 3VTMA 2WB1A 5L4FA 1NTDA 3PFUA 3QARA 1J1OL 1TQCB 5JLZB 2F8VA 1I1AC 5CD3A 3RPIB 4S1RH 3RRQA 4QKTA 1VIWA 1AJ7L 4LLDB 5FECB 1RJLA 2DMGA 3PG2A 3EDEA 1KXVA 4JBSA 1HNFA 4RDQG 3VGAB 3S96B 5B3JF 1N3NA 5JHBA 4Z78A 2JB6A 3B3IB 3US0A 1LM8V 3L7EA 3BPOC 4PJGB 3NOIA 4XNXH 4JKNA 3SKNA 5E2JA 2WO3B 1AXIB 3ZBMA 2JIXD 3G6DH 1SXCA 5E51A 5IWLC 1VEOA 2YWZA 5DUBB 2Y6SC 3VXRB 1SNRA 1EZVY 4MD5A 4F3FA 5BXFA 5HDBB 2VDOH 2RHEA 4KVCL 5E9DE 4TQHA 4XAKE 2DZEA 3MUHL 1JNNH 1GGCL 4K07A 3IDGB 2WXHA 1V3MA 3WYRA 4L8SC 3RL1A 1JDDA 3EBIA 1VDGA 3EF7A 3L3IA 4MCMA 4O5LL 4Y5YC 2BINA 5JNYA 3V0WH 3U9WA 5L2KE 3TA3C 1R33A 2XY2A 1A6ZA 3TWCH 3EYUH 2I25N 3MNWA 1HXMA 4Z0XA 4Z7VF 1WK0A 4PHZA 1CG9B 1QBLH 1JPGB 2F53A 3CFNA 3EDJA 4UIKL 5MEND 2PW2A 2A9CA 4UB0L 4ZQKA 1I1YA 1E65A 4PJDF 1NGQL 5DU7A 4AY0A 4Q52A 2WQUA 3JZYA 3HBZA 3EO0B 1GYUA 1UWFA 1HEZB 1VB9A 2DQDH 1T1WA 2BPBA 4GKSB 3DXAA 5IK3A 5DD1H 3VRIB 4L5FL 1KBGH 1L9TA 4YHNB 3W81A 2Y1AA 4CKQA 4JGUA 1LP9A 4LLWA 4GSQA 1BYNA 1CD8A 1KLGA 1XIWA 4QXVA 3TFKD 2R23A 4CW1A 3FOMB 4HBQA 3RB7A 2XU9A 1AXTH 3WHE1 2C3XA 2WTPA 3IMTA 4CMMA 1KIUA 1DJYA 4QUOA 3ZVVA 3CIQA 2IMNA 2W9LA 4OCYH 2BIIA 3WNLA 4DAGH 1MG2C 3X3FH 3K71B 1BQUA 4DW2H 4LCCB 1KIQA 3ULVD 3C8KB 3LKQB 2GUOA 2ZJSL 2QPUA 3EH3B 3QXUA 4HJJH 5AOMA 5EU6A 4HCIA 1I7TB 5T8IA 3TNNA 4E9LA 15C8L 1E4XL 1XTLA 3CHXA 3NCJH 1XQ4A 4HFWA 1Q9LA 3Q1SL 3NYKA 1KPVA 3FTVA 4GXFA 3MUZ1 4LKCA 2DS4A 1LGVA 2QPFA 3NIDF 5E70A 4NQDE 3GZPA 4G9FE 4HEMA 4AIZA 5AVTB 1MUJB 4M6AA 5GS3A 1DR9A 4Q7DA 4B0MB 4Q0XL 2CJSA 1GGTA 3H42H 3KLAA 2XWEA 4NFBA 5GRJH 4WCYH 1OQOA 3QEQB 2NX5A 4WW2B 5AKRA 3VWJB 1EDYA 5DFAA 2AJXH 3S4SB 2IPUK 2OR7A 1DBMH 2FSEA 3MYJB 4IRJD 4I1RA 1AE6L 4N3UA 3WS3A 4NWTH 4MQSB 1XF5B 4PJFB 3P73A 5EU5B 1KZYA 3VRLE 4HJ0C 4L8CA 3CFJA 5JOFA 5FHBH 3IFLL 5KTEL 5T3XE 4UYPA 3MLRH 3UBXI 4MJ4A 2XV6B 3NZUA 4M7LT 1DQLL 3UIYA 2EDTA 1X5ZA 4QF1B 5ICZB 5AYUL 5AUMB 5JOEA 1Y0LA 3ZDYF 4EVNA 5CHNB 3ECQA 4BWTA 4JO8A 2NY5H 3HC0A 1PW3A 5AW6B 5TQ2H 3PHOB 4U2YA 3UMNA 4FJYA 2UXGA 1XBDA 3H9HA 2QSTA 5ES4B 1HNYA 5FO7B 2WLLA 1TT6A 2O6CA 2P24A 4POUB 2YPVL 1MI5D 2QTVA 4M8UA 1R3JB 2Z8WC 4NGHH 2QQNL 3L5IA 4LEXH 4JM2B 1AKJA 1JGUH 4U0QB 4YZFE 4AJVA 3ULVL 1NZRA 4XR8C 3VJ6A 5F3BA 5FA3A 3BWZA 1FL6B 3U9PL 3E2HC 1YAZA 4C4UA 2BSED 2FWUA 3GSNL 4ZO9A 4ZSOA 1RMFL 2BP5M 1CLOH 5J12C 2PMZA 4N25A 4PJGE 4TQIA 4M02A 2RQEA 3SE9H 3DX1A 5B7FA 4P2QB 2NXYC 1YEHH 1AQ8A 4L3ED 1MF2L 3BVWA 1E3XA 3T6XA 3VXRE 2FR4A 1A3RH 4O02H 5HDBE 4XCYB 2Z35B 4OU3A 3ZDZB 5IMOA 2CK0H 4O9HH 5ITBH 5J1AB 1Z1WA 3FOLA 2WQVA 5D2LA 4HS8L 1J0IA 1MKFA 4HKZA 2V2TB 3DIVA 2ZF9A 5GPRA 1AI1L 2FQFA 3N44B 4L8BA 4X6DF 5GZOA 1Y6KR 3JTSB 1WD9A 1XCQA 3ETBJ 3MACH 4KX8A 4LL4A 1U3HD 3AGWA 5IHUH 2C1OB 3MRGA 1AS7A 5DD5L 1QTPA 5HHMB 2FJGB 5KYUA 1XH3A 3V0JA 3EYQC 5CR8A 4PJEB 1PJWA 1XFPA 4FNUA 3RDTC 5DRNA 3CDGA 4G72B 5DZLA 1MCOH 1F2XK 1VFOA 3NA9L 2WLNA 1T0OA 5CINH 1TZHA 1ADQA 2EH8L 3WLWC 3SZKC 2GT9A 3FT3A 1YMHB 3DA0A 4H25A 4YQXL 4PJIB 2QBWA 3LIZA 4DP9X 3T0EC 3VXPB 3EXJA 1ULVA 1CFQB 1U3NA 3FRPG 3MNVA 3B5HA 1JTTA 1U8JB 1GGIH 3AM8A 4XP1H 4W9HC 3VWKC 1Q72H 5C3IA 3PPSA 2J2ZA 32C2A 2C3VB 4EN3B 4Z7VA 3MUJA 3EYFB 5BNXD 1N6UA 3T6ZA 2BSRA 2N1TE 4H5SA 2QSVA 2ZOUA 4PJ5B 4DIXA 3P9MA 3IN2A 4PJDA 5CN3A 3S35L 4JFOB 4PGEB 4CA4A 2FWOA 4KRPD 1ZEAH 2L7EA 2WBKA 3OKLB 4DN3H 3H53A 4GG8A 4MBOA 4CC4A 3UFIA 2DQUH 5JIPA 2GJ6D 1JXJA 5ISZB 2MCPH 4DHLA 2E86A 4FAAB 4WK0B 1A14H 2OL3L 4K15A 4P2RB 4HC1L 4YSCA 4CMHB 4E0RA 4U7SA 2AV1A 4PLKD 2HLAB 3PAYA 2XWCA 4WK2B 3KG5A 1ZT1A 4PB0H 2Z7ZA 3T8MA 2XZQH 3ALPA 3E6FB 3FSVA 1BX2B 3H4FA 5FHAH 3RUGB 3VXTA 5I23A 1LO3L 3LZOA 2HX8A 4AC2A 2ZF8A 4K7PY 3UBFA 5DMKB 2AK4B 4MNGA 3RTQD 4XPTH 5B38G 4Z3IA 1PQZB 1R6VA 5CF3A 4EZJA 3QEQE 4IKKA 3CC5B 4X7SH 4QRTA 3QO0A 2J6EA 4YHKL 1IGCH 2NY7L 1Z3GH 3VXQA 2FE0A 4JPKH 1CXIA 3DX7A 4HJ1A 4FC3E 4L3CB 5C3LD 1F58L 4G6KL 4Y5XC 1M2VA 1URIA 1ZHBA 4MQTB 1K2DB 4U1JA 2M26A 1IGTA 5I1CH 3BSGA 5DFWH 3GIVA 3OPUA 4YLQT 1OO2A 1I8MB 3CZGA 4QLRA 4LO9A 4YSDA 3DPBA 3QG6B 4FFVC 5L8JB 2BNUB 1N4XL 4Y4KC 1NMBH 2H8PB 4XVSH 5GISL 3QA3A 2TRYA 3QUGA 5INDA 1TZGH 4KK6D 1V7NH 4EI5B 2CPUA 4N2MA 4HUKB 4ZX5A 2OJEA 4ZOAA 3M86A 1ORSB 2BOBA 4F2MA 1S5IH 5JW5B 4FQCL 5LNEA 3KWVA 3T8VA 4NWUL 2EICA 4Y5VB 2B3IA 4XB8A 1AANA 4JN1L 1TMCB 2YRPA 4LLYB 4Z3JA 5F9OL 1JUFA 2ZKHL 2ZX8A 3SD2A 3FB6B 3UMTA 5JQIB 5DD6B 1JCKA 1P9MC 4AGOA 3FQWA 3BP5A 2VL5B 3GBNL 3M8OL 4OJAA 3QI9B 1AY1H 4HK3N 3ZHFA 2NR6D 2XPGB 5KVDE 1ETB1 4AXWA 5EEUA 2VO5A 4NQCD 4AKOA 3C09B 2J3SA 3MV01 1I3VA 2EDOA 1PGRB 2YKKA 2VLJA 3MBEB 2ATPB 4LSTH 1Z0MA 4W9ZA 1DQDH 1D6VH 1PS3A 4Y4HC 