2MNUA

Backbone and side chain 1h, 13c, and 15n chemical shift assignments for edb and specific binding aptide
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
93
structure length
93
Chain Sequence
GSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EDB
publication title An Unusual Protein-Protein Interaction through Coupled Unfolding and Binding
pubmed doi rcsb
source organism Homo sapiens
total genus 3
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mnuA00
3VWJB 1A9EA 4JDTH 1HN1A 2XZQL 1ZHLA 1KCUL 4HKZB 3IJHB 2YRZA 1E6OL 3HB3D 3LD8B 4A6YA 3SDDA 1QO3A 4JRYA 5HD8C 1AXTL 1D6EA 1RVFL 4WI8A 4O9HH 2Y6SC 3Q5OA 4LQFH 4AH2B 2NMSA 3C6LA 2MQ3A 3QWRA 1A3RL 1J1XL 3VWJC 2CLZB 4PRID 4H1LH 4OZIF 5DJYA 3P4MB 3P4OA 4MDIA 4EDWH 3LD8C 3ZYZA 1VERA 2JCCB 1LEGA 3QPXL 1IMHC 4YWGH 4I48B 3EYFB 1JK8A 2P5WD 2Z31A 1EDQA 3UO1H 1QFWM 1MAJA 4JPKH 4XC1H 3LN4B 5HI5D 2NY6D 5EULV 3CDGA 4MS8D 5JXED 4I18A 1AQKL 5F7EH 4LSDA 5BV7C 4GAJH 5GS0D 3AU1A 1J0ZA 1OP3H 1P4LA 3WL9B 1YMME 4YBQC 2BXYA 4RGNC 3O2DH 4H8WL 1T7WA 3Q5YA 1INDH 5GIRB 3WHE0 2WWMC 4U1HB 2Q7NA 5D7SL 4F37K 3ULVE 1NGYA 1TQBB 3EBAA 2Q8AL 3MV7B 4GSDL 4QRSA 3GSUB 2Z8RA 3BEVA 1YNLL 4FFZH 2DMBA 1JNNL 4O02H 1Z9LA 1X44A 1HI6B 1MVUA 4HQQH 1M1SA 3LKRB 3T0AA 2QR0B 3I75A 1BWMA 2R1YA 3VGAC 2ADJA 2BSTB 4JFHD 3B4NA 3RVUD 4DZ8B 1MNUL 3MRDB 3QO1A 4U6HA 3U0PB 8CGTA 1TQBC 5ADOH 3R8BB 3ULUC 1QACA 3FONB 1HOCB 2HH0H 4XP9H 3HZKA 2ORBH 2XRAL 1V3LA 3VA2C 1JV5A 2MJWA 1QVOA 2AXHA 5GGTL 5IIEA 1H3UA 5EU5B 1PYWB 4PJ5E 4GT7A 4HGMA 2VDRL 2XWJB 3CCHB 1DN0B 4G9FA 4LCWD 4P3DA 2R15A 1HYRC 1K6QL 2QKIA 1H0DA 4Y19A 5KSBF 1I7UB 3WNOA 5DHVA 4Q9BA 1FNHA 1JF5A 2J7LA 5FF6B 1DFBL 4OTXL 1BFOB 5MHSE 5B4MD 3U4EA 4PRHE 3CLEH 4U1IB 4PGJA 4RIRA 3X3FL 1UM4L 1LNUB 2DKUA 3GMMB 5D2LE 3LV3B 4Y2DB 5ICYA 4R4FL 1T20B 4GW1B 3SGKA 3P0YL 1EH9A 1BF2A 1E28A 3C5ZD 1QR1A 2ESVA 1S7WB 1D5ZB 3STLB 1T3FA 4J23A 4M00A 1BVKB 4KVNH 3L3OA 1J87A 5EBLB 4UTBH 1DUYA 1K2DB 3RGVD 2VZ3A 2VDOH 4JG1L 4QHUB 5CD5D 4Y2DC 1JNLL 2WBWB 1Z3GH 3KNBA 3IJSB 4PY8J 2D7MA 1OAUH 4Z7NF 4K2UL 4ZUTB 1OAYH 1KB5H 4ZS6C 3QO0A 3D9AL 4HW6A 2YMXL 4ZAKB 4S2SA 5CIPH 1OAXH 3FQNA 1OF2A 2VLLA 4QRRB 4YHPB 3BPOB 4GRLC 1H8SA 1MELA 5CCKH 3DX9A 4ZFFB 4M7ZC 5C0CD 3OPZH 1BZ7B 3FHQA 3HA0A 4PY8I 2GJ6E 5MERB 3QXWA 1R5VA 5D70H 5CILL 5CEXA 1JNHB 2NZ9C 8FABA 4UDTB 4XCFL 3U9UB 5DO2C 2IQ9L 3FQUA 3NCFB 4ISVB 2NY5H 3A6CH 5GGTA 5FIEA 1L9MA 1F00I 1CGSL 2A74B 3RPIA 1E4WH 3U7YL 5SWSE 3V0WH 1MEXL 4L8CA 3W5NA 1RU9H 4XTRC 4KTEH 1KF9B 2FNBA 5J6HA 3CZFA 5DQDL 3HZVB 2J6EH 1AGDA 1ND0A 3GHEL 5JW5A 2Z8WC 4XPFL 4I5BA 3DJ9A 1G7QB 1FVEB 4OZFG 4OZIA 1ZV5A 1F6LL 1KIPB 5E24E 3QUYD 1GHFH 3NTCL 5HHOD 3VH8A 2C4FU 5I1LB 7CGTA 4XC3H 3G6JA 2UVFA 2B2XL 1H8OA 5IF0A 1BX2A 4YDJA 5LGHH 1I9EA 2LAGB 1REIA 3GGWB 3QEQB 4NSKB 3U6RA 4OV5B 4L4VB 4GKZA 5GZOD 3MLUL 4HIIA 1Q94A 4XVSH 5I17B 1OTSC 3BYTA 1II4E 4BZ1L 5B22A 1J8HD 5M95B 1YC8A 2GTZA 3O9WB 5CD3B 2H32H 4QCIB 3ULSA 3DURA 4LPYA 2X1WL 4H0HB 1CLZH 1E4JA 2BMKA 3OGCB 3O6ML 4BQ9A 1BQHB 2QQKL 4G6KL 3U46B 1NFKA 1E4KA 1ACYH 1UB6B 4UTAH 3MJ6A 4NQCB 1MHEB 3ZT5A 3DX7B 2EDWA 2GHWB 5CGYD 3MXWL 2NY4B 3EJYC 1IC5L 3O9WC 1X5GA 3BQUB 2DDQL 1ZKAA 5DVOA 1S7SB 5E0QA 3L3GA 1INEH 4G8GD 4GAFB 2E7BA 3K8KA 2P5ED 4JFYB 2A0LC 4QRUB 1A6TB 1XF3A 3H9SD 5C92A 5IHZA 3REWB 4HHAB 1JI2A 1IEHA 2XN9B 1W72L 2BXZA 2HJKB 5F3HA 4WV1A 1EUUA 4NKMB 1I8LC 2NY4C 4BUGA 1F4XH 3OR7B 3BQUC 4X9GA 3V4UH 5HI3D 4XHQA 3TT1H 2J8UB 2VTFA 2I26N 4IS6B 1OW0A 4K8RL 1I1YB 4Q6IB 5EU4B 3TO2B 1GXEA 3I3EA 3B5TA 2HLAA 5D96C 3V52L 1CD9B 3C2AL 1QFHA 4NQUA 2EH8H 4PJ8A 5DC9B 5F21B 3OSKA 3SDCB 5IFJB 1MAKA 4U6YA 4HMDA 4JHWH 5ERWA 4M7KL 1SEQL 5BMFL 2F54B 4PY7A 4I0KA 4XPBH 3MRJA 4XX1E 1QLRB 2IBZY 2KDGA 3CK0H 1LO5A 1QFWH 4LIQH 3TBYA 2DQDH 3NVQA 1QFOA 5JDSA 5FB8B 3QDGA 2A9NL 3L7FB 3AMKA 5J0BA 4DVBA 2RQ8A 3QZWA 3S37H 5DJAA 3F7PC 1OD7A 2F8OA 3BKCH 4V1DE 4L3ED 4L8BB 1MCIA 4GKNB 3WN5B 3ULVF 2Z8VC 3P73A 4K3GA 3MUZ1 5T3ZH 4XMPH 1UZ8B 1NBQA 4JM2D 5E8NA 1GZPA 2H26A 1JPFB 4NHCH 1KSRA 1OSPL 1MIMH 2Y06L 2IADA 3N1PC 1UM6L 3T8XB 5HHPA 4HC1H 2NY7L 5FCUH 1MCOL 1U6AL 3RY6C 3WN5C 5IG7B 3JWDH 2HT4C 3U36B 1EV2E 2OSLB 4KKAD 3FFCA 3DGGB 2XKSA 3PJSA 1VFMA 1BLNA 1XIWD 1W72A 1Y0LB 1UJ3A 2J8OA 3ARQA 3BPNC 4KJYA 5GGVH 1CD0A 1BQUA 3NFPA 5DRZB 1B0GA 4ZTOH 2X9WA 3EO1A 1QSED 1QBMH 3V8OA 3VXOA 3ZKXB 5I76B 4XPTL 2GQHA 4E41D 1VFBA 2EZ0D 4PGZA 3MUGA 1KGCD 5E94B 4FQCL 5TQ2L 2DTML 3QNZB 1DQLH 5DZNA 5E8EA 5HGHB 3HHRB 4M9PA 4WU5B 4OD3L 2F19H 4GW4B 5SX5K 4FFWD 3EOBB 3TH2T 4XCYA 1A4JB 5GJTL 2C1OA 4UV4H 5GRXG 3RIFF 1X5IA 4XVUC 3ZKXC 2GK0B 4M48L 3MRPB 3R0MA 1FLRL 4XNMB 4K9EL 5GGRB 3WV0A 5B8CA 1YEJL 2QHRH 3CGTA 4K3EL 2VXUL 5GPRA 2HWZL 3MBEC 4PD4J 1WWCA 5DFVD 5J13B 4K94L 1A1NB 4NGHH 5LBSH 1N64L 1WJ3A 2HFEA 2R69L 2CDFB 4DUWA 5T3ZD 1HQRA 5E2TH 2MKWA 5IQ9B 4JGJA 5MEQB 3NN8A 4FFYH 3TO4A 5B21A 3MACL 4J3XA 5GGRY 1V7MH 3H3PH 3VG9B 1CICB 3ULVL 2CPCA 4M5ZL 5INCA 4CU8A 3QSKB 5J13C 1P6FA 1ONQB 2JCCE 1KCVL 1HIMH 1MHHB 4RGNE 3RVTC 4MAYD 2Q87A 1C5CL 2VMFA 4FG6C 4X8JB 3FQRA 3VG9C 1CICC 1BFTA 4JFXB 2R0LH 3U4AA 3QNXA 2PO6D 1W2KT 