1CIDA

Crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
177
structure length
177
Chain Sequence
TSITAYKSEGESAEFSFPLNLGEESLQGELRWKAEKAPSSQSWITFSLKNQKVSVQKSTSNPKFQLSETLPLTLQIPQVSLQFAGSGNLTLTLDRGILYQEVNLVVMKVTQPDSNTLTCEVMGPTSPKMRLILKQENQEARVSRQEKVIQVQAPEAGVWQCLLSEGEEVKMDSKIQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of domains 3 and 4 of rat CD4: relation to the NH2-terminal domains.
pubmed rcsb
source organism Rattus norvegicus
molecule tags T-cell surface glycoprotein
molecule keywords T CELL SURFACE GLYCOPROTEIN CD4
total genus 37
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 1993-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cidA02
5ITFA 1I7UB 1AIFB 2EH8L 1KJ2H 2VDPL 1MIEH 3CVIL 3GSNB 5GRVK 3M45A 2EH8H 3HZYB 1CG9B 2OP4L 4MNGA 5C0RH 3QAZB 1S7SA 4XMLL 3C09C 4ZOAA 5HGBB 3GBML 4S1QH 1J7VR 4Q6IB 1R5WB 3NCYP 3DETC 3QUML 3VRJB 1FN4A 2R0WL 4ODVH 1C7SA 3FB7B 1VADB 4RAUB 5FFLA 2VDNH 4C56A 3MPCA 1QR1B 4UILH 1I85C 3RGHA 1CS6A 4X5LA 2XNAB 3SQOL 2IPKB 4ZO7A 3KPPB 3M8OH 3QWRA 4ZDHA 3VWJB 1J5OL 4EZMA 1ZMYA 4IRJC 4L3CA 3V5DB 1K6QH 1U8JB 3VE0A 1KLGB 3CSGA 2DBLL 4NUGH 4WTZG 1BECA 2ZJSL 4DEPB 1IAOA 3VXNB 4RGNB 1A7RH 1LEKB 4FXKA 1A7QH 4F80A 3INUH 1YEGL 1T3FA 4P23D 4PP2A 3TF7C 3DV4B 2GJZB 5IJVA 2BVPB 4ZQKA 4LLVA 1U8PA 5F9OL 3ARBD 1C5CL 2XOTA 5B38B 2HTKD 3KPLB 2F58H 2OR7A 1AHWC 3NIGE 4HFUL 3RUGE 2NY0B 2ADIB 3S5LB 1IM9D 4FZ8L 4MJ5B 4MCYB 3T2NL 3MJ9L 5HGGS 3QQ9C 2OJZH 4KMTL 4LCWB 4MQ7B 5MERA 5FYJU 5ICZB 5E8DH 2ZP0T 3O4LD 4NRXA 1RZGB 4CMMA 1DBMH 3TLRA 4AM0B 5I1EH 4TQEL 5HHME 3OAZH 4HS3A 2BHYA 1C8PA 1FVDB 3D0LA 3F6IA 1Q72H 2PXYA 2H8PA 3QXUA 1TVDA 4HIEA 1TJHH 4EOWL 4U49A 1X6NA 2OJEA 5SWSB 1U8JA 1ZXQA 1ZGLA 2IAMC 3QDME 1PSKL 3RVVD 5IBTL 1FSKB 5ITBL 4HXBH 4DGVL 3F62A 5ILTH 4ZNCD 1W72H 4AJ0A 2GFBB 3ARGD 5F89B 3JTTA 3IDXL 4RFOH 5FHAL 1VADA 4G6KL 5HHOD 2YN3A 3MOAH 5HHPB 1UWEL 2BCKB 2YXFA 4WNQB 4L3EB 1NMCB 1MIEL 3IFNL 4PGBA 2ARJQ 2A6DB 3JTSB 5C0AB 4HZAA 2YD6A 2YS4A 4XVSH 4WTWA 2R23A 1DUZA 2G9HA 1EEYB 4FXGA 5E4EC 5JUEL 3U1SH 1FL3B 1M4KA 1MHCB 1A3RL 4E41B 3WLWD 1AKJD 3W0WE 4UUJA 4XNZB 1IKFH 4LLAA 2DI7A 2NYYD 1GIGL 1ONQB 2W65B 2E7LA 3E1F1 4X0KA 1OARH 5I19H 25C8H 5ALBL 3O3AB 3VRIA 3MR9B 5JMOC 5I30H 1J1PL 1WF5A 1FVDA 5IHBA 2MQ0A 1OD7A 3RY5A 4KVNL 4WO4A 4G8EB 2CD0A 5HGDB 4KJWD 3EDEA 3MGTA 3QHZH 3NCFB 3QEUA 4GXVL 4PB9L 2BRQA 5EU5B 3BP4B 3DRQB 3KPRA 1EHNA 2ESVB 4OKDA 3MYZA 4JFHE 2A9NH 3SBWA 1JNHB 3NTCH 5JO5B 1Z3GH 5D1ZC 1F97A 1MI5E 1MRCL 1RIVH 4OM1H 4WDIB 1CDHA 4OLUH 3PQYE 3WFZA 5E24E 4LLUA 5EIIB 5IVXE 5J7CC 1GAFL 4U3CA 1EZVY 5IVXF 5EU7C 3BD5A 1HILB 5I8OH 1G7HA 1AP2A 4EIZC 5B8CA 4BSVA 3DIFA 1KIPA 5F7MC 4YXLL 3CJJA 1KN4H 4JO2L 4E42A 2OR9L 1P7KA 4HKJB 1HKFA 1YY8A 3MFFB 4Z77A 1QRNA 5IBUB 3H42H 5IMLA 1LDSA 1YEIH 4O51A 4BZ1H 1OP3K 3SDDA 3ZTJG 1RUKH 4JEGB 4QXGH 4KZDL 1FAIL 2ICES 5ADPH 1OTUD 3H7BA 1J12A 2BY1A 2L7UA 2ZNWA 4M93C 3MRIA 2IPKA 5JR1L 4YNYB 5HHPA 3E0GA 4Q2ZA 5IM7B 3KHOA 4OGXH 4Y2DC 2OX5A 3IFOB 3RWEB 1T04B 1C08A 1QO3B 3V4VL 4KH2A 4Y5YA 1N0XL 1S7RA 3QT2A 4IRSA 4CU8A 1MCLA 1PFCA 3QUKA 3SCMD 3IETA 3NOIA 3RWHB 5DWUH 2VLMD 4FMKA 1HYRC 1LP9E 2HFTA 4LEXL 3UTSE 4DTGH 5DUPL 4NO2A 7CGTA 5KVMC 3UJJH 4HUNB 4YDIL 2FJGA 5HDBF 5BVJA 2X42A 5C0BD 4PRDA 5BV7H 1P7QA 5LWYL 5DK3A 1U8MA 3VH8A 5ESQB 3QG7H 5KVDL 1AJ7H 1BZQK 3RWIB 4L4VA 3MX0A 5AD0B 4MJ5A 3HZVA 3A6CL 1SHMA 1V5JA 2J12B 4XC1H 4YHKH 5F21B 3VFPA 3PL6A 4J3UA 1KF9B 5HI3D 5GIRB 1AQKH 3RP1A 1U8QB 4ISVB 3T3MF 1YY9C 4X4ZA 5JOEA 1QSED 2V9QA 3MBEC 4D9RE 2DLFH 4RBPK 5KSBE 2QLVB 3GJFH 2JCCE 4YUEL 5A2IH 1W72A 4M7JL 4LAJH 5KSBA 5JUEH 5DYOB 4WHYH 3N9GL 1XIWB 1OVZA 1EAPA 3O3EB 3BPCA 1ZANH 3ESVF 1CF8L 4NO5B 3IFNH 1FHGA 3E2HC 3OKOA 2BOCB 1S5HB 1A9BA 3KYMA 4P2RA 3VXMA 3TBYA 1ACZA 3EBAA 3OHXA 4O58L 3VGHA 2HYMA 1RD6A 5IFAL 3LKNB 3WV0A 5DDHA 2HT2C 3IFLH 3KPNB 3QUXD 1DEDA 15C8L 4RBPH 4LLWA 5DS8A 1FPTH 3B5HA 2QADD 4LARH 3SCMB 2ZOKB 3DO7B 4X99B 1EERB 1YUHA 1KV3A 2FGZA 2AJUH 3BDYL 4GOSA 1EIBA 3QISA 3HLAA 3TV3L 4DCQB 4N8VG 3CDFA 1ED3B 5DJ0A 1SEBA 3BEWA 1CE6A 4OM0H 5J6GA 2AJ3B 4JY4B 3MNVA 2R0ZH 2YD3A 3RIFK 2WANA 1SY6A 4F7CA 4HFUH 1YEEL 3IDNB 4PTUB 3ZMRA 4DTGL 1N64H 5ICXA 3LN4A 3BD3A 1UEYA 2JCCA 1CIDA 3RJQB 1Q9OB 4PPTA 4XI5D 2OCFD 5D71L 1OP9A 2Z8RA 5HGHB 4HXAH 5IM7A 1BJ1H 4GBXB 3HCVA 5D7JD 1UZ8A 3CUPB 1U8IB 5I19L 1U8NA 1KG0A 4EVNA 1MHEA 4JQXC 4HLZG 3MV7E 4HS8L 3WIHL 3ULVH 2AK4B 2AK1L 2VQUA 4LK4A 2GTWB 4MZ2A 3WIHH 4TUKH 3DURA 2YK1L 3OX8B 1ERNA 5DVNA 1JCKA 2I60H 4M5YH 5B38G 1FYTD 3K4AA 1LO0H 4OQTL 4KMQA 5CGYC 5F6IC 1B3JA 1XFPA 4URTB 3PABA 3O3UN 1X5HA 4P5TA 2H2PD 2AKRA 3TJHD 2NZ9C 2F15A 1JZ6A 4NHUB 2DOCA 4XVTH 1ZSDA 3RI5F 2R1YB 4G6KH 3EYFB 2F54E 2HTKC 2CKNA 1D5BB 1KULA 1MJUL 1HQRA 2NW3B 5AWNL 1ZT4B 5GRUL 4PIRF 3MV7A 1UM6H 1RJYA 3LN4B 5EU5A 2PYFB 1EV2E 3FRPG 3UPAA 1IGIH 1FE8H 4J4PD 3EIFA 1B4RA 4HFWB 4KTDH 3IAGC 4K94C 1ZHNB 4M6OL 1Q9WB 4UT6H 3SE9H 4JO1L 3MRLA 4Y8AA 1CFTB 3PV7A 3MRJB 4WU7A 1YPZE 3KXFE 3WFEH 1X5GA 2M26A 3BN9C 3W0WB 1BZ9A 5DVMA 3BT2L 1HCVA 4FQXC 1YNLL 3HE6A 1MHHA 3PWNA 2NMSA 1AR2A 4M4PA 3MXVH 3SKOA 5DFTA 5DQJB 2LTQC 3OG4B 4PJHE 