3WD5H 1UVQB 2OK0L 4PLJC 1NCAL 3HI6L 2ODIA 3LNEA 4D9LH 4WFHD 1L9QA 2ZSWA 1E8XA 5DLLA 3FQXA 2SEBA 3UC0H 4BSWA 1P7BA 4P2QE 5F7KC 3OAYH 3RJQB 3ZQWA 4EBQH 1INQB 3PL6A 4KUZH 1W72B 2PXYA 2WYTA 1OL0A 2VC2B 3INUH 3ZDZE 1CICC 1QSFE 4ZOCA 2CO6A 1A6TA 1BXVA 5JYMA 3EYVA 2H1PH 4Y4HB 3S36X 5E6IA 5F0LB 1GKEA 2ZYHA 5C2BH 2AK1H 2WY3B 1GTFA 2MOQA 1CE6A 4ZAKA 4F91B 3NIFF 1GAFH 4RMUA 5I71B 3V7AG 1NBZB 5GGQL 3NCYS 3L5XH 2DJ4A 2OZ4H 4LIQL 4MVBC 3PNWB 1UD8A 4FQXD 3X2QB 4XMXA 5HHME 3ZL1A 2WWOA 3RIAK 1LJMA 4I2XB 5HVHC 1NKOA 1CICB 5FUOH 4MNQD 5C0FA 3IFNL 1M6OB 1F11A 4PJEE 1XR9A 5IMLA 1PZCA 2O61B 5HYQA 1W0VB 2WP3O 3HG1A 4HAFA 4P23C 3SE3C 3ZKXC 2NPLX 1JDAA 2ZG2A 1AQKH 2QHRL 3ZTDC 2EJ1A 3O41B 5DC0A 2Z4TA 4K5LA 4L0YA 4ONHA 4IQHA 4PJIE 3LNGA 4NPYB 4J27A 2ZNXA 4U6YA 4WHCA 6PAZA 2E7CA 3ME0A 1RJCA 1OALA 4P9MH 4BKSC 3MBWB 3AT9A 4OJCA 3H2PA 1O9WA 3ML8A 3IU4H 4X6DA 4X9YA 1S7RA 2A9BA 1E4HA 3ZTJG 5MI0B 4EOWL 4GI9A 1Q0YH 4HHAA 3MV7D 3N42F 4G43B 5GGTH 4V2CB 3QNYA 4I13B 2EE9A 2F54A 1TQBC 4YWGL 1PFOA 5GIRA 4PJ5E 3ARWA 3MLSL 3VFVB 3U9UA 4AZ8B 5CLYA 4WHYH 1OPGH 5JDSB 3CMGA 2YAPA 3ROLB 5L6YL 3P4MB 3VA6A 3D0VA 3SGDH 2VXTL 4RGOH 3IJYB 5F70A 3S5LG 1FL3A 3KR3H 5AW2B 2CGRH 3EYOA 1DVFC 2MCMA 5BO1H 5CMAB 4EZLA 1G4RA 4BD4A 1NCWL 1E4JA 1SY6A 4DQOL 4PBWD 5TGBB 4P2RE 4QT5B 5DJ6A 2BNQD 1S9XA 2H2PC 2UY7A 3FB5B 2YXWA 4OFQA 3CTTA 3S7GA 3WO4B 2CHZA 4C56D 4L3FA 3VNYA 1KTRL 3MJ8B 4D0CB 1QSEA 4UILH 1MCEA 5GGRY 3KPMB 3PABB 4PHXA 4EDXB 2P5WA 3SDXF 3C6LA 1RY7B 5KOMC 3FO9A 3BKYL 4HZLA 4UTAL 2WN3A 1GOFA 5FC9A 4ZDHA 3WEBA 4DWHA 2ZCLL 5LLIC 1MFMA 3MREA 1L0YA 1QI3A 1R17A 2DJUA 3RIAF 5HYJA 1XR8B 2X9XA 2XWDA 5ADPH 3KPRA 3NFPB 4U6VL 4GP5B 5DQJB 2H47C 1K3IA 1HWHB 4A6YL 2OTUA 2BM3A 1JGIA 3POCA 1W6LA 4NDMB 4PI0A 4LSUH 3P11H 4N26A 3WSQL 1L5GA 1JDCA 2YAEA 3VCLA 2AAAA 2YA0A 2NOYA 3S3PA 3EJPA 5FGRA 3Q44A 4QRAA 4LPWA 5B4MC 1NLBH 4XGZA 1HHJB 5I1DA 4WI3A 4X5LA 1NCDH 4IGBB 3CFEA 2DKMA 3ULUD 3S36L 1X4YA 1OXYA 3WIAA 3ZKND 5HGDA 4JFHE 4X9FA 2NNAA 3GPSA 5HGGS 3PP4L 3E8UH 3IFOA 4E9QA 2NT0A 5BV7H 2HN7A 4P59H 5I17A 2DH2A 2PYEA 4YDNA 4XN4A 2NYZA 2WQRA 4LDCA 1VA9A 2EE0A 1I8KA 4AEIH 2BIHA 3CN4A 4F7MB 5BVJA 3QUKA 4Y2OB 2WBXA 2WK2A 5CD5D 1XH1A 4MZIA 3MRFA 3BEVB 4DFIA 4JKKA 1P6AB 1BZQK 3RX8A 3BKCH 3OXRB 3HUJB 5T1LA 2B4CH 1J48A 3HMXL 1MAKA 1URZA 3RWGB 5JPMC 3AITA 3VFUA 5F72S 4IKNA 3CC1A 2X7LA 3L08A 3NIGB 1SOSA 2WMPB 1OGTB 4DZ8B 1TEFA 5DEGA 2VO8A 2VZSA 5F1NB 3SO5A 2OKMA 1FHNA 5IBUG 4FTVA 4KH9A 3SKMA 3QJOA 3QPKA 2JK5B 1CGWA 1WH0A 3CSFA 1YEJL 3ETTA 4YDJB 4XCCL 4UQAA 1UZ6F 3L2NA 2ZOOA 2DTSA 2G60L 1T6BX 4RDQF 3TVMD 2JTYA 4WI4A 5DEFB 2X3BA 3IGAA 1BWWA 2XV2A 1KELL 4MBRA 1YEEH 3GBLA 3FFCD 2DQMA 3A4EA 4NHUB 5E4EB 1EHLL 3HNTH 2Z92A 3SCMB 2VXQA 2X4NB 3BD3A 3F7YB 4U1HA 3WKML 1YMMA 4D0DA 4LLQB 4DGUA 3N50A 2VMCA 4JVWA 2MMXA 3EFOB 3FFDB 1KCWA 3E38A 2J5LC 4LLUA 4I2XE 4ZMOA 5GRUH 3UJIH 3VQ2C 1JYNA 2UZYB 1WIUA 1KJ2L 3U0WL 1D7CA 2BW5A 3TCXA 3B2UD 3Q2CA 1A8ZA 2VN6A 1OAKH 1YY8A 5DUPH 2WZPD 5HHXH 3SJVD 5H2BA 1KV7A 2JKLA 3LD8C 3TT3L 3L3GB 1MHHB 1A9VA 3C6SB 1TJIL 5K9JL 1CD9B 3FO1B 3HI5H 9CGTA 1BEYH 1KIPB 3KDMB 3ULUL 3N5AA 4PR5B 4BWWA 4PGBB 5BRZD 3EADA 4M6NH 4UOQA 4M1GH 2V7NA 2CCLA 1Q8MA 4HK3J 5D6DC 3KBEA 5C8JA 4MX7A 2WLIA 4XP9L 2WCPA 2NY1B 3REVA 3BUPA 1FNSH 3S3DB 2GB2A 3C60D 5AZEL 1UA6L 3EO9H 3QDMD 3B5GA 4MXVE 4CJ0A 2XWXA 1KEML 2X10A 1T80A 2YARA 1U21A 3KVQA 1NC2A 1FI8C 1G0XA 2B39A 1RZQA 2DM4A 5C1MB 3SE4A 2DQGH 1ZRUA 5C7ZA 3MV8A 2IG2H 3QWOA 4JHBA 1Q90A 2PWEA 5I19L 2E4TA 1W0WB 2WZ5A 5GXBB 1EJ6A 5CJBA 1WZLA 1V8HA 5DEZA 5T3XH 2OSLA 4NZTL 4XWOD 5TFSL 5IFAH 2QQLL 2Q7YA 4QRPD 2LFGA 1FNEB 1UXSB 2FLBT 2QGCA 2WUBL 1CGSH 2DYRB 3WE6B 3WIHH 1BD2B 4H1LG 2UYLA 3APNA 4M8QB 3HZMB 3QCTL 1SXAA 5I6NA 2BLFA 1XB8A 4FL4C 1QTSA 3DYPA 3FK3A 4N1EA 3B2MA 3SBRA 2X1QA 3MJ9L 2F15A 4R0LA 4UTBH 3VFWA 1E3FA 4JRYA 3BVNA 1MCBA 2CA4A 1A6WL 1A0QL 1J7VR 2D3VA 3F62A 4Y9CA 1XF3B 5K59E 1S3KL 2VXUH 2X6BA 3A24A 2QDVA 5D1ZI 3SDYL 3VB8A 4PJ9D 4JFQB 2D7TH 4W9CC 3HE7C 4XB3A 4HJIA 5F7EH 4ZUVB 4KX7A 2JKNA 4NUJA 3WTUA 5IG7A 5FK9B 2BH0A 2J57A 1Q0XL 4KQ0A 4G8EA 4KH2A 4EI0A 2ICWI 3CZUB 3T3PF 3ZE2B 2OSWA 3LNIA 4W93A 2WQXA 4FL4B 2OV0A 3GJFB 1TJHL 1ASQA 2IH1A 4KI5D 1Z66A 2UV3A 1JAEA 2DM2A 4ICXA 5DF0A 3IDJA 4JFDD 4XCFH 1RJYB 2BXZA 2E7BA 4N2BA 5B1KA 2W92A 3CLEH 3SDXA 1F41A 3FTYA 1S9KC 1H0DA 1CQKA 1SEQL 3ZX1A 4A2LA 2F5AH 2FX7H 3FO0H 3AUWB 4HUCA 4NIYE 5GHWH 2EDFA 1CBJA 2APWA 4Y88A 3P3SA 1DEDA 2C3HA 3ESPA 1X5JA 2LFEA 3IB4A 3VGHA 5E6RB 2VIRA 3WHXA 4BZ1L 4L29A 2LT9A 2WYZA 2QKIA 3ZSTA 3HR5B 1O9VA 3L95B 4MDJA 4TSCL 3EG9B 