1YMHB 2DWDA 4OLUL 5D1QA 3PGFH 4XNZC 1ZA6A 4W6WB 4FTVB 1KNOB 5E6IA 5KVFL 2O26U 1D6VH 4Y5VB 3QDMB 3ZKSD 3EOAA 1HZHH 3T3PE 4IMLA 2HN7B 4TTGA 2RCSH 1QFWI 4LCCB 4RQQA 1ZMYA 2ZG1A 4RDQF 5F97E 5MP6H 1CDYA 1RUPL 4LPUA 3TBWA 1MCBA 1OLLA 4U1LB 4NQVB 5T5NG 3GI8H 1D5BB 2BNRD 4AIXA 1ZT4B 4FZEL 1D5XB 2ZCLL 5LKNA 1CFVH 4HT1H 2C1PB 5D7IE 2DYPD 1S5HA 2ZJSL 3ZKQD 1MH5B 4NKOA 4U7KA 1CXFA 3IRPX 3QUXD 3FJTA 5EBMB 5B39B 4HH9A 5T5FH 4NP4H 1EERB 4PG2C 1U58A 2EEBA 4LCCC 1KJVB 4G9DA 3OWEA 5A40E 2XKNB 4PRBB 3U48A 1PZ5A 2HJLA 2X42A 5E08H 3RNQB 1RZ7H 5D6CB 5C0BE 1YMMA 3JV4A 4MB3A 2AJVL 2EE9A 2DQFB 1PG7X 4MDJA 5C09D 2X7LB 3BVNA 2YD1A 1MRCH 5I1KL 3QFJB 4QTIH 5AEAA 1AJ7H 1G9NC 3REVA 4OCSL 4PRPB 3E8UH 3DTXA 3G5XB 2CK0H 3GSNA 4LSQL 3TIDA 5I1CH 1A21A 1WWAX 4CGTA 1FIGL 4X4YA 5C0AB 2VDKH 3QUZB 1P4BH 1IL1A 4N5EC 4D0BB 4EI5D 4XRCA 3ARFA 1P5VA 4QXUH 4HH8A 2NLJA 1M05A 2W9EL 3F6IA 3WFHA 5CBAA 1G6RL 4HS3B 1I8MB 2V5YA 3A0OA 4HFWB 3BZ4A 4XWGL 4EOWH 2FD6L 1N5AA 3UJTH 3QIWA 2E3VA 2LTQB 3GSRB 3SPVA 5IEKA 5FGSA 3X3GL 3QUZC 4I0PC 3TN0B 1HHGA 3O8XA 1UKQA 2VIRA 4PJ5A 3VWKC 1BREA 2AV7A 5K93A 1AHWC 4IIQA 2QBWA 5IVNA 3RWEA 3JTTB 1IGMH 5LQBL 2MCG1 2DQIL 3VJ6A 3PL6D 5JO5A 4K71B 1FZMB 1U95B 1QBLL 3NCJH 4QRRE 4O2EB 4IOIA 1UB5B 5H8DA 4PRHA 3R1GH 4JY6B 5GRJH 1NEZA 3S96B 3N1QC 1GC1C 2BNQE 5D2LA 5IB3B 3G5YB 1BZQK 2E9WA 2VITA 3H42H 5IVXE 5IT2H 3FTGA 5IB4B 5GHWL 4MA3B 4O58H 4FP8H 4K71C 4G8FA 5FO8A 1X4YA 3LZFL 3FO9B 2IGFH 2JJSC 2J88H 4ZFZB 3WS6A 1MJ7H 4URTB 4XVJH 3K4ZA 4UBDD 3FN3A 1WT5C 5HHXL 3WIHH 4Z77B 3QA3B 3B5GA 1MUJB 3WNPA 5C0DA 3NPSC 2Z35B 4G80B 5J1SC 3TWCL 2DQGH 1R3LA 4WO4C 3NMEA 4TRPH 4YEEA 3MFGB 1QNZH 4P0DA 4X6DE 1SMOA 1NPUA 2XY1A 1J0KA 3HAEB 4JAMB 4KKCD 4KH2A 5EA0H 4OIAA 2CR3A 4AJ0A 4ZO6A 5KSUB 5C3LD 3RWHA 5EZJA 1I1AA 3EHBD 4G3YH 2VDPL 2GJ6A 4JDZA 5F9OL 1G6RA 3AM8C 2R2EA 1OCWL 1ODAA 1MWAH 2EDDA 2YA1A 2CLVA 4TNWF 5DJ2B 4QRQA 1JRHH 1NC4B 1T5WB 3LQZA 3QEQE 3VCLA 2WZPD 1Q9LB 2WW8A 4LARH 4P5KA 1XGTB 3D2UB 5KVEL 1H3PL 3RAJL 3N1MC 3B2UC 4P5TD 5SWSA 5DEGA 3EO9H 1EVTC 3UTZB 2XV6B 1NKRA 5CKGA 5TFSH 3R06A 1YEEL 4NQCE 1MCDA 3ELAT 4AEHH 2OX5A 4EZMA 4BKLB 4RX4D 1YN7B 2F5AL 3O3EB 4FN0A 5C0IA 4K7PX 4RCAA 4JR9H 4PJCE 5BRZE 4WUKH 1UH4A 2HAZA 4WNQB 3WJLA 4Y16D 3GSVB 1SYVA 5FO9A 1HYSD 1P5UA 1O7VA 1IT9H 4O5LH 5KOMC 3MRLA 4K23L 5LAXA 1ZLWK 5LCVL 4ERSH 5T1LD 3GI9L 2XY2A 5TQ0H 1TJHH 4JKWA 2J8UE 1OGAD 4FQJL 5JIIA 4L3CA 1B3JA 2BRQA 1A6WL 3KHQA 4XNYL 3JWNC 3RVWD 3LH2H 4CVXB 5C7XH 1MHPH 3V9FA 2NXYB 5HVFB 5IBTH 3MA9H 3SCMB 1KACB 1U8OA 5SX5H 4MX7B 2EDKA 5DSCB 1OP5H 3BKYL 4LSRL 4YHIB 1V7NL 5EN2B 1LO2L 1M7IA 3HMXA 1FRGL 4YE4L 3DHMA 4GQ9H 4N0UB 4E0RA 5EBWB 1IGCL 5JR1L 4LL9A 4OJFL 2DIAA 3ARDC 2APVA 2JELL 1WLHA 2NXYC 1NDMA 5D2NB 4YUEH 3HZMA 2DN7A 3MGOA 3DRQA 5DMKA 3LQAL 1LE5B 3MREB 2NZIA 3LCYA 4ZUUB 3T3PF 1LD9A 2BNUA 2V7NB 1JPGB 3T77B 3FQWB 4L29B 3ULUF 1J8KA 4IRSD 3T4YB 1N0XL 1VACB 4YHML 2VAJA 2YXMA 4KTYA 3RL2A 3T0EB 3VFSA 2IPUK 2PF6A 3GBNH 2CO7B 3P4LA 4AYFA 3FHAA 3H8NA 2DLGA 3ZMRA 5GXBB 1ZEAL 1QKZH 3HPJA 2NW3B 5D7IF 3SY0A 3VXNB 5JTWA 2PTTA 3QUML 3IGAA 1JZ7A 1U8KB 3BZDA 3ARBD 2WP3T 2Q1EA 4GXVL 1A7QL 3NFSL 5DHYA 2MCPL 2CRIA 4GH7B 3T0EC 4R0LB 4B7IA 4W6YB 3JXAA 4TUOA 2C3HA 4C56D 3I50L 5KSVB 4F7CB 1CLYL 1U93A 2NX5B 2OI9B 4NKDB 5IJVB 3ARSA 2HT3C 2VDMH 3UZQA 1A6VL 4W4NA 4N0RA 2PTUA 4V1DA 1QRKA 3B9KD 3FQXB 4WWKA 4P2RD 2R56H 5HVWA 4PRNB 3G5ZB 25C8L 3EO0B 3MCKA 4QOKD 2HVJA 1EXUB 3IVKA 1I1RA 2JIXD 2Y4SA 3I2CH 4C59B 3FT3B 5B38G 2X5PA 2O5ZH 1RHHA 5BV7L 3WHE1 1HQ4A 1NC2D 5EUKA 2DD8H 3GB7A 3VMPA 5FCSH 1BEYH 4KK9D 2BK8A 2NW2A 3O81A 5GGSA 4RGMC 1FE8H 4LSVH 3GZKA 1HWGB 1GPOH 3WS3A 3IFOB 5DK0A 2Y5EA 5J7CC 2R29L 4QY8B 1L7IH 2AJXL 1IAIL 1CE6A 3S3PA 2AEQL 3TBSA 1KJ3H 3EYSL 4HF5L 4ODXB 1FIEA 5E2VH 2Y36H 4OIIH 4QXTA 4NO2B 4X99A 1QQDA 4FQ1H 3ULUL 1FL6B 5CAYB 3TT3H 1KCSH 3G5VB 2BVYA 4MQTB 1YEIL 2A83A 1FVCA 4NWTH 4KWUA 4ELMB 4LSUH 1GVIA 1NCWL 1U3HB 3BHBA 4H5SB 1Z5LA 3QUMA 5IVXF 4ODHH 2WBJB 2VL5B 5DJ6A 1GGYA 3OKNA 4DKFH 2YK1H 3BP7B 2FEEL 1T0PB 3OKKA 4FRWA 1MJUH 4WENB 2Y23A 3VWJA 1GOFA 2Q20A 4HKZA 3IJHA 2A1WL 4FTVE 4UIMA 5E2WL 2VN7A 4DCQA 1U3HC 3VXQB 4JQIH 3QDME 4X7FC 5FK9B 3QDJB 2WBJC 5KSAD 3TJEH 4AH2A 1TNMA 4OZGE 3CPLB 1ZHBB 2H6PB 4X6DF 2CLZA 3MROA 5I16A 3BP5B 3CUPB 4U3HA 5HGAB 3NPZB 1FC2D 3LN9A 3P4MA 4BFIB 2F15A 1NCBL 2XWTB 3SDXE 3VFTA 2JCCA 3NZ8B 3D1MC 3GNMH 2NXZD 2O5YH 5I15L 3W81A 3LN4A 4P2OD 3WIFB 3GSOB 1KPUB 2EYSB 4MCYB 5I8CA 3WL9A 3PWLB 5F7MC 4A2MA 3DI2B 5GIRA 1FFPB 3QFJE 5EU6D 4OLEA 4XBPB 1L6XA 1F11A 2HKFH 1NCDH 4TSCL 4PJBB 4MNQD 5DJ8B 3TYFB 2ADFL 4G7YL 1HI6A 5C0AE 1QPXA 4KV5E 3VFUB 3QEGH 2DQTH 3TPUA 2YKLH 4Y4HD 3LKRA 4G7VL 2DM7A 4PJCF 3RWGA 2QR0A 3S3JA 1OARL 4GG6B 3CFDB 5D7IA 2BSTA 4PJAB 5GISL 1UT9A 3V7MA 1A14L 1KBGL 2HA1A 3MRDA 3AS2A 4HX1B 1S7UB 1T0MB 3VDCA 5KOVC 2IANE 1NGPH 3BN9C 3H9ZA 1ZWIA 1OVZA 4N1CA 3DVNB 1EHNA 1PYWA 1ZANH 4OM0L 1FZKB 5I8KH 3CCHA 1DN0A 1VSCA 3RHWF 3QG6B 4PB0H 5C0BA 5EU7C 4FXKB 3EOTH 1I7UA 3GRWL 1KEML 1FFQA 1KFAL 2X4OA 4YHOH 3TNMB 5D72L 2VH5H 4WDIB 4RA0C 1BFOA 3RZCB 3G6DH 1SJXA 2ZKHH 1IC7H 3N1GC 2VUYA 