1CIDA

Crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
177
Chain Sequence
TSITAYKSEGESAEFSFPLNLGEESLQGELRWKAEKAPSSQSWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVSLQFAGSGNLTLTLDRGILYQEVNLVVMKVTQPDSNTLTCEVMGPTSPKMRLILKQENQEARVSRQEKVIQVQAPEAGVWQCLLSEGEEVKMDSKIQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of domains 3 and 4 of rat CD4: relation to the NH2-terminal domains.
pubmed rcsb
source organism Rattus norvegicus
molecule tags T-cell surface glycoprotein
molecule keywords T CELL SURFACE GLYCOPROTEIN CD4
total genus 37
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1993-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA02
1CGTA 3L7EA 5ID0A 5BXFB 1B0RA 1J7VR 3IDGB 4LARH 1B0GA 2ORBL 2MOVA 2YWYA 1MI5A 1S78C 4P49A 2APXA 4LGPB 3JVGA 1TQBC 5D7IE 5ICZB 2FEDD 3O9WC 5I16A 3MACL 3H9SB 5CEZL 1G6RL 1Z5LB 1H0DA 1WFUA 3PWVB 4GMTL 1NCCL 1GSMA 4P9HH 5T1KA 1LK2A 1BFVL 3J8F7 4JFYB 3NA9H 1K6QL 2FJFB 4JPVL 4NO0B 4WFHD 1REIA 1LQSR 4NJAH 4X7SL 1Z9OA 2I9LA 3S34H 4QNPF 4YPGB 3V4VL 1A7QL 4M6NH 3RX8A 5D1ZC 1PAMA 4YDKH 4JB9H 4NP4H 5E70A 1JGLH 1ZHLA 4OZGA 5HHOB 4J4PD 3T0ED 3K8MA 4I2XB 3L3DA 2ZNWA 1P6FA 4PJFA 1IVLA 4PLJC 2QKIA 5MEND 4MMXC 4BQ9A 1F4WH 1HWGB 3Q6FB 1FFQA 1H8SA 5CWSB 1P4LA 4HUNB 2ED8A 2DQJL 5CHNA 3GRWL 2B2XH 4XCYA 1DEEB 4N90D 2DOCA 3VDBA 1T1ZA 4XNZB 4LIQE 5HD8C 4EQ3A 3OR6A 1FYTA 3RRQA 4HAFA 3ZKNC 1ZHNB 2NY4B 5EOQL 4JPVH 1HK6A 1H15B 1K9TA 5CJBA 2V2XB 4OCSH 3EYQD 4DUWA 3LS5L 3QUYA 3HC4H 1ZLVK 1DFBL 1FORL 4NQDD 5HI3C 4NQEA 5CGTA 1K5NA 2B0SH 4P23C 4JKPH 4G8EA 2VLKE 3ARGA 2ZUTA 2XA8H 5IV2A 4EUPB 3P0VL 4AQOA 2OJEA 3OTTA 4OV5A 2IANA 3MRBA 4NQVA 1KIRA 1SJVA 2Z9TA 1CFNB 1J8KA 4DAGH 1WFNA 4NYLA 3QIBB 4H1LH 2ZSVA 4B41A 5GS1C 1R3HA 1FC2D 2MQ0A 3WUWG 2GJ6E 1ND0B 3DOSA 5DJAA 3RZCD 2IH1B 3ARVA 4P2OC 4W81A 5BOPA 3NAAH 1N7ML 2DQJH 4MJ4A 4Y16A 3B9KB 3N1MC 1NC4D 2DQTH 3K4AA 4JFEB 4DTGL 1QYGH 4M8QA 1F90L 3UDWC 2HFTA 1T5WB 3MXWH 5D5MA 1TETL 2XZQL 4ZO6A 1Y6KR 2Z4QA 4NN6B 4HMEA 4JO2H 4X6BA 3TBVA 4OGXH 2OJZH 1VGKA 3CC5A 1AY1L 1P1ZA 5DRWB 1CGWA 1QSEA 3B9KA 4RRPG 5DDHA 4WUKH 4JO3L 3HC0A 4EJ1C 4R9HA 3UTPD 5LCVH 1EA9C 3UPAA 4S11A 2B1HH 1BVKB 4XMLH 4PJFB 4XXCC 5BQ7A 5T33L 2B8OT 2G2RA 4J8RB 4DWHA 3KPTA 5DJ0A 4GO6B 1MCJA 3BX7C 2DLFH 2EDTA 2XT1B 3DO7A 1CCZA 4JFPB 3ZKND 3FFCA 4QXUL 1N4XL 5KTEL 3D9AH 3G5ZA 3G9VA 5LAXB 3EYFB 4Y4HC 3WL9B 4RFNB 3KLHD 1KB5L 1T80A 3MUGA 5J1TC 3QP3A 3U6RB 4G6AD 4UT7L 1LDPL 5IVZA 4YDVA 4EUPH 3RWDA 4XVJL 3ZDXE 3WFCL 1CQKA 1YPZF 5D9SB 4MSWA 3DSNA 1RSFA 3L7FB 4XMPL 4U1NB 5I1KL 2OM5A 4YHIA 2OL3L 1HSBA 1PLGH 4M7LL 1ZGLM 3JV0A 3MC0A 2QADB 3LEXB 3FRUB 3O4LD 4PGEB 1AO7D 3RVUD 2ZG1A 1KT2B 1OTSC 2PYEA 2J5LC 4LNVA 3BKCH 4HJGB 3C5ZD 4Y4KA 4EVNB 4NO2B 1JFQH 4NT6A 2A83A 2ICEB 3GK8H 3TA3C 3WUWB 1T22A 1HZHH 4L4TA 3OV6A 2IPUG 2J4WL 4FOMA 1DBBH 4P4RA 1JF1B 3HFML 4LP4A 1S7XA 4U6XB 3MRCA 5C9JA 2N56A 4F8TA 3IDJB 4MWFA 1CTNA 4UOW0 2DQHL 3P4NA 1E4XL 2J8HA 4MA1B 5D1XC 1LE5B 4S1RH 4UDUB 5EORL 3JUZA 1KN4L 4TPRL 3OXSB 3BH8B 2I60H 3ZHKA 5JOFB 1F58L 3WXVH 1BFOB 2FEEI 5D7IF 5JQHC 3VMOA 4LGSB 3QXDA 4WGWB 1T3FB 4KU1A 5H35A 1CT8B 2EH8H 2J3SA 1YMMB 3ILPB 1R3IL 1WIOA 4YAQA 3RDTD 3O11B 4JG0H 1AGEA 4U7MA 4QYOB 4R2GD 1P7QA 3AGVA 1QHOA 4G8GD 4HDIB 3C9NB 1MPAL 2CPCA 2LTQC 3QXVA 3RGVD 4E41E 5HYIA 2AEQH 3UTZB 3VGHA 4BFIA 5F9OH 5KSBB 5INDB 3LZFH 2PCPB 3C8HA 3L3GB 4JE4B 2DQFA 4OLVH 4LIQL 5B8CB 2VISB 4MQTB 3IFLL 1NDMA 3PF2A 3QSKB 5GRJL 1I8IA 5F7DA 3GHBH 2VH5L 4WVRA 4ONHB 2YD8A 1BQSA 3N0PB 2ITDB 3EO1B 1WVZA 3DURB 3LMJH 5E95B 3SDCA 2V9TA 3BQUA 1KIQA 1CG9B 3RNQA 2VL5A 4ZAKB 3GBNL 4K7PL 4PJCB 5ENWB 5TDOB 5TE6L 1PFCA 3QQ9D 4Y88A 5C0GA 5T1DL 3VXTB 4A6YL 3ULUD 3MRGA 4U2YA 5DRXB 3MODL 5DEGB 3QIUB 4HUWB 1Q9OA 4JG0L 3U79A 3CLFL 1MJJA 4NZUH 4PGCA 3K8KA 5T1LB 3FOLA 1JI1A 2PTTA 2EH8L 5C0JB 4XNMB 3RQ3A 1BX2B 3QIWB 4AENB 5DUPH 2RAMA 5J6HB 5ACMA 1VADB 1MCSA 2E7BA 4U2ZA 5IFAH 5GS3A 2ATKB 1JE6A 3MSPA 1MCLA 3U0WL 4P57A 4Q6IC 2XWBB 4P2YA 3NFNA 4PGEA 1SJEA 2VLKD 1E6OH 2L7JA 4HWEH 1YC8A 4LSUH 3MLSH 2AEIT 3QIWA 1LP9A 1XR9A 3GFUA 3ZE2F 4NQEE 2HFEB 1YEIL 3V4UL 1CT8A 2VN4A 3BJLA 3REVB 3BP7B 4D94A 3PXJA 1A3LL 4L4VE 4KGJA 4DZ8A 4KJPD 3CLFH 3T3PF 1B88A 3DXAD 1QA9A 1U6AH 4UDUA 2BXZA 4I0CC 3HE6D 3EDDA 4RISL 3OKNB 5CP7A 5TE6H 3V6OC 5DQDL 3SGJC 5I30L 3N85L 3L3JB 4HFUH 3VI3E 1Q0XL 1NUGA 2GW5A 3BAEH 1XH3B 5KSVA 2X4PB 5GGTL 2VO5A 2Y4SA 3ARDB 2VXUL 1ETZA 3ULVF 4LLYA 1IGCL 7FABH 1NANH 4RGMB 4G7VH 1JPFA 5I1AA 3T8XB 4WUUE 1F00I 3T65B 4MJ6B 2E7CA 1OCWL 1EJ6A 3VFTA 2AV7B 3ZTNH 1YMME 2OR7A 4G6KL 5LWYH 1IQWH 4RIRB 4KRMB 3OG4B 1CGXA 3ZKSD 2NPLX 3FO1B 4OGZA 4PRIA 3G08B 1A6ZB 2EYSA 5B4MC 1CXEA 3FCTB 2UWEB 1MJUH 3MUHL 2HH0L 4QGTA 4JGJA 3X3GL 1HXMA 4Y4FD 3D3VA 3GMPA 1XCQB 3DGGA 2YPLA 1I8KA 3KPPA 3MLTB 3ULVH 4ZOBA 4G8IB 3RVWD 3SQOL 1JZ5A 4P9MH 3BKJL 3GBLA 3MRHA 3UZQA 5CKGA 4UTAH 2A9NH 3H3PL 3VW3H 1IM9D 3P40A 5ISZA 1XGYH 5CBEB 3IKCA 4K3DH 4XCFH 4DOHE 4J3WA 1HHIA 1LO3H 1YQVH 4KJYA 1JV5B 2R2HB 2ZOKA 1XF3A 2DKMA 3OKEA 4FFZH 1VA9A 3UO1H 3KPSD 4X6DE 3U7WL 3DVNA 4ZOCA 1RZKL 1HH9A 1K8IA 2P8MB 2EE3A 5CILH 4E41A 5TF0A 1AD0B 1ZLWK 