1MJ8H

High resolution crystal structure of the fab fragment of the esterolytic antibody ms6-126
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
216
Chain Sequence
VQLQQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGNIYPGSGYTNYNERFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCARKHYFYDGVVYWGQGTLVTVSAAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN MS6-126
total genus 43
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2002-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8H02
4I9WE 3S9DB 1WZMA 4IMKC 1IGFH 3HUJE 2FECI 4PLOB 4XPGL 4Z7UA 2FL5A 3MFFB 1AIFB 2FBJL 4K8RL 4F8QA 3P11H 3JVGA 4WVRA 1V7ML 3K2UL 4HUWB 1BQLL 4H20H 3BKJL 3KPMB 4WTWA 4ZXBA 2R69L 4G80B 1JJUA 4P2RB 4PBWD 1HEZB 3LQMA 3ZHKA 3AC0A 4RFNC 1QD0A 3MFGB 4LNRB 5I1AA 4XCFL 1ZLVK 1X6LA 2EXYC 2ZCLL 4YGVB 1F90H 2YUVA 4F9LA 3HE7B 3VDAA 3MRGB 4WUUE 5E5RB 1KN4H 5I1HH 2D7QA 3TN0D 1SY6L 3O6LH 1PVHA 4RDQG 3MUZ1 2KKQA 2QSVA 3BZ4B 5HD8D 4IRSC 1A14H 5JOFA 4EEEA 2VLRA 5DSCB 4HKJA 4E0RB 2X89D 4YZFF 1PKQE 3X14A 4I3RL 4WUKH 3CFCH 4LVEA 1N59A 3DGGA 1R5VA 3MRFA 4Y7MA 5HHMB 4BK4A 1HXMB 5EOCJ 2PUQT 4Q74A 2XNAA 2ZWLT 4KJPC 4I2XA 4DWHA 5FHBL 2ZCHL 5KG9A 4MCZB 2F54B 3GJFK 3K2UH 4W6XB 1WBXB 1QSFE 4L3EA 5FGCE 1PJ9A 3SE4C 4IHOB 1N5AB 3VRIB 3MLXH 2APBA 5F97E 4CVWA 5A2LH 1JWUB 1YMMA 1CIUA 5ISZE 4NZTL 5GGSY 3WN5B 3JVGC 3O4LB 3OPZL 3DV4A 4QGTA 1I7TA 1RIHL 3QG7H 3SKUD 3BRGC 2HMIC 5EUKB 5IUSA 4NDMB 1BVKB 4V2CB 3ZKMC 3N1QC 2FH6A 4M62L 4ORGB 4XRCB 1GYAA 5E4EC 1IVLA 4YK4C 5CEZE 2HKHL 2CRIA 3VXMD 3VRJB 5D7LE 2HJFA 2QQQA 3CSGA 5J7CC 5IQ9A 1J8HB 3QCUL 3IB4A 2P43B 3B2VH 2Y6SC 3T8XB 1WWCA 3VWJA 1A8JH 1A3QA 3LQAL 5FHBH 4FG6D 1G7MA 3U0WH 1B0GA 1UJ3B 2C4XA 1QRND 4MNGE 1R24B 3MPCA 3I02B 1RZGA 3RHWF 3DVGA 2A9NH 3MUGB 4NM8H 1HILA 1IQDB 2VLKE 1KTLB 2YA2A 3MJ8B 1C8PA 5J12C 2DICA 3OPZH 4P0DA 3K74B 2ARWA 3SBWA 3QCVH 2BJMH 3TVMD 1S7RB 4YIQA 4KDTA 1FAKT 1OSZA 3N1MC 3R8QA 3MBXL 3NTCH 2EYRB 5E03A 2NXZB 5I9QC 3H7LA 1IAOA 1T7WA 2HH0L 4MD0B 1HWGB 2EDWA 3OL2A 4OZHA 1Z0NA 1S7XB 2IPTL 5GS1A 5I76A 4BH8A 4EDWL 4D9LL 3HMWH 3HG1D 5ESQB 5KVFL 1ZHLB 1DE4B 2WBKA 2BSTA 1S9WB 3LEVH 4PRPA 5FYLD 1E0OB 3W9EB 1A7NL 2VZOA 3QIUB 1IFHH 5BRZB 1PLGH 1S9KC 1NANI 1VB9A 3A6CL 1EMTL 2ICWA 3ARDD 2R1XA 1B4JL 1FDLL 4GG8B 4LASL 5JW5A 3DUSA 2R0ZL 5IMLA 4PJHF 1EK3A 5INDA 1TZHA 5DD0H 4ZS6D 3S35X 3F58L 1MLBB 3RGVB 1JZ5A 5KW9L 4S2SB 4ZUSA 5DFVC 5KAQF 4M8VA 1TIUA 5IBLD 1X4XA 3IU3A 1KGCD 1F4WL 2KDGA 4JPVH 1MRFH 2WV3A 5JXED 5L6YL 3D0LA 5EC2B 4D2NA 3TM6A 1JTTA 5IBUB 3VGGA 2C3HA 3MLUH 5TQ0H 1CG9B 4HWEL 2P5WB 1EO8H 1A7NH 2RIKA 4V1DB 3VW3H 5K59E 2OJEA 4LLVA 2YZ1A 1ORSB 4ZQKB 2G60L 4HKBB 1JMXA 5CWSB 1TNNA 3GSVB 1A0QH 1I3GH 1MFEH 1LO2H 3UTTA 2FX8L 3G6DL 5JUEL 1JGLH 2B5IB 1GOGA 1H8SA 1NBVL 3T0AA 3MRJA 3MJ6A 4KV5F 5DR5H 1U8IA 4IIQA 1T83A 1KJVB 3VWKD 2WWKT 1H3UA 3AAZA 4MMZC 5HVHC 1U8PA 3NOIA 2XG5A 2EIBA 4JFPA 4ZODA 1A9EB 1AXTL 3RWGB 3CSYB 1W8OA 3BP5B 2GK2A 3ESUF 1I7ZA 4GS7C 4LDLB 4WWKC 4F57H 4WI3A 4NQCA 3CXHJ 4PJEA 2F19L 4DKAA 4FFZH 2FR4A 3GHBH 1D9KB 3L3GA 5IIEB 4GW1B 1AI1H 2XZQL 1N6VA 3STLB 4M1DL 4NO2B 1JPSL 3V6ZA 1K2DB 1A3LL 1MVFA 3AMLA 3GHEL 3JWDL 3PGCB 5J1AA 2UWEA 4YHIA 1KCRH 2NNAA 3FQXB 3WMSA 3QIUD 4OLVH 5D6DA 4XVSH 1YNTA 2WK2A 2H41A 4MVBD 5J9PA 2C3VA 1FQ9C 1WC7B 1IAIL 3KPRA 1JTPA 2PYFB 2B39A 3GB7A 2VXUH 4NO0B 1NCCH 5FO9B 4I3SL 2EC9T 1JI1A 5IGXL 5E8OA 2Z9TA 3I3BA 4DGIH 2W59A 1U9KA 2X4SB 2P44B 4ZO8A 4PV9A 5TGBA 3IF1B 2DQJH 1S7QB 4R4ND 5C0GB 4JFEB 1C1EH 4RAVA 5IB1A 2BXZA 5DJDB 1KBGL 1E6OH 4FFZL 3PHOB 1VACA 4TPRH 4XHJC 4W81A 5EUOE 3EYOA 4NUGL 3EOYG 3QDHA 4XAKE 1XAUA 3GNMH 1AP2A 3TJEL 5DYOA 5D7LB 3D9AH 3U2SA 3PWPD 4BKLA 3MYJB 2DI7A 4Y4KA 4Y4KC 2DD8L 2GY7B 3HNVH 4LARL 4QHMB 4M93C 2APTA 3ZHDA 1Q1JL 5HHOE 1KUMA 4LP5A 3BE1L 2CGRH 2HVJA 5DD3L 1JPST 3RTQC 3S36X 2JK5A 2Z93A 5DJ0B 1KPUA 1IKFH 1MI5B 3P3YA 1S7VB 3U6RB 2HWZH 4GUPB 3DETC 2X4PA 5DHVA 3L3KA 1TETH 3KPOB 2NZ9D 4XNMB 2HT2C 3AREC 4WCYH 1DBKH 4KUZH 3WO4B 4JDZA 2VR5A 2FSEB 5E2VL 1YA5A 3T4AA 2YPLA 5D7IB 3DIFA 2Q3AA 2HP4A 1ZA6A 2Y23A 4AJ0A 3BKYH 3VFTA 2C3GA 3D9AL 2SEBA 3O6FA 1AGFB 1HYSC 3FQWA 4GMTH 4FQPA 5DEGB 5TDOB 3IS0X 1C16A 1ZE3C 3RY6C 1BGXL 2IMMA 4Z7NF 5ICXA 2J8HA 5DHYA 4YPGA 4R96A 4WW2A 5E7FA 4LNVA 1OP5H 3QUZC 3IXTA 5E56A 1IC1A 5I16A 3W5NA 2I9TB 3O6ML 1YEFH 4P3WA 1D5IH 1F90L 1RHHB 4Q9RH 2OXGA 1KN4L 5DA0B 1Q9WA 1YNKH 3NMEA 4OGYL 5DUPL 4HWBH 3HZKB 1QKZH 2ZP0T 2JIXB 1JHLL 3JV0A 4HAFA 4PRHB 5MENB 3TIEB 4X4XA 1KJ2A 5DMJB 3TGXA 4Z8FL 1QFPA 3LRSA 5BZDB 1K5NB 1VFOA 2EDTA 4XMKL 5BS0E 1T7ZA 4JG0H 3LS5H 3CZFA 1JWMB 4YDJB 2GT9A 1U6AL 4KK6C 3RWDA 3W82A 3PWNB 5EWIL 3SCMB 2FJGB 43CAB 2H2PD 1T7XA 2XA3A 3BO8A 1DBJH 4PJ7B 4DK3A 3P77B 5CBAA 3T2OA 3QDJD 1LMKA 4PP1C 1IC4L 2DQGL 3BQUD 4L4VB 3RNKB 3IFPB 5EZIH 1BEYH 1GGBL 3QDMD 2AV1A 1MJJB 5DUBA 1YY9C 1C5CL 2ZZUT 5GGTL 4KZDL 3KPNB 3ZE0F 1EFXA 4JO4H 2NY3C 3EDKA 4HWBA 1J1OH 4P5KB 4OGXH 3QHZH 4YE4L 5F6HJ 4Q7DA 2XRAH 4OZIE 2Q6WB 5DK0A 2NX5A 2WUBL 1I1AA 3VFPA 2EDHA 3QB7C 3QO0B 5EPMB 3KLHC 4OZFG 1UCBL 4YR6B 4HFWA 4KGJA 2N56A 4LNRA 2VYRE 1U3HD 3S4SG 5HI5C 4ZUUB 