2MNUA

Backbone and side chain 1h, 13c, and 15n chemical shift assignments for edb and specific binding aptide
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
93
structure length
93
Chain Sequence
b'GSEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EDB
publication title An Unusual Protein-Protein Interaction through Coupled Unfolding and Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 3
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mnuA00
2N7BA 4XAKD 5DEFA 2R0WL 4NQCA 5EUOA 2XNAB 5DA4A 2AI0L 1MJ7H 4R7NB 5I0DA 5F70A 3PL6D 1OP3H 3F7QA 3S37X 3QO0B 3BSZH 5F72S 4NZRH 3OBAA 2BC4B 5EU6B 3BP6A 4AEEA 2ESVA 3QWRA 1I8KA 5IKCA 3VD3A 4X98A 5MEOA 4QRQB 4YBLC 3CFCL 1D5ZB 3SE9H 2Z8SA 4JG1L 3MNWA 4LLUA 1J5OL 1GRWA 3QQ3A 2XPGB 4I0KA 1P4IH 1E6OL 1OW0C 1KPRA 1JGVH 3KLHD 4ISVA 4N5ED 3ABZA 5FO7B 4NSKB 1L6ZA 1V3JA 4GG6E 1TJGH 1N7MH 5BRZD 5A2KH 3TVMB 1RMFL 1CLCA 3RU8L 1VKXA 4K55A 3LZFL 1AGBB 4GRLA 2QQKH 5EIIB 5C0BB 3U83A 1EBAA 2Z0BA 4IS6B 3V7AG 1IAIM 5TH2A 1IKFL 2YZ1A 3C08L 4XAWL 2P24A 4OKDA 4YR6B 5F9JB 4ZS6D 1PAMA 4F9PC 3MJ8B 5KSUB 1TVHA 1MLBB 4XX1E 2VXUL 2XQYG 4ONGL 1I1CA 4TUOB 5JW5B 1HILB 3U36A 2GT9B 1P4LB 4JY5H 3QHZH 3O6FD 4QO1A 1OT1A 5AAWA 4XHJC 2R2BB 4X0KA 1DDHB 3OJMB 4IIQC 2NY0D 1KLGB 2BOBB 5K9QI 4ZUTA 1FCGA 3TIDA 1TQCC 5BW7A 3P4OA 5HPOA 5DEZA 1IGYB 3RL1B 4HBQA 5C0RH 3MBEB 5F6IC 5LAXB 3MX0A 3SJVE 1KUMA 4PLKC 4XNMB 3MOQA 1QSFE 1ROWA 3C5ZB 1UG9A 2VLKA 4P23D 4HS6B 4N9GB 3ZT5A 2XKNA 2CJUL 1GJIA 5CJXC 1JHTB 3G5XB 1U6AH 2ADFL 3VXMA 1RJYA 2C7UA 2XZAL 2ICWA 3SKMA 5J13B 1HYSC 2ADIB 5E8PA 2F9BT 4G8EB 1MY5A 5K9KA 3EOBB 5ADPL 5A2LH 1EFXD 4I77H 2F54A 3OAZK 4QHMA 3O11A 5HHPA 1CT8A 1T80A 4M7LL 3ZTNL 3C5JB 4QHUA 4X7SL 4GOSA 4MHHI 1FNSL 1OWRM 1L7TH 2VISA 4LDEB 4UT7H 5DK0A 1NDMB 4GKOA 3MLWH 4Z78B 4NDMB 4NQDD 1V7NL 1WWWX 1RK1A 3HUJF 5FUZH 1MHEB 4JHWH 1AKJD 2ENSA 2OTUA 3ESVF 2BVPB 4JM2D 4L8SB 5DJ8A 2B39A 1IC7L 1JYNA 2GITB 2QKIA 3FN0H 3LKPA 5GGTH 4TRPH 4DTGH 2YPVL 3GI8L 4HXAH 4HMDA 5C0CD 5CKAA 2VN4A 3ARDD 5D7LD 3WL9B 3QUXA 3GSOA 3RY5A 1KJMB 5I1JH 5JW4N 1BAFH 2DM3A 4YGAB 3L1OL 4UIMA 3WSQL 2K1MA 4P59H 4O5LL 1YNLL 3B83A 4DGYL 1NDGB 4FQ1H 5B8CC 4GXUM 4IRJC 3P4MB 3QPQD 5CP7A 2D3VA 1EJOL 3RHWK 5L2KE 2CK0L 2E6PA 4P2CG 4U1LB 3RI5F 1FORH 1YEFH 4QXTB 3NGBB 3OXRB 3Q3GA 3PIQB 4U2YA 5EO0B 1XGYH 3GBML 1GHFL 2AJVH 5FA4B 3DI2B 2PXYA 5BS0E 4X80H 1RUKH 2D0GA 3BPNB 3QXTA 4OQTH 1MFDL 1FCCA 2NW2B 4MXVE 3WEXA 2WBJB 2FECI 3P11L 2BNRB 1JPSH 1N64L 5CBAA 1LEIA 4ZTPH 1OWWA 5HVFB 4QT5A 1KLFA 4Z18A 5HI4C 3QFJD 1JI2A 4ONOA 4RMTA 3GHEL 1MI5B 4JEGB 2FBJL 5E2UL 3DVFA 3MGTB 5I19L 3LEVH 3SDYH 2YEZA 5D72H 4DUWA 4L4TE 5B4MD 3OKKA 3O6LL 5ACMA 3V5DA 4WEBH 4D9LH 5C0AB 5KSVB 1CLZL 3O3BA 4NQXB 2IFGA 6FABH 3O2WL 1IQWH 4KK8C 2DQTH 4TSBH 3JV0A 2R4RH 5I1AB 4HT1H 4D8PB 3WLBA 1JF1A 5DDHA 4HIXH 1A1MA 3QQNA 1XIWD 4ODSH 5JHDD 2C1OA 1DLHA 4RQQB 3AMLA 2AEQL 4XCNA 5CJQL 4OLYL 2EC8A 1ZOXA 5D9SA 1F8TL 5K33A 5HGGS 5HYSA 2DL9A 5FGCE 2D31A 3VDAA 4LNRB 4PJAF 3HC0A 2QQQA 4C54A 1FNEA 3MXVL 1MIML 4RAVB 1IGFL 2NY6C 2H8PB 1PY4A 2VDPH 4N68A 4RIRB 1OD9A 2DB8A 1EERB 1Z0NA 3NOIA 1HIMH 4JFXB 4XVTL 4XCYA 3CNKA 4V1DA 3O8XD 1BFTA 3FHQA 1SEQL 4OBSA 4PGZA 5KOMC 3U4EB 3BN9C 1BD2D 3HLAB 4JJHA 1DQJB 2X5PA 4KJWC 5HGBA 3WNOA 2EIBA 3VXSA 4A6YA 2RBLA 5SV4A 4XNXL 2FO1A 1I7ZB 3LS4H 3QCUH 3E2HB 4FS0A 4HIHA 2XKSA 1WGOA 2I07A 4WI6A 5JDSA 4HKBB 5D2LA 4WDIA 4OFYA 3EYUH 3NCJL 5CZXC 3T77A 2AK4D 4OUUB 4ZSOE 4BFGA 1A3RH 4ENED 3QCVH 3UX9B 1U3HC 4M6OL 1DE4A 4PG2A 5KS9A 2VITA 3TJEH 1I8MB 2YMXL 3I9GL 4KJYA 2OP4L 1IAOB 5EU3A 3MFFA 4R0LC 2ATKB 1J05B 1FVEA 3TBVA 2NZ9D 5DJCB 3OB8A 4EUPA 4UOJA 3W39A 4GXVL 1A7PL 5CGMA 5FK9A 5SWZE 2HT3D 1A4JA 5INCB 4HD9A 5I75B 2JCCE 1YN6B 4I3RL 3CVIH 5IVZA 2W38A 4U0RC 3TBTA 3HUJE 1ED3B 2K7QA 4RMUA 5AWNL 4HIJA 4MD0A 3QXDB 5CZKA 3C5SB 1T5WB 2RHEA 2DL2A 5E8OA 3VXNA 4PG9B 1A9BA 1OARL 4I48A 4G7YH 1QO3B 3AS2A 1PY9A 1F90L 5DRXB 3D0VB 1F97A 4XNUL 4ZNCD 1HOCB 4C4KO 2RFXA 5I76A 2VH5L 4HWZA 5I8OH 1I4FB 3WFEH 3LCYA 1KBGH 4NHUB 4F8TA 3VXRD 4PLJD 4XPBH 1J8HD 1FN4A 3JV4A 5J1SC 2M2DA 1J11A 2NY1B 4IIQA 4KJQC 2PTTA 4OD1L 1F58L 1G6VK 3W0WA 3AVEA 1AXIB 3FFCD 5EORL 1T4KA 4FQ2H 5JW4R 5T3XL 5ADOH 2FH8A 4Z95L 5C2BL 5FKAA 3MOAH 4LSVH 3VFVB 1WZMA 1FHGA 1UM4L 3UO1L 1NKRA 3H9SD 3FO9A 1VGKA 1NL0H 1A7OL 2E9JA 1U2CA 4KJPC 2YA2A 3FRUA 5CJXA 4PJEB 3ULUH 4PB0H 1W2KT 4ZS7H 4HS3B 3HG1D 2CDGA 1FZJA 4O4YH 1K85A 2IALA 4L1HA 2EIEA 4TTDD 4JFZL 2VSDA 4F80A 5TPWL 3KPLA 2A0LD 5FYKU 3T3PF 3TIEA 3KPSE 4MA3B 3S36L 2WQ8A 3OWEA 5JW4Q 3BZ4A 1A1NA 1H15A 4X7TB 3QEGL 3TVMC 1ZHKA 1FH5H 2MQ3A 3BRFA 2HMIC 3MBXH 1AR2A 1WAAF 1TTGA 5FV1L 2Q7YA 4K07A 3A67H 1R3IL 4HC1H 1KIRB 5IG7B 4DW2H 3QDMD 2A83A 5MERB 4FQQB 3ARED 1NAKH 4KTEH 3GGWB 2OSLB 4PGDB 2BOCA 4Y89A 1A6WH 2HKFL 4AH2B 3DUUB 5F3HB 5C0DA 1DJSA 3PXHA 2CXKA 3KG5A 3O2DL 4XP9H 2CQVA 3WFCH 1R5WA 3BE1L 3FAWA 1S9WA 4FABL 4Y2OA 1DBJH 1G7JB 1HEZB 2O5ZH 4NOBA 4CVWA 3S4SG 1OTSD 5DJYB 2BMKA 3HNTL 5EA0L 3QUMH 4KXZH 2V5MA 1YEIH 4HCRA 4RX4D 4KRMB 3DX6B 3KPRA 4XHQA 5EZJB 4XNYH 4Z7UB 2VWEC 5ISZD 5E95B 1IEBA 1XGUB 1MQ8A 