2MNUA

Backbone and side chain 1h, 13c, and 15n chemical shift assignments for edb and specific binding aptide
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
93
structure length
93
Chain Sequence
GSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Unusual Protein-Protein Interaction through Coupled Unfolding and Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords EDB
total genus 3
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mnuA00
4A2LA 3LRSB 4N0YH 4GG6E 1Q9WA 4ZPTA 4LVHB 2ATKB 4CADA 3OF6D 4PREA 2JELH 4N0UA 3T3PE 3T1FA 4HKXA 2FX7H 1FRGH 2DWEA 3E3QE 4HEPG 2I60H 1F3JA 4OQ1A 5ICZB 4U6YB 4K8RD 3LEVL 1MFAL 4U0RC 3WO4B 1FQ9C 3GSNH 4P5KA 4Y5VC 3KJ6H 4P2RB 3MODL 2RCSH 4GRMB 1X5LA 1HIML 3E6FB 4QNPE 5FFLA 3PDOA 3RVXC 4KKLC 4KJYA 3DYOA 1JGEA 5I1EL 5GS1A 2KL6A 1ADQA 1DSFH 4X9FA 3INUH 5J11C 5LAXB 1T7XA 1MWAL 3LQAL 3QULA 2NY3D 1GPOL 1JNHB 2QQQA 1RPQA 1R5IB 2QADB 1FO0L 3R0NA 3UJTH 4Q2ZA 4WO4A 1R3IL 1NQBA 4PJIB 3QCTL 4W4OC 4JFEE 2CUIA 4NQXA 2X4OB 1RIHL 1BFVL 4WTZA 4PG2C 4WU5A 3QG7L 3WDIA 43CAB 3HCVA 3F7PC 3CVHH 4UIKH 5C09B 5I30L 1VGKB 3LRHA 4AENB 3TF7C 2O5YL 3IAGC 3BSZH 5ERWA 1MRDH 2QQKL 4LQFL 1TPXB 1FVCB 1XGUB 5D2NE 5L2KB 2Q8AH 5IB4B 3NH7H 4LSUL 4U6TA 4L1HA 3WD5H 1NFKA 3QUXC 1G9ML 1NFIB 3CZJA 3S37X 4I0PA 1NJ9A 2R2HB 1T1XA 3ALPA 1I7RB 1NMBL 8FABB 3RVXD 2PYEA 5T1MB 1A9BB 4S2SB 1YMHB 1LDSA 2VXUH 1UH4A 3VI3F 4C55A 4NKIL 1Q0YH 3D0LA 1HDMB 2PO6A 4N9GB 4TQEH 1VFMA 4GRWE 5DR5H 3MZGB 5GGVH 2O61A 1QP1A 3V2AR 4YHLL 4U6HA 4ZUVA 5K59E 1RK0A 1TMCB 1NCUA 2WIIB 4ORGB 3MR9A 2BRQA 2R0LH 3RRQA 1SJHB 4Y5XA 1OAKL 1QEWA 3RWFB 4WFHE 3R8QA 4KUZH 1K4DA 5FYJL 3UTPE 4WHCA 3WJJA 1RK1B 1TTGA 1ED3A 4YHKL 3MUGA 3QIWC 1JBJA 1HQ4A 1XGTA 2YPLB 4XTRD 4CADB 3EHBC 1A14H 2R0ZL 2IALB 1XEDA 4QRRE 5JR1L 4BQ8A 2E6PA 4H1LA 4RMRA 5DVOA 1J18A 4HAFA 2QLVB 1HE7A 2Y7QA 4J6RL 5EBLB 2OI9C 3G5ZB 4H25A 5HYSG 4PP2A 3CFDA 4OZFH 4QRRA 4BH7A 4RGNB 5F3HA 3OXRA 5I73C 1NH6A 1NEZA 2VQUA 2EZ0D 4EN3D 4HWZA 4ZXBA 3OPZL 3TN0C 2F5BL 1IC5L 3CUPB 1S7WB 4NRZB 2W0FA 3OR7B 5KVMC 2SEBA 3SDCC 2ZSWB 1UWEH 1ZT1B 2KZ1B 3VXSE 4KHXL 3MRDB 1A2YB 4OZFB 4PGCB 1IGMH 1J1PH 5C0ND 3ARBD 3GSWA 4NQCB 4Y4HA 5EOCL 4XCFH 1ZVYA 1CXHA 5JW5B 3DUUA 1BX2B 1QLEH 4ZSOE 1NANI 3TA3B 3IAPA 1FH5H 3V7AG 3G9AB 2VLLB 4ODWA 2X4OA 1XGPA 4CUCA 4HBCH 2LE9A 1OM3H 2CKBA 4KY1H 1DFBH 1HH9A 2P4AB 1NCCH 5D7SH 4ZSOA 1H8SA 1MNUH 3REWB 3CH1B 4P3CH 3TBVA 5DGQA 2A0LC 3MBXL 4YHPB 2DD8H 3L3OA 5ITFB 3VWJA 1YY8B 4I2XE 1NCBH 1Q9OB 1KJ2A 4QT5B 1WC7B 1W0VB 2DAVA 3ULSA 5FM5M 5BZDA 3KDMB 1QSEB 3ARSA 3QA3B 3FKUS 3CLEH 1KIPB 4G9FA 2G9HB 3DRQB 5BV7C 1A1MB 2BJMH 1MJ8H 2ADGA 2Q7YB 4OCSH 1DEEA 1NCBL 4X5WA 3CDCA 4GQPH 4BQ6A 2IJ0C 3QIUC 1WZMA 1F4HA 1J0HA 1XR9B 4HIIB 4S1SH 1KG0A 4NUGH 2GCYA 3O6FD 3V7MA 4JO4L 3TBWB 5C7XH 1VACA 5C0GB 1MF2L 4FQJL 5LBSH 2VDNH 4N9OB 3SE8L 1IEBB 2MOVA 5T3XD 2DDQH 5IR1B 5JLZA 1JN6A 4GMTH 1OPGL 5K9KA 3JWDC 4WWKB 4U1SA 3O6ML 4MCZB 4MB5A 5C0IB 3SKNB 4Q9QL 4U1JA 1F6AA 2VL5B 5FF6B 3HC3L 2NTSP 1M7DB 3FB8A 4QRPA 4P99A 1T21A 4UBDC 3DGGA 1JYNA 1YUHB 4YNYB 3WBDA 1NCAH 3MV11 4P3DA 3K4ZA 1H5BB 4PJAB 1RHFA 5D7SL 4JFEA 3D3VE 1CBVH 2ARJA 3MRKB 3SJVD 4DGIH 5IV2B 4XAKE 4P23D 2KDGA 4I3GA 4NJAL 3GJEA 3WMSA 4HJ0D 1S9XA 4LGRB 3AM8A 4NFDA 3S7GA 1NL0H 4KJQD 4F37K 3SDAD 4XPGH 2JK5A 3BD5A 4XMPL 4XVSH 2VITA 3GM0A 3CU7A 4NJ9H 3B8YA 4Y1AD 3LEVH 2QBWA 3GMNA 2I26N 4JG1L 1MFNA 1IGCL 2Q6WB 4H5SB 1ZT1A 5CP3H 3MRMA 4LLVA 4XWOD 4I77L 1AQKL 5KANG 3L9RB 4MXVE 5IOPB 4YHNB 1G6VK 4ISVA 4UI2A 1LO0H 3EO1B 3OKMA 4S1DC 5C0CB 1T20A 3LQZA 4U6XA 4IDJH 2RAMA 1NDGB 1JGDA 4LLUB 1RVFH 3E2HC 4LP4A 1KFAL 3GKWH 3WNOA 1TQBB 1P69B 2H32B 3F7VA 1MCLA 1HHJA 3EYQD 3OXRB 4NWTL 1F00I 2JB5H 1N7MH 5HHOE 4PJ9C 3S35L 4BJLA 1OAKH 3VGGA 3RTQD 2B2XH 1KCKA 3ZTNL 3BDBA 2CDEA 3QQ4A 5J1TC 1A7PH 2G5BA 3QDGA 3SGJA 4NQEA 1AY1H 2ADGB 3RU8H 4PD4J 2JLLA 2P5WA 3AGVA 3CXDL 5I74B 2K7QA 3VFOA 4R8WH 3O8XC 4P23A 4MNGB 4CVUA 4UIKL 4X99B 4I9WD 1UQSB 1B6DA 2GSGA 1JK8A 2D31A 4PG9B 5JNYB 1G0YR 5DRNB 3EOTH 1ITCA 3ULVC 1HCVA 4TQEL 2HWZL 3QRGL 5C0BA 4XAKD 3V6OC 1V8HA 3Q2CA 2J1KA 4LSPL 4YHPA 3LKOB 4L9DA 5AZ2L 1G9MH 1QPXA 3BKCL 1WCBB 1RZKL 5CJXA 4QT5A 2XTJB 4JM4H 4IS6A 3QDMD 5HHMB 3ZTJH 4G6ML 4TUJB 3D39D 2GTWA 4K55A 5JXAL 4TSAL 1E27A 4HZLA 2G9HA 3X3FH 1M4KA 1WBZB 3MLUH 4NRYB 2ZOKA 2APBA 4U49A 2BVOA 5D1QD 2VDQH 3MROA 3BP6A 4PGBB 1G1CA 3GSRA 4IOFD 1TNNA 4HKZB 3PP4L 2YS4A 1J05B 4P9HL 3RDTC 5GGSB 2HT3C 4P2OB 4LK4A 4JN1L 1ZXQA 3T4YA 1IQWH 5TFSH 2F53B 2X44D 5I19H 1JJUA 4AQOA 4ACPA 4AG4L 2BVQB 5IGXH 2ZWLT 5EBMA 1RUAH 2X4UA 2OX5A 4M6ML 1E28A 4M1DL 2AEIT 6CGTA 5K33A 2QQLL 3SCMA 4R2GC 4OLZL 4TTDD 5IMMA 1U3HD 4FFVC 2D4FA 5E99L 3K2MC 4OFIA 4XCFL 2Q6WA 2ZG2A 1I9JH 2HVKA 2G5RA 1RUQL 4GRWB 2R39A 5HHVL 4K94C 4YZFF 4TVPD 4E0RB 4WDIB 1HI6B 3EYFA 3WUWB 1NFDE 3IXAB 4PRPD 4TSBL 1U8HA 3UTSA 1CICC 4LNRB 2BY0A 2XKNB 3D0VA 1KN2H 3JV6B 3ARWA 4NN7C 4LNVA 5ICZA 1OP3H 1JWUB 1QKZL 4NNPH 4ELMA 1MCBA 1U36A 5E70A 5F7EH 4XB7A 4GRMA 4G42B 5F9JA 2X4QA 2YA2A 4YWGH 5BW7A 5T33L 4MHHI 4DVRH 2QV2A 2H2SC 5IP4A 4XBGB 4HJGA 4QTHB 3IDIA 4O00A 4ZDHB 