1CIDA

Crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
177
Chain Sequence
TSITAYKSEGESAEFSFPLNLGEESLQGELRWKAEKAPSSQSWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVSLQFAGSGNLTLTLDRGILYQEVNLVVMKVTQPDSNTLTCEVMGPTSPKMRLILKQENQEARVSRQEKVIQVQAPEAGVWQCLLSEGEEVKMDSKIQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags T-cell surface glycoprotein
molecule keywords T CELL SURFACE GLYCOPROTEIN CD4
publication title Crystal structure of domains 3 and 4 of rat CD4: relation to the NH2-terminal domains.
pubmed rcsb
source organism Rattus norvegicus
total genus 37
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1993-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA02
2X40A 1XFPA 1HH6B 3I3EA 3L9RB 2HRPH 1QBLL 1BD2D 5DJ8A 3HG1E 3HCVB 5FM4A 5C0RL 3AU1B 1S7QB 4WUUD 3NACH 1RQ5A 4NJAL 3MUGA 5T33H 3DRTA 4PJAE 4BFIB 5JXAL 3G08A 5E5MB 1KIRB 4X6CB 4L29B 5TJWK 5E9DD 1I8MA 4U6XA 4LLUA 3TNNA 5D7KD 4LHUA 1MLCB 2AEPL 3EYVA 5SX5K 5I66B 5E4EC 2X1OA 4L3ED 1C7SA 3IDMB 3AS0A 4ZFOA 4F58L 4R7DB 3FB7A 4JFPB 3ULUC 1MIEL 1FVDA 5HI4C 3TA3B 3IB4A 3UP1A 3O6KH 2QSTA 3OV6A 1MHPH 3S5LG 1UJ3B 4OZHE 1X3DA 4XCFL 3VFNB 3DVNA 2DJUA 2W91A 3LB6D 5I8CA 1QFUL 1K3ZA 2ARJQ 4QXWA 3HZVA 4G9FD 5BS0A 3FKUS 3GJFH 4TNWF 4JE4B 4GBXA 3RZWA 3NTCH 2DD8L 2EO1A 3MFGB 5LGHH 3RKDC 4ODWB 4A6YB 1AC6A 3IDGB 5IW1A 5SWQA 5D6CB 4P9MH 1PG7X 1MQ8A 1KLFA 3D87B 2VZOA 1DBKL 3GSNL 3T1FB 4ESKA 2AJYH 1BJ8A 1MFCL 4HKBB 4U1SB 5IVXA 3TEUA 4MX7B 3HNTH 2VWEE 5GGVH 3K7UA 3SDXE 3BVNA 1JGVH 1PKQB 3G5XA 3Q6FA 3TJHD 4H8WH 2B4CH 3IS1X 3NAAL 2PYFB 3EO0A 2NY5C 5DK3A 5H2BA 2CXGA 1FO0B 5E5UB 2EKJA 3OXSA 4HS8L 2H1PL 4ZSOB 4XAKE 4HIIB 3HZYA 4ENEC 4OZFH 4D9QE 4X6EB 3U7AA 3NCJH 1R0AL 1D5ZA 4ZOAA 4JAMB 1H8SA 2HG5A 4YFEA 3FN0L 1IQDA 2BVEA 1IL1A 5I18L 3FJTA 2GQHA 2R29H 1H3VA 5CJQH 3SDAB 5DT1H 4PJIB 3W0WB 3EDKA 2F9BT 4NSKA 4AJ0A 2R2HA 5B8CA 3QEQD 4HIXL 3MR9A 4Z7UA 5I1JH 1J0IA 1NCCH 1KT2A 3VDAA 1H3TA 3ARPA 5KSAD 4JFOA 3KPNA 2XZAH 3S35X 3WS3A 1HXYA 5DJ6B 4NKOB 1S7UB 3D2UB 4RDQG 4GW5B 2P8LB 4HCRL 3GSUB 4TTDC 2VKWA 5BW7C 4HK0B 3FRUA 2E9BA 4YDVB 4FZ8L 2LABA 2EE6A 4NNYB 5E24E 4Y4FA 3MUHL 3CH1B 4WW2B 5DXWA 3VRLF 1GVIA 1MH5B 1BM3L 1TJHH 4NJ9L 5C0JB 2BSRA 2SEBA 1XCTB 1Y6KR 2AAVA 3T3ME 2RQ8A 3QIWD 3F7QA 5MP6H 4OZ4B 3GSXA 1KCLA 3JUZA 1MVUB 2CLVB 2GCYB 2IFFL 5J4MA 5D8JL 2HFGL 4M7KH 3AU1A 1S7QA 3RIAF 5HHVL 4NC1C 5F1SA 3JV5A 5DS8B 1FVEB 2KQMA 3ZKQD 3DETC 4LPVA 4BFIA 4P59H 5CD5D 4PUBH 3ZL4L 1GGCL 1TETH 1UACL 1KIRA 1R3JB 3NFPA 2QHRH 5DMIL 5C09D 3VD7A 3X11B 1EBPA 1VERA 3BZFA 4N0YL 1UADC 4ZTOH 5JHDD 4L4VD 4N0RA 1BEYL 3X3FL 1FAIH 5I66A 2O5YL 2VB5A 2FJGB 4MDJB 4LIQL 5CIPH 3MYJB 1RUKH 4NO3B 2OTUA 4YE4H 4JJ5B 3KYMB 1FG2A 1JPTH 4OCWL 1B0GB 4WGWB 2EDRA 1OD7A 5F7UA 4RWHA 4TUJB 1IAIH 3GIZL 1DEEB 3MCKA 2P4AB 1A21A 2V5TA 4X7SH 4OJFH 2R0WH 2F74B 3QAZB 1FC2D 5DURB 2AEIT 3O3BB 4U1LA 3QWRA 4RQQB 2NXYC 3OR6A 1S78D 3QNXA 3UPRA 2WWKO 1WAAF 1AGFA 1J12A 4X7CC 3MRMB 4X6DE 4QNPE 3RWJB 1NUFA 1OGAB 1I85A 1MCHA 5C0CE 4BQCA 1KB5H 1Y6NR 4ODWA 4A6YA 1MAJA 1G9MH 3VG0L 1ZA6B 3IDYB 5DD3H 4XPHH 1NC2D 3T1FA 4Z76B 5GS1A 1RK1B 3KLSA 4XTRC 1UH3A 1NDGB 2IFGA 4PRHB 3TBYA 4MX7A 2H45A 1AFVL 1SEQL 1K8IB 2BNUA 5AUMB 4ONHB 2ZZUT 1PKQA 5D2NC 1XF4B 3ESUF 2OI9B 5IJVB 2Z31C 1HEZB 2NY7H 3PGCB 4JFDD 1XGUA 1YDPA 2N4IA 4WY7L 5A3IC 3MV9B 4ZUSA 1CDIA 1TZGL 2X9YA 2FHBA 1JPSL 43C9A 3IJYA 4PRPB 1M05A 2Y23A 2NX5E 3GSQB 1PX3A 1CE6B 4FFYH 3G04B 4AMKL 4ODVH 4AQOA 3AB0C 1BD2A 2CKBA 5HI5C 3C5ZC 4RWYH 1Q9LB 1JHLL 4Z7QE 3IVKB 3FRPG 2V6HA 4UOW1 3EIFA 4KAQH 4X7FC 4QHUA 5IM7B 3OAUH 1D6EA 3WEXB 1PSKL 3BP5A 5FYKU 1BF2A 3BGAA 5E9DA 2O5XH 2VISA 2H2PD 3BUTA 1FL6B 4NKOA 4R97C 2OMNA 4L3EA 3BP4B 1N7MH 5D2LF 2HKHH 1UM5L 2C3HA 3GSUA 4PYHA 4BM7A 5ID1A 2FECL 1T80A 2RIKA 2YRLA 2YD5A 2GSIB 4YDVA 5FHAH 4XNYL 1CFSB 1DN2A 3ULVH 2XWBA 1EZVX 2Y25A 2V5YA 3K1KC 4O5LH 1MH5A 1RU9L 4QRTB 1OPGL 4O51A 2ZCLL 4G9FA 5C0BB 3FO0H 3G9VA 4JM2B 4OCNC 4FFZL 2FO4B 4LQ1A 4IMLB 1MWAA 3UC0H 5FA3B 3LS5H 1UH2A 4PJHF 1T1WA 4MXWL 3FOLA 3S8WA 1ZLUH 1YEHH 3O81A 1ZHLA 4PG9A 3VRJB 2BRRL 2J6EH 3UAJD 4Q9BA 3LQZA 1CXFA 1Z0MA 1N3NB 1R3JA 5GJSH 5INDB 1JTOA 1N0LA 4ORZC 4S1QL 2HAZA 5E08L 2R4SL 4WI6A 3QB7C 3VD5A 4M7ZC 2FYYA 4NN6C 1OOAA 3IAQA 5L8KB 1ND0B 5IEHB 1ZT1B 3VCLB 5I1HH 3P9WB 4MDJA 1EFXB 1U0QA 2PN5A 3E0GA 4NO3A 4JJ5A 4XRCA 2IC2A 4KJPD 4YGAB 5I1EL 3GMPB 1DEEA 1CR9H 1TNMA 4P23D 2UZXB 5BS0E 5KN5B 3S88H 5C2BL 5F9OH 3WYRA 1SHMA 1CLZL 4LDOB 4S10A 3O3BA 3UTTB 4RQQA 3LEVH 2VXSH 1VCAA 4XC1H 5DRNA 4NKIL 3DXAB 1U6AL 4HT1H 3LAFA 1OGAA 2X1PA 2X89A 5EC2B 5C0IB 2DQCH 5KSAA 3QDJA 5T3ZH 3H6JA 2LU7A 2IBZX 4WFGD 5MHSD 2XZQL 4HGWB 4UIMB 3ARTA 3NA9L 4Y1AD 1E4XI 2R9HD 1ROWA 1EMTL 2EH8L 2CGRL 1HHIB 4EI6B 1RK1A 1B90A 3O2DH 1NDGA 5FYJH 3T3PE 1K8IA 4ONHA 3T0WA 2D7MA 5EORH 1XF4A 4WTZG 3J8F7 1T2QL 5IJVA 1H15A 3NH7L 3REVB 4OIAA 4XNXL 3QCUH 3GMNB 1RZ8B 5DFTA 4JANA 1J8HB 4C4KT 4KTEH 4H25B 1G7QB 4YHPB 2ATPA 4PJEF 1ZT4A 4Y2DA 1AD0B 4PRPA 4K23H 1LP9A 5E2JA 4P46A 3GSQA 5IROA 1MREH 1QYGL 4MNGA 5DVMA 5IJKA 4G6FB 1CE6A 2VDMH 3DTXB 3HI5L 3G04A 4Z7UE 3T1WA 3KHQA 2BCKB 4OTXL 3T0VA 1YEIL 