1BM3L 3KYAA 4PJIB 1IM9D 1AXTL 3DWTA 2NY7H 4YLQT 2R69L 3MBEC 1ONQB 2V2TA 4LKXA 3UPRB 5GS3A 2XIDA 1BVKA 4TVPE 1NMAH 5EOTA 1LDSA 2Y06L 5EFIA 4G6KH 2W0FA 3GMRA 1FL6B 3BKML 1YYLL 1EXUA 1I7TA 2H6PB 3T4YA 5E2TH 4MYWB 4Y5XA 4PV8A 5J13C 1I9IH 3I02A 4WTZG 4NWUL 4ZUSB 4KY1H 5C0GB 1N5YL 5E94A 3VFWA 4JFFE 2HN7B 3HMWL 3RVVD 3NH7H 3TCLA 1ND0A 2OK0H 3SCMD 3IFLL 1YEKL 1P7QA 4F2MB 3S4SB 2LU7A 4L4VE 5I1EL 1JNHA 3V6OC 3U48A 3JV6A 4UB0H 1EMTL 4GQ9H 5IB1B 3DXAE 4LOUD 1YMME 3MV8E 3OG6B 3RJDA 4K8RL 4JZOA 5DHVB 1IVLA 5I1CH 3JSSA 3ZKXB 3B3IA 5ENWA 3X11A 1S7WA 3JZ7A 4NKOA 5C86A 3HMXA 2YUVA 5LWYL 4G5ZL 3ZDYF 12E8L 4XH2A 5JIHA 1GXEA 2P4AB 1CGSH 3VJ6A 5F88B 1TJIL 2B1AH 3GDBA 3ARFB 1Q0YL 3ZE1F 1HI6B 1XCTA 3CX5J 2EYSA 1NGWA 2JB6B 2X70A 1CF8L 4FFZH 4JN1L 4X9GA 2O5XL 2R8SL 5T3ZL 4K2UL 3CXDL 5IB5B 3OTTA 5GS0H 1G7HB 5C08A 2BFVL 3RGVB 3D39E 1BQLH 1K4CA 2R0KH 1YNKH 1T20B 5DJAA 5D93B 1S5HA 2CSPA 3PNWA 3SDDB 3QDGE 2V7HA 2CDFA 4OI7A 3BPNC 1QOKA 4JDZB 5FIEA 2GFBB 5IV2B 3KPOB 1CQYA 1H9VA 3BO8A 4PJBB 2WBJC 4X5WA 1M7DA 4GLRI 2VXTH 3H8NA 4LRNH 3SPVA 3ZYJA 3LKNA 3F5WA 4KRNA 2NX5D 3B9EA 2XQYK 3MRJA 1A7QH 1KJVA 1RURH 1IBGL 4M6AA 1IL1A 1W0WA 5HI5C 3BZFA 5E9DD 4U1IB 2GJ6D 1X5HA 2Z35B 3HE6D 3ILPB 3QJFA 1V3MA 1PD6A 2JK5B 5KVGH 3GBLA 1G1YA 3CVHA 3FQTA 1AI1H 4LSUH 1PDKA 4J6RL 5C3TA 3REWB 4JRXB 2Y1VA 2BHYA 1U3HA 3WFBH 3GHBH 2CIKB 4JKWA 2IPKB 5DRWA 2UVEA 3RWFB 4R7DB 4YDVB 3L7EB 1VDGA 4HK3N 4P5MB 1NC4D 3C2AH 4NZTH 3DMMA 3MOBH 1PVHA 5ANME 3T3PE 4KFZC 5DJ0A 4UT6L 1F11B 1KB9K 2FJHB 3ARGB 2IH1A 4IEFB 1T7YA 4MHHG 5DD3L 4J23A 1CFSA 4YE4L 1CQKA 3MV9B 3G5VA 5F7WC 3DGGA 1WAAE 3D5OF 3QRGL 4DKFH 1BJ1J 4OCLC 5DHYA 1MNUL 2XG4A 1U8NB 1HQ4B 4JPWH 2XXMB 3BMVA 4KROD 4N90E 3GJFH 4EOWH 1MVUB 2AJSH 5EDXA 2B1HL 3BHBB 1LK2A 4QCIB 4OZFA 1NFDA 1NCBL 3NFSL 4M43L 5CFHA 1WZ1L 2ZZUT 4LAQH 4MNGA 1HHJA 4WI7A 5DEGA 1KC5L 3U1SH 1NGZA 1WWCA 2DQEH 1LO4H 1WLHA 4G7VL 4Y1AD 1AGEB 1HH6B 5LG1A 3V7MA 3IFPA 2P5WE 1K6QH 3O3EA 3RKDD 4NQSA 3S36X 2VLJB 1D6EA 2HJKA 4NUJB 4CAGA 1T21A 4QTIH 5MI0B 1KT2B 2DBLL 5I66B 5INDA 1SM3L 1IGIH 4JJ5A 1OL0A 4Z0BL 2KKQA 3JWDC 1HQRB 5KOVC 2XNAA 4Q9QL 4R7NA 1KTKE 2FEDD 4OSUL 1G0DA 5D6CB 3NA4A 3WDIA 2BC4A 2KL6A 5EU6A 4LNVA 4GAJL 5HYQB 4YPJA 4QRQA 3N1PC 4KI5C 4UMGA 4N0YH 1D5ZA 1U58B 1FFNB 1TZIB 2XPGA 3GIZH 1SJVA 5L88H 1DBAL 3SGDI 4TVPH 4Z8FL 3ROLB 1JPTL 1XF2B 3H7BB 3D48R 5FO7A 4DGVL 4S11A 4NSKA 2DQDH 4WCYH 1HE7A 2VXSH 5IHLB 1JIBA 3TVMA 5FGRA 4MA8L 4XMKL 43C9B 1BOYA 4LHUG 5T5NG 5I75C 5LBSL 1AGBA 4S1SL 1HZHH 5F1SA 4Q58C 1M7IB 5C0BA 3F7VB 4OIIL 5IJKA 4NC1C 4BJLA 2DM2A 2X44D 4IS6A 4OGYL 4UDTB 2EIDA 2NY4D 4G43B 4HWEL 5DT1L 5HHMD 1FRGL 4P46C 4B50A 2W91A 4YR6A 5F9JA 4Y19B 1OPGH 2AJUH 2H1PL 1LHZA 3MJ8A 2X09A 5KSUA 2X1XR 4PTUB 3RWEB 3ZDYE 2YD8A 1MLBA 1H3GA 1RIHL 4WFED 1FAIH 3RZCB 1YPZB 4TUOA 4YC2B 5IIEB 5JW5A 1YECH 2JELL 1HILA 4WY7L 1OGAB 3ZE1E 2GT9A 1P4LA 4R8WH 1BEYH 2Y36L 2DLEA 4EXKA 5DVOA 1QKZL 4OTXH 1KLUB 2R2BA 1DDHA 3Q2CA 1KLGA 1YA5A 2FECL 2R1WB 2WUCH 3ORJA 2BOBA 5E2WH 5IWLA 4Q9RL 3TYGH 1D5MA 1IQDB 1QSED 1IGYA 3RL1A 4RA0C 5GRYA 2XN9E 3GSNH 1EGJH 3MBEA 2DQGL 3BAEH 4RFNB 4NFCA 5LAXA 5C09D 4UTAL 4XMLL 1OAYH 4FZ8H 4KC3B 4XNMA 3C5ZA 2P46B 3C60B 1H3PL 2X9WA 4HS6A 4N9GA 4DFIA 3KDMB 5AYUH 3FO1B 3STLB 1YUHB 2FX7H 3DROB 1EBPA 4NKQB 1KEMH 1JHTA 4LSSH 3G5XA 5ESQB 3MLSH 1KJ3H 3U30C 2E7CA 5DRZB 3T3MF 1T7VA 4NOFA 1ZV5A 2ADIA 2GK0B 4X6FB 1QPXA 2VIRB 3VGDA 4G8EA 3EOBA 4PRPE 3QQ9C 3QRFM 3AGVA 3L3HA 5E7BA 5JIKA 2HH0L 4HF5H 3RTQD 2EDYA 3C5JA 1WUNT 2R9HD 2ZG2A 3C8DA 2EE3A 1UKQA 4LSTH 2B5IC 1EHXA 4M9PA 2AGJL 2DYPD 2EE9A 3SOBH 1NDMA 3VG0H 2HJFB 4F37K 5DS8B 5TFSH 5BCAA 4GMTL 1UQSB 4W4OC 1OTTD 5TE7H 4Z78A 4NDMA 4Y0GA 4OIBA 4G6JL 1GIGH 4BKLB 1MHEA 3CUPA 3TLRA 4M3KB 4N5UA 4OD2B 4WFGE 4DUXA 2BVPA 3AROA 4L8SA 2GSGB 1QRNB 1XR8B 5IBLD 2NR6C 3HHRB 1JVKA 1IE5A 2YKLH 4TYUA 1T1YB 3WL9A 4HUUB 1DL7H 4BYHA 1KJMA 2ZWLT 3BDYL 4NQCE 5EUOE 1I7UB 2YA1A 5B3NA 2MKLC 3IT8D 3TNNB 1NDGA 4YBHA 4GUPA 3P4MA 5CMAB 4MJIE 1R3KB 2H45A 2YD2A 1I75A 4QXTA 3OXRA 3IDGB 1C5DB 5HYJB 5EO0A 3PIQA 5FA4A 1OB1B 2EYRB 3E8UL 4BSVB 2X4OB 1RVFH 2ZUQB 3VFTB 3U0WL 2NW2A 4W70A 2WBJA 4QNPF 4RMSA 5HSFA 2IAMB 4J4PD 2BNRA 4JFQA 4Y4FC 7FABL 3V6ZB 4G6ML 4WI9A 5DXWA 3ULVL 1MI5A 2W9EH 2Q86B 3MJ9A 4Y2DD 5EBWB 2P8MA 4KKCD 3VDBA 1PKQB 5FYJE 3C6SB 3QEQD 4P3CL 2ZUXA 1FSKC 2VC2L 3B9KB 1NUGA 1DSFL 3MUJA 5C0AA 1NFIB 1U0QA 5ICXB 1SBBA 5KSVA 4WW2B 3B9VA 3PWVB 4NQXA 5HHVH 4ODTH 1ACYH 1HHKB 1HSBB 1Q72H 2X4UB 3AC0A 1CICD 3CLFH 3QUYB 4G6AD 4PJ9D 1QLRB 3CMOH 1NANI 3DYPA 5I1AA 2YPLE 4M6NH 4D8PA 1OCWH 5GS2H 4CN4A 2N7AA 3G9AB 4GBXD 1N6QL 4D9QD 4NRYA 3MCKB 4RQQA 3FQUB 3BH9A 1WT5A 5BO1L 1MFCH 4ERSL 3GKWL 1HNGA 1RZ7L 2FHFA 2R4SH 4LPVA 1ZVYA 4JFDB 3S3JA 4KVNL 2VDQL 4MA7L 3W81A 5C0RL 4NQTA 5KAQF 4LNRA 3L3GB 2OMBA 1PZ5B 5J3HC 4RAVA 2CKNA 4MGXA 5BZWB 5TJWK 4QRSB 4RIRA 1ZWIB 2AK1H 1PFCA 4JFXA 1BF2A 1T2JA 2ZG3A 1PG7W 1SYSB 3RGVC 3VXME 4MNQD 3U4EA 1FO0H 1NMBL 3HLAA 4HWBA 4D2NA 1DQJA 1L6XA 4Z6AT 5D93C 3MV7D 1UGNA 3SDDC 3AU1B 2O61B 1I7ZA 2UYLB 4OB5L 3UJIL 1SEBB 4OIAA 2BERA 4OF7A 5FYLE 4UIKH 3OAYH 4EVNB 