1CIDA

Crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
177
Chain Sequence
b'TSITAYKSEGESAEFSFPLNLGEESLQGELRWKAEKAPSSQSWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVSLQFAGSGNLTLTLDRGILYQEVNLVVMKVTQPDSNTLTCEVMGPTSPKMRLILKQENQEARVSRQEKVIQVQAPEAGVWQCLLSEGEEVKMDSKIQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL SURFACE GLYCOPROTEIN CD4
publication title Crystal structure of domains 3 and 4 of rat CD4: relation to the NH2-terminal domains.
pubmed rcsb
source organism Rattus norvegicus
molecule tags T-cell surface glycoprotein
total genus 37
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1993-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA02
3BT2L 5DRWA 1I1AA 5ANMA 4YHOL 3TNNA 1QOKA 2NXZC 4WRLA 2XNAB 1YNTB 1FSKB 4UB0H 3VWJC 1PEWA 4TUOA 5F88A 2YPLE 4ORGA 3B2UC 4RISH 5HGDB 2GT9A 4JDTL 3QNZB 5EO9A 3GSNL 4ZD3L 3T65B 3GI8L 1FJ1B 2YD8A 4XH2B 1OAXH 2NTFB 3FRPA 4XCEA 2VQUA 5L2JA 2ITCB 5KSBF 1E4KA 2BSTB 4HV8B 3CXDH 1KB5H 1LD9B 5J6HA 1EAPA 1GC1C 4PJFA 3F7QA 1NC2B 5KN5A 2NX5B 2CSPA 4AMKL 1G7IA 3OR6A 4TTDD 5H2BA 1IGJB 2FYYA 3CFDA 1OQOA 2YHGA 3PG2A 1HQRB 4MMXC 1AHWC 4NBYB 4Z77A 2HN7B 4NO5A 1VGEL 3TBTB 3RRQA 4HK3J 4M7KL 4P5KB 5CGMA 3SGKA 3RVVC 3FN0L 1YYML 1DE4B 3D39A 4UNTA 4ZDHA 1A9BA 3KPTA 4HWEH 4EXKA 4YX2H 4D9QD 4M48L 4GG6A 3QQ4A 4RZCA 1YYLH 1VPOH 4QKXB 4X6DB 4HEPG 4HIEA 4OD3H 1AKJB 4QXGH 3H8NA 1PLGL 4PV9A 1RIUL 4XGZB 3VU2A 1MWAL 2F74B 4HK3N 4ZPTB 1QSZA 4HK0B 4YGVA 4EDWH 2QHRL 3GMNB 2ICCA 1KB5B 3MV9E 1RIVL 2XRAL 4KJQD 2P5EA 5I0ZA 1YEGH 4I0CC 1N4XL 1KIPA 3AB0B 1CFSB 2YUWA 5TE7H 1WQVT 3GSXA 4M3KB 3EFDL 4GRLD 4JFOB 4AH2A 5ILTH 1B4JH 5DZNA 2EICA 1QRNA 4NUJA 5JDSA 3GM8A 3MGTA 4YQXL 2ZKHH 1TQCB 3DRTA 5BO1H 3DXAA 4RAVA 25C8H 4O2CB 1BVKA 1KJ2H 4OZGA 5KW9H 2IH3A 2O5YL 1YQVH 1G7QA 1T7WA 3LQZA 4K8RD 1NFDE 3GI9H 5GIRB 5JQ6H 3X14A 4UUJB 5IUSA 1N5YH 3TCLB 1XF5B 2Y1VA 5EU6E 4Z7WB 5EG6C 2A83B 1LP9F 4HKXA 4XBEL 3AROA 1MCWM 2ATPA 4UOW1 5B21A 4LF3B 4XPGH 4GMTL 4NRYB 4YHIA 3TVMB 3IDYB 5C0GA 1FV1A 2EDRA 5M95B 5FO9A 5E8DH 2YUVA 4XC3H 5LVEA 2ZCLL 5D2LB 4PJBB 4DVRL 3S96B 4HFWA 3P0VH 4IRJC 4QGTA 5T5NF 4NKOB 4LP4A 2QSVA 5KSBE 4L29B 1JI2A 4MDIA 1JHTB 1TCMA 5IWLA 2JKXA 1AGEB 2MQCA 4HS3A 1NLDL 4QHNB 3U0TA 5JHDA 5DF0A 1KJ2B 1EEZA 3MR9B 3OKDB 2W9LA 1I7TB 3PNWA 2ZCKL 3T4YA 4KKCC 3QDJB 1MPAH 4KGJA 3DX7A 4H1LA 5GHWL 2LV4A 2NQCA 1CLYH 4LGPB 3U30C 3R06B 4G6AD 4P2RD 4OZFA 1CLZH 5KANI 3C5SB 1J5OL 1PG7H 5FM8A 3WNKA 3QJHB 3IT8D 1RUML 1L0QA 3O9WD 3BPNC 5EOTA 1UJTA 2EDDA 1RI8A 4KDVA 1TTFA 3WO4C 4MZ2A 1BLNB 1AD0B 2PO6C 4UAOB 5CZXD 2PNDA 3QQ9C 2GAZA 1S9XA 4M1CD 5IVXA 1LK2B 1YEEH 5DUMH 4JM2D 1RD6A 2VXSL 5MHSE 4P9HH 4U6XB 5GGVY 4NN7C 1UM4L 5ICYB 2ADGA 2CKBL 4MA3A 4FQLH 4FFYL 3RUGB 1M71A 3VRJA 4WO4A 3MQIA 4DTGL 4U3HA 3KWWA 1RZFL 3UO1L 4G6KL 2R0KH 3RZWA 1QHOA 4NQSB 1PZUB 1AO7D 5I8EB 1D7FA 4JN2A 5I8CA 5DUPH 4QWWD 2VZUA 5F71A 5FOBB 1OGTB 3MJ9H 4X98A 2FIKA 2WIMA 3OJVC 4N1EA 3MC0A 3LQAH 1LP9E 3PDOB 3GBNL 5DJ2A 4DGVL 1CZ8H 1IAKB 4YE4H 3ZSSA 4J6RL 3PWLB 1INQB 4JFHE 1DBKL 3DGGA 5HVHB 1VFMA 3IDMA 4X6FB 4KZEH 3S9DB 3VFVB 3VW3H 3O8XD 2DI7A 3WNNA 1W72H 3N1PC 4PTTA 1QBAA 4KKBC 1CFVL 3WHXB 4NM4H 4UINH 1TTGA 4X0KA 4K8RL 4HXBH 5E2UL 3OAUL 4BH7A 4S1RL 4Z18A 1QRKA 2VDMH 4KTDL 5IBLC 3PWPE 1DLHB 3B5HA 3JV5A 3MUGA 5F8RC 1F6AB 4QHLB 2GJ6E 1NANH 5F1OB 1Q0YL 1A7QH 4U6VL 4H0GA 5HYEA 2W9EL 5KG9B 3RVWD 3TJEH 4C59B 2M1KA 1S8DB 3BQUA 3TO4A 2GW5A 4MA7L 4K9EC 1NUGA 4LAQH 4PJGB 5EPMB 4FNLL 1ZK9A 5IJVB 2R4RH 2VXVH 2ERJC 2DI8A 4NQDB 2IJ0C 4HWUA 3ZDYF 3ARPA 1K6QH 1OARH 3X11A 2BC4A 4RFNC 1U8IA 3CK0L 4X80L 2WQRA 4YHZH 5GJSL 5T1LA 2LU4A 1BQLH 1W72B 4LSTL 3T8XA 1MIMH 1M7DA 3K1DA 1MUJB 3WJLC 1BWWA 4XP9L 1RUAH 3FZUC 1VERA 2EKSB 4R2GB 5C9JA 4Y16B 4C83A 2DTSA 3V7AE 1FIGH 1VEOA 2FO4B 1HKLL 3S35H 4UBDD 3BUTA 3T1FA 3HZYA 4OJFH 4XVTL 3V6ZA 4K23H 2PUQT 3HC0A 1G7MB 3CX2A 4IOFC 4HPOL 3EOTH 5DGRA 1QSFB 1DDHB 1UGNA 4KK6C 4PYHA 1J8HD 5ITFB 5L0QC 3JSSA 1IAIH 1EDQA 1CICA 4JG0L 4OBSA 4KH2A 1DBAL 2ICWB 3IAPA 1HILB 3GK8H 4R4BB 1SY6A 2V2TA 4KI1A 4R7NA 3VXUE 1N64L 1IEAA 4PB0L 5DQDL 1T0NA 3SOBH 4KTEL 3F7RA 2QQNL 1ZMYA 1ZVSB 2VLKE 4KK5D 2EDWA 3S36L 1CFNB 1J05A 1NAMA 3GHEL 4TVPH 4OB5L 5H94A 1EFXB 3GMMA 5DI8A 2XXCB 2BNRB 4AG4H 3SGDI 4KRPB 4NQED 4ZFZA 5JUEH 4TSCL 4KVNH 2BHYA 4WW2C 1NJ9A 1OD7A 4FQCH 5EIIA 2K7QA 1S7TB 1FYTD 3MRNA 2VSCA 3DTXB 1MCKA 1RU9L 2R56L 3MRIB 2R1YB 4XNYL 5JW4M 3R8QA 1DFBH 4PPTA 1OGAA 5KVEL 3OKKA 5D8JL 2YBRA 4ODBD 4DGIH 1H0DB 1J1PH 1PY4A 1RURH 1FZMA 2EC9T 3OGOE 3MBXL 4MQTB 3K3QA 5D5MA 3MLRL 5LKNA 3HE6B 5EA0H 2XFXA 4LLYA 4P2QB 1K4CB 2DJSA 4NZUL 5C70A 1T20B 1VFOA 4XPFH 5GRYA 4HUVA 2WQ8A 3JV6A 4KKAC 3CDGB 4X6BA 3CC5B 4Z7VF 3ZDYE 3J7HA 1IVLA 4G8IB 5T3XE 1AXTL 4GH7B 3QUKA 2P45B 5DHVH 4NNXA 3E6HB 1T5XB 3DROB 5CJXC 5DWUH 3RNKA 4ZS6D 4MHHG 2LAGB 5DJDB 4OBRA 3QFDB 3TA3B 2CLRB 3ZKMC 1G84A 4S2SB 4ZS7L 4GAGL 4EN3A 5I1JL 1R0AL 1EJOL 2CD0A 4XAKD 1VGKA 3U2SB 3WFHB 4K94C 2AKRB 5AG9A 4NN6B 3WLBA 3LV3B 4FFWC 2X9YA 3EJYD 3KPRD 3G9AB 3TIEB 5EORH 3MV8B 4XI5D 5HYSA 4HGWA 4MVBC 4G8GA 4G5ZH 3D3VA 4H88H 5GQBA 5IJKA 2L0DA 1TLKA 1KYOJ 2EXYD 