4FHBD 2RJMA 3HI6L 2JB5H 3RL1B 1ZV5A 3K8LA 1T2XA 1UG9A 5HBBA 4QY8B 5DD5L 4P5MB 5D2LA 1RIVH 1IGCH 1K3IA 4AK1A 4G7YH 4HUMB 5D93B 4LEXL 1OY3B 5E2JA 2IPKA 4W4OC 1MLBA 4AJ0A 1KLUB 2BOCB 4ONOA 3DMMB 2GI7A 3SDXA 3KDMB 3C6SB 2XTLA 5I1AB 4JLRA 1MRCH 5DJAB 1N5AB 3GMNB 5DS8B 4GOSA 3IS0X 3HE6B 5EOQH 3AREB 3VJ6A 2BSSA 3P4MB 3SDCC 1HHIB 2DI8A 1YYML 5DQJB 4NKIL 4UNUA 5I1DA 1G7JA 3L3OB 4M7ZC 5EWIL 3FB7B 4EQ2A 2QTEA 5CP3A 4JO1L 2VZVA 2OK0H 4XWOC 2OBGA 3KPMB 4YHNB 4JVUA 3NCYP 4BQ6A 3LHPL 3HI6H 4GRWH 1IKFL 5JOPE 1P1ZB 3BPNB 2VAAA 4K55A 3PJSB 3TN0B 5HYJA 1BZ7A 3DMMC 1L6ZA 4PBVC 1ODAA 5CIPB 3L3IA 1HDMA 1WWWX 2HMID 4RMSA 1RJLB 4NRYB 3ECBB 3KXFB 5K9QI 3BPLC 4MQXC 1MI5B 1IBGL 3MFFA 4TNVF 5I1LA 3FCTA 5MENA 1X5AA 1M71B 1X5GA 3ARPA 3UZVB 2OP4H 5FUCC 1A22B 5D1XA 5DFTA 1MEXH 2EDEA 4LSUL 4S0TD 4OZIE 3NIFE 3Q2CA 3WFZA 3S35H 4ZAKD 3OR7B 1CFNA 4R4FL 5HHME 2VOTA 2BNQB 3QJHA 3EIFA 1CL7L 4NKIH 5D7SH 1ND0A 4WUKL 4LARL 1FFOA 5F1IA 4WW1B 1RURL 3GIVB 1U3HD 1KCUL 1UJTA 2NW2B 4OGXL 1ZA3B 4HULB 3JWOC 1UEYA 4OM1L 3S96B 5E8NA 3ULSB 3SDXE 2GSIB 1UVQA 2JIXD 3SBWC 2R2CA 3EZJB 3ZE1E 3ZL4L 4ZXBA 1NSNL 1U8QB 3MCKA 1K8DA 3PWPB 4N9GB 2R1XA 2COQA 2OJZL 4CMHB 1KIQB 3GIVA 4HXAH 4D9QE 1S5IL 2F8XC 3E2HB 3FMGL 1QKZL 4BUHA 3GDBA 4LAJH 3RZCA 1KG0A 4F7CB 3KHOA 5KVGL 4U1HA 1KXQE 2F5BL 1HNGA 5IT2L 2IH3B 2AJYH 5DK2B 3BRGC 5IW1A 4U1LB 5HHVL 5SX4H 3UAJC 5JORB 5KG9B 5AUMA 2R4SH 1F8TH 4ISVA 3MR9A 4W4OA 4QHUB 5J1AB 1QNZL 3O6FA 5F1OB 3TBWA 1I8MB 5EBMA 2ESVE 3B83A 1FV1A 1F4WL 3B9KD 1NSNH 2FX8L 3BP6A 4E9LA 2IAMA 1FCGA 1QEWA 3H9SE 3DVGB 3QCVH 4PJAB 2AJUH 1FN4B 3K4ZA 4LCCC 4HKZB 2NTFB 3MO1A 2I07B 4M62H 3ULVD 4FA8A 1T7XA 3I3EA 3FFCD 2MKLC 4HW6A 1F58H 1Q1JL 3MRIA 1QRNA 5IHZB 4XVUD 3K1DA 4Y4KB 1S7RB 4DOHB 3QI9C 8FABB 3BDYH 1A14H 1CK0H 2B2XL 3C2SA 4HUXB 4QCIB 2KPNA 4M5ZL 2IWGA 1DBBL 5DJXB 2J8UE 1R5IA 3FO2A 4J1UB 1BM3H 2H26B 3CFIC 4CN4A 4QXTB 3HAEH 2I27N 4WI2A 4I3SL 1MI5E 3BPNC 4L1HA 4D0BB 2HT2D 5IHZA 4YFDB 1SJHB 2EE2A 1Q9OB 1OAXH 1JIBA 2WWKO 1VPOL 4R3SB 3GMLB 2XPGA 3CK0H 4P3CH 5IQ9A 5E4EB 2XG4A 1RJZB 4OLVL 2YC1A 3WFEH 5GHWH 3KPRA 1G9ML 1IGYB 3MRJB 2BOBB 5DD3L 5E8NB 32C2A 4KJQC 1YEEL 1Q0YH 4X6CB 1Z3GL 3ZMRA 4M7ZB 4MNHB 1BFVH 3C60C 4NQVB 5CCKL 1NAKH 1OLZA 1KB5H 2J8UA 3DNKA 4NZJA 4Q7DA 3RL2A 4EDXB 5ITBL 4MAUH 1KJVA 1QSFE 3FB7A 3HS0A 2GITB 4GQPH 4NQUA 5DD6A 3ZDYF 1N5YH 1NAMB 4G8FA 2W59A 4Y5YA 1FDLH 4Z77B 1H3WM 4POYA 1N59A 2R23B 5ITFB 4HHAA 2OL3A 1QYGL 1DDHA 3BDBA 4L9DA 1B9ZA 5FV2A 3OKMA 1OAXL 3B5GA 3TZVB 3VD5A 4YHML 3RWIB 4RGNB 3BZFA 5FV1L 2AJ3B 3RDTA 3VXME 1U3ZA 1RUKL 3F8UB 3QB7C 1P7QD 4LASL 4MA8L 3VXQB 5JHDD 1KOAA 3F7YB 1JTOA 1T04A 3X14A 4AY0A 4X9FA 4CADA 2DL9A 4X4MA 5KSAA 4P3DA 5H94B 1IE5A 3HMWL 4DGYL 4LVHB 4OJFL 5C7XH 3O2DA 5KVFH 2EC8A 1NUNB 3AAZA 5BZWA 5FGBC 1IKNA 3BEVA 1QLEL 4DVBB 5SWSD 3KNBA 4Z7WB 1XF4B 4R6UA 5DJDB 1E27B 1Q0YL 5MEOB 1A5FH 1J8HD 3CFBA 3TZVC 2IBZX 2IMMA 1WT5C 1JTTA 2E7LC 3ARSA 4A2LA 2J5LB 3ARBA 2EKJA 2F54B 5IESH 2BSSB 4GRLD 4NDMB 3EFDL 2NY2C 4CVXA 5J89A 1AHWA 4Y8AA 2MQCA 2VJXA 3IGAB 1VFAA 4HX1A 2EDQA 2AEPL 2YZ1A 3BP4A 4ZS7H 1MRFH 1KTKE 4XH2B 4FN0A 4LNRB 4IRJC 4NKMB 4HS8H 3VFWB 3CAFA 2F5BH 1OAKL 1XAUA 1IQWL 2K3TA 2FGWL 3MV7B 3QFDB 3QEGH 2QQKL 4D3CH 4NQSA 2OL3B 3H8NA 3O4OC 5BO1H 3LDBB 1MJ7L 1OB1A 1GGBL 4I2XE 1IT9L 3RL1A 3WIIH 1A6PA 1U8JA 4JM4H 1UWXK 1IM9A 4KPHL 1LNUA 3VH8A 3P4OA 3HE7D 2YPVH 4OLZH 3RWEB 1CDIA 4OKVA 3S4SG 3KPLA 3DIFB 4PJCF 4XNYH 4KZEH 3MRRB 1QLRB 4HFWA 3FT3B 4NBXB 5FKPA 1ACZA 3KGRA 3SDDA 3HMXA 4OCYL 1L7TL 3NGBB 1S9XA 4PYGA 2HAZA 4YHZL 3SE3C 1A5FL 25C8H 1ZGLA 2GJ6D 1NBYB 4TSAL 4X7EC 4KKCD 1QFWH 2DQEL 1U0QA 2X4OA 5D1ZB 3UTTA 5T1DH 4A6YH 2QLVB 4MCYA 5EFIA 2P47B 4Z7OE 1EXUA 3N1QC 5B38G 1S7QA 2GAZB 5KVEL 3WO3B 4EIGB 3QG7H 4L9LC 3GNMH 4PJAE 3UTQA 5DRZB 2PYFB 5HI5D 3EYUL 1VACA 4O2EB 1XF3B 4LSTL 2SEBA 5DK0B 3RWFB 1UC6A 4QHNB 1VSCA 1JF5A 3EYOA 4M43L 4P5TD 2ADIB 4NNPH 4YUEH 1CLOH 1PX4A 2ZJSH 3DVIA 5GIRB 4NN5B 1EHLL 1LEGA 5D1QB 1GRWA 4M6OL 1FO0L 1UXSA 4LMQI 1I4FA 3TV3H 4O5LL 4PJFE 5HDQH 4BKLA 1ZLSL 4PJIB 2FH6A 5IJKA 4NRXA 4MQ7B 4L9LB 4TYUA 1BOGB 1UJ3B 4PGDB 4NFCA 5HPMA 4J3XA 5IMMB 4PREA 1NKRA 2BVOB 2PO6C 3H9YA 5DHVB 1N6UA 1YEFH 3MV9D 5EZIL 3AXLA 4XB8A 4EI5C 1IM9B 1SHMA 3GSRB 4L4TB 3NIDF 4Y8DC 1IBGH 3TYFA 3NZHH 3QQNA 1AGCA 3BSZL 3CDCA 4YAQB 5GGRY 5CGMA 3B2VL 4M02A 1INEH 3CDGB 3T0WA 1WT5A 2X9WA 4XPBL 3VD7A 3TYGL 4Y1AB 4WIQA 4Y19E 3GI8L 4CGTA 2YPLE 2F74B 1ES0A 1I1AD 4RGNE 1WV7T 1RZIA 3JV6B 4PRPA 4D9LH 3D25B 4MAYD 2R56H 4P2RD 1CIUA 1T3FA 3SKMA 3VFOA 3HC4L 5TQ2L 1G6VK 1NBVL 2DQGH 2WQRA 3KVQA 1LE9B 5C0IA 3WL9A 4D8PB 1EERB 3EAKA 1NMCB 4P2OA 4N0FA 4OM0L 1EVUA 5HPMB 4U31A 2JIXA 2WK2A 4FXLA 5F97E 3L5IA 3JV6A 4JRYD 1RPQA 4ISVB 3RDTC 2A6KB 4F8QA 3WN5B 4JM2C 5E2UH 3K2MC 5BQ7B 4MD5A 1R3KB 2D0HA 5C07E 1D7FA 1XEDA 1CBVH 4L8BA 1ZT4B 3V7MA 4JB9L 4NP4L 3UO1L 3MGTB 4V1DD 4ZPTA 3REWA 5ERWB 4JANA 4O4YH 4WTXA 2ESVB 2Q6WB 4NUJB 4S1QL 4BFEA 3T2OA 5IB4B 5DMJB 4OI8A 4GKNA 1IC4L 2G60H 2P5WD 4UIKL 1Y0LB 2XZAH 5H2BB 3L95A 4M93B 4ELKB 4LLQA 1A9BB 4LVNB 4ONGL 1CXLA 2OXGA 3EBAA 4N0CC 3GO1L 4OZHF 3QEQD 3B9DA 2F54E 1N2RB 2AJXL 3VFRB 