3I6GB 1AO7B 2OXGA 3DI3B 5TF1L 1A7BA 2ARJQ 2CD0A 4LEOB 5CGYD 1RUML 4Y5YB 4JHWL 4OUUA 1JE6A 3ULSB 2XKUA 2J7LA 4ZFZA 4AENA 4CJ0A 3T3ME 2OLDA 3UTPE 4E5XB 1KELL 1G6RB 5F8QC 2AABL 1FQ9C 2NY3B 1I8MA 3DUSB 1IAOA 1Z2KA 1HHGB 4HFWB 1CIDA 1J9CT 1QFPA 2ATKA 1J05A 1B6DA 1I7RB 3NA9L 3MREB 4LU5H 4R4ND 3PL6B 3DVIA 4EDWL 5DJCA 5FHBL 4N8VB 5INCA 2ED7A 4OGXH 1KTDB 1BQSA 1QLEH 1YN6A 4TQEL 3QH3B 3B2VL 3MA9H 3BPLB 1ED3A 3FOLB 5F7FA 1RZIB 1C1EH 3X12B 1XGYL 1UWEH 3TN0D 2AJVL 4KK9C 5D1XD 5LQBH 3QXDA 1DUYB 3C5SA 1T5WA 2LAGB 4OQTL 3T0EE 1QYGL 5DRNB 4G8GD 1FVDB 2BVQB 2DI9A 3LV3B 1XF4B 4P9HL 1NSNH 4PG9A 4WU5A 1XH3B 3DURB 3MRGB 4CKVX 1QO3A 2GAZB 3RVWC 2J8UB 4PJDB 5DRXA 4ZTPL 1PX3A 5BRZB 1HOCA 2KQMA 3DBXA 1CZ8H 4UV4L 3LVEA 4PPTA 3O4OB 3FQRB 5DQ9B 5HGAB 1I4FA 1O5DT 4NHUA 4XPGH 1R5IB 3HC4H 5IESH 2RJMA 2HFGH 1S9KC 1W72B 5AZEH 2OBGA 3IFNH 4JFED 1C16B 3ARVA 5D1ZD 3O6ML 2GCYB 5MI0C 1S7TB 1KYOJ 1OGTB 3BWAB 5BV7L 3RWCB 1NLBH 1E6JH 1W72L 4NUGL 3V4UL 3G04A 4NM8L 2EH7H 2ORBL 3VFVA 2R4RL 3HAEG 3OGCB 4MB5A 4QNPE 1AXSB 4NKDB 4OJFH 5EOQL 3O6FB 4ZFOL 4JDTH 1F4YL 4PJEA 1UCTA 1MCCA 4HS3A 2NY0B 3LKQB 5FDWB 4LSPH 5CAYB 3S7GA 5E6ID 3D69B 1A2YB 3DVNB 3QG7H 1SBSH 1MCEA 3SGKC 4PRHD 4MA3A 4P23B 3WKMH 2WZPD 3BESR 4X7TA 2NMSA 3V4PH 3LEYH 1BECA 1HIML 2EEAA 3U7YH 4YNYB 2AEPH 3R1GL 4V1DE 4JPKL 5JXAL 2PCPB 2VXQL 4H8WL 5IG7A 4LRIA 1A6AB 1X5FA 5IQ7H 1OM3H 2E5EA 2FD6L 1X44A 4FQQA 1MUJB 4JKPH 5FYJH 1FYTD 3UJTH 3VXSE 1EFXB 3GGWA 3B5GA 2OSLA 3M07A 4NRXB 2BCKB 4PGDA 3QCUL 1KIUA 4XC3L 3HAEB 4AH2A 3WIHL 3DUUA 3RGHA 1A47A 5F3HA 1UVQB 3E3QC 3FT2B 3RZCC 5DD1L 4YC2C 4GKNB 5KVEL 3CFEB 4N0CC 3DPBA 3V9FA 5B39G 2O26U 3PWJB 1ITCA 3T2QA 1G7JA 1HEZA 1T22B 2XZQH 4NQDB 1OP9A 1DUZB 5DJYA 3UTOA 4C55A 1IEHA 1AKJB 3IS1X 3IDXH 4X6DB 5EZJA 5ITFB 4JM2B 1S3KH 4Z7UA 1CFTB 1XGUA 2AV1A 4OM0H 1MCIA 4PJIA 1RUPL 2DQCH 5KS9E 1JP5A 3IAPA 1NGQH 4QGTA 1S9VB 5C0CB 1ONQA 3ARDB 5D7LB 1T83A 3SJVD 3UPRA 3C60C 4QRRE 4UNUA 1FL6A 2XZCL 4R4FH 4JY4B 3GFUA 2P48B 2H6PA 5ESVB 4HH8A 5JUEH 1X3DA 2CGRH 2PTVA 1KN2H 3SE4C 4H25B 1JNLL 1G84A 2Z93B 1IFHH 2HLFD 1EO8L 4CN6A 4UAOC 4OCYL 4ZUSA 5C0GA 1J8KA 4FQIL 4M00A 3CFBB 3SN6N 2HN7A 3OKDB 3SDXE 4WI5A 5J4MA 1S8DB 4G3YL 1JCKA 5B39B 4PP1C 4F2MA 1NC2D 2HFFB 4HBCH 5FYLH 3U7WH 3S4SA 3WBDA 5C6TH 1SY6L 4KQ4L 3QUZD 3QI9D 4NKMB 5IB1A 3QFJB 1GL4B 3V8CA 1EVTC 4WEMB 3CSYB 3G5ZB 3RA7L 1HNFA 1F3DJ 4NM4L 4J3TA 1FIEA 3LHPL 5DHVA 3MRCB 1MOEA 4WO4D 3DO7B 1KEGL 1IGCH 2DJUA 2OTPA 4PY8J 1CE1H 1M4KA 4NC2B 2CO6B 5CLTA 3EKCA 1DZBA 4GSDL 2HTLC 1GGCL 5F93C 4HPYH 3F7RA 3MOAL 5F88A 3ARFA 4YDKH 1HI6A 5I15L 1FAKT 3BWUC 3H6JA 1JN6B 2JB6A 2ZSWB 4OD3L 1Q9LB 1L7IH 4Q9BA 5L2KD 4M4RA 3ULUL 5IB5A 3A6CL 1XIWB 1G7HA 5JHDB 2OX5A 3OKNB 1SJXA 1CE6B 2LFGA 1T20A 4FQCH 1MCOL 3KYOB 1ZKAA 3UTSD 3SDDA 1MQKL 2ZUQC 4JDZA 2GFBA 1MCPH 1PSKH 5IV2A 4PJBA 5JOEA 2IAMC 1LDPH 3JVGC 1NGPH 5TE4H 4M48L 1ZHLB 3O8XB 4J3WA 3MQIA 3TA3C 2YBRB 1CL7I 4U1IA 4KK6C 1BD2B 1QVOB 3SKOB 2Z35A 4LARL 3ILPA 5GZOD 3EJZD 2JK5A 4FZEH 1TNMA 4NP4H 1TQBC 5DI8B 3HR5B 3SDCD 4K7FB 4N1CA 3B9KC 4L4TD 3REWA 2W9DL 4JPIB 4CVXA 4JRXA 5F9WB 3X3GL 2ATPB 2CIKA 4GXUN 5FHAL 1JHKL 2IPKA 4DJMA 4POYA 4WW2C 4WJ5B 3DNKA 2PF6A 2DTSA 3RWFA 4R7DA 1T1WB 4YDVA 3TH3T 3L7EA 1QBMH 2QQLH 3MJGX 3EDJA 1LO3L 4P5MA 4PJ8C 3LQMA 4PREA 1F11A 1DBJL 2FJHA 2O5ZL 3ARGA 1TZHB 4MQXC 4WUUE 4LQFH 5CSGA 3UBXI 2AK4B 4J3SA 2CRYA 1PYWA 2ZUTA 3MV9A 4DVBB 1J10A 1H8NA 4Z0XA 2OR9H 4L1DA 1UWXK 4Q7DA 4G9FE 3RQ3A 2O5YH 1PLGL 1RY7B 1U8NA 1HQ4A 1C5BL 2OL3H 2V7NB 3P0YL 3HZMB 4UBDD 1MVUA 1NMAL 2C26A 3W11D 3WS6C 1F13A 4LLQB 3BHBA 4PUBH 5DUMH 4QCIA 2DLTA 1MWAB 3L5IA 5DJXB 4Z7WB 4HUWB 3ZE0F 1N4XH 1AC0A 1V7MH 3O6KL 1AGEA 1B4JL 1HH6A 3LN9A 4UTBH 4OF0A 4PY8I 3AB0C 2VLJA 3H42H 3RUGB 3FB5B 2W07A 4NUJA 4XPAH 2OK0L 1R3LB 4ZUUB 1KT2A 3QEHA 5I66A 3UPCA 5HHXL 3WKNA 4WI8A 4DVRL 2VAJA 2FX8L 1CGUA 3T04D 4H5SB 1HQRA 2G75B 3BGFB 3KPRD 1MIEH 3MRKB 1BZ7B 1B2WL 5D6CA 4Y5YC 2MMXA 2LE9A 2QSVA 3BUYA 2J88L 4GRWB 4OLUL 2YD3A 5CZVL 1J8HB 3C8KB 4JFHE 5HYQA 1MJ8H 5I1CL 2APBA 3GSRB 4IDJL 4PJ7A 1LGVA 4R3SA 5E8DL 1U58A 3FFCB 1JGLL 1FFNA 1RPQA 1TZIA 1AQKH 4HV8B 1CTOA 2OTWB 3TP4A 3ROLA 3SGKA 1CVSC 3H7BA 4RFOL 5EO1B 1XF2A 3PL6C 3MLRL 2AP2A 3ZKSD 3H9SB 4OFKA 4EUPH 2D7MA 5SWZD 3MACL 1HYRC 43C9A 5GS0D 1AGFB 4NCDA 4ZPVB 1MY7A 1HKFA 5T1LA 3HG1B 1M7IA 3BPLC 3F7VA 3CZFB 3RAJL 4L8DB 1C7SA 4UDTA 1A6PA 4GG8B 3EOYG 4Y19A 3KLHC 4N5EC 2JB5L 3GSUB 1DN2A 4PTUA 3RWEA 3RNQB 2DLFH 2F58L 4L4JA 4FQJH 1FNGB 4NCC2 3RZCA 1YPZA 5IIEA 4LASL 5D5MB 4S1QH 1N6UA 3NAAH 3O4OC 4ZOEA 1OGAA 4I2XB 3EO1B 1CG9B 5BV7C 3GJEB 2ZG1A 4KMTH 4ZNEE 1KLUA 2OZ4H 3QDMB 3MRQB 3QXVA 3AREB 1R0AH 1H3TA 4NKIL 1WFUA 4ZS6C 1IGTB 2OI9C 5GGQL 1R3HB 1RIVH 1BFVH 1E4WH 1AY1H 4KRPD 3WUWB 1IQDA 5DMIH 2QHRL 4AEHH 2C3VB 4XVJH 4DAGH 1M71A 1MCJA 3WO4C 3C60A 5DLML 1I9RH 1ZAGA 2NYYD 4AQOA 3KDMA 3FO1A 3STLA 1YUHA 3DROA 3O6FC 2EICA 3ET9F 3P9MB 1NCUA 4OZHB 5ESQA 2NY0C 3TV3L 1MREH 5DRZA 3SE4A 2GK0A 4X6FA 2VIRA 1VGEH 3R8QA 4OLWL 5ISZB 1DQDL 4ORZC 1IM9B 3LKRB 1Z9OA 1ZE3C 5EPMA 2VN7A 2MHAB 3ZYZA 3KPSD 3OZ9H 3VFMB 5C7XH 4P23C 3BEVB 1FC1A 