1MJ8H

High resolution crystal structure of the fab fragment of the esterolytic antibody ms6-126
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
216
Chain Sequence
b'VQLQQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGNIYPGSGYTNYNERFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCARKHYFYDGVVYWGQGTLVTVSAAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN MS6-126
molecule tags Immune system
source organism Mus musculus
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
total genus 43
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2002-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8H02
5KAQG 4XT1C 3NA9L 3TN0A 5BMFH 4GKZB 3GO1H 4CL7A 2VJXA 1RU9L 4N1HB 4NKIL 5LXGL 4XTRC 5I74C 1BZ9B 1QRNE 3ZHKA 4JY6A 1B0RB 1CR9H 1U3HA 2C1PB 2FX8H 1A7RH 1OAXH 1JGEB 4BKLA 1ED3A 4HV8A 2HFTA 4KDWA 5D5MA 3JWDH 2F54B 2YKLL 4OZFA 4HW6A 3WFCH 3SE9H 2FRGP 3Q2CA 1K6QH 2F74A 3AFLA 3O4OB 4HK3J 4GAYB 1Q94A 2HAZA 4MQXC 5ILTH 3PGFH 3U0TA 3ULUE 1LEGB 1BBDH 1LEKB 4HXBL 4R4ND 5GRYA 4NHCH 3TPUA 5DMKA 5C0NC 2R8SH 2CQVA 4LEOB 4RGNE 3W5MA 2EDKA 1HQ4B 4RCAA 3MV7D 1MJUH 4NSKB 2Y5TB 2W60A 1TLKA 2P8PA 5GGVY 4MXQC 4HFUH 1A02N 4PG9B 1T83A 2OLDA 4YJZL 4ZXBC 3TLRA 1NCTA 4HEME 2Z35B 4JDVB 3X14B 4QXWA 1LE9A 5SWZE 1IKFL 3EOAA 3VFUB 1ZS8A 2IH3B 4PY8J 5IHZA 1AXSB 1BOGA 3RVUC 3V95A 1MVFA 43C9B 1KEGL 1WFNA 5T1LB 1RVFL 2J8UA 4URTB 1S7UB 3IXAA 1LO5B 1DUYA 4S10A 1NPUA 3SDDC 1E6OH 4N5EC 1MI5A 2VITA 5E8EB 5C09A 2EIBA 1KCSL 5GSVA 4YZFE 3AVEA 5KSAC 3TEUA 3ZHDA 3S3JA 1UKTA 2ARJB 5L2JB 2F5AL 2Z31A 2UY7A 3FHAA 5ETUA 4BKLB 2C9AA 3ARDA 1A1MB 3RJQB 2GW5A 4HKJB 4XC1H 3P4OA 4PV9A 3GRWL 2Q6WB 3RDTA 1AGBB 5DURB 3L5WA 3UZQA 4U3XA 5FUOH 4H1LG 5KSAB 1RULH 4PB0L 5HHQA 4DUVA 1XGYH 3N1GC 1FV1A 1SY6H 3N1FC 3TBWA 5I1GH 4GW1B 4ZO6A 1FSKC 1NMCC 4M7JH 4BQBA 5D2NA 1EERB 3PQYD 4HWBA 3VFGL 1B6DA 3QWRD 3OR6A 5EN2B 2DWEB 1JZ7A 1G6RL 5HYQB 4I3RH 4UT6H 4GMSL 5A40E 5E1AA 1PZUB 3GKZA 5DQDL 2YS4A 3ULUF 4OZFG 2ZJSL 3L1OH 3MOBL 1SM3L 3FONA 4XP6H 5C0EB 5EOCL 4LLAA 1NJ9B 4Y8DC 2CUHA 4B53A 4YXHL 2XQYG 2J8HA 4LKCB 4EBQL 1FFQA 3IDGB 4Z95L 3V5DB 1NFIA 5I1JL 3F7YA 4TVPL 2E7LA 5IB4A 43C9A 4JFQA 4P9HL 1HIMH 1H8SA 1QQDA 2NW2B 4L29B 3MRIA 4HS6A 2VWEC 4XBPB 3PUCA 5GS0L 1XGRB 1C7SA 4OGAC 1I7UB 1UFUA 3IKCB 3UTSB 5JOPE 1F4AA 4ZAKB 3RRQA 1IC7L 2JB6B 1ZT1A 5GS1B 1BD2E 1E6JL 1BFOA 1UH3A 4TN9A 2A73B 3MRCB 2FIKB 4HWBH 4YHLH 1B0RA 1D5XB 4I5BB 4HCRL 1N0XH 1YJDH 3GSQB 4EUPG 4OLEA 1N64L 4PREA 4NKMA 4PRHE 3KGRA 2JELL 5ESAB 3P0VH 3GM0A 4HKXB 3OBAA 4KUCD 3PHQA 5GS1C 4LRNH 2W60B 1RJLA 4POZD 3EDKA 2P45B 4RFEB 1IJ9A 3HZMB 4BYHA 3U0TB 1OF2A 5L88L 1ZHBB 5JIPA 2W65A 4FQXD 5IFHH 5JZ7C 1XIWD 1X5ZA 4CVZA 1FZKB 1OTSC 2P8PB 5DHYB 3QFDB 5CAYB 1S7RA 3I02B 3O45A 3X13A 2UY6A 4HF5H 4QTIL 5GRJL 2BVUA 2X70B 2AQ1A 4MCZB 1NDGB 1D9KA 5JA9A 3T0AA 4LCUB 5I1CH 1RHHB 5KVFH 4Y5YA 3T0VA 3WUZA 4R7DB 3RA7L 1MI5B 2EC8A 4DQOH 3IS0X 3I2CL 3QUXA 1QSFD 1OSPL 1QKZL 1XIWC 5EBMB 3RI5K 5FA4A 3JV5A 4JZOB 4WEBH 1ZS8B 4GRWE 3TPKA 4Y1AD 1JYVA 3N85L 1A7OL 3BGFC 2CH8A 1T83C 3RL1B 4OUUB 2VERN 4ZFGH 1XGQA 3AU1A 1AGDB 3TNNB 3G9AB 1A6AB 1CFVL 2P5WE 4Z78A 4OLVL 4XVSH 3GKWH 1AY1L 4W68A 3LQAH 2PXYD 5FOBB 1CD1B 3ALWA 1F13A 3VCLB 3PDOA 3WSQL 1M1SA 3A6CH 2E6QA 4FQHA 2Z92A 5KSAA 4D94A 4OF8A 5HDLA 4P57B 4MD0A 2VIRB 4Z0BL 2VZUA 5DRXB 4N5ED 1OW0A 2YD2A 3MOBH 3FO1A 4GMTL 1XR9A 5CEZH 4OSUH 4IRJD 1U8MA 1B0WA 2EYTA 5LBSH 5DRZA 1HYSC 4M62H 2BK8A 5DUPL 4OCYL 3DXAD 2ZCHH 4G43A 1NGPL 4H5SA 4LLDA 1XCTB 5T1DL 3QO1B 4HJJL 2DJ4A 3RGVA 5HHNB 1QSFE 4P49A 1PDKA 3FMGH 3C5JA 3RX8A 4YFDB 5H94B 2YPLE 5HHVL 3VXOA 2AV7A 4NQCB 5IGXL 1ZXQA 5DUBA 3OKEA 4P4KB 5ENWB 1A6TA 5KSUB 3MRIB 1T21B 4HS6B 4AG4L 3GMRA 4HBQA 4V2BA 3KYMB 2VXVH 1OGTB 1Y0LA 4FFZL 4YDLC 1M6OB 4PJIB 4MZ3A 2R1XA 4W4NA 4Q2ZB 1GSMA 3NFNB 4K07A 3B8YA 1CYGA 1NC2B 4K3GA 1NBVH 1DQTA 2K1MA 3CXHJ 4M1CD 4Q9RH 1C5CH 2DJSA 3ZKQD 4X0KB 3IGAA 5FM5O 3S9DB 3OKYA 3FB5A 5A3IC 4OUUA 4FQXB 1P84K 2RBLA 3O0RH 5ID0B 4PJFF 2PN5A 4JEGB 2OCFD 4LU5L 3OR7B 1LEKA 1YYMH 1CD1A 2XWJA 4DTGH 3WIIH 1G6RH 4EVNA 4R96B 3EO9L 1I3RB 3QEHA 1AQKL 4R9HA 2VL5A 4G8IB 1MQKL 4KXZH 4XP4L 3RWIB 4R4NC 2EKSA 3X3GH 4BSVA 3MBXH 1DBJL 4RFEA 4PREB 3VG9B 3A0OA 4HH9A 5HYJB 3GI9L 4PY7B 4TPRH 1DLFH 1Z6JT 4NRZA 4Y4FB 2D7NA 2E27L 5DA0B 5DC0A 1KBGH 1KSRA 1A1NB 4P2CG 1KG0B 4R4FL 4YXKH 3BEWB 4R3SA 5F3BB 3E3QC 4LRIA 4RBPH 2CMRH 4AZ8A 1OTTD 1HKLL 4XNMB 3TH2T 4XP6L 4OZIE 4PJHB 4CJ1A 3U2SA 4Z7WE 3NFPB 3QUML 4MCZA 5EBMA 3IDIB 3UJIL 3LKNA 1KCSH 4J3TA 1SEQH 2E7HA 3KPSA 4KKCD 1SJHA 4MJ6A 3ZDZE 2C1OB 1MREL 1CFQB 4R7DA 1EJOH 1MJJB 1QRNA 2DL9A 2DJUA 2IWGA 2OK0L 2VDPL 1D5ZB 3ARBA 5ESQB 1I7ZA 5GSVB 3C08H 1JPFB 4KZEH 4PJ8A 4YQXH 5E4IA 3P40A 4NQED 3T0XA 4JM4L 1HHIB 3QEQA 4JFOB 1S3KL 1CDCA 5JHDE 4N1EA 3ARGB 3WIHH 4X6CF 4HS3A 2B1AH 3DV4B 1S7VB 4LK4A 1JNNH 4ELMB 5AYQA 2FBJL 1F3RB 3FT2A 3MGOA 4QOKE 4HGWB 3BRFA 2RR3A 3VD5A 2ICCA 2ZCHL 5DS8A 4V1DE 4GKSA 1MIMH 2D03H 4M6AA 4L5FL 2WP3T 4ZOAA 5IQ9B 5DJ2B 1GZPB 3BUTA 4GT7A 4GKNB 4R96A 2XTJE 3K2MC 2F53B 5KOVC 1IEAB 5I66A 4P46C 1DZBA 2VDNH 3HI6L 1CIUA 3MLWH 2R56H 1UWGH 1KB5H 