4UZGA 4XPTH 4AIXA 5GIRA 2FWOB 3PWPA 2PETA 4YWGL 1RJYB 5KSAC 1YMMD 2XQBH 4L8SB 4L8CB 3MGOB 3HPLA 5I19L 3RY4A 2V5YA 2FNBA 3QXDB 2V17H 3OL2A 4PV8A 4RGOH 4PIRF 1KPUB 4WFGD 1I8IB 4RAUB 1DUZA 1CDHA 1IAIM 1SJXA 2GQHA 4RWYL 4XC1H 3IF1B 3HUJF 5D7JC 3QUMA 4OD3L 2UY6A 4BFIB 2FX9L 4F57L 3ZDZE 2G75A 1I3RA 4M61B 1U3HB 1CBVL 1DN2A 4QHLB 5L88L 2VE6A 1WAAE 4PGBB 1D5IL 3N1FC 4LLVB 2HN7B 3HLAA 4B50A 1VFUA 1FYTE 3CIQA 1DQLH 1CLZH 3GJFB 4TUKL 3UP1A 4M4RA 2EIBA 4U3HA 3KYOB 1AXSA 3ES6B 1DE4B 5CSZA 2YUZA 2BY3A 3UYOD 3GO1H 3C6LD 5BRZA 5ITFA 3BIBX 3MFGB 1FLRL 4ZUTA 3QRFM 2E7MA 4R96B 4WV1C 4RFEB 3WNMA 4XVUC 4J4PA 3T0EA 2X4TB 3KPRD 1JWMB 1T66C 3BPCA 5IB2A 1F42A 1MFEH 1G9NL 4HWBL 3U6RA 3WEXA 3HG1A 1A2YB 1XF5A 4Z7OF 3VFVB 1VHPA 4UV4L 1KB5A 5MEQB 2DMCA 2R29L 3V52H 2ZWLT 3MLVH 1DANT 3CFJA 1T4KA 2Y25A 1EHNA 1N26A 4JQVC 1YN7B 4W6WB 4HQQL 4O51B 4JPWL 4GLRH 2C1OA 5ITBH 2B5IC 5F71A 1UB5A 4U3CA 3WS3A 4AM0B 4RBPK 3HG1B 5HYSG 2BC4A 4ENED 1NLBH 3AC0A 4KK8C 5C70A 4I48A 1FVCA 1C1EH 2JB6A 3TVMA 4AL8L 5FYJH 3TJHD 5ALBL 5C6TH 5I1JL 5HGGS 4M5YH 3SDAC 1PQZB 4KKAC 1S8DB 2BMKB 4U1KA 3KXFE 1MH5A 1GGCH 1HKLH 5EBMB 5EH1A 1F4XL 2AERT 2K7QA 4HIHB 3TO2B 4ZPVA 5CJQH 2J6EH 2ZUQB 1P7KA 4HMDA 4MDJB 4MJ6A 5JOPD 4U6HA 1KNOB 6CGTA 4PG9A 3QUZB 4NWTL 3AROA 1JK8A 2V9QA 1NQBA 4H5SA 1YPZA 2W0PA 4Z77A 4GBXD 2ZG2A 3QA3A 2E5EA 4PJ7B 3NABL 1G9NH 2PYEE 3QQ4B 2NY6B 3LIZH 5TF1H 1IC7H 5HTSA 1F3DJ 3FB6B 4OZ4B 3WNLA 4N1CA 3WLWD 4P5TB 5EU4B 3EDFA 4QRUA 5EPMB 3MCKB 2H9GB 3L3KA 4LBEA 1DE4A 3OKKB 3VXQA 1CDYA 2JJWA 1H3PH 3SGKC 1FAIH 1S3KL 5KSAB 5GGVL 5C7XL 5FYLE 5MERA 4N8VA 2EDKA 1PY9A 2EDLA 4ZOAA 5KOVC 1DQDH 3AS3A 2DLHA 4JY4B 3T2QA 2F9BT 3U9UA 4XRCB 3O6LH 2ZUYA 3QEUA 3H9HA 3LN4A 1JGUH 2Z92B 2AEWA 4K23H 2ZSVB 1AXTH 1YEDA 2F8OA 2ZOLA 2X89D 3VA6A 1FFRA 5DR5H 3SDAD 2D9QB 4HIJB 3A6CL 1EHAA 2HMIC 4MNHA 5KSAD 5BVPL 4H25B 4XHQA 3K46A 1L7IL 2NY0B 1A7PH 4PV9A 5FF6A 3G6JE 1YY8B 1MQ8A 5ESAA 4HT1L 3BYYA 2OQJB 3UPRB 1GZPA 3W9DA 2IBZY 1TJIH 4X6CF 3RNQB 4GAGH 3CK0L 4P3CL 3VFNB 3B43A 4DKEH 2NNAB 4KDTA 1BZ9A 1RZIB 1G9MH 4LP5A 5HGDB 5EUOB 3I6GA 3N85H 1NL0L 2FGWH 3C5ZA 4Y4KD 5TH2B 5FB8A 3ALXA 5DURD 1I8KB 3LKQB 1MNUL 4GMSH 2GJ6A 2IG2H 3PV7A 2Z0BA 3I9GL 4KY1L 2VXQH 2YUVA 1B0RB 3IDGA 3ZE0E 3BEWB 4RAVA 3H9SD 5JHDE 3VE0A 3HG1E 5FO9B 1KN4H 3TH4T 2H26A 3RKDC 4RWHA 2W9LA 3AM8A 3RWCB 1A4JB 5ICZA 4ODSL 2Y07L 1FIGL 3SO3C 4HWZB 1A1NA 4Y5VA 3TIDA 1SY6A 3D2UA 3RTQA 4J7RA 3BMVA 4OZFB 1A0QH 3ZYOA 2IALB 1T1WA 1CD1B 1MAKA 1E6OL 3MOBH 1D9KB 4MNGB 1IL1A 1FVDB 5D93C 1CXKA 1BEYH 1ZSDA 1R6VA 4Z7UF 1ZLUK 4UBDD 3O3EA 3QJFA 4JFHE 3D5OF 4O9HL 5C09D 4PR5A 5D5ME 5GJSH 5IOPB 1LEKA 5KS9E 2ZG3A 3RGVA 3HE6C 2IPTL 3DX8B 2A9MH 2EKSB 4R2GC 1ZHBB 1U8HB 3O6KL 3I75B 3BP6B 2B20A 2Y5TB 4DGYH 5EZLA 2DN7A 4NM4L 1TENA 5CZXD 3O2WH 4TOYH 3S6CA 2RBLA 2KKQA 1INDH 1NCNA 3RA7L 3ARWA 5DEZA 3SQBA 1NCBL 3MBXH 4ZO7A 4CNIA 3RWCA 5DRZA 1UA6L 3QWRA 5K59F 2APWA 1EGJA 4GRWF 2MSPA 5E6IB 5IGXH 1IZKA 2EO9A 3A0OA 3EFFA 4MA3B 5DK0A 1JPSL 3PWPE 1L9MA 5L0QB 15C8H 4H1LA 4F15B 2HTLC 1I7ZB 4HSQA 4LVOC 5GPRA 1AO7E 3OPZH 1T1XA 1KULA 4CJ1A 3RU8H 4CDGC 4DW2H 1W72B 3SY0B 2WBKA 3FJTA 5IR1B 1IAIL 5EO9A 1RK1B 3V6OA 3QPXH 4HUVA 1ZLSH 2W65A 1OVZA 3LKQA 3WE6B 4PJIA 4HIIB 4RMTA 3OXRB 3C5JB 1OP5K 1I7TB 4CW1B 1ZHBA 1QFWI 4PRHD 4MCZB 4PGDA 4H8WH 2AABL 1TZHA 2JB5L 5GHWL 3N1GC 4ESKA 1UEMA 4O02H 1S9XB 3PGCB 3IXTA 1RUQL 1RD6A 4CU8A 3QIWC 2WANA 4ZD3H 1NFDF 1WSST 1JYNA 4R7DB 2ZCKL 4P0DA 5C0EB 1T1WB 5L2JA 1OAUL 15C8L 2HKHH 5I74B 4KZDH 3CFKB 1OAZL 3L3HA 1PSKH 4GQ9H 4X0KB 5B22A 2PYEB 1XCTA 5DQ9A 3MCLH 5ALCH 4GFTB 4MD4B 5CIPH 1BAFH 3SCMD 1T22B 4FQCH 2CLRA 2ZUWA 4OGYH 4LNRA 2P24A 4N8VG 3RA7H 1AKJB 1EEQA 4IOIB 3QQ3B 1XF2B 3QFDA 2GSIA 2ARJB 5D7IA 2HG5A 4S1QH 3CX5K 4RISH 1IGIH 5J3HD 2YR3A 4I48B 4K94H 4X9BA 5IBLC 4N8CH 2HRPH 3EDJA 4ODTH 1G6RH 2FX7L 4GKOA 3QG6A 2BVEA 1IKFH 1KTRL 2HJKB 3JTTA 1BFSA 5J11B 4GSDL 3M8OH 5DQJA 1HKFA 4JM2B 1DBJH 1ZWIA 5JXED 1WWCA 5L7XL 5DMGC 1ZE3C 3MRRA 2NR6D 4Z7QF 3O9WB 4P9HL 4YBQC 3RVXC 3QWOB 5KS9B 3BZEA 1XGRB 1EGJH 4HKBB 4FZ8H 2AJZA 2WZPD 3VXSA 1EBAA 1A7RH 3K74B 3HR6A 1P53A 2OXHA 3VXUA 4R96A 5B3NA 2BDNL 5C2BH 3RIFF 3RWGB 4DZ8B 2VR5A 3ZSSA 4FQ2L 5CIPA 5ESVA 4K9EH 1FRGH 3GNML 5HVHB 3EO1A 3MUY1 5JMRA 1D5IH 1MUJB 1EIBA 1AXIB 3LEYH 3LRGA 1HH9B 2QJDA 1N6QH 3EGSB 2AP2A 3MRMB 5FUZL 2NY1C 1LP9F 3FQWB 2JCCE 4PRHB 3L5HA 4KMTH 4Q9QL 3HZMB 3QIUC 3KR3L 1A4JA 4NQDA 3W39B 4NQED 3L3HB 1IRAY 1P7HL 2BVTA 4PTUA 2EE9A 2NMSA 4XBEH 4PY7B 2DYPB 2EYRA 5IB1B 4KTEL 4NC0B 4CVXB 4CVZA 4YDJA 5T1KD 4Z8FL 2IAND 2V5TA 2EXWC 1GGYA 4I9WE 2JJVA 3V79C 5DURB 5E4EC 4AMKH 1YYLH 4HCRL 1YMMA 2XACC 1JRHI 2D0GA 4Q74A 3OQ3B 3S36L 2DWDB 4AEHL 3DETD 4TN9A 4RQQB 1CXFA 1D5XA 5L8LB 3QIBD 1LO0L 1FVEB 3K4DA 1NGZB 1F11B 2NY1B 3TLRA 4UQ3B 2OQJA 1FZMB 2AI0L 3G6DH 1INDL 5I75C 3UPRA 1AI1L 3KYOA 5TDPB 5ETUB 4YHZH 2O5ZH 4JN1L 3U9PL 5INDA 1JWSB 4JG1H 4E0RA 1AH1A 4FXKB 5J9PB 2YSSA 1JTPA 3MBEC 1GPOL 3L95B 1NDMB 4J3SA 4Y4HA 3T0AA 2R0WL 2BRRL 3NTCH 3CVIL 5HVGB 5I8CA 1FNFA 4WENB 5AAWA 4PY8J 4JDTH 4NO2A 5I74C 3QCUH 1F6FB 3L3JA 1NCAL 1QBAA 1TPXB 3T0EE 3IFPA 1WBXB 2ICWA 2FBJL 3QUYD 