1RIUL 2CKBB 4KDTA 3H9HA 4M02A 1FO0L 1D6VL 5BOZG 4JHAL 2JF1A 1I85A 2PCPA 2VERN 1R3KB 3DX7B 2X4OB 4TPRH 3R8QA 1JGEB 3NAAH 2H2PC 4YDVB 1DUYB 3PWUA 3CLFL 2ZSVA 1OAKL 3DTXA 3PE9A 2EIBA 1L6XA 3KJ6L 4R3SB 4HGWA 4M6AA 3UDWC 3ULVE 1JUFA 1J88A 3U83A 2COQA 3BX7C 3KYNA 1ZVHA 4P2OC 3S37L 3DUSA 5FO7A 1QKZH 4HUXA 1T1YB 1V05A 4NYLA 2UV3A 3GMOB 4ZUVA 4OCSH 4ONFH 2BJML 4JFQB 2CH8A 2IWGA 1RPQA 1KFAH 1RU9H 2X70B 3D18A 4OZGE 1JGLH 1GC1H 4TSAH 5CBEB 3MNVB 5HGDA 4GMTH 4M9PA 5E7BA 2XZCH 4LCWD 1TTUA 3AU1B 1RULL 3GKWH 3BFOA 5HVHC 1M7IB 4M6NH 1QQDA 4BZ2H 1KTRL 4WFEE 4V1DB 1G7PA 3EAKA 3CFBA 4YC2C 2IAMD 4LQFH 1SJHB 4I13B 4QHMA 1OSZB 2NY2B 5ALCL 2VH5H 2HA1A 2XPGA 2A9ML 2J5LC 3MBEB 1NMBH 3PWPB 2RR3A 4P2RD 4ONGH 3F5WA 4P99A 1CTNA 3LPWA 4HWZA 1K2DB 3ZDXF 4OKVA 4I18B 2DTSA 1ZT7B 4OB5L 3F7YB 2AI0H 2EXWC 4L4VE 5M94B 4RMQA 2W0KA 4YJZL 2APVA 3V7AE 5I1KH 3S35X 4WUKL 2AS5M 4GT7A 5EO1A 2ZCKH 3AM8C 3W81A 5JQ6L 4M7JH 4ZUSA 4D9LH 2R2CA 1AXTL 3ZYIA 4J3VA 5CKAA 2P8MA 1QR1A 3IVKB 3Q6FA 4CU6A 2PO6B 3JWDC 5E6ZA 3BKCH 3QRFM 4YDLB 4KPHL 3G6JE 1AHWB 2DWEA 3ZSSA 2PR4H 1ZLSH 3OJDA 5DC9B 3MRPB 1I9RH 3QBTB 5GGVY 3SDDB 5C0NC 3MXWL 4PV9A 5LGJA 5DURB 4XP4L 5L7XH 3QUZD 5FF6B 4MNQD 1X4XA 4IRZL 1DANU 4NGHH 4EXKA 2I27N 1EJ6A 3TN0B 1LO3H 3ARWA 1DQTA 4M1GH 4WW2C 5CJQH 3Q2CA 4W6WB 4KK9D 3WJJC 4ETQA 5I17B 1AXSA 1MLBB 1QRNE 2KBGA 3KPSB 4YLQT 5CS7A 3P4NB 1QUNA 4QHUA 2UWEF 1QNZH 5GGRY 2APWA 2VLRB 4JO4H 3GI8L 4O5LL 3VFUB 1HXMA 1KB5B 4UINH 4HJJL 2F53E 5IOPA 2YZ1A 4EUPB 2HMIC 4LSRH 1TQCC 2ATKA 1R6VA 4L1DA 3X11B 2F54D 3QCTL 4HAGA 4GG6B 1KT2B 2FEDD 2C3VA 3QCTH 4MNQB 2GUOB 4G3YL 2WINA 4H8WC 3O6LL 3GNMH 1A3LH 1H3TA 4N90D 5SV4A 1FV1A 5IVXB 2APFA 2IH3B 4Y16B 3FO9B 4OLYH 5JIHA 4S10A 3TZVD 4KRMB 1E4KC 1YMHA 2NZIA 3HC0A 3EOAB 5JW3H 4Z7UA 1EO8L 4HBCH 3BEVA 5HHNA 4G8FA 5DO2D 5KBNC 2DI8A 4GAGH 2GJ6A 3CZFB 3EYUL 2HG5A 4PR5B 1CGUA 1BWWA 1UENA 4X9FA 3QUZA 4DGVH 4HK0B 4ZOBA 2VL4A 2XA8L 3SDCB 4BSVB 5I1DA 4XNZC 1IAIH 3T08A 4QHUB 5KSVA 3C6SB 4V1DE 3H6JA 2Z8VC 4PRNB 5ADOL 2Q8AH 2MNUA 4QHMB 2FB4H 3MJ8A 1YA5A 3DRTB 5JW4Q 3OTTA 1MJJA 5FOJA 1KIQA 3KWWA 4UTAL 2BNQB 4XBGA 2CK0L 2PNDA 2VABA 2X41A 2A83A 4KVNH 3QP3A 5DMIH 2NY0C 4FZ8H 4NZUH 4YHLH 4A2LA 5B22A 1EJOH 5D2NC 2X1XR 3U4BH 4JFPB 3VD9A 1E4WH 2VN7A 5D5MA 4V1DD 5J6HA 4JJ5B 2QQKH 3MMEA 5IMKA 1I1AB 2ADGA 5KS9F 5GS0D 5I1HH 2HAZA 3BHBA 1L0XA 1MSPA 4ZUWA 3L9RB 4R4FH 4X0KB 3PABB 4NWUH 4HS6A 3Q6FB 3VG0L 1RUML 5C0EB 1CK0L 2F54B 2OR8A 5D7JC 3KPLA 3MACL 3N06B 5J0BA 3OKYA 2I9TA 2A1WH 1IAMA 4XPHL 5C8JA 1U8HB 4PD4K 3GNML 2YD4A 1OWRM 1QEWB 1GZQB 4MQTB 4OI9A 1F3RB 3UYRL 3RVUC 1GPOH 2EYSA 4Y5VB 1XGUA 1RJLA 3I2CH 4L1HA 3VXUB 3KPQA 4UQ2B 4BUGA 5D5MF 4QCIB 3DX8A 1KEMH 3K0WA 2PR4L 3VWJD 2D31B 4PLKC 5IJKC 3DX9B 5KS9A 2X4NB 5EOQH 2AGJL 1FGNH 1A4JA 1SEQL 5CILL 1CL7I 2FGWH 1LD9B 3QUYA 2JJTC 2Q8BL 5ISZE 3GFUA 3GI9L 2X4RB 4QXTA 4YGVB 2OZ4A 4M7KL 2JJWA 4Z76A 3O2DA 1CFTA 4F7CB 1DBML 5K59E 1A6WL 1JHTA 4J23A 3WKMH 3ULUL 2D03L 1G7PB 1JPSH 3DYMA 1Z5LA 4FRWA 4Q58C 4DN4H 2ZSWB 4I5BA 1S7SB 1F13A 3RUGF 4JY5L 5D93C 3SE8H 1HH9B 4UBDD 2YMXL 3LZFL 1U42A 1I1CA 5BV7B 3MA9H 4X6DB 4OB5H 4MS8D 1YEHH 2YA1A 5LAXA 2NLJA 4LVEA 4RGOL 4IDJH 3HTLX 3RL1B 3LSOA 4I3SH 3MLSH 4XXCA 2J1KA 4P5MA 1BZ7A 3CC5B 3LEXA 2KL6A 3TPKA 3SBWC 1FVEB 4LQFL 1TETH 5JOPD 3QAZC 3H7LA 1OAKH 4P5TB 4KRLB 3LQAL 5C0CA 4PJFA 1OGTA 3JSSA 1Q94B 3KYAA 5C6TH 2AXFB 3FO1A 3FZUD 1J5OH 1WAAF 1MEXL 1XGYL 3AREB 5EORL 5D7LA 4JLRA 3TFKD 2NXYD 4UILL 1TJGL 4JQXA 1RZ8B 1YMMD 4FMFA 1ZT1A 4TNWF 2OBGA 2VL5B 1WBYB 1GOHA 3UTTB 4WW2B 1KCKA 4OQ1A 2AAVA 3UZEA 2QQLH 2XRAH 4NKMA 4M8VA 5JOPE 4U6YB 4LHJB 4XVJL 5FGSA 3WFDH 1A7NH 3FB7A 4RAUA 1D5MA 2ILLA 1D3CA 4HG4J 1OGAE 3DROB 4R7NB 3J8F7 1J0KA 1CICA 3OAYH 4OGYL 4JHWL 3PQYD 4JM4H 1WAAA 4XBEH 4XH2A 1EX0A 5FK9B 4TRPH 1LDPH 5DJ0B 3DETD 3RWIA 2QSCL 4CBPA 2A73A 3O81A 4ELKA 1CZ8H 4KKCC 4XNUH 4ZMAT 3O8XA 4CVXB 3OKMB 4Z9KB 4KRPC 5BZWA 1F8TH 1CZ8L 1LO5B 4XNUL 4PJ7B 4P2OA 1AXIB 3ESUF 1YUHB 4MNGE 2Q86B 1KEGH 3L5IA 4YZFE 2RCSH 1YEHL 5HHMB 2FRGP 5GRWA 1LP9B 3UTSB 4X6DA 1FH5L 4BH8A 3SGDH 5C9JA 4QRRA 3V95A 5EU6A 1H3PH 1DP0A 3KPMA 1GGIH 1SM3H 2AJVH 4PD4J 4EDXA 3LKNA 3N9GH 3FQUA 1Z5LB 1WCBB 4M5YL 1BAFH 4R8WH 2FCBA 2GI7A 1XF4A 1IC5L 4ENEC 3DYPA 4HIHA 1NCUA 3VXUE 4U1MA 3UTPD 3U9UA 1LGVA 5T1DL 2Q7YB 4OZFG 2HLFC 4RDQF 3EW3B 2MCPH 5HVHB 3AREA 3O6KL 4JGJA 3FCTB 4X6DF 5KSBB 5DGQA 1A47A 1XGUB 4S1RL 2VR4A 3DIFB 5D6DC 3IDNA 4PTUA 1HI6B 4JN2A 3O9WA 5A2LH 1IVLA 5IFAH 1X5AA 3GSWB 2YPLE 3S96A 2VXVL 4Y2OA 4F3FA 5BMFH 1TQCB 4PFEA 1TJGH 4G5ZL 3FRPA 4QRRE 4P2OB 4X6DE 1BJ8A 4KJWC 4R4FL 1HDMB 4WW2F 5EU6B 4DK6A 3DSFL 5D96C 1QSEA 5CP7A 4M5ZL 4Z7QF 2WLYA 3MV8D 2BVTA 5IEHA 1CFNB 2J4WH 1NCNA 1K4DB 3V8CA 3OJMB 4S0SD 1NC2D 2CLZA 3OB8A 3V4VH 5K9KB 4RWYH 3T4AA 4RISH 1MH5B 2ZUSA 3U0WH 4PP1D 4OF5A 2BFVH 3DECA 3IDIB 4B41A 3HFMH 2LTQB 1H8OA 3RWHA 2CJUL 1U9KA 4FP8H 5M7QA 3HPLB 4O58H 5IK3B 2QHRL 3S3SA 3UTSD 4E0RA 1QLFB 3TYGL 3L3IB 5C09A 2YBRB 4M9OA 5HJ3A 4G9DA 4FFZL 4KUCD 3V79C 5KSUB 3BP5A 5KN5B 4WW2A 1LD9A 3PHOB 4U4BA 1KC5H 3OXRB 4P23B 1U41A 4J3WA 1RUAL 4DN4L 3X3GL 3SO3B 5F88B 3UTTE 5DF0A 4O51B 1TIUA 