4XZUB 3TVMB 1OLZA 3LN4A 2X41A 2GY7B 2EC9U 1G7LA 3ULVF 1U42A 2EH8L 3MRMB 4Z8FL 2OR8A 3Q6GL 1T21A 1JMXA 2DI7A 3QG7H 4XGZB 5DMGC 1HOCB 5FKPB 4LSQL 2DM4A 1A7PH 1FL6A 4L8BA 2X40A 4UZGA 3F7PC 3SBWC 4GXVL 4ETQB 1DQJA 1E4WL 4DGYH 2PW1B 4JCMA 1DN0A 5GIRB 2P5EE 4FQJH 1F97A 5JZ7D 4MD5B 4GW5B 4F7MB 3HZVB 5DEFB 1IGIL 4HHAA 1NGPH 3FTGB 1AXTL 1P6FA 4WEUD 3ISWA 1QNZH 1BLNA 4OTXH 3KR3L 1QFWM 5ADPH 1VPOL 4FQXA 4GH7B 5C7XL 3KHOA 1EMTH 5AZEH 5HHMB 2X4OA 4Y2OA 3ZZ1A 5E8NB 5JORA 1AHWB 4AENB 3VI3F 2HT3C 3QCUL 4ZTPL 3OHXB 3RAJL 4AG4H 5JW4R 2BNQE 4NO5A 1B2WL 1X7QB 4K7PX 2GT9A 3LQAL 4V2CB 1B0GB 2FJHA 4YHZL 1U91B 3EYSL 5L8JB 1F4YL 3HTLX 4MHHI 4WDIB 4PUBH 2VDNL 3HI6H 43CAB 2LU3A 3LCYA 5ID1A 1AD0B 1AGEA 1KFAH 4FQQB 4L8SC 4F57H 4U3HA 1GGCH 1HYRC 3TWCL 1JZ3A 2Y5EA 2CRIA 4HJGA 5B3JF 1RZ8A 4F7CB 5DJ6A 1RIVL 2FCBA 5MEPB 4JKWA 4FQIL 5B39A 3NCEB 1J0KA 4PTUA 4NQUA 8CGTA 4YR6B 1FFOA 3UO1H 1CVSC 3VXMD 5F70A 2HKHH 1A14H 3MJ9H 3QG6B 5CZXD 1EPFA 3THMH 2Z93B 1HQRB 1X5FA 2AQ2A 2JK5A 1NGZB 3GIVA 3G08A 3F7VB 4MQ7B 1IC5L 4OZFB 5K59F 3CLEL 3QXTA 3TIEB 5C1MB 3VFRB 2EYRA 1S7XB 4WW1A 1CLOL 4KMQA 2MTPA 2BVEA 3B43A 3CMGA 4FZEL 2LV4A 4ZS6C 3B3IA 4XB7A 1J8KA 4JY6B 4J1UA 4X9IA 4TOYH 5CD5D 3ILQD 1ZHLB 3QUMH 5DGQA 5FGBC 1F4XL 2CLRB 2G60H 4L8CA 5TH2B 2NY2B 5TGBA 2X4OB 4ZNCD 3E8UH 4OD2B 4MD4B 3U0WL 3WS6C 2GITA 3FCTB 4CW1A 4R4FH 3MMEA 3HE6B 2HRPL 4ZQKB 1I1AD 4U7SA 3HMWH 3AMLA 3GHEH 4PUBL 4QHUA 3T77B 5C07E 4B7IA 1EBAA 2A1WL 3DARA 2V2TB 1FNGB 2HT4C 3HRZB 2RCSL 4S2SB 5KVEH 4EUPB 4MCYB 1NAKH 1A3RL 4BUHA 2PUQT 5TE4L 5CS7A 1DQJB 1YYML 3MRKB 3JZ7A 1KCRH 1BZ9A 1RZ8B 1DBMH 4K2UL 4GW5A 4WNQA 3L7EA 4RAUA 1Q9OA 5T3ZL 2A74B 4OF3A 5IK3A 1CGYA 1G7MA 4KJWD 4HIXH 3ELAT 1KN2H 1WAAF 3PWPB 4WUUB 5GPRA 3VMNA 5I73C 2CUIA 2HLAB 3STZB 4LSVL 4JANB 4ZOBA 5GGSY 4I9WD 4ZFOA 1CZ8H 1JF6A 3SDXA 4R2GC 1CVRA 3ECBB 4X80L 1AGBA 2BXYA 4MNQD 2X1XR 3ARZA 2EYRB 1MQKH 5EA0L 1QEWB 1KELL 1WBYA 3QHTC 4YGAB 3TPUB 1UM6H 4JG0L 2OJZL 2P43B 1EO7A 5EUKA 3HG1A 4RGOH 4OZHF 5DLMH 4DW2H 4BELD 4TUKL 5IBLC 1BZQK 5ICXA 4NKOB 3SDAA 1T0MB 4JPIA 4P3DA 4LIQE 3VWJC 4X6DA 3S5LG 4AMKH 1D3CA 4Y4KA 1T2QH 4F7CA 4O2FB 2MKWA 4LVNC 1KXVC 2DQGH 4OKVB 2QHRH 1LE5A 2JE8A 5C6TL 3WIFB 4JN2B 5TE4H 1KJ2H 1JYNA 2DDQL 4RZCB 1MIEL 1QA9B 2OM5A 4K71B 2YA1A 5IUSA 3EFDH 4L4TD 3D2UB 1OTTC 5GSRA 1KIQA 2A1WH 4WVRA 3B8SA 1SY6L 4HK3N 5TDOB 4MNGE 5C0CA 3LKSA 4OJFH 3MJ7A 3BT2H 3ARPA 5HGAB 5BQ7A 3TESA 2DTSA 4K3DL 3IYLW 2Q76A 3R0NA 5EU6D 5GXBB 2ZUWA 5J57B 3A6BH 4KHTL 2AVGA 1YMME 3BSZL 5HHPB 4FRWA 2Z93A 4RFOL 4PJBF 2X5PA 1C7TA 4EJ1C 3BDXA 5IIEB 1OD9A 1FZOA 3EDEA 3TIEA 4JFEB 4JFHE 5IWLC 5ILTL 2ZUSA 2I60L 4P4KC 1L0YA 1GXEA 3JTTB 4HK0B 1AJ7L 3LB6C 4YWGL 2NTFA 5JPNB 3MACH 5E6IA 4ZTOH 5EZOL 5D1ZA 2RQ8A 1EZVY 2FR4A 2UVEA 3HPJA 1YEEH 3P30L 4CMMA 4X6FA 2AJVL 3K1KC 1K85A 1RD6A 2XQYK 4OFDA 4NQEE 4HIIA 1NH6A 3KPRB 4XWOC 3LKPA 3UEZA 4D9LH 1KB5B 3DVIA 3MSPA 5E5MA 4Z7VF 3MRMA 1E0OB 3C6LC 3O6FC 3DUSB 5D7IA 5MENE 2ENYA 3DPBA 4HFUL 1HWHB 1YC7A 3GMLA 2NY4C 1D5IH 3MV8D 3CUPA 1X5IA 5FO7B 5DQJA 4HUUB 3EYFA 3IDYC 3QDJA 3WHXB 3O6FB 4LASL 1A7NL 1FNEA 5EIIB 2QL1A 4YIQA 3R8BB 1QVOA 3MV7A 4CN4A 1NMAH 3STBA 4Y19B 3HUJF 3D25B 4YDKH 4PTTA 3MA7B 1OARH 1MFDL 5IEKA 4Y5XB 3TJHD 4M61A 5DJYA 5INCA 5J11C 2BNRA 8FABB 1OW0C 1FNAA 2OR9L 3D48R 3SQOH 3L3IB 3JWDL 3C6LA 4KK8C 3MBEC 3PDOB 2DQCH 4Q6IB 5ESAA 5L2KA 2LU4A 2NZ9D 4Y5XC 2FATH 4X4YB 2HKHL 4X6EA 2GUOB 4NJAH 4LEXL 1QNZL 1NEUA 3B9KC 5DZOA 3WFDL 1LDPL 1OP9A 3RY6A 2VZVA 3RTQC 1RZGA 4ODXB 2XI9A 3LEXA 4PLNC 1E6JH 5F7FA 5L9DH 1LE5B 4YFLF 4PJGA 4HX1B 3STLA 3VRJB 2IPKB 2V9TA 4IJ3C 4ORZC 4WJ5B 1ADQL 1ZE3C 3TA3B 1TFHA 1T66C 3ARDD 5GS0H 2O93L 3O41B 4JO2L 2ED7A 2NPLX 4PJ8C 1P53A 2CIKA 1V05A 5HI5C 1MFNA 5KSUA 3W0WE 3BAEL 4PJCA 4JFFA 5JXEC 1Z0NA 3TBTA 4N0UE 4ZTOL 4LCWD 3MTRA 1XGPB 3QB7C 5EO1B 2OTWB 3DBXB 4L3CB 4OLWH 3PQYA 3UDWC 4JFDB 5ALCH 4C56D 1LK2B 3GUTA 1RIHL 3JV4B 1P7KA 4XTRD 3Q6FA 4PRAB 3QNZA 1SM3H 4KQ3L 4QRSB 3SDCB 4PJAF 1DEDA 2CR3A 3GRWA 4LRNL 3MODH 4LCUA 5GGRY 4Z7QF 4JO4H 3F58H 1MVUB 1H5BA 3DWTA 2UWEE 1JWSA 4FQHB 4JHZA 4QXUL 3BIAX 2Q76B 2QQKL 1MY7A 5CUSL 4ZUUA 3WNLA 1LK3H 1KC5L 3QQ3B 3KYNA 4QGTA 4JG0H 1XR9B 5DJ8A 2VLMD 4G6JL 3PF2A 4H26B 4X7SL 4J8RA 1NUFA 1KGCE 5T3XD 4TSAL 5JUEH 1ZGLA 1BGXL 2LVEA 4Y5YC 1JRHL 1ZLUK 3SQBA 4PGCA 5EZOH 1FAIH 4X6FB 1XIWA 3BEWA 3QEUB 3QPQD 4PJGB 4ZOEA 3CCHB 4UBDC 2J8UF 2VDKH 3DI3B 5ENWA 4RMWA 3UYRH 1KCVH 1KENH 2ZG3A 1UC6A 2DTMH 4RFNC 1JHKH 4Z7NF 4WWID 4AH2A 2J6EH 5FOJA 1DL7L 2NX5B 1OAKL 5HYSB 4M02A 5EU3B 3DGGB 1ZLSL 1LWRA 3IU4H 3RWEB 3GJFH 3O9WD 1MPAH 4EKXA 4ENEC 3IJYA 1T1YA 1MFCH 5J56B 3ZMRA 3OSKA 3VFPA 1FGNH 1EUTA 2X05A 5CLWA 5DJYB 3BKCH 3ZHLA 8FABA 2A0LD 2QR0A 3WHXA 1IGMH 4R8WL 1OT2A 4NUGL 3WN5B 1T0NA 3MV7B 4XX1E 5GHWH 2RHEA 2QKIA 3NFNA 5T1DH 4U31A 3DUUB 4KUZL 2VDQH 2DIAA 1IBGH 1FLRH 1R24B 4P46B 5IMLB 5ESVB 3WLBB 5DQ9A 2DQTH 1U95B 4C55A 3P2TA 2F54E 2FL5B 2DYPA 3WJLA 2B8OT 3ARSA 1GC1H 2EC9T 3RVVD 5D7KD 3O4LB 2FECL 1D5MB 3W9EB 4FQCH 3WO4B 2NY7H 4YHIB 3WEXA 3S35X 1FV1B 3TBWB 1Z3GL 4OI8A 5EC2B 4K94C 1SVZA 9CGTA 4YO0A 1A9EA 4Q58C 3QI9D 3L7FB 5F7EL 2JB5H 1G7JA 