2Z35B 3VXQA 2LU7A 3RWDA 3ZTNL 5D7SL 5FYLD 4ZAKA 3ARDA 5HHOB 2YC1B 2X70A 5DHVB 2XTJD 2PYED 5DRNB 5FM4A 4WEUD 1UVQA 2FECI 4XWOD 3RVTC 4CVUA 5C0NC 5E94A 2JK5A 4OM1H 5CWSB 1E4WL 4H5SB 4I48B 2FSEB 4LCWA 4OLUH 5I1IL 1QO3B 2D31A 3VXSA 4G7YH 4G8FB 2IAMD 3MNVA 4W81A 3L7FA 1FZOB 1X3DA 2VDNH 1A0QL 2Y07H 5E9DD 4X9HA 1CVRA 2C1PA 4DEPB 5CFHA 2CIIA 5IK3B 4ZXBC 1TDQA 3SE9L 5FUZL 1A6AA 1ADQL 4PJ9A 4XNXH 3K4DA 4PJAA 2I5YH 4I4WB 4NQVA 2E27H 4NRXA 4F7MB 1S7XA 4LGSB 1KCSH 4BELD 5DURD 1CF8H 4RGND 3QI9B 1IC1A 5CSGA 1AE6H 3PWNB 5CD5D 3DETD 1JPTH 5E00B 4ZUVA 2GY7B 2WP3O 3TBVA 2A6IB 2LVCA 4NO3B 2XZAL 1FNSH 5GRXG 2VC2H 3D25A 4ZUWA 1U2HA 3TPUB 1J18A 4Z7VE 3TBWB 2R8SH 2FEDD 4MS8C 4G7VH 1AC6A 4RX4A 4HWZA 3MLTA 1DLFH 3GMLB 5GGRA 1NKRA 4XXDB 5I15L 1FNFA 4KJWC 1DANU 3MNZA 4YBQC 5CIPH 5L6YH 3TV3L 3NCYS 2UWEF 4ERSL 2VLJE 3RFZC 3SDCD 3LDBB 1I8LC 2XV6B 1QNZH 5T3ZH 4GMSL 4U3CA 1U36A 4LSQH 4LSRH 2H3NB 5GZOD 5E2WL 1T2XA 4DUWA 5L2KB 1ZHBB 4DFIA 3U7YH 4O4YH 4BQBA 5DXWA 5MEQB 5FV2A 5EBLB 3EOYG 1U6AH 2EYRB 2WBJC 3WNOA 1JPFA 2VXUL 3VFUB 4KVCH 4ALAH 2XQBL 3P77B 5I30H 1X4ZA 1IZKA 5B22A 3OG6B 3MA9L 5IR1A 5DJ0A 1YJDL 3TZVA 1F4WH 4L9LA 4HS6B 3QCUH 3ARGB 2XWTA 5CBAB 4X5XA 3WE6A 3BE1H 3AREA 4LCIL 3RVXC 3NGBC 1UKQA 2IG2L 1I1AD 5CIPB 4PJ8B 2RCSH 4G9FB 4AL8L 4NO2A 4JFDE 2OTWB 3IXAA 1ODAA 2Q7NA 3QEGL 1B6UA 4QXWA 4Z0BH 4APQA 5AUMA 3S4SA 3ZO0A 1WBZA 4HIJA 4X7TA 2H2PD 5FYLL 1YA5A 4X9IA 1JZ8A 5DR5L 1DQJA 1KLUB 2Q8AH 4WJ5B 3DURA 4OIIL 4R3SB 4Q9RL 4QTIH 2ZZUT 3C8KA 1UM6H 2FLRT 1KEML 5E4EB 1RJZB 5GGQH 3BKJL 3VWKC 3RDTA 2NXYC 2DBJA 2ED9A 1ROWA 4JAMB 3TNMB 1FORL 2I24N 1F58L 2NY2B 3I02A 1KLGB 4J8RA 2CPCA 3KYMA 1WWCA 2NY4C 1AFVL 2C3WA 3ULVD 4JDTH 3GSNH 4ZD3H 3D39D 2D7OA 3GI8H 4YHYC 1MI5B 4HUUB 1XGQB 1JI1A 4MCZB 2IANA 4YHPA 2HFFA 3VGBA 4X4ZA 3UTSA 4P57B 1VCAA 5I8OL 3HPJA 3HA0A 1MRCH 3MLYL 2MHAB 3HPLB 4CDHA 3AXLA 1HINL 3VRIA 1F3JA 2UWEE 3ARBA 5BS0E 3WFZA 3GBML 2R0LH 3LVEA 3MRMB 3LOWA 4WV1B 5FOJA 2E7BA 2W0FA 3H7BB 4I8DA 4WHTA 2J6EL 1OAZL 1U8PA 1YEJL 3FFCA 1J7VR 1A7OL 1VESA 2P5ED 1GVIA 3V9FA 1FZJB 2I26N 5C0IB 5CEYA 1I7UA 3FN0H 1YYMH 4WEMB 5FIEA 3REVA 2YMXL 2OJZL 3IF1A 5D7JA 4BQ8A 3BHBA 5GRJL 1JWUA 4EJ1C 3AVEA 3FCTB 4M48H 1REIA 1F4AA 1QRND 5A2JH 1NEZB 5C09A 4EEEA 2JJSA 5C6PB 3DXAD 4OLZH 4NZTL 3GSNB 1PLGH 1RIUH 4M8QB 3RZCA 1MWAH 5ITBH 4HKZA 1CDJA 2EE9A 5MI0B 4YDKH 5JOEA 4FFZL 2V17L 5K9OB 4KQ4L 4EUPA 5FDYA 4WI8A 2J1KA 1PKQB 5GS0D 2J12B 2XZCL 4WWKA 1ACYL 5KSUB 3CFEA 4ZUUB 2P4AB 4N0CD 2WWMD 4DOHB 4UDUB 3OTTA 2N7BA 2W38A 3EFDH 4HULB 3KYOA 3HG1A 3TIDA 1Q1JH 1BAFL 1FZKB 3SE8L 3IDGA 4YQXH 4FQHA 5ADOH 2HH0H 2W0LA 3U4EB 4I77L 5GGVL 3DJ9A 4QRPE 3SGEI 4HUWA 2O5YH 3QDMB 4MA8H 1C16B 1U58B 1RIHH 5MENB 4XCNB 1U92A 4MB5A 2DAVA 4TUJB 1SVCP 2MOVA 4XBEH 4G6ML 1YDPB 5JHDD 4GS7B 5GGRY 3BWUC 3L6FA 5E95B 4UIKL 1MWAB 4G42A 5IM7B 4Y2DC 2EIZB 4GMTH 2NNAA 3RNQB 4PJHA 1ES0A 4KDWA 4JFFA 5F44A 2HJKA 4CVXB 1NCWH 3IGAB 2IADB 3TFKC 1P7KB 1SYSB 2ZCLH 3BEVA 5F7FA 5EU3B 1ZHNA 4DVRH 2GCYA 1ONQB 5CJQL 5EFIA 4OSUL 3U79A 3FMGH 3QWOB 4WUKH 5ISZE 5EBGA 3ILQC 3WNPA 3LKOB 3NZHL 3HB3D 2HKFH 4FXKB 5C07E 2V9TA 5JHLL 3QCVL 5GJTH 1NLDH 4N5UA 5JW3H 4PRPA 4Z76B 1T0PB 4HCRA 1LE5B 1CFBA 5JMOC 1GOHA 3RTQA 1A6VL 4GKOA 2VLRE 2Z91B 3ULVL 3ES6A 4YR6A 3RIFK 2D03L 5KSAC 3Q6FA 5GHWH 2F5AH 4D8PB 1I1FB 1BD2B 1YMMB 4JY6A 2HVJA 3ZSTA 4UT7L 1I1YA 4DZBA 3GMPA 4IM8A 3G6JA 3ECBA 4EOWL 1HHGB 4WO4D 2FRGP 3CUPB 1RUMH 1S78C 4LLDB 4F58L 2MKLC 4QLRA 2QQKL 3IU3A 3O3UN 4X7CC 3CMGA 3HCVA 3W2DL 1CXIA 1UM5L 1OCWL 1WITA 4GLRI 4LMQI 5K9QI 7FABH 4RGMB 3B2VH 1L7IH 5CCKL 1KTKE 3I75B 2VXSH 2V2WA 1RZKL 2UY6A 1UM4H 3IFPA 2CKBH 5DMIL 5E6IC 4OV6F 2AP2A 1AGDB 2UZXB 4Z8FL 3IDUA 3GUTB 4PRNA 2FL5A 3CFJB 4HG4J 4XNMA 1RZFH 3SBWC 2EZ0C 1NCAL 4G6KH 4FFVD 3C60A 1I9JL 2AERT 5F9OH 5GGTA 4X4ME 5DJCA 5F70A 4PJ5A 5TDNB 3DVNA 1KGCE 5GS0L 1E4XL 2VLME 1DBML 5I19H 3WBDA 4P49A 2A9NH 3QIBA 4JCMA 2FJGA 1AQDA 4DGVH 4EBQL 1A22B 1DBKH 5CEZE 3GZKA 3BQUD 1I9IL 3TO4D 2NLJB 5CEXA 4TNWF 2X2YA 2WZPD 4O02L 1TVHB 3OKNA 4JO1L 1A4KB 4N90E 5HSFA 2GKIA 3VD4A 1GC1H 2CKBB 3OAUH 4S1RH 3UJIL 4KTDH 1CDBA 5LXGL 4KI5F 3INUH 5T1LD 5ACZB 5HI3D 4NYLB 5INCB 1CD9B 1BX2A 1Q0YH 4WI7A 4ELKA 3O4LA 2NZIA 1MVUB 5IHZB 1S9WA 3MLSL 3U82B 3H9HB 3WLWD 4XTRC 1WTLA 2ZWLT 3BW9B 3RJQB 4MA7H 4PGEB 1FG2B 4DGYH 1AGBB 4P3CH 4FNLH 5I9QB 1MY7A 3HZMB 3LKSA 3W0WA 1N59B 1LNUB 3UPAA 2JE8A 3VFSB 3UTZA 4X6EB 2OQJA 3GSWB 1CICD 1OP3H 4DWHA 4E5XA 4XT1C 3QO0B 5ID0B 1R3HB 3UTTE 4DQOL 5BV7C 5TGBB 5AAWA 5ESVB 4Q2ZB 4XP9H 2DMCA 2NY5L 4J2XA 3LIZL 2VIRB 2HRPH 3QDGB 1N7MH 1WBXB 3M1BB 1I8IB 5BRZE 3SPVA 2DQGL 2D0FA 1AHWB 5E5MB 3ROOA 4XVTH 2VRAA 5DK0B 4PRIB 4U1SB 4ONGL 5IVZA 4HPOH 3SDYL 3JUYA 4YPGB 5D70L 2EDTA 4NKMB 4HKJA 2FDBP 3PWUB 3MV7A 2BNUA 4JG0H 2ZG2A 5I8KL 1WBYB 1DBAH 3T3PF 2A77H 3L1OL 3A6OA 3PHOB 4MJ6B 1FFPA 4BA8A 3QNYB 1DQDL 5EU5B 4OLXL 4E0RB 2BFVL 5TE4H 4PB0H 5DQDH 3K4ZA 2A2QT 3RY6C 4ESKA 1OGAD 2VDOH 2WV3A 2AK1H 3HKFA 3H42L 3JV0A 4KTEH 1L4IA 1VSCA 2QQNH 1IJ9A 3ZL4H 3JTTA 4PJIB 3S36H 3GHEH 4PJ7B 3ULSB 4OB5H 2AJZA 3FT4B 4JQVC 5JMRA 3L5WA 2G2RB 3FFDA 1RUPL 1LEIA 1N5AA 3EO0B 4I5BB 4F8QA 