1MJ8H

High resolution crystal structure of the fab fragment of the esterolytic antibody ms6-126
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
216
Chain Sequence
VQLQQPGAELVKPGASVKLSCKASGYTFTSNWINWVKQRPGQGLEWIGNIYPGSGYTNYNERFKSKATLTVDTSSSTAYMQLSSLTSDDSAVYYCARKHYFYDGVVYWGQGTLVTVSAAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN MS6-126
publication title High-resolution crystal structure of the Fab-fragments of a family of mouse catalytic antibodies with esterase activity
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2002-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mj8H02
1JCKA 4HIHA 3QI9A 1A6ZA 4Q9RL 4HG4J 1TFHA 4CN6A 1JE6A 4U1KB 4O58H 2QV2A 3H9SA 4ONHB 1F58H 4AT6A 4I5BB 5SX4I 4Z0XA 4PS4L 4RFEB 2AJYL 4O2FB 3ILQC 4UILL 5DUMH 4P99A 3LKPB 3T2OA 2A6KB 2V5SA 2XY1A 3MXVH 4Y2DB 1EXUB 4QGYA 4K94L 2YRPA 4Y19B 32C2B 2IADA 3KS0J 4LNRB 4AG4L 3SKNB 3GI8L 5LXGH 3MCLH 1QFWH 3WFEH 1HILB 1N2RB 3LDBB 5IW3A 3V52L 1RZFH 2VDLH 4MYWB 1UEYA 3LQZB 3ZKMC 4XI5D 1Q72H 2W9EH 2H2PD 3B9KC 4NO5A 4FQ1L 3MLZL 5SWZB 1MHPL 4KDTA 1U58A 5IB5B 3EOTH 1BQHG 5AUMB 1QEWB 1DTUA 3TIEA 1MFDH 1T1ZA 1KJ2H 3DX8B 4WFFE 1RZ7L 5IB2B 4GRMA 4POYA 5FO7A 4LRNL 4GXVH 3ARWA 3TN0D 1ED3A 1ZT7B 1IGTA 3TIDA 3SKOA 1P84K 5HDQL 4UV7H 3BN9C 1P4IH 3KPOA 3IGAB 5E99H 4WENB 3MRDB 5C8JA 1U8HA 2OZ4L 4JO2L 1JWUB 3SPVB 2CKBH 2R69H 3VFOB 3NFSH 1QFUH 4UDTB 4QRRE 2GUOB 1JHTB 2F5AL 3EOBA 1JGEB 3EFFA 1DJSA 4XNYL 1BVLA 1S7RB 3VXRD 3RI5K 4IMLA 1EFXD 4X4XA 2A74B 7FABL 3C2SA 1UH4A 3VXPB 1XGUB 4ONOA 4LVNB 1S7WB 2YOCA 1CE6B 5F3HA 4ODWA 4U6VH 1OTUC 4GMTH 2XZCL 1NAMH 1EEQA 2H2SC 3MJ9H 3UJJL 4EDWH 4LEOA 4I8DA 2BY2A 3ARBD 1M6OA 4J6RH 2P5ED 2H26A 2YRLA 4ETQA 2UVEA 4XCEB 4Y0GA 3PJSA 5ADOL 5I76B 2J6EL 3BH8A 3TO4A 3V5KB 2P24A 4WUUB 2A9NL 2E9JA 5MHSE 4NWUL 1Q94B 2ZCLL 3F7RA 3RWJA 4X99A 5DQJA 1LE5B 2RFXA 4ODVH 4OM0H 1HNGA 1YJDC 3QEGL 5D7SL 5DD6A 3IVKA 2I5YL 4AH2B 3QI9B 3O6MH 2EXYD 1A6ZB 1NJ9A 1FGNL 3GGWB 3BKMH 1CFVH 2CD0A 3MRKB 4GT7A 4AT6B 3VXQA 3BZ4A 2UYLB 3L9RA 5FGCE 3QEQD 1DDHA 4LF3A 2FH6A 2NY6B 4APQD 3KDMA 4HLZG 4N0CC 3UDWC 4XGZA 1BWMA 1RZJC 4JFFB 1I75A 3HKFA 2DTSA 4LU5L 3F7PC 2IADB 4PJ5E 1RUPL 4Y2DC 3SE3C 2KH2B 2VR9A 4KKAD 3LH2H 3KHQA 1KNOB 3BKJH 4OQTH 1CGSH 1BBJA 1I1CA 4KKCD 1NKOA 5DJDA 1LP9E 3FQNA 2Q20A 3LS4H 4K7PL 1IC5L 4PB9H 3IDGA 2ADGA 3QWQB 1XIWB 4YGAB 3RVTD 5HYIA 1UZ6F 3LDBC 1NGPH 2EH7H 4QXUL 1MCEA 5IR1A 2Y07L 4YBHA 1NBYA 5D2NA 4Y5YA 4Y4KD 5EBGA 2WZPD 1SY6H 3HNTH 1HHJA 3CFBB 4TSCL 4Z7WE 3TIEB 1GSMA 5C6TH 4HS8H 5FO7B 5HHNA 5ICXA 3CGTA 1JZ3A 3CX5J 2Y7QB 4KPHL 5L7XH 2ICCA 3QQ3B 5ECJE 3KPOB 1I7ZA 1AGEB 1U91B 4XP1L 4EOWL 4KKBD 3SE8L 5C8JB 4X5LA 5F9AC 1U8HB 3X3GL 2E7LA 1S5IH 1U8PB 3U7WH 3MV7A 4WO4D 4BZYA 5IT2H 1KJVB 5C0FB 5MERA 3CVHB 4CU7A 4M6MH 5EZIH 5C6PB 4EJ1C 1EHAA 1Y18A 3EFFB 4GKNA 2AEQH 1BVLB 3K80A 5HPOA 3ARTA 4IMLB 1VFAA 5CKGA 4X4XB 3BPCA 2IPUG 1AO7A 5JLZB 3K8KA 2X4TB 5GS0C 1AR1C 5FKAB 2WNGA 3J7HA 5C6WH 5F3HB 3LOWA 4OIIH 4P23C 4X4ZA 2E7HA 1KV3A 1NMAH 2WP3T 1SBSH 3RNKA 5JPMB 4YHKL 5E03A 4TNWF 4TUKL 4LVNC 3SKJL 1ZGLM 3TFKC 2HJLA 3KLSA 4Z7UE 1KTLB 4LEOB 1XF2B 2A1WL 4Q6IB 1G7QB 4L9DA 4K23H 3U7YH 3A67H 4FQQB 1J1PL 1G7HA 3PJSB 5TE7L 4CADB 1LO0H 3TO4B 4ZD3L 1IMHC 1DBBH 1HQ4A 2Z31A 3VXRE 2O5YH 5DQJB 3U4BH 2J8HA 4S11A 4XC1H 1E4XH 5TDPA 2NY3B 4CDGC 3PWPD 1XCQA 5DD6B 5A16A 4CMMA 2VE6A 3CSPA 1NJ9B 4RSVA 3ZYZA 3T0DA 1DQLL 4JGJA 4OZHE 5BZDB 1UA6H 4HUUA 3HI1A 3VGDA 4L3EA 3QI9C 4U05A 4K9EC 2VXUL 4H8WH 4D94A 2YPLD 3TBSA 4JEGB 5SX4H 5I1AB 4M8VA 5K33A 2FL5B 2P5EE 1A0QH 4XGZB 3T1FA 2IQ9L 3FKUS 4TULL 3G6AB 4XNZC 2ZUUA 3CDYA 3DGGA 3H9HB 2NY6C 3BRDA 1RV6X 1A3LL 1G9MH 3S36X 1XGRA 1LO2H 3RL1A 2EIZA 2ED7A 4WI3A 4L1DA 1BBJB 3K0WA 5J7CC 1S8DA 4YDJA 1P5UA 4LSUL 2J88L 5FYKL 3UTQA 2ADGB 1PG7X 1OP3K 3WFHA 4Z76B 1NBYB 4Y5YB 1XIWC 3QEQE 5L2JA 1UWEL 4JZJA 1T03L 3MOAL 4M1CD 5CINL 2C1PB 3B2VL 1JMZA 1DSFL 4LASL 1Q9WB 4UOJA 3ILPA 5KVEL 4KDTC 4HK3J 2CK2A 3U46A 5GJTL 1PGRB 3W9DA 1XT5A 4P5TD 3S96A 4OJFL 3STZB 1C12B 1Q8MA 3QXAB 3QCVL 3V6OA 3MRCB 4ZUUB 3T4YA 3BWAB 4ESKA 1JPTH 2BC4A 3MGOB 5DQ9B 3RWDA 3C08H 4GXUN 1OAZL 2EDLA 3I02B 3IJHB 3INUH 1XR9B 1T2QL 3VI4E 4XT1C 5JTWA 4JO4H 3MV7B 4AK1A 3F62A 5EU6D 4OV5B 1INEL 1WFNA 4YPJA 3OMZA 1NGZB 4GKNB 3ROLA 5EUOB 3O11B 3HRPA 5GGRA 5TF0A 1VFAB 4NQDD 1V7NL 1MCKA 3WKNA 3S4SA 4QWWC 2VABB 1DVFB 1PDKA 1TETH 4ODTH 4MA1C 1QBLH 4Y1AB 1UQSB 2DQDH 5DURD 3RBGA 2NY1B 5TF1L 4HHAB 2C7UA 5KBNC 3RNKB 3G9VA 1DLFH 3BQUD 3O3BA 5T1MB 5AAWA 3JUYA 2HJLB 1KCVL 4GQ9H 1FNEA 4IOSD 4EDXB 1OW0C 3REVB 4PJGA 4UNTA 3GRWA 1BFSA 2OJZL 2ED9A 3I6GA 2Q8BH 5D7JA 4KRPC 1EEZB 2X4OA 1HIML 5HDBE 4PJDB 2XN9A 4ZYKB 3QUXA 4JDVA 4NWTL 4R4NC 1OARH 3O6LL 1HQ4B 5C0DA 1GGBH 1SQ2N 3V0WL 3TO4C 1GGIH 2YSSA 2FECL 5LWYH 2MPAL 1XCQB 4YDIL 5DEGB 5A16B 4I2XA 2VE6B 4M7KH 1ZS8A 4JHAL 3VJ6A 4E42B 4E5XA 4LVEA 4CW1A 2R2EA 4OSUH 4KMTH 5JQ6L 2W65A 3L3DA 4PJHA 4UUJB 3V0VA 2FD6H 1YYLH 1FYTD 2KQMA 3REWA 3KPMA 4H20H 5EZOL 1FG2A 5IEHB 4NBXB 5F9OH 3FCTA 2XRAH 1T5XB 3LEYL 1OVZA 1UB6B 4FTVB 3E3QE 3RWCA 3N1MC 1KCRL 3O3AA 3W0WE 4YQXL 5C09A 3HRZB 1CVRA 4LSRL 3I6KB 