1CIDA

Crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
177
Chain Sequence
TSITAYKSEGESAEFSFPLNLGEESLQGELRWKAEKAPSSQSWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVSLQFAGSGNLTLTLDRGILYQEVNLVVMKVTQPDSNTLTCEVMGPTSPKMRLILKQENQEARVSRQEKVIQVQAPEAGVWQCLLSEGEEVKMDSKIQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL SURFACE GLYCOPROTEIN CD4
publication title Crystal structure of domains 3 and 4 of rat CD4: relation to the NH2-terminal domains.
pubmed rcsb
source organism Rattus norvegicus
molecule tags T-cell surface glycoprotein
total genus 37
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1993-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA02
4S0SD 3AROA 5GGRB 2VL5A 1QBML 3HE6D 1MAKA 1FG9C 4XPFL 4OUUA 1VDGA 2AP2A 2Z4QA 1U8JA 2A1WH 1I7RA 2VLRE 2Z92B 5AZEL 1M7IA 2NX5B 5CKGA 5DZOA 3LN5B 2JIXA 4FMKA 3OGCA 4LLQB 4LNVA 2CGRH 4PPTA 3SDXB 1JGVH 5GRWA 1VA9A 2W9EH 3EYSH 4PY7A 3ROLB 2BNRB 1YNTB 5FF6B 1VSCA 5C0GB 4E9LA 5C2UB 5CEYA 2PCPB 4J3OC 1JVKA 2BVOB 3FO1A 3PIQA 3U7YL 3SCMD 5CIPH 2MOVA 3QISA 2Y72A 5D2LA 1G7PB 4G8GB 5DVLA 2QTEA 4YBHA 4LVEA 3WFEH 1MCHA 4XCNB 4OZHB 3MV8D 4BFBD 4XCCL 1OP3H 2VXVH 4LPUA 1BFVL 3VXMB 5K9JL 5FM5O 2YEZB 3MSPA 1CLOL 3LEYL 1XR8B 3S37H 4LCUB 1PGRB 1HSAA 4N8PA 2X4OA 3F65A 1CXFA 3VDCA 5GS0L 3BKYH 1FRGL 3FQXB 4WW2A 4BH7A 3C6LB 1ACYL 3QEHB 2NXZD 4S1QL 4LSVL 12E8L 3VGBA 5EU5B 1K6QL 2FEDD 4JY6A 3MGOA 5IJVA 4NO0D 3QDAA 3F8UB 3BYTA 4QRUA 1RJLA 5IG7A 2X89D 3HC0A 1PKOA 4G3YL 1MFCH 5CBAA 3VWJC 5FGCB 2DWEB 4FQIH 1SBSL 1J7VR 3MOBL 2YPLE 5AAWA 2NW3B 2ZJSH 2VITB 1N0XH 2B7DT 5HHQA 1FIGH 4Y5XA 4FXGA 5GRVK 3ULUF 1DBJH 1YYLL 3NZHH 4JCMA 1JNLH 3AS1A 3MRRB 5DEGB 1C16B 5HHME 2Z91A 3UJTL 1NLBL 3QI9C 4OZFB 5D6CA 3W81A 5E8DH 1T7WA 3KXFB 1WK0A 1YJDL 1R5WA 1GGCL 4ELMF 2ENYA 1INDL 4FMFA 1NBVL 3GMMB 5IWLC 3DETC 4N0FB 3MLXH 1DANU 5JXED 5H35A 4X9GA 4F9PA 2D3VA 4K23H 5CWSB 3ZDXF 4CDGC 2MJWA 3HTLX 5EOQL 1LEIB 1FO0B 3HRZA 3PDDA 4LSRL 3PNWB 1EAPB 5F93C 1G0DA 1OQOA 3S37X 4PJEB 2EDFA 4R97C 3WUWA 1QLEL 3U82B 4OCNC 1T21B 5FCSH 5IBTL 2B39A 1HQ4B 1JI2A 2FIRT 1DE4B 3MLTA 4PJ5D 3SDDC 3EOAA 5EBWA 1QRND 4H25B 4N1HB 5TDPB 1BQHB 1CU4H 2R69H 4CMHC 1KEMH 1J0JA 4F7CA 4HULB 5IMKA 1F97A 1NH6A 4LRNL 4OCRH 5F1KC 4MJ2A 3RGVD 4PTTB 1ZHLB 1G6RB 2F19L 4OZFH 3SE8L 1D5IL 5ALBL 5IFAH 4Q9CA 2HLFC 4G9FA 1GGYA 2X5PA 3GMQB 3RKDD 4FS0A 2LFGA 4XI5C 5FYJL 5BZDA 5LXGL 2XY1A 2ZUQB 1UC6A 1FC2D 1H3UA 1RZJC 3BJLA 5I8KH 3ARFB 2Y5EA 5DD6A 1FAIH 5J11B 3RRQA 3RVWC 1KIPA 1NBZB 2LV4A 1FO0H 2X4UB 1IGTA 4HMEA 5JW4N 3FRPA 5L6YL 3H9SE 5LGJB 5IM7B 3W0WD 5BV7C 2XKSA 2ARJB 1CT8B 3LSOA 2C26A 4PJFA 1RU9H 1QR4A 2OLDA 5SWSA 2KH2B 1RULH 32C2A 4JG1H 3MODH 4HXBL 1HSBA 3VFPB 1UM5L 5TQ2H 2X09A 3GSUA 3MCLH 1TMCB 4MA8H 4Y89A 5C0JA 1G6RH 1PG7H 1L7TL 3L5WB 4L8DB 3GIZH 1ZEAL 1CFTA 1YNLH 1Z3GL 2N56A 2FGWH 4QF1B 3BMVA 3SOBH 4I18A 2YUWA 4LCWA 4XNQA 3O8XB 4YHIB 2GK0A 4DKFL 1KBGH 3Q5TA 3MUGA 4MD4B 1KXTB 3L3OA 2BMKB 4GSDL 4ZO9A 2Q1EA 4OGXL 5JPMB 3M8OL 4I4WB 3PE9A 1OGAE 3ARGA 2UYLB 4ZUUB 3BRGC 2WBJB 1WWWX 2VZTA 4KH2A 3O6KL 4XP1H 1NCNA 5DFTA 5FKAB 4RMWA 3QDJD 1JYXA 3MJ7B 2F5BH 1VHPA 4CNIB 3U1SH 3PL6C 2Z93B 1T6VN 5GSRB 5KS9B 3KLSA 4KQ4L 2AABL 2R56H 4NN5C 1VADA 5JMOC 2IPKA 1J8HB 1EMTL 2YRPA 4OZIE 2HFFA 3F7VB 1J11A 5DK3A 3FFCD 1KJVB 4HK0B 1KC5L 4GRMB 3MRBA 2GUOA 4Y16A 2MCPL 3D6GA 3RTQA 4ZYKA 1LVEA 1KLFA 5ICYA 1MRDL 3S7GA 4UBDC 4OIIL 4JKWA 5KSVB 4KUCF 4V1DD 1LE9A 4LAQL 2VR4A 2BFVL 3PDOA 3O9WC 1VB9A 1ITBB 5DEFA 4YXLH 5DJ0B 1JNHB 3CSYA 2FIKA 1NC2D 3VWJD 5C08A 5BW7C 1NAKL 1EVUA 4LASL 3LRSA 4EDXB 5CAYB 4YDKH 5SV4A 3DRTB 2VLKE 3ULVL 5A2LH 5F9OH 3NFSL 4ZOCA 4K3EL 4NQDD 1QSFE 4QXTA 3CC5A 1NANH 2F53D 4XPTL 1UG9A 3NCCB 4MJIE 4Z7QF 5T3XE 1XCTB 4K7PX 1FJ1A 4P2RB 5DMGC 4W6YB 4X7EC 3QI9D 1CDHA 1CGTA 4RAHA 5F7MC 4XNUL 3V5DA 3FRUA 4LPWA 2ZUUA 1EEYA 1JPSL 3MRQB 3U0PB 2AKRB 4AMKL 1T20B 3AUVA 2I27N 4AQOA 3DETD 3QEQD 2YOCA 2RHEA 2VDNL 2HH0H 3MNVA 2UWEB 3IU4H 5FOJA 5J3HC 3UZVB 5ACZA 4F37F 3CK0H 1DBKL 3U2SA 2J6EA 3JWDH 1RK1B 3MFGB 3RX8A 1P4BL 2ZZUT 1F4HA 1DLHB 4XGZB 3HZVA 1IM9D 1MSPA 4Y4HD 4TUOB 4W81A 2D31B 4X8XA 3TNNB 3SDDD 3BZFA 1QO3A 5B38A 5F7DA 4AG4L 1L7IH 3MRGB 3RA7L 4KWUA 2QQNL 5DMIH 3SPVA 3RIFK 4R4FL 5FAAA 3UO1L 4D8PA 4BSVA 3IKCB 2X4RB 3W39A 3PP3H 3M07A 3I85A 4LCCC 4HBQA 1D9KB 3I9GL 1FZJB 3EGSA 2DDQH 2HLFD 3FOLB 1I8KA 4XB8A 1RURL 4OZGA 2W65A 2CLVB 4JFOB 4XI5D 1IC5L 1WVZA 1MCOH 5DRNB 1HDMA 3UTSD 5EFIB 2GJ6D 2DI8A 4P2QE 3RVWD 3NFPB 4ZUVA 1AGEB 3KJ4C 4H88L 1W0WB 3T1WA 5FGBC 1JZ4A 3BH9B 1WEJL 1UKTA 4GXVL 4PJIE 1QVOA 3QFJE 2DICA 4GRWB 1WIOA 1MLBB 2M1KA 2CKNA 4OD1H 4P3CL 2FWOB 4G6JL 2E7HA 4CVXA 3LHPL 1HXMB 5C0EB 4XB7A 5IIEB 4NQEB 4H8WL 5D7JB 4PRAB 3C60B 4LVOC 5IOPB 1MCEA 3V4VH 2DB8A 3OAYK 4NGHL 5MHSD 1YMHB 4HEME 4P3WA 4XPFH 1GOHA 4KKAC 1CDCA 4MD0A 3VXSB 1CZ8L 5AZEH 5ESVB 5MEND 3B43A 4MNHB 2XN9B 3P2TA 1UWEL 2QADC 3GSXB 5C0IA 2Q76B 4LLUA 1F4YL 3OPZL 3OL2A 3TM6A 1CICC 2NY4B 1GGBL 2R2EB 1P9MA 1S9YB 3B9KA 1BJ1J 4P46A 1KPRA 4LCYB 1BOGA 1FP5A 3EYUL 5D7IE 3VFVA 1A6PA 5LGKA 4ZXBB 3U7YH 4GRWH 3ZDYF 4GMTH 1UZ6F 1E4WL 3KNBA 3RL1B 3WFZA 5DQJB 