4LGSB 3LV3A 4RRPA 4Y2DA 3NAAL 1T20A 3BWAB 2FO4A 4GW1A 5B3JE 1LWRA 1Q72L 1U0QA 5GRVL 1EJ6A 5JW3L 1S7WA 1D5ZA 5JIKA 4U2YA 2HRPH 1DP0A 1BVKA 4IRJD 3RZCC 4EN3B 3DUUB 5EBLA 5ITBL 4QNPE 1K2DA 3RDTB 1N6UA 2ICEB 4NYLB 4GRLA 1FAKT 1ZLWH 3RKPA 2F8VA 1U9KA 1B88A 2ZOKA 2ZUSA 4NT6A 3JUYA 5A2IH 1R5IB 4HWEL 3RX8A 3IJSA 4PJEE 4ZUTA 3MMEB 2VLME 2J2ZA 3O6LH 2ED7A 4QRPB 4HCRL 4YZFE 3GBMH 5FAAA 3RDTC 4QRRA 4N8VA 4P23D 4R97B 3R0NA 2X89A 4M3KB 5BQ7B 1HILB 3KJ6L 1J1PH 1UA6L 3SKOB 1BZ7A 2I9TB 4XPAL 1A5FL 5EOQH 2BNQA 2GSGB 5IVXA 1JNHA 5EIIA 3MCLH 4NQTA 5TE6L 2E8ZA 4ISVA 4J4PC 1E27B 4XZUB 1S8DB 4P4KD 4AL8L 4D3CL 4DN4L 4HGKC 3DNKA 5CJXC 2Q6WA 5DT1L 2LE9A 5FKAB 5IP4A 1HEZB 3GRWA 2PR4L 4W68A 4K3JH 3V8CA 1Y6MR 4OZFB 3HTLX 4LRNH 1KG0A 1T1WB 1F3JB 1Q9KA 4JLRB 4P9MH 1PGRB 2OK0L 1CBVH 3LKPB 1G7QA 1FL3A 1FVEA 1H3GA 4X6DA 3S5LG 3DUSA 1AO7B 4PGBB 1MVFA 1CYGA 5DJZB 3S3SA 1KIPA 1BIHA 4W4OC 3AROA 4N5UA 2B1AL 1MCCA 2O61B 1BD2D 1ZHNB 1FNSL 3BD3A 3DV4A 1BP3B 2OL3L 1O5DT 2X9XA 5F7WC 2M8XA 3AY4C 4RFNB 4NQSB 2VL4A 2CGRH 3QEQA 4NSKA 1ZVHA 4JFZL 4M6MH 1FYHB 4M03A 3GJFB 5I17A 4PRIB 1UQSA 5E99L 1MY5A 4M61B 5I1HL 3V5HA 1ZLSH 3O45B 3O9WA 4OUOA 5CD3A 3TBTA 3RA7L 4HPYL 4MB4A 1NUDA 5JA8B 2VRAA 3KYKH 1NCCL 4HCRA 1H3VA 3U46A 4RFNC 2WUBH 3FFDB 4U2ZA 4IOFC 3BGFB 1H3TA 1IAKB 5DMJB 5J3HC 5T1DH 4NQCA 1EK3A 5J1AA 32C2B 2NY6B 4KTDL 1I8LA 4ZDHB 1IEAB 4OI7A 3BGMB 4MCZB 4P9HH 3BQUA 4PJCA 5BRZA 3V0VB 4NKIH 5BVJB 1PVHA 1CIDA 4RAVB 4KVCL 4KK5D 1S7SA 3AUVA 3QXDA 2FJFB 5DMGD 2WAHA 2P47B 2WWKO 2Y07H 4QRUA 4CNIB 3REWA 3LSOB 3T3ME 1OAKL 4HHAA 1K4CB 5C0JA 5HI5C 3VH8G 2NY6C 4NKMA 4MS8C 5JXEC 1VFUA 3CSPA 4R6UA 5GS0C 2YEZB 5HDLA 3FMGH 3LMJL 4OZGF 2J8UA 4HJJH 3WLBB 3BIBX 5IW6B 1RD6A 5D7LE 5F7LB 1EBPA 3T0EE 1I1YA 1IBGH 4ZYKB 4RGOH 3V4PH 3WJJC 4UAOB 2HKHH 3TO2A 1VGEL 1JE6A 3SDXF 4PTUA 2WNGA 5JIHA 3CXHK 1I9JH 4LHJB 4K7PY 1LO4L 2ENSA 1FSKC 2EXYC 5IFJA 2OL3A 3ARZA 5EOCH 1N2RB 4LCWB 4U4BA 4Z95H 5K9OA 3KPTA 1NSNH 2GUOB 4H1LB 1K3IA 3HC4L 3UYRL 5FB8A 2W91A 3O3BA 5IB5A 4G43B 1G7MB 3IDGA 3EOYG 2ZZUT 1A7PL 2Q86A 5C0GB 1HHHB 4L8BA 1VPOH 5F88B 3WN5A 1TZIB 5EORH 2XNAB 1JF6A 3RY6A 4WUUE 4K3DL 1Q9OA 3PF2A 3HMWH 1UZ8A 2V9TA 3N50A 4JHBA 4KV5F 5FECB 2E7MA 3FB7B 1LE9B 1UXSA 3O6FB 3QXVA 3T0DA 1B4JL 2YXFA 3PIQB 3HG1D 3WIIH 5B4MC 1GGTA 4R3SB 3T8XA 3RGVB 4ZXBD 1KIRB 5I0DA 3U36A 2MQCA 4Z7UB 1NKOA 1VA9A 4O2FA 1XGPB 3TA3D 2W0FB 1Y0LA 3C5ZC 4R7NA 2A77L 1NGZA 2VR5A 3ILPB 3IAPA 2XWBB 4JRXD 5ANMB 4FQ2H 3KXFD 5A3ID 5I1AA 5DRZA 4OM1L 4ZUSA 3RGVC 3L1OH 1WITA 5I76A 3DROB 5HHMB 2AVGA 5DYOB 4M1DL 5CD5C 1UCBL 5C0CB 4FQQB 2CIIA 1S9YB 2VDQH 5E94A 4MJ5B 2D7QA 3QH3A 4I3SH 4NZTL 4S1RL 3TH3T 1A7RH 4HUUB 3VFMA 1LGVA 1K4DB 3MBEA 3NABL 3H2WA 4GW4A 4Y5XC 1JUFB 2HFFB 4GAYA 1CI5A 3VD5A 1A4JA 3Q1SL 1J0JA 4WFEE 2XTJC 5IQ7L 4HIHA 4YEFA 5CGTA 3MRPA 4XNMA 2V17L 2YN3A 2H2SD 5F71A 1G9NL 2WMPA 2GTWB 5JA9A 2AXGA 1A1NA 1NAKH 5HSFA 1ZGLB 1N4XL 2ILLA 1D9KD 3P30L 5LXGL 3MA7B 4PJEF 4Q58C 5IQ9A 2YZ1A 5MEQA 3QUYB 2JB5H 3E0GA 4LPXA 1H15B 1R0AH 2R1WB 1SJEB 1M6OB 5HHOB 5CP3A 1CICA 2FX9H 3GMRB 4YZFF 4Q2ZB 5AZEH 3JZ7A 4MXQD 2AABL 2LVCA 3Q6GL 1LK2B 1ONQA 2MHAA 1XAUA 3N9GL 3A67H 1MHHA 4OFKA 1AE6L 5KVGL 5EOCJ 4I3RH 3QUYC 5FUCC 4X8JA 5KVMC 1TTGA 3NCEB 4JZNB 1KB5B 1J8HB 3IDMA 1DBBH 1RULL 4JFXA 4O51A 1MF2H 4NQED 4C54A 4OF5A 4U1NB 5CIPB 4Z0BH 4DTGH 1UACH 1JZ5A 3WKNA 2XT1B 4FXGB 4FTVA 2NY0D 5I19H 3QDMA 5GZOC 1F2XK 1LK3L 3ZKMD 1GC1L 2F58L 5FHBH 1FYTE 3O3DA 3IF1A 2HN7A 4PG2A 2ZCKH 4OZGA 2V2WB 1UZ6F 4LCCA 4YJZL 3P3YA 2UYLA 3FCTB 4U1LA 1XCTB 3OB0K 4YFEA 3OHXB 4M9OA 1TFHA 1D5BA 4G8GB 3SDXA 1XZ0B 1W8NA 2P5EB 3OKYA 1IQWH 1D5XA 3H9SB 5ESAB 5JORA 5EU7E 3TVMD 4PJAE 3RIAK 4KHXH 3KLAB 3TNNB 3OKMB 5CGYC 3DECA 5DMIL 1TIUA 5E9DE 1I7ZB 3WO3B 3MR9B 2XKNA 2YS4A 3KPOA 4RAHA 3RWCA 3KVQA 2NY5C 4JFED 5D7JC 1NJ9B 2UZIH 3D0LB 1WIPA 1DUZA 3OAUL 4F7PB 3RNQA 2IPUG 2DI8A 3IDIA 5ADPL 5D6CA 1TXKA 1GGUA 3QCTL 5HYSG 2VXVL 4NPYB 2DM4A 5E7FA 3HR6A 4HLJA 2DQFA 2X7LA 3QFJA 3SE4C 1GZQA 1IGJB 3G5XA 4XNUH 3PHSA 1CTOA 4ZFGL 4K3HA 4WI4A 1AIFB 1JGEB 4HDIA 3QQ3B 5C0AA 3QUZA 4I0PA 1Q0XH 4DGIL 3VWKA 2FBJH 4MQXD 5IW1B 1E4XH 5DC4B 1AHWA 2R0KL 5DLML 1ZVSB 1MJJA 2ATPA 3QWQB 4I0CC 4PRDB 3SDAC 4HS3A 1I8MA 4X9IA 3UMTA 4KDWA 3FO0L 2IANA 4L3EB 2QSVA 4ZTPH 3HLAB 4PFEA 1X7QB 2VC2L 5CSZB 4X7DC 3QAZB 5JPMB 4JM2B 1XF5A 1PKQE 5HGGS 4NQXB 1JPTH 4P3WA 4KJWD 1T1YA 4XP6H 5ISZD 2X1OA 4WHTB 1RIVL 1T2XA 1JHKL 1FORL 3KLSA 4XNQB 4QRPE 4NM4H 5EO9B 3U7WH 4G6JL 3WSQL 1FZMA 4EUPH 1Q8MA 2BOCA 3QHZL 4O2EA 3TJHD 1UB5A 1ZT1A 3FAXA 2JJSA 1KN2L 4G42B 1HSBB 4P46C 3QAZC 1RZ8B 1SY6H 3S96A 4JM2C 4WEUD 5ICZB 1WT5A 3LEYL 3R4DA 5IB3A 1X5JA 1XIWB 2D31B 1RZIB 2ENYA 2GK2A 1UCTA 3KPSD 5IB4A 2QQLH 5FA4B 5F3BA 1RURH 5FM4A 4WO4A 3RY5A 3DV6B 12E8L 3MOAL 1QSEB 2EKJA 2JF1A 4L9LA 2VR4A 1DQDL 4E41B 2FL5A 2YD9A 5F9AC 3TLRA 4KKAC 2DQHL 3PP4H 5ECJE 4X7SH 4Z77A 1XIWC 1MCQA 2EDTA 2J5LB 3QA3A 5SWZD 3VFGL 4GRWF 2EH7L 2Z35A 4PJEA 3AM8A 2P42B 4YGAB 4C58B 1QHOA 1RFDL 3DO7A 2AJSL 1S7XB 4JCMA 3TV3L 2AJZB 1AO7E 1A7OH 2B20A 3O4LE 4DVRL 2X4RB 1JMXA 1UYWL 3HE6D 5C2BL 5DTFA 4PYGA 2J5LC 