3EYOB 2X44D 2EIZB 1X3DA 1I85A 4C55A 1B90A 2E9WA 4PG2A 3I2CH 5IKCB 5E9DD 1O5DT 1HDMA 1L0YA 3PWPE 3BAEH 4W70A 1FZKA 2HLFD 4GG6F 4FFZH 3I84A 3V4PL 3QCUL 4QT5B 4C57C 4RRPA 3WFHB 5IGXH 2IBZX 1BGXH 3D48R 1AE6L 1N7MH 2YPLE 3GDBA 1B88A 5GGSY 3C09B 5TE6L 4WEMB 1MLCA 5EOCH 1BAFL 5I1GH 1IC1A 1O7SA 1R3KB 4MA7H 5D2NC 4Y5YC 2RJMA 3U1SH 5C2BH 3U46B 2Z4QA 4XBPA 4CN1A 1FQ9C 2YZ1A 3HE6B 4FXLA 4X9IA 4UIMA 1B6UA 1YMMA 3MUY1 4HUXB 1BFVH 1U95A 1TZHB 2JCCB 2BC4B 1B0GB 1CICD 4HLZH 2OYPA 3QUMB 4U1SA 2P7TA 1BZ9B 5EIIB 4KV5F 3UYPA 1OSPL 3VRIA 3ESUF 4GAJL 4XVSH 4WI2A 5ISZD 1PZ5A 4XP6L 4PP1C 2E7LC 2BFVL 1RIUH 1WZ1H 4MMXC 3QQ4A 3GSXA 1F4HA 4N8VG 4NJ9L 4OCYL 3KNBA 1UKSA 2EO9A 4K8RL 5FV2A 4O02L 4G7VH 2BX5A 5DGQA 3MRGB 4W6YB 4MNQD 4HCRA 1R5VA 1JF1B 1KB9J 2P8PA 3QIBD 3D25B 4L9LA 1OM3H 5JOPD 1IVLA 4PP2A 4FQLH 3I6GB 5D7JB 4PRHD 3PHQB 2FX9L 1ODAA 3V4VL 1U3HD 3GSVA 5T5NF 4B53A 3QUXB 3JBG7 1JZ6A 4EKXA 1TJIL 4Z5RA 4RMUA 4LMQI 1NCWL 4NQDE 2B20A 1ZT4A 3FT3A 2YSSB 3VH8G 3AC0A 3GMRB 3LHPL 3NFPA 1P9MC 5MI0B 4P9ML 4TN9A 2Z31C 4PREB 4YK4B 1ZHKA 5LGHL 1DBAH 2VWEE 3VJ6B 3HE7A 1EZVY 4HPOH 4E5XB 5INDA 4CW1B 2FYYA 2R2EB 3FO2A 5EA0H 2V17H 2W65B 4PJHB 1DANT 4LPXA 3A6BL 1IEAB 1FG2B 2R29H 1F90H 3FQTB 4O2CA 3MRQA 3EOYG 3ZYOA 4WFHD 2NTSP 2DKSA 1MCOH 3O2WL 3F58L 3P9LB 3RWCB 1EEYA 5ACZB 3SE9H 2H3NA 3TP4A 5C09B 4WCYL 4NZUH 2YD3A 3RA7L 5F7EL 1HNFA 2PTTB 5TGBA 3OAUH 2VXVL 3MUHL 1IQWH 1C1EL 3RKDD 4X98A 3VFNA 3HAEA 1I3UA 5BRZE 4NZRH 1BFTA 1HDMB 2AK4B 4PJBE 4U6XB 1CXFA 3QH3A 3PP4L 3CXDH 3OKOB 5LGKA 2VLJD 2ARJA 5F72S 3EYQC 2VLRA 5TDOB 1FYTE 1SJHA 5JHDB 4NKOA 1YEDA 1BZ7A 4ZFFA 1DEEB 1HINL 5JW3H 4FZEH 4H25B 4LIQL 3BX7C 2AABL 3GIZL 4PJAA 2NTFA 4Z7WB 4JQVA 5B4MD 1X5GA 1FN4A 5ENWA 4KHTH 3GSWA 5E7FA 3BDBA 2ADFL 4G7YL 2CPCA 3G08A 1U9KA 2B4CC 4G43B 1CLCA 3FQXA 3VRJA 5T1LD 1SJEA 5D7IA 3KPRD 4LMQE 2D7PA 3UXFA 3VFMA 3C8KA 1MCHA 5EZLB 3UPRB 4KI1A 2DQEH 3V6OC 1DQJA 2FNBA 3VRIB 3QUYD 2F58L 3HMXH 2GK2A 1PZ5B 1QSED 1F97A 3KPQA 1RIHH 4HUVA 4KVNH 3MCLL 3NN8A 1RURL 4J12A 3L3GA 1MY7A 3HPLA 4OF5A 3ZDYF 1WBXA 2HJKA 2VDLL 5GRYA 5A43C 5HHQA 5KG9B 4HQQL 2FEEL 4HK0B 1KN4L 4OLXH 3FFDA 4ELME 4DQOH 4PTTA 4X7DC 3ARFA 4QOKD 1HSAA 3TN0B 2FX8L 4JFHE 2HFGL 5DJAA 1LK2B 3VWKA 2XTJD 3OWEA 4XBEH 4RMQA 1CK0L 4PRNB 2P8PB 5C86A 1BX2B 2ZKHL 4L9LB 3V4UL 2HFEB 1U2HA 3HB3D 3EOTL 4OD3L 4PP2B 4N0FA 3JZ7A 3ULVD 1ND0A 1K8DA 2GITA 3FQWA 2IAMD 5FF6A 3FT4A 4UTAL 3SDXF 1KXVC 3B9AA 3L3JA 2XFXB 3GSVB 2AJUH 2W1NA 5ISZE 2W0FA 4UV7L 4DCQA 1D9KA 5D7JC 4NOFA 3NA9H 4Z5RB 4QEGA 3O9WA 5IOPB 1KIPA 2GTZA 3FT3B 1KB5A 3QUXC 3NFPB 3D39A 2EE2A 1CI5A 1ZHKB 4I1NB 3UJTH 1D5XA 1LEGB 2N7BA 4RFOL 1KJMB 5INDB 3MREA 2FYYB 3FO2B 1RZGA 2WUCL 2R0LH 4YHNB 4NQEE 4PV8B 1PYWA 4GRWH 4YK4C 4D8PA 5ADPL 1IAMA 4O2CB 1QFWM 5BV7L 3MRQB 3RWIA 4JDTH 2P5EB 5BXFA 4QRPA 1JNLL 2GJZB 3MRNB 2H3NB 1TIUA 1IQDA 3H9SE 4MCZB 4OZIF 1NBVL 2BK8A 4CU6A 2ICWA 2CRYA 3MFFA 5IB1B 5TGBB 3C5ZD 1NAML 4EI6A 3CH1A 5HD8C 1FL6A 2DL9A 4KK5D 1T83C 5C9KA 3WL9A 1Q0YL 1A1NA 3FHQA 3WHXB 4N1CA 1P1ZB 2Y72A 3DX7B 3M17A 1YECL 4G8GB 4QGTA 3SCMA 1I3RA 5FKPB 3LRSB 5CD5C 2ARJB 4PG2C 4TNWK 4R0LB 5ILTL 1SJHB 4NKOB 1YEDB 3RHWF 4ZFFB 3O3DA 4PBXA 4PJFA 4IJ3B 3O2DA 4QF1A 4JY4A 1LNUA 3O4LD 4M1GL 4G9FD 3EO0A 4YH6A 4KHXH 2NTFB 1OAQH 1OWWA 5EC2B 5SV3A 3RJQB 3QYCA 3O6ML 1FN4B 4KK6C 1F2QA 1G9NH 1T0NA 1SJVA 4IMKC 3GSWB 4NKQB 4CU8A 2P44B 1OLLA 4DKFH 5BS0D 4FZ8H 2VITA 2PR4H 3OB0K 3FL7A 4M7LT 1SJEB 5D7IB 4QHKI 2EYSA 3C8KB 2Y06L 3FQUA 1AQKH 2ZJSL 3RUGF 4BZ2L 1EH9A 2NXYD 1AC0A 5DD5H 4G8FB 3JV5A 1S78D 1MOEA 5A2FA 5J6GA 1BQLL 4P4KA 3HC4H 4R6UA 3HHRB 4CVWA 3KPQB 3R1GL 1CR9H 4RISH 4HUVB 4U1LB 3RY6A 2VDNH 4Y4KB 3SY0A 3BKJL 4DN3L 3L3GB 2YC1A 2R23A 2H32A 4OTXH 4X4MA 5HHQB 2HJKB 4A6YH 5T3XD 1D5IH 3X14A 2OR9L 5CJ8A 1UEMA 2NY7H 5D70H 3FFDB 3S37H 3GO1L 3ZL4L 3CXHJ 4X7TA 1EAJA 3GK8H 4MD0B 3VWKB 2BZDA 1D5BA 5T1KA 3D3VA 4HEPG 5D2LF 3HZYB 3KPRE 2ZUYA 1FBIL 4RAVA 2QQQA 1BIIA 2COQA 3MV9A 5HJ3A 4ZFOL 1ND0B 4HS8L 1K8DB 2GITB 3QFJA 1OAYH 4L9LC 2X4QA 3L3JB 2XICA 4HF5H 2ZUSA 1QSEE 3G5ZA 3L3HA 3K4DA 1D9KB 3GJFB 4P59L 4OGXH 1GOHA 2JJUA 3O9WB 1KIPB 1OOAA 1ZWIB 5CCKH 1KB5B 3O3UN 1SM3L 1G6RA 3P0YL 3AFLA 4E41D 1MIML 5C08A 4XPAL 4F7MA 1HXMA 3NH7L 4QXGL 1MFCH 3P4LA 3QDGA 4JPKH 1PYWB 1ZHLB 1Z5LA 4GW4B 2FBOJ 1R6VA 4D8PB 3ME0A 2NLJA 4HV8A 3ZYIA 2QQKL 4X9HA 5DFVD 3LKNA 5HPMA 1UWXK 1YN6A 1JGLL 1TNMA 3RWIB 5DTFA 3U6RB 4FP8L 3Q6FA 4QRPB 2GY7B 3IRZA 3X13A 1IQDB 3BP5A 4BH8A 2OR8A 2ICWB 3GMLA 4N9OB 3MFFB 5F7KC 1IEHA 3WFCL 1H3GA 1KYOJ 2DIJA 4WU7B 4PGCA 2BMKB 1CS6A 1XH3A 4GRLD 4XB8A 4R97B 3EO1A 1A1NB 3D2UD 3OXRB 3M17B 3JTTB 1LHZA 4LPUA 5DLMH 3GSNH 4O00A 5KJRH 4KTDL 1GPOL 3QULA 4XNUH 4EN3A 4KJWD 5IHLB 2VR4A 1ZHNB 5DK3A 4JAMA 1MJ7H 5F9JA 1ZTXH 4G6AC 2EXYC 3HZKA 4P46D 2APVA 1LNUB 2EKSB 4MX7A 3ECBA 1Q38A 3ARGD 3EO0B 4KQ3H 3FB7B 5ID0A 4R0LC 4CVXA 3PIQA 5I9QC 5I1IL 1TXKA 4MB5A 4KZDL 2CGRL 1T0NB 2GCYA 4MDIB 5D2NE 3TBTB 4XP9L 4JQVC 4Z7VE 3SOBL 2CIKB 4JPVL 2FB4L 2EYSB 1A22B 5JXEA 1ORSB 1RIVH 3DECA 4O51A 1A0QL 4ZOBA 4I13B 3EYFA 4ZUVB 4M93B 1T7ZA 5GSRB 4P4KB 4BFGA 2EECA 3UTZB 3MV01 5E2TH 4ZMAT 