1Q9LA 3WKMH 4QHKI 4ZYKA 1SYSA 5IM7A 4MD4A 2J5LB 5AWNH 2J2ZA 3MSPA 4XBEH 5C6TH 5TF0A 3W11D 4WHYH 3L5WA 3VXUE 3GNMH 1HE7A 4L4VA 1FL6A 4AT6B 3BP4A 4O9HH 1AXIB 3UJIL 5EU3A 3S37L 3U7YH 4PYGA 1VFBB 1H3PL 3MJ6A 2GSIA 1KGCE 4ETYA 1NGYA 2OP4H 4OLEA 4APQB 4NO5A 4KROD 1FL5B 2GKIA 3P0YL 4LPXA 2DQIH 1I3UA 1CFNB 3FZUD 2P5ED 2O5ZL 1EEYB 1KYOK 3ARDB 4FP8H 5DFVD 5E99H 3TA3C 2F53D 1G7IA 3UZQA 1L0YA 1N64L 1UJ3C 5GSRB 3BZEB 4OD2B 2ED7A 1M7XA 2Z91A 3HLAA 5FA3A 2VE6A 2AEQH 5HI4D 1A9BA 5DRXA 1OCWH 3C8DA 4LASH 1U58A 1AQDB 3VRJA 1I85C 5TH2A 4P3CL 2G5BA 3MRRA 5HHMD 1N3NA 2VC2L 2NY3B 1XR9A 4LHUG 1VGKB 4PD4J 2BFVH 4F7TA 4X6BB 4S2SB 5CCKH 4WWKB 5IEKB 1PQZB 5GS1C 4YQXL 4XCNB 5IGXH 1OD9A 3HE7D 5DD0H 1IKFH 5LBSL 1OARL 3FQRA 2CIIA 5DJYB 4PBVC 3A67L 1A1MA 3F58L 3UTSD 4KZEH 3PHOB 1U8QB 1IC5L 4P99A 5KSBB 3CH8A 5B39A 3LRGA 5BQ7A 3V0WL 5E8PA 3BZDA 5I30L 5EWIH 4JREB 3G6JB 1G9EA 2AI0H 4F9PA 1F02I 1WWBX 3DXAA 4DGVL 1WT5A 2DLFH 2WWMD 5E6YA 3WDJA 2NNAB 5EC2A 5D7JB 3S34H 4HUMB 5C2UB 3VGEA 3LQAC 4ENED 4E41D 1KV3A 3SDAC 3T2NL 4JFED 3O6LH 5FV2A 1JK8B 2IH3A 4IHOB 4C83A 1HHIA 4KKLD 1SM3H 2DICA 1FQ9C 3MJ7B 5T3XH 4J6RL 4S1SL 4CRPA 3TVMD 5CJXA 1D3CA 5I1KH 5B38A 1MRDH 4PB9L 3OBAA 3S97C 2PCPB 3REVA 3P9MB 3LN9A 1OAZL 3KYNB 1T7YA 3GMNA 4GMTH 5KOMC 1GIGL 2W9LA 2YMXH 4H25A 1G7QA 1OTUC 1BD2E 3BPOB 1AD0A 3RGVB 4RA3A 4DKDC 4XP9L 1BPVA 3GKZA 3TFKC 3DTXA 4WW2C 3B4NA 3NA4A 3OAYH 2BCKA 3JWOH 2A73B 2FCBA 2HLFC 5I6XB 1ZTXL 4UNTA 2QLVB 2I27N 4I0CC 5E9DE 2B1HL 4G80B 4V1DD 5D7KE 5DTFB 4EIZC 1BBJB 1OAKL 1U42A 3HUJF 4LNVA 4DVBB 4R4ND 4NQEB 5DMKB 4L3EE 1FBIH 2DQDH 1A7QL 1IM3A 1NBQA 1Q1JL 2OXHA 1BFSA 4UB0L 1YN6B 2GW5A 2JJVA 4GW4B 4PJCA 4PR5B 4KK9D 5DQ9B 2AJVL 2EDJA 4LVOB 4IRJD 5T5FL 4OLYH 5HD8C 1A7RH 3WFCH 3WUZA 4G9FE 3UROR 2F19L 2GK0A 2GT9B 1P2CB 4LCYA 1RIUL 4Z7VF 1UCTA 2BVQA 1CFNA 2D03H 3BE1H 1LK3L 1XCQB 1IT9L 3HC4H 4H5SB 4U1MA 4QRRA 4CJ1A 2RCSH 4XPTH 3ARDA 4HWBL 5ADPL 1YUHB 3GGWB 2XA8H 2WQ8A 3ROOB 2ZUSA 3O2WL 3RAJL 5DVKA 4FTVB 2PXYA 4KRPB 1OSPL 4ZFGH 1MFBH 4JHWH 4OZGA 3BZEA 3QAZC 1A14L 3V95A 1U8HB 1RK0B 5J6HB 5KVEL 4P57B 1PZ5B 3GMRB 2DS4A 4X9HA 4M1GL 4X83A 5KS9F 4POZD 1AQDA 1CQYA 3P0VH 4FMFA 4YDKL 4RMRA 4QHKJ 4X5WA 1T1XA 1JHKL 1NANH 5DUPL 4QTIL 4PJ9D 3IDYC 4X6BA 4S2SA 3C2AL 4Z0XA 4ODSH 4BFGA 4WWKA 3ZKMD 5JMOC 3TT3H 4J1UA 5IEKA 4U1IA 1X5GA 1OF2B 2Y07H 3TPUB 5IQ7H 1QVOB 3ARED 2OI9C 1ZS8B 4PLJC 3PWUA 3SHSA 3PHOA 2ZUXA 4AM0B 5SX4I 3T8XB 1CL7H 3RJQB 3QEQE 2O26U 3PWVB 2CUMA 5ESAB 3GMOB 4OD1H 3M07A 4K2UL 1G0XA 4N1EA 5FOJA 4Y2DC 1QSFB 3BO8B 3QDJE 3G6JA 2DF3A 3OAYK 4P46C 5IROC 1MCLA 4RRPA 4X99A 2WIIB 3TCXA 3V5KB 1HNFA 5IJKC 3HC0A 3T2QA 2A1WL 5BVPH 3TLRA 2QSCH 1TENA 4OZHF 5HHPA 4I5BA 1JRHL 5D7JA 2BHUA 1MJ7H 5F9AC 2VIRB 4TNWK 4YAQB 2D31A 3MCLL 3K46A 4JKMA 4Y4HB 4KDTA 5CP3A 4JR9H 3FFDA 4OKDA 4O4YH 1A2YB 2C3GA 1VEPA 3KDMB 4OLZL 1RIHL 2VAAB 4QHMB 3MC0A 3NZHL 1LP9E 3P9MA 4MNGE 3KYNA 4OB5L 3W5MA 5CFHA 1A22B 2NTSP 4BQ6A 3SDXF 5DMGD 3LIZH 2B39A 1G7LA 3O6FB 4RAUA 3BGFC 3V52H 2F53A 4OLXL 1YQVH 1J18A 2R56H 1UCBH 3RGHA 5KAQG 5HYEA 2IH1B 2HT4C 4WCYH 2J8UA 2CR6A 4G6JL 4OM0H 3E1F1 4N90D 2A73A 1E27B 25C8H 5C09E 4F80A 5J9PA 5GS0L 2R2BB 4JO1L 5JHDE 5ANMB 1AE6H 4JM2C 4L4VE 4P4RA 1U93B 5I74B 5BJTB 4WU7A 2ZUWA 3DO7B 4NQEA 5E1AB 4QYOB 1RULH 1F00I 4PGBB 1LO3L 2H3NA 3VGFA 1LE5B 4GLRI 4JVPA 5ESQB 4TSCH 4KHTH 4UNVA 4EN3A 1CYGA 4PS4L 2MMXA 5EOQL 5L0QB 3I6LE 4MJID 3VGHA 1HNGA 3D25A 2CO7B 3H9ZA 3J7HA 4NQCD 1J1XL 4P4KA 4RISH 3B5TA 3PQYA 3UTSA 2EDWA 2R1WB 2ZOKA 5FUOH 5AZ2L 4KMQA 5L9DL 1F8TL 2MSPA 2PKDA 4HLJA 4PJ8D 3QRGH 4GAGL 3WNLA 1N59B 4OF3A 3ZT7A 3L5XH 4KVCH 4H5SA 2E8YA 1I3RB 3E8UH 2C4FT 3EAKA 4FQJH 4XMKH 5GISL 4LVHB 1YUHA 1FNFA 3B9DA 2P5WD 5EUOA 4RGND 1ZWIA 1BQSA 2E7BA 5E8DH 5AAMA 4FTVA 4D3CL 4RA0C 5D1QD 3P40A 2FX8L 1SY6L 5J6HA 4BZ1H 1WC7B 1A6AB 4P57A 4AENA 1PZ5A 4F9PC 1A5FH 1DN0A 5DRWB 3GMRA 3VA2C 5CBAB 4OKVB 5EOCH 1A6WL 1OWRM 4JFDE 3Q5YA 1YJDL 1CDYA 4GS7B 3IXTB 4GKNB 5JXEA 2YPVL 5GGTL 3RIAK 4TUKH 1DLFL 2Q7NA 4PLNC 1LO5B 1RY7B 8FABB 2HN7B 2OTWB 4YGVB 3N06B 3DMMD 3MODH 4TRPH 3ROLA 1KCUH 1C5CL 3QIBB 1KULA 2CDGB 3TPUA 3EYUH 4PJFE 1K9TA 1QVOA 1K8DA 2C3XA 5CJXC 1NCAH 1W72L 5KOVC 1MFDL 4R8WH 2XZCL 4EI5A 5IMLA 4U4BA 4ACPA 4M6OH 3WL9A 4KTYA 4ZS6C 4G6AC 1UEYA 3UYPA 2P7TA 5KVFL 2A6DB 1QBLH 5ENWB 2FWOB 5C0RH 1DSFL 4S1DC 3IJSA 1NUDA 3IKCB 2NW2A 1EGJL 4PY8I 4NJAH 3V5KA 4JZOB 3QI9B 4F7PA 5JXAH 4NO2B 2X4SB 4J3XA 4PRDB 4R4BA 3VFGL 4QGTA 2HP4A 2AV1A 3W82A 1MEXL 5EG6C 3L7FB 1BVLB 2AEPH 4JHZA 4QNPF 2ZSVB 3SO3B 3VGBA 1OY3B 1A2YA 2J5LC 4K7PX 1RUML 3N1QC 1AR1C 4DKFL 4F58H 3KDMA 4Z7WA 3CMGA 4P5TB 4QEGA 1IEAA 1MIEH 4OFDA 4FQ2L 3MRFB 5IWLA 4GG6E 4MD5B 1F3RB 5DUBA 1IEHA 3FL7A 4P2OB 1KJ2A 1UC6A 3C60D 4Z7NE 3STLB 5C0GB 2JCCB 1TZIA 4XCFH 3BX7C 3GJFB 2QL1A 4IRSD 1QFUH 1U2CA 5DJZB 1KJ3L 5F9DC 2D7QA 2AXGB 2OS7A 3X12A 1SMAA 4J3UA 2DI9A 3RQ3A 4Y5VB 5IB1B 1OSZA 1QD0A 2DD8H 4APQC 1NFIB 1NGXB 5CGMA 1XZ0A 5FGSA 3QEGL 4HC1A 5I16B 1ZVHA 4NOBA 3BEVA 1X6LA 2CO6B 3OJ2C 2QQQA 4R3SB 3U7WL 5J8OA 1R24A 4OIBA 3U4EB 1E27A 1KCVL 1U8PA 3ARDC 1JI2A 3D5OF 5FGCE 4DKEL 4KQ4L 3SGDH 3VXMD 4OI8A 3GSNH 1DBKH 