4WI7A 4OD1H 4TRPL 2DM3A 5JW3L 3EJYC 4EN3D 3NPSC 4YPGA 1OGTB 1DBML 4QOKD 1C1EL 2FHBA 1IC4H 2JIXB 3ZHLA 2ZCHL 5K9OB 3LH2L 5L2KD 4XP9H 1F4YL 3P9LB 3S34L 1HKLL 5IKCB 2DJ4A 1NCCH 1OARH 4D2NA 1FO0B 1NH6A 3EHBC 3BPLB 1CL7H 4XI5C 4BYHA 2VDLL 4F9LA 1IC5H 1RFDL 1J5OL 1VKXA 3JSSA 4GXUM 5F3BB 1JNLL 3V4VH 1NDGA 4FQCL 1XR8A 4K3JL 4U05A 5EDXA 3DXAB 5JO5A 1X4YA 4AG4H 3BE1H 2I5YL 1A7OH 3PWUA 2QSCL 2Q87A 1RZJC 3OKOA 1NGPH 5MEPB 4J4PC 3T0EC 1PG7H 1FNHA 4RMRA 2R8SL 3BZDA 5E9DA 1U8IA 4JN2B 5FB8B 3FQUB 3RNKB 3LKOA 1RJCA 4U1HB 3ARRA 3L3IB 4P23A 4K23L 5K9OA 3K2UL 4ZSOA 2E8ZA 5KVFL 5D6DC 1N5YL 1OP3H 3JZ7A 3SOBL 4NUGH 1CFQB 3FO9A 5TDOA 3ESUF 2IC2A 1I8LA 4L3AA 1I1CA 4OQTH 3MRQB 4IRSA 4KQ3L 3L5XL 2IH1A 4TUKH 3NZ8A 5I2IA 1S7SB 1A1NB 1JGDA 3VFOB 1QNZH 2FD6L 1FZJB 2FO1A 4G6MH 3WNOA 3QXTA 4GRMA 1A02N 3EYOB 2FSEA 3R8QA 3OR7A 3LV3B 2BVPA 1EEYA 2AJYL 5DJ0B 3P77A 2OSLB 3BH9A 2WBJC 3E6FA 1VADA 3S88L 4E5XB 1A64A 2ERJB 4JLRB 4JQXC 1GC1L 1OD7A 2IAMD 4MJ5B 1Q9LA 2BCKB 5HJ3B 1R3IH 5L9DH 5I8CB 4Q9RH 1KJ2B 1U8KA 3QZWA 4X7DC 3BD4A 2FEEL 4HF5H 3QR2A 1FNSH 2R39A 4MA8H 1ED3B 4LGRB 1FL6B 4TUJB 3OMZA 3A67L 1ADQA 2V7HA 2AV1B 5D96C 4AH2B 2BSTB 3LMJL 1LHZA 3UAJD 5CJQL 4CU6A 4YEFA 3O4LB 1HOCB 1AP2B 5DMIL 3B6SA 4V2CB 5MI0C 4XI5D 3LN5B 3G5VB 3W11D 4PTUB 5EU6E 2A83B 2ICEA 1GJIA 1OGAD 4F9PC 3QDJA 4FABL 2HVKA 4NN5C 4Y4FC 2X1WL 3ZTJG 5EOTB 1CGUA 1HE7A 4L3EA 1QRNE 2QQLH 2QR0A 3F65A 2DICA 4OT1L 5CCKH 3VGBA 4OCXH 1VEPA 3SJVB 1OT1A 1MWAH 4U3XA 3MNVA 5A2FA 5KOMC 3X13B 3D0VB 4V2BA 5D1ZA 3GGWA 2BOCA 1MLBB 2NY6C 5HHXL 2M8XA 4J23A 1WZKA 5FYJU 3Q6FA 4KI5D 4YHLL 3H9SA 1KGCE 2OI9B 3WCYA 2Q7YB 1P7KB 3MUZ1 2YPVL 1FGNL 2FIKB 2QL1A 4YBQD 3RY6C 5K9JL 1T20B 4KPHH 2X70B 3FO0H 2RGSA 4HBCL 1E4XH 2ESVD 1FZKB 3VXOA 5ESVB 4NOFA 3IFOB 2HRLA 3F6IA 1JNNL 5DGRA 3RVWC 1N8ZA 1BQHA 4YHNA 4ETYA 4WHTA 1UH2A 3S37X 5EU5B 5E8PB 4B5EA 3FFCB 1SBSH 1QOKA 4YFLI 3ULVE 5C09A 2LVCA 3V4PL 4X7CC 3V5KB 1WTGT 3MV8E 1GOHA 3A6CH 3MV9E 1LD9B 4K7FA 4KKLD 3BPCB 4ZFOB 1V5JA 1HQ4B 3I9GH 2YPKA 4R0LB 2FJFA 4LVOB 4WDIB 4FFWC 5KAQG 4OZGE 2Y7QB 1A47A 1KPVA 2XICA 4YDVB 1KCVL 3HNSH 3DYPA 5JIHA 4RNRA 1KCLA 4KUZH 5JXAL 1HYSC 1U93A 4ELMF 1BAFL 1RVFH 2FLBT 4PJHA 4WW2C 4JFFE 5CJXC 4RGMC 3W0WE 3QUYB 2VLKA 4S0SD 2ED7A 5EU7E 1A6TB 3V0WH 3QIWD 2CO6B 2NX5E 2C4XA 5HDBF 1DSFH 4HWNA 4LDLB 1RHHB 3I3BA 4GAJH 4GRLA 4KVCH 5FYJD 5GRJH 4R7DA 3NCMA 2CK0H 4M6AA 2ZCLH 3QQ9C 3PWUB 5HDLA 2CRYA 3VWKD 1JNJA 4LPCA 3CFKA 5LXGH 4WHYG 3WHE1 5TPWL 5FCSH 4JFXA 3CFEB 1JYWA 4YH6A 5CP3H 4APQB 4P9ML 4HUXA 2YRPA 1NCWH 2YK1L 2YBRB 4JY6A 2P7TA 1QFHA 3BD3A 3TBYA 1YNKH 2O5YH 2C4FT 5I1IL 4ORGB 3VXSD 4N5EC 4ODXA 3K1KC 4M00A 2WP3O 5FYKE 4M8QB 1JZ7A 2WIIB 2AKRA 3FFDA 2HG5B 3GMRB 2FWOA 1UADC 1T7YA 4L3EE 2A0LC 4RA3A 4BK4A 3VXMD 4XP1L 3D6GA 5I1GH 3MNWB 5I66A 3SJVE 4HJ0D 3MLYL 1KJ3H 4ZFFB 3KXFD 3IDMA 3MXVL 1XIWD 2OSLA 3BH9B 3E6FB 2HFEA 3IJYB 3OGOE 4HXBH 3SGDH 3EJZC 5EU7C 2IFGA 4UDTA 5T3XL 4FTVD 3W82A 1AGCB 5L7XH 2NY7L 3LSOA 1S9WB 3RBSA 3RL2B 4EDXA 2J8UB 1CGVA 5I30H 1MLCB 1JFQL 2CXKA 3VA2C 3IDMB 2DJUA 2X1XR 1GGBH 4NFDA 2DIBA 5EU3B 1H5BA 5C0BA 2EZ0D 2XKSA 1RU9H 4N5ED 3QO1B 2B39A 3OAUH 5HYQA 1SYSA 4ZNEA 3I75A 5EORH 1LO5B 5JHLL 5E9DB 2HFGH 3DUSB 4FQXA 4HUUB 3WUZA 1YY8A 1X5LA 1RMFH 3PDOA 2CDFB 2IJ0C 3OAZK 4POZD 5IBTH 5IMLB 2VXVH 1WWBX 4N9GA 2MMXA 5BXFA 4HPYL 3DGCR 2A6IB 1NCDL 2HJFA 5GGSB 1T04B 5T3XH 1ORQA 4PB0H 1AHWC 4UAOB 3DVFA 4XPAH 5I73C 1E4JA 5CSBA 2AJVL 2Z92A 5E6ZA 1AIFA 5CZXC 4YHMH 2IFFH 3GEWB 3VXUD 4F9PA 2VLRA 3MRNA 2E7LA 4D9QD 3D18B 5DJCA 4HG4K 1WBYA 3PE9A 3MJ6A 1ZANH 4PY8I 1CZ8L 4GW1B 3V6ZA 4C56B 5GS1B 5CFHA 2VAJA 5F88B 4HC1L 4QOKB 1KCRH 5DK3A 3P9LA 2OI9C 2WP3T 3EYSH 4NO0A 4HUKB 4PG2C 3KJ4C 2A9NL 1DBAL 2BK8A 3TFKD 5H37G 4PRNA 1MAMH 4WCYL 4LLUA 2GTWB 4X5WA 2IADB 2R1WB 3D85D 4WTWA 2W9EL 4NNPL 2XKUA 3VMPA 1I7UA 1HIMH 2IQ9L 5IJVB 5F1IB 4G3YL 5H35B 2D7PA 4HXAL 4Z7VF 4JRXA 1T7ZA 1FL5A 1BECA 2JF1A 2DLEA 1ADQH 5HY9B 3L6FB 2QEJA 4RDQG 3VD4A 2R1YB 5IESL 2IGFH 1OF2A 5I8OH 3HN3A 4OCMC 4PV9B 5FF6B 4PG9B 5EZJB 3PDGA 1EZVX 5JTWA 3MBXL 3X17A 3EYVA 4P2RA 3U4EA 4HPOH 4X80H 1R5IB 3D69B 4D9RE 3N1PC 3QRGL 2VXVL 3FQWA 1S8DA 2BMKA 4U1KB 2DKUA 3Q5YA 1X4XA 2HT2C 1EFXD 1FIEA 1RVFL 3AREA 3N06B 5L88H 3WLWC 3LKSA 4NNXB 1QBLL 4M1CD 3MV8B 3OZ9H 3ELAT 4PJHB 3U36B 3DBXB 5AG8A 1JRHH 5I9QB 1GHFH 4MDIB 1KEGH 2Z91B 3GM8A 2N4IA 3L5JA 3ARXA 5LVEA 3NFSL 1ZGLB 2MCPL 5FYLH 2F54A 1A1OB 5FXCH 4CKVX 2EEBA 1ZTXL 1XF5B 5E00B 1KJVB 2D4DA 3BGAA 4MNQD 1LO4H 4LSDA 1S7QB 2GAZA 3LS4L 3MV7E 4KFZC 2P8MA 1N4XH 2PR4H 5KTEH 3PGDB 3PQYD 2NX5B 2NCMA 3DX6A 3FQRB 3INUH 1CTOA 1AJ7L 3U0TA 1V05A 4ZTOL 1D9KD 4IRSC 5IHBA 4PJDB 4XWGL 1EEZA 3ET9F 1RV6X 4I8DA 4TQEH 3ME0A 4DUXA 4LHUD 1NLBL 2IPKB 5CSGA 4XCCL 2F53B 1H8NA 1WJ3A 1KSRA 3RI5K 2DIJA 4X99A 5J56B 2J8OA 1HH6B 5E2VH 3QUMB 2IAMC 5FK9B 5B39B 4C56E 1BQUA 4NO5B 5C0BE 1BZ7B 4IOIA 3UXFA 3AS1A 1QSFB 3LEVL 4IIQA 3DTXA 3CVIH 3RIFK 4M48L 4M1GL 1PVHA 3LKNB 1RURH 2ZJSL 2MCPH 4B7LA 4X7SH 1BFTA 4B53A 3CD4A 3RJDA 4E5XA 3KJ6L 3VXRA 1WZ1L 4OAWB 1S9VB 1JN6B 3A67H 5F96H 4K3DL 5B8CC 3FTGB 4OZHA 3CGTA 1D6VL 3DX7B 4GG6A 1QACA 3VWJD 3U1SH 