3CZFB 1Z0NA 4G9FE 2GTWB 2YC1B 2YK1H 5GRJL 2C9AA 2NYYD 3N85L 5CIPA 3VD5A 4XMLL 2XN9D 4X7TB 3QZWG 3DXAD 1MI5A 2QHRH 2VSCA 4MS8C 4P5TB 2D7NA 3GB7A 5BS0E 2XACC 1MJ8H 2X09A 3VG0H 4RAVB 1AO7E 1IBGH 1BBDL 3VWKC 4PRID 2DBLL 4NKDB 3S4SG 1T7YA 3QFJB 3ROOA 1GYAA 2X4QB 1DP0A 3KWWA 3O2VH 3VFPB 3DSFL 5EU6B 1WC7A 2E6QA 1VKXB 3UPAA 2VDOH 3L3HB 1I9IL 2GK0B 4RMVA 3STLA 5GGTA 1NCCH 4LSPL 5DGRA 5EO0B 3L1OH 4WFGD 2SEBA 5CUSH 3UAJC 1D9KC 5I66B 2P8MB 3NZHL 3O9WC 4YDKL 1J8HA 1YEGL 1T2JA 4TUJA 3TF7C 1WZLA 2NR6D 3WN5A 1I8LA 5HGBB 5KVGL 3QDGB 1Z5LB 5EN2A 3WFDH 2NLJB 2VLKD 1IKNA 2EXWD 4ELKB 3KYKH 1MAJA 1INQA 3PL6A 4ODTL 4UZGA 1NBQA 3X13B 1NFKA 1T0PB 2BOBA 4BH8B 4AENB 4PYGA 4K3GA 4L3EE 1DLFL 1GVIA 4WI8A 3VXUA 3GMQA 5D1ZA 1ZLWH 3GMMA 3L5XH 3C87A 4YE4L 5HHVH 2NNAB 1A6TB 3TA3B 3OJMB 3EO1B 4C83B 5I71B 4MAUH 5FYJE 4NHCH 3QXTA 3GHBH 1YEJH 5AWNL 4EN3B 2E8YA 5TFSH 1M7IA 4JAMB 3SCMC 4Y4FD 1YNTA 4OD1L 3WSQH 1OT2A 5I8KH 2YXMA 4J8RA 1H3PH 1NCBH 5LWYL 2FLBT 4UIKH 4AY0A 5IWLA 4NC1C 2OQJA 1L9MA 3KLAA 2IQAA 1IFHL 5HDOA 3TCLA 2XY2A 4WHYG 1VGEH 1EHXA 1I1FA 2DD8H 3X12A 4CVUA 2DMBA 4RRPG 2FATH 1NLDL 2EZ0D 4ZPTB 4Q9QL 1X5HA 4L5FL 1F4XL 3T3MF 5HSFA 4JR9L 4XZUA 1TQCC 1OGTA 2X6MA 5I1KH 1ACZA 4K3HA 5AYUL 1P84J 3BI9X 4JG1L 5E5RB 3SO5A 4X6DB 1I9RH 4O51B 4PIRF 5E9DB 5DZOA 3D9AH 4Z78B 5FHAH 3VE0B 3QA3B 5JDJA 1FPTH 2O5ZH 2ICES 3LV3B 1FL3B 4X8JA 1T4KB 4MJ5B 2BOCB 4M93C 4P4KC 4U1MA 4JG0H 4OFPA 4IHOA 1CLOL 4KK9C 2VQ1A 5IVZA 4RDQF 5B3JF 3TEUA 4FABH 3BW9B 3AMLA 1HH9A 1JUFB 15C8H 2CIIB 3D1MC 5CJOL 4F8TA 1AHWA 2JK5B 4BYHA 1FFNB 1CICB 5HI4D 3D6GA 1IRAY 3KPNA 5DS8A 3ROOB 5E95B 5IW1B 1U8KB 2B2XL 1Z3GL 4PJCE 3NIFE 1M7DA 1WC7B 5DEZA 1RULH 5FXCH 3RWFA 3PWLA 1N0LA 5KS9A 1NCAL 2XWBB 1ETZB 3P0VH 5K59E 3IT8D 4H88L 3B6SB 2Z8RA 1GJIA 3BHBA 1QBML 5E2WL 3GJEA 2XN9E 3K46A 2ZWLT 4JRXD 1VFOA 2J6EA 4OB5H 4LSQH 4F9PC 4MNQB 5HGAB 1GAFH 4FNLL 3VGBA 3T0EA 1ACYH 2VQTA 2CLVA 3PHSA 5ALBH 3QIBB 3C9NA 2BHZA 3BO8B 4PRIE 3ARED 4I2XE 3QG7H 4Q9CA 4G5ZL 2Y6SD 2ZCKL 3MRIB 4M03A 5CEYB 4G7VL 2AJVH 4P3DB 5FK9A 4PRHB 5C3LD 2UUDH 1NAKL 4MWFA 2BOBB 3C5SB 1U3HB 4LL9A 3VD3A 2QSCL 3GMQB 3VXUB 5D1ZB 2VZSA 4RBPH 3OGCA 1F42A 2JKXA 4WFGE 1QHPA 4OI9A 3UZQA 4UQ2B 2WV3A 5D5MB 3BISA 4WI7A 1JPGA 1JNJA 3TA3C 4N0YH 1UM6L 1QLEH 1M7IB 4OZGF 3LB6C 4J3UA 2XQBH 3TBYA 5JO5A 1PKQB 2X10A 1YNTB 1MAKA 3FZUD 3HC3L 5DJ6A 3RVXC 2IPTH 2PETA 5IBLD 4EN3C 4J8RB 3HAEG 1KCUL 1W0VB 2HTLC 5B21A 2VC2H 5IG7A 2OQJB 3UTSA 5IQ7H 4DGYL 4X6BB 4HPOL 1MJUH 3QXVA 3FN0L 3S3SA 4HJGB 4M43L 4BH7B 2AVGA 4ONFL 2PO6A 1HHHB 4XZUB 5IB3B 4IDJL 5DQDH 5H37G 4QRSA 4HWBA 1UVQB 2FO4B 4AMKL 3NMEA 3ARFD 3QO1A 4F33A 2Q76B 4J3SA 3QG6B 1WUNT 2Q7NA 2VLJB 5JHLL 5JXEC 1YMME 2I60L 4YXKH 5EG6C 4KZEH 2PNDA 2DDQH 3I75B 3WBDA 1FIEA 3QDJA 4XX1G 1RZIA 4UNUA 1MELA 5DHYA 1G7LA 3MBEA 3F7YA 5BOZG 1S7VB 4G6FB 4O4YH 5FYJH 1A47A 3JV4A 3LIZH 1EBPA 3EJZD 2VUOA 1RAMA 5DJ8A 5DI8A 1XGQA 1IAIL 4QYOA 1M4KA 4Y4HD 4F3FA 1FO0B 4LLWA 2DYPD 3PWVA 4XBGA 1HH9B 3A6CL 2A6DA 3MSPA 5D1QD 3O81A 5T1LB 1F6AA 1AHWB 3IJYA 3KPRB 4JRYD 2AXGB 2HT4D 1G0DA 2DN7A 1Q1JH 4KHTL 1CICC 3CNKA 4LK4A 3QUYB 4HJJH 2W91A 3GEWB 4J1UA 3RWFB 3PWLB 1AR2A 3IETA 5FUOH 3VXMA 4YFDB 1IAOA 5E8NB 2WBJD 3N9GL 35C8L 3LEXA 1U6AH 1NBZA 1C5DB 3EYSL 4EQ2A 1DQML 1K4DA 1WAAA 4LPVA 3R0MA 2ID5A 4WI5A 4QOKB 3DROB 4ZNCD 5E0QA 3OAYK 1MRFL 4YHZL 2XTJB 4XMKL 3WO4B 4MJID 1P7KB 2R0KH 2CLVB 4H0HB 3IYLW 4JFYA 5EO9A 4B7LA 4NO2A 2CQVA 2F54A 2XZAH 3EW3B 3CFCH 1I8LC 4KRMB 4HXAL 2OL3B 1U3JA 3DSNA 5FK9B 1AP2A 5CGTA 4L8CA 1JTPA 4AL8L 2DQHL 2V6HA 4OLZH 1J18A 4UOW1 1G7MB 2J7LA 1B4JH 3U2SB 1EX0A 3OGCB 2NXZC 1EPFA 4GRWF 5J4MA 1QNZL 3SGEH 5C0GB 4KJYB 2IG2L 5D1ZC 4H1LA 4JRXE 1B2WH 1CL7I 1CXHA 4OF7A 3CC5A 2E8ZA 2WQ8A 1KG0B 3TBYB 1MPAL 4MSWA 3TNNA 4DUXA 1NFDB 5BOPA 4X6CB 5DJ6B 1FZMA 4UTBL 3QHFH 3WFBH 2K7PA 1F3DJ 2D7OA 3WUWA 3IDXL 4JJ5B 3DUSA 1OGAD 5DD3L 3OAZH 3EJJX 1A4KA 1KXTB 2VLRE 4N8CH 3AAZB 4X5WA 3S5LG 2ARWA 5IWLC 1T0MB 3H6JA 3C5ZB 2PO6B 5JPNB 4PJAE 2HKFL 2DJUA 5EU7E 4QRSB 2NX5D 3WNMA 1JYNA 5SWQB 1W72B 3EO9L 5C7XL 5I16A 4AEHH 4JM2D 1UACH 2ZOKA 2EC9T 4NZDA 3UBXA 5K9KA 1NCDH 4LQFH 4G8EB 5DVLA 4XX1E 4OGAD 1FAKT 3FFCA 2VXSH 3QDJB 4AEIH 2VZVA 1Q9KA 5DHYB 4XAKD 3ZT5A 3O4LB 1J12A 2AJSH 4I3RH 4Q58C 1JV5A 2O26U 2OS7A 4POZD 5BO1L 4QYOB 5IVXA 4JZOA 1OQXA 2X4PA 1J9CT 3MFGB 1RSFA 2A6DB 1FRGH 4OF0A 1CT8B 3HMWH 4XPTH 1A6VH 4NQSA 2EDKA 4ZUWA 5DUPH 1R3JA 2HVJB 4PLJC 2RAMA 1ES0A 1YC8A 2H45A 5ICYA 2GW5A 4KWUA 4WHYH 1AHWC 4NT6A 1VADB 4W6XB 1YJDL 4J1UB 5F7WC 1JPST 1XF5B 3IETB 4IM8A 5EBWB 3OKNA 2PR4L 1NSNL 1IAOB 1TTGA 4Z8FL 3DJ9A 1WTLA 2X4UB 3H7LA 3QUYC 1CE1L 5GGVY 4M62H 1G9EA 4JFQA 3MRRA 3QJFA 5DHXB 1AI1L 1EJ6A 3MMEA 4UINL 2KDGA 1DANU 4HKXB 4NO0D 1ZVSA 1RZJL 1MCBA 4JFYB 5EO9B 3D39E 4JRYE 3BD4A 5J11B 1RUAL 1F3JA 3WO4C 2HLAB 2V5RA 1ZANH 5DYOB 4HC1A 3LPFA 1ZOXA 4DVRL 3IAQA 1QVOA 1XGYL 3FO1B 4NN7B 4NRYA 3T2NH 5ICZA 3DX6B 5LCVL 4IRSA 4HBCL 3IDMA 1HHGB 5DJXB 5ITBH 1Z6JT 3GMNB 4NN6B 4KTEL 2ZG3A 1NDGB 3S34L 4H1LB 2CMRH 3CK0L 2YMXL 2FIKA 4I4WA 4E41B 3Q3GA 3CC5B 1C16A 2AV7B 2BJMH 3H0TB 4HCRH 4YWGL 3H3PH 3V5DA 1YQ2A 4MJIE 3UTTB 