5B8CB 1N5YL 4IRSC 1K2DA 3FZUC 4XCCH 2QJDA 3PL6D 1BFVH 3QIUD 3VFMB 5K9JH 3IU3B 5T33L 4X7FC 3DV4B 1CLOH 3HUJA 3LEYH 4GKNA 1LK2B 3HPLB 4Y4KC 1S7WA 3TBVB 3C5ZA 5GS0H 1FRGH 4U33A 1ACYH 3T0BA 3VI4E 4S1QH 5D7LD 4LSVH 2XKNB 3SGDH 4A2MA 5DT1H 3M17B 3WFDL 1AP2B 12E8H 4HKXA 3R0MA 1K6QH 2QV2A 3IDYC 1TFHA 3OSKA 2DQIL 4PP2B 5EH1A 3EOYG 3NGBB 4NWTL 4PRID 3L5JA 5I9QB 4HIIB 5GGTL 1VFAB 3OHXB 2I5YH 4UBDD 3MRKA 4N0UE 4G3YH 5DD0L 2BSRA 2VL5B 2AK4D 1SBSH 1U8OA 4XH2A 3MOBH 4OUUB 3AY4C 4ZOBA 3O9WD 2Z4QB 1U8JB 1I7RB 1IGJA 2VAAA 1M7IB 3DUHA 1G7MA 3EFDL 2CD0A 5C71A 3GK8L 4E41E 4JZJA 3OGCB 5FOBA 1YYLH 2APBA 1A6WL 4PY7B 3ZZ1A 1HNFA 1FCCA 1XAUA 2DMBA 3UJTH 1H5BA 2BVEA 1NLBH 1N8ZA 1Z9LA 4M8VA 4WUKL 3CIQA 1KTLA 2DWDA 1LEKA 5L2KD 1YJDH 1U8KA 1GGCH 3BPLC 3MCG1 3OKNB 1FGVL 4J3SA 1CF8L 2NNAA 1INDH 1NBVH 5CEYB 5J4MA 4PJAF 3TJHC 3SN6N 3DVFA 2BSTA 1U6AL 4N9GA 5GGUB 5DMGD 2EEAA 1HEZA 3WFBL 5D2LB 4LMQI 3UTPE 5EOQH 3GI8L 4P9HC 2B5IB 4LSRH 2CPCA 3RWDA 2F5AL 1WFTA 4OFVA 4QOKA 4LHJB 2E9WA 2GIYA 4PB9L 1QLEH 1GH7A 5IBTH 4BZ1L 5J3HD 3Q5OA 3RHWF 1HSAB 2X4OB 3H3BC 5L88L 4WW2B 4BH7B 5DQ9A 1P1ZB 3QB7C 4F3FA 1JJUA 3WV0A 5IVOA 5D5MF 5EU6A 3SY0A 1F11A 5MEPA 2ZUXA 4JY6B 3WSQL 3MGOB 3SQBA 5IJVB 1F3JA 1S7QA 4QRUB 2V5TA 1JPTL 2G75A 4IRJC 1RJLB 2F19H 5IG7B 3K74B 2X1QA 3HC0B 2AXHA 2ARJQ 3SE8H 1D5IH 2LVEA 5CP7A 5ALBH 4JJ5A 2EEDA 4ODXA 2YN5A 2Q6WB 5CBAB 5HHOE 1AFVL 2D7QA 1DQLL 1VFBA 1Z0NA 4KJPC 5KN5A 1LK3L 3SDAC 2CDEA 4MAYA 3QIBB 1VERA 4N1EA 5FYJH 3VG9B 5LXGH 4LAJH 3OTTA 2BY1A 3MRNA 4Y5XB 4FXGB 3WDIA 1CDGA 1JZ8A 1UM6L 3E2HB 3L6FA 3X17A 4OI7A 1NSNL 3D25A 3ULUC 2Z91B 1YEDA 3FCTA 1EK3A 2VUYA 2YD4A 5D6CB 3TIDA 3FQRA 5L6YH 1R5WB 4HK3J 3MLZL 4PJ7E 1JGUL 1A1MA 1T1ZA 1M05A 3MRMA 2R0WL 5H35B 1UYWL 1HKLL 4HXBH 1UM5H 1JZ7A 1BQUA 3HRZB 3X11A 4N5EC 1UCBL 5HI3D 1L7TH 4HKJA 5J6GA 1ZEAH 3WUWB 3EDJA 4L8SA 4MQXC 4J2XA 1Z3GH 4JCLA 4HT1L 4NQTA 3RNKA 3C08L 3MV8E 2OI9C 4Z0BL 3V9FA 4KK8C 3ELAT 2ZG1A 3V5HA 4PJEF 3EOAB 5D93C 5EBWB 4DKFH 4UI2A 1RK0A 4KKAD 1AIFB 2FBOJ 4GW5A 3BMWA 3BZEA 4GSDH 4F7CB 5IMKB 1URLA 4OGXH 2VZOA 2QADD 3M8OH 4QRTA 5GS0D 1U36A 5C07D 2YA2A 4JY4A 3ESUF 4KZDL 4NOFA 4G9FB 1GVIA 1CICD 1OW0A 4WV1A 3O6KH 4UNVA 4F7EA 3MXWL 3SGKA 1P4IL 3T0EC 5BZDB 4XVSL 3FO9A 1AO7A 5DD6B 4KQ4H 2AABH 2UY6A 1WISA 1G84A 1KIPB 4IRSD 1EMTH 4PRDA 3FZUD 4JFED 1IGTB 2HKHL 4LHUA 1ACZA 1AI1L 2IPTL 1FL3A 1KC5H 4Y5YA 5HDLA 2DRUA 2MCPH 3GSWA 3LSOB 4Y4KD 1BZ9A 4PJFB 1MRDH 1EUUA 2E9IA 4OIIH 5SWSB 32C2B 3VWKC 3N1FC 4LAQH 1X3DA 1HSBB 3CCHB 2BFVH 2IF7A 2JCCA 4QRRD 3KYOA 4U3XA 4LEOA 5IKCA 1CFSB 5C0JB 4RWYL 1EA9C 4OLVL 4GH7B 1CFTB 2PYED 3JV6A 1FIEA 4MLSA 1NCTA 4I18B 1NAKH 5IP4A 4LCWB 4NWUL 3S96A 4LASH 2VLLA 4XNQB 2HVJA 2EIZA 2GK0B 3MRJA 1F3DH 1TPXC 3MREA 3ULVH 3LRHA 3NFSH 3MUGB 4K3EH 4DVRL 4PJ5E 5LKNA 5IVXE 3L3OB 2EXWC 3O3UN 1QRNE 4XPTH 1KTKE 2IANA 3STBA 5GZOC 3RWGA 1EO5A 2HJKA 3ARGB 3QULA 1GHFL 4XNUH 3KPMA 4YEEA 1BJ8A 5CLWA 1JPSH 3KYKL 5FUZL 4AMKH 2WANA 3TJHD 3BZ4A 4DN3L 4C56D 4DKDC 2HT4C 2VDNH 1VADB 5IVNA 2DQCL 2IPKB 4I2XE 4KC3B 1DBKH 1JL8A 2H3NA 2HFFB 1UVQA 1P4BH 5C6WH 3MRBB 3VI3E 4RMTA 2GUOB 4Y16B 5DFWH 4ZYKB 5SWQA 2MCG1 3RTQB 3SE4C 4S1DC 1C5DA 5IMMB 5BVJB 5ICYB 4AIXA 4AG4H 4PLNC 4FTVD 1E0OB 1KIRA 4D9RD 3RA7H 1LE9B 4KMQA 3SEPA 2QQNH 3D2UD 1RZKC 4KZEL 3PDOB 4R4FH 3UO1H 4GS7B 4GUPA 5DEFB 4PJHE 3MLRL 4IRJD 4ETQA 2FIKB 3I9GH 3P4MA 5HDBE 5C08B 4PGZA 1RURH 1NFDA 5EZLA 3LRSB 2BC4A 2EC9U 4KJPD 1ZV5A 1IE5A 3SDAD 2D7TL 1IC5H 4X5WA 4Y1AE 3AREA 1MCPL 3U9UA 4D0CA 4WFHE 4H88H 3OG4B 1REIA 3GM0A 3QO0A 1ODAA 3VD7A 3ULUD 1FJ1B 1I9JL 1WEJH 5J06A 5DUPL 2V2WA 4GXVH 3NTCL 4LSQL 3EDFA 4BYHA 3V5DB 1ZHKA 3FRUB 1EEYB 1ZT7A 4P3CH 4G6JH 5ANMB 3LHPH 4JGUA 4H8WH 1NJ9A 4F9LA 1JF5A 3QDJE 3R0NA 4N0RA 5FO7A 4AZ8A 5E6IC 3TVMC 1KEGL 3MNVB 5GQBA 4EBQL 4NGHH 2QKIA 5ACZB 3S4SA 2ZG2A 3U2SB 1T89A 1SJXA 4N5ED 4JDTL 1U3ZA 3OMZA 1CZ8H 3B83A 3KLAA 1Q9LB 4PGDA 2BOBA 3HZVB 4MQXD 3KDMA 5HHVL 3FT2A 2BSED 1DUZA 3D5OF 4UAOC 1UWEH 4RGMC 4KK8D 3NN8A 1X6NA 3BZFB 3FFCE 3VXOA 5F7DB 4UIKH 5B38B 2V5YA 1F4YH 2A74A 1FE8L 1VACA 3OPZH 4NRZA 5HYQA 2J1KA 4XVUC 3TBYA 5F7HA 3SPVB 1U3HB 4R26L 1GGBH 5IB1A 4YO0A 5I17A 4V1DE 4BSVB 1E6OL 4RBPK 4P4RA 1BOYA 3W39B 4PBWD 2EIEA 4JM2A 3EYUH 4HGWA 4ZSOA 3CZJA 3EGSB 1S7UA 1FLTX 5CGYC 1I8KB 1E4WH 1N5YH 5LG1A 1DQML 5E00A 2DTML 4JPIA 4OZGB 2W65B 3T0ED 2Z8RA 1WWAX 5GS3A 5T33H 1HDMB 2HFTA 2AVGA 4PY8J 5DA4A 4EQ3A 3DI3B 4ZUVB 4NQDE 4JRWA 5EA0L 4NHCL 4HXAL 3LKQA 4BUGA 3B4NA 4L9DA 3BT2L 1F3RB 5HI4C 3T08A 4HW6A 1QVOB 4ODTL 3WFDH 2NR6C 4GBXA 4PBXA 1X5XA 2ICEA 4TVPL 3VMNA 4NIKB 2DQIH 4OGZA 4CVXB 1VFOA 1R3HA 4NWTH 3CH8A 5GGTH 1YEEL 3W5NA 2SEBA 1RHHA 3VWKD 3THML 5DD0H 4LL9A 4NBZB 3QEQE 4O5LH 1WWCA 1RZ7L 5EOTB 3O6FC 3PWPD 1TDQA 4HLZH 2Y23A 4MB3A 4MD0B 4PJDA 5IB2A 1JWUA 4Q9QL 1IZJA 1XMWA 4HWZA 3EFDH 1Y0LA 2BSSA 1BBJB 3FB7A 3GK8H 5KANG 3QRGH 4LVHB 1AGDA 5C0IB 3HNSL 1A6WH 4LLUB 5E0QA 3TEUA 2AEIT 1G9EA 1IKFL 2P46B 2LVCA 2PXYA 4NCDA 5GZNC 5C1MB 5DA0B 3L3HA 1Q0XL 4WUKH 3DLQR 1JPST 3DO7A 3B9KB 2EXWD 1FGVH 1KPRB 1CF8H 1BOGB 5GZOD 3WNMA 1U6AH 5ISZB 2A6KA 2E27L 3WFBH 3KNBB 4JFDD 3MLUH 1K2DB 3GI8H 5FECA 