4DP4X

The 1.54 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
b'VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp4X00
4YL4A 4HAKA 4BWTA 2P80D 5IY5B 1AZBA 4AKPA 5LDUA 3X1FA 3NP3A 4WTQA 2UX6A 2YAQA 1ET7A 1ID2A 3FPYA 2I7OA 3V9CA 2WO2B 2AVFA 1MZYA 3SBPA 1AS8A 5I6MA 1L9PA 1E5YA 4HIPA 1CC3A 3JTBA 4DP6X 2PP8A 3NSDA 1AAJA 5D4JA 4HHGA 4E9QA 3V9EA 1OF0A 4WKXA 1BEXA 3ZBMA 1JZJA 2XVBA 4E9XA 1KDJA 1RZQA 1PNDA 2VW6A 4AZUA 2PPCA 1BXUA 3QJRB 3RYMA 1FFTB 4DP9X 1E65A 4NERA 1PF3A 3FSAA 3EHBB 1SJMA 3AG4B 3QJQB 2GBAA 1NINA 3WNIA 2DYSB 1X9RA 2XUWA 4BDVB 3FU8A 2HX8A 1J5CA 2CJ3A 2YXVA 1IUZA 2IH9A 3PPSA 4DP7X 3FT0A 3OD3A 3IN2A 3CDZA 1A4AA 1L9TA 2FTAA 3NJKA 2A3TA 5B3SB 3T71A 1AZUA 2DYRB 2FNWA 5I6KA 2BP0A 2Y69B 4HZ1A 1A3ZA 1JZIA 4A68A 1R1CA 1W6LA 2VMJA 2GI0A 2NRDA 2VM3A 1AS6A 4CSPA 1UATA 2CBPA 4M3HA 2LLNA 1MDAA 4DP4X 1AG0A 4DPAX 1AZRA 2YAOA 3QJUB 4A66A 2FJSA 1OCCB 4BWUA 5ANHA 4YSAA 2MRYA 4BXVA 2DWSA 1BQKA 4E9WA 3QJVB 2B3IA 2YAEA 3FU7B 2XXGA 1AACA 1BYPA 5PAZA 1NWPA 2GSMB 3AZUA 4AI7A 4KO7A 2BZ7A 3NJHA 2J5WA 5B1KA 1AR1B 2PPDA 1J5DA 1FA4A 3AG1B 4N4YB 1SHXA 1JZEA 1NPJA 2EINB 3FYIB 1SDDB 1AANA 2WSDA 3S3DB 3NJGA 6PCYA 1NPNA 4YSCA 4KOBA 1NZRA 4HALA 1RKRA 2AANA 4GXFA 2P80A 3GDCA 5EHFA 1BAWA 3EH5B 3PAZA 1W8EA 1CUOA 1NICA 3FS9A 3MX0B 3NYKA 4GYBA 4RH4A 1ILUA 1MG3C 1XB3A 3L45A 3TASA 4YSQA 2HX7A 1A4BA 3FU9A 1B3IA 3FQ1A 3MBWB 2YAFA 2XU9A 2BP8B 4Q8BA 3PAUA 2HZHA 1ASPA 2FQGA 4BK5C 2Q9OA 2HRGA 1XB8A 4A2GA 4FAAB 3EF4A 1KGYE 1MG2C 2CAKA 1GR7A 1ASQA 4UANA 2VW7A 2PCYA 2XXFA 2YAMA 2I85A 2UX7A 3IBOA 3NSCA 1BYOA 3WKPA 1OV8A 1SNRA 3X1GA 2CUAA 2HX9A 1DYZA 1GY1A 2OJ1A 2VM4A 2XX1A 2UXGA 4PCYA 1AS7A 3S3BB 2RACA 4ENZA 2IH8A 2UXTA 4G7QB 1GYCA 2XV0A 3UGEA 3T6VA 1ZIAA 2CALA 3AY2A 1ET5A 3TA4D 1GS8A 2FT8A 3FYEB 2HXAA 3NJJA 5B1BB 3SBRA 2QT6A 2BWDA 3PXLA 3AG3B 3QQXA 2EIMB 2TSBA 3NJLA 5D4IA 3X1EA 1JVLA 2BW5A 2H47C 1ZDQA 1N70A 1KCWA 2OCCB 4DPBX 1NIDA 2FT6A 2ZOOA 4DP8X 1RCYA 1E30A 5A7EA 2IDSA 2TSAA 3PCYA 1M56B 2QPEB 3WKQA 3WI9A 1AZCA 2JKWA 3BQVA 1M57B 1NIAA 4DP2X 4HCFA 1OE3A 1V10A 3C75A 1PZCA 2PLTA 2DV6A 3ABKB 3IE9A 4A2DA 1WA2X 2XX0A 4HHWA 1FWXA 1JXFA 1L9SA 3CDZB 1E5ZA 3T6ZA 1IBZA 4GP4B 2H3XC 1NTDA 3ZX1A 2E86A 5B1AB 1J9TA 1YLBB 2EILB 2BP0B 2CCWA 3PAVA 2J55A 3NJFA 1A8ZA 2J57A 4G72B 1W6WA 3S3CB 3S8FB 4UAHA 1L9QA 2DY2A 3NSYA 3G5WA 5F7AA 2IDTA 1L9RA 4E9TA 3N2JA 3NJIA 5I28A 1OE1A 2XLLA 3D12B 3NSFA 1L9OA 4G70B 1DZ0A 5I6LA 3EH4B 1MZZA 3FQYA 3PLYA 4F2FA 3FSZA 3WG7B 2ZONA 4HCGA 2BZCA 3WIAA 3T9WA 1PLBA 4YSUA 2FT7A 2PPAA 4DP5X 2FWLB 3X2QB 2Y1AA 3UAEA 2J56A 5I6OA 4JHVA 1WAEA 2EIKB 1OCOB 3UADA 3ZIYA 4G7SB 4G71B 4KO6A 4UF7C 1AG6A 2XYBA 3CVDA 3NJMA 1PNCA 4BWWA 1SF3A 3DTUB 2PCFA 2AFNA 1V54B 4A2EA 4DP0X 4KNTA 4YVNA 4YSDA 1AQ8A 2I7SA 1N68A 1SF5A 5B7FA 2VSKB 1IKOP 4YSSA 1HFUA 4A2FA 4TXVB 1PLCA 3ASOB 1PZAA 2HLEB 4QKTA 4W1TA 3QJSB 3FQ2A 2OV0A 1EZLA 3TBBA 4A67A 1RZPA 3QJTB 3OMIB 4W9ZA 1HAWA 1CURA 2FQEA 3FSVA 1ILSA 1V55B 1OCRB 1J9SA 1XB6A 1ADWA 2IWKA 5I6PA 1T5KA 3ERXA 2YAHA 2YQBA 1KDIA 1ZPUA 1JXGA 2VN3A 4MFHA 4QLWA 1KBVA 3IN0A 3OMAB 2AZUA 4P5SA 4X4KA 2JXMA 4YSEA 1QLEB 1KV7A 1HAUA 1NWOA 4E9RA 1XMEB 1WS8A 3OQRA 2VSMB 2MTAA 2QPDB 2UXVA 4G7RB 3ABLB 3N55A 3NJNA 1KBWA 4GY4A 2PPEA 5I26A 2VW4A 5I6NA 2QDWA 1AZNA 1F56A 3QPKA 4F7KA 1TEFA 3OMNB 4E9SA 2BHFA 2GB2A 1ZIBA 2XWZA 3ZDWA 1GS6X 5FC9A 2GIMA 1GS7A 2EIJB 2PPFA 