3TNNB 2YA2A 25C8H 4OT1H 1FZMB 5AZ2L 1YYML 2FEDD 1KEGL 5F1OB 2Q87A 3O6FA 4ZXBA 4HT1L 3WUWB 4D3CH 3DUSB 3QNYA 4MLIA 4OZFB 3RU8L 1HE7A 2I07A 4KH2A 4X5WB 2NQCA 4DKDC 4NRXB 5HXMA 3IFOA 1QPPA 2VZUA 4PJFE 1R5IA 5LBSL 1TCRB 4K2UH 4FFWD 2IBBA 5ID1B 3IRPX 7CGTA 5F6HJ 4PY7B 3BWUC 4HPYL 5KOMC 2VERN 3D2UB 4MQTB 2HA1A 3C5ZC 2PO6C 2ZOKB 4IRJD 4XWOD 2X1XR 3PDOA 3RVVD 5F1IA 1EV2E 1UM5L 3FFCB 3VA2C 5GS0L 4N90D 1HEZA 1U41A 4RMSA 1VFMA 1OTSD 4PY8I 5FYJU 5DO2C 3ARGB 5CWSA 3GMOB 1BOYA 1RK0A 4DGVH 5CMAA 4YBLB 4LP4A 1OGAE 3IFLL 4XNUL 4JN2A 4X6FB 8CGTA 5ANMB 4NZTL 4NQSB 3V6BR 4ZUWB 3HAEH 1R3JB 1U36A 3UO1L 1UFUA 3BH9A 2NX5E 1S7QB 5ICYB 3I9GL 3VRLE 3WJLA 5EU4A 1J1OL 4OD2A 2WWKO 4YXHL 3HN3A 4Z7NF 1U0QA 5MEOA 3D3VE 1T1WA 2XIDA 4JZNB 1SEQH 1QYGL 3JWOL 4PG9A 4PBVC 1B0RA 1R24B 1QLRB 5M7QA 3OKNB 3VMPA 3C60A 1CDIA 3MV9E 1T22A 5H37H 5CBAB 2FJFA 4W68A 2I9LA 2X40A 3MRRB 4QHUB 5DD0H 3DI3B 4K9EL 4QHNB 3PXJA 4P57B 3ESVF 3DARA 3DXAB 4CL7A 3TBVB 2DLHA 2QSVA 1VA9A 1L7IL 3T65A 4DKEL 4ZG1A 3S3JA 1J1XH 1KT2B 1ZVSB 5CS7A 4WWID 1TPXB 4HKBA 4U1HA 2PYEA 4HG4K 1H5BB 3RVUD 3RPIA 3L7EA 3V0AC 4M48L 1WSST 4P9HL 5FGBA 4DN4H 4KI5D 1N8ZA 4JCLA 5C08E 5F1KC 1I8MB 5JUEL 4ETYA 5JXAL 3VFRA 1GXEA 5J11C 2QHRL 2VZ1A 2MOVA 4IRSB 2ZG2A 4XVUC 1VENA 2R1XB 3IDMB 4KJPC 1F02I 2OP4H 2OK0H 3R0NA 1T66C 1Y6MR 4UDUA 2P5WA 1V3MA 2ARJQ 3QDMA 4RFNC 4K3JH 1QLFA 1PEZA 1T3FB 1S9VA 5GRVK 2VLKB 4HZAA 1RI8A 4ZUTA 3MV8D 4DFHA 1VGKB 3O6FB 1JBJA 1RHHA 3DBXB 4D9RD 5CHNA 5C0NC 1PG7L 5IBUG 3P30L 1ZA3B 2W60A 3KJ6H 1CLZH 1MEXH 5BZWB 3L95A 3STBA 2B1HH 5DJ0A 4NO3A 3IFOB 1N6QH 3WD5L 5D7LB 5J3HC 3TJEL 2E7CA 4JHBA 2H6PA 3KYKL 2V2XA 2FBJL 1YEHH 3MGTA 4Q2ZB 2GJ6A 4PLKD 2WIIA 5MEQA 4V2BA 1C5BL 5L2KA 3CVHL 4UT7L 5IFJB 3PDOB 4MQ7B 5GISH 1X7QA 5KVDL 4RX4A 1G7JB 1FG9C 4Y4FB 4OCWH 2YPVL 1HQRA 5I15H 5D71L 4MAUL 5I17B 3T04D 3O45B 1RK0B 2AQ3A 3MRPB 4K3EL 4M4RA 5E5UB 4ZODA 3GHBL 5CMAB 4Z7OE 1U93B 4L8SB 4OLWH 1PSKH 3TBWB 5D1XD 4F7PA 1C8PA 2KZ1B 4JFOA 3C6LD 3ULSB 4UT6L 3X3FL 4M6NL 5CSBA 1GGCL 5C0AA 4MA3A 3TPUB 4GUPA 5FCUL 1UXSA 3P11L 1GGYA 3KPLA 3L5WA 1MI5E 5SWSA 5MEOB 5B38B 2NY0D 4NN5C 1T1WB 4TRPH 3EGSA 4OLUH 1B0RB 2BCKA 2Z93A 3ZTNH 3DLQR 3C60B 3O2DH 1Q9LB 2CSPA 1YNLL 3VWJA 5I1KL 3FHAA 1KBGH 4UT9L 2Y5EA 3IFNL 2FHBA 2O5XH 3SDDA 1LVEA 2I9LB 5HHPA 3BIBX 4NKIL 4MXVF 2AP2A 1KUMA 3D9AL 1LWRA 4X4YA 5F89A 4OKDA 3MO1B 1XR8A 2HYMA 4M61A 4OF8A 1EO8L 1ZEAH 3T65B 2YD9A 4LOUD 1E28A 1I1YB 2Y5TB 4LLYB 3WYRA 2UWEE 5HVHB 2WM0A 4X7CC 4Z0BH 4ENED 2X2YA 3ZDXF 1N8ZB 4DEPC 1J8HE 1TPXC 4H26A 4YX2H 2VZ3A 2YUWA 3C5JA 1AD0A 1I4FB 4YDLB 3GHEL 3VFRB 4M5YH 1FSKB 2ZPKL 4XCYB 1W8NA 4DZ8A 4FQXD 2MFNA 1P7QA 5M95B 1FORH 1PX3A 15C8L 1A9BA 4OCRH 4NQTA 2H32H 5GGVL 4P2OA 3EJYC 4IRSC 5C07D 4UDUB 4M9OA 4Z6AT 5IMOA 4JRXB 4AIXA 1ZLVH 1QTYT 4BK5A 3DOSA 1QLFB 3B8YA 1IL1A 2DRUA 1ONQA 3PQYD 4HKZA 4N0UA 4HIEB 4KI5E 5DT1L 1RHHB 1I8IA 4C56A 4GKOA 2XA3A 1TQBB 4DWHA 3NFNB 3QQ9C 2W60B 2ESVD 4LSQL 1CD0A 4CDHA 3O6FC 2ED8A 4ZXBC 4I3SH 4MD4A 5AD0B 3GIVB 3WXWH 4TTDD 2V5TA 4KJQD 3QIUA 3E2HB 2V2XB 4MCYA 4YHOL 1G6RH 3MGTB 4M4PA 4IDLA 1RU9H 1P4LA 1QSFA 2J12B 4LCYA 3I50L 2V7NB 3HFML 4PJDF 3SJVD 1X7QB 5DK2A 2BVQB 1AXIB 1BQUA 2GYSA 4DW2L 3WNOA 4CVZA 4RMTA 3OHXB 1J0JA 4I77L 1HQRB 3MV8E 4YIQA 2QQLL 3AS2A 1G6VK 3QFDA 1BD2D 1VFBB 3BE1H 5IBTL 5C0EA 2HP4A 5IHZA 5DJYB 3TT1L 1CLYH 4F7PB 3IFPB 2R0WL 3CSGA 2MQ3A 4JFOB 5AZEH 1WCBB 5CZXD 4JO1L 3OF6A 1H0DB 1N59A 2JB5L 4LKCB 3ZKND 1J5OH 4GG8A 2VL5A 4S2SA 5E94A 3F7VA 1F6FB 3HCVA 2G9HB 3UCRA 1MFBL 3VGGA 4K8RC 1MCJA 2UZIH 3KXFD 5C1MB 3Q1SL 3KPSD 2ZSWB 2BVPB 5H94B 1LD9A 3WJLC 3EGSB 4DVBA 4LAQH 3IXTA 3WLWC 4Y5XB 3MC0A 2MHAB 4YHLH 3VWJB 2C3XA 2WSKA 5DQDL 3HUJB 5I1JH 2ITDA 1ADQH 1M7XA 1EO5A 4BA8A 4KUCF 1YNKH 2OCFD 3C60C 3MA7B 4G80A 3RTQA 2IANB 5FM8A 5I75B 2V7HB 3RAJL 5KS9E 4X7SH 4XTRD 1NC4A 5EOQH 5IMLB 1JHKL 3HG1B 3LD8B 4FQIH 2YBRA 4MNHA 4U31A 5D1QB 1CU4L 4LHUD 4NHUB 3QNXB 5I2IA 4H26B 3LIZL 3MZTA 3TGXA 3C5JB 1AD0B 2WUBL 4JM4L 5D2LA 4DZ8B 3LEVH 3L5JA 5FGBC 2DQFB 3HZMA 4FQ2L 3T0EE 4U6TA 3GKWH 4UBDC 3DWTA 1E4KA 1EMTH 2B5IB 1A9BB 4N9GB 5H8DA 5JZ7C 2BNRD 1A7NL 5FYKD 1FSKC 2WBJB 1QUNA 1AGCB 1E4WL 5CIPH 4JANB 3D18A 2BSED 4GKZB 2QQNL 4HMCA 4MXQC 3VXSD 1IGJB 3T0VA 1IC7H 3G6DH 3KPPB 3W11D 1ONQB 1AGFB 2BNQD 5CEXA 1YUHA 1VDGA 4FHBD 5DJ2B 3SQBA 2B4CL 4N1HB 3PABB 4PJ9A 3PV6A 3WEXA 4U6YB 2X5PA 4IIQB 5BVJB 4L29B 5GS1A 1D5ZA 4RNRB 5L0QC 4MD4B 1RZKH 3QISA 5HYFA 4P2QD 5FCSH 3NIFF 3C6SA 3PWNA 5ELIA 2HG5B 3D69A 3WE6B 1MRCH 1VCAA 3QUML 4KKLC 4PJGF 4X8XA 1QP1A 3PGDB 1QSFB 1OLZA 2EDNA 3T4AB 3E0GA 1HHIA 3MNVA 4YPGA 4ZOEA 3E2HC 3AS3A 4IS6A 2YKLL 3LKSB 5DK2B 3PQYE 4CVZB 1EIBA 4KRLB 2AKRA 3EUUA 5HI5C 4PJ8D 1WCQA 1A6UL 3B2UC 3LQAC 4GH7B 4PJIB 3NCCB 4Q9RH 4TSBL 2IJ0C 5IHZB 3UBXG 3FZUC 2ESVE 1U92A 2XWJB 3IAGC 3E6FA 4G6JL 1L9NA 3BEWB 4PS4H 4XPHL 4ZPVB 4PRAB 1QRKA 1JF6A 5GRZA 3QJHA 2AJYH 3GI9L 1UZ6E 4GG8B 3B83A 4PJHF 4UILH 2VL5B 5KANG 3UROR 4S2SB 3F7VB 3GRWL 5GZND 5D93B 3HCVB 4K94H 1WISA 4A2MA 3OKEB 4HXBL 5FECB 1P69B 4Q6YA 3ARUA 1RZ8B 2E3VA 3ES6B 1YPZA 3FRUA 4PJEA 2P8LA 3MTRA 4JM2B 4AG4H 4ZS7L 3GI8H 4ZQKA 1HKFA 