4ONGL 5I1EL 2F5AH 1I1AC 2XZZA 3K3QA 4PTUA 4JDZA 4PB9H 2CO6B 5KG9A 3HUJB 4GKNB 2HT4D 4BZ1H 3WS3A 1S7WB 3O2VL 4LSDA 4Z78A 2DF3A 3C5ZB 3L3DA 5L88H 4HSQA 1ZTXL 3UTSE 4RGNB 4JN2A 1YPZF 3UBXI 1ZVHA 4HKXB 2HT3C 1MJ7L 1KULA 1H3XA 4S1DD 1I3RA 3KLHC 1N5AA 1M1SA 3WSQH 4WI3A 1NGZA 3UZQA 2HP4A 2L4OA 5F6IC 1JPTH 1CGSL 3MRKB 1EHLL 1UEYA 1T5WA 4Z18A 1IVLA 1G6VK 2BSRB 1U8OB 4KUCD 1AFVH 4XH2B 2X6MA 1DQLH 1OGTA 4HIJA 3U30B 1LK3H 1MHPL 5I1CL 1IGJB 2LU4A 2VAAB 5MHSE 1G7MB 4ETYA 1MJUL 4OF5A 4JZJB 5FOBB 1UM6H 5T1DL 2W60B 4LHQB 1MFAH 4ZFFA 1NSNH 3TNMA 5MENE 2VQ1A 4MA7L 1H5BB 2VZUA 5E7BA 3RL2A 1GJIA 1L0XA 1N8ZB 4Z7WA 1KTLB 1LEKB 2DWDB 5F96L 4QXGL 2P48B 1U8KB 2J2ZA 4X7SL 2NNAB 2YA1A 4RMQA 3AMKA 2YPVL 3MLZH 3QSKB 4RX4A 4OQ1A 2BSTB 1JGUH 4N9GB 1QSZA 1HEZB 2DBJA 4KI1A 2R0WH 4NBYB 4XAWL 3OJMB 1UYWH 1HKLH 2EDJA 1P69B 1SBBA 3QCVL 5ELIA 3ZDZE 3ARRA 3V95A 1JYNA 4AM0A 1UCBH 5INCA 1JF6A 4L4VA 3RWDB 3OKOA 4QOKB 2ITDA 2NY2C 4LKCA 2A83A 5E6ID 3TVMD 1K5NA 4HT1H 3C08H 4Z0BH 1IEHA 4CVWA 4FXLA 1YEIL 3MRHA 5DQ9B 3WEXA 4F3FB 4P9ML 3FB8B 2HFGL 2QBWA 2VXSL 5EU6B 2HVKA 1DVFA 3SY0B 2UV3A 2JJSC 1F11B 4U1GC 4Z5RA 5MEPB 3RUGA 5D1ZD 5D7LE 2FEEL 2YRZA 3IJYA 4ODHL 1F3JB 5CJ8A 1S7QB 2G75B 3C6LC 4JQXC 2FZ3B 4L3EA 4KZDH 5CP7B 1E4XI 4JJ5B 4ODXB 1G9ML 4XVUD 4PRIE 1QRKA 1VFBB 3JTTA 1R5VB 2OJZL 1MWAA 3MXWH 3G5VA 4J1UA 3T2OA 1P4IH 5KN5B 4JVWA 2CDEB 4MAYB 5CJQL 4JKKA 2AK4E 3MRNB 1LE5A 4XVSH 3D39D 5FFLA 5ACLA 3VFOA 4K8RC 1AGCB 1F8TL 5CGYD 4M03A 5DC0A 3L6FB 1U8HA 4DEPB 3T2PA 2K1MA 1YEDB 3FCTB 1CVRA 3F5WA 4NRXA 1KB5A 2VAJA 3TIDB 1AI1H 5FDWA 2IPTH 3SKOA 3FQRB 4I9WD 4DZBA 3VXPA 3HNTL 2I07A 4KKBC 1I75A 1W8OA 5D4QA 5L2KE 1T1ZB 1A1MB 4XX1E 3V6OA 1M05B 3MRMB 4LU5L 3S3JA 5HI4D 2R1WA 3T0DA 2NR6D 4RDQF 4NC1C 5IB4A 3V6ZA 2YD6A 3UROR 4EIZC 3X11B 1JZ5A 4RWYH 2FX7L 2VQTA 4OLVH 4DOHB 4HKJB 2J7LA 3FN3A 5J6GB 2IPUG 5C0ND 1W72A 4L8SB 5SX5H 3MNWA 3QG6B 5DJDA 3RNKB 5D2NC 3QDMA 4NWUH 1RVFL 2FYYA 3V5HB 5C0RL 1HE7A 3TO4C 3NMEA 3BUYA 3O6FD 3FAWA 1A8JH 1Q9KA 3KG5A 1RK0B 1GCFA 5JXAL 4DVRH 4EI6A 4YK4C 4GW5B 3BZEB 1KXVC 2V7HA 4L5FL 4BZ2L 4PJBE 4QRTB 1XGRA 1P2CA 4WWKC 4NNXA 4JY4B 1HHHA 1GHFH 5GZND 1RY7B 2ICCA 4HH8A 4WV1B 3I6GA 1J9CT 3W9EA 4F7EB 2GHWB 3KYKH 5FUZH 3WNPA 1HHJA 1U8NA 1T7ZA 3VXRD 2AQ3A 4DN3H 1AC6A 3O3AA 2KQNA 3FO9B 1AO7B 3QZWG 3KPSA 1A4JA 4LRIC 1RUPL 4IMKC 1F4XL 2Q8AL 2DQCH 1FNGA 2NZ9C 4DGYL 4PRDB 4JRXD 2J8UA 4HG4J 2AI0L 3G6AA 4LHUB 3EHBD 1I1AD 1FL3B 3ARFC 1CXHA 4Y5YB 1CK0L 3DTXA 4HUUA 4O2EA 3GSWB 1I3VA 4OCMC 3EJYC 5ADPL 4RA0C 4NQSA 3UXFA 2H8PA 1CDJA 1UENA 2ICWA 2JCCB 1L0QA 3KYOB 5AZ2L 4KZEH 2HT3D 4LEOB 5IKCB 3KLHD 1V3LA 3MLRH 2AS5M 4L9LC 3TA3C 4OCYL 1RJYA 4HZLA 2ZUTA 3VRJA 1JNNH 1EO8L 3GIVA 2J8HA 3KS0H 3BZDA 3S96B 1MWAL 5DD1L 2VLLB 1V3JA 4FFWC 2HVJB 2EIZB 3MRJB 3MREB 4KGLA 3PXHA 1XT5A 4WENB 2D7TH 3KJ6L 4MQSB 3BYYA 3PG2A 5FO8A 1MCPH 3QDGE 4OF7A 2IANB 1G1YA 4WTZG 3UTTD 3RWGB 1KB5L 2HJKB 1I9JH 3QULB 1MRFL 1LDSA 1WFOA 5DUPH 3WS6C 3NTCH 4LSQH 1BGXL 3KPMB 5C07E 1Q94A 3BZ4B 2A9ML 2VXTL 3L3GA 3H7LA 4P4KA 1B0GA 3CX5K 1JCKA 3D85A 1KEGH 1WAAE 1K4CA 3PHSA 4EBQH 2E7BA 4YFLF 5GHWL 3BGFB 5DJCA 3HA0A 2H3NB 5IQ7L 3DV6A 5BS0A 4HWUA 4PIRF 4JDTH 1UVQB 3H0TA 1W72L 4GAGL 2WMPA 2NY2D 4E42A 2ED9A 5SWQB 5HHVH 3R06A 1R3KA 4JFEE 4KDTC 7FABL 2P5WD 1C5DB 4LHUG 4DUWA 3QXUA 3PQYA 5ENWA 1GGUA 4XNMA 2WK2A 1UJ3C 1FE8H 4TULL 1KIRB 2Y6SC 4GO6B 4ZTOL 4R26H 1DN2A 4L4TD 2AXJA 3CFEA 4GUPB 1E6OH 5HHXL 2Z31A 2YS4A 3C6LD 4ETQB 3VD4A 4QRRE 4YBLC 3P4MB 1NC4A 2DKUA 4GT7A 3MJGX 1NFDB 5EZLB 5H8DA 1DQMH 1T03L 2DTMH 2BC4B 1K85A 3OJ2C 3EOTL 5CZXC 1BFOA 3LKRA 4X5WB 3AREB 2WAHA 1D5ZA 1TITA 3U9UB 4D0CB 4K8RD 5TH2A 1MFBL 3F7YA 1NGXA 5FHAL 4XNZC 2R4RL 3QO0B 4JQVC 5EA0H 4NHCH 4HXAH 3BT2H 4H26A 2V2WB 3HCVA 4ZDHA 4ODTH 1ZHKB 1OOAA 3GJFH 3RVXD 2E6PA 1X6LA 1ZT7B 4TVPH 1CI5A 4NQCE 5KVMC 4BKLA 4LMQE 3HI5L 4J4PC 1NEUA 3MBEA 4KKBD 5SWZD 1YEEH 5B3NA 1NJ9B 1JIBA 2VLJA 4IBLT 2F58L 3FQUA 3THMH 1C5CL 2QKIB 3S4SB 5BOZG 3GSNA 1EFXD 1RZ7H 4I0KA 4Q74A 1SVZA 4YDIL 3OJVC 1JHKL 3KLAB 4Q9QH 5EU4A 4PGDB 2BOBB 3KDMB 4JVPA 5C0BD 3FT2B 3U0WL 3RPKA 2B4CL 3NN8B 1F45A 1AQDA 3HNSH 3TO4D 2A74B 1VACB 1IKFH 4POZC 4NRZB 4U6VL 5BVPL 5JW5A 5HYQB 3TBYB 3W82A 4YGVA 2EYRA 4O2CA 4P3DA 1Q0XH 5ESAA 5JQHC 1A7BA 3WCYA 5IB1B 5I16A 5I17B 5FGSA 4D9RE 4U0RC 4CDHA 4P4RB 3ZKXC 3ORJA 4JM2B 5AYQA 3ISWA 4HGWB 4WWKD 4ZSOB 1RQ5A 4PUBL 1I8LA 1S7UB 4X83A 5E2VL 4UDUA 2E27H 3I75A 4Y19B 1ZS8A 4JPIB 5E00B 4ZODA 1TZGL 2DQHL 3KPRD 4ONGH 5I1EH 4TQEL 2G5BA 2V2XA 3O41A 2CDFA 3VXUA 3O2VH 3U36A 5M95B 2AV1A 4PRPD 3IETA 3LKQB 1ZTXH 5KOVC 4X7TA 2ENSA 3DUSA 1FZKA 3FO0L 1U8MA 2ICEB 1MJ7H 2DL2A 1CDIA 4X5LA 4MZ2A 1R3HB 3EJYD 1I8IA 2BVUA 3OXSB 1CGSH 1EHLH 2SEBB 1RHHB 1XF5A 1GXEA 1QSED 5D6DA 1VEMA 4ELME 4LIQL 4PJDB 6FABL 1MHPH 5I1CH 5IB2B 5D7JC 1JWUB 2O5XL 2OR9H 4HWZB 3TA3D 1Y0LB 2BSSB 1MJUH 2PTVA 4JJHA 3ZDXE 1TQBC 1AGDB 5T1DH 1JYVA 3UTZA 2E8ZA 4FFWD 4MA7H 2PXYB 3EKCA 5HVGB 4MMXC 3K2MC 3L3HB 3MLVL 4WO4B 5F96H 4QXGH 3NCYP 2ERJB 5B22A 4X7SH 5HYJA 2IAMC 2YPVH 5DR5L 5FXCH 2IC2A 3LN9A 2V5MA 3BPOC 2BZDA 2A6KB 1X4ZA 4XAWH 5J57B 1OAYL 3U4AA 3QCVH 3TP4A 1NGYA 