2V6HA 2VWEC 2DB8A 1U3YA 2CQVA 3DTXB 4Q6IB 5SWZB 4OBRA 1CVSC 2C7UB 2CKBL 3SKJL 5IT2H 1JYXA 2Z31B 1TZGL 3GSNA 3QUXD 1BGXL 5D2LE 5A2KH 2MPAL 5TE4L 2YD4A 2UYLA 1SVZA 4WO4A 3QDGB 3DECA 3SE8L 3OKOB 3RGVB 1IGMH 2R9HC 3AS2A 1OQOA 5F7EH 5D96B 2AJ3A 1UACL 4X98A 3OXRA 3OR6B 2Q3ZA 1KJMB 1TCRB 4U6VL 2VIRB 2DD8H 4OZFH 4D0DB 3M1BA 4PRBB 4GKSB 4DUVA 3MLPA 1GZQB 3SPVB 4J12A 4Y2OA 1A7NH 4XHJC 5HHNB 3WD5L 2HT4C 4L3CA 3B8SA 4UILL 4HQQH 1YEHL 4EUPA 4GG8A 3RUGE 1CFSA 3QXUA 4B7IA 5BMFL 5D7LE 1X7QA 2VZTA 4P4KA 2C1PB 4Y19B 4G8IA 4OF7A 1KIRB 5FOJA 3TNNA 2R29H 4QTHB 3V52L 2CJUL 3R1GL 3QCTL 5IVXE 3CFCH 1FNGA 4HAGA 4BZ1L 4NZTH 1J1XL 3V6OE 1QBMH 3BKMH 4RRPA 1A14L 3QNYB 4JPIA 4NHUB 1A8JH 4JM2D 2R4RL 1I7UB 5ALBH 4FQHA 5C6TL 4NJAL 1J5OH 5B39A 1UZ6E 1OGAA 4TVPH 2HJKA 4F2MB 1EHXA 1Y0LA 1NFKA 1YEKH 3LPFA 1BM3L 5FO8B 3MJ9L 3P9WB 4L29A 3EFFB 4MA3A 1NMBH 4DKAA 1IL1B 3QFJD 3PHSA 1SMOA 3HUJB 4M7JL 2KQMA 1IFHL 2EZ0C 2F5AL 2Q86A 3T4AB 4CAGA 1FNAA 2GITA 2YA0A 5DD6B 1U92B 5GSVB 5IEHB 4AEIH 2H3NA 3C8KB 4P2RB 2IPTH 2D7TL 4Q0XH 3U4EB 3WIIL 2X4PA 5L6YH 3EO9L 3CH1B 3BZ4B 3MJGX 3CVHA 2VABB 4JREB 4O2FA 3CJJA 3T1FB 5T33H 3T8XA 4YHOH 4DFIA 2OL3H 3M17B 4JDVA 4I3GA 3O0RL 5JDJA 2QHLA 4LEOB 2ERJC 4OZIA 3T3MF 1L7TH 2EDDA 1DQDL 4WUUB 3O3EB 2JE8A 1MFCH 1T83A 2BX5A 3MO1B 4U1IB 3PJSA 5KVDH 2YHGA 3VFUB 5JXEC 1S7SA 2CJUH 2A0LD 1AO7A 2X7LB 5I0ZA 4DZBA 1Q94A 1U8PB 5D7IB 5J0BA 4M7JH 3BUYA 1U8OB 4DFHA 4LEOA 3GSNB 4CMHC 2YK1H 1TLKA 5IBLD 4L8DA 1PKQB 1QBBA 2FJHB 3UTPE 2FJGA 5AUMB 2P5WE 3HZKA 4K07A 4CVWA 2CLRB 5TJWK 4P46D 3WLBA 4GKNB 4HIXH 3O3DA 3LZFL 2EXYC 1GAFH 2G5BA 4LSTH 5F3HA 3S97C 3CDGA 2WBJD 2HTKD 3VH8G 1MCPH 4HLZH 3O3AA 2WWMD 4LAQL 1NBQA 3T2PA 5HI4C 2HWZL 3I50H 4ZUWB 5KJRH 4Q2ZB 5DK2A 1OTTC 5TDPA 5LGKA 1M7DB 5I17A 5GGSA 3TBYB 4PJCA 1OSZA 2YSSB 1DLFH 1DLHB 5I8EA 1L7IH 3VXPA 1IQDA 1AIFB 2R0ZH 4HUWA 4XPGL 5INCB 3P4NB 3FONA 3PHOA 1U8OA 4LKCB 1R3LA 3U48A 2OMBA 4OZIF 2N7BA 4EEEA 1Q8MA 4KKCC 1FVCB 1SVCP 1U58B 3NH7H 3O41B 4KQ3H 4C83A 3D2UD 2P8LA 3G9AB 2P4AB 3E1F1 4U7SA 3AREC 4O2FB 3QUML 1LO3L 1YQVL 4CMMA 4NQCA 3UC0L 4MB5A 4FXGA 2ZUUA 2VDMH 1S9VA 3SDCD 2VLKB 2DYPA 2EYRB 5IB1A 1NCDH 4M9PA 1KNOA 4J3VA 5J3HC 4M5ZH 1HNFA 1CL7I 1UENA 3C5SB 1MCKA 1YPZB 4H5SB 4HK3N 1E28B 1UCBH 1MIML 2N1KA 2V7NA 4ODBD 5DD1H 3RGVC 4FQQA 3FO0L 4KVNH 1ONQB 2GIYA 3ZKMD 2BHZA 1CGYA 1IMHC 1CZ8H 2FHCA 1H9VA 4LSVH 4PRPD 2VDNL 3C2AH 5FDWA 5C0AE 1PKQA 2FJHA 2CDFA 4KZEL 1OSPH 3IETA 1UFUA 3BISA 2QSTA 1X5IA 4X6BB 4NIKB 4OLZL 4Q97A 1E28A 4LU5H 4BSVB 1HZHL 5DC9B 2VDOL 2ENYA 1BQHG 2CSPA 2AGJL 2APBA 1CN4A 4Y5VC 1YN7A 2PO6D 4Q6YA 1JZ4A 3KPNA 3ULUL 4XMKH 1NLDH 3E2HC 4LLYB 5C9KA 1CFTA 3EW3B 3WBDA 5JA8B 1BVKA 4G7VL 4LCYA 1KTDA 1B4JL 1QLFB 2ATPA 1NGWA 3F5WB 4H88H 3B5HA 1X7QB 2C3GA 4G9DB 4XVTL 4OM0H 3HRZB 3RUGB 2IGFL 3TF7C 5DT1H 4WNQA 5L0QC 3KDMA 1L0QA 4UDTB 3LRSA 5GGUA 3V5HB 1QHPA 3HE6A 3AAZB 2V7HB 1HXMB 2O5ZL 4JN1H 1C5CL 3I2CL 1UCBL 3RDTB 3D0VA 3KPPB 3BD5A 3MLTA 3HC3H 1J1PH 4WY7H 3CVHL 4TNVK 1AXSB 3ES6A 2WINA 2R0WH 3P0GB 4OCNC 4XZUA 3QDME 2V2WA 1ZHKA 3BSZH 3QULB 4I77L 2J8UF 3VFGL 4UIKH 1ZEAL 4EIZC 4TTDD 5GGRB 5HHOE 4OZ4A 4WEBL 1W0YT 3T2NL 5DJ6A 4YLQT 1OHQA 3MROB 4APQA 3RPIA 2CDEB 4L5FH 1A9EB 4MJIA 4OKVB 4PRID 3TT1L 3KNBB 3LQAL 4U6YB 4PJGB 4GRMB 4JM2F 4K8RC 3QDHA 1KBGL 4P4RB 1RZ7H 3GRWA 2ITCA 4PRBA 2GK2A 4I5BB 1DBMH 4HG4J 4XPAL 1ZKAA 5LQBL 2NY2B 1ETZB 1KELL 2YPLD 3MODH 4XNUH 4RGND 2OP4L 3WE6A 4GAYB 4P2RE 3RWJA 4UBDC 3MV8A 1KJ2A 3T3ME 1D9KA 4NZRH 4XB7A 4N0FB 1EMTH 1N0XL 3MLRH 1DFBH 4H88L 1FORH 3TBSA 1AJ7H 1ZXQA 4NO3A 4WGVB 2PTUA 3F7RA 4F7TB 3H42L 3CMGA 4GRWB 4PTTA 2FRGP 4JGMA 1A7RL 1KB9K 4WFED 5EC2A 5I1CL 1FNEB 4KI1A 4YHPA 5F9WB 1A6AB 1EFXA 1LP9B 1TVHB 3PABA 2PXYA 2AJVH 3OHXA 5DHYB 3D48R 1QRNB 3SHSA 1IAMA 4ODTL 3HG1D 4PRAB 2OK0L 2YEZB 2Q86B 3T4AA 3TA3A 2M2DA 5FUZH 4JO4H 1R3JA 2OZ4L 4WFFD 4PLNC 4LK4A 3QH3B 5GGTA 4F80A 1CFTB 2P5WB 2EECA 1ZS8B 2AS5M 5CLWA 2QR0B 4HC1H 1EV2E 4FZ8L 2OTWA 5IV2B 2AQ3A 3VG9C 4XNZC 1S7TA 3NA9L 4JZJC 3VWJA 3BVNB 3LQZB 4YFEA 2Y1VA 1AR1C 2X4RA 1EEUA 2QSCH 1J1OL 2GUOB 4WW2A 4NRZA 3QUKB 3WIHH 4Z78A 2MPAH 4QRPE 5IVXA 4XP6H 5FK9A 4BQBA 1RIVL 1LGVA 2R69L 2W65B 4KMTL 1E4KA 3D2UB 1S9YB 4Y2DC 4PS4L 1MFBH 1JCKA 3T77A 2VC2H 1YC7A 2XRAL 1ZHLB 3PWNB 1JHKL 4OZGB 4I18B 1TJGL 4GW4B 2C4FU 2ADIA 3MLZH 1MHHB 3TJHC 1NC2D 4HK0B 3MJ7B 4IIQC 4UV7L 1MIMH 1W0VA 2QV2A 1ZAGA 1NCUA 4GLRI 1X6NA 5D1QD 2PNDA 3OKYA 2G75B 3SE8H 4HHAB 3VD3A 4F2MA 3RVXD 1V7MH 1DJSA 1T0MA 2UUDK 1R24A 1YUHA 3SDAB 3B9KC 4L29B 5K59E 3BN3B 1UVQB 1QFOA 1O7VA 1B6UA 1ZVYA 2BRQA 2W9DL 3UJJH 4UT7H 1DL7L 1DUZB 3EOBB 2AI0H 3L6FA 2EDOA 1LO0H 1CU4L 1KLGA 3IXAA 5IQ7L 5FCUL 4OF0A 5EU3A 1BQLL 4I18C 3ZYJA 1JZ6A 4O5LH 4LLQB 5HDQL 4Z6AT 5IROC 1DZBA 4I4WA 4L4JA 5F7NC 4FP8L 4GG6E 1Y6MR 5E03A 1RZKH 3IDYB 3FT3A 3UJIH 4M1CC 2IH3A 2F58L 5A2IH 2Q1EA 5SX5K 3P0VH 2X4QB 4OFPA 4X8XA 1MLCA 3VRLF 5KG9A 2AQ2A 2JJTC 4PJBF 2AXGB 1QSEB 4KROC 4WO4D 5DDHB 5DEFA 4K3HA 3ZO0A 3MLZL 3TIDB 5E08L 3RWHA 3RPKA 3L3GA 4NFBA 5DEGA 1HSBB 2Z8SA 3ARGC 3IDUA 1WCBA 4HV8A 5L8JB 4OCSL 5DSCB 1NFDE 5ILTH 5HVWA 2R69H 4ZUVB 1U41A 2D2OA 4KC3B 1UT9A 