5LWYL 2VDNL 2DQTH 2CDFA 4K0OA 3QYNA 4JDZA 2HFFB 2PW1A 4UAOB 3PYCA 1OTTC 4QRSA 4K8RD 3HUJE 4FZEH 5ICUA 4A04A 2Y3AA 4XC1L 4ZXBA 3BISA 4ES9A 5AWNL 4JY4B 1OTUD 2J12B 1A1NB 3AMKA 4K5NA 2OMUA 1H3VA 3MRIB 2BHUA 3NIGE 4N1CA 4DGYH 1L9SA 1T1YB 2F7IA 4JZJA 1EO8L 2OPCA 3S9DB 3ZZLA 1UXWB 3F6IA 3CFUA 4XBMA 5I2IA 2M8XA 4TUUA 4P46A 5CLWA 2V0AA 1KN2L 4L4TA 4NAJA 1SHXA 5BO0D 5DHMC 4S11A 3W82A 1WC7B 1JNJA 4R84A 3EW3B 4OLUH 5HDLA 5D70L 1KPRB 4HS3B 1D9KB 3TEUA 4BFOA 1I53A 1RUQL 2O72A 3QQ9C 5DUMH 3QIWD 1CR9H 1CS6A 1YLBB 2CCVA 1MNNA 1ESOA 4LASL 4OD3L 2P8LB 4R7LA 1LE5A 1S9WA 1QX1A 1P4UA 2C7UA 3B7TA 1NGYB 1UACL 3RURA 1BF8A 4A2MA 1SJEA 2PTTA 4PRIE 3SDAD 4DUXA 2ATAA 3TBCA 3OXSB 4J6RH 3U0TB 4IIZA 3NZHH 3DVGA 5CZXC 4PV8A 5F88A 1KCSL 2HRGA 2XN9A 2F6AA 2EE3A 5JUEH 2Z31A 2GCYA 1A6UH 2D7PA 4JFZH 4BA0A 1V5JA 1F45A 5T5NG 1SRDA 1T20B 4X4XB 5EIIB 1U6AH 4RMQA 5JPNB 1KXVC 3UZEA 1KJVA 3IF1B 5DK0B 2Y7MA 1NMAL 1B4JH 4JDTL 5F7WC 1E5UI 3T2PA 3ZKSD 3CFBB 2FQGA 1AZNA 1QPPA 2YMOA 3SN6N 5E9NA 4HWZB 1UHVA 1F56A 4OF7A 4I3RH 4P05A 5B1AB 5GGRA 3V0HA 4G8GA 1RZJL 3U83A 1FJ1B 5J0BA 3AB0C 2A77L 3GMOB 2JVUA 2VRQA 1N3NB 2QQKH 4ZPVA 3QR1A 4HWBA 4K8RL 5LBSL 5J13C 2WZ6A 3FUDA 2A6KB 4R4NC 1W16A 3WY2A 2OI9C 1JOIA 1PKQA 5EU7C 1ZLEA 3B6SA 4MA8H 2WXLA 1E4WH 3GLZA 4QOKD 5B39G 3X1BA 1E4KA 4E9SA 4OVUA 2YFOA 3UZQA 3AGVA 1JF6A 1TQSA 3LKPB 1AGCA 3D3VB 4GKNA 5JNYB 2XTLA 5J8OA 2NCEA 3JV5A 3U48A 1NJ9B 2QKSA 4UMGA 5A43C 3CE1A 4FMFA 5FFLA 2DQHL 2YAHA 1G7QA 4W4NA 1A6ZB 3MNWB 1HINL 2FO4A 2OI9B 4JHUA 3TGXA 5L8KB 1XBRA 3CSBA 4PG9A 1BMGA 2B1OA 2F53B 4BE6A 2PW2B 2LOEA 4ZQKB 1JK8A 1I1YB 2XWBB 2YJLA 2N7AA 5J1SC 4JB9H 2DYSB 3LVTA 1DVZA 4NN7B 4RRPM 3ZRSA 5E2TL 5G4NA 1J86A 1XIWC 1MJUH 1DFBL 3D1MC 4PJHB 3VGFA 2TRHA 3ZE2E 2ZWZA 1HCVA 4YBHA 5EWIL 4LP5A 2HMID 1X5IA 2FVNA 4KOCA 5C07B 3VUAA 3SEPA 3DXAB 4APQA 4RBPH 5IB2A 4PW3A 1AG6A 5KVDH 2HA1A 4ANVA 3KZ8A 1G9NC 2QVKA 3EBAA 1LP9B 2MIZA 2HVKB 4F57H 2YFNA 1KLGB 4MJ5A 1Q1PA 3R1GH 2QFRA 4OLWL 1E2VA 4CW1B 2H5UA 5KWYC 3THMH 1E6JL 1OK8A 4FP8H 4U1NA 2B3RA 1P4BH 4CMMB 5IMKA 4JEGB 3ULVF 5DFVC 5TE7L 4WI7A 5A3IC 2X4RB 3HZYA 1FZMA 2BX5A 3BZ4A 2WLKA 3CU1A 5SWZA 3OKMA 2ZXEB 4DJMA 4MJ6A 4KDWA 4FNLL 2VITA 1F5WA 3BCFA 2CMRL 4H0GA 4M3KB 2EEFA 4M6MH 3VE0A 5DTFA 5I1IL 2GUOB 2JJUA 4Y2DD 1OAXH 2NZ9D 5EU6B 3TLRA 4LHUB 1GOHA 2HZHA 3TNNB 1B6DA 4EIGB 3LPWA 4HFWB 2ZAGA 5AG9A 3EH1A 1KPVB 4LKCB 2VDPB 1AO7B 1ZOXA 2CIIB 5L2JA 1X9UA 2JCCA 2FNWA 5I9QC 3LEXA 3WIIL 3SE8H 3JWNG 1P1ZA 4FLQA 5E1HB 2K8QA 4XRCA 4LXFA 2GI0A 4GJTB 3EJYD 3KLAB 1W8OA 2X6CA 2NX5B 1QEWB 2Q3ZA 4J3UA 5IROD 3MCYA 2VDMB 4JFED 4TN9A 5DVPA 4YZWA 2NNRA 4LAJH 1X5GA 1R3IH 2A7BA 2YOCA 2WGXA 3BFOA 3WS3B 3P2TA 5ANHA 4WSKA 3NDZE 3P73B 4X50A 3VVVA 4MXWH 5FO8A 2H32B 4L8CB 5F7DB 4Q6KA 5DRXB 1TJMA 4UQEA 4HJGA 4JM0A 1XB6A 4R4BB 4OCLC 5DZJA 4YFEA 1BAGA 4JCMA 1QR1B 1W91A 4R97C 2Y4SA 2Q2EB 4H8WH 1TO5A 2X2JA 2P3YA 3MRBA 1LEKB 2BVUA 3R0NA 4WI2A 5M94B 3ZRCC 4P3DA 1GGYA 4WI0A 5LO7A 4E41B 2NY0D 5D7LA 4G70B 1WDAA 3GDCA 3DVIA 1JNHA 4NM8L 1KXQE 1Y0LB 4Z77A 2AZAA 3BUQA 4EVNB 2XOTA 3BYYA 5I6KA 2F5BL 2KZBA 4EI6A 1H3PH 1MCPL 1C08A 1QR4A 3BZFA 3HC0B 4X80L 5ELIA 4HKBA 3SGDI 4DGWC 4G7VH 1CL7L 5A6IA 3OKDB 4OFPA 4OTXL 1WBZA 1IE4A 1RVFH 4IMKA 3H9HB 1UJ3C 3MRLA 3GSVA 2QJDA 3QNFA 4FERA 5FM8A 3U4AA 2WLLB 1DVUA 3BGFB 2FJFA 2P24B 3G04A 4NXKA 4QLWA 1WV7T 4PW9A 4S1DC 3VFMB 5HSFA 3GUTB 4BM7A 1YJDH 5I82A 1EAPA 2XJKA 1SDDA 5FA3B 3ARXA 2VZUA 5IM7B 1NCUA 4MXQC 4ZSOB 2IH3B 5F1SA 5F9JA 1O75A 5EIQA 2WZAA 1FBIH 2V2WA 5GZOC 1XGYL 1HU8A 4MQ7A 1SYVB 3LEYH 1Q0EA 5H37H 1OW0A 1ZT4A 2DKUA 3BUIA 4DP7X 2FR4B 2EVFA 4YHOL 5EOCL 2Z4QA 2NZIA 1RU9H 1Z5LB 5FYJU 4ZFFA 4GI8A 2FEEI 5IMOB 5LGJA 2Z7WA 1IEHA 2H3NA 5D2LB 4FF9A 4U6HB 1T0PB 4AQ8A 5IW1A 1KEGH 4PS4H 3KYMA 1YNKH 4L8BB 5FLUA 1DL7H 4R4FL 1B3JA 1RL1A 2C9VA 1UOKA 3HB3D 3MRGB 4G7SB 3FRPA 2JIXA 3M45A 4BDVB 5L4JA 1TTUA 2FYVA 2F53E 2CR3A 5KYUB 1CIDA 3LZFH 1XH3B 3VI3F 4B9PA 4N20A 1IILE 3LS4L 5DR5H 3CDGB 4LSVH 2WO4A 2WWKT 1J1PL 4PJHE 3WELA 3DIFA 1E5BA 4HIHA 1U4EA 2L7JA 4GAGH 4JAMA 5C07E 3DXAE 4TTDC 2GT9B 3BHBA 4TL5A 4OIAA 5JQ6L 4DCQA 3DX9A 3PXHA 3FXIC 1G5AA 1Y6NR 2BVOA 4WEUD 1IAKA 5MENA 1VZGA 2ARWA 2AS5M 1LP9E 2BRRH 4HPOH 5KBDA 4H8QA 4ADJA 4NT6A 2Y2YA 1CFSA 2J2ZB 32C2B 5KS9F 1AP2A 2DDQL 4Z7VB 1E9PA 4O51A 3ULAB 9PCYA 1JZHA 2XYCA 3VG0H 4M03A 5HVWA 4H5SB 2YSTA 4IYKA 4K3EL 1CU4L 1FORL 3P9MB 4PJDB 1M9SA 3SPGA 3TO4C 1N70A 1NDTA 1W72H 5EPMB 5JOPD 2VC2H 2JELL 3O3DB 4NCC1 4OCWH 4GG8B 3CFCH 2YD2A 5B38A 1KCUL 2R0ZH 1A21A 5EU6E 4TQ8A 2EUZA 1S5HA 3K80A 4P49A 3CVIH 5LCVL 2XSKA 4YE0A 