2W0FA 5CGTA 3FJTA 4ZNEE 1E6JL 1OGAA 5FECB 1H8SA 1A2YB 2ZUYA 4JDZB 5KG9B 5CJXA 3LQAC 5FA3A 3WS3B 3MRPA 2HJFB 3GSNL 4Z78B 3L3DB 3VFSA 1B3JA 1YEIH 1IARB 2ZUSA 2UUDH 4B53A 4P9MH 4JN2B 4DJMA 1U95A 2HFGH 4I3GA 2VXSH 4PYGA 1EHNA 4XWOC 4GQ9L 3PWUA 4Y4FA 1WZMA 3O4OC 1I3RB 1N5AB 3BJ91 1NGZB 4APQC 3ZT5A 4ODHH 3UCRA 4Q0XL 3DHJA 4OZIF 5LAXA 1T5WB 3AVEA 2Y6SD 3KPTA 1G9MH 4JPKL 3UAJC 1CGYA 1JGDA 1OGTB 4OIBA 4HIJB 5DXWA 2OJZH 5FK9A 5I9QC 5CJQH 5JHDD 3K7UA 3DECA 2X2YA 3NCMA 3VXTA 43CAA 4BQ8A 3ARDC 3WN5A 3PWPE 4OB5L 4WVRA 1DTUA 1F8TH 3OQ3B 3I2CL 1HIML 4ZFFB 2VDQL 3TNMB 2VQ1B 3VJ6A 4KTYA 5CZXD 5E8EA 4Z7WB 2WWKT 3P9MA 1KENL 3SO3C 2VOTA 1ZLUH 4UUJA 4MXQC 4NN6B 3HNTH 2VDKL 4LU5H 1A6VL 5E9DD 3DO3A 1CD1A 2CRZA 5DMJB 2WLYA 3RIFF 3ARBA 4MJIA 4AM0B 4J4PD 4PD4J 4XCYA 5E03A 5INCB 4L4VB 2FX7H 2ZSVA 2BVTA 3OKOB 2ITDB 4JFDE 2HFEA 3C2AL 4LKCB 3HG1A 1K5NB 2X42A 4XXCA 4HS8L 1RVFH 4PY8I 5C0RH 2X1OA 3MRHB 4XP4L 3WEXB 4R6UA 4NO3A 5JXAH 1X4YA 2HVKB 1DVFB 1WT5A 3R4DA 1KCVL 4HDIB 4Z5RB 3RUGB 3JBG7 4L5FH 3IJYB 4BZ2H 4UNUA 5MERA 1WIPA 5I6XB 3V79C 1CFNA 4L3EB 4R0LA 2F54B 4R8WL 1RD6A 1RZ8A 2H9GA 3JTTB 1MWAB 4DGIL 4J1UB 2XOTA 3G5VB 5DVKA 1H3GA 2CUMA 1FHGA 5ACMA 1CG9A 1LE5B 3TT3L 3KPOA 1TTFA 3T0AA 5A2KH 1RUPH 1F4XH 5HBBA 2Q8AH 1U8HB 1NDMA 4DGYH 1QBBA 2QL1A 3F5WB 4NRXB 2QHRL 1KB5B 3ZTJH 2AI0H 5FDWB 3SKOB 5TF0A 1CK0H 1UQSA 2XWBA 4DZBB 3ARUA 3VXPB 4OZ4A 4WW1A 2I07B 4KMTL 5ADPH 1PEWA 3X12A 3S36L 1E4KA 5I1AA 1CCZA 4PP1C 4XT1C 5C09D 2DQGL 4M8QA 2Z8VC 3HI6L 2R1WB 1OD7A 4P2QA 5IB4B 1FL5A 3V6ZB 3BEVA 4ZPVA 1K3ZA 5AZ2H 3V7AG 2EDWA 2BNQB 2GKIA 4PJIA 3QUZC 3HR6A 4I3SL 2YKLL 1W72B 4OCYH 1EO8H 3SKJL 5DJDB 3FAXA 3QDMB 2FYYB 1MWAH 5IROC 5DD1H 4HF5L 5MEOA 5KZCD 4D9QD 4KVNL 3BUYB 2K9UA 1Q9KB 4NQUA 1BVLA 1CLCA 4Q7DA 4EI6B 2CKBA 3KJ6H 3X13A 4P23A 1QQDA 4W4OA 3CSBA 4J3TA 4X6BA 3EIFA 4DKEL 2V7HB 3BN9C 2H41A 1XGRB 1P2CB 2EC9T 1B4RA 4NNXB 1KB5H 3D9AL 1MRFH 1HHHB 4M1GL 4KDVA 3LPGA 5JW4M 1BGXH 1DUYA 2ZOLA 3I6GB 1W2KT 3W9EB 1LP9F 4Y7MA 1HHJB 1U8NB 2IH1A 2F74A 2IAMD 2RBLA 5D9SB 4UTBL 4PJGF 4NM8L 2A9MH 2VXTH 4LK4A 4UT7L 3O3AB 3ZYZA 5IT2L 4G43A 3KPSB 4S1RL 5C9KA 3QFDA 4K3HA 4YHNA 1FNGB 5T3XL 5GHWH 1KF9B 3BKJL 3NCJL 4ZUTA 3D39E 5IQ7H 5D7IA 2J8UB 4ODSL 4HWBL 3G6AB 3ZHLA 4PRNA 1W72H 4GAGH 1R0AL 4HUUB 3DTXB 3HMXA 5ITBL 4O2EB 7FABH 3GDBA 2OXHA 4NQSB 2EDYA 4I9WE 4FP8L 2H8PB 4TULH 4JR9L 5E8NA 1JZ3A 4M02A 4XWOD 1ZLVK 2ICWB 4ZTOH 3ARQA 2DM3A 3I6LD 4JKMA 2NY7L 3UZEA 3DVNA 4JQIL 4APQD 3MV9D 5HHXH 1I9IL 4M7JL 1WZKA 5E4EB 1RJYB 3FT3B 4HZLB 5CLTA 3VRJB 3VI4F 3GSVA 3L3IA 4A2LA 1RAMA 5CSGA 2OSLA 4Z7VA 3UAJD 1T03H 4K71B 4YHOL 1D3CA 1I3UA 3EOTH 4NKIL 1A4KB 3P4NA 3LPFA 4L29A 4N0UA 5FO8B 1FDLL 1IGCL 1T3FB 3ARDD 1MFNA 1MFBH 4F7PA 3BD3A 1K8DA 5FHAH 2R4RH 15C8L 2VLRB 3VDAA 1KCSL 4XPAL 1MPAL 1QPXA 4HMDA 4AEEA 5CZVL 4E41A 2BY0A 2HN7B 2JIXD 3NA4A 2HA1A 4MXQD 1H3WM 1Q94B 1S9WB 3HI5H 3L3GB 4P4KB 1B0GB 1YEGL 1U41A 3D85B 4LVNB 2F58H 1K4CB 3VXRE 1C5CH 5HGAA 5K9QI 4NNPL 4U3CA 5DJCB 1RSFA 5IFHL 3DV6B 5BS0B 4YDIH 3H0TB 3RJDA 1JHKH 3KYAA 3MV7E 4E42B 3U0WH 3QG7L 3ZDYE 3R06B 1R3KB 1UZ6E 4MWFB 2B4CH 3FKUS 4RRPA 3PQYB 5ENWB 4XNMB 1B9ZA 2MNUA 2CKBL 3E6FA 4U6VH 4YUEL 5BVPH 1F2XK 1IT9L 3U6RA 4FXKA 2VISA 4NQVA 2FLRT 5DJXA 4YFLI 1MY5A 1MUJA 1F00I 3CFEB 3FT4A 3DVGA 4XZUA 2Z31B 1EV2E 5M94B 4PUBH 5GIRA 1L4IA 5JLZA 1NC4B 1T7XA 3T0VA 5E2VH 3Q6GL 4POYA 5DJ6A 5DC9B 1TZGH 2DQHH 4MNQA 4GS7C 3ZKMC 1HQRB 4QRPD 1BFOB 3LKRB 3GKWL 3BQUA 5EDXA 2DM4A 4TQEH 5HHOA 4MVBC 1EHXA 1MAML 5FYLL 1BWWA 5TH2B 2YPLB 3P11L 1DQDL 1DLFH 4PG9A 3F7YB 1NGXB 5F1SA 1DBAL 5ETUA 1YECL 3HE6A 5I66A 4H26B 2R2BA 4JKLA 3HCVB 4ZDHB 1D5MA 4AL8L 5CD5C 3JSSA 2XPGA 3FO0H 4HFUH 5ECJE 1XGUB 1A7PL 4K9EC 3AAZA 3BGAA 4OM1L 4ZUWA 5HHMB 2XTJB 3IRZA 3MBEB 1ADQL 4F7MA 4PP1D 2VLJB 3L9RA 1KJMA 3FQUB 4DFIA 4AEIL 2BNRE 4MHHG 3GSNB 4PJ7A 3IFPA 1TVDA 4LIQH 2BY2A 3BVNA 3UJJL 1AKJA 3BD4A 6FABH 1J1PL 3QUZD 2O5XH 5EU4B 3GUTA 1CLYL 1V7NL 2Q8BL 3CDFA 1GYAA 2EE9A 3IAQA 4GMSL 2A73A 4JHWL 1JWSA 3IDMA 3SCMA 2AJ3A 1AQDB 4N8VA 4MDIA 5DDHA 3U46B 4NJAL 5JW5B 2P5WE 4YGVB 1FZOA 2EYRB 3MLVH 4O2CB 4P3DB 3MV8A 5ESAB 4K94C 2KUTA 2EDOA 5I16B 1G0YR 1MHEA 3CSGA 3DIFA 3BN9D 1BBDL 3VXME 5DR5H 1T1WA 4WHYH 2JK5A 4UDUB 5D5ME 5IV2A 3I75B 1OAYH 2XFXA 3TCLA 1HNGA 1ZS8B 4JM2F 1CGVA 2WLZA 1TCMA 1E6JH 3WKML 3IDIA 4NO0A 2G5BB 2V2XB 3O41B 4QNPF 3MOAL 2BJML 2X89A 1Z0MA 3U36B 2AV1B 3GSNH 2R23A 3IETB 4M6NL 1N59B 1I9EA 5TE7L 1HHKA 1ZHNA 4K7FA 5FGCE 4X7TB 3DUSB 4NN7C 4GQ9H 1U8MB 4YXHL 4U3HA 3TN0C 3NAAL 3TESA 4WTXA 5FV1L 2M8XA 3EYQC 1I8IB 2PTUA 3O3BA 3ARTA 4Q0XH 3NBNA 3ZE1E 1N3NA 5DD5L 1XF5B 3SO5A 4JB9L 4OLXL 2VN7A 4JPKH 1U8QA 5SWZE 1NCBL 5JW4Q 4LNRA 5I8OL 5F8RC 1X5HA 3KXFE 1D6EA 4BM7A 4NC1E 5JDSB 2C4XA 4OB5H 5J89A 5JXEA 3I2CH 2PW1A 3UTZB 1HIMH 1RHFA 2VDQH 3HZYA 4ELKA 2AEPL 5C0BE 3QIWC 4LCIL 1IQDA 2FX9L 4H0HB 1T83C 1KENH 5HYJB 4LCWD 4FQ2L 5I71C 1WV7T 3D48R 5IFJA 1O7VA 3HC4L 4PJEE 3RBGA 4OI9A 3WJJC 2VDKH 4PJ5A 1A6VH 1S5HA 3ZT7A 4PG2C 1ZA6A 4HEPG 4P46C 1NGYB 5IVXF 2W0FB 1OGAB 3RI5K 2P45B 4LQ1A 3LY6A 3C2AH 3RGVA 3KPRE 1BZ7A 3DMMC 5FA3B 2XV6B 2DTSA 3MRPB 1B0WA 4HS8H 5DWUL 