1ZDSA 5I5IA 4NAJA 5TK4A 4E9YA 2PP9A 3WNJA 4A2HA 1PY0A 2R7EA 1BXVA 4DP1X 2GC7C 1WA0X 2IWEA 3IEAA 4AKQA 4JHUA 3OM3B 4KO5A 5I5MA 3BVDB 2BWIA 3UACA 1J9RA 1IC0A 4DPCX 1AIZA 1JERA 3T6XA 2B08A 3FSWA 3KW7A 3T6WA 1BQ5A 1PMYA 4F2EA 1GY2A 3CZUB 2IWFA 1AOZA 1GSKA 4YSRA 3UAAA 1CYWA 2YXWA 5B1JA 2IDUA 4P5RA 4KOCA 4HCIA 3S8GB 3SBQA 1PAZA 4KNSA 2XV2A 2IAAC 2HRHA 4FA7B 5E9NA 1URIA 2QDVA 5AFAA 2JFCA 2X87A 1M9WA 2YAPA 1NIFA 4AX3A 4N8UA 4BXSV 1TU2A 3GXUB 1OE2A 1KCBA 1SFHA 2IDFA 3CG8A 3DIVA 4BDVA 2XV3A 1WS7A 3X1NA 4YVUA 4KO9A 8PAZA 4YSOA 5F7BA 2IDQA 3TU6A 5D4HA 7PCYA 1ZV2A 2Q5BA 2PP7A 3AW5A 1BXAA 3NP4A 3ABGA 5AZUA 2BW4A 4NB7A 2UXFA 1VLXA 2GC4C 3X1BA 2GHZA 3AG2B 5B7MA 1J9QA 3TBCA 1ETJA 3HB3B 3ASNB 2BO0A 5AKRA 7PAZA 1JXDA 1A65A 1GW0A 1X9UA 3UABA 3DKHA 4KNUA 2ZXWB 1OOWA 1NDTA 2N0MA 1EHKB 5PCYA 2FQDA 1QHQA 2DWTA 1CYXA 1SHWA 1TKWA 3FU7A 4K9JA 1JZGA 3FPXA 6PAZA 1KYAA 2ZWNA 4PAZA 4YSTA 3GYRA 1SDDA 3ABMB 5B1JC 1JZHA 1PZBA 5TK2A 4L0PB 5I5JA 4YSPA 4GP8B 1JVOA 4ZK8A 3NT0A 3HEIB 1IBYA 3H56A 1I53A 4CSZA 1OCZB 1ET8A 1QNIA 1SFDA 2W88A 4AKOA 4EF3A 1BQRA 2AZAA 4GP5B 3CVCA 1ASOA 3KW8A 9PCYA 2WO3B 2H5UA 3H4HA 3JT2A 3CVBA 3SQRA 2X88A 5B7EA 1E67A 2BP8A 3H4FA 1WA1X 2R7EB 2FQFA 1PLAA 1TEGA 3U25A 1NIEA 4M4RB 1JZFA 1NIBA 3EH3B 1PCSA 4E9VA 1JOIA 1A4CA 2YARA 4Q89A 4JKNA 2W8CA
chains in the Genus database with same CATH superfamily
1QLRB 4YL4A 4ZFFA 4HH8A 3V5KB 4APQC 2O1AA 2OXHA 4B53A 2A6DB 1A4KB 4UT7L 4WSJA 2YWYA 3SE6A 3H53A 3RX5A 1JMXA 1Z3RA 1E4HA 1AI1L 1E3XA 5E6YA 5F7FA 4DGVL 2E7CA 4FNRA 4JFHE 5C71A 4GAGL 4IJ3C 3HZ3A 1FC2D 3H3PH 4H0IA 1FZJA 4OAWB 4QHMB 5HHQA 4L3EE 2E0PA 5ITFB 4HWZB 3KR3H 4TQ8A 3JV6A 3KH4A 4BZ1A 4TVPH 4GXUN 2Y06L 2A0LC 3KPMA 2P8LB 1OTSD 3FJTA 3P73B 3QCTL 4JFHD 4OCYL 3EF7A 2F19L 5C09B 4LHQB 4BJLA 3UFIA 4GAAA 4L3ED 3ZE2F 1KN4H 4XTRC 5AVQB 3TJEH 2C9PA 1H3GA 1G9ML 5BV7C 2AJSL 3N85L 1CFNB 4DP9X 2OTWA 1WT5C 4XHJC 5DJZA 1I85A 1D9KB 5E2TL 1Q9OA 3EXJA 2J21A 1DBKH 5TQ2L 4CW1B 1BYNA 5D72L 5K9JH 3LS4H 4JFPB 1UZ8A 2IH9A 2OKMA 3RDJA 2BSDA 3I50H 5T5FL 2BSCA 1XBDA 5DD6B 3UTZB 2FTAA 2ZUSA 4M7LL 4TQIA 1FC1A 3PNRB 2BS9A 1IV8A 2OMBA 3M46A 1AGFA 3L1GA 3RTLA 5I6KA 2A1WH 2JKRM 3TC9A 2JTDA 1SVBA 2VERA 4HZ1A 3EO1B 2HJFA 4QAMB 3AB0C 3H42H 2W9LA 3HS0C 3LXAA 1TZIB 5ESVA 3KCPB 1IBBA 4R3SB 1ZHNB 2WXRA 3OKEA 3QFGA 2RBLA 3BH9B 1JN6A 3QB7C 1EUTA 1AD0B 4DW2H 1AZRA 1YY9C 4I18C 1DBBL 4XOAA 4BWUA 1HXYB 3DI2B 2WKOF 4TRPH 3QFJB 1I8MA 2E76C 1RLWA 4G8GA 1R5WA 3RWDB 1UOVA 3D9AL 3NUKA 3QQ3A 4FDWA 3RWCB 1BZ9A 4W9CC 3V5HA 1KXVA 1XEDA 2CUIA 3OPUA 5EU6A 1DVUA 1JWSA 2I27N 2XN9E 3U9UA 5ID1A 3DX9B 5E00A 1MIML 3BVUA 5LHDA 3QUMH 1HXMB 3TO4C 4LPYA 1A6WL 4NO2A 1SYVA 1OZUA 1AANA 3FZUD 4NUGL 3WJLC 1XHHA 5EZOL 1MCBA 4K55A 5ILTL 1N3NA 4WI6A 5GRWA 5CSZA 5CBEA 1T6WA 5IR1B 1AGCB 5TE6L 1J8HE 3RIAK 2D2OA 1S7UA 1A6ZB 4ZUWB 3SKJL 1I8LC 5CILL 3CFCH 3KG5A 4BQ9A 4Y88A 4BFJA 3T8XB 3L45A 2HX7A 3HE7C 4HUKB 3KJ4C 1H3TA 1R3IH 2CCVA 1M05A 4AK2A 4LFHG 2K4AA 1MFEL 2X4RA 5GJTH 4IBYA 3MOBH 1MRDH 1UZGA 1KCRH 3HJEA 5F1IB 3QUYB 5EPMA 2R0ZH 3L1FA 3TA3D 1WRFA 4P2OA 2GBTA 3KGTA 2F53A 1KIQA 3BP6A 2W9DL 5IHWA 5MERB 4K8RD 1G7MA 3QWOB 4HGWB 3H9HB 4PREA 4NS0A 3L5XL 5T3XL 3B9VA 2HT4D 4GW5A 4ZFOB 4HUVA 5EULV 2DD8H 2G3MA 1EXHA 4JHWL 4FTVE 4CC0A 4D0BB 1OP4A 2IV8A 5F9JA 3KPQB 1AS7A 3VD3A 4LPCA 1JTTA 1OTTC 4MAUL 3O8XD 4IU2A 1CGYA 1SEBB 1X5ZA 3WIIH 