2IFFH 3DV4B 3C2AL 3QO0A 3V52H 1MHHB 4I9WD 4M7LL 1KFAL 5E8OB 5DZLA 4NFCA 1G0YR 3D0LA 5FAAA 1IM3B 2RB8A 4AEHL 5A3IC 4Y5XC 1IZKA 4HUMB 3UTOA 2A9ML 3RTQB 4JKMA 3VWJC 2C5DC 2E7MA 3VW3L 2DWEA 3SDDC 4FQ1H 1TJGL 3MLZH 3OKLA 3U30B 3VXME 1BREA 1J0ZA 3T77A 1A1OA 1MHPH 3UMTA 1K6QL 3DO7A 1NC4B 1NDMB 1RZ7H 4FG6C 4LRNH 4J23A 4HH9B 4ZUSA 1IT9L 4Q97A 1GIGL 1M05A 3F7QA 4I3RL 4LGPB 3U0WL 5I2IB 3RIFF 4PUBL 5HDQH 3LD8C 2NZIA 5D1QC 5T3ZL 3KXFE 5ESAA 1FGVL 5KANI 4OFYA 5ETUB 5K9OA 4ONGL 2F54E 5EC1A 3MRJA 1FL5A 5CP7A 4YGVA 4BSWA 4JO2H 2A0LC 2JJSA 1GOGA 3ARSA 1TCMA 4OGZA 3BN3B 2F5AH 1A21A 2WINB 3MACL 4PRPA 4BFEA 1JWMB 1KJ3L 4P2OC 4XNYH 1QRND 2WBJC 2P45B 4LARL 5AEAA 2BHUA 3CFEB 4WW2B 5K93A 4MLSA 4NO0B 7FABH 1JP5A 5AG9A 4UOW0 1YUHB 5I30L 1XZ0B 4R7NA 4GBXA 2CDGB 3PV6B 3RFZC 3WEXB 5DRZB 5DJZB 3QUZB 4V1DA 1IC4L 3OTTA 4N5EC 4PFEA 4DOHB 4NCC1 2FJHA 1LO5A 3T8XA 5L9DH 2BNRE 4LSTH 1CGVA 3C6SB 2R9HC 5FYKE 3BP4B 4PTUA 2EYTB 4F2MA 2W9DL 5ADOH 3F65A 4XP4L 3IJSA 5F7DB 2NPLX 2J6EH 2IWGA 3VXSE 1KF9B 2NW2A 1RUML 5H2BB 1HHIB 3QIUC 3SDCA 1FVCA 3IDJB 4NWUH 2ZCLH 2FECI 5CD3B 4HS3A 4K7FA 3Q0HA 4KK8D 2ADJB 4HIXL 5E56A 2BNQE 3FB6B 5ITBL 2G2RA 5D7SH 2M1KA 3QEGH 5HI3D 4HULB 2C3VA 3HC0B 3MV11 5T33L 1FGNH 2R2BA 2X9YA 5E6ID 4ODHL 1P4BL 1DBML 4J7RA 4HCRL 1MAML 3E6FB 4ODBD 1Y0LA 4P2QE 1FH5L 3RVWD 2BVOA 2F74A 3L3IB 4XPGL 5I1CL 4LVHB 1T7VA 1YPZB 4PJEB 1ZLSL 1YN7B 4LU5H 1MRDH 3UZVB 4IRJB 4PGBB 5IVXE 2A6JB 4ZAKA 5FA4A 1GRWA 5GGQL 1AXSA 1IM9D 3KAAA 1AGBA 5D93C 1KN2L 4JKKA 3U36A 4JKPL 5KSBB 3FRPA 4YBQD 4ZQKB 5HDLA 3AS1A 2DIAA 3QO0B 4JM2C 1LO3L 2X41A 5CGMA 4K07A 4HZLA 1IC5H 3ISWA 2HT2C 4UU9A 1EJOL 1AQDA 2LAGB 4RMWA 3QPQC 3D0LB 1L6ZA 3GSQB 3ZDZE 1KPUB 2A83B 3MR9A 1JK8A 1MHCB 2DWEB 2OTUA 2Y07H 2VXTL 2QADB 1UG9A 1UENA 1A1OB 3S88L 1R3HB 1K4CA 4TSCH 3RTQC 2NY4D 1NCUA 3K7UA 2ZP0T 1J7VR 1CN4A 3H2WA 4PJAF 4KPHH 3GBMH 3MRMB 3LSOA 5FDWA 4HWZB 4W4OA 3ARDD 4URTB 5IIEB 1TTUA 4XP1H 3CLFH 3RI5F 4QY8B 4HKJB 4CJ0A 4EOWH 3MRJB 1FL5B 1T1YB 4HMEA 3SE8H 5CP7B 4WWKD 1V3LA 3TJHD 3X3GH 5D7IF 1E4KC 3CFKA 4JFEA 2OTWA 3LS5L 4PRPB 1MCLA 5EOTA 1H3XA 4KMQA 4LEXL 2WP3O 3N06B 5L8KB 1X5IA 5C0RL 3G5VB 3QQNA 4R4BB 3TT3L 3UEZA 4EXPX 1HOCA 1QPXA 4HS6B 4HFWB 4XP5L 4WW2C 2PCPA 5T5NG 4KXZH 1T1XB 3LRHA 4V1DB 3VU2A 4M6AA 1GZPA 4YHKH 4ZOAA 4TUKH 2X4SA 4Z95L 3SKJH 1XCTA 3DIFA 3JSSA 4PJ9C 3IDUA 1A9EB 3QUZC 2A1WH 4NYLA 5E8DL 5GS1C 5I1LB 5C0BD 3DURA 3OQ3B 4F2MB 2YD4A 1J1PH 1HI6B 1W0WA 4KU1A 5TE7H 4QHMA 5EZJB 4ZD3H 2PKDA 4ZO8A 2NW2B 5JW4N 3VD4A 3SDCB 4XH2A 1ZGLA 2Q86A 1QRNE 1KACB 2R39A 2XG4A 4YLQT 5DRXA 5CGYD 4HS3B 3AXLB 1CYGA 5IFAL 1GOFA 5C0AD 2IH1A 2VN7A 3EHBC 1A8JH 5KOVC 2OK0L 2B1AL 4ZDHA 4NQCD 2ZUQB 5KZCD 5HGDA 3RZCD 3FO9B 1E0OB 4LHJB 2C3GA 4ZNEE 1DQLH 2VZTA 4OZGA 4RGMC 1MQ8A 3S7GA 1VPOL 3N50A 4NGHL 1Y0LB 3IXAB 2ADIA 4YEEA 1IEBB 2JTDA 4LKXB 3ZMRA 3BRFA 2IQ9H 4TULH 4OUOA 3WIFB 3NCYP 2VH5L 4PJXA 1ZA6A 4EBQL 3QEUA 2DWDB 2DLFL 2X1WL 4RAHA 4BSVB 2DKMA 1A7QL 2VLLA 3KJ6L 1AXSB 1A3LH 3CIQA 1AGBB 1EAPB 1T6WA 3U36B 3DYOA 3B3IA 4JFDD 1F11A 1KLGA 4LVHC 1NGQL 4KKNA 2HH0L 4IRJC 1XEDA 4XWOC 1XF3B 3W5NA 1KB5L 3DMMA 3IU4L 4MQSB 4LSUH 2J88H 3RVVC 1U8OA 2P42B 4LSDA 1B6DA 1MHEA 1CBVL 4XVJL 3SGDI 5KN5A 1FZOA 3RDTD 4LCWD 2FHFA 4TTGA 1NFIA 2AV1B 5D1XB 2OTUB 3BPOB 4OCXL 3BP7A 2J5LB 4JHZA 3C6LB 3X11A 1CCZA 1UWEH 4KV5E 3QUKB 3WLBB 1T03H 3MOAH 5CINH 3B2VH 5CJQL 4PJFF 1DSFH 4LASH 2QADC 3DVNA 3BKYL 1MLBB 4F80A 5JW5B 5KVEH 5GJTH 3ARXA 1RMFL 4OJFH 1JWSA 3QCVH 1M71A 2OSLA 2PYEE 4QNPE 2VISB 5MP6L 1DUZA 1U8IB 4WY7L 1OAZH 1T2QH 2WQRA 2V2TA 3FTGB 5E00A 4C56D 1WBYB 5DDHA 2IPKB 4JFEB 1INEH 2OTWB 2AQ1A 4JY5L 1IGML 2DQUL 4JKWA 1LDPL 1UJ3A 2JJSC 1XGPB 1E27B 2BDNL 1ZXQA 4BZ1L 1V7NH 2FEEI 5FOBB 3P9MB 2NMSA 3MNWB 1X6LA 4UB0H 4JLRA 1CDBA 3O8XA 3QDME 5TF1H 5EU5B 5HYJD 1TJHL 5JORB 5IEKB 2X4SB 4GBXC 1XCTB 3DIFB 4FQXB 4OCNC 4CMHB 3TZVD 1K9TA 3QNZB 5C0IB 2OJZH 1LEKA 5F8QC 1ITCA 1HYSD 4R2GD 3WFZA 1HIMH 5C07B 5E2JA 1FIGL 2AK1L 5EIVA 3VCLA 1AIFA 2O61B 2CO6B 6CGTA 1JNNL 2R56L 4NWTH 4LSVL 3CDFA 3O6LH 3OZ9L 4LIQE 3V0WH 4PPTA 4P2RD 2IH1B 1MIEL 5IK3A 4Z77A 3RJDA 3SDCC 4ZDHB 2MPAH 4C4KT 4YDIH 3MLVH 2NZ9D 3NPSB 2GJ6E 2V5MA 4JHAH 5DMGC 1ZSDA 4BKLA 1K5NB 4HC1H 4NUGL 5GZOD 5L2KE 2X89D 4JPIA 1BMGA 5JQ6H 5TPWL 1YEIL 3HI6L 2ZUQC 3PHOA 5EZOH 2ADIB 2YD5A 1F4YL 3MRFA 3LEYH 4ODXA 5C70A 1BFOA 5E2UL 4HUKB 4HUWB 4P2CG 2UY6A 5EORL 5T1DL 1KCRH 4JFZL 3MRHA 4JN1L 4PJXB 2OR7A 1ZA6B 4YQXH 2A77L 4PLNC 3OXSA 3U9PL 4XCNA 2VLLB 3ETBF 3U83A 1B9ZA 4LSRH 1NMBH 3CU7A 3SJVB 1F11B 3HLAA 3T2QA 5C0AE 3CMOL 3V6ZB 1MREH 4ZAKC 3DMMB 1JI2A 1AY1L 3FN9A 4NQCE 3CD4A 4KROD 4F7TA 1NC2D 5J6HA 3V4PH 1MHEB 3QCUH 1SYSA 1BD2B 2JLLA 4WFEE 4R96A 3WS3B 1MWAB 1AE6H 5EB9A 4PYHA 1AGDA 5TE6H 5J0BA 1D6VL 1BAFH 1EVTC 3HA0A 2Z8SA 5D1XC 3TCXA 3BPOC 5BQ7A 3SKMA 3DVNB 1I3GL 3EZ8A 3WIIL 4RA0C 1OAXL 3PWUA 5HGHB 4U1KA 5TQ2L 3TH3T 2VN4A 1JWSB 2FCBA 4KGLA 3UDWA 5AZEL 3ZDYE 4I5BA 5I8CB 4JFDE 3KXFB 3KPSB 3MOBL 3VDAA 1TITA 4O2FA 1R5WB 4KDWA 4LCIL 3G04B 3AROA 2EYRA 2A6KA 3G6JB 4NFBA 4PGDB 3IB4A 1H8NA 5JIKA 3BPNB 1BJ8A 4W4OC 1KYOK 2V2TB 1OSPH 1DBKL 4GAJH 1N5YL 3GSUB 