4FQHA 3VFSB 3S6CA 4XP4H 3QWRD 4GRLC 2W1NA 5E2UL 3ARZA 4JRYA 1CGXA 1U95B 2NXYC 3EW3B 1I7ZA 5I73B 3PWUB 5FYKD 1KCVH 4I2XA 4Y4FB 2ATPA 3T09A 1KN2L 1FYHB 2X1PA 5LAXB 3BI9X 5CMAA 2VZ1A 4R8WH 1JGDB 3VI3F 4L3AA 5FK9B 4DGIH 5FGRA 2VZVA 2C4FT 3LQMA 1EEZA 3W0WA 1FQ9C 3TT3H 3VXTB 43CAB 2EDRA 3WN5B 2XXMB 5BCAA 3W2DL 3G5XA 1A6ZB 2AJXL 4PJHA 2AJYL 3ZKMD 3VJ6B 3QXAA 4Z0XA 3GJEA 2QHRH 5E8EB 5GS2H 2ILLA 3P9MB 1OWRM 3FB5A 4MVBD 4UIMA 2EE6A 4UUJB 3UDWA 7CGTA 2OTWA 4KMTH 2GYSA 3S36H 3C87A 5EN2A 3S5LA 2X9XA 2DQGH 2DM2A 3HI6H 4HJJL 3QUXD 1CD1B 5CD5D 5A2IH 1X5LA 3ARBB 1A21A 4MJIB 4OKVA 1IAOB 2VNCA 4RWHA 2LTQC 2ZSVB 5EPMA 5L8JB 3GSOA 1CQYA 2HFEB 2PO6C 3GMRA 4I3SH 2YKLH 3HG1B 3SKJH 4AT6A 2Z92A 1J1OL 4UZGA 1JZ6A 4FQLL 4HF5H 3C8HA 4KVNH 3S3SA 1I4FB 4NO3B 3SDXA 3F6IA 3MNZA 2X4TA 1CL7I 3QUKA 3ROLA 4PJ9B 2J3SA 4DKEH 1QP1A 4QGTA 3QEUA 4DN4L 2C3XA 1N6UA 1CFNB 3D9AH 4M1GH 4R0LB 2DI9A 4KXZI 4Y2OA 1RZ8B 1UKSA 2H9GB 5EO9A 1C1EL 3FFCA 2A38A 2NY1B 4UTBH 4NM8H 1JHTA 1CG9B 4UT7H 5IT2H 3DX8A 3KPOB 1PVHA 4S1RH 4EDWL 2GSGA 2PUQT 2DKSA 5T3XH 1NDMB 2R8SL 2CK2A 2OCFD 3BKJH 3NCJH 5C70A 1UM4L 4ODSH 5EUOA 4HWBH 2VDPL 1R0AH 1UQSB 2XWBB 5ITBH 4OZ4B 4WW1B 4F7TA 4J7RA 4PLJC 3X12B 1NC2A 5I1AB 3PGDA 4NZRL 1EERB 2FB4L 4M8QB 4FP8H 1YY9D 4P2QB 1FL5B 1XF3A 3BEVB 4ZPVB 4XP9L 3TN0D 4NQDA 1X5IA 2X10A 2NY7H 1Q1JL 1I85A 5E9DE 1C08A 3EYQD 4JQIH 4ONHA 4EN3C 2F53A 4PJIB 1I9IH 4M7JH 2FNBA 3QFJB 3U4BL 5T5NF 2BX5A 3DVIA 3MUY1 4JO1L 5E4IA 3QI9A 4WFGD 4P2RE 5A3IC 5MEOB 4YHOH 2CDGA 1FZMB 5EOCL 1KCRL 3U4EA 2CUHA 4NKIH 1Y6MR 3FQNA 1JGVL 1BVLB 4PGCA 4DTGL 3H9SD 2CKBB 3MRRA 3X13B 2GQHA 1QQDB 2BCKA 4MX7A 4P23B 3RPIA 5IWLA 1FDLH 1IGCH 3QEQA 4X6BB 3MRCA 5D70L 1PBYA 15C8H 4U1KA 5E7FA 1KCSH 3QIWD 4XPAH 1MPAH 1ZT4A 1VFUA 3W11C 5CZVH 1WTGT 1DUYB 2ZOLB 3T65A 3LV3B 5IJKC 3U79A 2IH1B 2F74B 1XZ0B 1IM9A 1EPFA 4Y4HA 1YEGH 4G43B 3SDDA 2J5LB 1XCQA 3MUJA 4YHNB 1KG0A 4NNPH 5C0FA 4P46D 2GY5A 3SGKC 4ZUTB 5IFHH 3GBNL 4XRCA 2QEJA 5D7IB 1AGBB 3JVGA 4BFEA 3MJ9A 4PRNB 1NMCB 4P0DA 5MI0B 4ORZC 5D8JL 3V6BR 4MSWA 4ZAKD 4QEGA 3QG7H 3DMMD 2KDGA 4FRWA 2LQRA 3HMWL 2B0SL 2AGJL 2Y7QA 1N64L 3PP3K 4GRLD 2CIKA 2YD2A 4PJCF 2X1WL 5IW1A 2CKBH 4YUEH 3ROOB 5E8NB 1IT9H 3QEGL 2NXYD 3C8KA 1P6FA 4UTAL 1N4XL 4KJWC 4WJ5A 5DHVB 3DVNB 4U1LA 2NY3B 2GJ6A 2PF6A 2RIKA 4F80A 3GSVB 3L3IB 3Q6GH 2OSLB 4Z7VB 3TYGL 3X3GL 3CXHK 5CZKA 1IILE 4DWHA 2VR5A 3UC0L 1QYGH 3P4NB 4L29B 5DRXA 4CAGA 4N0UB 3GKWH 1NBZA 2CLRA 3MBXH 3QAZB 4Z76A 4D9QE 1MAMH 5FYLH 4X6DF 3P11H 1DQDH 4F7PB 4NQEE 4PBVC 1K8DB 1K8IB 1DBAH 1YECH 5KVDL 4YJZL 2D0GA 2X4QA 4AL8H 3QXVA 4E41B 1T66C 4JN1L 1A7PH 1KTRL 3GKZA 3CH1A 2OZ4A 5MENA 1GZPA 1A5FL 1ADQH 2VTFA 5H2BB 5B3JF 2NQCA 4M1CC 2XN9E 5CJOL 2IH3A 1CFVL 3WO4C 2NZIA 3L5WA 4AEIH 1FNFA 3CMGA 5DHVH 2VLKD 1QSFD 2YWZA 3PP4L 1AGFA 1EAJA 3UJJH 1J1PH 1B0RA 3CMOL 2PO6D 5I1IL 5MP6L 3NOIA 3DHMA 1CLYH 1V7NH 2Q8BH 4GMSH 4NDMA 3UJIL 4JHWH 5ID0A 4LKXA 1DQQA 4OJFL 5FEBA 3QHFL 2BMKA 3LPWA 1QBAA 1KN4L 5J13B 4NJAH 3E6FB 5HXMA 3RDTC 4HPOL 3VGAB 3U6RB 1PQZA 4FXKB 2VISB 4NQVB 5DJXB 1TCRA 3VFTA 1MUJB 3QIUA 2EYTA 2ESVD 5J12B 3FT4B 4HV8A 2W92A 1BBDH 5HYFA 3DVGB 4XZUB 3CX5J 5GIRB 5D96C 5DK2A 1AXIB 3I6LE 1KSRA 4CNIA 2XG5A 2DLIA 1YPZE 5DJ6B 3MV9E 5GSRA 5KS9A 5D7LA 2MQCA 2AK1L 4JM4L 4MNQB 1N0LA 3V0WL 1INQA 4YR6A 3TZVD 3GSRA 1U0QA 3BQUB 2EDTA 5HHOB 1JUFA 3MOAH 2BJMH 4PG9B 2BVQA 3E1F1 4HK0A 1KIQA 3ZLQC 5IQ9A 4M6NH 5ETUB 2ZOKA 3HE6B 2AK4A 3MJ9L 5TE7H 5I66B 4B7IA 2R2BB 1D5MB 4BZYA 3O9WA 3LDBB 2XPGB 5KSVA 4YXHH 3G6JA 2X4PA 3AAZB 3NAAH 2ZP0T 4JDVA 2VXQL 1ZT1A 4ZUWB 4A6YL 1L9NA 3C8DA 4PLJD 1FSKB 3FONA 1BF2A 5HY9A 1EXUA 3HI1A 4F7MB 5BW7A 3TLRA 1HCFX 5DD5H 3L9RB 1KJMB 4JB9H 4OLXH 4LSTL 4MJ5A 3M45A 1OP5H 1NCBH 1GL4B 1RZJL 4QRQA 5I8OH 4PJ7B 2EEBA 1IGYA 1RJCA 3IFPB 3KWWA 4PRHA 1EX0A 4DCQA 3BVNB 4EN3D 1P6AB 3K2UL 4F9LC 3GUTB 4MQTB 3UPCA 4J8RA 3V7AE 2A73B 2DIBA 4G6FD 4M3KB 1JWSB 3IDMB 4G9DA 3SCMB 2AJ3B 4N8VB 5A3ID 1T89C 3F12A 2JJTC 4I8DA 4MDIB 5BV7L 4K55A 2AEPH 3H42L 4LCIH 5D2LE 2FX9H 3VE0A 1FZOB 3MV8B 5HYIA 2MPAL 5BRZD 3B9AA 1MHEB 1T5XA 3O3DA 4K7PL 1I9RL 2NPLX 3DIFB 1U92A 5F7UA 4FQ2H 4R7NA 3HC4H 1BFSA 1T1WB 2FSEB 4TPRL 1A1OA 4FQCL 2HMIC 1A3RL 4GLRI 4JHZA 2JK5B 3W11D 5IV2B 2XFXB 3TCLB 2NXZB 4ZNCD 1XF1A 2D4DA 2NY5C 2OZ4L 4WCYL 4PJBA 4ZTPL 1XIWC 3AS3A 3OX8A 5GS1C 2AJSL 3PWNA 4JM2C 1YC8A 3IDIB 1MIML 4NO0B 4G5ZL 4MLIA 2E8YA 1HILA 4QRPE 4M5ZL 4U7MA 1UZ8A 2R23B 5DWUH 1C8PA 1T80A 4FA8A 1J86A 1HHKB 1ZHNB 2ZCHL 4K7FB 4U6YB 5E2UH 1IL1B 1RIHL 8FABA 1FYTA 3MGAA 3D0LA 3QNZA 3Q3GA 1S9KC 5TDNA 4LCCA 4WFFE 1BFTA 1KN2H 3O3BB 1N3NB 2X4RA 4GBXC 1U8QB 4MDJA 4LNRB 4KJWD 3LEXB 2XYCA 2P42B 1D6EB 1J5OL 3WL9A 1EUTA 5T1KD 5FGBA 4FQQA 3W2DH 2PW1B 5ERWA 2AJXH 3HZYB 1SJVA 4ELKB 2AJYH 2COQA 5GRYA 3N1QC 4HK3N 5CGMA 4HUVA 1IQDB 5F88B 1BMGA 2HKFL 3D69A 2I60L 4JVUA 1PG7W 5IFJB 5DI8A 1NPUA 4U1SA 4LPCA 3ILQC 4PJ5B 1S5HB 4HJJH 1FAKT 1ZA6B 4X4ME 1T66D 4KUZL 3FTGA 1JTOA 2ICES 5E70A 1C5BL 3ZHDA 3B5GA 4QT5A 4OQTA 3CFJA 4M1CD 2FX8L 3RGVB 4I5BA 1BZ7B 5C07A 1RI8A 4WI8A 3BISA 4NCC2 1J1OH 3IDNA 1QSVA 4FQHB 4FQLH 1CICA 4EXKA 4H20L 4X6CA 5DURD 1I7ZB 1VEPA 