1MJ8H

High resolution crystal structure of the fab fragment of the esterolytic antibody ms6-126
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
216
Chain Sequence
VQLQQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGNIYPGSGYTNYNERFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCARKHYFYDGVVYWGQGTLVTVSAAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN MS6-126
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2002-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8H02
2D7MA 2H45A 1MI5E 2DM4A 1T1ZA 5T1LD 2OP4H 4I9WD 4Z0BH 4X7CC 3U30B 3VXQB 3G6AA 2AXFA 4U3XA 5KOMC 3W9EB 5CHNB 5DK0A 3TCLB 5J6GB 4M43H 1RV6X 2IPKB 2VN7A 4PG9B 5F7DB 2MCPL 4ZTOL 4HC1A 2ADIA 5F9AC 3GK8L 5FECA 5DWUL 2F9BT 3KR3L 5DO2D 1LO5A 3C6SA 3NFNB 2V6HA 4XHQA 4XPAH 2VC2H 5BZWB 1UWXK 4HWBA 1R5IA 4FQIH 2Z31A 5IBTH 3STLA 2XN9B 3IJHA 1CXEA 1FVDA 5CMAB 4Y19B 6CGTA 1KJMA 4ZXBC 3MTRA 3KYMA 2AGJH 5GGSB 5FUOL 5J6HA 5AZEH 4ZG1A 4QRPD 2BK8A 1N7ML 4LSSL 4JO4H 3LKNB 3ALWA 5DFTA 3DXAE 4XVJL 5HYSA 4J12A 4G6ML 3TF7C 4EJ1C 3QQ9D 5HDBE 5IJVB 4KUCF 2X4QB 3L5WA 2APBA 1OM3L 1WWBX 2GCYB 1NKOA 4OLYH 4M6OL 2O61B 4V2BA 1HWHB 1C12B 2VLKA 4XAKD 5I1HH 1JPST 5I1IH 5A2IH 3DRTA 1VFAB 1AO7D 1A1NA 1E6OL 3I2CH 1G9NH 3GJFB 1H0DB 4Q0XH 5DMYA 3H9ZA 4ZOCA 3O6FA 1U3HA 4MA3A 3PDOB 4QYOA 3TVMD 4X4ME 3JWNC 5EO9A 4N0UA 2APVA 3VRIA 3Q3GA 4XP5H 5DURD 3ARDD 2DJUA 4U6XA 1UA6L 5SWZD 5TDOA 3U6RA 1IFHL 2RQ8A 4G6JH 5CJ8A 5SWSD 4OD2A 1OTSC 4AENA 5HXMA 4P5MB 4XXCC 1SYVA 1UKTA 4KKCD 4OIBA 1DBML 1V7MH 1UXWA 3NGBC 2UVEA 2IWGA 1A4KB 2H26A 3FN3A 4KQ4H 4QCIA 1WJ3A 4ODVL 5D1QB 2WANA 4BH7A 1BJ8A 5HJ3B 4UQ3B 1A0QL 1Q0XH 3D0LB 4RX4A 5A16B 3QA3A 1A8JH 2LE9A 4XBEH 1M4KA 5T1DL 2W0FA 1KIRA 4JG1H 3ZMRA 5IVXA 3KPSE 1OF2A 3NZHL 1MHPH 4APQB 5INCB 3EYVA 2H2PC 3O2VH 4DOHE 2VLRD 2Y9RT 3MRFA 1HK6A 4WHDA 4LRNH 4JFPB 4LLWA 4NUJA 1MQ8A 4OGAC 5I1JH 2B5IC 1I1AA 1DBAH 4ZQKB 3D85D 1EMTH 3TCXA 3LS4L 5C0AA 4IDJL 1SMOA 3QPXL 1MCRA 1PSKL 4G8FB 5D7IE 4WFHD 4U3HA 3QUXB 3S37X 5DHYA 4FQLH 1CGYA 3LKQB 5GIRA 2FGWH 3KPRD 1ND0B 5K59F 5BV7C 1CL7H 1YMMB 5FA3A 5GSRB 5I1KH 4QRQB 5IFAH 2OXHA 5I8OH 3FQRB 3BD3A 4Q2ZA 2E6QA 2FR4B 2XZCL 2ATPA 4PJBB 1JPSH 5C7XL 4DKEH 4HKJA 2CIKA 4YHYB 1NC4B 4OJFL 2MPAL 3RQ3A 4OLEA 2B20A 2NXZD 1FHGA 1P7QA 3EOAA 3EFFA 5HDLA 3UPCA 2LABA 3K4ZA 1F2QA 4YC2B 2VDOL 4MD4B 3PHQA 4DW2L 2FJHB 3HCVA 3HRZA 4XPAL 1ZLWK 2VC2L 5IWLA 1OB1A 1D6VH 3A6CL 4EEEA 4NKDB 1HHGB 2PYED 3T0EA 3JZ7A 4R0LA 2ITCA 5JLZA 5JW5B 3MLXL 4GUPB 4FXGB 5HVWA 1HXMB 1LNUA 4Z95L 1XGTB 4PRHA 4KHTL 2AEWA 1U8OB 2BZDA 2G75B 5DD1L 4I0PC 4K8RC 4QOKE 5I1DB 1T04A 4PJ8C 1U91A 1I3GL 4JO4L 1Q94B 2KQNA 4U3CA 3SO5A 3CFKB 3WDJA 4CL7A 4ONGL 2GUOA 1CGXA 3BYTA 4P9HH 3RL2B 3PJSB 4X8XA 1NDGB 2XQBH 5HGHA 3CLFH 2P44B 5F89A 5HVFB 1CFSA 3MV7A 4DFHA 5KSBF 1MY7A 4UIMA 1X5JA 3BKYH 3TIDA 4PRID 2R2EA 4IDLA 4XCNB 1PY4A 2EZ0C 1UM5H 3JWOH 4Z7QF 3SKOB 5IKCB 1NGYB 2ATKA 1MNUH 1HXYB 3RGHA 2Y5EA 1BEYL 2ILLA 3ULVL 4PJHA 5CJQL 3UBXB 3MYJA 1G9ML 2VXVH 1I75A 1UEMA 2R1YA 1IGCH 3QDJD 4Q0XL 5DRNB 2I25N 2FB4H 3GEWB 3FO0H 4KAQL 4S1SH 3QUMB 3MOAL 2FIKA 2DQIL 5IBLC 5L7XL 4L4TA 2H3NA 3GRWH 1PDKA 2PN5A 3RWIA 2MKLC 5F6IC 4WW2C 4OLUH 3Q6GL 4IOFD 3U0PA 3HE7B 3ZYIA 1NAKL 4WO4D 3GMNA 3EJZD 1U8NA 1I4FA 4U1LB 1JN6A 4G7YH 3FB7A 1W8OA 4JKMA 4X5XB 4EUPG 1IAII 1V7ML 4UB0H 5DJ8B 1RMFH 2BVUA 1KXQE 3QULA 3LRHA 3H42L 4EXKA 3RWEB 4HUWB 5DRWB 4GBXB 4A2MA 5C0FA 4YWGH 3FTGA 3O11B 4N9GA 5IHUH 4GAJL 3U2SA 1CZ8H 1S9YB 4QRRD 3U36B 5C0GB 1EFXB 4PJGA 5E6ZA 1YN6B 2PR4H 1NLDL 3W2DL 4S10A 1DQLH 2YMXH 3SGEH 2EH7L 3RWCB 1IGTB 1JPTH 4FQ2H 5D5ME 1YZZA 3GSUB 3V4UH 4NN7C 4OB5L 1T6WA 1NGPH 5IT2H 3LHPH 1AGEA 3WIFB 3K1KC 2YA2A 5IB1A 4Z76A 1BECA 2NY2D 1AGBA 5FYJH 5I71B 3BZ4A 4HLZG 2JELL 3NA9H 3MRRB 2YPVH 3MRLA 4O5LH 1UXSA 3KLHD 5LGHH 3MGTA 1KLFA 1OAYH 2EDEA 4LKCB 1T5WB 2C3HA 3RA7H 4HUUB 1JPSL 4XPTH 1RSFA 3UZQA 3FRPG 3SGEI 3GMRB 4MAUL 1KULA 1LEKA 1FBIL 4HCRL 4OF6A 4GG6A 4GW5B 3MRNB 4IMLB 2Q87A 4I2XE 4K3DH 5MEQB 2BJMH 4Z7WE 4LPCA 5CP7B 3RNQB 4K9EC 4HWZA 3OHXA 1MREL 2EDYA 3ARFD 3RWDA 3OF6A 3OAYK 1ZT1B 1YUHA 2ED9A 3GSNL 3S37L 3VFPB 1FZMB 2JCCF 4E0RA 4MHHI 5ICYA 4PTUB 4N1HB 4RNRB 1JNHA 3RGVA 4Y16A 1GZPA 1GGIH 4NQEA 3P4NB 4JANB 4JLRB 2DI9A 4LCCB 2R56H 3SDDD 5L0QB 1SQ2N 1CE1H 4LVOB 1BJ1H 4P2QB 3I9GL 1HIMH 1B4RA 4YHZL 4NN6C 4UTBL 3MREA 2VKWA 3UTQB 3BSZH 5DQDH 3BQUD 4RGNB 1G6RB 3TBYB 3RX5A 4BUGA 3ARGD 3JWOL 5FUZL 1HNFA 4N8VG 3DX9A 4FFYH 5LGKA 4EDWL 4Z5RA 1VFUA 4PJ7A 5MEPB 1ZGLB 3V0VB 2VXVL 4PJAE 3L3JB 1BQHG 4BELD 3S3SA 3IFLL 3HZVB 5F7FA 1WF5A 3HG1D 1HSBB 1CF8L 3QDHA 1KENL 3OTTA 4HX1B 3FO1B 2VAAB 4EXPX 2FB4L 3DHMA 5CSGA 4PGBB 4LHUG 5JHDD 1IRAY 1KB5B 3MJ7A 1F11A 2ICWI 3GRWL 3PNWB 3WLBB 4XNXH 4D8PA 2Z0BA 5E99H 4NM4H 3S4SB 3T4AA 4H88L 1T66C 2BNRE 4OLUL 1QRNA 5HHXH 4XX1G 3D39D 1V3MA 4KRPC 3VMNA 2A6IA 1U3JA 4ODTH 4BUHA 5MERA 2OJZH 4EKXA 2CRZA 4G7YL 1SM3H 4YO0B 2XPGA 3B2UC 5KSAB 2YC1A 3U9PH 5FKAB 1K4CB 3DWTA 3STZA 5FYKU 1MRFL 5HVHB 4ZXBD 5BXFB 4L8DB 4F58H 4YWGL 4P2YA 4JY5H 3TV3H 2JTDA 4HIIA 1CZ8L 4MQTB 1OOAA 4YE4H 3GSNA 5KTEH 1A6ZA 1NCBL 3C60C 