2CDEB 1NFDE 4Y8DC 2HJFA 4MQTB 4HS8H 5DS8A 2V9QA 3MMEA 4ODHL 1UQSA 1SJEB 1BVLB 3IDJB 2YPKB 1HCFX 3T0XA 2W1NA 2J4WL 3QHFL 3KPQB 2ZNXA 3MV11 5DUPL 5EUKB 2NNAB 3NCEB 3SQOH 2EXWD 4BKLA 3FONB 2AV7B 2UY6A 4OD2A 4KPHH 5DMYA 3ZYOA 1MCBA 2GSGA 3QA3B 1B9ZA 1QRNA 2UV3A 5EZIL 5MENE 3SCMB 4ONFH 3NFNB 4PRIE 1FGNH 1T1YA 2XZZA 4HUUA 4P4RB 1NAMB 4RAUB 1E0OB 3IDYB 1TTFA 1I7UA 2QSCH 3T8XB 1DVFD 2Y6SC 4N0UE 5F1OB 3TNNA 4S10A 1FG2B 1T0MB 1WCQA 4XPHH 3RWJB 2VDMH 5CMAA 5JQHC 1KV3A 5EU6E 5I1LB 1R3KA 5IW3A 4L3ED 3KYKL 4J8RB 3JUZA 3ZE0E 1Y18B 3IDGA 1C5DA 2BNQA 4IRZH 2ZUVA 2J6EA 3ARDC 4ODWB 1ORSA 4EEEA 1RZKL 4FTVE 4TVPD 3OF6D 1ZGLP 1OB1A 2EYRA 4BSVA 2X4OA 3K0WA 3VG9B 5LGJB 4UOW0 2Q8BL 2IAMA 3JVGA 4WCYL 3QPQC 4HLJA 1ZLUH 2H2PC 1LD9B 3HNVH 3V6ZA 4EN3D 5E08H 4JRYA 2Q87A 2Q86A 4HJGA 5C0BE 2HRPH 5EBWA 1PKQA 4U1MB 4O9HH 4Y88A 2GJZB 3C6SA 3X13B 4EBQL 3PGFH 3U0PB 1JMZA 5TQ2H 3B9KA 2WSKA 3QQ4B 3BGMB 1A7RH 2H9GA 1NFIA 5DVMA 4L4VD 5ICXA 5K9JH 4P3DB 4WW2A 3PWVA 1HSBA 1HHKA 2X4UA 2NX5B 3MR9B 3QUYA 1YECL 1QLRA 1FPTL 2BVYA 4CADB 1YEGH 3DXAD 5E9DB 2EXYD 1YMMD 4LVNB 3MV8D 1A3QA 2GJ6B 4JHAH 3HE6B 2DTML 2ICES 1A6TB 3P77B 3TO4D 4XPTH 2FEEI 4NO0D 3UZQA 1DBKH 5E2WL 3P9WB 5B4MC 3MLTB 3N1QC 1L0QA 2VWEE 3QWQB 5GGUB 1INDH 3V0WL 2L7JA 3WLWD 4JFDA 2G9HB 3GKZA 1KOAA 1P84J 4LPWA 5E5MB 5I1IH 1EGJL 2L4OA 3L3GA 1PZ5A 1ZEAL 1NC4B 1S78D 5BZWA 1KCSL 4QRSA 1ZWIA 2D7PA 2YD9A 5GIRB 1IGML 1KEML 2BSRB 3VD4A 2DM4A 4D3CH 1XIWC 1KJ3L 1X5KA 3VRJB 1SYSA 2R2EB 3D39D 3FO0L 3OR7A 3TH2T 2P8LA 2ARJB 3CH1B 4YUEL 3NN8B 1ADQH 1Z9MA 4KI5F 5DUBB 3EDEA 3QDGD 4TSAH 5E56A 3REVB 3K8MA 3AU1A 4KROB 2O61A 1NCDL 3EOTL 4E41E 2UYLA 3QIUD 2PR4H 4OF3A 1MFAH 1SEBA 4HPOH 4OGZA 2ZKHH 3R8BB 3TFKD 4EVNA 3I6GA 3SOBL 1SVCP 1PW3A 4M5YH 4UINH 4RWYL 4YXLL 1J1OL 3V6OE 3LPGA 1X5JA 5FKPB 1KJ2L 4LEOA 4G8FB 3FHAA 5CLWA 4ONHB 5D6DC 4Y5YA 4WI2A 3G6JF 4Y1AB 1DBMH 1JTOA 5SWQB 1IRAY 4PRDB 4F37F 1FDLH 4E5XA 4R26L 4WU7B 3PP3H 5F9WC 3U4BH 1G6RA 5HY9B 2AXHA 3WV0A 1X6NA 1FNLA 4KZDL 1HHGA 1QNZL 4HFWA 1I7RA 3WNKA 3MREA 3KYMB 4ELMB 3KJ4B 3PL6A 1JRHH 1KTRL 4N8VA 2V5TA 1EA9C 4OLXH 4OI9A 4AMKL 1EHLH 5JXED 2I5YL 4ENEC 1KTDA 4PB9H 2FRGP 3QH3A 4KHTL 4M9OA 2DMKA 4FFWD 1RZIA 1MEXL 4N90D 3X12A 5F9OH 3M8OH 3ARXA 1T3FB 1DUYA 3NCCB 3V8OA 2FIRT 4CMMA 4JANB 4P4KD 1FVDA 3LV3A 2NZ9C 1OAQH 1XF4A 4BSWB 1XH3A 1JGUH 2VDRL 3DURA 3MRGA 4YO0B 5JHLL 2GAZA 4LAJH 4NIKB 2J8UA 4FFYH 4PJDA 5BRZA 5HYIA 2HT3C 4A2LA 2B2XL 4I3SH 4HIIA 4JG0L 3FQRA 2XTLA 4JKKA 5DQ9A 4W81A 5HGAA 3VI4F 4KQ3L 2W9EL 5KVMC 2P5WD 1GGIL 1WIOA 3RWGB 1K5NB 2NY4B 5HHMB 5I6XB 1W72A 4CU8A 2R0WH 1C16A 5TF0A 2AI0H 5BZDB 1S7TA 4ZUVB 1S9XB 2CO7B 1OGTA 3BWAA 2I24N 2PETA 5T5FL 3RWCA 3BGFC 5FM8A 5FV2A 3CMOL 5JORB 2GEEA 5E1AB 5EG6C 3O3UN 4KXZI 4KTYA 5GS2D 4M6NL 3OGCA 3CFCH 1AXSA 4NKDA 5DMGD 2HA1A 4PLJC 1NJ9B 3K81A 3O6FA 5J0BA 3VW3L 2P8PB 2Q3ZA 1E6OH 5FO8B 5L6YL 3LKQA 5FDWA 5GPRA 4W6YB 4HHAB 3D69A 4FQHB 1WISA 2KH2B 3NBNA 1A2YA 3DVNA 2R4SL 3VE0B 2GTZB 1QSEB 3MXWL 1RMFH 5JOPE 3RU8H 5C09B 3LZFH 3V4VL 4P23A 1L9MA 3EDDA 2J8HA 1IKFH 3GSXB 4YNYA 3U6RB 3C08H 4XAWH 2Z8WC 4BFBD 3B5HA 2PCPA 4OFPA 2B4CL 2VSCA 4BH7B 1GOGA 1JHLL 1A6AA 3B43A 1P9MC 3DSFL 2VXUH 1MUJA 4ONGH 1N5AB 5LGHL 4TTDC 4N1EA 2OYPA 5ELIA 1EFXA 2P7TB 2JE8A 3UBXG 2A0LC 3FAXA 3RTQB 2BCKA 1YJDC 4AJ0A 2DIBA 3HAEA 3WIFB 4AZ8A 3SHSA 2DYPB 1UVQA 3FT2A 1U42A 4GKNA 4IMLB 3CFEA 5FYKD 1UXWB 3HZVB 3PWJA 4QHKJ 4OLVL 2CLVB 3PV6B 4NQDA 1DUZA 1II4E 1WIPA 4OAWB 2MKWA 1AKJA 4JB9L 4N8PA 3AREC 1JL8A 2V9RA 4X6DA 5ITFA 2EDDA 2NLJB 1B0RB 4JM2A 1CFTA 1EZVX 2YR3A 4POZD 3O81A 4BUHA 4KI5E 2CJUH 2XN9D 1S9VA 1ZANL 3VXUE 3CAFA 5C0CA 4MX7B 3OKLA 3ARDA 5D7LA 2ADFH 2IBZX 2XZAH 3MGOB 4HG4J 4QRUB 3QXUA 2EC9U 3I6LD 4M62L 3GMLB 5GRVK 4YHOL 1NBZB 4JY4A 4Z7QE 5C70A 5ADPH 4DUVA 2YRLA 5ESVA 3ZT6A 3FZUD 1QR1B 2YN5A 4H25A 2KPNA 2Z93A 3CIQA 3ZTNH 4X7SH 5EU7E 3UBXB 1FNSH 4PRPD 3SKNB 2F5AL 2VAAB 3G6JE 4HK3J 3MRDB 5B21A 1SY6A 3CFBA 1TZGL 3LMJL 3OKDA 4FA8A 1FE8H 1S8DA 1LP9F 2AJXL 5B39A 4K7PY 2HFFA 1FLTX 5IB3A 4F57L 4QKXB 4AG4L 1I8IB 3UEZA 3UYPA 4XCFH 1IC7H 1YEJH 3QFJA 4WV1C 1OF2A 4CUCA 3CSYA 3GI8H 2YPVH 3G5ZA 4Y2DB 4AK1A 5T3XE 4WFGD 5K9OB 3I84A 3MRCA 4OZIB 3DO7A 3QEQB 4UZGA 4ZPTB 3HB3D 2XRAL 5IFHL 3L1OH 3WSQH 5IVNA 1P4BL 3SCMC 4O5LH 1YNLH 1D9KC 3IXAB 4DGYH 4MA1C 3VMPA 3QIBD 3BP6B 1UZ6F 2ESVB 3PWPE 1CICB 2CK0H 2EH7L 1CXIA 4PJ9B 4PJGB 1F6LL 2EDHA 4HGMA 1JN6A 1M6OB 2ZSWA 1Q9LA 3GBMH 1GHFH 4MJID 3JWOC 4GBXB 4R97B 4PJEE 1XIWA 5JHDA 1MFDH 1KPRB 5CEZL 4ISVB 2DWDB 3OKNA 1CE6A 3P11H 2ADJB 1N64H 1HWGB 1CU4L 3OR6B 3VG9C 5F6HJ 4JGJA 8FABA 1HDMB 2VQUA 2NXYD 1YY9D 2QQNL 5I71B 4OKVB 3GHEH 2DRUA 1WBZB 5EIVA 4APQD 2DKUA 2FBJH 3LEYL 4QHKI 4TNWK 1ZHLA 5KVFH 5I19H 5D7IF 5GGVY 1KCKA 3O8XA 1KGCD 2YBRA 3SE8H 4KK5C 4MNQB 3CDCA 1K3IA 1BD2A 1QVOA 3SKOA 3GUTB 5FYJD 4GAFB 1OM3L 1CLZH 3MV7B 4X7CC 5DI8A 3HR5A 1XGQB 4K7FA 2L0DA 3O2WH 4JPIA 3CK0L 2WWMD 2R0LL 2CH8A 3GZKA 3T65A 5JPNA 2ATPA 3H0TB 2EDTA 4ETYA 1HKLL 4PJHB 5DFWH 1T1WA 2BJML 2I9TB 5J12B 4C58B 2GW5A 5L9DL 2YPLD 1P7HL 2IGFL 3L5JA 4LVNC 3VXPB 3PE9A 1TZHA 2XZQL 3MCLH 2AEQH 