4L8DB 2H2PC 3BO8B 3MXWL 1A3RL 2GCYB 3B9VA 3MNWA 1AGBA 1TZIA 4XAKD 5EO1A 3O0RH 4F7PA 4L8SA 1OARL 4WW2F 2YBRA 4JY6B 5TQ2H 4IRJB 1D5MB 4LQFH 4YGVA 4JKWA 5KSUA 1MCDA 2EC9T 1PZ5A 3FT2B 5F7UA 3LB6D 4JVWA 2ZCHH 4H0IA 4GW5A 4AM0A 3V95A 4MXWH 5D7JA 5E8DL 1NAMH 1S7UB 4FRWA 4M1GH 1G7IA 1XGTA 2YA2A 1T66D 4JFFD 1J18A 3MRMA 5E9DD 1AKJD 5E7BA 4DEPB 4AYFA 5E2TL 4HEPG 3W39A 1NL0H 5B38A 5DUML 1S78D 3FT4A 3F7VA 1LDPH 3RTQD 1OPGL 2WBJA 1G7MA 5F89B 3UTSD 1HINL 1HH6A 1NCTA 4J3TA 4H20H 5ICYA 2BP3A 3TO4D 4IMLB 5DRWA 4D0CB 4HBQA 5EIIA 2Y6SC 4HC1A 2XOTA 5I1CH 3MOBL 4QXUH 4UTBH 3EOTH 4Y2DB 2YPKB 3MRPA 4L8SC 3O9WA 5CEXA 1B4RA 2CIIA 1JHTB 3QNYA 4XTRD 1TTUA 3P11L 4YIQB 3S3PA 3WUWA 2AJZB 4PJEF 2OYPA 4A6YB 1DEDA 4U1MA 5B4MD 3DX7A 3MBEB 2A9ML 3P4MA 3U0WH 1WBZB 1T4KB 3MZGB 5GZND 1I9JL 2APFA 1JUFA 1DN0B 1XZ0B 4M1DL 2C7UA 3FQTB 5GGRA 4GRWE 4HJJL 5JW5A 3NH7L 1BBJA 1LEIB 2A74B 4W70A 5DC0A 3DARA 1YEHH 1FP5A 5E2TH 4TSCL 3DRTA 1AP2A 3BKYL 4Z95H 4WU5A 4FQLH 2EDRA 1D5MA 1QSED 1WWAX 2E27H 5HGHA 5AD0A 1NAML 1U42A 3NA4A 1EO7A 43C9B 3EYFA 5CGYC 4F9LC 3R06A 1X5JA 4PRNB 1T0NA 4NGHL 3O6LL 4I0PC 5AZ2H 3RWJB 2NY0D 4MA7L 1GXEA 2XPGB 1GIGH 5IBUB 3IT8D 4PLJD 3QAZB 4PJ9C 3RUGA 4ZUUA 4LOUC 5MEOA 3ARDA 1RZGA 3GJFH 3CLEH 1OM3L 4KK9D 3V5HA 2NYYC 4FXGB 3ARBB 3DHMA 4M9OA 5D1ZD 3IKCB 1MCIA 3FQTA 1OP3K 5C71A 1JV5A 2UY7A 4GUPB 5CJOL 1I3GH 1QR1A 3FOMA 5MEQA 1RJYA 2O26U 3LKNA 5DRNA 3CU1A 4XXDA 1S7VB 4OKDA 2ENSA 2V2WB 3TFKC 1Q72L 1ZLUH 5DS8A 1U2HA 2FBOJ 1BPVA 5KVDL 4MAYC 5IOPA 4Y2DA 1ES0B 4CVUA 1MRFL 2H45A 2BSTA 4M93C 4FP8H 1I9RL 5E5UB 2VERN 2KBGA 3MRFB 1EAJA 3QHZL 3MNZB 4RMUA 4HZLB 3IETB 2VB5A 4LLMB 2P24B 1IGJA 1G7LA 2D0FA 1MSPA 4CNIB 5IP4A 1JMZA 1A0QL 3KYNB 2VE6B 3DX6B 3FQRA 1UYWH 3MXVH 1RUAH 3HMXH 4HBCH 3HC3L 3Q3GA 4DEPC 1WGOA 3WN5A 4PJGE 2X41A 1KIPA 2CLVB 1WAAF 2JELH 1UM5L 3ARFC 1NGWB 3MNVB 4POZC 4U1LA 1WCBB 4ZNEE 4HS8L 4GUPA 4WTZG 3HRZA 1MRCL 3U7WH 3IVKA 3QFJE 4APQD 3VRLE 4NCDA 4FMFA 4WWKA 1IGFL 3TBSB 2R56L 3S5LG 4Z76A 4R0LC 2XXMB 3JWOL 5ABDE 1IC7L 3G6AA 4G8GA 1J0KA 3DLQR 4HH8A 4CJ0A 3DUHA 4FQXB 1PZ5B 3BKML 5C0RL 3U2SB 2R2BB 4XNUL 1A6WH 4KH2A 3FN9A 1Y18A 3CFDB 3HNSL 1U9KA 1RY7B 4HWEL 1TJHH 1TZHB 1BWWA 1KCVH 2DBLL 2H41A 4AT6A 5BV7H 3BP4B 1KBGH 4ZQKB 1FL6A 3I6KB 1MCQA 4KAQL 5SWSE 2XWBA 3QH3A 2F74A 4H25A 5SWZE 2FECL 4MD0A 4JDZA 3UBXI 5JPMA 3TZVA 5FOBA 4HMCA 4HUVB 3MROA 2SEBB 1RK0B 4O2EA 3GSQA 3GSNH 3NN8B 3DROB 3BQUD 1UM4H 1J86A 2AV7A 2PKDA 2LQRA 1CIDA 3ZTNL 4XP1H 4ZOEA 3D3VE 1BP3B 4LKXB 1VERA 1LILA 3KWWB 5GJTH 4H8WL 3D39A 3ZKQD 4APQC 1XF1A 4YXHL 4FQ1H 1N6QL 1U8LB 2C3VB 5SWZD 3W0WA 5EOTA 5FOBB 4XX1E 2A6KA 4BKLB 3ZKMC 2EIZA 3FHAA 2O5XH 4OFIA 4DQOL 1I7RA 4QNPE 4HFUL 4YGAB 2QQNL 1NFIA 4ZFGL 2WUBL 3KXFA 4AMKL 5IJVA 1A6UL 1XIWA 2X4UB 3F58L 4M6OH 4IOFD 3EYUH 3HE7C 3CSBA 4OF6A 1C7SA 3QAZC 4PJ9B 2V17L 3GJEB 1WICA 4F7PB 3W5MA 4BQ8A 4X7FC 4HJ0C 2EEAA 4ERSL 5DXWA 4H8WC 2LABA 1MWAL 1T0MB 3GIZH 2VWEE 4Y5YC 1SBBA 1TTFA 2XN9E 2XZCL 3AU1B 3QHTC 1KT2A 4OF5A 3NPZB 4WWKB 1XR8B 1X5HA 2AK4E 4M03A 4IMKA 3BMWA 4JEGB 1UWXH 4NNYB 1TJHL 1OLLA 2VITA 4POUB 1MCWM 2BXYA 4N8CL 1RIHH 2AJSL 4FQXD 2H1PL 3Q3GB 2B1AL 3MQIA 5EOCH 4N8VB 1P69B 2H32A 5HHOD 4C57C 1GOFA 1MOEA 3MJ8B 3VG9B 1YEJL 3HE7B 5EN2A 2HFGL 3JV5A 3L1OH 3MV9A 3HUJA 1U8QA 3OXSA 2FECI 1A21A 5E6YA 1VENA 2HT3D 1NFDA 4LRIA 5DZLA 5DLMH 3CVHH 3KAAA 1I4FB 4GG6B 3PUCA 3QFJB 3IAPA 3GI8H 4PP2B 3IDNA 3TGXA 4TULH 1S9KC 1N0LA 3MV01 3FN3A 5DJDA 1FRGL 3S5LB 3DXAE 5F6HJ 5KN5A 1ITCA 5EUKA 1NBVH 2DQGL 3CDYA 1NEZA 3QNXA 4N0UA 2Y6SD 1KGCD 4Y0GA 2A2QT 4YIQA 3UJTH 4OD2B 1JK8B 2BDNH 2H1PH 2EDNA 4GRLB 1CICC 1FJ1A 2AW2A 4ZUTB 1VKXB 3JXAA 2Q76B 1FNEA 4LSPH 3OSKA 3WXWL 3LHPH 4LF3B 1TXKA 2A73B 2VIRA 2J2ZA 4IHOB 4ZUSA 1DCLA 2B1AH 2X1PA 2Z4QB 4N8PA 4RFNC 4X4XB 2H8PA 5D7LB 3U4BL 5FYKU 4IOSD 1MREL 3M07A 4MB4A 2NY3D 4JFFB 3EHBD 2YRZA 1Q38A 1EAPA 4DN4H 3AMKA 3TT1H 2DDQH 4XCEA 1C08B 2Y06H 3VDAA 2FR4A 3KLAB 3ARTA 2C1PA 4U6YA 4Y19A 5CD5C 3RVUC 1NJ9B 4UINL 3LN5A 1ZMYA 3HPJA 4I5BA 3FL7A 5CLTA 1I1AC 4HKBA 1P5UA 4YDLC 5F7FA 4KXZH 1NAMA 4G8FB 2YUWA 4NKOB 1MVFA 2NW2A 2NY0C 4NZTL 5CAYB 4YO0B 4G6AC 5F6HI 2WLZA 5DJYB 5JDSA 3TPUB 3ZL4H 4YQXH 3FB5B 3ULVL 3WFDL 1JI2A 5LBSL 1W72H 4LLVA 5IROA 1FAKT 1S7WA 1F2XK 4HK0A 3GMLA 2DQIL 1GZQA 3J7HA 3BKCL 5C0NC 5I1LB 4KRNA 5EO1B 4OQ1A 3HAEG 1AGBB 4U1IA 5F9AC 4XVSH 4YC2C 4F57H 3LS5H 5F9JA 3GSVA 2FCBA 4U1NA 4DN4L 3NCCB 3MBED 2ZUVA 5DD3H 5T3XD 5H2BA 3C5ZC 2D03L 1ZGLP 5BJTB 2HVJB 5D8JL 1UM4L 1QQDA 1SJHA 3INUL 3ECBA 4JO4L 1Z9SA 5M94B 5L6YL 1T1XB 1ZA6B 2J4WH 2NXZB 4X83A 2YXFA 4EBQH 4YXLL 3LS4H 4PB9L 1OW0C 1FG2A 5FYKD 3CCHA 4KI5F 4OF3A 1QPPA 2NY4D 4CMMB 2ID5A 1A6VH 2JK5A 3FHQA 1PG7X 2D3VA 1YDPB 2VQ1A 3MJ9H 4OQTA 4L3ED 4LVEA 3NFPA 4J8RA 5I15H 5TFSL 4NUGL 5C0ND 4X7TB 1BX2A 2DI7A 5C0JA 3QDJB 3GKWL 3EDEA 2P8PB 4V1DB 4OIIH 4EN3C 1T6WA 3DMMA 1ZT1A 3MMEA 5IIEA 1AGDB 4HKXB 4X8JA 5CMAA 2BVQB 3SGDI 5MI0B 4ALAL 2DM2A 5E5MA 2UZYB 2B4CL 4M8VA 5F8RC 3EOTL 1FL3A 4RX4D 1QO3A 4UT6H 1R3LB 4K8RH 4Q9CA 1FNLA 3BGMB 5T5NF 4ZUSB 2Y07H 3C08L 1FG9C 4QT5A 3RJQB 2ESVA 1G84A 3MLXL 4QHUA 5J1AA 3TESA 1CLYL 4HS6A 3FQNA 1PEZA 