3QJHA 3EDDA 5E2WH 5IVZA 1NCWL 2I9TB 5I18H 1W8NA 2RJMA 3CZFA 4F7PB 3ALXA 1EEZB 1FIGL 5LAXA 1CLYH 3CPLB 3RUGE 4U1LA 3L3OA 1DANU 5CZVL 2QEJA 2O26U 5L9DL 4JKLA 1JGDA 4GRMB 3NIGF 3IAPA 3KPNA 2VABA 1FG2B 3JBG7 1PJ9A 1RMFL 5E7BA 5E94A 1D5BA 2PXYB 1P9MA 3KJ4B 4Q9QH 2YK1L 3OF6A 4P2RB 2XACC 2R2BB 1HH6B 5J6GB 4RAHA 1OP5H 3VXQB 1A3LL 4C56B 2RGSA 2DQUH 3RVWD 4DKFH 4HMEA 4XCNB 2R1WB 3PQYB 2F19L 3BP6B 2CDEA 2HKFH 1MNUH 1GGIL 2PXYC 3ILPA 3RWJB 2ZSVA 1NMBH 4PRDB 2P42B 5DYOB 2Z8RA 5H35A 5JORB 1G9NH 4WV1A 4CMHB 3WHE0 2XKSA 3KYKL 4HIJA 2L7JA 4J2XA 5I71B 4U1KB 1FORH 4S0SD 3GSOB 4JKMA 2GFBA 2C3XA 1JGUL 4X4XB 3LN5A 3OJMB 3IJSA 5CSZA 2FR4B 5TQ0H 2AJXL 2FX9H 3TJEH 4CMHC 2PYEB 4S1QL 2ZOLA 1J87A 2GQHA 4QRPB 4FOMA 3MUHL 1D5MA 1NBZA 2BERA 5C0AA 3W9EA 3MRBB 1U92B 1NCAH 2HG5B 4R0LB 5E03A 5DVNA 4KJQD 3TO4D 1RY7B 4PP2A 5F1KC 4H0HB 1YECL 3BFOA 3AM8C 3K74B 3JSSA 3B6SB 4KK9D 3U9UA 1ZHBA 4G5ZH 4GXVH 4GMTH 2DLEA 4JRYA 1QR4A 4KQ3H 3C6LD 4TULL 2AV1A 1DANT 3W39B 5C08B 3H9SE 2H3NA 1PQZA 2DLIA 1DEEA 4OLWL 4M7KL 5LJYH 1S7TA 3F7VA 3WKNA 1FFPB 5CJ5A 3BYYA 4FN0A 4MDJA 3KPNB 3BAEH 1EBPA 1OT1A 1OGAB 1RJYB 5DJ0B 3T4AB 3LKOB 1NCBH 1MFBL 2B1HL 4QT5B 4K55A 2K9UA 1T66D 3QEQD 5DTFB 5GRUH 2R2BA 2WUCH 2NY2C 3MNVA 2XXCB 2IG2H 2ZNWA 3VFTB 4GQ9H 2I5YH 1BLNB 1HZHH 5E8OA 3HE6C 5L0QB 1I9EA 3MR9B 1F3JB 1ZLVK 2FEEI 2LVCA 2OS7A 1Q72H 5JOFA 5DD3L 3T1FA 1AD0A 5DUML 1JZ2A 1BQHB 1DR9A 3PWVB 1G7JB 1FNGA 4F80A 5IESL 2G75A 2D0FA 3WCYA 3U6RB 4WDIA 3QDMD 4L4JA 2D4DA 5DFVD 1WUNT 4JR9L 4XPBH 3RKPA 1RJCA 1JTTA 2Y6SC 3ROLA 5ICYA 5CZKA 5B39B 3QZWA 1FVDA 2ZNXA 4HT1L 5I1LB 3OTTA 4GW4B 2R56L 3WV0A 3O4LA 5HHOD 1JZ5A 2IGFL 4PJCB 2D31B 4ODSH 2R4RL 5JQ6L 1VGKB 5C0BE 5T1MA 3KLAA 4FQQA 4DKFL 4XBEH 4WRLA 4GLRH 2VZTA 4WU7B 4RNRA 5D1QA 4NCC1 4N5UA 4P2OA 4WI4A 1NCAL 1T03H 3B2UC 2FD6L 4G9FD 3MRQB 5GHWL 5FGCE 3CNKA 3GSWB 3QRFM 1IGFL 4LCCA 4U1LB 4LPXA 3HLAA 2JK5B 5IBTH 1TXKA 1MI5E 1RI8A 4PB9H 3MBXL 3T2OA 2HJLB 4JY4B 15C8L 5ISZB 2VABB 1MCSA 4GRWB 3I6GB 3OV6A 5E7FA 4GG6E 1C8PA 4APQC 5SWSD 1MHPH 1RUKL 1CXKA 3QIBA 2ZUXA 1EZVX 3MRLB 5SX4H 2NLJB 5K9JH 4ODUB 1SEQL 3MZGB 3DURA 3I9GH 3EO1B 1BBDL 4KH2A 3T2PA 1L7IH 5I1IH 2KL6A 2AJSH 5EO9A 4XPFL 1UJ3C 3OG6B 3UTQA 4HUXB 2XV6B 5H2BA 2DQTL 1QLEH 2IPTL 3BH9B 1ZVYA 1MWAH 4J23A 5KVGH 2I9LB 3I3EA 2VLLA 1SYSB 3HKFA 4I3RL 1Y18B 2EZ0D 2HJFA 1A5FL 3PL6A 4JFFE 1G9MC 3VGEA 4MZ2A 4PY7A 4XMPL 1MH5B 4C59B 4NRZB 2V7HA 4OLYH 3H9YA 3WLWD 3FQTB 2QSTA 3QIUB 3E2HB 1HSAA 4NQDE 3B9KB 3O3DB 3VH8A 4PS4L 4HXAL 2UUDH 4QYOB 3PGDA 1VFMA 5HHOE 5MHSE 3O9WB 3QI9C 2BVOA 3P0YL 4NBZB 2VZSA 4P5KA 4K3HA 1EGJH 2CDGA 3STZA 3QIUC 1A4KB 3L7EB 1I3GL 4GOSA 5FFLA 5HGHA 5CJOL 4PRPE 5AG9A 4GUPA 2CO6B 2VR5A 4P99A 1IRAY 1A47A 1N7MH 1S5IH 1FAKT 4NIKB 4TUKH 2N4IA 4JR9H 4P2QE 4UINL 1LP9F 5L7XH 2CKBA 4PJIF 1MCPL 3BO8B 4PJ5A 1MAML 4DK3A 4Z7VB 2R0ZH 1YNKL 1UVQA 1QFHA 3T0EC 5DHXB 3P4MA 1GRWA 3VFSB 1FVDB 2C7UB 2R4SH 5BXFB 1F4WH 1UM4L 4JY5L 5EU7E 3EOTL 3MRFA 3O4LD 4RIRB 5C86A 3U4EA 1ZT7B 4NZDA 1I8LA 3BIKA 3MUJA 3VFOA 1SMOA 4G8GA 3L3HB 3M1BA 4LLDB 4HC1A 3QO1A 1HHGB 5DMGD 3QCTL 4XPTL 1H5BC 5FV2A 2VXUL 4OQ1A 1RZKL 5F7MC 4L9LB 1Y6MR 2CD0A 4R97C 4H20H 4HPOH 3MA7A 2DBJA 3VDBA 3SKOB 4Y16C 4M61B 1OP3K 4P2OB 1FL5B 3IRPX 3F6LA 5EU6B 4YX2H 2EEBA 2R1XB 4HUUA 2BOCA 4P3CH 3QDJD 4KK9C 4DUXA 1JGVL 4Z78B 3RVXD 1BECA 1IGYA 1F8TH 4YFLI 3VXUA 4P2OC 5C0CB 1V7NH 1QVOB 5A2KH 4PJDA 4OT1L 5IB5B 4Z7QE 4FABH 2J12B 5C0RL 5DRNA 3IJHA 3MCKB 4F3FA 4XNXH 1WIUA 5JPNA 1AGFB 3KPQA 5JHDB 5D1QC 3C8DA 3TFKC 3VH8G 5D4QA 2EH7L 3GDBA 3MLRH 3GMMB 4LPVA 1XZ0A 1CFNB 2C3VB 4DGIH 1YNLH 3H9ZA 2YZ1A 4KK5D 2AJXH 1VKXA 2R2HA 4IOIB 1Q0YH 1LO0L 2EYTB 4HBCL 4V1DB 5EOQH 4JFEA 2IG2L 1X6LA 3W0WD 4NO5B 1NCCH 3P4NA 1XCTA 4FTVA 4X6CA 3TBSA 5BS0A 3C8KA 1T1WA 1YEEL 1OAZH 1QR1A 5D1ZB 5E0QA 3A6CL 5I1JH 1A8JH 1W72H 4F9PA 4PJXB 3WL9A 3UTTD 4MNHB 4YIQB 3O3DA 5H2BB 3VH8B 7FABH 4UILH 3CX2A 1E4JA 5IHBA 4PJ7F 1FYTE 5IEKB 2GHWB 1P2CB 5D1ZC 3U30B 1IQDB 1G0DA 1HCFX 1QBML 4YBLC 2AKRA 3OAYK 4BSWA 1MJJA 1QRNB 3MJ9A 1J1OL 1I9JL 3HS0A 4MXWH 2AK4E 1FCGA 2Z9TA 4PGEA 4Y4FD 2LABA 4YNYB 2D7TH 5K93A 2VQ1B 5FHBH 5ANME 3X17A 2Y07L 4X7FC 4UQ3A 3U83A 2MSPA 2FX9L 3MUGA 5L2JA 5C0IB 3AAZB 1BX2B 5E08H 1A6ZA 4OI9A 5I8EB 3IJHB 2DQCL 4F3FB 5FYKL 3H9SD 4XC1L 1YEDA 2GJ6A 3MZTA 2Q7YB 2EE9A 4ZFZB 3DO7B 3RGVD 2ARJA 4LLYA 5HHME 4RGNB 4LSPL 2ICWJ 1VESA 4OCWH 1LILA 2HT4D 3VWKC 1P69B 4RGMB 4BH8A 4Y0GA 4NPYA 3NABH 3SDDB 2OL3L 4B5EA 5FGBA 5E6YA 3L9RA 3W11D 3HMXA 3DTXA 3C87A 1TCRB 2C7UA 3ARXA 5F7DA 3QULA 4LCCC 1TZHB 3FN9A 4LCYA 1XGUA 3Q1SH 4NQVB 5EBWA 3OKKA 5EN2A 2UWEF 5FYJD 1EDQA 2AS5M 3D3VD 3BI9X 1CDYA 4XP4H 1A21A 4FQ1H 4HG4J 4G6KL 5LVEA 2L0DA 2EDYA 1U93B 3Q48A 5ESQA 4EDWL 1LMKA 2DM2A 3SDCA 3FQNA 4J3VA 1C16B 3IFOA 3U79A 3KPPA 5IB4B 5F97E 3PP3K 2OP4L 5C9JB 3DV6B 4H1LB 3FTGA 5GJSL 3BE1H 4M3KB 1XGRA 4RMSA 1CFBA 3LIZL 5FK9B 1U58B 3SKUD 5BRZA 4UI2A 3UP1A 4PPTA 1J9CT 3FO9A 4LQFH 3VXNA 1C5DB 2Z0BA 3MRPB 4NDMB 4UOW1 3RVTC 1Q9KA 2DMKA 4H26A 5HHXH 1YQ2A 4GFTB 4HT1H 1JN6A 3EYVA 3WXWH 1MHPL 4D9RD 4G6FB 5EBGA 3HG1B 5DJDB 4LARL 1B0GA 5IB2B 1U8HA 1DQLH 1KUMA 3UJTL 