2EYRB 1S7WB 5H35A 5EFIA 1K8DB 4DTGL 4HK3J 3VXMB 4RFEA 4JM2A 3MMEB 1DQLL 3CVIH 4G9FB 1WFOA 2YMXL 4NQVA 3X17A 1JPTL 1SEBB 1CR9L 1S9VB 3NCCB 1F6AA 4WNQB 5C6WH 3JTTA 3WN5C 2BFVH 2D0GA 4WFFD 3AREC 3QCUH 1Q1JH 1JF1B 2EKSB 5ITBL 1JMXA 1ZV5A 5EC2A 3D0VB 4ZDHB 4ZNEE 1J1XH 1MQKH 1MI5D 1JRHH 5GGTL 4KTEL 1SY6L 3P30H 3H8NA 2FWOA 1NDMB 3NTCH 1KEMH 4V2CB 3CSYA 3NA9L 4MCZB 5EO1A 3B5TA 3FRUA 4PGEA 2DTML 2AEPL 1EXUB 5GGRA 5D1XC 4XNYL 4PBVC 1NGZB 1DL7H 3HTLX 2F5AH 5I17B 3BW9B 1QVOA 4WUKL 1DVFB 2FECL 3ARBB 1M7DB 5J11B 4UINL 3RUGF 4OCNC 4H20L 4C4KO 1YY9C 4M61A 1U8LB 3O6MH 5BW7A 1OTSD 3GRWA 5E95B 3VDAA 3ZDYF 1MFNA 5EBMB 1KJ2B 4PR5A 2DLIA 1JRHI 4PJXA 3FAWA 3BFOA 4LSVH 3DXAD 5F9JA 5ICZB 4ENEC 4NJ9L 4JHAL 3RTQB 2D2OA 2HKHH 4JFDB 1U6AH 4HJJH 1BVLA 4XH2A 3SO3C 2VUYA 4MNGE 2WBKA 4PG2A 3ZT5A 5HY9B 3TBTA 1KIQA 5FHBH 2AK1H 5C0IA 1F97A 4OGAD 4TSAH 2I07A 5IUSA 1G6VK 1U95B 3MC0A 4PB0L 5K9JH 1ONQB 3HR5B 3K4AA 4CJ0A 3ZTJH 1K6QH 3GGWB 3BDYL 3B2VH 4UT7H 3JTSB 1LK2B 4QKXB 1AXIB 3VD9A 2Q7NA 1BQSA 3HNVL 3SE9H 1MF2L 3D5OF 4NO3A 1J8HA 1YNLH 3C8HA 3B8SA 4YUEL 4HT1H 2E6JA 2N4IA 4TVSa 3SGJC 3BEWB 5F88A 3HMXH 3BIBX 3BWAA 3CC5A 4UTAH 4KFZC 4JFYA 4LMQI 3UYRL 1KCSL 2YRPA 4HGWB 2NY5C 5GGTA 1WAAE 1SY6A 4ZAKA 5KSBE 3V5HB 4HV8B 4OZIA 1P69B 5I8EB 4M5YH 3MGAA 5GRJL 1CDIA 5MENB 2GJ6E 5IB5A 2AJYL 4FQHB 1AKJD 3TT1H 4QHUA 1HHHB 5F7UA 3TJHC 1SM3L 1QA9A 2EIZA 3WSQL 3UTZB 3RWGA 3NIGF 1K85A 1W0VA 3KPSD 3L7FA 3MACH 1DFBH 3IJSB 3V4PH 1JZ6A 4RMRA 4JJ5B 1NANH 4F15C 4G8GA 4UOW0 4PV8B 1S9XA 1ZLVH 5DF0A 5TQ0L 2XKNB 4DUWA 3MLYH 1OP3H 2H9GA 3LPFA 1I9IL 3LKPB 1WEJH 4I0PD 4K7PX 2ZOKB 2YD6A 4PJ8D 3D69B 3EBAA 5KTEL 5HDQH 3AB0C 3MRBA 4N0RA 1N6QH 3AXLB 2DWDB 1QQDA 5EZLB 4JY6A 3RY4A 4WFGE 3MX0A 4WU7B 5M7QA 2NR6C 1HDMA 2BX5A 4F9PC 2Z92B 1JGLH 2EZ0D 2GY7B 1XF5A 4LCIH 1C8PA 4FQXA 2BY1A 3GJEB 3M1BA 3NFSH 3RZWA 1IAOB 4OFYD 1A6PA 1CCZA 3PWNB 3NTCL 5D7JA 3BIKA 1T4KB 4JN2B 4EOWL 1E4XH 2RFXA 1CWVA 1DL7L 1GL4B 5D2LA 3VGBA 4K7PH 5IBLD 4LDLB 3DX8A 4LGRB 2VXQH 4P4KB 5LKNA 3PHOB 4WI7A 5FHAH 4G6FD 4L29A 1OAZH 3UYOD 3BPLC 3WIIH 3L3DB 3ZLQC 4XPHL 4HG4J 2NMSA 2P42B 1FFPA 3CFEB 4PBWD 2PO6A 3PQYA 3AUVA 3SCMC 4AH2A 4P5TA 4D9LH 1TQCB 2D0FA 4QOKD 5DDHB 4KDWA 2GTZA 1OAQH 5F3HB 4MXWL 3PWPA 4F7EB 4Z77B 4YHMH 1MRDH 4LEXH 5FF6B 5LCVL 2DQCH 1MCSA 4J3TA 1J0JA 3GB7A 3QQ3B 2VAJA 1NJ9A 4LSQL 3CJJA 2W59A 1ODAA 1RULL 2VDRL 2ZUSA 3IGAB 5HDOA 1BQLH 2HH0L 5ALCH 3IETB 4Y2DA 3SDCB 4OD3H 3LOWA 3WFEL 1E4WL 1MFEH 1CXLA 5K9JL 2BOCA 4G43B 4TN9A 1F13A 1Y6NR 3CCHB 4L9DA 5I0ZA 3W0WB 4PUBH 3EO0A 1CGUA 5D6CA 2PTTB 1N8ZA 2HFFB 1EZVY 2Q3AA 5E03A 2XKUA 1A14L 2EDXA 1XF1A 3GSXA 2CLVA 3MCLH 4WTWA 3ULUL 4YDKH 2X1QA 4JZJA 1MIMH 2CKBB 2PTVA 1PZ5B 4U2YA 4UTAL 5JDJA 4U1IB 2QSTA 4U4BA 2QQNL 5F1OB 4ISVA 4O9HL 4FQQA 1EV2E 1GZQB 4IRJA 3H0TB 1NCWL 3DJ9A 3MXVH 2YEZA 4XCEA 3VA2C 2NXYB 1FIGH 4OZGA 5ECJE 1IC5H 3DMMA 5DJDA 2IH1A 2C1OA 4NIKB 5I1GL 4JFEE 2R4RL 4YHLL 1UM6H 2AXHA 4AL8H 4HFUL 1QFWM 5EUOA 1RURL 3V4PL 4DN4H 4PJ5A 3S88L 1A6AA 1TZHB 3HZKB 1NEZA 4Z7VA 1I85A 1VFBB 1SJEB 4K3EH 4WW1A 1YMME 4UNVA 2A74A 5FKPA 1FFOA 3LIZH 4XXDB 1F45A 4FABH 1G0DA 3QT2A 1WEJL 4IMKC 1FZOB 5J8OA 2B4CC 2ORBH 5FO9B 4PJBE 4LLDA 1MCNA 1H3PL 1MHEA 1BOGA 1ZHNA 1NBYA 1HILA 3CFIC 5BRZE 4NUGH 1CFTA 3GO1H 4JFXB 2PW2B 1OWWA 1P7KB 2LVCA 2P7TB 4CMMA 3OB8A 1RZJL 4N0FA 5ISZE 4Y5YA 5D1QC 2F19L 2B0SH 3N1MC 2WLZA 4ELMB 1T1YB 2GSGB 3MNZB 1SYSA 1VCAA 4DN3L 5F97E 2XWTA 4JKWA 5K9OA 2HMIC 2AI0H 3L5IA 2VR5A 2DAVA 1H3GA 2D7TH 4ZFOB 1IE5A 4RAUA 1MJ8L 4KJQC 3MRIA 3A6BH 1MELA 2HVKA 3ZTNH 3EFDH 4NO2B 3MV9B 4HG4K 2CDGA 4K7PL 5DEFB 1TLKA 4F33B 5SV4A 3FO2B 3VRLF 2XQYK 1NCNA 1M6OA 3NCJL 3VD7A 5L9DL 3MRGB 1T66D 1XF3A 3CK0L 1T03L 5I1LB 3GMQB 1U8KB 5ILTL 2CR6A 2XA8H 1LO2L 1EAJA 4KRPD 2XTJB 1S7RB 3VDBA 1CFQA 2IANA 3U7YH 4UUJA 1FDLL 3X14B 1OCWL 5DEGA 1RIVL 4MDIA 2YRLA 5IQ9B 1WBXA 4PJDA 3B2UD 4LCWE 4LVHB 1YPZF 5CZXC 3HI1B 3TN0A 2Y7QA 2AEIT 4XPGL 4WWKC 4NWTH 5M95B 3RY5A 1B0RB 4Q74A 2PXYC 4YHYC 2HJFB 5F3BA 1G0XA 1FNGB 3PP3H 4LEXL 2AEQH 1DE4A 4PY8J 1MVUB 5CSBA 1G7QB 2FBJL 4M3KB 4XRCA 3HHRB 3MROB 2I9LA 2Q7YB 1BFVL 2ICEA 2CGRH 3RUGE 3C08H 3T77A 1MWAH 3N50A 1J18A 4NKOB 2XQYG 5BS0E 3VWKB 1S7SA 3NCMA 1B6UA 3UJIL 3BVNA 5EU4B 3ZDYE 5TDPB 1YECH 1RVFH 3ARED 3GFUA 4ZUVA 1J0YA 3WJJC 3IAQA 2HLAB 3G5XA 3ZT7A 3MLPA 3B9DA 1CGSH 4NKMB 1LWRA 4JDZA 2PYFA 1KT2B 4R4FH 4LARL 4X7TA 1FFNA 1GAFH 4KUCD 1TMCB 3JVGA 4QRPA 2BNRD 1UENA 2HG5B 3WE6B 5D1XD 1D5BA 4R96B 4NQDB 3MLRL 3S4SG 1OAUL 2J8UA 2X1OA 3VD3A 4OGXH 25C8H 2NTSP 4M02A 1I1YB 4DQOH 2WIMA 2YD3A 1FIGL 2OL3L 3SE8L 5DVLA 3F7VB 1QACA 1M71A 1YY9D 4YHPB 1DEDA 4HZLA 2RIKA 3C5ZB 5EIIA 4BZ2L 1H8NA 4YPGA 1JUFA 3BPCA 1AO7A 5A2JH 3LQZB 2JF1A 2VSDA 5GGSY 3IFOB 2ED8A 4W4NA 1XGQB 3IU3B 4ENED 4YDIL 4XT1C 3TVMA 4JFZH 4LLVB 4O58H 5JO5A 4FABL 3T1FA 3BOVA 5EUKB 3RP1A 1L9NA 5C0CA 3F8UB 3TESA 2EDJA 1ED3B 4LP5A 4ZFGL 1EJOH 2ORBL 3ARDA 4XC1H 3GMLA 5SWZA 1A2YB 2FNBA 4GW1A 1J1PH 3T0AA 4HULB 5SWSA 3IF1A 2R4SH 3ZE2F 2VJXA 1CICC 2EEAA 2DQJH 2YSSB 5DQJB 2B0SL 2Z9TA 5JIIA 3JV4B 3TZVB 1P53A 3QNXB 4G8IB 1NUNB 4NQXA 2AI0L 5FYJU 3HMWH 