1KLUA 2FECI 2PN5A 4I2XB 5A2FA 1CBVL 4WY7L 2ATPB 3BXNA 2VABA 1WAAF 3ZYOA 1A7QL 2H26A 4DN4H 4RFNB 1F6LL 1S9YA 2P8PA 4HUXA 4LCYA 3ZKQD 3OJDA 4IRSA 3TV3L 1U93B 3RDTD 2W9DL 1MOEA 4MA1C 3UTPD 5CMAB 4NFBA 1C1EH 1A7NL 3AM8C 1H15A 1EEZB 3W0WB 3CNKA 5F8QC 4Y4KA 4P5TC 2EDKA 5MEQA 1AJ7L 3EJZC 4EDWH 4K7PY 3VW3L 4HKZA 4FZEL 4RMRA 4PJHB 2R8SH 4B41A 5SWSE 1JRHI 1LK2A 3HPLA 5EBLA 3QXAB 5F9WC 1UM4H 4Z0XB 3GJEB 4QRRA 3TBVA 1F90L 5FM5M 2VDPH 3FB5B 4UIMB 4JFFD 1NLDL 5D1XC 2OTWB 3O6LL 3TIEA 2PYEA 5F1OB 5EN2B 1NUNB 4NZRH 3S5LB 2FB4H 4CKVX 1F58L 4LCWE 3AY4A 3OGOE 2EDLA 3HPJA 2GW5A 5AG9A 4XP9H 2FH8A 5F7EL 1T2XA 4OKVB 1Q1JH 4X98B 4Q97A 3AGVA 5EPMB 5KSBA 3GSOB 1T6WA 1CXIA 3GMRB 4NM4H 3U4BH 5DSCB 4WDIA 4JO1H 4AT6B 3PXJA 5EOCH 1KCRH 4L1DA 3SDCC 3QDJB 4DTGH 3RWHA 3MNZB 2X4TB 3QUKB 4RGOL 4ZUSA 4R2GC 2Q86B 4C56A 3BP5A 2Z8WC 5D70H 3QEUB 1A7RL 5FYKE 2EDEA 3OKNA 3RQ3A 2GITA 2NCMA 3I84A 5F70A 1JGLL 3N85L 3QUYC 2NLJA 3NIGF 1TJIL 4P2OC 5GGUA 1AQKL 5EO9B 3FFCB 1FG2B 4GMTL 3ZSSA 4NO5A 2F8OA 2ZKHL 3K4DA 4M5YL 5KVFL 1JHTB 2DBLL 4YNYA 3IB4A 3DX8B 2HMID 4V1DB 4FTVA 4YE4L 2GSGB 5J0BA 1XIWD 3D2UA 1JN6A 2C3WA 3GBNH 5EUOB 4OQTL 2VC2L 4JM2D 4L1HA 5E5UB 5D8JH 1P1ZA 4OBRA 3N1MC 4IRJA 5DT1L 4F7TB 4EI5A 3HMWH 3QA3A 2B0SH 2AGJH 3BIAX 1F5WA 1N64H 4KHTL 1NC2B 1QACA 3VWJB 3PGDB 4HKBA 1YC7A 5F9JA 1YEJL 3TFKC 3QEGH 4YPJA 2I5YL 1XF3B 1TTGA 3SDAA 4UTAH 4NQDB 1N4XH 3S5LG 2Q6WA 1QFWI 1C08B 4K07A 5E24E 5CJBA 4ONHB 3V6OC 2F53B 1SJHA 3ILPA 4GXUM 5DGRA 2EICA 4J6RL 3ALXA 2EH8L 3QIBA 3O2DA 43C9B 1PX3A 4GBXD 3TYGH 3X3GH 3QI9B 1R5IA 2CDGB 2WV3A 3U4EB 3DSNA 1PSKL 4PV8A 1RFDL 3AB0C 3UC0H 3FQNB 4HIXL 2YK1L 4PGCB 3SE9L 1PYWA 1RJZA 4MX7B 2BCKB 4XMLL 3RPIB 2CLZB 3QEQB 4U2ZA 4R3SA 5E94A 1Q72L 3H2WA 3VU2A 1CD8A 3MRCB 2P8MA 4ELMA 4HC1A 4NPYA 4KU1A 3BPCA 4U1KB 4PJXF 3QYCA 5KVDH 1KXQE 1ZT4B 3RZCD 4G80A 4JN1H 3T65B 3LEVL 1JE6A 2OL3A 2HTKC 2DOCA 4R97B 1JMXA 4POUB 1A5FH 1IM9B 1IQWL 4Y4HB 5JA9A 2AJUL 3KPNA 3ILQD 5CJOH 4NUGL 1CFVH 4YZFE 3SDDB 4M6ML 2OTUB 2B8OT 1XCQB 2MTPA 1KG0B 4R7DA 5C0FB 2Y1VA 2M26A 3DX7A 4OLUH 2N7AA 4XRCB 3G6DL 4CMHB 3PP4H 4PLOB 4NC2B 4MSWB 3CMOH 3IF1A 5I1IH 5MP6H 1OM3L 1AIFA 4URTB 3UJIH 5C0AD 2BNUA 4HG4K 2Y7QB 4AH2A 2DQFA 4OJFH 3QHFH 4IJ3C 3RVUC 2CIKB 4KK5C 1KN4H 5IW1B 4KK6C 4HPOH 1NCWL 3C8KB 4OZGE 3T0EA 2EKSA 5C8JA 2EH7L 3VH8G 1G7QA 4WJ5B 2MKWA 3C09C 4U1LB 4H0GA 4N0YL 3UTSB 2GJ6B 3QCTL 5IHUL 4QO1A 4O58L 4P9HL 3S35X 4I0PC 3GMPA 5IHBA 2AK1H 4JM4H 1QBLL 3V0WH 4PR5A 3V4UL 1DR9A 5BV7B 5FUCC 5DRXB 5I8EA 4Z7VF 2CLRB 4WFGE 4Z76B 3EDDA 4P5TD 1ROWA 3L5HA 4OM0L 4LEXL 1CN4A 4YDLC 3EJZD 1A3LL 1DQJA 3VWKA 3HS0B 4H1LG 3MJ9H 2X4QB 5E5RB 5HVHB 2ZCKL 1MI5A 3D0VA 2GT9A 3LB6D 1QOKA 4M61A 3CH1B 4A6YH 5MENB 2VXQH 5D1XD 1FNHA 1GZPB 3CCHA 4C55A 1EGJA 3PABA 4KHXL 1CVSC 1CFSA 1DCLA 2IH3B 3HZKA 1AHWC 3N9GL 2AQ2A 2Q7YA 4LSTH 1PKQE 2P24A 2WBKA 2AV7A 2RCSL 4AQ1B 1RZJH 1ZK9A 1G1CA 2DQJL 3QJHA 4Y1AD 1AGFB 5GGQL 3K2UH 1B0RB 2V9QA 3MLYL 3ULUL 1W0VA 1X9QA 3O2DL 4GQPH 4WFHD 2D7MA 4IS6A 4NDMB 3ARSA 4LLYA 3EUUA 2FHCA 5ID0B 5L8KB 4LKXB 1DQQB 1NDGB 5F97E 5BV7H 3SDCD 4JFDA 1CD9B 3H42H 3DWTA 4JGJA 1PQZB 1TXKA 1PD6A 1TCRB 3PL6B 4R2GD 3VFTB 5FO9B 2MPAH 3QIUB 4HC1L 5AUMA 1WICA 2EYTB 1L6ZA 4K7PH 1OLLA 1I9RH 3CFKA 4HV8B 5I8CA 5LBSL 4O02L 1SM3L 3HB3C 4ENEC 4FQXC 4NN5B 3KAAA 4TPRH 3HUJE 4FQCH 3NH7L 5DK2B 1A3RH 2ZSWA 1KYOK 2KL6A 2OL3L 5D7LB 3HR5A 3QUYD 3QQNA 4P2OD 2OZ4H 4WCYH 1GZQA 4ZTPH 1INQB 5EG6C 2AJSH 4YR6B 3GSRB 2D9CA 2Y9RT 3P0GB 1RMFL 1MIMH 4PRIB 1JUFB 4G5ZH 1OT1A 2UZIL 4UOW1 1CIUA 4M5ZH 2BVQB 1G7LA 1KIQB 5IQ9B 4NSKA 2ZOKB 2AK4B 2FBJL 5IEKA 1OSZA 2ZCHH 2ED8A 1RIHH 5DJYA 5IMMA 5BVJA 3O9WB 2X4SA 4Z7UA 3G6JB 1Y6NR 2X4PB 1VKXA 4NJ9L 1E28A 4JDVB 1ZT1B 4YHZL 3FONB 5HY9B 1EXUB 3HI1B 1JPFB 5TJWK 3TFKD 3WBDA 3E3QC 5I1JL 4MJ5B 5T1LD 8CGTA 2C3GA 4QRQB 3PV6A 3EYVA 1FPTL 1IGYB 2XTJC 3KWWB 4PRHB 4DCQB 5KAQG 4L8BA 1T2JA 4D9LL 1J5OH 2C5DC 5CINH 3ARPA 3STZA 4J8RB 5M7QA 5T3ZD 4JHAL 2MKLC 4G9DB 1P4LA 3RKPA 3F12B 3BUTA 3GHBL 1EHAA 3VE0B 2HKFH 1X5YA 2W59A 5ABDE 2I60H 1R3JA 5F7FA 1T5XB 2Q3AA 3O3DB 3BSZL 1EJOL 2E5EA 1U92B 4R7NB 5E6IA 3TVMA 5I1HL 1TJHL 3AS0A 5ANMA 1A1OB 2YC1B 2PR4L 3GMNA 2ESVE 4HZAA 3BH8A 1OAQL 4PJBB 1N26A 5F89A 3CX2A 2HTKD 3OX8B 4KUZH 1EGJL 1C5BH 3PWNB 3R8BB 5D1ZA 5LCVL 3REWA 1JYWA 1JGEB 2FX8H 1L0YA 4ZQKA 4JHBA 4BFGA 1HILB 1S3KL 1UZ8B 4JZOA 1Q9LA 2APWA 2VDOL 2W91A 4PGJA 1U8PA 3P73A 3ABZA 2DLGA 5K59F 4H20H 1WZ1L 4KRPC 8FABB 1FYTB 3D0LB 3QNZB 2FD6L 5I0ZA 1JMZA 3Q3GB 5F7YC 5GGTA 2AXGA 4JFZL 5TDNB 1CBVH 4WY7H 4LCCB 3D39A 1F13A 1A7QH 1U3HA 1JTPA 2PKDA 2XZQL 3RVUD 1KCKA 4TYUA 3TV3H 4KK6D 2W9DH 4OIAA 1CIDA 3EO9L 4DFHA 2IPUK 1IGML 5EO0A 4MDJB 3MUHL 1A7NH 4I3RL 2AXFB 1Q0YL 4ODWA 3KJ4B 3WL9B 4UT9H 2DD8L 1CE1L 2ZWLT 4XX1G 4FQQB 1AJ7H 3UX9B 4I0PD 2JB6A 5ERWB 2K7QA 3MCKA 3VW3H 1QFPA 4FZEH 2VUOA 4HH9A 1N6VA 3CDGA 4BQCA 4HUVB 2FJGB 4FFVC 1F90H 3D69B 1S7RA 4Y2DC 4QYOA 5B39G 1NLDH 1JK8A 4M00A 2EE3A 3O6LH 1WLHA 3O45A 1RZKL 5DI8B 4U1SB 5BRZE 2R29L 1F58H 5SX5K 5F1IA 3O6FA 4DGVH 5F7EH 3FTGB 4QT5B 3QO1A 3CFJB 3IYLW 4GKOA 5EOTA 3QHZL 1WFNA 5CFHA 4I5BB 2J12B 1UB5A 4KKNA 5C07B 2CIIA 