2BRRL 4OZIF 1XH3B 4F7PA 1CTOA 1U6AH 5JHDD 3VXUA 4OLEA 2EIDA 1INDH 1OP5K 1WUNT 2BY3A 3JTTB 3FB8B 3VMNA 1S7UA 2MWCA 1OF2B 3Q0HA 3RZCB 2X05A 1KB9K 1KIUA 2QKIA 4EN3A 3PP3H 1CDIA 4HPYL 4OZHA 3CSPA 2W9DH 5E0QA 1BX2A 1KJ3H 2Q8AL 4PRIA 3IU3A 3TV3H 2IH3A 2XFXA 3HRZA 1V7NL 3I50H 2NY3C 4JPIA 2Z4QA 1I1AA 1KJ2B 2ADGB 5C6TL 4DN3L 5CSGA 2IBZY 4JJ5A 2M1KA 5J1AB 1ZHLA 4L8CB 2NY2C 3FQWA 3P73A 3ABZA 3EO9H 4AEFA 1EJOL 3TBTB 4ORGA 2E7LC 3HR5B 4WO4B 3UJIH 5F7YC 5MEQA 1SMAA 4PG9A 4I8DA 2WBJA 3MLTA 2Z31D 5AUMA 1AR1D 4QLRA 1T2QL 4JO2H 3SDDD 3K4ZA 3FT4B 3LS5H 4LVOC 1KYOK 5IB2A 2BSSB 3I6LD 3QG6B 5ACLA 4XC1L 3QPXH 4JRYB 4YWGL 2FATL 2ZKHH 3KPSE 1RVFH 1OGAD 4RQQA 4XP1L 3DX9A 2OK0H 1IARB 3QFJB 5H35B 4AIXA 1MJ8H 4MJ6B 3RTQA 2DL9A 3U9PH 4OM1L 5E2UH 2W9DL 4U6XB 1NH6A 1IGCL 3MRIB 2HG5B 5DHVA 2AXGA 5D4QA 2QSVA 5EOTB 2IQ9H 4P46D 3T4YA 5C0BB 3X12A 5GS1A 3C9NA 1A4JB 4XX1G 1WTLA 4GAJL 5KZCB 1GAFH 3UJJL 3JWOH 7FABH 5L2KD 1IGMH 4MA1B 1QEWA 3RA7L 5EU7E 1JPFB 2PYEE 5JLZB 1YPZB 1IGTA 1N6VA 4FN0A 2VQ1B 2CRYA 1RZ7H 4KY1L 2CO7B 1MCBA 1NBVL 4J12A 1UM5H 4NWTH 3FQXA 3JV4B 5IUSA 2DD8H 4HS3B 1YN7B 3NPSB 3WJLA 4G8GB 5E08L 5D72H 5E8EB 2EECA 4WTXA 3I84A 3D9AH 5I1AA 4MA8H 4HIEB 3WIIH 1GH7A 3THMH 2WW8A 1RIHL 4KQ3L 4PJEB 5C08E 5IMKB 1GGBH 2E5EA 5AG9A 3LD8C 4DVRL 4X80H 4NDMB 1HE7A 3FAXA 4NZTH 1C5CH 3BPNC 3UX9B 3QCVL 4WFFE 4JFXA 2NR6C 4PGDA 5J1AA 4H26A 3SDCD 4KKNA 5JHLL 1NEUA 3UJIL 5JXEA 1FG2B 4H26B 4FOMA 4UOW1 4LLVB 1P7QD 4G6JH 4TSBL 4L4TA 1HYSD 1FNGA 3VFTB 4O9HH 4YHNB 5D2LF 4DN3H 4LSPL 4XNYL 1LK3L 4LVHB 1HHHB 2VXVH 3PWLA 1DUZB 2YEZB 2IALA 2X89D 4PV9B 5E8PB 5DEFA 2EIEA 3C08H 4QXGL 4KZDH 4JFQA 3L7EB 5GGSY 3ARFB 3O6FC 2ZUWA 2BCKA 2UWEB 2AXJA 2Z35B 3CXDH 3WS3A 2O61B 3I75B 1F3DH 1I3UA 4PRIB 2PO6A 4XCNB 4AG4L 4B50A 1IKNA 2HT4C 2VIRA 5D1XB 2ZNXA 1WTGT 2C3WA 1F2QA 1CBVL 2E3VA 5A16B 5K33A 4ZFFA 3OKKB 1MPAH 2XG5A 4Y16C 4AL8L 3IS0X 3A67L 3T2NH 3LD8B 4FQ1H 3S8WA 5DD3H 2J88H 5E6YA 3QA3B 1BOGA 4JVPA 4F33A 1L6ZA 1QSEE 2VDOH 4M62L 4XCYA 3RY6A 4ZXBA 4AM0A 5IT2H 4HJ0C 5EWIH 1IEBB 3QFDB 2EH7H 5E8DL 4NRYB 3C5SB 4TVPL 4D9RD 5HHOB 1A4KB 3RWJB 5SWZD 5L8JB 1KEGL 4XPGH 4NBYB 3AAZB 5HXMA 4LOUD 2FH6A 3HG1A 5JDJA 3VXOB 2X4QB 2A6KB 5HD8D 2CXKA 3ILPA 3VWKD 3LVEA 1QLEL 3SE3C 4LU5L 4ONHB 2P5EE 4R4NC 3TBWB 4KK5D 5I0DA 1H15B 4JO4L 5F7FA 4PGDB 3PUCA 2AJYL 1NLBL 1RK0A 1U58A 4U05A 5JORA 4L4TE 4W68A 5C0BE 4AL8H 3MNWB 3GMLA 4RDQG 1KLUB 5F3BA 5IB5A 3EFFA 1N26A 2HRLA 4HD9A 4OZFB 2VXSH 4WHTB 3GKWL 1RULH 4Y4FA 4PGEA 1S5IL 3G6JA 1JUFB 4GO6B 4JANA 1NKOA 4L8SB 2Z4QB 2BDNL 2HT2D 1IZJA 4U6TA 3SQOH 35C8L 5DJ2A 3QIUB 1WEJL 5IBTH 1E6OH 4R26L 1YMMB 4PJXA 2EZ0C 4P46A 4NNXB 5ANME 4UTBH 1NBQA 4GG6E 2VTFA 3HPJB 5EOCJ 2D0FA 5T3XD 1H3WM 2XWTB 1KXTB 2EE9A 3BDBA 1DFBL 2CRIA 3HZYA 3TH3T 1J0JA 4FQCH 1A8JH 1MHHB 3VXQB 5JXAH 5E00B 3FO0H 3LMJL 1FSKC 4TOYH 4OF6A 4OD3L 2EYRA 3LAFA 2P8LA 3G6JF 4G9FB 2CMRL 4MX7A 5H8DA 4RQQB 4Y89A 1IAKA 4OZGB 1U2HA 3OV6A 4QEGA 2EO9A 1EO7A 4NQDA 3B43A 3CX5J 4UDTB 3QSKB 4PJXF 1QACA 2A2QT 4QYOA 5E2WL 3B9AA 4N0UE 3VXRD 5F93C 3MV7D 1VGEL 5HDQL 4LGSB 4N0UA 1UXSB 4L9DA 1XGPA 1U3ZA 4WGVB 3UP1A 3L6FB 2YHGA 4ZUVB 4L8SC 2CDFB 1K8DB 4PYHA 5I1LA 2VZSA 3IDJB 1T1YA 3X3FH 1M05B 2XZZA 3QUYC 1BD2E 1CR9L 1U8OA 5B21A 5INDB 1P4IL 1OM3L 2PTVA 4LEOB 1I3RB 4FQ2H 4QRPD 4M1DH 4YDVA 3SDXE 1KGCE 1P1ZB 5I75B 2MPAL 5GXBB 1RZKC 2UZXB 1YEJL 3IU4L 4HX1B 2AEQL 5JW4M 1X5XA 5CJBA 1VKXA 1ZLVH 1IZKA 4M4RA 4U6YA 5HBBA 2D3VA 4ZPVB 4BKLB 3L3OA 5KSAA 4OZGF 4ELMF 2ADFH 4RMSA 4CADB 4J8RA 2GSIB 3N50A 4NQEA 5AEAA 1UZ8B 3CUPA 1GL4B 2VDOL 1U93A 4WI8A 3OAUL 4HH8A 2P4AB 4X4XB 4KQ4H 3MRMB 1I7RA 1O7SA 2HH0L 4GQ9H 5C2BL 5D7SH 3VXRB 3MLPA 3CFCL 1J1XL 2XT1B 1FFRA 4LSPH 5ICXB 3O4OC 1Q94A 4X98A 3BKML 3TNMB 4LOUC 3THML 1SJEA 4YHZH 3QULA 1FNAA 5EBGA 1NCAH 1QR4A 1RHHB 2EC8A 2N4IA 4LHUG 5INDA 3QQ4A 4XWGH 2FBJH 3E6FA 4MVBD 1MLCB 1IAKB 4OZGA 2IANA 4GS7B 3ARQA 1DEEA 4JY5H 3SE8L 4JDTL 4Z7WF 4YBLB 4EI6B 1RZKH 1Z9MA 4O00A 5K9OB 4JREB 2ZOKA 2P46B 3E8UL 3DO7A 3HG1D 2DQHH 5BV7L 1XF3A 2YC1A 2F74A 2WAHA 4QNPE 4MHHI 2G75B 2IG2L 3L95B 4ZUUA 3ARBC 4R7NA 3G5VA 4JAMB 4O9HL 4AQ1B 1H3XA 2XN9D 1CICC 1JPTL 2IQ9L 3VI3E 1VSCA 5EIQA 5JA8B 2ICWA 4IOIA 5ANMB 2X4TA 2R69H 3O6FD 1RMFL 1A6TA 3SDAB 3F58H 3MRMA 3Q5YA 3K8MA 5D1QA 1AR1C 4LCUB 2NY5L 4PUBL 5KVDH 3BPNB 2KZWA 2FIKB 2Q7YA 4XPHH 3D9AL 5FA4A 1P9MC 3AM8A 4GBXA 3VG0H 1S7TB 5DTFB 1MJ8L 2DQJH 5MP6L 4XPFH 1FNEB 1R5IB 4WRLA 3EUUA 5DHYA 1O7VA 3ISWA 3OZ9H 4WU5B 5I2IA 1QFWH 3S34L 1A7PH 2W9EH 1XGPB 3CMOL 2E9JA 3TC9A 4N0UB 5L88L 1JNLH 4PJDB 5C0CB 4GW4B 4Y1AA 1K5NB 4F8QA 3HMWH 3Q5OA 3VDBA 5AAMA 1KXQE 5D7LE 4JFEB 4G5ZH 1CGSL 3QG7L 5LBSH 5BJTB 5F96L 4HH9A 4MAYC 3VG9B 2C4XA 5T3ZL 2XTJD 4LCWE 4IRJA 5EULV 2V2WB 5C0CE 3LPGA 5BQ7A 1VPOH 4LRIA 2AQ1A 4Z8FL 5F6HI 1RZKL 1UXSA 1H3GA 1KUMA 1A7OH 4HCRL 2VNCA 3OKDA 4R0LA 2FX7L 3MGAA 2J8UA 1ZKAA 4U1JB 4ZOCA 2VXQL 2P7TA 3RU8H 1JZ8A 1NFDF 4RMRA 1B9ZA 2VOTA 3QO1B 5C0AE 1FZJA 4ZO8A 1IGYB 3PWVA 4WFHE 5JZ7C 2H26B 4HUUA 3GRWA 1U93B 4OLUL 4ZXBB 1OP5H 2O61A 5D7IB 1EUUA 2VLKA 1BOYA 2VDKH 3VWKC 1DQDL 2VWEE 5FOBA 4F9LC 3GUTA 2XWBA 3OAZK 1XIWC 2FDBP 3UPRA 