5HPOA 4LIQH 4H0GA 1KF9B 4P4KC 5B8CA 3TPUA 1PLGL 5CD3A 3QEGL 4HS3A 3BGMA 5HJ3A 4ZXBD 2VSCA 1JGEB 4X98B 1NGQL 1QLFA 2ATPB 2ED9A 2I26N 3HAEB 2I07A 5ILTL 5T5NG 4GMTH 4KROB 5BCAA 5ETUA 3STZB 4C54A 3V0VB 4XPFH 5F8QC 3O41A 2HKFL 4FNLH 4E42B 3D25A 1ZT1B 5D72L 4U7KA 5B3JE 2H2PD 5C0GB 1UH3A 5ENWA 3CLEL 1OM3H 2X7LA 4YNYB 3FRPA 2BOBA 1LE9A 1FV1B 3W0WB 3I50L 1IEAA 1SQ2N 3QDMB 4QXGL 1JPGA 4LPVA 5KZCB 1Z6JT 4Q2ZA 3ROLA 4JFHD 4Y2DD 2LAGB 4PJXF 4ALAH 1ZHNA 1BFOA 5L9DL 1K85A 1ZVHA 2DD8L 1I75A 3GI9L 1FG2B 4JFQA 4JGUA 5IGXL 3QHZH 2VDQH 4JKKA 5EU6D 1I9RH 3O3DB 1NPUA 4P4KD 3T08A 3NTCL 2UWEA 4LPTA 3MLUL 3D85B 4W68A 1L6XA 4UTBL 1FJ1B 5DWUL 1FDLL 2MFNA 1TVBA 2ZUXA 3QUXB 3HZVB 3V5DA 1HHGB 1M7IB 4MQXD 4ZFOL 4XNXL 1MCOL 2FYYA 3VWKA 4UILH 1NCWL 4WI4A 4PGJA 4S2SB 1Z3GH 4ZQKA 4URTB 4MJIE 5GSVA 2OR9H 2NNAA 2RIKA 1IGTB 1AC0A 1OTUD 2A77L 3LQMA 4IRZH 3C5ZB 1R5VB 4AIZA 4LKCA 4YPJA 2YWZA 4QRPA 3ROLB 3UX9B 4IDLA 5GZOC 4G80B 5T1KB 3BQUB 1SY6H 5SWQB 1A7BA 2UWEE 4QF1B 3DX9B 3G5XA 3AY4C 1R3JB 1CXHA 1S7XB 3V4PH 2X4SB 3VXMA 3GSUA 1X44A 2DQHH 3AVEA 4JPKH 3TNMA 4HS3B 5DVKA 1G0XA 4R8WL 1ZS8A 5DJ6B 1LMKA 3S37L 3U7AA 5EA0L 5TE7H 1OSPL 2Z35A 4PD4K 2VLJE 3C2AL 4FTVA 2IALA 2YZ8A 1ROWA 4LSRH 3WNPA 1JNNH 4C59B 2QSVA 1FE8H 3C6LC 4LASH 4BA8A 4HXBL 3HZYA 1F02I 2WINB 4MDIA 3DI3B 3C6SA 4EN3B 1K2DA 2QQQA 3HZKB 4LLWA 1F97A 5E8OB 3U82B 3GSVB 3AB0C 3CXDH 4RNRB 1G7QA 1WFTA 1YEGH 3GBNH 4K7PH 1G7HB 4QRPB 4NWTH 3HAEA 1J10A 5EZLB 4WNQB 1P4IH 3ZDXF 3BW9B 4PJDE 5DFVC 5C0BB 3WKML 2HWZH 2LTQB 3CNKA 4X4ZA 3PGDA 4LSSL 4OLYL 2NZ9D 2DLFL 1CVRA 4JFPA 3NZHL 2H6PB 2RFXB 5F21B 3OKEB 3FRUA 3ARZA 5C0DB 1RULL 2CKBB 4QWWC 4X5XB 3EOAB 5DO2C 4XPGH 1JF6A 3UEZA 2ICES 3VFPB 4J3UA 5ANME 1QVOB 1U8NA 5DD0H 3ORJA 4JKMA 4PLKD 4D9LL 3VG0L 1VACB 4X8JB 5CMAB 1M71A 5D2LB 4X6FA 3O3BB 3C5JA 4Z0XA 1EJOH 3FOLB 5F7LB 5I73B 2JB6B 4WFFE 3H42H 5GS2H 5IG7B 5DMGD 5MHSE 1EPFA 4YK4B 4QRTA 1J12A 5TPWH 3DJ9A 4P46C 1F11A 1KPVB 1A6ZA 2EYSB 3DO7B 3C5SA 3ARBD 4ETQB 4NZDA 4O02L 3A6BH 3IU3A 3PGFH 2HH0H 3OKLB 1KUMA 1M05A 3UTTE 4Z8FH 4Q6IA 4G5ZL 3CH8A 5SWZA 3OPZL 1DQQB 3MRCB 4XBEL 5C9JB 1OAQH 1QSEE 1R3KA 4MJIB 3LAFA 2F8VA 1P84J 4Y4FB 5HDOA 3KPMA 1TPXC 4HH9B 4UB0H 3STLB 1YYLL 1MJ8L 2D7OA 1RHHA 3AY4A 1PZUB 3ARFB 3FZUC 3HZMA 4YK4C 3T0EB 3BHBB 1DVFB 1AGEB 3RI5F 1MJUL 4HJGA 4EVNA 3U30B 4R3SA 1U95A 1HILA 4YHLH 3MYZA 3H7LA 1DEEA 1UWEH 2BNRE 1X9QA 5J57B 4FQXC 5IIEB 2IFFL 4G6JH 2CR6A 4K2UL 5J6GA 1F6LL 2C1OB 4KK9C 3QUXC 1DVFA 3PXHA 1K3ZA 1XZ0A 3SCMA 5JPNA 5HHOA 2BC4B 3SGEH 4EKXA 4NDMA 3BPOC 43CAB 4XMKL 1NEZB 3QNXB 2A74A 3QWOA 5TQ0L 5KS9A 2NXYD 1MFNA 3NFSH 5ESQB 4OIBA 5HHPB 4JHWL 3IJSA 2CRIA 2GKIA 3HI5H 5D7KE 2VQTA 5FAAA 2RR3A 4GRLC 5IFHH 5I9QC 3AU1A 1WF5A 1FYTB 1F4YH 3I02A 2GY7B 3VFMB 2VXTH 1RUPL 4LVNC 2K1MA 1LWRA 4UOJA 5JW4Q 5HDBE 1GGIL 2EXYD 3WS6C 2G2RB 3QUZA 1PW3A 5CJXA 5J11C 4XBGB 4LHUG 5BZDA 1EH9A 2W91A 1P6AB 5I17B 1PX3A 3FO2B 5TE7L 1U3HA 4S1SH 3UMTA 1G7PB 3CSYA 4ODVH 5CEYB 4D0BA 4OLXL 5SWSB 5F1NB 5CILL 4MD5B 2C26A 2NZ9C 3ARED 1I1FB 3BGFB 3E6HB 2RCSH 4GAJL 2VZ1A 4WI6A 4XPHL 5EO9B 3X3FH 2OLDA 3GJFK 3A6OA 4M62L 4YX2H 4F7MB 5CZKA 1X5ZA 4PV8B 3MLRL 4XP4L 2QQNH 2JELL 1JPFB 3FQXB 3WFDH 2MWCA 3IJHA 1QEWB 4GH7B 4C58B 5IB3B 2IAMB 3TVMC 5MP6H 2DQTL 4FFWD 4OQTL 3UDWA 3VFVA 4WCYH 1T89C 3NCEB 5K93A 2NTFA 2Y9RT 5I1JH 2GY5A 3UJJL 3JTSA 3OKKA 1RUQH 4AQ1B 4ERSH 4P46B 1BD2B 1KLGB 2OCFD 2HJFB 3DV6A 3MLWL 3TC9A 1GCFA 4KRPC 2E6PA 4OM1H 3QNZA 2NW3B 4JQIL 1U8HA 1VDGA 5IQ7H 3IJHB 2HTLD 3DETC 5CD3B 5DJZB 5J4MA 2Z8RA 1BVLB 2X1QA 4ZUWA 1JZ2A 1N0XH 4P23B 1OP9A 1JWUA 3C60B 1KCSL 3RIAK 4OLXH 5DD0L 1H5BB 4BH8A 3TN0D 2XFXB 3KR3H 1FZOA 4XP5H 4CBPA 3NIGF 3QBTB 5GZOD 2VABA 1MFBL 1NANI 3UTSB 4TVPE 1TDQA 4UT9L 4NWUH 4NM8L 2X4NA 5IVXB 5IMOB 4X6DF 4PUBH 4P2QB 4P2OD 1WUNT 4G9FA 5EZJA 1JPGB 1R5WB 2CGRL 3MGOA 5E00A 2NY6D 4OLWL 2FH8A 4NC2B 1Y18B 2XRAH 1VCAA 5AD0B 1JZ8A 1QBLH 1AO7B 1I9IH 3ZE2E 5E5MB 1TITA 5JIPA 1YPZE 3VXRD 3LEVH 5E6ID 5B21A 4GXVL 3VFMA 4QTHA 1MQKL 2BNQD 1R0AL 4XPBH 1AHWB 4G43B 3U36A 5GS1A 5CUSL 4R4ND 5FYLL 5IBTL 2XN9A 4OFVA 2P5EA 2JJSA 1T03H 4OCRL 2P7TB 4U6TA 3GK8L 5JO5B 3RKDD 5TGBB 4JRYB 4KUCF 1F3JB 1CS6A 3ALPA 3TWCL 4I1NB 1QSZA 4FQ2H 2CIIB 4QXWA 4MAYB 5FGCE 4NWUL 4U6HB 3CXHK 1CLZL 4RZCA 5DUBB 4RX4A 4Z7VE 3GMRA 1WIPA 4JHZA 4TSBL 4DN3L 1HI6A 5EC1B 5AZEH 2AAVA 3BT2H 3HA0A 2EDYA 2X1OA 3PNWA 4WHYH 4YQXL 4ZUUB 1ZT7A 1YQ2A 4PB9H 1U95B 2NW3A 4P3DB 2PTVA 4Z76B 3PL6C 3SE4A 2VH5H 5HGDA 1HQRA 1UKTA 4NPYA 4Z7NF 3GBML 1BVLA 1F3RB 2E6QA 5HYJB 5LAXA 3QDMA 4GMSL 3MNZA 3PWVA 4LBEB 2R0KL 5JR1H 3B8YA 1WC7B 3WDIA 1BMGA 3FOMB 4KRPD 5HGHB 1GZPB 1Q1JH 2F58H 1BD2D 1N64H 1Z2KA 2AEQL 1R3HB 5KW9H 3MCG1 4F33A 4JM2A 4ZS7L 2XWJB 1U3JA 1IAOA 4MGXA 1OAYH 2GTZA 1M4KA 3MUJA 2B1HL 3BYTA 3CUPA 5JW5B 2FD6H 5BS0D 2AJUL 1Q9WB 4OCRH 4XPTL 3L5XH 1RK0A 1F90H 5CJ5A 4K8RD 5DHYA 1EXUB 4MCYB 1N8ZB 5EFIB 3HI1B 3K81A 5D5MB 3FQNB 3PP3H 1GAFL 4WU7B 1E6JH 1XIWC 3GSXA 4MZ3A 5C3LD 4Y5XC 1BGXH 2HVJA 5EU6A 2EDBA 5MERB 3RZWA 5AYUH 5D7JD 1T0PB 4JZJB 2FDBP 3RU8L 3T0BA 1G7PA 3CSYB 1EBPA 5GSRB 3L5WB 4I3RH 3BGFC 1N64L 5A16A 2GJZA 5GGQL 3OBAA 2ITCB 3BVNA 