4GAGL 4X6DF 4Y19A 1A6WL 32C2A 3DYMA 3NVQA 4LNRA 4XP6H 3SKNA 2UZIL 1UJ3B 2BFVH 3QT2A 1HILA 4LAQL 1N2RA 5ESVB 4NJ9H 4OCYH 4K7PX 4K8RH 2C3HA 4O02H 5I73B 3LQZA 4LOUC 3O8XB 4HIIB 5BCAA 4HFUL 2FJGB 2R2HA 4LHUB 3DV6B 4V2CB 5D9SB 3L6FB 2CLZB 5CAYB 3OJ2C 4U3CA 3LZFL 5MEPB 1FCGA 4OGYL 4JVPA 2RIKA 3O41B 3SDAD 3NBNA 5DA0B 5IB5A 4N0UE 4RGNB 4L8DB 1MCNA 1QEWA 4WEUD 2BNRB 3DX8A 4FQIL 4BFIB 5IB2A 5ESQA 2BSRB 2DS4A 2F5BL 4KAQL 1CF8L 1S7TA 3GUTB 2FX9H 4C56E 4CMHC 3V4VH 3N0PB 3VCLB 1ZT7A 3QHZL 1HHKA 5EO1B 2E9BA 1N3NA 4LCCA 2Z92A 2OXGA 1TJIH 4KC3B 1NCWH 3GKWL 1AKJA 1EMTL 2FGZA 1CD9B 2Y23A 1C7TA 4Z77B 4D2NA 3IDNB 3LHPH 3MRDA 1QBBA 5IFHL 4OZIE 4P9MH 2BNQB 1BJ1J 3S35X 5FM4A 2HJFB 1HZHL 3VFOA 5F21B 2PUQT 4UNVA 2K7QA 1JGEA 3LKRB 4JO3L 3NPSC 3TC9A 2ZNWA 2IC2A 3A6BH 1S7RA 3R4DA 5MHSD 4MNGB 3W81A 4P2QB 3TWCL 2DQTL 3VXPA 3O2WH 3F58H 1CE6A 3PV7A 4PBWD 3D5OF 4WCYH 3P4NA 3RA7H 3W2DL 5F7EH 1JZ2A 1X5FA 2VXVH 2LU4A 5DVOA 1C1EH 3HLAB 5B8CA 4P2RE 5GGTL 1WIPA 3EOAB 3MLUL 3EBAA 5HHME 2CR3A 4ZFGL 1ZE3C 4PJ8B 3VFSB 2DQGL 3PP4H 1OD9A 1Q9OA 2BERA 4F7TB 4LLMB 5I76A 1SYSB 3SGJC 5D5MF 3FT2B 3V5KA 3DMMC 4PJ5D 4WUUA 1NGYA 5ALCL 3SGDH 2EEAA 3UZEA 3RUGE 1Q94A 3E8UL 2F53D 3R8BB 4F7CB 1HINH 3KLHD 3RGVA 4LIQH 2DI9A 2AABH 3GIZH 1XF4B 4AH2A 3SKMB 5BQ7B 2EDBA 3GGWA 4G3YL 5C92A 3PWUB 1F4WL 2EH8L 5DHVH 2ZUXA 3MRKA 2EDDA 2ADFH 4G7YH 2KL6A 4JFPB 2XXMB 1UKTA 2UYLA 5I19L 2QTEA 4L4JA 2EYRB 3ALXA 4ZO6A 2XKSA 1H3WM 4JFFA 3DI2B 5L88L 1T20B 4XXDB 5D2LE 2F58H 4ZFZA 3UYOD 3RL2B 4Q9BA 4HJ0D 4GXUM 4XPBL 1KNOA 1RURH 2IFFL 3NZ8B 4ZS6C 1JPSL 4Y16A 5DFWH 5GSVA 3VXOB 2HWZL 3Q6GL 4HQQH 1UJ3C 5F9WB 3GBNL 1KN4H 2I9TB 1XIWA 2R2HB 2FX8H 1I1AD 2HFGH 2FLRT 1W0YT 1E6JL 4U49A 4UAOB 4G8IB 1TNNA 1X4YA 1CK0H 4KY1L 3O8XC 2ZKHH 3V4UH 4EI5A 1G1CA 1MUJA 4OD3H 1UYWL 3CFBA 5IESL 5DWUL 4U1NB 4R7DA 5ESQB 1S7TB 4UTAH 1GL4B 3CVIL 3ULUC 1HHKB 2Y7QA 4RGNC 4LCCB 1N3NB 4D0DA 2Z92B 4R26L 3QQ3A 2AXJA 1X5JA 3MGAA 1F3RB 1AGEA 1U91A 5JIPA 1AKJB 4XHQA 3DO3A 4F37K 5KS9F 2FGWL 2J3SA 1U8PA 1YC7A 4LAJH 4IRZL 2VIRA 5GXBB 4XCCH 5IROA 4RFOH 5GPRA 1KJVA 5C0FA 3CVHA 5JIHA 2WUCH 1A6AA 3NA4A 1YY9C 3CFDB 4XAWL 1Q0XL 5ADPH 5BV7H 1A7OL 2XQYG 4GG6B 5JLZA 4KMLB 2Q6WA 2X4TA 2X1OA 1JNLH 5FKAA 3VD7A 4E0RA 1NBVH 5E4IA 1OW0A 3P4NB 4OLVL 1M1SA 1NGXA 1JNHB 5JPMA 5C0CA 3TYGL 4QKXB 4TVSa 1KTLA 5B8CB 3QDHA 1XF2A 1Q0YH 1TTFA 5L9DL 4Q6IA 2R0ZL 1G7QA 4LSTL 1Y6KR 1W2KT 5I0ZA 3QRFM 1YECH 2IPUK 3CU1A 2AI0L 1Q9OB 2YEZB 4FQQA 5EDXA 4LBEB 1HSBA 3OKDA 4CADA 5E6IB 5ILTH 5FFLA 1NGYB 1DBJL 1T21B 2Z0BA 3FRPG 3BDYL 4G42B 4WHCA 4F15B 1F4AA 3RGVB 4M1GH 1KJ2A 1KIUA 1NFDF 2DLIA 4X6CF 1P6AB 3ULVL 4AM0A 4RQQA 2OL3L 3EIFA 2JIXD 4WEBL 3QIWD 3BZEB 5BZDA 2ZG1A 2VLMD 3IKCB 3GJFK 2Y06H 5I1AA 2ZJSH 2FL5A 5FDYA 5DRWB 5B39B 4BZ2H 4J4PA 4XNXL 2CKBA 4RDQG 3G6AA 1BQLH 1MRDL 3H9HA 4ZFZB 1HWHB 3T2PA 4PJ7A 3PGCB 3R1GH 2Q7YB 2F53E 4I18A 4EUPA 3CAFA 4DN3H 3GSOB 4Y16B 5GSVB 5CZVL 5JIIA 1KSRA 1EDQA 2OR9H 1A02N 3V8OA 3GO1H 4NJAL 1DL7L 4U0RB 3ZL4H 3OAYH 1MF2L 4Z76A 3BPLB 1UH3A 5EBLA 2V2WB 4OLEA 1CFTA 5F9WC 1ZGLP 4EI5B 1FBIH 3PXHA 1MUJB 4K3DL 1S7SA 1FC1A 4R7DB 2C1PA 1RPQA 4HWBL 1Q9WA 1UCTA 3T1WA 3HNVL 5FM5M 1F6LL 2VDPL 1X44A 3GBML 1MCCA 4D0DB 3STZA 1C12A 1QD0A 3QXAA 3MRCA 4P59H 4ZUUA 3BWAA 3CLFL 3MGOA 5DQ9A 3FJTA 3B9EA 3U4EA 5EH1A 2DM7A 1V05A 4LCCC 1SM3H 3WXVH 5MEND 2DOCA 3I02A 3IJHA 5KW9L 1XR9A 3P0YH 5GQBA 2IGFL 3FOLA 2R8SL 2VIRB 1MIMH 1YEEL 2F15A 4XPAH 1CFBA 4OV5A 3U9UA 3NH7H 2CUHA 4QXGH 2J8UB 1A6AB 3NCEB 5ACMA 1NGZA 1WAAF 3PG2A 5EUOA 3O11A 2E6JA 2QQKH 4L4VD 1JRHL 3CFIC 3D85D 5DZNA 4X6EA 4H5SB 43C9A 1JGLH 5DK0B 2VABA 1DVFA 5IJVB 2Q6WB 4FP8H 5KSAD 1WBZA 1JGDA 5C0BB 3Q5OA 4Y1AA 1UQSA 4E0RB 5I8OL 4HHAA 4M7JL 3K2MC 2KPNA 5I1HL 1UT9A 1EBAA 1NEZA 1NGXB 2J2ZA 5C0CB 3RWGB 3WFCH 4OM1H 5T1MA 1FJ1A 4YHIB 1FZJA 4KDVA 1EVUA 4OQTA 4EDXA 3REVA 5TE4L 3RGHA 4FFVC 1EEZA 5KZCB 5T3XL 3RZCB 4KTDH 3T3ME 1GPOH 5B8CC 4PJDA 3W0WD 1HSBB 2CO7B 4ZYKA 3OKDB 2HMIC 3NCYS 4KK8C 2MSPA 1P9MA 4ODSL 1U8NB 4RCAA 4M8QB 1LK3L 1SY6A 3ORJA 1PY9A 1KJ2B 2GT9B 3DHMA 5DEGA 3JWOC 5I1IH 3MNZB 2FSEA 1DE4B 2ERJB 4AM0B 4RQQB 1WT5A 4KZDH 2CGRH 3RRQA 4F15C 4S1SL 3QCTL 3RGVC 4E42A 4XP9H 3ZKMD 4UUJA 1CGWA 3SOBH 4CNIB 5IEHA 2CDFB 4JPVH 2FB4H 2VKWA 1T5XA 5B3JE 3B9KD 1MNUL 1UB6A 4FTVA 3QWRA 3B9VA 4TOYL 2CKBB 1I7TB 2PXYA 3HRZA 3RDTB 3T09A 4LCWB 4P9HC 4EXKA 3R06B 3WNPA 4PJ7B 2YRZA 3I6KA 5JNYB 3EYOA 1UB5B 3ZHKA 4I18B 4EUPB 4Q7DA 4GW5B 4MAYA 3RY5A 1N0XL 5IKCA 1G1YA 5GRJH 3W82A 1YZZA 3OB8A 3N85H 3SDXB 2VXQH 1X5AA 4XMLH 1IAII 1QA9A 1A3RL 4Y16C 1FDLL 4QT5A 1S7UA 12E8L 3BSZL 5EBLB 1I7UB 4WTWA 1CFTB 2VLME 4U0RC 5IVXF 3HNSL 1BBDH 2RCSL 1S7SB 2DBLH 1H3UA 1R3KA 5CJ5A 1X6NA 1SBBA 4XVTL 4EI5C 3DSFH 3HE6A 1KLUA 1I9IH 2NY5C 1IAKB 4HUXA 4MZ2A 4R8WL 3NCMA 4XMPH 1TZHA 3ZDZF 2JCCA 2ATPB 4LSPH 1B0GA 1BEYL 3MYJB 3U4EB 4Z18A 1YY8A 1ULVA 1OTUD 4X9BA 3QUMA 2H2SD 1BZ9A 4JPWH 5EIIA 3NZHH 5HYSA 3FOLB 4YDKH 1JL8A 1OP5H 1YEGH 2W0KA 3U9UB 5HYJB 2DI7A 5KVGH 4OUUB 3A6OA 2Y36L 5GHWL 3U7AA 1MCWW 3LY6A 5CILL 4S0SD 5IROC 4X6EB 43C9B 3JXAA 4L4TD 1LDSA 4UB0L 4I48B 1WBZB 2XKNA 1JGDB 4OZGE 5HVFB 4KTYA 