2R2BA 1UXSB 2DWDB 4FQHB 3SN6N 3GSOA 1MFCH 2PXYC 5F1OB 2C5DC 5HYQB 4BQ9A 4X4YA 3UZEA 5FUZL 2RGSA 3AGVA 2HFTA 3BD5A 5CGYD 4PJCE 4PJ9A 2ERJB 3VXQA 2EIBA 2W0FB 4GRLA 1BVZA 5ESQA 4A2LA 5LWYL 4HD9A 4JQIL 1HINL 2P49B 3DUHA 4LF3A 2GY5A 4HUVB 2CJUL 4ODUB 1NCUA 2NY3C 4HS8H 2H1PH 2DM3A 3C9NB 4JG1H 3WDHA 3ULSB 2R1WA 3OXRA 3UO1L 4RMSA 4WWKC 1EH9A 1R0AH 1XIWB 4JO4L 1JZ4A 1JWMA 2NY0D 2V9TA 5CAYB 3FHAA 3FN0H 1O7SA 4BFBD 5I18H 5J56B 4P49A 1I3RA 4OZGE 3TYGL 4BQBA 3BH8B 3L3OB 1OTSD 3HPLB 4WFGE 5MHSE 5JIPA 2VLKB 4Y1AE 1ODAA 4PJBB 4HIXH 2P43B 5IMOA 4BA8A 1SYVB 5DA0B 2WBJD 1CXHA 1S9YB 1MPAL 2H26B 1WC7A 4QGYA 4JREC 5ALBL 1GGTA 3CK0L 5DRWA 4HCRH 4GKNA 5D7JC 1H3WM 1LO5A 1HH9B 4O2FA 4FZ8H 4JFXB 2A0LC 1HILB 1F3DJ 2XACC 5L2JA 1WK0A 4KDTC 3RX8A 3EYQC 2X4PA 1T3FB 1BM3H 2QR0A 1HYSC 4NJ9H 4OBSA 1MI5D 3W0WD 3MV01 5F7HA 5B39G 4M43L 4GAYA 4G5ZL 3T0ED 3VD3A 4PJXA 2HJFA 1UB6B 1S9KC 1OQOA 2A6DA 1PG7L 2IFFH 4GAFB 2RBLA 5D8JH 5ENWA 1F6FB 3MRBB 2HFGH 4YR6A 3BPOC 2EEBA 3RGVC 5HHVH 3HR5B 2VQ1A 5EU4B 2Q8BH 1J10A 1HKFA 2G60L 4NKMA 5LQBL 3QJFB 5TE7L 2YA1A 3KYAA 3ZL4H 3TBTB 4F8TA 1BLNA 1GGCH 1UACH 4OUUA 3CAFA 5DMIH 2CLZB 2X4SA 5FCUL 1YMHA 15C8L 3EJZD 4G8GB 4L3CA 5I6XC 2UWEB 4N0YH 3P4OB 2ZSWB 5CIPB 2VL4A 1BEYH 4X0KB 2IBZY 3X3FH 5B38G 1OAUH 2O5YH 1A02N 2ZSVA 2VAJA 4LIQH 2EC8A 4MJIA 1AHWB 2UY6A 4YFLI 3ULVD 2VUYA 1OAXL 5TGBB 4OCWH 1HKLL 2P5EE 5FECB 3CUPB 4RMTA 3GIZH 4OD3L 4MD5A 1U2HA 4NZDA 4N9GB 4PJ8A 4XPAL 2F53E 3T0AA 4EN3C 1XR8A 2JCCA 1HDMB 4DJMA 3T3PF 3GJFA 2J8UE 4QXUL 4LVOC 5DJZA 3LMJL 2HTLD 1C12B 2D0FA 2Z92B 4WIQA 4JFZL 1NFIA 1NGXA 3GZKA 1PX4A 2NY4B 1JMZA 3MXVL 1T6VN 2XTJB 4QRQA 4OQ1A 2DBLL 3VG0H 3QUMB 4Y19A 5HHME 1JJUA 3CFIC 3S35L 4YHKL 5MERB 5ETUA 1UXSA 1BGXL 2DWDA 3AMLA 2CDFA 3VMPA 1BREA 4KRPC 2W65B 5HYQA 1H3XA 3MV11 3I9GL 1VACA 1AFVH 1SEQH 3QUKB 4Z7UF 2X2YA 3U6RB 3TN0D 3KG5A 2W0FA 1CVSC 3RWCB 3D0VB 1W0WA 1ZLWH 3UTSE 2BK8A 4ZPTB 2BOBB 4WY7H 4KV5E 3SKJL 4XWOD 3EJYC 3QHZL 1OW0A 4P3DB 5JXEC 4OZFA 1UZ6E 4YXLL 1TZGH 4PJDF 1JPSH 1HSBB 1MNUL 5MEPA 5HGHB 3C9NA 5DQDL 5TPWL 4P2RD 1BFTA 1XIWA 2VYRE 3MRGB 3RNQA 4IOIB 3KLHD 4AMKH 5EUOE 1NJ9B 3WLBB 1D5MB 12E8L 3DVGA 2R39A 4OCLC 4KXZH 5DJCA 5F7NC 1UENA 1JHLH 3L3OA 4E41E 5DRZB 5F44A 4BELD 5I75B 4HK3J 5GGRB 4JFEE 1NAML 1F11B 4HWEL 4DFHA 5T3ZD 4PRHD 3JV6A 5CILL 1PSKH 5CBEB 3GB7B 4QKXB 1SYVA 4YPJA 5LCVL 1S9YA 3ZKSD 1Q9OA 2H26A 1TZHB 2Y9RT 4TVPL 3QG6B 5IR1A 4FXGB 2R69L 3RUGF 2B0SL 4XVUD 2I25N 5FYJD 1NC4B 4OGXL 1G7PA 3UTZB 1U3HD 1UM5H 3SY0B 5IHBA 1EHLL 1SJVA 1EHNA 1S7SB 1HH9A 4XNYH 3RY6C 4JFXA 4YEEA 4Y4HC 1N2RB 4MGXA 5I2IB 3C60A 1P84J 4L9LB 1DBBL 1KN4L 1RU9H 4IRSA 1OPGH 4BSJA 3CFKA 2UVFA 4OF6A 3OG4B 2ZCLH 2GUOB 4J3OC 5IWLC 5JW3L 3HAEB 4EVNA 2FNBA 4HPYL 3FMGL 2BZDA 2X4UA 2PO6D 4V1DE 1DQML 2IJ0C 4FFZH 4LP5A 1UB6A 3DUUB 3KPRB 2I5YL 4RRPG 2W92A 3MRBA 3NCMA 3O6FC 4ZFFB 3VXMA 3X13B 3CX2A 5HJ3B 3BIKB 3HR5A 4CAGA 4MXWH 3GM8A 2V7HB 3RVWD 2BRRH 3QJFA 4CW1B 1JBJA 4NQVB 4G8EA 4DTGH 4EIGB 4G8GA 4S1QH 4JKKA 5E08H 2UWEA 2R4SH 5CIPA 5GRVL 6CGTA 4FQXD 5I74C 4ZUVA 4LEXL 1ZLWK 4DK6A 3VU2A 3CSPA 3NN8B 3B9AA 3P4NB 5TGBA 3E3QC 1RZJC 5CUSL 5I1EH 3CUPA 4NO0B 1EVUA 3SPVA 1CTNA 1I1YB 3FT3B 3PWPB 4XNQA 5C2BH 1XF5A 3ZMRA 5FO8A 5IW6B 1CLZH 1HDMA 3TT1L 1PKOA 1T7XA 4PG2A 3OR7B 1H8OA 1Z9SA 2BVOA 2Z92A 4G8IB 1I8IA 1KB5A 5HYSB 3HZKA 1U6AH 3LKNA 1CZ8L 3ZTJG 1TVHB 2PR4L 2XG4A 4ONGL 3VA6A 1T03L 3QUMA 2LVCA 1GGUA 2XZQH 3QZWB 3NA9H 5ITFB 1XGYL 4LVHC 3VMNA 3V5HB 1Z3GL 1EMTH 2EH8H 2CGRH 3OKMB 3IXAA 1EFXD 5FHBL 1EJ6A 1I1RA 2NZ9D 3DRQB 2WP3O 3RWCA 3W81A 2C7UB 1T2QH 1RVFL 3D0VA 3P0GB 3NH7H 2EO9A 4XNXH 2NYYC 2NY6B 4DOHB 1A8JH 5H8DA 1MI5A 2J88L 4GS7C 3D3VD 3WLWC 4KMLB 3UTTD 3WD5L 4HH8A 4RNRA 3W9DB 4JY6B 1QYGH 1T1YA 5CKGA 3HI5H 5HDQL 3BMVA 1I8KA 1MCNA 3HTLX 3VI4F 1NJ9A 3WLBA 2ZPKL 1D5MA 4MB5A 4OTXH 3C5SA 1BIHA 1JYNA 2C1PB 5L8LB 1PZUB 1BF8A 1YEIH 2V9QA 2DWEB 3SKOB 3JBG7 1WVZA 32C2B 1F11A 5DJ2B 1V3MA 3LKOB 4M5YL 5CBEA 4HMDA 1WFUA 1KJVB 3OJDA 5JOFB 3LN4B 1LK2B 1TZHA 1U8MB 3Q48A 3QG6A 4LCUA 3L1OL 4FXGA 3GSVB 4ZUWA 5T3XD 5JO5A 3EYOB 5FDWA 4LVNB 3P2TA 1NC4A 4XBPA 2AGJH 3UTZA 3SY0A 1IC4L 4OCRL 5DEFB 3UJIH 3QFDA 1H3PH 2L7JA 1S7SA 1A3RL 3AMKA 5H94A 3MV8B 4NBZB 2VLJB 1ZHKB 5I2IA 3P0YH 4L9LA 2MTPA 3SO3C 4XMLL 3SQOL 7FABL 4PJXE 2O5ZH 5EA0L 2EC9T 2GUOA 4N90E 1JUFB 1YMMD 2G2RB 3IAPA 4HS3B 4P2OC 1QR1B 1N64H 4HGMA 1VFUA 1F6LL 1JGLL 4HKZA 3EOYG 5FKPA 1A7OL 2AJUL 4M61A 1FC1A 4ZFFA 3BJLA 3X13A 4U3HA 5I1IL 4Y5VC 3H42L 4DFIA 5JW5A 2RAMA 3WN5A 4P3CH 4LSPL 1ADQL 1CCZA 2VC2H 4MJIE 3TN0A 5CSGA 5F6HI 4ZUTB 1HYRC 4LNRA 4NQCE 4S1RL 4BYHA 5EIQA 1X5XA 4JB9L 4YQXH 3QFJD 1BMGA 3GSRB 5LBSH 1OARH 4H8WC 4HX1A 2B4CC 3NN8A 5E0QA 2ERJC 5ISZD 5E2UL 4YHNB 3A67H 3F58H 1DUYB 2FEEI 4Z9KB 1QACA 1IC5H 2UYLB 2P5WE 2Y72A 3FT3A 3PWPA 4RGNE 1OW0C 1AI1L 4LSSL 5IW6A 3EFDL 4JPWL 3V0WH 4G6KL 1EJOL 5I30H 3OR7A 4NM4L 4Y19E 1O7VA 4G8IA 4CADB 4DGVH 5HYSA 1A6ZA 2O93L 1XIWC 4KZDL 3V2AR 4TOYL 4WO4D 4F2MB 3T2NH 3JWNC 3O2DA 1U41A 2YA2A 4H1LB 3V5HA 1KPVA 3MRJA 4XP6H 4CVWA 3B2UD 1U3HA 3EW3B 4XC3L 1Q0YL 5D5MF 4J6RH 2DQHL 3IKKA 4S1SH 1LO0L 3KXFB 4RAHA 3DRQA 2AJXL 2YD6A 