4P3DA 4C56E 4KDTC 3MFGB 4FTVD 5JA8B 1HIMH 3TA4D 1S9KC 1E40A 3FRPB 3MLYL 3NJJA 1OSEA 3IJEB 1UA3A 5DHMC 3C5ZB 1R47A 4J8RA 3K8MA 3EOBA 4C56D 3N04A 4JO5A 3VWKB 4P2QD 4MQ7A 4APXB 4QNPE 4J3UA 4OIAA 1LHZA 1S9YA 1E30A 5A7EA 3VFPB 4Q97A 1QSFA 4R96B 1FNGB 4BQCA 1JXKA 4WJG3 1GW6A 4J1UA 1CBVH 2SEBA 1VGEL 4ESKA 1WEJL 3SODB 4A2DA 3IU4L 3SY0B 2DQFA 4K7FA 4G8EA 4QHPA 1JXFA 4NQXB 2WXGA 1EHLH 1BA9A 1MFMA 1DQLH 2H3XC 1T1WA 1JK9B 5F1KC 3KDMA 2UY6A 3WJMB 1WCQA 1E6OH 3HW7A 1ACXA 2EILB 1GIGL 1U58A 4QF1B 5C6TH 1HNGA 4OM0H 5E1AA 3G6DH 2E4TA 3BGMB 4OW6A 2WXMA 4CU7A 3GJEB 1YEFL 4KRPB 2XQ0A 4FXKB 5CUSH 1GCFA 2DQHH 4J12A 3MRMB 1AQDA 4DKEH 4P5KA 1OWWA 1QI4A 3ATEA 3P3TA 3QXDA 2P5EB 1LNUA 2VAAA 4RAUB 1JGEB 2B14A 4FC3E 5ALBH 2VDKH 4HCGA 4RQQA 3TPKA 1L0YA 1B2WH 1P7KA 4KITB 2BERA 2DQTH 2J56A 4LCUA 5EA0L 4BFGA 2EIKB 4PJIA 3A4EA 3GMPA 2NTFB 3E6HA 4G7SB 3O3EA 4RGNB 4WFEE 5KSAC 3ZT7A 1EO7A 3MRNB 4QNPF 5F0PB 1XF1A 4BWWA 1Q9LA 3L6FB 3KYOA 3TBVA 1F4YL 5JR1L 2NXZC 2H0PA 2EVJA 1QHOA 2NY7L 4MB1A 4YXHL 4WW2C 4YVNA 4X7SH 4N86A 1N68A 2OSLB 3T3MB 1M9SA 1NEUA 3ETTA 4G7VL 4ELMB 1VB9A 5FHAL 3UAJD 1S7TA 2XWDA 1BXXA 3DVIA 1D5BA 5FECA 3I3DA 3P0GB 2QLYA 1WICA 4LLVA 2CU9A 2WCPA 1H5BC 3R06A 1K4DB 3HAEH 4NSKB 2YS4A 1IGTB 5DRWA 2VMFA 4UYQA 4L2YA 4N90D 4F7TB 2A74B 1X9QA 1WBYB 3M1BB 1AOHA 3AU1B 2GJRA 1XB6A 4X9IA 3U4EA 3EZ8A 3RJDA 3MRJA 1X5YA 2X1WL 4WW1B 1VA9A 3QPXL 2K3HA 5TE4L 1PZ5A 4K8RH 2ICWB 1M53A 3AACA 3CHRA 3PRZA 2Q8AH 3DRTA 2MQCA 4PHXA 2RFXB 3AXIA 2BSTA 3T0EB 3FUMA 4GKLA 4NYLA 3S88H 1XR9B 4ECNA 4M1CD 2DWEB 4UM8A 1A9BB 2NZ9C 2JLPA 2Q3XA 4NQSA 5EN2B 2BCMA 5FFOA 3LZLA 2XWZA 3EBGA 2OLDA 1UXLA 2CIIA 4Q2ZB 5GS1C 5IHUH 3WEXB 5C0JB 5HD8C 3W39A 4K3EH 3QRGL 3X3FL 2ED6A 1G6RL 3NA4A 4N0UE 1R46A 2XICA 4NPYA 1UM4H 4QOKB 1IZKA 1WA0X 4MMXB 4WGWB 1U36A 2JQAA 4JANB 4OH2A 4RISL 3V6OE 4LLQB 3SOBH 1RJLB 4H4NA 3AITA 3PDOA 5DJXA 4JLRB 4JL2A 1DVTA 4EI5B 2MNUA 5CCJA 1FNSH 4M62H 4CU8A 1UXSA 3HI6H 3QDHA 2JIXD 4KK8D 3KW7A 1S5HB 2EIBA 4N22A 2EUXA 4X7TB 2WWMC 2YUXA 5L7XL 5MEQA 3DDGA 4K7PY 4ODUA 1IAOB 1CXEA 1X7SA 2F7OA 3HTLX 4QLRA 5ANMB 1SHSA 3CN3A 1EXUA 4LEOB 3Q2LA 1JPST 3E9UA 4WDIA 4UV4L 4FQQA 2OXGB 2HRHA 2VLME 4TSAL 4MA7L 4PPTA 2HT2C 4NOBA 4P9HH 1UM5L 3LSOA 2AXJA 4ZQKA 4PH8A 1NBYA 1B0WA 3RNKA 1FFOB 2OR9L 2IQAA 2A99A 3FQTA 4G1MA 4QXGH 3ZO9A 4B7IA 2VLMD 2XKNA 4JG9A 3RU8L 5E1QA 1EFXD 3RHWF 4G9DB 4RMBA 2B2XL 3EYQC 5LO7A 2WVSA 2XV3A 5F6IC 1JF6A 3DTDA 4M02A 2P5WB 1IEAB 3VMNA 2JELL 4KO9A 2W0FA 1BQUA 3ZTJG 2NY6C 5F7BA 4YX2H 1ZGLM 4XVSH 3TYFA 2NY5H 1B88A 1UB5A 2DMHA 2VR9A 3D05A 4FQXC 2ILLA 4M4PA 4AV0A 1MSPA 3NCMA 2ZF8A 3APNA 3DK2A 4AT6B 2R1XA 4JVWA 2ZAGA 3L3HB 2EC9U 3TBCA 1NAMA 4PJ7B 3B6SA 3NTCL 3BP7A 3DECA 1JSYA 2IPKA 3N50A 4WW2F 4JDEB 4HVBA 3OAZH 1P4IH 1E8YA 3UYRH 3C5SA 2J6EA 3BIKA 5DD0L 1IGCL 1DSWA 1CO1A 1TDQA 3U82B 2CHWA 2N0MA 1I3RB 1URZA 4WEMB 2H9GA 4D9LL 1ZRUA 5KVFL 1UXWB 3VGAC 3WNLA 1C7SA 3VFTA 4JK0D 5DZAA 4Y0GA 2A9NL 2JJUA 3FFOA 4R97B 4M6NH 1NGXB 1VEMA 3DUUA 2BNQA 4YZFF 3WFBL 1FZOA 1UCTA 2AABH 3KPPB 4EZLA 3NJXA 4KTEL 3DSFL 3PL6D 4RFOL 2MTPA 1ORQB 5DMYA 3B2MA 1GTFA 5IBUB 3UTTE 3D69A 4HA1A 3T6QC 1NDGA 2WYIA 3FCTA 4RBPH 4JG5A 3WIFB 4Z77A 3H56A 2X40A 2N59A 4AXWB 2WPGA 2QVTA 1BOGB 1CU4H 1GYVA 4O2CA 2AZAA 3UTTD 4NBYB 4QRPB 1T83C 4PJXF 3RUGF 3UZQA 4U6XA 2H5UA 1JGDB 3H4HA 3KZ8A 2EKJA 2F68X 4WO4D 1ZS8B 3SJVE 2GJ6E 