4JQXC 3HE6C 5CJQH 4OLYH 4UOW1 1A02N 1F8TH 4N8CH 5GRWA 2AK4A 1AQDB 2D7NA 4IRSD 4DVBA 5D70H 5CIPH 1JZ8A 3HFML 2FZ3B 3MXVH 1IGFH 2BX5A 1I1AD 1PGRB 5KVDH 1DCLA 2V7NA 3HZMA 4XVTH 1I3VA 2F15A 1K8IB 1SEQH 3V6FB 4MNHB 4LLQA 5DJZB 3PP4L 4M6ML 5ESAB 3U9PL 3ZHKA 3BDXA 5K9KB 2J1KA 3VWJC 1G9ML 1MWAA 4PR5B 2APWA 2YSSB 5DJXA 1VSCA 4Z7WA 2CGRL 4HUWA 2V17H 4XNXH 5J8OA 2EDXA 1JWMB 3AS0A 4HWBH 4PJXF 4NQEE 1CXHA 4ZAKC 3TN0B 3VDCA 5D1XB 3RUGA 3FB5A 4M1DL 4YZFF 5I16B 4G8GB 1R3LA 1AP2B 4ZUUA 5FYLD 3NCJH 2IFFL 2YRZA 2AXFB 4HBCL 2JJSC 3Q48A 4H5SA 2G75A 3MRKA 1QQDB 1BZ7A 2E8ZA 4M6OH 3LKPB 4QYOB 4GKSB 1X4ZA 1BJ1H 3VXRA 1MRDL 3I9GH 2YMXH 3KXFE 1J8HA 3C8KA 3WHE0 5IMKB 5IHUL 2FYYB 1YEDB 3UTPD 1MFBH 3L5WB 4JFEB 3GSRA 2BK8A 3RX8A 1JUFB 5D1ZB 3FFCA 2LVEA 4HV8A 2A6DB 2OTWA 4GXVH 1A7PH 3MUHL 2XICA 5T3ZE 4K3JL 5I18L 5EO1A 2FEDC 4LVOB 4XX1G 3H9SA 3RNKB 5AWNH 3GMMB 2EDKA 1XF5B 1G7QB 1AGFA 4ZPVA 3GNML 5B3JF 3HG1A 1ZTXL 3O41B 5E6IB 1HN1A 3CZFA 1OARH 4L8DA 4LDOB 4GG8A 4HUKB 4TUKL 4F7MB 1P9MA 1I8LC 1K3ZA 4XNUH 3T0ED 2W60B 4GT7A 2XYCA 2A9ML 1CLYL 1IAIL 4YWGL 3GSUA 4PRHB 3V6BR 3DTXB 3HZYB 3PQYE 2BSSA 1LDPL 1IARB 4OM1L 3RNQA 4GG6B 1QFWI 4KHXL 2RCSH 1FNGA 4EQ2A 4ZOBA 1UZ6E 5JLZB 5D5MA 1VFUA 3U79A 4WUKL 4OD1H 4X6BB 1F58H 4I2XA 1CG9A 5EORH 3NPSB 3U4AA 5T3XH 2NY4C 3QT2A 5I6XC 3QDMA 3GM0A 3MRQA 3O3BB 4QRTB 4Z95H 5C2BH 1FYTB 4J2XA 3AREA 3BISA 3JUYA 1BOGB 2VZ1A 1IGTA 1R3HA 1UM4H 35C8L 3UO1H 4PBXA 5MEQB 3WUWA 4IHOB 4AY0A 1Y6KR 2C3VA 4HK0B 4PTTB 2FX9L 4XBGB 4FQLL 3HKFA 5KSBF 6CGTA 4TOYL 1UYWL 3EYFA 3A6OA 1JGEB 2DD8L 3P9MA 1VACB 1N2RB 2KZWA 4OZHA 2CK2A 4JFZH 5DJ6B 1YEEL 3S3PA 4BZYA 4XBPB 3R0NA 4P2OD 5TPWH 3MV9E 4RX4A 1FIGL 2PUQT 3UC0L 5ISZA 1ZT1B 3S36H 5D71L 1IM9A 2DMBA 2O5YL 3QEGH 1DQLL 2EEDA 2F5BH 4XCYB 3JV5A 3SJVB 3VFMA 3GSVA 4GAGL 1R3IH 3BEVA 1ZT7B 4O2EB 1CD9B 5CWSB 1CR9L 4D9RE 2CDEA 3VD7A 3ZT7A 2EH8L 4KV5F 3L3IB 3T2OA 1BVLA 3MTRA 3TZVD 3IDJA 1MF2H 2YPKA 3CH8A 5JQ6L 2HT2D 5EUKA 2HKFH 2NNAA 3PDOB 3FONA 2AV7A 5F9DC 4A6YL 3O2DH 3H42L 3QA3A 2ZOLB 3BE1H 2R9HC 4FABH 5EWIL 3SCMA 3ULVF 3P9LB 1NC2B 2EE2A 3HNTH 5EA0H 4P4RA 1NAMA 4RAUA 5J89A 2VDNL 1ZLVH 1OTTC 3QUZB 3QI9B 3S96B 3AMKA 3T8XA 4HEME 1BM3H 1AXTH 1FG2A 2WUBL 1T0MA 1FZMB 1KYOK 2I9LB 2R69H 2DDQL 5I1LA 5JDJA 5B38B 4WO4B 4J8RA 3MFFB 3C2SA 2F74B 2Y06H 4IMKC 1BHGA 3KLSA 5IBLC 2GKIA 1Y18A 1J0IA 4NNPL 4PJXE 3BKMH 1YYLH 2XXCB 3G9VA 4ODWA 5JNYB 3W39B 1A4JB 1EAJA 4QRRD 3B8SA 4AYFA 3ZE2F 2ZCHL 3NZ8B 2EYTB 4S1RH 4YHLL 4NWUH 3HI6L 3HZKB 1N5YH 1U41A 5D2NE 4LCWA 4Q6IB 5L2KB 1LD9A 3HMWH 2F8XC 2CKBA 1LP9A 4RFEA 5IFAL 5EU5B 3GEWB 3EOAB 2FGWL 2Y25A 3IFLH 1YEKH 4J1UB 4XI5C 1WK0A 2V5RA 3NIFF 2GJZA 5I1EH 3MRRB 3H9ZA 4Y5VB 3X13A 3UTSB 4X83A 5CP3A 2BVEA 3U0PA 1N6VA 2HKHL 3FJTA 3ZMRA 1EMTH 4OI8A 3QQ4A 3BGMA 5HHNB 4GRMB 4J4PC 4P3DA 1AIFB 5IK3B 1DP0A 3LB6D 2NX5A 4K8RH 2RQ8A 1F00I 3E3QE 4OF6A 3B9DA 1EAPA 4CADA 4DGIL 4CGTA 1OGAE 4JPVL 5E9DA 3G5YB 5LWYH 3K3QA 2GJ6A 4G5ZH 4JQXA 4ODBD 12E8H 3HE6A 4NN7B 4YHPB 2CRMA 1A6TA 1AC6A 3P77A 3VXTB 2E7BA 5DHVH 1J1PH 1P1ZB 3BEWB 1TJIH 5B3JE 1Q0YH 4RSVA 1AFVH 3LRHA 4L4TB 2ZNWA 3D0LA 3MLTA 1HINL 4MVBC 1BREA 3N1FC 3FO9B 5GGUA 5C0ND 1CF8H 4MS8D 4JN1H 2G9HA 2O5XH 2CRIA 5E5MA 2R8SH 5T3ZH 3MUZ1 4MCZB 4G6AC 4K2UH 3CXDH 1NC4A 2BFVH 5T1LD 4PLKD 5K59F 3BIBX 1A1OB 1I9RL 5HHOE 5GIRA 4GBXC 1UCBL 1FNAA 2BSRA 4R97C 3QUMB 1I3RB 5D7KE 3VRJA 2R2EA 3JBG7 1OP3K 2ARJA 3CH1A 3LD8B 3NN8A 1I1YB 2ED9A 5DUBA 1A1NB 1H15B 2C4XA 4LCCB 3Q1SL 3REVA 2APXA 1IBGH 1NEZB 5JO5B 4H88L 4TNVF 3FB8B 5IJVB 2UZIL 1GGYA 3EGSB 2ICWJ 3IU3B 2VLME 2JJSA 4QOKE 1VPOL 2PNDA 5FKPA 1UA6L 5D7JD 3CSPA 4G8FA 3OKYA 4ONHA 4O51B 2FJGB 4NHCL 5I9QB 3RIAF 3BDBA 3H9YA 5SWQA 2IH3B 1B4RA 1OAKL 1FBIL 1G7MB 4P2YA 4WU7A 1NBVL 3TPUB 2UVFA 4ALAL 1O7VA 5DD3H 4PLNC 2RGSA 1JV5B 4GQPH 4YE4H 4NNYB 4IOIB 3KPRB 4WUUD 5KSAD 3KYMA 4ELMA 5BW7C 5CGYC 2F53D 3ZHDA 1MRFL 4IRJD 2MQ0A 1MNUH 3EFDL 1XGTB 1RUAH 4KVCL 4HCRL 2B1HH 4BQ6A 4G9FD 1G9MC 4LSDA 1NCBH 1NCAL 3NFSH 4M43H 5HYJE 2VQTA 25C8L 3BZDA 1T3FA 1FJ1B 1WZ1H 2BDNL 5KANI 4HAGA 1IC4L 1KC5H 4DZ8B 4BSWA 1WBXB 4G7VH 3VFGL 4YO0A 3ULVE 1EEUA 5CJOL 1XR9B 3MNZB 5SWZB 1IM3B 3P4NB 1QHPA 1ZXQA 1INQB 4XGZB 4ZDHB 2XY2A 3HUJB 2DBLH 2VTFA 1SM3H 4U1HB 3FN3A 1SQ2N 3MLUL 3RWGA 1K5NA 1PKQE 3TN0C 3EJYD 5D1XC 3BOVA 5DR5L 1C8PA 4Z0BH 4Q9QH 3BT2L 5BZDA 3GBNL 4OSUH 1S9XA 5I1GL 2X2YA 1F42A 4GAJH 4DN3L 1NLDH 2DQJL 4J3VA 4XBEL 3EDFA 5JORA 2JKXA 2NXZD 3ZE2E 5E1AA 1UM6L 3NIGF 2BNQD 1S7WB 1MFEH 1NJ9A 1OY3B 3CFJB 4JFHD 3QDJE 2P8PA 1S7VB 2DLGA 5FO8A 1DBAH 4Z8FH 2NTFA 1JPTH 4HHAA 5D1ZC 4FQHA 3ROOB 2M1KA 3QZWG 3F62A 4DGVH 4KRPB 1OHQA 4MD5B 3HMXL 2HWZL 1PQZB 2GTZA 1QSEA 3NIFE 1CS6A 4XMKH 5LBSH 4YBQD 2IEPA 5E2JA 4JRYD 3WNLA 2NY6D 1R24B 4OIIH 4OGYH 2D4DA 2X40A 4HWEH 5DT1H 1FRGH 2DQHL 1S5HB 3GSXA 1WF5A 2CDFB 3U6RA 3H3BC 5CEYB 2N56A 1P5UA 3TJHC 5E6IC 2H1PH 5GGRB 5FEBA 3V0AC 1ETZB 4KJWD 1N5AA 4TSAL 1RIHH 2P7TA 3GJFB 1MPAL 2JELH 5IMMB 1NCTA 3FB6B 3CXHK 1EUUA 4WY7H 3RTQA 3WHE1 3KPSB 1WTGT 4OZFG 1EEQA 2Y36H 2KDGA 4YHNB 3HI5L 2DYPA 4PJFF 2VZVA 1QKZH 1P6FA 1AO7E 1UXWA 2R39A 3HZVA 4YHML 