1HYSC 1QPPA 4QXUL 1S5HB 2N1KA 2H6PB 3D25B 4ODUA 3TBWA 5CEXA 3EYUH 3OR7B 2D7TL 1ZHKB 5AZ2H 1Q8MA 4XP1H 4GT7A 2VLRA 1XF4B 1Y18B 4HDIA 3LRGA 4J8RB 2KL6A 3HUJA 2GK0A 2P8LB 4Y4FB 5DT1H 1F5WA 4PREB 2R2HB 4PGCB 1FNAA 1H5BA 3OKKA 5HHVH 1UVQA 3ZKXB 4P2QE 1F4WL 1HZHL 1OD9A 3D85A 1GOHA 2CJUL 1LVEA 5MEOA 1NC2D 3GM8A 5BOPA 3UTTA 4RGNE 1WISA 1LEGA 2FHBA 2OJEB 2UVFA 4Y4KB 3TJHD 3KPRA 4ZD3H 4WI5A 2QR0A 3CFDA 4LIQL 4QNPF 1KIUA 3H6JA 2OL3A 3PL6B 5GS1B 4NBYB 1AXSB 1CN4A 3MRPA 2BC4B 1FO0L 4JHZA 3ZE0F 4HUXA 4NC0B 1G7IB 5HPMA 1RY7B 2ZNXA 3HS0A 1OHQA 1INDL 2WBJB 5EBWA 3ZKMC 4S11A 5DYOB 3WNOA 1Z9OA 5HGAA 2ZJSH 5EU5B 1WZKA 5ETUB 4GS7C 3UJJL 5SX4H 3OJDB 2NR6D 2BY0A 5KS9A 2X70B 4M9PA 1QR4A 3Q6FB 2PYEA 5E2JA 5BO1L 3NCYP 3LEVH 1CGSL 5IMLB 1J1OL 2X89D 3UPAA 5EN2B 3PDDA 1G0YR 4IS6B 3DTXB 1FYHB 3LN5B 5JDSB 2CRIA 1KYOJ 4TQEH 4JQIH 5F9OL 3F7QA 1BREA 2RR3A 4H1LH 4YFLI 5DRZB 2Y07H 3CFCL 2NW3A 4X6FB 3BXNA 4TNVF 5E6IC 1A6WL 2GJ6D 1AC6A 1UFUA 5FCUL 5KVGH 4OGXL 4P48A 3D87B 4NWUL 3LSOA 4FNLH 3VXME 4PRIA 2XIDA 1NCDL 4DQOL 5TF1H 1JYVA 1H3UA 2Q76A 3ZE1E 4RWYH 1GOGA 4L9LC 5F6HJ 3JXAA 3HFMH 4PRPD 2WUBL 3AMKA 4XMKH 3SCMD 5SWQA 3SE4A 2V2XB 3F12B 3QDJA 3KPLB 4NZTL 1L6ZA 35C8H 3TBVB 3HC4H 3EOTH 1CT8B 3VXRB 3BJLA 4O58L 4WFGD 2P24A 5ALBH 1FNSL 4MA8H 3WFBH 3V4VL 3VE0B 5DMIH 3PV6A 3O3DB 3MRKB 1QHPA 1D6EB 4GW4B 3C5JA 2XZQH 1MCJA 4GKZB 5CIPB 4WO4A 1FO0A 4ODSH 4QT5B 4WDIA 2R4SL 2IAMB 5HYJB 3VFGL 2CUMA 2W65A 2E9BA 3MUJA 3LV3B 2WIIB 5HVHC 3K8LA 2R1XA 1LO0H 1NH6A 5TDNB 4ALAH 5F7KC 2ERJC 1RJYA 2BRRH 3TYFA 2OR9H 5ANME 3WHXB 3WHE0 1MAKA 1AHWA 2A1WH 5AZ2L 4QRRA 1JVKA 1QLEH 3MBXH 4KK5C 4OCYL 2ESVA 1UB6A 4XP1L 4NHUB 3ESVF 4PJHF 4R2GB 4JFDE 4XZUA 3HZYA 3P73B 4B41A 3E6FA 3AM8A 4TUJB 3H9HA 4LSUL 1QSEE 4ZPTA 2VQUA 5BV7H 5HHOB 1J10A 4OLXH 4CUCA 3EZJB 3RVWC 3QFJE 1NFDA 1U8QB 5ID1A 5F1IA 1KJ3L 3HAEH 3T8XB 3SDXA 5FV1L 4UILL 1L7IH 3J8F7 4UU9A 5KZCD 1MCPH 5DJ2B 4YK4B 4LRIA 2MQ0A 2YPLA 1XGYH 4D3CH 2ZSVB 2V5SA 1DVFC 1CK0H 3LDBB 5L88H 2F54B 1RZFL 1JHTB 1FP5A 4Y5XC 2CPCA 3BE1H 3I6KB 3FHAA 1WQVT 2AJXL 1GGUA 4LPYA 1A47A 4ZUSA 1B88A 3ROOA 3LKSB 4NRZB 1IKNA 1BBJA 2R2BA 4N1EA 2EXWC 5J1AA 4Y88A 4Z9KB 1C5CL 1RJLA 1W0WA 2Z91B 5MENE 3QRFM 4PJGF 1RZ7L 4UIKL 1GYAA 4MCYB 5D1QD 1YPZE 3ARFA 4Y7MA 3VXOA 1NMBH 1EEZA 4B7LA 3RTQC 2A6JB 4MAYA 4C4KT 3X13A 3NCEB 4JDVB 4IOIB 4HWNA 2HMID 4G42A 1JV5A 1A21A 3ULSB 3L3KB 4HXAH 1CVRA 3ARSA 4KJQD 1DANT 2P46B 3SDDA 4F2MB 3KPOB 4MX7A 1VADB 2AABH 1FNEA 2VNCA 3L5JA 4U7KA 3IXTB 4Y5VC 2Y5TB 5C0EA 3FQUA 3WV0A 4C56B 4OI8A 1RJZA 3WKMH 4BFIB 5I2IA 3V5DB 3FONA 2R0ZL 2ZUXA 1QO3A 1N3NA 5C09B 4S0SD 4JFED 2XA3A 3BQUA 2EDOA 4GRLC 5TF1L 2ADFH 1N4XL 2J4WL 2O5ZL 4JN1H 5E2TH 3W11C 1WBYB 1YMMD 2Z93A 5HYEA 1IGYB 4TNVK 3VXTB 5EPMA 4KVCL 3MYZA 3QCVL 1MAJA 4WCYL 1FGNH 1MCIA 5CZXD 3HG1A 3L3GB 3WJLA 4GG6F 4WWKD 3MO1A 4P5KB 2AXJA 2PXYD 5JHDA 5E9DB 2VXTL 2HLFC 4MA8L 5BRZD 4O2FA 1MCCA 4L1HA 4LKXB 1UWXH 5EZJB 1I1FB 2Q8BH 4CADA 2DYPB 5ISZD 1G7MA 5IW3A 4QLRA 3GSVB 3B3IA 3O3EA 3GI9H 3P77A 3P4MB 5T5NG 3IS1X 5CAYB 4PIRF 3S34L 1PKQE 2HJLA 4WEMB 4X9FA 3QXTA 1GCFA 3MJ6A 4FZEL 4X80L 1IKFH 1ZWIA 4CVZB 3P9LB 4FN0A 1LO0L 2OQJA 5DS8A 3RL1B 4ALAL 3MLTA 5KJRH 3BZEB 2WINB 1T20A 2LTQB 1P2CB 1R3IH 4BQBA 5IMMA 3V0WH 4LCYB 4X5WA 1U3YA 4BQ9A 3MJ8A 4XMPH 5ERWA 4DVRH 3MJ9H 3LMJL 4TSBL 5IEHB 5E1AB 1OGTA 1DQQB 1OGAB 1Q0YH 4JRXA 4LQFL 4PY7B 3RX8A 1BX2A 4MQXC 2IADA 3ZE2E 1CBVH 5BV7L 4H1LA 4X7EC 2C3GA 4PRBA 4LCWD 1F3JB 1QFWH 1TJIL 4OCMC 4XVTH 4BH8B 3V5KA 1LDPL 4ODBD 4ZUTB 5FYKE 4CVXB 1L7IL 1MI5A 1UZ6F 2ENYA 5EB9A 4OV5A 3W0WE 1MCPL 1GHFH 3NCFB 2NZ9C 3UTSB 3BH8B 1NL0H 4U0QB 3M8OL 2DIJA 2EH8L 3CIQA 1PLGL 1X5YA 3D18B 2FX8L 1JF6A 1T83C 5T33H 2IG2H 3VH8B 3OV6A 3SJVA 1AD9A 4X9GA 4OZHF 3DSFH 5BS0D 2YWYA 3BE1L 3H9SB 4K9EH 4KXZI 2QQLH 2E8YA 3VXSE 3JWDC 3RNKA 5IVNA 3C87A 4LASL 4N90E 4PV9A 3SBWC 2KZ1B 1T3FA 5HHQA 1D5IL 3S6CA 3J7HA 4DCQA 2NY0C 1KCRL 1TQCC 4FFVC 2JB6B 2CIIA 2APTA 3GNML 2C4FT 1CICD 3V6ZA 1TVDA 1WLHA 1U8HB 3DARA 4FTVB 5JQ6L 4K8RL 4QNPE 4PP2A 1MFAH 1YEGL 3LZFL 1NMBL 1YEEH 6FABH 3SKUD 3WD5L 4Z0XA 3DXAA 3BDXA 5ESQB 3PV7A 2BVPA 4ONHB 5IB3B 1HYSD 4HJGA 3NMEA 1C5DA 2J88H 4FXKB 1EFXD 4RAHA 5CD5C 3DGGB 2H32H 1VKXA 5F7EH 5T1KD 1CFBA 2X4RA 2VITB 4ZOBA 1ZGLP 5I30L 2LU3A 4JHWL 4H8WH 3WKML 4PB9H 4ZS7H 1A22B 3VXPA 1EAPB 1NQBA 4LSTH 2XWBA 3UTPE 2ADFL 4K55A 1RZGA 5DK3A 2DQUH 3SDYH 5C71A 1WCBA 2OR7A 3KYNA 1XCTA 5D6DC 4EN3C 1G9EA 1MFDH 1W72B 5DHVA 3HRPA 2UWEB 4ELME 1BZQK 3CH1A 1B4JH 3BPOC 5BMFH 1NCAH 3P9WB 3VGAB 3HAEA 3QG6B 3DROB 4TUOB 4XAWL 4PJ9C 4TPRH 3AROA 1U8JA 3NAAL 4E41E 1CDBA 4JFOB 1ZLWH 1MLCA 4M8QB 3TYGH 4J1UA 5FCSH 3KDMA 3AU1A 3ZKMD 4U1HB 2BNQB 3KXFB 2CLRB 1F58H 1P4LA 4P3DB 1T2XA 1AKJA 4RIRB 2NZIA 5C07B 3WUWA 4JR9H 3SGDH 2XTJE 5DMKB 4OQTL 5JXEA 2F5BL 3G5ZA 4WY7L 1HI6B 1GGCL 1KN4H 1FVEB 3V52H 3FFCA 5BVPH 4ZFFA 5DJAA 4I0PA 4PJ8A 4XMPL 3BUTA 4EUPH 4QXGL 4LBEB 4QGTA 1XGUA 1P4IH 1L9MA 2P8PA 5E6ID 5DJYB 1NGXB 4G5ZH 5BQ7A 4ZTPL 1FAKT 4HXBL 4NQCB 3G5VA 2P1YA 3ES6A 2QJDA 2GTWB 4TVPE 4O51A 1I3RA 5FK9A 3O3BB 1RFDH 1CDJA 5HPOA 2J6EL 4QEGA 4OZIF 5EOQH 