1T0MA 4M62L 3IDNB 1LP9E 5FM8A 1BBJA 1CICB 4N90D 4X6CB 4PJGE 4UIKL 1KLUB 2CH8A 4RGOH 3VXRA 3LCYA 1HWHB 3FMGL 1OAUL 3BXNB 3IKKA 2VABB 2H26B 1A7RH 5C0DA 3KR3L 1AO7E 3QDHA 2P5EA 2IFGA 2AQ1A 2P8PB 3MTRA 4HUXB 5TQ0L 2C7UA 3OJDB 4IRSB 2DMCA 4ZG1A 3IDXL 4L4JA 4JFEB 4JRXA 1JGLH 3N85H 5EO1A 5ISZA 5LWYL 1PAMA 1TJIH 3G04A 1AQKH 1I1AA 1CGWA 4KI5F 1PZ5A 5EIVA 4G8IA 1H15B 2ZKHH 1HH6A 5JOEA 4M5YH 5KVFH 3HB3D 2DBLH 4FQXD 1PDKA 4ENED 4Y4KB 4YH6A 3SGEH 1EJ6A 4WUUD 2FRGP 4ZO8A 3OKEA 3UPRA 2AJZA 5MEQB 2BVPA 4HS6A 4YE4H 4HKZB 2E9JA 2Y36L 5EBLB 5D1QC 4QRRB 4OQTH 3IDYB 2VC2H 4Q6IC 1I1FA 3DURA 3RJQB 2OYPA 3NCYS 4CVUA 4LDLB 3O4LD 3GZKA 5J1AA 3TIEB 5CHNA 4MJ6A 2PYEB 3MYZA 4KHTH 3FOMB 4M7KL 3DX6A 4YFDB 3S3PA 5DZNA 1YEJH 3CU7A 5D7KE 3HPJB 3C6SB 1X7QA 1J10A 4F15C 3UEZA 3LD8C 4MXVE 5E1AB 1S7TA 4O5LL 5KSBB 1NBQA 2N1KA 4M7ZC 2YSSA 4HUKB 4WDIB 3UTTA 1MY7A 4J6RH 2EH8H 4PD4K 3OR7A 5K9OA 2DLTA 5GPRA 3QRGL 1PSKH 5JPNA 1KUMA 1RFDH 3PUCA 2W60A 4HIXH 2YK1H 3RWHB 3BPLB 3SE9H 4I0CC 2H2SC 4ZUSB 4XMLH 1JFQL 2XQYG 3T1FA 4C56B 1Q72H 3BP5B 4KRMB 3SDXF 1E27B 4PJAA 4QRSA 2V9TA 3ZYJA 1DFBL 4HJGA 4CGTA 2GITB 4YDJA 2WP3O 4PYHA 1MHCA 2NLJB 3MRIA 3OAZH 3LEVH 1SYSA 5I1GL 3PDGA 3DOSA 4NO5B 1LD9A 3T0WA 1IQWH 3MLUL 4YNYB 1DEEB 2AJUH 2P5WA 4GG6A 4LSSL 4NUGH 1QNZL 4TVPE 3UYRH 2XICA 4M6MH 4FTVB 1D5XA 1MAJA 5C9JA 1KGCD 3LIZL 4OZHF 3D2UB 1JN6B 1MCDA 4KPHL 3QPQC 1I7UA 3G6DH 4OCLC 4L4TA 1DP0A 4ONOA 1OM3H 4IRJB 3FB8A 4EI5B 3IGAA 3QA3B 1NCUA 4HKBB 1Q9WA 3ARYA 5F9JB 3Q1SL 4JFFE 4KRPD 2UVFA 1MCWW 3GRWA 1NCWH 5GRZA 2FZ3A 3SDAB 1O5DT 4N0CC 2RGSA 3OB0H 2EH7H 3OG6B 3I3BA 3VXUD 5F9DC 4XMKL 3ZE2F 4N0YH 2QQQA 2UZYB 1E4KC 3ALPA 3QCTH 3SDYL 2W38A 3QZWA 5IHUH 1R5VA 1SJHB 3ILPB 1ZKAA 4O58H 4P9HH 1P84K 4JANA 4M9PA 1LEGA 1X4XA 1R5IB 4LLAA 3IDUA 3KLDA 5I1KL 4PV8B 1AGCA 1QBLH 3RI5F 3V4UH 1MFAL 4XAKD 3WFHA 1PYWB 1RJZB 4HS3A 3TF7C 1BP3B 1IGFL 5E94B 3ZE1F 4R3SB 5SWZA 3BPNC 4ELMB 4OM0H 2P8MB 4LEXH 4NPYB 1A3LH 3WKNA 2RFXA 3BPCB 4LBEA 3I6KA 4EZMA 4JFXA 3BAEL 4ZPTA 1EFXA 4G80B 4GAYA 4Y2DD 2ZCKH 4W4OC 2GJZB 2OL3B 3DROA 3CLFL 5EBMA 2EIDA 5C0BA 2ARWA 2MSPA 3C5SA 3D18A 5D2NA 3KPNB 4HFWB 4KHXH 4MXWL 1A1NA 5CEZD 5I2IA 4ISVA 3N9GH 2XY2A 3TO4A 3LZFL 5D93B 1NEZA 4R7DB 1UA6L 2RCSH 5HPMA 3DX7B 3QG6A 2DQJH 1P7QD 5GGQH 3IF1B 4EEEA 3MLYH 3ULUH 3QDGD 4BJLA 3O2DH 4CN4A 1IAKA 4WWKA 3JWNC 4WTZA 1J18A 2BNUB 4AH2B 2FLBT 2DQFB 4ZSOE 2DIJA 1TTUA 4QGYA 3ZYIA 1FLRL 3KPRA 3T0EB 2EKSB 4QNPE 5C8JB 2NY6C 1QR1B 5JW4R 4U1JA 1G7QB 3KHQA 4HC1H 4TSBL 3CPLA 2W0PA 4LP4A 2X44D 1I1YA 4O02H 5LBSH 1SM3H 4LRIA 4IMKA 2ID5A 4MNGA 5JHLL 3NH7H 4PRPA 5KSUA 1CGUA 2OL3H 3GMPB 5L7XL 1GC1C 3RIAK 2VDRL 3BOVA 2DM7A 4K3DH 4PR5B 5I8EB 4WEMB 3I50L 4M93C 1E4XL 3MXVL 1RMFH 1V3KA 1MCFA 2UZIH 5I75C 3FN0L 1DQJB 1IBGL 3VWKB 2DQEL 1SJEA 1QSEA 2FBJH 5D1QD 5JNYA 3CLEL 3PWPB 1MI5B 3D0VB 3KYNA 2GT9B 2OMNA 4Z77A 3QH3A 4NJ9H 4M61B 2X05A 4L9LA 1ZVSA 4U1IA 4BELD 1YQ2A 4YHZH 3PABB 3SE3C 2O61A 4M7LL 5DHYA 3HZKB 3GRWL 5BXFA 5JOFB 3CXHJ 5BOPA 2Q7YB 5I1JH 4OUOA 2P24B 2QLVB 4CL7A 2AV7B 2J4WL 3QHTC 4YLQT 1S7XA 1FPTH 4K8RL 3QJHB 3MACL 4D9LH 1N6QL 1W0VB 3OKKA 4DQOL 5L0QC 5HPOA 4IS6B 4JHAH 4LLYB 1EEUA 3LN4A 3WS6A 2XTLA 4KQ3L 2VXUL 1XGQA 3GHBH 4JFDB 3U9PL 1A3QA 1B2WL 1WBXA 1SQ2N 5C0AE 1AR1C 1K4DB 5DC4B 2H2SD 4NQCD 3FQTA 4Q9BA 5AUMB 5I8CB 3BSZH 1EJOH 4YPGB 3CFKB 1S9VA 4KV5E 4PB0L 5I1HH 4O51A 1TJHH 4Q58C 2PR4H 4F58L 1YNKL 2G9HA 2ZSWB 1ZE3C 3WD5L 1Z9MA 3TCXA 3HR5B 2XWTA 1OAQH 1GZQB 1MJJA 1EGJH 1CQKA 1VEOA 2R15A 2UUDK 4LF3A 5KS9F 4KDTA 5LCVH 4PGEA 4RQQA 3S97C 2CRMA 1QUNA 1S3KH 1UJ3A 3D87B 1G7LB 2VDOH 1RUAL 3CUPA 5TDOA 4NSKB 3GJFA 1WZ1H 3SJVD 3QPQD 5IEKB 1OSZB 3F58L 2E7LC 2D7PA 3NA9L 1S78C 2Y25A 5DJYB 2X4SB 4Z7UB 1Z5LA 2FD6H 3NVQA 1OTSC 1VKXB 5JHDA 4JFZH 3SQOL 1E28B 3BO8B 5I30L 5GGRY 1IKNA 1F4WL 2XZQH 3IFOA 4XC3L 1FNSL 3G6JF 4O9HH 2G2RA 3B9DA 3EO9H 1MCJA 3ZKSD 1NBYA 1IGMH 4N0CD 1JNNL 4PREA 5HTSA 25C8L 3PV6B 3EYVB 3CGTA 2FGZA 4I3RH 4Z7WE 1NFIA 1Q0YH 4L8BB 2DD8H 3STZB 1CE1H 4XNYL 4JQVA 1ZLUK 5HYEA 1P4LB 4XPGL 2YA0A 5E9DA 3V52L 3L95A 1YMMD 3LKPA 1V7ML 3BP6B 1G9NC 1J8KA 4J4PA 4P99A 1OB1A 1R3JB 1JNJA 5DMKA 5DUBA 4ZOEA 2ADJA 5E6IB 3TVMB 1RZKH 3LRGA 3GMNB 4U1MA 3QNYA 2R29H 2HRLA 3BH8B 1HOCA 1DN0A 2I9LB 1CFBA 5F89B 2BVYA 2DJUA 5F7KC 2GCYA 4CN1A 4UAOB 5D1ZB 3REWB 4RGMB 1OAZL 3FHQA 3QHZH 4YIQA 4ZQKB 3RUGE 5CUSL 4UU9A 2UWEF 2DIAA 2NXZC 4M3JA 1FFQA 4M62H 4JZOB 3HFML 1U8PB 3P73B 4OT1L 4YFEA 3U83A 2CUIA 3DRQA 4XXDA 2I9TA 3K1DA 5DS8A 2BHZA 2VE6A 3IJSA 3ZSTA 4RMVA 5CP3A 3QPXL 2AXGB 4UV4L 5JO5A 3FMGH 3D39B 1OAUH 4NKMA 4J3VA 4IRZL 5IHLB 4OFKA 4TSCL 3KR3H 5TQ0H 3IDGA 3VFGL 2BDNL 2VZSA 3IDXH 5F6HJ 3WHXA 3QJFA 5EO0B 1LO5A 5LWYH 2NY6D 2GAZB 5ID1A 1EBAA 4N68A 3L3KB 3DSFL 2B1HL 2H6PA 4X0KA 4Y19A 4ODWB 4KY1L 4G7YL 4Y5VC 4MYWB 4ZFOA 4XNXL 1O0VA 4EJ1C 2JB6B 5C09A 3V6OE 2R2HA 3MCKB 4HH9B 3KYMA 5KSAC 2Y36H 3CDGB 5KTEL 4RAVA 2VO5A 1OP9A 5JIIA 3OKMA 4KROC 5T3ZE 3D3VA 1S7RB 5HDQL 1NCAL 4QYOB 5DYOA 1U42A 3Q5YA 1DBBL 1JK8B 3VFRA 3HE7C 3WXVH 1VPOL 3O45B 4M7KH 4XBEL 5E1HB 3BWAA 3T04D 6CGTA 4HBCL 2DLEA 1IC7L 3C9NA 4GRWF 5F1IB 3O6FB 2JJWA 4UQ2A 2YRLA 