4NNPL 3MRGA 4R2GB 5KSVB 5AG8A 3JWDL 2BSTB 4LDLB 5EWIL 1NEZB 3MJ7B 4RGOL 5A2LH 1CTOA 1JF1A 3ET9F 3JUZA 1FJ1B 1TZGH 5HHOD 5GJSL 1FZJB 3D25A 3QXWA 1KIRB 4YE4H 1L6XA 5MENE 2DKUA 2Z9TA 1KIQA 3TVMB 3PHQA 5FV1L 5AWNH 1UH2A 3MLTB 4Q6IC 3DRTB 5BMFL 5H35A 4M6OL 4TPRH 5E1AB 5CFHA 4XRCB 2NW3B 4WGWB 1H3VA 4L4VE 4OD1H 5F3BB 4ZSOE 4Y2DD 2G5BB 5BRZD 3GMRA 2IH3A 5F1SA 1FNGB 3V9FA 3MLVL 1FVEA 1MCPL 4PREA 2FSEB 3NAAL 1VEMA 1IFHH 4TQEH 4S1DC 4HC1L 5TDNB 2NY3C 4MHHG 3M07A 5F71A 1NLDH 4Q9QH 4L5FH 1F4XH 2ERJC 1IEAA 4P2YA 4JR9H 1K2DA 2E6PA 3HR5A 4PB0L 4FXKB 4I0PA 5AYUH 3FQTA 4JG1H 1WIOA 4AJ0A 2HT3C 3P9LA 1U42A 1IGYA 5ACZA 2X4RA 4QTHA 4KROB 1NC2B 2GAZA 2PXYB 1T83A 3W9EB 5SWZD 2PTTA 4J4PC 1NMBL 4AEFA 4NC2B 4MAYB 2YS4A 3IAPA 1MREL 2AK4A 2VDKL 1WQVT 4U6XA 1CLOH 4HWUA 1QA9B 3OKOA 4I18C 2R4RL 3IF1A 2VDQL 1S7UB 3AU1A 5TDOA 4M7ZB 5JHDA 3FONB 3O3EB 1RUQL 4K55A 1DEEA 3S9DB 1BQHA 5CJOH 4IMKA 3AGVA 4H25A 4LLVB 4NQXB 3BMVA 2B0SL 5F70A 1EHLL 4Z7WA 4HWEH 3F12B 3U79A 2B2XH 1Z3GH 3MODL 4JFHD 4X5XB 4JY6B 5FIEA 1KLUB 5GS0D 1AR1D 1I7RB 4G43A 2D7QA 1KELL 1LE9B 4CBPA 4P23D 3KS0H 1NCAH 1KOAA 4O2EB 1YY8B 4H88H 5EZLA 3TFKD 3UPRA 1QBMH 5E2WH 5JA8B 3MOQA 5HYSB 2IFGA 4ERSL 4DFIA 3P4MB 4QRRB 4GRWE 4FNLH 2V9RA 1YQVL 3K81A 3MLSL 3SDAB 1D5MA 2AGJH 4JQXA 5KG9A 3BEVB 4G5ZH 2ZCKH 4QNPF 1Z9SA 4HK0A 2XKNB 2H1PL 4XC3L 2F8OA 2MCPH 1NAKH 3TN0A 4NM8L 1LK2A 1FFRA 1DVFC 4NQED 2QSCH 4KQ4L 3VXNA 4PRNA 3Q48A 1BX2A 4R2GC 2HFEA 2NY1C 3UC0L 2G75A 4JVWA 3QI9D 1KIQB 2EEDA 5A2KH 2KQNA 4Z7QF 5KTEL 3DRQB 3H9SD 2XFXA 1O7VA 1UM6H 4YR6A 5H35B 1OSZA 4JJHA 2EDRA 4GSDL 3TVMC 2NZ9C 4KGJA 3SDYL 2CKNA 3HC3H 5IOPA 2NY6D 1ZLWK 2BY3A 1EFXA 4QRTB 3ZKQD 4DAGL 1KCUH 2IH3B 4L4TE 2WANA 1FVEB 3E6HB 2WWMC 1LEGA 4DGYH 4M1DL 5IQ9B 1KJMA 2C3WA 3FN0H 5CSZB 4KVCL 4M43H 4YHNA 4PV8A 2PTVA 4OZHA 5HHOE 5DSCA 4ONFH 2N56A 4CAGA 1WT5C 1K2DB 1YEKH 3HR5B 5FGCB 4I0PB 4IDJH 3W39A 1HH6B 3ARBA 5C0JB 4AMKH 2P5EA 1IGYB 1CXKA 2GJZA 2X4RB 3MRNA 4QTHB 4L8BA 2PF6A 4B41A 1WITA 2GAZB 4JHWL 4MCZA 1S7XA 5JHLH 2I60H 4RAUB 5DMIL 5IB1A 4PJ5B 1SHMA 4PD4J 5IW6B 2PXYC 3CX2A 2F19L 1U3ZA 1V8HA 3WHXA 1P1ZA 3DX7A 4G8GA 1LP9B 2XV6B 1IILE 4Y19E 5FKPA 4KUZL 3IF1B 4MAYC 3LRSA 4NQVA 1T89A 1IAIH 1NMCB 1DUYA 4NM4L 3AU1B 4R0LA 4ODUB 3VGAB 3A6CH 1JPFB 3O6KL 2W9LA 3P9WB 1EO7A 5F88A 1BQHB 4N68A 4MDJB 1AXTL 4ORZC 4M7ZC 5EC2A 4U7KA 1S9XB 4JFXB 4UV4L 3C09C 4QWWD 3CDGA 3KR3L 4X9FA 1AC6A 3FQRA 5SWZE 3LQAL 2KZWA 9CGTA 2HRPH 1FNSL 5J8OA 3MCKB 35C8H 3HE6C 3N9GH 3EYSH 1DQMH 1E6OL 2GIYA 4G8FA 2ATKA 4IOFD 3HUJF 2Q3ZA 4RMRA 1MRFH 4YHZH 4XMKH 4KRPD 4U1LA 1CVSC 4Y4KA 3MJGX 1D5MB 3GMPB 2EICA 3FOMB 4P4RA 1VHPA 1V7ML 4HXAH 1DZBA 1SMOA 4AL8H 2DQHH 3TO4D 4F57L 3AB0B 4MD0A 2DQCL 4JB9L 5JR1L 4WIQA 2CXGA 3VXNB 1CL7L 6FABL 5E6ZA 3HZYA 2NCMA 1QNZH 4Z7UB 4EIGB 2G75B 2IG2H 2M2DA 1G9MC 3VFWB 1PEWA 1NUFA 3MJ8B 4WO4A 1BHGA 3HR6A 4YR6B 1QBAA 3H7BA 1OSZB 2J1KA 2UUDK 5IHBA 1GZQA 3GJFA 1MPAH 3MLYL 2CJUL 3MA9L 5TJWK 5IUSA 4HEME 3ULUH 3VXRB 2OTPA 5I8EB 4ZTPL 3VXTB 4HAFA 1ZWIA 1EFXB 4UTBH 5I1EL 4MJ6B 4S1QL 1T5WB 4ALAL 1NGWB 3PDDA 3IDXH 5DD3H 3KJ4B 4XCCL 4PGEA 4N0RA 5D6CB 2QEJA 4WUUE 3TNMA 1C5CL 4EIZC 5MI0C 4DUVA 1ZHLA 3NABL 4GW4A 4OZHB 3ZTJG 5DSCB 2UV3A 4S1RL 1IJ9A 4BJLA 2X05A 2HKFH 3V8CA 3W39B 3U82B 2A73B 4LGRB 3U6RA 3MLWL 3ARBB 1JJUA 1IKFL 3EO9H 1HXYA 5C7XH 1MJJB 4L8BB 2PYFA 4I0PC 1S7XB 2BVUA 4NBZB 5DD1L 4WU7A 2BMKA 3EDDA 2MQCA 4M00A 5FA3A 2HN7B 4HGKC 4DTGL 5J89A 4Z7NE 4JFFE 3OXRA 3JTTA 2VYRE 4P5MA 1OL0A 2DQJL 3QEHB 3RIAK 4PJIF 4NQVB 5BO1H 1DUYB 1ZHNA 3QIWB 2X42A 3BKCH 2CUIA 5F88B 2VDRL 2GHWB 3QEQB 3ZE2F 2EKSA 2YPLA 5D96B 4PP1D 4BFBD 3FB7A 2MKLC 4APQB 3VGAC 3IDIA 3MV7D 3VDBA 3JVGA 5INCB 3NPZB 5SX5K 3CDGB 4MDIA 3OR6B 3TBTA 1YJDH 3FQRB 4LNVA 4JM2F 3O4OB 1BP3B 2CIKA 4U2ZA 3S97C 4NNYA 1NSNH 4Z8FH 1AO7D 1JN6A 1CE1H 1ORSA 1AI1H 2ATKB 1CFSB 4ZUVA 5GSRA 4Q0XL 4UINH 3UTZA 1QR4A 1RZJH 1KC5L 3CZFA 1INDH 3EDEA 5J57B 4WW1B 2EDEA 4HAGA 5E24E 3DTXB 4XI5C 2GTWA 4YAQB 1PG7W 1RUAH 2OMNA 4P4RB 1SEBA 2QJDA 2H2PC 1QOKA 5E08L 3OX8B 4DVRH 5IMMB 1RVFL 4XWGL 1XGYH 2IALB 4JQXC 2Z31D 5LCVH 4WJ5A 4P5TA 1A5FL 4HBCH 5E5MA 4GW1B 1UM4L 3TN0C 3H9YA 3THML 1CWVA 4NKDA 1AD9A 4KTEH 1IGFL 4ISVB 3S34H 3CUPA 3MUGB 3CK0H 2YMXH 5GGUB 3SEPA 4WO4B 1OF2A 2R1YB 3VFPA 4YWGH 5EU6A 2VRAA 3H7BB 4G6KL 1VKXA 4L3ED 1SYVB 4F7EB 1EGJL 3BGMB 1GZQB 4YXLL 2GK0A 4HIJB 1S5HB 3UPCA 3VFVB 5EO0A 4F9PA 4NQDA 3D85B 1FNLA 1YYMH 1DEDA 5EUKA 5AZ2H 4WW2F 1KEGH 3WXVL 4YO0B 5FYJD 3SQOL 1JFQL 5I66A 5IMKB 2P8MA 4HT1H 5DEFB 4B0MM 3RU8H 1PX4A 4PGEB 1GHFL 3K1DA 4MXWL 3TNMB 5JQHC 5HGBA 4OLYL 4BQ6A 4R90H 4WHTB 2APFA 3KJ4C 5LBSH 3EYQD 4A2LA 4KUCD 4ELKA 1EEUA 3L3OB 3H8NA 4W4NA 4HPYH 1CD1A 4YZFF 2QR0A 4K7PY 1HXYB 1IGIL 2KKQA 1GH7A 5TH2B 2PYFB 4FS0A 3W0WB 3EKCA 4OFKA 2CK0L 3WIHL 4AENA 5KSUB 3NCBB 3ARBC 1UM5H 3OAZK 2BY0A 5GS0H 4OM1L 2MQ0A 3SBWA 5DUBA 5FA3B 2NNAA 3DVGB 1A6TA 3TA3A 2AXFB 4C83A 4P5MB 1GCFA 3QWOA 3PWPB 1WV7T 1X5LA 3IFLH 2ZSVB 1JHLL 5A1AA 5EULV 3U0TA 3UX9B 4D0BB 4MXVE 4F58L 5HYQB 4NZTH 3UTPD 2YPLB 1T89C 3LKQB 3UO1H 4XCFL 3B9KB 3I9GH 3QIWC 1J1OH 3IDIB 5IF0B 2BVEA 5GIRA 2K9UA 4IJ3C 