4OFYA 5FDWA 5CZVH 2BCKA 4J23A 3N9GL 4YH6A 2DQEL 2VXUH 3ILPB 3OR6A 4NKQB 3JV5A 1MCQA 1R0AH 1CG9A 5T33L 1BGXL 2JJUA 5J57B 4JZOB 2GITA 4R7DB 2C3VB 3FB5A 1R5VA 2OM5A 4NM8H 3CXHK 3PWJA 4K9EL 5CINL 3Q5OA 3L7EA 5I19L 4NQDE 5B39B 2JJSA 4WW2A 3MRHA 2VO5A 4HLZH 1ZGLM 4DZBB 5JPNA 5CLTA 1CFNA 4JRYE 3VXUE 4LVHC 4TYUA 1ZVSA 4PRAA 4HIJA 3CFBB 4P49A 1A7NL 1UWGH 4F7CA 2P5EB 3BP4A 1J11A 2BMKA 3QXWA 1YEEL 2AJUL 3QEQB 2NY6B 1GIGH 5DR5H 4NCC2 1JWMA 3O4LD 2QQKL 4JKKA 5ITFB 3FQNA 3DX6A 4G80A 4K94C 4X8JB 5E6YA 1C16A 4OQTA 4KK5D 5F7EL 3VXMD 4YXHH 3VD4A 4LK4A 2DI7A 1JHLH 3VWKC 4G6AC 5TH2B 2QHRH 3X12A 4EQ3A 2IQ9H 1EHLH 4ZS7L 3RU8L 3DO7B 2LAGB 1ZS8A 4OCWH 4PS4L 4ESKA 4KV5F 2R0LL 5E2VH 3WBDA 4Z18A 2CK0L 4ONFL 5A40E 1PX4A 2GAZB 1YEKH 2DQUL 3VG0H 3O3UN 3QIWB 2VXSH 4PTTA 3ALPA 5I16B 2V2WB 1S78C 3MRQB 4JEGB 4W70A 5JPMB 2NNAA 3NH7L 1N2RA 3KYKL 2NY5H 2EDWA 1A7RH 3UCRA 5FA4A 1BJ1J 1BWWA 3P4OA 4UNUA 2XG4A 3DVIA 4NZJA 3HC3H 1DVFD 4K23L 5D71H 4RAVA 1OAKL 4TPRL 1QLRA 2J6EA 2FIRT 1RUKL 4M1GL 4HHAB 3R0NA 3CNKA 2XICA 3KLSA 3TO4B 5CJXC 2A6KA 1YJDL 4KUZL 4XB8A 3X3FH 1QFUL 4YR6A 4QHMB 3C5ZC 4P3CL 4GFTB 3REWB 2EXWD 5F1NA 1HQ4B 3SKMA 3ELAT 5ICXA 1N26A 1S7QA 2X4NB 3RTQD 1F4XH 1CU4H 4FQJL 4JFDD 1WT5C 1PQZB 4OUUA 3QZWB 1FZJB 4U0RB 5FO8A 1A1OB 5CBAA 1CD1B 1X4YA 1QSED 4X0KA 4AY0A 4GLRI 2EE6A 3PDGA 5AAWA 3OAZH 1P4IL 3QFJD 3AY4A 3O9WC 5CD3A 3VFRA 2O5XH 1CE6A 4K3GA 4ZYKA 2H32A 1U92A 5CP3A 4NNPL 4OCLC 2X9WA 1Q9LA 1T1XB 1UQSB 4GRLD 5GZOC 3T2QA 2EDBA 3DVNA 2FX9L 3W11D 2ADGB 1HSAA 4UDTB 3WIHL 1RFDL 5KVFL 2ICCA 5EOQL 2D03H 3TBSA 5C0BA 4U1JA 4RFOH 4G8EA 3HZMB 3MV8E 4Y4FC 2C1PA 3GSWA 1NAMB 2E8ZA 5IESH 5IW6B 1XR8A 3ZKXC 3Q5TA 3EYSH 5IHZA 1G9NC 5EWIL 4GXUM 2HLFD 5EUOF 2I9TB 4NM8L 4Z7WA 4AEIH 3OGCA 5MEND 2EYSB 1YEHH 2ZUTA 3CDCA 2PKDA 3VFSA 4DK3A 1T1ZB 4LSPH 2O93L 2AJSH 2AXFB 2CO7B 5DK0B 1WFUA 4MNQA 4M48H 1RK0A 2GY5A 3PUCA 2ADIB 5E00A 5FECB 1JGVL 3HI6H 4WI2A 12E8H 3N0PB 3G6JF 1LO5B 2DLTA 3C6SB 3OG4B 5D1ZC 5KG9A 2WBJC 2Q6WA 3L3OA 3LAFA 4OZHE 4Q9RH 2Z31B 3JSSA 3STLB 2L0DA 1FVDB 5I6XB 5IIEA 1KJMB 3C60A 4U6VH 3V95A 1TTFA 3KYMB 1JHLL 5C9JA 3INUH 1YDPA 5C6PB 2FEEL 2C7UA 3VI4E 4LLMA 5J6HB 2VDLH 1RIUH 4MQXD 3QEHA 4F37F 4BZ1L 2UUDK 4CJ1A 1ADQL 4PJAA 3FT4A 4R97C 4KMTH 3WN5A 4EUPA 3AREA 4OLVL 1ACYH 1F4YH 3T04D 1YNKL 1YYMH 5DSCA 1A4JA 3C9NA 1CLZL 3QDGE 4NZRH 3L5WB 1A6VL 4FQ1H 1RJCA 1RHHA 2NY5L 4OM1H 5E08L 1A7RL 3MLVL 4HGMA 4MJ5B 4HH9B 5E70A 2NZ9D 4OFIA 3QUKA 4ZSOE 5DZOA 2GIYA 1N5AA 1D5XA 4NOFA 2OX5A 4XP4H 3DRTB 3L5XL 5D71L 3WIHA 1A1NB 4PJDF 3GJFH 4YHNA 4JE4B 5KVDH 1YQVH 3FB8A 5F96L 3C2AH 3O6FB 1CIUA 1U3HB 2YN5A 2FLRT 1CI5A 4J3XA 1QEWA 5EORL 1L4IA 4GKSA 1FFRA 1S8DB 4MA3B 4QYOB 5EO9B 2HFGH 2YD8A 3RIFF 4KH2A 3VRIB 2NY0D 1B2WH 4FFVD 3Q3GB 5HGGS 4JPVH 3ZO0A 4U6XB 3E8UL 4R9HA 5EC1A 1A3QA 1S7XB 5TDOB 4M4PA 2EDQA 2B4CH 1CU4L 4OD2B 1EGJH 4AENB 3QQ4A 4X6EB 3QFDA 2E9WA 4XPFH 1SYVB 2DWEA 2WZPD 3LN9A 5CD5D 1UXWB 4QCIB 2H26B 3DVGA 1XZ0A 4BH7B 1MHHA 3QA3B 2F54E 4OI9A 2W0FB 3MCKA 2L7UA 1FPTH 5IVXB 1CD0A 5FYKD 1OF2B 4ZNEA 1IQDA 3ET9F 4FOMA 1J05A 3W0WD 3MRFB 3W9DA 4CRPA 5DVMA 4R7NA 5D70L 4NUJB 4LLWB 3H9YA 2BSTA 4L3ED 4K7FA 3RPIA 1OTUC 1I1AB 2OTWA 5F72S 4LF3A 3H3BC 4EN3D 5KBNC 1ADQA 2K7QA 5C0AB 3DPBA 1V3JA 2H1PL 3K74B 3VH8G 1UYWH 3SGJA 5FOJA 3VWJC 2DMBA 4XP9H 3VXSD 3CPLA 5DHYB 4N90D 5GIRB 5LGJA 5I66A 5F93C 1VEMA 5FA3B 5DD6A 4PJ9D 3O81A 1MCEA 5AYQA 5IW1A 1PEZA 1IM9B 3MODH 4AEIL 4P23A 1AXTH 4PLJC 2AS5M 4Q2ZB 4C56E 4QTHB 1JZ8A 4M6MH 5INDB 2ATPB 2AXGA 4GSDH 1NC2A 4F8TA 4HPYH 1EBPA 4KI5F 4YK4C 5FYJE 1Z0NA 1TETH 4JCMA 4M48L 1P5VA 3EOAB 3RHWF 3EFFB 3K2UL 4Q9QH 4IRZH 1MJJB 1TVHB 3HI6L 3MLUL 1CDUA 1ZEAH 5IEKA 2ZCHH 3FOMA 3PHQB 3HCVB 3HRZB 1NSNL 1UWEH 4U6HB 1OB1B 2VRAA 4Q9RL 1JNNL 1HKFA 5IMOB 1FZKA 3T0EB 4URTB 4YBHA 4R0LB 1P84J 2ITCB 5T1MA 5JLZB 4H5SB 5HHMB 4HIXH 3UTPD 4WI8A 1LNUB 3FOLA 3INUL 4PRHB 3BKJL 3NABL 4OM0L 2VDLL 1RIUL 3X3GH 1T04B 1U91B 2JK5A 1KOAA 4F9PA 3MUGA 4DKFH 1YEJL 2GUOB 1JYNA 3WFCH 2L4OA 3G08A 1F4YL 1PKOA 2XXCB 4H26A 5E8OA 1CFSB 2X89A 3MV7B 2JJWA 4UIMB 1ULVA 2D7PA 3TIDB 4E41D 4I0CC 2R2EB 2NW2B 4DFIA 2R1WA 3KPMA 2ATKB 3QJHA 5KSBA 1QNZL 3OKLA 4XGZA 4N9OB 5AUMA 1PG7X 4NYLA 4QHKI 3MYJB 2Z4QA 1YYLH 2R1YB 3O8XC 5KW9H 1S7TA 3IDMA 4LVNC 1YQVL 1NKRA 2XTJD 1NGQH 5TPWH 5I76A 1MPAH 3QUMH 3ABZA 2FIKB 1JPGB 5I1EH 1IEBA 4L4TB 1MCOH 2HFGL 2H3NB 4PRPA 3RWIB 1B2WL 1ZT7A 5IK3A 2ZKHH 2V9RA 3RWJA 4HAGA 3U0PB 2ZUUA 1AY1L 3GMNB 4M7KL 1U8NB 4M5ZH 4X4ZA 1I4FB 3UTOA 1JN6B 3FB7B 3L3HB 3ZHKA 4JM4H 2WW8A 4P3WA 4XPFL 3UTSE 3RIFK 3TCLA 5B21A 3UBXI 3QULB 4JG0H 3IU4H 1PG7H 4TVPD 1T89C 5DVOA 3FTGB 1R3LA 3VWKD 3NFNA 4G6AD 3U0TA 3H7BA 3U2SB 3MFFA 2W9DH 3DIFA 3I3BA 4TSCH 2VDMH 1MCFA 3HA0A 1DJSA 1DANU 2R0KH 5CJOH 3UO1H 1KJVA 3L3IA 4MB5A 4OGYL 1BVKA 2JLLA 3I02B 3PG2A 2YKLH 1H15A 3TIEA 2YD4A 4EI5B 4TNWF 4FTVE 1WSST 1N59A 1S78D 2KBGA 2DMKA 1AGEB 1T5XA 1Q72H 2CQVA 4OCSL 4P46C 2VDQH 5GGVY 4Z76B 5IB1B 2IPTH 2MSPA 3RI5F 4JRYD 1AGBB 3MUZ1 4QXTA 3VXUD 5B39G 1QSVA 3BZ4B 3O4OB 5D93B 3MRLB 4L8CA 3RKDC 4JPIA 1UXSB 3MGTB 4L3CA 1C12A 4UT6L 3CUPA 4GSDL 3C5ZD 4XWGH 