1YEIH 3LOWA 3ZE1F 1YYML 4JN2A 4JKPL 1EVTC 1ZHKB 4GBXA 5TE4H 1IGFL 3BWAB 4FP8H 5F3BA 4L8DB 2DOCA 5CJOH 1KJ2L 2P47B 1RU9H 3MRRB 1D9KD 4X6FA 3RP1A 3BP5B 3CVHL 3TPKA 4J2XA 1BZQK 3B4NA 2P48B 5FCUH 3SPVA 2EDTA 2DRUA 3ARRA 3ARZA 3OJDA 5IVXE 5E99H 3C2AH 3QFJA 4OF6A 3M17B 2HTLC 4FQ1H 1N0XL 3TNMA 4D0CB 3HPJB 2XACC 3L3DB 4M93C 3FO0L 4HGWA 3LQAH 3IDXL 2EDXA 4AG4H 1MQKH 4O02H 3PQYA 1CFVL 1NLBH 2IPUK 4X6DE 1DBMH 5F8RC 4P9HH 4KTEL 3ARGA 4G7YH 3V5KB 3MLXL 5T5FH 1S3KL 1HYSD 2F74B 2QR0B 3BUTA 5D2LE 1WVZA 4PV9A 3U9UB 3RVWC 4LKXA 1IILE 3SGDI 1G7PB 1WJ3A 3TCLA 4EIZC 5IHZB 5D1ZB 1OPGH 4NYLB 3BDYL 4HW6A 4HWBL 4NO0B 1N5YH 1W0WB 4MJIE 5JPNB 3PDOB 3B9EA 1F42A 4M4PA 2R2BB 4PRHA 4M6OL 4Y19B 4LPVA 4OJFL 5JW4R 3U4BL 5DC0A 3SDCB 3TJEH 5I15L 1KUMA 1H3TA 1KB5H 4LCWE 1MI5D 2H2PD 5D4QA 4PJXA 4M7KL 3UJTL 1QYGH 1IAOA 2NCMA 3R0MA 5L0QC 3VMPA 2XWBA 5KS9B 1FNAA 5CP7B 1YZZA 1EHXA 1WCQA 4OFPA 4XVJL 3O9WA 2APWA 3D48R 1Z5LB 5DI8A 1A6AA 2PKDA 3BP4A 3CD4A 3LN5A 3OKEB 1KB5B 3EJZC 5CSZA 5DD5H 4ZS7H 1EERB 1C5CL 4DOHB 4OGXL 1GGTA 1NC2B 4BSVB 1CDJA 3BKYL 4PJFB 4CJ1A 4P2RD 5JPMB 2GY5A 3TVMC 4EKXA 2M8XA 5ALBL 4TVPE 5E5UB 3C5ZA 4N8CL 4M9OA 4XAWL 3PNWB 2SEBB 3PP4H 5F8QC 4N9GA 4KPHL 1Y6MR 1T89C 2UY6A 1IZKA 3QR2A 5JO5B 5F7LB 4HUMB 5F9OL 3ZDZF 4L4JA 4MXWL 3GKWL 4HXBH 3HE6D 1E4KC 2X4UB 2CXKA 3WE6B 4JN1H 3TA3A 4LNRA 1IARB 1DLHA 3GSUB 4FHBD 4JB9L 3CMOL 4MA7L 3HZVB 4XH2B 1D9KC 5FM4A 5ACMA 2AK1L 4JM4L 3RQ3A 4I5BA 1OAQH 4JREC 3NIFE 1H3PH 3WXWH 1H15B 1FYTA 1G9NL 5HBBA 3QFJB 3O6LH 1MHCB 3EGSB 3W0WD 5DWUL 1U8OA 1IGYB 3DYPA 1GAFH 4FG6C 2CIKA 1QRNE 1LEIA 4NJAH 5CD5C 3CX5J 4ELMB 4DTGH 4M1GL 2EO9A 3S4SA 1FZOA 5J3HD 3O3EB 5GSRA 4GAJL 2DQIH 5C0RL 1YEHL 3BZDA 3QSKB 4ZFGL 3S88H 5D7IE 5IW3A 2Q1EA 3IFLH 1UB6A 1UM6H 3FN3A 4M1CD 4N1HB 1AXSB 2HAZA 2DQHL 3QCVL 1OTUD 2H8PA 1NKRA 1N3NB 4UDUB 4Q9QH 4JLRB 3MNZA 3MLVH 5J06A 2VQ1B 4LBEA 5TDNA 2AJ3B 2I9LA 1P1ZA 3U0TA 2MHAB 1Q94A 5CINL 3V0VA 1A4JB 1QFUL 1J11A 1U3HC 3Q5OA 3VD4A 4WNQB 3OZ9H 4U1HA 3FHAA 1NC4A 5J0BA 1DQLL 1Q9OA 2ZUWA 4LMQE 4G43B 4OD3L 1KLUA 1Q72H 3R1GH 3RWEA 2FL5A 1XGPB 5DQJA 4JRYE 3EW3B 1U8MA 4F7TB 2YD5A 3CLFL 4B5EA 3VD3A 2IFGA 2AJVH 3RNKB 1VA9A 1CFNA 2BNRA 1XF3A 2J2ZA 4NO5A 5SX4I 3CSPA 5D5MA 2I5YH 2VABA 5DJCA 1GL4B 3QIUA 2UZIL 3QEHB 4NDMA 5A43C 4JVUA 4I2XA 3E6HA 3RTQC 1YYLL 1ZWIB 1SHMA 5GGSY 5BRZE 1VPOL 3LIZL 5MERB 3VXRB 4PJ9D 1ZHLA 1S7QB 4HWUA 1HHHB 4M93B 3K46A 4LEOA 4XPGL 5MP6L 2Z35B 4OB5H 1T1ZA 3P9LB 4PJHB 4QHUA 2P8MA 3FFCB 2NXYD 2W9DL 2X4NA 2Y5EA 2FEEI 4F7PB 2PW1B 3NGBC 4AL8L 5SWZE 3HLAB 3LKNA 4FXGA 4LSQL 5ICYB 4CW1B 4XWOC 5HHXH 3WXWL 4MZ3A 4M9PA 3ULVD 1RVFL 3WNNA 4QTIH 3MRFA 4CMHC 4HD9A 5DJ2B 2VDPH 3FFDB 5DSCB 1YEFH 3QDME 4OD2A 1TDQA 2F8XC 2FX7L 2CDGB 4MD5A 2AEPL 4I1NB 3DO7A 1YA5A 1YEGL 4M6NH 2HRLA 1CGSL 3C8KA 1QSED 2BCKA 5E4EC 2QSQA 3VFSB 1L9MA 5ANME 2F53D 4QTIL 5E4IA 1ZLVK 1JPGA 4YFLI 4ODVH 1WZ1L 4EJ1C 1WBXB 5GISH 2YZ1A 4LLYB 1OAYH 4J8RB 4HH9A 1TZHB 4IM8A 3KPMB 3LY6A 3P77B 2VLJE 3C09B 2V7HB 4O2FA 1BQHA 3NAAH 3KYNB 4U1IB 1BQUA 5E9DE 3ABZA 3QEQD 1CK0H 1OB1B 2VLJA 4RX4D 3MBEA 1JVKA 15C8L 1A3LH 1MY7A 4NQEE 3IDYC 3GI9L 3CK0L 3TP4A 4PRHE 4WI4A 3RWGA 2D9CA 3V4VH 3A6CH 3FQUB 4K2UH 4V2CB 3G6JE 3SQOL 1J0IA 1T03L 3QUZA 4G9DA 1MHPH 3WV0A 4HUKB 5D8JL 3O0RH 3D2UA 1I8LA 3EYSH 2Q86B 4JFYA 3OKLA 2DLTA 1DTUA 3EDKA 3PWUB 2FCBA 2R9HD 3H42L 4X4ZA 4HJ0C 1QLEL 3KNBB 3QHTC 2AXGB 5JHDE 2D7NA 4P23C 3MACH 5CD3A 4OLXH 5DJYB 4LBEB 1AE6L 4LASL 4FZEH 3SDAB 5EZIL 3MR9B 1G9MC 1DBJH 5EDXA 5MEND 4UBDD 2GEEA 2ITDB 1QQDB 3C60C 4Y1AB 3HI6L 2BMKA 3I3EA 4FZ8H 4FA8A 4Y2OA 3SQBA 3LB6D 3O3DB 4UILH 3KR3H 1AH1A 2A6IA 1PEWA 5FDWA 4WW2F 5FV1L 1F11B 4D2NA 3ULUH 3B5GA 3UO1L 1ES0B 4OFVA 4YDKL 3K1DA 5FYJE 3T3MF 3EOBA 4Q9CA 3GB7A 3ZLQC 2CRIA 2BHYA 4O2EA 3BZEB 2EYRB 1UWXK 4ZPTB 4N0CD 1R3HA 4OCXL 4YHKH 1NEUA 4YHLH 1T2QL 2DQEH 2PF6A 1OLLA 3P4NB 4E9LA 2YUWA 4QRUA 3TN0D 1UWGL 35C8L 3DHJA 3QG6A 2V6HA 1N59B 4JZNA 4LHUG 2VLRB 5F6IC 5FKPA 2FZ3B 4WW1A 1OSPL 1N5AA 2F8VA 1NUFA 2DQTL 3T0EA 4P5TC 2AV7A 1MEXH 4XCYB 5BOZG 3QEHA 4NDMB 4FMKA 1MFDL 5DRWA 3UTSE 4LVEA 1X44A 2FJGB 1GRWA 2A0LD 4OCLC 4E41B 5GGRY 4TUOB 1TVHA 3ILPB 1D6EB 3MRRA 2DJUA 3BJLA 5J1AA 4XWGH 3BESR 3CGTA 4Y4KB 5EO0A 1K8DA 4KHTH 1T5XA 4ONHA 1MJUL 3L3OB 5ITFA 3QJFA 4NZTH 1L7IL 4YGAB 5F7HA 3KPLA 4LSUH 1JPTL 4OIAA 4R7NB 3T0BA 1MIEH 4IIQA 4QXUH 5C9JA 5IUSA 1JWMA 4IRJC 4Q0XL 3MRHB 4M62H 2AK4A 4RWYH 3IDXH 3FN0L 1A5FL 1UKSA 4MAYD 5F9AC 3GJFA 4WUUA 3QI9B 2DYPA 4AJ0A 5D93C 2EZ0C 4Y4FC 4K8RH 4GKNB 2N4IA 3VD9A 1N6QH 1QD0A 4PRPA 1IBGH 4KTDL 2YUVA 3PIQA 1R3IH 5EU6D 3S37L 3B6SB 5E2VL 4AYFA 1XIWC 1FO0H 1WFTA 4WEBH 2NY0C 3UP1A 4K7FB 4HFWB 1VADA 3MREA 3I75A 1B3JA 3VFPB 2ARWA 3DVIA 4FQ2L 4Y19A 5TPWH 1GC1L 4D3CH 4MLSA 3P9MA 4YDVB 1RQ5A 2P1YA 1YEIL 2ZCKH 4EI6A 1ZEAH 3HG1D 2XZAL 3QQ3A 4P5MA 4P2QA 5D2LA 5I0ZA 3UYRH 5MEQA 3OB8A 5EZOH 2R8SL 2YBRA 3CVHA 3RIAK 1S7SA 1AHWB 4QXGL 1UA6L 2ZUVA 1UZ8B 4N90D 1LP9A 4U3XA 4HPOL 2ZJSH 1U93A 1CGYA 4JFDD 5GSVA 4Z7VA 3ZHDA 3ARGC 4JREB 5EORH 5CEXB 5BXFA 5DD0L 2Q7YA 4DGYH 2AAVA 5EFIA 4MD0B 1AHWC 3EOAB 2QTEA 3P4LA 3MGOA 1QSFB 