4X80H 3H7BA 4XN8A 1BF5A 4AZ8A 4TNVF 2E8ZA 1FL3B 2XYCA 4DVBA 1UT1A 4ODWA 1K8DB 4LL9A 4I77L 3V0HA 3WYRA 2K9UA 4PRNB 3SJVD 2GJ6D 1AXIB 4Y1AA 3SY6A 1INDH 1A7RH 4FQ1L 2EO9A 4NUJA 2HT3C 2ED8A 3QORB 4ZMLA 1SPDA 2WWKO 4ORGB 3PIQB 4CVZA 4GO9A 4RRPG 2EXYC 2JJWA 1PCXA 2YBRB 1AS8A 2C3VB 3GSXA 5CIPB 5D1XB 3MRRB 4DOHB 4HMEA 3FTYA 5L6YH 4L8CB 1ECZA 2EXSA 4XXDA 4ZXBA 3Q2CA 1CLZH 4OZFH 4U3XA 3M45A 3NCWA 4FFWC 4JO8A 5EUOE 3IGAB 5C0FA 4PP2A 2NQCA 4RX4A 1KDJA 4Z7AA 3OHXB 1PNDA 2VW6A 3D8MA 5CR8A 5A2FA 3HUJB 1PDKB 4KPHL 1B3JA 1KPRA 4IBTA 3DV6B 5F9AC 5GGSA 2HA1A 3VXUE 2H1XA 2CLVA 4N87A 1MNUL 2Y6SC 4QHNB 3DX3A 4JQIH 3DURA 2XA3A 3LNEA 4DN3L 4F1SA 5FR3A 1T7YA 3VXUD 4ES8A 5D1QC 1YMMB 4R7DA 2BNRB 3D0LB 4PM1A 2MOQA 3GS0A 1BLNA 4G9FA 4AMKL 5JW4N 4QJ5B 3EBAA 2X6CA 2Y2YA 4NQEE 1BECA 3MACH 2X2JA 4D8OA 3UERA 1R5VA 5ADOH 5CD5C 5C08A 3UPRB 2BP0A 4PJFA 1E5AA 2ESVE 2WP3O 4D3CH 2F18A 1W6LA 2R69H 1CQKA 3DGGB 1MHHA 3QUMA 4OFQA 2O6CA 3P0VH 4NQED 2DKSA 5DMIH 1SLVA 4PRIE 1JUFB 1PTZA 1EJFA 4GUCA 4PJCA 4AVJA 2ESVD 1RXLA 1VACA 4Y4FC 1II4E 1MKFA 1PQZB 2D3LA 2H45A 3OKYA 1ZGLP 3UO8B 2BCKA 1E27A 4YHLH 1GJUA 4PRID 4U1NB 3BN9D 2NSQA 5EUKA 1JGIA 3GSUB 4PB0H 4WWKB 2PTTB 5GZOA 3IJYA 4O58H 1YMHA 3ILPA 1G43A 2VISB 3HR5A 2QQNH 15C8L 1IZJA 3D6GA 1QVOA 3M86A 1W72A 3TYGH 4LVOC 3VCLB 3WEAA 5HYFA 1QA9A 4NP9A 2JH2A 1O7DE 3SDCA 1FDLL 1N26A 1PU0A 5T8IA 1VEPA 1NANI 1UD6A 3T0VA 3U0PB 3CBRA 3UBGA 5E4AA 2AQ1A 1HTYA 4Z78A 2WXJA 1TVBA 3MCLH 4X4MA 3MCG1 2Q2LA 3TESA 4TLSA 4WNQB 4WU5A 2JSFA 3L7FA 3BIBX 3UYPA 3CK0H 3K4ZA 3RWFA 2AV7A 4ZUVB 1E5UI 3QQDB 3VMOA 3MRHA 3DJZA 3V0GA 4OF6A 2BK8A 2WYZA 1DUZA 4N0FB 3N91A 4ZUUA 4QHLB 1AIFB 4Q8BA 2R0KH 5DMGD 3LMJL 4AQAB 1DUYB 1XGUA 4XGZA 1FLRH 2XKUA 4JHBA 1EHNA 4TPRL 1MW1A 4JFXB 3WFZA 3WTVA 1FAKT 4HU2A 4GNKB 2R56L 3C6LC 1PL3A 5I73B 2YAMA 1BAFL 2PCYA 1MY7A 3KYMA 4N9GB 1FVDB 4L3EA 4U1GB 4L1LA 1C8PA 4XPHH 3IMUA 2JI3A 2ZX6A 3GSVB 3BSHA 4L8BB 3N3EA 3D7PA 3EGSB 3BD4A 1KCLA 3P77A 3S3BB 5AKTA 1B9ZA 1X5MA 3ZDYB 4MWFB 2A9ML 5E2WL 1HL4A 1SXAA 1F58H 2VDLH 5KSVB 3IETA 2CALA 3FO2B 5DFVC 3P2TA 2HXAA 2J4WH 4MJ5A 4EEEA 4FXGC 5DJ8B 1DL7H 2HTLD 2V7NA 3AG3B 4L05A 3PHOB 2TSBA 4MXQD 1INEH 4NGHL 3VFUA 5LNDA 1Y18B 2EYTA 3OPZH 5LBSL 5SWSE 3K0YA 4IOFD 2QHRL 1KXVC 1KIRA 1SM3L 4K3JH 4XN2A 2TSAA 1FJ1A 1FP5A 4MMYB 5JPMC 3QCUH 5EBWA 1U8LA 2N3JA 3KBHE 4N8VB 4L4TB 2IADA 3BE1L 1M57B 5SWSD 2VLRE 5ESAB 2XN2A 3QDMA 4FQCL 2K8QA 5FO8A 5FDWA 5AW5B 3KCWA 2GY7B 1S7XB 5C0DB 5D7SL 1K3ZA 1F6FB 2UWEB 2E9WA 4K9EC 1E2VA 5BJTB 2Y7QB 2PW1A 3AQYA 2AKRA 2PTUA 4AL8H 4FP8L 4JZNB 1BG1A 3MRKB 4GS7B 3S37X 2ZQKA 4FKEA 5FO9A 3UC2A 1OTUD 1NTDA 1KXQE 4PGCA 4JGUA 2E86A 1C5CL 4MJ4A 3K6SB 4ZPTB 2IH3A 1DO6A 4UIMA 4UT6L 4OVUA 3GRWL 1JZ3A 3CVIL 3NSYA 3LH9A 3V7AE 5GJSH 2QQLL 1OP3K 3ZYIA 4ZS7L 4P2OC 3N2JA 3MN8A 2XLLA 4XE0A 3OJ2C 5DHVH 4BINA 3LHAA 3FQYA 5C09E 3GXIA 1WF5A 5HJGA 3A6BH 4HUXA 1BEYL 4XBEH 3MLUH 3L4ZA 2UY7A 1MPAL 2CUMA 4UDTB 2ZXEB 3L3OC 5C09D 1FNFA 1LWRA 4G3YL 4G71B 5ESQA 3U0TB 1RIVL 5CAYB 2IFFL 3DI3B 3WTWA 4NO3B 3GFUA 1OL0A 1M6OA 5HDBB 3K46A 4QRBA 5EZIL 4OKDA 4A2EA 2F15A 3TA3A 1D9KD 4PD4J 2OMNA 4UQIM 4X4ZA 2VJ8A 3OX8A 4J8QA 4JFDE 3CPUA 1RHHA 1HFUA 1DANT 2Q7NA 2YN5A 4TSCL 3WBDA 2ARWA 4B9JA 5J4MA 4B6ZA 2CWRA 5C86A 5I1DB 3KBFA 5CLWA 3O6LH 3ME0B 4NZFA 4QKTA 4LCIH 4YE0A 2WP3T 4KJQD 3MBEA 4R8WH 3S35H 1DQIA 4JFDD 1DE4A 1WIPA 3RQ3A 