5DGRA 4M03A 3KG5A 2QSTA 3ZYJA 3LHPL 1X3DA 2VLRE 1FNSH 1WIUA 3CLEH 1PZ5B 5ALBH 5L2JB 3RAJL 2ESVE 1W0WA 3G9AB 5FA3A 1FBIH 5AD0A 1BD2A 4GKNA 2Z91A 1M7DA 1WWWX 2G60L 2QR0B 2RFXB 1GGYA 2NX5A 3MRGB 5K9JL 3GI8H 1CGXA 2NX5E 4RISL 2R0KL 3VW3H 1U3JA 2OLDA 5IB5B 4JHWH 5I1CH 2A9NL 4FHBD 2ESVA 6FABL 4GRLB 3FO2B 3LKPB 3GJFB 3UBXA 2YUZA 4QWWD 2MQCA 3T77A 5LGJB 3EGSB 4WV1C 4LIQL 3JWDH 4NZJA 1P7QB 3TJEL 1Y0LB 1ZK9A 1AD9A 1WIPA 2BVEA 1AGCA 2VLJA 3CIQA 4CGTA 1ZTXH 3ZTNH 2Y23A 2VSCA 3K4DA 4KTEH 2NTFA 4MXWL 3FT3B 4LNVA 4U1GB 2GEEA 5ITBH 2QL1A 3SDDC 3IKKA 4S2SB 5EIVA 1FL3A 1MHCA 5EORH 4XPTL 2MMXA 3P3YA 5T1MB 1OM3H 3UPCA 2BVPA 3FJTA 4U0RB 2BRRH 4ONOA 5KS9B 4PY7B 3SHSA 5DJZA 5T1MA 1KJVA 3X3GH 4M8QA 5T3XL 4U1SB 4KWUA 4LF3B 3ARGA 1KJVB 5D7IA 4NNXA 3GIZL 4PYGA 3BAEL 2C7UA 3LEYL 5F1SA 5B3NA 3MXVL 1QPPA 1JF6A 1IGTB 4G7YL 1FO0A 3ROLA 1CXKA 4QRPB 4PJCB 3T8XA 3TVMC 3QDGA 1NBYB 5GJSH 3ZL4L 3DVNB 1OT1A 3NMEA 5I1JL 5C0EA 2N7BA 2VB5A 3GM0A 4LSSL 3U0WL 1T1XA 1SBBA 5IMMA 3RY6C 5DQDL 3KPTA 3X11A 5C0BA 3X12B 3T77B 1Q72L 3FRUB 2LU4A 1ZE3C 2VZUA 4NPYA 4U6XA 5MEQB 4Y4HC 1AD9B 3AUVA 3KS0J 2BZDA 1NSNL 3MLVL 3NH7L 4Z7VE 4Q7DA 2LV4A 5D7IF 1AIFA 1S7QB 2RFXA 4M3JA 3KPRB 4MCYA 3RVXD 1H8SA 3R06A 3K74B 4Y8DC 3SE3A 1OL0A 5ID1A 2XWJA 5IMOA 1EZVX 1YEKH 3M07A 4XPAH 2D7PA 2Z8WC 1KFAL 1JWMA 1MJJB 1NGZB 1P2CB 1UACH 4KC3B 1S9KC 2DDQH 3EYSL 4F9PC 2WWMD 2R23B 2IAMA 1S9WB 2DWDB 2WZPD 4WI9A 4JM2B 1WFOA 2C7UB 5IB3A 2YSSA 4ZYKA 5FB8A 3OKLB 2YD5A 1DBBH 3MZTA 4BQ8A 1HCFX 3HN3A 3BESR 1YPZA 2I60L 1FNLA 2Y07L 5DMKB 4Q9QL 2XQYK 1TETL 2QSCH 1IT9L 2IQAB 3BSZH 5F89A 5DQJA 4KRPB 2VZ3A 4WNQA 1F4YL 3LS4L 2HVKB 1T80A 1E6OL 3EOYG 5D1XA 1FZOB 5GGRA 4HWUA 2ICWJ 1YYMH 1OPGH 1A7RL 3ARGB 5F9AC 1FV1B 4YBQD 1FRGH 4LGRB 1RURH 4PREB 1VFBB 5CGYD 1DFBH 1K6QL 5F88A 3VD4A 1MH5A 1CIUA 3GRWL 1DBKH 1XF3B 1VFAA 3BP6B 3EGSA 1N5YL 2W60A 3T4YB 3N1PC 2IBGA 3L3GA 4JFEA 4RRPG 5BQ7B 2VAAA 4GG8A 1OLLA 4CMMB 3KLAA 5KSAD 3P0YH 3MRLB 2LFGA 3LIZL 2BVOA 4P0DA 3DWTA 3B3IB 4XNYH 4WY7H 3WNLA 1ZWIA 4TQEH 5D1ZA 3AU1A 2YD8A 2CDGA 3SDAC 4YE4H 2FL5A 4PRHA 4P57A 4LL9A 1NFDB 3CFBB 3LKSB 1T66D 32C2B 4P59H 5JXEC 2FO4A 4FXKB 4ZAKA 3T2OA 4Z7OF 2E9BA 3MUGB 5EU6D 3ZDZE 1HDMA 1HKLH 4I77L 2I9LB 1A1MB 5HSFA 4ZD3H 1YEDB 1RIHH 1OGAB 3RNQA 4J1UA 43CAB 2VZ1A 2XQBH 2V2TB 1QFPA 3QIWC 1G9MH 3UO1L 3MNZA 4WWID 3U7YH 1LQSR 1KCRH 1HN1A 3O6FA 2EDXA 2X2YA 3HAEB 1IFHH 2APXA 5LCVL 3IXAA 1PQZB 3VGAB 3TYFA 5DUML 3MV8A 3GZKA 3QDHA 4WFFD 4HJ0D 2B7DT 3ZE0E 4QRUA 2P49B 1R3KA 3DX7A 4OSUH 2XZQL 3QJFB 5MI0C 4UTAH 2ADJA 2DMBA 3C9NB 3R0NA 1N5AB 3GMNA 2DM3A 1XF2B 3DO3A 1S7WB 5GGUA 4Y4FC 4DGIL 4ZPTA 35C8H 2F74B 3GHEL 2YMXH 2P1YA 4KTEL 3QXTA 3T2PA 5TF0A 3NABL 4HK3J 4Z0BL 3AS1A 1EUTA 2YPVH 4JG1L 1ZHKB 3W39B 5ESAA 2ZPKL 1QSEB 3UJTL 1G0XA 4AZ8A 3BGMA 1Z0MA 5T3ZH 2XTJB 4WHCA 2W1NA 4TNVF 4P2QB 5FUZH 1L7TL 4ZFGL 2AABH 2CKBH 1RJYB 3TO2B 4UNTA 1XIWD 3BPOB 5CUSL 3QO0A 3HE6C 4X4XA 4M48H 12E8H 3SE4A 2XA8H 2J8UE 2K3TA 3ZTJH 3RA7H 2OS7A 2BVUA 4NKQB 4NQDD 4P2QE 1I1FB 2CPCA 4TVPD 4X4MA 2X1PA 1EVTC 4XNQA 4D2NA 3O45A 3U9PL 2E8YA 4LCYB 1Q1JL 3T0EE 1XMWA 3T2QA 4Z7WB 4NFCA 1ZSDB 3I3DA 3SOBH 1N5AA 1VEPA 3VD5A 1OAUL 2W9LA 3NPZB 2VISB 4X7SL 3P30L 2BP3A 4M62H 3L3DB 4NKMB 4CL7A 4PTTA 2NQCA 3KAAA 2VISA 5D1QC 3DVFA 3WLBB 5E03A 3Q3GB 4IJ3B 2OQJB 4H88L 5E7FA 3BXNB 2DQDH 3ARFC 3O6FB 3VGBA 1U8OB 4PJ9A 2P8PB 4BH8B 3OXRA 3GJEA 3RL1A 3EDDA 5AZEH 4GAGL 1U8NB 4K94H 3HZVB 1NC4A 4TUJB 5D6CB 1KN2H 3LKOB 1HSBB 3VFVB 3AC0A 2CLRA 5C08B 3IFPA 4LPCA 1DEEB 1OT2A 2CK0H 5C0ND 3QO0B 3X14B 5DRZB 4ELMB 1TLKA 3GHEH 4W4OC 3FTGA 3HC3L 1PJ9A 3OJ2C 2XZAH 2DJ4A 4JPKL 3LSOB 4Z76B 1R3LA 2NXZD 1Q9KB 1XGRA 4NJAL 4U7MA 4HUWB 3O3BB 1I7RB 5E00A 2ATPA 1T04A 4UT7L 1E27A 1GOFA 5GGUB 2DIAA 3PP3K 5CP3H 3T65B 2EDOA 5FKAB 5HYEA 4UI2A 3WKNA 3OR7B 5JR1H 5BRZB 2AV1A 5FYJD 4GQPH 5HHMD 1DQLL 1L0YA 1MI5A 1GHFL 4KI5E 5C07E 1C08B 3FO9A 3SGKC 3T1WA 2XI9A 3MNZB 5IIEA 4N5EC 1T5WB 1Z9SA 2E9WA 3L5WB 5CEZE 4OZ4B 4X6BB 3ILQC 1HEZA 3MMEB 1C12A 2EYSB 4A2MA 1I9JL 3OL2A 5DT1H 1OW0C 5E9DA 4ZTPL 4JZJC 5IFJB 3OPZL 3AMKA 3BZDA 3QNYB 3WFCH 4K71B 4QTIH 1H15A 1JNNH 4GMSH 3VXTB 1P69B 1MCJA 1HQ4A 1KIPB 1RK0B 1RUPH 1XGQB 2HFGL 3M17B 5CLWA 4P57B 4PG2A 3E8UH 1AXSB 1MLBA 3VFNB 1ZWIB 4XAWH 2GHWB 2XQBL 3VFPB 5HVGB 5I8CA 1DLHB 5DVLA 4GUPA 1TQBB 5JIKA 2FECL 5SX5K 4HBQA 5LAXB 4R97B 4TPRL 4U1LB 1EPFA 5I1AB 1Q0XH 3PJSA 2FEEL 2Y36L 4YR6B 3TFKC 3D25B 3DARA 4FFVD 1PEWA 2CLVB 4G8EA 3QFJD 2UUDH 1AD0B 2PYEA 3FZUC 4NQDB 5HTSA 4X6CE 3S7GA 1VFBA 5GS0C 4G6ML 3KPQB 4FQXD 4TTDD 4OGYH 3QXVA 1T1XB 2MKLC 3W2DH 1T5XB 1TQBC 1L4IA 2DKMA 3VJ6A 1S5HA 3TBVB 1YMME 2W92A 1F5WA 3FFDA 4PR5A 1QO3A 1RU9L 3G04B 2YPKB 4XVJH 5IEKB 4R26H 3QIUC 3T3ME 5GGTH 4RA3A 1HKLL 4I77H 2V17H 1P84K 1DBKL 5EBMA 3GMLB 1T0MA 1RFDH 2GSGB 1I1AD 3LDBC 1EFXB 2HLAA 4CDGC 3ULUC 5SWZA 2Z31C 5GISH 4IOSD 2Q76A 2V6HA 2YRLA 4G9FE 3V0WL 1MFCL 4MQ7A 5MERB 5IW1B 1MJUH 1U8QA 1A0QH 3TBWA 4R4BA 4J3SA 4FS0A 3S88L 5C92A 3BQUA 3HI5H 4A6YB 5DO2C 3CC5A 1KIQB 5T1LD 5T33L 1DVFC 4R90L 1HILA 3P0YL 3FFCA 4PRAA 1PG7W 4ODXB 2B4CC 1WGOA 5D7KE 1QBLL 5E6IC 3IFLL 3GO1H 4GRLC 3ZE1F 