2MNUA

Backbone and side chain 1h, 13c, and 15n chemical shift assignments for edb and specific binding aptide
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
93
structure length
93
Chain Sequence
GSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Unusual Protein-Protein Interaction through Coupled Unfolding and Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords EDB
total genus 3
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mnuA00
1UB6B 2YUZA 5AG8A 3CFJB 2E27H 4JFHD 4XB7A 3FO2A 5BW7A 5DJDA 4HDIB 1UT9A 2C3XA 4WO4C 1SJEA 4JPVH 4XPAH 3V2AR 2X4RA 1OF2A 3GUTA 2DLIA 5ICZB 3RUGA 2KPNA 4CJ0A 4O2CA 1AP2B 1GJIA 2F8OA 2VL5B 3GRWA 4CRPA 1RFDH 3CFDB 4HUUB 1WCQA 5L0QB 3C87A 1NCAL 2ED9A 4IHOA 2ZZUT 3V0VA 4WGWB 2J88L 1LNUB 3PGDB 3ETBF 3L6FB 2Q86A 2VIRB 3LMJH 3OGCA 1D9KC 4WGVB 4LCWE 1AQDB 2VR5A 3HUJA 4PY7A 4KMLB 3E2HB 4LSQH 3V5HB 4BZ1L 5C08E 4AZ8A 15C8H 1KF9B 3BKML 2P24A 1RJLA 3U1SL 3CPLB 4YDJB 2LV4A 1C12A 4Z78B 2H2SD 5J1AB 1QR1B 2X4PB 5GHWL 4PJ5E 2OYPA 3VU2A 3BH9A 3X13A 3VG0L 4UAOB 1BF2A 3TJHD 2A0LD 1NC2D 3H3KA 3OKDB 3O9WD 4HFWA 5GJSH 3EOTH 4NQVB 4KJQC 1FC2D 3EFFB 5IMKA 1QO3A 4Z77A 1OAXH 1H5BC 3DOSA 2Q8BH 5HSFA 4OD1H 4UB0L 3WJJC 3WNLA 2XRAH 4P2RD 3W0WB 3UJTH 3A6CL 2GJJA 1S7QB 4JG1L 4KRMB 3VI3F 1QBMH 1NCTA 3QHZL 3D85D 2DM3A 1PGRB 3IETB 4JFDE 2Z93B 1Z0MA 5L2KE 4L3CB 2CQVA 2X1XR 2OTWB 4KKLC 1LILA 4BK5A 2GJ6E 3HZYA 4QT5B 3ZE0F 1QSFB 3QZWB 3ES6B 3AY4C 4PRBB 2GSGA 5FK9A 4EJ1C 2Q20A 4U2ZA 5AZEH 3GSWB 4FTVB 5FECB 5LXGL 1ITBB 2HLAA 4KV5E 4NBYB 5DD0H 3ARDC 3MZGB 4JE4B 3WFZA 1CFVL 1QFWI 1NJ9B 2WBJB 4PV9B 5HDBF 3T09A 4Y4FB 5D5ME 5KZCD 5HYFA 2BNRE 3HR6A 3RVUD 3QDHA 2MQCA 4FFYH 2W1NA 4M8QA 5F89A 2YPKA 4F33A 5FXCH 4X4ME 2YD1A 4PJCB 5ESVB 1T04A 4EN3D 5C6TH 3SKOA 1TJHH 5E7FA 3BQUB 2UV3A 5AWNL 2VXUH 2PETA 2UY7A 3VRLE 3GSVA 5K9QG 4ZNEE 4OZFG 3DURA 4QRRD 4HGWB 4P2YA 3O0RL 4FQ1H 4Y4FC 1HYRC 3P4NB 4XPBL 1CICC 1UM4L 3BW9A 3KPNB 3L5XH 4YGAB 4OQTL 2NNAB 4HX1B 4YBQD 2OQJB 3WS3A 5CKGA 3B2VL 3C5ZB 4X4XB 3LB6C 5T1DL 4S10A 4HT1H 4D9RD 4U49A 4HFUH 1IQWH 1CR9L 3FRUB 3REVA 1HXMB 1PVHA 3MRGB 5I71B 5TF0A 5A2JH 3I75A 4R0LC 2FGZA 1RZKC 3T0EC 4ODSL 4PJHA 5E5MB 5EN2A 5H37G 1RY7B 5I66B 1CK0H 1QHPA 3EO1A 3UDWC 3LQAC 2MQ0A 4R3SA 3D1MC 5C0IB 2DD8H 3IFNL 4QTIH 3RAJH 4ODTL 3ZLQC 4YLQT 5IEHA 4WRLA 4IMLB 1CU4L 2GITB 4TULL 3I50L 2PW2B 1KJ3H 4QRRB 4APQB 3GMLB 5DEFA 5I17B 1VA9A 4DKFL 4XCCL 3HPJB 2AW2A 3MREA 4R90L 2W0PA 4PRHD 1QVOB 5MP6L 3BIKA 4LDLB 4F7EA 1KTRL 1NEZA 3RGHA 4PJ9B 1BAFH 1I7RA 4PY8J 2QL1A 2NYYD 3MLUL 1KB5H 3PQYD 1MFEL 1ZLWH 3TNMA 2X7LA 4R4FL 3IDNA 5ELIA 2EDNA 3WKML 4MNHA 3QRFM 4L29A 1FFPA 1MNUH 3MLRH 5E8OB 1MCOH 4JO4H 1T0MA 4OZ4B 1LO4H 1BD2A 5JA9A 1MI5A 2ZOLB 4NNPL 4ALAL 1CD0A 4NBZB 3VH8A 2O26U 4G7VH 4I4WA 2G5BA 5D6CA 1GH7A 3DXAD 1OGTA 4XNMA 1ZHLA 3WFCL 3MRMA 1U91B 2RFXB 4L5FH 3VFSB 4RA0C 4U1HB 4TSBH 4MXQD 5LGJA 3CZFA 1E6OL 3LDBB 3EDJA 5L8JB 1JFQH 4JY6B 1KPRA 5BXFA 2B4CL 3HLAB 3T8XB 1EHLH 3V5KB 5I1GH 2EXWD 1LK2A 2D0GA 4X99A 4QRPB 3U0TA 3QDMD 5T5NF 5ABDE 2IH1B 4QHMA 2BOBA 3UC0H 3KPMB 3GEWB 1YEDB 3FO9A 3ZKND 2XFXA 4U1NB 4JRXB 5JW5B 4N1EA 1FL5B 2VZTA 2VJXA 4MLSA 3NIFF 4G6ML 2FJFA 4LF3B 1J8HB 1MCJA 2QADB 4X5WB 5CWSA 3NACL 1A7OH 5D2NE 3WE6A 1BIHA 1FP5A 5E8NB 3OX8A 3EIFA 2YRZA 4WHTA 3TO2B 3KDMB 2HFGH 1M6OB 4LNRB 4PJBE 5I1KL 3PWJB 4JO2L 2XTJE 3CFKA 4FZEL 4Y4KB 5DA4A 1U8PA 2EH8L 2F19L 5E5RB 3MBEB 3K8MA 5JOEA 1F3JA 5FO9A 4MNQB 1S78C 3HR5A 4DK6A 5D1ZB 3JWDC 3HC0A 4G9DB 2V9RA 1SEQH 1LVEA 3QUZD 3MGTA 4N1HB 1BJ8A 4WWKB 1A1MB 3RKDD 4M43L 1JGVL 4NHCH 4XH2B 4KJQD 1YECH 1MFBL 4LRNL 5ADOH 3DXAE 3EO0B 1KTKE 4QHUB 1CDBA 1Z5LA 5D1QB 2AABH 3D3VA 3RTQB 2VH5L 5E4IA 1S8DB 1RZJC 1DVFB 2YA1A 3VXSE 4JN1H 4LSRH 4NRYB 5LAXA 1EGJA 3OXRB 5C0FA 1A3LH 1MAML 3F8UB 2YN5A 1OP5K 1NAMB 3MFFA 3X3GH 5FYKD 1J87A 1ONQB 4UT6L 4AEHL 5FV1L 2OSLA 4H88H 1ES0A 3F65A 5T1KD 3MLWH 4FS0A 4MB3A 3V0VB 1CFQA 3KPOA 5M94B 3UTZA 1F3RB 1EJOL 1XR8A 1J1OL 3L3JA 3NIDF 5HHMD 3AM8A 5DD6A 4C57C 1XF2A 4NFBA 2VITB 1NCWH 4XVJH 5FYLE 4TOYH 1FIEA 2P44B 4O5LH 5FHAL 4AIZB 3QZWG 3UPCA 4XT1C 3VFOB 1F6AA 1UXWB 3WIHL 1S7TA 2ED7A 5D96C 5IVXA 1TZGH 1BOGA 2QHRL 3EOAA 4XCNB 3C08H 1YPZA 3RVUC 5C2BL 4FXGA 3N1QC 1MHEA 2D9QB 3I2CH 3P4OB 1PJ9A 2Q6WA 5FYKU 4MDIB 1XFPA 1B0WA 4QRQB 4XBEH 3L3DB 1FDLL 2BVTA 4NZJA 1W0VB 2DQJL 1YDPB 2CIIB 3E6HA 4LPWA 4PJEE 4ZUTB 4N0UA 3RL1B 4I0PA 2J8UE 2Z31A 3DMMA 1A6UL 3AB0B 4ZQKB 1DN0B 3F7YB 4JHWL 4GW4A 5D2LF 4NWTH 5K9KB 1AGBB 5I16B 5FGRA 1DN2A 2HVJB 4U6TA 3FB7A 1A14L 1QBLL 4BJLA 2M26A 2NLJA 4X7SH 3MUHL 2MNUA 3EYFB 2QLVB 2X4RB 5EZOH 3R0NA 4P23A 4M93C 2R56L 4KDTA 3AFLA 3CSYB 5DT1H 1VFAB 5L9DL 5E08L 5C07E 4R7DB 3DGCR 4PRIE 5D71L 3OB0K 2BOCA 4NQSB 3QI9C 4WUUE 5KOVC 3RX7A 3EUUA 1YMMD 4P4KC 3IDJA 4HWZA 2X70A 4OLVH 4AL8H 4F57H 1WEJL 4ERSL 5F7UA 3RJDA 1U8HB 4ORGA 2GAZB 1V7ML 3KPSD 5KANI 5SV4A 1GC1L 4YBHA 2Z4QA 1FNLA 4UINL 4ZYKB 4OFKA 1B9ZA 2BRRL 4ISVB 4HK0A 4TNWF 4CMHC 3D25A 1RU9L 1IEAA 2HJFB 3R06B 5EWIH 3VXUE 3AXLB 3B9KD 1CGSH 2FHCA 1W72A 5I2IB 4TQEH 3ARDA 5DJXB 3OQ3B 5JHDE 4YXKL 3KPRA 3IU3B 4POZD 1X7QA 