2CM6A 4JO2H 1MQ8A 1MRFL 2EDFA 1MLBB 1CURA 3O8XA 2VXUL 2R0LL 4MDJA 3A67L 1DJWA 1ZHBB 1PLGL 5DWUH 3H7LA 2WV3A 4XNXH 2JB5L 3EJYD 3ERXA 4FTVA 5EO9B 1ZPUA 4MQXD 3QULB 1TVDA 1O9ZA 3ZHFA 4KH2A 4NP4H 3FQWA 1NWOA 4U6TA 5E5MB 3RY6A 1I82A 3FUHA 2PYFA 4HHAA 1CFSB 3HB3D 3HBGA 1H6FA 4S1RL 2ZX5A 5J6HB 4PJAA 1B0GA 3EG9B 4P2QA 4PJ9D 2BH0A 3CVHH 4MCYA 5SV3A 4JJ5B 1CLOL 1NLDH 5DJAB 3P2DA 4HYTB 3V4UL 5EF2A 1W2KT 1EGJL 4FG4A 1PKOA 2JKXA 4ANUA 4OD2B 2XNAB 5EU4B 5FA3B 5F1OB 2BVUA 4GQRA 5IQ9A 1OP3H 1AXSB 1DVXA 1PG7H 2VLLB 5D7JB 5GS0C 3ZL4L 4FFYH 5AW1B 1YPZE 4BA0A 3BWAA 5I1KL 3SDDB 2KS0A 3OVUB 1WUNT 2VDPH 1QX1A 1M3JA 4S0SD 2HFFA 2OMUB 2DQGH 1PIGA 2X1PA 1FFNA 4KXBA 4CRPA 2EACA 2R1YA 3P30H 1HILB 1JNHB 2WKLA 2OZ4L 3CFEB 4NKIH 1ID5I 5JXAH 3MNWA 4PVMA 3D2UB 1GOGA 1Q1JL 1JHLL 1VADA 5FA4B 3OR6B 4F24A 2BVPA 3T6WA 4P46B 1LQSR 3NIDB 5D2NC 1G9HA 2JKLA 1N0XL 4P3CL 4YSRA 3KPSA 1CE1H 5DS1A 4KQ3H 1Q9WA 4Q74A 1MCHA 1GKOA 2B1AH 2EXWC 4M1GH 1MJ7L 1HH9B 1E4XH 3ARDD 4X5XA 2D7QA 1FRGL 4MZRA 1YJDC 2YMTA 3L9RA 5IMKB 2NYZA 3FUKA 1DQML 1AE6L 5J57B 1F4XL 1UXMA 5JIHA 1LTXA 1XX9C 2CR3A 2XFXB 4DN4L 2H26B 5K33A 4HFWB 4AIZB 3C8HA 5FGCE 1L5GB 3KPLA 4M5TA 3ECUA 4OFVA 2X5PA 4POZC 5IVXB 3Q44A 4XB3A 3QIUD 3W11D 1QEXA 4HGMA 4Y19E 3AT8A 1GZPB 2APTA 2QV4A 3UAJA 2Y07L 3RPKA 4X7EC 1QI5A 3QG6B 3AMLA 3MV01 5EB9A 2P8PB 3P40A 2B4CH 2Z65C 1GPOH 1TENA 3IDYC 2F7IA 5D4HA 3C5ZD 2FR4B 1MQKH 3PABA 4F9LC 4KQ4H 4LVHB 5IW1B 3VWKD 5FXCH 4ZDHA 1MW2A 4MNGB 4QYAA 4R4FL 1UACL 2G3ZA 1A1NB 5DZVA 2GC4C 1UASA 4EXKA 3IAQA 1AR2A 1OCWH 1OSZB 5B7MA 1ETJA 4QJ4B 1N64H 2G5UA 1Q9KB 4L4VB 5DZNA 3ASNB 7PAZA 1HI6B 4IU3A 1NEZA 4Q56A 3V52H 2QSCL 3H3BC 4MB3A 4BRJA 5I16A 3UABA 2XWEA 3JTSA 3WXWL 5EEUA 1E9OA 2VITA 5EWIH 1I9IL 1FL6A 1WPCA 3L1OL 4H25A 2ICWI 2HKFL 4UT9A 4GQ9H 4GKSB 2FGWL 3BHBA 4I9XA 1MAML 3ZQWA 3ULUL 2W59A 1SOSA 2LHAA 3GHEL 1ZLSL 5DF0A 4MKTA 3CZNA 4Q0XH 3VXTA 2P5EE 1RZKC 3K72B 1TG8A 3LHPL 5KJ4A 2WLMA 3OLGA 4KRPD 4N3TA 1IBGH 1JZHA 3N44B 5TK2A 4G43A 2FHCA 2Z4QB 5KS9A 5HDQH 1MELA 5IFJA 2P5ED 4R5VA 2ZICA 2WZ0A 3UTOA 2OSXA 4ZK8A 2QZQA 3S98A 1KGJA 5DRZB 1JCKA 4CSZA 1ZKAA 4HF5H 4XCFL 4DAGH 1MAKA 2ZTBA 1KIUA 3ZL1A 4J6RH 3O0RH 5DSCB 5DT1H 1XGRB 2G0LA 4UQAA 3EOAB 4UDUB 5H4YA 2W07A 2JIXA 4MCZB 3V6OA 4BCZA 4DK5A 4ELME 4XWOD 3WIHH 5CEYA 4TUJB 4OV5B 2FSEA 3OF6D 3RVWD 3V0FA 4NEHB 1U33A 1FLTX 2W8CA 1KEMH 4OZFA 4Z3GA 1UB6B 3DXAB 4LSDA 4XMVA 1FYHB 5DVNA 4HX1B 1O6SA 5CNHA 4HW6A 3CHXA 1G6RB 1NBVH 4NO5B 4PRBB 3VD7A 3WTTA 4ZYKA 2DKMA 4PGBB 3R18A 4YGVB 5DI8A 5GGTL 1SQ2N 4P48A 3ECBB 4KK5D 3EJZC 3SYOA 4U3CA 3X11B 5JIKA 4Z7NF 1NDMB 4DVRL 4UOJA 1A0QL 1BEXA 2JCCF 3HZYA 1K8IA 2AJZA 2AVGA 2CO2A 4HBQA 4JL1A 4WEUD 3SE9H 5EEWA 5D93C 3JV4B 3QJRB 1HDMA 3IDIB 2ZCKH 3LKRA 1U3HB 1U8IB 1ETB1 4JEGB 4DZ8A 2R69A 1HZLA 1FG9C 3WHXB 1PX3A 3I6GB 2BOCA 1T66C 3UZVA 3CFNA 1KTLA 3UDWA 1WTGT 5F9OL 2HKHH 4YHIA 4KHTL 1DDHB 1UCBH 1MCKA 3S4SA 4QOKD 2XA8L 5CKGA 1GC1L 1SDAB 1NMBH 1XH0A 4Q9BA 3BD5A 4P8QA 2IGLA 1R17A 3E7JA 1KLFA 2HH0H 2OYMA 3E38A 4ELKA 1IL1A 2HUEA 3WL9A 1TTFA 5ABZA 3FK3A 1R1CA 4EI5D 5JTWA 5B38A 4P59L 5ITBH 4L8SB 1CL7L 1UFUA 5ANME 4R90H 4L29B 3CGTA 3PL6A 3MUY1 2ICEB 4WWPA 5IJVA 1KLUB 5L2KB 3OC5A 1YEHH 1DLFH 5CHNA 4X99B 4TNGA 4U0RB 6FABH 4BFFA 4Y5XC 4I2XB 2IPUK 3DMMB 4RDQF 3X3GH 3SO3B 3E8UL 1FFPA 2LAAA 3QQ9D 4R26H 3TBSB 4W81A 4ATWA 2VWEC 2XZQL 3TX4A 3MMEA 