3LQZA 4PG2A 3GM0A 4WO4B 4LPYA 3U46B 4QXTA 3THML 2AK4B 3QI9B 3HFMH 1BJ1H 2XIDA 2R2HA 1KIUA 4L3EB 4U1SB 1NAKL 4K71C 3O45A 2BNUB 3RFZC 3KLAA 3L3OA 3NOIA 4JFYA 1GGTA 1OAYL 3VFGH 4U0RB 3H3BC 2B7DT 3V6FA 4XCNB 4YE4H 3MOAH 1HWHB 3KPQB 3DPBA 3ROOB 4ETQA 2Z8VC 2Q7YA 3VGDA 3CFCL 4JQIH 3QG6B 5I1KH 1H3XA 4FFVD 1AFVL 1AQDB 1WK0A 2CMRH 4J6RH 3C08H 5AEAA 3TH3T 1T20A 4ZTOH 1IFHH 1OQXA 3MRKB 1MF2H 5D6CA 1RZJH 4KJPC 1HYSD 1EFQA 2W1NA 3NMEA 5EN2B 4IOFC 1LEIA 1FPTH 3GMOA 1T5WA 1I7ZA 4OGYL 4LLDB 4WWKC 5DVMA 2QQLL 2ILLA 3S36X 4Y1AA 1UJ3C 4TNWK 2WUCH 4P59H 1BOYA 3VI3F 5CHNB 5FKAA 2YXMA 3BAEL 4TTDC 3T1WA 1EZVY 1T89A 1FIGH 5K9JH 3ARFA 2F5AH 2DMKA 4P5MA 5GGQH 5C0EA 4EI5B 4HWUA 3RX5A 1HYRC 4BFBD 1B0WA 3HRPA 3KYKH 4PJFF 1GIGL 5K9KB 3RVVC 2F19L 5CEZE 4L4TE 4P2OB 4P2QD 3WXVL 5FECB 2PTTB 4DKFL 4MS8D 5EUKB 2ZKHL 3KJ4B 4PLKC 2VLLA 2A6JB 3NZ8B 2XZZA 3MREA 5F1KC 2PYED 2J6EA 2NY7H 1A1MB 4Y1AE 1MELA 4MX7B 2DTMH 3ULUE 1R0AH 4UB0L 1JBJA 5DJ8A 4U1GC 3FONB 2XTJD 3PHOB 1RI8A 3PP3K 4L4TD 4P2QE 8CGTA 3SDXF 1FQ9C 1PGRB 3LVEA 2NXYB 4MLSA 1JZ3A 1HN1A 4X4XA 5D2NC 3MLUH 4NNYA 1LK3H 2Y36H 1Y6NR 3TPKA 2XA3A 3H7BB 4MA7H 3PV6B 3TEUA 2DQFB 4KAQH 4XAWH 1Q72H 5T3XE 1MRDL 4OUUB 2MNUA 2DWEB 5JLZA 1BBJB 3WKNA 3ARDC 4H1LB 1VFOA 2H2SD 1IAIH 5CJOH 1AD9A 1CDUA 4KUZL 5JXAH 5HI4D 1G7IB 2A6IA 1UM6H 4TOYL 5MENB 1UB6B 4LQ1A 4FXKA 4N0YL 3QPXL 5CJ8A 2FEDC 4G6JL 1IGYA 2Z31D 3QIUA 5ANMA 1HOCA 4CL7A 1L0XA 1DQMH 4ZSOB 1DVFC 1K8DB 1PBYA 1LDSA 4P5KB 3RVTD 4TSAH 3JWDC 1JPSH 1ZSDB 2VR4A 4N9OB 3U7YH 5DJ2A 1SYVA 2XNAB 3W81A 3GMMA 4HGWA 1LEKB 1H0DB 4F7MA 4PLOB 3P4OB 4LSSH 4OFYA 4OLYH 4PJHE 2YD7A 3WKMH 2VKXA 5C0RH 2O93L 2ZP0T 4HDIA 1VESA 4ZYKB 1Q9WA 1RULH 1Q0XH 3REWB 3WV0A 3MGTA 1UGNA 2DBLH 3H2WA 4LU5L 1S7RA 4OZHE 4XAWL 4U1JB 3KLSA 5D2LF 3UBXA 2AK1H 4UUJA 4PTTB 2Q7NA 4PYHA 4WI9A 5DJXA 1NBYA 1QFWL 3R0MA 1WBXA 1H3VA 2ICWB 1MHEB 3X12B 2EYTB 1MNUH 5EUOA 4I0PA 5LWYL 4ZYKA 5DD1L 4GW5B 2YKLL 4YHOL 2K7PA 5EIVA 1JGLL 1UH4A 3Q1SH 4FQIH 1CI5A 5I8KH 3DV4B 1KTLB 3JV4A 5BZDB 2P8PA 4V1DA 3QXWA 2P1YA 3QWRD 3TM6A 4LDOB 3F7QA 4GG8B 4KKNA 3CDFA 1PSKL 4GQ9L 1LD9A 4MWFB 3WIFB 4X0KA 4I0PB 1T1YB 3ZDZF 3RUGF 2R2EB 3TNNB 3S35X 2FX7H 4FFZL 2X42A 3B2VH 3RPIB 4JFZL 4F58L 4PJIF 3NIFF 3I6LD 4YE4L 3X11B 4MHHI 1A3QA 4G42A 2XTJC 4XCFL 4R8WH 4OI7A 1LO2L 5KVGH 4KI5C 1NC2A 1D5ZA 1CE1H 3DXAA 2E7HA 3BIAX 4TUOB 3TYGH 5EOCJ 4ZPVB 3BRFA 5FO7A 1YECL 5FHAL 1X6LA 1S9WA 3RKPA 4PJCE 3IAGC 2DQDH 4DGIH 3S8WA 1HHJA 2BJMH 3UTZA 2R4SL 3RWDB 1RZ8B 2HTKC 4HGWB 3KPOB 4RFOH 3EO0A 3JTSB 5HGBA 2GK0A 3MRDA 2YD3A 5GS0L 3EGSA 3GSXB 1BJ8A 1A6UH 3B9AA 3SJVD 1D5XB 5LXGL 3LB6C 1BBDH 4HH9A 4HLJA 5E6IA 3BP5A 1KPRB 1YMHA 1CU4H 4WUUA 4QO1A 4Y5YB 1NGYB 5F44A 1D6EB 2YEZA 3M1BB 2KUTA 2ADJA 4ENEC 2XFXA 5K9QG 5FGCB 4P3WA 2YD1A 3T09A 1CE6B 4UQ2A 1CE1L 4G3YH 3IDJA 3TT3L 2P48B 5I71B 4OCWL 1CD8A 3UTQB 3NBNA 3GUTA 5BVJA 4CN6A 1ZANL 1SEQH 1E4WL 4K3EH 3S4SA 3G5YA 4GKZB 2EC9U 3EZ8A 3H9HB 4KTYA 5ICYB 4YHYB 4M5YL 3OB8A 4U4BA 1OSZB 4LDEB 1NUDA 4LPWA 4P9HC 2XZAL 3CX5J 4KDWA 2RHEA 3O6FC 1I1YA 2YRLA 4JFDB 1AQDA 1T83C 5FGSA 1PD6A 4RGOL 3RP1A 3RWIA 2Q76A 4C4KO 1F6AB 3FB8A 2IQAA 3OB0K 3MTRA 2CKBA 5FKPB 3BXNA 2XQBL 3U4BH 2BVQA 2XWTB 4OIIL 3F6LA 5C2UB 4DGIL 3QQ4A 1WIUA 3WFEL 3G5XB 4JKLA 4N90E 3ULVC 4JREC 2BY0A 3FB6A 1CWVA 3X3FL 4JFFA 3PQYE 5I2IB 1GPOH 3PABB 2I60L 5E94B 2DIAA 1GHFL 4DVBA 2R0KH 5JR1L 3U9PH 1J0ZA 1TFHA 4HS6B 5BS0A 1WEJL 1J05A 1MWAB 1J11A 3PWNA 1ZT7B 3V6BR 3ZKXB 4XZUB 2F53A 3HKFA 3OAYH 4WHTB 1N3NB 2XN9D 3TBVB 2HT4D 5GRWA 1FL3B 1U8IB 1HSAB 5HSFA 5I0DA 2V5MA 2X44D 3HZVA 5C08A 1CD1A 3OJDA 1IEBA 2W60B 2PW2B 1MCCA 1INEL 5T1LD 4CADB 5D71H 3S7GA 3DWTA 3PQYA 4K3EL 3CU7A 1YEDB 1Q9KB 3ZDYE 2WW8A 5AYUL 5IEKB 3V2AR 3LH2H 4Y7MA 5SX5H 1KC5L 4JO3H 3IRZA 1PKQE 4AEEA 4PJAF 5F72S 5JHDB 2WLYA 4KV5F 4PGZA 3B5TA 1G9MC 3SCMB 4JO2L 1B2WH 1TJIL 4JFQB 2IF7A 3P77B 4LRNL 3LEYL 5IKCA 4NYLB 3MBEA 4C55A 1MVUB 2YD5A 2NY5C 2FATH 2VLJD 3FO9B 2KL6A 1D9KC 5SX4I 2FX8H 3C09B 1HCFX 4HJJH 2A6DB 3BI9X 4R7NA 1JWMA 3U1SL 1D5BA 1AKJA 3VXPB 2EDJA 2IQAB 1IQDB 1N7MH 3MGAA 4JZJA 2X40A 4QRUB 5EPMA 1W0WA 1DQTA 4RMVA 3KJ6H 1EMTL 1N2RA 4R4NC 2EH7H 4BH8B 3HZYB 4G8GE 2XTJB 2OR9L 3SY0A 5LKNA 4MXQD 3MJ7A 3SPVA 2Y23A 4FQLL 4EN3A 3UTSA 1IGML 4Y5VB 5KSBF 5HD8D 4HWZA 2BSRB 1TVBB 3QUXA 5DHXB 1W0WB 5TE4H 5GZNC 4YXLH 5GXBB 4F7EA 5HHQB 4ZO8A 4ZODA 2ARJQ 2X4UA 3V8CA 1P9MA 4NJ9L 2DF3A 3QEQB 4QT5B 4KHTH 2XKNB 1X5FA 5GS0H 4YHYC 4OD2A 4F15C 4KQ4H 5D7SL 2VDRH 1A3LH 4HIXL 2YD6A 3PL6D 1D5BB 1XCQA 4KK5D 4TULL 3ALWA 5FO8A 4G80A 5BS0B 2JCCA 4MZ2A 4QTIH 1NKOA 4FABH 1P84K 3UYRL 1CFQA 1E4XI 2YS4A 1S3KH 2X6MA 2QADD 3E6HA 1QD0A 2VXSH 4NUJA 3STZA 4LRNH 2FO4B 1KXTB 1HINH 5DMIH 2CIKB 1NEUA 1J0YA 1Z5LA 4YHPB 3BZ4A 3CH1A 4RZCB 5DUBA 3BIKB 4N68A 2C3XA 3KYKL 4NQDB 1L4IA 2IG2L 3T77B 5HHXH 1C12A 3M17A 4WI8A 3R4DA 2HYMA 3MLYH 5GRVK 4PJ8D 3VFSA 4BSWA 3VU2A 4KQ4L 4XBGA 1RUAL 2L0DA 4J2XA 4IRSD 4KHTL 3RX7A 5A2JH 4G42B 3CC5B 1I3VA 2XNAA 1MCEA 3VFUA 4ZSOE 4XC3H 3EUUA 1QRND 5FYKL 3MZTA 1DP0A 5IMKB 5IFJA 2VN7A 4MX7A 3JWDH 3MA9L 3WFBH 4XNXH 3WO4C 1MCBA 3FB5A 1MJJB 2HKHL 1XIWB 5DJZA 4JPIB 3QUYC