3KXFA 2GEEA 2RR3A 3BGMB 3G6DH 1NGQL 4LEOB 5IIEA 3C6SB 3IFLL 3MRBB 3W9DA 3AU1A 1DSFH 4OCXL 3BRGC 4IRSC 2J5LC 4UZGA 3V0WH 2Z35A 1EAPB 5EBMA 3WFBL 5JZ7D 2H8PA 1FVDA 1JRHI 1HINH 2EE9A 5IEHB 3DRQB 1LO0L 4HAGA 4MQ7A 3S36H 3A6CH 4E41A 2E9IA 3L5JA 4XNYL 4G8IA 3PWVB 4OGYH 3M1BA 3CDGB 5EUKA 5IB1B 1QP1A 5DQDH 2Y4SA 3BPOC 3GMMB 2JIXB 4GUPB 1XF5B 3QI9B 3T3PE 1IC4H 3TWCL 3AS3A 3WFHB 3BN9C 1X4XA 4L1HA 3C60B 4H20L 3UBXG 2BCKB 4AIOA 1KEML 3D18B 2H2PD 1UA6H 4ODVL 5I1DB 3KPRD 4QRPE 5DJYB 4E9LA 2CK0H 4I77L 3MYJA 5CCKL 1QPPA 5SWSA 2ARJA 5F1NB 5SWSD 3UTTD 2WBJC 2WWKT 1RUQH 2W9LA 4JRXE 2W92A 1GAFL 2FH6A 3D2UD 2EYTA 1X5LA 5KVFL 4YAQB 3KYOB 4HKJA 5KSUA 4M7ZB 3FOMA 4OGAD 1TQCB 1NBYB 4QNPF 2ZUQB 1IRAY 4LSPH 3PHQA 1FYHB 1U95B 2P5WE 3NCEB 4YEFA 3E0GA 5F96L 5MEPB 1KC5L 3MODH 3C6LC 4G9FD 3WS3B 1OP3K 3O0RH 4XNMB 2LABA 5E5UB 3DV6A 1CFSB 3CK0L 4CU6A 2Z92A 4N0YH 2L7UA 2FO4A 4CBPA 3QFDA 1FL6B 1U8NA 3SE3A 1RUPH 3L5XL 3Q5OA 1EEYA 3HMXL 2ZUTA 1ZLWK 3OKKB 1EFQA 1HSBB 1SYSA 3ARFA 4ZOEA 3ZE2F 4A6YH 4XCYA 4Y4KC 1OM3H 4KKLD 1CT8A 4NO3A 3BH9B 3TIDB 2JCCB 4DVRH 1FL3B 2VC2H 1A7RH 4KJYB 5LWYL 4HFUL 3P4MA 4LDOB 1JZ3A 4QHLA 3W2DH 4NNYA 4H5SB 3SE3C 4D9QD 1MQ8A 2X40A 2GITA 5DD1L 1QTYT 1AR1D 4IRJA 4HXBL 4Y2DA 2DQGL 5BQ7B 3I6GB 4R8WH 1JRHH 5BMFH 2WAHA 3W0WA 4X80H 2MMXA 4NKQB 4M5YL 5D7KD 2GJZB 1J7VR 1QFWL 4TULH 4XZUB 5DRXB 3SO5A 2DDQH 3CVHH 3FZUC 1Q38A 1CIDA 2YHGA 4C54A 2CRZA 1WWAX 3U9UA 4WDIB 4MAYA 4N90E 3BFOA 2ZPKL 3VFPB 4UOW1 2A6JB 3E3QC 3QEHB 4L4TB 3FQTB 2BK8A 3TNMB 3CX5J 4FQJL 2MJWA 1C5CL 4ZUSA 4IRSA 4RGMC 1AO7B 1W0WA 3TZVB 1ZGLP 4CMHB 4M8VA 3RX8A 2O61A 3T04D 5I30L 3I3EA 4GBXC 2GYSA 1WAAF 3I6LE 4EXPX 2ZOLA 2GIYA 4DW2L 1T83C 4I3SH 1M71A 4Y19A 2EXYC 3BKYL 4ZPTA 1MCOL 4JO4L 3ZKXB 4OZIF 4ONHB 3RGVA 1N2RA 3BZEB 3FQRA 3BUYB 5HYJD 3UO1H 1BZ7B 1V7NH 1AE6L 1GGBL 2V5YA 4NCC1 5FA3A 3I6KB 1VGEH 2KQMA 1D9KB 5HI4D 2IANE 3IAQA 4WFED 4KRPC 4U1IA 4ZMAT 4Z7VE 1J5OL 4HH9A 3RVWD 5JORB 3NPSB 5GS1C 3MA7B 4PJAA 4AMKH 4QCIB 4PUBH 3WFCH 2XWTB 5TE6H 4URTB 1N4XH 1N0XL 3C9NA 4PRPD 4F7MA 1HH6B 2VQTA 3K74B 3DI3B 5FYJE 5J9PB 4QKXB 1RIVL 3L95A 2EE3A 2FEEI 4U1LB 5L6YL 4Y1AA 1KEGL 1NFIA 2W9EL 1D5ZB 4OT1H 3QEGL 3LHPH 3S97C 3ZE2E 2CRIA 2J1KA 4S2SA 3IFOA 3ARBA 4YO0B 4F7CA 5T1MB 3WL9A 3TEUA 4XXDB 1HH9A 4WI3A 2ZG2A 3TJEH 1INQA 4RNRB 1JIBA 1T1ZB 4P4KD 1CFNA 3ESUF 1QSEE 1MHEB 1I85A 2V2TA 4HBQA 4OLXL 2X4NA 3HAEH 2AJUL 43CAA 1CL7L 43C9A 3QUYD 4GRMA 4R3SB 4I18C 3F58H 4JR9L 2VXTL 5SWZD 2IPKA 1IKNA 5CILH 1UZ6E 1IZKA 1JGUL 1MCIA 5CINL 3JV4B 3QUZA 4QOKD 5L88H 1JMZA 2C3WA 1OPGH 3RL1A 2AXGB 4K23H 1FZOA 1HQ4B 4RGNE 4WNQB 3ZHDA 4NNXB 1OARH 2VLJE 2IWGA 1DTUA 4XVUC 4LSVL 4P3CL 1F4HA 4HPOL 3FO0L 4U7SA 3MRHB 1KB5B 2XNAB 4POZC 1JZ8A 4XRCA 5E08H 5SX5H 3OKNB 5DS8B 1WWCA 2WUCL 2IAND 4WWID 5KVDH 2X7LB 3MLXL 1JWUB 2HKFH 1DEEB 3QBTB 3B2UD 3NTCL 2Y1VA 5EPMB 5EUOF 3PHOA 4HPYL 5FYKL 1P5VA 3SDDC 4RWHA 4LCUA 5CZXD 1UM6L 4JZNA 3NN8A 4PGDB 4UDUB 1IC1A 3T0BA 4ZAKB 1L9MA 2MFNA 3BPCB 1AD0A 1DQQA 5AG9A 2YXFA 1WJ3A 1WF5A 1TITA 4WFGE 5EU5B 2AERT 5AZ2L 4DZBB 5CHNA 2V5TA 3QA3A 3MPCA 4HKBA 2MKWA 3BPLC 3T08A 1EO7A 2J6EH 3UBXA 3AREB 3BI9X 3DSFL 4DVBB 3S37X 3VXRE 3C8KA 1BOGB 1BJ1J 1T1WA 4NWUL 4EXKA 2HJFA 3R06A 1I8MB 2Y07H 2A83B 4Y16C 1OAZH 1VHPA 4JFDB 4QLRA 3SY0A 5I71C 2DM7A 1QLEL 4JFED 4NKIH 4KJWC 3GHBL 3KPRB 1EIBA 2RJMA 4U1KB 3V52L 2EE6A 4LVEA 5I1CH 4Q6IB 5DVOA 3LN4B 3GK8H 4TVPD 5MHSD 2DWEB 1UEYA 5TE4H 4GG6B 4Q9RL 4OKDA 5FHBH 4NQXB 2DJ4A 1E6JL 3I2CL 4O2FB 2JB6A 3PABB 4OI7A 2LAGB 3RTQC 2AS5M 4ZFZA 2VN4A 5HPOA 4E0RB 4X5LA 4S0TD 5AAMA 3W5NA 3QPXL 4TSAL 1A64A 4LOUD 4DAGH 5MEQB 4G5ZH 3U4BL 3DV4B 3GSXB 4D8PA 4JRYD 3GIZL 2JLLA 1JK8B 4JKLA 1N64H 4P5KB 4Y4KA 2KUTA 4FQ2L 4LLQA 2WZPD 2CR3A 3TZVD 1RJYB 4R97B 4PY7B 1F3JB 2DQIH 3HR5B 4FQXC 1RIHL 5GGQH 3S5LB 1ZK9A 2BJML 4ZUUA 1WBXA 4Y7MA 4QRTB 5E2VL 5IKCA 5IBUG 1KENH 1NUFA 5B38A 3JTSB 4LGRB 2X10A 1C16A 1EUTA 4DGVH 1V3KA 5DUPH 1QRKA 5FFLA 2VISA 4M03A 2DQCH 1AD9A 5KS9F 1E28B 5IFAL 5I1AB 5GRJH 1NGPH 1FZMB 3GMOA 2Q87A 4PJ7B 1A7QL 1ORQB 5IMMB 3WSQL 4JVUA 5HDQH 5DHVB 3TBYB 5FYKE 1JGLH 3OGOE 4YHOL 4IMKC 3LD8B 4CVXA 5E99H 1BOYA 4N0CC 4U6XA 4HSQA 3UTZB 4OV5A 1XR8B 1I7ZA 4M61A 5FO7A 2BNQA 4HWBA 3MRRB 4L1DA 2XTJC 1KPUB 5JHLL 5TH2A 5HHPA 1A7PL 1G9NL 1H3XA 1ND0A 1RUPL 1I9RH 1EXUB 4MJIB 1RZFL 1Q1JH 4PJ9C 3CXDH 5C6TL 2ZSWA 2EKJA 3JWNC 3VFWB 2PYEB 4YK4C 3CCHA 4OZGE 1CFBA 5TPWL 5IVXB 3NPSC 1EMTL 3PE9A 5EOQL 5L7XL 4YZFE 2XZCH 4LRIA 4XC1H 2PO6D 3GRWL 4XPBH 5F7FA 3PWPB 2VLKA 1GSMA 4M3KB 5KSAD 3IDMA 4G80B 2DQGH 1IE5A 4WEBH 3VXRD 4ZS7L 1I4FB 1MFDH 1Y0LB 3T77A 3WFBH 1MIML 4IM8A 1YEFL 2RBLA 5D2LB 4OF3A 2APBA 4JPIB 3R8BB 4I0PB 2DOCA 3SE4C 2H26A 3SDAC 4UIMB 5T3ZH 1U41A 1H3TA 5JNYA 5JIHA 4HUUA 4YDIL 4K3EH 4P3WA 5E56A 2NR6D 1S7WA 5FCSH 3H2WA 4JAMB 2J2ZA 3O81A 4NKMA 1EEUA 1TCRB 2HFEB 2X4OB 1T5XA 2F74B 1ACYH 1T66C 2FYYB 2R29H 3BPLB 4Y1AD 3IT8D 1IVLA 4CU8A 4H20H 4J6RH 1FLTX 3LKSA 4OKVA 2Y25A 3EAKA 1ADQA 2LTQB 1HEZA 3QUYC 2DI7A 3T2PA 2OTUA 4AYFA 5DMIH 3SJVB 4PRHE 2QSCH 1C12B 3GKWL 2HRPH 4CAGA 3KYMB 1AE6H 4LKCB 1U95A 1GGCH 1QQDB 5HDOA 1LO3L 