4BBWA 1HEJC 3GSOA 1AGDB 4K94L 3T65B 2CA3A 3MLWH 1A7NH 4AYFA 2GY5A 3CLFL 3WE6B 3NDZE 4OF3A 1O75A 1MY5A 5C0CE 2X6VA 2WN3A 2NY0B 3FO1B 3IMSA 4HEPG 2FD6H 3DX1A 3HMXL 4ZXBC 1EZSA 4AYSA 3AREC 5C9JB 5T3ZE 1X5GA 3Q13A 5L4IA 1N2RB 3FOMB 1CK0H 3QUGA 2A6KA 1OF2A 2WWOA 3UTQB 5C0CD 5FOBB 3DYMA 3BYTA 3WXVL 3SJVA 2P5WD 1DEDA 1I8IB 1QLEL 3M88A 4AEEA 4ZNCD 2D3JA 1IGFH 1JYVA 3NYKA 1H3WM 3QH3A 1F6AB 1Q94A 5DQDL 4HXAL 4Q9RL 5B3JF 5T3ZD 1PEZA 4Z3EA 1WBZA 4BM7A 1CFMA 3QIBC 1UWYA 1B3IA 2DL2A 4MJIA 1H3PL 3K2UL 1KWGA 5C0AA 2J25A 3ML8A 4E36A 1ZLWK 1BWWA 2OZNA 4J28A 4AGPA 3F84A 4P4KB 4FJZA 3DHUA 2Q9OA 4Z7WB 5A6LA 4JB9H 5FF6A 1J05B 2GITA 4Z8FH 2CO7A 3ARGC 3JUYA 3REWB 5K39B 1HCZA 2VN5A 3LN9A 3MODH 3OKMA 3T1WA 1A6AA 1DQTA 2OR7A 1BQHA 3CFIC 3RZCC 3UBXI 1XGTB 4Y7OC 3ILDA 1A4JA 1BF2A 3OKNA 4OCNC 3VH8G 4YNYA 1Z9MA 5I17B 4BKTC 5GRVK 4NWTH 2MWCA 1JI2A 1DCEA 3FO9B 1AGEA 1ZVSB 2VXQH 3EYSL 1AYOA 4W4OA 2VERN 5EUOA 2BMKB 3VFRB 1P6AB 3D18B 3M07A 4JFVA 1EHAA 2EUZA 3KPNB 4H8WL 4Z5RB 1ET5A 4Z18A 1E7VA 3VXUA 4PWHA 5E6IB 1ZS2A 2BWDA 1HQRA 3OWEA 1N70A 1KCWA 3QBTB 1EDQA 3WKMH 2Z91B 12E8H 2XVGA 4JRXB 3PP4H 3RA7L 1S7WA 5FWQA 1A47A 4JY6A 5J3HD 1YNLL 3MROB 3KYNA 4NQEA 5F7UA 3GTNA 2OSYA 2W65A 3ZDZB 3CZSA 3NACL 3MJGX 1J1XL 2ESVA 3EJCA 3VXNB 3GTVA 2JJTA 4PLJD 5I8KH 1J1PL 1G9EA 4PS7A 5DJCA 4PG9A 4OI9A 5EOCJ 1IBZA 4CMMA 4NQUA 4YC2C 4KKBC 1JHKL 4PRIA 2FO4A 3FQUB 3MRLA 4YFDB 2Q7YB 3VACA 1HXKA 2HTKD 4NKOA 3VXSB 1J9TA 1U3YA 2BDNL 1NMCC 4FTDA 5HHOA 1YC8A 2KQNA 2J57A 4JKMA 4JN2B 5K9QI 1S9VA 4FERA 3SE8H 4ACTA 1JZ4A 3BOVA 1ZLWH 4BH7B 1QR1B 3QORD 2WAHA 2R29L 3TLRA 4DOHE 1JG9A 1HHGA 1ICTA 2MQGA 5KW9L 1A02N 2LVCA 3EH4B 4K23H 2B20A 2G75A 5AVTB 2DICA 3C8KA 5DWPA 2DIBA 2YA1A 3JWDH 2V2TA 4IS6B 2DQIH 3VO0A 1TETH 2VDMH 3CSTA 1IBDA 4A7UA 1UJ3B 2X4QB 4U6VL 4UF7C 4KXAA 4QD2E 4TOYL 3U6RA 2FJGA 3IDGA 4I5BA 4MQTB 4NWUH 3ZKND 5E4EB 2OMXB 3RAJL 4XNAA 2PCFA 3L3DB 2Y2WA 1JPGB 1T4KB 3QA3A 3G04B 3ZW3A 5TDNB 1XGYL 2BNRE 5B7FA 3I6KA 3FT2B 2C26A 4NDMA 1L6ZA 1DEEB 2WVVB 4HWEL 3LEXB 3ZTDC 2QKIA 4QO1A 1Y07A 3QJSB 5EC1A 2BNRD 3CVHA 5FK9B 4HMDA 4DEPC 5T3ZH 3UC0H 3UTSE 1XH1A 2VZTA 4F7CB 5I30L 4KTGA 3SHSA 5D7IF 2HLAA 1LO2H 1UVQA 2XJKA 5EIIA 4Z95H 1M71B 2CDGB 1IGYB 3ESOA 4NUQA 2PTVA 2BNUA 3GLAA 3OMAB 4P5SA 3AU0A 1KV7A 2VR7A 1AXTL 4YXKL 4R0LA 1MCEA 2B0SL 4JM2D 5FHBL 5SWZB 2FB4L 1DVFB 3QQ4B 1JYNA 1F4HA 2WAQA 4G7RB 3ABLB 1QKZL 2MPAH 2WBJB 2W1NA 1A5FH 4FNSA 4NN7B 3A5VA 3OKLA 1HL9A 5I26A 3GLEA 4L8DB 2VRKA 2VAJA 4N0YH 4QJ3B 3LVEA 5KYWA 4OQTA 1UT2A 3OMNB 3FMGH 4WWKD 3U30C 3JT0A 4M9PA 4RSVA 3W9EA 3PGCB 4Z0XB 2YXMA 4ZFGH 2CGRL 5SWSA 3L13A 4YXLL 4NJ9H 2PPFA 3DHPA 4B96A 1ETZB 3NIFF 5AD0B 5TK4A 4OIFA 2R83A 3T4AC 1TMQA 2EIZB 3WNJA 4J3OD 1ORSB 4ANWA 3CCHB 4JZJB 2NY2C 1WFUA 2EDBA 5F21B 5CGMA 2WUCL 3GBEA 1P7QB 1QRNE 4XMWA 4U1SB 4S1QH 1YQVH 1QLRA 3X12B 3V5KA 4EZJA 1ZANH 2DJ4A 1YEEL 1A4KA 4DPCX 1ADQL 1QRND 4NKMB 2D03L 5TF1L 4KI5C 1KXQA 1EANA 4OLXH 2OTUB 3F04A 1ONQB 3CDYA 1G7IB 2KBGA 2X4OB 1YUHB 4KUZL 4ZO9A 4XO4A 4M5YL 4ZUSB 1HYSC 5AZEL 4KJYB 3V0EA 4OAWA 4QHMA 1BZ7A 4U4IA 2CKBH 5E9DB 3WFHB 1E9PB 5ITFA 3WFCH 4HWZA 4N2EA 4XNZB 5JW3L 3MBEC 5DJDA 1FPTL 2P8LA 1MW0A 5C09A 1S6NA 1XCWA 3ZDYE 2XG4B 3H9SB 3O8XC 4O5LL 3AS3A 4R4ND 4XXCC 5DDHB 3IKCB 3K6DA 2X87A 1RJYB 2KUTA 1D6VL 1VF5C 2I07A 1CFNA 1JD7A 3WO4C 4XPBL 3FRUB 4ONFL 5AOKA 3LPFA 1D9KA 2GPZA 4Z3TA 