1F11A 4A6YA 1U8OB 1XH3A 1TZHA 1S7WB 5C86A 2DLTA 5J11B 3KPNB 1JHLL 3PGDB 1RU9H 3MMEB 4H0IA 4CRPA 4W6YB 3TYGH 4XNYH 3DX6A 1A1OB 3KLSA 4WNQB 2B0SH 3O9WB 1DCLA 3WKML 4OKVB 4KI5E 3HRZA 1ETZA 1HYSD 2IPTH 2ZUXA 5D8JH 4CN6A 1DQML 3D0LA 1YY9C 4HF5L 1JWMA 2CLVB 3RL2B 4EN3D 2I27N 3QFJB 3DBXB 3MLRH 1CFTA 3NFNA 5FHBL 4DZ8A 4K7PY 4KXZH 3FT2A 3QIUC 1UACL 2Y7QA 1B0GB 3MA7A 2JB5H 1UZ6F 1QPPA 4PJDA 3RPIA 5F6IC 4JKPL 4JFYA 5J1TC 4YHNA 5HD8C 1QBLL 2KBGA 1HNGA 4LSUH 4ETYA 4JN1L 1DSFH 2H2SC 1AXTH 4Y5VA 5E08L 5EOCL 2AABH 1NGYB 1IC4L 1T1ZA 4IRJB 4G8GD 4M61B 1F2QA 3D3VD 4OQTH 4ZFGL 2IPKB 4POUB 5C3TA 2ZUWA 4PRAB 3HZKB 5SWQB 5J9PA 3MLVL 2EE6A 3EDFA 4ZAKD 3ARDD 2HMIC 4PRHB 4GAGH 1FFQA 5KZCB 4KUZL 5I1JH 4NDMA 3DX8B 4U7KA 1CWVA 3OBAA 1J1XL 3O11B 5IW6A 5FYKE 1MVFA 3EW3B 4WCYL 5J1AB 4LCWD 4Q9CA 3L95A 1A14L 4RA0C 5L8KB 1LO5A 2KZWA 3O45B 3OAZH 5KSVB 5L8LB 1JJUA 4KHTL 2PCPB 4UIMA 4KGLA 4OTXL 3VXSD 3ULUF 1ZANH 3EGSB 1KPRB 3QUYB 5JOFA 4J3WA 3GIVB 3QUZC 3T3PE 2BX5A 1SY6L 1XGRA 3QYCA 4JB9H 1CBVL 1U8HA 3ZE1E 1J10A 3BPNB 5IOPB 1UG9A 4LIQL 3LCYA 5D7SH 3I9GL 4JLRB 5JXEC 4PJ9D 3LEXB 3G9VA 2PO6B 1EUUA 4H25A 4NQXB 2DWEA 3LN4B 2E5EA 1G7LB 4WUUE 1E4WH 3BP7B 1YY8B 4P46A 3B9VA 3WN5C 4YXHL 4JZOB 4GBXA 3U0WL 3RY4A 3VFOB 3G5ZA 4X7FC 2HLAB 1I4FA 3JVGA 4WENB 4GAFB 2A38A 5I1KL 3OKLA 2V5SA 4KJPC 4PGCA 3OL2A 4MQXD 3RA7L 3P4OB 2EDXA 1XIWC 1A0QH 3CD4A 4OF5A 3L9RA 3PDGA 4U05A 3BH9A 3V2AR 1TETL 4RX4D 1JK8A 3SE9H 1V7MH 5CBEB 3MPCA 4Z0XB 1Z2KA 4L3EA 4PIRF 5HHPB 3NA9H 4Z5RA 5T5FL 3SCMC 2XWJB 4KRLB 32C2B 1BIIA 3H9SA 1SYVA 5CZVL 4K9EH 3BISA 1LEKB 2CDFA 4ZSOE 1S7VA 1KACB 1XGUA 3VH8A 5DGQA 4XRCB 1GPOH 1MLCA 3RWGA 1UZ6E 3KHOA 4MJ2A 5DA0B 4ODXA 1U42A 3D85A 2D3VA 5KOMC 1MCJA 3VCLB 3RU8L 1EIBA 1RUKL 4M6ML 1AR2A 1RULH 3WEXB 5EU4A 4X4XB 2EKJA 1N6QL 2R4SL 4OLVL 4JDZA 3VXRA 5JO5A 3PV6A 2FX7L 3NFSH 2GFBA 1P84K 4P4KA 2XN9E 2FX9L 1XR8B 1JTTA 3TZVD 4B7LA 2O61B 1K85A 2DB8A 3RWIA 4LHUG 4GMSH 1TFHA 3W9DB 5DJZA 5I17A 3G5YB 2FH8A 3MXVH 5J6GB 3ARED 4Q6IC 2MWCA 1MIEH 4O58L 2FJHB 2G75B 3RBGA 1U3HC 4M93C 4TPRL 1P5VA 4XMKL 4YNYB 2ERJB 3DHJA 3O3EA 1DQLL 3UC0H 4N8CH 5C2UB 4APQD 3A67L 4OFIA 2R1XA 2VXUH 3NCFB 2AV7A 4LNRB 1RZ8B 4NFDA 2XQBH 3VJ6B 1AQKL 3QQNA 5DRZA 2RFXB 2BSSA 5EBWB 3MA9H 3UAJC 3MRJA 4POZC 3NCJH 2ZCHH 4R0LA 3E8UL 5E4IA 1R3KA 1B3JA 1TJIL 5CJ5A 1T5WA 3FOMA 5D1ZA 4LCIH 5JOPE 3RDTD 3LKQA 4P5TA 1E6JL 2IG2H 4LEOB 4HEME 5B39A 4AL8H 5FECA 1AGCA 1H8NA 5CP3H 1G0DA 4FTVB 1PG7W 5FK9A 3BYYA 4X5LA 5L0QB 3FO1B 1ZT4B 4LKXA 4RRPG 3F7YA 3GBLA 3O3AB 4AZ8A 1R5VA 4OZHF 2QJDA 2BMKA 1JBJA 3EOBA 3L3OB 2PXYC 4HUXA 5DR5H 3T0EE 4Y1AA 2IAND 4F8TA 3RWEB 5E6YA 5JW4Q 4OIIH 3HE7C 3UTSD 4XP4L 4Q9RH 3RVWC 4KDTC 2XNAA 3MUY1 4HPYH 5DHXB 1KEMH 3VXOB 3BKJH 2Z8RA 4NGHL 3G04A 5HGDA 3ARBD 3QNZA 5EC2B 2W0PA 3T65A 5C0RH 1TQBB 1QYGL 1FJ1A 1ZT1A 1CCZA 2NTFA 5IMMB 2FHBA 2ITCA 4OFVA 1BFTA 3FFCD 2BSTA 4HV8A 1I8MA 1ZLUK 1RK0B 1FFRA 4F7PB 5F7LB 1LD9A 5E8PB 3KPRB 3O3BA 4WW2B 3IKKA 2BVPB 1NC2A 5D7JD 3CSPA 2NX5A 1MFCH 5GISL 1HI6A 1IGJA 2J8UF 3BSZH 1HQRA 3FOLB 1GH7A 2EYTB 5TPWH 4HBQA 4Y88A 5C09D 3MLYH 4K94H 3TBTA 2GK0B 4P5KA 1HINH 4D94A 3UJTL 4XHJD 3RZCD 3KYNB 1DE4A 1VADB 2PF6A 2NW3B 2ID5A 3HS0B 4KKNA 3TYFB 5C08B 1OAZH 2D9CA 1YEJH 4K3DL 1A7OH 2ICWJ 4X6DA 4U1GC 1NLBL 4WWKD 3T77A 3ZYJA 1IFHL 5HYJE 3EO1B 4NP4H 2YMXH 5BZDB 4F37K 1FVEB 5GRJH 1AKJA 3IFNL 4XGZA 4YHML 1KF9B 2Z9TA 4PS4L 3VFGL 4WTZA 3HG1D 4ZPTA 4HK0A 4IRSC 5E9DB 4ZO7A 4NZTH 3F12B 2JJTC 5CAYB 2VR4A 1D6VH 1OP5H 5IW3A 5HVGB 1FAIL 1CFSA 3VXME 2V17H 3D9AL 4OD1L 2C3GA 2IALB 4JFOA 5DD1H 2ADIB 4ZNEA 1EPFA 3HN3A 3DO7B 2A1WL 1OB1B 5DURB 4IIQC 1C5CL 2OXGA 2JJUA 2GHWB 1ACYH 3BJ91 12E8L 3GSQA 1T89C 5MERA 4O5LH 2X41A 3U4BL 2ESVE 4JFFD 4UUJA 1ZS8A 3ARFC 4HW6A 1XF5A 3SE8H 1BECA 3TCLA 4Z7WA 1H15B 2A83A 2YRPA 2C3VB 5M7QA 1FNHA 2FHCA 5DYOB 3X17A 3IJHB 4LF3A 3OAYH 5BCAA 6CGTA 3MRGB 4NRYA 5JTWA 1DL7L 3TVMA 2YN3A 1QFHA 1U8KB 4PRPD 5J12C 2CK0H 5JPNB 4PJBA 2WBWB 3S96A 3RTQD 3U7WL 4NKOA 2EDBA 2X4OB 1RFDL 4L29A 3DMMC 2MCPL 2CUMA 2DQHL 1QFOA 4RNRB 2J8UE 1KJ2A 3MR9A 3AS3A 3OKDA 3VGGA 3KLHD 4WDIB 3FRUB 1I7TA 4J4PA 4ZXBB 4U1NB 3NZHH 1IM3B 3QDJA 5JHLH 3QCVH 1ZVHA 5EIVA 3R06A 1UB6A 4QHUB 2A0LC 1E27A 3C5SA 1MAJA 4HFUL 5FA3B 5HDBE 3V8OA 5FYJH 3QJHA 2D03H 4JY5H 3VFNA 3RWCB 3TNNB 3WFBL 4UV7L 1Z9OA 2F8XC 1PY9A 1NCDH 1BLNA 4EOWH 1HXYB 1AD0A 5GZNC 1U8MB 4S1DC 4P23C 3UZVB 3CX5J 1AP2B 2GT9B 3KYKL 3MRCB 5E8OB 1GIGH 4F58H 1LK2A 2MPAL 1T7XA 1MEXL 3C60D 1SBSH 3TM6A 2QQKH 4DN3L 4MD4B 4PG9B 3IAQA 3W2DH 2P47B 5ICYA 3L3GA 4PJ5D 3WS3B 1OCWH 4TSAL 5IBTH 5BW7A 3RUGA 5CCKH 4D9LH 4R26L 2XICA 5KN5B 5L7XH 5FO8B 1G7IB 2ENYA 1EA9C 2FYYB 3CFDB 3QIBD 4F37F 3BZEB 5F7WC 2Z8VC 1ZLWH 3BKCL 1BZ9A 4NQSA 1MCNA 5I8EA 4WFHD 2WUCH 3GIZL 5HGAB 2KDGA 4GQPH 3BN9D 1OGTA 3E6FB 1J87A 2F19L 1CTNA 2H45A 2WBJB 2X4UA 4NQCE 5A2KH 1A9BB 1NCAH 5ESAB 3QUMA 4X9GA 2E7HA 1I9JH 3NMEA 3PDOA 5IIEB 1PSKH 4HG4K 1NBZA 1IAKA 5EUOB 3PWLA 1INQA 4HIEB 5GS0H 1E4XH 2R9HD 1DBMH 1F6LL 3OG4B 4X6FA 2ADJA 2YA1A 3PJSB 1X6NA 2FJFB 1IZJA 4M43L 3FONB 3VFVA 5CD5C 2VDKL 4LEXL 2DLEA 3O4LD 4YK4C 3S34H 2HJLB 4JJ5A 3WHXA 3T4AB 