4HPYL 3NPSB 2YN3A 1D9KC 4PJIF 1Z5LA 4N68A 1FN4B 1OP9A 3LB6C 3RJDA 2X4UA 2AQ2A 5IR1B 1LEKB 4R4NC 5JQHC 3F6LA 2YUZA 1IGMH 4LLUA 2UWEE 2ZOLA 4QGYA 5GHWL 1IC1A 4LFHG 4HWZB 3OHXB 2DLHA 3RWDB 5KAQG 1YUHB 4NNXA 4E0RB 4IMKA 2DLFL 4HKZA 4XNUL 3IDUA 4WEBH 5ICYB 3UPRA 1MH5A 3KHQA 1ZANH 1H8SA 1L7TH 5T3ZE 1JNHB 2JCCA 3RGVB 4Y16B 2OTUA 2R0WH 1GZPB 3NVQA 3W5NA 1AI1L 4WUUE 4NQEB 4CDGC 1ZSDA 2BNQE 5KSVA 4M7JH 1FG9C 3SOBH 4MQ7A 5D1QA 4Y89A 2YOCA 1TQBB 3D0LA 5GZOD 5KN5A 5T5FL 4FFZL 3DUSA 1A7BA 5IJKC 3MREB 1LE5A 1FFQA 2VSCA 3I84A 2J8OA 3E2HB 1G6RH 1U9KA 2GI7A 3OAUH 3DX9B 3IKCA 5K9KA 4XNZB 3BX7C 4Z5RB 1BAFH 5L6YH 4Y4FD 4PJ7B 4UT9H 1A7QL 4X6CF 1AGCA 5FV2A 5B3NA 4RGMC 2KH2B 2ICES 4JO1L 4ZQKA 3MXWL 3HI5H 1OSPH 4I3RL 4PFEA 3CVHL 4JFEA 5ACMA 1NGQL 4G8FA 1ORSA 4NQCE 5E24E 3MJ7B 1F11B 1IC7H 3FCTA 3WNKA 4AT6A 1YMMA 2GKIA 4D8PB 1WFTA 1LD9A 3T4AB 1P4BH 5LXGL 5F9WB 1QRNB 2KUTA 1IQWH 3FQRA 3QZWG 1UACL 2GYSA 1FQ9C 1BF2A 3OSKA 1NFKA 2A6IB 4WWKA 5MERB 5L8JB 1I8LA 2B1HL 1O5DT 2C4FU 2PXYA 4JM4L 2XPGB 5D1ZD 2JB5H 5DD5H 2WBJD 2OSLA 5BRZA 2YC1B 4O00A 4KKAC 4RZCB 4JG0L 4N8CH 1ES0A 2E7LC 5ISZA 3STZB 2BDNL 5J7CC 3KHOA 2XNAA 2YBRA 1D5MA 3QSKB 2E6PA 4HIIB 4NKDA 1DN0A 3GSNB 1A6ZB 2R0KL 4HZAA 5BOZG 3UO1L 1A9BA 3BI9X 5H35B 2R39A 3EW3B 4I13B 4JM2B 4RFEB 1YC7A 2Y1VA 3QXDA 4E9LA 3QO0B 3MV8D 4GAGH 3S96A 4NQVB 3WFHA 4BFEA 4HUMB 4FQCL 1F6AB 1IGJA 5HYQA 3JTTB 1CDYA 3MOBH 2P5EE 3F7RA 5AD0B 4J4PC 5EC2B 5EU6D 5FYLE 1KPVA 5A43C 2NY3B 2ZUYA 3QCTH 2IPTL 3EDJA 4CU7A 2R29L 1B9ZA 4WU5A 3GUTA 2FWOB 3HLAA 4TNWK 3CSYB 5EO1B 3WNLA 3FRUB 4PGEB 3SKOA 5IKCA 1JNLH 1SEQL 1CXIA 1NGYA 5GGRB 2BERA 4LCWA 5EU7E 1QSFE 4MZ3A 2AK4A 4Q6IC 5DRXB 2AJZA 1QVOB 4W6XB 2VDNH 3EKCA 3RI5K 5IM7A 2ITDA 2D7NA 1FLRL 2R2CA 3CVHA 5DRNA 4NZDA 2I60H 3N85L 2G9HA 5IGXH 2YD7A 2EDRA 1RZIA 5IVZA 3RUGA 4KGJA 2FD6H 1GC1L 1JE6A 2VISA 2XZAH 4J3UA 5ENWA 1MIEL 5BS0A 4PJEF 1KJ2H 1EO8H 4PR5B 3ZZ1A 2BVYA 4Y1AE 4PJXB 1PG7W 5F9JB 3H3KA 1UJTA 1PVHA 4UV4H 2R0WL 1DLFH 3BO8A 4U1LA 4XH2B 1BVLB 3WL9A 4KI5E 1RIHH 1WBZA 5ADPH 5EG6C 3QDGD 4J6RH 4YDVA 1SVCP 3IDNA 3IDYB 3JUZA 1CICA 4C59B 3RVXC 3GMOA 3TBTB 2NY6C 4LU5L 5C0IB 5GS0H 5CSZA 3T3PE 1DSFH 1OTUD 4LGSB 1RUPH 4AMKL 2X4PA 1EFXA 3ZYZA 5I73B 2VLLA 4R2GD 3WXWH 2VUOA 5T1KA 1XGRA 5GRWA 3VWJD 1JYWA 5EU7C 3QRGH 4M6NH 1GJIA 2E9JA 4OFDA 4Y4HA 1EEQA 2NYYD 2A9NL 1J8HB 4B50A 5E8DH 2M1KA 5F88B 3NIDF 2G2RA 5FGSA 2FZ3B 4PLJD 5AG8A 3CSPA 4JRWA 3BWAB 2IFGA 3CC5B 3QIWC 4JFYB 4DKAA 5LVEA 4I3SL 1I1CA 1S7VA 2IBBA 4UQ2A 4YHOL 5A2LH 2VYRE 4OZIB 2B8OT 3WXVH 4EBQH 1IAIM 1T5WA 5IB5B 5DI8A 4QHUB 2UZIL 2F54D 4GMSH 4JAMA 4LAQL 4HIEB 2AJVH 3UJTH 4CNIA 4R3SA 2NQCA 3RWGB 4KI5C 5DD5L 5I18H 1W0VB 3L7FB 1IT9L 5I8KL 2OZ4H 1KC5H 4G8GB 1S9XB 4X98A 5MEQA 4FXLA 1EHAA 3R8QA 4N1CA 4WI9A 2H9GB 3GKWL 3N1QC 4QRTA 3RNQA 5HDBF 1TCRA 2VH5H 4DGIH 3MRBB 3NACH 4WJ5A 1QQDB 4JY6B 3LQAL 2H8PA 3MLSL 4B53A 4L4VE 1HDMB 3U7WH 2AQ1A 5A2FA 1K4DA 3P4NA 1NCTA 4MA1C 2X4OA 5I1AA 3QHZL 2CRMA 1XF5B 4C56D 3AFLA 4FQXB 4UDUB 3G6DL 1XGPA 5E6IA 3M1BB 3MUHL 3O8XD 5D7JB 3BIKB 5FYJD 4HFWA 2EDTA 3OJ2C 4MWFA 2NTFA 5ADOL 1X5HA 3RIAF 1JWSA 2RFXB 4W4OA 3O2DL 5D2LB 1EERB 1ZGLA 2Y06L 1XAUA 3DX8B 1VPOH 2P5WD 4L9LA 5E2WH 5D96B 2UZXB 3TJEH 5D72L 5JUEL 1ROWA 1IILE 1WFNA 3SGKA 3HE6B 4ETQB 1FFPB 3DV6A 1MCDA 1UCTA 2PO6B 3PQYB 4GQPH 4M1DH 3OGOE 3CFJA 4AH2B 4P5TB 2DYPD 4U31A 3OXSA 2X05A 2GTZB 1EO8L 2ZUQC 2DLGA 1SHMA 3PWPB 5L2KA 2ZG3A 2X1WL 1DLFL 1EEYA 1B0WA 4KDTC 4PJIE 5E8EA 4GKOA 3GB7B 2HWZL 1GGBH 2YD2A 2DQDH 3PGCA 5LQBH 1NMCB 1A5FH 3TWCH 5C6TL 4JB9L 3BKMH 5D7IF 5BXFA 3NFPA 4Y2DB 1RPQA 1VA9A 3TPUA 1FRGH 1R6VA 2BOCB 3O4LA 5FYKH 3UYPA 2N7BA 4NFCA 4BSJA 2NY4B 3DX7A 2LFGA 3EO0B 4R26H 1K8DA 5D6CB 3VXMA 1N8ZB 4ZNCD 3QRGL 1FG2A 1MAMH 1WIOA 1QZ1A 3BEVA 2CDEA 4P46D 3T65A 5DQ9A 4Z7OE 4WNQA 1BVZA 3GSXB 1Z9MA 2CLVB 5E8DL 4UAOC 1W8NA 4J3SA 2V9QA 3BPNC 2X5PA 4JZJB 3RKDD 8FABA 1FH5H 2JJTC 1JHKL 2CKBH 5LJYH 5IVXE 4RRPA 4ISVB 4FQQB 4WENB 2GT9A 4IRJB 5FGBC 1D9KD 3LPGA 5GJSL 4NJAL 2YEZB 4XCEB 3LB6D 5E8PA 1EXUA 3WXVL 3O2DA 5EOCJ 2ZPKH 4OZGB 4R4ND 5B8CC 3MV01 5GRVK 4WI6A 1QP1A 2AJVL 2IH1B 3BW9A 3UJTL 5DMJB 1DVFA 3O6FC 4MD0A 1I9JL 4LOUD 5D4QA 4QHLA 3U0WL 4PJ5B 4F7MA 4N0YH 5GPRA 1A6AB 3MR9A 4Y5XA 1NEZB 3LD8B 4Z7VB 3P11H 3GBMH 4WW1B 2A74B 4CMHB 4NDMA 4R8WH 1FFOB 1U8LA 5EZIH 4H0IA 2C3WA 3FN0H 2V17H 3VGGA 4DJMA 2VABA 4HS6B 1MLBA 1LK3H 5EA0L 4R90L 2VH5L 3QQNA 4DGIL 5ANMA 4GQ9H 3NACL 3KJ6H 4LLDB 2QKIA 1MHEB 1BOGB 1J88A 2R23B 1ZHNB 1NBYB 1HILB 4JFDA 3EOBA 1CFTB 4DAGL 5H2BA 4CMMB 1MCHA 4N0FB 4Y5YB 5DUPH 4D9RE 1QSEA 5HY9A 1SYSB 5E56A 4M93B 5GRUL 2XWTB 4XP6L 5K9OB 5IB4B 5TQ2H 4Y5VA 3QFJA 5B3JE 3T0EE 4HF5H 1DBBL 1U95A 2IH3A 4MZ2A 3MRIB 2HVKB 5DLML 4OF8A 2IFFL 2CDGB 3GGWA 1UCBL 3I6LE 2AAVA 4GRLA 2QADB 3V6OE 3P0YL 3BGFC 5ABDE 5B4MC 4LPTA 3QIUC 1M6OB 3SQOL 1XF3B 3TJEL 1NCCL 1T2JA 5IG7A 1S3KH 4NZUL 3V0AC 4NBXB 4ZMAT 1VFOA 1CFQB 2IANB 4O02L 4OTXH 4UUJB 3RIAK 3ZDXE 3JWDL 5T3ZD 4U33A 5TGBA 5DEGB 4WUUD 4MDIB 5CUSH 1WBXB 4G3YL 4PJDB 1AE6L 3V5HA 2BNQD 3TN0B 3D3VA 4KKAD 4CU6A 5DUBA 5MENA 4ACPA 1CFVL 1RHFA 1YPZA 1J5OH 1J86A 