3SKNA 5D1XA 3U1SH 3UYRH 1KJ2B 5IW6B 3INUL 1WBYB 2VMFA 1IFHL 3EFFA 5IMKB 5A40E 1VFMA 3GJFK 1CFVH 3O11B 3EGSA 4NKDB 3CC5A 4M4PA 3OKKA 2XKNA 4FG6D 4YUEL 5I1JH 5B8CB 1QEWB 2AJVL 1E27B 1QRNE 4E5XB 5JHDD 1IKFL 4RISH 5TDNB 4L3CA 4O02H 3PWNB 3VGAB 3T4AB 1KIUA 2OR8A 2CKNA 2UWEA 3ALXA 4L9LB 3FO2B 5DJDB 4F33B 1DQLL 3OV6A 2GSGB 4JANA 1I1AD 3X11B 3MJ8A 4RA3A 2MCPH 5I19H 1AP2A 3RU8H 3D3VD 4YDLB 3CMOH 2EKSA 4XZUA 1QNZL 1IEBB 4OZ4A 4WI6A 1A4JB 4M6MH 1XCQA 1KN4L 4PJAF 5INCA 5FDYA 2R23B 5F9OL 3QQ3A 4HKXB 1YMMB 4L8BB 3QEHA 4FP8L 2I60H 4OGXH 3SKOB 3QB7C 4PGZA 3P0YH 3QJHA 1MJJA 1AO7A 3G6JE 4OCSL 1KIRA 2V5SA 3P9LA 2I07A 4K71B 3ZT5A 4H25B 4M9OA 1ADQL 3ISWA 4R0LA 4JFYA 1ZLSH 3DURB 3SDCC 1A21A 2WNGA 4C56D 5BS0A 2XWBB 4FQQB 3Q3GA 3LAFA 3SCMD 4P2QA 4MJ5A 4TNWK 2PR4H 5KOMC 4RFOL 3QIBD 1NCNA 3VXMD 1A5FL 1XH3A 4DN3L 1K3ZA 4HCRA 1N8ZB 1UCBL 5EPMA 2VDRH 4TTDC 3SDAA 4Z7NE 1IAKA 1PY9A 1JHKL 1KT2A 4PJCF 1AI1H 1S7RA 5HYQA 4KKCD 4HUWB 3HAEB 4OZGB 4MGXA 4LF3A 3QO0B 4Q74A 4ODBD 4HBCH 2OXGA 4K3GA 1JGVH 1NBQA 5EU5A 3M17A 5DR5L 1F00I 4BQBA 4GRWB 2X6MA 1NFIB 5DI8B 2P5EE 2HJLA 4ODSH 1J18A 3DIFA 2IADB 2NY6D 3QSKB 4F7EB 1DLFH 2PW2A 4QRRA 2F5AH 1N6QH 3S36X 1IGIH 4Z0BL 3S34L 4L8DA 2FBOJ 4GLRH 1HE7A 3GSWA 2Z31C 4FTVA 5FECA 1BPVA 1ORSB 4QHLB 5B22A 4JREC 2FX8L 3LPGA 3VXOA 4GAYA 1I7RB 1X5FA 2ZUUA 5GGRB 4GAJL 2D7TL 4IMKA 3DETD 2FATH 4DAGL 1MLCB 1DVFA 4P48A 1WV7T 4WNQA 4C56E 2QHRH 1CICD 3LS5H 4N0FA 1MRFL 1KLGB 2VXQH 5DVMA 4YBQC 4OLYL 3ZMRA 4P99A 1EHLL 3H9ZA 3BVNB 5C9JB 2A38A 4NZUL 4U0RC 4FABH 2V2XA 3ZYJA 3HRPA 1T1YA 4KRPD 3VI4E 2L4OA 5I76A 3SDYL 2F9BT 2ITDB 3L3IA 5DQJB 5EO9A 1KTDA 2FBJL 2Q7YA 1TZIB 3PHOB 1K8IA 1S3KL 4LVHB 4YNYA 5EOCH 4N5UA 3ZDXF 1WZMA 4K3JL 1HXMA 2GHWB 3LEXB 3PP3H 2X1QA 1YNKH 1NAKL 4GKNB 1TQCC 3IS0X 1AD9B 3ZE0E 4K55A 1IGFH 3G9VA 4XMKL 2H1PL 4X98A 1WICA 5CHNB 4IOFD 3LKOA 1PY4A 1M4KA 2YMXL 3LCYA 2VQ1A 1YN6B 1OP9A 1YEDA 3K2MC 3NIFE 2XFXB 4ODHH 3N1FC 4HUVA 4P46B 1D5MA 3LN5A 2CDGA 1HKLL 1KIQB 4Z7WA 3JTTB 1FG2B 2WIMA 4FNLH 2EZ0C 4X9FA 4FQCH 3SKUD 4HT1L 1IQWL 5FF6A 4PJHE 1L9NA 2ENSA 2ZSVA 5GRZA 1DVFC 2P46B 1D5ZA 3MRKB 3LY6A 4JFQA 1XGRB 1QLFA 1WFOA 3UAJD 1KCKA 1NCCL 4CADB 1MAMH 4NUJB 4UT6H 3FL7A 5ALBH 1FIGL 2DTSA 2X09A 4Y89A 2VLKB 4JO3H 5TDOA 2VYRE 3EHBD 3IDXH 5IHZB 1L7IL 2BOCB 3B5GA 1QPXA 5ENWB 4K7FB 4Z7VF 2V7HA 5CSZA 4R7NA 1E4KC 1FYTA 3EFDH 1ZA3B 4JQVA 1TQBB 2CKBB 1CBVL 1BFVL 2N4IA 5KVGH 4ZXBA 4Q7DA 3ULUD 3UPRB 2ADFL 4P5MB 1RK1B 1RZ7H 1Q9KA 4G5ZL 3EKCA 2VOTA 2FX7L 1BAFL 2NPLX 1LE5A 3HRZB 3MLUH 2YS4A 4LCIL 3PQYE 2D7NA 1UB5B 3D85A 2MQ3A 4OJFL 4PGCB 3IJHA 3S9DB 5LG1A 4QYOA 2YA0A 4WTWA 3T2QA 3MRDB 1CL7I 3WHXA 1CDYA 1BD2E 1A7NH 3SBWA 2VABA 5FUOL 4A6YA 4G43B 1DBKH 1FO0A 5EFIA 4S1RL 1V05A 2VZ3A 1ZLUK 2APFA 2HRPL 1UWGH 1A0QH 5TQ2H 5ESQB 3KPLA 4APQD 3FT2B 4Q58C 2DQCL 1TJHL 5IHBA 5IBLC 4YHYB 1ZT1B 1T1XB 4L8CB 4RMWA 2F53E 3ALWA 1WCBA 5LBSH 3L3HA 3SDDA 4U4BA 3E8UL 3K8KA 4JFFB 3TBVA 5IGXL 3OR6A 2IBZY 1PQZA 4JZOA 4HS6A 5B38G 3QIBA 4PP2A 1HHGA 1LO5B 3O6MH 2R0LL 4EUPB 3BAEH 4MXVF 4YDVA 1NKOA 4EI5B 4M4RA 3T2NL 4MS8C 3CVIH 5CIPH 2V7NB 2J7LA 4F7PB 1WLHA 3QRGL 5F1IA 3QI9A 5EULV 2JE8A 3GI9L 1NMBL 5IB4B 5E9DA 2VO5A 2YK1L 2DQHH 4G9DA 4C4KT 3ULUE 3THMH 4Y4HC 2BCKA 3HNVH 4WHDA 5I1IL 3GMPB 3QQ4A 5HPMB 1HZHL 1HWGB 4G6FB 1RMFH 4JFZH 4Q6IC 4N0YL 4ZODA 4X8XA 1M05B 1OWWA 5TDPA 5FAAA 3QXDA 5FB8A 4NO0D 2H26B 2XY2A 2HH0H 4OD2A 4X7SL 4JFEB 1DQDL 1S7VA 2EKSB 5DO2C 2AJZB 1IEBA 3N1GC 3FQNB 4NN5B 3QG6B 4M6NH 1CE1H 4AT6B 4LLUB 4DKAA 1IC7L 5I73C 2IFFH 1X5KA 4XI5D 1ZLVH 3I84A 4RFNC 3RHWF 5C6WH 4GS7B 4U3HA 5ETUA 3UMTA 3QEQE 3AY4A 3QJFA 2J4WL 5DJAA 3O41A 3WNMA 5SWQB 3VXSA 3QCUL 1UH4A 1R3JA 4B53A 1MFEH 1F02I 1YEKL 3DHMA 3MBXL 3VFOA 4DGIH 3ZDYF 2AQ1A 1HSAB 3IRZA 3JTSA 3BP5B 4GAGH 2YD2A 4QGYA 5SWZB 5C2UB 5A2FA 3IGAA 2Z35B 1TPXC 2OL3A 2Q1EA 1J05A 3VI4F 3VXPB 4P57B 1KJ2A 5IW6A 5JPNB 3DETC 1KN2H 1PBYA 4P2OB 4PS4H 4UUJB 1HQRA 1IZJA 4PJDB 4B0MM 1DANU 1RFDL 2E6QA 4LCCB 3RWCB 1OW0C 3G5VA 3TWCH 1F11A 4G8GA 5CKAA 5F9WC 3CDGA 3HZKA 4OUOA 3Q2CA 3CVHB 1NGWA 4HEME 1AGEB 5IWLC 4IOIB 4HQQH 1DSFL 4LHUB 1J1XL 2RB8A 1I3VA 4OM1H 5JXEA 3DX6B 4YFLF 4OCMC 4PJ8C 5B8CC 5TGBA 3D18A 3IJYA 1I9EA 1LP9A 3TBWA 5B39A 1UKTA 3QG7L 4JM2C 4S0SD 3X11A 3T3PF 3UC0L 1ORSA 1FDLH 1K6QH 1Q9OB 3RX5A 1FNSL 4NQDD 4X6FB 4WI4A 1QA9A 4HJGB 4XWGH 3MJ6A 2HT4C 4YAQA 4RRPG 1DBML 1JGDA 2O5XL 4GMTL 5GJSL 1B2WL 5J11C 4Z7WF 3VFNA 3F5WB 3O45A 3D2UA 1ZSDB 2HG5B 3MYJB 1YY9C 1QG3A 5KS9A 2IJ0C 2XRAL 4NUGH 5F9OH 1CFTB 1JPST 2XN9E 1MEXL 5FA3B 1Z6JT 1KIRB 5D96B 3FO1A 4NZUH 1TJIH 3DV6B 5GRYA 4DVRL 4M5ZH 1S7WB 2CK0L 3B3IB 4OGXL 3V7AE 3CH1A 5KSBB 1RUML 3RP1A 1ZT7B 4KFZC 3P9WB 5B4MD 5I76B 1G7PB 3MRIA 4PRNB 4XTRC 4I3GA 5DD1H 1FE8H 2WLZA 2DQUL 2Q76B 1BM3L 3C9NB 3VXNB 4HXBH 1YEEH 5DFTA 4KHTL 3VRJB 1DBBL 1F13A 3IETA 1TZIA 2IEPA 4MJIE 1MVFA 4BSWB 3EYQD 2ADIB 3ARGC 4MJ4A 4ERSH 4KUCF 1FNEB 1NEUA 4ZO8A 5IB5A 5D7SL 4NHUB 1T4KB 1KIPA 5BQ7A 5D9SA 1R3IH 4PTUA 1INQB 2JJSA 4LSTL 3O9WC 1FPTH 3GSUB 5IHUL 2UWEF 5FYJL 4IRZL 3P4MB 2D0FA 1CXFA 5F7KC 3H9SA 1PKOA 1AY1H 1FYTD 4M62L 4OAWA 