3NOIA 4LVOB 3MLZH 1G7JB 4FFWC 2Z93B 3MBXH 1DBML 1E6JL 3IFNH 4TNVF 3WUWA 3ZTJH 3SE8L 5IJKC 4NNPL 5FUZL 4J3UA 3S4SA 1ES0B 4PRIE 4OFDA 1XGTA 3D2UA 1A7NL 4LKXB 1A6AB 2X4NB 3K74B 1PX4A 5DFVC 1YNKL 2ZSWA 2EE3A 3MV8D 4YHLL 1CCZA 1QEWA 1WCQA 1S3KL 5IFAL 2BSRB 1BOGB 4HMCA 3UTZA 1VEOA 1C1EL 2P5WE 3NCMA 1XGQB 3ZDYE 2R0WL 4ORZC 2IEPA 1T22B 3C5JB 2B0SL 3ARPA 3O3EA 2PO6B 1QBBA 4R2GD 5ITFB 4JREB 5F72S 4YDIH 5D71H 3JUZA 1PEWA 1BHGA 1R3HB 3JWDC 3GSVA 2AI0L 4MAYC 1F8TL 2EDLA 3NCYS 1ZXQA 1PFCA 2YPLD 5GGVY 5HPOA 3ARED 4U0QB 5ID0B 1E4XI 1JGLH 3MJ9L 4JREC 4PS4H 5HJ3B 2YPVL 2BNRB 3DX6A 3INUL 4F3FB 3B2VH 3HN3A 5T33H 4XVTH 4E42B 3OKDA 2DYPB 4ZD3H 3RKDD 3QUXB 3ARDA 5A43C 2CJUH 3EYOB 1M7DB 4LLYA 4WI3A 2GFBB 5L88H 3E6FB 3HNVL 4YHIA 5EN2A 1KELL 5DA4A 4LCWE 1IARB 1MFCL 2ZNWA 3HC3H 1BM3H 3QUXC 2MNUA 5C09B 5IFHH 1J18A 3DGCR 4O4YL 4Y1AD 1IQDA 5LGJB 1UXWB 4YC2C 5I1IL 2OP4L 1AI1H 1LE5A 4UT6H 4X5XA 2FGWL 3C8KA 1LEKA 5DR5L 4U6VL 2DQCL 3VD7A 2V7NA 4PJ9D 3T77A 2DI7A 3FQWA 1CXHA 5DGRA 5D7LA 3B9AA 4AENB 3T0EA 4U1KB 2X4TA 1DR9A 1FHGA 1QG3A 1NDGA 3CXHJ 3WFDH 1TCRA 3W11C 4X7TB 4H20L 3TH4T 3WFBH 3NZHL 4WGVB 4MMZC 4MD5A 4OCYH 5BJTA 5F96H 4OB5L 4EI5C 1UWEL 3IDXL 3VDBA 4Z7UE 2HYMA 3V7AG 4WHCA 4BUHA 3EFDH 1U3ZA 4QF1B 2P43B 2XG4A 3AXLB 3FRPA 5KSVA 3PL6B 5ANME 4F7CA 2H45A 1T7ZA 4NZJA 4NKDA 1R24B 3MJ9A 1U2CA 2XTJE 4NCC2 5C0CE 4D8PB 1HDMB 4R90H 1A4KA 4WUUA 4ZNEE 1C5BL 2G60H 3THMH 4PRNA 3BE1L 3EO0A 3G5ZA 4CMMA 4LLAA 1EXUA 3QJHB 4IDLA 4PJ7E 1T21A 3W9EB 4MD4B 4KRPC 3OB0H 3FT3A 3PL6C 1EGJL 1YYLL 1UENA 4C4KO 1KXVC 3O11A 2PETA 1WFUA 5FYKH 2COQA 2ZCHL 2FB4H 2VZ1A 1XGYH 5C0EA 4NIKB 3DSNA 2BDNH 1A2YA 4E5XA 1OWWA 3IFOA 4YHYB 1WIOA 1NGWB 3X17A 1Q38A 2Q8BH 4P59L 1RJYB 4Y8DC 5FUCE 5JNYA 4YAQB 5KN5B 4UBDC 4NO2A 1F2QA 3QG7L 1DVFD 1CLOL 4LEOA 5CZXD 5HHOE 3QRFM 3L3IB 1OGTB 4PJFB 3EKCA 5DHXB 3W2DH 2C3VA 4PJHF 4JKMA 4HKXA 5D5MF 5DD5L 3C60D 3G5VA 1ZAGA 5A2KH 4HKJA 5I6XB 4NZUL 4OLXL 2YZ8A 4YQXL 1EFXA 1U3HA 2C3XA 2R2HB 1B0RB 4Y4FD 2OR8A 4KKCC 1S5IL 2WBJA 5GGQH 3UC0H 2QL1A 4DQOL 3QIBD 3QULB 1BBJB 1MCLA 5SWQB 5TE7L 1J8HE 3BP7A 4P5TB 1CIUA 1N3NB 4P4RB 43CAB 3MOBH 1ROWA 4LLUB 4CKVX 5I6XC 5AYUL 5GGUB 2ERJB 3W5MA 4NQDD 2NY2D 4JE4B 4JM4H 4EUPG 3LRSB 1X5HA 3MPCA 4MAUH 2IMMA 1KXTB 1TMCB 4M7JH 1IEBB 3D39D 4RMQA 1FNFA 3LKOA 3KYOA 3CPLA 5EZIL 2YSSB 1ZHBA 2H6PA 1T1XA 3KR3H 3CUPA 4MJ2A 4NNYB 1PQZB 4P5MA 4Y16B 5DD1H 5F7DB 3ROLA 5FYKD 1YEKH 2XZQH 3H9SE 2L4OA 1E6OH 3H9HB 1ZT7B 3FO1B 2ZUXA 4HZLB 5J8OA 3HS0A 1NBVH 3C6LD 5T1LB 1RIUH 5C0RH 1AXTH 1PG7L 3WIFA 3GSOA 1BQSA 1KPUA 1OGAB 5DHVH 5DJCA 4WHYG 1A3RH 5DVKA 4X6FB 3EUUA 3RNKA 3MV9D 1HYSC 4MCYA 4OCWH 5BZDA 2ICWA 2B1HH 3BIKA 3PWLA 2A6IB 4LNRB 5AWNL 3SQBA 5CJ5A 1MRDH 2Z31D 1FFPA 4OD2B 4XBPA 3UPAA 1FYTA 4ODUB 1MWAB 1P7KB 1T7VA 2AAVA 3UTTA 3ZDYF 1XR8A 1TTFA 4HIJB 3QHFL 3O2WL 3TYFA 3BSZL 3VFUA 1T04A 4Y4KC 1B2WH 2KL6A 1PDKA 2H9GA 3PDDA 3RVWC 5LJYH 1WEJL 4POZD 5C07D 3IDJA 2KKQA 3L7EB 1EUTA 4PJAA 1MREL 1FZJB 5AUMB 4L4TB 1U8JA 3EDFA 4NZRH 1P2CB 1S7UA 3OF6A 3OJ2C 4CW1A 4L3EE 5FOJA 3C08L 5E9DA 2RGSA 2EC9U 2OXGA 1LDPL 1F4YL 1FL5A 3EYVB 1S7TB 4IRSB 4PJXE 1YEGL 5CS7A 2V7HA 1YNLH 4G8IB 4S10A 1FZKA 1FNEA 2PYFB 4U49A 3QG6A 2CIKB 4FXKA 4BSWB 4JB9L 4KUZH 4R96A 3MJ8B 1PLGH 4D0CB 4EBQL 1YYML 3GSXA 4NOBA 3OMZA 2HTLD 3GSWB 4YDVB 2YBRB 3OXRB 4WDIA 2X70B 4PGCB 4PJGE 3MRBA 1MNUH 2C3WA 4YLQT 3RZCA 3ARBB 3TC9A 4JG0L 3W9DB 3LHPL 5I8EA 2XRAH 4LCIL 2K7QA 2XN9D 2XZCL 1HE7A 1OT2A 5TPWL 4AQOA 4Y19D 3BWAA 4MMXC 4XH2A 4C56B 1A0QL 2VDRH 2P45B 3MRHB 3FN0H 2VDNL 1WBZA 3CXDL 3MLWL 1EEQA 3DX8B 3MRIA 4E41E 3B9KB 3KYMB 4I9WD 5HXMA 4J3SA 1KGCE 3F7YB 3RDTA 2I60L 3OZ9L 4P2RB 4M5YL 1DFBH 2FATL 4OTXH 2IJ0C 1Z6JT 5IM7B 3LS4L 1EEYB 1MY7A 2CH8A 5IW3A 1HKLL 1U91A 2XZAL 1HSAB 2L7JA 2JIXB 1PKQA 2YUVA 4OLVL 5DFWH 3MRMA 1TNNA 4R4FH 3EGSB 4J3TA 3MMEA 2ESVD 1IGYB 5DUML 3MFFB 4LIQE 4QRPA 4YHNB 1X4ZA 3Q5TA 5C1MB 4PREB 1NC2B 2RBLA 3B9KC 2IQAB 4J4PA 5MEOB 1KLUB 5CUSL 1HILA 1MFNA 4ZG1A 4JHAH 5F9JB 3SKOA 3UBXI 2I9TA 5CJXA 5JW4R 3H7BA 4JG1H 1IC4L 1PX3A 3QCVH 4J6RL 4XCCL 1VFOA 5HGDA 5GS0L 1JNLH 4OGYH 5JXAH 5T3ZE 2BHZA 5DJ0B 4DK6A 6CGTA 4N0FB 4K2UH 1G0YR 3ETBF 3KPQB 4XZUA 4KK9C 3M1BA 2YD3A 2FBOJ 3D9AH 3HE7D 4HPOL 2D0FA 2AQ3A 4W4OA 5FKAA 4QXGH 4K7PL 1IGIL 2HG5A 3K7UA 4OZFA 3S5LB 5CILH 4JLRA 4PJ7F 3AY4A 3RIFK 4JDTL 2VZSA 4XCFH 1IFHH 1AO7A 4PGBA 4KUCF 3O4LA 4YX2H 3BP4B 1NBYB 1T4KB 2FWOA 4JKPH 3U7YH 2QADD 4JFOB 4O9HL 4LQFL 2QQNL 2XQBH 2FEDC 3SO3C 4AEEA 5ENWA 5KSAB 4LDOB 3DRTB 5E1AA 1L4IA 4Z7WB 4NQSA 5DQDH 4AIZB 2HFTA 4U3XA 5C6WH 4XPFH 4JO3H 2IPTH 4EDWL 4R26H 1XT5A 4OCLC 4M61A 3ORJA 3O45A 1YPZB 3RI5F 2ID5A 4YWGL 3NTCH 5FOBB 1TCMA 2GY5A 2ZSVB 4OLYH 5KSAC 3UO1L 2P5WA 4XC1L 2B2XH 3ALWA 3ALXA 1N6QL 4KMTH 3PWJB 2NXZB 3G08B 4XCNB 1F3DJ 5F7EL 4P2OB 32C2A 4W6XB 3FAWA 5JXEA 3BGMA 2FLRT 3MLUH 3O2DL 4JO2H 4RAVA 4HK3N 1T83C 4NO5B 4BZ1H 1FDLH 5GJSH 3UZVB 3WJJA 1G7IB 3KGRA 5EU6B 4CNIA 3DXAB 3O6MH 2ARJB 1IGTB 2QQKH 3U82B 1K4CA 2X2YA 4P2OC 2ARJQ 2DIJA 4HQQL 2P8LB 1RZKH 1MJ8L 3OX8A 4MNQB 3IKCA 1DQQB 3OXSA 5C9JA 1YEDB 4ZODA 4CDGC 3WLBA 3L95A 1IC5H 