5LAXB 1VADB 3QG7L 4PB9H 3SKUD 5JLZB 4AK1A 4G7VL 3ULUL 1DJSA 1JPST 1OAZH 3MGOB 1X5AA 1GIGH 1QO3B 3EFFB 1UXWA 2XKUA 3STZA 5E00B 3NIGE 3Q5TA 3O4OB 5L7XL 3W9DA 4ZFZA 2Y5TA 4JZJB 4XP9H 1WWWX 2FX9L 2LQRA 3QQ9C 2VZ3A 2WMPA 4ELMA 2W0KA 3V4PL 1K4DA 3FQTB 1TTFA 4HJ0D 4XBGA 3QISA 2FD6L 4F3FA 2AW2A 2C1PA 1ZTXH 4WHCA 5HHNB 2B1HH 1GGYA 4OUOA 4JZNB 4CN1A 5IHUL 1OAKH 4R2GD 5CD3A 1HYSD 3FQUA 1KJVA 4GKOA 2Z8RA 1A7QH 4I3RL 4K8RC 4WFHD 4ODTL 5JOFA 1Q1JH 1P1ZB 3LN4A 1MJJB 3P11L 4UB0H 1X5IA 4YDJB 1T22B 4U1HB 3EYOA 5JOEA 5E8EB 2CIKB 3U9UB 2R2EB 5DEFA 2AJVH 3EKCA 3IYLW 1YY9D 1QEWB 5EU6A 4OFYA 5T5FH 3W39B 3KPSD 2IQ9L 2N7BA 2ZP0T 1GRWA 3MV8A 3RWDA 1P5UA 4OLVL 2ZUTA 2F19H 1ORSA 1FNHA 3ZKND 1CD1B 1RIUH 4G43A 5FYJU 1AHWC 1LK3H 1IT9H 4X6CE 3SDDD 1ZT7B 1XGPB 4HWBH 5ADPH 5HGDA 1JUFA 2DLEA 2G2RA 3VXME 3O2WH 3RAJH 1IE5A 3FQWB 3WIFB 1OVZA 1QSEB 5HDBE 1OSPH 1RJZA 3UTQB 1A14H 1FFRA 4PJFF 2FLRT 5B21A 5KVEH 4U31A 1QNZL 3ARBB 4JPVL 4M1GH 1UYWL 4MJ4A 1G9MC 5DHVH 1MCDA 2NY4C 3FO2A 4YDKH 5F1IA 1JHKH 1BAFL 1UVQB 2XTJC 3D69B 5BV7B 3DECA 5DUPH 4QTIH 3VFWB 4UBDC 3TNMB 2VLRB 3C2AH 3VFUB 2NQCA 3G5ZB 3H7BB 3CVIL 4FQQA 5DSCA 4MVBC 1V7NL 1KIPA 4U2ZA 2D9QB 3QCVL 2G9HA 3IFLL 1S5HB 3GSRA 1Q94A 1QBBA 5EBLB 2VH5L 4F7MB 3NGBB 5E2WL 3U0TB 2AJSL 4ZODA 2BNRD 4KGJA 4XT1C 5HGGS 1X7QA 3KPMB 1NANI 2ADIB 3MJ9L 1ZVSA 4K2UH 1DBAL 4OCSL 4NUGL 4GG6F 1ORQA 1NUNB 3KNBB 2A1WH 4MJ5B 3T08A 5F7WC 1JRHH 2FBOJ 2ZOLA 4YIQA 2WK2A 3DV4A 2X70B 4QHLA 1JV5B 2RB8A 3BD3A 4ZSOE 1P4BL 1U92B 5E95B 4Q6YA 5GS2H 3MCLH 4HBCL 2C4FU 4H1LA 5I75C 3MA7B 5IVNA 5IB3B 2NY1B 1F13A 4Y4KB 1FFOA 1K2DA 2YWYA 4HMEA 1CL7I 1MI5E 2F8XC 1RIHH 4I77L 1VADA 1A4JA 4AG4L 3Q5OA 4C56D 3W0WE 1AXSA 4LLVA 4OZFG 2FEDC 4NYLB 5JLZA 3NZHH 4KRMB 1GYAA 1HOCB 3JSSA 5F7FA 3MGOA 4OB5H 3T0EE 1QFWL 1C7TA 3L3JA 1J1OL 4L8CB 5E00A 4WENB 3OX8A 2B5IB 1KLGA 3NBNA 3IFPB 4OLXH 4Y5XB 3FO1B 5GSVB 4JZJA 4HEME 3F6IA 4L9LC 1XF3A 2YN5A 3CFJB 3CGTA 4G6JH 3VFRB 1P6FA 3F8UB 1D5BA 1Y0LA 5GS0H 1FLTX 3QULA 2EYSA 1CICA 4JO1H 4JZNA 5EZLA 1S8DB 2EEAA 2MFNA 1IGJA 2OJZL 4JVWA 4MS8C 2WLYA 4ALAL 2QV2A 5C0AA 1IEBB 1Z6JT 1CGWA 1LO3H 1P69B 3ULVE 4RDQF 1C5DB 3MRCB 4YDJA 1YEKL 3QFJA 3VDCA 3NVQA 1QBML 2CIKA 5E8EA 5J6GB 4PS4H 5EOQH 4WFFD 1GGBL 5M95B 1A1NA 1QEWA 5ISZA 1J1XH 1QLRB 2D7NA 4EXPX 5AZ2H 5L9DH 3MRQB 3MV7D 3QXAB 1F8TH 1WICA 3GBML 2L4OA 5DZLA 4GAGH 3ZDXE 4KJWD 1KFAL 3RIFF 1NFDA 1ZT7A 3BYYA 4JKPL 4MSWA 5GISH 4M1CC 4GW1A 3WS6C 5GS3A 1Q0XL 1MELA 1U91A 4W70A 4GRMA 3SCMB 4D3CH 3JTSB 5IMMB 3MOAL 4HKXA 2FX8H 4OCXL 1SY6H 1F4AA 2V7NB 2YUVA 3GSWA 2HMIC 3MBEA 3PF2A 4F8QA 4U6VL 4XHJC 3ARBA 2AQ2A 3D9AL 4RFOH 1S7WB 4KH2A 2A74B 3GHEL 5MENA 1A6WH 1S9WB 1XGTB 1YJDH 2MQ3A 2K7QA 2YPVH 5GGTH 4M5ZH 1DLFH 5CLTA 1NKOA 2CRMA 3VFWA 3TNMA 2V5SA 4HUWA 2VLRA 1ZEAL 2D3VA 5CJBA 5TDPB 1C5CH 4P2RE 3EO9L 5D2LB 2Q6WB 1S5HA 1KC5L 3U9PL 2DKUA 1W72H 2AKRB 3R8BB 1MFDH 2KZWA 1EEZB 2Y06L 4ZFOL 2XZCH 4IRZL 4G9DA 2MNUA 3F7VA 1ZK9A 3LRSA 2W60A 2GJ6B 1FFNA 2NY6C 2GTWB 5EPMB 3L5IA 4GRWB 4B50A 5T3ZE 3AS2A 4D9RD 4DVRL 3KPMA 5D6DA 2OJEA 2HTKC 2ADIA 1DSFH 3VWKA 3EYFB 4ZO9A 5AZEL 1EGJH 4LQFL 2P8PA 1XH3B 2ATKB 3PL6B 5FYJE 1VFMA 1TTUA 2HJLB 3P30L 1F4YL 3VFGH 2X70A 4PJHB 1MEXH 5KJRL 1U92A 2IPUK 3QIBD 4M3KB 5AYUL 3MA7A 4BZ2L 5IB3A 4JO2L 1UFUA 4LSQL 4Z5RB 1NEZA 4Y89A 2VZTA 1RUMH 4DKFH 1C5BL 3B83A 3KPSA 1VFAA 3FOMB 5IBUB 5ICXA 4YEFA 4FQ2H 2R0LL 5IIEB 1S7VB 1T04B 4LVNC 4NYLA 1CGYA 1K6QL 1HOCA 1OAYL 4XX1E 3QQNA 3OPZL 5EIVA 5IOPA 4ELME 1KJ3H 4L8CA 4ZNEA 3RVVC 1IGML 3KYOB 4Y5XA 5GSVA 1IGIL 2DQJL 3QWOA 5GZOC 3QI9D 1MIML 1G84A 5A43C 5I1CL 4KV5F 1VPOL 3QEGH 1FH5L 5BO1L 1LGVA 1B6DA 1D5XA 1KBGH 3CFJA 3U7WH 3VFRA 1JZ7A 4KK8D 1KCVH 4DKEH 5BZWB 3QUZB 2ICEB 4KQ4H 1J05B 1WAAA 1WFNA 35C8L 1OP9A 1S8DA 3QNZA 3UYOD 2P24B 4JCLA 4YBQC 1CK0L 2XFXB 3PP4L 1RJLA 5FUZH 4P5TD 5F6IB 2M8XA 5TF1L 1FZJB 3MFFA 5J1AB 5LWYH 1P7KA 1T20B 4JQIH 2YD3A 1HINH 2HLAB 5D4QA 2MHAB 2CJUH 4D8PB 3N0PB 1QLRA 5F3HA 5IBLD 3UO1H 3MRQA 4JHAL 3QXAA 3SGDI 4JO4H 1UZ8B 3M17B 1KIQB 2UV3A 1EO8L 1U8OB 3KLAB 4M1DL 3HAEG 5JIHA 3QXDB 4PJEB 4BH7A 2NY2B 4GKSA 3TYGH 2YD7A 3SCMA 3JTSA 5IMMA 1YNTA 5CMAB 4L4JA 4DN3L 2ZCKL 1MPAH 2V7NA 2XY2A 5ILTL 3R06B 2ICCA 2JB6B 5ALBH 4J4PA 5LKNA 1G6RB 3CK0H 1BIIB 1S7TB 4WVRA 2DM7A 3SE9L 1L4IA 1EAPB 2F15A 4K7PL 1INDL 1S9WA 4KKCC 4LCWB 5DO2C 2VQUA 2LU3A 3TIEB 3FB6A 3D3VE 3UTTE 3C6LD 1X5KA 3OF6D 4U0RB 3SE8L 3L7EA 1KTDA 5D2LA 2PTUA 3OKOB 2Q6WA 1LMKA 2Y6SD 2GIYA 4OCYL 4R6UA 4UV7L 2YPKB 3U2SB 2F54A 4X98B 2VLKD 4PLKC 4M43H 3OKNB 4G5ZH 3B9KB 5E6IB 5DMYA 3QUYB 2GTWA 4W4NA 1PG7H 5HYSG 3W5NA 1G1YA 2LFGA 2D2OA 3O4OC 5I15H 1G7JB 3PDOA 1FZKB 4LRNL 4YBLB 3EBAA 4JZJC 4HJJL 5K9QG 1YYLL 2G60H 5T3XE 1XH3A 2GITB 4I18B 4GKZB 5LQBH 3F7YB 5TE7H 2HJLA 3QQ3A 5FCUH 3FONA 15C8H 3PP3H 1GAFL 4PJHA 4A6YL 1CICC 3TZVB 2PTTB 2BXZA 4PGZA 4Z5RA 3HRPA 3OKEB 3HB3D 3G6DL 4MDIB 2Q8AL 4BQ8A 1OAXH 1HKLH 5IHLB 3MRPB 1IKNC 5C9JB 1J0HA 4OD3H 4XVSL 4HJGB 2EDQA 1S7VA 1T04A 1YMME 1A0QL 2GAZB 3I75B 4WI7A 4XPAH 4U1JB 2KBGA 1I7UB 1LNUA 2YHGA 1B4JL 3ARQA 2QKIB 5A2KH 2ESVB 4QXUH 4RAVB 1T0MB 4XX1G 3LMJH 3Q3GA 2ZWLT 3SBWA 1KCSL 1FL3B 1FO0L 