5I74B 5BOPA 2BSED 3MXWH 2QQKL 4DTGH 9CGTA 4OB5H 5KSVA 3MRCB 3QO1B 3BD5A 4YHYC 1MJUL 4K9EH 2AGJH 1ZAGA 1I7UB 3VMOA 3F7VB 4ZUSB 4ZUWA 4GRLA 3MV7E 4FN0A 1DQJA 1TJGH 1LO2H 1KBGL 5E4EC 2KQNA 5C08A 4JFQB 5I8CB 5MEOB 1HYSD 1YJDC 3WFHA 3U30C 5C9KA 1SVCP 4PTTA 4XNQB 5F3HB 3MOBH 4TVPL 1NCBH 5HGBB 1CICB 3MRQA 1P4BH 4LQ1A 4EN3A 4PP1D 4OIIL 2P8PB 4HIJB 1BEYH 4HWEH 3O6FC 1ZTXH 1OAYH 2WV3A 2PW1B 5B3JE 3QDJA 5IBLD 5LGKA 4RGOH 1V5JA 3ZTNH 2VXVH 4PJDF 5IB3B 4LCUB 5FUZL 3RWIA 4HK3J 3FRUA 4QOKA 5E2TH 1PZ5A 3H8NA 3U30B 4XMPH 5J12C 3TH2T 1MCPL 3MA7A 2Q8BL 2VXQL 3W0WD 2DJUA 4MA1B 2A6DB 4MNGE 4KTEH 3MV01 3I6KA 1IT9L 4JG1H 5HYSA 4NZRH 1GOHA 2GTZB 3SE9H 1NC2B 1DBKL 5GSVB 1JZ7A 3FFDA 1HOCA 1MCCA 4P2QB 1AGDB 2BSTB 3HPJA 1JHTA 2Y7QB 2UZIH 3VFTB 2XWTA 2V2TB 1HH6A 4NSKA 4XAWL 5F72S 3WLBB 4KVNL 4NC0B 3QIUA 2P5WA 1G6RB 3EOYG 3ROLB 4WU5A 1CLZL 4M1DL 2D31B 5LXGH 4XAKD 4WY7H 2JELH 1HCFX 5T1MA 4WW1A 1I1FA 2Y36L 1P9MC 5F96H 2D4FA 3O4LD 1T1XA 1NLDL 1CFNB 3QEGH 2D0HA 5CMAA 1FAKT 4E0RA 4X7TB 4U3XA 1JV5B 3O8XC 3L7EB 1I7TA 3CAFA 5AEAA 2GJZA 4LU5H 1YUHA 3BP6A 1A3RH 2LVCA 2VXUL 1VGKA 1YN7A 5IB2A 1FFNB 3L3GB 4X6EA 3BJ91 2JJSC 5CGTA 3W39B 3RNKB 2VZVA 2VXTH 4FQ1L 4F7PA 4LLWA 2WIIB 3GM8A 4PBWD 3FT4A 4N9GA 3V7AG 3FB5B 1PG7L 2F5BH 3MRMB 3DUHA 1JRHL 2D7PA 3WHE0 3HPLB 3ESVF 1U6AH 3NCBB 2Z8RA 4IS6A 3K8LA 3O3EB 1FVCB 1NDGB 5ADPH 1KPRB 1VEMA 1JF1B 1M05A 5F3BA 5GJTL 1JZ5A 2WLYA 3ET9F 1KCVL 2H45A 3QXDB 2E9BA 4P4KA 4P3CH 4PRAA 1NBVH 4JHAH 3PV7A 2WWMD 3UTPE 3IF1B 3IXTB 4LPTA 3O4LA 5CP7B 1P5UA 5J7CC 4NKIL 5IJVB 4CVXB 1GYAA 1B0GB 5GIRA 3O2VL 2YN3A 3V52H 5JW5A 1GOGA 3ARUA 1FL5A 3K2UL 4MA8L 4AM0A 5JORA 1T1WB 4OQ1A 1S7XA 4XAKE 3TPKA 3GBNL 4OZFH 4G43A 5FHBL 4F7MB 2BFVL 1KJMB 4DKFH 3ARGA 1OGAA 3RGVC 5C86A 2ZSWB 4C83B 1M6OA 1NUDA 1ZANH 5D1XD 4NQDB 1R24A 2X4UA 4YE4H 1J1PL 4L8CA 4NJ9H 4BH8B 2WUBH 3VXPA 4XP5H 5JLZA 1S9KC 4PG2C 4PJAE 2X4NB 5FO9B 2HRLA 4KGJA 1S9YA 3MGOB 4GH7B 4X0KA 2EIEA 5DYOA 1JNNL 5GGTA 1HQRB 4M7LT 1ITCA 1I3RB 4OD3L 5DTFB 4PRPE 3BE1L 1EO8H 1NANI 1BFSA 3PDDA 5D2LA 4EI5A 1RIHH 5GGQL 3RWHA 4MAYC 2HKHL 4DQOH 1EK3A 2EO9A 3LHPL 4AQ1B 5D7LE 1CF8L 1GXEA 1M7DB 4UQ3B 2XQBH 2EDOA 5MI0C 1NGYA 3I3BA 3TBTB 3HG1D 1UB6A 1N5AB 1X5HA 1XGRA 5E8PB 1XF3B 3MLTA 3QDGA 4O51A 3WSQH 5J56B 5C08D 4F3FB 2CLZA 4GRWH 1R5WA 1OF2B 2CR6A 4F2MB 4W70A 2YK1H 2YZ8A 4OD2B 3MR9A 5IF0B 1DEEA 3BZFA 1FZMA 3GMOB 5E00B 3HB3C 2VDQH 4CDGC 3NMEA 5D1QD 3EYUH 4ZUUB 1Z9MA 4JLRB 1MUJB 2PF6A 2HT2C 3B5HA 4XCEB 4UQ2B 2YRLA 5ETUB 4GT7A 1QQDA 5MENB 4K7PL 4I2XB 4MNQD 3ZSSA 5CJ5A 4L3EB 2BVUA 2R8SL 1BIIB 1N6VA 4EI5D 4KJWD 1F90L 5ERWA 5FDWB 5DRZB 3L3DA 3VFWA 4NJAH 1D5BB 4NC1C 3CCHB 4ONGL 5I75C 3CC5B 2XA8H 3QIWA 5JOFA 3RDTC 3QFJA 5ILTL 1A7QH 3DO7B 2Z31B 4J1UB 5I1KH 1H3GA 1OTTD 4ZS7H 4Y5VB 2EDEA 4Y4HA 5EIVA 1YEKH 3RTQD 4TYUA 4H0HB 3BGFC 5I16A 4U1KA 3IDYC 1MCDA 2WWKO 2UWEB 4L9LA 4EIZC 4LOUC 5CD3B 5D71H 3NFSL 3G5VB 4YWGH 5AZ2H 4YHPA 3HZMB 3DXAA 3DVNA 1T20A 1RZFH 4JPIA 3HG1E 2FECL 3VXTA 1YECL 1Q9LA 5ADOL 1DZBA 1JTOA 3B9KA 2G9HB 1MH5A 1J5OH 2NXYB 3NZ8B 4OBSA 3NFNA 3WKMH 3TNNA 4HS6B 2B20A 2Y07L 1EMTH 2OL3L 1BQHG 3KHQA 5BZWB 1TCRA 2X4OA 4DGYL 1CYGA 3UTSD 1R3HA 1WFUA 2DKUA 5EBWB 4AENA 1INDH 5I1HL 4ZUWB 1RJYA 2M2DA 3GKWH 4UT7L 4FXLA 5EWIL 2I07B 2R2HB 1FLRH 2GSIB 4QGTA 2BRQA 1LD9A 3UYRL 1SJHA 3CH8A 2DJSA 4JAMA 4FQQA 1WQVT 2H3NA 1K8DB 4U1MA 3S35H 3AXLA 3G6DL 3MRNB 1FNSH 1YYML 4LARH 2I5YH 3RZCA 3VCLB 4XPGH 1T7XA 4NRXA 1QYGH 1R5VA 3MSPA 2CXKA 4JDVB 1A1OB 1G0YR 3QUXC 1U3HA 3NFPA 4PJ9D 4RISL 3KYMA 1URLA 1HHIA 4JFDD 4WEMB 4JFEE 4OCRH 4NIKB 2Q76A 3VXNA 2BSSA 1OVZA 1OP3H 2IAMD 4PJBB 2H9GB 2IAMA 4PJGA 2IALA 5HHPB 1A6UH 4M1GH 5IVZB 2HJLB 3HC4L 3T1WA 4GRWF 4Z7VB 1TNMA 1WZLA 3BP4A 4QEGA 1A14H 4IOSD 4NPYA 4M6ML 2NXZC 1MRCL 3NTCH 2IGFH 4LPYA 1F58H 1ZMYA 1KYOK 3OKMB 2R2EB 3BEVA 3BRFA 1M7XA 3EJZD 3ROOB 1TVHB 4P4RA 1P2CB 3EOBB 4PRIA 4U1SB 2AVGA 1NL0H 3T4YA 2XZZA 4RFEA 5C0AD 4HKXA 1HN1A 5C0AA 1YC7A 3BEWA 2EXWC 4YIQA 3UJIH 5GGVL 3CLEH 3PJSB 3ARWA 3VFVB 4ZG1A 2AV7A 3MV9B 5J3HD 2QQKH 5T33H 1E4KA 2NZ9D 1T66D 5C6PB 3HA0A 3MNWA 3HG1B 1FFQA 1YY9D 5I9QC 2FIKB 4JFYB 2VLKE 4HZLB 4KJPC 5ACZB 4K9EL 5F3HA 2EECA 2V2XB 1K2DB 4HF5L 5IOPA 5JOPD 2XZQL 3W39A 1T5XB 3OR7B 2X41A 4W81A 1U36A 5CEXB 5DUMH 3GI8H 5D1XC 3JXAA 1CN4A 3MV11 4FTVD 3VGFA 1H3WM 3QDJB 5CUSH 2C1OA 4MCZB 5B4MC 4GLRI 1J1OH 4OZHB 1RD6A 2X4TB 4WHYH 4H25A 4R0LB 4YXHL 1G9NC 4ZXBD 1ROWA 4YNYB 5DR5H 2UVEA 4FP8H 1TQBC 4P5TC 1MCKA 3O3EA 5CLWA 2BDNL 1EEYB 2VDNH 3AUVA 3KLAB 3Q3GB 2F8XC 2WINA 4MJ5B 5EO0B 3K0WA 3KWWA 4MQXC 4HWNA 4RIRB 3WJJA 1G6RH 4YDIH 3RWDB 4YBLC 2W0FA 4P4KB 2JK5A 1ZLSL 3E3QE 5D1XB 5T5FL 3V4UH 3ARBD 1DBJH 4K3DH 4OGAC 4R4BA 4H5SA 1KJ2H 2GK2A 2PXYA 2ESVD 3GSOA 1H8NA 1P53A 3KPQB 1QOKA 4FHBD 4HUVB 1CE6A 3ARFD 2DDQL 5ALCL 2A77H 1HOCB 4LSSH 4LNVA 1UADC 3KJ4C 4JPKL 3MX0A 4OLWL 2YUXA 2VN7A 4OIBA 3HLAA 5JXEC 4GAJH 2NY1C 1CBVH 4YBLB 4G8FB 5DC9B 1EBPA 4PG2A 2P5WB 1CZ8L 5K9JL 4UV4H 1RZ8A 3VXOB 1BVLA 1RHFA 4WHYG 2R4RL 4NWTL 4WW1B 1MRFH 5DJ0B 5IR1B 1Z3GH 5E0QA 4XHJD 5HYJB 3L1OL 1ZVYA 5J0BA 1AXIB 5SWSE 3CD4A 2FO1A 4QF1B 