4Y4HB 1CFBA 3IETA 5T5NF 1MPAL 1INQB 1TPXB 2HH0L 5C3TA 4ELKB 2WWKT 5TDPB 3O2VH 2ORBL 2E7CA 3VDAA 1QRND 1RUAL 3OGOE 1UWXK 4HUXB 1JYVA 2QSQA 4X6CB 4QHNB 1W72H 1CR9H 1BQHG 1F97A 4Y4HC 3GFUA 5DVMA 1N2RA 3UBXG 4LCWA 2E6JA 3MLVH 1TPXC 2I9LB 4ODSH 2GUOA 3LPGA 4F7TB 1ACZA 2DAVA 3O4OC 4XMLH 1IC1A 1S9KC 2BSED 3K46A 4PV9B 2GJJA 1OAQH 4G43A 1F02I 4IMKC 1OT1A 2PYED 3BKJH 2W0LA 3G6AB 5F88A 1TZIA 5IEHB 1H3WM 5BMFH 1EX0A 5FECA 4J3OC 3C5ZA 5TF1H 4DFHA 3NCYP 1UJTA 2VDOL 3ARVA 4IRJB 1RJZB 1FGVL 3O2DA 1S9VB 4R3SA 1ZS8B 3RGVA 4UMGA 2MQ0A 3PHOB 5GQBA 3UYPA 1OAUL 3EDEA 2JK5B 2R0ZH 4Z7UA 3P0VL 4PJXF 1ERNA 5D93B 1XGPA 4X0KB 1OAXL 3PWUA 2WIIB 4WTXA 4Y5XA 1T2JA 3ILPA 4AEIL 2ZPKL 5CJ8A 5E5UB 5ANMA 5HGBA 5CCKL 3ABZA 3BT2H 4PJDF 4OGXL 3OPZL 4RFEA 2F53D 1NLBL 3DROA 4TSBL 5DYOA 3UTSD 2ARWA 5C0CA 4PJGF 1S9YA 2NY7H 4BFGA 4ZNEA 1WGOA 3FFCD 4HUUA 1ZSDB 5D93C 4U33A 4NO3A 5DD6B 3IDYC 4PJ7A 1F6FB 3A6CL 1K4DA 3QUKA 1JUFA 1KV3A 4GXUN 3TN0D 1E4WL 5DFTA 1AP2B 4WU7B 4P4KB 2W1NA 5ESQB 3V0WL 1CFQB 4P23C 1RU9L 1DBKH 5J11B 4C83B 1AD0B 1CGUA 1RUQH 3B8SA 1QP1A 2J6EL 3E3QC 4NUJB 3BP6B 2GTWA 4NNXB 3LKNA 4FQCH 5C0ND 3X13B 2YC1B 1LO0L 1ZGLA 4MA1B 1JZ8A 4LLQA 1K9TA 2JJVA 4P4KC 3V5DB 1ZA3B 1G7LB 2IALB 3MNVA 1JWMB 4XC3L 4GKSA 5EBGA 3QUYA 3LEVH 4OUUB 5GJTH 1SJEA 1M6OA 1BD2B 4HK0B 5C71A 1CDCA 4Q2ZA 4EVNB 5E7BA 1FLRH 4HUNB 1AXSB 5BO1H 1I7TA 3IB4A 5DGQA 4MA1C 4QRTB 1MFAH 4TNWK 3MRNB 1UWGH 4K94H 1Z9OA 2YWZA 3C9NB 3TO4D 2R69H 4TULL 4M1GL 1T03H 4K55A 1CLZL 1J8HA 3F12A 3DBXA 1OGAE 1CFSB 4U1NA 1XFPA 4PBVC 5CIPA 1WAAE 1NAMB 4PLNC 3ULVH 4FXGA 3L3HB 2BOBA 5JLZB 1J9CT 3P9WB 1TVHB 4LRIC 4WCYL 3B83A 3F7QA 2FR4A 4APQD 2BC4B 1U8QB 3GDBA 4NFDA 2VLJE 1C5CH 4PP2B 4B53A 1KPRA 2ICCA 4LAQH 2W65B 3L9RB 3FCTA 5D7JA 7FABL 2HTKD 1XCTA 3D69B 5IHBA 1T66D 3F58L 3R8QA 4RZCB 3GKWH 3H9SA 5ESAA 1F4XL 4ZMAT 3V4UL 4N68A 3OKMA 1DEEB 4OF6A 5D1ZD 3SE4A 4MNHB 2J6EA 4OD1L 3MJGX 3MR9A 4OZHE 4JQVC 4R7DA 5CP7B 3FRUB 1A1OA 3CJJA 4KK5C 1RJCA 3GJEA 3VRLF 1CDHA 4G6ML 5HYSB 5L2KD 3MNWB 2OQJB 1CGYA 4F7PA 4NRXB 1RUPH 2BRRH 5CZVL 4Y8AA 4JGMA 1OTTC 4NPYA 1BECA 4JY4B 2EH8L 1ORQB 3HC0A 4FZEH 3WFZA 5I30H 1SEBB 4KJPD 3SDAA 4JHWL 1JHTB 5TDOB 2SEBB 4MGXA 3S7GA 1VFAA 3HCVA 1CGWA 3CK0L 4LIQL 1F13A 2DQDL 5KS9F 1AIFA 3QQ3A 4Z5RB 4N9GB 1YMMD 2X4SB 4ZO9A 5IW1A 4C56E 3S37L 2H32A 5C8JA 2DTSA 3BKCL 1R3IL 5I1GL 5DRXB 1MQ8A 3Q48A 4NM8L 3LEXB 2AJVH 3ULVD 1J5OL 3VXPA 5AG8A 1X5XA 2AJYL 5T3ZL 2HT2D 1IE5A 2Z0BA 4L3EA 3GIVA 1F6AB 3HI5H 3VGBA 3TIEA 4RWHA 3BKMH 3MX0A 4KY1H 4L8SB 4OCSH 5CSZA 4PJXA 4J2XA 2XKUA 3U1SL 4QOKE 4P46A 1J1OH 3SCMD 4ODTL 4JM2A 4OIBA 1AGCB 5B39G 1FIGH 4XAKD 3NA9H 4NQXA 1JTOA 5GRWA 3KDMB 3WHXB 4WHTA 4HC1L 5FCUL 4XNQA 1OTUD 1RK1A 3HG1B 5EO9A 2CD0A 4ZXBB 1S7QB 4PJGA 2EO1A 3G04B 2QHLA 4G42A 4ONGL 1HSBA 1YEFH 3O8XD 4Y5YB 5GGVL 3I3DA 4FNLH 4P9HC 3TA3B 4ZTOL 2PTVA 1RZIA 1QBML 3G9AB 3GO1L 4JRXB 2VJXA 3KXFB 2WUCH 3ZHKA 3QJFB 4ZXBC 4OQTL 5CBEA 5LQBH 1SYSB 2DQIH 4E41A 1LMKA 3P11H 4Y5YC 3PQYD 1HNGA 3TA3C 2BVEA 1JYNA 4QWWD 3IXAB 4UV4L 4E9LA 2FSEB 3PV6B 4WFHE 3UDWC 3MLPA 5A3IC 4M7LL 2WLZA 4M62L 1J0YA 1WVZA 1S7XA 3MOQA 1DE4B 5IJKA 2FJHA 2AJZA 2QHRL 4ZFOB 1SBSH 5FM5M 3LZFH 5GRUL 5LBSL 4NGHL 2D0HA 3T1WA 1UWXH 3UEZA 2NX5D 3EJZD 5E2TL 1NGXA 3PWPA 1G7JA 2X4UA 2YPKB 3MRQA 3IRZA 3DMMD 4H25B 1D9KB 2Y5TB 1F42A 5I18H 1V7ML 3TWCH 3H3PL 4DGVH 3RU8L 1ES0A 2HJFA 3BYYA 2H2SC 1JF1B 2PN5A 1A6AA 1IAOB 5FGCB 2X4NA 3ZSSA 1HIML 3VFPB 1R5WA 1OP9A 5CSBA 4Z7OE 2VOTA 2CK2A 5IMLA 2GJ6D 4HC1A 3UPRB 2ED8A 1RJLB 3VI4E 1FFRA 1BOGA 1D9KC 1PBYA 1XGQA 4MAYA 5D7KD 2UVEA 3MJ7B 3C6SB 3MGAA 3V4VL 2E6QA 4U1GC 1CG9A 3PGFL 4NQEB 3TYGL 3DVGB 4MXQC 2P8PB 1D6VL 4OFIA 1H3PH 1QBAA 2HFGL 2NY0B 4X5WA 1HZHL 1R3HA 2OZ4L 4OQTA 3HAEG 2RCSL 2DJ4A 5EU6E 4KJQD 3RZWA 2RAMA 1I3VA 5IWLC 3T2NH 5MP6L 4LVHC 2ZUUA 4NOFA 5GS2H 2BX5A 4IOSD 4JFDE 4MNQE 4KZDH 4UILH 1A6UL 5ID0A 3FB6B 1CFVL 2XG5A 2F5AH 5HJ3A 1C08A 2NY0C 4WW2B 4F3FA 2OTWB 1MCWM 4H88L 4U6TA 5T5FL 4F2MB 4MJIE 4E42A 3TVMB 5JDJA 1JJUA 2AEPH 2IH1B 4O2CB 5JOFB 3ZKMC 1GRWA 1JYXA 5KG9B 3QUXA 4AG4H 1F4WL 4Z6AT 4LASH 3EYOA 4M93C 1M7DA 5JPNB 1JWSA 1CFNB 1BIIA 1A02N 2GFBA 4HIEA 4X6CE 3E6FA 2MWCA 5JQ6L 4JFEB 5MEPA 1RZ7L 2EC8A 4YXLL 4AY0A 1YN6B 3QDJD 3ZE2F 3GI9H 1X3DA 5IMOB 2WANA 1XGRB 2DQUL 3MLTB 3B43A 2P44B 4PLOB 1LVEA 4FQJH 2VXTH 2UV3A 4XNYH 2CK0L 3KYAA 3B3IB 5I1CL 2EKSA 4J8RB 3FT4A 5IKCB 5LGJA 1UXWA 5T1KD 1LEIA 2VDKL 2IBZX 2DBJA 4MA7H 4V2CB 1GJIA 1MCJA 4N0CD 4UT9L 3MNZB 2ITDA 5HDBE 3BKYH 4LSRH 4NC0B 2Y9RT 4I1NB 5H2BB 4EI5A 2Z91B 2AQ2A 1LO2H 4ZUWA 4AENA 1QSVA 5DQJB 4GAGH 2GAZA 3LRHA 4PB9H 3UJTL 4LAJH 4QO1A 4JJ5A 4WI6A 3B9DA 1G9EA 2R4RL 5ACMA 1RUKH 4UQ3B 2VZOA 4YPGB 4FFVC 3LQAH 4PJIB 1CXIA 2OZ4A 2VABB 2JLLA 4MQXC 5GS2D 1IGML 4OZHF 1GCFA 4MJ6B 4LBEB 5ISZB 3RHWK 1I8IA 3K0WA 3ARTA 4QF1A 5AAWA 1N0XH 3NCJL 2BVTA 3K2UL 3PL6A 1B0WA 4WY7H 3BZEB 4MNGB 4UU9A 1ZEAH 4XMKH 5BS0A 5GSVA 3H42L 4XBGB 3SHSA 4M6NL 2BVUA 5I73C 3GEWB 3H0TA 3E3QE 3S36H 4KJWC 1EBAA 4O58L 5B38A 4FP8L 3QJHA 1A7QH 2MCPH 3KPSB 3ARXA 2KQMA 5BZWB 4D0DA 4YDLB 4ZPTB 1MJ7L 2AXFB 4EQ3A 3TJHC 3D18B 1EHLH 