5E1HB 4JFZH 4DN4L 4H0IA 3MXVH 3S7GA 3S98A 3DUSB 5K9OA 4L4TB 2DBLH 3F6LA 1FIGL 3GSNA 5JIKA 3G5YB 2GFBA 1NCBL 3S35H 4W6YB 5BZWA 3QUZA 2Z8VC 3CX5K 4YHKH 1SEBA 1A9EA 5FXCH 1BGXH 2WINB 1JTTA 3DX9B 2P24A 3I9GH 3QFJE 2XFXA 1CQKA 1A47A 1ZANL 4U3CA 3MBEC 3P77A 5ISZE 1FZJA 3ARBC 4LLWB 1R5WA 2EZ0C 4ODXA 3CSGA 5KANI 1UQSA 1T20A 3AXLA 3SKJH 3QHZH 2VXQL 1YNKL 2GI7A 1IZKA 4YXLH 4D8PA 5BV7C 4Q9RL 2XI9A 3X14A 3QDMA 4NUJB 1MNUH 3KJ6L 5DQDH 1NFDE 3JWDC 5TPWH 5DYOA 3IFOB 1KCKA 1UZ8A 2NY4D 3DX6B 1TCRB 3NZ8B 4B7LA 1NCNA 2W0LA 3PIQA 5IB2A 3QXDA 12E8H 4PJEA 1LQSR 2W9DL 3NGBC 3FT2B 4BH8B 2MJWA 4PRAA 3VFMB 5KZCB 3ARGA 2QBWA 4PP1D 1EIBA 1NAMH 4PRBA 2GTZB 4HWEH 2HFEB 2YBRA 5CILH 3V4VL 2RJMA 5MENE 4JRYA 5D6DC 4UINL 3VWKC 2R0ZL 1U9KA 4TVPH 4HCRA 2R69H 2B0SH 3MACL 5C08B 1AO7B 3PP3K 4FA8A 1L7IL 3HUJB 4U6TA 5SV4A 4OGXH 1CGTA 5DK2B 2QQKL 4LCWA 4JJHA 4KKAC 1EHLH 2D4FA 1NUGA 4Z8FL 3IU3B 1REIA 4KXZI 1ERNA 3ALWA 5JZ7D 4RZCB 2NY1C 3OKOA 4I3SL 1DBBH 1KN4H 4NRXB 1MHCA 4Y4KC 4TTGA 2WW8A 2APVA 1UM6L 2I07B 5EUKA 5BCAA 1FYTB 3U2SA 5JW3H 4FG6D 4HPYH 3FMGH 4RGMB 3OKNA 2YOCA 2H2SD 2IALB 4Z7VB 1YN7A 1L0XA 1DQMH 5E6IA 2DKMA 3CSBA 4HZLA 1NMCB 2I5YH 1M1SA 3HRZB 1CLOL 3IDJA 1FRGL 4JRXD 2FECI 1MCWM 5F88A 5J7CC 2EDFA 2B5IC 3BN9C 1G7JA 3VXSB 3ZSTA 1VEMA 1J88A 4Y5XC 3S37X 2EH7L 3QEHA 3G9AB 2GITA 4I18A 1AXTH 4GKZA 5IFJA 2DAVA 3F7YA 4MAYB 4H1LG 1KNOB 2A83B 4ONFL 3U0PB 4KUCF 3OG6B 3KPSE 5KS9B 1Q9KA 3ALPA 3QHFL 4OGAC 1PJ9A 5IKCB 4I3GA 1FFPB 3BW9B 2Q3AA 3DNKA 4LEXH 4MDIA 1BFOB 3EHBC 1MFAL 1DLHB 3ZHKA 1TJGL 5CUSH 3CFEB 5ICYA 5C9JA 3IGAA 4ZNEE 4PJAB 4HJGA 1LO2H 4UDTB 1CN4A 3ZSSA 3QDGD 2OX5A 1I7UA 4YHML 5C0ND 1IGTB 4LCCB 2QKIA 2VDLL 1T83A 1ZSDA 3TT1H 3THML 1T0MA 3O9WA 3BEWA 5CZXD 3CMOL 1O0VA 1AD9A 2H41A 1X6NA 3SDCB 1H5BB 1CZ8H 4LGRB 4WUKL 1ZMYA 3OAZH 5EBGA 1RIVL 1PDKA 3DUSA 4GXUN 2C4XA 2AK4D 2PR4H 4QF1B 2O61A 4ONGH 1T03H 1IJ9A 3NIGF 3RZCB 3AS1A 3DVIA 1XGYH 4K7FA 2KZ1B 4BK4A 4K3GA 1Z3GH 2EC9U 4OV5B 3DX9A 3ZDZE 5JW4Q 3A6BL 3S6CA 3SCMC 3CC5B 4OZHB 3MREA 3QUXD 5F97E 1FN4B 5FHBH 4J3TA 5I76A 1KTLA 3MZGB 1G7HA 3O45A 3C6LA 4J4PC 1RVFH 3OF6A 5SWZD 1ES0B 2VZVA 3HMXL 3BT2L 4Z77A 4M7LL 2BNRE 4MA8L 5E4EB 1BJ1H 3WD5H 3RVXC 1QQDB 4QTHB 3NZ8A 1TCRA 5HDQH 3DGGB 2D7PA 2ZPKH 3FT2A 3DURB 1JP5A 3VFMA 3ESVF 2AEWA 4L5FL 5FFLA 4MQTB 1XAUA 4M5YH 3LPFA 4P5KB 4ZAKB 4R4FL 1BX2A 5DD5L 5D7IB 1AGDB 4X6CF 3MROB 5IF0A 1EHXA 1JL8A 3NIFE 2VSCA 3L1OH 5CP7A 1FZMB 1T66D 2H6PA 5I9QB 4C56E 1AO7A 3HUJA 3L3GB 5HDBF 5GRVK 3HI1A 1IC4H 4OCRH 5CEZL 3N50A 4MD0A 1U3ZA 5ELIA 2RFXB 1A3RH 3IU3A 3V5DA 2F54E 1DP0A 2VN7A 2DB8A 3SQOH 4XMLH 7FABH 4XCYA 4M48H 4XI5C 1AGBB 2I07A 3V0AC 1S7RB 4R26L 5EA0H 1FYTA 1WITA 5E94B 2VMFA 4Y16D 4I0PB 5F9JA 3V0VB 1LEIA 3VH8A 4XNUL 5I17A 5I19L 3OQ3B 4OLUL 4CMMB 1JGLH 1A7OH 4Q58C 2AJUH 3OAZK 5K9JL 2DYPA 3SBWC 4OAWB 1E4WL 3C6SB 5I1IH 3H42H 4TUOA 2MKWA 3VW3L 1S7XA 1KJMB 2B2XL 4FFVD 4LSPH 1ADQH 3V6ZB 4ZXBB 5HDLA 2FR4B 2A83A 4WFFE 1BOGB 3U0PA 1F6AB 1NEZG 5SWSD 4YHIB 5DJDB 1FAKT 3QUZC 5JORB 5KS9A 4S1RH 3TPKA 4JB9H 2XG5A 5H35B 3MV7E 2DM2A 1XGQA 3CVHB 2Y5EA 4WEBL 1D9KD 5E2VL 1VENA 3HG1A 4PTUA 5D71L 1X4YA 5J13B 3RDTB 3C8KA 1RURL 5E2UH 5DJ0A 2DMKA 4KWUA 3VWJD 4PREB 3I6GB 1V3KA 5FA4A 1MY7A 1AC0A 3DJ9A 3QNYB 1AI1H 1IGTA 4LSSH 4LCCA 1KPUB 3EFDH 3MZTA 4JPWH 5C92A 4G6KH 1EJOH 1U36A 4NM4H 1EK3A 3IDUA 4PJIF 2EECA 4J12A 5D7LD 3SDCA 3BP6B 2ITDA 4KZDH 1M7DA 1QRNB 4TOYH 4O2EA 1MCRA 4KI5D 4X5XB 2JJUA 2NY2C 4K71C 3RZCA 4ZPVA 4YNYB 4DGIL 3T4YB 4EJ1C 4Q6IB 1JYVA 1N5AB 2X42A 4EUPB 2JJTA 3GK8L 4XC3H 1Q0YH 4I4WA 4OZHA 1FN4A 2DQHH 5TE4L 2E7LA 4KFZC 1LO0H 4NPYB 2J3SA 2AJXH 3LKRB 1J11A 3KPQB 2JIXB 1A7BA 3QG7H 2C3WA 1HXMA 5LXGL 3VXTB 4X6DB 4G7VH 1INEL 4HFWA 4F7EA 3ULUH 1AKJB 5C0CB 3HPJB 1MCOL 5E8OB 2HT2C 5ACZA 5ID0A 1RSFA 1HI6B 4UTAL 2DQGL 5L7XH 2X7LB 5HYJD 4JEGB 3TCLB 2D7TL 1LD9B 4U0RC 1CDGA 2X4QB 3GM0A 1BBDL 3SDYL 3ZTNL 2FX9H 4HG4K 1NCWL 1HQRB 2GJJA 4RMQA 4KKCD 4NT6B 5DO2D 5FM5O 3MNVB 4MZ3A 3V4PH 3DGGA 1T1ZA 3TWCL 3SDXA 4JRXA 2FD6H 3ET9F 3KVQA 3O11B 3NPSB 4EDWL 4YHZL 5IHUH 5T1KD 3FTGB 3B9KC 3ZDXF 5E6IC 3QUYC 4YO0B 4RGOL 3KXFD 4ZAKA 1CDHA 5JW4N 5GS2D 4I3RH 1ZHBA 3BQUB 2PF6A 4ODTH 5EO9B 3P11H 2NX5B 4ZO8A 5FM8A 4YBLC 4R96B 5T1DL 1FZMA 5GIRB 2F8VA 5D1ZD 4I18C 2I24N 1Z5LB 5T1LA 1GZQB 4KK6C 5HDOA 3FAWA 2IQ9H 4AEFA 1KELL 2C1OB 3MTRA 4OLVH 1JFQL 5FDYA 2Y7QB 1GGIL 1CFQB 4L3AA 4NRYB 3E6HB 1GZPA 1HWGB 1Q8MA 4Y5YA 5C7XL 1S7RA 2XKNB 5E94A 1DQJB 3LSOB 3WFDL 3RHWK 4D0CA 1IMHC 2AK4A 1J0KA 3EJJX 5BVJB 2RR3A 1T83C 3HE6B 3ZT5A 1AGCB 1QNZH 3QIUB 5FEBA 4JPIB 2YZ8A 4HH9A 4JPVH 1UYWH 2P42B 4LIQE 3V6ZA 1KJMA 5FK9B 1BAFH 2BMKA 4TNVK 5TQ0L 5KBNC 3FQNA 5SWZA 3CVIH 5JORA 2W59A 5A16B 1V7NH 3MUGB 4LPTA 1NPUA 3DRTB 3QXWA 5DUML 3QCVH 2AJZB 4R97B 3IFLH 2V2XA 3UCRA 2VH5H 3FAXA 3G08B 3RDTA 5E2WH 1AIFA 3MJGX 2AJSH 3N1PC 4U6XB 4LLUB 3TNNB 3G5VB 1YEFL 3V7AE 3I6GA 1NBVL 1QSED 4LHUB 5KG9B 3QNYA 1KPUA 4ZS7L 1NGQL 1OLZA 3MJ9H 1DBAH 3DYPA 4OCSH 5E7FA 2X4NA 4NUGH 1XT5A 3FB7B 3CDGB 2Z9TA 3WFEL 1FVDB 5ITBL 1BFVL 3BPCA 2HT3D 1IGFL 2DLTA 5D1XB 2Z4QA 4Q97A 5FF6A 3DROA 2EDEA 3DVNB 5I8CB 2A2QT 4ZUUA 1P4BH 3L5JA 