1HXMB 4Q9RH 3NPSC 3PV6A 4G9DB 3LSOB 3QZWB 4LCIL 4OAWA 4WHDA 5HJ3B 5KSBA 4UTAH 1WVZA 3CVHL 1SMOA 2WQRA 4XMLH 4JO1L 2NLJA 1B0RA 1H3PH 2VDOL 3IDMB 5DJ0B 1KIPB 3TH4T 2Y4SA 1T6VN 3K4ZA 4MX7A 2PYED 3W2DL 3KYNB 1DQQB 4M61B 1E4XL 3D9AL 4PJAB 3MGOA 3RVUD 3QPXL 4QRUA 2B8OT 3FQXB 3RKPA 1DVFB 1BZQK 3IETB 5C9KA 2AQ2A 4YFLI 4OLXL 1JPST 3C87A 4DOHE 1QR1A 2HH0H 1EUTA 4OUOA 1VADB 4L3EB 3C8HA 4PB9L 4BA8A 3UBXA 1A6UL 1WFTA 3SKNA 4U0QB 2VAAA 4M7ZB 3MRDA 2AGJH 1KNOB 4OZFB 5BJTB 2VDLL 4NFBA 5F9OL 3M8OL 1U8MB 1KCRL 3ULUF 2AJZB 4YJZL 4GMTH 4MNGB 1Y0LB 2EDEA 4MXWH 2VR9A 4BFIB 3ILQC 3ARUA 4G6JH 4AT6B 5JA8B 4J4PA 3VMNA 3IFPB 1DQML 3Q5OA 4BM7A 3B2UC 3ARSA 2HLFC 4EN3B 2Z31D 4PJCF 4Y2DA 1VFOA 3TYFB 5K9OA 4OZIA 2X9XA 3QEQA 1CYGA 4ZPTA 4R2GC 1FL5B 1XEDA 3BDYH 4BFEA 1U8KB 5MEND 4YHZL 4PRID 3BW9B 5IB2B 3IXAA 3DV4B 1MHCB 3SE3A 4XNZB 4OV6F 3QUZC 1CICA 4PJ9A 5BVJB 4PJGA 4PG2C 5F9AC 3DXAB 4EJ1C 1YMMB 1M6OA 3ARRA 3MV8B 4X6CF 2Y07L 1UWXH 4KUZL 2VMFA 4KJPD 4GBXA 4KU1A 3BFOA 4WO4C 3E8UH 3U82B 4PFEA 3TO4B 2MSPA 3BYYA 3U0WH 1WIUA 4NO0B 2DWDA 1NQBA 2CUMA 4XP4L 1NH6A 4DEPB 3ZTJG 2ADJA 4OZGF 4FTVD 2W0PA 3GSNB 3OR6A 1Z5LA 3GSQB 3MV01 1BBJB 4LLMB 4G8IB 7FABH 1HDMA 4G6MH 1MAKA 4OKVA 3ULVH 4I5BB 5J1AA 2Y5EA 1WBZA 5SX4H 4Q6IC 4P3CH 1F3DH 4YX2L 2KZ1B 4XP6L 4TULL 3D39B 2VC2H 4MNQA 1DSFH 3NIGE 3GUTA 2R15A 4CVZB 4BH8B 4LEXL 4Y5VC 3MV7A 4LCUB 3GSWB 3QDGB 4Z7VF 3X14B 1XGQA 4LPXA 1ZLSL 2Z8RA 4UNVA 3QIUB 3W82A 3QO1B 2OJZL 1I9JL 3H0TA 4HX1B 5F7EL 1GH7A 4PJHA 2I9TA 3HA0A 2C5DC 1N6QH 3LOWA 2COQA 2BHUA 4PIRF 5C0FB 1MCLA 5BO1H 3VXPA 1LE9B 2WV3A 1OAZH 2XTJD 4ERSH 1D5MB 3GKWH 4AIOA 1RZ7H 2YK1L 3VWKD 2X89A 4NN7C 2VDKH 3RWHB 5GZOC 3EJZC 4KVNH 2VDQH 1AQDA 4MA7H 4YXHL 2FZ3A 3H3PL 5GGTA 3MRMB 3KPTA 4CN1A 2P5EE 1RZ8B 1K8IA 5ANMB 1OAXL 3V6FA 2C1PB 4MNHA 2FHCA 5DJZA 1NMBH 5ESAA 8CGTA 1TPXC 4PJFE 4PR5A 4WW1B 2YSSA 3L3HB 2BVOB 1QD0A 4JGMA 4JVUA 3UJJL 4OB5H 1JWMA 3CU1A 3UJIH 1HHIB 1UB6B 3MLVL 4U1GB 2C3HA 1MCHA 2FWOB 4LCCC 3TN0A 5ALCL 4E41D 5D1XA 5TF1H 1FE8L 3W11C 3PWNB 2X9YA 3U9UB 2JCCF 5I16A 4G8GA 4P4KB 1AP2A 1RUMH 2AXFA 1RIUH 4DKEL 1EX0A 3CUPB 5F3BB 2GUOB 3EO0B 4XVUC 4UV7L 1YEHL 2QJDA 1QQDA 3LIZH 4XCFL 5HVHC 1YEJL 1KELH 4QYOA 5IBTH 2E7LA 5I9QC 4GKSA 4EDXB 1XF1A 2AABH 2P5WB 3V79C 5EN2B 5IMKA 5DFTA 1DFBH 4MWFB 2FYYA 4WWID 1YEDA 3L5WA 3V2AR 3NA9H 1EHAA 4JFEA 1HK6A 1JUFA 2VLRE 1YC7A 5D1ZA 3VU2A 4BQ8A 4EDWH 2D03L 5FHBH 2A6DA 1T1XB 5DK2B 4YHYC 5KG9B 1CBVL 2UWEF 4GUPB 3FB7B 4W6WB 3VFRB 4YQXH 3ULUE 5C07E 4TQEH 3B2VH 3IU4L 3MPCA 3RNKA 3GMMA 1TENA 3MRFB 4ZO6A 2AXGB 1XF5A 1G7QA 4QWWD 5GRUL 3WMSA 4X4MA 1QYGH 2DQFB 3V52L 3O41A 5E6IA 4PJCE 3OG4B 4P9HH 4Z76B 4LP5A 4F7MA 4JFQB 4O02L 2W60A 1GCFA 4Y5XC 4UV4H 1WEJL 4QRPE 2VKXA 4U05A 4CL7A 2CLRB 4PRHA 3DTXA 3HZYA 4BZ2L 2XA8L 1T89C 4GG6A 1QACA 2P8MB 3G6AB 2Z92B 5JLZA 5KVFL 2ZSVA 3QULA 4X6BA 1AJ7L 1A6ZB 5HI5D 1FO0B 4K3GA 3SE8L 5AEAA 3VH8G 3O6MH 3D3VE 5CINL 2WBWB 1BD2E 3MJ9L 4X6CE 5BV7H 1LO0L 1MFNA 1T7WA 4QTHB 4QRTA 5JZ7D 4LGSB 1FYTA 1W72H 4NUGH 3V4UH 5CKGA 4NM8H 3K2UL 2ORBH 1BOGA 4XTRC 4UNTA 5MEQA 4IHOA 4OZGE 4HK0A 5EOQH 4PTTA 4XBGA 1F4YH 1RI8A 3I3BA 5CGTA 5DD0H 4X9BA 4NRYB 1GC1L 3C9NB 3BH9B 4S2SA 1A9EB 1J0HA 3MCLL 3T09A 1JGEA 1VACA 1N2RA 4N8CL 5ACLA 5E0QA 5DJ6A 5L8LB 4NWTL 4AEFA 4XBPA 5D70L 5FYKL 4ZO8A 2QADD 5HGDB 4M5ZL 1YMHB 1ZT1A 5KVDL 4GJTB 4D94A 2XN9B 3DO3A 5JOPD 4Z7VE 3SJVA 3R1GH 4YAQB 3U0TB 1TVBB 4JPKH 5JXAH 2VXQH 2NYYC 4H8WH 4NN5C 1ZT7A 4O2EA 3VH8B 2EZ0D 5CWSA 2MPAL 2FD6H 1ACZA 3DJ9A 2E9IA 5GXBB 4QEGA 3L3IA 2V17L 1CFVL 3I50L 5IVXF 4XC3H 4KKBD 4U6YB 4HWBL 4PRPB 3WIHH 4YDLB 3WDHA 3PDOA 5DD1H 1B0GB 4FXKB 5KVEH 1VB9A 2ZOLA 4JKLA 5I73C 4L9LB 4R96B 3P9LA 4HAFA 1NC2A 4JQIL 3BD5A 1ZT4B 3GMNB 3T2NL 4ZFZB 4KKLD 1D5BB 4AENB 3QUZA 4ODUB 3QI9A 3S96A 3JWDL 3KGRA 4K9EC 5GJTL 5DC9B 1RUPH 1FFPB 2EXWC 4OCNC 2CIIB 1FZMA 1Q1JL 2I9LA 1JTTA 4GRWE 2H32H 3CLEL 1J8HE 5B38A 4WO4A 1OAUL 3DMMC 1JWUA 4YPGB 1MFBL 2F74A 2OS7A 5DC4B 4KI5D 3VXUD 4KMQA 2XZCH 3FFCE 1KENL 5JNYA 5F97E 1FG9C 3RI5K 4H0IA 3QIBB 3SKJL 2BRRL 1JNLH 4NQUA 3NZ8A 2EYTA 2ZPKL 2EDFA 5ILTL 1EO8H 3VA2C 1VHPA 4OCYH 3MNVB 2IG2L 2G2RB 3HZKA 4FQIH 4I9WD 4Q6IA 4MJIB 3UTTE 5L2KA 1QLFB 5EU5A 3EOAA 3HG1E 4G3YH 4M7ZC 4J1UA 4WU5B 1BGXL 1GGBL 4HWUA 3D18B 1RZJL 4U7MA 1SY6H 3MRRA 1T0PB 4KQ4H 4P46D 4Y5VA 3TWCL 3UTSA 4NO5B 1Z9LA 3DBXB 3A6BL 5HHNA 2D0HA 2NXYB 4GRMA 5C0EA 1YDPB 3RA7H 3ETBF 4LBEB 1P2CB 1AIFA 5IK3A 2RCSL 4APQB 2UWEE 2AKRB 4HFUH 2N1KA 4NM4H 3LHPH 3GJFK 3NABL 1KEGH 4X8JB 4LSQL 1ERNA 5FOBB 4MDIB 4EQ3A 4EN3C 3ZHLA 4Q2ZB 3WIIL 4HC1A 3G5YA 4J12A 1JZ5A 5T3XD 4GSDH 4XB8A 5EULV 4YHPA 2HJLB 3VXTA 1GGCH 1A0QH 1P1ZA 3BEWA 3SDCA 4MAYD 3G04B 1A4KB 4L4TA 5I15H 1YN7B 1DLFL 1RULL 5I0ZA 1T1ZA 4OD3H 1WWAX 4QF1B 2FNBA 1T2QL 4XNZC 3PWPD 3VGEA 2I26N 4MCZA 3VD9A 5F1NB 1JRHI 3A6CH 2XOTA 1BF8A 3TESA 3BGAA 1A1OA 2YPLB 4WWKD 4L8BB 1F2QA 1WICA 2GQHA 5DYOB 1MCOH 3VGHA 3QUMA 1I3RA 2UUDH 1P53A 1MQKH 4IRSB 2Q20A 4DEPC 3QXAB 1UM5L 1I1YA 4CU7A 1I1AB 1OP5H 3QQ9D 1PJ9A 2MWCA 4DZBB 1BJMA 4M7KL 2V2WB 4LCCA 4JM4L 4M48H 4TPRL 2F5BL 4WNQB 2VR5A 5IMOB 1NEZA 5JO5A 