1RJYB 3D48R 3NGBB 4Y4FC 2FD6L 1J0KA 3VD3A 4U6HB 1X5FA 1TNNA 1BEYL 4O02H 4V1DE 1CG9A 4GXVL 1F6AA 1CLOL 4QHLA 1MCWW 3X12B 4DW2L 4ENED 3IETA 5AG8A 3W0WD 4ZYKB 2HRLA 4AH2B 1QBBA 1Q0XL 3NABL 5KG9A 2VXTL 4GRWH 4JQIL 1S8DA 5LXGH 4X8JA 2CJUL 4RAVB 1U95B 5HHNB 1BVKB 3RWFB 5EPMA 4PJGA 4OZGB 3VRLF 1S5IH 2E6JA 5IJVA 4LVHC 5L9DL 2R2CA 4NQDA 3X14B 3VWKB 4ELMF 1G9ML 3OQ3B 1OP3K 4LSSL 2XWBB 4IEFB 1DANT 4JRYB 1BGXL 1O7SA 4JKWA 1DEEB 1MHCB 4IMKC 4OZFH 2DKUA 1W72A 5E7FA 2Y06L 2ATPB 3V79C 1MUJA 2NY4B 2EKSA 2QL1A 2Z0BA 3EYUL 4Y16A 3SO3B 3ZDXF 3OKEA 3KDMB 4MXWL 1ZVYA 2FO4A 4GW4B 4YHYB 4RFEB 4DKEL 3MV7D 3BDYH 1FV1B 1U91B 1H3PH 2YSSA 3W82A 4DQOH 2ITDB 5DMKB 4PJEF 1G7MA 4NWTL 4P9ML 3KPOA 1QSFA 1DDHA 4OF3A 3VDCA 5A3ID 5T3XL 2HG5A 5ITFA 2YXMA 4GRWB 5IB5A 1QBML 2DQGH 2RGSA 4ODTL 2YOCA 4XMLH 4M9PA 4L4VE 3MBEA 2YUZA 5ESQB 5D1QC 4OGZA 4NN5B 2EDJA 1XF2B 1HILA 3SDYH 4L8CB 1C1EL 3STZB 5D70H 4HSQA 4JFEE 1CL7L 3CH8A 4R4BA 5GS3A 2FLBT 3K8KA 4U2YA 3UTQA 2JTDA 3AS0A 1G9NL 1ZLVK 3EYVB 4QOKE 1JMXA 1WT5A 1FIEA 1CU4H 1CFNA 4JHAH 3P4NB 4NNPL 1FH5L 4K3JL 1EFXA 3DSFL 1KELH 3SJVA 4JM4H 3MLPA 1IAMA 4OZIB 1KXTB 3H42H 2RHEA 3KPSE 4KV5F 2DM2A 4JR9L 2XA8H 1S7TA 1TJGL 2GAZB 1LMKA 3DTXA 4D0BA 1RUPH 1FL3B 3MRIA 2DQFB 3UBXI 1MLBA 1JZ7A 1ERNA 2HTLD 3PGFL 1SBBA 5DA4A 1JHLH 3GB7B 2OTUA 5I0DA 1H0DA 5FFLA 4MNQB 1BWMA 5F89B 3KWWB 2F54B 3WKMH 3HE6A 1HHKB 4QTHB 1CXKA 3IJSB 3NOIA 1K4CA 5F1NB 5C0AB 4LGRB 3VRLE 1T20A 1DQMH 4HF5H 2R1WA 5ID1A 2EYSB 2BNQB 1EZVX 2OM5A 3CC5A 3CDGA 4X98B 5TQ2H 2E7LA 4G8IA 1MAML 2FIKB 1OAQL 3BMVA 3IVKB 3E6HA 4LK4A 1UACH 5HGBB 1MFAL 1T5XA 3F8UB 3DROA 4RSVA 4JKPH 1DTUA 1MCRA 1QBLH 3FQNB 4JN1H 3IDMB 15C8L 5DJDA 5B4MD 3ZDXE 3KNBB 3QFDA 4U1LA 3TA3A 1OAKL 5DK2B 5EOCH 4S2SA 1IC4H 1R5IB 1LDPL 4WIQA 5CGTA 5D7LE 5J13B 3U2SA 3WFHA 3MNWB 4PJEE 5EZLB 2OZ4H 4NKDB 3MLVH 4XNQA 2X1XR 3LV3A 3GJEB 2EDYA 1EHAA 4KUZH 3TIEA 2Y5TA 1MREH 3KJ6H 3MV8A 2IH1B 1CL7I 1H3XA 1WGOA 3LS5H 2KH2B 3PP3K 4WCYH 4KAQL 2WINB 4MLIA 4P46D 5KSAB 3TO4B 2AXFA 4OTXH 1R3LB 3I2CL 2Z35A 4GBXD 3N9GL 5D7IB 2IFGA 5SWSA 4IMLB 5HHOA 5I71C 2OBGA 2YC1A 1OSPL 4J12A 2HT4D 5DRNA 1X7QB 1CR9L 1SY6H 5CWSA 4HBCH 1T7VA 1U8IB 4H5SA 4I48A 2FSEA 1MCOL 1WK0A 1QO3A 1SJEB 4LIQH 4XPHL 3I9GH 1P4IH 5T1LB 5D2NE 4L3ED 3A6BL 4KY1L 3H9SD 5C9JB 1O5DT 5DC4B 3T09A 2P5WB 4KV5E 1RUQH 4GJTB 2CGRL 3SQOL 1VKXA 4J1UB 4YDLC 3V4PL 5IK3A 5E6IB 4H0HB 3QIWC 4AEFA 3HC0B 3LHPL 1I7RB 4HZLB 3RA7H 43C9B 4I4WA 4ZTOL 2X4RB 4XXCA 5DEFB 3WUWG 1CICB 3D85D 3QI9A 5EO0B 4PB9H 4L4TE 4D9RE 1QSEA 3TJHC 5T5FH 4LDOB 4I0PC 1FNLA 1K4DB 5E00A 5CZVH 1NFKA 3VXRD 2WLYA 4Y19B 3QG6B 2V2TB 4DK3A 4JREC 3OKYA 3V7MA 4P4KD 1BQUA 3QEQA 1MNUL 3ETBF 3TPUA 2FGZA 1T0NB 1HH6B 2J8OA 5J56B 4OZHA 4C57C 3MODL 2P43B 4L3AA 1J05B 3V0VA 5H94B 4YHKL 3MTRA 3S6CA 5DI8B 1J1OL 1YC7A 5BV7H 5C0BB 3HHRB 2H26B 4ZFZB 2CR3A 3RI5K 1CD1B 1E6OL 2VO5A 2CRYA 5EIIB 1HDMB 2LVEA 3MRNB 1N6QH 4HJGB 3MREB 4OLVH 3HNVL 2H3NA 1KT2B 1S7RA 1XGPB 2FX7H 1TENA 4Y0GA 2DBLL 3RX7A 5L2KA 1ZHBA 2AK4B 2FX9H 2HT2C 5E24E 1MJJB 1F8TH 1GZQB 5MEQA 4ZUTB 2YBRB 2XOTA 2EYRA 3LZFL 4J3XA 5D1ZD 3VFUA 4O58H 3UYRL 4P5TD 5D5MB 1LO4L 3P77A 2L7UA 4XMKH 3KXFB 2APBA 2IQ9L 4LLYB 1UQSB 3JV6B 3KLAB 3ARGA 2CXKA 3O6KL 1X5ZA 4LRIA 4BH8B 4X9BA 4NJ9H 5BV7B 1AQKH 4Y1AD 2X9XA 5CIPA 2EH8H 4PJ8A 4GG8B 4NJAH 3JBG7 2OTWA 4QRRE 2AEQL 1P6AB 2NYYD 3ZYOA 1BF8A 3VD5A 4EN3B 3TT3L 2HAZA 5EZIL 2OTPA 5FO7B 2YUXA 3EYSH 1KLUA 2CDGA 2WIIB 4WJ5A 5J06A 5EU7E 4R3SA 1MF2L 3CFKB 1OPGL 2OK0L 4JPIA 4MJIE 5HI3C 2DOCA 1RJZA 1BJ1J 5J4MA 4IJ3C 5DD3L 1NC2D 2NX5D 4CJ1A 2HA1A 4HGWB 4EI6A 5GXBB 4JAMA 4P59L 2F53E 5ALCL 2UY7A 1WCBB 4J3OC 3IDIB 4OCRL 4XB7A 4K7PX 3RWDB 3K7UA 4OI9A 5ELIA 4LCCC 3ZKND 4NGHH 1PZ5B 4TQEL 4XNZC 4Y8DC 1MY5A 3AAZB 1UVQB 4HUUA 2JK5B 4JDVA 3HI1B 2BXYA 2D31B 4P57A 3C5JB 5J7CC 1JV5B 3SE4A 3VFTB 4N0FA 4UV4L 3KPLB 4F80A 2AJXL 1A1NA 3MXWL 1YEHL 2MHAA 3B6SB 1AKJD 5FDWB 5SWZE 5GISH 5IT2L 3L7FB 1RZJC 3MRMA 3H7BA 2FNBA 2J3SA 3BPOB 3DYMA 1HSBB 3OJDB 1TJHL 1SEBB 1XGTA 1FZJA 5C0IA 3UJTH 2FWOB 4PJ9B 2P1YA 5BOPA 4HJ0D 4NQVB 4ZOEA 1BPVA 3FCTA 3FQTA 5ADPH 1FC1A 1ITCA 4K3DH 4OUOA 1RHFA 4N9OB 3R8BB 3QIUB 4RMQA 5JIPA 1NEZA 1IFHH 3THML 4YO0B 5F6IB 5LGHH 1OWRM 3RI5F 3GSNA 4CJ0A 3IFNH 4M8QA 1IM9A 5KVFL 4PS4H 4JO2H 4BFEA 4KI5C 2XG5A 1NFDB 3D25B 1UB5A 4ZUWB 5B38B 2C4FT 2VDLH 2VUYA 1T4KB 5EU6B 1PKQA 4LPUA 5HYIA 5D93C 5KSUA 2HFGH 4ZUUA 1SJXA 2VUOA 3K80A 3D0VB 4H8WL 5J3HC 4UDUA 4OD1H 2OCFD 3RHWK 3TVMD 1FZKA 1C5CH 5E1AB 1YEFH 4G80A 3L3JB 3U4EA 3MGOB 1WISA 12E8H 1FBIH 1UENA 2BVYA 4NUGL 1F6FB 3U4BH 3QDMA 1C16A 1U58A 1WWAX 2XKNB 5KSBB 5MENA 4XCNA 3LN9A 1RQ5A 1L9NA 2VN7A 4TUJA 5LGJB 2L7JA 5IKCB 3EYFB 4Z7WE 2LFGA 1YDPA 3NVQA 1IT9H 5I66B 1MWAA 4J4PD 5IM7A 1U93B 1FG9C 5D9SB 2EIZA 4ZO6A 4KK9C 3QDJD 3RNQA 5E8EA 3R0NA 7CGTA 3WIFA 5GSRB 3AY4C 5IR1B 2GY5A 3K74B 5F7MC 2IADA 1P7KA 3BRGC 2VISB 5EU3A 3WN5B 2X7LB 3WE6B 1ONQA 5D2LE 1A7NL 4LHQB 1TTUA 1DVFC 2ARWA 1RFDH 4KPHL 3LKOA 3TH2T 1UZ8B 2MCPH 4FXKA 2DQHH 3IXAB 4FQJL 4Q58C 4APQB 2DLFL 2BVQB 3BWAB 5AUMB 4PJXF 3S4SB 4PBVC 2IBGA 1LE5A 5I74C 4X7TB 2DL9A 2Z91A 3GMOB 1JFQL 5HDOA 3SCMB 3TBYB 