2DJSA 4YNYA 4HBCH 3T4YA 4Q6IA 4EQ2A 5BS0B 1MFEL 1N5AA 4GBXB 4N8PA 3KLDA 4LLYA 1NLBL 3OMZA 4EUPA 4YJZL 1MJ8L 3DX7B 3PHSA 4NPYA 1I1AB 1MF2L 2ZG2A 2W38A 3LKRA 5I1GL 3KPQA 4I77H 2JIXA 4AG4H 3KPPB 2E9WA 1U8IB 2MCG1 1KG0B 3O8XD 3LZFL 2EDHA 5B22A 1AKJA 4CN6A 4H88L 4XP1L 2V2WA 1QFWH 5E8OA 5CSZA 3BDBA 1J1OH 4NOFA 1JRHI 4ODHL 3WIHL 1E28A 4PFEA 3QDAA 1IVLA 4X4ZA 3BVNB 4Z6AT 3TCLA 1LD9A 1T7ZA 2X4QA 4GXUM 3RU8L 2F8OA 3P73A 4XXDA 3M8OL 2R23A 5GGVY 1QKZL 4WTXA 4JM2F 5EFIA 3MNVA 3EO0B 4AQ1B 5H2BB 3PDGA 1FG9C 3QPXL 3OXSB 3HZYB 4NHUB 4RGMC 4Y4KD 3FTGA 2OJZH 1C16B 4YO0A 4ALAH 1NMCC 1NBYB 1T5XB 2HG5B 5JA9A 1IQDB 3ARFD 3BQUA 1RZGA 5SWSA 5HPMB 5F7DA 2NXZD 4N8CL 5GIRA 1YEKH 4NSKB 2EIEA 4XB8A 1QBMH 3ILPB 5B8CB 1D9KA 3MR9B 4Z7UB 2VR5A 1GGBH 1KT2B 1E6OL 3UPAA 3VWJA 2Y7QA 3E6HA 1HXYB 4N5ED 3GBMH 4HWBA 3RA7L 3U48A 1FDLL 1KFAH 1N0XL 4JKPH 1FVCB 3VXUB 4FXKB 1X5ZA 3FRUB 1DQJA 4W4OC 2CH8A 2ARWA 3LSOA 1DBJL 1WIOA 4TVSa 5D7LA 1Q0XH 4MCYA 4MQ7A 1FGNL 1D6VL 4Y4FB 4LCCC 3MOAH 3GKWL 4Y2OA 5GPRA 4OCXH 4UQ2A 4DQOH 3HE6A 1KN2L 5DHVA 4N68A 5ADOL 4U6VH 1I8LA 2DBJA 3QIUA 2Y36L 4WI9A 3D9AH 3SDCC 3GHEH 1H5BC 3H0TA 2BNQD 2IAMB 3GSXB 1HZHL 2X4OB 4HXAL 5FK9A 4UMGA 2A6KA 3H2WA 3QO1A 1MRFL 3D39D 3RZCC 2LU4A 1IM9D 1KLUA 3DBXA 4DCQB 1P9MA 1ZEAH 5A16A 2E8ZA 3AY4A 3EO9H 2AJZA 2JJTC 5K93A 4R9HA 4U6HA 2J12B 2E7LC 1KC5H 3U9PH 3NFPB 4FNLL 1P7QD 2Y06H 3BZFB 3LKSA 2RHEA 3JV4A 4IRZH 3G5VA 5KG9A 1YNLL 2CD0A 4DVRH 2OTUB 3WFHB 3U36A 1FG2B 5AZEH 4LQFH 4LOUD 3CDGA 1IAKA 5M94B 5L88L 2NTFA 5T1KA 2XWJA 3MCKB 1KENL 2Z93B 5D1XA 3U46B 1JNHA 2VWEC 1T0NA 3RVXD 3P30H 4DUWA 1F4YH 3BWAB 2W07A 4HEPG 4NBXB 4HC1L 4V2CB 4U1LB 4B53A 5KJRH 3OR6B 3QXTA 3UPRB 3QNXB 2MKLC 2PNDA 5AYUH 5GQBA 4BZ2H 1AGFB 4JO2H 4LSQH 1QR4A 1X5LA 4MQXC 3DX7A 1NGZB 4ZAKC 2XQBL 1C5BH 1IQWL 1I1AA 4GT7A 1Z9LA 4K9EC 2BY0A 4JFFD 3KPPA 2R0LH 1LO4L 1U8IA 5I9QC 5IFAL 1KG0A 4DZ8B 3BYTA 4DZBB 1K6QH 1RZJL 1FE8L 3GBNL 1OAYH 5GS1B 2EDKA 3OPZH 4KJYA 3VXPB 3BKJL 1QUNA 2AV7B 3TBYB 3BGMA 2OMBA 4AYFA 2BNUB 5CJ8A 3GUTA 4JRXE 1IGMH 1R3HB 1F4HA 5MEOB 1IGIH 2DQJH 2X4RA 3VXNB 1MIMH 1I4FA 3QPQC 3PL6D 5I1CH 5FO9B 1VPOH 1XGUB 1YDPB 1FH5H 2KKQA 5BO1H 4ZUSB 1UEMA 4Y5YC 3ME0A 3K0WA 4G42B 3D1MC 1JZ2A 1WUNT 4I0PC 43C9B 1NFDF 3IJYB 1M05B 1DL7L 1LDSA 35C8H 1TLKA 3F5WA 4BZYA 4NHUA 1U95A 4QRPD 3TH3T 2E7HA 3RTQD 1C16A 1CK0H 3PP4H 4JLRA 3BPLB 4KKBC 1JWSB 1NBYA 1T5XA 4YDLC 1BD2B 2CKBB 2VL5A 1WZKA 3D85D 1INQB 3MLTA 5TF1H 5HPMA 4RIRA 5HI3D 2ARJA 3ILPA 3QDGE 2BC4A 4QHUB 4ZXBC 1D6EB 3HNSL 3BP5B 1FNAA 4LFHD 1AH1A 1N8ZB 5E9DB 2VISB 4X80L 4JHAH 4BUGA 3UTPD 1IAMA 5GGRY 1EO8H 3RVUC 3ARWA 4MWFB 4L3EB 4PJDA 3VH8G 1Z9OA 5ID1B 5J13C 2AK4E 3RDTC 1FVCA 3VXUA 2IBGA 4FXKA 5DWUL 2OR9L 4J2XA 2YC1A 1DQDL 4XHQA 5FGRA 3FT4B 2XWBB 5JW4M 1JYWA 4M8QA 1VFOA 1RD6A 1T21B 4DN3H 2ZCKH 5ILTH 4O51B 5MI0B 1FNGA 1CBVL 4G9FB 3SE9H 5SWZE 5GGTA 4K7PH 5A1AA 1INDH 3ARSA 2IAMA 2W0PA 2X4OA 4I48A 1MWAB 2J8HA 5EO1A 2FSEB 1I7TB 4DCQA 1MFNA 3RUGA 4Q9QL 3O8XA 4Q6IC 3PHQA 1T1WB 3FOLB 3SE8H 1RZIB 1ZHLB 4PG9B 1W72A 43CAA 3IDNB 2EE9A 1AGEA 2I26N 3LQZB 4OCYH 4UV7H 3ZE0E 1IAIM 4HQQL 2B1AL 2DMCA 1GL4B 4HXBL 2FYYB 3RVTD 4YHLL 3BDXA 1EGJA 3SOBL 3KYKL 4YPGB 3WFHA 4XRCB 1JIBA 4DGYL 3H3KA 2FATL 4LRNH 1CWVA 4HJJH 5EIIB 1YYLH 2Z93A 2FO1A 5TDOB 4LL9A 3U46A 4LPWA 3ARFA 4TVPD 4EOWL 3U83A 3BWAA 1KTKE 3GI9L 4QRSA 1GAFH 2ENYA 1RAMA 4A6YH 3NPSC 1O5DT 5DRNB 3VE0A 4TSBL 1L7TL 3O4LD 5J3HC 3QEQB 4JY5L 1CFVL 1NGZA 2ID5A 3G6DH 2Q8AH 4MXQC 4QXTA 3BQUC 3L5HA 5KSAB 3QDJB 5CEYA 3B43A 4XVSH 3F7PC 4DZ8A 1A0QH 1FLRL 4DZBA 3ILQC 3ZDZF 4P0DA 1B4JH 4JQVA 2DTSA 3VXPA 2AV7A 3UYRL 3DO3A 4PY7A 4PRID 1KCSH 1R3HA 1FO0H 5MEOA 3VXNA 1H15B 4DN4H 1YEDA 1NMBL 5FO9A 4JDZB 2DQUL 1DANT 4LBEA 1DFBL 1FIGH 4JANB 4XZUA 3TO4D 4G42A 2ATPB 4LSTL 1NCBH 3NCBB 2E7CA 4FQIL 1ZT4B 4Y2DB 3TZVD 3NMEA 2FL5A 2VUOA 1LP9B 3QIWB 5SWSE 4N0CC 3WJLC 2NR6C 4P46B 3SJVD 4MNGB 3K8MA 3N1GC 5IQ9B 4BK5A 1U3JA 1JWSA 1JPGA 3Q2CA 3CDYA 3HE6C 3D39A 1ZANH 1KEGL 1JNJA 3INUL 1A6UL 1INQA 2XN9D 2ICWI 1I8LC 3QIUC 4WUUA 1RV6X 4GUPA 4R90L 1FIEA 4XPFL 4ZYKB 2VXQH 4U1KB 1SYSB 1YNKH 4MD4B 3EOTL 4Q9RH 5C09B 4ETQB 1P7QA 2DOCA 3NIFF 3KJ6H 1N8ZA 3L5WB 1R5IB 5F96L 4RBPH 5JHDB 3WCYA 4QWWC 4L4VB 1KXTB 3AY4C 3UX9B 3MRIA 5D7LE 2BX5A 1JNLL 4MWFA 5D72L 3OB0H 5DFWH 4OBRA 4OT1L 5CGTA 2W9DH 2X44D 5EU3B 4KI5E 1DEDA 1N5YL 3BGFB 1TXKA 3FT4A 1ACYL 2P47B 1NGYB 4TULL 4NO5B 1RMFL 4UI2A 3V4VH 2YUXA 4NWUL 2A9NL 1J0YA 1T21A 4UINH 2XKSA 4YBHA 2R0ZH 3T4AB 4HS6A 3MACH 4K8RL 1L7IH 2OLDA 1G7IB 4HW6A 2X4TA 5D1XC 4ELKA 2QQKH 4XCCL 3EO1B 1J0JA 1BP3B 4JFFA 2Z91B 3SKNA 4Z8FH 3HLAB 1U8KA 1X5FA 2VE6B 2FSEA 1I7TA 5DD6A 2EKSA 1A9BB 3TYFA 4DUXA 4H20L 5DRXB 5HYJE 3BH9A 2APXA 1NC2B 1U58B 4XXCA 4GBXC 1RZIA 4I3SH 2FZ3A 3IDNA 4URTB 4Z95L 5TH2B 1UM6H 2G5BB 3MRRB 4H0HB 1I1AC 1EPFA 2Z35B 5IHZA 1OHQA 1XR9B 2EXYD 4F7TB 1U8LB 1IAIL 5C71A 5GZNC 2CUHA 4NCC1 5BRZD 4JFDB 4NQDD 4JN2A 3GIVB 4LEOA 4U1GB 1CLOH 3KXFE 2YD8A 1FRGH 4YPGA 1FYHB 3FQRB 2CIIB 4XP5H 1A1MB 2EH7H 4MNQD 4QRPA 3B9EA 5EIIA 3RTQA 1U8NA 3S4SA 5TDOA 5GS0C 4ONFH 1DE4B 4WW1A 5B39B 3D85A 3TBSA 5BQ7B 4MB3A 4EUPG 5T5NF 