4FMKA 4OGAC 3O4LE 5IJKC 4UILL 4L29B 1FL3B 3FB8A 4LARH 3RBSA 3BXNB 4X8XA 5IJVA 4OCWL 1QHOA 3IXTB 3EGSA 4YHIB 3IU3A 3P4LA 5GJSL 2W9DH 1MF2L 1MCDA 4O51A 2FJGA 3X3GH 2HLAB 5FHAH 1JHKH 3ZLQC 3MROB 1VEOA 5GRZA 2IH3A 1LO3H 1G7MA 5F1IB 4ETQB 3QIUC 2FL5A 3TPUA 3DARA 5HXMA 2NR6D 5D4QA 5HD8C 2RB8A 2WANA 3TFKC 5IOPB 1JV5A 2JJTA 4NNYA 4IOIA 1QSVA 4XP5L 5IWLC 4RGNE 3IJSB 4S0SD 4RISL 2AV1B 3I75B 3BJLA 1X5AA 2JF1A 1PLGH 5DJDB 4WGVB 1C5BH 3P0YH 1T03L 4JO3L 1XGTA 4BELD 4JZJB 3C5ZC 4LFHD 5IVXE 1KB9J 4WHYH 4K3DL 2HG5B 2HFEB 4JZNB 3TC9A 1FJ1A 1SHMA 4LIQE 3RBGA 4S1RL 4DZ8A 3O6KH 1WBXA 1B4JH 4KTDL 1OQOA 5FM5M 1CWVA 1XR9A 1T89A 3MNZA 5SWZA 3OKEB 2XA3A 3VFSB 3H9HB 1B6UA 4Y4FD 5JXEC 1IM3A 3P4NA 2XWBB 4TTGA 2FHBA 1FV1B 1Q9KB 4NQED 1INQA 1G7PB 2K9UA 4XGZA 4ZDHA 1D5XB 1ZHBB 3HUJA 4U1GC 5DWUL 4ZFGL 5HHXH 4U1HA 4ACPA 4DVRH 2FX8H 3KJ6L 4S1DD 4P4KC 2A74B 5L7XL 1B2WH 2AJYL 4P9ML 4U1JB 2VERN 1KCVL 2FR4B 2J88H 2WP3T 4XWGL 4K8RD 4OLUH 5CZVH 5JOFB 4L8SC 4V2BA 3BYTA 1PEZA 4IDJH 3UAJC 5E9DE 5E8DH 1JGLH 3KXFD 3CFJA 3D85D 1IT9H 4GRWH 1S7VA 5JMOC 1J1PL 1QBAA 4Z7NF 4QHLB 1J1XL 2YD5A 4PJ5E 4RFOH 1AFVL 3ROOA 3MLRH 1CGTA 4GO6B 4XPFL 5C8JB 4AQ1B 5F7UA 2EO9A 4MD5A 3BP5B 1PQZA 5T3ZD 3MACH 4LCWD 2NY2D 4LLWB 3DX9B 5FYJU 1JF6A 4Q6YA 2MTPA 4IDLA 1ZS8B 5IM7B 3NGBC 1R24A 3RAJH 3S9DB 3NTCL 5I1KL 4K94L 2DKMA 3CFKB 3ZKMD 1JMXA 2H26B 3HNSL 5CEYA 5AG9A 3RGVD 4P2OB 5MHSE 5GGRA 3QWOB 2JB5H 4YIQB 3D87B 3RVXD 4EI5D 1ETZA 3WFZA 5K9QG 2F58H 3ZYIA 5I2IB 2OL3B 5SWSE 2J3SA 4BQCA 3GJFA 4LASH 5IMMA 3FB6A 3KPSA 1C5CH 3PQYD 1U3ZA 2K7PA 5A43C 3H7LA 4YHNA 1BQHG 1FC2D 3IB4A 4HQQL 3IFOB 2NTSP 5H37G 4M93B 1F3RB 1N3NB 1EPFA 4NKIH 3MLXL 1HXMA 3TZVB 4CVXB 4P5KB 5GGQH 1C12B 4G9DA 2FSEB 3LSOA 3QZWA 4Y1AE 2QHRH 5AAMA 3NACL 1UENA 5HJ3A 3EYSL 1ES0B 1GC1C 4PP2B 5GRJL 5HVWA 5DFVD 1H3XA 5DLMH 3IDMA 4PREB 5IR1B 1KIPA 1F45A 4WRLA 1QFWM 3KYNA 1DQQA 4M61A 3TV3H 1PYWB 4PJAA 2XT1B 1WT5C 1MJJB 3BIKB 4OLWH 3FQXA 4KKAC 1DQDH 1DVFA 4Z0XB 1REIA 3IETA 4PD4J 2CMRL 3OGOE 1RUAL 1VADA 4L3EA 4W68A 3S35L 5EUOF 1U95B 5LVEA 4POZC 2MOVA 5FUCE 1KNOA 5BJTA 5HI3D 1IGJB 1BQHB 4K3HA 1U8MA 4X5XB 2E7HA 2AJZA 3OF6A 4ODHH 4F33B 4WENB 2A1WH 4QRRB 4RZCB 1Y0LA 1TJHL 3CX2A 3S98A 4BFIA 3S8WA 2J4WH 3QHFH 4D9RD 5DUPH 4ZFFB 4AT6A 5KBNC 2XWJB 1DQTA 4U6XB 4UDUB 3PDDA 4DWHA 15C8L 4L8CB 3FZUC 5KJRL 2D9QB 5TE6L 4HUVB 1S7RB 3E2HC 4EN3A 4YDLC 4WVRA 5EZIH 3VFOB 3O2VL 3QEHB 1U36A 3TYFA 3LN4B 4NZJA 4JFFA 1CDIA 1J0KA 1JK8B 1FL5A 1U8KA 2SEBB 4L9LC 1T5XB 4AL8L 3BW9A 5IB2A 3DV4A 2QTEA 3BRDA 1MHCA 3D25B 3BUYB 3BVNB 4IBLT 4L4VA 4HXBL 4PGBA 4ZD3L 5ECJE 1NLDL 2IQAB 3IKKA 3KYKH 1RD6A 5BVJA 4U7KA 5CCKL 3AFLA 3DXAA 3OXSB 4PJ7B 5L8JB 3MA7B 1NGXB 2D7TL 4R3SB 1YMMA 3OX8B 1MFEL 3MV8A 1ZHNB 4NBZB 1DEDA 1RZKH 1U92B 3LN5B 3IJYA 3HB3C 3TO4A 4XCCL 4NO0A 1INEL 4F9LA 3TNMB 3DRQB 2Q8BH 1LO5B 3H3KA 1IEAB 2IBGA 3O3AB 3GSNA 3PXJA 3QIBC 3GSQA 1BBJA 4LLMA 4G8IA 4LIQH 4WGWB 3HC3L 2R23B 5C09E 1AGCB 5T1LB 2CUHA 2D7QA 4HMEA 5KW9L 3UYRL 4I5BA 1RZJC 3OV6A 3BKJL 2IPUG 1CN4A 4MMZC 1K9TA 4EBQH 2IANE 3D39A 3F6IA 4EXPX 3EFFB 4JCMA 4CVZA 4CRPA 4BH8A 3BP4B 1MCNA 4LCUA 3GSWA 3QDGA 3S5LG 3X14A 3PHOA 4Z7NE 1FPTH 3RIFF 2NXYC 1RZGB 3QIUA 3QO1A 1YY9C 3UXFA 2O93L 3MFGB 1TFHA 4HX1A 5E4EB 5GZNC 2EE6A 2IC2A 3F6LA 2DTMH 2PN5A 2NY1C 4X9HA 3ZDXF 4BK4A 2NY5L 4KMLB 3SDAA 5C0FA 1QG3A 5D7JB 1LE9A 3LH2H 1UWGL 3V0WH 1WCBB 3QXWA 3RWHA 1M71B 3D2UD 5IW1B 1EHNA 3S37L 1Q38A 1UB5B 4M03A 1ZEAH 3EAKA 3MRMA 2X41A 1KCSH 3UZVB 1T0NA 1IGMH 4H1LH 5ALBH 5F7DB 3IAGC 1RZ8A 3CU7A 4O2CB 5ANMA 3FO0H 4LHUD 5J57B 2C1PA 5HHOD 5D7SH 2UY7A 4WUUB 4F7EB 5KSAB 4OCXL 4YUEH 4P2QD 4CDGC 1N0XL 2F53B 1U2HA 1NBYB 4I4WB 4WW1A 5B8CB 4IRJB 5AZ2L 4YXKL 5EPMB 2BVOA 1NCDH 3DSNA 5JXEA 1WAAA 3EOTH 3S5LB 4XXCA 5SX5H 1I1AC 1HHIA 1UB6A 4G9FB 4LGRB 2FWOA 2R0ZH 3BPCB 4YXLH 4RWYH 1T6WA 1J1OH 3MMEB 5E7FA 3PWNA 3U9UA 4PRNB 4MXWL 4P4KA 1AE6L 1KJ2H 4LRIC 4PP1D 1HXYB 2AJ3B 1ZLWK 4NQVB 5F3BA 2GUOA 3THML 5GGRY 3EO0A 4QOKD 3IDNB 4P2RE 1L9NA 4R26H 5TDOB 5AG8A 2IADB 5CILL 4EDXA 4Y4KD 1D6VL 4V2CB 1E4KA 4JQVC 2P5WA 5IF0B 1CXEA 2OMNA 4JO4L 5EN2A 5IT2L 1WBYB 4KZDH 1QTYT 4MWFA 1QNZH 4OZIE 4C56D 3VFUB 4XNQB 1YYML 3JTSB 3L5XL 5HTSA 1IZJA 1T1XA 2WLYA 5DK2A 5KG9A 4NT6B 3FB7A 3G6DL 3VFRA 4I1NB 4AMKH 1KB5B 2FGZA 2ESVE 2I5YH 3IVKB 3QBTB 1GSMA 2NXZB 4C83B 4KHTH 5CEZE 3RY6A 2BNQB 4U33A 1MEXH 2VZUA 3MRFA 2XFXB 2AXGA 1MCWW 1U8JB 1T83C 1ORSB 2FB4L 4JZJC 2HTKD 2DQFA 3SQBA 3BKYL 2WBKA 3B6SB 4Z76A 2VDRH 5JHLH 1U91B 2WIIB 5HYJD 5DGRA 2J6EL 5GRXG 1MJUL 2B2XH 4JG0H 2CLRA 3ULVD 1XF3B 2X4QB 4JRYB 4KQ3H 1LEKB 4HJGB 4NJ9L 3BRGC 3S35X 1GGIH 3G6AA 2Z92A 5JA9A 1QZ1A 3WHXB 4OFDA 1IMHC 1A6ZA 1VERA 3TA3D 1FO0A 1F4XL 2YZ8A 3HPLB 4OCRL 2H9GB 4QTHA 5T5FH 5T33L 4M1CD 3ZDZE 3B4NA 1RV6X 3D6GA 1PBYA 4UUJB 4G6FD 3EO9L 4ZTOL 4LLAA 5BOPA 3VW3H 5JW3L 3SGEH 5L6YH 3C9NA 4P99A 1KCUL 4PJ8D 1FGVL 3ZKXC 2AERT 1A9EA 3KHQA 1OAZL 4MQXD 3N50A 3QDJD 4NZUL 2VDKL 3A0OA 3MXWH 3LQZB 1MVFA 2AW2A 3ARFC 2Y9RT 3VXQB 3GK8L 3V4VH 5HGDA 1YMHA 4HJJL 5D2LF 2VLKE 4K94C 5C92A 4U6TA 1KF9B 2XN9A 4MXQD 2PYEB 3S6CA 4YAQA 3U0TA 3OR7B 1CDCA 