5BO1H 3OX8B 4YHYC 1JUFB 4WWID 4LSRL 4PTTB 1H5BB 4QTIL 3QCVL 3G6JA 3HZMB 3BGFB 4YHNA 3SJVA 4LRIA 1BEYL 1GGBH 1JPTL 4X5WA 3C5ZD 4HKJB 1QBAA 2VKWA 3LCYA 4IOFC 4R8WL 5J13C 2YWZA 3RX8A 4JO4L 4KKLD 1HXMA 4JY5L 3D85A 1I8MB 1DEEA 2J5LB 4X4YA 4I2XB 3HMWL 5JMOC 5KVFH 5HHNA 2CKNA 3ZDYF 5KG9B 4MHHI 3VXSA 4P2QB 3SE9H 1N8ZA 5C0FA 4OCLC 1KG0B 4XP4L 5GHWL 4RRPG 5HHXL 1U8LB 1DANT 5DMIH 1I7TB 3FFCA 5D1QC 2JF1A 3AU1B 3WIFA 4G6KH 4K7PX 1Z9MA 1VFBB 4DUXA 2B20A 2GCYA 3TT1L 4XRCA 5J11B 4NN7C 1RY7B 4Z7UF 1JPTH 8FABB 1HK6A 3FTGB 4ELMB 4XPFL 5KS9B 2OI9C 3QPQC 4ZFGH 2BNQA 3T3PF 3THMH 3RWJA 5HSFA 2LVEA 3HCVB 5GGVL 3RTQD 3UBXA 4LK4A 4G6MH 4MXQC 1MRFL 2BOBB 5L6YH 4M9PA 1UA6H 3HC0B 2XN9A 4NQEB 3SO3B 5D1QD 5MI0C 3RVWC 3U82B 3MLUL 4NHCH 3C60D 3C5SA 2VISA 2NLJB 4LCIL 3RIFK 5C7XL 3V6BR 5IVXE 3ARDC 2YZ8A 4ODBD 2G60H 5EC1B 5TQ2L 4PJ5D 1QLFB 5D7JC 5IW3A 4A6YB 5DVLA 4D3CL 5JXAL 4AEHL 4UDUA 2DYPA 3G6DH 2DLIA 5GXBB 3CX5J 4Y19B 5BS0A 1M1SA 5D5MB 5H35A 4YIQB 4OLWH 4BFEA 4YWGL 5EZOH 1OSZB 3PQYD 2EDKA 5FAAA 5D8JL 5HYJD 3O41B 3M1BB 4PJFE 5E9DD 3S36L 1TTFA 5E7BA 4ZFGL 5C0CA 4L4TD 4DN3H 3NA9H 3NN8A 4X6DF 4WGVB 3P30L 1CL7L 3UC0L 5FEBA 4JN2A 2CMRH 4MVBC 1S9WA 1AI1L 3FFCE 4K94C 1N6QH 4NNYB 5F7MC 5C09B 1JPSH 4WRLA 1BFSA 1II4E 3B9DA 5E0QA 4OKVB 4UUJB 4GKZA 3WN5C 4GG8A 4JE4B 2D0GA 3OAZK 3QNYB 4F7TA 1A7RH 2PXYC 3CDCA 2NY0B 4W4NA 2CKBL 4PJFF 1WAAE 4NRYB 4KTEL 1BJMA 5CGTA 4KJQD 1QSEA 1PBYA 2O5ZL 3KLDA 4F15C 1JV5B 4HS6A 3LN9A 5IVXF 4JKPH 1ZLWK 1NUNB 4G42A 1WISA 4ZUSB 3MMEA 4Z5RA 2EECA 3FQUB 1F8TL 4HK3N 1UACL 2ZUWA 3NA9L 4PR5A 3LKPB 3ZDXE 5B3NA 1C7SA 1HXYB 3I3DA 4FFVD 4JFOB 1KIPA 4P5TB 3O3EA 1J8KA 4I0PC 2X41A 1OT1A 4AIZB 4HC1L 1E6JL 1ORSA 4ZQKA 1FVCA 4ESKA 3ARDA 3VFWA 1JWSA 3HNVL 4LARH 5DHXB 2EH7H 1GC1H 1K4DA 3VXME 2NY0C 1S7SB 5D7LD 3WFHA 2AJUH 4GRLA 1DN2A 4LGSB 1IEBB 1ZLSH 3P2TA 2ADJB 3GJEA 1IGJA 5IM7A 1Y6NR 1KTDB 1NAKH 4TVSa 4DCQA 4ONFH 4O58H 3RUGE 1UZ6F 1L4IA 3QPXH 5GRVL 3QHFH 2V7HA 4NN5B 1M6OA 4HV8A 4PY7A 1PG7L 5I8KL 5MEPA 3E0GA 3CSYA 4MNGB 4BH7B 5L7XL 4F80A 3BZEB 4NQCB 1JGDA 3BP7B 1AR1C 2FR4B 1NPUA 1YEKH 4JKLA 4XVJL 4HX1A 5ICZA 1HSAA 5IOPB 4MJ2A 1TQBB 1A6WL 4XMLL 3V6ZB 1ACYH 1EEQA 2AJ3A 1XZ0A 4WFED 5SX4H 3W0WA 1LP9F 4KROD 1CICA 1G0DA 3MV7D 4NNPL 3MRPA 2QSCL 5GRVK 5J9PB 2JJTC 5I1DA 2D2OA 3KAAA 2XY2A 1WC7A 1ZLVH 3D39E 4NO0A 1RIVL 3H3KA 3O4OC 3P9MB 4PGDB 3MZGB 1I9JH 2Z8VC 4JRYD 4MA3A 3QXTA 4Y5VA 4ONFL 3DWTA 3HG1B 3QHFL 2A74A 4EN3B 4PJEE 1QFUH 4HWBL 3SE3C 2EE2A 5E99L 2NTFB 1HZHL 3V6FB 5GGVY 4POYA 2UY6A 4ODHH 4S1QH 2G9HA 4JFXA 3CC5B 1WUNT 4L3ED 5D1XD 3QXUA 3RL1B 1LO4H 4LKXB 2FX7H 2R15A 3DRQA 4P23A 3O8XD 2MPAH 3HMXA 4XMKH 5FYJE 2UUDH 5ISZA 3VFNA 1CLCA 2BRRL 2FL5B 3MFFA 3QNXA 4TTDD 3Q6GL 1DLHA 2YK1L 3HPLB 2DQCH 1QLEL 5CIPA 1KYOJ 1RK0B 5I1EL 1KT2A 1TPXB 4P2RA 3TA3B 2JK5B 1N3NB 2Z93B 5J4MA 5FM8A 5HYSG 1T5WB 4R4BB 1BWMA 4LSVH 2XKNA 1IC5H 4NKDA 1NUFA 3BHBB 3HFML 1LNUB 4QOKA 3MRGA 4DW2L 4CKVX 3F7VB 5EZIL 3VG9C 1HZHH 4JHZA 4R26L 2Q20A 5I1LA 3OJVC 2CIKB 3MGTB 5E5MA 4BZ1H 1LO4L 2DLFH 3OF6D 9CGTA 4FHBD 3SJVE 4GKNB 3LV3B 2FJFB 3DURB 3QSKB 4OIIH 4AEIL 1NCBL 4MLIA 1PKOA 3N9GL 4NNXB 4QWWD 5E8PA 4BFIB 1AGFA 5J12B 1N2RB 5TDOA 1CFBA 3WFCH 3CJJA 2ZUVA 3MCKA 3MV01 4R96B 5J6GB 5GISH 3V5DA 3NIGF 5JOEA 1LWRA 1QLEH 3IXTB 5FV1L 4KMTL 1WBXA 2W91A 4JKMA 4LSSH 1WEJL 4OD1H 1XIWA 5TDNA 4X8XA 4YHOH 1MH5A 1FFOB 2Q76A 1IL1B 2YEZB 2IBGA 1YMMB 4JRWA 4RGNC 5BO1L 3ILQC 4HFUL 1JYNA 4H1LH 4R7DB 4WWKD 4E41E 2ED8A 2K9UA 3PQYE 3G5ZB 4P3DA 1R3LB 4YK4B 1KN2H 1K3IA 1Q0XH 5EUKA 3B9VA 1SMAA 1MUJA 3SGEH 4NO0D 1F13A 3VFVA 5C6WH 4R90L 1C5BL 5DF0A 4P46C 1O7VA 2AXGB 1NCUA 3OKMB 5C08A 3LRSB 3TJHD 1UM6L 4Q6YA 1FL5B 4U6TA 2FCBA 1G7LB 2GFBA 3U7WH 1FORH 1MFDL 1P7QA 3QJFB 3ZKSD 5I15L 3SGDH 4YBHA 3DXAA 4U1NA 4O5LH 2FJGA 4OJFL 3WNKA 43CAA 5GS2H 3GIVB 1YDPB 1BF8A 1R3IL 5HDBF 3CNKA 3I84A 1R24A 3I02A 1Z9LA 3CU7A 1FNEA 1GAFL 5ACZB 4Z0BL 5HDQL 4WHDA 3DVIA 3UBXI 5DI8A 5E4IA 4F7MB 1GSMA 3PWPE 5DUBB 4H5SA 3ZHLA 4UTBL 3CFBA 3IVKB 3KPNA 1L9MA 5E00A 4ZS7L 1FN4A 2HFEB 2O26U 2B0SH 4DQOL 5GGVH 1UM6H 1WBYA 4OLXH 3SDDB 1CE1L 1DUZB 3T2QA 5L9DL 3LQZB 2NX5B 1NC2D 3U7WL 4YNYA 3O8XA 3V5HB 2E6PA 1E4KC 4LCIH 3GDBA 4KKBD 4O2EA 3LKNA 4OV5B 4MNHA 4JPWH 3MRBA 1BP3B 2WUCH 1UWGL 3QIUA 5KVGL 2PXYD 1AFVH 4Q0XL 4PB0L 4JEGB 3U4EB 4AEHH 3OX8A 4UI2A 2R1XB 2ZJSL 1H5BA 4HIXH 2I9LB 5I66B 3E1F1 4RBPH 2BY3A 3KYNA 2AEWA 4UTBH 1LVEA 1TZHB 4LSUH 4EOWL 4KVNL 1MHPL 5DUMH 1HHHB 1TITA 1T4KB 4GRWH 4NZRL 2EYSB 2DLHA 4QTHA 2JJTA 3AREB 3RL2B 1NL0H 2ZOKA 2YBRB 5B8CC 5EC2A 3C08L 2CDGB 4M00A 5D1XA 4Z9KB 5IJVA 5B3JE 1Z9OA 3QUXC 1MRCH 1CDYA 4WHYH 3Q5TA 3MRMA 3NCYS 2J8UE 3ZT5A 2WUCL 1GGTA 1MWAL 5KVGH 2VDPL 4KROC 4V1DA 3V4VH 3RNQA 4H0IA 3CZJA 5D93B 4HKBA 3N85L 2W0KA 2ZJSH 4XPBL 1KIQA 4ETQA 1M05A 5HGAA 4X7SL 4PLKD 1SQ2N 3HNSL 3TYFB 1TJIH 4UNTA 3VD7A 3WKML 4DFIA 43C9A 1I3RA 5FHAL 2WWMD 2W60B 2D9CA 1F58L 4J4PD 3U46A 2VAAA 1CK0L 3CFEA 3GI9L 2BOBA 1A9EA 2VC2H 5F96L 4NQEA 4RWYL 4CRPA 4OF3A 3BP5A 4U0RB 2PO6C 5E6YA 3FRPG 2AEPH 2VB5A 2HVKA 1P5VA 3GSXB 5JIHA 2OTUA 1ITCA 3LDBC 5IIEA 4XMPL 2AJYH 1LDPH 1K4CA 