3H8NA 3QP3A 4LOUD 2O5YL 4Z5RA 4I13B 3N50A 5ELIA 1V8HA 3EZ8A 1UEMA 3HNTL 4WHTB 3IDNB 3PHQB 1P2CA 1J11A 2PETA 5HYIA 5C07B 1GOGA 2EE2A 4LCWA 3RIAK 3SGKA 1I3VA 4OIAA 2L4OA 4NGHL 3PIQA 1S9WA 1BQHG 5L0QC 4TTGA 5EU3A 3X11B 1CBVL 3K2UL 4JM2F 3AREA 4KDTA 3BPOC 4X7TA 3GBLA 4RWYL 2ZPKH 4YHML 3T1WA 1EH9A 2X4UA 1YPZA 1R5IA 2VO5A 4JVUA 3CU1A 4P5TC 5C8JA 5HYFA 7FABL 1A2YB 4NN6C 5D72L 3UTSE 3PABA 3WSQH 5KN5A 1FDLH 3S34L 1FAIL 1I8KB 4GRMA 4E0RA 3ZE1E 5D5ME 4AEIL 1A9BA 3HC4L 3GSOA 1INQB 1AP2A 4X5LA 2UV3A 1EXUA 3DO7A 5LG1A 4K94H 4GAFB 1H3UA 1PEWA 2X4PB 4DCQA 2E7MA 1Q0YL 1N5AB 3QXVA 4Y16D 1G9NC 2NY6C 5DQ9B 4UU9A 5I8EA 5DK0A 3FQUA 3HE6D 4F15B 2DD8H 3L7FA 1WEJL 4H1LH 5FDWB 2P7TB 3IU4L 4QXGL 4OD2A 3GSUA 4ZS7L 4YDIL 5D70L 2YA2A 4BH7B 3WLBA 1JK8B 5ISZD 3VW3L 2WLYA 4LPCA 1J1PL 4JFPA 2NTFB 3I85A 3KXFD 3UC0L 3TBVB 5F71A 1GOHA 3KLHD 2CR6A 4HQQH 2ZKHH 4CNIA 4DKDC 3K8MA 2C4FU 5F1NA 3S36L 4U6HA 5DRXA 3DXAA 4J6RL 1EK3A 1J0ZA 1EIBA 1MRFH 1JRHH 1GGTA 3MRKA 1FHGA 4XMLL 3WD5L 4P48A 5TDPA 5T1KD 3TV3L 1CDHA 5IVZB 3FRUA 2WP3O 5T5NF 1FFOB 3DTXB 1R3LB 5IMMB 4P5MA 1CR9L 3TJHC 4ESKA 1HKFA 4DZ8B 4N68A 3PV6A 4MJ4A 2X1OA 4UT9H 4YE4L 3EGSB 3PWLA 5F7UA 1VFUA 5F6HI 1YNTA 5JXEA 2CK0L 4G3YH 3T4YA 2NY5L 1KB9K 2JIXD 4YHNA 5F89A 1HHHB 3QCVL 1U93A 3S3PA 2Z8WC 2MKLC 2PW2B 4NWUH 4WV1B 4DOHE 1HSBB 2DS4A 2QADB 4WW2C 3ZDXE 2A9ML 5KBNC 1WCQA 3S4SB 2XWBA 4FZEH 2EICA 3IS1X 5BV7L 2XG4A 4RMRA 1JVKA 4HULB 2H6PB 1YMMB 5J89A 3B2VH 3ARED 4JCLA 4MXVE 2H2PD 5I2IB 4LLVA 1JN6B 5D2NE 1DVFC 1B2WH 1CFSB 4PV8A 3MLUL 3NAAH 4BK5A 4YC2C 3DMMD 3D9AH 5J4MA 2FO4B 5HD8D 4QRUA 1V3KA 5IW3A 1KG0A 2B0SL 2QLVB 1T1WB 5C0BD 2VISB 2WZPD 3SE4A 1QYGL 1TQCC 2MWCA 1AKJD 1J18A 2XWJB 5F21B 4Y2DB 3UTTA 4EVNB 3TO2B 1BM3L 3H6JA 4MHHG 1G7QB 4UV7L 2YPLB 5FF6A 4ZNEE 1URLA 2FHBA 1WFUA 3QUZD 4PJ9B 5TQ2L 1FLRL 1TPXC 4H25A 1MAKA 1S9XB 4JN1H 1N3NB 3QISA 4L3EB 4MMZC 4X7CC 3W0WA 4HZLB 1W72B 1KN4L 3U9UB 1CLYL 2V2XA 2Q86B 4U6VL 1I7ZB 3ARUA 2CLVA 4XNQA 1PZ5B 3LRGA 4ODVH 3T2QA 1KGCD 1TQBC 1T5WB 4K7PH 25C8H 4TNVK 1AI1L 3HC3H 1R3KA 2VQ1A 1SQ2N 3AROA 3MOAH 3PABB 4WFHE 4U05A 3RAJH 3MUGB 5GS0C 3GGWB 4NQSB 1BPVA 1SJHB 4MJ6B 4O2CB 4KQ4L 1CFQA 3SGKC 2R2EA 4DKAA 1R5WB 1UENA 4KRNA 1XF4B 4AL8H 1AR2A 4OFIA 3U9PL 2AJSL 1YDPA 2HVJA 4OGXL 3CIQA 5JNYA 2IH1A 4MMXC 1G6RB 3CZJA 4I2XE 3AUVA 5E4EB 5GJSH 5J12B 4D9RE 1F90H 4HS3B 4S1RH 4PRHA 4BH8B 2DIJA 2W9DH 2H9GB 3S7GA 5I17B 2X1QA 1E27B 4JKKA 4JZNB 4J3SA 1GAFL 1Q38A 2V5YA 3SDCD 3PNWB 4FQ1L 4X7SH 5I18L 3MBEB 2IEPA 4FXGA 4LP4A 4Z7WB 1HSAB 1GHFH 2PTTA 4NO0A 4EDXA 1WISA 1QSEA 1KCUH 5DQJB 4XH2A 1CLCA 3C08L 3H42L 2VLLB 4RWHA 5D1QB 1T22A 4LGSB 4N0UB 3OX8B 1RUAH 2JJWA 4W81A 4AYFA 5IVXA 3EAKA 2R9HC 2DQGL 2JKXA 1HEZB 3MV9E 3FL7A 3L1OL 4KI1A 5CCKL 1A1OB 2I24N 2YXFA 1QTYT 2LFGA 4FQ2H 3MV11 1OGAD 5FK9A 4Y4KC 2JTDA 2NLJA 1NFDA 5IBLD 3VXPB 35C8H 3ZDXF 3RWFA 1IGCH 3PV6B 3OJDB 1XAUA 3O9WA 5LGJA 4KTDH 3BO8A 5B8CB 4OCXL 1G1CA 1QBBA 1MCWW 4ONFL 1FNSL 1DBBH 4OUOA 4YH6A 5C71A 2OJZH 4QRRB 4KKCC 4PB9L 5I1GL 4MA3A 4PJAB 1T89A 1NCUA 2MPAH 1ZEAH 3PWPD 1U3ZA 3BGMB 1XR8B 1NAMB 2F53E 3U30C 3CAFA 3BPCA 4CMMB 3NA9H 1QLRA 3HE7D 2XXMB 3CFDB 4PP1D 3BPNC 4H8WL 5FKAB 4OLUH 2FO4A 2FHCA 4U1GB 4I48A 3QEGL 1OPGH 3BH9A 4XBEL 4UT7H 1X5GA 1AFVH 4KKLC 3DSFH 1F2XK 5I2IA 1L9MA 3UTTB 4LOUC 2PO6D 1Z9OA 3QIBC 3UDWA 5MENA 3DRTB 1MFAL 3OKDB 2FJFB 1YEKH 3SE4C 5CEZE 1CE1L 3QDJE 1CFTA 2FECI 4JZJA 2P5EB 1EAJA 4I0PB 4NNYA 4UTBL 3GJEB 4OLZL 4OLVH 5I1AA 3C60D 3BQUD 1RUMH 1MCJA 2NY2D 3F8UB 3NIDE 5E6IC 5KVEL 1I8KA 4WU5A 25C8L 1GCFA 4JAMA 4JO1H 2YRPA 4YHKL 3MGTA 2V2XB 4OBRA 1HHJA 2E9JA 4G6MH 1QHOA 1OQOA 1EFXA 1IVLA 1IE5A 3IAQA 1O7SA 5JOPD 4XVUD 2NW3A 3C5ZC 4ZD3H 4TTDC 4X4YA 4QLRA 2OZ4L 4ZPTB 3RA7H 2DLFH 2WUBH 2XIDA 5DURD 3NN8A 1J7VR 2FZ3A 4YE4H 1NBYA 2KH2B 3FN3A 4E9LA 2WANA 5GRVK 4GRWH 2DBLH 1I1YA 3QI9A 1X5AA 3S96B 1E27A 1JK8A 3QIWB 2F15A 1P7HL 5M7QA 4KKBD 5GGRB 2YSSA 1JNHA 1VGEH 1UACL 5IFHL 5T5NG 1ZHLA 3O8XA 1CTNA 3ZE2F 5EIQA 2DMBA 2VZ3A 4X99A 4LPUA 5F1NB 1NL0L 3IDXL 5HYQA 2MNUA 2WQ8A 3W2DH 2ZKHL 4M9PA 2JJTC 3MRBA 3W9DA 3GKWL 4IRSD 4WW2F 2NY0D 5CJQH 5JDSB 2Y7QB 5I75B 3IDGA 3V5DA 5IHLB 1KTDA 3SJVB 4QF1A 1FO0L 1Q9OB 5HVHC 4HCRH 3ZE0E 4PBWD 1BIHA 1SBSL 3HE7C 4Y1AE 1MCCA 1J05B 3I75B 1QQDB 5FYKD 5SX5K 3IFNH 3GSVB 4BFGA 4EUPA 3JXAA 3RUGB 4PY8I 5DK2A 4OGZA 3IKCA 3UTSA 4BFBD 4XNYL 2G2RB 1I7TA 4X98B 5FO8B 3IF1B 3CSGA 1TJIL 1G0XA 1BWMA 1MHHA 4NJAL 3MLTA 4QT5A 4ZUTA 3EIFA 5DJZA 4ZSOA 1EHAA 4HD9A 2F8VA 4Z95H 4Z76B 1BEYH 4WGVB 2VDMH 3CMOL 2BOCB 2DDQH 1FRGH 4QOKA 2QV2A 1I8IB 3O3BB 4F58H 2VH5H 3OAUH 5C0DB 1X5LA 1S9VA 3MJGX 2R9HD 1EMTL 4LLQA 5BOZG 2FL5A 5DDHA 1T5XA 5CINL 4HKZA 2W65B 1BFOB 4G7VL 3BPOB 3EOBA 4K8RH 4WI2A 1A7NH 2YD6A 4OLXL 1MF2H 5KVMC 2BY1A 2FGZA 2IBBA 2VLRD 4CVXB 2CK0H 1JNHB 2DKSA 4NN6B 4NM8H 3D3VE 3DXAE 3FN0H 4JG1L 4LPTA 3FAXA 4P5TA 1ZEAL 5ACZA 1T4KA 1FVEB 4K3EH 3RU8L 3O11A 3WL9B 4Y7MA 4NQTA 5ICYB 1Q8MA 2J88H 4AH2B 3AGVA 1U8LA 1A6VL 2FEEL 1JV5A 1FNSH 3GFUA 1K4DA 3VXRE 1M4KA 3QFDA 3BKMH 3Q6GH 1PZ5A 3I02A 3SY0A 2IF7A 4EN3A 3U46B 4NNYB 1MLCB 3BVNB 1NBQA 2E9BA 3FT3A 1DBAL 4UQ3B 4Q0XH 