4AMKH 2HN7A 3OAYK 4JFPA 4U33A 4UNUA 5AWNH 3K3QA 4ENED 3MA7B 1D9KC 2GJZA 5IJVB 4LCWA 3HC4L 1G7LA 1W0VA 2A6JB 3P77B 3KGRA 3AMLA 5HHXH 1H8NA 2VJXA 3JV6B 4H8WL 3W9DA 4LGPB 1BIIB 5FAAA 4G8FB 5I16B 1YN7A 1IC7L 2C1OA 3QRGL 1E4JA 5DJYB 3BRGC 1LO0L 4ZUTA 4R0LC 3GIVA 1X4YA 1N2RA 2G9HB 2HTLD 1I1RA 4FXGB 5DD3L 4AY0A 4V2CB 4Z78A 1FCCA 3HG1E 1EFXA 2HLAB 4WFED 4OJFL 2Y07H 4G7VL 4Q9QH 4NC1C 2CK2A 1FIGL 3IGAA 3B9DA 4O02L 1AY1L 5DJZB 1BQHG 3IVKA 3B2UC 3NIDF 2A6DA 3Q6GL 2GCYB 4P23A 1NGXB 5GS1B 3G04A 4C83A 1MEXH 1QA9B 3QUMH 4UNVA 1SBSH 1FJ1B 2G5RA 2HRPH 3N1QC 4HCRH 3A6CH 3V8OA 5ITFB 4NM4H 5CSZB 4YHNA 1HWGB 2VIRB 3AS3A 2KH2B 2O26U 3U46B 3VFUA 5CFHA 3GHBH 4C58B 4OZIE 4PJCF 5I1CL 4HDIA 3QQ3A 4P2YA 3ZHDA 1JYWA 2A38A 4Q6IA 1PDKA 1JFQH 2WNGA 1D5ZB 4JQIH 4WDIA 3B4NA 1G7LB 4BQ9A 4E5XA 3D3VB 4PB0H 4RCAA 5DRWB 3PJSB 4OZIB 4RAVB 3Q5TA 4Y5VC 4YDJB 4MAYB 5DJCA 4IMKC 4GRWE 4PLJC 2JJVA 3FFCB 2AEWA 4EJ1C 4L29A 2VKXA 3OZ9L 1IM9A 2XKNA 3FOLA 1LE9B 4GW1B 4M43H 4MJID 4S11A 5K93A 3UCRA 3QCUL 3DVNA 3TGXA 1NGWB 4PLJD 3L3JA 3S96B 4PJCA 3T8XB 5IW1A 1NEZA 2B20A 4KKAD 4NHUA 3VRIB 3HHRB 2EH7L 5F9JA 5L2JA 1D7FA 1G9NH 1QHOA 5EN2B 3U0PA 2VZTA 3DV4A 4TTGA 3FQTA 2FEDC 1EMTL 1QFOA 4ZFZB 2FZ3B 4WUUA 5C09E 3SEPA 4P3CH 1CWVA 3CDGA 3DURB 1JPFA 4QNPF 3N1GC 4JJHA 4XMKH 5CIPA 1X5LA 2AVGA 4QRTB 3O2WL 1G7QB 2B0SL 2ZUQC 4NN7C 1P5UA 3D39D 4LSQH 2ZCLL 1MFCH 1LEKA 1ZLWH 3TBVA 3L5WA 1HHKB 1UKSA 3NN8B 4BQBA 2R4RL 1JZ4A 4W81A 1OAXL 2FLRT 2VAJA 4XCCL 5DZNA 4H5SB 3V6OA 3KPPA 4MXWH 3MOBL 3NTCL 5E2UL 4PJDF 1BFSA 1JF5A 3NCBB 1CGSH 3TIEB 4I1NB 1G9MC 1OTTC 4UV7L 5J6GB 4XWOC 1T66C 3HE6B 1AKJA 4ZO6A 2D7TL 4OIBA 3ES6A 3D6GA 5HGBA 4Z8FH 1QP1A 3SDXB 5EC1B 3MOQA 5IQ9B 5DLML 2X09A 3O2VH 5D2NE 4RA0C 3MACH 3FB5B 4G43B 1IQWH 5LGHL 5MEOB 4UINL 1IKFL 1Q9KA 1OQXA 5KVEL 1OAYH 2IMNA 4UMGA 2R2HB 3BH9A 5GHWL 3MLTB 4HKXB 4XWOD 4PJDA 2VQTA 3K8LA 5ADOH 3EZ8A 3ARUA 4XAKD 2NX5D 3C09B 1IAIL 1A3LL 5GQBA 5HPMA 5DEZA 1DVFD 3GGWB 1S7UB 1A9BB 3KYMB 4M6ML 4F57L 2F5AH 3MRKB 4KMLB 1NC4B 3ARBA 3A0OA 3G08A 3BGFB 3VGAC 3HI6H 3S9DB 2FB4L 1OP3H 5DD6A 5H2BA 3VE0B 4HIHB 1T22B 4NZDA 2Q8BH 4RX4A 5IF0A 2AXHA 2H3NB 4BJLA 5F7KC 4NKDA 4L9LB 5MEPB 4OLYL 2E6QA 3CCHA 2YD9A 4NJ9L 2FX8L 5CJQL 4TULH 3LKQA 1HXYA 4PB9H 2R56L 4QF1A 1IL1A 4KI1A 1QFWM 4WHDA 4I18A 4C56D 1HOCA 4HWZB 3L5XH 4HZLB 4QRRB 4I3RL 3DMMD 3DX6B 4YEEA 4WEUD 4Q74A 4L9LC 1ZEAH 3SCMA 5I15L 4WV1B 5IFHH 2DKUA 3KHQA 1TVHB 1LO2L 3O8XB 5I1LB 5TDPB 3EYQC 5CD5D 3I02B 4G3YH 1OW0A 5GGTA 1H0DB 2AEIT 3L1OL 2R29H 1DL7H 4Y4HD 3U4BL 3QULB 1RHFA 2ERJC 5SWZE 3MV01 4K2UL 4I4WB 4WFHD 4AT6B 5DSCB 4QRQB 1X5ZA 4RRPA 4JR9L 4TUJA 3MV7B 2YWZA 1WT5A 3TCLA 2AK4E 3VMOA 3W9EA 3OX8A 1R0AL 4Q9BA 2WBKA 1KJMA 4LCIH 4OLXL 4LMQI 3MV9A 4JFFB 3OWEA 4ESKA 1CFQA 1MAKA 2GJJA 4DFIA 3V52L 3BRFA 4FQ2L 4YC2B 1SYVA 2WV3A 3RUGB 5EUKB 4RFOL 5IHZB 1KN2L 4XC3L 1AXTH 1VCAA 3SGKA 3VWKB 4P5TD 4F58H 1YYLH 2P5WB 5IVOA 1UA6L 3VWKA 3ZT6A 5EUOA 5CAYB 1A1OA 1XIWA 4NO3B 2LAAA 4OGZA 4NQCA 4DFHA 2OTUA 4FFZH 3BSZL 3RBSA 1PGRB 1BZ7B 2I9LA 2B1AL 4I0PB 1YC7A 1S7VA 3O45B 3WIFA 1G6RL 4AQOA 4LVNB 4AH2B 4L29B 2H32A 3GRWH 3T0BA 4HULB 5EPMB 4KUCF 3ES6B 1NAMB 1K8IA 1ZS8B 4OTXL 3KPRE 1EAJA 3D87B 4WI3A 5JOFB 1QFHA 1JE6A 2EXYC 1ZVYA 2MPAH 3W39A 5EUOF 2Q86A 3MR9A 3MUHL 1R5VA 2CUHA 4L4TD 4Y4KD 5DMJB 3BGMB 1S7XB 1XAUA 2YOCA 4M7ZC 5I66B 2X4RA 1JTPA 4HK0A 3ZT7A 5J1SC 4LDLB 4YFLF 3ZKMD 4O4YH 5GSRB 1P6AB 2AJXH 1I1AC 4MCZB 4ERSH 3LQZB 2VWEC 3TZVB 2VXUL 3BJ91 3BEVB 3KPRD 4S1RH 4UQ2A 4F33B 1CFVH 4EI5D 1CDGA 4LSSH 2L4OA 1X5FA 2ITDA 1JPGA 2AEPL 5T3XE 4OV5A 3PP4L 4HIJA 4O02H 2J6EA 3UBXI 3QIUA 3B5TA 1FL5B 1N5YH 3T0EB 1U3HA 3IJYA 1MHPL 1KT2A 1FVEA 5J6HB 1CR9H 2XKNB 4ZUWB 1MFBL 2ATKB 1VFMA 5E4IA 1ND0B 4HC1A 4YXHL 2IC2A 4RGNE 1WITA 4FTVA 4APQB 1CDUA 2A77L 1VGEH 4DJMA 4E5XB 4WWKC 1J86A 4TYUA 4RIRB 5F1IB 4RGOH 4IHOB 4EDWL 4LP4A 5J57B 1I3GL 1XR8B 3LN9A 3MV11 4P5MB 5DURD 1FNGB 1IQDA 5HHQB 2X4QA 3QUKB 2DLEA 4F8TA 1HINL 3ARPA 4Z18A 1XCQA 4PJIA 2SEBA 2VXSL 2VXTL 4JPWL 4PRPD 4K3EL 3REWA 1NPUA 5SWSD 3UTTD 3CZFA 1K85A 4Q6IC 4MNHB 4M6OH 2FJGB 5FCUL 2CRZA 4YPGA 2R2EA 4QRPE 5J9PA 1MHPH 2RJMA 4QTHA 1IKNC 2X1WL 5HGAA 3E3QE 4EIGB 4Y5VA 3JXAA 4FQQB 2DDQL 1KLGA 4DGYL 4GKOA 5FM5O 1YNKH 4DQOL 1JV5A 1JHKH 2A0LD 5D2LB 3DV6A 4BSWB 4X6CA 1HNFA 2EDQA 3UTQB 4UIKL 1IGJB 3WS6A 4JANB 3MCG1 5I6XB 3QNXA 5FXCH 4KROB 1QHPA 1T4KB 2XN9E 4LPXA 5IR1B 3WFBH 3R1GL 1FLRH 2Z9TA 5DHVB 3BKYL 1F3JB 1ZT7A 1KTKE 1PZUB 3RNQB 5FB8B 1WISA 3QI9B 5DJAB 3DUUB 3D25A 2W0PA 5GJTL 2BVYA 1NDMA 1U8HA 1FORL 4JHAH 1JWUA 1TTFA 5I1HL 3F65A 1P7KB 4CN4A 1N64L 3WLWC 4R7DB 4X6CF 2WWMC 4JKLA 3VXOA 3ZDXE 1KCLA 1O0VA 1S78C 1GCFA 4K7PL 5BRZD 3MYJB 4CKVX 3D0LB 1BFTA 4AG4H 2MTPA 2FLBT 3MLRL 2K9UA 3BAEH 1T0PB 4H20L 4RIRA 4WUUE 5F1IA 4ZAKD 2BVOB 3DVGA 5T33H 2H41A 1C5DB 4AENA 2BNQD 2Y06L 3SDCA 1E0OB 4KXZI 3PF2A 1ZLVK 1ZANL 1NGYA 4PJEA 4X7DC 3EO1B 3BP4A 1ACYL 3ZKXB 1EHAA 3DGGA 3QIBB 1BEYL 4XNMA 5IFJA 1YJDL 4UIMA 3H3PH 1FFNB 4JRXA 1MCPH 3FFCD 3RZWA 3G6DH 3NACL 2PXYD 2PO6D 3JV4A 3VDCA 2EDDA 3BQUC 1EEUA 3FFDB 3QEQD 1ULVA 4CRPA 4R97C 3C8KB 2QJDA 3WN5C 1WQVT 4PGJA 3F12B 3QJHB 