5HHOB 5T5NF 3PGCA 5E2UL 4NZUL 3ESVF 3SGJC 2C4FU 3DJ9A 3MLWL 1UYWL 4IDLA 5DGRA 2NXYD 1W0VB 2X4RA 3RX5A 1WITA 2WW8A 5CP3H 1NAKL 2GSGA 4O58L 3KPRB 1ZGLA 2ERJC 4CN1A 5E8OB 4KMLB 2AI0H 2OR9L 3NN8B 1WVZA 1INQA 1AJ7H 4JN2B 5AD0A 2H26B 5C0BA 4U1HB 2X1WL 1P7HL 5L88H 4AIXA 3ZT6A 3TO4A 5IB1B 2VLKB 5IJKC 5CSGA 2D4FA 2IBBA 4U6VL 5KVDL 4XMLH 1ZMYA 2A73A 4NQCD 3P9LA 4KRMB 1F2QA 5I8OH 4K3GA 2APWA 4KXZI 1ZVSB 3DX8A 4GKZB 4JY4A 3O9WC 2QR0B 3L3JA 4NZUH 3QNYA 3HC3L 3MYJA 1A5FH 4G8EA 3NIFF 4M7JH 4PD4J 4KROB 4G3YL 1NSNH 5EH1A 1KELL 4PFEA 1TZGH 3FB6B 5IFHL 1BLNB 3L5WB 3QUXB 3HAEA 3KYOA 1QPPA 1S9YA 5IFJA 5C0EB 3BJ91 4UAOB 4I4WB 1QFUL 2Z31C 3DX9A 2EZ0C 3O11B 1WZ1L 5C6TL 2X4TA 4JDVA 4P3CL 5C0AE 1J0HA 2E8ZA 1A3RL 1U3HA 4QXUL 3L3KB 3MRQA 3GSQB 1QBBA 4PJGA 2HRPH 3VI4F 4EN3D 1FV1A 2BNRE 2WZPD 3PWLB 3S34L 4ZAKD 3RHWK 2FSEA 3H42L 4DK6A 1YY9D 3LVEA 4ZFFB 3MBEB 3IDIA 4BQ8A 4MJID 4DAGH 2YPLB 1QO3B 3L6FB 2XN9D 3R0MA 2P8MA 4AIZA 3HS0B 1ADQA 3MJ9A 3ARDB 3VFWB 3VFTB 1J5OL 3H7BA 4GRLB 2DQCL 1GOFA 4PJIF 4WV1C 2ADJA 3GJEB 5CEXA 5IMOB 3REWA 1KTDA 4XHQA 4KJWC 1IAII 1DQMH 3QDGE 4J8RA 3AS0A 1J8HD 2AKRB 2V7HB 3G6AA 2AK1H 1TQCB 3GI8H 2P5EA 4J3VA 4XXCA 4XXCC 4PGCB 4EI5C 4OM0L 3TZVB 4HC1A 5FDWB 1IMHC 4C58B 3EKCA 3ARVA 2GJ6A 4KDVA 1ZT1B 4Q9BA 4V1DE 3Q1SH 4OI9A 5LGJA 5T3XL 5DJZB 2RCSL 4WV1A 2Q8BH 4KGLA 2KQMA 4Y1AA 3SDAD 3VGDA 3O3UN 1XZ0B 1CE6A 2B4CH 3SBWC 5CJ5A 1D5BA 1K5NA 3D85D 4HKZA 4RQQA 3SQOL 1VA9A 3BIKB 3KJ6L 2ZNWA 3T04D 4RBPK 3MNVB 1EGJH 4KI5C 5T1DH 2IPUG 3SDCC 3IDGB 3CUPB 3IETB 3DXAD 5ADOL 1MJ8L 2J8UF 3DHMA 3P9MA 4ZFOL 5KBNC 4HIIB 5CCKH 2H32A 3BO8B 4C83B 2FLBT 3QUXD 4KQ3L 4PJ7A 2AK1L 5IG7B 5CBAB 3S3SA 2NXZD 5FYLH 2GUOB 4P59H 4I0PA 2OZ4H 5DJ6B 5TH2A 3KDMA 4JANB 1A7OH 2YKLH 4UAOC 4CMMA 4HKXA 4P4KB 2BMKB 2ENYA 4OFPA 4M7LH 5FYKE 1EFXB 4WWKA 3SGDI 2ITCB 3GSNL 3WXVL 1A1OA 4L9DA 2EO1A 3VH8B 2AQ2A 2VZUA 5EZLA 4PD4K 1U93B 1BX2B 5BW7A 5I1JL 2E7MA 4XBEH 2Q6WA 3V6OA 5DS8A 3AY4A 3CH1A 3QXVA 3TA3A 2LV4A 4PS4L 1NAMA 1YY8A 3UYPA 1I1AC 1AH1A 3GGWB 3GMLA 2PW2A 3CGTA 3IJYB 4RFOH 1I7RA 5BVJB 1QUNA 3RZCA 3WNLA 3SDXA 3QYCA 1FLRH 3ZE1F 2XY1A 3INUL 3MGTA 5E5MB 5DMGD 4MA7H 4OM1H 4CVXA 4KJYA 2UZIH 3KPSD 4PJ5E 1UQSA 4ISVA 5FV2A 2DAVA 5IROA 4QXWA 4R2GD 2HMID 5E6ZA 2MOVA 2BFVL 3GUTA 2GJZB 3D3VE 3FB8A 3D85B 3MCKB 5SWQA 1MCFA 4NQVA 3V5DB 1BQHG 3VXSB 1CT8B 1BQLH 1XR8B 1SJVA 1WFUA 2ICWI 4XBPA 1KG0A 2ATPB 3JTTB 2CH8A 1A6TA 3LB6D 3E6FA 1QZ1A 4KHXL 4P3DB 3SPVB 2EXWD 2YD2A 1NEZB 3A6BH 1FL3B 1VFBA 2Z4QA 3FQRB 4JQIH 2GCYB 4U1JB 5AZEL 5E6IC 5I75C 4RGOH 1F3DJ 1EEUA 4BM7A 4W6YB 3MZTA 2XWTA 4EI5A 3W2DL 1FL5A 1SBSL 4Y4FB 5IW1A 4NZRH 2W65A 1JYVA 1FYHB 1A6UL 1OM3L 4I9WD 2L7JA 3RWJB 2FEDC 3QUZB 3UBXB 3L95B 3QJFA 1P7QB 2M1KA 1DBMH 5KSBE 3HC0A 1X5KA 1N5YH 1N0LA 1NGXB 4P49A 4ZUTA 1WQVT 3PDDA 4J1UA 2VISB 5EA0L 1CLYH 4EUPG 4U05A 4JFED 1MWAH 2KZWA 5D93C 3V4VL 1CGTA 3O45A 3CFKB 3RY6A 1BIIA 3C8HA 1INEL 1DQJA 5FGBA 4A6YA 4NJ9L 5I0DA 3RFZC 3GIZL 4F7MA 5BS0B 5D5MA 3HI5H 5H35B 2VZSA 3RDTD 1IEAA 5IHUL 2DKSA 4HLZH 3VCLB 4KQ4L 1QFWL 1GZPA 5E8DL 1OB1A 3SDDA 1QHPA 5SWSE 2CR6A 1R3HB 4MJIE 3N1PC 4FFWD 5T1LD 4QRPD 1AKJD 3DRTB 3WUZA 3CDGB 4OV5A 5D1ZC 3OTTA 4M8QA 4XMPH 5C09A 2W07A 1LEKB 3TT3L 5A3IC 5GRJL 3QDJB 3SKOB 3RU8L 3IXAB 3LKQB 1HNFA 2I5YH 3U7AA 1CGSH 2EDQA 2HRLA 2V5RA 1CGYA 3WS3A 5J11C 4JFFB 4N5EC 1A4JB 1K3ZA 1DQTA 4S0SD 1RUQH 5F1SA 1QBMH 4YHML 4X6CA 2FO4A 5JR1L 2AI0L 5IHUH 4EI5D 3MBXH 4HS6B 2YPVH 5FA4A 2Z8WC 3VI3E 4UV4L 2VAJA 3HC4H 3T0WA 1GC1C 1IKNC 2X70A 4WO4D 3O9WD 1Z3GH 3OSKA 1QSED 1CFNB 3MACH 1VSCA 3U4BL 4JO1H 3RI5K 3ROOA 1MHCA 1HXYA 1JRHH 2Q3ZA 3M17A 1KIPB 1MAMH 3HR6A 1PY4A 3O3EB 4K2UH 1V8HA 2EDYA 2XFXA 1EJ6A 3MUHL 3BD5A 5MEND 3VDBA 1S8DB 3A6CH 1JWSB 2X4NA 1EHLH 3NFNA 5FA3B 3B9KC 3IU4L 3RY5A 4F37F 2VDNL 1RV6X 4L8SB 4KVCH 3WHXB 3CXHK 1CFTB 2IC2A 4NCC2 3O2VH 4OIBA 4R4FL 3TYFA 4L8DB 3RUGA 1UM5L 5J1SC 1OD9A 5IM7B 4GAYA 5C86A 2MFNA 5CEYB 4E5XA 2FIRT 5DD0L 5DURD 4LLWB 4N8PA 3U46B 3RVTD 5T3XD 4KC3B 1UEMA 2P45B 5MEPB 4I13B 1Y0LA 2PR4H 5C07B 3WV0A 1DFBH 3C6SA 1NDGB 2YUXA 1JGDB 4Z7NE 2ZSWA 3SKJL 3MACL 3SKNA 5MEOB 4P57A 3VH8G 2F53B 3VFGL 2R0KH 5ICZB 3MV8D 1JRHL 2MJWA 4Q97A 3NCJL 2XWJA 4FRWA 2AJ3B 5CZKA 1OWRM 3RAJH 2B2XL 3VW3L 3NCMA 1CICB 1K8DA 2WBJA 5I1DB 2ESVE 4L4VD 1W72A 4HUVB 2NY1C 4GKSA 3IU4H 3GKWL 5IBTL 4R4FH 2AK4A 4MA3B 2LE9A 4C56D 4XWOD 5SV3A 2GSIB 2XKUA 1G9EA 5HPOA 1XR9A 4K07A 4JRXD 2H26A 5C0BB 2NTFA 1PW3A 4PYGA 3VDCA 5DD5H 4OZ4A 3U9UB 5FOBA 3QQ9D 4N0YH 4ODTH 4POZD 1RZFH 5HD8C 4YHLL 4LKXA 1QR1B 4HIHA 3SQBA 4WJ5B 5IR1A 3DRQB 5FK9A 2B4CL 1JZ4A 3BN9D 2VE6A 1CIDA 1OGTB 4PGEB 3PGDA 3P0YL 1KYOK 5L2JA 5CZVL 4OZGE 3VFNB 5T1DL 4P2RD 2IF7A 4BSVA 5ADOH 1BLNA 3NIDE 2VDML 5JNYB 2ZSVB 1FJ1B 4WHTB 5D96B 3SE8H 5T1KD 5C0EA 5EU3B 3DECA 2MMXA 1N7ML 1N3NA 2FIKA 4JN1H 4K3EH 1GZQB 1UH2A 4X6CF 2XKNB 4ZOEA 5EIIB 3ZYOA 2X4TB 2OBGA 2R4RH 3ZDXF 3LMJL 3GJFA 3MRQB 4MLSA 1LNUA 1CF8H 4MQTB 4LCYB 5CJ8A 4X6DE 2MHAB 3PWLA 3F7VA 1M7IA 3MV7A 1L9NA 1C7TA 2A6KA 5K9QI 1KBGH 4KDTC 3QFJA 5AWNL 3FOMB 3RDTA 4TPRL 4UOW0 2YWYA 3LV3A 2VSCA 5DJXA 5FYJU 2H2SD 4K9EH 2C1OA 