4FQHA 5F3BB 3BGAA 3R1GH 4KRMB 4YGVA 5KVMC 1HQRA 1VEPA 1DE4B 5DTFA 4BA8A 4E42A 2ZCLL 5D5MF 5I15H 2I9LB 3ARYA 2QLVB 2DQDL 4N5EC 5LQBL 4K94H 3O0RH 3TWCL 3T77B 3BKML 4TVPH 1IGIL 4HBCH 2G5BA 2BVEA 2XKNA 1S7SB 3BVNB 1X5KA 3LKPA 1XT5A 1MRCH 3TH4T 15C8L 4ZUVB 1LE9A 4PJEE 4XTRC 3G5XB 1A6UH 3PGFH 2JJVA 3T0BA 4J4PD 1GVIA 2VDKH 4HUKB 3V6OC 5CCKH 1MAML 4NQCD 1A1MB 4JDZB 2PYFB 3WUZA 4X7TB 1U41A 5DK2A 4QRPB 5JW3H 3CZFA 4PJCE 4POZC 3ISWA 1D5BB 1NCUA 3KWWB 3DNKA 2J8UB 1BLNA 2SEBA 1S5IH 5IFJA 1OSZA 1MEXL 2D3VA 4Z7WF 1CYGA 5I75B 3PWUA 2XYCA 1MJUH 3ETBF 4X7FC 4YZFE 4V1DE 5J12C 2FATH 3CMOL 4NN5B 4C57C 5D7SL 4OZFA 5D7KE 1JP5A 1M71B 1DUZB 4KK8C 2R69L 4HZLB 3GIVB 4CKVX 4F80A 5EIIB 3UAJC 4YPGB 1JUFB 3BPCB 3OL2A 3PHOA 1AO7B 3C6LA 4MVBC 1PKQA 4YIQA 3NIDE 1I9RL 3P11L 3GBML 3QXAA 3EAKA 3TVMB 1X5ZA 5JO5B 3SBWA 2XRAH 3T1FB 2HVJA 4LSRH 1WCQA 4PRNB 3JBG7 1NPUA 5C0CB 2FEEI 4IRSB 3TNMA 4KZDH 3BUYB 3ULVE 5DURB 4GKNA 2P5ED 3ARDB 1QR1A 1MFCL 5F3HA 4OIIL 3GMLB 5SWZB 3RVXD 4GW1B 2DM7A 4NSKA 2NY6D 4F7EA 4Z77A 5FYLD 5SWSB 3IF1B 1I7TA 4MS8C 4CAGA 4YHIA 1ZTXH 4PJAF 2APWA 4MJ2A 2EYTA 4LFHD 3LKOA 2MOVA 4NO5A 4JFFA 1NFIA 2H2SC 4S1RL 3AMLA 1QSFD 4NQXB 4UMGA 5TQ2L 3O6LH 4ODUB 1TCMA 3TBWB 3QAZC 4G43A 1DQMH 1CD9B 4A6YL 4EDXA 4U05A 4XCFL 4HDIB 4LL9A 3WNNA 3SKJH 4U1NA 1NMAH 4NC2B 3QIWD 2YZ8A 4EI5C 3HUJB 2GK0B 4LHQB 4P59L 5EU3A 4L3EA 3ZKQD 1H5BB 3OKKB 4LAJH 1RD6A 1UVQB 2E27H 5D6DA 3OB0H 4EN3A 3D85B 5C0RL 5E7BA 1RZKL 1PZ5A 2GFBA 5MEOB 4Y1AD 4KU1A 3UTTB 4JDTH 3VXSA 2VR4A 3O2WL 5I9QB 43CAA 1LEGB 4JKLA 3O4OC 5D93C 3KPRB 5CUSL 3MBEC 4KI5D 2D9CA 4FHBD 3A67H 4JZNA 4OIAA 4PJ9A 2QR0B 2HT3C 3CFDB 4KVNL 1KGCE 4PJ7E 5D8JH 1MVFA 3LCYA 2OL3B 4QXWA 2E7MA 4I48A 3RVTC 1WZMA 4NKIH 3MRPB 2W0KA 4OT1L 4KY1H 1ZE3C 5HPMB 3HS0B 2FX7L 4M1CC 5EBWB 2O5YL 2NXZB 3RZCC 1NLBL 5HGAB 1XIWC 3WO4B 2ZG2A 3F7YA 3P0VL 4Z7UF 2VERN 1KEGH 2R8SL 3DOSA 3VDCA 1JGDB 4YHKL 5KS9B 5F7HA 4OAWB 1FZOA 2V7HA 3VA6A 2HN7A 1HEZB 3FN9A 3M17A 2PYEB 4X6DF 4Y16C 3T09A 4DGVL 1DBKL 5CCKL 3D9AL 2XKSA 2EEBA 2L7JA 1BD2D 4AEFA 3VU2A 3ECBA 3VGEA 2B7DT 1FYTA 4ELMA 1TQBC 2NW3B 3BXNB 1ERNA 4I77H 1MCLA 1AQKH 4DWHA 2K9UA 4OSUH 1WITA 3LSOB 4A6YA 5E5MA 3BESR 3QYCA 5E4EC 4E41A 4XNZC 4PRIB 3DBXA 1AD0A 2Q76B 1UJ3B 3PP4L 4YQXH 4HUVA 1Z3GH 1XCQA 2FYYA 3QR2A 2E7HA 5SWQB 2OP4L 4Z0BL 1KG0A 3QDJB 1EPFA 2VLJE 3GHBH 1M1SA 1U8KA 1WV7T 4M43L 2EC9U 4D2NA 1T6VN 3P9MA 1G7LA 4JPWH 4M9OA 2P24B 3SEPA 4L4VD 2LQRA 4LSRL 5D2NB 5GGVH 3PV6B 1EVUA 2GJJA 4GRWB 4FQIL 3IDXH 3W81A 3T3ME 5IBTL 3C5JB 3EYOA 2CO6B 3QHFH 7CGTA 4WO4B 5CIPH 1FO0B 4M7ZC 3JV6A 2AGJL 2W65B 5AZEL 3MROA 2VZ1A 2WWMC 4KRLB 5AEAA 1A6TA 3QO1A 4QF1A 4QHNA 3RKPA 1S7UA 2WP3O 1RJYB 5TFSH 3TYFB 4ELKA 1JJUA 4JVPA 3FO9B 1WAAF 1RI8A 1AHWB 1NGWA 4PJXE 5HHPA 2ESVB 1UB6B 2LV4A 2QSVA 4XZUB 1NBZB 3QIBC 4OLYL 3SKJL 1NMAL 2CMRH 3HZYB 4YBLC 3E6FB 1IAIH 4PLKC 4GH7B 5I1HL 3DGCR 1U93A 3THMH 3H9HB 4ZPTB 2F53E 5I1IL 4D9QD 3I2CL 3VMOA 1OY3B 1F4HA 1G9NL 4NP4H 3C09B 2HG5A 2IBZY 1KIPA 1NFDB 5ID1B 5F1IB 3NIFE 3WLWC 3G04A 5DC0A 4JDTL 3SDXB 2IBGA 1CLYH 1E28A 1SMAA 4S2SA 2VQTA 2JIXB 4UU9B 3O6FD 4JRYA 2NY2B 3I75B 3VXUA 2BY3A 1IVLA 2YPLB 4XP5L 1I1YA 5D8JL 1BFOA 4KWUA 1J8HE 3C8KA 4XPBH 1BM3H 2CKNA 4G6JL 3P0GB 4P2RE 1S9WA 2J12B 4RDQG 3FQTA 2HKFH 4LNRA 5C08A 3ROOB 3LS5H 4KQ4L 2DLEA 1EO5A 3MLWH 43C9A 2R2BB 5J1AB 1Q0XL 1WWCA 5E2UH 4XBEL 1WT5A 1RJLB 1W0WB 4YDLB 4JG1L 2HRPH 1INEH 1BIHA 3ARFB 3RWHA 3EJJX 3U7AA 3VXOB 1MHPL 2I5YH 4LHJB 4KPHH 4BM7A 3O2VL 1XH3A 4KI1A 3VFMB 4MAYB 3X13B 4LRNL 5JW4M 4G42B 1D3CA 1JV5B 5I1JL 32C2A 3O9WA 4U7SA 4G8GE 1SJHB 1ZA6A 1DBAL 3SDDB 1BWMA 1EMTL 4MX7B 1T1WA 1FNEB 1RU9H 5C0EB 2F58H 3FQUB 4YDJA 3QNXA 4G8IA 5DVKA 2ZG1A 1ZLUK 3UX9B 1RJZB 2A0LC 5I2IB 3P40A 4FQLL 3K8KA 3FONB 4L8BA 1S5HA 2XY2A 1QO3B 1N3NB 2FGWL 5B4MD 4D0BB 4RSVA 3VGHA 1FNLA 1CL7L 1ZHKA 3BQUB 3QIUD 4HPOH 5A3IC 2V5YA 1KSRA 3KPPA 4GG8A 2GEEA 3GMMB 3OKEA 1ITBB 5I1KL 5IFAL 5I8OL 1KCUH 2FHFA 1FAIH 2Z93B 4NFBA 4Y4FA 5EPMB 5MI0B 1IM9D 1HHKA 1NEZG 2Z35A 4DKEL 3BZFA 1TJGH 3OKOB 1R24B 3LY6A 3LH2H 3Q0HA 2YZ1A 4X9HA 3MO1B 3B9VA 4G9DA 4CGTA 2CRYA 3MRDA 1AIFA 4O2FB 3U4BH 1LO3H 1IAMA 4QRUA 4CADB 2WUCH 1D6VL 1G7MB 5D2LE 3B3IB 4N5ED 5IV2A 4D9RD 3O3EB 2K1MA 3QHFL 3P77B 2KQMA 3M45A 1FE8H 1RUQH 5DD0H 3UDWC 5C1MB 1T21A 2HJLB 3KJ4B 4K71C 5D1ZA 3FKUS 1VGEH 4KKLC 2UUDH 4R4BA 4GXVH 1ZWIB 2ADJA 2XZZA 4YXKH 1C7TA 4XTRD 3PQYE 2OQJB 3MLTB 3I6LD 1T20B 5DZLA 4QY8A 4YBQC 4P9HL 1JI2A 3ME0A 5ESVA 1K5NA 2XQBL 3CLFL 3FAXA 2VZSA 3H2WA 4X5WB 5IQ7H 3MJ8B 4O4YH 1XF2A 2YPKA 3VG9C 5ERWB 3Q6FA 3BKYL 4POZD 5IROC 1UM5L 4GRMA 1OGTB 4PJFB 4JRXB 2CMRL 3OAZK 2WK2A 1MNUL 3I3EA 1FJ1A 2J2ZA 3MV8A 1KB9K 1BX2B 3KPTA 2Y36H 4H8WC 3GMPA 2IADB 2CXGA 4JREB 1PZUB 4H1LB 4PRBB 1IARB 1IGCL 2E9IA 2DMCA 1OPGH 1TZIA 4ZPVA 2KDGA 5DJZA 2E5EA 4J3WA 4GJTB 3V5KB 3S5LA 1Z0MA 4S1SL 3FO0L 5EU6A 1PYWA 4KK8D 1C5BH 3K0WA 1GPOH 1MI5B 3UAJD 4OV5B 2YXFA 3EDEA 4MVBD 4U6YA 3QEGH 1E0OB 4LEOB 2X9XA 4PJBF 2YHGA 4XPBL 3V6FA 3SJVB 2ARWA 1AD9B 1A9EA 4OZHA 3HE6C 3RNKB 4UB0L 1RMFL 4PV9B 1NUFA 1T3FB 4F7TA 4XBPA 4DCQB 1CTOA 4K2UH 4PLNC 5E2UL 