4M48H 1UWXH 2AEQL 1HINL 4RWHA 4F7MA 1C5CH 1KTDB 4JQXA 5FOBA 3U7YL 3VH8A 4D0DA 1UH2A 3PWUA 3KPPA 4M7LL 3STLB 35C8H 4BZ2H 1LE5B 3SOBH 1GZPB 1VFOA 1NFDF 1NEZG 3ZT7A 2VXTH 4TSCH 4JHAH 5IQ9B 3KLDA 2J5LB 3HZKB 2VLKE 2UVEA 1UFUA 4PJIF 5C0CA 4ESKA 5CMAA 5GZNC 5F9WB 4OM1L 3GSUA 2YWYA 1R3HB 1UENA 2B4CC 1KIUA 5DGRA 2A9NH 4P59H 1JI2A 3TBTA 4ERSH 5E2UH 3UZEA 1SEBB 1F11A 2H3NB 2ADJB 3FO9B 1NBVH 5TH2B 1ZGLM 1R6VA 4GXUN 2V2XA 3AS2A 3Q48A 3GMOA 3TZVC 5HD8C 3L5XL 5I0DA 3GO1H 1MVFA 1CG9A 1TVBB 4WFFD 5CEZE 4O2EB 2BOBB 1I7TA 4P5TD 4JFEB 2H26A 3KLHC 2VWEC 1Y0LA 4H1LH 3RL2A 1I75A 4F9LC 2Y1VA 5TJWK 5B38A 3TESA 1L7TH 5DYOA 3WS6A 3VG0H 5IFHH 1TFHA 1A1MA 1LILA 1J0YA 1N59A 1XMWA 1CS6A 4H8WL 3MXWH 4MAYC 1Z0MA 4RDQG 1EFQA 4R90L 4YIQA 4J7RA 5TDPB 3L3JA 4Q6IB 1BGXL 4BZYA 1U8LA 1JNLH 4JVPA 1DJSA 4KKAC 5D6CA 4JO3L 4UDUA 4OUUB 1IGIL 1WUNT 5GGRA 4KZEH 4QHMA 2IEPA 2ZNWA 3IDYB 3FMGH 3S36H 43C9B 3GMMA 2E9JA 3TBWA 2BDNH 1BVKB 3BX7C 3K4AA 4RGOL 4NN6B 5HHOD 5HI3C 4MQTB 5JMRA 1AY1L 1NBYA 3O6FA 3FAWA 4GS7C 1F3JB 4PIRF 1A7PL 4AT6B 2IADA 5FGCE 3BIAX 4XP6H 2B2XL 2M26A 5EIVA 4I3SH 4CJ0A 2EH7L 2R0WH 3NN8B 4XNYH 3DX7A 1G1YA 4R7NA 5CILH 3VGBA 2J8UE 4G8GE 1U58B 5IJVB 1T66D 3Q5TA 4WHYG 4KHTL 2PW2A 1J1XL 2GFBB 2VUOA 4JFZH 4PBWD 4KK6C 5I1CH 2N56A 1D5XA 1DQDH 1YNTB 4L4TE 3U6RA 3GZKA 1HSAB 5GGQH 3VWKC 1IM3B 5HDQH 1CU4H 2GSGB 3HRPA 1XF5B 1WIUA 2MMXA 4HMDA 1EPFA 4KRPD 3HI5H 3TO2A 4MXQD 3RX8A 1R5WA 3NFSL 1VGKA 4U3CA 4EQ2A 5D7LB 1MREH 4PJBB 4GRLC 2D31B 6FABL 1AP2B 1UWGH 2DB8A 3MLRH 1T5WA 5HHXL 1KIQA 2VJXA 5KSBE 1KCRH 3FTGB 5C6TH 5LJYH 5IM7A 5ALCH 3RKDC 2XKNA 4RGND 2OYPA 5ABDE 4J4PD 1CFTA 3H2WA 4P2QB 3RWJB 1MAML 1QLFA 5I19L 1QR1B 4PJDF 5CJ5A 5ILTH 3THMH 2V2TA 4YO0B 3T4AA 4HBCL 4HKZA 1GGYA 4KMQA 2BRRL 1IEAA 3WSQH 4ONGL 2BVOB 2J4WH 3LKRB 2NXZC 1H3GA 3R8BB 1XF1A 2VL4A 2VH5H 8FABA 2E27L 3H9HA 1JPGB 3MV8D 3NZ8B 2B0SH 3DOSA 5J6GA 2C3WA 4OSUH 4L4VB 1GGBL 5JHDB 3VJ6B 4KU1A 4IRSC 1KTKE 1ZHBB 1OY3B 4OLYH 4R4BA 4F9PC 1KF9B 4NQVB 3P0YH 5C0AD 1HHHA 5B39B 2CKNA 5IB1B 4ZUVB 3VFMB 4HFUH 1OQOA 4R4NC 3VW3L 1Q9LB 1Z9MA 4MGXA 3ELAT 4DVBB 4Q74A 2NY4D 4O58L 5D70L 1RURH 3VGAC 4N1CA 4F7PA 3SQOH 4AEHL 3U82B 4X7SL 3A6CL 4IIQC 4X6BB 3VFRA 2YXFA 5CBEA 4CU6A 4HWZB 4JO1L 4U7SA 2UZYB 3GMOB 2FX9L 4I18A 1OCWL 3C6LA 3RGVA 3T77A 3VMNA 5DJZA 4WV1C 4LLMB 3CFDB 5DMGD 3OKLB 2VZ3A 1NJ9B 3SJVE 3PG2A 4JRXE 1PBYA 2GJZA 3VWKD 3LN9A 1T2JA 4DKEL 1A9BA 1OW0C 5EU7C 4NT6B 5GJSL 3SKJH 3WFEH 4X98A 5D1QA 2FX8L 2YEZA 1HSAA 5AAMA 1F4XH 3BPCA 3QH3A 1AKJA 1T66C 5IB2B 1ZA6A 1DQJA 2J3SA 4XBGA 2OMBA 1WAAF 4MA3B 1P9MA 5HI5D 2J8HA 2B1AH 3GM8A 4AT6A 2X1QA 1HHIB 4JKLA 4XP1L 1ZLSH 4R90H 2VDMH 1TZIB 2VLJB 1BGXH 5JIKA 3DX7B 5CP7A 5JUEH 1S5HA 4LPUA 4OF3A 3QAZB 4JG1H 5BZDB 2XZCH 5D7JB 1EFXB 1FL3B 3BGMB 1H8OA 2ZPKL 3FB5B 4YLQT 5I1AB 4HUXA 3EOBB 1IGJB 3HHRB 4MAYB 4DQOL 2EYSA 2O5YH 5GRUH 3VRJA 3DMMB 2NW3A 5B4MC 3FOLA 3KDMA 1T89A 4WFFE 4MVBC 4RX4A 2K7PA 2OTUB 4RQQB 4ONFL 5DUPL 4K7PX 2GCYB 3KWWA 5FO9A 5MP6H 1G7PA 5BZWA 3TA3C 1V05A 2FIKB 5MENE 4RDQF 1UACL 4L8SA 3QUZB 4GW5A 4JHWH 5BRZB 1SYVA 1DBBH 1EBAA 3V0WH 2EXYD 5FGSA 3FN9A 3DWTA 1UB5A 5DJYA 1NCCL 2W0FB 5B8CA 2R0LL 3FQTA 4QF1A 1FJ1B 4X7EC 3UTTB 1JF5A 2VLKD 1A0QH 5HVGB 5IBLD 4CDHA 4PJHF 4OQTA 5C8JB 4P4KD 5F9WC 1P6AB 3WDHA 2DI9A 4Z7NE 3KPRE 3O2DA 4M7ZB 4I5BB 5E8EA 5I8KH 3MA7A 4M43L 1FO0B 4GT7A 1I3GL 4FTVE 4JE4B 3Q0HA 4QRPB 4PJXB 2J8OA 1MFCH 3U7WH 4C56A 5D2NA 2O93L 4I0CC 3DXAA 1LK2B 3LMJH 5LCVL 1I3VA 1OTUC 3HMWL 1SM3L 2FB4L 3O2VL 3LHPL 4JY5H 3RWJA 3F12B 1C5BH 2HRPH 4L3CB 3WIFB 2CK2A 4HQQH 3KPOA 4PRIA 4DWHA 2WBKA 4J23A 5CJQH 3IKCA 3VD7A 1ACYH 3IDNA 1SJEB 4R4FL 4HWBH 4J6RH 5J3HC 4P4RA 5LGHL 3S9DB 4P9HC 5I18L 1K5NB 5BCAA 2QSCL 1CN4A 2YPKB 2YMXH 1AI1H 2BVPB 4PJ7F 4KK9D 2LTQB 5GGTA 2XY1A 1I1FB 3SBWA 3UTPD 2EDNA 2WUBL 3FT2A 1B2WL 1BFOA 1FORL 3FJTA 2WV3A 1IVLA 4O9HH 4BUHA 1P1ZB 5JPNA 3BQUB 1PKQE 4XC1H 3FQWB 1VKXA 5HGBA 3F5WB 1T22A 4WEBL 5EC2B 1X6LA 3UJIL 5I66B 4WWKA 3KS0H 3ZTJG 4U1HB 1GAFL 1OQXA 1QA9A 2H1PH 3NIDE 4GUPB 3T0ED 4ZFFA 1EA9C 5DMIL 2YBRB 1R3JA 5JW3L 5EU4B 4K94L 3AS3A 1BQSA 2RCSL 1RFDL 1R3LA 1RUKH 5H35A 1WTGT 2PTUA 1FL3A 4XZUB 2ESVE 3TT1H 4PJDB 3QFDB 1CGVA 1EVUA 2NY0D 3RY4A 4F58L 1QRNB 3AAZA 3BN9D 5D5MB 1HCFX 2A6JB 5EPMB 1KB5A 3KPSD 5KVGH 4PJDE 3TVMD 3E1F1 2F5AL 2Q7NA 4HCRH 4BKLA 1K8IA 2FJHA 1TJIH 5HGAA 2EICA 4POZC 3S97C 4W4NA 4G80A 3IDJB 3EO0A 1PQZB 3X13A 3SDYH 2X41A 3QUYA 4Z95L 3TH4T 3NTCL 4NBZB 2AQ2A 5DRXA 5E94A 3IYLW 1WBYB 4F8TA 5I1IL 5F9DC 5IMOB 1G6RA 5H2BB 5ADPH 5EOQL 1J8HE 2ZCHH 1G7IA 5I9QC 2VN4A 4Z7VE 1NSNL 2HTLD 3NABL 4EXKA 3DUSB 4BM7A 4NN5C 2CDFB 4PR5A 5BVPL 3T3PF 2V7NB 2H2PC 4NKOB 2W91A 3UYOD 3VRJB 1MEXL 4RAVA 3EDFA 4H1LG 3UPCA 2VERN 3LS4L 3GSQB 4M00A 4Y4KD 1DBAL 3RWEB 2QQNH 1Y18A 1FNGB 2EYTB 3B3IB 5GIRA 5TH2A 2AGJH 2VXVL 4WNQA 1XCTB 1WFUA 3ORJA 3ZKSD 1NFIA 5A2KH 2X70B 1V3KA 4JY6A 1T7WA 1GYAA 3GMPA 4MWFA 5CZVH 4ZXBD 5DEFA 2D2OA 4OLEA 3BMVA 3K81A 3C5JB 2AKRA 2Z92A 1OTTD 5KOVC 3NH7L 3SE9L 5HDBF 4OTXH 4DN3H 1YPZF 4PGZA 5F71A 1OGAD 5F89B 1YNKL 3FQRB 4X7CC 4OFDA 2DJ4A 3H0TB 2VDOL 5ISZE 