2XFXB 5FO9A 1XF5A 2VXQH 4YBLC 4KJPD 4LHUD 5EUOE 3BZ4B 4OD2A 3BIBX 4CNIB 5FYKU 5JLZA 5EBMB 2FATH 2RQ8A 4X6CB 4XPFL 5INCA 2VDML 3QH3B 4HUMB 1U92A 4PJEF 5E5RB 3PWNB 5INCB 4NKIL 4OBSA 5ETUB 3JUYA 5DMKA 4Z7QE 4FQJH 4U1LA 3O4OB 3RL2A 4BSJA 4YDIH 5K9JH 1CXEA 3H0TA 3V6OC 2BFVL 3WEXA 1WC7B 3ZT5A 1KB5L 1VERA 5L0QC 3VFTA 4K71C 3U0PB 4KTYA 5HHQA 5IVXA 1M6OB 2BSSA 2R29L 3PGCB 3BE1L 4POZD 1IGFL 1KTLA 1VACB 2OL3H 3F7VB 4HT1L 4RFEB 3T4AB 3H9SA 2ADIA 2OTWA 4RFNB 2NNAA 4YHYC 2VLRD 1G1CA 1FDLH 5IBUG 5BXFB 3IDIA 3BH8A 1JFQL 2W0LA 4RMTA 2JK5B 1LNUA 2DAVA 3BYTA 5BMFL 3S36X 2BXYA 1RUPL 2HFGH 2X4PB 2R1XB 4K9EL 3OBAA 3RU8L 5F8QC 3QI9A 5HI3C 2AJZA 3RVWD 3CVHB 5ERWA 1AHWA 1UM5L 4MJ2A 3M17A 5DC4B 1CGYA 2HTLC 5IIEB 1A1OB 2AP2A 4DKDC 3UTZB 4FFVC 1OD9A 1RUQL 5E2VH 2YA2A 3HMXH 2DMCA 1GXEA 5HYJE 3U48A 4KPHH 2H45A 1T89A 3WHXA 1OF2A 1FNEA 4NQED 5DHYB 3RZCA 5DJAA 4OV5B 1BQHA 4JCMA 5EUKA 4LRNH 1R24B 5ISZB 4LIQE 2R39A 2EDTA 1A6UL 1FZKA 5L2KE 2VLKB 3QDAA 4XMPH 4EDWH 3G5YB 1E27B 1I9EA 3SKOB 5D6DA 2PYED 4CVZA 3O9WC 1KCUL 5B4MD 3DMMA 3BJLA 2CGRL 2HJKA 4QXUL 2RB8A 2WP3O 4AIZB 5J13B 4QGTA 4LDEB 1OSZA 3LS5L 3EJJX 1QLFA 5KAQG 5GS2D 2YBRA 2C1OB 4N0YH 4C56B 4P2QD 1MCOL 5I74B 4Y19D 4OI8A 1DJSA 3KNBB 2WIIB 4PLNC 1CE6B 2WBJB 5BW7A 4PG9B 4ZTOL 4HJJH 4OKVB 3EOTL 2E7BA 1JTTA 3TH2T 2CLVA 12E8L 3D69A 1HSAA 4K3JL 2MJWA 3MJ6A 3GK8L 1B4JL 3C8DA 1BEYH 1CGWA 1T7VA 4M7LL 4ZS7L 4N0CC 1ADQA 3ARDC 4W4OA 2SEBB 4OCMC 4OFDA 2YUVA 4IRJD 3U6RB 2OMNA 2XYCA 1BX2B 1WAAE 4KI5C 1GZPB 3ARYA 1F11B 4Y19E 1HINH 3J7HA 1CXHA 2IFFH 5HDQH 4L5FL 1FCGA 2C3HA 3QIBD 5FUOL 5BO1L 3QJFA 5DRZA 3GSWA 2AJXL 3PL6D 4XP5H 4GRWH 5EUOB 2W0FB 4L4JA 3NACH 2JB6A 3GMRB 1CDJA 2LU3A 3FB8A 1WJ3A 2DTMH 5CEZL 3EFDH 1G7JA 3BPOC 5FA4B 3MJ9A 3NCYS 1T83A 4GKZB 1P4IH 3F6LA 4XWGL 3MBXH 1YQVL 4GBXD 4YHIB 4JLRB 4M5ZH 1TNNA 2Y4SA 3MLXH 2VDRL 3U4EB 1FL5A 43CAA 4G9DB 3C6LD 1MCCA 5F7WC 4HKBB 3RKDC 4FQXB 1WCBA 4QT5A 1Z9OA 3LRSB 4KDTC 1F42A 5CJXA 1WEJH 4HFWA 5DMYA 4KJYA 2JCCF 4M43L 4LCCB 1DQMH 5E1HB 1UWEH 3NCCB 2OR9H 1LP9A 3UTSA 5L9DH 2A9MH 1MCFA 3BVNA 5ACZA 1H5BC 3G5VB 3MRQB 4Z7OE 1Y18A 1QFUH 4PRDB 3RDTC 1MWAA 1OWWA 2UYLB 4IRJB 3WDIA 3FO0L 2A73B 5D5ME 1CXFA 1A6WH 3RRQA 3WKML 3OB0K 1S7WA 4JFYB 3GMPA 3GI9H 5SV3A 1NC2A 1AQDB 2CDEB 4Y2DD 3E3QC 3U36B 3W0WD 1SJEB 1Q0YL 1MCHA 3CCHB 1YEJH 3IU4H 2AJVL 2X9XA 5F1NA 3LV3A 3T1FA 1DBAH 5FGCE 4WWKA 3PXJA 3WNKA 3HE7D 4NQXB 2B2XL 4ZG1A 1JF1A 1LP9F 4JFZL 5B8CC 4PS4L 1S7VB 4H20H 5SX4H 3NZ8A 3U30B 2PW1A 3G5YA 3GBMH 4S1QL 4BQ6A 1HSBA 3VFVA 3LQAH 1HH6A 5DUMH 3NFSH 2NY5C 4P3DA 4I48A 3P4OA 5JTWA 3NGBB 5E2WH 1HH6B 4G6MH 2FJFB 3L3OB 2ZOLB 3L1OH 2VUOA 2D31A 4GAFB 2ICEA 3ET9F 4UZGA 3ZKNC 4XBPA 3BMWA 5E2TL 4NQEB 4LKCA 2J6EH 5E2TH 1C1EL 4EDXB 3ZYZA 2F54A 1HIMH 4M7LT 3QEHA 2BSTB 2BVQA 4GSDL 2BSRA 3BKJH 3I85A 5D7JB 5B8CB 4PV8A 4IOIB 1LHZA 3B2VL 1E6JH 4YK4C 3HUJF 3LMJH 4NNPL 5KG9B 1IAII 4MQXD 4XVUC 4KKLC 1MFDL 3GEWB 3HC4H 1KJMB 3U6RA 3L9RA 3ME0A 4JPKH 1PG7H 3RWCA 3D2UB 4F15C 2YN5A 5TQ0H 4EUPG 3VFMA 3NIDE 4DAGL 1MCSA 5CMAB 1RI8A 1T7ZA 5C0FB 5F97E 2AGJH 5JPMB 1G7MA 2HT3C 3RWDB 2OSLB 3N1MC 4PRNA 3VD3A 4GH7B 2Y72A 2EYTA 4S1DC 3NH7H 2C1PA 3IETB 1A6ZA 2DB8A 5C08D 3PL6C 5DXWA 2FR4A 4JVUA 4N0YL 2EYRB 5CD3B 1BM3L 4AEEA 4HBCL 3U4EA 2FGWL 3K2MC 2DQUH 3QEQB 2P8PA 4R96B 3ARGC 2F58L 3PG2A 1CK0H 2BNUA 3D5OF 4LCIL 4OLXH 1F58L 1NLBH 2XWTA 5F9OH 1RJLB 3UXFA 3BZ4A 4OD2B 4YPJA 3VXQA 1FLTX 4X8JB 4Y16A 3WMSA 2UWEE 5CJ8A 1J87A 5L8KB 2DL2A 1KIRA 4JFFE 5KVFL 2XY1A 2I9TB 4YFDB 3HAEA 1DE4A 2R0LL 2GTZA 3OKNA 4Y4HB 4OQTA 1YMMA 4U2ZA 1KNOA 3STLA 4FFWC 1PX4A 5KVGH 5FKPB 3GSXB 1NANI 3R4DA 5GZNC 2Z93B 1SMOA 1LO2H 1T2XA 3BZFB 1A3QA 5TFSL 3TN0D 5ENWA 5ERWB 3GMQB 2QQKL 3G6JB 3CPLB 4K9EH 5TE7L 1KENL 5CZVL 1P4BH 3ARZA 5JDSB 2BHUA 2YEZA 2ARJA 2IFFL 1KCSL 5KJRH 1SYSB 4ZAKB 4O2CA 3L6FA 5BXFA 5E08H 1HHJA 4NPYB 2NY4D 1C16B 3NABH 4U6HA 4Z5RB 2OP4H 5CSBA 2DMKA 3KWWB 3BDYH 4UDUB 3RBGA 1UM4H 1JNJA 1EHLL 4WI7A 2VMFA 2DQDL 1K9TA 4Y5YC 4XMKL 4E41A 3B3IA 4D3CL 1B6DA 3TVMA 4UAOC 5I1DB 5HYSB 1ONQA 4V2BA 4ZPTB 4KKBD 4G9FA 3VH8G 1INEL 1AFVL 1A14H 1JHLL 4NRZB 1HHKA 3NN8A 3RIAF 1TENA 4AYFA 4Q9CA 4GAJH 3RL2B 3FHAA 4XP9H 2HJFB 5LCVH 5JIPA 3OKEA 3CLEL 4K3HA 3CFKA 4X7CC 4QRUB 5IHUH 2WK2A 4XCYB 3DUHA 4QXUH 3LHPH 5JXED 3MO1A 4JY6B 3PWPD 5FGBA 4G8GE 1BVKA 2BOBA 3CX5K 5DR5H 5DJYA 5JHDE 1RY7B 1AI1L 1SY6L 3UTZA 2EC9U 2CXGA 1N2RB 3C60A 3SO3C 3TPUB 5IV2B 5GHWH 4LPWA 3TZVC 1ZVSA 1EVUA 1TPXB 1QPXA 2XV6B 5TE4H 3TIDA 3G5ZB 4LLUB 2ZG2A 1ZLUK 3UTOA 1FC1A 4PY7A 4NBZB 4MNHA 3WS3B 1H3VA 1C5BH 1ORQB 4F58L 1DQJA 5TJWK 3MLUL 1OAQL 3RNKA 3R0MA 4M6MH 2NY1C 3L5XL 3DRQA 3QQ9D 4P5KB 4D9QD 5FYKL 3T04D 1RIVL 1C5DA 3KXFA 3LIZH 4AENB 4Q9RL 4GXUN 3ULVF 3TO4B 3MJ7B 3MJ8B 1I7TB 4WI4A 4S1SH 1VPOL 2B5IC 2HVJB 1GGCL 3TP4A 3QWQB 4C4KT 4ZAKC 2E6JA 4KI5F 4Z7UF 1DZBA 3EZJB 4A6YA 1I75A 1T3FB 1QKZL 4I0CC 1A4KA 1RVFL 5L7XL 3KYKL 4JM2C 1EFQA 4Q6YA 5CBEA 1QG3A 1TITA 3HE6D 2I25N 4Z7NF 2FSEA 4MJIA 5EZOL 3DUUA 3QIWA 1G6RA 2FIRT 5C0AA 5JQHC 2XWBB 1JPST 5I9QC 1ZVSB 4XVUD 5J3HD 1MRDL 2X7LB 1IAOB 3IDUA 3QA3A 5TQ2H 3S5LG 1BD2D 5IV2A 1GGBL 4I2XB 4LLDB 