4MS8D 2Y25A 4RFNC 3V6ZB 4BKLB 5IHUL 4JQXC 2YD9A 4OZGE 2BSED 1WZ1H 2BHYA 4PP2B 3NGBB 2A73A 1ZHBA 1KFAH 4Z0XB 3DXAB 2PR4L 4GKZA 2H2SD 4MJIE 1CGVA 1UEYA 5JXAH 4J3VA 4X99A 4YFDB 4HJGB 1C5DB 1IGFH 3QJFA 4AYFA 3UEZA 2MTPA 5GGRY 1VKXB 1NMCC 5GSVA 4FQ2L 3QDGA 3T4YA 3V4UL 4ZUUA 3LRSA 5J4MA 4V1DD 1NGPL 5EBLA 5BJTB 5IT2L 3MZTA 5F71A 3LHPL 4EI5D 4ZSOA 4ZOEA 1AQDA 5D7KD 4Z7UE 1I7ZB 2FCBA 4P2OB 2B5IB 4WGWB 2NY4C 3VXPB 3FQWA 1CXHA 1WC7A 3AAZA 4OUOA 1A64A 2FJFA 3IB4A 4U1GC 4QHKJ 2D4FA 5DEZA 5FYJL 2XWBB 1U3ZA 1OT1A 2Y6SC 4X6DE 1RZGB 2X2YA 2YPVL 5EH1A 4O5LL 2NY1B 1KN2H 1WCBB 4DGYH 1KCUL 3TA3A 5IF0A 5LGHL 3VWJA 1OAYL 3KYNB 3MQIA 1TITA 1DQTA 3T08A 5DMGC 5DHVB 1W72H 3RA7L 5BV7B 3MBED 3OKDB 4XPTL 3CH1B 2HT3D 3ULVD 4XB7A 3MPCA 5LG1A 3U1SH 2OI9B 5DUMH 1U8QA 1ZAGA 1V7NH 3HAEB 1MCKA 3RVTD 3N06B 1VERA 1I8IA 1U8JB 5T3ZH 5DFVC 4K3DL 2BJML 3GJFK 1IAKA 1LO3L 4J1UB 3KDMB 3AU1B 4M1CD 1IBGH 5IOPA 3B9AA 3RZCD 2X44D 1AGFA 1P4LB 3V8OA 3R0MA 1XIWD 4KTDH 3QI9B 5DD0L 1TVBB 4JFQA 3ULUE 2DICA 1JHTA 1LP9B 3DETC 3KYOA 1GGIL 4O2CA 2W0PA 3WUWB 4EI6A 1I85C 4GXVL 2R56L 5L2JA 2W38A 4DOHB 1CE1L 3G5ZB 4Y16D 4NRZA 1HIML 1R3KA 3FFCB 3S8WA 4ZFFB 5DJAB 1LEIB 2HFTA 1BIIA 2VIRA 3BSZL 4PJ8B 5DQDL 1GOFA 4MMZC 1XGUB 4G6KH 2P8PB 2HTLC 4FFYL 4XX1E 5BQ7B 4U49A 5CEYA 4OCRH 3GDBA 4Y5YC 3G5VB 3ES6B 1U58A 3L3KA 1JGUH 3ROLA 1QFPA 4O51B 3MNWA 1I3RB 1OPGL 3KS0H 1KGCD 4LLAA 5FK9B 1R3JA 4L1DA 2Y5TA 4KHXH 1ZLSH 4C56A 4M03A 4X7SH 2Y72A 5H94A 3BP5A 1KACB 1L0QA 4JCLA 2DTSA 2Z8SA 5B22A 3O8XA 2DRUA 2FL5A 3PGDB 4MD5A 5FDWB 5LWYH 1R3HA 2BCKB 4XNXL 5E99L 4NM4L 2QADC 3NPZB 3OR6B 5HHXL 1CG9B 1H3XA 2GITB 4QRPE 2APXA 4ODTL 1VACA 2V2TB 3FB5B 2OJZL 3L95A 5I74C 2EC8A 2P5WA 3VFNA 1A7PH 4X4YA 3PWJB 4ZUWA 3L7EB 5F6IB 1CDCA 4OI7A 2FJGB 4WW2B 3MRHB 5GXBB 3U9PL 4P9MH 2CDFA 3MLZH 5JPNB 5CEZE 2VZUA 1CFNB 3BH9A 2GSIA 1TDQA 2XWJA 4F58L 4OLZH 4JY5L 3OKNA 3TV3L 4PRAB 5EZJA 2YD5A 4D0DA 1JIBA 4HIJB 5CKAA 2DYPA 1WZ1L 3RBGA 4F7CB 2WWMD 1CGTA 3BP4B 2BMKB 4XAKE 4XNMA 4YE4L 2KKQA 5JXAL 5HTSA 1BBDH 4MSWA 3C5SA 1JWMB 3CVIL 5FYLH 3QUYA 3R06A 3FQNB 3EYQC 3DX6B 1EHNA 4G80B 4IM8A 1DLHA 2E3VA 1C16B 5FAAA 3W39A 4OKVA 2BFVL 3QCUL 2VE6A 5JHLH 1Q1JL 2ICWA 3QIBD 3G9AB 5C0CE 5GGUA 4PLKD 3X12B 1WWAX 1J1XL 3ZSTA 1MQKL 3ZL4H 1EEUA 1JRHL 2ZNWA 3LKRA 2AJ3A 3P30L 4P4RA 4NN7B 2XN9E 2VLJD 1KEML 3NOIA 3RDTA 4Y19E 5E1AA 5SWSE 3RBSA 3RAJH 5K9QG 3WLWD 2RBLA 1DUYA 4PY7A 1RZJC 4PTTB 1I8MA 4M7LT 2F5AL 4P46A 3ARTA 4JY4A 2NNAB 1A7OH 1N2RB 2VMFA 4OBRA 1X3DA 1F3JA 3OZ9H 4Q9BA 5FA4B 4I18B 5F8QC 4OD1H 3QUZC 5I8CA 4Y8DC 3G5YA 4RAVB 5ACLA 5I75C 4AEHH 2W60A 5T3ZL 3SDAB 3O6ML 4TOYH 3SQBA 1D9KA 4ORGA 1LHZA 4L8SA 1IBGL 3GI8H 5F7MC 3EUUA 5F7NC 1V8HA 4YR6B 3SKNA 5L8KB 3WDIA 4YXLH 4LSVL 4S1QH 4XCYA 4ZFZB 3S36X 5F1NB 3U30C 4FA8A 1P6FA 3SKMB 2HKHL 1U6AL 4HJJL 3T2OA 1EK3A 3B9KA 3UTTE 3DYMA 5ICXB 5K93A 1S7QB 2DQTH 4HWEH 1BZ7A 1WZLA 4OUUB 5FHBL 4IRSC 2AK1L 3L5HA 4R6UA 4TSAL 1IZJA 4NO0D 3L6FB 5FO8B 5HI5C 3T2NH 5CBAB 2F53D 4X0KB 1WGOA 4PY8I 1BF8A 3D2UD 3UBXG 4FZ8H 4G6KL 2BSSA 1K6QL 2DQFA 5AYUH 1N64H 3VFRB 3ZE1F 3HNTH 3B2VL 4UT7L 4YNYA 1CE6B 2A0LD 2BVTA 1JFQH 2QV2A 4NN6B 4FXKA 1JTTA 4ZYKB 5IJKA 1U92B 4X9IA 1DDHA 3SE9L 3PWVB 3U83A 1YNLL 5A3ID 1Q9LB 4HT1L 1C7SA 4GMTH 1U8PA 3S36H 4ZO7A 3U4EB 2AERT 4UOJA 5KS9E 2FH8A 3HMXL 4X7SL 1HSAB 3V7AG 3LEYH 3BMVA 4U1MA 4P2RD 2IGFH 1UKQA 3TBSB 5C0BB 2AKRA 4U1JB 2QQQA 4G8EB 1HINH 2C1PB 3GSWB 4M5YL 1NAMH 1XR8B 4FRWA 4XI5C 2D31A 5IHZB 5HI3C 3DLQR 3TT1L 5I1CH 3RVVC 3H3PH 4M7LH 3OGCB 1K8IA 2FGZA 1AFVH 3MACL 1DFBL 3BHBA 3VFSB 4P9ML 2HFEA 4KRPB 3IDIB 2EDLA 2ZP0T 4WUUA 4MNQB 3MLYL 4G8GD 2BXYA 1RK0B 2V5RA 2J7LA 5E00B 4KKLD 2BNQA 2DQGH 4HC1H 1OQOA 2OMNA 5CS7A 2E7CA 5D7LA 2E7LA 3TPKA 5HDQL 1N6QL 1IC4H 4H0GA 5KG9B 4YBQD 5JOPE 2Q6WB 3G6JA 3L3OB 4HWBH 4XVUC 3HPLA 1YNTA 4PRDA 5IIEB 3C60B 3BT2H 1JGLL 5C9JB 5D2NE 3QG7H 3QNZB 4LCIL 4LLMB 5SX5K 5DC4B 3QEHB 1KTDA 5DVNA 4APQC 5HGDA 4PJAB 4JO2H 3DECA 1MCBA 3NFSL 3WN5B 4EUPB 2BNUA 3RAJL 1E4XL 3S35X 1P9MC 3B5HA 4MJ4A 3F65A 4J4PA 1FVCA 5FM5O 1PBYA 5DSCB 1G7HA 3JV0A 4WI3A 3C9NB 3REVA 1A7OL 1RHHB 1YEFH 2VXQL 1H9VA 5FHAL 4NRXB 1OAZL 3QUKB 1BQUA 3WIIL 2WSKA 1D5XB 3P4LA 3QUXC 4KROB 5I0DA 3HMXA 3IFPB 1F3DH 4HKBA 2ESVE 4Q6IA 4YHNB 4B5EA 3WMSA 3FB8B 3HNSH 1HH9A 1X5FA 1UJ3C 1BPVA 4D9LL 3HE6D 4GKSB 2EICA 1KCVH 1OAQL 3PQYD 2W9EH 3ESUF 4S1QL 3TM6A 4HWUA 1N0XH 1F8TH 1T7VA 5FO7A 3BZDA 4YHML 1MRDL 3HR6A 1TIUA 1NFDE 2DQCL 5EC1B 2QTEA 5T1LA 1WTGT 4AIOA 3S35H 3SDXE 5C0JB 5B39A 4U1SA 1T7WA 4HWEL 4YC2C 1VDGA 4OF7A 3QQ4B 5D2NC 3V7AE 1BQLL 5ALCL 2DWEB 2YPLE 4OD3L 3SO3B 1U2CA 1MFEL 3KGRA 3DVGB 2MCPH 4ZTOH 3GK8H 3I6GA 3KR3H 3MCKB 4PUBL 5AYUL 4C58B 1IEAB 3FJTA 3WCYA 2CSPA 2B2XH 1IQDB 4OFVA 5JIKA 4LCUA 2NY4D 4CVWA 1HE7A 3EO1A 1J05B 4JPKH 4R7NB 3MCLL 1D5ZA 4K7PY 3CDGA 2Y6SD 3JUYA 4YDKL 3S36L 2BSTB 4K7FB 3RPIB 1MIML 2OTWB 5FUOH 1XR9A 1QSFA 4LF3B 2XACC 5DMGD 1HNGA 1QFOA 3DO7A 2ENSA 3V6BR 1N7MH 2I26N 1J9CT 4X4XA 3FFDA 4XVJH 3CPLB 3MXVL 4EQ2A 5DXWA 3EHBC 3QPQC 5I66B 2WP3T 4G6MH 4XC3H 5DD6B 3IDJA 5DFVD 1OM3H 2Z8WC 4M7LL 1IC5L 4P23B 3O3AA 2PW1A 1AFVL 