2RFXA 4UV7H 1WK0A 4IRZL 3FT2A 5DURD 4NCDA 4ZOBA 1A6VH 5T1MA 2Z4QB 1MCRA 2GJZB 1J7VR 4CVZB 25C8H 1NGWA 4OCRL 3QNYB 5EA0L 3SQOL 3S8WA 1OSZB 5IMMA 2IC2A 3U2SB 4C4KT 1ETZB 4G3YL 4YAQA 4HZAA 2OR7A 1BD2E 3AFLA 4UI2A 1OGTA 2LAAA 4FQLH 1NFDB 1LP9B 4NFCA 2FIRT 4JO1L 3CDYA 4EN3D 3QXAB 4X4ZA 3VXMD 2A2QT 3O0RL 5IK3B 4Z7VB 2R2HA 1B0RA 1OPGL 2V9RA 3L3KB 3QI9D 4WEBL 5L2JB 2AJXH 2F74B 2DBLH 4W81A 3QULA 1BBJA 3HE6C 5SWQA 3EYSH 4HF5H 4WI2A 4AMKL 1YEHL 4BJLA 2Q7YB 1N3NA 4P4RA 43CAA 4WI5A 3MV8B 3QEUB 4LLUA 5GGUA 5TFSL 1DQMH 3ULUH 1P9MC 3LRSA 4AEHL 1AGBA 5E5MB 1KT2B 4KZEL 4EXKA 4Q9RH 5INDB 3C87A 3OL2A 1UEYA 2YSSA 5JZ7D 2DQEL 4R2GB 1CLCA 3U0TB 1XF2B 4O5LL 5FYJH 5MI0C 1TETH 4NNYA 1PQZA 1U8PB 4YO0B 5F7DA 1EO5A 4HWZB 2A1WH 4PGDA 1AD9B 3WIHA 5K9KB 2YPLB 1NMBL 4S1SL 2APBA 5TQ0L 1JZ4A 1ZT7A 3FO1A 4HZLA 4OGZA 35C8H 3AREB 2V2TB 1CD1A 1I3UA 5T1LA 2C26A 4R2GC 4OCMC 1OGAA 1QYGH 2XQYG 3OKOB 4N90D 3LH2L 1WAAA 4X6FA 4Y4KA 5C7XL 1MHPL 1XF4B 3SE3C 5IBTL 1HHIA 1N8ZB 4ETQB 4YBQD 4YK4B 1NCBH 4RGND 4KDTC 5J9PB 1MIEH 1C7SA 3AREC 4OD2A 2WWMD 5DVLA 4ZSOB 3IS1X 1MWAA 5F7FA 2VLJA 4HIJA 2HVKA 5I15H 2GIYA 4M1CD 1A47A 1FV1B 2AK4B 3OR6A 1C5DB 3ZE0F 3DVFA 4YUEL 3RKDC 4X80L 5A1AA 4YK4C 3BXNA 2VYRE 3L5XH 3PE9A 4KC3B 5FUOH 2XPGB 4Z0XB 4U6XB 2X10A 4Y1AB 1AY1L 1Z0MA 1FZJA 3MLRH 3OJMB 4WTZA 1KC5H 3P4NB 3PGDA 2QLVB 3ULUD 6FABH 1VADB 2X40A 3IXTB 4D9RD 4ORGB 3HRPA 4OCNC 2X1PA 3MRRB 3G6JF 4LCYB 4OZHA 4PJ9B 4YHZH 4NRYB 4HBQA 1S7TA 1CD8A 2A9ML 1DANT 1J86A 4G8IA 4G7YH 1QKZL 4YNYA 3CDCA 5KW9H 1KN4L 3MJ8A 1IM3A 3N1FC 4D0CA 4G7VH 5M7QA 1TTUA 5FYJD 3HG1E 1OARH 3GSWA 4YDVA 3OXRA 4BZ2L 4DOHE 3BJLA 5GISH 3OJVC 4H26A 4JY5L 4LKCB 3KPLB 4PJ9C 2AKRB 4JDVB 1NCTA 1PEZA 3W9DA 2V5SA 2AGJH 5IHLB 1NGQH 3SOBH 1A9BB 1K8DB 5C0BD 4U1SB 2VDML 4JRXE 3MRHA 1QA9A 4N1HB 3RX7A 2WQ8A 3GRWH 5D72H 4UNVA 3B9KA 3KYMA 1RZFH 3UJJL 4FZ8H 5IM7A 1KLGA 1HWHB 4QOKA 4HIXH 3SGDH 2O5ZL 3WNLA 2FZ3A 2WLYA 3CFKB 1HSAA 1SJHB 5E8OB 4ZQKA 3MUY1 4ZOCA 1TVBB 3NAAH 4QHMA 5HI4D 1BEYL 4YHNA 3RVXD 4ZNCD 1UG9A 4PREA 1NC2A 1FE8L 2IQAA 4LSVL 4KRMB 5MEOA 1GPOL 1KLUA 4QHKJ 2CDEA 4G6AD 4N8CH 3VFVA 3WEXB 5F9JA 1DBAH 3D85D 4Z8FL 1T6VN 1KJ3L 3PDOB 5E2VL 3K8MA 5HDQH 2Y36L 4HWEH 1XH3B 4OIIL 3IU4L 5EPMB 1BZ9B 1MLBB 4N0FA 4G8EB 4FQ1L 5CEYB 3JV6A 2P7TB 2FX7L 2GSIA 3BH8A 3JWOH 5EOTA 4EIZC 1MI5E 1DVFB 3QEHB 4M3JA 4TTDC 2R2BB 5FGCE 2PW1B 4NWTL 1JI1A 4BH8B 3C60B 2A6KB 3O6FD 3QIUD 4BSVA 1EVUA 4U7MA 2BNQD 3BPCB 2BY1A 1CF8L 2FX8L 3K2MC 1KTLA 1OD9A 3CVHB 4XPAH 3S5LA 3SO5A 4DKFL 4Y4FB 1S7RA 1J12A 1FPTH 1CVRA 4HKBB 4X9FA 3BJ91 2N7BA 3QIBB 4NN6B 3F7VA 1DVFC 5CZXC 5HVHB 4F7EB 4QHLB 1I75A 2BY0A 2UY7A 5TE6H 1HNFA 2FECL 2W0KA 3JTSB 2EDFA 3OBAA 4D3CH 1D5IL 3BP4A 1T4KA 4JQIL 5HHNA 2A6DB 4NQDB 2NY2B 3MQIA 3TJEL 2FO1A 4JFOA 3F5WB 5HHMD 4LDEB 1MLCB 1QTYT 2VB5A 3DRTA 3D39B 3QIBC 5EFIA 3RJDA 5HVHC 2X6MA 3IT8D 2AK1H 2WBKA 3FB8A 4JHZA 1AKJD 1BAFH 2OK0H 3JV5A 5E1HB 1OTSD 4ZAKC 2D0GA 4Y89A 1Q1JL 1ZHLB 2NY2C 1P84J 3BPOC 3GNML 5FOBA 4GW5B 3TZVA 1T83A 3VG0H 3VRIA 4ZOEA 2O5YL 1D6EB 2BVQA 5IMKA 2OL3H 3RUGB 2VR9A 3C6LB 5F89B 4MA8L 4XCNA 1EO8H 4P2OA 4ODBD 2GCYA 1OY3B 4JFEE 1Z9MA 5DJYB 2QSCL 4JFZH 3P4OB 4MDIB 1MCWW 3MV9B 3X11B 4HD9A 1C16A 5IR1A 4NO5A 4X9BA 2V5MA 1JK8B 2HKFL 2Z31B 2A0LD 2VXSL 5EU6A 4XP1L 4CN4A 1NLDH 2ARJA 2E7HA 1IGTA 5CHNB 3U4BL 2NYYD 4KKLC 2DQTL 4JFDA 4MNQA 4JANB 4I18B 1JPSL 2IFGA 1RK0A 1YEDA 3LKQA 1FFNA 4MJ4A 4Y4HA 1WISA 5IVZA 5IESH 1X5YA 3STBA 5C07B 2EO9A 2ICES 4MJIA 3S9DB 4M43L 3DETD 1NGYB 2EE2A 4QRSB 5CSGA 3ES6A 5E8PB 3SGDI 3BEVB 2R4SL 1JP5A 1ZANL 4HUXA 3KPRA 4IMKA 4X6CA 4QHNA 3UBXB 4UINL 2DL9A 3V7AE 1MVUB 4PB0L 3ZSTA 4PJIE 1GGBH 3EOTL 3WNMA 4XGZA 4YHOL 4POZC 4KPHH 3LMJH 2VH5L 3K3QA 1FO0L 1JN6B 5HVGB 2FHCA 4WFGD 1HHJB 1URLA 4ALAH 2ZKHL 5DUPH 5F44A 3HZKB 4MNGE 1JV5B 5IIEB 1QVOB 4XAWH 1AGEB 1MAMH 3G6AA 1JZ3A 1W8OA 4LCUA 1LO4H 4GMTL 1H0DB 4Y19B 2APTA 3UTPD 5DHVB 3QCUH 4XWOC 5JW4N 2HTLC 2FHFA 4IEFB 3RVVD 1OHQA 3UYRH 3U9PH 5ICXA 2FJGA 1RJZA 1RZGA 1S9VA 1ZS8A 3Q6FA 4RIRB 3PHOA 2AJUH 4KAQH 2I5YH 1LO3L 1ZLVK 1A7PH 1IM9A 1GOHA 4P2QE 5DZOA 5SWZE 4FQXD 1P7QA 4K3DH 3NIGE 1ZHKB 3PABA 2DJUA 3T2QA 1NANH 1IGFL 1E28B 1QR1B 2ESVB 1WCBA 4MXVE 1T3FB 5CP3H 4LVEA 4Q6IC 4ZPVA 3L3OB 3SBWC 1WBYB 1J1PL 4ESKA 1DUYB 5DI8A 4P23A 4LSTH 4H1LG 2D7TL 3KNBB 1LP9E 3LOWA 5EO0A 3WNNA 1K3ZA 5CEZH 1N59A 3MCLL 1ZSDA 1BOYA 2ADGA 3SDCC 2AV1B 1U42A 5DD6A 3M07A 1A22B 4Z7VE 1ZOXA 1X5KA 4L5FL 4OT1L 5EU3A 3ZE1E 4U0RB 2VN4A 1AP2A 2IPKA 3FQNB 4JCLA 2FLBT 4WU7A 1OF2B 3MRGA 3VGHA 5I1EH 4P4KA 2A77H 2VLLB 1TJIH 3HE7B 3MYJA 5ESQA 1FZOA 3RBSA 4HUVB 4C83A 4IHOA 3MZGB 4OAWB 3PGCB 1FO0A 3MV8E 2EIBA 1R5VB 2F5BH 4M1DH 1UCBH 3BP6A 1SMAA 5CEXB 4NC1C 1MQKL 1CBVL 1BBDH 3MBED 5TGBB 3X13A 2YC1A 3S34L 4GKOA 4WTWA 4U0RC 1UKTA 3V5DA 2EICA 3NABH 1MCPH 1JWUA 1ZA3A 3HE7C 1G7LA 1GOGA 2IALA 3Q1SH 1GAFH 5DQ9B 2XTLA 5IQ7H 1T89C 2J3SA 1BD2A 4L8CB 4JFPA 4HUWA 5J6HB 1ED3A 2QADB 1AXSA 1Y6KR 2V17H 3Q2CA 5JW5B 3UJIL 1EAJA 2OM5A 3MRNA 2IF7A 4OZIB 1ZLSL 3DO3A 1N4XH 1Y18A 3P30H 5D2LF 4F33B 5ILTH 3DLQR 1OP5K 1WC7A 4PV8B 2QADC 1OB1A 1AQDA 5IF0B 