3C2SA 2DB8A 1IEHA 3MFGB 2X70A 4KKLD 3GSVA 3ZTJH 3FAWA 1P5UA 5DJCB 2R1WA 4KPHL 2FSEB 2P5EA 5HGAA 2EDNA 4BZ1L 3FO0L 1I7RA 3GI8H 5TFSH 3HNSH 1RMFH 1KCUL 4GG6A 4JM2D 3O6MH 3ZE1F 2LAGB 5CGTA 3TCLB 6CGTA 2YSSB 4AIOA 1KIRA 1I8IA 2VXQH 1A0QL 1FIGH 1TJHH 4M43L 1BBJB 2IAMC 3L95B 3OKNB 1CCZA 4WI6A 3WIHL 4HWEH 2FZ3B 4W6XB 5DDHB 3I84A 5FECA 3EO9H 3RQ3A 4PG2A 3RJDA 1LEGA 5F7DB 3FO1B 3NACL 2BVQB 2W9DL 1Q9WA 3D69B 3C5ZD 1JNLH 3QJHB 1BJ1H 3VRLE 1B4RA 1VB9A 5DXWA 1YYLH 1IGCL 1UZ8B 3NIFF 3SDDA 2BY2A 3S4SG 4X83A 1MY5A 4QF1B 1KB5A 2XFXB 4EI5D 4JGUA 1MREH 4P5TB 4YDVB 4XCYA 1NLDH 5CCKH 5F7LB 3E6FA 3INUH 2AABL 2H32A 2Z91B 3NVQA 1UM5H 3A67L 3OKMA 1JHTA 1ORSA 1U8LB 5D2NC 2ORBL 4U2ZA 5CEZD 2IFGA 5JO5A 3WDHA 3EOAB 4H1LA 1FG9C 1B9ZA 3P0GB 1C08B 1KT2B 5JDSA 1AXSA 1KACB 5HVWA 1UA6H 3V4VL 1TVBA 3GHBL 4MAYD 1MJ8H 3ULUH 3QDGD 4D0CB 3OXRA 3QIBD 1XGTB 3EYOB 3UO1L 3VD7A 3HE7A 2YRLA 3UBXI 3B5GA 1NKOA 4PRDA 5DYOA 1QSVA 3O2DH 5DMIH 3AB0C 2X4UB 1ROWA 4Y2DC 5IP4A 4EI6A 5BMFL 4HJJH 2ICEA 3BGAA 5HHMD 5IW6B 4NJ9L 5ISZE 4YBQD 3ZT6A 4JN1L 1XCQB 2KDGA 3BESR 4L8SA 3DYOA 4MS8D 1SBSH 4J3XA 1A3QA 1NAMA 4P9ML 3L3IA 2BFVL 3F12A 4XPGL 4ZSOB 1JZ6A 5AYUH 1LDPH 3TM6A 1HXMA 1K9TA 4HXBH 2CKBH 5BV7C 4GRWF 3FO2A 3T65B 3KPRE 4I8DA 5JLZB 4ELKA 2Q8BL 1RVFH 1OVZA 5BXFA 5ICZA 4NZUH 3DYPA 2QQLH 1K3ZA 1T4KB 3CLFH 3O6LH 3MRGB 3OZ9L 4APQB 3ZT7A 2XFXA 5C7XH 5E08L 3MNZB 2BHZA 4JZJB 3CXDH 5F88B 1WT5C 2P1YA 3TBTB 3DVGA 1BJ1J 5C92A 5FHBL 4KJYB 4OV5A 5MEND 3VRLF 2IPUK 3QNYB 2DRUA 1GGCL 2ARWA 2SEBA 3MLSL 3FOMB 1WJ3A 1IM9D 3IU3B 1HI6B 1CIDA 4NQDB 3IFLH 3U4AA 4JO4L 3MRNA 1MVUA 5E99H 5DSCA 5ADOH 1DVFB 4LSTH 3TA3C 4KMLB 3GBML 1BIIA 2BRQA 4MX7A 2X89A 5IMKB 1N5AA 3LD8B 4YX2L 1TQCB 3O3EB 3TO4A 4OAWB 3K1DA 5CHNA 1INQA 5AZEL 2I07B 5DD6B 3PWNA 4Z7OE 3V7AE 1A7RL 1WC7B 1YC8A 2HN7A 4P4RA 1GYAA 1T3FA 1CK0H 3LS5H 4UMGA 3MCLL 4JO2H 1LO2L 5MEOA 3LD8C 3CCHA 3CDYA 4Z7VE 1JL8A 2W9EL 1INEL 4PGCB 5EUOA 1IGIH 4YHLL 4XGZA 3VE0A 3IFNL 3B9EA 1ZGLB 3L3KB 4TUOA 1H8OA 4M6MH 5FGRA 1TQBB 4AK1A 1J0IA 1DFBH 3NZ8A 3BZ4A 1HZHL 4JHBA 4L4VA 3D85D 1HHKB 2XY1A 1IQWH 1G7HB 4IIQB 3FZUD 4OF5A 2GK0A 2A6DB 5LKNA 1R3LA 4K3JH 4AEIH 1KCKA 3ZKMC 3LEVH 4XVTL 4OZ4A 3CMOH 3TV3H 5ACMA 5EFIB 4PJCF 4P3CL 3ALPA 3L3JA 5CBAB 1CD8A 1RHHA 1MRFL 3BEVB 3ZTNL 12E8L 3VFPB 1UWGL 3X12B 1QBLH 5AZ2H 4P5MB 5EOCH 5BV7H 4V1DD 2EDBA 3LKQA 1T04A 4UV4H 1FL3A 2AERT 5LGKA 4ODBD 4NOBA 2ATPA 3T0EA 2XTJD 2P5WA 3MRJA 3NCFB 4PGZA 1IT9H 2E8YA 2YN5A 2WBJA 1ZHKB 4WO4C 1FBIL 1K8DB 4JB9H 2W07A 3GZKA 3OB0K 4EI6B 1VHPA 2OMNA 5HSFA 4I0PC 2GJ6B 2B5IC 4KI5F 3RHWK 1XCQA 3LV3A 4A6YH 4K94L 3UZVB 2VIRA 1SYSA 5JXAH 4WW2A 1W72A 3MA9H 2VLRB 2V7NA 4FXKB 4X6BA 1AGEB 4PV8B 4QXTA 1JPST 1MPAL 4TVPH 2V5MA 1W0VB 2B5IB 2XWTA 3CSYA 4AEHH 3K4ZA 3G5XA 5TFSL 3S36H 1CWVA 4XMKL 3L3KA 5EC2A 2BHYA 4OV5B 3T04D 3QH3B 3UC0H 3CDGB 3LHPL 1F6FB 4OFKA 5AYUL 4C57C 3QHZL 3VXOB 4XNQB 1FYTB 1KLUB 3QIWC 1DBAH 1UGNA 4JFFD 5J1AB 2IFFH 4OFYA 2CXKA 3CFBB 1MUJB 4NGHH 3I50L 3P9LA 3QUXB 4OZ4B 5D1XC 2VDRH 4AQ1B 4MX7B 3MV7E 2WWKT 2DAVA 3RHWF 5IV2B 3BQUC 1EFXD 4PRIE 1MLBA 1X5JA 5IFJB 3D85A 4NQDD 4M7JL 2YUXA 1A6VH 5MERB 3VI4E 2A9NH 2ZSVB 3KPLA 1HI6A 5ANMB 3FCTA 2AI0L 4YHPB 5I9QC 1AGCB 1MJ8L 3GNMH 4N9GA 3VXRD 3EHBC 2BOBA 1OAYH 3GRWH 5CGMA 4L8CB 2IH1B 4LIQH 3V6FA 1CFNA 3GJFK 5HDOA 3CDCA 4NQCD 3U0PA 5B8CA 2NQCA 4WI3A 3BMWA 3MOQA 3INUL 1KPUA 1ZTXL 1SYVB 4PP2B 4TUOB 5I1IL 4WY7H 2W0KA 4Y88A 1RUPL 1M71A 2AAVA 2EKSB 1HINH 5FA3A 2VDML 1A6WL 1JPGA 4MLIA 1JNLL 1JHTB 1JGLH 3VFGH 1PVHA 4XP1H 1XF2A 4JQIL 2FYYA 3SE3A 1KJVB 5EUOB 1OAQH 2G9HB 1IAII 3OAZH 4KI5E 5BZWA 1NGWB 1FL5A 4RQQA 1T2XA 3MROA 3CH8A 4NO0B 3ILQC 3V0WL 4C56E 1DFBL 3CFIC 3P9MA 4MWFB 4TYUA 3TYGL 3U0WH 2GY5A 1HYSD 1WIPA 3HZYA 3CVHA 3PQYE 3DX7B 5GS0D 3O6ML 4F8TA 5BW7A 5AD0B 1EHNA 2NY5H 1QLFB 3BDBA 2YD4A 4MA8H 2OTUA 2GSGA 1CF8L 1RK0A 1QPPA 4K7FA 4MAYB 3SCMB 4KK6C 1H8NA 4MB4A 2EIZB 4WCYL 5IW6A 5I0DA 4XPAL 5IK3B 3ECBA 3LHPH 4OZIF 4UDUA 1BD2A 4ONOA 5DJ0A 4JANA 3U9PH 4O58L 1DBML 3SCMC 2ZSWB 3VWKA 4UB0L 1HILB 5F9WC 2X4PA 3ESUF 1O5DT 4HFWB 3ZKXC 2PYEE 1ZLWK 5JOEA 2OR9H 4HDIB 1BFVL 3CC5B 3FB8B 3QT2A 4QRPE 4YEEA 4GS7C 3PWJB 4ELKB 3F7QA 1TETH 2F58H 4OKVA 5T3XE 1MFDH 3PWVA 1CDJA 4AY0A 4GW4A 5IESH 1LO0H 3HB3D 3WIFA 4X6DB 15C8H 5SWSE 3D0LA 4G42A 1P1ZB 5F9WB 3PP4H 2FJGB 1GAFH 3LB6D 3SE8H 1FGVL 4JHWH 4XNUL 5ALBH 1GGYA 4XI5C 3I2CH 1EFQA 3QH3A 1EEYA 3MLSH 3X13B 5EDXA 4CVUA 2OZ4H 5E2JA 1I3UA 2HFEB 3H9SB 4IDLA 4EIZC 4EQ2A 5DD1L 3Q5OA 4X99B 1U9KA 2H26B 5CEZL 3F65A 2AKRB 1S7WA 1GC1C 1F8TL 1OGAE 1D7FA 4GRLD 3OKDA 1YUHB 5FKPA 3AC0A 1U8QB 3QWOA 4GAJL 2D31A 3MX0A 4MNQE 4HWNA 5KVDL 3S36X 4JREB 3U7WL 4LAQL 1MCKA 3T0DA 1S7SB 3FQWA 5TDNB 1DLHA 1IKNC 1FRGL 2EH8H 4Z8FH 1AE6L 4PYGA 4ZUSA 3BW9B 2X10A 3MUY1 3PE9A 5H8DA 4RA0C 3WXVH 2F5BL 3LEVL 3CGTA 4N9GB 1S5HA 1S9VB 3QQ4A 3T4YB 5IW1A 2V17H 1V7MH 1EFXB 3T0WA 3U7YL 1N64H 3FO9B 3NPSB 3HNVL 4FZ8L 3UPRA 4MJIB 1JTPA 2R0WL 5DEZA 3GM8A 4S0TD 5D70H 1F4HA 1UH4A 4ZUTB 1R3JA 2Q8AL 3MGOB 5F93C 4MVBD 5JXED 1MFEL 2F54D 3U48A 1ETZA 3PP3H 1KTLB 4HZAA 1JWMA 2NYYD 1KFAL 1UM4H 4UNUA 4IRSB 3G6DH 4DFHA 4RISL 