3FQXB 4N0CC 3QEQA 3UAJC 5HY9B 1OB1A 4RFEB 2GI7A 3RZCD 3BH8A 2B4CH 3CSBA 3O3AB 3GIZL 4RBPK 5JXAH 3BRFA 1QRND 4DKFH 1LE9A 3BQUA 3DI2B 5EIIA 1FFRA 4HV8B 3PGFL 4YBHA 2ZOLB 3BPNB 1A6PA 2A6KB 4RMUA 4N8VB 1BBJA 1P6FA 3I85A 4OKVB 4RISH 5T1KA 4XPFL 1PLGH 5SWSA 1K5NA 2R2EB 4QY8A 5DHYA 2FGWL 3U4EB 2H2SD 1EJOH 4H0GA 1SYSB 4Y19D 1GHFL 1NMCC 1DCLA 2C3HA 1BEYL 1NBZA 4JG0H 1JZ7A 5E24E 2CDGA 4MD5B 4QCIB 4GQ9H 5HHPB 2HT3D 3L7EA 2EE6A 4R7DA 3BWAA 3IJSA 3V6OA 5SX5K 3DGCR 4DUWA 1HKLH 4LOUC 4JZOA 3LRGA 4GH7B 1D7FA 5D1QC 4AK1A 5JW5A 4XCCL 1FIGL 5B22A 1VEOA 2OZ4A 5IWLC 1L0YA 1X7QA 5CGMA 1CYGA 3VXRA 4FQLL 5BVJB 1ODAA 2VISB 5HI4D 1HILB 2IH1B 4AH2A 5A3IC 2EKJA 4UAOC 4H26A 3T0WA 2AV1A 1NMAH 4KRNA 5IESH 2CR3A 5IW1A 3GMRB 1NCWL 3OJDB 5D71H 3T8XA 4R2GD 1HQ4B 5DVKA 2GTZB 4HXAL 4Y4FB 1ZGLA 4IRZH 4QRQB 1KGCE 4UQ2A 3RIFK 4NCC1 3I2CH 3NN8A 1QPPA 4XPTH 5FYKU 5F7KC 4MNQE 2FYYB 3OGOE 4JDZB 3HN3A 4JRWA 3BH9B 3O8XD 1XH3B 2X09A 4LCWD 3NPSC 2LU3A 3OWEA 4GAFB 1XIWB 3OG4B 5DFVC 1HEZA 3GMPB 2MSPA 3H7BB 1AO7B 1JRHH 3HNVL 3OKOA 2O5XH 1CLZL 5F1NA 3ZE1E 1G7LB 4Y2DD 4PV9B 5FUZH 2DQGL 4RZCA 5JHDD 2E27H 5D7IF 4L8SC 5I8CB 1KCSL 2C3VB 3AB0B 3WJJC 4GXVH 3CAFA 1QQDA 2OLDA 2HFFB 3O6KL 5EUKB 3WXVH 4NOFA 1IT9L 2LAGB 5JHLL 1MCJA 3V5HA 5EO0B 3VFMA 4MDIB 3WJLA 3HAEB 4V1DB 2DQDL 3MV7B 3GNMH 1T1YA 4RGMB 3BXNA 1VESA 1G7IB 1XT5A 4LSTL 4ELKA 3HC3H 3EFDL 2DLEA 3ZSSA 2A9MH 2DYPD 1JWSB 3C6LC 4P3DB 2NXYC 3HC0A 4U31A 4F15B 3VFWA 5E8NA 5C0EB 5HI5C 2B39A 3LEXB 3TO4C 5BS0D 2AVGA 5IV2A 4LSRL 3QI9A 4HUVA 4XVUC 1EAPB 4M5ZL 1IEAB 5CSGA 4HS8H 2MJWA 2J8UA 4G8GA 3DGGB 5IEHB 5D9SB 1FFPA 1IRAY 1FSKC 4NZRL 2OXGA 1HOCB 5E2JA 4V2BA 2JJWA 2E7LC 1KPUB 4NT6A 4ZTPL 4LKXB 4P2QE 1NMAL 4XHJD 4KI5D 3IJSB 3PQYE 3GRWL 4QLRA 2FWOB 3O2WL 4I48A 1KC5L 2AJXH 3MRMB 1GGIL 2V5MA 5ESVA 1CVSC 3N85H 2Y6SC 3WE6A 1FC1A 4XCCH 4IRJA 1FCGA 1AHWA 1OCWH 2VR9A 2XWBB 3ARVA 5E03A 3TC9A 5KS9A 2JJTC 2OK0L 2UWEB 4OV5A 4O4YH 2BY1A 2P44B 2Y4SA 5SWZB 3U0WH 3LRSA 1S9VB 3FCTB 5HYEA 2D0FA 4DZBB 4HS3B 3BO8B 4PJ9B 2HN7B 1IFHH 3T1FB 1KTLB 2HFGL 4GW4A 4KC3B 1CE1H 1JTOA 3F6IA 2BY2A 2WP3O 4LOUD 5EU5B 4BSVA 1LWRA 4AIZB 2ZUQC 5DQDL 1A22B 1KV3A 1XIWA 3Q1SH 1FBIL 4YAQB 4HS8L 1GZPA 1ZMYA 1VFBA 3NA9H 4PTTA 4JPVL 2I07B 1BJ8A 2BOCB 2YEZB 3QXDA 4AM0A 5HTSA 1R0AL 1P9MC 1DQJB 4FRWA 4OF0A 1JP5A 4QNPF 1CDBA 4LFHG 3P9MB 1V3LA 1YMMA 2QKIA 3MGTA 3VRLF 5IW1B 1QFWI 5T1LA 3MUHL 3JTTA 1LO4L 1XGRB 4L8CA 4LPCA 1UEMA 3OKMB 3RKDD 1FE8H 1J8KA 3TO4B 2BFVH 1L0XA 2EIZA 1BWMA 4JVWA 2AABL 1R3KB 1NMCB 4YDJB 3RZCA 1FO0A 2GJ6E 1MCOL 4HH8A 3W9EA 2IQAB 3NIGF 7FABL 2PR4L 4GRLD 3ULVF 4ZG1A 2AV1B 1CG9B 4MAUL 3THML 5MEQB 2Z31A 3HI1A 3OKNB 3RZCC 1T4KB 4U2YA 4WCYL 3FRUB 1ZGLB 1U8MB 1T0MA 4OI8A 4YC2C 32C2A 5JOEA 1WT5A 4Y5XC 4X6EA 1XFPA 3P30L 4JDZA 3GSNB 4LIQH 2DDQL 3X14A 1QUNA 3ETBF 2WP3T 4EN3C 1KACB 3KLAA 3NBNA 6FABH 3VGAB 4LVNC 4CBPA 5BJTB 5C08B 2EDLA 1JHLH 5E1AA 1UB6B 4LRIC 2UZXB 4WWKC 5C6PB 2CQVA 5GGSA 4OZGB 1D9KA 3EHBD 4NGHH 2P42B 4IMKA 1GIGH 1FNEA 1JYVA 2EDFA 5EOQH 5BMFH 5D1ZC 2AEWA 4XXDA 1DQDL 1CGTA 3GI8H 3F5WA 1CDYA 3K74B 5IG7A 4MHHG 2NY2C 2IADB 4KKCD 4N0FB 1QFWM 1GOFA 1A7QL 1XGUA 2GTWB 4OQTL 1CCZA 1UM4H 3VXMA 3SKUD 4KVCH 5DUBA 1M71B 4FFYH 2NY5L 3Q6FB 4FMFA 3KYMB 1INEL 1WICA 5DURD 3I3DA 3ARBC 3MRQA 4PJAF 5LG1A 1RZGA 3DIFB 4HIJB 3HB3C 5TQ2L 5HJ3B 3QIBC 2D7MA 4DZBA 3OAUH 4OF5A 3WFDH 5J56B 4IMLA 1XGQA 3JV6A 1N0XH 2P8LA 5FB8A 5HYJD 4NZUL 1W72B 3ROOA 4CGTA 1HYSC 2RR3A 2YA1A 2EDHA 1QNZL 2H6PA 1A6WH 4NO0D 4WEUD 2A73A 2B20A 1S7RB 1S9WA 3TZVD 2IG2L 3PWPE 2WWMC 4XHQA 4EQ3A 1U3HA 3IFOB 3EO9L 4LSVL 1AJ7H 4WVRA 3EDEA 4I48B 5IWLA 4CN1A 2ZG1A 3SDDC 2A1WH 1UJ3C 1UKTA 5K9OB 5CJBA 2C5DC 2VR5A 4WY7L 5AYUH 2ZUTA 5CMAB 4X4MA 4G9DB 4ODTH 5IQ7L 5INCB 4YDIH 3HE7B 2HG5A 1NBYB 3O6FB 4GG6B 3MXVL 2JCCB 4UINH 4GG6F 1YJDH 3IS0X 5K9QG 3CPLB 4NNPL 4ZFFB 3G08A 1INQA 2DKSA 4ZXBB 3VMOA 5FECB 4HK0A 3RBGA 4HS6B 2GIYA 4OAWA 3QXDB 2VDRH 1ADQL 4AIXA 3WFBL 4KQ4H 2P7TB 4G8EB 1A02N 3VRLE 2G2RB 3U1SL 2HFTA 1MCDA 3QNXB 3TLRA 5C08E 5FYKH 4FXKB 4QRSA 4U3HA 4BZ2L 2R0KL 3QHZL 1S78C 1W72H 4L3EE 3BZFB 5DURB 5E00A 1OWRM 2E9IA 4XNZC 1QYGL 3VE0B 4P5TB 2COQA 4G80B 2WWKT 1Q38A 2MKWA 3O4LD 4FQXD 2QKIB 2YPVH 2VN7A 1WBYA 43C9A 1IQWL 3T2QA 2WQ8A 3FRUA 1G6RB 4PJ8D 5H2BA 2W0PA 3OAYH 5BW7C 2DIJA 5ADPL 4PJXF 2VLLA 1CL7L 1BF2A 2FH6A 5IW6A 2OP4L 5D7KE 1X5ZA 2E7HA 4K3EL 5J12C 1X4XA 4PGJA 5IVXB 3BZEA 1N0LA 3FZUD 5IROA 2IBGA 2D7TL 3CH1A 2R29L 1XIWD 2PXYB 3F7QA 1ZLWK 2R8SH 5EZOL 3MMEA 5F7NC 3H9SD 1QBAA 4YO0A 2WW8A 3SJVA 1N2RA 1AE6H 2ESVB 2X4SB 4K7PH 4XGZB 5IJVA 2PTTA 4YR6A 3HZYA 1AKJB 4ODSL 4ZO9A 3TVMB 1UVQB 1FNEB 5IT2L 4LLAA 5I1KH 3CMGA 4NCDA 3C5SB 1MPAL 3HC4L 4CMHB 4PJCA 4X5XA 2YD8A 2H6PB 1ZHNA 3QPXL 4PLJC 3PXHA 2J5LC 2FHCA 1X7QB 5CJ8A 1QNZH 1IFHL 5D96C 3WFCH 3PXJA 4DVBA 4EXPX 5JDJA 4PJIE 4MSWB 5T3ZH 3KXFB 2W9EH 3BIKA 4I9WE 5E7FA 1NC4D 2IAMA 3KHQA 3QUZC 3ZYJA 1P4BL 4KKBC 4LSSH 4EN3B 5L7XH 3JTSA 1EEQA 3B2UC 3KPLB 3ES6A 1P84J 3RKPA 5CHNA 1YMME 2BC4A 4DKAA 3GIVA 1KIQB 1YYMH 4KJPD 5DC4B 5I8EA 2FJFA 3SKNA 3TBSB 5E6ZA 5C0IA 2APFA 4NC1C 3QXAB 5KSUA 2XTJE 