2C1PA 3D1MC 3FJTA 5TE6L 5A2JH 3P11L 4EN3C 1N2RA 2VLJE 1IGTB 4PJ7F 4Z18A 4H20L 3BWUC 4PB9H 1MJUL 2A77L 4PRHE 5L8JB 2VIRA 1OGAD 3REWB 5L2KB 3MXWL 3QR2A 4LVOC 4OCWL 3H0TB 3KPQB 2YRZA 5D72H 2YC1B 2VXQL 4ZNEE 2BVOA 5JLZB 1SHMA 5TDNB 1IKFL 3G08B 1IL1A 2C3WA 2R2EA 1NGYA 4APQA 3S5LG 3CK0L 3RTQB 2CXGA 3G5ZA 2VL5B 3IFOB 1R3LA 2NY3B 1L7IH 4WCYL 2K7PA 4MCYA 1MUJB 1KULA 5D2NA 3L3IB 1NGPL 1B88A 5E2VH 2VABA 3C5JB 2E3VA 2AXGA 1AQDB 1YEDA 3N0PB 4KXZH 3VFUB 4Y19D 2EDLA 4FTVD 4YLQT 1YJDC 3CCHB 1BZ7A 3KHOA 2ENSA 3ARXA 5TE6H 4K3DH 4Q9CA 5IVZA 1FZOA 1HCFX 1ZK9A 5IB3B 1MCJA 4WO4A 2W9DH 5CUSL 1KEGL 2GTWA 4QHNB 4L4TB 3ZO0A 1NCTA 2Y5TA 3TWCL 1NFDE 5D72L 4C83A 1GHFH 3O3DA 4B50A 4D0DB 5HYJB 4WUUD 3EDEA 3F12A 4ONHA 5TFSH 4PJ8C 2ADIB 3EO9L 1U8MB 2PTUA 4YHZL 2HAZA 5KSBB 3KDMB 3QIWD 1JF6A 2A6DA 3E8UL 4N90D 4LDOB 5I71B 5DI8B 4G8GE 4HKXB 3KJ4B 4F2MB 2BMKA 1A6VH 4H5SB 5T3ZL 4HWZB 3WUWA 1NGPH 4PP2B 2J1KA 4LPWA 2ITCA 4JO3L 4LGRB 1FN4B 5CSZA 2XOTA 4LPXA 5H37H 1FG2B 1T83C 2PYEB 3TH4T 2CDEB 4NM4L 4RIRA 1U93A 2FNBA 4KHTL 1FRGL 3D0VA 1X3DA 4K3DL 5C0AB 3BSZH 3CH1B 3MBED 1A6PA 2R69H 3RQ3A 3BDXA 4DGYL 1YY8B 2JCCF 4MNHB 4ZPTB 3GGWA 3GMLB 4NM8L 2VJXA 1YEJL 2CSPA 3NABL 4K8RD 1QYGH 2W9EH 4GO6B 2BHZA 2QSQA 4U49A 2Z35B 4F58L 2XXMB 3QZWA 5GSRB 3VXUB 4TUOB 1ZAGA 2ED7A 1IC4H 1QVOB 2YPLD 3BESR 2XTLA 4MSWB 4BYHA 4MJ6B 4LHQB 2DIBA 4G8FA 2CUHA 5C0CE 5T3XE 2FYYB 4PJCE 5E8DH 2D03H 1R3KA 3ZKXC 4DVRH 5BCAA 3F7QA 4GW4A 5GZND 4TUKL 5E9DA 1HHHA 2VUYA 1MCBA 4NKOB 2WINB 2ZUQC 2CUMA 4MAUH 4NM4H 4QTHB 3U9PH 5GGQL 3O6FC 5DQDH 5JZ7C 4RISH 2WUBH 1IM9B 1G7IA 1RUML 1D5MA 5DEFA 4V1DD 5EBGA 4TUJA 3MRDB 3JTTA 3D18B 4MJ5A 5ADPH 2AV7A 5FGBC 4RFEA 1A1NA 3TIDA 4G7VH 5KVEL 2W9EL 3SPVA 4YX2L 2F54E 3UTSD 4HUUB 2ICWJ 2BSRA 1FL3A 2IAMB 2VOTA 3FQRA 1RZ7L 1V7NL 2R29L 1OTUC 1QBML 4N5UA 3DBXB 3T3MF 5E6IB 1ZHBB 4Y1AD 3SDYL 3QRFM 1H3PH 2PCPB 3ZDZF 3KWWA 3HHRB 5KW9H 2W65B 4PIRF 1I3RB 3NPZB 4Y4FC 5DMGC 4TTGA 2HKHH 2W60A 3L95A 4XP9H 5DO2C 5GS0D 1UWXK 1T1YB 1YPZF 5I8EB 4K23L 1XH3A 4J3UA 5HGBB 3U9PL 4CW1B 3OHXA 4WIQA 2J6EA 5TQ0L 4K9EC 5DQDL 5CGYD 4NRZB 4AENA 4D8PB 3FHAA 3MROA 4KY1H 5T5FH 4ZTOH 1G7QB 1S5HB 1L6ZA 5ADPL 1TTGA 4KK8C 4ONGL 3MLPA 2YD1A 4LL9A 2LVCA 3H9HB 3MUY1 4YDKL 2HG5A 4NT6B 1OPGH 1S9VA 1U3HC 1W0VA 1RZ7H 3O2VL 1HYSD 4UDTB 5D6DC 3BGAA 2BP3A 1IGYB 4MJ4A 2NY5H 5DZLA 1D9KC 1GZPB 2ITDA 4AM0A 4FA8A 5FUZH 5DDHA 5C0DB 5IK3A 4KH2A 4C59B 1WIPA 2HH0H 3M8OH 1R3HA 1INQB 4G6ML 4JVPA 1U8KB 3QJHA 4A6YL 1C08B 2F19H 4RMWA 1IE5A 4U1HA 4UB0L 3CDGA 4D9LH 3VFGH 4U7SA 3TO4B 5GRXG 3MRCA 2A9ML 1LP9E 5EU6B 5C07D 1KPRB 3TA3D 5CJBA 1LEKA 4HMCA 4IM8A 4FABH 1U58B 1QQDA 3MLSH 2LU4A 1XEDA 3KGRA 1H3GA 5JHDB 2DMKA 1OOAA 2J4WH 2A1WL 3OKDB 1FDLH 4L4VE 4G8EB 4YDKH 4JO2H 3MV8A 3FFDA 5F6IC 3LPGA 2VXUL 6CGTA 1T22A 2UV3A 1ODAA 2BDNL 3IDYB 3FB6A 5IVNA 5ALBH 5HDLA 2J2ZA 5IGXH 4IMLB 4N9GA 4DKEH 1S7WB 4PRNB 1NGZA 3V6OC 2Z91B 3TBSB 4Z76A 3LEYH 2IALA 1V3MA 2R0WH 3O11A 4IOFD 3QQ3A 1I1AD 1T0MA 4MA1C 1IQWH 4XAWL 1D5ZA 4JDVB 1HSBB 2EXYD 4LRNL 1RUKL 4LCWE 2NW3A 4XP6L 4DN3L 1ZWIB 3F5WA 3LKSB 4APQC 1U92B 5D9SA 1F4WH 2LU3A 4KKAC 1FV1B 4YHLH 4IMKA 1MHCB 1MAJA 4XGZB 3H3BC 5B21A 2CKBB 3O3BA 5CLWA 5HI5D 4N1EA 3TJEH 4S10A 1JP5A 4D0CB 1MCKA 2H8PB 4A2LA 4QRQA 4FQ1H 3HS0A 3TLRA 4ZYKB 1R3JA 3LQAC 4P5MB 4XCCL 4DZ8A 5IB4A 4JM4L 4XCEA 5HJ3A 4W68A 1HHKA 2EDXA 4M3JA 3JXAA 5D5ME 3EFDL 2A1WH 3HPJB 2NY2D 3BE1H 1NH6A 4JO2L 3RVVD 5CEXB 1NAMH 1JGLL 3GMQB 4GAYB 5LVEA 2R2BA 1NBVH 2GJJA 4DKEL 2IGFL 4NN7B 3LEYL 4Y5YB 1AGBA 4LU5L 2RR3A 5JPMA 5HPMA 3K81A 5DD1H 1BAFL 2GYSA 3RWIA 3IKCB 5E8NB 2ZNXA 1JL8A 5MEOA 4EXPX 3QWOA 4P57B 5DJZA 1CR9H 1NKOA 2F53A 1FFPA 3AFLA 1FBIL 3V0WL 4WV1B 4YXLH 1FYTA 4LFHG 2XWJB 2ICCA 4KRPC 1VDGA 2Y9RT 1EDQA 2D9QB 5BXFA 1MCDA 1X5HA 1A7QH 3O2WH 2V5YA 3ARFB 1DSFH 4AY0A 2VDQH 1K8DB 5KZCD 1BGXH 5C1MB 3NA4A 3MBEC 1OSPH 2JJSC 4U6XB 1XFPA 1YEFL 3VGFA 3NCBB 4H26B 3O6FD 4HIIA 1YC8A 3VA6A 4YDIH 5DT1L 5CFHA 4KK9C 2AJSL 1EEYB 3I85A 5IKCB 2QQLH 1AQKH 4I77L 4KK5C 2G2RA 4PRBB 4Z7VB 5MHSE 3SDDD 2KQNA 3EYFB 1BM3H 5DD1L 4UT6H 5IBLC 3PG2A 1XMWA 1QR1A 4M1GH 3KYMA 5IR1B 1TZIA 3B83A 1H0DB 2W0PA 4NC0B 3NAAH 1OGTA 4PGEA 1TFHA 3C2AH 2VXVL 1QSVA 1E4XL 1O0VA 4S1RH 1FNHA 1A7QL 3O8XC 2GKIA 2VH5L 1U6AH 1AIFA 2VDLL 1QA9B 1AR1D 4BSVB 4CL7A 1LD9A 4LKCB 5EWIH 1TJGL 3KPMA 3D48R 4F3FA 1OSPL 5JIIA 1YEIH 2ILLA 4KJQC 4L5FL 1JPGB 2ZG3A 4HS8H 5GRZA 1HEZA 4MA8H 1AGEB 5F7EH 1YMME 2PW2B 5C0RH 5JO5A 3IJYA 1X5AA 3EO9H 3QUKA 3X13A 3PQYB 2QQLL 2E7HA 5SV4A 1G9ML 3BW9A 3UTQA 1YECL 3PHQA 4OD2B 1ROWA 2A6KB 3U48A 3EYVA 5I74C 4DKFL 5JOFB 1U8NA 3OZ9H 1PKQA 1CN4A 4S1RL 1FRGH 5F3HA 1N59B 3DGGB 3QEHA 1CDGA 1XCTA 5TPWL 3FB8B 3H3PH 3ARFD 3BSZL 2V5TA 1BPVA 2E6QA 4ZMAT 3MV7E 2IWGA 3LRHA 5EU6E 4L3CB 4WU5A 1DUYA 2YSSA 1YEIL 4IHOA 2VQUA 5JLZA 2BVOB 2NMSA 1MFBL 1JNLH 3GO1L 1WWBX 1NGYB 2XQYG 4APQB 4F58H 5M7QA 3E2HC 5C0RL 1RIHH 3O4LA 1Q8MA 2FJHA 3U30B 4QTIH 1WWAX 2VL5A 3UPCA 1F4XH 4OGYH 4OAWA 4O00A 4S0TD 2D4DA 5C0CD 4U1GB 5D2NB 1BREA 3VXRE 2VABB 4HG4K 5JIKA 1AQDA 3FT4A 4U1LA 5AUMB 4L3EE 4ZDHA 1BZ7B 2HLAB 4EDXB 1QTYT 3RWHB 4L3AA 