5E8PB 4LKXB 1YZZA 3QHFH 3QUML 4N0UA 4UUJA 1QSVA 2HVKB 2AABL 4YX2L 2MQCA 3QEQA 1MVFA 3MMEB 3KGRA 1MFAH 5DLML 1TJGH 4LSVL 5ACLA 3O2VL 5H37H 3UZVB 3MJ8B 1HHKA 2AXJA 2ICWA 2IH3B 3LEXB 4RBPK 4C83B 4YHMH 5B8CC 4C59B 2VDLH 2XPGB 3THMH 3VG9B 3OB0K 3CMOH 3VXSD 4ZO7A 5B38B 3O0RL 4LLDB 4MAYD 4WUKH 4JDZA 1RZ7L 1RIVH 4L8SB 1F5WA 1QP1A 3VFTA 3Q1SL 4GG6B 4CUCA 3RWEB 3QIWA 4HSQA 3MLYH 4Y4FC 3VJ6A 3BRDA 5IQ9A 1PYWA 3NCYP 2JTDA 5E4IA 4NRZB 1DVFD 1RZFL 4ORGB 5BOZG 3I84A 1YJDC 1KXVC 2AVGA 1BHGA 3HMXH 3BT2H 4KK5D 4M7LH 3PV6B 2IAMC 4UILL 5D5MA 4MA8H 1QSEE 4U1KA 1JPFB 4OV6F 5J12B 5FGCB 5C09A 2Q1EA 1IM3B 4QO1A 4ETQA 4PJDE 1R5IA 1FPTL 1UG9A 2IPKA 5JHDA 1CDBA 2FDBP 3MNZB 1P5VA 2EXWC 3TBWA 5DJXA 3ZYZA 1ZVYA 4YHYB 3PWNB 4B0MM 4PJCB 5EOTA 4X8JA 5BMFL 1R3LA 1X5YA 5HHOD 1CXIA 4XNMA 1NAMA 4GOSA 2YUWA 3WNPA 2VR9A 4NKQB 5J11B 4L5FH 4PJ7E 4GMSL 4P23B 2GK0B 4LCYB 1NL0L 4R4FH 1SJXA 5DD5H 2EYTA 4G6ML 2BVQB 4U1MB 1R6VA 4QRRB 3IETB 3T4AA 3BKYL 1SQ2N 3RUGE 3O4LA 2X09A 3EO1A 5CEZH 2PXYB 2H9GB 4OFIA 4OZGB 3ULUD 1Q72L 2VLMD 4P2QD 4LDLB 1ZLSL 4Y1AB 1YEGL 1NC2A 2IGFL 4GSDL 4CGTA 3LRHA 4CNIB 3MYZA 4R7NA 4X5WB 2OZ4L 1T1XB 2VDPL 2QTEA 3FO9A 4PD4K 4R26H 2Z35A 1U8LA 1ONQA 4Z0XB 4JHBA 3R8QA 3VFSB 5JQ6L 2D4DA 4JFDA 4J1UB 4MQXD 4XNUH 3E6FA 4CVXA 4U1IB 3GIVA 5I19H 4OLUH 3RKDD 2CDEA 3TO4A 5K9JH 4JFHD 2DQFA 1YEEH 4OGZA 4NZRL 5J57B 1E4WH 3SJVA 1IILE 3PWUB 2ZNXA 3VW3H 2B2XH 5IP4A 4FFWC 1DDHA 3CFDB 1A7NL 2BVPB 4LLAA 4PJFA 1DE4A 2XN9A 4LKXA 4MA1C 2HVKA 4M6AA 4KMTL 4X99B 2VO5A 3MOBL 3HC0B 5IESL 3GRWL 1A6VL 4JKLA 1UWGL 3U30B 4WEBH 3BPLC 3GMMB 1J5OL 2XZZA 3MMEA 5D71H 5HHPB 4I5BB 1RURH 4I0PD 5I8KL 2COQA 1GOHA 2PYED 3EDEA 3DX8A 2D31B 4JY4B 5DQJA 2XV6B 2DJ4A 2YPLD 3MJ8A 3LEXA 5GRXG 5C07D 2X5PA 3FFDB 3VD4A 2AQ3A 5CSBA 2IAND 4TQEL 2X1QA 2XPGA 3MRHA 3MLRL 5I0DA 4MMZC 3R0MA 3V6OA 3JVGA 5IV2B 3ABZA 3MLXL 4LLDA 4KROB 2BNQE 1JHTB 1VB9A 4L8SA 2P5EB 1WBZB 2IPUG 4GG6A 1G7LB 3D39E 3DSNA 2CK0L 3DPBA 4RAUB 4DGIH 3RWEA 4NFCA 4GH7B 4EQ3A 2F53B 4WUUE 4XMPL 4LRIA 5ECJE 2VKXA 3AAZA 3GK8H 2YXMA 2J8UB 3GI8H 4TTDD 4U0QB 2XA3A 3LB6C 2WZPD 1R3KA 4NRZA 8CGTA 4U6YA 5MI0C 2Y1VA 3D48R 1II4E 4ORGA 5LXGH 1T5WA 5J9PB 1INEH 3PV6A 4UIKL 2FIKA 4P5MB 1MCOH 2MCPL 4P4RB 3FCTB 1JPFA 4WU7B 3LOWA 4UTAH 1JGDB 2DQGH 2H3NB 2D7TH 3ALXA 2EIDA 5HTSA 3ZTNH 1BBDH 5BRZA 3SDYH 4NQDA 1NCWH 1T0PB 3D18A 2ZG3A 3MNZA 1QRND 1TMCB 4XXCC 5IMKB 1D5IL 4YC2B 3HE7B 4EN3B 3RNKA 3TWCH 1IAOA 3L95A 3PWNA 3VI4E 3CFCL 4IM8A 1A6PA 3D25B 4P4KB 3WHE1 3FHQA 2EDNA 3PQYB 1V8HA 4MNQA 2ZOKB 3TJHC 3UTSB 4EDWH 4YHZH 4PJ5D 3MLSL 4LARL 3DETD 4P23A 5DI8B 3W2DL 1WZMA 4RGOH 5HVHB 4UDUA 4HFUL 1MCQA 4HPOL 5JPNA 1BWMA 3TBVB 3IETA 5T1DH 4JFFE 4CJ0A 4HLZG 4LGSB 1K4CB 3OKDB 1NGWB 4HF5L 5EUOB 1ZWIB 4LLMB 4GRWE 2H9GA 3WXVL 1N6QL 3N9GL 1F4WL 1WTLA 2BY1A 4AH2A 1KELH 4E41B 4AENB 4EKXA 2V5MA 1JFQH 4Y1AA 4JFEB 1GGIH 4GO6B 1DN0B 3CSYB 4CNIA 1EEUA 2X9WA 1RJYB 5F7EL 3CDFA 1JF6A 1UWEL 5C7XH 3TVMB 5KSAC 2NXYD 3AUVA 1NMAL 5GHWL 2HKFL 5KSUA 5A2IH 4PLOB 3WFDH 1QG3A 3RPIB 3ROLB 3VFSA 2L0DA 2G5RA 4QRPE 2BJML 3LH2L 1YPZE 3BJ91 5HGAA 2NZIA 5IT2L 7CGTA 2B7DT 2NX5D 3VXRD 1K8DB 5BXFA 1DTUA 4KDWA 3UXFA 1ADQA 2M2DA 4EI5B 5IMLB 2BVUA 4N0UE 4XTRD 3WL9B 1I1CA 2YA0A 1MHHA 1EHAA 3CFDA 2BVPA 3L3DA 5TQ0H 2P7TB 3A0OA 1N4XL 1DVFA 1S3KL 1X5HA 5DHXB 4O2CA 4U49A 3SGJA 3IJSB 2NW2B 3QIWC 1RZKH 2Z31D 4V1DB 5CZVL 5DUMH 1DR9A 3UTPE 5A3ID 3O41A 4MXVF 1Q9WA 4F7PB 3GMMA 3PWJA 4R4BB 1GPOL 5GGSB 3RWIA 2B20A 2AV1B 3FFCD 4JY4A 1OP5H 1YEFH 1NBVH 4M4RA 2E6JA 3DGCR 5HY9A 5CD5C 1NGQH 5HI5D 4EBQL 3B3IB 2QQNL 3C5ZD 4IRJB 4Z7WB 1HHHB 3WFEH 1IEAB 4BSWB 5AG9A 5ITBH 5IV2A 1BFVH 3H9SD 4OIIL 1IGFH 5DUBB 4L8BA 1KJ2B 3DVFA 3E2HB 1R5VB 1JNNL 1TZIB 1JHTA 4YK4C 2P5EA 2BSTA 1MCBA 5I8EA 1WBZA 2APFA 4IDJL 3X12B 3IDIA 4JVUA 5JW4R 4X6FB 1MFEH 3K4AA 3ZTJH 1OTTC 2GY7B 1NLBH 1OSZB 3NCCB 4I2XA 1MJ8H 1XZ0B 4HIJA 3BEVB 5D5ME 4HDIB 4JO3L 4M7LT 5I1GH 1WTGT 1R24B 1U8PB 1J1PL 4YXHL 1S78C 5DHYB 4LHUD 3LZFH 4QHNB 4XPBL 4HG4J 5F1NB 3CFBB 4M00A 2E6PA 4H88H 1JN6A 4XP1H 4P5MA 1CVRA 3LPGA 3FCTA 3GSOB 3ISWA 5HHXL 3K80A 2IADB 4X4YB 4ODHH 3WIHH 4KI1A 1JGDA 4PJ9B 3VXQB 3IFNL 3RU8H 4GRLB 3RL2B 3M8OH 3WXWL 5IMKA 1NEUA 1XF2A 1QKZH 3SE3A 4R0LB 3HE7A 4LF3B 3QA3A 4G3YL 3AREB 4TVPE 5FCSH 3QPXH 2XY1A 2BVYA 5BS0D 5CJOL 1TQBB 3OXRB 4M62L 5I8OL 5DI8A 2HJKA 1JWMB 3O4LE 4U1GC 3MCG1 1ZGLB 3BOVA 3ZZ1A 1QFWI 2XQYG 3TBVA 1HSAB 2HH0L 5FOBB 4N8CH 2JB5L 1JZ8A 1K4CA 3OKDA 1NGWA 2R15A 4LLMA 1MCEA 5IMOB 4JDVB 1KCRH 4F37F 1TDQA 4KUCD 2PYEA 1E6OH 4E41A 5BV7L 4PRIE 4QOKD 4D0BA 1PD6A 4OFPA 4JFEA 2YPLA 1I7RB 1WT5C 5K33A 3CSYA 3JWDL 3DWTA 1OP5K 1RJYA 2LAGB 3RA7H 2IANA 2NLJB 1FDLH 1N0XH 3WSQL 3TVMA 4FQ1L 2BRQA 3JTTA 1SJHA 2H2PC 4O2FB 1DBJH 4G7YL 4G8FB 3SEPA 3RPIA 3BUYB 3WFBL 1FGNH 1OT2A 1H0DA 3VGDA 5L2JB 1L6ZA 1E4KA 3SJVE 1D6VH 3H9HB 2X4PB 3GKWH 2QR0B 2F5BL 4MAUL 1FJ1B 1KN2H 3ZE0F 3OHXA 3VG9C 4NIKB 5ADOH 2XN9E 2Y36H 1QLFB 2FLBT 2EDYA 3MRDA 3K8KA 4GAYB 1HZHH 4HXAH 4FQPA 4PJXB 2HJFB 5A2FA 5BW7A 4L8SC 1MRFH 4NQSB 5EU5A 4ODBD 4YR6B 1OB1B 3MOQA 2HA1A 2VQ1B 3G6AB 1XGRA 4V1DA 4LFHG 2XXMB 4NKMB 1P53A 3U1SL 4K07A 5IK3B 1K5NA 