4Z77A 4XP5H 4D9LL 1VEPA 3C6SA 5F7FA 4HGMA 1XH3A 2HJLA 3I84A 5DHVA 4WFHD 5KTEH 2RFXA 5FUCC 2K1MA 4P2RA 1DQTA 3UXFA 4HIXL 2WLZA 3OKDA 4F37F 1FNSL 2YD3A 3QG6B 4HK0B 4ZAKA 3QWOA 1KFAH 2P5WE 4WENB 1VADB 4DZ8B 4JO2H 1PX4A 2XI9A 4U1MB 4WW1B 2Y06L 2H8PB 4QOKA 5FHBL 4JY5L 1CGUA 3A0OA 3H9HB 5AG9A 4M7JH 4EOWH 4H8WC 4TSBH 5EZLA 2PYED 4X98B 5D1QB 2JJVA 2E6QA 3EYQC 2YR3A 4PD4K 4DAGH 4OBSA 2J6EL 1JTTA 5E8OB 5FXCH 4MA8L 3HMXL 4NQVA 4DFHA 4NOBA 2WBJD 3VFTA 3E0GA 2OL3B 1UKQA 4X5LA 1N4XH 3WIHA 2V2WA 3HPLA 1LP9F 3QQ9C 2QSVA 4PGEB 4JPIB 1MHCA 3EGSA 4S11A 1HILA 3BAEH 3QDGE 5GQBA 3BVNA 1MFBH 5INCA 2OR7A 2VKXA 4B41A 4F7MB 4RQQA 3C60B 4WJ5B 3QNZB 5IVZB 5D6DC 2IPUG 4Y88A 5T1DL 3GMQB 5EFIB 3D25B 4O5LL 2VTFA 4UQ3B 5FO7B 2FO4A 4MJ5B 2XICA 1A4KA 2GITB 3G6JB 4XP4L 5EWIL 2APTA 5DRNA 2X1WL 1UM4L 1FFQA 4L4TA 3RL1A 4MNQA 2XZZA 1UXWB 3SE4A 5JOFA 3SKOB 3BKML 5C07D 2Z93A 4PFEA 4OLXL 1QBLH 4BK5A 1X5AA 1T1ZB 3P9LA 1U91B 4QHUB 3OAZK 3E6HB 5DMKA 5DTFB 4JHZA 1ZHNB 2HMIC 4PRID 1FPTH 5E2TH 4IMKC 1YQVL 4UIMA 2AXFB 1EK3A 5F1OB 5D2NC 2FEDD 1MRFH 4JRYB 3X11B 5FA4A 5KS9F 3FAXA 4NRXA 5E6ID 2L0DA 1EMTL 3UDWC 3MJ9H 5I1GH 4XRCA 4PPTA 1KN4L 1ZTXL 2Z31D 4FQIH 4ALAL 1Z3GL 3WLWC 1T1YB 1SQ2N 1SMAA 4R2GB 4J1UA 3TWCH 2ESVA 2X4SA 5ANMB 1HI6A 2HJFA 3EYFB 3WUWA 5FO8B 5DD1H 4LAQL 1CFNB 4FQHA 4DN4H 3PJSB 3TFKC 3V5DA 2Y7QB 2R1WA 3QIUD 4MJ2A 2F8OA 1RD6A 1Q1JL 3MLYH 1PD6A 1WLHA 4CL7A 4I3SL 1B4RA 1RY7B 5J4MA 3SBWC 3SDXA 1U2HA 1VFBB 1KTDA 4S2SA 5FHAH 1AO7D 4KK6D 1I8MB 2IANE 3V4UH 1A9EB 3CCHB 4GFTB 4PJ5B 5TE6L 1BAFL 2YXMA 4FNLH 3U46B 4HIHB 3H3PL 4QGTA 4UNTA 4Z7UB 4KTYA 2FLRT 3TEUA 1WZ1H 4G5ZL 5I1GL 4MA8H 4WIQA 1RZIA 2V17H 1BX2A 5FAAA 2OL3L 4OM0L 4XMKH 3LKNB 5GS2D 3D3VB 2PTVA 3HA0A 1YQVH 3TV3H 4ETQB 4GRLB 1AC0A 5J6HB 4KROB 3B43A 3FQUA 3CFIC 1KNOA 4TRPL 1RIUH 1O5DT 4L4VE 4CNIB 1CXLA 3NPZB 2HKHL 3F62A 3DBXA 1CDHA 5EUOE 3UC0L 4JQXC 4OCYH 1WGOA 4PJHE 2XWTA 1JTPA 4L9LA 3EFDH 4PJEB 3L3DA 3REVA 1EH9A 1DL7H 1MRCL 4QRRB 2BNRE 2IMNA 4NP4H 4F8QA 1WBXA 3ARTA 1E4WH 3QIBB 2XZQL 3D39B 5DS8B 3KLHD 5E6IB 5FEBA 3G5ZA 5E5MA 3ZE0F 4JM2B 4AM0B 3QQNA 3CJJA 1DVFA 4BH7B 4L4TB 3RL1B 1JIBA 1G7MA 4HZAA 2ZUUA 5I1DA 5CZVL 5I75C 4LVHC 3QIWD 4PJBA 4TSCL 3AVEA 2FH8A 5T3XH 4UTAL 2VXVH 4JJ5B 4XCEB 5I1LA 5DTFA 1L6ZA 5DMKB 2FSEA 4OT1H 4HX1A 1HZHH 3IJYA 2DBLL 3TH2T 1Y18B 4XCNA 4U7MA 1B9ZA 3PHQA 3TH3T 4FQXC 1Z2KA 3QUYD 3VWKB 5DJDA 2JCCF 1MCQA 5F7YC 4NM8L 3AY4C 3RAJH 3P4NA 4G7VL 4NQUA 3ULSB 3K2UH 1NCTA 4S1RL 5B3JF 3T0DA 2PYFA 5FO8A 1S8DB 4JZNB 1ETZB 5FKPB 1G7HA 3KS0J 1FIEA 1FZMB 4X9BA 3QFDA 5DK2A 1L6XA 4RRPG 1INDL 1JV5A 2HVJA 3T0EB 3BISA 25C8H 4HWEL 2UUDH 5B39A 3CFKA 2EEBA 4RFNC 3VFVB 4F57H 4FG6D 4OGZA 4ZUWB 3TZVB 3X14B 2E5EA 1RJLB 2RBLA 5I6XB 4F3FB 4KY1L 5D1ZA 3QCTH 4ZD3L 4G9FD 1M6OB 1YC7A 4Z0XA 3CZFA 3FRPG 4NFBA 2R1YA 1JRHI 1UADC 3PDGA 4YE4H 1NCDL 3J7HA 3NCYS 1I9IL 4UT7H 2RB8A 4WTWA 3LD8B 2CSPA 2C7UA 2DTSA 3L3HB 1YUHA 1OGTB 4LCCB 1AGEA 1OAQL 4YNYA 3KHOA 1IC4L 3VCLA 4EOWL 3WFBH 3PABA 4RGNE 1ZSDA 3UZQA 3GUTB 4PP1D 5D7JC 4HIJA 5F1SA 1IL1B 2AI0H 3L3IA 4JB9H 4MA7H 3WN5A 3B9KB 4NFCA 3DV4B 2VLKB 2XT1B 4Y4HD 2Y36H 1NAMH 4GG8A 3PE9A 5IB3B 1MJJB 3QULB 3I02A 4IHOA 4PJFA 3MRNA 1FGNL 5CLWA 1BECA 4K7FA 1MJUH 1Z6JT 5IEKA 3F6LA 5JHDA 2ADIA 3OF6A 4MNGA 1MCEA 1TZIA 3D39A 1OAUL 3RUGA 1A9EA 1NAML 4TUOA 1JUFB 4NO3B 5IBTH 4P57A 5ALBH 5KBNC 2Q3ZA 3RVTD 1Q0XL 2YOCA 4JAMA 1G0XA 4BK4A 3HRZB 1UJ3A 4NZJA 5ADOL 5D1XD 1JYXA 5I1AA 4NKDA 4DOHE 1MVUA 2R56L 1WWAX 1JE6A 3GJFK 4YXLH 1S7SB 3L3KB 1KBGL 4M3JA 5C0EA 3VXOA 5EBGA 3JWOH 1MHEB 4G8GD 2F53E 2VXTL 5L88H 4HV8A 4QGYA 1KPVB 2WIMA 2XFXA 3LH2L 4ZUTA 5IVXA 4JG0L 1TETL 1KNOB 2PXYD 1FGVH 4WI2A 5DJ8B 3BKJL 4L3EA 5TF0A 2G60H 4ZOCA 3BI9X 3SY0A 5MEPB 3DBXB 4UV7H 3RVWD 4X6DB 5F1NB 3F7VB 1G9EA 3HC4H 5KVDL 1AXTL 2DKUA 1FJ1A 3N0PB 3BE1L 5GSVB 4PRNA 3W39B 2PO6D 2QL1A 3HR5A 5BRZA 3VA6A 5IJKC 3W11C 4ODSH 4PRAA 4E42B 2Q8BL 3H7LA 2MPAL 1EEYB 4OLVL 3ULUF 4K3DL 1JFQL 3MCKA 4H0IA 4OZ4B 4YBQC 5I9QB 2HYMA 2C26A 2VOTA 3OR6B 4AQ1B 2NW2B 1FLRH 1RZJC 3VXPB 1I3RA 3VFOB 4KDWA 5D2NB 4NGHL 2EECA 4DQOH 4G6FB 1M6OA 1F58L 2NY6C 4MCYB 3AUVA 4PRBB 1PVHA 3L3GB 4KTEH 5F6HI 1GC1C 3G6DL 3W0WA 3DX9B 5FYLD 3HZKA 2MHAA 3H9ZA 3PUCA 3QWQB 3BGMA 4Z9KB 4QHNB 3C60D 3RNQA 1HZHL 5EBLA 3U79A 3MLTA 4P46D 1B4JL 4TULL 4XVTL 1NLDH 4FABL 1NEZB 4YX2H 5M94B 5C2BH 2X4QB 3SE3C 3RDTB 1KPRB 3GSNL 3RNKA 2BOCA 1G7HB 3P4OB 1FFOA 4XPBL 4I3RL 2OZ4L 2IGFL 4LRNL 1TJGL 1E4XH 2Z4QA 3WFZA 5D6CB 4HJGB 1MCFA 4ZOAA 5I1HL 3U36B 1L0QA 1TZGL 5DUML 3QUXB 3MJ8A 3GSXB 2WIIA 4ORGA 1AGFA 4GW1A 4HJJH 2R15A 4OLUL 4DVRL 4LLWA 2XKUA 3WFHA 4IRJB 5DZOA 2O61B 1R3KA 4HHAA 4YIQB 3GBMH 2K3TA 5EC2A 2EKSB 4OZFG 5AYUL 1AGEB 3PQYD 3BYTA 3ZYIA 1ZT4A 1IKFH 5EN2B 5GISL 5D6DA 4YDIL 5E0QA 2CK0H 5DT1L 2BERA 4EN3A 4G3YH 4NNYA 3WO3B 2DQJL 4E0RA 3LH2H 1JGLL 3O9WD 3OJVC 1EHAA 5FKAB 1MFDH 5SWSD 1FBIH 1A7OH 1YEGH 2XG5A 4YHMH 5CEZL 1FFNB 4M8QB 3JTSB 1ZLSL 1E4XL 1U42A 2WK2A 1WK0A 1X4YA 4YPGA 3A67H 4KI5C 4KDTA 3IDGA 3FFDA 1J0KA 4X9IA 3VG9C 1EZVY 4LHQB 4LDOB 3QAZC 2X4TB 1S7WA 3O45B 5DJXB 5KSAB 2N7AA 1NGZA 4KDTC 4U6VH 