1K8IA 3PWUB 3QUZA 1MCQA 3UTPD 5GIRB 1F45A 2X1XR 3T8XA 4I18A 3ALPA 3NIFE 3VXMA 1GPOH 1G7MB 1GRWA 2IH3A 1UJTA 4MWFB 1WEJH 3T65A 3VXSE 1ZGLM 4Y89A 1NBYB 5T33H 5GRWA 1JNLL 3CFKA 2VTFA 1YEGL 3WO4C 1BIIB 3IDJA 5IF0A 1FCGA 2A6DB 3UP1A 2APFA 4LSTH 2ATKA 3AMKA 1U0QA 1FO0A 2DN7A 1GIGL 2VQ1A 3KS0H 3RGVC 1Q0XL 4HWZA 1S7RA 4JVUA 3NTCL 4JAMA 4EVNB 4JJ5A 4XPFH 5D7KE 4KZDH 4A2MA 3FN0L 1OB1B 1FPTL 3T1FA 4Y5XB 5EORL 1I3UA 4Z7OE 1G6RB 1K6QL 4BZ2H 4NN6B 5KSAB 2YMXH 1MFDH 1DE4A 4JFDA 4ZTOL 1KF9B 5J8OA 4ZPTA 4PRPB 3KHQA 3OJMB 1GPOL 4CBPA 1I8IB 1AY1H 2MSPA 2DM4A 5GJTH 5BRZA 5TQ2H 3SKMB 1H3WM 2GJ6E 2EC9U 4GMSL 3B8SA 2NY0D 1HH9A 4YC2C 1KCSL 5ITFB 1GAFH 5LAXB 4TUOA 1QVOA 3L7EA 1HH6A 4TSBH 3ARBC 2NXZC 3IDUA 1XGRB 4YWGH 3FAXA 1A4JA 2FYYA 1EAJA 5INDB 1I4FA 2BNQD 3BUTA 4GW4B 1MLBA 4WFFD 4QRRA 3E3QC 2DDQL 4M7ZC 1IC7H 3VGBA 1FPTH 2NY6C 4IBLT 1WWWX 3P30H 4GJTB 3OGOE 2H9GB 4DTGH 4UB0H 3TBTA 4P9HH 1I1YB 5B3JF 1CFNA 1KENH 1NFDF 3QDJE 1WV7T 2V2WB 4OKDA 4HWEH 1N26A 5IHZA 4Z77B 1T66D 1CG9A 3M17B 2WIMA 1JI2A 1I85A 4XP4H 1UWGH 3NGBC 2NY2C 1PAMA 5HHXH 2J4WL 4PP1D 3OMZA 3OR7B 4GS7B 1XGPB 5IB5B 4P46B 4KDWA 2FX9L 5IEKA 4KTEH 4FTVA 5E6IA 5F70A 5E1AB 3CD4A 3AUVA 3KXFE 4XPTL 1CFTA 5EBWB 3MRJB 4LIQE 3T0XA 3WKNA 1GXEA 2MKLC 2VNCA 1RUKH 3F65A 3DHJA 1OAKL 2F9BT 2EE6A 5C07A 5CHNA 4DTGL 4P9HL 1EA9C 1KENL 4N5ED 3KS0J 4YBLB 1IAMA 3HMXL 1DBAH 5IHBA 5EU5B 3RX7A 1UZ8A 3JWDH 4L8SC 1MCIA 4TSCL 4KRNA 3ZMRA 2H2SC 2MQ3A 1D6EB 2CO6B 2HG5B 3L5XL 1ZLSL 3WE6A 12E8L 2BY2A 4L4JA 4ORZC 2WBJB 4ZD3H 4KWUA 3N85H 1NCAH 2PYED 3EW3B 2IBZY 3T0EE 4N0UE 1YMMD 5D5MF 1NCCL 1TVHB 1IGYA 5A1AA 4GKSB 2PYFA 1BD2B 2Q86B 4HUMB 2IGFH 3O0RH 5IROC 2AK4B 1EFXD 1SYSA 5ESAB 2ERJB 3L1OH 3GMOB 2GSIA 2V5MA 1U8KA 3ULVL 5C8JA 2DQEL 5ID0A 2CO7B 2BXYA 4LQFH 3BH9B 4IIQC 1RFDH 3X3FL 4PLNC 1MCPL 1LK2B 3LOWA 1EHXA 2E9JA 4CJ0A 3EYOB 4JRXA 5GGRY 5I73C 2VE6B 4NNPH 4YHKH 1QP1A 5T1MB 3MRNB 3AY4C 5LBSL 4QHMA 1A7RL 3PWPB 1T22B 2GW5A 4KK8D 4ZD3L 3S5LB 1KSRA 1LO5A 1ZHNA 4OZIA 1P4BH 2ZSVA 2DQUL 3QP3A 4WHTA 2IG2L 4TNVF 4LSQH 2IALB 3LPWA 4OZHF 5TE4L 3TP4A 5J0BA 2W38A 2VR4A 5EIIA 3MGOB 1S7VA 2DLTA 4NCC1 1KLGA 4HUKB 4X0KA 3F5WB 1RQ5A 4XNMA 5FYKH 1GGCH 2MHAA 4HSQA 5GS0C 1NCNA 1A2YB 4I5BA 2VLLA 4L9LC 1MHEA 5TF0A 2QEJA 1RFDL 3PWJA 2HKFH 2JELH 5K59F 1NDMB 3QHTC 5I8CB 3WNPA 3KPRE 3T77B 1JN6B 5EOTA 4QNPE 1UH3A 3ZSTA 3QFJB 4PJDE 1HOCA 1Q72L 1F6FB 4H25A 1DLFH 7FABH 5HYQA 1R3JB 4P5MA 2BOCB 5HJ3B 4HC1H 4X7CC 4N8CL 2C1OB 2C1PB 2SEBB 2FZ3A 4QEGA 5DEGA 1FFNA 4PJ5A 1C16B 4Y5VC 5DTFA 4M6MH 1T04A 4PJ9D 3GMQA 4YPGB 4HS8L 5GS2D 3SDXE 5CILH 4HGWB 1ETZA 4NQCE 1KXQE 3QPXL 4H1LB 3JV5A 1MQKL 3QCTL 1MFAH 2E7LA 5JPMB 3HB3C 2DQIL 3O9WB 5B39B 1B2WH 2DRUA 1OCWH 3IKCA 5E8NA 3RTQA 4OCNC 3VXPA 1GGCL 1H8OA 1UB5A 2WQRA 3TIEA 1YEKL 4OIIL 2HKFL 3DI3B 2DM7A 2G5RA 4ODUB 5FYJD 3ZYIA 3C5ZB 1CTNA 4X4XB 4OSUL 5BXFB 4J3SA 3O6KH 2KZ1B 4U3HA 3M45A 1DLFL 3X11B 4N8CH 4ENED 1QOKA 5GISL 4YDJA 1FZOB 3UAJC 4NC1C 3BD4A 4KMTH 2EYTA 5ELIA 4K71C 2WMPA 1DBJL 2VXTH 1AC0A 4O4YH 2AQ1A 5T3ZD 5IJKA 4DKDC 4HFUH 3CVHH 4HIEA 1CVSC 3BPLB 4QRPB 2HFGL 4ONHB 3ZL4H 5DFWH 1HDMA 1OWWA 4OM0H 1F4XL 4FXLA 4KKCD 4PRAA 1YQVL 4I1NB 3K4DA 3MLVL 3KYMB 3K8KA 4F2MA 5ID1B 4DZBA 1MJJA 1AKJB 4IRJB 4ZFOB 4X6FA 4F9LC 4NKMB 3EAKA 2BNUB 2HA1A 2PTVA 5C9JA 4GQPH 3O6KL 3LIZH 1T0PB 3LKOB 2FATH 2Z8SA 4LKCA 2F74B 3NCCB 4F3FB 3Q6GH 5C0AA 1BVZA 1I1AB 2PW1A 3VFPB 2PXYB 1YEHH 3DMMC 4M3KB 5E8EA 4YR6A 3S7GA 4LQ1A 4AQOA 4O4YL 3BZFB 3RZCD 4I3GA 1LEGB 3X13B 3PQYA 2ZOLB 3PNWA 1FL6B 3ULVD 4LEOB 3NZ8A 3RA7L 5HVGB 2BVTA 5J06A 4NWTL 2A0LC 3IAQA 4PJBE 4DGVH 5BJTB 3EDFA 1CE1H 3GZKA 5B38A 1IKNA 1FGVH 4W70A 5E9DB 1NCBH 1ONQA 1OAXL 1LGVA 2ZCKL 3ETBF 3HR5B 5IBUG 4PJ8A 1R6VA 5BZWB 1P4IL 1N64L 1IGIH 3L3DA 3GK8L 3CLFH 4XBEL 3U7YL 4U3XA 4E41B 3BPOC 4D9QD 1YEHL 2O5YH 3F6LA 3S6CA 1T21A 1UM4H 4FFVC 2VLJA 4TUJB 3MRHB 4RMSA 4ODWA 1XF2A 2MKWA 2CQVA 1U91B 1I75A 5DZOA 4Z7WF 5EUOB 1U8LA 5ILTL 3WIFB 3F6IA 3HG1E 1G7PB 1XGYH 4FQCH 5MI0B 1BOGB 1CWVA 5EBMB 5ITBL 3WIHH 3ZE2E 5AUMA 4YAQA 2IADA 5DUML 1TXKA 3L9RB 1DVFC 1IC7L 5F7YC 3FTGA 3THML 4Y5YC 1URLA 3K7UA 2BNQB 4EQ2A 1SMOA 1K8IB 1FGVL 2Y7QB 4HUXB 2BFVH 3I9GH 2EKSB 2XN9B 3NCYP 2A2QT 1N64H 5T5NG 2YR3A 1B6DA 5IQ7L 4X7TA 4LLDA 4ZAKA 2IH3B 3M07A 4MWFA 2VDPH 1UM4L 3MOAH 1XCQA 4LIQH 1X5XA 4D3CH 2P5ED 3D39B 2IQ9H 3SEPA 2DOCA 1H3VA 4Q9QH 2R1WB 2ATKB 4X99B 2DYPB 4NT6A 5HHMD 4TQEH 4Y19A 2ARJB 2XTJE 4FQIH 3REVA 4JFQB 2J5LC 3V7AE 5JW3L 5IB2B 4X9BA 3WSQH 5GS0L 1OP3H 3JWOC 1H9VA 5C0DA 1VFAA 4Y5XA 5ESVB 3W2DH 3V0AC 4CU8A 2LAGB 1U42A 1A6UH 3BVNB 2YA0A 4TTDC 5BV7L 1MCHA 1ZS8B 1DN0A 1C08A 4ZUWB 1NBQA 3CX2A 1G7HA 4PREB 1CICC 3ARYA 3MJ9L 4AZ8A 4JFDB 2AJVH 3O3AB 3D3VD 2DQDH 4LRIC 4OUUA 4OT1H 1U3ZA 3OXSA 5EOQH 1K9TA 2WP3T 2OSLA 3SKMA 3QUMB 3TNNA 5C70A 3B3IA 4YQXL 1FVDA 4LIQL 3GMRA 2FD6H 5JHDA 1F3DH 2H45A 4M93B 4GAJL 2X2YA 2LABA 1T1XA 5K9OA 1I4FB 1WIOA 4NRYA 3GMNB 2HFFB 3U30C 1C12B 4KVNH 4PJBF 1FE8H 3MMEB 3MGAA 4J6RL 3TO2B 3FQUA 3K2MC 3OKLA 3B9KB 2PF6A 5L88L 4K7PY 5BV7H 4NO5A 4UIMA 1JK8A 1EERB 5DVOA 2WBWB 2V7NA 1F6AB 1KOAA 4OD3H 2DKMA 3H9YA 