4NO0A 2ZNXA 4H0GA 4NZTL 2YUWA 3IJSA 1T3FA 3F12A 1TTFA 4F58L 1YUHB 2NY0B 4PJGF 4JKKA 4HH8A 2R23A 1GZQB 3ARQA 4EI5C 1HHJB 4CGTA 1ZHKA 3UZVB 2OP4L 1MHPL 1A0QL 4V2BA 5E9DD 3SQOL 1A6TB 4LLWB 3BDBA 5E03A 1LE5B 4K94H 3KPTA 4LSPL 4P0DA 3DVIA 3ME0A 5D1ZA 1DQJB 5I6XC 3MLTB 4HGKC 4XBGB 1ZGLM 2A9MH 1ZT4A 1U8QB 3KYNA 3NA9L 3NAAL 1ZWIB 4LLDA 3A6OA 1AGFA 3H3PL 2DQFA 5EZJA 5F3BB 4OF0A 1JGEA 3R1GH 3RL2B 1OSPL 4UBDC 3ZL4H 3RTQA 5EO9B 1P7QD 5LAXB 4JB9L 1T03L 2DIJA 4OLEA 1HKLH 4A6YL 4ZNEA 5CEZL 4X8JB 4TUJA 3IB4A 1MIMH 1DQML 4G8EA 2XKUA 3VW3L 4O00A 2VC2L 1RZIB 2KKQA 2WSKA 4OFVA 2VQ1B 3V95A 1VKXA 1TENA 1B0GA 4PJ7F 3VD3A 1BQHA 4PB9H 1FFRA 4YZFF 4UQ2A 3WV0A 5DK2B 2LTQC 3L3JB 4K3EL 3P77A 1VEPA 4KTYA 4FQIL 4QO1A 5I8KL 43CAB 5TE7L 1KULA 2W91A 3RPIA 3IAPA 2J12B 4QXWA 3QIBB 5JW4M 1HHGB 4EI6B 1JYXA 1A1NB 4ZFOL 5GRUH 1A6VL 3JV4A 3RVTC 5CIPB 1TTUA 4O9HH 2H1PH 1DCLA 4YR6A 3S5LG 2Q3ZA 1WGOA 4TSCH 1MVUA 1UWXH 5DQ9A 4XPHH 4M48H 5CBAB 2Q6WB 2ZP0T 3O6KL 5CEZD 5JW4Q 5E9DB 1FNAA 2ADFH 1LWRA 2A74A 2QKIA 3MROB 4PGBB 1J1PH 4XCFL 3P0VH 2C26A 2G60H 4X7TA 2VL5A 1S7VB 3TF7C 4CN1A 4F9LC 2NTSP 1O7SA 1FZJB 3S3PA 3RBGA 3DECA 3H7BB 5E70A 5CSZB 1UB5A 2W0LA 5ANME 5TFSH 3SDXA 3GJEB 1A6AB 1XF3A 2R0WL 5IB2B 2HA1A 3UBXI 4M1CC 3IDXL 4P23B 1A2YB 1CI5A 2NW2B 1I1RA 1AC6A 1ZGLA 3ZT7A 3F6LA 1BFOB 4LGPB 2GJ6B 1R3JB 4LKXB 4C56A 1YY8B 5B21A 3F6IA 2P49B 1EO5A 5LBSL 1NFDF 3MODL 5DWUH 1SJHB 4JLRA 1SEBA 4DVBA 4BSVB 4NQCE 1UJTA 3N06B 5J1AA 1UWEL 4NYLB 2X1PA 3FT3B 4S1DC 1JNLL 2VE6A 2ZKHL 4OCNC 5I73B 1KJVB 3LOWA 2OR7A 3EDFA 4PB0L 3TV3H 1F4YL 4P2OD 2O93L 1BIIA 5BV7B 1A1OA 2DWEA 1A7RL 4R4NC 3U4AA 3OAUL 1IJ9A 4GG6A 3SDYH 1QLRB 5EU4B 2ATPB 4Z7NF 1ZHNB 1MLBA 5ITFB 3ARXA 3QIWB 3KLDA 4KJPD 1HHIB 4U1JB 5E24E 3MRJA 2R8SH 3MOAH 1W72B 1AGEA 3B9AA 5JXAL 1C5BH 3ARDB 4Y4HB 5DJXA 4X6BB 4M6OL 2CLVA 4Z95L 4JKMA 1NAML 2XA8L 3BHBA 1CDGA 5IB4A 4V2CB 2H2SC 1LO5A 2NY4D 2YKLL 5E4EB 3EHBC 4GQ9H 1XR9A 4X6CA 4HS8L 2J3SA 4YDKL 4ZXBC 3WD5L 3GSNA 3G6JF 4CVZA 1LDPH 1IL1B 5BS0D 2V7NA 5E2VH 3J8F7 5B39G 5FO8B 3VGDA 1NL0L 3MA9H 4RAVA 4ZD3H 3GB7B 5HTSA 4JQIL 2DYPA 5KANG 1PSKH 3TNNB 1WBXB 3CLEL 5C0AB 4Y4KD 1FYTB 4LPCA 5D72L 4JVPA 5F89B 3VFNB 1KCUH 3GI9H 5DD5L 1R3HB 3QDGD 3ARFC 2BNRB 4O2CB 5KSAB 2R1XA 3V79C 4Y88A 1MCBA 2HJKB 5C0GA 1XF5A 1M7DA 2ZOKB 2FIKA 3SJVE 3K4ZA 3BPNB 2B0SL 1CTNA 4QNPE 4F37F 1OCWH 4FFVC 4JKPH 1IM9A 3A67L 3ULVE 4PS4L 1VGEL 5ANMB 1JCKA 5E6ZA 3W82A 3EBAA 2VABB 2Q86B 4A2MA 5SWZA 3HN3A 4BQ9A 4TUOA 2F8VA 2X4SB 2NNAA 4PGEB 1CG9A 2RQ8A 1MJ7L 5TPWH 5F1NA 5DD3L 1GGTA 1BQSA 5IF0A 4OUUA 5DZNA 1GZPA 4LCCC 2VDNL 5FYLL 5J6HA 1RJZB 4TVPE 1AXSB 3U7AA 5BJTA 1PKQA 3K4DA 1RZ7L 2I5YL 3S96B 5I18L 4C59B 4Z78A 5BZDB 3QWRD 3PHQB 1YEJH 5MENA 2DIBA 1J0JA 1RHHA 4Z7QE 1E6JH 1BZQK 5C7XH 2EDRA 4MS8D 4NQVA 5ALCH 3QG7H 3QAZB 4MXVE 1KYOJ 1TVBA 3KLHC 2CDFB 3ILPB 3WFDL 5IVZA 4D3CL 1UWXK 3D0VA 2QQNL 3T0EE 3NIGF 3BIBX 1F11B 2AXJA 3V5DB 4MXWL 1W72H 2XT1B 2PO6A 5K9JH 3AMKA 4NBXB 1DBMH 3LB6D 4RWYH 3BWAA 1CGWA 1J0YA 4K3JH 1TVHA 2HN7A 3ULSB 12E8H 3UTSB 3WEXA 5E8EA 5I1EL 4PJ9A 1UC6A 2FEDC 1OLLA 2EH7L 4ONOA 4RZCA 2R39A 4BH7B 4PJEF 2J8UA 4Z8FH 1KNOB 4PJ8A 3I6LD 3LIZL 1A22B 5F9WB 1EEZB 4OM0H 1JN6B 5D2NB 2X4QB 2G9HA 4YJZL 4AG4L 5J8OA 4O4YH 1GGCL 1NPUA 2ZUQC 5C0ND 1HEZB 4HUKB 5F6HI 1BD2B 4YH6A 2QSTA 1CD1B 2QJDA 1PZ5B 5BRZD 4U6VL 1CLZH 4J3UA 5FGBA 3KNBB 2EDWA 5GSRB 3V0AC 1BECA 2P1YA 5LCVL 1NBZB 3CFBB 3QNXB 3BDXA 3WIFA 1UJ3B 3DTXA 5KG9A 4I8DA 3CUPA 2ATKA 5GZNC 1WBYA 1ZHBB 1JUFA 3NPZB 4U2YA 3V6BR 2B1AH 4Y2OA 4BELD 1NLDH 2RFXA 4P59H 2DBLH 2AJXH 2W65B 1U8LB 4V1DA 2BNUA 4OCLC 2JF1A 3FQUA 1CDCA 1IGYA 4R9HA 1RI8A 3P3YA 1WITA 2VTFA 1UM5H 2JK5B 1AC0A 4XVUD 1OD9A 2NXZD 4BFGA 3TCXA 4WU5B 1KXQE 3TVMC 3JWDH 3H3BC 5HHXL 5I19L 4F9LA 1I8IA 3FO9B 2GFBB 4U1IB 4LQFH 4ZAKD 3VRLF 1S5HB 3TFKC 3FB8A 1BZ9B 2DRUA 2BX5A 4KK9D 4R2GC 4K3DL 1HHKA 3UDWA 2YZ1A 1CLOH 1ZVSA 5DHXB 3L7EA 1MAJA 4YEEA 4O58H 3Q6GL 5HI3C 1J10A 5C07B 3JBG7 3HNTL 4Y5YC 4WW2B 2VDML 3NH7L 1WFTA 4RBPK 2QADC 3MRQB 1F8TL 2WIIA 1H3UA 2KBGA 2JKXA 5JDJA 4FQ2H 3CLFL 4E41E 5ACLA 1T3FB 4WENB 4JJHA 1QD0A 4Q0XH 3D0LB 4JPWL 5C92A 4KAQH 4HIIB 5DMKA 1CD9B 1IT9H 1D6VL 1JF1A 3WIIH 3QEQD 3VRIB 3SE9L 4YIQB 1FQ9C 5DMIL 1R3KA 5EB9A 4L29B 5DEZA 4D0BB 1MRDL 3SGKA 1AIFA 2HFFA 3OWEA 4AEIL 1UH3A 1NCBL 1OGTB 3HAEG 3SDAB 4U1GC 3GBLA 3IXAB 1U91A 5AD0B 1OB1B 2CK2A 4WIQA 2D7QA 1WC7B 3P4NA 5F9AC 2FSEB 1LK3H 1WAAA 3R0MA 5IOPB 3AM8C 5FCUL 3P73B 4LPUA 4E42A 2G5BB 4OD3H 2W59A 3VFTA 5D8JH 3TCLB 1N6QL 3OHXB 4M7LH 2OTPA 3O9WB 4GBXA 2X2YA 4TSBL 2C1OB 3QXWA 2QHLA 1BFOA 4HIXL 5EZIH 2GJ6A 3DX8B 1GIGL 3GZKA 3MV8E 4R26L 5HYSB 2AXHA 4U1HA 2D31A 3H6JA 5HGGS 1I8LC 1JPTL 2BY2A 3I02B 4MX7A 3QIUD 3O2DH 4NYLA 1T4KA 4UDTA 4UV7H 4Z0XA 4PB0H 3ZHKA 4FXGB 1KLFA 1JHTB 2Y7QA 4J7RA 3AB0C 5E94A 5D5MA 5AUMB 3EO1B 3QUYA 5D6DC 1EZVY 3MRFB 2IFFL 1MIEL 4MDIA 3KJ6H 3U48A 1GHFL 4PB9L 3JWOL 2FATL 1T0PB 1NGZA 3RU8L 1A1NA 1XT5A 2H32A 2O5YL 2UZIL 4OCWH 4U1NA 4LNRA 2P8LA 3TYFA 2VLME 3ORJA 3C8KB 2V5MA 1VESA 1G9MC 4EZMA 1NCDL 1NAMH 4OZIB 3U36A 4XP1H 3OMZA 4POUB 1XGPA 2XPGB 3TN0D 1Q8MA 