1PKOA 4JDVA 1JIBA 3X14A 3LS5L 1XF2B 3QG7L 1MJ7H 4QRTB 4PLJD 1U3YA 4IRJA 3I75A 2CKNA 4EI5A 5IHZB 4LCIL 2YMXL 1CGVA 1YEHL 1H15B 1W72L 2WWMD 4W6WB 2GJZA 3QRGH 4U49A 1GIGL 2CRMA 1J05A 5J6HB 2R1YB 1K5NA 4G6FD 1RJZB 2C5DC 3BGFB 2HJFB 3DUHA 5HJ3A 5ADOL 1UG9A 5I8CB 1KTDB 4HJ0C 1S7WB 4JHAL 2IBGA 5JTWA 4L5FH 4N8PA 2EIZA 4I0KA 4YPJA 3SE3C 3VGBA 3RKDD 1I1RA 3QUYC 3JV6B 2EKJA 2F9BT 2OP4H 1OAYL 3MLTB 5DEFA 4GG6B 1JNNL 4W6YB 1A7QL 2APTA 3H2WA 4ZUSB 3IF1A 1B4JL 4HKZB 5TQ0L 4HIEA 4JY5H 1C5DA 5CJXC 3LDBB 4GJTB 4MA7L 5DRWB 3P9WB 4JJ5B 4KZEL 4DOHB 1ED3B 5J11B 1DN2A 35C8L 3WIIL 1HXYB 2AEPH 4ZDHB 4JFYA 3QUYD 1ZT7A 4I4WA 4HMCA 5JNYB 5EUOF 2WINB 1EEYB 2V7NB 5IROA 1Y6NR 3UJIH 1KENL 2RIKA 1PSKL 4PJ5B 2FHFA 4N0YL 5HTSA 1NUNB 2FJGA 3CC5A 3FB8A 4JVPA 1JZ4A 3QQ9D 4PBVC 5FO9A 1R0AL 1JPTH 4LLWB 1Q9WB 3RI5F 2A6IA 1AO7D 2YKLH 2HVKB 3FOLA 4X7TB 4XXCA 1IEBA 3SGJC 4YDLB 2X1WL 3L3GA 4Z0XA 4UDTB 3X3GL 3REWA 3AB0B 3VFWB 2NZ9C 5D2LA 4J3WA 2MPAL 1AI1H 3HC3L 1J8HD 2EDXA 3KPMA 3GB7A 4HS8L 2HLFD 3QWRA 1XGPA 3OKMB 5TF0A 4OCLC 4JO3L 4ZFFB 4PRPB 1REIA 4TTDD 1FBIH 3JV4A 1HINL 3T0EE 1BVKB 3CVHL 5I19L 2DQEL 1JWSB 4OM1L 5D1XD 5J13C 3SKJH 4U1NB 2OL3H 2BSTB 4KC3B 3BKJL 2QHRL 4JFQB 2LTQC 5LGJB 4X9GA 2E8ZA 3Q0HA 3NCJH 4L9LC 2XQBH 1IAIM 5BJTB 1MWAA 4WGWB 4YUEH 5FUZH 2V6HA 4RMUA 1KEGH 1AR1C 1T20B 2LTQB 1YEFH 4K9EC 2DI9A 1IILE 4DAGH 5I1EH 1FO0A 4I2XB 3GI9H 4J8RB 1AY1H 5IEHB 4XVJL 2CDFB 3BKCL 4HWEL 4HWZA 3LQZA 4PRID 1WBXA 1U8JB 5K9KB 5IKCB 1MRCL 2X7LA 1T89C 3MRHB 2V2TA 1ZOXA 5IJVB 5IHUH 1NDGA 5EORH 4S11A 4E41B 4UQ2A 3MPCA 3G04A 1CXLA 1RZIB 3Q1SL 4IHOB 3EUUA 4Y5YB 3IAGC 5LQBH 5C2UB 3V4PH 3R1GL 1CL7I 5D71L 4UAOB 2X1PA 2PW1A 5EU6E 1IQDA 5HPOA 3OB0H 3VWKD 4N0YH 1YY8A 4D9QE 4GBXA 4FABL 3O45B 3ARFC 1FJ1B 3ARGC 2CLZB 3Q3GB 5EZIH 4Z7WF 2GTZB 4UAOC 5C0CE 5IFAH 3GBNL 3HHRB 4LDOB 5LGHH 5J6HA 3WXVL 3QRGL 3U1SH 1T1YB 1X5KA 1CQKA 3KPSD 3DETD 2SEBB 3ARFB 3FOMA 3U7WH 2YMXH 2ICEB 1IM3B 3HCVA 1B3JA 5FA4B 4TULH 2PO6B 1K2DB 3WUWB 2ITCA 4DVBB 3WE6A 2Z8VC 3MRNB 4U4BA 3IFPB 3RZCC 1ORQB 1KEMH 4LLVB 2X6MA 3TT1L 1Z9LA 1OWWA 1ZKAA 2D3VA 2CK2A 3NFSL 4WEBL 1FNFA 3HZKA 4G3YL 2BP3A 2BNQA 1MWAB 3KS0J 3VW3H 5C0IA 2RB8A 3IXTB 2DLFL 2WUBL 4QHNA 1BJMA 1UKSA 2ZUUA 3K0WA 5JLZA 3LS4H 1HE7A 5EU5B 5HYJD 1JI2A 3DETC 1EO8H 2R2CA 4PJXE 2NY1D 2ZCKH 3HAEA 4JFYB 5CINH 4NQVA 5EBWB 1UXWB 4HUKB 4O2FA 1JGDB 3NTCH 1TCRA 3BQUA 4U6XA 1F6LL 1XF5B 2FEDD 2JJSC 4E41A 1IC5H 2AEIT 3FOLB 4G8GD 5I9QB 3L3JB 4OQTA 2YN3A 3NCYP 2AK4B 1UEYA 4KI5D 3H7LA 1C5BH 4HUWA 2F19H 4LF3A 1DVFA 5GSRB 3P73B 5K33A 1RUQL 2OSLB 4HUMB 1TJIH 4OZGF 4M5YL 3B9DA 2EDTA 3RX7A 4EXPX 4NFBA 2YEZA 5DQDH 5IMKA 1N0XL 1YJDL 1A7OH 1PX3A 4IDJH 4Z7UF 5D2LB 2CJUH 4HGKC 4QRRD 1LNUA 4K3DH 3WS6A 1AHWC 1BFTA 4S1SL 4GXUM 1BMGA 5F6IC 3UAJD 1DQQB 2YPKB 2VTFA 2WIMA 3LZFH 3SGJA 3EYVB 5CBEA 4J12A 3UTSD 1VENA 2NY3D 2R4SL 3EDFA 5SWZD 4N0CD 3TT3L 2EEAA 1QRKA 2I25N 5IJKC 5BJTA 4QTIH 1XT5A 3OKOB 4P4RB 1PKQB 2BMKA 3EFDL 2GUOA 2QSQA 4Y89A 3SCMD 3N1MC 4OQTH 3TO4B 1A5FH 1H3VA 5B38B 4XP9L 3JUYA 5FYLL 2AJUL 2IC2A 3AS2A 4G7YL 2XZAL 5CSZB 4QRQA 3LEXB 4MXVF 1QP1A 1OARL 2ZPKL 1U8PA 4ONHB 5BVPL 1EAPB 1NLDL 3VXTA 1NDMB 3X3FL 4IEFB 2B4CL 2YXMA 3BKJH 3V6ZB 3RVWC 3AREB 3MXWH 1YY9D 4DVRH 1FFPA 3O11B 4KVNL 4NRYA 1YPZB 1Y0LB 2NTSP 2Z35A 3BQUB 3QCTH 1YYLL 3RVUD 3JVGC 3JUZA 1A6PA 1PQZB 4YK4B 4X8JA 5B38G 3MC0A 4R0LC 4S1QH 2K7PA 3ZKXB 2IH3A 2BCKB 2BNUB 2YPVH 5CBAA 5EIIA 1JWUA 3CXDL 1HHIA 1P5VA 4G80A 4OLYL 2ICWB 4OGAD 3ARBD 1UWEH 1ZWIA 1RZ7L 1YY9C 3CD4A 3M8OL 2XYCA 1K2DA 3WUWA 2E9WA 3VDCA 2QQLL 2APXA 1LVEA 2B39A 1DUYB 4HKBA 4NZJA 3D0VB 4P59H 5IR1B 3T3PE 3VXMA 3MLXL 4JFZH 3ZDZF 1S9YA 2OYPA 4PJBA 3ZO0A 5B3NA 3GSUB 2G75B 3MR9A 2XQBL 3QFJB 4KPHH 4OCSL 2E6JA 3HG1E 3FQUB 1EGJA 1VCAA 4BQ8A 5CEXA 1I3GH 4GSDL 2WINA 1E28B 3D39A 5F6HJ 3T8XA 1A1NA 5I1DA 2XRAL 2DL2A 5EPMA 3BZEB 3ZYIA 4XP9H 5GZNC 3BPLC 4CBPA 1J1XH 2N7BA 4NT6A 4IMLA 4EUPH 2YC1B 2BVQA 4I9WE 2PKDA 3GMQB 1T7ZA 4K7PL 1OM3L 4U6HB 1CICA 3PGCA 3DXAB 3NOIA 1WTLA 1AXIB 5T1MB 1S7QA 2H2PC 2IADB 3WJJA 2EZ0C 1GGBH 1KN4H 2D7TL 2H8PA 3NPSC 1OB1A 3KPMB 4F8QA 2VSCA 5KS9B 1E4KC 4M62L 2D9CA 5DVKA 3SCMA 5JO5B 1FZMB 1KCLA 4R2GB 1QFOA 3H3PL 3QHZH 1HHHA 5D5MB 1KJ3H 5SX4I 5TPWH 4ZMAT 1TVBB 3IDMB 1F3DJ 4GLRI 5C0CD 4ELMA 2AK4A 3HZVA 1QBLL 4GAYA 2VN4A 3SGEI 1X4ZA 2XN9A 4Z7NE 1C5BL 3B9AA 2J6EA 2H2SD 4YXKL 2H32H 4FFVC 4L29A 3VGDA 3SJVD 1YEHH 4BFIB 4J3UA 4HFWA 4POUB 2C3HA 4OZHB 2E27H 4QO1A 2D7PA 1Q0XH 3NH7H 3O81A 5EWIH 1J10A 3LPFA 3MREB 1LNUB 4HK0A 3B83A 4G6JH 43CAA 1X4XA 4Y2DA 1PY4A 2FWOA 4ZPVB 4CVXA 2FJHB 3CX5J 4HGMA 4JPWL 4IDJL 5I0ZA 3A6OA 2YD9A 1VDGA 2HH0H 3DGCR 4L3AA 2CIIA 3VA2C 5CD3A 1U8KB 5DJ2A 4ETYA 1I1AC 4U1MA 1I9RL 4N90D 5DMKB 3MROB 3NABL 4JREC 3CK0L 4OD3L 3CSPA 5KZCD 4QRUB 1YUHA 3RIFF 1U8QA 3DX7A 3DX8B 3V52H 3QUZA 4XNZB 1T5WA 5AZ2L 5F7WC 2OTUB 2DKMA 3DGGA 1DLHB 4RQQB 5F88A 5D6DA 1MLCA 3BVNA 4OFYD 3V6ZA 4HHAB 2IQAA 2HFEA 4OQTL 1L9NA 2G9HA 3DVNA 4M6NL 3CVIL 4M7LL 4NBYB 2NX5D 3CVHB 1E4XH 5EOTB 2HKFL 4A6YL 3V79C 5GGTA 1MHEB 1J5OL 5ETUB 1FQ9C 2ESVD 4N8VB 4Z76A 4JZOA 4PJBB 5T1LA 2BNRD 4MSWB 1YDPB 2VRAA 