4YXHH 2DQIL 4J3XA 5D96C 1A14L 4ZPTA 4APQC 1YPZF 4PJEF 1QYGH 3JWOH 1TENA 4HGWB 3ZDXE 4NNYB 5F97E 5KSBF 1JN6B 5BJTB 2FX7L 3I6LD 4X6DA 3LN9A 2DB8A 4G6MH 5E9DA 4K9EH 4Z78A 3O4OC 5IVNA 4KKAC 3VE0A 3QA3A 1I8KB 3UJIL 3BIKA 4KKCC 4J3TA 1BF2A 3LV3A 5FHBL 1L7IH 1FL3A 4DKEH 4GRWB 4XNMA 4GMSH 1T4KA 4MJ5A 2BOCA 3K2UH 3RVTC 8FABB 1BPVA 4M48H 3RWHA 4P9HH 5D7JD 1CZ8H 1SEBB 1UGNA 4NP4H 2VXQL 3MV7E 5JUEH 4Y4KC 5JXAH 2MKWA 3QUXD 4ELMA 4IOIB 2EE6A 3HI5L 1BVKA 5EUOE 2C4FT 3BW9A 3MRBB 4WJ5B 2JELL 3PWJB 1JUFA 5E5MB 5FGRA 5IB4B 3I3BA 2CIIA 3BJLA 3B5TA 2JK5A 1FFNA 1CICA 2P48B 5HY9A 1AD9B 2YN3A 4Y1AE 1J87A 3CUPB 5IW1A 2VAJA 1U8KA 2X70B 1ERNA 3MXWH 2G60L 1OF2B 2CRZA 3K8LA 4KKBC 2EIEA 1OAUL 3FO0L 4XMPL 2EDQA 3S36H 1KCSL 2XWBA 1ETZA 4WO4C 5CJBA 3VH8A 4NQDB 5EUKB 4PRDB 3B6SA 4H0GA 4QO1A 5J9PA 1MVUB 2NY5H 4JPWL 4PJDE 5HD8D 5C09D 1PG7H 3P30H 5DURB 2BSSB 1MFEL 3BUYB 4MNQA 5CEZL 5HGAA 3O0RL 3BQUB 3WD5H 1DN2A 5CD5D 5CJXA 3QIBA 3TJEH 2M26A 1A4JB 2QLVB 3BO8A 1CD1B 2FBJH 1K8IB 2QR0B 3MRIA 4BUGA 5CEYA 1B3JA 4JQIH 4P3DA 4PRHA 2Y25A 4NPYB 1C5BH 3C5SA 3CVHH 4UT7H 1U3HA 4BQ8A 5JHDD 5KVDH 4KK6D 5EOCJ 4PRBA 1TZGL 3SGEI 3E3QC 5DUBB 2FRGP 2YPVH 5D71H 4FTVE 2F8XC 1JTTA 4UQ2A 1PVHA 4A6YB 5BRZB 3QWOB 4PJBB 2CR6A 5D5MA 4K3EH 4R3SB 4D9LL 1UWGL 1PD6A 4NSKA 4TVPL 2GI7A 4R97C 3B9DA 1YMMD 1EFQA 3LKOB 3RPKA 4TPRL 3U0TB 4UT6H 3G5XA 1SMAA 2CRIA 3X3FH 1PKQA 1FYTB 4M6NH 1GGCH 2D31B 2XWTB 5FCUH 1W0VA 3P11H 1NCTA 4YUEL 4PV9B 1CFQB 5GIRB 1NUNB 4TQEL 4X6BA 2EEBA 3VFUA 1N64L 4HJGA 3ZTJH 4O9HL 1QHOA 5HYEA 4BH7A 1FFOB 4HDIA 1N4XL 3JVGC 1HHHA 1TVHA 2GSGB 2VJXA 1YNLH 3OV6A 4UT9H 3IFNH 5IB3A 1UVQA 2FO4A 4NKIH 4FXGB 2FZ3A 2X4NB 2Q76A 2GSIA 3QG6A 2APXA 5GS3A 2VLJA 4IBLT 3BIKB 3V6OE 4G9DA 1EO8H 3M1BB 3I75A 2JCCE 3K4AA 4XNMB 3BYYA 3UTPE 4N8VB 5IHUL 3RWHB 3EAKA 3G5YB 5E2VL 2ICEB 1S7VA 3GHEH 4ELMB 2WK2A 3C8DA 4R4FL 1RJYA 1Z9MA 1BVKB 2ZPKH 4M1CC 1FO0A 1WEJL 2XPGB 1WK0A 4J3OC 4EUPH 4P23B 1LEIB 5T1LA 1JYWA 3KPRA 3LRGA 5GGVH 2AXGA 5HY9B 3I6LE 1TZIB 4P5TC 4BSJA 4NFDA 4QRUB 3GSNB 3HE7D 4HWEL 1J05B 4OCMC 2LAAA 3KYMB 4X80L 3MPCA 5JA9A 3FAXA 1NL0L 1JYXA 4NRZA 2OLDA 3QUYA 1UZ8B 1WZKA 3ZLQC 5ISZB 1QSEA 1G0XA 1FVDA 4UQ3B 4ZTOH 4PJGE 5KAQF 3VH8B 5E8NA 4M5ZL 4GKSB 4KFZC 1C5DA 5DT1H 5J9PB 5D8JL 1XGTB 4QOKA 3DROA 2CRMA 1IARB 1MH5B 5BW7A 1L7TL 3VG9B 5DF0A 1CFNB 3RX7A 5GRVL 4FN0A 1P7KA 4NQEB 3RZWA 2RGSA 1EUUA 1G9NC 2VWEC 3QP3A 1K3IA 2AGJL 4G8GD 4YHOH 4HIHB 2OL3A 3BQUC 4G6AD 3S37X 2IAMA 4C54A 4M3KB 2MCPL 1C08A 4PJHE 2VLRD 3MLPA 3H9SB 3I50H 4W81A 1K85A 4MJ4A 3HFMH 4MB3A 1FNHA 1G7MA 4U4BA 4Z0XB 4DW2H 3GM0A 2J4WH 4PRBB 3NACL 3U2SA 4I77H 4XNZB 5C0GA 4FMKA 4KJYA 2QQLH 4BM7A 5HVWA 1LQSR 3V7MA 5C09E 3NIDF 5IBTH 4JGUA 3SBWC 5T3ZE 4NSKB 3TT1H 1MFAL 5I71C 2R0WH 4JO1H 5C71A 3G5XB 1KG0A 2JB5H 1NFDA 4X6CA 1U8QA 2DJ4A 2AK4E 3NCJL 2W0PA 5L6YL 4JJ5A 2R15A 1R0AL 1MFBH 3AAZA 3VFUB 1X4XA 1JF5A 5JHDE 4FFYH 3Q1SH 4PJXF 4NO5B 1T0MA 4Z7VA 3C5ZA 4HDIB 5JPNA 1TVHB 1U58B 1YEKL 4U0QB 4MS8D 1T1ZB 2D03L 4GRMB 5SWQA 1W72A 3T0BA 2FZ3B 1ED3B 1FLRL 1KPRA 2GSIB 1IGTB 3VWKD 2XOTA 4OAWA 4G8EA 3TIDB 3SKOB 4G9DB 3RAJH 2HLFC 4XPFL 1CXIA 3P73A 4FMFA 1KTKE 1JHKH 3O4LA 1ZMYA 4G9FA 1CU4H 1OAKH 5GS2H 3S35L 4HGMA 2LABA 1AJ7L 2WUBH 3EOBB 1RJYB 4JM4H 3K3QA 3UAJD 1D9KD 5HHXL 4FQ2H 1EHNA 1YEFL 4WU5A 5J1TC 3O9WD 4MA1B 1CT8A 5BS0A 2FH8A 1A1MA 3VFGL 1A7NH 3D39D 2HVJA 1E4WH 4EVNA 3BT2L 1MCWM 5F96L 3G6JF 2QQNH 5EU3A 5T5FL 4ODWB 3PP3H 3WKML 4NRZB 1VADA 1D7FA 1QSEB 1XF5A 4KRPB 1FVDB 2HRPL 5EBWA 1MWAL 1M6OB 2X4UA 4CJ1A 4QRPD 1C7SA 2B4CH 3GNML 3JWNC 2H26B 2OJEA 1QO3A 1H15A 4ETQB 1RHFA 3BH8B 3ELAT 5FUZL 2P24B 1JZ7A 4HKXA 3BGFB 1ZLVK 3RWJB 1JVKA 4X99B 2RFXB 2ZOLA 3QUMH 5A2IH 3VG9C 3ULUF 3IVKB 3SCMD 4PGZA 2HLAA 3PE9A 5TQ0L 2IAMB 5DYOA 5CJXC 4BQCA 3QIBC 1C08B 3FO1A 5DR5L 3DX6A 2W92A 2YKLH 3VXQB 1IAIM 3BZ4B 3QAZB 3L9RB 4LPYA 1HHGA 1DDHB 4TUOA 3DVIA 4LF3B 5DJXA 1U3HC 1NPUA 2D4FA 3KDMB 1A6UH 3GMNA 1KENH 1JGUL 1NDGA 5DXWA 4TSBH 4E41A 5JDSA 1XFPA 3EYUL 2AV7A 3H0TA 4G6JH 4XPHH 3UTTA 3ZO0A 3P0GB 2VB5A 3GI9H 3ULUL 1U8QB 4LSSL 2AJZA 5DJDB 4G8GE 3GRWH 3FQNB 5LG1A 4HXBH 3IDGB 3D87B 1OB1A 3U0PA 4NDMA 4P4KD 3W5MA 1PJ9A 1X4ZA 4OZFA 1F8TL 5FB8A 3TV3L 5IR1B 1NLBL 4ZS7H 4KK9D 4NRXA 5D2NB 2MJWA 1Z9LA 3C2AH 4Z7VB 1Z0MA 1TCRA 1HHJB 2MNUA 4M7LH 5ID1A 1KFAH 4GRLA 4PY7A 4LP5A 3D2UA 2D0GA 5HHNB 5ICXB 1F45A 1KPRB 2EDOA 2A9MH 4OAWB 3VW3H 5T1KD 3RKDC 3BUTA 3D3VD 1TJGH 3OPZL 4TSAL 1I7ZB 5D7IE 5CBEA 1K6QH 3P73B 4HD9A 1I9JL 3MV9D 4P46A 3WNLA 5CLTA 1MQKL 2YWZA 4G9FB 3ARGA 3GMOA 3QFJD 1JYVA 1IT9H 1IGCL 1MCRA 1GIGH 2ICWI 3U0WH 2GFBA 3QZWA 2ZUWA 4PUBH 1G84A 5MERB 5T3ZH 1FGVH 4OF3A 1NQBA 4X6FA 1Y18B 4ONGH 4WU5B 3F8UB 2OBGA 4LVOB 5B4MC 3BKCL 5BS0B 5KVMC 5ANMA 3LMJL 1A1MB 3BPCB 2FR4A 1AO7B 2DTML 1CGXA 4WI4A 1S7QA 4EVNB 4M02A 3M8OL 1ZLUK 5C08D 2NXYB 5EU3B 3MACH 2R2CA 3ZT6A 4YHML 1KJ3H 1WWWX 3QDGD 4PJCA 3MLXL 2JJVA 4JZNA 4LARH 1R24A 1QLRA 3BGAA 1X5ZA 4GLRI 4IOFC 5FYLL 5CBAA 4S10A 1N6VA 5I30H 2HKHL 4QHUA 2OJEB 4QHNA 1QO3B 1H15B 1G7HB 4P57A 4DZBA 4FQCL 1IC4H 2VDML 3DXAA 3TBVA 2C26A 2Z31B 1KT2A 1INDL 1H5BA 3DETD 2XI9A 3TA3D 5TDPB<