1NBVL 4KROD 1FFNA 4NQXA 4P9HH 5IK3A 5F7HA 5T1LD 4P2QE 4LCWB 4WI7A 3K1KC 3S4SG 4EN3B 3EW3B 2FNBA 2P8PA 1YQ2A 3MBEA 1S9WA 1AY1L 2JCCF 3EDKA 4KI5F 4M62H 1FRGL 2DN7A 3N1PC 5KTEL 4KQ3L 4KQ4H 2Q7YB 1X5GA 4N8CH 3Q0HA 5KSBE 3UCRA 4LLYA 3HPLA 1IGFL 1T22A 3MV7A 3G6AB 1HI6A 2I25N 3CU1A 4EIGB 1CFQB 1E4JA 5GGUB 1HDMB 4AM0B 4JFOB 2PO6C 5L2KB 1JHKH 2AJSH 4LHJB 3HS0A 5CGMA 3G6JB 3X12A 1KBGH 5C0RL 5A2IH 5BV7H 1MF2L 2CDEA 2R1XB 1Q94B 1U58A 2A6DA 2B0SH 5C0DA 1U8JA 1T21A 1OGAB 3LKQA 3OPZL 1G9ML 2GTZA 5K59E 4EOWH 3KHOA 4RQQB 5GGSB 5C3TA 4PRDB 2CMRH 1FG2A 4ZTOL 4J1UA 4YHLL 2VDKL 2VITA 3RVTD 5I2IA 2ARJQ 4HGMA 4FFZH 3JWOC 4G9FB 3UTQB 3O2VH 1DE4B 3FHQA 4N68A 3QQ9C 4DQOL 4Z6AT 1INDL 2ICWB 1TZGL 1A4KA 3CSGA 4QHMB 3C08L 3STLB 2I24N 4UOJA 3SKMB 3ILQC 3W9DB 3CSBA 2IH3A 4NN7C 4O02L 1FFOA 2ADJA 3QI9D 4N0UB 3WIHA 3BO8B 3UTTA 3HNSH 2FZ3B 4GXVH 1BFVH 3B9KB 3QUKA 5EZLB 2C1PB 2QQNH 3NGBC 2E8ZA 4JRYE 1ZANL 4MB5A 4NP4L 1AGBA 4RAHA 5L2JB 3TO4D 4Y16A 2HLFD 5CP3A 3VWKD 2DLTA 3BISA 1LEIB 1IEHA 4MNGB 5TF1L 1T89A 3RBSA 1F6LL 2FJHB 4XPTH 3HI1A 4KVNH 2DMBA 4JJ5B 5E1HB 4Z7UE 2MKLC 4OBRA 5EBWA 1Q9KB 4J3XA 4LCYB 3QT2A 1T7YA 2AQ3A 1XAUA 4NQEB 1NMCC 3LQMA 4Z76A 3BUTA 2EIBA 4I2XE 1KTLB 3WBDA 3QXTA 1R5IA 4XX1G 1EGJL 2J8HA 3IU4L 4IRSD 4NKOB 2FD6L 4M7JH 4Y5XB 3ZT6A 5IVOA 1YYLH 4FG6C 4MWFB 4IS6B 1RIUH 1NDGA 2BZDA 5JZ7C 1DDHB 1RZGA 3NZHH 3P2TA 3EO0A 4OFIA 4YHMH 1Z5LB 5D1QA 2FH8A 1JN6A 4C55A 3PWUA 3ZDZF 4NT6A 1DL7H 1NAMA 3U46B 1A5FH 3DRTB 4DN3H 4XMKH 4ISVA 3FOMB 2MPAH 1NC4D 4Y0GA 1U3HB 4LIQH 1V7MH 1MCRA 3LPWA 4HXAH 3KPOB 1ZT1A 4WW2F 2GAZA 4U31A 4Y5VA 2EDHA 2BRRH 4PJBA 3H42H 1H15A 3U0PB 3T2NH 1I9IL 3SCMB 3V4VL 3QIWD 4JZOB 1T5WB 2P8MA 5DRZA 4LKXA 4C56B 1RURL 4LAQH 1MWAA 4ZDHB 4EBQL 3TIEB 4YHNB 4KDTC 1CGSL 1JPGB 3WN5B 4TQEL 5DD3H 1SVZA 5IEKA 3HFML 3OKMA 2HLAB 3N0PB 1EAPA 4NJAL 2PTUA 3SDCD 3MGOA 2VLJB 1JWMA 2P5EB 3KPSB 5DUML 2A6KB 4J8RA 3UXFA 3V6ZB 4YQXL 1LGVA 3SCMC 3E6FB 4F8TA 3V4PH 1OGAE 4Q9QH 4G8IB 3BEWB 1MY7A 2B4CC 3ZTJH 4BUHA 1A47A 4YHPB 1SM3L 3DPBA 2BFVH 4BZYA 1B0RA 3VFGL 5ICZA 3KYAA 5FA4B 2FDBP 5KVGL 2X1OA 1EBAA 2HN7B 5GGTH 1OAKL 3UTSA 3WEXB 1IMHC 1LD9B 1OQXA 1W72L 2C3GA 1N5AA 1NMAH 1KCRH 5BOZG 4WFFD 4CMMA 2B1HH 7FABH 1PX4A 2HT2D 4PRPA 1N59B 1TNNA 1NCAH 2YD7A 1AQDA 3FCTA 1KSRA 4Y4HD 5FUOH 4Q0XL 3VXRB 5FOBA 1U3HC 4R7DA 2AJYL 3KS0J 1F6FB 3CPLA 4YDJA 3REVB 3LIZH 2X05A 1TCMA 1J12A 2YOCA 1WTGT 3IDJB 5I1DA 2PKDA 4MA7L 5ISZE 5DJYA 2A73A 3QDGE 3DTXB 3FZUD 1AIFB 1EDQA 3ECBB 3PXJA 1YNKL 3WDIA 2P45B 3SJVD 3NABH 3RWFB 3H9HA 4Z7OE 5HBBA 1FL6A 1U8NB 3D69A 5D8JL 2BNUB 3HZKB 4E42B 1CT8B 1PG7H 5J9PA 1OGAD 4XMLH 4NRZA 1U93B 5E9DE 5HHMB 5GJTH 3C5SB 3WXVH 1KT2B 4CDHA 1XIWD 3T0XA 8FABA 5BJTB 5JPMA 5A16A 1C8PA 3MRBA 2JJVA 3C6SA 3T0WA 3GO1L 4IRJC 4ZFGL 1HCVA 4DZ8B 3MUGB 1Q9WB 2AI0L 3VFVA 1IAIL 3I3DA 2Q8AL 2BXYA 3MCKA 1AQKH 3ULVH 4UTAL 2R4SL 4NO0B 3IKCB 4XGZB 1T2QL 1NGZB 2OR9H 4X6FA 2OMBA 3GI8L 3NZ8A 1S7SA 1YEGH 2QR0A 2IGFL 5C09D 2UUDK 3DIFB 1Z9LA 3L5IA 5T3XD 5C0NC 5CEZH 1IC5L 1UVQA 1A6WH 5HI4C 5DD0L 3BX7C 3EJYC 3OR7A 3LKPA 3VWKA 5J57B 1CR9H 2PO6B 3QEQA 5KVMC 4TNVF 2IPTL 2DTML 1CFTA 2Y6SD 4PJ8D 5DRXA 3EYOA 4J4PD 3HG1A 3FKUS 3ULSA 3GSVB 3PDOA 4BKLA 3H9SD 3U4EA 4HGWA 4HCRL 2XG5A 5JHDA 4XRCB 1ZWIA 4LLDB 3TLRA 1AGFB 3MJGX 4KK6D 2NY2C 4H0IA 1JGEB 5D4QA 4OJFH 1FC1A 1G7PA 4PRNA 1ZE3C 1T83A 4H1LH 1SY6H 2CGRH 1FJ1B 3LSOA 4O9HL 4GAGL 4KK8C 4KVCL 1X6LA 4PJXF 5IHUH 3UAJC 3L5WA 1CWVA 4JDVA 3IXAA 4X6DA 3VDBA 5DFWH 3BIAX 3BVNA 5C9JA 4XP6H 4M7KL 4XNZC 3WUWG 1PX3A 2F58L 3LPFA 4G8GE 2P5WD 3MJ7B 2NY5H 4ONHA 2R69L 4F9PA 2VDLL 5JQ6L 3OPZH 5HD8D 4CW1B 4GBXB 1P7QB 1MJUH 3L95B 1CTOA 5DF0A 2IALB 3LKQB 2Z93A 4KZDL 4D0DB 1K8IB 3E8UH 4PBXA 2X9XA 4Y19D 1JNJA 2DKMA 3ULUC 3QCTH 3QEUB 4NZTH 5HI3D 4APQA 5I0DA 1RK0B 5HYJA 4FXKA 3D9AH 4QCIA 5TFSL 3B2UC 1MAKA 3O2DA 4HG4J 3O6ML 1GIGH 4R26H 5D5MB 5AUMA 2JCCA 1FL3A 1DE4A 3SDDD 4U1LA 2JB5L 2FR4B 5GZOC 4YPJA 1J0KA 4NM4L 1I1YA 1YEIH 1RUKH 3WL9B 1RPQA 1U8KA 5CJBA 3OAYK 1QZ1A 3FB8B 2ZG1A 2AJUH 1MIEH 1QRNA 4G42A 4RMUA 3WFEL 4GXUN 2PW1A 4W4OA 1U42A 3MV9A 4TN9A 5EU3B 2IQAA 2BERA 4KTDL 3WJLA 5HGDA 1AGCA 4PJHF 3QULA 4FFWD 4PJ7E 2VNCA 4JEGB 1C1EH 4XBGA 1AXTL 2LE9A 4WW2A 4CADA 3VW3H 2AXGA 5JW4R 5EU6A 4LLQB 4UILL 1MHHA 3RL2A 3ARZA 5FV2A 1CQYA 5CSGA 1G7JA 3NIDE 3TJHC 2P47B 1FE8L 4G8GD 4TUJB 2X4TA 4UI2A 2HVKA 1M1SA 4JPVL 4JQXA 5ENWA 3PV6A 3VGEA 1SEBB 3A6BL 5GSVA 2YD8A 2BVPB 3HS0B 1IGML 1AO7E 2ZCKH 3G6JA 3PWUB 3X12B 3QWRA 4NGHH 1Q94A 2OL3H 3QIUB 4FZEH 2EYRB 5DHVA 3TBYA 5KBNC 4G6KL 2EH8H 1JFQL 2CKBL 3KPMA 4QRSB 3VXSD 5BS0E 1DJSA 3VD7A 4P23C 4PGDA 2V9TA 1MF2H 5ITFA 3UEZA 3PL6C 4DTGL 5IT2H 1DQMH 4ZQKA 2V17H 3O3BB 2NY7H 3TYGH 1T7ZA 1KCUL 2DM4A 3RPIB 3MV7D 3WE6B 2BDNH 4NO2A 4P2RB 1EA9C 1GOFA 1CVSC 4HKBB 1C08B 4HUMB 4H26A 1NUNB 3UBXB 5FYLD 1OAZL 1XR9B 1YYMH 4LARL 4X6CB 5EUOE 2DIAA 4G6AD 4BFIA 3PL6B 3PP4H 4XXDA 1J0ZA 1YQVL 1FORH 2CO6B 3BXNB 3OJ2C 5HHVL 3MOBL 3B9VA 1EFXD 3IVKB 3SBWC 2C1PA 4HHAA 1JWMB 2P5EA 2D2OA 2A6KA 4J8RB 4RAUB 1DR9A 2A74B 2DI8A 2QKIB 3F12B 4QRRE 1XGYH 1A1MA 3ZTNL 5JOPE 4QOKE 4HMEA 