1BX2B 5T1DL 4HEPG 5JLZA 4F58L 5IBLD 3AMLA 4PUBH 5CEZD 2APFA 4BA8A 4GKZB 4P9HL 5CZKA 4ZSOE 4NKIL 1AE6H 1U8QA 4NRZB 3KLHD 3K1DA 2GTZB 2WV3A 3ULSB 2FCBA 3DURB 2W65A 2KUTA 2VWEC 2Y07L 4F57L 2BMKB 4BSJA 1U92B 5FKPA 1ZK9A 1RULH 4JJHA 3D69A 4TSAL 3DPBA 5KTEL 2H8PA 1CGTA 3W0WD 1XR9B 3KHOA 1KXQE 1I4FB 4Y1AE 1AGFA 1PAMA 3GSNL 4XXCC 1DEEA 3FMGL 4HJJL 3AS1A 4MNHA 3ALPA 2F58H 2N4IA 2VXQH 1RZJC 3V4PL 1ADQH 2HKHL 4ZOAA 3N85L 3U7AA 5HYSA 3MNWA 1JHLL 4HGWA 3STZB 1CTNA 2VO5A 4CU6A 1XF3B 3CFJA 5IHZB 1R3JB 1ORQA 3GHBH 1QRNB 3I6LD 5E5RB 5TDOA 3K81A 5EOCL 2SEBA 5DS8A 4Z95L 1NANI 4HUKB 5FDYA 5DMIH 2L0DA 3OJDA 5ESVB 5KSBB 4CDHA 5JUEH 3MV7E 4X4ME 4YXKL 5F7YC 4N9GA 2QV2A 2X4QA 2X4SA 2HLAB 2R8SL 1PJ9A 1QUNA 1VPOL 2VXVH 3LEXA 4NWUL 3FO2B 2PYEB 1P1ZB 4OI8A 4Y5VC 1YNTB 3VXSD 4U6YB 5F1IB 4HS8L 3HMWL 1C12B 5ERWB 1CXLA 4PY7B 1YZZA 3MRJB 5IGXH 5EB9A 5F6IB 2J12B 3QDGB 2UZXB 3TF7C 3WHXA 3RJQB 5J6GB 3HG1A 5DJAB 5J12B 1WQVT 2IAND 4DN3H 1S7QA 4ZXBA 3CFCL 4Z78A 1T5XA 3LPWA 3FO0H 3G04A 4UQ2B 1A6PA 2NR6D 4Y5YA 5DUBA 5CMAB 3RTQD 2H26B 2VC2H 3MXVL 4FQ2L 3TA3A 1AR1D 3WDIA 1NH6A 4JRXA 3UDWA 5I74B 5J12C 1TZHB 3CX2A 3P2TA 3QJFA 3QQ4B 2VDQL 1RIVH 1YJDH 1I3GH 2F53B 2KBGA 4I3SL 3GMPB 1P7HL 3UTSB 4DZBA 4HBCH 1JZ2A 4LGRB 1FFOB 3WSQH 1GSMA 2X09A 3FFCB 1RZKC 2Z9TA 2CRYA 3PJSB 1KN2H 1W72B 4DW2H 1UJ3B 3IXAA 5GRYA 2I07A 2FSEA 3CDFA 3V6ZA 1T0NA 1CN4A 1B0GB 3C8DA 3S36X 1U2HA 3VXOB 1DE4A 4BQBA 3O41B 1KIQB 2KH2B 2J4WL 3MOAH 1VFBB 4I2XB 1G9MH 1NAKL 3VE0B 2DLHA 2YRPA 3BH9B 2N56A 3ZKND 4NQDE 2LTQC 4UIKH 2VZUA 5C2UB 2MOVA 3BW9B 3TN0C 1HK6A 2YPKA 1DTUA 1DL7H 1MRFL 1D9KA 2JB5L 2Y5TA 3NFNB 2C1OB 1JGVH 2VLMD 3VFGH 2EH7H 5ACZB 2FX9L 3X12B 1RIHL 5AZEL 4JPVH 1RFDH 3T1FB 3UTOA 1MCNA 1MI5A 2BZDA 3TFKD 4LLDA 3TV3H 1H9VA 4EIGB 1IZKA 1IAOA 3VFPA 4PLJD 2ADIA 5C0NC 5FYKE 1AXIB 4PRAA 4DVRH 2CR6A 1RJLA 4LHUD 3ISWA 1VKXA 1H8NA 1Q9WB 1KJMB 2HLFD 3RUGE 1DBMH 3C6SA 3TO4B 1MF2L 1E6JH 5IWLA 4Z0BL 1N7MH 3HFMH 4NNPH 5FUZH 4C55A 3WLWD 2WM0A 3MV9E 1GGCH 4Q0XH 3LKSA 1ZLVH 4HV8B 5F1NB 5FHBL 5L0QB 2ZCKL 4BZYA 4WEMB 3BO8B 5H94B 3VFNA 4APQB 2RHEA 3CX5K 5J56B 3KWWA 3HMXL 3PNWB 2JJTC 1XMWA 1FQ9C 4OBSA 2R0WH 2DQJL 1IQWL 4HAFA 4BYHA 2A6JA 4F80A 4L4VE 5JOPD 5E2JA 1TLKA 5C07E 4G5ZH 3K8LA 1DCLA 5JOFA 5H37H 3EOAB 3ARGD 4HXAH 5KG9A 2AI0H 4APQC 3UCRA 1QLFA 4IMLB 1U36A 4QYOA 5D1ZB 1PY9A 1FCGA 2UZIL 4GMSH 5EC2A 4JFEA 5HYJD 3TBWB 2HTKC 5FDWA 5L2KB 1YN6A 3QPQD 2C7UA 2B8OT 1QOKA 1XGRA 3I02A 3MJ9H 1DBJH 3MLTA 2W60B 4MSWB 1YDPB 1OQOA 1CQKA 3INUH 4NKOB 4BK5A 3L6FA 3ARDD 4HH9B 5D1ZC 4XNUL 3B3IA 4GRWH 4MHHI 3HPLA 1NUFA 1EAPB 1I1FB 1Q0XL 1PZ5B 4QEGA 2XN9E 1E4XL 1WV7T 3HNVH 5D8JH 5H2BA 3VW3H 1YMMB 3JV4B 4D9LH 4NBXB 1LHZA 2C4FT 3LB6C 2DKMA 4X98B 1MFCH 4KRNA 2IG2L 1JNJA 3FOLA 3REVB 1G0XA 1JCKA 3DTXB 3WXWH 3TIDB 2NY3D 3MGTB 4O4YH 5DK2A 4UQ3A 1RMFH 4YPGA 5I1IH 2YD8A 4TOYH 1JPTL 2JCCF 4XP6L 4CADB 1IL1B 2FGWH 3CC5B 3FL7A 4U6VH 1WIUA 4B41A 1N5YL 4MJ6A 4LBEA 3OKLB 3NH7L 2NLJB 3VXUD 4F15B 5CBAB 2ESVE 3VGDA 1WF5A 3BZ4B 2F54E 2OS7A 2HT2C 1N5AB 5BXFB 1F4AA 1FP5A 3DARA 3TESA 4ONHA 2HT3D 3SPVB 4MNGA 2X44D 4HWBH 4TVPH 5C6TL 2YD5A 1HHGB 3O8XB 3SCMC 1CDBA 2VIRB 2VLKD 2H3NA 4L4TD 4JFFD 2AV7B 1ITBB 4C57C 1UWEH 3RWEB 4F15C 4NC1E 1OTUC 5JO5B 2VISB 1QSZA 2AXFA 3PP4L 4X7SL 4PRHB 4M6AA 5D2NC 4X6EB 1NEZB 2BERA 3PQYB 4WUUD 4XXDA 4Y88A 3E6HA 3BEWB 4P2QA 5SWZA 4ODVL 1L0XA 3FTGB 2E27L 4CVZA 3BE1H 4LPCA 1A7OL 4OLZH 2IMNA 1P6AB 5SV4A 1OSZA 3HI1B 3S97C 2ZUQB 3WKML 1EGJH 1YYLH 3B6SA 4DEPB 1GGIH 1ETZA 4PG9A 5DRWA 3SKMA 3WNKA 1AFVH 3MLZL 3HE6A 3RL1B 3MBXL 4QWWC 3K4DA 2ZCHH 4TUKL 1LP9A 3IFNL 5C0DB 4EI6B 3DMMB 4XPGH 4CU7A 4JRWA 5DDHA 5IK3A 1JRHI 3LS5L 1I9IH 4R0LC 2ZUQC 4KROB 4KKBD 2F74A 1A3LL 3WS6C 5IOPA 4NC2B 4P59H 3RWHB 3T65B 5EZJB 3EJZC 2OI9C 1W0VB 4YHKL 4P49A 2Q7YA 1HHKA 5JHLH 4JDZB 2GJ6B 3CLFL 3MV8A 4LU5H 4EUPA 1CLOH 2VWEE 1R3KA 3DMMC 5FO7A 4TVPD 2IBBA 4QRQB 1SY6A 2OJZH 4LHUG 5E5MA 4KQ3H 4OLXH 5HYQB 4KK6D 4YQXH 2EDQA 4MWFA 3Q3GA 2XOTA 1F90H 4GOSA 4DAGL 4P5KB 4MHHG 5I75B 5INDA 1DLHA 4YDIL 5D71L 3MV01 1S5IH 1HH9B 4P57A 1DQJB 1U8LB 4DQOH 1OL0A 2V2XB 3FOMB 3CFIC 3U0TA 4TVSa 3SE3A 5CFHA 4HWZA 5CINH 1TITA 1AD9A 4EKXA 3R06B 4GS7B 5I75C 3SJVD 4CN6A 4PS4L 3AREA 3IS0X 2V2TA 1S7VB 5F8RC 5T33L 4M8VA 1JGDA 3LDBB 3OKOA 5EIQA 1CU4H 1SYVB 3DI3B 5FO9B 1EJOL 1LDSA 4ETQA 3AAZB 4JPWL 4N0YL 4GS7C 4NN5B 1QRNE 4OKDA 2OR9H 4DKEH 2E9JA 4ZSOA 1KJ2H 2YUXA 5HPMB 2P1YA 2M2DA 3RUGF 3FZUC 3LDBC 3L3JB 5KSBE 2AEWA 1MCKA 3HC3L 1BM3L 1PG7H 1BQLL 5IFHL 2Y7QB 1FV1A 1QSFD 4OLWL 2OBGA 5J4MA 4IBLT 4Z0XA 4UT6L 3I84A 1FH5L 4R4BB 1U8OB 5T1KB 2PYEE 3ZDZE 1KTRL 1VADA 3UTTD 3BN9D 3VRJB 4ORGA 4I48A 3EYFA 4PJ9A 3CMOH 1DZBA 3IFLL 3UP1A 4FABH 2VUOA 4AM0B 3QHFH 3O2WH 5HYFA 4WFFD 2BFVH 2YA2A 3UXFA 4I13B 4LPTA 3WFBL 3RQ3A 5I9QB 3NBNA 3HZMB 4OCYL 1FC1A 1WEJH 5F96L 3RWDB 3EZ8A 4N0CC 5L8LB 5M94B 1QD0A 2CMRL 1LD9B 2DS4A 3KPLA 2VDLL 4JDVA 3CVIL 3EFDL 4Z7NE 3C08H 3DXAD 4U1HA 3RL2B 1SM3H 1VHPA 3MV7A 4PRPE 4X4MA 3GSUA 5BCAA 3VFSB 1K8DA 1YEGH 4MQSB 3BRGC 4JEGB 5I9QC 3LRGA 4U1SA 3T2OA 2EDNA 2ICWJ 1QLEH 3QQ9D 3HPJB 5L6YH 2DLFL 