5AW4B 4E0RB 2OW6A 4JE4B 3DVFA 4Z5RB 1WPCA 1QLFB 3BP4A 5D7IF 3WNPA 2YPVA 2R2HB 3VXTB 1QEXA 3G6JF 3GIZL 4KROB 2ZXDA 3UAEA 4P9HC 3CPUA 4F58L 2DF3A 2CIKB 5CJXA 3NCWA 1B0IA 2RACA 2UWEB 5CUSH 2NX5E 2FT8A 2FZ3A 3GSNA 3QO0B 3NFSL 3GK8H 3VXQB 1P5UC 3KJ4B 3DX7B 3FCSA 3MKKA 4QYOA 4WF7A 5L7XL 1M2VB 3D4YA 1ZHBB 4U1JB 5CO1A 3WN5C 4GMTL 1JXGA 1IGTB 2W0FA 2W5PA 5KEZA 3ATEA 4FS0A 1KYUA 4YAQA 2A2QT 1BFVL 3SOBL 3KH4A 4IKJA 3MZTA 1I7UA 1SVBA 2PWDA 2BS9A 2W07A 5IHLB 2VM9A 2HRHA 3QA3B 1M7IA 4N8VB 5INDB 2CE6A 4MS6A 7FABH 1WA0X 1Z9PA 2X70A 3AY4A 1T22A 3GRGA 1NGZA 2VXSL 3O3EA 4KJPD 5LGYA 5C0EA 4E41E 1KPUA 2OJEB 4IRJA 1PAMA 2BVPB 2M1KA 4WFFE 2R27A 2BOBB 3OR7B 1KTJA 3L1OL 4OCXH 2OMTA 3FUIA 5CS7A 1D2OA 4ZI8A 1OKEA 2RJMA 3GMQA 2BFVL 4R7DA 1P7QD 2J8UB 1LK2A 3QULA 1HQ4A 2ZIDA 2ITCB 2AJZA 3PF2A 3RY4A 2FJHA 3SQBA 4WFGD 4OQ1A 5E1GA 1K8DA 3RIFK 1ED3A 2XJLA 3O4LB 3N41F 2G4GA 3BP5B 3NH7L 1XHHA 5IJKA 3MJ6A 1IEAA 4OD1L 4GQPH 3IXAA 4AKPA 1XH2A 1OHQA 3VFGL 2A6JB 4ZNCD 3K3QA 2PXYC 4Y89A 4WTWA 4XP6L 2H6OA 3CDZA 3AXLA 4GKZB 1I1AD 1DLHA 4QWWC 1OV8A 5E6IC 5HJBA 4ZSOE 1P84K 1DVXA 4JREC 4ZAKC 5SV4A 5EU4B 2E74C 4H26A 3UGXA 2EDHA 3VVWA 3FQXB 1MIEL 2SEBB 2J88H 3A22A 3FT4B 5J9PB 1PYWA 3CMOH 3PL6B 5DT1H 1MI5A 1F18A 2MNUA 4FRWA 1JCVA 1YEFL 4C59B 1EEQA 4UOZA 2CO6B 1A6TB 3Q6GH 3QXDB 4KV5F 5D2LE 4AM0A 3EYVB 2MKLC 4EPSA 1H3WM 4RISL 5E6IB 4BE5A 2DICA 1BM3H 3LH2L 1CE6B 2OL3A 3MLUH 4ZAKB 4HC1A 1KBKA 2BSEA 2FO1A 3LMJL 1X9RA 3FZUD 2H9GA 2B2XH 4CU8A 1FFQA 2XVGA 2FATH 3ZYIA 2G0KA 1OP3H 2A73A 5B3JE 4L3EA 1RFDL 1A1OA 5A7EA 1S7UA 1N0XH 3QHZH 5C0FB 4NQED 2EKJA 2P8MB 1QASA 1T03H 1XR9B 3TA3D 3RFZA 2G3MA 3HHRB 1VERA 4MA1B 4DOHB 5HYQB 5IV2A 3HG1B 5HJ3A 1X5XA 5BMFH 1I82A 1MFNA 2XLLA 3X11A 2MQ0A 3KBFA 4KJYA 1MCWM 1QFUL 3DETC 1WG3A 2HJKA 4ONHB 1U3HA 1AS8A 2WIIB 1XGRA 3P77A 4U6YB 1LDPH 1HJCA 2PP9A 5FUCC 3ME0B 4BUGA 3S5LA 4TSBL 2FQDA 3V0VB 1IKFH 2H1XA 2X38A 4X6DB 3RIFF 4QHLA 5L9DH 2AABL 1NGWA 1V7MH 5B8CA 1TVBA 4S1SH 2YWYA 2X4OA 4HHAB 1RURH 2I60H 4UQ3A 4Z7VE 4BFIA 5FKAA 2OXGA 2F54B 3MYZA 4HX1B 4MD0B 5AVSB 1O7SA 3VI3A 4ZUWB 1QYGL 2WNGA 4PJDE 5DRZA 3BUBA 5DHXB 4IHBA 5F1OB 5HDOA 5IB4A 3U9UB 4U7KA 3FU5A 1QW9A 1ZHLB 4ELMF 1D7DA 1C16A 3D0VB 3EGDB 2H45A 4JZNB 3C6LC 1XZWA 1MREH 4XPAH 3TT1L 5BUAA 3QDHA 1J1XL 1BBDL 4NNPL 5J4MA 1T2QL 1UH4A 2GJPA 2WVVA 3Q2WA 4GXUN 4U1GB 2BXYA 4YLBA 1S9XB 5I1HL 2UY7B 2H0PA 1OF2B 1GS7A 4M29A 2CNYA 2X41A 3ARBD 3D6GA 3QHFL 4W9GC 2ADJB 2PR4H 3I2CL 1JV2A 5KS9A 4WNQA 2G30A 2UVEA 3BESR 3KL5A 4ZW7A 2P5WB 2IAND 5EH1A 2R1XA 3MMEB 3DHMA 3T8XA 5SX5H 3JQOB 1AOHA 3FO9B 4MNGE 4NRZA 1HE8A 1T1ZA 1A9EB 1N68A 3DJ9A 2GJ6A 4HZLB 5FYKU 2AMUA 3N85H 5I6PA 4FLOA 4ZDHB 4YFLI 2AAVA 2YKLL 2CBQA 3MREB 3PWLA 1MRCL 2RD0A 2EE2A 1A5FH 5EORL 1RK0A 4KPHH 5C0IB 4PN6A 5CIPA 4B95C 1UT2A 2ORBH 3MODH 5D7JB 1Q9WA 4LNRB 1B3IA 2OTUB 2C3WA 1HDMA 2E9BA 5AALA 4E9XA 3K74B 3RTQA 5D7IA 2W95A 2HVJB 3ULUF 2K3TA 1YEKH 2P9RA 3ECUA 3G6JA 4M5TA 4HJ0D 4XGZB 1FAKT 1ETA1 1Y6MR 5KOVC 4N2NA 4IK7A 1D7BA 3NABH 4E5XG 1SHWA 2AQ1A 3CFEB 3BUDA 3QDGD 3QQDB 4XCEA 1BA9A 4XC3H 1WA2X 2O5ZL 1FDLL 3HN3A 4FMVA 1OLZA 5HGDB 3VTTA 4Z76B 3ET9F 3SGEH 2WANA 2HN7B 2Y69B 3SQOH 1UB6B 4CNIB 2IGTA 2PYEB 5I0WA 3CXFA 1JHTB 1I8KB 4M62L 4AL8C 3H7BB 2FHFA 3S5YA 1BQLH 1FFPB 2DMCA 2XWZA 1MFCL 1MFBL 3BQUB 1YECH 3CZNA 2CRZA 3MRFB 4LCIL 3A6CH 4A1RA 2P28B 2Y1ZA 1NAML 4DVBA 3GSRB 2NDFA 1FUNA 5T5NF 1ZJAA 3P4OA 5JHAA 2J25A 4WWKB 5L8LB 3QIUD 3HE6D 2VLJE 1KCRH 4HCRH 1YEDB 1E9QA 2EVIA 3T4YA 4JJOA 5CJQH 2IAMB 1OTSD 2F0CA 4GSDH 4AQ1A 3PWJA 4HG4K 4KRLB 1OP5K 4WDIA 2Z91A 3MQIA 3Q8CA 3SKMB 3VW3H 1N6VA 4LCWB 2NR6A 1T7XA 2DMBA 3FUKA 3GJFH 4J8QA 4MB1A 3ZTEA 4NQCA 1CF8H 5AW7B 5AW5B 1QRND 1K72A 5H94A 3T4AA 4AMKH 4LP4A 4XCNA 2P49B 3GFUA 4GXUM 2R0WH 1I85A 1HL8A 2FBJL 5E5LA 4OAWA 3RVTC 2RB8A 2VDKB 3CLFH 2L7QA 5DWUL 2Z92B 2XIDA 3NRPA 4IRSC 2IDQA 3SYQA 3WLBA 2X87A 4AQAA 4D0DB 3BT2H 1YMMB 1S7TB 2LU7A 4F9PA 4YHLL 1F4HA 1SVCP 2WAQA 3Q6FB 3ETSA 4H20L 4LLUB 4GT7A 5IBLC 4GI6A 3WJJA 3GPEA 3LX9A 1BVNP 1X9LA 1CLVA 3RLSA 3W3BA 4DOHE 3HG1E 3V0DA 4XPGH 2VLRD 1FLTX 3VQLA 3P2BA 3QCVH 4UTAA 5LGHH 3GMRB 5LNGA 1BZ8A 5D8JL 3FTUA 5EZIH 1F3RB 3TO2A 1AIZA 5LXGH 3GRWL 3W37A 2IBZX 2V9TA 2IH9A 5DHYA 1EO5A 3P3RA 3P0YH 3LQAH 4FQXA 4KY1H 4A6YA 4M7JH 3MLVH 5IF0A 4WGVB 5I5RA 4TVPE 3NIFB 5ECGA 4X6DE 4LQFL 3WLWD 1CXLA 4MNQA 1K9TA 2AGJH 3UXFA 4QHKJ 2V7NB 2IF7A 4NI3A 1QQDA 3SE4C 5MP6L 4BK4A 3MBXH 3DC0A 4MA3B 2F54E 2NW3B 1UD2A 3L4UA 4FULA 4MX7B 2WLIB 4S1QL 1TFPA 5C8JB 2PCYA 1QBML 4TQEL 4GAJL 2CRYA 2ZWLT 2JCWA 3NUKA 1DJZA 1T7WA 2WNWA 3ABZA 