1TVBA 1CK0L 1YQ2A 2P8LB 2B4CH 4N8VG 3VH8A 1JHLH 5KS9F 1X9QA 4HKJB 5DZOA 3WFHA 3DSFH 5A1AA 2ZUYA 3VGGA 1F02I 5LGHH 3FT3B 4GMSL 4GW4B 4K7PL 4P2OC 4H0HB 5I8KL 3WXWH 3ZDXE 3RWDB 1SMAA 2F54E 3CJJA 5FUOL 4YEFA 4YDIL 1U8HB 4U6YA 4PRPA 3BQUD 3LEXB 4YHKL 2MQCA 3KR3L 1B0GA 4FXKA 3NFPB 2HT4D 4M7JL 4L9LA 4OLVH 4XT1C 5F7MC 2X89D 4R96A 5CD5C 5MP6L 1RIUL 5HDOA 3O9WD 1TTUA 1ZT4A 3C6LD 4JB9H 1TETH 2F8OA 3GMNA 4PYGA 4M93C 5FM5O 3U2SB 5GGSB 1D5BA 2VB5A 4ODUA 3SDXF 3HS0B 3TZVC 1KFAL 3LIZL 4RDQG 5IBTL 2HT2C 2Z31B 1FFPA 4HGWB 4PGCA 1A6VL 2CIIA 1ZANH 2ZCKL 3HRZB 2C3WA 2ICEB 5F96L 1CL7H 1DFBL 1FZOB 3BX7C 4YPGA 3PUCA 2LAAA 3ARGC 5ICZB 2IBBA 5MENB 1RU9L 1G6RL 4M62H 1N26A 1X6LA 4PRIB 4YHOH 1I85C 5DO2C 2Y7QB 3IYLW 2E6QA 5A16B 3QIBA 4YQXL 1W0VA 4U1SB 1UJ3B 1NCNA 4N0UB 5I17B 2F5AH 3MNVA 5M7QA 2G2RA 2OR8A 1TZGH 3ALWA 3LMJH 4MJIA 1QLFA 1QA9B 3RHWF 4CMMB 4X4ME 3Q6GL 2AJXH 3QNYB 5GGVL 4J7RA 1WQVT 2A9NL 3TT3L 3D18A 4XXDB 3GI9L 4LMQE 4FTVB 4JLRB 2JJUA 4NO5A 4F57H 3KPPB 4HKZB 3VI3E 4AG4H 3LKOB 1FYHB 4HIIB 1ZGLB 3EYVB 3GB7B 4HMCA 2V6HA 4PRHE 4PY7B 5F21B 1YDPA 1LK3L 3BPOB 1J0ZA 4LBEA 4Q0XL 1P2CA 4PRBB 4APQA 2AKRA 4X8JA 2WP3O 5FOBA 4MDIA 1CI5A 1GOHA 1T2XA 2XRAH 5IFHH 3N85L 4Q2ZA 1P4BH 4RBPK 3IF1B 5EBMB 2HJLA 1FYTE 4N9OB 1A4KA 1IAKB 1YN7A 4DN4L 3VRLF 5L8KB 4QF1A 3LB6C 1Z6JT 2YXMA 4AM0B 5F1NA 5DD0L 3WUZA 2A77L 4JE4B 4M3JA 1Q9OB 2YPLA 2B0SL 5CEZH 4L8BA 2RR3A 2Z91B 2XTJB 5DYOA 2APTA 3EYQD 3MYZA 3VWKB 3IJHB 1CU4H 4Z7OF 3T1WA 2LV4A 4IRSA 5GSVB 5ID1B 3QXAA 3VRIB 4DCQA 2QQNH 4HZLB 4XWOD 1RJZB 1UADC 1I1AA 4GW5B 3VCLB 5T1DL 5C0NC 4DZBA 4MS8C 2V2WA 3WFDL 3HN3A 1PX4A 4WNQA 4FNLL 2ZJSH 4LP4A 5IMOA 5CSZB 1J12A 5E99L 3NIDE 5LCVL 2WIMA 4L29A 1FL3A 3MZTA 2LABA 3BXNA 1JPFA 3IXTA 4YHIA 3CK0H 1Q0XL 2R0LH 4UT9L 3ZL4L 2HLAA 3QIWD 1HKLH 4WHTB 3MROA 5F71A 2BJMH 4JQVA 4QY8B 3QNXB 3M45A 1BMGA 3LAFA 2NY5C 4E41B 5L9DH 1ZK9A 5F1IA 1WZLA 4ETQA 4Z5RB 2IGFH 5E4EC 5D2LE 4MZ3A 5EO9B 1R5VB 4ODVH 5IOPA 1T04B 1A14H 3MO1B 2OQJA 4D0DB 3S34L 1R3JB 3HFMH 3MZGB 5D7JC 4ZXBD 3IJSA 1GPOH 2Y6SD 3I75A 5DQJB 5F7YC 5DJDA 5IQ9B 4G80A 2JTDA 3X3FL 5HDQL 3OKLB 2F19L 4RFNC 2DQIL 4JZJA 1QSFD 3FRPG 3MC0A 1OSZB 1JZ7A 3PP4H 4M6MH 3U9PH 1GZQB 5FCSH 2HG5A 2HFEA 1G9MH 2P5ED 4JZNA 1KXVC 2ICCA 3E6HB 3RVTD 1KIQB 3CC5B 5FAAA 2A6KB 5KSAC 1Q8MA 4U3HA 5DVNA 1FLRL 1M7XA 5ITBH 5DMJB 4XMPL 3OKEA 3VFSA 3H9HA 2H2PD 4M1DH 2XWBA 5GS1A 4WEUD 1VESA 3P0GB 5HBBA 1FV1A 1Q9KA 2FBOJ 1G7PA 3QEUB 5BMFL 1D5XA 1ZHBA 2IFFH 1BWMA 2AVGA 3KWWB 5IB3B 2QV2A 3UTSE 1ULVA 3T0EA 1U9KA 2ADGB 2QR0B 4ZO7A 2A74A 1UACL 5CBEB 4U1JA 1OF2B 2FR4A 4K7PX 4HLZG 1NGYB 1MRDH 4FOMA 5B22A 4HFUL 4R9HA 5IHUH 5JOFA 1DTUA 4UQ2A 3OKOB 2MNUA 5HYEA 1QR4A 1A3LL 3W0WE 1S7XA 1PEWA 4LSRL 4U7SA 3EJYC 1A0QL 4ZUWB 4QHLA 2VLRD 1RK0B 4K3JH 5I18H 2PO6D 4OFVA 5I30L 5BXFB 1XZ0B 3RDTA 5C8JA 2BRQA 3BP5A 1ORQB 2E9BA 4JFOB 4TUJA 1I1RA 3WD5L 3K74B 3ULUD 4URTB 4LLWA 4IOSD 3DX9A 5C07D 3GNMH 2YWZA 2NXZC 1ZS8A 5IM7A 3NCBB 3FMGL 1T66D 1ZTXH 3BH8B 5BOZG 4G42B 4TUKH 4OLZL 3CFKA 4M02A 3FKUS 2IPUK 5BS0D 3EZJB 1YQVL 2H26A 2VE6B 5CIPB 1EIBA 4P2OA 3QISA 8FABB 2A9MH 3OB0H 1CLYH 3QWOA 3ARWA 1IAIH 2QADB 4JY6B 4YIQA 4YWGH 2WW8A 1UEMA 3CSGA 4OM1H 1EEYB 3K4DA 1OLLA 2IMNA 5ETUB 4KHXH 5I2IA 2OL3A 4QRPD 1VEMA 2FJFB 4WUKH 4YBQC 3OPZL 4JAMB 3VRLE 5TQ0L 4U6VL 3UDWC 3IFOA 5E1HB 3I6KA 4HZAA 2DLIA 4WI4A 5CEXB 1N3NA 2CRZA 2NW3B 3D3VD 3TZVA 4P5KA 35C8H 1C12A 3T65B 4F8QA 5JPNB 2VRAA 2FSEA 3AAZB 4Q74A 2C9AA 1ZLUK 1NFDF 2FX9H 3QUYC 2X6MA 4FQLH 1ES0A 4PP2A 4Z9KB 1P5VA 4Z7OE 1SVZA 3DOSA 5E4IA 2WWKT 4TOYH 2MFNA 5IR1A 3FQNB 1UYWH 2YXFA 1RQ5A 2DD8H 2PTUA 3TCXA 1I85A 1RUQH 3GRWA 1YEEH 4NO2B 1X5XA 4RGOL 1FIGH 3UC0H 1MJJA 3BIKA 3KPRE 1MCQA 5D71H 4Y4HD 5FA3B 2EO1A 4KWUA 1R6VA 1DQLH 4L5FL 1M05B 1OTUD 4LPUA 4JO2L 4NGHL 1U95A 3N06B 4GAGH 2I27N 3VXUB 2VOTA 1CR9H 1IGJA 1BQHA 2EH8H 5GISL 2H2SD 4X5XA 1F4HA 4F33A 3K1DA 3QP3A 4QRRA 1QFUL 4RZCA 1OW0A 1TMCB 5SX4I 2R1YB 3RP1A 4TSCH 3RVUC 5CS7A 5JQ6H 4ZFFA 2XWJA 3OAUL 4U6XA 4UDUA 5F1KC 1MWAL 2BHZA 4L8CA 3QNZB 4A6YH 2Z4QB 1AR1C 1NUDA 4HUVA 1S7RA 5I74B 4K23L 4CVUA 3FFDB 3G6JB 5EWIH 3VFOA 2XQBL 2EDWA 3LN4A 5DD5L 3SDXA 1K8DB 4P46B 1JK8A 3VGBA 2VDNH 1YNTB 2SEBA 4W4NA 1T5XA 4F9PA 1A5FL 4RGMB 2WUBH 2HVJB 1JGDB 3D25A 3BVNA 5IP4A 5M95B 3VXRB 3GM8A 4KGLA 4X4YB 2DDQH 5F44A 3TPKA 2IQAA 5E8NB 5JPMB 2Z31C 3OXSA 2YHGA 1NGXA 3MA7A 4NNPH 3OX8A 1G1CA 2NY3C 1RZFL 1ZHNA 5DQDL 2OZ4A 2DQUL 2P45B 1IT9L 4JVWA 3LN5A 1U92A 5FFLA 1ZMYA 4MAYB 2ZCHH 3WUWG 3ALPA 3TNMA 3DRQA 4YHLH 2PYFB 2X4TB 1LO5A 2EDJA 3MUY1 1IEAA 3HI6H 3O3AA 5GRVL 4OT1H 2G5RA 3OKMB 3U46B 4LHQB 3PWPB 2R23A 1UJ3C 1AGCA 3OAZH 3PP3K 3MLZH 4OZ4B 5C08E 3UPAA 5JR1L 5IFAH 5IEKB 4WWKB 2FGWH 1KPVB 2E3VA 2E27L 1G9NL 1O7SA 1XGPB 3UTTD 4DQOL 4BK5A 1QEWB 2HKHH 4H20L 3BZEB 3U30B 3LRGA 3EFFA 2BSSB 2FATH 3J8F7 3BP4A 1P7KB 3PGDB 4U49A 4LFHG 1C5CL 4DGIH 1RZGA 5DD6B 4JPVH 2CR3A 1YJDL 3BPOC 2Q76B 3RWIB 2HFTA 2AS5M 4XP1L 2B5IB 5HYFA 4P5TD 2H3NB 4MD4B 1I3GL 2JJVA 5EC1B 1BBDL 5D7JA 1HINH 1S5IL 1WCBA 5H2BB 5H94B 3P2TA 1X5ZA 5IW1A 1GGTA 4F58H 1Q9WB 1UB5A 5JMRA 5LXGH 3T1FB 3INUL