4JN2B 3RY4A 4JB9H 4R90L 3NIDE 2F53E 3IKKA 3IGAB 2G60L 3B9EA 3UTSE 4DZ8A 3U0PA 5H37G 5LWYH 4YGVB 3I6KB 3FONA 1HOCA 2LV4A 3WFCH 4WTZG 1SJHA 5E8OA 1NUNB 5TPWH 1J11A 1U93B 1TVBA 5FYKL 5EU5A 2FB4L 1PZUB 2W38A 3IDNB 2XWJA 4OSUL 1QFUL 1T6WA 2J8UF 2BDNL 4I2XE 5DURB 1IKNC 4MB5A 4DGYH 3CXDH 2YUWA 3VFRB 5FF6A 1DN2A 2I60H 2Q8BL 3OZ9H 1M71B 3IVKB 2FATH 3UTQB 3LS4H 5DJDB 4U1IA 2BCKB 1HKLH 2XZAH 1XH3A 1LNUA 3TBVB 2EYRB 2L7UA 5EPMA 3GMMA 1MLBA 5F9DC 4G8EA 1NCAH 1WWBX 3BAEH 5EUKB 1DSFH 3GB7B 5DUMH 1DVFA 3ET9F 3QEHA 4RWYL 5T3XE 4KKNA 3I9GL 3LN5B 3ZTNH 2PW1A 4BH8A 1T2QL 3STLA 1U8NB 3HNTH 1HINH 1CDIA 5CUSH 3WS3B 3BGAA 1UM5H 2D03H 3VXMB 4PD4K 1CE6B 1MCHA 4QHUA 3L5HA 3S37X 3QI9B 1IC4H 4OFYD 4J6RH 4HKBA 1RV6X 3QIBA 3MOBL 1CDUA 2AXJA 2BJMH 4X99B 4F7EA 2G75B 1EPFA 4JM4L 3IJYB 4ZAKA 5DZLA 4EN3C 2A83B 4M7JL 1NAMH 2A6DA 4NQDA 5E70A 3GSQB 1B6DA 2XI9A 4YHPA 1DQTA 1JYWA 3WE6B 3BHBB 1PG7W 3F5WA 4CJ0A 3QI9C 4ZFFA 1IGIH 4OF7A 5DJ6B 5MERA 3GUTB 3OKNB 2RJMA 3OKKB 1XGUB 3O4LD 3WXVH 5I71B 5DD1L 2QJDA 4UDTA 1ZGLP 2IAMD 4L4JA 3U9UA 3SKUD 1YEKL 1NL0L 2FYYB 4UIMB 4DCQB 1WZ1H 4H0IA 2A74A 4R97C 4GW5A 1X5LA 3HUJB 3GKZA 1NBVL 1RIUL 5C0RL 2XA3A 3C5SB 1OM3H 4I77L 3RUGA 2QQNH 4IOFD 5F89A 3CAFA 5JZ7C 5J3HD 5I71C 3MROB 4KXZH 3T0XA 3HZVA 5I16B 4AEFA 4OCWL 4YR6B 2B1HL 5L2KE 4MXWH 1MRDL 3MV9A 3X11A 5BV7B 3VFTB 3RWIB 3QWOB 4RGNB 5I1LA 5MEND 4PR5B 3CX5J 5CHNA 1FAIL 1N6QH 4HJ0D 1B2WL 4JANA 2OJEB 15C8H 3GGWA 3T08A 1L0YA 1BGXH 5I8CB 4L4VA 3TGXA 4OV5A 4NZRL 3UZEA 5C07A 1YECL 3VGAB 2LQRA 4QCIA 3HB3C 4OCXL 1F11B 4PGEB 3V79C 3OGCA 2EDOA 5E8PA 1BQHA 1OWRM 3QISA 2Z8SA 1VESA 2Q76B 2XFXB 1RI8A 3UBXA 5C08D 4M1CC 1EEZB 2EXYD 1UB6A 3TPUB 4L3AA 1MJ8H 4KUZL 1BFVH 1MHEA 1PLGL 3RWGB 3DX7A 4XAKE 5D7IB 1JN6A 1T7XA 1HHJA 4N0UE 1MPAH 1DLFL 1NUGA 1ZVYA 4RMVA 1ZWIB 3ZZ1A 3RX5A 4JFYA 1A6TA 3BGFC 1AGEA 1RUAH 5D2NE 1R6VA 4UOJA 3M45A 43C9B 2PXYD 2XN9A 1U8HB 2HJKA 3MTRA 4XI5D 5C0BB 3FN0L 3OR7A 3GBLA 2X4OB 3O6KL 4WIQA 4IS6A 2XA8L 4RSVA 4Q6IA 5EU4A 3SBWA 3QRGL 5L7XH 3ZDZF 3PQYE 2BVPB 3U79A 2FO4B 2D4FA 5FXCH 1ZHKA 1G1CA 3SDCA 4Q74A 4KQ4H 2F54A 3HNSH 4RNRB 4UAOC 5DXWA 1QLRA 1WBYA 4JHAL 3RVUC 3EDDA 4LGPB 1OLZA 4GRLB 4WI9A 4LP5A 2ZOKB 4NT6B 3LIZH 3L7FA 1FGVH 4AK1A 3QCVL 2NX5E 4M7ZB 5JXAL 3QYCA 1BMGA 4OGYL 3D85B 5CJOL 4FA8A 2ZUVA 4K7FB 3L3DB 2AV1A 1RZJL 4GKNA 5HI4C 1JMZA 2H2PD 3P0VH 4KHTH 3RVXC 1T80A 1V5JA 2GEEA 2DMKA 4AEIH 2XTJD 3HE7A 3ZHDA 2ZPKH 3SE9H 1A1MB 4G6AC 1JPFA 4N8VB 2O5XH 4QXGL 4HUVA 1JFQH 4OGXH 4TUJB 4OAWA 3NIDF 3QIUB 3PGCA 1T89A 3QDHA 1NLBH 2BNQB 4TSBH 4GBXD 2B39A 5IVXB 3GM8A 4KRLB 4KXZI 5EIIB 5TGBA 1IFHL 5ALBH 5D7KE 5IG7A 4V2BA 4YX2L 4KUCD 4KMQA 1DDHB 2OSLA 3DGGA 3SEPA 4JKPL 4NO0D 3D5OF 5DQ9A 1JZ6A 4XPHH 4LOUD 2Q6WB 3O6FC 3QIUC 1JVKA 5F1OB 5AYQA 2XQBL 1EZVY 5IBUB 5L9DL 4HG4K 4X83A 2CXKA 1I9RL 3H3KA 5ALCL 1KG0B 2XXMB 1Q9KB 5IB1B 3H3BC 4JO3L 2IPTL 3QNZA 4R26L 1FL3B 4X6DB 1LO0H 3DUSB 5HGHA 1AKJB 4YDKH 4WU5A 2H1PL 4ELME 4LF3B 1QR4A 3GK8L 4F33A 3EOBA 1VENA 4OLYL 3PG2A 3ZLQC 4PV8A 5B3JF 3DV4B 4ETYA 2WIMA 4KMTL 2EIEA 2GK0A 5HHVL 4DUXA 5JHDD 1MCSA 1S78D 4NUGH 4PBWD 1U8MB 5GGRA 3CU7A 3D0VB 4QNPF 3ROOB 2N7AA 1UQSB 4XXCA 3KG5A 1F5WA 4JO2L 4NRZA 3V5HB 3RGHA 4B0MM 2CDFA 1FDLL 1MCEA 3QDJE 3TBTB 5GJSL 4TULH 5KJRL 5J06A 3DHJA 4M1GH 3WDJA 1U92A 5IROC 2N1KA 2VAAB 4J3VA 1D5MB 3HI6H 4WWID 1XR9A 1RZKL 1I4FA 5J1AB 1OAZH 4JKLA 3OAYK 1RUMH 4WCYH 4PJCB 5BRZB 1F58L 4GG8B 5DWUL 3KS0H 3JWOC 2WINB 5D7JD 3O2VL 3QXDB 2DM3A 2GT9B 2OTPA 3STZA 3S35H 7FABH 3H9YA 4GRMB 1R3JA 5D96B 2NYYC 5D6DC 3BDYL 5C0JB 1YMHA 3F58H 1CR9L 1QRNA 2PW2B 1KNOA 4Y5VA 3MLVL 4ODSL 5ESVA 4TPRL 5KSBA 4OD1H 4XMLL 1OAQL 2IWGA 2EEAA 4PJBE 4G6MH 3DETC 2KZ1B 1U41A 4PTUB 3BKJL 3A6BH 2B4CH 5CZVH 5DK3A 4NQVA 1EMTH 3SDAD 2CDGB 3FO2A 2PYEA 1P1ZA 1ZT4A 2M26A 3CH8A 1YNTA 2C1PA 4GG6E 2YR3A 5F1IA 2J8HA 4AIOA 2OL3B 2BHUA 1MH5A 4DFIA 1C12A 5B39A 5EBMA 4KK8D 1KEGH 5K9OB 1KJVA 5TF1L 5T3XL 1VDGA 2DRUA 4PRBA 3IU3B 5E8DH 5A2FA 1WICA 3O3BB 2Q3AA 5IB5B 4IJ3B 5J6GA 3IDGB 1V3MA 3VXRD 2Q86B 2R0ZL 1R3IH 5FYLH 3RWFB 5I1GH 4NM8H 4UNUA 1RY7B 4UDUB 4BFBD 1J5OH 1Q9OB 2AJYH 4UQ2A 4FQXB 4P46D 4J7RA 1IAMA 5FHAH 5CMAA 5HI3C 3TCXA 4PRPA 3BT2L 3U1SH 3RVVC 1TVDA 4IJ3C 3BPNB 4ODTH 1UXSB 2DLEA 5AZ2H 5L8KB 1TZHA 2IH3B 1JBJA 5D1XD 1PSKL 4D0BA 3QQ4A 3N0PB 5E6YA 3ESUF 2F53A 3GMPA 3UTSA 4KI5D 2NY1D 3BFOA 4FQIH 4CBPA 1FFOA 3HRZB 4FQXC 4U3CA 4HFWA 4O2FB 3OB8A 3FN9A 4ONGH 2QSTA 2R2CA 4R7NB 3T3MF 3VXME 3GSRA 1NGZB 4MQ7B 2VSDA 1DBKL 3TN0A 5I1AB 1YUHB 4ZUSB 5KVDH 1RUQL 2CKBH 2CRZA 3GO1H 4XB8A 3I6GB 3O41A 1KIQA 2GI7A 4I2XA 2CIIB 3JTTA 4N9OB 3QH3B 4OQTH 4FOMA 2CQVA 2GW5A 3VFMB 3VE0A 3BH9A 1U95A 3MBEB 1QZ1A 4GAYB 3BW9A 1IKFL 3LEVL 4GFTB 4JY6A 3NFNA 3KS0J 4OBRA 5ACZA 4HIHB 4M7LH 3ZL4H 3X12A 3G5YA 4M62H 3T1FA 5BO1L 5EZLB 5DD0L 4MA3A 3NACH 4JFQB 1EHAA 4ZS7L 4XP5L 1MFAL 5GRUH 3FO9A 3TCLB 1UWGL 5FYLD 2AXGB 3PWPD 3D3VD 3HUJE 4YXHL 4ZFZA 2MPAH 4Z9KB 4PTTB 1Q9WA 1KJMA 1T03L 1BFSA 1KENH 1MUJA 3MRKB 1V05A 4G80A 1V3JA 4R8WH 4QKXB 2JJTA 3RU8H 1TENA 4N90E 1BVZA 4RISL 2UWEB 4XNZB 3HAEA 4JAMA 2EZ0C 1YY9D 2MHAB 4HV8A 5GS1B