4H1LA 4J3OC 3L4YA 4I3SH 4LSRL 5FUCE 5EZLA 2NY6C 2ZXWB 1XF4A 4I9XA 3Q8EA 4G8FB 3TBSB 3WNNA 4PD4K 2MCG1 2QMJA 4OM0L 1J87A 4R0LC 1U95A 3IJ7A 2CLRA 12E8H 2HKHH 3MV7A 5HHQB 4NZUH 5C9JB 1HX0A 4IJ3B 2CHNA 2BP8A 1QSEE 4G6AC 3N91A 1TTCA 3N42B 5KUKA 1I9RL 2P5WE 1DVTA 3DUUA 5CXPA 3HMXA 3V52H 2R4SH 2XRAH 4YR6B 5SWQA 3F7RA 3N04A 2A9AA 2EYSA 3BPNC 5C0JB 1X5FA 4X2UA 3OKEA 3QZMA 3BVNB 4JRYB 4KKPA 3RWHA 4ELMA 3Q0HA 4PRPB 2EH7H 4YHZH 4WO4C 3D2TA 2XIIA 4FMKA 4PWEA 1VPOH 2BNQA 3J27A 4BK8A 3MJWA 2G2RA 3KPRE 2WXFA 2ZOKA 4KI5F 3KYNA 4NUJB 1KDIA 4PBVC 1IBDA 4C56A 4HWNA 4K94C 2CU9A 4KWUA 3TASA 5JIMA 3GRBA 4ANWA 5A6LA 4XO8A 1NDMA 2IH1B 1K6QL 2AFNA 3K8KA 4EKXA 5TPWH 3RQ3A 4EE2A 5E2UH 1TFHA 1F1AA 4JPWL 2DOCA 2QKIC 3LEVL 1RZIB 1IAMA 5EOTB 2CM6A 4DGIL 4QXUL 1UA7A 1H8SA 3WKNA 3FB7B 4NI6A 1IFHH 2RH0A 2E27L 1KLUA 1GZQB 4QXGH 3KPPA 1MJJB 2X4PA 1SOKA 1N0LA 1KJ2A 3DKHA 1AS6A 5G4OA 4OSUH 5AVUB 3WMQA 1DJSA 2PYEE 3ELAT 1X9QA 2VIRB 5EZJA 1FZKA 2XZAL 5F96L 3WHXB 3DARA 3HG0A 3KBPA 4JZJC 2QQQA 4MDJB 4WUKL 1FYTD 4M6OH 1AGDA 2NNXA 3VD7A 4XNUH 2HLEB 2PW1B 4P46C 5F3HA 2O6EA 4MMYB 4UT9A 2E5EA 4QRSB 3MCKA 1UOWA 5FW6A 4ZTOH 4R2GD 4U49A 1IQWL 1DQML 1EEYA 3OJDB 3O4OC 5FYLH 3FRUA 5GGSY 4ZXBB 4YC2B 3QNZA 2A6DB 4KDTA 5HJGA 3TIDA 3TXAA 3IJ9A 1ZS2A 3QK0A 3LVEA 4M48L 4ABWA 3UYRH 1DJGA 1XGQA 2ZQKA 4HUWA 2DD8L 5IQLA 2E47A 2COQA 2X4QB 5I2IB 3M6DA 1M57B 2RMNA 4FTVE 2CCWA 4KVPA 3O0RL 4AG4L 2F7RA 4FTDA 3H3KA 4LCWE 2OBGA 4B3EA 3O4OB 1D7FA 3BH4A 2WHVA 2VR9A 4G59C 1MPAL 1H6UA 1RZ8A 2YSSB 3MRKA 3MRNA 4KKRA 4NN6B 3WTWA 2P46B 1NBVL 3LJ3A 2P5PA 3L16A 3O6MH 4HUUA 5I8OL 1LE5B 1YMME 4PRBB 3UZEC 1SJEB 4EIZC 1N64L 4M7LH 3CSTA 4PRHD 2VN4A 5IJVA 4I4WA 3J2PA 2JKSA 3HMWH 3EHBD 4OQTL 3H2QA 4PV8B 2VQUA 3DO3A 3TVMA 3MJ9A 5EN3A 3P4NA 3BUTA 4MVBD 4NRYB 2XN9B 4NQQA 3LHAA 4DN4H 3JWDL 2X2UA 2Z31B 3GSXA 2FBRA 4NAQA 3ZU8A 3FFCA 3MC0A 1GPOH 2PYFA 2YLHA 4WNSA 3BSHA 3EBGA 4FQIL 5ALCL 3QH3A 1JHKH 4GXVH 1ZHNA 3B83A 3QORB 5CGYD 4JRFA 4PTUA 3NIFE 3C5SB 2VDPH 3HN5A 4HULB 1J12A 2CD0A 4UV7H 3FQRA 2ALWA 3QDJD 5K1JA 2GY7B 2WZPA 3TV8A 4OI8A 3CFKB 4AGPA 4KQ4H 2KDYA 4P5KA 5B39A 1RIUH 3DUSA 3EBHA 5GGRB 3SJVA 4G8GB 3U2SB 4PWKA 1E4KC 5BOZG 1VFBB 2CDGB 4V1DB 2EDKA 5CN1A 2XTJB 1F3DJ 2VDMH 2B59A 4LOUC 3IJSA 3U7YH 1LE9A 1TJXA 1H15A 3F04A 2Y3NA 1SEBB 1UH2A 2P5ED 3PPEA 4HJUA 4PJBB 4LOVA 3K0WA 5BRZA 4FNTA 1OEZW 1JGLL 3I6GA 2EO7A 4F7CB 1FA4A 2ZXBA 5K9QI 2H32H 4BZ1A 2KLRA 1UOLA 3FPXA 3HC3L 2JI3A 3L7FA 3B6SB 3LH8A 3QXVA 1ZMYA 3VFSA 1L6ZA 2ETWA 2C26A 2VRAA 1N8ZA 5FCUL 1V3KA 3VFNA 2ILLA 3IDXH 1U8OA 4LSSL 5FOBA 4Y19D 5ICXB 3WNJA 2A74A 1WAPA 2HRPH 4X7CC 5CCGE 2VSDA 3C60A 2PO6B 4W6WB 2F8OA 5C7XH 3QDMA 2GFBA 2H2PD 4BFNA 1YN7A 4KTGA 3VSVA 3OM3B 4APQC 2FO4B 2BSDA 4NYLA 4P4KD 4JRYE 1K5NB 2ZXGA 2ZTBA 2C3GA 2Z8SA 2FH8A 5FXCH 1OGPA 3PIQB 1TTRA 1UD5A 3SDCD 1JK8B 4MD4A 3H6AA 1Y18B 5JHLH 3UBHA 4ZMLA 2CNZA 2LTQB 2PNDA 1R5VA 5IVXF 2LU5A 1H9VA 3L4CA 4G3YH 4RGND 3REWB 4QRPA 3GD1C 4FNRA 1XGPA 3B9EA 3NSCA 1YQVH 2OJZH 5SWSB 5IB2B 1T04A 4PH8A 4APQB 1ZT7A 2XIBA 2YUZA 2ZWNA 4CADA 4F1SA 3CN2A 1E0OB 2ZONA 2AEQL 4PWIA 1MRFH 3QQ3A 1SF5A 4XBGA 2BZCA 2K9FB 4Y1AB 2IOMA 2Y72A 3SDXE 1G7HB 1SDYA 3U4EA 1GS8A 2E9GA 2A6IA 2AQ2A 4PJ9A 1FPTH 3PQYD 2NY3B 1P5VA 3EKCA 4DEWA 2K1MA 1RLWA 3O6FC 4Q6IB 3GHBL 3RA7L 1KBBA 5I24A 1JIBA 4W9LC 2VMJA 2VJXA 2XXCB 2YD3A 2CBMA 3HZYB 4RMBA 1IFGA 3BMVA 3RWJA 3CZLA 5I76B 4MB4A 3T3PB 1FIEA 3QUML 4JFDA 1KGCD 5PAZA 3X3GH 4DPAX 2VITB 1U8KB 1WSST 1WZMA 3RY5A 5HDQL 4KZDH 3WY3A 3NG5A 1ITBB 4OZGB 1Z9OA 3ATDA 4IRZH 2HFGH 4KQ3L 3QZPA 3FQ4A 1YY9C 1TQWA 2XG5A 3PGDA 4WKZA 4NKMA 1OCWL 4KKBD 1B9ZA 1DZ0A 3RGBA 3CX5K 3WFEH 4P5TC 4DUWA 2G5RA 1A7QL 1JE6A 2JCCB 3BDYL 4JKPH 3LEXB 3C5XA 5D2NA 2A9ML 3TEYA 3SPJA 1BF5A 4Q8BA 1VFMA 1P1ZB 3B7RL 4P04A 5AENA 2C9AA 1JYWA 2XKUA 4U1LA 4XRCB 4S1RL 35C8L 1Z9SA 2I27N 3NP4A 4F15B 2XWJB 1FZOA 2R4RL 1ZE3C 3MRCB 1ADQH 1MCLA 4L4TE 5A2JH 4UU9B 5HTSA 5LBSA 2YGOA 1OT2A 4ODTH 2HKAA 4H88H 3QJZA 2CG9X 4OD2B 3CK0H 4LSDA 1VACA 2WLZA 4Y1TA 1Z3RA 4HJGB 1MAJA 1GXEA 2VT0A 3G6DL 4QTIH 3TV3H 1DEEA 2BCKB 3WFDH 1CYWA 2PUQT 1CDGA 2VDOL 4ZTPL 2HVBA 4P3DB 5DS1A 4IMKC 3CFMA 2GKIA 3LAFA 1JNNL 3B37A 3W9DB 1HESA 2EXWD 3K4ZA 4Z7QB 4WFEE 3U82B 5A40E 1JNHB 4FG4A 2XN9E 5FGBA 1F6AA 3UG5A 3MN8A 1XZ0B 4YDKH 1EAQA 3AZUA 3QS2A 1UZ6E 4U31A 3QIWA 3EYUL 3TWCL 4FYRA 5C0CD 4EI6B 3BZFB 2NSQA 4NXSA 5TDOB 4HKBB 2BHYA 1WITA 4JFPA 1YEIH 4RCAA 3SDAA 3WKYA 3FDWA 1OARH 1WGOA 3GSVB 3BKJH 2P8PA 4HZAA 4DH2A 3R19A 2FJFB 1OW0C 3G04B 4BV1A 4AMWA 1IMHC 1WA1X 2DQDL 4G8GE 5D1ZD 3FCTA 4C55A 5DD1L 1IBGL 