5FYLE 2L4OA 1I8IB 2CLRA 1BM3H 1F4YH 5DRXB 5J89A 3TIEA 4F7EA 3RY5A 4XVUD 4YUEH 2W59A 4YDLC 5HHQA 1QLRA 4BH8A 5I2IA 3MOBH 2Y36L 1RULL 2VXSL 2GSIA 1KT2A 1P4LB 4JRYD 3BFOA 5E4EB 2DQCH 1NDMB 3L5JA 5B39G 4C57C 1XZ0A 3N1GC 3ZDXF 1ZS8B 4GUPA 2ZNXA 2VDQL 1SEQL 4TNVF 2OR8A 4HWEH 2UWEE 3D85B 3VXMD 3GDBA 1WITA 3IT8D 1INDH 1QFWH 1HSBB 3VFTB 4GMTL 1NGXA 4LGSB 4X6EB 3IB4A 5J13B 4D0BB 3RWGB 5C0JA 1OL0A 4WUUE 1WF5A 5KANI 2EXWD 4ENED 2PNDA 5FB8B 3MUZ1 1CDCA 4UT9L 1BIHA 1IC1A 5I73B 4GKSA 1EEYA 1IEHA 3IGAB 1MCWW 5LXGL 5EOTA 3NCJL 3PWVB 5HDQL 1F45A 4U1NA 4UMGA 5JORA 3IFPB 4YFLF 2A6DB 5D7IB 3MCLH 4X4ME 4E5XA 3OBAA 3UZVB 2A77H 3NFNB 1GGIH 3U2SA 1XR9A 4U33A 4RFEA 3DTXB 2AJXL 3RU8L 3IETA 4MQ7A 1EXUB 4K23L 1D9KB 4JM2C 3CDGB 4U6XB 3O2DH 2JF1A 3AREC 3IU4L 3ARBA 2Z91B 4LLUA 5C86A 3NCMA 4OCRH 4AMKL 1X9QA 4I4WB 5ADOH 1U91A 4P3CL 3C08H 1CF8L 3N1FC 4LU5H 3TT3H 4CMMA 3OAZH 4JO1H 5ITBL 5CBEB 1VSCA 4PRBA 2V2TB 5L8LB 5FGBA 2AXFA 3QZWA 1NBZB 1LEGA 1IKNC 1OLZA 4MJ6A 1EHLH 1A7NL 3MXVH 1U95B 1JWMB 3DX8A 4IDJL 3W9DA 4BSWA 3KVQA 1QBBA 1II4E 4KHXH 3MLTB 2XA8L 2FIRT 2NY1C 3Q1SL 3WNKA 4XPTL 2FJGA 5CBAA 1IM9A 2V9QA 5D71L 3CCHA 5JNYA 3VD5A 1IAIL 3MRBB 3U46A 1CE6A 1XF2B 4TOYH 1T83A 3WLBA 5JTWA 1I7UB 3SDXB 2AV7B 3AS1A 1JF6A 2NQCA 3KAAA 4OCMC 3U0PA 5FHAL 3RVVC 3WIIH 3ESVF 2X42A 3RZWA 4YK4B 1EEZA 3ECBA 4LCUA 3BP7A 4K3JH 4LKCB 2AXJA 3MUJA 3KPNB 1HHJB 4J3OC 4AIOA 4U1JB 4LARH 3VFGH 4HK3N 1NDGA 3BGFC 5TE7L 4U1LB 1F2XK 2WANA 2VMFA 5DJXA 4JQVC 5T3ZL 5KSAA 4Z7QE 1NC2D 4R26L 3Q6GL 4PJBE 4Y16D 2FIKA 4Z7VB 3UTOA 3DVFA 3MJ7A 3QWRA 2VZUA 2F54A 1YEDA 4QRSB 1OTTC 2FR4B 3IF1B 1FDLH 5KSVA 1CL7I 5IT2H 3ALXA 5JQ6L 1HHKB 4JANA 4C83B 3BXNB 3VH8B 3GBNH 3S5LG 4RMWA 3WHE1 4L5FL 3BHBA 4WO4B 3BQUD 2VC2H 4CU7A 4LEOB 3CXHJ 1J8HD 3LKSA 1WCBA 4J3VA 1KIRA 5JA8B 5E00B 2VQ1A 3I75B 1FLTX 4A6YL 4EIGB 1MCPH 4H5SA 4X8JA 4JFQA 1PKOA 2WM0A 5EBWA 4XCNB 4HUNB 4JGMA 5ESAB 2AJZB 1CFBA 4ZUSA 5J9PA 2XQBH 1LEKA 5D9SA 2FGWH 5I1LB 4K9EH 3MNWA 3UAJD 4ZODA 2R2HA 3RVTC 3MBXH 1RIHH 2NY0B 5D5MF 1CFVH 2PR4H 3F7RA 5IB4A 7FABH 3FO0H 1QTYT 2DM4A 1F5WA 4NRYA 4JPKL 3DX8B 1ZLUH 3LZFH 2PTTB 3OX8B 4JZJB 1FZMA 4NSKB 4OV6F 2XWJB 4JHBA 4B7LA 2AK4D 3RWDA 1OF2A 2V5SA 3ZL4L 3INUL 5KJRH 3PDDA 3VXSD 5GJTL 4XGZA 3HNSH 3VFVA 5LKNA 5ACZB 1FLRL 4Z7OF 5C6WH 5HPMB 5ISZD 3T04D 1AIFA 3DMMC 3UJJL 4HH9B 3WKMH 4DUVA 1JV5B 1F2QA 2HVJB 3EYUL 5J7CC 1A7OL 1GSMA 1K4DB 3S36X 3MRPB 2QHLA 3OAYK 5I66A 1JGLH 5MI0C 4EBQH 4MDIA 3LKPB 1L7TL 2NNAA 3OSKA 5KVFH 4LQ1A 1ED3B 4Y4KC 3MV7A 1I1FA 5J57B 5DLMH 4ZO7A 2BK8A 1JCKA 3SGJC 4UINL 2J88L 1BFOB 3GIVB 2P5EB 5I8EB 3TBSA 4BSJA 3RX5A 3OXSA 3S34H 3ECBB 2GHWB 5H37H 2IFFH 3QXWA 4DCQB 2NY6B 3NCYP 4LL9A 3L3HA 1GXEA 2GJ6D 4JFZL 1KELH 5AZEH 1KB9K 3HG1E 5E56A 5HYSA 2AJSH 5ETUB 4KMTL 3BO8A 2ITCA 3N1MC 3HLAA 2X9YA 5FK9A 4XNQA 4KUZL 2KQMA 2VDLL 4POZD 5FYKL 5B3JE 3HFMH 3TT1L 3L3JB 4Q6IA 5DUMH 3RJDA 5F1KC 5F96H 4DAGL 1IQDB 4NBXB 5GHWH 3IAQA 3KNBA 2VR4A 4XNXH 3TM6A 2OZ4H 3QUXD 1X5JA 1F97A 4M7LT 2VDRL 4GBXB 5DD3H 4JM2F 3ILQD 1W8OA 5JXEC 5DA0B 5EULV 5I16A 2VIRB 4G6KH 1EEZB 4I0PC 4QTHA 5DJ6B 1OOAA 3C5SA 1QSFE 3SDCA 1IKFL 3ZKXB 5KVEL 2DLFH 2OXHA 3LSOA 3S4SG 3CX5K 3L95A 4P9MH 3MV8A 1A5FH 2XPGB 2EDBA 2I9TA 2C4FT 3TPUA 5GGUA 3M17A 1AP2A 1CXFA 1AD0A 3BPLC 4P57B 3TIDB 1U58A 3LN4A 1ES0A 1KJVA 2F5AH 5H35B 4X8JB 4M5ZH 1BOGB 4JZJC 1WISA 3T08A 1EUTA 3BKMH 5EBWB 1RUPH 1ZA3A 1F13A 2R29H 4P9ML 1QRNA 4ZUSB 3VWJC 3SDYL 4WTXA 3HI6H 3ARGB 3WKML 3B9VA 4KK9C 1VCAA 2YC1A 4PJGF 5EU3B 5AWNL 3RHWF 4EUPA 2HLFD 4LSTH 4HIIA 4H25B 5C0CD 3SDXE 2DICA 2EDYA 2PW2B 3D9AH 4MD4A 1ONQA 1A4KB 2GITA 1TJGH 2IANB 3U6RB 4MVBD 1JN6B 4JFYB 4XNUL 3IJHA 2YUZA 2ICCA 5HGGS 2P45B 5C0GA 5T1LB 1M71A 5BO1H 1T03H 3T2OA 5AD0A 1BVLA 4MX7A 2YD9A 1FSKB 2QEJA 4WWID 1JGUL 5K9KB 3IDMA 3I6GB 4U4BA 3FB6B 3HUJB 1OW0A 3HFML 5C3LD 5DRZB 3W5MA 4CN6A 5HYJA 4JRYA 3X11A 3OKEA 2AEQH 3V6ZA 1IGYA 5DLML 3JUYA 3VU2A 5D93B 4JFFB 3C09C 3RPIA 2VC2L 2A83A 4MWFB 1F58H 3W0WB 1LEIB 3MSPA 5HDLA 5DD0H 5FIEA 4ODUA 4FZ8L 4LVOC 5TF1L 3ZKNC 5IQ7H 1K3ZA 3U30C 4D9QE 4Z5RB 4HPOH 3TA3D 3ARDA 5FK9B 5HHOB 2A38A 2LV4A 2Q76A 2MPAH 1BHGA 1EFXD 1TETH 4IOFC 4ZTOH 1V3JA 5KAQF 1A3QA 1OF2B 1RIVL 5I1DB 4FTVB 3FB7A 1A7RL 4XCYA 3TFKD 5KVGL 1GJIA 4L8BA 1D5MB 4NC2B 5ESQB 4I3RH 3HNSL 2Z31C 4R0LA 2B1AL 1CXEA 5EC1B 4KAQL 1Q0XH 1E4WL 4GSDH 3QDJE 3MV8B 4QRQA 4ZQKA 1T2QH 3UTSD 4WI3A 4KDVA 4X0KB 3AREB 2A2QT 2X7LA 5DVLA 2YK1H 4RISL 5FUCE 1DN0B 5C0AB 2AP2A 4IRSB 4YHYB 2J88H 2VZSA 1DQQA 2G5BB 5GRJL 4GLRH 3FT4B 3QBTB 4PGDA 5ANMA 3V4PL 4UQ2B 3G5XA 4Z7WA 4C58B 1WIPA 1FVDA 2CMRL 4JFOA 5DHXB 2VIRA 2W92A 3O4OB 2BNQE 4L9LB 3STBA 1KELL 4LLDA 3C6LB 1RJCA 1CFQB 3VXUA 4MA3A 1JPTH 1K85A 4PRPB 3QDGB 2HJKB 5MERA 4D0DB 3BEWB 3HZMA 2CLRB 2V17L 4K3DH 4H20L 4J3SA 1HEZB 2W60B 2BHZA 2X1XR 5K9JH 2IBZX 5IFAH 1AXIB 4FQJH 4YE4L 1Z0NA 3HCVB 3IJHB 4S1RH 4Z7QF 5F1IB 1F4XL 2NTFB 3LKOA 1X5KA 1P4LA 4LARL 3SHSA 3VFGL 1ZA3B 3JXAA 4X7FC 3FFCD 4KZDL 4S1DD 4LSRH 3C08L 4KXZH 1IC7H 4XI5C 3QNYA 3QT2A 3P30H 3FOLB 1KCVL 5HHNB 4Z8FH 3O11B 4ZPVA 2HLAB 4R26H 4GAGH 4HGKC 4NIKB 5C2UB 