3MXVH 4I3RH 1XGUA 1NSNH 4FTVE 1MQKL 1U9KA 3DLQR 4Y4FD 3SGEH 2C4XA 1IKNC 4M9PA 4OZIA 1BBDL 1BREA 1JJUA 2R0KL 3GIZH 5C0BE 5IUSA 3SO3B 4TUKL 2OX5A 4Z9KB 5IVNA 4HK0B 3L1OH 4HJJL 3UYOD 4XVSL 4QRUA 3MRHA 2VH5H 3FQXB 4PJIA 4JDZA 2NY6B 1MCHA 4CUCA 5JMRA 4I0CC 4HAFA 2DF3A 4PRPB 4W4OC 5FM5O 1FV1B 4PLKC 1ZGLB 2YEZA 2DKSA 3FAXA 2VE6B 3T0ED 3R4DA 2UZYB 3BT2H 3SO3C 3Q1SL 4MD4A 4NT6B 4GJTB 1BLNB 4XP5L 2VZOA 2XV6B 3VGGA 1QSEA 3KR3H 3MV7B 1OOAA 4BSVA 1FZKA 5KSAC 3AU1B 5J89A 3SDAD 3X3FL 2N7AA 5BZDA 3EOAB 3LH2L 4U05A 2X4UB 4ZAKA 5T33L 3SKJH 5E8DL 4OV5B 4KZEL 3ILQD 3BE1H 5IV2B 3O6FA 2VXSL 2BY3A 4XPFH 3P4OA 4HS8H 4MSWA 3VXMB 1H15B 3U0PA 2HT4D 1FGVH 2CLVB 4HF5H 4LVOB 2Z9TA 3VXSB 5J12B 4HXAL 3OX8B 4PY8I 1YNLH 3S3SA 4WHTB 3G5YB 3FB6A 2FL5B 2EDDA 2VR9A 3ZL4L 5HVWA 3PF2A 1K9TA 4WTXA 1KACB 2XKNB 1OLZA 2FJGB 1IL1A 2OCFD 1I9RL 3V4VH 4HLZG 3RGVD 1MVUB 2OZ4L 3PWPA 4F57L 4MNQA 5JTWA 1P84K 5E95B 2ICWA 1JPSH 5MERB 1FNFA 4KK8D 2W60A 1YZZA 3W9EA 3QDGB 1IGJB 1E4XL 3OBAA 4O51B 2YC1B 3LQZB 2IQ9H 3U79A 2DYPD 32C2B 2DD8L 5GXBB 2AJXL 3PABA 1KJ2L 3MCKB 4RAVB 3GB7A 1FN4A 3QUKB 2L7JA 5EZLA 3TT1L 1BEYL 4OD1L 4MLIA 5HD8C 5F7NC 3FN0H 5A3IC 2RAMA 1XIWB 2X70B 3HCVB 4G3YL 4XPHL 1PG7W 4AIXA 4LQFL 5KSAA 5DD6B 2R1WA 1JUFB 4NQUA 2B5IC 4HCRH 2DQTH 4NHCL 4RBPH 4M3JA 1GZPB 3VXRA 3PHSA 3V0WL 1VFBA 4K3HA 5CJOL 1R5IB 1CLOL 1I1AC 1CD8A 5I75B 4QXTB 1BQLH 4DOHB 3WN5C 2HFEA 5ANMA 3MUJA 2BHYA 2F74A 3K4AA 4JDTL 4D3CH 3LKNA 3LN9A 1BX2A 3DVFA 3VFRA 3O45B 1LO4L 3GSRA 3LEYH 3QNZA 5IJKC 4ZNCD 1E28A 4H88L 4S1SH 4WUUD 4XPAL 2UY6A 1VDGA 3C6LA 1X7QB 3FO1B 4LVNC 1IAKB 1X5XA 1RVFH 5MEND 3CFCH 4WCYL 2H6PB 4X7EC 3QFJD 5H94A 1U3ZA 4KMTH 2K7QA 3CFIC 5D2LE 4I48B 4PJIF 3TBSA 1AH1A 4U1JA 1QR4A 3OTTA 4JM2A 3WIHH 5ITBL 4I5BB 35C8H 3DRQA 1J11A 1EXUA 3CFEB 4XXCC 1MHCA 2VDOL 1W0YT 5E8EB 2NLJB 5EORL 1CF8H 1P7KA 1FNEA 5FUCE 5IB5B 1MWAB 1ZXQA 3N1MC 4ZDHA 4LSQL 5C09A 3VWJB 1MPAL 1RK0A 4L8DB 1F4YH 2Y9RT 3GNML 1MCWW 3DSNA 5IEKB 1NKRA 1TZHA 4EDWH 1QKZH 1NLBH 3JV0A 1L4IA 3ZKSD 3QIBC 1HNGA 3VG0H 4MMXC 1F3DJ 4XPGL 3V6ZA 2FECI 4GAYB 4LLMB 1P7HL 1Q72L 2YPLD 2DQEH 4TTDD 2HP4A 1Y0LA 3T77B 3CDCA 4UTAH 5GSRA 4NC1E 2ORBL 4AH2B 1R3KB 2OR9L 5EU7C 1Y6KR 2ARJB 4MA1C 4UIMA 1KFAL 3QJHB 4EQ2A 4JO2H 4OCRL 3ARTA 5GS1B 3QR2A 4UNUA 1BP3B 3KYOA 4HKJB 4PFEA 1RZKL 1K4CB 3ARYA 5LWYH 1YMMA 4XCCH 5DUBB 5CJ8A 1U8LA 1AFVH 5GRXG 5LJYH 1W8NA 3BP7B 4OF8A 3O8XD 2O5YH 3AGVA 1WSST 4G6AC 1U3JA 1UACL 1WUNT 1ZHBA 3K1DA 2P42B 3LKSB 1N3NB 4OKVB 1CFSA 5FOBB 4W6WB 1XCTB 5DJ2B 2GQHA 4KRLB 5IM7A 1I8IB 3TT3L 5BVJB 3SJVA 1HH9B 3QPQD 3SGDI 2H32H 1UCBH 4GKNA 3SE8L 4KVCH 5E1AA 1UH2A 3DYMA 4KJYA 3SKNB 43C9B 3VXQA 4TPRL 4LP5A 4NNPH 1V3LA 1EJOH 4P3DB 5CLTA 2V17L 1FNHA 4NOBA 5HHNA 1KIQA 1R0AL 3REWA 1ETZA 3NCCB 1WBZA 1PKQE 5GS2H 5H37H 1TVDA 4NO5A 4WI5A 2AXFB 5DWUL 5DRNB 1YC8A 4IDLA 4LFHG 1G6RA 2XPGA 4S1QL 3NCYP 3OKOB 1U93A 3U9UB 1XMWA 4PYHA 3S34H 2W38A 3STBA 2NZIA 4HIIA 4NQCB 15C8L 3BKMH 5CJQH 3D39B 4L4TA 4NM8H 1QRNB 2BC4A 3T0EA 2FX8H 5ICYA 3U83A 4MHHI 3HMXA 5SWSB 2NX5E 3S36L 1SBBA 4GS7C 4HUXB 3CDYA 2C4FT 4XNYH 1KOAA 3IKCA 2O61B 5FGBC 3JVGA 3MXVL 5I8OH 2XA3A 4Z5RB 4WO4D 5AD0A 3KG5A 5GGRA 1QYGL 4IOFC 3L3GA 3MOAL 4RWYL 2XY1A 4JFOA 1IGCL 4RIRA 2EYSB 4X6DF 4P5MA 4OCYH 2FLBT 5K33A 3WXWH 4P2CG 5KN5A 4UB0H 3K80A 2AK4E 3BD4A 4LSSL 1KELH 4XHQA 4GQ9L 2BMKA 3ZKMC 4K7PH 4PRHB 3DX8A 1QBML 4OLXH 3PV6B 5F9JA 4UV4L 2GJ6D 3LEXA 2KL6A 4YFEA 3TN0B 3ARFB 4FQLH 4ONFH 3TFKD 3TA3C 4WUUB 1SEQL 2XN9A 3OKEA 4FQXB 2XN9D 1KTDB 3L9RA 1MRCH 5EH1A 3W81A 2DM2A 2VWEC 2OXHA 3DROA 4NNYB 3HHRB 1KCSL 2FIRT 2H32B 4IEFB 5GZOD 1OAUH 1LEKB 5F6IC 3MNVB 2IBGA 3TC9A 4ETQA 2BY0A 3L3OB 3MBEC 1GPOL 3ARBC 4HV8A 1SY6A 3CK0H 5B3NA 5IV2A 1HILA 3L3HB 4GKZA 3X3GL 4DCQB 3NFSH 1H8OA 3MRFA 4CW1A 1VADB 2SEBA 4HIHA 2MOVA 4WWKC 5K9OB 1CVRA 1C7SA 3TJEL 5KAQF 3QUZB 2ZCLH 1JK8A 3BKJL 1DEDA 4KUZL 5J4MA 1CGTA 5JXED 3MLSL 1DL7L 3MNZA 5IMOB 3LQAH 5DGRA 3FQTA 4NNXA 5F1IB 5CILL 1BBJB 2LQRA 2VB5A 2C7UA 1G7HA 4APQC 2PCPB 4PJBF 2Z8VC 3E2HC 3IS1X 3MV9D 4H1LG 4JB9H 3VDAA 5CGYC 2B2XL 4XP1L 3KYNB 3B2VH 3KXFD 2V5RA 4YX2L 5T5NG 5T1LB 1OTTC 1OARL 5B38B 4NUJA 4YXLH 3S7GA 1HINL 3DUUA 1RURH 4LAQL 3UTPD 5K93A 4NFDA 5IESH 4JM2F 5DMJB 2WMPA 5JR1H 3RIFK 1J8HD 3LD8C 5DGQA 1U58B 5EIQA 5TDOB 3DBXA 1BZ7A 3FN0L 4MD0A 4P9HL 1X5JA 2CUHA 4LLYB 4YHZL 3HE6D 1VKXB 3QULB 1XIWA 1T0NB 3QDMB 3DYOA 3VJ6A 4YFLI 2IBZX 4EKXA 4GKSB 2VIRA 1RK1A 1MFCL 3MLYL 4LCIH 2QBWA 3TCLA 1K4DA 4UIKL 4LLVA 3MR9B 5EO1A 3BZFB 1U8JB 3PL6D 2ICES 4D9QE 4JFFE 2P24B 3IJHB 3AREA 3ARBB 4F7CB 2Y23A 1A6ZA 5IFJA 3QXAB 5DT1L 5L9DH 1QR1A 2V2WA 5KAQG 5D6DA 4S1SL 4HD9A 2FB4H 5A43C 1BX2B 3U2SB 4Z0XB 3CXHK 3LV3B 4YPGA 1NMAL 2VUOA 1T1ZA 2OL3B 1UWGL 2YBRA 2N56A 1HNFA 5F88A 4PBVC 4HFWB 3O8XA 1U8MA 3MLVH 2NXYC 4OZFA 5HVHB 2CMRL 3E6FA 2NY0D 5C1MB 1CDIA 5IWLA 1I4FA 1DANT 4M7LL 3GHBH 4WFGD 5JOFB 1EGJH 1P4IL 2EEAA 3IU4H 3V8OA 3WO3B 5JDSB 3HZVB 1IQDB 3TVMB 3GIVB 2X9YA 4X6CF 3X14B 4ELME 4L9DA 5L2JA 3QYCA 2ZSVB 4NN6B 2GY7B 1UM5L 1ZKAA 5TGBB 3VA2C 3DUSA 4MWFA 3T3ME 4YDVB 5DC0A 3HI1B 5EOTB 3T0AA 6CGTA 1PD6A 1JGLL 