4LU5H 2Y36H 2XTJE 2J6EH 2V3FA 3GF8A 4MNHA 1AXSA 1G7IB 3C2SA 5F9JB 5CLXA 3GI8L 2ADIA 2Y1YA 3MUGA 4MQ7B 4PJAF 3AQXA 4BZYA 3QEGH 3D8MA 5JA9A 1AXTL 1PKQE 4DKEH 1DUYB 3DV4A 5C0GA 2Z4QB 2DWYA 2P45B 4FQPA 4PJCB 1DFXA 5E5UB 3SKJL 3V5DB 3WXWH 3V6ZB 2XV3A 1QFWM 2FECI 4YHYC 4GQZA 1BAWA 2H3NB 3K6NA 4OCYL 5FW7A 3WO3B 4DAGL 3ECBA 3X3FL 1C5CL 2Y7QA 4DW2L 4K7FA 3KYMB 1FHGA 4JHZA 5JHDB 1TLKA 1U8HA 2IQ9L 1KJ3H 2L4OA 2ZKMX 1KBWA 1UWEH 2JIXB 4OGAD 4NO2B 4CSPA 2IWKA 5C70A 5EDSA 3RX7A 2DLTA 1KGWA 5HI4D 3JYCA 4IW4C 4B6ZA 4QOKA 1OE2A 1AC6A 4JFYB 1UATA 5A1AA 4WEEA 4ZFGH 2EABA 1NFIA 2KH2B 4Q4EA 3SGEI 2AJ3B 2BNRD 1JK9A 1PD1A 4JAMB 4YDLC 1MCHA 4UT6H 5I30L 5GRJL 4HIPA 3W38A 4WCYL 4DCQB 4A2DA 3GXIA 3DX9B 2NTFA 1WFMA 2AJXL 4GRMB 4OFKA 4Y1AE 5T1JA 1DBML 4ZS6D 3HAEG 4F33B 1J9CT 4J3VA 1AR1C 1GJIA 2ZWSA 4RX4D 3WUWG 4NWTL 4ZD3H 2XX0A 4X8JB 5GGSA 4NT6B 2BS71 1GC1C 2ZSVB 5ANMA 3TFKC 4U2ZA 4EKJA 3WFCL 5E03A 4JFFB 5I18H 2ERJC 1GY2A 2Y2WA 4M1CD 4YDLB 1JWUA 4NJ9H 4QJ4B 5IVXA 1OSZA 1CZ8L 5SWZE 1FNFA 3MCLH 4L0ZA 1DQTA 3T3PE 3O0LA 4A7QA 1A25A 4N0UA 3L4XA 1L3WA 5E6UB 2JB5L 4A2HA 3IE4A 5B38B 3HZVB 2AQTA 3MKGA 2OULB 4KXZH 4YXHL 2YIHA 4YSUA 5IQOA 2UX6A 3VSQA 3UOAB 1GW6A 4OZGE 4Q97A 5CJXC 4N6QA 3ZHNA 5I66A 1IGIH 3S37H 1MCCA 3D0LA 1THCA 1FFTB 3HR6A 5CJ8A 4N0YH 2Q8AH 4H2AA 1W9XA 1YUHA 1OSPL 2CLZA 2NXZD 1WEJH 4X4KA 5F93C 2JCCE 1AGBA 4JFXB 5TQ2L 3UCRA 1I7RA 1W2KT 1INEL 4HIJA 2EIZB 4N90D 3F84A 5FUZH 3L3JA 3HS8A 1D5BA 1U2HA 4RLDA 1AGEA 2VWEC 4Y2DA 3FUEA 4DK5A 1E42A 1OCRB 4NGHL 5IT2L 1JF5A 2FZ3B 2FNBA 3AY4C 5DA0B 4QYOB 2BJMH 2Y6TE 4IRJC 1ILSA 5I75B 3LSOB 2DWDA 2FLMA 4HETA 1BP3B 3KJ6H 3MX0B 4TVPH 3BUYA 4YAQB 3RP1A 1CLOL 3T1FB 2WD0A 4EUPG 5HVFB 2K6YA 3OJMB 3SE9L 2K78A 2YK1H 4NO3B 3BWUF 4B9YA 1M3IA 1MFEL 3MV9D 1KB5L 4XHJD 1JP5A 3JWOC 1M7DA 4XMZA 5IROA 3QQ9D 2X70B 1AD9B 5C0EB 1T22B 4JFEA 1A3QA 1K4CA 4O9HL 5ITBL 1H5BA 1KPUB 4IRJB 1O6VA 3ZXAC 4Z7QE 5C0AD 3Q13A 1UWXK 3F7VA 4U1SB 5IJKC 4XVUD 1NH6A 3MXVH 1GZPA 1HIMH 2OMTB 4GW5A 4NQXA 3GS0A 2NUPA 4I1PA 3OQRA 5E2VH 5DQDH 3GMQB 4R7DB 4F27A 3QULB 2EYRA 4G6ML 4PY8I 4GEJA 2XBDA 3V6FB 1SY6H 1JZ2A 2AJZB 5KVMC 5T3ZD 3QPXL 2FJHB 2QADD 4NO0D 3AAZA 1K8DB 4OCRH 2C9XA 3MLZH 2NY4D 2BS8A 5K5YA 4LQ1A 5H4ZA 4L5FE 1MCOL 3ZHKA 1IEAB 1CTOA 3FU7A 3I02A 2QSQA 3KWXA 2AEPL 2F2HA 3L3OA 4HVBA 3IXAB 4ZW3A 3KPSB 1KGJA 4HJTA 4IU3A 3VDBA 1UXMA 3CDZB 1NWPA 3T08A 4O2CA 4NNXA 4OY9A 5HPOA 1JMXA 2CAKA 5CLZA 2WNXA 1AGFA 2R0LL 4A2GA 1SPDA 1Z32X 2N1KA 4L23A 3ZTNH 2J8HA 2YEVB 4H26B 1N9PA 1Q72L 3BAEH 2FTAA 3RNKB 5D93B 3T0AA 4AW4A 2ZUQC 3DI3B 4QJ5B 1FLRH 1PYWB 3TIEB 1O0VA 3VACA 3UROR 2R1WA 2XN0A 3IKKA 1R3KA 3QJHA 2PPAA 3LY6A 4BINA 4X4ZA 3OBAA 3EJSA 3D9AH 1ZAGA 2KS0A 5CNHA 1EFXD 1IGMH 3QZOA 1CQYA 1GS6X 1T3FA 1ZEAL 3QEHA 4R4ND 2O5XH 1BZ9A 3U7AA 4DN3L 4OLVH 5LCVA 1FH5H 3U30C 1TZ8A 4YUEH 5HYIA 3I6LD 2H9GB 1FVEA 3L48A 4KMLB 2E7HA 2JFCA 3HNSH 4BSJA 2MCPL 5IP4A 1U3HC 5T1DH 2EECA 1A14L 2Y7OA 2Q1EA 5JIQA 5D71H 5ITFB 43CAB 3KYOA 1A1OB 5T5FL 5MHSD 4Y8AA 4PD4J 4PB0L 3RFZB 4PJAA 2XZQL 3SPHA 5B8CC 4ICWA 5IV2B 5FHAL 3RY6A 5HJ3B 3LN5B 3O9WD 1EX0A 2OMZB 1IC7L 1CI5A 4AEFA 3QW9A 3UL4A 2UXFA 3X11B 1E8YA 4DESA 3KS0J 3BZEB 4LP8A 1ZV9A 4WI8A 2K45A 1XGRB 3P77B 4X7SL 2LV4A 2YUXA 5I0XA 2ZOLA 1IGCL 3AUVA 3HNVL 5KANI 1EA9C 1Z3GL 4U7MA 2N0KA 3TESA 2DEXX 3H0TA 2YXFA 3U36A 2GI7A 3FUFA 4XOAA 2X3AA 1NGWB 3ATFA 1XEUA 1TVBB 2BZDA 2KL6A 1ZK9A 2X4OB 1YNTF 3E9UA 1PG7X 4UQ3B 3SB3A 5T3ZL 4BFIB 3QFJD 3RWDA 3ZW3A 2YR3A 5E00B 3VI3B 2EILB 2Q8BH 1NMBL 5DRZB 3PJSA 4AVJA 5FWQA 1TZGL 1V7NL 2C1PA 2VOTA 4JG1H 3X1FA 1FFRA 4KRPC 1DSFL 1QG3A 4CSTA 5ETUB 1UEYA 1S5IL 4KNSA 3MRMA 2ZUVA 4M7ZB 2IXQA 2EEBA 2VDKH 2WVVB 3OKYA 2YBRB 3KLQA 2XC8A 2VXQH 3WNOA 2F74B 3H3BC 5IVZA 4PLKC 5EO1A 5E8DL 3RPKA 2VXVL 3KWWB 5AVWB 3BDXA 4W9IC 4MCYB 4WNQB 3HCVB 5KSAD 1A3ZA 2R1XB 2GHWB 1AY1L 5HI5D 3ULVE 2EEAA 2Z93A 3FTGA 1A7BA 3DBXB 4NRZB 1T1ZB 2GK2A 2ZUXA 3QIBD 3RTQC 3FH5A 4KZEL 1AR2A 3D51A 4AVIA 4CJ1A 4HF5H 4G82A 3KBHE 2DTMH 3PWLB 2XBZA 2YEQA 1UD4A 4E5XA 1INDH 1F42A 1ZANL 4LSTL 1OANA 3WG7B 2W60A 3KLDA 3VXUB 4LVOC 3CQQA 1Q9WB 2C9UA 2NLJA 2K7QA 3GMPB 4B9FA 1BIIB 2XN1A 3SBWC 5FO9A 1CLZL 4B7IA 1RLBA 3UC0L 1R47A 2BZ7A 5JW4M 1AZRA 1OAYL 2OYMA 3MJ7B 5I1EL 2XZCH 4PU2A 5GS0C 4KTDH 4NC2B 2TAAA 4ODSH 3D85D 2ZZUT 3G6JB 3INUL 4IIQA 3SDDB 4K7PH 3BMWA 3L9EA 2UZXA 3Q2VA 4KK6C 2IBZY 1QPKA 2H1PL 4Y16D 2HWZH 5C2BL 1J5IA 2AK1L 2APSA 2IVFC 4IDJL 4OZHF 2WUCH 5EU3A 5K1NA 3EIFA 1NAKH 4KDVA 4LGSB 4Z7WA 3PE9A 3PS6A 4KXAA 3ARGB 4UINH 3BZ5A 3DSFH 4X6BB 1SBBA 3KPLA 3MRDB 2EVGA 2E9JA 3QFDA 3E80A 