3ZE2E 2ENSA 1VESA 3QNZA 1NMCC 2C26A 4G42B 3NA4A 5BRZA 4KAQH 5HYJB 1UJTA 3NFSL 3MO1B 3VFGH 4S1DD 1Q1JH 4PJGB 3WFEL 1CG9A 4JFDB 4MNGB 4XAKE 4R90H 3QR2A 4XP9L 2W07A 3HI5L 3QDGE 1N6QH 2R2EB 1RJZA 4OZFH 4U7SA 1FZMA 3WD5H 4WFGD 1I4FA 4PRPE 2FX7H 1TJHL 2I07A 1IGYA 2JJSC 3BZEA 3PWPA 5F7NC 3X17A 3S6CA 3VXRE 5F71A 5HJ3B 4XNXL 3V0VA 4NN5C 5I16A 4WU7B 3T0EC 4NP4L 5J12B 2HKFH 5AUMB 1BAFL 4R8WL 3BP7A 3B6SA 1Z3GL 5KAQF 3QWOB 1IGCH 4DW2H 1BREA 1BF8A 3UMTA 5IB2B 1QQDB 1W0VB 2A6JA 4JM2D 1N4XH 3IKCA 4F37F 3HA0A 3TO4A 4QHNB 4P48A 1REIA 3QPXL 5DQDH 3VRLF 4Z7WE 1ZHLB 4L8CA 5BJTA 4OAWA 4JQVA 4P5TC 3P9WB 2OTUB 5IEHB 3OMZA 1MRFH 3VXTA 1BBJA 3RNKB 3S37X 4HIXL 4NKOA 1H5BA 3C5JA 2F8VA 5FKPA 4YK4B 1MCDA 4RGNC 4GKNB 2B1HL 4X6BA 5F6IB 4XCEA 1KIRB 5DLMH 4EQ3A 2ZUTA 4QOKA 1IBGL 4D0CB 1R3JA 2HFFB 2ZJSH 3RKDD 3RWGA 3C2SA 5FKAA 3DGCR 3TWCH 3RUGA 1MVUA 4IS6B 1F6FB 4JZNB 2R8SL 3ZZ1A 5ESVB 1N0LA 1PKQB 4B0MM 4U1KA 5J9PB 4MMXC 4GBXC 4NUJA 1BMGA 1Q8MA 5IEKA 4U1HB 2ZCHL 3TCLB 3O4LA 1FYTA 4F7PB 2NTSP 4JFFD 1YNKL 5K9OA 2X44D 3HI1B 4MAUH 4XMLH 3GSNH 1DLHA 1F00I 5IQ7L 3ORJA 1J10A 5HYSA 5TF1L 3FN0L 2CDFA 1L9NA 3HZKA 2V7NB 3I9GH 5F70A 4YE4L 1D6EA 3NVQA 4LBEB 4OCLC 3MUZ1 1ED3A 4OFIA 1T2JA 2V2XB 4JFOB 3AVEA 4PJFF 5IB1A 1IEAA 3ZE0F 3PDOA 1KC5L 4LKXB 1CXIA 3ZKND 2B1HH 5HHXL 1K8IB 1NKRA 3PIQA 2ICCA 1IJ9A 2EDJA 4HGKC 1QSVA 4R2GD 1IC5H 5DK2A 1MNUL 3VCLA 1DN0B 1KPUA 1NEZG 4YHZL 5K9KA 1MNUH 1WWBX 3GO1L 2ZUUA 5KW9L 1UQSA 1MCOH 3PQYB 2JELL 2P5WE 3HS0A 5BZDA 3K7UA 1I9IH 1D5XA 4N0FB 3WLBA 2R1YA 4I0KA 3LZFH 4JM4L 1MRDH 2QV2A 3QDJB 4PV8B 2HFEA 4JG0L 4MS8C 3STLB 4G80B 2X4OA 1QVOB 4JG0H 4YAQA 1D9KB 3LOWA 1JN6B 2VDKL 3WFBL 4PJ8A 3MREB 4LRNL 4X7EC 4TRPL 1FIEA 2V7HB 3FONA 1UEMA 2BNRE 4JZJA 4OZ4A 3NZHL 1N59A 3U9UB 3EYOA 5HDBE 1NC4D 4NQUA 1FC2D 4NHCL 1N6QL 4Y88A 5C09D 5I75C 1RZIA 5JMRA 3PWVB 4YHKL 1U91A 2FX9L 4NNYB 4E9LA 3TO2A 1XGRB 4XHJD 4U1JA 5C0RL 1MOEA 2EIZA 2VLKE 4KTDL 3GKZA 1O5DT 4I3GA 1ZA6A 4DVBA 2CDGB 3FKUS 1T83C 1U3YA 4PRHE 2XRAL 3MFGB 4WI5A 1IRAY 1MQKH 3PQYA 4K3GA 4NCDA 2EDRA 5IJKA 1CXLA 5E1AB 2GAZA 4HIXH 1JJUA 3WL9A 1J05B 3EHBC 1P7HL 2IBBA 1IC7H 3QRGH 4HT1H 3CU7A 5EO0A 4N68A 3DXAD 4PRBA 2LVCA 1XGYH 4RZCB 1B0GB 2WQRA 5HYQB 2KZ1B 1MIMH 3ZL4H 2QQQA 1U2CA 4F3FB 4POZC 2Y5EA 1MVUB 4GXUM 1UZ6E 4IS6A 1HXYB 4P9MH 1W2KT 3IFOA 4FQPA 5ADPL 3D1MC 3K81A 2IANE 4QXTB 1T20B 4POUB 4KHTH 3VXMB 1BGXL 3DXAE 1PKQE 3MA9L 5MHSD 1IM3B 3WNOA 5TQ2L 3N0PB 2CRMA 4MXQC 2D9QB 4HV8B 3RDTB 3AXLB 1ZT1B 3HMXL 5CIPB 3TM6A 3O3EA 1MPAL 4PJ7F 4POYA 4H0GA 3TN0C 4HWBL 1GPOL 3DXAB 4IRSD 3FONB 5GISL 4OGAC 2V7HA 4XC3H 1OGTB 1J8HB 1BLNA 1GHFH 5MHSE 3K2UH 4K55A 4CN1A 3HZMA 1UKTA 5GGQL 3MRBB 2XZAL 3ULUF 3KYOA 2GK0B 3BW9B 5CBAA 1S8DB 2AJSL 4YIQA 1FDLL 3WDHA 2F53D 2NY6C 3C5JB 2C3XA 3EFFB 2XWJB 1DN0A 2VE6B 3OPZH 4ETYA 1CLYL 3VI4F 2BNQE 5KOMC 5E6IB 1IQWL 1HZHL 5DZLA 1MREL 1CQYA 5EZOH 1FQ9C 5I30L 5C0IA 2W60B 1UC6A 4PJ7A 1M05A 3CU1A 5F1OB 1T1ZA 1IEBA 4LKXA 3V4PL 4K3JH 2EDLA 4HZLA 4WW1A 5E5MA 4YHPA 2G60H 2X1QA 2YPLA 2VDLL 3WJJA 4PJ5D 2BMKB 5DI8A 3KNBA 2WIIA 2E9IA 2YUXA 4JFDA 3ZYOA 3HG1B 3MGTB 2D7QA 4OZHF 4DVRH 3BISA 3DHJA 5SWSE 3CXHK 4ZO9A 4BFEA 2GY5A 4X5WA 2Y5TA 4L8DB 2X4NA 3K2UL 4AEIH 2X10A 1I4FB 1CF8H 1GC1C 1RJZB 3MRRA 3HNVH 3T3PF 2XACC 1AGEA 3ARDB 1FVCB 1ADQL 2BNRA 3QDJD 4NWTL 4WUUD 5LWYH 4MDJA 5IP4A 3MLZL 1PG7X 3O4LB 1R24A 1FFPB 4FZEL 4NJ9H 3UYOD 2O93L 5LGKA 3T0AA 5H37H 1AGBA 2G2RA 3TCXA 1WZ1L 5CEXA 5JW5B 5C6PB 3CNKA 1CE1H 1QRNB 4P3CL 4E42B 1JZ3A 4HUVA 2FO4B 1U95B 2AABL 1UXWA 3GSOB 5KZCD 3NIGF 5ACMA 2F53B 4NO0A 4C56E 1A6AA 2H8PB 4X6FB 4OFYD 1FG2A 5IW3A 3FFCE 4TNVK 2ZPKH 3P77A 2GUOA 1V3KA 1YEDA 5BVPH 3LB6D 4JKWA 2MFNA 3NA9L 4HMEA 4IMKA 4JGMA 4Y4KC 2VZOA 4PY8I 1IAIM 3MLUH 2ZKHL 4G6FD 4OT1L 4J4PC 3EYVA 3KDMB 1HHHA 5FECB 5IOPB 3EYVB 3KDMA 4KUZH 4LEXH 5T5NG 5JW4R 5HYFA 5T5FL 4GRWB 1K4CB 2H9GA 3KS0H 2HH0H 5T5FH 4J6RH 4KRNA 1BM3H 3HNTH 2VITB 4XVSL 4X7FC 4YFLI 5EA0H 1WLHA 3G5ZA 4ZXBD 2E7MA 4X7SH 5FA3B 1AE6L 3PNWB 4Y19B 3EO9L 4LCCC 5D9SA 5EG6C 1PYWA 3ULSA 1JGVH 4M61B 4KV5F 4L8BB 3RWEA 1GIGH 2DYPD 1NFDE 4UUJB 4CAGA 4N9GB 3C87A 1EFXD 3OR6A 3ARRA 1VFAB 1PX3A 3BP6A 2FJHA 3IJSA 1MFAH 4LSRL 5EU3B 4G8IA 1BQLH 4CVZB 3MRPA 1EXUB 5HHNB 5F7UA 3E2HB 1SJXA 4KROC 1FIGH 4HLZH 4ZFZA 4JZNA 4K23L 3SN6N 2A6IB 4GRMB 3KJ4B 5LG1A 5DFVD 3MRRB 4D9LL 2H26A 4YBHA 3RHWF 5ABDE 4K94L 3V5DA 3F12A 3QJHA 3S98A 3B83A 1H3UA 1TVBB 4U1IB 5EBLB 1TCRA 4YDKH 4EI5C 4D8PA 4JRYD 4LNRB 5D2LA 3G6DL 4HUKB 1HIML 3MRFA 1G6RB 1MY5A 1FFQA 5DZOA 2J6EL 1AC6A 5IMOB 1AGDB 2AI0L 4K8RH 2Z31B 3JV6A 1BBJB 4CW1A 2DYPA 2JKXA 3L7EA 4KHTL 4YHPB 4GUPB 5JORB 1T2QH 3W5NA 2X1OA 3D3VA 5FDWB 2N56A 3B5GA 1GRWA 4TVSa 5H94A 1CFNA 1F4HA 2Q6WB 3QXAA 1MFDH 5BW7C 3INUL 3S5LA 1CFSA 4GW4A 4Y1AB 4NNPH 2EKSA 3MRHB 1A14L 1JHLH 3WSQL 3H9SB 4R7DA 5I1KL 4U2YA 3ALPA 1L0QA 2NY0D 2PW2B 3SKMB 3PHSA 3NCMA 4KU1A 2CIIB 1A3RH 2KUTA 5IVZB 2QKIB 3RFZC 4ZQKB 3V0WH 1DQJB 3JVGA 1E4XI 5FDYA 3VI3F 4XXCC 2L0DA 3VRLE 4P5KA 2PTTA 1T0MB 1WFNA 2VN4A 3IJHB 5DJDB 5GGQH 2ZUYA 3WFHB 4BZ2L 5DHXB 1NCDH 5D1QB 3AXLA 4IOFD 3QNXB 3KYNB 8FABA 2FJHB 3IJSB 2LAGB 3QO1A 