1FZMB 4DCQB 4XP4H 3BRDA 4CW1A 4LSQH 5EZJB 2UZXB 35C8L 4JFPA 2C7FA 2A4EA 1C1EH 5I75B 1NLBH 1ZVHA 5ISZE 3J27A 2GUOB 2ZG2A 4FZEL 5HPOA 4JFDA 3UTZA 4L4TE 2PP7A 2GTQA 3OTTA 5L9DL 1UYWL 2NY1B 3T08A 2EZ0D 3BSZH 3M1CA 4JRLA 5DHEA 2BIHA 1CJYA 2OMYA 5ISZD 3P0YL 2R4RL 1MWAL 3EO1A 1J9QA 2UWEE 4KXDA 4L4TD 1CTMA 3GLZA 3HZMB 1TZIA 1XGPB 1NKOA 4YUEH 3KCPA 2P26A 4R3SA 3IDXL 1ZHNA 3NFNB 4RFNB 3BH9A 5B8CA 4W6XB 1PD0A 2CM5A 2IC2A 4X6EB 1AD0A 3PXHA 4KNUA 4Y4KC 4JKWA 2CNYA 4PJ9A 2FH8A 1OOWA 4R5XA 3WAJA 1HXYA 1OAJA 2EEXA 3QFJA 3CD4A 1DJZA 4JHZA 3RWDA 5J1TC 3B7YA 3RWCA 4B41A 4JR9H 4WY7L 1KYAA 4A55A 4YO0B 5L8LB 4NO0D 4RMUA 2RMNA 3DX9A 1DN2A 5E0QA 4BRVA 3WIHA 1LL1A 4IOIB 1KB5L 1Z32X 3PDGA 5BW7A 4AIEA 1WH0A 1YZZA 4LVNC 4ENED 4OT1H 5IR1A 1AGCA 2OMZA 3MXVH 1YPZA 1R19A 3NABL 5ID0B 4ZUWA 1A6ZA 3JBG7 1J7VR 1OHZA 3LEYH 4ZFZB 1WAPA 1T22B 3RVVD 2O30A 5D1ZB 2J8UF 4FYSA 1B6UA 2PWDA 3T8XA 4GP5B 3CVCA 2YUZA 5L2JB 1IC5H 4FQIL 3P4MA 3QNYB 3QJZA 3VXMB 1CICB 5HBBA 3NIGF 1IFHL 4PGDB 4HUUB 2E27H 4KY1H 3H4FA 2KZ1B 3V5DA 3ZHDA 5A6MA 3QUYA 3UAJC 2FQFA 4Z7UB 4EUPB 2Z1PA 3FOLB 1T0NB 3DYOA 1EWHA 4EN3B 2CHXA 3QHFL 2AEQH 1HSAB 1W91A 4LFHD 4KZDH 5F88B 3QWOA 2P80D 4HGWA 3H9HA 2A9DA 3HE6B 5LCVL 2IAMC 4DUWA 2ITFA 4ODHL 1TJIL 1WAAA 4H8UA 4ZFOA 2XWBB 4PS4H 4E68A 2GT9B 4M3JA 2J73A 4D0BA 2OYLA 4OZHB 4LOUC 5H35B 4KI5F 2HJKB 1MXDA 2GK0B 1SEBA 3GSWB 2FSDA 1CC3A 5EOCH 3NSDA 5D96C 3U6XA 3ULVL 2IWGA 3IGUA 4TUKL 3QYCA 2V2WB 1MF2L 3FRPA 4QKXB 3IJEA 1FE8H 1OAQH 5DEFB 3C5ZA 2NOYA 5KWYC 3VWKA 5JZ7C 3EYUH 1PSKL 4APXA 2X7LB 1UGNA 4HD5A 1ZEAL 4GI8A 4WEBH 4I87A 2HPTA 1MREL 4IOSD 4WRLA 3E3QE 1O6VA 2LABA 3SPCA 3VFPA 3FSAA 3VFMA 5T3XE 3BZ4B 2ENPA 4R96A 1FNGA 4H8PA 1A1OB 4W9IC 1MCOL 1MFBL 2HX8A 3BJLA 2CJ3A 5D7JD 5T3XD 3RGVC 4UT7H 4DFIA 3SDDD 2IOMA 3O6FB 1UA7A 3FFCB 2WIMA 2BVEA 1AI1H 5FYKL 4DGVH 3WJMA 4HAGA 1AZUA 4GAGH 2DIAA 3TEXA 3WS6C 1NQBA 4QF1A 1OANA 3FU6A 5KSUB 6TAAA 3SN6N 3B9DA 5ICXB 1SN0A 3NIDE 3BGMA 5IG7B 2VE6B 2Y06H 1MDAA 1FIEA 3D2UD 1F2QA 3MRMA 4XZ4A 5EIVA 4UTAL 3V0AC 1NOFA 1HHIA 4P46D 4KKPA 2P5EA 1OCCB 4RAUA 1JGEA 1WC7B 1G9MH 4ISVB 4RMWA 2EE9A 5DZ9A 2AJSH 3GI9H 3N85H 2JNZA 3U0WL 3K91A 4KXCA 4IRJC 4X6DB 1A7PH 2ZYIA 2NLJB 3MUZ1 3GB7B 2QLVB 2NTFA 3G08B 1DSFL 5IVXE 3MRNA 3X17A 3GT6A 2J5WA 5D72H 2Q86B 5A16B 3S9DB 1N12A 2FNBA 2MMXA 3RIFF 4CU6A 3CFJB 1I31A 1MHEB 2Y5TB 3DDFA 3OF6A 3GHBL 5T5FH 1AY1L 2MSPA 4U7KA 4GXUM 4RAHA 2OSLA 3BCFA 4NZDA 3IMWA 3W56A 5FUOL 4ELMA 5A2LH 1L0PA 4MNGE 1J87A 1MWOA 2D8KA 3CSPA 4UQBA 1ODUA 3QQNA 4JAMB 1VESA 5KANI 3PWLB 2V9QA 1OO2A 2XN0A 3CDGB 4D7PA 4NSKA 2VXQA 1IGTA 1HQ4B 3IF1B 1OGAE 1A6UH 2IV9A 2WCGA 1QFOA 1UJTA 1WV7T 4IMKA 3SE4A 2A74A 3M1BA 1WBYA 5GRZA 5C6PB 3AU1A 4M6ML 3JZYA 3KHOA 1XZWA 3E6FB 4OIIL 5AAMC 4Z7QB 2FYVA 3PGFL 4WEEA 3SYPA 4WW1A 1BM3H 4XAKE 4K7PL 1KCUL 2C8NA 4HG4J 2ICWA 2XBDA 1UWFA 2I85A 3NSCA 4BELD 3VD0A 1GXEA 4ZO6A 2EDDA 2EJ1A 2RFXA 5TPWL 2JMRA 4FL4C 3CN2A 1XR9A 2DWEA 4XAKD 3D0VA 2BJMH 1A9BA 3FF8A 4N2HA 2RACA 1FCGA 5EZOH 5C0JA 5DLLA 4JPIB 4Q2ZA 3HS9A 3ETSA 3WEXA 2XQYK 1RJCA 3TBTB 3OLIA 4KKNA 4TNWF 3ESMA 1IC7L 3SPHA 2YPVA 3IDMB 1T7WA 1AMYA 4ZW5A 3TT1L 4QOKA 2H3NB 3EGDA 1IX2A 4MMXA 4X5WA 3NK3A 2RIKA 3O2VL 4JANA 1TOXA 2YSSB 4LLQA 1SHMA 1RJLA 3K5SA 4F7PB 1WFJA 4JLRA 4IBZA 1M56B 4EI5A 5JPNB 4GG6B 4NJAL 1NOAA 4OD1H 2Z93B 3G6JF 2YRBA 1NIAA 4WI5A 3O2DL 3RL1B 4ABVA 