3G6JF 4PJIE 5GRJH 3LN4A 4PJHE 1YMHA 2AJUL 3FT2B 4P46A 1YNLH 3TV3L 2B8OT 4FTVB 2Y36H 5LGHL 3D39D 5E1AA 1IEBA 1KPVA 2RB8A 1ZGLP 3EO0B 3FO9A 1NUDA 3C5ZC 5TE4H 4FQXD 4WNQA 3QFJE 2OS7A 3QDME 2VDKL 2P47B 3CXDL 4YPJA 3QG6B 4F7EA 5BRZD 3GSUB 4G5ZL 1AXSB 5I17A 2W0LA 4AIOA 3RWIB 2O61A 4N68A 1A1MA 2XWBB 3LKRA 4J3XA 4OCRL 1HSAB 3ALWA 5IOPA 1NFDB 3V4UH 4GRMB 3IJSB 1FYTB 5C0ND 4K2UL 1I85C 4LLMB 2QSCH 4Z0XA 1J5OH 5ACMA 1JHKL 3ZTNH 2QADD 2VWEC 5KSAD 4WHYG 3NBNA 3HE6D 1P7KB 3ZE0E 1MIEL 3OB0H 4Y2OA 3RKDC 4HLJA 3NIGE 5DQJA 25C8H 3GSNA 5GZOC 4Y5VB 5ESAA 1NFIB 4LPTA 4OZGB 4RMRA 2A74B 4EN3A 4YO0A 3UJTH 2B1AH 4JQXA 1W0WB 5SWZD 2YPKA 1RIUH 1HHIB 2G2RB 3C6LD 4PRBA 1AJ7L 3BH9A 3DVNA 3EFFA 2EXWC 5CMAA 4PG9A 3MRLA 2F58L 4LBEB 3Q5OA 2I24N 4HT1L 4P23B 3RVVC 1T20B 3QULA 4O9HL 3SQOH 1GH7A 3EOTH 3KNBB 2B2XH 4WFFE 1Y18B 4HCRL 2QKIA 3FOLB 3VXUD 4NN5C 3QNXB 3SO3C 3UJJH 1LO5B 1ZHNB 4OZIB 2DQFA 1KT2B 1NGQL 4XNZC 3SOBL 4HIJB 4X9GA 1JNHA 2BNRB 2HFGH 4HH9A 3ZL4L 3CFDB 3QEUB 5FO8B 3BHBA 3V79C 5IVXB 4FQXC 2AAVA 3QUKB 1CXKA 1ERNA 4P46D 1T66C 2XYCA 4NWUL 1A2YA 4KFZC 1AR2A 3BW9B 3UTQB 2VLLB 3EO1A 5LQBH 4XZUB 3LS4H 2BVYA 1NDMA 3OAUL 2HJLA 2OL3B 4KAQH 5SX5K 2XQBL 2FJFA 5IW6A 4R6UA 2DJSA 5IV2B 4M4RA 4QRRD 2WBJC 4ZO6A 5E8PB 1F3RB 5I1JH 4G6FD 5IWLA 4P2OB 3QRGH 4HXAH 5DTFB 3QEHB 5D7KD 3OKNA 4ZNCD 3TEUA 1T04B 4TRPL 2ZG2A 5MERA 1CGXA 4LPYA 2QADB 2ZKHL 4M6NL 1YJDL 4B7IA 4L3CA 4WU5B 2HT3C 5FGSA 4HGWA 3JV4A 3SE8L 4KZEH 3D2UA 1UWEH 2YSSB 3NZHL 1IGMH 1B4RA 2R4SH 4OLUH 4DUWA 2X1PA 4NQXA 3GBML 5JDJA 1CF8L 4HDIB 1OY3B 3S98A 1BQSA 3PDOA 4UQ2B 4P2RE 1MCOH 3HTLX 3WCYA 5EZJA 2XZAH 3OKMA 3FT4B 4U1LB 3U0PA 1UGNA 1S7UB 3QUZD 5E2WH 2GK0A 5HY9A 1C5DA 3VFRA 1I3VA 4ZDHB 4HS3A 3K46A 2CR3A 1E4XI 4WI7A 4EDXA 5AEAA 3TPKA 4K9EL 1SVCP 3HRZA 2Z8RA 4PJBA 4PTUB 3AVEA 4G8GB 1I8KB 1RMFL 3I75B 3QRGL 2NY2B 3ELAT 4ODVL 3MA9L 2Q7YB 4LVOB 3VXNB 1I9IH 4U1NB 1ZT7A 3MXWH 4OCWH 3VWKA 2ZKHH 4L4TE 4P9HC 1DDHB 4GSDL 3T65B 1KB5L 1FNEB 4KQ3H 1NBYA 4FQLH 1G9NC 4X6BA 1CQYA 5IF0B 3CMGA 4L29B 4YDVB 3P9WB 4LF3B 3RPIB 1VFUA 1FO0B 1OAQL 1U8JA 2VQ1B 5C0NC 1UVQB 3MNWA 1MCOL 4KK6D 3UTOA 4M7LT 2BERA 4IRJA 1FZKA 3IVKA 5E00B 1HQ4B 2PO6A 2HFEA 4MXWL 1A7BA 3MO1B 5L9DH 2G5BA 3IYLW 1ORQA 1YYMH 1WBYB 5FDYA 3LKOA 1CFQA 1DBML 4K3HA 3MLRH 4DN4L 3WDJA 2AJXH 4PJIA 2PXYA 3LD8C 5EA0H 1EBPA 5E8EB 3LKNB 4PRHD 1EAPB 1MCLA 1CLZH 2BVUA 3DO3A 4PRIE 3CVHB 5D1QB 2I60H 2ZOLA 5LAXA 5ITFA 3JWDC 1FL6A 3R06A 1HH6B 4JFZL 2I9LA 2EEAA 3NH7H 3O6LL 5I66A 3ULUH 2R23A 1XGRA 3E8UH 4F7CB 3WL9B 3KYNB 5TE7H 1IARB 1VERA 2X4OB 4DEPC 3WLWD 3P4MA 3GMPA 4KV5E 3T0ED 4WUKL 2R9HC 1HKFA 1AO7A 4K8RC 4S1DC 3VD3A 3L3DB 2J6EH 2H9GA 4KHTH 3OR6B 2GI7A 5FKAA 2ZOKB 4G8GD 2O5XH 2YXMA 2CDGA 3LSOA 4JPIA 4PBVC 5IHZB 3DLQR 3U1SH 4X6EB 1U91A 4I48A 4MB4A 3CPLB 2FD6L 2HN7A 5CP7B 4NZTH 4NBXB 4YH6A 4G9FA 3EZ8A 7CGTA 1VCAA 3D3VA 3LEXA 4TVPE 1T5XB 3SGKC 4D94A 3VJ6A 3WFZA 5IEKB 3NH7L 1WAAA 3W11C 5SWZA 5DC4B 3H9SB 2BHUA 3IS1X 4P99A 4Y4HB 4GBXD 1XF4A 2J88L 4X9FA 1JGEA 5KSVB 4HGKC 1WBZB 4J6RH 1SBSH 1GL4B 1RURL 3UJIL 3QI9B 1T2QL 2FO1A 4HK3J 3BEWB 3HE6A 5GGQH 2AXFB 4RISL 5B38G 4ZAKB 1T6VN 4HCRA 1T3FB 1RUMH 1PFCA 1YYLH 1JFQH 1CLYL 1MSPA 3C8DA 4PYHA 1QFWI 5I2IA 1CDIA 2X44D 3UZVB 1Q9OB 32C2B 5CKGA 4PJFA 1AD0B 3E2HB 4U4BA 5HHOD 1YNLL 4R7NA 3TV3H 1WZLA 2J7LA 2XACC 1INEH 1FNLA 4YX2H 4UT9H 5JQ6L 3BISA 3ZDZE 4BSWB 5ERWB 3TN0A 2X4RB 1RJZA 1JHTA 2GSGB 3DPBA 3VD5A 4L9LA 4IS6A 5HYEA 5KTEH 1QFWH 3EJYD 3S88H 2PTTA 2OQJB 2Y06H 4FQXB 3FRUB 1LEIB 3HUJB 5JA8B 4IRSB 1D5XA 2NYYC 4WW1B 5CLTA 1CLOL 3ARBB 4OUOA 3O3AA 3WIIH 4KJPD 1WT5A 2BSSB 4OUUB 1DL7H 4G8IB 3SO5A 5I8OL 2EDOA 3OXSB 4LGPB 3B3IB 3QDAA 3TT3H 1ZVSA 1YC7A 2E27L 4HJJL 2X10A 3TVMA 3RU8H 4XCNB 1KB9J 3U36B 4UBDC 2X6MA 1RZJH 5ALCL 3S3JA 4NN6C 1FZMB 5T1KB 3G5XB 4WUUB 5I1KH 1GGIH 3HE7D 4I0KA 3L5WA 2HFFA 2CIIA 3C60B 2GHWB 1TLKA 3PL6C 4ZFZA 3UTTE 4JM2C 3TO2A 1NLBL 3B9KA 4PRPE 3VGHA 5EN2A 2V17L 2QJDA 5E95B 4RGNB 5IVOA 3N06B 4UIMB 1FNAA 4U7MA 5F7FA 3V0VB 2V7NB 1P4LB 5CAYB 4JRYE 2WSKA 3OBAA 1MJ7H 4QHKJ 1VGEH 2A0LD 1CI5A 3TCLA 1HOCB 4XB8A 4WTXA 1OD7A 3SGJA 2BOCA 5DRZB 1KNOB 1CZ8H 3WHE1 3VXUE 1TCRA 3RWCA 1EHLL 4MAYB 3UYOD 4WTZA 1VGKA 3PABB 1LO2L 2VDRH 2X05A 4M03A 3O4LD 1RPQA 4D0BB 2M26A 5IMOA 1FIGH 1V5JA 3IDNA 4JN1L 2D7MA 4K3EL 4WDIB 3K3QA 5DHVH 3LMJH 2NY4D 3RRQA 5DC9B 1Q9LB 2P5EB 4QKXB 2X4UB 3QIBC 3LPFA 4H1LA 3RZWA 4CVZB 3GSUA 3VI3F 1GVIA 4MX7B 5FDWA 4OB5H 1N4XH 1ZT1A 5ACLA 2XWBA 4F9PA 4MDJA 1JCKA 2Q8BL 1SEBA 3HAEH 1SJEA 4LPVA 5HHME 1PSKH 2NR6D 4L8BA 5D1ZA 3MLYL 5MHSD 4Z0XB 1D5BB 5C07E 3F7RA 1KJMB 4HKZB 4RQQB 1EGJL 3X11A 3P4LA 4N0CD 3BIKA 2FWOA 1P7KA 3F7PC 4CGTA 4JFDD 1QACA 1E4KA 2E8YA 3JWOL 2EYTB 4NSKA 5CCKL 3OAZH 5J89A 4X8JA 1TMCB 1FIGL 2JB6A 5F9DC 1SEQH 2H32B 4YHPB 3ARPA 4OLUL 2P7TB 3FKUS 5F9OL 1W0WA 5I74B 3R8BB 1MCWM 1BFVH 3BFOA 3PV6A 5C0IB 2OM5A 3RIFF 3DVNB 1ZLWH 4OB5L 3S96B 4Q2ZA 4CN4A 4UINH 2OR8A 4JVWA 5DD5L 4PG9B 2UYLA 1ZLUH 4CMMB 5D2LE 1XF1A 5EU4A 1MFCL 4DZBB 1AKJA 1CR9L 1J1PL 5C71A 4XH2A 2EZ0D 5CINH 3WXVH 1JGVL 4WWKB 5FCUL 4YFLF 1EFQA 5C9JB 3QH3A 5DLML 4K8RH 4HPOH 