1BQSA 4RRPA 1BOGB 4OCXH 2YD5A 3PABB 1I1FA 5K59F 4UB0L 5EUKB 3V6BR 4OF0A 2ATKB 2FZ3B 1HHGA 3OB8A 4RISL 4MD5A 5F8QC 4LLDA 3FAWA 1KENH 2WNGA 5HHXL 3WFBH 4UV7H 3I02B 5DMYA 1OAXL 1C5BH 4MAUL 1XCQB 1JN6B 3LH2L 2ED7A 4LLUB 3GSOB 4NZJA 3CXDL 3BIKB 4OF8A 3DV6B 3SGJA 2Q76B 3MRFB 3KYKH 2MPAH 4ELMA 2B4CL 4LNVA 1KG0B 5JLZB 4MB3A 5AD0B 1TVBB 4Y5XA 1FRGH 1FNEB 4TSAH 1EMTH 2AXJA 1AGDA 4EIZC 3GUTA 3AXLB 2X10A 1V8HA 2D9QB 4JHWH 3I6LD 4Q6IB 3BKCH 4YFLI 3SKNB 1JYWA 3UDWC 1VPOL 3QZWG 1U8QB 5TDNA 2CUHA 5F1IB 5JIHA 1W8NA 3JUZA 2ENSA 4PLKD 4QY8B 2GJ6B 1JWUB 3LS4L 2EXWD 2JCCF 2WAHA 1KCUH 3I84A 4OLYL 5FB8A 2AW2A 1K3ZA 3RHWF 5E0QA 3VGEA 2R29H 3B9KC 4JO3L 2VDKH 5FV1L 3C6SB 1TVHA 4HKZB 4TULH 4WW1B 4NNYB 4NQDD 3OWEA 5TE7L 3DECA 2CKBA 5ILTL 2FD6H 1FVDA 1NBVH 5H35B 1BEYH 4I2XE 1P53A 4WWKB 2ZKHL 3CFEB 3WNLA 3WFEL 1OTTD 2OR7A 5ACZA 4DW2H 5INCA 1MVUA 1E28B 2RBLA 1YQVL 4Y16D 5IHZA 1Q0XH 2PXYB 5JQ6L 4PJXE 3H9HA 3LKNB 3BW9A 3HE7B 1JPSH 2XZQL 4PGEA 1FG2A 1AGBA 1MHEB 5L9DH 1H9VA 4UQ3B 3HZMA 4ONOA 3DV4B 4Y5YC 5K59E 1N59A 1QSFD 1LNUA 1G9MH 3VFSA 4LSSH 3Q0HA 4X6EA 3GSWA 4JPWL 1BGXH 3IDJA 3MBED 2AV1B 2BY3A 5E8DL 3EHBC 3QO0A 4F7EB 5ID0A 1R3HA 4XC3L 3T0DA 2Y06H 5TGBA 5ESVA 4G42B 2CDEB 4Q2ZA 3T0EC 3EYUH 1XAUA 2VIRA 4MXWH 1CGWA 3QDGA 4DKEH 3BVNB 4PBWD 1I8IA 1X5IA 1YNLH 1T80A 4Q6YA 5FKPB 2QKIB 3BEVB 1AHWA 5E5MA 2ZP0T 4FQIL 1ZHNB 2PTUA 2GCYB 5DK0A 2MTPA 1X4YA 4PRIA 3FB5A 2BY2A 3CNKA 2VLKB 3IS0X 2GI7A 5C0JA 5LGKA 4P9MH 2UZIH 1EFXD 1MHHA 2X44D 3SJVD 5T3XH 3W9EB 4NKMA 1QBMH 2D4FA 4ODTH 2XPGA 3ULUD 4KRPD 3PWUA 4PRPB 1WBYA 3LY6A 3FT3A 5IHBA 4NFBA 4DCQB 2CRZA 6FABL 1WTGT 4U1GB 1YN7B 3PHOA 4MJ6A 3QNYA 1F3DJ 2EIDA 5HI4D 5EU5A 4E0RA 3FQXB 5JIIA 3N1GC 3QUML 4E41E 1JYXA 3LRSA 1IKNA 2CR6A 1SJVA 3V0WH 3BP4B 1K5NA 1X9QA 2JCCE 4XVUD 4PJIA 4PJ7A 3ZE2F 1KXVC 1TMCB 2MCG1 4NNPH 1UH2A 1JF6A 5HBBA 3FT4A 3VXPB 4HAGA 5KANG 3G5VB 1FNAA 2DN7A 2G2RA 3HE6D 3QPQD 3QXDB 4MNGA 3EO0A 4I5BA 1F5WA 4P9HL 3OGCA 1TZIB 1UKSA 2F8OA 4M6AA 2BNRE 2W92A 4ZPVA 1HXMA 5DMGC 4JR9H 3JV4B 4FQLL 4HIIA 2V2XB 2HT3D 3PGDA 4CW1A 3UMTA 1K9TA 4BFIA 1A1OA 2AJUL 4OKVA 5ECJE 1WFTA 2VKWA 1GRWA 4C56B 1F13A 2R0KL 2BVOB 5HHVH 3ARFB 3SDAC 5KVDH 2ZSWB 1NBYB 2FR4B 3L5XH 4MNHB 1PEZA 5DUPL 1DN2A 1FL6A 3TA3D 1A64A 5I6XC 1H3UA 1R24B 3EIFA 3RL2A 3LSOB 3QFJA 3DBXA 4FQQB 2FX8L 2AXGB 3LQAL 4OGAC 5KAQG 1B0GA 4P2QE 1CZ8L 3K1KC 5I76B 1JTPA 4HH8A 3GSRA 1T83A 1MAMH 5J12B 4MQSB 2W65B 4M8VA 4TVPE 4FQPA 3MV8D 1W72L 3QIBB 3U36B 1YPZA 4IRJA 1MFAH 3A0OA 3L3DB 1AQDB 2DIAA 4UINL 3RVUD 2IPKA 1A6TB 4PRAA 3DMMB 15C8H 5DC0A 5SWQA 5K9JL 1CD8A 2VDML 2Y36H 5SWSD 1Q9WB 2YEZB 1NL0H 4HLZG 5HHOD 4PRHA 4PV8A 3U9PH 1J0ZA 1LDPH 3DX8A 3OKNB 3O11A 4I9WE 5ALBL 1A7QL 5J1AA 5C7XH 3V4UL 3O45A 5KSVA 3QO1A 5F3BB 2PCPA 2R0WL 2DQCH 1D5ZA 1BX2B 3EGSA 4ELKB 4FRWA 4RMUA 1YN6B 3QUYA 2AQ2A 3NACH 4KAQH 1A6PA 4HX1B 1F42A 3GIVA 1K6QL 1OARL 5DD6B 4Z78B 3QAZB 4G3YL 1NUDA 4F9LC 3I2CH 2IBZY 3HNTH 3N9GH 5IOPA 5J1SC 3NN8B 4JLRA 4YHZL 4P99A 1BQLL 3LEXA 2YD4A 2PO6A 5AYUL 1QUNA 3DVFA 4MAYC 1RUAL 3S5LG 1EGJH 3FO2B 3LN4A 1G7LA 5DDHB 4OQTA 5F7DB 5BOZG 1KC5L 3VG0L 1MCOH 3T04D 3SE3C 3ZE2E 1AGFB 4XPHH 3QI9D 2D7TL 3PIQB 3ULUL 1LEGB 4PP1C 1Z6JT 2AGJL 1QSED 3EYOA 3A6BH 4TNVK 3VFOA 3NPSC 2VKXA 4KUCF 1NMAH 5CSZB 1UEYA 4AEHH 2OXHA 3EOTL 3JWOC 3P4OA 3SQOH 1CDHA 3EJZD 3QEQD 3WXVL 1M7XA 4PGDB 3WIIH 4Z7VB 2APWA 1XCTB 3ROOB 4TOYH 3DYPA 4N5ED 4N8VG 1T0MB 2VITB 5CBEA 4Z0XA 2EDOA 2PYFB 4RGOL 1T21B 5HHPA 1F4XL 4ZFOB 2XWJA 2ZG1A 32C2A 3S8WA 4GSDH 1N0LA 2UV3A 1LEKA 3F7VA 3ISWA 2O5XL 4LVOB 3LB6D 2DJ4A 2IPUG 2VLJB 4EI5C 4YH6A 1CDYA 1TXKA 3H0TA 1U8LB 3KS0H 4XRCA 4ONHA 3QRFM 1R6VA 2MKWA 3P4MB 1XF3A 2ZUVA 4XBGB 5CJ8A 4OIAA 2D7NA 4JRXA 5L2KD 1MNUH 4YK4B 2Z93A 2GITB 4HMDA 3BO8B 2Q8BL 5JUEL 3SKOB 4Y4FB 3VCLA 3MODH 1QVOB 2HTKD 2QEJA 3IRPX 2M8XA 3UTPE 1OHQA 3W11C 3WEXA 4YHKH 2AQ3A 4X4XA 4Z7UF 1NANI 1DUZB 1Y6MR 5GGSB 1KCLA 1LEIB 4NM8L 4QYOB 4QGYA 1NFIA 3BGMB 4LL9A 4M7ZC 2VLLB 5E99H 2O61A 1WF5A 4QRTA 3ARGD 4PGZA 3W9DA 1X44A 3G5YA 3HNVH 2X89A 5DC9B 4DGIL 3CVHH 1J1PL 5D72L 4JVWA 2ICWI 2PW1B 4U0RC 2FJHA 2G75A 1J11A 4PJ8D 5E5UB 5EA0L 1IRAY 4YNYA 2H41A 1FYHB 4JJHA 4XPFL 1EVUA 1QD0A 2VDRH 3OXSB 3IU4L 5FGCB 4R8WH 4OI7A 1KB9K 4LNRA 1LO4H 1RZ8A 3NFNB 2Q87A 1FFNB 4DZ8B 3VJ6A 2RFXA 3WJLA 5EBWA 2Y7QB 1I1CA 1KIQA 4KTYA 3IFOA 5DWUL 4GXUM 3QEUB 1PX4A 5DQ9B 4WHYG 3CAFA 1OT2A 1P7HL 4JVPA 3O6KH 1T66D 1AR1D 2O93L 4YZFF 3PQYE 4LEOA 4IS6A 3N06B 3RY5A 4G9FE 1NPUA 3PWJB 5GS1C 1IAII 4FTVA 1CYGA 4PRBB 1ZT4A 4XVJL 5T3ZE 3O3AA 3CVHB 4WI9A 5J8OA 3TT3H 3GJFK 4NDMB 5D1QB 5EORL 2IGFH 3IKCB 1RSFA 5IQ7L 1DN0A 4F7CA 1D3CA 1WV7T 1LO5B 4DKFH 2B1AH 4XCCL 1H3TA 3W5MA 4BZ2L 2OK0H 2E9WA 3C6LC 1A3RL 4JFPA 3VXOA 5DD3H 3HFMH 2IPUK 5EC2A 2UWEB 5ALCH 5DJYB 5JOFB 3GEWB 3MYJB 3NCYP 4OM1L 5IMMA 4OCRH 4BSWB 4M5YH 4I3SL 3M17B 1HOCB 1RK0A 4F7PA 5E8PA 4WW2A 2FH6A 4RWHA 1JVKA 3DGCR 5CP3A 3ARVA 5CJOH 1MI5E 3DWTA 3FOLA 3UPCA 4N0UA 4OCNC 2VDNL 2Y07L 4UV4H 4Z7UE 5CD3B 3CSBA 2R2HB 2I07B 1BBJB 2YN5A 3I6GA 1J0IA 3KYNA 4ZUSA 1VADA 4B0MM 3NFPB 4PGCB 5IT2H 2NW3A 2C7UB 2HP4A 1PG7X 2I5YL 5KVMC 3UROR 5KAQF 2X1OA 