1UM6L 3O45A 4M6OH 4AL8L 3BKCH 4DN4L 1T7YA 3MSPA 4N8PA 4Y1AA 2AXGB 1NC2B 3IVKA 4MJID 3TH3T 4K3EL 2UY7A 1E6OH 5DGQA 3DURA 3LIZL 5F6HI 3DETD 1EUTA 3IDGA 2NX5B 4JQVC 3HE7C 4F15B 5IEKB 3FOMB 1KLUA 4YLQT 1IC4L 3QNYA 1KPUA 2M8XA 1FZKB 4NUGL 3KNBA 3GO1L 3TLRA 1UA6H 1IFHH 5T1MB 1H8OA 2OS7A 3FOLB 4GBXC 4S1DC 5DA0B 5GS3A 2HTLD 5F9DC 1G7JA 5F21B 2BSRB 1R5WA 1DBMH 3MGOA 1XMWA 5IB2A 4KZEH 2JK5B 4MQSB 4JO2L 3MUGB 4ODVH 4MAYC 3WYRA 1YY8B 1A0QH 4DVBA 3A6BL 5ESAA 1GSMA 3EFDL 3G08B 5T1DH 3ZTNL 4UZGA 5E8OB 4H26B 1KXTB 2VLME 1Y6MR 1Q9WA 1YEFL 1NUDA 4L3AA 1BD2A 2R1WB 5FOBA 5GISH 3KPMB 4HK0A 2EECA 3B6SA 3QJHB 5KSBB 1T1XA 2P47B 2QADD 1MHCA 3OKLB 4XGZB 4YAQA 3U9UB 4NYLB 3ZYJA 4MB3A 1I8KB 3VMPA 4EIGB 2XA8L 2W07A 1RK1B 3BN9C 1F6LL 4UDTA 3U7YL 2NCMA 1S7TB 3IDMB 5I71C 3LS4H 4IDJH 3QPXH 4PJFE 1PSKH 4JRXE 5I76B 2GQHA 1KCLA 1KCVL 2VZTA 1P1ZA 1IEBB 3W82A 5MI0C 4NWTL 3WUWG 3WNMA 4PRPB 2ID5A 3CU7A 1ZT7B 4LLYA 4LHUD 2AEQL 5IK3B 1DQJA 1G1YA 1EO7A 5CWSA 3RWJB 3RJQB 3S35L 4C55A 2XY1A 2CGRL 2XZCH 2VL5B 3C08L 3AGVA 5C7XH 5C70A 1MWAL 4BSVA 4OJFH 2MPAH 1C08A 4L4VA 3A6OA 3EYQD 3P3YA 4KDTA 2A9MH 1FORH 1UM4H 1YECL 1RVFL 5E8NA 3SJVE 4MJ6A 3DYPA 2VDOH 1R3LB 3KJ4C 4DW2H 3U0TB 3H7BB 3MFFB 5J1SC 3DIFB 3A6CH 2B2XL 5T5NF 5JOFA 1EDQA 3MRCB 4LCCC 3IXAA 5L0QC 4ELMF 2X40A 1KJVB 3L3IB 4JPKL 4LVOC 1BVKB 1E4KC 4R4FL 4Q7DA 4JVUA 1GAFL 1QBBA 3MLXH 3E3QE 4OCXH 4Z95H 3KG5A 1H15B 4KHTH 3TIEB 5FM5M 5DD1H 3TNNA 1N59B 2AV1A 5J9PA 4IHOA 4RGNC 1I3GH 1OD7A 2PNDA 25C8L 1BHGA 2PTUA 2J1KA 1T5XB 4ONGH 4NQSA 2ZSWA 3QUZD 1KTKE 4G9FE 2JJTA 3TP4A 1WUNT 5CEZD 4JREC 4XC3L 4S0TD 4QXTB 1OQXA 1V3LA 5FGBA 2FHCA 4L8CB 4JPIB 4MJ5A 4HH9A 5B38A 4C54A 4L3CB 3BKCL 1BEYH 3ULVH 5CJQH 3CUPB 5DJ0A 1G9MH 3K2MC 5B8CA 2ZUWA 3VJ6A 2EIDA 1MCWM 3DUUB 3HN3A 3KLDA 1J0IA 1Z5LB 4JFZL 3DVFA 5KZCB 2X4UB 4PJIA 1RZ8A 4KAQH 3ARXA 3MOAH 1S8DA 3VXNA 2APFA 2X4SA 1Y0LB 1EJOL 2DQIH 5L7XH 2IALA 4LLUB 4XC1L 2ZOLB 4BQCA 1AH1A 5C0CD 1J1PL 4IRSD 1K3ZA 4RA3A 5HI5D 4NNXB 5KSAC 3Q6GH 4HKZB 1Q9OA 1S7XA 5JORA 4A2LA 2DQJL 3UPRB 1MH5B 2XN9D 1NAKH 1UH2A 1X5LA 4Y19D 3VD5A 3E3QC 1OLLA 2JCCB 3MFGB 2OTUB 4X6EA 1QLFA 1MWAA 1ZSDB 3HMWL 1H3TA 4KZEL 4OFKA 5KSVB 4B7IA 4WI4A 2VQ1A 3EYUL 3H42H 2C26A 4MQ7B 4QRSA 3VFOA 3MA7A 4GAYA 3DRQA 1M05B 5KN5B 4I8DA 1LP9E 3DUSB 4EVNA 3OX8A 1LE5B 4GAJH 4E5XA 2WQRA 5DT1L 3MNVA 1ZT4A 4RQQB 5GISL 3ZHDA 1I1RA 5HHVL 3IKCB 3FFCE 5K9KB 1NLDH 2QEJA 5F1KC 3W2DH 2XFXA 4ODXA 1YEIH 4P2OC 1AJ7H 1X4ZA 2EH7H 5SV3A 1AGCB 4YEEA 4XI5D 3GSRB 3L9RA 1ETZA 1LGVA 5HI3D 2EE3A 4OB5H 3RVVD 4X6CA 4ZD3L 4JFEB 2NY1C 3QIUA 1FSKB 2J3SA 3UTTD 3EGSA 1ORSB 4CDHA 4YEFA 3FCTB 4HS3A 4AT6B 4WHTB 1LD9B 2M26A 2JELH 4J3OC 1IM9A 2V7NA 2UV3A 3ARBC 2OI9C 3BGMA 1UZ8A 2V9TA 5J11C 1D7FA 4QTHA 1M7XA 5INDA 4WWKB 3F58H 4BSWA 2ZJSL 2PXYB 3NCBB 2DDQH 2OSLB 5BRZB 3FB6B 2A9ML 1FORL 4WFEE 3CD4A 2X7LB 4MAUH 4XVUD 1ES0B 1UM4L 5ISZB 1JMZA 1MJJA 1XEDA 1FBIH 3QI9C 1TVHA 4HCRH 2XNAB 1JGEA 1HKLH 2F74A 2YBRB 1D5MB 1X9QA 5IMKA 4CN1A 1FL5A 3QISA 3LEVL 4U6HA 3ALXA 1T0NA 1MREH 3B4NA 4WV1A 1DN0B 5IMOA 4APQD 5JXEC 3GSNH 3S37H 1A9BB 4TQEL 4JQIL 2IC2A 1CL7I 4H5SA 3QXDB 4OCXL 5EOCH 5GS0C 2Y07L 3S96B 4OLWH 3WFHB 4RMQA 1IGJB 3V6OA 1T22A 5HYQB 4PGDA 3UC0H 3WS3A 5KVGL 4IIQB 2JE8A 3HB3C 4M6AA 3I9GH 4FNLL 2FEDC 1KPVB 3QUXD 2FO4A 3ARGA 4LDOB 4YHZH 3LEXA 1IJ9A 4UTBH 4WU5B 4RWYL 5GRVL 3GUTB 3HLAB 3HFML 4NQTA 2X9YA 1VGKA 4HBQA 3MRMA 2NW2A 5FUZH 4XMKL 1KNOA 1G7PA 3LN4A 1UB5A 4LCWB 3ZSSA 4EDWH 3KPNA 2AK4B 35C8L 2AJZB 3HC4L 3EOTL 2X4TA 3VGFA 3IFLH 5JOPD 1NC4D 3E0GA 5IM7B 2ITDB 5ALBL 3CVHB 1CF8H 1KENH 5H37G 3WFBL 2Q86B 2DL9A 5DMIL 1YMHA 4X6BA 2G9HB 1JPGA 3RUGB 1RZIB 5IVZB 4IJ3B 2XZQL 3D39A 1K9TA 2F8OA 2VISB 5ENWB 4Q6YA 4ODSL 4H88H 5BS0B 3QWOA 2JJSC 4BFGA 3N1GC 4W6WB 4PJEA 5IVOA 3BO8B 1HHIB 2F15A 2QHLA 3L3HA 3WL9B 1WBZB 3VRJA 4YDVB 4ZXBA 2BRRL 3IDNB 2OR9L 1CICB 5FB8A 3NBNA 3GMOB 1JK8B 2A1WL 3MBXL 1QLEL 4PJCA 1MRFH 2VL4A 5CSZB 3GZKA 5E94A 5F1SA 5JZ7C 5HHNA 2I24N 4KXZH 2ESVD 2X4PB 1NCBH 2VLLB 3QP3A 1CIDA 4F3FB 5TE6H 1ZMYA 4DTGH 5T1KB 1XGRB 3IFNH 3KLAA 3I02A 1YEIL 4OLXL 1AJ7L 3EHBD 4V1DA 1T2QH 3QPQD 4ETYA 4Y4HB 4EI5A 1CR9H 2BVOB 2AV7B 5C0DA 1TZGH 2G2RB 5GQBA 5ITBH 1HHJA 4KKBC 2YRZA 1WTLA 3I85A 1XGYL 1CD8A 5D9SA 4D3CL 5GZND 2JIXD 5KSUA 5GGTH 4KTEH 1S7VB 1SY6H 4UQ2B 4P4KC 2DBJA 4Y0GA 3ARVA 1CK0L 5L88L 1AGDA 2YPLD 4HIHA 4DUVA 2FLBT 4I18C 3SPVA 2DTMH 3MBEA 2AEPH 4YJZL 4XNYH 1FL3A 4EIZC 1F2XK 3HE7D 1JNJA 3W5MA 5DI8B 1VB9A 4LLQA 3NN8A 3SDAC 4JAMB 3F58L 3PWLA 4WUKH 4CNIB 4R3SB 3SY0A 3FL7A 3VI4F 2DDQL 5C0BE 1FN4A 4UINH 1CDHA 3ARWA 4LPWA 3K7UA 1L6XA 5IR1A 4H20H 1RQ5A 4F7PA 4XXCA 5J13B 3CXHJ 4JO3H 1OAXH 4DZ8A 4RMSA 1HKLL 4X98B 4CVUA 3RZCA 4GBXD 2BOBA 1XIWA 4S1DD 4QRTB 1BZ9A 4GS7B 1JF5A 1TCRB 1JWUA 4HXAL 4HKXA 3VCLA 4MAYD 4WJ5B 1KXVC 5EOCL 1RUMH 2H8PB 4NJ9H 2EDFA 2AABL 4JHAH 4OLWL 4P57A 3SDCC 1T7ZA 1K4DB 4MNQE 5J0BA 3UC0L 2X4OB 1NBVH 5I1AB 5BZDA 3CSGA 3AY4C 2CH8A 2BP3A 2FECI 3QXUA 1XGPB 5E6IB 3BN9D 4JN1L 5E2TL 4PB0H 3O6KH 1E6JH 3EO9H 3TT3H 4HFWB 4X4MA 4MWFB 2NTFB 4NT6A 1AR2A 1JWSB 3BDYH 1FGNL 4K3JH 1MUJA 3V7MA 4CBPA 4MYWB