3BXNA 5HTSA 4HPYH 4GAFB 1OT2A 2VDQL 4Z78B 4B5EA 1BX2A 2F74A 1VEPA 3DV6A 4ZXBB 1KLFA 3TWCH 2DQFB 1TQBC 2PW1B 4NC1E 2X5PA 1NAMB 4JQVA 1ZVYA 4XCFH 2EIDA 2ZCLH 1INDL 4HF5H 3CFDA 4M5ZL 4UILL 4WEBH 4OLYL 3HE7A 3LN5A 5DWUH 5BVJA 4K7FA 1BFTA 1A4KB 4NQEE 1OQOA 3PNWB 3MXVH 4OIAA 2E7BA 4P4RA 4PG2C 5FKPA 1SM3L 5T3ZH 5K9JH 2BK8A 5E1HB 2OL3A 4CVXB 3TO4C 4KTDH 2VLRB 5DSCA 1UQSB 4ISVB 3SE4A 1VEOA 1B6UA 4JZOB 3PXHA 1LP9A 3UZEA 1EEZA 5JHDE 3VFSA 3L7FA 4HPOL 1R5VB 3GUTB 2WLYA 3HR5A 4M48L 2E9WA 2YOCA 2FBOJ 3EOBB 4PB9L 2QADC 4N0RA 1OVZA 4OQTL 4L3EB 3ARFC 1JZ7A 3VRIA 3QQNA 2ATPA 4JKWA 2VLJB 5GQBA 1CQKA 2A6JA 1JWUA 4MNQE 4KI1A 4NQXB 3TA3C 3O2DA 5JW4Q 1NC4D 3CK0H 1V05A 1IM3B 5AZEH 1G9MH 2BRQA 1JHLH 2XTJC 1F4HA 1ZEAL 4ALAL 1EX0A 5EBMA 3U0PB 2RGSA 3DMMA 2YD7A 2GK0B 2V9QA 3FN9A 4HS3B 4Z8FH 2XWTB 4EI5B 4Z7UB 3KYKL 5IW1B 4CDGC 4PV8A 1RVFH 2NW2B 5FF6B 3HRZB 4H0GA 4PJBB 4XPGH 1QEWA 1N5YL 4HUWA 3J7HA 4X7FC 3VXNA 4QYOA 3T0EB 1NGXA 1UKQA 2WBJD 2EEDA 4KUCD 2W9DL 5CUSH 5ENWA 4J1UB 2COQA 4X7TB 4ZXBD 4BZYA 2GY5A 1BD2D 4YGVA 3C8KB 4YFLI 2IAMC 1IQDA 2NY7L 1YUHB 1JNJA 4L29A 3NACL 4YHZH 5I1IL 4X99A 1LHZA 3BZ4A 5FFLA 1KJ2L 1X44A 5LWYL 1M71A 2FGWH 2FGZA 3UO1H 1OGAA 4KQ4H 4JFQA 1IEAB 4LOUC 1A14L 4HJ0C 3MQIA 5IB2A 3I2CH 3MO1A 1HHJB 1ULVA 4U1KB 4XP9L 1G84A 4HMDA 2WIIB 2ZUQB 4U6YA 5I76B 4WHCA 1NCWH 2LTQB 4MCZA 1JTOA 2WAHA 4PJIB 4R0LC 1ZS8A 2AERT 3MREA 3WFDH 4H88L 1PYWB 3DUHA 3DRTA 3P4NA 1P2CB 4JB9L 1KCUL 4D9RE 3FHQA 3U79A 4I0PD 1X5ZA 1KTKE 1CXHA 3HZVB 3CVHA 3MUJA 3QDJA 1HINL 5D1QA 3DYMA 1YEJH 3IXAA 1FVDB 2OMNA 5T33L 4M1CD 1CICD 1BVKA 2CK0H 3OWEA 2DWEA 4UZGA 4Y1AE 4ORGA 3P4OB 3SGKA 3AS2A 3EDJA 5GZOD 4P2OD 2JTDA 3MRKA 4PJDB 4JM2F 2HJFB 1C12A 5BOPA 5IQ9B 2Y5EA 2AW2A 1J8HA 4JPVL 1CLOH 4GBXC 3OKLB 4H8WL 2X70B 4C4KO 4OZHE 3VWJB 3X3GL 2A9MH 1EUTA 4PRIA 3WFDL 1F2XK 5EU7E 3V52L 2BCKB 2CLVA 1RZGB 4GQ9L 3G5VA 3CPLA 4UOJA 3MUGA 2JCCE 2HN7B 4FOMA 2XFXB 4JFDE 1KTLA 3MJ8A 4G9FB 4KI5F 4NC2B 1NEZG 4PJXA 3LN4B 2C26A 2VLKD 3LDBB 5CWSA 3LEXB 2X4NB 1ND0B 1MI5E 5FA3A 2BDNH 3D69B 2R56H 1V7NH 1NC2B 4KKAD 4EBQL 5KANI 1KPVB 2VXSL 2X40A 4WFHE 4F15B 1I7UA 1U8IB 4EKXA 4PJDF 1IAOB 1RJYA 3AAZB 3QG6A 2UWEF 3HLAA 1UXWA 2CPCA 2V17H 1DFBL 4JZNA 1F4YH 3WLWC 1AXSA 5I17B 4LP4A 2EDEA 4EIGB 5EB9A 5ESQA 1I7ZB 2AXFA 3QFDA 5I19L 1UKSA 3GHBL 3TPUB 2ZSWB 1A1MB 2D7PA 4RGND 3L3GB 1JIBA 4R97C 5I2IB 1MCCA 3IJSA 3CU1A 1MY7A 1X4ZA 1XF5B 3EJZC 1ZT4B 4BELD 1AD0A 2NNAB 2FLRT 3FQXA 4LLMA 4N9OB 3RWEA 4R7NB 3K4AA 3VXOA 6FABH 4BSWA 1YN7A 3WFEH 5IMLB 4XP5H 5FM4A 1RJZB 1UADC 1WFTA 4X4MA 1AHWC 3GM8A 1YZZA 4BA8A 1D6VH 4DGIL 2NZ9C 5DVMA 4G6JH 2ICEB 2IJ0C 1MAKA 4G9DA 1A02N 1J11A 4OZGA 1MCEA 3DX6B 3S36H 3QNZA 1BAFH 5EO0B 5TGBB 3DUUB 4KKCC 4WW1A 2YPKB 1U8QA 5C0GA 3IGAA 4QRTB 5H2BA 1CYGA 1KIUA 4U1MB 1G0YR 5CMAB 2L7UA 2EDNA 2ZUSA 1N6QL 4PG2A 4WJ5A 1S78C 3TZVD 1CTOA 3GM0A 3GEWB 1LO3H 1EO8L 2OJEB 1AP2B 2OR7A 3MLSL 4LLVB 4Y2DA 3QULB 4TVPH 5D7LA 2VLME 4RAUA 2DD8H 3GSVA 2XKSA 3KNBA 4DVBA 1ES0B 3K4ZA 1OGAE 2VDMH 3G5YB 2MWCA 1ZANL 4XTRC 2CKBH 3EDDA 1W72L 4CNIB 2OL3L 4KKLC 3OG4B 2HVJB 3C60A 5FXCH 2CD0A 2FIKB 1JNHB 4CU7A 5JA9A 3TZVC 3U6RA 2X4PB 3MTRA 1MIMH 1VKXB 5CJQH 1F8TH 3BP6B 4LCYA 1FC2D 1I1FB 2H3NB 5AYQA 3RJQB 3V0VA 1D9KA 3RWFB 1UC6A 3BYYA 3I3EA 1JNNL 1FAIH 3STLA 4Y5XC 2DF3A 2GAZA 5C0JB 1K2DA 5D7IA 3DIFB 5J1AB 3FOMA 2UWEB 4YHIB 5DLMH 4M1DH 1UH4A 2QQKH 5DRZA 3SE3A 3KLAA 1YNTB 5DMKA 5FUCC 3FT3B 3FQWB 2JLLA 4NQTA 4WI2A 5I18L 3CSBA 3BGFC 4P2OA 2EH7L 1CD1A 1OTSC 4Q58C 3BRDA 1UG9A 3OKNB 1U3YA 2N4IA 4D0BA 3BIBX 3IDNB 3GBNH 4WDIA 4MA8L 3QI9D 1W72H 3KPQA 5I16B 1Q9LA 4M61A 4OLYH 3G08A 1RHHA 4F7PB 5DUPH 3B5TA 5CD3B 1DQLH 2R2EB 3EIFA 3MXVL 3QWRD 3BZDA 1QRNA 2ADGA 3IDXH 4JFEA 5GSVB 5CJQL 5JW4M 4MD5B 5FYKL 1SEBB 3FAWA 4PJGF 2HTKC 4MCYB 5E4EB 4EJ1C 4KMQA 2JELL 4LVHB 1KJ2B 4B53A 4YXLL 1HQRA 1A6WH 3HKFA 1S7UA 3DGCR 3LS5L 1MVUA 2F5AL 2JKXA 4BKLB 1G9NH 4K94L 3QA3A 1P9MA 1DSFL 5B22A 3BKJH 4UU9B 1VADB 4PTUA 3KPPB 3VFMB 4X6CE 3RWDB 3PWNA 4DUVA 2GTWB 5DJ0A 2JB6B 3QBTB 2FH8A 2YD9A 1AXIB 2M2DA 5CILL 3O3DB 2IH1A 3LHPL 5DHVB 4CMHC 2AJSH 5C0IA 2ADIA 5JORB 4OZGF 2ZPKH 2D0FA 3RNKA 3ZDYE 3ZTJG 3EGSA 5CSBA 1U2HA 1NC4B 2IANA 3MNWB 4G7YH 3U4AA 2A6IB 4PP2A 5CSZB 3QH3B 4Z7WE 4GG6B 2PYEA 2R39A 4OGXL 2G5BB 3Q0HA 2GIYA 3E6HB 4FXKB 3U0TA 4Z78A 1EV2E 2P24A 5CGYC 1TPXC 5ICXB 5DK0B 3DV6B 3MJ7B 4WW2B 5EBLA 1TJGH 4DGYH 4XNUH 2AXHA 3MLTA 4PLJC 2NZIA 2LFGA 2I9TA 5EPMA 4HFWB 3FONA 3ZLQC 3T09A 5I1CL 3RY4A 3S4SB 3LHPH 4K7FB 3HFMH 2QBWA 2DB8A 1YNKL 4ZSOE 3VXUA 1JUFA 1GIGH 5D7SH 5IEHB 1KJ2H 4PTTA 4WW2F 5FKPB 4XPAL 3WIHA 1YECH 2R23B 4YHNB 4UIKH 2D03L 5HHPB 3QIBB 4X5WB 3KLSA 2B5IC 4G7YL 1JGUH 3K8MA 3TNMB 1J0ZA 5D7IF 3EOAA 3P4MB 3GMPB 5IESH 3L7FB 3QCUH 4BZ2L 4QF1B 1DEEB 4AL8H 3LIZL 3K1KC 1CGVA 4MJIA 4X4YB 1BFOB 3AM8A 1TJHL 3T4YA 1WK0A 3HNTL 4P2QA 4JB9H 3N1FC 1KCUH 2L0DA 1D5MB 5DEFB 3QWRA 3OAYK 4N8VB 3A67H 3QXDA 5I1CH 4G7VL 4I48B 4YHOL 3O81A 2VR9A 4NOFA 1S78D 1HN1A 4M5YL 5H37G 3VRLE 1KEMH 4EIZC 5T3ZE 3MCG1 3TT1H 4HUUA 2R29H 1T0NB 5F72S 2BJML 3QO1A 3BUYA 3L5IA 3SDYH 4FFWC 1X5JA 4XPAH 4YZFE 3SDXF 