4GAFB 2OZ4H 4LHUG 32C2A 1GHFH 3H0TA 4A2LA 2FYYA 5TDPB 5E99L 4Q2ZB 3U4BH 1TZHB 3UP1A 1AR2A 3THML 1Q9OA 4Z76B 3HNVL 5C2BH 5IQ7L 3GSQA 1CXHA 3CFDA 25C8L 3NGBB 3O4OC 3RY5A 3U46A 3GMRA 2PTTB 4AK1A 1JGDB 5CBEB 5IG7B 1B4JH 5GGUA 3WS6A 4AH2A 3BSZH 2MHAB 3CIQA 3CGTA 5KS9B 4WU7B 5FKPB 3K7UA 3SHSA 2WP3O 1YYLL 4ZFGH 2AJZA 2AI0H 2BSRA 3C09B 5C0BD 3SCMA 3NH7H 4Z7WE 2R2HA 2LU7A 4G3YH 4QHNB 4Y5YA 4XC1L 2GT9A 2O5ZH 5DUPL 3V4UL 2WK2A 1UXSB 3DNKA 1T2QH 3EGSB 5KSBA 3BP7A 1ZT7A 4KI5D 1UZ8A 4J3VA 4RGNC 2NW3A 3A0OA 3HKFA 1QSED 2DLFL 3S6CA 3WDHA 5C3LD 3MRRA 3V4PL 3GSRB 4J3WA 5HYSG 2B5IB 5GPRA 2OQJA 2ZJSH 2Z8WC 5EFIB 2EIZB 1FVEB 5TQ0L 3UTQA 4LIQL 4JM2D 1MCFA 4KAQL 3WIIL 3FTGA 3C5SA 4JVWA 4DUXA 2X42A 5DRWA 1UG9A 5ESQA 3STLA 2N1KA 4S1DD 1JI2A 3UROR 1KIPB 1WISA 2BVEA 2A6IB 3CU7A 3V6FB 5E5MA 2AJ3B 4I48A 3DVGB 5CEYA 1YPZF 2IMMA 1T89C 3DHJA 7CGTA 3CXDL 3BO8A 3UTTB 1SBSL 2FZ3A 1KB5L 4R4ND 2BSSB 1GCFA 3IDMB 1A4JA 3ZKNC 3OR6B 1PQZB 4NWUH 1LE9A 3RDTA 4YHLH 1PFCA 3EZ8A 5C0CB 4ZFFA 4MJ6B 3C60D 1X5AA 3AC0A 2HWZH 3IJYB 1NFDE 5E2JA 3TBWB 5IW3A 5F71A 3PQYA 3QEQB 4XP6L 1J1XH 3EYQC 4DJMA 2VDOH 1MJJB 4QXGH 2Y5TA 4XTRD 1OTSD 3BIKB 3B43A 3MUZ1 1MJ7H 4UV7L 1EZVX 4JRYA 1A8JH 4WUKL 3D39D 4LLMA 3GNMH 2ICWI 4NQCA 1CICA 1LP9B 2AK1H 4F80A 1S78D 3JWOH 2Y72A 4TUOB 3GUTB 5EBGA 2R2BB 4J3OC 5DSCB 4Z7UA 3ECBA 3E1F1 5IMMA 5GS1A 4X6DB 4V1DD 1OPGL 1AXSA 4P2RE 4B41A 4LLUA 4K23L 3DRTA 4DFHA 1MI5B 3QIWC 3VG9B 3OJMB 1K2DA 4U6YB 5DJZA 4ELKA 4LRIC 1F2XK 3MRIB 3BQUC 5I0ZA 5FYJU 4OGYL 3MUY1 1P7QA 1DQLH 1WWWX 4JQVC 2CUIA 2R2CA 5SWQA 5LGHH 4MQSB 3WJLC 3RWFA 5JXAH 2Q8AH 4K8RC 3VGAC 5ISZB 5I8EA 3QWOB 4ODWA 3WN5A 3BP5A 2BSTA 4UOW0 3HE6A 1F97A 5TJWK 3VFRB 1QEWA 3C8DA 4YC2C 1J05B 5GRVL 3WD5H 2BNRD 2DBJA 1YA5A 5JPNA 1G7IA 3U0TB 4BSWA 5ID1B 3O6LH 4QHKI 1N7ML 1IAIM 2DTMH 3QFJE 4LGSB 3RI5K 4O4YL 4LCCA 4UBDD 2J8UB 3AROA 3MUGA 4JANB 2F54A 1GGBH 3TBSB 2IANB 4GG8A 1S7QA 2APTA 5D72H 5FM8A 3D39E 4XC3L 4OLVL 1MY5A 3F7VA 1G9MH 2QSQA 1MCQA 1ZS8A 3DSFH 1Q0YH 3P9MA 5M7QA 1CDJA 1DLHA 1I9JL 3TZVC 1R0AH 1F5WA 2YUVA 3RIAF 2CGRL 5I8CA 3DX6A 1FHGA 3MRCA 3BRDA 1MNUL 1IAIH 3MLRL 3Q48A 4WO4A 5C09B 4FFZL 1GC1C 2JTDA 5J1SC 3RAJL 2BC4B 3S4SA 2X89A 3LSOB 3EYOB 2FEDD 3FFCE 2CPCA 3RKPA 5C08B 1SM3H 3D48R 5CJQL 2VAAA 5BS0B 5IESL 5HHOD 3ABZA 3G08A 5FYLH 5HHOA 3UTSE 3VWJD 4OQTA 4W4NA 3J7HA 4RGOL 1IGYB 5DVKA 4N0CD 5GGTL 1FSKC 1A6TA 3ULUL 1JGUH 3BQUA 5C0FB 1PLGH 4X80L 4M5YH 2YSSA 3IDYB 3RY6A 5HYQB 3CZFB 1NC2A 1QSVA 3BGFB 1D5XB 1OT1A 3FFDB 2GY5A 3PNWA 4Z18A 4KTEL 4J12A 1VERA 4PJEB 1CQKA 1K4DB 4RX4D 1BWMA 3BPNC 3FO0H 3OXSB 1I8LA 4M7KH 1P4LA 3QXVA 2FR4A 5DQDL 1C08A 4X4XA 2DQDL 1C5CH 5DVNA 2PTVA 2BP3A 2PN5A 4ONFL 1RV6X 4BFIB 1UZ6F 2GK0B 3C5ZC 4PR5A 2PYEE 2WWMC 3VXUD 4ENEC 4PJGE 3BKCL 3EJYD 2XKSA 1OHQA 5IHZA 1KXVC 5CZVH 5E8NA 4I77H 4LSUH 1NC4B 3UO1L 5DTFA 4K9EC 3BOVA 3QCVH 3QQ3B 5HDBE 3W11C 4LASL 1BVKA 4U0RB 5IMLB 1O7VA 1EAJA 3GSNH 4WV1C 5CMAB 3KR3L 2DAVA 3U7WL 1F4XL 3OF6A 1BBJA 2NY2D 1MFBH 3OF6D 4AL8L 3HRZA 3X14A 1D3CA 5DD5H 2A9NH 4I18B 5C0AE 5EOQH 4FZ8L 3LDBC 4UINH 3OJDB 4YFDB 4PREA 4X9HA 5EU6B 2B7DT 2CKBH 1B4RA 4WVRA 5I1CL 3QDME 4HIJA 1FO0B 3D3VB 4LHQB 1MCEA 4YQXH 1UEMA 3FQWB 1O0VA 4PLJC 3PGFH 1OT2A 1G7JB 1MWAL 4LVNB 1RU9H 5CAYB 1U8OA 5HGHA 3OKLB 4FQCL 5IB3A 4Y2DD 2NY3C 2PTTA 2F15A 4JZJB 4HULB 2W9DL 4UMGA 3JWDL 3F58L 1S7RB 4O5LL 4RGMB 1F4AA 5F1SA 2GUOA 2OJZL 3R8QA 2E9JA 5F44A 4JRWA 4UTBL 2VQUA 2I9LA 3H9YA 2EDLA 2IQ9L 3MRLA 4O2EA 2AK4D 3N50A 3SGEI 4F37K 1NCDH 2R15A 4Y5YB 1FIGH 2QEJA 2CD0A 3C2SA 1D5IH 4H26B 5C7XL 4N8VB 4IJ3C 3TT1H 1F6AB 5F9JB 3HUJE 4LEXL 4JN1L 4LSRL 1D5MB 2R29L 5IFJB 4R96B 3C6LD 4OTXL 4FXKB 1V3MA 3O3BA 2VDPH 4LLAA 1EERB 3ROLA 3ARGB 2HYMA 3QIUC 5D7IB 4HS3B 4PJ5A 1FRGH 5MERA 2BOBB 3AREC 1U2CA 1IBGH 3CFJA 1TMCB 3HB3D 3QQ4B 3QDJE 4JM4H 1I3RA 2VR4A 4PRID 3S8WA 4EUPH 1QBLH 3L3OA 3BXNA 5CD5C 3MRJB 1S9WB 3DMMB 4JKWA 5GGRY 2K1MA 4HK3N 1FVDB 4DFIA 5HYJE 4X0KB 5EBLA 1KG0B 2IMNA 1Q0XL 4HIHB 2NY2B 2R56H 5CJXC 5C0CD 1NGYB 2HWZL 4S1RH 4OF6A 1G7QB 4ZFFB 5D7JB 1TTGA 3EYFA 1XGUB 5L2KA 1WAAE 3HE6C 1ZV5A 3K3QA 2JIXD 3MNZB 4ZXBB 4PGJA 2ZUVA 4NM4H 4JFPA 5EIIB 1RUKL 1JPFB 3ULVD 3TN0C 3TP4A 3GHEH 1G7LA 3EFDL 5L8KB 1EFXB 5E8DH 4KZEH 3FT4B 3CX2A 4N9GB 2A2QT 4W6YB 1UENA 4OLUH 3MV9E 5HVGB 5A1AA 2XI9A 2XZCL 3BMVA 1SJVA 1SYVA 4PJDE 5BRZA 1G9EA 3ZYIA 3T65A 3QISA 1R5WB 1XEDA 5IQ7H 1QNZH 3RZCB 1NGXB 3ZDYE 2DMCA 3QNZB 2BNRA 5F21B 4OLYH 4LP4A 4P57A 1KCLA 4P2OA 2FEEL 4NN5C 3MFFB 1QO3B 3FAWA 4EDWL 5F9DC 3EDDA 4UILH 3BSZL 1BGXH 4NP4H 1S9XA 4PD4K 3W2DL 3VFMB 4JR9H 2IH3B 1BHGA 4PJCE 2PXYD 2NY6C 3JTTA 4UNTA 4U0QB 3GMQB 5JO5A 2DQEL 1M7IA 4XPTL 3QDJD 5E6IB 5IQ9A 3MO1A 4BFEA 4QXUL 3SN6N 5DJCB 5J6HB 5L2KD 4ESKA 4MCYA 2ID5A 3SKJL 1UQSA 3V9FA 2PR4L 4DEPB 4Q9CA 5ILTH 2EDXA 5I8EB 2ZCKL 3HZYB 1UGNA 3IKKA 2LAAA 1JNHA 3ES6A 4J6RL 4RMVA 5DURD 5C0CE 4YHIA 1RZKH 2BVOA 3ULUF 4MDJA 2YR3A 5DYOB 5EUOB 5GRJL 4UU9B 4IHOB 2V7HB 3NCYS 5L8LB 2VDLH 1IC4L 2NY7L 3I6GA 1SBSH 5J1TC 2NQCA 3HZMA 5I30H 1T20B 3INUH 3TVMD 1EHAA 5GS2D 1OAQH 3QHFL 5IFHH 3GMMA 4JZJC 1JE6A 1MH5B 3MNWB 4ODXA