1NCBL 4FABH 5FUOL 3T0BA 1J5CA 4IHOA 2ZUWA 5E8NA 2R2EA 3EYSH 4AQ1C 3ZKMD 1DJXA 5HHPA 2PP7A 1JPFA 1MN4A 1PD6A 2F58H 2JJTA 1AQKL 1TMQA 2GPZA 4UI2A 4FADA 3KPSE 3MLYH 2R29L 2NR6C 4Y8DC 3P4OB 2N7BA 5EEYA 2GABA 4Z0BH 3MOBH 1P7QA 3T4AC 4OI7A 3D2UB 4AK1A 4P9ML 4WWPA 4ZYKA 4ZUSB 2VRKA 1I85C 1U92A 2OCJA 4K55A 3K72B 2WBJC 4JO2H 3IU4L 2ZKXA 4L1HA 1RIHL 3B4NA 3GEWB 4AQ1B 1JPSH 2OXHA 1KB9K 4RQQA 4DEPC 2Z91B 1PZ5A 4FJ6A 2APBA 3OF6D 5E9DD 1VGEH 2EQDA 4NCC2 1PG7L 1NEPA 3W39B 3KHOA 4NQCB 3N41B 3WJJC 3MTRA 3ZQXA 2WTOA 4ELKB 4C83A 3KNBA 2AKRA 4JO1L 1OPGL 5H94B 4XX5A 4AE0A 1I1AA 3L9RB 4XCNB 1RZFL 3U4BL 1KOAA 5C0RH 1G94A 3EF4A 5GJTH 1FG2A 1BFSA 3KR3L 1JYXA 3WLBB 2E46A 1RZ7L 4AQAB 5AZ2H 2DBJA 4QXTB 2EXYD 1G43A 4UM9D 4DGVH 4FQXC 4L3EE 3D18A 4R90H 1KCVH 1V10A 3FTWA 4BQBA 1EZUA 1WAAF 4TM9A 4QEGA 5EOCJ 3Q8FA 1H6FA 4KO7A 3TZVC 4I5BB 1AHMA 5D96C 4JX0A 4J5VA 3T0VA 4MMZA 3GC3A 3TO2B 4JQXA 4BZ2H 4U1MA 3GQFA 2DBLL 2DQIH 5DHYB 3EDKA 3OHMB 4L8SA 3ESOA 4F37F 3BXNA 4Y5YA 5CCHE 3FH8A 3FT0A 5IB1A 2HPOA 4NQEA 4TTDD 3TA3A 2FEEL 3OZ9H 4KHXH 1QQDB 1NIAA 4PMEA 5D96B 3RU8L 3VI3E 1AZZC 3CZFB 3P11L 1L9NA 2F68X 4ZNEA 3MJGX 1J0YA 3GMNA 4H1LB 4UQ2B 4L37A 1ROCA 4BUHA 1Z9LA 3ILQD 3BVVA 2FX9H 3ASWA 2ZD0A 1BVOA 1BVZA 3BAYA 4WI9A 4X5XB 4CC0A 3QWRD 5FYJE 3OX8A 4PCKA 1G6RL 4HSQA 3TO4D 3ARDC 1QA9A 3HRZB 3EJUA 2WB7A 4F2EA 3MV7B 3DK2A 2WM0A 2EIEA 4G9FD 1IAIM 4FDWA 3WEMA 5BV7L 4RESB 6FABH 1DLFH 5ABDE 1KTDA 2IPKB 4M9OA 2UUDK 1J05B 4MB3A 5GS2D 5KVEE 3PU7A 1YNTA 4LPUA 3BRFA 1A22B 1NAMA 5LDUA 4NAMA 4XNZC 1CFTA 2EYSB 5E4OA 1ASOA 1TYJA 5CEZH 3QUYB 2X4TA 3ZE1F 2GJ6E 3OKEB 5C08D 3RWHB 1RP8A 3FU3A 1Y1UA 2BNQB 5GRZA 3LRGA 3VFRA 2G2RB 3FQ2A 4DP0X 4C56B 1IVLA 4NBYB 3ARBA 3KLKA 4P99A 1T0MA 2OFQA 4M3JA 3A21A 3MOAH 5T3XD 4PJ7F 4F80A 1NDMB 5GSVA 3CX5J 1VSCA 4EEEA 1EXHA 1L9OA 2IANA 2QSCH 2V7HA 2E7LA 5TDPA 2EUWA 3N1QC 5K9KB 5DUJA 2FJUB 1N5AA 2WXRA 2DIAA 2ZCHH 4P4RA 2JSFA 1KJMB 3NPZB 4O58H 4MCNA 4HH9A 3G6JE 4IBYA 2YD6A 2O5YH 4UQ9A 1HSAA 1CBVH 4H13C 4UT7H 4X8GA 4L2YA 4LIQE 1FRGL 1EANA 3K1DA 3L2LA 4F7TA 4B9KC 5AOLA 1IJ9A 4HWBH 1YEEL 1KLUB 2GJZA 1P7HL 4P2OD 1QP1A 4WJ5A 3TBTA 4TUKH 3ZKNC 2YAMA 2F1AA 3B7SA 3UO1L 2FK9A 4G1EA 4F7PB 4KDTC 5EZJB 4WHYG 1FZKB 3IDYB 2YD0A 4Q6YA 1DHKA 4L0PB 4QAMB 5EOQH 3UJIL 5LUMA 4M8VA 1AGDB 1CFMA 4ZOBA 1I8UA 3ZK0A 1GGBH 2D7NA 3GRWA 4B5EA 5CD5C 1HT6A 5C71A 2LU4A 3QDGA 2ESVD 4IBZA 1IRAY 4N8CL 3MLXH 1S7SA 5D4JA 1AHWB 5LXVA 1HI6A 4GY4A 3FRUB 1IAOA 4R7XA 2HJLA 1BEYL 5K9OA 2GAZB 3EH2A 3LRLA 5DJ2B 4OZHA 4C4KT 2JXMA 5EMYA 4Q9QH 3W9EB 4M6NL 3IJEA 4PSRA 5KBNC 2JLPA 5ABAA 1FIGH 3IWVA 3O3AA 3HBGA 1M53A 4KHTH 1WBXA 4UNVA 3FQNB 4NQCE 4J4PD 3ISRA 4A67A 3QIUA 3HTLX 3HE6A 3FN0H 1A65A 3TVMC 1RUPH 4S0SD 2K8MA 5CKAA 4L1DA 1RZ8B 4MAUL 4PGDA 5AKSA 4FLSA 3MRKB 3T09A 2PWGA 1O9ZA 2P43B 1BREA 2WCGA 5E24E 3TL5A 4WFHE 4HUUB 2DQGL 3NSXA 3C08H 2IG2L 1A3LL 4ERSL 2QGBA 1MHPH 1USQA 3WTSA 5T3XL 3BP7B 2XYBA 4QDGA 4I87A 5ILTL 4K71B 1QRNA 3D4CA 3PGCA 3WIHL 4L2LA 3SZ6A 5D1XB 3B2UC 3N40P 4TULH 5F6HI 2ZX7A 3GSXB 3US9A 1NLDH 4HIIB 4QO1B 1N18A 2CGZA 3V4VL 4UTBL 4A7UA 5BVPL 1A4JA 1J18A 1U8PA 4BBWA 2KYIA 4D9RD 1ZHNB 2BFGA 4ONGH 5IFJA 4LBAA 4KXZI 5DJYA 1J1OH 3H1ZA 2D7TL 2RA1A 2O6FA 3EJJX 3R4RA 3FQRB 4ORGA 4X6FA 5HGHA 1AJ7H 3LHPL 3PNRB 2VLRA 2I07A 1QLEL 4XNYL 5D9SA 3SJVB 2ODHA 3KYKL 5DC9B 2VMEA 3B2VH 1WAAA 1EZLA 3T2OA 1JGDA 1CO1A 5I6XB 2ZP9A 3OQ3B 4XCFL 2B59B 3I9IA 5DJ8A 2C5DC 3EGSB 3OMIB 3IJSB 3CLEL 1TYRA 4PS7A 1LE9B 1RUKL 3SBPA 4CBPA 3FB8A 3ZZQA 1ZVSA 5KVFL 3UAAA 3NZSA 5AVXB 3FO0L 3AFLA 3PUCA 3T65A 1PU0A 4HH8A 5HY9A 5IREA 2WXKA 2YPLD 4JPQA 3L4WA 3MV7E 4KVCH 2RALA 1SJXA 2JV6A 1N8ZB 2WQ8A 4TNFA 5FOBB 1U8OB 1HN1A 4OVVA 1TKWA 2A74B 2VZ3A 4O5LH 3C60B 2XXFA 5BZWA 3ZGHA 1WBYA 2BHFA 1TEGA 3QDMB 4HCFA 3QEQD 3GNMH 1YN7B 3VWJD 1H8OA 4IU2A 2Y0SA 3QUZD 1J8HB 2TSAA 3TJHD 1IV8A 4FZEL 4ELME 4UB0H 3I85A 4BFBD 4TNGA 3D5OF 5F9WC 2E7MA 2BNQE 5DHVA 5C0NC 3TPUB 4PJ9C 4C56E 3LZRA 1R5VB 4BK5A 3ALXA 3W2DL 3EO1A 4DGYL 4QRPB 4YO0A 2ZCKL 1XGPB 1UASA 3WTVA 2XQ0A 4XNDA 1T04B 4DKDC 5F71A 1ZT7B 2EO9A 4I0PC 3K2KA 1A7RH 3QUXC 4LSPH 3JWNC 1IB5A 4XBGB 3CG8A 3QQ3B 4FG0A 3PHQB 5F9WB 2A9DA 3U4EB 5EEVA 2ZKWA 4KMTL 4PJ9B 4OLUL 1I9IH 3P69A 3ZOAA 1P5VB 4MWFA 4X98A 5DUML 2IGFH 2LGNA 4ZT1A 2FH6A 5I1GL 4NO5B 3BP6A 2VDQB 3WEXA 3IU3B 4XBPA 1V3LA 2DV6A 1KFAH 3RWJB 4WK4B 1FFNB 5D2NC 4J6RL 4OGZA 5FB8A 3NZHL 4P48A 4PJ7A 2ZJSH 5KSUA 1UT1A 1C12A 3MRJB 4GW4A 1RZJC 3AU0A 4AUYA 4TKWA 4M93C 1SN2A 1B90A 4NZ8A 1S7WA 5JUEL 3ULUE 1M42A 4H8VA 4N8UA 2XG5B 4JFZL 3SPCA 2OAAA 4NKMB 4N24A 4ZRGA 1U6AL 1KG0B 