5TDPA 3FO0L 4YFDB 2OP4H 3ZZ1A 1QRNE 3DMMB 5A2KH 4OFYD 2DDQH 3MNZB 4NOBA 8FABA 4DGVL 3TH3T 4ELMA 5KS9A 1SYVA 4N0FA 1OP3K 3QEQD 1JGEB 3P73B 5FF6A 4NZDA 1Q9KA 4H8WH 5IESL 3TBWA 1DTUA 2XTJD 1KB9K 3QHZL 4YE4H 3T2PA 1FORL 3D2UD 2ED9A 4NHCL 3T0EA 4MXVF 3BEWA 3HE6B 3TFKC 3JV6A 5T5FL 4NRZA 1TJHH 3MROB 3QAZB 1UCBH 2GJ6D 1EJOH 5EIVA 1AD9B 1S5HA 4MQ7A 3BIAX 4LASH 4X98A 5GZNC 4PJFB 2HTKD 4P23D 3QIWA 4JRYB 1MI5D 4M5YH 4JR9L 3HZMA 5DGQA 4QT5A 4LSTL 3HUJF 1XGYL 2VXSH 4QLRA 5D8JH 1JHTB 4XX1G 1B9ZA 5IFAL 1F6LL 2NCMA 5AYUL 4XNQA 4RGMB 2WIIA 3K0WA 4OF8A 5F9JA 1QFOA 4CMHB 2V2TA 4U6YB 1ZHKB 1LDSA 2CMRL 1K6QH 3F62A 5I19H 3NVQA 4XNXL 4PJXF 1EPFA 1RUPL 4KK5D 3P4NB 4LHJB 2YHGA 4PY8J 5ETUB 3SE9L 5EU6A 5F88A 4O02L 3TF7C 1CXFA 4TSCH 1MFNA 1QQDB 3HZVA 5GHWH 5BOZG 5DRNA 3FFCB 2EDBA 6FABL 5KSBF 4IOSD 1ZKAA 4F7TB 5BV7C 3VXQA 4TSBL 3A6OA 5JHDD 3MV8B 3G5XA 1D6VL 5F7WC 5DFVD 1E27B 1J87A 2VLJD 4ACPA 4OI8A 3WLBB 2CIIB 1T2XA 5IFAH 5MP6L 2DJ4A 3HCVA 2DIJA 1J0YA 2E9IA 4Z5RB 2AJZA 4FQJH 3WXWL 3BDYL 1UZ6E 1EHNA 5EN2B 5DJAA 3B5GA 2DI8A 2XG4A 1T80A 1UXSA 5D9SB 1XGUA 4PRIB 5F1KC 4GAGH 1PQZB 3CX5K 2FDBP 2H8PA 1MCRA 5BRZE 1MCNA 3BWAB 4QRQB 3TCLB 1QLFA 3T2NH 4J2XA 4ZYKA 1NLDL 4LLUB 4UDUB 3EFDH 1KNOA 1J05A 4R3SB 4HEPG 5JXAH 1SJHA 3D25A 4OCXL 1ZANH 4U33A 1S7SA 4KRPB 1FFRA 4OCYH 1MELA 1IAIH 1NC2A 2FX9H 4OCSH 2MQ0A 4OFIA 3BPCB 4DJMA 4QHUA 4MYWB 4GT7A 4Z6AT 1I7UB 1TJIL 1RJYB 1WICA 5I8KH 1HI6B 2IPKA 1M6OB 1UEYA 1UXWB 2DQJL 4HV8B 2X4UA 4CVZA 4JZNB 3CLEH 4JGUA 4O2FB 4FQJL 5F96H 2PNDA 3QFDB 3STZA 5DEZA 4WEMB 4XVJH 4Y16C 1EO7A 1PG7W 1JNNH 4RFNB 3QWOB 1FAIL 1TQCC 1ZOXA 2F8OA 3IFLH 5ICYB 1P69B 4OD3L 4AEFA 3PP3H 4TNVK 5I30L 1XF5A 1FNSL 1LDPL 1WT5C 1XIWC 4UUJA 1ZT4A 3V7AG 4BQ9A 3RWEB 1IZJA 3TBYB 1V3LA 5E2UH 3WJJC 3VXOB 5I18H 2YD5A 4FNLH 3WBDA 2FEEL 3L5XH 3MA7A 3MLZL 1L0QA 3GBNL 2CGRL 4MHHG 3UROR 2VZ1A 1NCAL 1QSEB 4WFGE 2EDFA 3GSRA 4LLYA 1ITBB 5GS1C 4N8VG 1A9BA 4NSKB 5KN5B 4XAKD 4PGDA 5HYSB 3AS3A 3FN3A 1MFAL 4FP8L 2KPNA 2P7TA 1TCMA 1OCWL 5C08D 2WP3O 4PR5B 3LKPA 1U8QB 1NQBA 1G6RL 2HYMA 3CH8A 3PDGA 3KPSE 5H2BB 3EYFA 3ZYZA 1E28B 4JFXB 3CC5A 4U1MA 1VPOL 3ZKNC 4JFOA 4LQFL 3RL1A 3QDGB 1LK3L 2R8SL 2UYLB 1H5BC 2EDDA 3C2AL 1OAUH 4XH2B 1E4XH 1J10A 4M7KL 3V4UL 2WNGA 3IFLL 4RAUB 4GMTL 4JDTL 3UBXG 4OF0A 1RD6A 3FMGL 4QGYA 3WFHB 3BN9C 4RMTA 2YK1H 3W81A 1JHKH 1GC1L 1QA9A 1A5FL 2DIAA 1LD9B 3ULSA 4M7JL 1I1RA 1DEDA 1IGJB 4CNIA 3NCEB 1T7YA 4UBDD 4DCQB 1RK0A 3O6MH 1JPGA 1ZV5A 4IJ3C 5INCB 2DQUH 2NTSP 4Y19E 3VWJD 4LSQL 2DYPD 2F53D 3SY0A 3CFIC 4NKDB 4DW2H 4LCWA 1VKXA 5JO5B 1Q38A 1D3CA 4FP8H 1QKZL 3BP6A 4IRSD 4P3CH 3ZYJA 3LN5B 5E2TL 1I1FA 3BZEA 3GKZA 3VI4E 1V3JA 3PHQB 4OD2A 4P4RB 2Q8AL 3UTZB 3RWFA 1UFUA 1DQDH 4HX1B 5I1LB 3K80A 2CIKA 3N50A 4C55A 1FVEA 1MEXH 4C57C 4ZTPH 5FIEA 3W0WB 3ROLB 5HGGS 4U2ZA 3DI2B 3KLAB 3FT3A 3WFCL 4BFIA 3B5HA 3H3PL 2HFTA 2X89A 1EEZB 3VFSB 5E08L 1CD1B 3SDCB 4Y4HD 1XCTB 4P5TC 3RVUD 4LAQH 3X17A 4KPHL 2YN5A 1MF2L 3FZUC 2UVEA 2DL2A 4M6ML 1EXUB 3RVUC 1NGQH 1XF3A 1I9JL 3HG1A 1XIWB 4NPYB 1MH5B 3QQ4B 4GBXB 3MCLL 4FQQA 2YEZA 1J18A 1HKLH 1MQKH 4PJEF 4U0RC 1HHGA 5SWSB 2ADGB 5GSVA 4XNZB 1KN2L 1N0XL 2IAND 2A38A 2I26N 4OFKA 4ODHL 5GGTH 3TYGL 4BQBA 5F93C 5LQBL 1U36A 3QAZC 3VFVB 1JGUL 1B3JA 4POZC 4ZTPL 4KRLB 4RX4D 3QA3B 2NY6D 5I1GL 2ESVB 4UU9A 3KPPA 1Z9SA 3HPLA 4NQUA 5GIRA 2XZZA 4QYOB 5HI3D 4LAQL 1F3JB 1GJIA 5FYJL 5GGSB 5GJSL 1T5WA 4P2QE 4R4BA 2AGJL 2EDRA 3VXMB 5I1EH 1S7TB 2NY4B 3B9AA 3ARBD 4ODSL 3C8KA 3NZHH 3CVHL 2W92A 2V2XB 2R4SL 4LSRH 5C6PB 1IAKB 3IDJB 1F97A 2VLMD 4FQCL 4WI8A 2MQCA 2A83A 1KB5A 3FCTB 2F5BH 3MLVH 3JTSB 1HCVA 4OGZA 1WFNA 1M71B 2A6IA 1OGAB 2BHYA 3DURA 4JJ5B 3VGAB 3P0VL 3ECBA 2Q87A 1HHJA 5D7JB 2F8VA 2XQYK 4FQ2L 5EFIA 3W0WD 3U0TB 1DUZA 5J3HD 3LQZA 2D7OA 2FATL 5KOMC 4WFHD 4WU7B 2VL4A 5K93A 1RHFA 3MA9H 1PYWA 3DYPA 3B6SB 5DQ9B 5FYJH 1EJOL 1AFVL 1FFOA 2Q76B 4Q0XH 4PJAE 3S35H 3BT2L 4OD1L 4PJ7E 3BH8B 1GCFA 4OZFH 3RGHA 2D3VA 4ODSH 4NFDA 5KJRH 4RFOL 4J3OC 1XIWD 4Q9QL 5D2LA 5FO7A 3SDDC 1YN6B 3RA7H 5DFTA 4XI5D 3KXFD 5GGRA 2DWEB 1OHQA 3P4OA 3H9SE 3H2WA 3WSQL 4M9OA 1BVLA 4Q6IC 1A6ZB 3MRKB 4PJDA 4RGMC 3NFSH 4WW2C 35C8L 2DTML 1EZVX 3DX7A 1T4KA 2DKUA 3T08A 3PHSA 1PGRB 1YYML 2YUZA 2EYSA 3Q3GB 4MJIB 4XNXH 3IT8D 3AREA 3DXAB 1BFOA 1CS6A 2AJVL 5IMMA 3MV8E 2YBRA 1NGWA 3OJ2C 3WO3B 3CLFL 3GIVA 4OT1L 5C7XH 1S5IH 2G75A 4O02H 3NIDF 1F11A 1E4WL 2JE8A 1KCVH 4NRXA 3BKML 5C09E 2BCKA 2CLVB 3I6KA 2P5EE 5HXMA 4E9LA 3RNQB 3BYTA 1A64A 5DRXA 4GAJH 5KJRL 4PJXB 1T0NA 3OR7A 1BBDL 3VG0H 3BMWA 5IB5A 4XNYH 2N7AA 3A6BL 1PZ5B 4X7SH 4XPTH 4JFZH 3D69A 5J6HA 5DRWB 1KIQB 3RKDD 3OKKA 4O2CB 4RGOL 1RZJC 4NIKB 4QXTB 3S37X 5ITBH 2E9BA 4P48A 4N0FB 4JRXE 3QI9C 3P73A 4BSJA 4ZOBA 5GRUH 4OV6F 3IFNL 4FQHB 4OLXL 3PF2A 5CEZL 4YNYB 3O8XB 1J1XL 1RU9H 4HQQH 5CHNB 4GAGL 3JV6B 2Y25A 3ILPA 2F15A 1DBAL 5CD5D 1MPAL 2H2PC 3MRBB 2AJYL 4LVHC 2GEEA 5IT2H 2P8PB 5ABDE 4JPKL 4JG1L 4X98B 4POUB 1UCTA 4XCYB 2I07B 3QIWB 4JRYA 1D6EA 4LAJH 5JZ7D 4JQXC 1IBGL 1D9KD 2ID5A 1YN7B 4Z7UE 2IPUK 1R0AH 5LXGH 1PEZA 3CAFA 2ORBH 3R1GL 4JFYA 4PJ9B 2JB5L 3RJDA 5GGTA 3ZE2F 3UMTA 2OR9H