2ZKHH 5SWZD 5FGCB 1F4WL 4DKDC 3BT2L 1HXYB 2X4RB 2ADFL 5GJSH 3SKJL 3WFEL 3HZYB 2V9RA 1KCUH 2X40A 3T4YB 3BW9A 5ACLA 2BOBA 4GXUM 5GS3A 1HQRB 5AEAA 4IJ3B 5C0FA 3SDAC 1KBGH 2GQHA 5BQ7A 1MFBL 3ALWA 1KCLA 4KK5C 1FYTD 1Y6KR 5IVOA 1S5IL 4HC1H 5E8DL 4Z0BL 3OB0H 2QJDA 4UB0H 1YPZB 3S4SB 4F3FA 4M1GH 1YY9C 5D7IA 4Y5YA 4OUOA 1H5BC 1P2CB 3MGOB 2IBBA 1VFUA 4WFED 2VAAA 3A6BH 1F02I 1K4CB 5HDBE 3PWVA 3RTQA 2OR9H 5DJ0B 2ZPKH 2APXA 1MCKA 1YN6A 1D5BA 2AJVL 5DRZA 5GS2H 1DUZA 1QEWB 2BNQD 3FQTB 3RWFA 1S7QA 5DWUH 4OD1H 1Z9LA 4PLKC 4MA1C 2Y07L 3KYKL 5F97E 4R0LB 5KSAC 3QUZD 1DANT 1HNFA 1A7BA 1D3CA 5E8NB 1TVDA 5CIPB 3FOMB 1K9TA 3ULVH 2CR6A 3P0YL 4JPKH 4LLQB 3O2DL 3QISA 4J3UA 5EU4A 2LU7A 4YBQD 5DJDB 4HIXH 2EO1A 4V1DE 3SDCD 5DD3L 4P4KB 3STZA 3VCLB 5TQ0L 1LO2H 3T2NH 4M61A 2D7QA 3C8DA 4IDLA 3VXSB 3RVUD 4NQSA 3IVKB 4DK3A 1BJ1J 1CGXA 1SBBA 4J3WA 4XMLH 4DGIL 1R0AH 1CLCA 2XZQH 5L7XL 4KGJA 2C1PA 1T22B 4X6FB 3EO0B 3BYYA 5EBMB 4FFYL 5F3BB 3KPSE 1X6NA 4R3SA 1U8NA 1RJLA 4Z6AT 3DXAD 2W65A 2F58H 3KXFA 3W0WE 1A6ZA 2DS4A 2WWKO 3NGBB 1JPSH 4PJDA 3GSWB 4NQCA 4ODVL 4L29A 5BRZD 3SDDB 4MMZC 4RAVB 3FO2A 3RAJL 5LQBH 4Z7WB 3DUHA 1R3JB 4XMKL 4S1SL 2X7LB 4Q9RH 3ZKMD 3OB0K 1KIPA 4G9FB 4Z7WF 5J11B 5IVZA 1JWUA 1QACA 4ZSOB 2EE3A 3PWLA 5CINH 2H9GB 3H9SA 2OR9L 4HLZH 4BZ1L 3K80A 2YK1L 5E94B 2JIXB 1BD2B 1DP0A 1MCWM 2IPTH 2HT2D 32C2B 4TUKL 5JIPA 2A9ML 4ONGH 1Z3GH 1YNKH 3MRCB 4NQTA 2B1HH 1MCIA 3MRDA 1YMMD 4PRNB 2NTFA 1KSRA 2D03H 3SKMB 1I1CA 5HD8D 4LHUD 3PP3H 2GUOA 1IEBA 1HWHB 4GKZB 4LGPB 1GGCL 3RA7L 2FHFA 3OJMB 2XQBL 4OCWH 1ZT4B 3WIHL 2NNAB 3LPWA 5IMOA 2F54D 5HGDA 4P2OC 3UCRA 3TO2B 3C2AL 3MLRL 5IMKB 4YQXH 1AGDA 1T1WA 3JVGC 4GRWF 4JY6B 1Q8MA 3N1QC 1FG2B 3SGDH 5L2JB 3PWNA 1MELA 3RWIA 1QLFB 1A6AB 4LPXA 4J1UB 3SGKA 4XP9H 4LDEB 4PY7A 4QHNA 5JXED 2R23A 3DXAE 3P0GB 4YHOH 4OLUH 3VRIB 2EYRA 4XNQB 4WUKH 2BZDA 3RDTA 2DQDH 4EEEA 1FDLL 1NCNA 4W6YB 3MNWB 1S7XA 1F8TL 2ZJSL 3L5WB 1I8IA 2PETA 1IT9H 3H8NA 1BPVA 1NAMA 5EO1B 4PJCE 4PUBL 3C5JA 2D03L 5EOCJ 4JO2L 1KJ3H 1UJTA 4ZUUA 1KPRA 2F19L 3ZZ1A 1QZ1A 4LMQI 1JGUH 4AEIH 1QVOA 1PFCA 4JZOB 3ILPA 5ID0A 3M8OL 4Y4KA 1CGWA 4YHIA 2O26U 5DZNA 5EB9A 3RUGE 4FQQB 4KUCF 5M95B 4XNYL 4E41A 5GGUB 3JV4A 3HG1B 4BQ9A 1RZJH 5T1KB 4YXLL 5M7QA 2RGSA 3VA2C 3WIIL 4CVXB 1LP9B 4M7JL 4FABH 1DBKH 2G75A 4U6VL 3Q3GB 4HUXB 5D1ZD 5BXFB 4WW2A 1EJOL 1CR9L 1JPSL 1Q9WB 5HJ3A 3FO2B 3EUUA 3IDGB 1JZ8A 3B83A 1IAIH 2YSSA 2X9WA 3KJ4C 3MV7D 4G8EA 3QPQC 2DWEB 5EOTB 4Q6IC 5GRXG 3TN0A 5D5ME 5IFHL 4O9HL 4QXGH 3OMZA 2HT2C 5F6IB 4JKMA 1OSZA 2FECI 2DBJA 2A6DA 2DYPB 5TGBA 2W0KA 3DV6A 2MCG1 4HJJL 4L4VD 4HFUL 5C1MB 1WAAA 3T3ME 1SYVB 4QXUL 1WZLA 5DFWH 4KJYB 2Y25A 4OZHE 5MI0B 3QI9C 1N64H 5I16B 1QFHA 4P46B 5HHME 1P4BH 4LSSL 3UDWA 1NUNB 5F7EL 1RZIB 2BSSA 3G5VB 1DN2A 3C5ZC 4GW1B 4LU5L 3TT3L 3QH3B 4JJ5A 1J8HA 2X89D 3X3FL 4G43A 3GNML 2RQ8A 2GSIB 1GGUA 2YN5A 1LK3H 1UM5L 2X05A 5B3NA 3DX6A 1UXSA 2Q20A 3PWPD 3QPXH 4P5TA 3MLZH 5J6HA 3LB6C 5EUOF 3VFUB 4X7DC 1NDMA 4U05A 1LO3H 1LK2A 1JF1A 4GRWH 2HFEA 1SJVA 4J12A 3TIDA 1YQ2A 5GS1B 3B5HA 4XX1G 3S3PA 4URTB 4UDTA 4ZMAT 4D0BA 4LCIL 2XNAB 4OI9A 4F7CB 2DKMA 1HHGA 1RU9L 1T7YA 3VXUD 3ZSTA 3ZE0E 2H9GA 5BVPH 4HLZG 1PG7X 2YPKA 1YN7A 5KN5A 2X4TA 1IGFH 1ACYL 4R4FH 1M05B 1UACH 4PJHA 3U48A 4JM2A 1UB5B 4BUGA 2B5IC 2GT9B 3WS3A 2DLHA 4AEFA 2WMPA 4YR6B 4PJCF 4HXAH 3G04A 1YEKL 1OVZA 3KG5A 5MEOA 2VE6B 3QEUA 3ARBB 4NQCD 4Z95H 3TIEB 4F7EB 3U2SB 1C7SA 3ARFC 3QDMA 2R1YB 1OGTA 4LCCA 3IETB 4YH6A 3BDYH 3VG9B 1N5YL 5KSAD 4MNHB 1ITBB 3MA7B 4G6KL 1QKZH 4X0KA 1CL7H 2OSLB 1S7TB 4Z77B 1JI1A 2BSED 2E3VA 4NUJA 2BCKB 2F15A 4HPYL 3DHMA 3CVHB 4EDXB 2JKXA 4IHOB 5I6XC 2FD6H 1XGTB 2YPLA 4LSVH 4Y8AA 4HULB 1UH3A 4HUVB 1GCFA 3DV4A 5T3ZE 2ADIB 2XTJC 1RUKL 2XRAL 3HS0A 1NGYA 2R9HC 4HKBB 5DEGB 3UO1H 3E8UL 3IDIB 4ZDHA 5JW3H 1BVZA 4IJ3C 5L88L 1CE6B 3I6LD 3MFGB 1PQZA 2Z0BA 4H20H 2UVFA 4P49A 3FB7B 1RSFA 3V0AC 3IFNH 4JFXA 5GHWL 2W60A 5CBAB 3ARDB 1KIRB 3SCMD 3SGEH 3ET9F 1MH5A 2Q76B 2P43B 5ESQA 3HRZA 2R4RL 3AMLA 3R06A 4ODHL 2Z35A 4LKCA 1JHTB 2AI0L 2PYEE 1N7ML 3NA9L 4XPAL 4L8CB 1ND0A 1U8PA 5C0AE 1UT9A 2DLFL 2BNQA 4XWGL 2X4PB 2YMXL 4Y2DB 3BVNB 3UJJH 4PJ9A 4U1LA 3EYSL 1BZ7A 4MA1B 3L5XH 3BIBX 2WZPD 2HFGH 2NX5E 3FONA 1BBDL 4S1QL 1KXQE 4TYUA 2UWEA 4OV5B 4NSKA 3SPVB 2WINB 4M02A 4GS7B 1J5OH 4FFZL 3IRZA 2BVUA 1DDHB 1VFAA 3E2HB 3C8KB 4GG8B 2YPVL 4OIIH 1EDQA 3PQYB 5DFVD 3QHFL 5F3HB 4UOW0 4NP4L 1ZHKA 1YNTA 2EXWC 4ENEC 1AQDA 3LQMA 2EIEA 1XF4A 5T3ZD 4S0TD 2NW2A 2Z8WC 1UZ6F 1RUAL 1I7UA 4M48L 4F9LA 1ZTXH 1H3WM 1U9KA 4HAGA 3D3VD 5E8PA 3MJ9L 1IAMA 3W82A 1ZGLP 3QUKA 1C5BL 4KROD 3BZ4A 1CFSA 5EU6B 3FOMA 1CTNA 3PWJA 4MCZA 4HF5H 2GK0B 1CQKA 4ZAKD 4OZIA 4F7CA 2XA8H 3RGVD 1M7DA 2XQYG 5GRVL 1TCRA 3HR6A 5GJTH 1NC2A 3FO1A 4FN0A 2Z4QB 3S98A 2XZCL 2JIXD 5SWQA 2HFEB 1P7QD 2IQ9L 1KG0B 5BQ7B 3QUXA 1GOHA 2ZG3A 1XGYL 3GBNL 3UROR 3U4AA 2DQFB 1E0OB 2OQJA 2NMSA 3VH8G 3G04B 5AG8A 4FQHB 3O0RL 3OZ9L 3BRGC 3EO9H 1RJYB 2GAZB 5DEZA 3M45A 5JLZB 1P2CA 5AZ2H 4LHUA 4ZFZB 4YHYC 1MJ8L 4HWNA 5DMIH 1DLHB 4Y16B 5GRZA 2GT9A 4OGAD 4Y1AA 3WS3B 1MH5B 3N9GH 1JGVL 2P46B 3ROLB 1UCBL 