4PV9A 1BLNB 4OUUB 5L2KD 4FNLH 1BQHA 1YMHB 5IFHL 4L3CB 3DARA 5GGSA 2FGZA 2YEZB 3V6OE 1TVDA 4OGYL 3MJ9A 4Y4FD 5FIEA 1YNLH 5E70A 5J12C 2Q86A 2DTML 4MJIB 3B3IA 4IRJA 4NQCB 2R1XA 1HHHA 3LKQA 4BSWA 5I1DA 1J0ZA 5L88H 4PJ5A 5F7LB 1KENH 4PJ8B 1GCFA 4U2YA 5IVOA 2BHZA 4P9HC 5FKAA 4YHYC 1R5VA 2ORBL 1XR8B 5F7MC 25C8L 1GC1C 4KJPC 2WIMA 2WBWB 5J11C 1G9NC 4X6FA 5FYLL 4P23C 4RGNB 5D1QB 1HIML 2XQBH 1IQWH 2FHFA 1FGVL 4HDIA 4QRQB 3MLWL 4Y19B 1Y6MR 4HZAA 1LO4H 3S96B 5IFAH 5DHYA 1VKXB 3DYOA 1LVEA 1RZJH 3GBNH 1FE8H 1MOEA 4QHNA 5ETUB 3CFBA 4UU9A 5F1NA 1CLYL 5BRZE 2CDFB 2HRLA 3MBXL 4NQDE 1R3IL 4LPCA 3BKJH 2IADA 5HYIA 3MRLA 3I3DA 1VACB 4Z78A 2Z0BA 2J7LA 3TA3D 3DMMB 2R9HC 4MA3A 1X5JA 3RL2A 1W0WB 1EO7A 4MNQE 5FYKD 3NAAH 3VFVA 4R0LA 4OZFB 3WBDA 5EULV 3AREA 3VXRA 4U7MA 3QWRD 3VRIA 2OL3L 3QR2A 3GHBL 5MEPB 1DL7H 1CT8B 5GGUA 4QCIB 5KTEL 3RNQB 1ZGLA 4W6XB 2I9LB 4HV8A 1I3GL 5D2NA 4OF0A 3DVGB 3U4BL 4KI5F 4IS6A 5DJCB 1HSAA 2Z31A 5FOBA 5D70L 2AERT 4JM4L 3JV6B 3HNSH 4JDVA 1AQKL 4NM8L 2H8PA 1Q9OB 3VXSE 5DEZA 4X80H 5IR1B 1I7RA 4NN7B 1G7PB 3U30C 2NLJA 3W11C 1TNNA 5DWUH 1X4ZA 1I7ZB 2OR9H 4UAOB 4G8FA 3H9SA 1DQDH 3BUYA 4HUXB 2WAHA 3C60B 3H9HA 4JCMA 1PG7W 1FJ1A 4ZOBA 4IRSB 5EZJA 3CFKB 1CBVH 2V2TA 3SDAD 4WHTA 3MNWA 5ERWB 4IDLA 1ZXQA 2W1NA 4EVNB 4HUUB 2KUTA 1QLFA 4XWGL 1CD0A 1IGCL 4KROC 2X4UB 2CLRA 4EEEA 1N6UA 3FZUC 3TJEL 1DANU 4NQSA 4S11A 4PGCA 5EU7E 2XNAA 5A2LH 1OT1A 5EZOL 1OB1A 4Q9QH 3CZFB 2VXTL 5DFVC 3RL1B 1YYML 3VXMB 1F58L 2YSSB 5LGJA 3G6AA 3D2UD 1J9CT 5D7SL 2YD4A 4FRWA 5IK3A 5F21B 1UM4L 4M9PA 4G8EB 1OTUD 4HQQH 2B1AH 4L8DA 3MPCA 5HHOE 4LMQI 2X10A 2YEZA 3HZMA 4RX4D 4HXBH 3TFKD 2BHYA 5AD0B 1B0RB 4YHLH 5J1TC 3SOBH 4ZUVB 3KYKH 2HLFD 2UVEA 5C0DB 4DGYH 4NQCA 2FATH 4IMKA 2E27L 2DLIA 3SPVB 2NY0B 4XNQB 4YC2C 3SE3C 3HE7C 4MA7L 3CIQA 4EOWH 1K3IA 1XF5B 4I2XE 3T65A 5FO8B 2IQAA 4PJGE 3GI9H 4B41A 3H8NA 3WFZA 3DLQR 4X7TA 4P4KC 5FO7A 3ULUE 2BVOB 2VLME 4N0FB 4P2QE 1I8IB 2FJHA 4TSBH 1L7TH 1KB5B 2P5WA 4JQXA 4NN5B 1OGTA 3HZKB 4JY5H 3LKNB 4MYWB 1CFVH 5D1QA 5HVHC 1VHPA 2WBJB 4NHCL 2VABB 3I6KA 5HD8D 4MB4A 4QOKA 3S96A 3QDHA 1VKXA 1FLRH 3TF7C 2WWMC 4I1NB 4M02A 4PY8J 2YS4A 2Q87A 3IXAB 5E8NA 4DAGL 1YECL 2JE8A 5D7IE 3T04D 3UYRH 3IAGC 3IF1B 5EBMA 1ZA3A 4JG1L 3ZLQC 1BWWA 4JFHE 3QEUB 3DMMA 1NMBH 3RI5K 4KKLC 2DQUH 3NCFB 4KTDL 4NGHL 4Q9CA 1I9JL 1DFBH 1T89A 3QCTL 1MI5B 3L3IA 1P4IL 5DURD 5IUSA 3TVMC 4LSTH 1IBGL 1QA9A 4FQIH 4OZIE 4WU5B 1CT8A 1AR2A 4RNRB 3BKML 1OAQL 4QCIA 1E4KC 1OGAD 3MXWL 1HQ4A 1T1YB 3T0EB 3ZO0A 4RFNB 1I8KB 2X89D 1EXUA 5ESVA 2OTPA 2I9LA 3QDJD 4KC3B 1KEGH 1A6UH 3INUH 3C5SB 1W8OA 2IMNA 4R90H 4OM1L 2PYEE 4EI5C 4PJ7F 3X17A 1G6RL 4XPFH 2YPLE 1FNSL 5C07E 4HIEB 1TQCB 3EOTH 1U8JB 5L2KA 3OJDB 4XP4L 4F57L 2IANE 1MAML 4NCC2 5F96H 4D0DA 3A6OA 4PLJD 4BSVA 1MRCL 3CLEL 3LN5A 3KJ4C 4LCUB 5JO5B 4ZUWB 3CU7A 3DI2B 5FDWB 3REWB 2ZJSL 3EGSA 1JNLH 3MV9D 5D72H 3SGEH 4R4NC 4OT1H 4XBPB 3QFDB 4AEIL 2UZYB 4Y2DD 4PRPD 1N5YH 1ZAGA 1I7ZA 2ZKHL 4P46D 2OYPA 5H94B 5TQ2L 4ZQKB 1P84K 2J4WL 4HUXA 1F3JB 1ACYH 3GJFK 4TULH 1HH6A 3MQIA 1RMFH 3L9RA 4RMUA 2WSKA 3B6SB 4NWUH 2PETA 2A9NH 4O58L 3HCVA 4KK9C 4X9GA 3M1BB 4IRJC 1QHPA 5ERWA 2Q8BL 4K8RH 5GRZA 4OLWL 4HUUA 5K59E 1WFTA 4XCCH 5E5MA 3E2HC 4X6CA 5GRWA 4L29A 4HKZB 3R0NA 5FKPB 4X8XA 4M61B 4H20H 3CZFA 3K81A 3RL1A 2YSSA 1MLCA 3K2UL 1OAUL 5JW5B 3IDMA 1QRNE 4Z95H 3WN5B 1BJMA 2DM4A 4R7DA 4JFPA 4CU6A 3NOIA 3TN0B 3TA3A 2EDOA 1OTTD 4LNRB 4NC1E 4POZC 4JGJA 3I6LD 2APWA 2HT4D 5AD0A 4PJ5E 1B0RA 1UJ3A 3I2CL 3NCYS 3VFNA 1ACZA 3BPNC 4HX1B 5C0DA 4PJ9C 5C0BD 4CMHB 3C87A 5JA8B 2BERA 4GRLC 1CLCA 4P2RB 3ZKMC 1WCBB 4JM2D 3QJHB 5E56A 5F7YC 4R0LC 1CFTB 1J7VR 3IDGA 1F4XL 5D6CA 3AREC 4CDHA 2YD2A 2ADGB 2OK0L 5CEXB 2QADB 1HWHB 3QUMH 1TQBC 4N0FA 1WEJL 4NKIH 5CEZD 1B9ZA 2AABH 4YX2H 1A6ZB 5FGBA 2VDKL 4HKBA 4U1SA 3W9EB 4YXKL 4HMCA 4OQTL 3BMWA 2WBJA 5DLMH 2VABA 4WEMB 4LSVH 3O2VH 2PYFA 4C54A 1KPVB 3MRJB 2BOCB 3N85L 1FO0A 1U3HB 1RHFA 3EYSL 3IF1A 3LVEA 4ZSOA 3PJSB 4HIIA 3QEUA 4X6EA 3VXRE 3O0RH 5J06A 1SVZA 4JAMA 4ZMAT 3VGAB 1RZ7H 2AXHA 1UXWB 1LDPL 3STZB 2ENSA 2N7AA 3Q1SH 3SDAA 4PJIA 1OP3H 3W0WA 1OWWA 4WU5A 5D2NE 4GQPH 3DXAD 2FX7L 4YHOL 4ZFZB 2Y5TB 1MUJB 2DI7A 2PO6B 3O3DB 3T0EA 4ELMB 4K94L 1K4DB 4XBGB 4AEHL 2FJFB 5DMGC 1NFKA 4M3JA 1RZFH 4F3FB 1IZJA 3N1FC 4NFBA 5DJ6A 3U0WL 2FB4L 4U7SA 1S7UA 2P1YA 3D2UA 3FFCE 5DR5L 3BRGC 4GW5A 4UILH 2P8LA 5CD3B 3B5GA 4HIEA 5E5RB 1JYXA 3FQUB 1U8JA 4HK0A 2F58L 1WWCA 4NNYA 1FPTH 3HR6A 4RX4A 4MCZB 2D9CA 3QHTC 3REWA 4WW2A 3CH1A 4ZS6D 5L8JB 4FQXB 3H9SE 4G6AD 3OKKB 1J8HD 5C0JA 4GRWF 4OF5A 1XCTA 3BDYL 5BMFH 4X9IA 4S1DD 1DQTA 3S37H 4PRNB 5EU6B 4N9OB 1DZBA 4OZ4A 4ZQKA 3RWDB 4G6FD 1F3JA 4GMSH 1ORSB 1MVUA 3HAEH 5JUEL 2E9JA 1NL0H 2CLVA 2GCYA 3B6SA 1WWAX 4G43B 5JOPD 4G6MH 4LAQL 3IRPX 3JZ7A 2EDTA 3M1BA 2CK2A 3BKYH 4IMKC 5C86A 5DS8A 1FVEA 5EH1A 5HGDB 3RY5A 4PJ8C 1YPZF 4Z18A 3JUYA 1V5JA 3X11A 1RJZB 1AR1D 4DTGL 3BZ4B 2X41A 1L6XA 1Q72H 1X44A 2ZNWA 1ZLSH 3QXVA 1YEGH 2KL6A 2J6EA 2IGFH 1UB5B 4GSDH 4JQXC 5CZKA 4RGNC 1BQHG 2ITCB 2FJGA 4JPKL 3MYJA 3FO2B 5D1QC 5F1IB 2OZ4H 2VDPH 4WDIB 5LG1A 3KYMA 4D9LL 1B0GA 1UA6L 2ILLA 4PGDB 4TUJA