4LVHB 2ZUYA 3BP6A 2MOVA 1Q94B 1CT8B 2ADGB 4PJ9C 1XF4A 5F7NC 1S9YB 1ZWIB 5GZOD 4BFIA 2ATKA 4XNXL 1J88A 5D2NB 1WZ1L 1U8NB 3F58L 1P1ZA 1SMAA 2ICWI 2UZIH 4UV4L 3FB6A 4HKBB 1UVQB 4FQLH 4U1SB 4LVHC 3PJSB 3RZCD 1LO2H 3U36B 4G9DA 1CLOH 3GSNB 1RUQH 1WIOA 2IQ9H 2BDNL 5D1QD 5E2WL 2AJVH 1RK1A 5T3XL 4XC3L 1T3FB 5CGYC 1BFVH 2DWDB 2EIEA 2L7UA 4N8VG 3R06A 4LNVA 1F58H 4PD4K 4CGTA 3L5HA 1M05B 3V6OE 1XF5A 4L3EE 3DVFA 1IL1B 2H9GA 4U1MB 1PYWB 3OMZA 4YR6A 3UTPD 2R69L 3CZFB 3TC9A 5CFHA 5TDNA 1EEZA 3JWOC 3MLZH 1TDQA 1CL7L 1U36A 5C9KA 2HTKC 1NGYB 1LK2A 4KY1H 1OPGL 4X9FA 5B21A 2OL3A 3VXSE 3DROA 4IOFD 4TSBH 2EIDA 3Q5YA 4TNWF 5E4EC 4ERSH 2APWA 3TYGH 3KPRD 3LSOA 4KK6D 5T5FH 1J12A 2H26A 5DFWH 4GQ9L 5D7KE 3VXPA 1H5BB 4YFEA 1QHPA 3GMNB 3LKRA 1KEML 2EDWA 1S3KH 1DQQA 1G1YA 3W2DL 3F7YB 2JB5L 4L8DB 2NR6C 4Y4FC 5IOPB 5KS9F 3WJJC 3OG4B 5D96B 4HUVA 5D7LA 1WBZB 4FQCL 3WNOA 5HPMA 3QQ4B 2J6EL 3LEYH 1KJ3L 5TPWL 1KB5L 2HJKB 3RX5A 5SV3A 3HB3C 4NYLB 5KSVA 4N0CC 4NN5B 4JQXA 1K8DA 1PFCA 4GG8A 5DJAA 4N1CA 4ISVA 4BSJA 4JJ5A 1IBGL 4MNHA 4DGVL 4F33B 4XCFH 1G7PB 2PTUA 2R23B 3RTQD 4ZD3L 2ESVA 1QR1B 1MHCB 4JVWA 4Y4KB 1FVCB 2G5RA 4BSVB 1WFOA 4R7NB 3VFVA 3SE8L 3BPCB 4KRPD 4YDJA 5DEGA 2X4RA 2A9NL 5E56A 3WFZA 4TSAH 5JUEL 1MCWM 4B0MM 2HTLC 4WENB 4NC0B 1AKJA 3D18B 3UJTH 3C8KB 2FLRT 3ZL4H 5I8KL 3MJ8B 4F37F 1HIML 1CDBA 32C2B 3OPZL 3HFMH 3MV9B 2M1KA 5EH1A 3V0AC 3MYZA 2IFFL 5BQ7B 2QTEA 3HNSL 2GJZB 1A6AA 1GGIH 3OJVC 2V5TA 2DTML 5FM4A 1L7IL 3LQAC 1O7VA 3MLWL 2JLLA 5FYJL 3SOBL 1UM5L 5D8JH 3D2UA 4OF0A 3GJEA 1D5ZA 3ARBB 2JB6A 4NC2B 4QRRE 1OQXA 1I4FB 4Q0XL 1SHMA 3FFCE 4LNRB 1HKLH 4PJAE 3BD3A 3SE9L 4IOFC 4OLUL 4U0RC 4PBXA 4ALAL 4RGOL 3EJYC 3HNTH 4DWHA 2BSTA 2GKIA 4P57A 1F6AA 3S98A 5HHPA 1DQDH 3OB8A 5LXGH 4BM7A 3UTTE 3ULUL 3WDIA 4ISVB 3GJFA 4R90L 1P7QB 5IIEA 3S96A 4GKNA 4O2EA 1KULA 1RZIA 1T7YA 4LMQI 4QHLA 3EOYG 3KPTA 2DN7A 3L3GB 5DHYA 4ZNEA 3HRPA 4G43B 4H5SB 4X5WB 5F9JA 2JCCF 2XRAH 5CJBA 1JRHI 5E95B 4LSVH 4GAGH 4NSKA 1WZLA 4OGYL 3QXUA 3QDJB 2VLRE 4YXLL 1BM3H 3MGAA 4YDJB 1T6WA 5DEGB 1CGTA 1YN6A 2D7QA 5CP3A 1OB1B 1WAAA 2XZQH 1IEBB 1VGKA 5ABDE 4HWZB 1C16A 4OCSH 3O3AB 4WO4B 5EO0A 4Z0XB 5GRUL 4JGMA 1QACA 4NQDA 4U7KA 3S5LA 5EFIA 1K3IA 4KTEL 1LO4L 3ES6A 3VFNA 5FO7A 1FNHA 5IOPA 2W38A 3P4LA 5GQBA 1EHXA 4UTAH 1AGDA 5DUMH 2RCSH 1UWXK 1YY8B 4OZHA 3G6JE 1UWXH 5C3LD 5HI4C 4Z7UE 1TTFA 5DT1L 1OSPH 1QKZH 4L1HA 4X6DF 1I85C 3NBNA 3UMTA 1KN2L 4F57L 2VUYA 4P2QA 2GTWB 4U1JB 2H1PH 5MEOB 2JJSA 4G8FB 5T3ZH 1CDGA 4O5LL 2BRRH 3TJEL 2BVPB 4XAKD 3VGFA 3QUXC 5L6YL 4R7NA 3VFVB 2FATL 1PAMA 4TRPH 1ND0A 3B9VA 4P3WA 3CUPB 1U2CA 5SWSA 1G7PA 3G5VB 3MO1B 4NM4H 1L0QA 3CFJA 3SJVE 3TA3A 2DYPD 4Z5RB 3LAFA 1YJDC 3TFKD 5DJXA 1MH5A 4Y1AB 2VL4A 3WS3A 1X3DA 4PRNA 4P4KA 1PG7L 1H3TA 4LL9A 5A3ID 3CK0H 1FPTL 3CXHK 4DJMA 2GJ6D 5ITFB 1H9VA 5E9DA 3KPOB 4ODWA 2YEZB 5K9QG 1WWBX 3FMGL 2VQTA 3EFFB 1F00I 4TSCL 3PGDB 1CGSL 4RAVA 1D5IL 4KRPC 4KY1L 4DCQB 5C0RH 4ZXBD 3IFPA 3MLZL 3MODL 1Q9LB 2DMCA 5E8OB 2Z31D 5KVFL 3C9NA 3T0BA 5GRZA 4NCDA 3WFDH 5C8JB 2CUMA 2NW2A 1WITA 5KANG 1Z0MA 1IM3A 2EE6A 2X09A 5EZJB 3RNKA 2BNRB 4JLRA 1PKQA 4F7TA 3P30H 1S5HB 3S8WA 4E0RB 5EU4B 2CXGA 3WKML 1F58L 3NMEA 3TP4A 2ID5A 3ARGA 4IM8A 1I3RA 4EOWL 2EXYD 1I7RB 1WWCA 4C83B 3B2VL 2CLRA 3ZE2E 5HHQB 5D7JA 3LMJH 3T08A 5GGUB 2AQ3A 2OQJB 3D3VB 5ERWB 3TCLA 2AGJL 3DX9B 3RFZC 2XG5A 3BSZH 5KSAD 2NR6D 2ZOKA 5E1AB 2BVPA 3TBVA 1J8HB 5D71H 2VLJD 3UCRA 1YECH 2VZOA 4BH7A 2W0PA 2ZUVA 1KNOB 4G8GB 4X6DE 5SWSB 5HD8C 4NJ9H 3HC0B 4D0BB 5DFVC 4JRXD 4DN3L 3VXRB 3QUMB 4AM0A 1KJVA 1L0XA 4WJ5A 4PGJA 2B1AL 2VXTL 1QG3A 4QRQB 1H15A 3ULVE 3OJ2C 4XVJH 3OXRB 4UOW0 2ENSA 4XP5L 2VC2H 2QBWA 3SKOA 3MCG1 2EEDA 5HDBF 1C08A 1KT2A 1HOCA 5TDPB 2YD7A 3FRUB 3QHFL 1TTUA 3ES6B 3VFNB 4NZUL 1LO4H 2C1PA 3QJFB 5IR1A 1MCOL 2VAAA 5E8PA 3DRQA 1OAKH 3JWDC 1TTGA 2Y4SA 4ETQA 3BWAB 1KV3A 4HEPG 3QZWG 4HQQL 4WTXA 1AQDB 2CKBL 2F8OA 4LFHD 4MAUH 4LASH 3FFCD 1OAUL 3BPLB 5E6ZA 1EV2E 4KUZH 3RWCB 2OJEB 4OCNC 3T3ME 3QNXA 4NO0D 1D5XA 2VLKA 4I5BA 4JGJA 1ZSDB 1R3HA 1T0NB 3PWJA 4TPRL 4XB8A 4MJIE 1EAPA 2NY1C 4G6KH 4PGBB 1LEIA 3ULSB 3MYJB 5KG9B 3OGCB 1RFDH 3GMQA 1AHWA 5E8NA 1JP5A 3FB7A 2J5LC 2OQJA 1IGJB 1KLGB 4UTAL 5JW3H 3RNQA 2GTWA 2UYLB 3WS3B 1OOAA 1LD9A 4JM4H 1X7QA 1U3JA 3CPLA 1KC5H 1JPTL 2Y72A 3RVTD 3AS1A 1M7IB 2I9TA 2ZG1A 1ZANL 5D5MF 3V8OA 5GGTH 3QDMA 1EVTC 4P2YA 2Y1VA 2X2YA 3R0MA 1EO5A 3TZVB 5CJOH 4WY7L 4RSVA 1U8IB 3P9MB 1KPRB 1DN0B 4ZS6D 5GIRA 1AFVL 3VFMA 4OGYH 2R29L 3EFFA 1Q9LA 4I3SL 4GAGL 4XXDB 5E24E 1KTRL 2VDQL 3NIGE 2R15A 5GRVL 5M94B 5KS9A 3IFOB 4PS4H 4TNWK 1QRND 4MA7H 4MJID 5TH2A 4FFWD 2ICWA 3BDYH 4NP4L 4OKDA 2N1KA 5GJTH 5H35B 5J6GA 1M7XA 3G08B 4MQ7A 4ZSOE 1YEIL 5F1IB 3IDMA 4QHKI 1FFNA 1I1AA 4OCXH 4AENA 1UJ3B 3C5SA 1NGQL 4YQXL 5CUSH 4S1SH 2NY3B 2Y06L 3HN3A 5DMJB 3JVGA 5T1KA 5CILL 1P4IH 4W4OC 4DEPC 3OR7A 4ZO8A 5DD0H 5I1DB 2CIIB 3UTOA 1CLZL 3HUJA 3QAZB 4PJFA 2R8SL 1JHKL 4NZRL 4XAKE 5IF0B 3D3VA 5ERWA 3DX6B 3RGVB 5FYJH 3SOBH 1YMHB 1S7QB 2O5XL 2YC1A 4C83A 3L3OB 2EDQA 4Q9RL 4AT6B 5EPMB 3D9AL 3PDDA 3L9RB 5SWZA 4Z7OF 2E7LC 3FKUS 4YO0B 1BEYL 1G7IA 5I6XC 4Q6IC 3O9WC 