5IW1B 5C08A 1KCSL 1CF8L 4WEBL 4GAJL 1RK1B 4L3EB 1AE6L 3EO1A 3GFUA 4G43A 1Q94B 2OMBA 5BZDA 1Y0LB 1FVEA 3H9SB 5IFHL 5TQ0L 2NY3C 1JCKA 1FNSL 4R4ND 2VC2L 1EV2E 3C5ZC 3THMH 4TRPL 1LK3H 5CJXA 3F12A 3RWHB 1DLFL 5KVFH 4QRPB 4O51B 5IFJB 3QDMD 5IVNA 1KEGL 1JGUL 4M5ZL 4DJMA 5MEND 3EYQC 2IALA 4ODXB 1QLEH 4XBPB 5L6YL 5ETUB 3DO7A 4JANA 5F9AC 4XVSL 2ZUUA 4F3FB 1QNZL 4KKLC 4H8WH 3VXRB 2ZPKH 4LSRL 3L3IB 3PV6B 2GFBB 3PGCA 1KFAL 1T6WA 2QSQA 4LQFH 1H15A 2J88L 3P30H 2VR9A 2C3VA 1QR1A 5I17B 2LQRA 2IF7A 1B2WL 3IJHA 5IHUH 1LE9B 3HMWH 4MSWB 1OAYL 5ISZB 3MLWL 3MRGA 4BFBD 3JXAA 5C07B 2H6PB 4HD9A 4FP8L 1U8KA 3K4AA 3HLAB 3ZT7A 3ARWA 2YD3A 5JPNA 2A6DB 5DS8B 5DRZB 2VLRB 1FL5B 2X4OA 3V95A 3MJ8B 3K81A 4HH9B 3T2PA 5GS2H 4R0LB 2QADC 4AEIH 2FGWL 4QT5B 4YDLB 4HZAA 3D5OF 5KVGL 1A7NH 5T1KB 4LFHD 1JPGB 3WNMA 4WDIA 3FRUA 3QIWB 4ZXBA 3GKZA 3R0MA 4U1NA 5JW5B 2D7QA 1AGCB 4PD4K 1IM3A 2Q8AL 4FQJH 5FK9B 4BSVB 2DLFH 4B7IA 5D2NC 5D7KD 3UTOA 5CEZH 4QHUA 3PF2A 1JFQH 2OP4H 1AJ7L 4ZMAT 3K0WA 4IDJH 4I0PB 5I1EH 2NY6C 3RWCA 4JKKA 4NHCL 4JZNA 4P46C 4JREB 1WICA 3S35X 3AFLA 4RQQB 3ZKSD 1IGTB 1BD2E 1YMME 5IBUG 1HXYA 4G8EB 1U8MA 3VFMB 4OQ1A 3G04B 1AP2A 3MRCA 5E8OA 5I2IB 1VENA 2WW8A 5HHXH 1ZT1B 1YECL 4PY7A 4MAUH 4MD4A 4PG9A 3LH2H 4WHCA 3WS3A 1I8MB 4J7RA 5EOCJ 5KS9F 3O3BB 1MRCL 1I8LA 1K8DB 5FO8A 2B4CH 2NR6D 2W9DH 1HI6B 2DIJA 2VOTA 3BGFB 4NBXB 1EHLL 3BZEA 4OM0L 2R0LL 3H3BC 4KK8D 5I1DB 3N85L 2YA2A 1F3RB 5HGAA 3V6FB 4KFZC 3E6FA 3WDJA 2WBJA 3O6LL 5GSVB 4R90L 1N2RB 5ESAA 4FXGA 2E6QA 1DUYA 1O0VA 3VE0B 4NZRH 2C1OA 5IIEA 3QHZH 1P2CB 4U33A 1E0OB 5EUOA 1HCVA 3T77B 4X4YA 3NIFF 3PJSA 4OLZL 2FJFA 1Z5LB 2WBKA 3FONA 3QUXC 1X6LA 5FGBC 3MJ6A 3LS4H 4K3HA 5ITBL 4YDKL 2HJLA 2CLZB 3T4AA 5I1GH 1C12B 1RJYA 4OLYH 1J12A 2BXZA 1OOAA 1CQKA 4U6HA 4JO3H 4KROC 3BESR 1I3UA 1TZGL 1MFDL 1YEDB 3X12A 1UJ3C 3B2UD 4ZYKA 4F15B 3P40A 4UTBH 4D9QE 1Q1JL 3STLB 1UWGH 1WAAF 1RZJH 1JTOA 1JGLL 2JIXB 2HH0L 1BQHG 3WFEH 1QFWL 5ADOL 5HHNA 1U95A 3RWFA 3UTTB 4LPWA 2IC2A 3GSQB 3QH3A 4JPVL 5MERB 4PJCF 4MA8L 3SEPA 1HHIB 1RIHL 3QDGD 3VWKA 5FM5O 1ZS8B 4P2OC 2XWBA 2ZUSA 3CDFA 1Q8MA 2DJUA 4KMTL 2E7CA 2XZQH 4JRYA 3OSKA 1CLCA 1DEEA 4JM2F 4PRID 1MHCA 2VZOA 4U1MB 1A21A 4LPYA 3ZTJG 3SDXF 3A6CL 4LCCB 1IGYB 3RVVD 1OLLA 4XNZB 1R5WA 3P9LB 1WCQA 3KDMA 4GW4A 5EU7C 4JPWH 4RFEA 1U91A 1NCWL 1KPUB 3O41A 3BPCB 2ITDA 5DMKA 1W0VB 4YC2B 2NY1C 1UA6L 3BKML 4JO4H 1MELA 4X6CF 3FMGL 4WUKL 3V6OE 3D69B 2GSGB 5KS9E 2HKFL 2ORBH 2EO9A 3K2UL 3MYZA 4QHMB 3ARUA 3OKMB 4FQIH 5GJTL 2B2XL 5ESQA 4K7FB 5JW3L 1E4JA 4NIKB 5MEOB 4LKCB 4U7SA 3O6FB 1XF2A 4LCYA 4L8CA 2CH8A 3STZA 4CU8A 2BOBB 2Y6SC 1X5XA 2B5IB 5JORB 3TO2A 2F5AL 3OHXB 4X7DC 1UB6B 2WMPA 3EYVA 6FABH 2Y9RT 1E27B 1SM3L 4M62L 2Z8SA 3P4NA 1PD6A 3QUMH 3VFNB 3KYAA 1GSMA 3MACL 4OZIA 2GYSA 3NIFE 5DQJB 4E42B 4XPTL 1ZHKA 4N68A 7FABL 4FG6C 3B2VL 5D93B 3QFJD 4PP2B 1L7IL 3U1SH 1FL3A 5L8JB 4V2CB 2DQFA 4PYGA 3L3GB 2BY1A 2SEBA 2V5YA 4XHQA 2Y5EA 3MO1B 3WXWH 3GB7A 4P2RE 3CCHB 3EFFB 1XMWA 4MNQA 3HUJF 5F89A 2AJUH 5K9QG 1EHXA 4IRJD 2F54A 1WAAE 1HHKA 2UVEA 1M6OB 4QTHA 3IJSA 5F9OL 1BZ9B 5F1NA 5C0AA 2QR0B 2HVKB 1N6VA 5K9KB 2EYSA 4PJCE 2BNQA 1AD9B 2P48B 5DFVC 2NY0C 4XC1L 4XP6H 4PRHD 2X4UB 5I19L 3OV6A 5KZCD 2FX8H 3QUMB 3IVKA 2A9NL 5GRVK 5HGBA 1JUFB 3QZWA 3OKOB 4Y2DA 1NBZB 4KKCD 4NPYB 3SDXE 3FQNA 4HQQH 1AXIB 2ADJB 5E2TL 4OD2B 2COQA 3KNBA 1C8PA 3JTSB 3WJJC 5DK2A 3NPZB 3QUYD 1MCSA 5IMOB 4TVSa 1R5IA 3C9NB 2HWZH 4JJ5B 3U48A 1M7IB 1DVFB 5JPMB 1GC1L 4YLQT 5I75C 5IROC 1OF2B 3MNWA 5EZLA 5K9JH 4HXAH 4NKDA 3GJEA 4X6CE 1AO7E 3RKPA 3KPMB 4UDTB 1CG9B 3INUL 4UQ2A 1JRHH 1MFNA 1IARB 3IETB 2PO6D 1RY7B 5ALBH 3QQ9D 2IH1A 2WINA 3V4UH 1P7QB 4NRZB 5KSAA 1R3LA 4X8JB 2R0WH 3CZFB 5D7IA 4IMLA 3IAGC 4DGYL 2P24B 4P3CL 1FPTH 4WI5A 3WD5L 2LTQB 1X7QA 4G6FB 3B3IB 4G3YH 4OLWL 4AT6A 1SJEA 3OXRB 4YGAB 4NFCA 3PHQB 4J3VA 2OLDA 1H5BC 3VXNB 3ZE0F 4F9PC 2Y25A 5AYUH 3WMSA 5BZWB 4LU5H 3VGAC 4M7LL 5T1DL 2P5WA 3OKEB 1KC5H 2HRPL 3VG0H 1N7ML 2OZ4A 4ZSOB 1AIFB 1R3JB 5ICXB 3RAJH 3D18A 2D7TH 3ULUH 4J1UA 2YSSB 2AGJH 1ZA6B 1PKOA 2BCKB 5E6IA 2DQEH 4O2EA 1I7RA 4GQ9L 4HZLA 3LEYL 4KQ3H 3KPOB 4HC1H 5HTSA 43C9A 4JRXD 2HG5B 5IB5B 4KKBD 2X4RA 3WXVH 3SBWA 5DEFA 4O9HH 3TCXA 5CKGA 1QQDB 3MBEB 5EO0A 3HUJE 4C4KT 4RGOH 1F4XH 2A77L 3MLXH 5IBLD 1K4DA 4XP1H 5ENWA 5FKAB 3RQ3A 4Y19A 3IS1X 3QG6A 2O5XH 4FXLA 4M1DH 1NAKL 4OZ4A 3BD5A 5TE4L 3UTQB 3O6ML 3REWB 3S37L 2VDOL 1HH6A 2AK1L 4L4JA 4RMSA 3ZL4L 1FCCA 2VJXA 4KHXL 2X89D 3B9KB 2ZSVB 2P8MA 3SJVB 1BM3H 1MCIA 5DZOA 4AEEA 2VYRE 3QR2A 5C0BA 3W81A 1LDSA 2X1PA 1J8HE 2H26A 5HI5C 2Q8BH 1IEHA 4B50A 3CJJA 1CD1A 2VE6B 4UU9A 4WU7B 4ODUA 1HDMA 1NUNB 1AI1L 4PRDB 4D0BB 4HJGA 3MREA 3V5HB 1KT2A 3TYGL 1XGPA 4DVBA 3BUYB 2B0SL 4NM8H 3B9AA 1ND0B 4AQOA 3FZUD 2AK4A 1MLBB 3WFCH 4M6OL 3WUZA 3M8OH 2IPTL 3EOAB 1MJJA 1GZQA 4ZUTA 2J5LC 2OTUB 4Y4KC 2BJML 3ROLB 2X9WA 5D72H 1QFWM 2AJYH 4X99B 4W4NA 1T1YA 2WSKA 5MEPB 4IOFD 4R7DB 3KXFA 4Y5YB 4KK6D 4FTVD 2JB5L 4WFFD 1UQSA 4WGWB 1BBDH 4NQEE 4L8SB 2R1WB 3IU4H 1BF2A 4HKBB 5ID1B 3S88L 1A1MB 4LSUL 3KLAA 4AENB 1QG3A 1KSRA 1Z9MA 4H1LG 4BH8A 1DSFL 1FYTE 2JELH 2AABL 3B4NA 4U7MA 4TYUA 3ZE0E 