3FQXA 3U7AA 4PJGE 1FIGH 5FUOH 5JMOC 4GAGL 1CIUA 2UZIH 4PJ8C 4LLVB 1OAXH 5EIQA 2ARJB 3QJFB 4X6BA 5K9OA 4U0RB 3WO4C 3RY6C 3WJLC 1AC6A 1M7IB 3UBXB 5IBTL 5KS9E 4K3JL 4DTGL 3KYMA 2BVTA 3REVB 4Z76B 3SE4C 1QHPA 4GRLA 1AR1D 4KVCL 5E1HB 1F3RB 3BUYB 1DANU 3PWLB 4PUBH 3ILQC 4PYHA 1I1RA 1SYSA 4NBYB 2VITB 2HP4A 5IHBA 1NCWH 3NCEB 1JNNH 2GY7B 1SEQH 4W6XB 3S3SA 3PGCA 3MREB 1QLRB 2FZ3A 2VSCA 1AXSA 5DF0A 4EBQL 4G7VH 1HH6B 5TE6H 3EFFB 1MUJB 4ZXBC 5T3XL 5SV3A 4P46C 4O5LH 1EO8L 3NIGE 2VDPL 1CGSH 3VWJD 5DD6A 4BFIA 2FECL 1RZJL 3JVGA 2AJUH 4X9GA 4LVOB 3GBLA 1B0GA 3V5HB 1MLCA 3IDMB 3H9SE 5HPOA 4MXWH 1BLNB 2DBLH 2VISA 1V7NL 2BJML 2W65B 3GO1L 4GBXC 5KOMC 1AFVL 1DLFH 5EU7E 2VZ1A 1MI5B 3O4LA 5IMKA 1TTFA 5C0JB 2JCCE 4TVPH 1QBML 4R97B 3VI4F 1MRCH 4YGVB 1H15A 2FL5B 5HYFA 5ERWB 1RZFL 3MJ6A 5F88A 3QG7H 5FKAA 5GS0H 3PWJB 1UZ8A 2PYFB 4ZFOL 4F33B 5IFJA 2GK0A 2EIDA 2C1OB 2WWMD 3O6LL 1H8NA 3BH9A 1ZLVH 2FLBT 3DROA 1YDPB 5CEXA 1F90L 5I76A 4KV5E 2ENSA 2NW3B 1QBMH 3MV9A 2PO6C 2IAMC 1I1AB 4R0LC 4X99A 2JIXA 1FC2D 3GK8H 4U7KA 5DS8A 3MCLL 5T1MA 3KYKH 3IU3A 2VXUL 4LDLB 1MCRA 2O5XL 2X10A 4HSQA 1RMFL 2AJUL 4PBVC 2VB5A 4XXCC 4JLRA 5TF1H 1JGEB 1C1EL 4U6HB 1E4JA 3NABH 2BVQA 2YUXA 5K9QI 3M1BB 3HUJA 1A1OB 1J10A 2H3NA 2BHUA 1REIA 4HZLB 5I1IH 1H3VA 1CU4L 1IGTA 2PXYA 3BRDA 1NGQH 4JDTL 1MAJA 3FO1B 4GBXD 1JWSA 5JR1H 4K71C 4IS6B 3RWIB 3UYRL 1BAFH 5HGHA 4TVPL 2A6JA 3ULUD 3V6ZB 4LCWB 1ETZA 4O51A 2VLKA 2BNRB 3TVMA 1HNGA 2NZ9C 1K8IB 2FJHB 3S3JA 4NO5B 2YD7A 4S0SD 1N8ZA 4K71B 4E41E 3AU1A 3KPSB 1V5JA 3UTTE 1KCVH 1T0NA 4JY4A 4Z8FL 1XF2A 4FFZH 1OAZH 1EMTH 5EU3A 4FFWC 4Y4HC 1PJ9A 2R23B 1MRFL 5FOBB 5K9JL 5DD5L 3CFEA 3CNKA 3FT2B 4NPYB 3D2UD 4C56D 1NKOA 5CSBA 2Y06H 3ZHKA 4FQXA 4M6OH 3RI5K 1OT2A 4NHCH 1HIMH 1RJYA 2GAZA 5DC9B 1IGML 1J1PL 4G8FA 4PLNC 4ODBD 1N64L 5TDOA 4NZRH 2DTML 4LLYA 1UWEL 2FWOA 3UBXA 3PV6B 4DKFL 1I1AD 4RFOH 5T5FL 4ODXA 1AI1L 1OT1A 2QSTA 2IAMB 3MRFB 2V2WB 1G6RL 4XZUA 5IBLC 5T1DH 3VDCA 3DVNB 2NY5C 3FT4A 5IVXF 4ZO8A 1R5VB 4GQ9L 1BFTA 3G5XB 3L5HA 4CVXA 3RBSA 1NUDA 3W5NA 2GFBA 2W9DH 5E8DH 3I02B 1S3KH 2DLIA 4PP2B 2DIBA 4HKJA 3RFZC 1PY4A 3A67L 1LNUB 4EUPH 2H1PL 1GZQB 1FV1B 4Y5YB 2NR6C 3E8UH 4J3XA 1P5UA 2YSSB 2CJUH 1OGAB 4EI5A 1YEEH 2BVYA 5BJTA 4ZNCD 4OBRA 4DZ8A 3PGCB 1HHKA 1AR1C 4JANB 4NRZA 4C83A 5DK0A 4YFDB 3TCLB 4RMQA 5B4MD 4G3YL 1I3RB 3V9FA 3QUMB 4EI5C 1G9NC 2Y07H 5ESAA 3SKOA 3L6FA 3NFPA 3QUYC 2IQ9H 1F3DH 3AXLB 1OWWA 1T5WB 1CQYA 1U8JB 3M1BA 3FQNA 1RJZA 5DVNA 2C1OA 3W9EB 1IAII 2UY7A 2AJZA 4TTDC 1HH9B 3DROB 3RVVD 3PGDB 2Y6SD 5T1KD 5SWSB 5DFTA 4UB0L 1H9VA 2XTLA 3HI1B 2BSTA 3BEVA 1TJHL 5KVFL 3DNKA 4BA8A 4PRPE 4MJ5A 4HC1L 5MEPA 3DRTB 5C0FB 2Z8VC 2CLVA 3MRLA 1KLGA 3MRKA 3WD5L 4XPBH 4GO6B 3O3BB 2LQRA 4YBLB 3LKRA 4HUUB 1ORSB 3QCUL 1CVRA 1JF1B 2NX5D 4QKXB 1ZHBA 3BKJH 2ZCKL 4LASH 5EPMA 5JDSA 5DJAA 3GSXA 3TCXA 4QRUB 3MRGB 2KZWA 1WZKA 3DRQA 4Z7OE 5KVDH 3LEYL 5MENB 3EOYG 1WIOA 3RWHA 3O3AA 1IGTB 1IAOB 3KPRD 3TO4D 4LCCC 1PAMA 2AK4E 2DM2A 3QEQB 2Z8RA 5HY9A 4MS8C 3C6LD 2ZCHL 1CDIA 2ATKA 4Z78B 5C07E 4UNUA 3D85D 3VXMB 4K7PL 1PW3A 4JM2D 4R4ND 1CFTB 5GS1C 1N6QL 2WBJA 3K7UA 1U0QA 2C4XA 5IG7B 5C07B 5TE4L 1OD9A 4YPGB 4ZPVB 2OJZL 4HK3J 4RFOL 1FNGA 3I9GL 1XCQA 1AD9A 3CDFA 2OSLA 4Q9RL 4HIEA 4LCWA 3TYFA 1DDHA 4X6CB 4MNQD 4IMLB 3V4PH 4W4OA 4D3CL 4NWTH 2XV6B 3GIZH 5LAXA 1HQRA 2R1WB 2R69H 1P4IH 4YUEL 3U36A 4N0YL 3GBML 4KI5E 1F4AA 3G6JF 1YPZE 4Q6YA 4YZFE 4HG4K 1L4IA 2NXZB 1BZ9A 2NY1B 1YEKH 1LDPL 2FEEL 2OMNA 1NBVL 1DBKL 2CH8A 4H88H 4QOKE 5E6IA 4JPWL 1YPZA 1FGVL 5FCSH 3ARUA 3CXHK 3OQ3B 3T09A 4EI6B 1EO7A 5DK3A 4QHKI 1FVEB 2XQYK 3BKCH 1Q9LA 4LIQE 3L9RA 5E6IC 5IOPA 4FQCL 1YN6B 1FYTB 2FEDC 4LSPH 1OTSD 2I27N 5L2JA 1RFDH 4G8IB 4F9PA 4MJIA 2HWZH 4A6YA 3AFLA 4HPYH 4OZIF 4JPWH 4B50A 4HKXB 1FYHB 1X4ZA 4CU8A 3HZVA 1JHTA 3PHOA 1MIEL 3T65B 3QUML 3CSGA 1MIML 4FTVD 5INDB 4XVJH 2J12B 5I71B 4OF8A 2IF7A 5EO9A 3MMEB 5DXWA 1AO7A 2CLVB 3MRLB 5T5NF 5JA9A 4KJQC 4N90E 1T6VN 2AQ1A 3I6KB 5ILTL 1S8DA 1NCAL 2ED9A 2C9AA 2NY4B 4M3KB 5CWSA 4NM8H 2NX5A 3SKMA 3TNNA 3EAKA 5GRVK 3VI4E 3OKOB 1QVOB 4OM0H 5A2FA 5D96B 5DQDH 1I9RH 4NM4H 4D94A 1FG9C 2AJ3A 4YHOL 3IJYB 4HX1B 4PG2A 1J88A 3GJFH 4XXCA 3VXRD 1EAJA 3FFCE 4E41D 4XBPA 1GH7A 1TTUA 3SCMB 3ZYOA 3QQ3B 2WLYA 4J4PC 5CS7A 3SEPA 5KZCD 4FOMA 2B7DT 4P23B 3HKFA 3O2VH 2FB4H 4RA3A 5ITBH 4PG9A 2D7OA 3FO9A 1AD0B 1NCDH 3D1MC 3K1KC 3KPOB 4H26B 3QRGH 1RJZB 3C5ZD 2NYYD 3OAUL 1EAPA 4MXQC 4MMXC 4B7IA 3HC0B 3MV8E 4XMPH 2R0KH 2OM5A 2YRPA 5DJCB 2F9BT 3OGCA 2A77L 1U3JA 3BP6B 2B1HL 4XB8A 3NCFB 4KJWC 2P24A 5GGTL 3UBXG 3ZKQD 4KWUA 5AYQA 4PJEF 4F57L 4F15C 3GKZA 2BSRB 1WBZA 2H45A 3MUY1 5F7WC 3UC0H 1WTLA 3WL9B 1T2XA 2FX9H 4OZHA 2D7PA 3MA9L 4QXTA 1HOCA 1A3LL 2C3XA 2VABB 3S35X 5ID0B 2ZSVA 4JKPH 5DJAB 3MRNB 2QADD 5A2JH 2A74A 2E7LA 2EDWA 4XTRC 4FQQA 4UZGA 3ZHLA 3RUGB 4KH2A 3BD3A 3B2UD 4TPRL 5IBUB 4CVZA 4Q7DA 1I85C 4G6JL 3OV6A 5IF0B 1S7UB 5IHLB 1MHPL 4NQDB 4PV8A 1FN4A 2G75B 4WW2C 1ZSDB 4KK8D 5BMFL 1XCQB 4I77H 4OD2B 4PJ7E 1J0JA 4X4XA 1LQSR 3JV4B 1J1XH 2X4NB 3Q6GH 4LPWA 1LO0L 4B0MM 1MCNA 3VGFA 2BNRD 4APQA 3QA3A 5JUEL 2CD0A 2CKBL