1OQOA 5EO1B 3PXHA 4NQEE 1LEGB 1ES0B 4OUUB 3OR7A 4KK8C 5CWSB 5E94B 3QNZB 5F3HB 1P53A 4XCNA 2P8MB 1XF5B 4FQQA 4OCSL 3TJHC 3HE7B 4XPAL 1E28A 5T1KA 1DBJH 1NDGB 3F7YA 3GBNH 2PXYB 4U1SA 3BWAA 2YPLB 1AD0A 1YDPB 4LU5H 3CMGA 1J1OL 3C60C 3WSQH 4B53A 3LQZA 2FSEB 4MJIB 3TZVA 5C71A 4PRBB 4L3AA 1T0NA 1J18A 4QRSA 2FHFA 4WUKH 3GJFA 5GRYA 1DBBL 1Y6NR 1Y6MR 2BY2A 3RTQB 1UCTA 3D2UA 3V6ZB 5I8CB 1G9NC 2DS4A 3ZHKA 5D9SB 1VHPA 4ALAL 2VLLA 1YYML 4ELME 3WNPA 2HMID 4MA1C 1IC1A 1YEKL 4YZFF 1F4YH 4AEHL 2ENYA 2YK1H 4N8VA 5C07D 1LE5B 1G84A 1AGFA 3IT8D 5I9QB 3M1BA 4DOHB 1N8ZA 1CU4L 3FO2A 4OD3H 2GSGA 5IVNA 3DXAA 2Z31A 4PJ9B 4XRCA 3EJZC 3P73B 5JXAL 2Y9RT 2X70A 3D18B 3MBXL 3EYFA 3T0EA 3BYYA 4U1IA 4DOHE 1W0WB 1MCQA 1T5WA 2R4SH 3JZ7A 1JI2A 1XR9B 4PBVC 1UXWB 3JWOL 5I71C 1XF4B 1DSFH 4KAQL 2UZIH 4OF3A 1YNTB 2P5WA 1XCTB 4HX1A 1CLOL 4M1CC 2VDQH 2EEBA 1LK3H 4KV5E 2CKBA 3LV3B 3C6LB 5J11B 1KBGH 4J3OC 2G75A 3L95A 5IHZA 3ARED 2UY6A 1TZGH 4AEIL 5K9QG 2NY1B 1JGVL 3DOSA 4YR6A 3T65A 2XN9A 2HJFA 4QTHB 3WJLC 1X5JA 1A6VH 1EEZB 4UT7H 3S4SG 4EI6A 4I9WE 4HEME 3U7WL 3PGFL 4M61A 4CVXA 5HI4C 5T3ZD 1GGUA 4NQVB 4JRYA 4KVCH 3ELAT 5EOCL 1BZ9B 1KB5H 1AC0A 4JHZA 3ULVL 4UV4H 5LGHH 1F4XH 5FYLL 4KQ3H 5BCAA 5E70A 3QUXC 2VZVA 5DD1L 4FA8A 5IWLC 5C9JB 2H9GB 4MD4A 1FYTE 5IB1B 3O4LE 1F4WH 3GM8A 5E5MB 4WW1B 4PS4H 1KLFA 3QDMD 1PD6A 1ZT4A 4UV7H 1HQRB 3I50L 4P23C 4JRYE 4PJIE 2PKDA 2AJUL 1I7ZB 4YGVA 3LKOA 5C0DA 1MAJA 1A9EA 1FYTB 2H6PA 3LKRB 4R2GC 1I8KB 3CDCA 3MCLL 5C1MB 4BKLA 4HUXB 3KLSA 2VSDA 5FO7B 3MLWL 3GSOA 4WWKD 2I24N 3BXNA 1INQA 5I18H 2GTZB 3T3PE 1XZ0B 3GSQA 1AQKL 3OJVC 4G80A 1UJ3C 1P1ZA 1G6VK 1A7PL 4D0BB 1MFNA 1YN6B 1CD8A 1KCVH 4YWGH 3RVXC 4J1UB 3CZJA 5DK0A 1XH3A 3HR6A 3MODH 3H9HB 2JJUA 2W91A 4RX4D 4XNQB 3STZB 3RVVC 2UVFA 1Q9OA 1KG0B 4EVNB 5EZIH 3L7FB 3HNSL 4TUKL 5HY9A 3R8BB 2NY1D 3T1FB 5AZ2H 5DUPH 1R3LB 2LE9A 5DSCA 5IROA 2DQCH 1Z9LA 4OFYA 4TSBH 1V3LA 5ID0B 4OF7A 1CVSC 1DVFA 3VI4E 2LABA 3MCKB 2BERA 5D1ZB 4RNRA 1CQKA 3SPVB 3IB4A 5E6ID 4LASH 4NQVA 1EA9C 1UCBL 2DLTA 2R1WA 1TVHA 5TH2B 3UJTH 2DIBA 2DM7A 3RPIB 4X99A 4BK5A 1MF2L 4XMPL 1GSMA 2I07B 5F7EH 3QFDA 3GSRA 2WBWB 4PJAF 3B8YA 1T03H 1WBZA 1EEZA 3CK0H 3D69B 5DMGC 5H37G 4NM4L 3CSYA 4D94A 2R56H 4LVHC 2DF3A 1YNTA 5EB9A 5E4EB 4IDLA 4PJ5B 1NAMH 5CWSA 5E94A 4LDOB 1JTOA 3BE1H 5DJ2B 3H2WA 5MEPA 5DMGD 2JLLA 3WNNA 3H9YA 5D2LE 1OARL 5TDNB 3TYFB 2FYYB 1MCWM 4G42A 2YUWA 3GSVB 5CCKH 1BQUA 5CZXC 3FL7A 5C7XH 5F7LB 2NY2D 3B8SA 1UB6B 3B2UD 3VXMD 2NZ9D 1G9NL 2QHRH 5DYOA 5J12C 4QHKJ 2NY4B 2WINB 5GS0H 3MRNB 1OGAA 4NO5A 4TTDC 5D1ZD 5IB4B 4YQXH 1RZFL 3AGVA 1GGIL 1SM3L 1UQSB 1EH9A 1PAMA 1JGDB 3MRCA 4ALAH 4GKZA 1F90L 3SOBL 2X4UB 4KK9C 5BS0B 1N8ZB 4AK1A 1F4WL 4UB0H 5F1NB 2HFEB 4F7MA 4PJBE 5IW6A 4ZSOE 5MEND 5AYUL 1QFWL 1NAKH 3MV9E 3L3KB 1OY3B 1VDGA 5KVEH 3KPSA 4Q0XL 1MQKL 4F7TA 1OSPH 3ARVA 4RMVA 2K7QA 5H94B 1NMAH 3HRPA 2MQ3A 4MD0A 1IC4H 4ZFOA 1MELA 3VA6A 2I5YH 1DR9A 1NJ9B 5C9KA 1W0YT 1HSAB 3D3VE 5E2VL 3BN9D 2FHCA 4ODUB 2AEPH 4D0DB 2D7TH 5T1LB 1PVHA 2VR9A 3BVNB 3FT2B 3BKYH 5ACZB 1ORQA 4YO0A 3FN0H 4DKEL 1V7NH 1S78D 5E8EA 1CICB 2R69L 1CU4H 4G8GA 1KBGL 5F3HA 3MLYH 3TIEA 4IRZH 4KROD 5MENE 5TPWH 1TCRB 2F5BH 3BWAB 1TVBA 6CGTA 4C57C 1NDGA 1MCNA 5TE7H 4MJIE 1ZA3B 1JHTB 5DC0A 1F4XL 5FYLH 3C2AL 4PJ8D 3CSBA 4NSKA 1MRCH 2HJKB 4L9LA 5J4MA 5IHLB 3DMMB 2B5IB 4HJGB 1OTSC 5L88H 1FNFA 3G5XB 2QEJA 1A1MA 5KSAC 3I6GA 5DFWH 3OKEB 3RX5A 1RSFA 2G5BA 1RJCA 2OI9C 4CNIA 3MOAL 4KMTH 5EU4B 3IJHA 5DJDA 2VKWA 5ISZA 2DQJL 5MP6H 5GGVH 3V4UL 1LWRA 3MZGB 1HXMB 2CR3A 3C60D 2NY3B 5IB3B 2H1PL 4JFZH 2IALB 5FGRA 2AEQH 4MWFA 1G6RH 1CVRA 1BJMA 1KGCD 5E8NB 4MQXC 5IT2L 2IFGA 3IDGB 3ROOB 5ICYA 3RY4A 1JRHI 1A2YA 2R0WH 4UIMB 4K8RL 3U1SL 1G7HB 3PGFH 2JJSA 3L3GB 1QD0A 3NCJL 4MB5A 1U58B 5ESQA 3OGOE 3B9KD 2Q3AA 1FYHB 1LO3L 2HKFL 4K7PY 5CJOH 3VMPA 4APQD 5JO5A 1LEIB 3IKCB 4J7RA 4LHUA 4PREA 3SKJH 4MLSA 2Q1EA 1R3HB 3CXDL 4WFGE 2A6KA 4HCRA 4HSQA 2BNQA 2V17L 4DAGH 1A6PA 4RSVA 4CDHA 1DLFH 3SDYL 3V0VB 2BJMH 4DQOH 2HVKA 5GJSL 1I9JH 1SQ2N 1PG7L 4LFHG 5HHOA 3QUYB 4L3ED 3I2CL 4H5SA 2GCYA 2NYYC 1NDMB 2DLGA 2H1PH 1NGXA 4PRPB 4BSWA 1T21A 3MJ9H 4J4PA 1G0DA 2F19L 1AGBB 1S5IH 2G2RB 1TTGA 4N9OB 2VQ1A 5CIPH 5D1QD 4MA3A 5FOBB 4KZEL 2B1AH 3H7BB 3V5KB 2DLIA 2NY7H 2D7MA 3O41B 4FG6D 4JDZA 4GSDH 3BGFC 4ZUSB 1NGPH 3WUWA 3CDYA 4U3XA 4Y19A 3SKMA 4ZUTB 5FCSH 3CX2A 3PP4H 3U2SA 3GB7A 1JZ5A 2GT9B 4ONGL 4I18C 5SWSA 3ULSB 3VFSB 1NLDH 4L8BA 4L4TB 2EEDA 3QDGD 1NCBL 3DGGB 3IDXH 5FHAH 4C55A 2AJZB 1I7TA 4RMWA 4U31A 5EC2A 1LO4L 3TJEH 5EFIA 4NRXB 4XZUB 1YPZF 1C7TA 3ZHLA 3FQWB 4HH9B 1ZOXA 3QPQC 2EE2A 1A5FH 1JHKL 3UBXB 4WY7L 5F7DB 5JPNA 5DD0H 3RJDA 2I5YL 2X9YA 4XBGB 3ECBA 5EOQL 3MQIA 5EBWA 4MD0B 3IU3B 4LSTL 1CN4A 3BW9A 4LNRA 1KJ2A 3BOVA 1MFAL 3X3FL 1NSNH 3OG6B 2F53A 4NO0B 4QGYA 2X6MA 4PP2B 2OL3B 1A64A 3O41A 2VXTH 2D7NA 4XHQA 3V5KA 2ERJB 3H0TB 3NFPA 3WEXB 8CGTA 1EO8H 4MSWB 2G5BB 3ZE2F 5A3ID 3BO8B 1R3IL 4HV8A 4PRPA 1BQSA 3IJYB 4MCZA 5A40E 4I48B 3OR6B 1YMHB 4XTRD 2DLHA 3UAJC 2OTPA 4MA3B 3QIWD 4P49A 4IMLB 5GGVL 3BUTA 1YZZA 4MGXA 2GJ6E 4I2XA 5IK3A 3PNWA 4N1HB 1AE6H 1KACB 4YHLL 5I1GL 1AO7A 4HKZB