3ZTJG 3SDYL 1V3LA 4OZGE 4OFVA 3M8OH 5FHAL 4RISH 2DQFA 5BRZD 4LSTL 1FSKB 4Q2ZA 3NFPA 1AQKH 1NMCB 3PL6D 5J7CC 5MP6L 1EHLL 1ACYL 5I6XB 2UUDK 1MFEH 1RU9H 3DX8A 1OGTA 3GK8L 3LKOA 2OR7A 3B2UD 1KIUA 1FFRA 2DM3A 3MBED 2P24B 1OCWH 5EBLB 1B90A 4JE4B 1FZJA 3HPLA 4XNUH 4K7PY 1VFBB 3QNXB 1U8NA 3VWJD 3MXWL 5J9PA 2XZZA 3T0EB 4G7VH 5D93C 3TCXA 4F9LA 1HCVA 3DHJA 5D2LF 5TGBB 5C3TA 3HR6A 3RWHA 4BFEA 1UCBL 1RURH 2XZAH 1AE6H 2VL5B 4G8IA 2VR4A 1UACH 4PJ9D 1VKXB 2ATPB 5JOFB 1L7TL 2GCYA 1NLBL 2YD5A 3BP5A 4F7EB 4L3ED 2X4SB 5D93B 3CFDA 5ID0A 3CDFA 4IMKA 4NO3B 5HGBB 1W0YT 4O58H 2WBJB 3TA3D 4UIKH 5JR1H 2X42A 4HLJA 2BRRL 3OXSB 1DCLA 4LP5A 1UB6B 4U1SA 3ZYOA 4WCYH 1CDUA 4TQEL 4N0RA 2YK1H 2X4QB 3CSYB 3WBDA 5C0AB 3QSKB 3E8UL 2OZ4A 2HT3D 3CFEB 4QGYA 1K5NB 4A2MA 3WNKA 1SEBA 1RJYA 3D39D 4U1GC 4E41E 3WDJA 5HYJA 4KWUA 4JAMB 4PJHA 3X11A 1FO0H 3UJJH 4OJFL 5I1LA 3HS0B 1JGUH 2V2WA 3O2DL 5DMIL 3TIDB 3VD9A 4HH8A 4NP4H 4HSQA 4O51A 5C08A 3OQ3B 3L3DB 1CFTB 3NH7L 4PR5A 3CLEH 4LLUA 3UBXG 2J4WL 3QDGE 3UTZB 5F7EH 4KZDL 3ROOB 3CVIH 3N9GH 4XPHH 3NCCB 4ZTPH 1G84A 4JY4A 5KTEL 3L5XL 5IFJA 1CE6B 1MHEA 2LE9A 5EULV 5KVDH 4I3SH 1A3LH 4EIGB 1IAMA 2ED9A 3QUKB 4RDQF 1MRDL 5E6IB 3QQNA 3CFCH 5IQ9A 5HI4D 2GJ6E 4PJ8D 1RZFH 1MLBB 3KYNB 3OWEA 3I6KA 2D4FA 3KNBA 3QIWA 5MEQA 3C5ZB 4YDIH 1P7QD 2DQDH 2AK4D 1MOEA 1RK1B 3DSNA 5I30H 1GGUA 2VXSH 1Y18A 1T7WA 4PJFB 1YEIH 1B6UA 5DRZB 5D1XB 4D0DB 2CRZA 4UBDD 5HPMB 1CFSA 1LHZA 2B4CC 2KQNA 3SJVA 5I16A 4CDGC 1QFPA 1UM6L 5E6ID 5I15L 3C2AH 1J0JA 3TVMA 3EO1A 5FA3B 3WN5C 1A6WH 3H3KA 1VACA 4RZCA 1MCDA 1QSED 2VKWA 1TZGL 4M93C 5DUBB 1H3PL 5DFTA 4XVUC 3U82B 4FFYH 2JIXA 4MGXA 4PJ9A 4E5XB 3BISA 3V52L 3GMRB 4BZ1H 1MFAH 1T2QL 1QO3A 2ZUQB 5IMMA 4L8DA 1G7LB 3I6GA 3P0VL 2IANA 4PRIB 2OXHA 1KJ2B 4LIQL 2M2DA 3VWJA 2DI8A 2HRLA 2DQFB 4ZS7H 3R1GH 2WBJD 2P47B 4GMSH 2DD8L 3KYOA 2AEPL 4QYOA 3RWHB 1E4XI 1NANI 4Q6IA 1MEXL 1AC0A 4Z9KB 1AC6A 4Q74A 4I1NB 4NC1C 4HDIA 4D2NA 1NGXA 4KROD 4F7EA 3FRPG 1TNNA 5T33L 3QUKA 3VFSA 3VWKB 2VDOH 3RVVC 4R4BA 3B3IB 4NYLA 3S37X 5KSVB 2Y9RT 4JQIH 3FN0L 4C4KT 1MCPH 1U8HB 1FO0B 3IXTA 4Z7VA 4I2XA 1CXHA 1IKNA 1SBBA 4Y4KD 3WFEH 1G6RA 4F9LC 4YXHH 1NANH 4KI5C 2ZCLH 4CN1A 1U8JA 5K9KA 3O0RL 4NZTL 1CXEA 3P77B 4MAYC 4YHMH 1QSFA 5FM5M 3BH8A 1SEBB 3HR5B 3MFFB 5SWQA 3GMLB 5EUOE 1CLZH 3CX5K 1FP5A 4UUJA 4NO3A 4QKXB 4M3JA 1K4CA 4JFXB 3EYFB 3P0YH 2DLHA 5ACLA 4L4VE 1KPRA 3RZWA 5I1KL 5FYLD 3VFMB 4LVEA 5I71C 1EEUA 2W9LA 2HFGL 1FJ1A 2X4QA 1YPZE 4WFGE 4PTUB 3D25A 4X4MA 3DI2B 1RZ7H 5IVXE 2EDRA 1KELH 4GUPB 4M4PA 2A77L 1GH7A 5CSBA 4UIMA 5AEAA 4WI5A 2A6KA 2LU7A 3VU2A 4PRHD 4TSBL 5HI3D 2F5AH 3QWQB 5F1IA 1R0AH 4HCRA 5H37H 2YR3A 2JJUA 4KRMB 4MQXD 4LLUB 1X9QA 1P9MC 3DJ9A 4M9OA 1XZ0B 4M4RA 4MD4A 1NGZA 3D69A 4HJ0D 3G6AB 5MI0B 4UIKL 5DD5H 1BP3B 3VFOB 4WW1B 3SDXF 3OKNA 3LEYL 2P46B 3BXNA 5CIPB 2IAND 1OL0A 3N9GL 4QRPD 5DRNB 2H45A 1A1MA 1EJ6A 1NSNH 2BZDA 3FQXA 2KZ1B 2AXGB 3QHFH 1TZGH 2BC4B 5J0BA 4EI5B 3L5WB 5F7KC 1J0YA 4D0DA 5E5UB 3OR6B 2FWOB 4ZPVA 4JRXB 1UCBH 5DI8B 2PF6A 5JMOC 3IVKB 2FB4L 4OCRL 4ZFGL 4M1DH 2DKUA 3QXAB 2W91A 3GIZH 3MBEA 3H9HB 4OZFH 4ODVL 5BCAA 4LKCA 4KRPB 4R26L 2PTTB 4WNQB 4L8BB 3QXWA 5I30L 1OCWL 4QOKD 4MNQB 5CKAA 1T7VA 3O8XC 4B7LA 5C0FA 1FZKA 3CH1B 4BA8A 5BVJB 4WHYG 5MP6H 5KS9E 4M5YH 5E70A 3KXFE 4FNLL 4IRSC 2OI9C 3GSNH 5IT2H 1BQUA 3VMPA 2FIKA 6FABL 4MDJB 5JHDA 2NY4D 1MELA 4KQ4H 5FYLH 4P5TD 4UILL 4PJEE 4CAGA 4NKMB 3H7BB 3S4SA 4YWGH 4XVTH 1G7MB 5EUKB 1OAXL 1S78C 4NOFA 2A73A 3MRCA 4KTYA 1T1ZA 3JV6A 4OF7A 1AD9A 3ZYZA 2VLKD 2J8OA 3KYOB 3V9FA 4FQLL 2VXUH 1PBYA 1WT5A 3HUJE 2ZOKB 5DVOA 1QFWH 4CU8A 3A6BL 4LGPB 2HA1A 4ELMF 4KFZC 2FIRT 3D2UD 1H3GA 5DT1H 3NA4A 2Q3AA 4H8WH 1VERA 1UQSB 2GI7A 1ITCA 2JJVA 5FYJU 2DQJL 1QFUL 3QUYB 4G8FA 3DO3A 2FDBP 1INEH 4JN2A 2WWKO 3ARTA 4CADA 3VDAA 5DF0A 5H94A 2P4AB 4I4WB 4OCRH 4YHIA 3WEXB 1YN7A 5C2BH 4Z0BH 5CJXA 4P46D 3V0VA 2VDLH 3IVKA 5JW5A 4OT1H 4HC1L 4H8WC 4P9HH 2A0LC 5GRJH 3W9DB 1W0WA 4ONFH 5I1EL 4AIZA 4X8JB 1JGLL 5L7XL 1FIEA 1AR1D 1ZVSA 5E9DB 3SQOL 3IRZA 1JWUB 1DDHB 5IVXF 2NY3C 4G80B 4ZXBB 2CDEB 4NNPH 1D5BB 2PXYA 2R0LL 3ILPB 3RWJA 2BX5A 1WZMA 3GBMH 4YZFF 2YD1A 5DVMA 1YEGH 3OKKB 4WV1C 2DIBA 4PLJC 2CO7B 4C56A 1S7XA 1NKRA 1EGJL 2JELH 1MIML 4HLZG 1CTOA 4XRCB 3V5HA 1IC4H 4EN3C 1JBJA 3O8XD 4JLRB 4ZPTA 4PJBE 3LKSB 4D3CH 4P9HC 4X7EC 5JPMB 4KRLB 4G6ML 3BWAA 4QRPA 2AJYH 1PG7H 3HI5L 4NDMA 4M1DL 3IJSB 4F7TB 2KKQA 4R0LA 1JGVH 5D7JB 1N6VA 1XMWA 3LQZB 4WO4D 1H3XA 4PJ5E 4F2MB 2A83B 2AJZA 3HC4H 1R3IL 2A2QT 2BC4A 3U1SL 3AS0A 1TPXB 4KK8D 1IAIL 3MRPA 3TVMD 4NM4L 1MCHA 3QDHA 3MRDB 5DR5L 5KSBE 1XH3B 1UQSA 1WBXB 2HFFB 3BXNB 4WUKL 1VACB 2IPKA 3QUMA 1IZKA 3GSRB 3IDIA 4O5LH 2XICA 5D1ZD 5DMYA 2AXJA 1KNOA 5K9JL 4OCMC 4X4ZA 2C1OA 5HDQL 1N5YL 2D03L 3UZEA 5DTFA 5LWYH 1BREA 5A2LH 4U6TA 3C5JB 1FL3B 4I77H 2XKNB 1QPXA 3QDGA 1P4LB 3V0WH 3VXSB 1UB5B 4NQCA 1HN1A 4ZXBA 2A77H 4XP5H 2J8UE 4CDHA 5L2KB 5FYKU 4ZOCA 2C3WA 2VLME 1FC2D 4K23H 2R0ZL 1NFDE 2ITCB 3VXNB 1RULL 4IMKC 4PB0H 4KXZI 4RMTA 4X6EB 4Y5VB 4DEPB 1C12A 4KKNA 2WAHA 4ORGB 5DJZB 4DAGL 1KPVA 4K8RD 4KTDL 5DK0B 2VAAB 1BQHA 5HVFB 1MQ8A 3VXUE 2OK0H 4KVNH