3CZJA 1NWOA 3QZWG 5EFIB 3IRZA 3EOAA 5D2NB 5DJCA 3U1PA 1B4JL 1OTUC 2ADGA 3BVDB 4G6JH 3NCYP 1I3UA 4WJG3 1D2PA 4Q0XH 2YXVA 4U1LB 1FYTA 1T1XA 1I1FB 4NENA 4A68A 3WJMB 1X6LA 4I3RL 4N2IA 1U8QA 1A1MA 1AFVH 3ZR5A 2K9UA 3TPKA 1DANU 1HHHA 3HKFA 1P9MA 4DPCX 1FN4B 4HD5A 1E6OH 2PCXA 4NRXA 5EO9B 4CSSA 5FGBC 4DZBA 2DQ6A 1VACB 2JWYA 4ODXA 2EACA 3CDCA 2CHXA 1RK7A 4KNUA 1QKZH 5AOZA 3KLSA 4WI6A 2BY3A 5ACLA 4HZ1A 4MCZA 4YIQA 3IMUA 2P7TA 3B1TA 2X05A 1HOCB 1RZKH 2DKSA 3NJKA 1E4WL 1AC0A 1O5DT 3KHQA 1DQLH 3RVTD 4XMWA 2R7EA 4PRAB 4IRSD 5HGBA 1JWSB 5D7EA 3IEAA 5AYUH 4OB5L 4LKXA 4NZDA 1FZJA 3PY9A 5D1XE 1EJFA 4DETA 1FL5B 3FFCE 3IETA 1LNUA 3IMWA 2BMKA 3QIWB 4KJWC 4XPBH 3X17A 4S1QH 1HCFX 3DRTA 1MNUH 2GG1A 1UTDA 5D1QC 2XACC 4JFPB 5ADOH 4ZBJA 3SDAB 3LV3A 4ZX6A 3D69A 5MERA 4JB9L 3VFOA 5BZDA 4PRHA 3TS8A 4EN3D 2X40A 1ZLVH 2K4WA 3MTXA 2P8PB 1MELA 1MJUL 1U8MA 1RUMH 1MDTA 5F0PB 1HWWA 2QQNH 1ZD6A 3SJVE 2MPAL 3ULVH 2HX9A 3EGXB 5GGVL 3FCTB 4N2HA 5K93A 3V8CA 4OLYH 3T0WA 2LLLA 3CWGA 1AXSB 1R75A 3MRRB 5ISZD 1SF3A 4F57L 2ADIB 2D4FA 3MUGB 3DHJA 3R1GL 4TTGA 1NDGA 1C5DA 4FFTA 1MF2H 4J3OD 3THML 1IIIA 1OAJA 3BVTA 3QDJA 1CF1A 1P4BL 4RIRA 3QUMA 3DV4B 4AT6B 4KITB 2NY6D 2NT1A 3T0XA 2XFGB 2AEWA 3WDJA 2AQRA 4PEEA 3QXAB 3GTVA 2AK4D 2FAUA 4LPXA 2Y7QB 2Z0BA 5IIEA 2X6VA 4FOMA 2VABB 4K7FB 3QDME 3ZE0F 1JWMA 2EDLA 2VR7A 1U8HB 3MFGB 3NPSC 3WTXA 2P5EA 1DSWA 3SYCA 5CSBA 4G6AD 3ZDXB 3ZHDA 1J8HE 5CCKH 3L81A 3MUY1 1EVUA 3T6VA 3IMSA 2MJWA 2CHWA 2XA3A 4YSAA 3WUWA 4ZODA 4QOKB 5I8EA 2Y06L 2ZOTA 2YGPA 1UZGA 4Y19A 3SE8L 4QRPE 2OMWB 4N0CC 4HUVA 1NFIB 1NMCC 2EH8H 2EC9U 4YBLB 4WO4D 1JK9B 2NY2C 5F89A 3NPSB 1BLIA 3N9GL 2X9YA 2HMIC 4EI5D 5I73B 4NOFA 3G5WA 4P4KA 1LO5B 1O7DC 5G55A 5I1AA 2YOAA 2SODB 3PRZA 1P4IH 1R3IL 3PWPD 5EO0B 2XWTA 2ED7A 3SDCA 3UTZA 3F7PC 1ERNA 2K3HA 5KN5B 4YSOA 4F8PA 4MXWL 3GMLA 2E9IA 1A7PL 3GWJA 3RB5A 4RSYA 2ENPA 3MO1A 5DZPA 5CEXB 4X8XA 3PDDA 1MFUA 4H8WL 1SQ2N 4KI5E 2YUWA 3JWNE 1G7MA 2W81C 5E7FA 1OSZB 4AM0Q 4IBQA 5IVXB 1LWJA 2EZ0C 3QI9D 4AYMC 4DO6A 2A5UA 5J56B 4JFDE 3S4SG 1KZQA 2AQQA 4N0UB 1NEUA 4J39A 1CC3A 2FGZA 1HXKA 4XWGH 1QBAA 5DZOA 3GSOB 1MY5A 3JBG7 3MXWH 4FFWC 1F2QA 3PQYA 5BS0D 4D8OA 1T5XA 4XXDA 5I66B 3LOWA 3ETBF 3KAAA 2IH8A 3MBED 3QNXA 3D0LB 4N6RB 4XX1G 5G5DA 1H3PL 4OZIF 4XMUA 2CLZB 1YUHB 4P07A 3GZOA 4G7VL 3RZCB 1AGBB 1QI4A 1JI2A 4NC1C 5D2NE 4GSUA 4EQ3A 4EUPA 1LO3H 2VTFA 3UG4A 4ANXA 1IM9D 1RVFL 4G6FB 5KBMA 1EIBA 4GS7B 1ZS8A 2X6MA 1B9KA 1B0WA 2AP2A 1D5BB 5L88H 4Y2DB 3NAAL 2YMXL 2QDWA 1U8CB 4QRUA 3M1CA 4YHKH 2NY7H 1LEIB 1IBFA 1BLNA 3ZT6A 3H56A 1YJDL 5IROC 3MA9L 3BIBX 4G6KH 5C6PB 2WBWB 4R3SB 3V5KB 5DFTA 5DCCA 2E8ZA 4OCNC 4PWGA 1IGFL 3BEWA 1UOVA 3STZA 2OX5A 4GO9A 2BIMA 3LEYL 2W0KA 5FR3A 4HJSA 5GISH 5JPMA 5EF3A 1OCZB 4H7VA 3V4PL 3D39D 4GKLA 1W8EA 4K9EC 5BJTA 3AXHA 1RU9L 4Z1PA 1KB9J 3ES6B 4JFEB 3WL9B 5D4QA 1ILUA 1JTOA 1H5BB 3X14A 2OM5A 3TCLB 3CHPA 4FQCH 4RMTA 1SDAB 1ZGLB 3T3MF 4PS4L 4NWUH 3L3OC 2VQ4A 4K94L 4ZO6A 3I3BA 1GZPB 2AITA 3I9AA 4GW5B 4JN1H 3QCUL 5ACZA 2NUPB 3A3YB 4YDZA 5FYJH 4Y4FB 5LBVA 5F9OH 1P2CB 3BAJA 3K1KC 2ZKHH 4NP4H 3ALWA 3FL7A 3O8XB 4RAUA 1HCZA 1MFVA 5DJAB 3LZFL 3AAZB 1C7SA 1FNGB 2ZICA 5IJBC 1AIFB 1OCCB 4ODWB 1ZLUH 3UP6A 1Q4NX 4I3GA 5HGAA 5KVEH 4G2AA 2NY0B 4XH2B 4NPKA 4DUVA 3I02B 3FU7B 2R2CA 1AQDA 1S7XA 3WFHA 4LPVA 1DYZA 3OKNA 1QUNB 5GQBA 4K5PA 5C0CA 4NNXB 5D5MB 5TH2B 3VH8B 3IDNB 1B4TA 4ODUA 3H8NA 3TBYA 2YEZB 2YD8A 2GBVA 4HPOL 2BRRL 1L7IL 3N43B 1CT8A 4OR1A 3TH3T 5T1KD 2JJWA 1BQHB 4KTYA 1NOFA 2CDEA 3BPLB 2R1WB 3NRQA 1F6LL 1R3KB 4L9LA 1QFOA 2Y7LA 3QJHB 4YMPA 1RAMA 4JY5H 4XI5D 1BG9A 2WLYA 5D1ZA 2C7FA 4XAWH 1W72L 3CIAA 5DK2A 3QEHB 4HIQA 5E1AA 2VC2L 1BZ9B 4TUJA 3RY6C 1BOGA 4RFNC 3UZVA 4OCWL 3CFCL 5GGQH 2ICWA 2R0ZL 3DV6A 2IV9A 4FKEA 5D6DA 4LIQH 1D5RA 1XCXA 1BXXA 4KNQA 3U0PA 1WCBB 3CVIL 2CH8A 2XA8H 1MEXL 4GINA 3IFNH 1KTCA 4QOKE 5EV7A 5DVLA 1C8PA 4QY8A 1SJMA 1LO4L 1ITCA 4X7TB 5EF0A 4IMLA 3NGBB 2QHRH 2WXQA 3BAKA 3OGOE 4HBCL 5CGTA 4M61B 5KAQG 4WV1B 2JKXA 1DBBL 5DJ0A 5EUOF 1X7SA 1LO0L 2VZTA 3DX8B 2GBTA 2J73A 3HB3B 1E8WA 2ZOLB 3ARVA 1O6SA 2GIYA 2OP4H 3EZ8A 4IGBD 4J3OG 1OM3L 3U36B 3RBSA 4J1UB 3QC6X 4EOWH 1L6XA 1IKOP 1HZKA 3LKNA 1PDKA 2PPCA 1KB5A 4ANUA 2XVKA 4YWGH 2X4SA 1TR7A 2XFXA 2BNRA 2CO7B 2ISDA 4AK2A 1ORQA 1F02I 3PJSB 4WKXA 3KCPA 5IVXE 2AXJA 2EDNA 3U4KA 4F5CE 3HBQA 7FABL 2VXTH 2X09A 3O6FD 4NUGH 4N0UE 1TTAA 2B9AA 2X28A 3Q9QA 1AH1A 3L3DA 4MFHA 1X7QA 2GC7C 2ADYA 2FX8L 5IFHH 4RX4A 5H37G 1WD8A 4OCXL 2V5MA 2IXQB 1KACB 4D0BB 3I6SA 2HTKD 3LNDA 1GMIA 4YN3A 2EKSA 3BIKA 5IVZB 1YYLH 2OCFD 4JO4H 1XV8A