4GG8A 5IB1A 4OQTL 4U1LB 1IQWH 4TTGA 5AZEL 2YPLA 2VDPL 3VI4F 2CKNA 1EH9A 5FO7A 2WIIA 2W60B 4XNQB 1QLFB 1ZTXL 3CFKA 4NQUA 4XVJH 1IMHC 2BK8A 1ZANL 2Y5TB 3E2HC 4XMPL 2ZUQB 1MH5A 5IQ7H 4R2GC 3LMJL 2OR8A 4S0TD 1MCFA 1T6VN 1WCBA 2G60L 5F9WC 5JIKA 4XCCH 4JB9L 3BMWA 3IDIA 3MFGB 2AXFB 3SKMB 1V7NH 4BZ2H 5I1AB 3RY6A 4K07A 1A3RH 1X5YA 2CIKB 5SWSB 4BFGA 4OI8A 1D9KC 1PZ5A 4KZDL 2P49B 1ZHLA 4MQ7B 1TIUA 1S9VB 1DBBL 5JXAL 5IB4B 3AAZA 2FHFA 1A47A 5IEKB 1D5XA 1PQZB 3LRGA 5C08D 5E70A 4JQVA 4XAKE 1QA9A 4I18C 2I25N 4I3SH 5A40E 3HI1A 3C5JA 1JV5A 3VFTA 3KPLA 1CIUA 2RJMA 1EXUB 3S5LA 1XGYH 3B6SA 4KKAD 5HYJB 5FDWA 3KPRE 4D0DA 4UILH 5AWNH 1OTUC 4CDGC 1VKXB 2AEWA 1HSBA 3OJDA 1KJ3H 3WHE0 1SEBA 3MV9A 1V7ML 3TP4A 2FWOA 1AH1A 3NA9L 1A5FL 3GJFA 5FYLE 4BQCA 4M02A 5FF6B 4HT1L 2E8ZA 5I6XB 3ZKMD 2XTJE 2PYEE 2WWKT 1A6UL 4K9EL 1UADC 3LQMA 3VXMB 4KXZI 2YK1H 3MLZL 4WEBH 3QIUA 4GAJH 1CDCA 4YO0A 1QSEB 2Z4QA 3U46B 4UZGA 3GMRB 5IFHH 4FFWD 1GPOL 4W70A 5TQ0H 1RZ7L 5D71L 1Z9SA 3TEUA 2ESVB 1NFDA 3QEQB 5B38A 4FMFA 5A16B 3CVIH 1T4KA 4FQ2L 3MFFB 4MVBD 4TRPH 5EU6A 5DVKA 5EWIL 2AJ3B 4OZHB 5E9DE 5E2VH 3HNSH 4FZEH 5JZ7C 1RULL 3D0VA 3V0VB 1KEGH 1JGUH 1OT1A 4M5ZH 4GAYA 1T3FB 2HLFC 1NDMA 3NFSL 1A7RL 4PJFF 3RVTD 5C0ND 1A4JB 2XZZA 4J3UA 4XVSH 3O2WH 5E1AA 3JWOH 3VI4E 3L3JA 4RGNE 3MGOA 5HDLA 3BAEL 2D2OA 3CMOL 3MXVL 1WZ1L 2BDNH 1S7RB 5DO2C 1UT9A 1MIEL 1KFAH 2DF3A 2XKNA 4LVNC 5KSBA 5CINH 2J88H 5A2IH 3ULVF 4X7SH 4RFOL 5D1XC 5IKCA 2KZ1B 4HIXH 2ICEB 3EYFA 3QUZA 3UC0L 2LU3A 2YD7A 1S3KL 4N8CL 1G0YR 3LKRB 5I66A 1FNGB 3L3KB 4GG6F 1BJMA 2J8UB 1B2WH 1CE6B 5FCSH 3SQBA 5JXEA 3M45A 3GHBL 1OAYH 1U93A 2KKQA 2BERA 4ZXBD 3MLWH 5D9SA 2WLZA 3ZYZA 4MAYB 2PR4L 1JZ6A 1NCTA 3UBXB 5GSRA 4FP8H 3UEZA 2EE3A 2ILLA 3NCJL 2DQTH 2ZCHL 4KRNA 5BVJB 4OF7A 2VISA 1CQYA 3WN5A 2X7LA 3GGWB 2OI9C 3NPSB 5DHYB 2X4PB 5BVPL 2M26A 1UZ8A 1H8OA 2V5TA 4N1HB 3SDDC 2FGWH 1XIWA 4LMQE 3BWAA 2BVQA 1OW0C 5KVGH 1CGYA 1G6RH 3PL6C 1KCVH 1W0YT 1SJHA 4LCUA 3X3GH 3GMOA 3SCMA 3TBYA 2CDGB 2VQ1B 5IB3B 4KJWD 1BOGA 2A6JB 3PABA 4OZGF 4YBQD 2HKHH 2NY7L 2CMRL 2QLVB 4HPYL 5EUKA 5E7BA 4JPIB 2ATKA 4JQXC 2FZ3A 2YA0A 3ESVF 5LBSH 3W39B 2I9TB 1AJ7H 4Y7MA 4EI6B 1FHGA 5C0RL 4NHCH 1GOGA 3EZJB 3BKYH 5D6DC 5ANME 3WYRA 1YEKL 4GO6B 1XCQA 1JN6A 1BZQK 4XZUA 1JNNH 4ZFFB 4LLUA 3GSOA 3BIKA 3DV6A 2Q76A 3MRFA 1U9KA 5FYJD 1WEJL 2NZ9C 2WBJD 2Y4SA 4DKDC 3FJTA 3G6DH 3UJJH 4NQCB 2EDKA 1MFCL 3BP5A 1KG0A 5JLZA 1YECH 4X7EC 1VFUA 4JDVB 3BSZL 1LP9A 5AD0A 1NH6A 2W59A 5TPWL 1TVBA 1FNEA 1G6RB 3FHAA 4N0FB 2FEEL 4YDIH 1A1NB 1ZLUH 4M7ZB 4BZYA 4K94L 2UYLB 3OF6A 1K2DB 1KTLB 5TH2B 4PJFE 1EHLH 4LP5A 4OM0H 1MJUH 3CFBB 3N85H 4Q6IA 3RVXD 4U0RB 1U3HA 2V9QA 3SKNA 2X4SB 1U8QA 1XGTB 5F1IA 1WJ3A 4OV5B 2RB8A 3PWPA 4QY8A 4NP4L 3CSYB 4V1DB 1J88A 2H9GA 3O6LH 3S36X 4R90H 2GJ6A 5FHAL 2BSRB 4P4RB 3TN0C 3ULVE 3D39E 3FQTB 4GKSB 4RDQF 4WTXA 2DM3A 4GG6E 1IC7L 2YZ8A 5HYSG 3FL7A 4MZ3A 3ARYA 3WCYA 3EZ8A 1PDKA 1B4RA 3C6SA 1D6VL 1IM9B 2XYCA 3D2UB 4WW1A 3O2DA 4EIGB 4NNYA 2P44B 2DLGA 3VWKD 3EDEA 1UB5B 4CNIA 5DD1L 4C55A 3EDJA 3HMXA 2G9HB 4AM0A 5IVXF 3AMLA 4JRYD 3VG9C 5H35A 5GS1B 1TZGH 2P5EE 1MFDH 3H3KA 4C54A 2NY4D 4O5LL 1E28A 2VL5B 1ORSB 4NO0B 2PXYA 1S7QA 1PJ9A 5FEBA 3LKNA 1QRNE 4TNWK 1JGLH 3QPXH 4G80B 1QFWH 3HE7A 1INDH 3QWQB 3ARGC 4KDTA 4M1GL 3DXAE 4JPVH 3MX0A 2Z31B 3VFPB 1MHEA 5F3HB 4UQ3A 3DV4A 4OZGE 5IVOA 2O5ZH 4PJ8C 4YHLL 3HI5H 4LHUB 4KMTH 5E8NB 1P6FA 1XF1A 2E6PA 3IFLH 2AV1A 4L4VB 4PUBL 3WS6C 4C4KO 2KQMA 4F7EA 2CK0L 5DJ8B 2CDEA 3A6CH 2EEAA 3KR3H 1QFUL 3DUUB 4JFEB 5E8EB 1D5BB 3BVNA 1JGEB 3WIFB 1J8KA 3VXUA 1P9MC 3QRGL 3FO9B 4RMVA 5FKPA 2QKIA 1ZSDA 5H37G 3BKMH 1UA6H 4BZ1H 4OFDA 2VLKA 5IFAL 1JPST 2VZVA 1ZT7A 3BD3A 1Z0NA 3W9EA 4P5MB 3K2UH 2NY2C 3DOSA 4UTAH 4GRWE 4XPBL 3P9WB 2B2XH 3KPSB 4PG2C 4DCQA 5JHDE 4L5FH 3AUVA 3CH1B 1YN7A 4WFGD 5IGXL 5FYJL 5HHMB 3Q5OA 3FQXA 4JY5L 4WFED 3CU1A 4WGVB 4QEGA 3S98A 4RBPK 1K8IB 3BP4A 1T2QL 3P4LA 4IRSA 1NCDL 1SM3H 3C5ZB 4YUEL 1JP5A 4M62H 5DJAB 5AEAA 3O2VH 4MNQD 2JJTA 2Q1EA 5B8CC 4MD5B 3VXPA 2EIBA 1GIGL 2F54D 3G5VA 4N8PA 3MACH 1V3MA 3QXDA 3ILPB 4MMZC 1SBSL 4WV1C 1TZIA 5C0AD 1NCCH 4XPTH 2ZG3A 2DKMA 2BNQD 3JV4A 4IIQA 5IBTL 2V2XA 3K8LA 4D9LL 4ELMB 5L7XL 3U0PB 5IVXE 4OIBA 1T89A 2BOCA 4Y2DD 1LVEA 4NBZB 4C56A 4Y5XB 2BVOA 4PLJC 3ARFA 1PAMA 2ZSWA 1NBYA 2FR4A 2WUCL 4MNHA 3TFKD 1R24A 3DHMA 2OSLB 4NHUB 1NMBL 3MCKB 3KPQB 3LSOA 1WIPA 4FQQA 4MNQE 5MI0C 2AXGA 5DVMA 3ILQD 5D7LB 1BMGA 2AXHA 2BRQA 1PSKL 4PJEB 2F5BL 4P3WA 3TGXA 2C4XA 5HJ3B 4XC1H 5I76A 2V7NB 2W65A 3U36A 3S34L 3F58H 3L3DA 1G7PB 1QPXA 5KSAD 5FB8B 5CILL 4U1JB 1A6TA 4ZO9A 1L6XA 3DMMA 4FQXC 5E2TH 2KL6A 5L88L 2QADB 1Q9WA 2YEZA 4QO1A 3X3FH 1VFBB 4S1SL 1VA9A 5LQBH 4Y4HC 2P8PB 2V5MA 4RWYL 1S78D 1FVDB 4JZJB 4GRMA 5F3BA 2B7DT 4GS7C 3GSVA 5D2NB 3P9MB 1OTSC 5CKAA 4PLOB 5IEHA 1YN6A 4UOJA 1S5IL 4O00A 1F4YL 2P5WD 1IGFL 5HY9B 4HX1A 5DD6A 4N9GB 3H3PH 4Z78A 3BEWA 3UZQA 5CGYC 4IRZL 2NXZB 3RGVC 5JA9A 3NN8A 5E6ID 3VWJB 4D2NA 1MQKH 3WD5H 4P23A 4ISVB 3NIDF 1ZV5A 3FO2A 5DDHA 5F7DA 4OLWH 1JNJA 2JB6B 3NTCH 2EZ0D 3RKDC 1CN4A 5DFWH 1Q9OB 4Q9QH 3IDJB 1AGFA 3BDYL 3PIQA 1LEGA 1H3PL 4L4TB 4QCIB 