3OXSA 1HN1A 3MJ6A 5D71L 2XNAA 5HYSA 3QT2A 3JWOC 3DGCR 2HLAA 2XKUA 3QO1B 4EOWL 4LGRB 2P4AB 3NPSC 3T3ME 4R90L 1FNEA 1UB5B 2VSDA 2CIIB 1T0MB 1MIEL 3VGDA 1NQBA 1S7SA 3HKFA 4Q6YA 3ZTNL 3MGTA 5CBEA 1MLCA 2OK0L 1UCTA 5HHNA 1KT2A 2IAMA 3RGVC 3VXRB 1JFQH 4HAGA 5DVMA 4X8JA 1XGPA 4KMLB 4WO4A 5C0DB 2P5EB 3DXAD 5E8PA 1DFBH 2R0ZL 2C7UB 3MZGB 1AR1D 1FFPA 4JRXB 2YD9A 5EO1B 3DYMA 3G04B 3PHQA 5I1GH 1I1AB 2J8UE 2DQTL 1PZ5B 4G8IB 5F3HA 1HH6B 3SGJC 2H45A 1UJTA 4PJCE 4KI5C 4LFHD 1TQCC 4LSSH 1QNZH 3OKEB 3UPRB 2AJZB 1A2YA 2BVPB 4JLRA 3WLBA 3QQ4A 4YHYC 1V05A 4HS6B 5F7NC 5FV2A 1YN6A 3LIZH 4KPHH 1J12A 4OGYL 2HJFA 2IBZY 2VKXA 1I1FB 3DURB 2VLMD 2RB8A 4ORGB 1YPZA 4APQA 3MV9A 3IXAB 2VR9A 3BKML 5F6IB 5J1AB 5CHNB 5FUCE 4PJ8C 4MJ6B 5D72L 4KDWA 1LHZA 4D0BA 3DX6B 3LAFA 1C7TA 2M2DA 3BKCL 1ZXQA 4G42A 3Q1SH 4WEUD 3WIIL 1S78D 4OSUL 3IT8D 4WWID 1GPOL 2R2CA 2YXFA 5HGBA 1X7QB 1OTSD 4GJTB 4X6DE 3AS2A 4XMKH 1F02I 3ARDA 1S7TB 4HGMA 3SDYH 1MHHA 1AE6L 3IJHA 2YSSB 3CD4A 3UTTB 4AK1A 2NTSP 5KSBF 2OR9L 3OR7B 5K9OB 5I1KH 1EIBA 5JPNB 2WSKA 5B3JE 4Q2ZA 5C0CD 1T22A 3MA9L 3WHE1 4FHBD 3GMLA 3PJSA 4ZFOL 5J7CC 1IGFH 3T1FB 4N90E 1ED3A 4HAFA 4PJAB 4QRSB 4XCEA 3BDYL 2UVEA 4GAJL 1BQLL 2EDDA 4HJGB 1V3MA 3BAEH 1AKJD 4YDJB 1J87A 1UFUA 1MHCB 3MRIB 1KCLA 1SYSB 3BX7C 5BS0E 1F3DJ 1OARL 5ALCL 2PNDA 3CLFH 3H8NA 2NY2B 2AEQL 1QA9A 3P0YL 1LD9B 2EZ0C 4NNYA 3UBXG 2P5WB 5BJTB 4MXWH 4GG6B 3TPUA 3QCUL 3LZFH 3PWJA 3GNML 2APXA 3PQYE 4L3CA 5D2LF 1D5XB 2RQ8A 5C9JB 1UA6H 1MCRA 4WUUE 1DL7L 1I7UB 3RWCA 4U1GB 4L4TB 5D5MB 1IJ9A 4F8TA 2PW2A 3UP1A 5HGDA 2B2XL 3MQIA 4MB4A 3IGAB 4LIQE 5I1DA 4WW2F 4HDIA 1FLRH 1Q9WB 3O4LE 3FO2A 1JHLL 3H6JA 4LSUL 4QRPA 1J0HA 4TSBH 2F54A 4UOW0 3DARA 3QZWB 2D0FA 3MJ8A 5DK0A 5JHLH 2BRRL 1M6OA 2J8OA 4FFZL 4JANB 4ZS6C 1LEGB 1A7OL 5JA8B 5L7XH 2VDRH 1ZLSL 1I85C 4CU6A 3LQAL 3ZKNC 3E3QE 5DQDL 2MQ0A 1MF2L 3I50H 1IRAY 1E4XH 3MXVH 3WFHB 1WWBX 4HS3B 5J1SC 5JW3L 5SWZB 2XTJE 4YAQA 2IJ0C 5AWNL 2V9RA 3FN0H 5SV3A 1IBGH 4QXUL 2RFXB 4LBEB 3CU1A 5EC1B 2VLJE 2DQEH 5KSAD 3I6KB 4JFXB 4QHLA 3CLEH 4KROD 4ZPTB 1EFXB 4GAYB 1MELA 2A6DA 3H9YA 5F7LB 2X1XR 3B5HA 3DROB 3QUZA 5EBMB 3HE7D 5C0BB 4JPWL 1MCSA 3C5SB 3D18B 5D2NB 4M7LH 1A1NB 1HXYA 3GRWH 5IROA 5I2IB 4ISVB 2Q3ZA 2BNQA 3TO4B 2YZ1A 2G60L 1NEZB 5FIEA 1U2CA 5HPMB 2DLFL 2J4WH 4YK4B 2NTFA 4QHUA 4K8RH 1OF2A 1BJ1H 3MACH 4Y4HC 1N6QH 4DQOH 1KGCE 4FN0A 2FO4B 4X4MA 1IAKB 4HQQL 2XWJA 4WWKB 4C57C 3RY6A 3GB7A 2DYPD 4OD3L 4HJ0C 3Q48A 4KQ3H 2VXUH 2EE2A 5IMOA 3JVGC 3U9PH 2C4FU 1B2WH 3TBWA 1A6TA 3KPRB 3EDKA 4HGKC 4P59L 5FYKU 4U1JB 4U6TA 3CPLB 3JV5A 1I1YB 3A6OA 4PB0H 4MNGB 1G7HA 4JRYD 4F58H 3EYFA 4PRPB 4U31A 1YNKH 5KSUB 3N0PB 2RJMA 5D9SA 3VXUE 3F62A 3WD5H 1P53A 4QHNA 3WDHA 4RISL 5TE6L 1BD2D 2UZXB 4M6OL 4OF8A 3ULVF 3MV7D 4YHML 2QSTA 2CRIA 4KI5D 4MA3A 4IIQA 2ZUQC 3MYJA 4X4YA 2QSQA 4XAKE 2YZ8A 1RUAH 5J11C 4WEBL 1SJEB 1QSEB 5K93A 3RZWA 3S88L 3F58H 5JNYB 3NA9H 4O00A 3MRDA 4JY5L 3A6CL 4OZFG 4XVTL 4KJYA 3KYNB 4OLZL 4MMZC 4Z77B 3QH3B 2D2OA 5SX4H 3SQOH 4NKQB 4L9LB 3HC3L 1ZVSB 2YPKA 3TA3B 4PJ8D 4U1IB 2P1YA 5I30H 4PJFF 4N1CA 1F4WH 4XC3H 2O61B 1FNSH 5DHYB 3ME0A 5HVHC 3P0VL 5BXFB 1NCCL 4QLRA 5TGBA 3MRFA 3FT3A 25C8H 1S7XB 5CEZE 2N7BA 4C59B 5CSBA 1NEZG 3P9LA 3OKKB 1RIUL 5B4MC 4ZFZA 1A4KA 5HYJE 2HTLC 1KJ2A 4TNVK 4XNYH 1AXSA 3V0VA 3LN4B 4XPGH 4RFOL 3V52H 2QSCL 1T3FA 2VDML 2QHLA 1XGQB 3MRLA 1WBXB 1V7MH 2VH5L 1T2QL 4XBGA 3O8XC 3WXWL 2VLRA 5E95B 3FQTB 1BQHG 4YGAB 2YXMA 1S9VB 2NX5D 3SHSA 2DQDL 2HN7A 2KBGA 4O51B 2BXZA 4NOBA 2XQBL 2VIRA 1S9WA 4QWWC 2FDBP 2G9HB 1AY1L 3QWRA 2BNRD 2DJ4A 2XWTB 4G8FA 3QIUC 2WBJC 1MJJB 3KPLA 1QFOA 4HPYL 5CKAA 4NHUA 1UH3A 2YHGA 2EZ0D 4GW1A 4LF3B 3TBSA 4LGPB 1MRCL 1OAZH 4PGEB 5IR1A 3FQWA 1NCDL 4RQQB 5CUSH 4OF3A 5JQ6L 1UJ3B 2HG5A 4U1HA 3CUPB 3HFMH 5TDOB 3GJFB 4OT1H 1H0DA 1I8MA 4MWFA 4G8GD 1BIHA 1SEQL 5F21B 1HH9A 1Z5LB 2E7CA 3QPXH 4UV4H 5JHDB 4BQ6A 3VXMD 4YBLB 1FVCB 4IRZH 4TSCH 4Z7UF 3IFOB 1KYOJ 1PG7X 1MCLA 2G2RB 4NKDB 4NQXA 3VFGH 2BDNH 2HWZL 1T1YA 4AENA 4NZJA 1NANI 1NBYB 4PREB 1NFIB 1BJMA 2B1HH 3DSFH 4KY1H 4G7YH 1HQRA 4XNZB 2BOCA 3JWDC 4ZS6D 2K7PA 4IDLA 4XNXH 1S9XA 2V17L 5E9DB 2AJVL 3QUXA 3L95B 5KTEH 1EH9A 2NYYC 2YPLA 5JDJA 4YHLL 3LKPB 3ZKND 1E4JA 1JTTA 5HDQH 4IOIA 2CRYA 1NCAH 4OLWL 2R1XA 1WFUA 1OB1B 1DQTA 5DMKB 1DBBH 2PYFA 5DUBB 2IBZX 2ADJB 1XGUA 1VPOH 1Z2KA 4M7LT 3WNNA 4XBEH 3HG1E 4LSPL 4U1MB 1MVUA 1QEWA 3QNYB 4HBCH 4WRLA 1IC7H 4HUMB 1ULVA 1ZLWH 3AXLA 1HOCB 1DN0B 3VA6A 5D71H 3EDEA 2GCYB 3KXFD 1WZLA 1D6VL 4TOYL 4EOWH 5J1TC 2V5SA 4YIQB 4R90H 1S5IL 4UU9B 3K80A 5IF0A 3K46A 3B8YA 2IMNA 1MIEH 3NIGE 1F4AA 3OV6A 3ZTNH 4XXDB 3DRQB 1U2HA 2I9TB 2OK0H 4P48A 4OLEA 5DS8B 2PETA 2VE6B 3IJSB 1BQSA 1KJ2L 4OLYL 4U0RB 2X9WA 3U46A 3VGHA 3ZKXB 2VJXA 5JO5B 3SJVE 4YZFF 4NKMB 4N5UA 4HJ0D 3T4YA 4PS4L 1BWMA 3JTSB 3IXTA 2R0ZH 3IDGB 2ED7A 3ZE0F 3WHXB 3QJFB 2IFFL 1LO5B 2GK2A 2P44B 2JELH 5ID1B 3IFLL 3VA2C 1AC0A 2DQTH 3IVKA 2LU3A 4MCYA 2H6PB 4X0KB 3RP1A 4UINL 3AU1B 1U8LA 1NUGA 2JF1A 4ZFOB 1D9KC 5C09B 3B9EA 2R2HB 1HZHL 4OZGF 5FYKL 3RX5A 3KYMB 3SKMA 4Z7NE 4RAVB 1DLFL 4OGYH 1FVEA 3OKMB 3TN0A 3D3VB 2NZ9D 1MH5A 5GRVL 3O6ML 1N59A 5DYOB