3FB7B 1MQ8A 4M7LH 5CSZA 5T1DH 4S1QH 4Y19D 3T0VA 4S0SD 1FLTX 2XQYG 4C58B 4PGDA 4Z7VA 3TWCH 1TCRB 4XMLL 1XCTA 1B88A 3FB5B 1T0MA 2VITA 4GT7A 2PYFA 5I18L 4GQ9H 4EUPG 1T21A 5C0JB 2C4FU 2DS4A 3LEYH 4L9DA 1MAKA 4ZFOA 3D87B 5HVWA 3QCTH 5IB2B 1MHHB 2AVGA 4EKXA 4XCFH 5C0BD 3WV0A 5SX4I 4HIHA 1G1YA 2XPGB 1Q72L 2JJVA 1CT8A 2VLJA 2Z92B 3FT3B 4R96B 1E4XI 1U8LA 4UNUA 3ZE1F 3UPRB 3EAKA 4LASH 1CU4L 3P4MA 1EGJA 4JHAL 4PBXA 4XBGA 5FGRA 1KN2L 1NC4B 1NAKH 3FAXA 1KELL 4EQ3A 3LRSB 4JM4L 2AK4D 3O6MH 2GITA 3S37H 1K5NB 3BO8A 4XNUH 1FQ9C 2I9LA 1ZLVH 4XTRD 4Y4FA 3SKOA 1QVOA 3DRQB 4KHXH 5F7HA 5ACLA 2XA8L 4KROB 5F6HJ 3Q1SL 1DUZA 1MRDH 4DN4L 5GGSA 4IOIB 3KXFD 4MNGB 3S97C 1VACB 3OGCB 4QYOA 3ET9F 5C0BE 3DIFA 2YPKA 3BGMA 4ZPVB 2VLLA 1HXMB 1P4BH 1SEQH 4HIIB 1I9EA 1AI1H 4GUPB 3RIAK 4MXVF 4CW1B 3I50H 4BFIB 1YNKL 3L5JA 2PW1A 1MFBL 4TTDC 2FBJH 5CJBA 4NCC2 3CGTA 5EBMB 4BSJA 2N7AA 4M6OH 3RL1B 3HZVB 4JFDA 1G6VK 1OGAE 4PJAF 4P2OB 2BJMH 3UBXG 3OXSA 1FL6B 5TQ2L 4NSKA 2YPLD 1OD9A 4IMKA 2QBWA 1FFNA 4PGJA 5KTEL 5D5ME 5F1KC 1NUFA 1JHKL 4YBLC 3S88H 3QEUA 5DQ9A 2BZDA 4YXKH 3GSRB 2HFTA 3NIDE 2XACC 3WFDL 4MJIB 3PE9A 2YWYA 3AM8C 1YPZB 5F7YC 4EVNB 1EEQA 2F53B 3PWJA 2OZ4L 3MRLB 4Q0XH 3QA3B 4PRBA 4KJQC 5I16B 3MROB 5AZEH 3CVHA 4PV8B 2VDPH 3QG7L 5CS7A 5I9QC 2XQYK 5D1QA 2BVEA 1MREL 3KJ6L 3IKCA 4GRLC 4MJ5B 3LS5L 4UOW0 4IDLA 1I9RL 1ZTXH 4XPAL 2YS4A 3QO1B 1EEYA 5AAMA 1JF1A 5EC1B 4WHDA 3U30B 5MP6L 1D5ZB 4XMPH 4YXLH 3V6OC 3P11L 5SWZB 3LMJH 4K8RC 2FB4H 1F90L 2UWEA 5DJYA 5BS0A 2G60H 3PP3H 3MYJA 4G8GE 4HBCL 4JFZH 4BSWA 3D3VE 2W1NA 4YDVA 5SV4A 3M17A 1JNHB 1HOCA 4XB8A 3MV9D 1P4IL 4KZDH 3WO4B 5EO1B 1YY9D 1DBBH 4RMTA 5JXAH 3KJ4C 1KYOK 3LN5B 3FO0H 4FOMA 1RUQL 2DICA 4LCWE 3QIUD 1KNOB 4NN7B 3EYOB 5CD3A 2R2HA 3VXSE 5HD8D 1D5MB 3KG5A 2I07A 1BBJA 4TN9A 2ZNXA 3TH4T 1A9EA 2H2SD 3NFPA 2C7UA 3U7AA 1IKNC 5IW1A 5DJ6B 1TITA 3PDDA 4LARL 4MXVE 5EU6D 4IOSD 1I3VA 3S3PA 3KVQA 4PB9L 4UT6L 1CDIA 1RK1A 1TVDA 3FQUA 1A5FH 4YWGH 1Q94A 4NC0B 4HT1H 1J0JA 1Y0LA 4QRQA 5DEGB 2NY0B 2HMID 1A6UH 3FTGB 4PJAE 1T7YA 3F7VB 4CVZA 1ZXQA 1YEIL 3MLZH 4O2FB 3HR5B 4G6AC 1IC5H 3H0TB 5J11C 3WL9B 2DRUA 4ONHB 3RWHA 4MD0B 1XF3B 4QRPA 4O51A 1ZWIA 5IFJA 1RZ7H 2V6HA 5D71H 4GOSA 3RIAF 5BV7L 4JRXB 3O9WC 2WP3T 2ZOLA 2Z93B 2V7HB 4FQ2H 2EEDA 4XAWL 2MSPA 4XBPA 5DRXB 1MCQA 5EWIH 5ETUA 1EJ6A 5FA4B 3QUZD 5I75B 2PETA 3OX8B 3ZDZF 4F3FA 5CZXC 5IF0A 3MRQB 5JXED 4M1CC 1XT5A 1OP9A 1XZ0B 3L3IA 3PHSA 5DVLA 4M03A 5C0CB 1A7RH 4JM2C 4GXUN 3E1F1 1NFIB 3K2MC 2DQDL 1F8TL 3PV7A 4BUGA 4QRTB 3BAEH 1WUNT 1T83C 2VXQL 1N3NB 2YD2A 3CMOH 4JFQB 1WZ1H 3EUUA 5DLML 3MRDB 1LE9A 4MSWA 5ISZA 3EO9L 5I73C 3ZHKA 2YKLH 4KJPD 4B5EA 3MCG1 4RFOH 3BZFB 5C07A 3P0GB 2H6PA 1S3KH 1XIWD 4RFNB 1BHGA 3RJDA 3HLAA 3AU1B 4QWWC 1IE5A 3GHBH 5GGSY 1H5BB 3BDBA 4NJ9L 2A6DA 5DS8A 3SCMD 2VLRA 1FL5A 1GGYA 5FXCH 2PR4H 3MJ8A 2EH8L 5MHSD 1KIQB 4OT1H 3VGAB 3IFOB 4HH9A 2KQNA 2MQ0A 4NJAL 3WSQH 4U1IB 3ARSA 3FKUS 4QT5A 1M05B 3O8XC 2EDEA 5T1KA 1JPGA 5HDQL 2VWEE 3QUYC 5BVPH 3QIWA 1UC6A 5HHQB 4IS6B 5JW5A 3R1GH 3EYSL 1IBGH 1JGDB 1FLRL 2H8PB 4BSVA 1ZOXA 1T22B 3CLEH 4OCWL 4I0PA 1DN0B 4F7CB 5I1HL 1NSNL 2NY7H 2CMRH 4RQQA 1IGTA 1CFQA 4JFHD 2EE2A 1X5GA 2CO7B 4JFPB 4G8EA 3OF6D 1FDLL 3VFMA 4ZOAA 5I2IA 1FC2D 1LILA 4NKIH 4BJLA 3BP6B 1YEKH 1U3HD 1M4KA 4X4MA 1IGCL 4PJHF 3PWPD 1WEJH 2KUTA 1MCHA 1K8DA 2GJ6D 4F7TB 3ZDZE 4WI3A 4N0UB 1X4XA 2IANE 4U1HB 5I1DA 2P7TB 1UKTA 4UBDC 3UTSE 3UAJD 1FN4A 2FBOJ 4POZD 3V6FA 3I6GB 2J5LB 5LCVL 4ZUSB 4FA8A 5C2BL 4Y4KB 2NCMA 4IHOA 5GSVA 5IV2A 5D6CB 4D3CH 1N2RA 1T03L 3VE0A 2VERN 1NDGB 2E9IA 5HDBF 5ADPL 3IJYB 3MJ7A 1P2CA 4M6NH 3FFCE 4I2XB 1X5AA 3MRPA 5INDB 5LGHL 3H7LA 4G43B 1Z5LA 5FHAH 3WUWB 4JO2L 3G6JF 4L3CA 1DBJH 2PXYD 2CLZA 1C08B 3C2AL 1C12A 4PJXB 2VDLL 1IC7H 3HE7D 4U1KB 1OM3L 5C09E 2OS7A 4KK5C 3BRFA 3NZ8B 2HFGL 3QQ3B 3TBSA 4P3DB 1YEDA 2CK2A 1UFUA 3N50A 5A2LH 2G5BB 1X5JA 1ITBB 2OL3L 4JANB 1VFAB 3STLA 1GGBH 3T0WA 1YEFL 3B5GA 2ADFL 2JIXA 1NMCC 4F2MA 1N26A 3UTTA 3LEVL 1FBIL 1KN4H 4PGBB 3E2HB 3PGCB 5A43C 1HHIA 3P73B 1BOYA 2A74B 5CMAB 3VXUD 3HG1E 5BRZA 3WO3B 5F9WB 1QR1B 4M1GH 1IT9L 4U1MA 2VLKD 4HWBH 3MOQA 1IGYA 1D9KB 4LCCA 1LO0L 5F93C 4YHLH 3P9LA 4N0YL 3ZZ1A 1QACA 3TESA 1KPUA 4PUBH 1WSST 3BPCA 4I18B 3DVGA 1W0VA 4W4OC 1L6ZA 1PBYA 1QFUH 2DQUL 1EUTA 1Q9LA 3D69A 3VH8G 5GGUA 4AJ0A 4QF1B 2GSGA 4PJHE 4E41B 4JFFE 3QRGH 4CADB 4ZS6C 4QHMA 1WZLA 3OKMA 3MZTA 4IRSD 3ME0A 3MRHA 4LSVH 4K7FA 2JCCB 5MEOA 5IFAH 4LKCA 3O6FA 1IAOB 2BOBA 1TQBC 4JPKL 5JORA 2FECL 1YJDC 4XPBH 3OHXA 3S3SA 4OCXL 1GL4B 3F65A 2A73B 4PRPE 3EJYC 4G6JL 5IGXH 5IP4A 4XX1E 1JGVH 5T3XD 4XI5C 1T1XB 3BX7C 3FN9A 1KENL 1X5HA 5DQJA 4JZNB 4YDJB 2PW2B 3IRZA 4C56D 1C5BL 1T2QH 5AYQA 2R23B 3ARFD 4E42A 4OCSL 4YUEH 2EXYC 2A9MH 3ZKQD 1A6ZA 3G6JE 1UCTA 2XTJC 4HAFA 5IMKB 2DWDA 4PP2A 4XWOC 1X5LA 3U83A 4PY7B 3O2DL 3CIQA 3E0GA 5LAXB 2IQAB 1FRGL 2QSCH 3HMXL 3MO1A 1EMTL 2Q6WB 4BM7A 3HAEG 4WY7H 3CCHA 3EFFA 1J9CT 4LAJH 5DJXA 1IILE 2IAMC 3QDHA 1IEBB 4JHWL 3MUJA 1M6OA 4LVNB 5TDPB 3QP3A 4RIRB 2QR0A 2HVKA 3DMMD 4C56E 5K9KA 5B39G 1JNLL 5D1XB 1AD9A 1NMBH 4ETQB 5EZJB 4FXGB 1DUYB 3GMQA 5SX4H 1GGUA 5HPMA 2R2EB