4HCFA 3TF7C 4NZTL 2W9DH 5GZNC 2PLTA 1XZ0B 1S5HA 5T3XH 3VE0B 5KS9F 4J3BA 2Y1ZA 3VD9A 3C08H 5FV1L 4PRDB 4X7TA 2F8VA 1GGTA 3DXAE 3CQPA 5CM1A 5JYMA 4CVUA 1D5ZB 1ZK9A 2QR0B 3FB5B 5D7HA 3DX7B 5ANMA 1WISA 4ZSOB 4LEOA 5DYFA 5B1AB 5E51A 1N5AB 2EEFA 3PJSA 4BZ2A 4LNRB 2OXGA 3DXAD 1IGMH 3S8FB 4I48B 1F18A 2E4FA 5SX5K 4Y4HD 2V5SA 1UHVA 1MVFA 4XMKH 1RZJH 3GRBA 3KVPA 1FNLA 4H8QA 1JYXA 1W8NA 1RZ7L 2G4EA 3NSFA 1FFOA 2MKLC 3D1MC 2W0KA 4KROC 1VFBB 1J5IA 2ZG1A 1OSYA 4G9DA 4AC4A 4CADB 3ZDXB 1J0IA 5FPIA 2FT7A 5C0CA 2CJUL 1JDCA 1A8JH 1N5YL 2P5WA 1IEAA 1HKFA 4JHVA 5HDOA 4PJEF 4QRQB 1JNLH 1V05A 1VGEH 1DVYA 4M48L 2V37A 2K7QA 4OCMC 2IG2L 4AT6A 4FG2A 4U1JB 1NGZB 3L3HA 1GJIA 4FA6A 3MOAL 2YKLL 5A2AA 4PJ7A 3IYLW 4LLAA 5F7DB 2L7EA 3KH3A 5JLZB 2C7UB 2DOCA 2X28A 5AWNH 4JDEA 4AQEB 1GIGH 4FEIA 5LNEA 1EEZB 3L3IB 3FQ2A 4CBPA 3ATFA 5DZOA 1YEFH 4W9ZA 3FB7B 1UXWA 4XNYL 4KVPA 1QRKA 4YBLB 4OF7A 4XP6H 4LU5L 1NGXA 5TTRA 5L2KE 1T5KA 2JJTC 2R59A 1ZA6B 2B16A 3GUTB 4MFHA 1YDPB 3KPPA 4I2XE 3H3PL 1QLEB 2FLRT 2J1XA 3WLWC 1WS8A 1ORQA 3L2LA 1TMCB 4MJ6A 5EBMB 2QPDB 5L2KD 1M7IB 2WQRA 3KR3L 3KM1A 5DHXB 4MX7B 4TVPL 4GY4A 3W1ZA 3K1DA 3DMMD 1F4YH 3WIFA 2WNKA 1QEWB 5JR1H 1SRDA 3NAAH 4AXWA 1F56A 1KN4L 1BOGA 5SX5H 3TJEL 4YXHH 2X4PB 3VG9C 4QRRE 1YVLA 4PCSA 4QRPA 5M94B 1JGDA 2V5YA 3BUIA 5KVFE 5C7ZA 1E5CA 2QGCA 2NY0D 1ZS8A 4QRRD 4LLYB 4XPFL 1DBKL 4JUTA 5E2UH 5KBDA 1XF3B 1FL3A 2WTRB 3SDAB 1AHKA 1K8DA 2K0RA 4PRNA 2X4UB 5GSVA 4NUPA 2PXYB 1G5AA 3O2WL 4Z7WE 3QORA 2A1WL 3IRZA 3PIQA 4ORGA 4PJ5E 3R8QA 5CCGE 2H2SC 3LCYA 5TE4H 1JNJA 4Y2OB 1F8TH 2YBRA 3H42L 4YHNB 2C3VA 3CQQA 3UG4A 5EO1B 3JWNC 3UBXA 3CZUB 1J8KA 1JWMB 5I71B 5D1XA 4PJ5D 3MRRA 1TJMA 3T8VA 2YXFA 5ACZB 4L8CA 3DJSA 4XX5A 2F1EA 5DO2D 5KJ7E 3R4RA 4DW2L 4N0CD 3VFOB 3GSRB 3IGAA 2WQSA 1DVQA 2W91A 2X3CA 3R4DA 3OHXA 2YD3A 1T6BX 3X3FH 3BSZA 1IILE 2ZOUA 3UP1A 4FOMA 2IBGA 1XCXA 5EORH 1I8KB 3BW9B 1WZMA 2FJHB 1BSIA 4HJSA 1IAKB 4QHNA 4R0LC 1HVXA 1INQB 1OE2A 2HFEB 2HTLC 4FFVD 2BVQB 4HJ0C 1TF4A 1RIHH 5JOFB 2EICA 3A0OA 4WHDA 2GTZB 2X6AA 3ISWA 3CZKA 1E6JL 2B77A 1HKLL 1YMMA 2NPLX 2Y22A 2BNRA 4JRXE 3D0LA 2NNCA 2QADC 3AW5A 1LE9B 2BSRB 2VL5B 1U91B 5F44A 2XZCL 4PS8A 2ISDA 5KSBB 1R3LB 4KK6C 3UPRA 5IEKB 2DJSA 4JRXD 1XCTA 1R3IL 5L7XH 3ZTJH 2F5BH 3VI4B 3DGGA 3FFDB 5M7QA 1BZQK 4OZGB 2GSGA 5I9QC 1MRDL 2OQJB 1KCRL 2Y5EA 1JUFA 2R0ZL 1T5WB 2ZUXA 3RPBA 4NCC2 1VCAA 3NZSA 4JM2A 3VXSE 4XVUD 4TQPA 5DMJB 1EEQA 3RTQD 5L8JB 2WTPA 2O4EA 4MA7H 1NDTA 5PCYA 5L8KB 1UM5H 2FQDA 4QEGA 5BS0B 4U1NA 3FU0A 1QBLL 3MJ9L 4LZKA 2BLFA 4K9JA 2OR9H 4WWKA 3GSUA 3VXSD 2X4NB 3FPXA 3RU8H 3BXNB 3Q48A 2X89D 1I7UB 4QXWA 2VISA 3NCJH 2B2XH 4H40A 2X9WA 3QARA 3VCLA 3MGTA 5BZWB 5CJ5A 5F8RC 1P4BL 3TJHD 2Z4TA 1SEQL 2WSPA 1D3CA 2K6YA 3O9WB 1HIML 1UGKA 3TXAA 5F3BB 4U1HB 1P5UB 3H1ZA 3QC5X 4WNQA 2X38A 2YN3A 2V17H 3QRFM 4ZUVA 3QQDA 4XMZA 1QRNA 1ASOA 2PWGA 1E8XA 1WFNA 3ETBJ 3KW8A 3B2DC 2F7PA 4V2BA 2WO3B 1XFPA 3QAZB 4N2BA 4N0FA 1TTCA 4NFDA 1AIFA 1Z0MA 2J20A 4AOFA 1K2DA 3WTSA 5IVZA 4AQAA 1TEGA 1DUYA 2FL5B 1CBVL 1B4LA 1IGCH 2BVTA 4MYPA 5KN5B 4GRMB 1JZFA 4HDIB 4TMPA 5T1MB 4Y7MA 3HHMA 4YOKA 3PS6A 5KVFH 4O51B 5BUGA 2E6PA 3TGXA 1DQLL 2A9NH 4N9GA 5E99L 4LRNH 3HIZA 1ML0A 3WFBH 4HS6B 4YDKH 1E6OL 4UTBL 2PUQT 3FQ4A 4KTEH 4L8BA 4MNQB 4MB4A 2I7OA 3EGSA 4OKVB 5B21A 4OM0L 2WO2B 2KHAA 4MWFA 3V4PL 1SJEB 5IQ7H 3L54A 4XZUB 4HISA 1OB0A 2APFA 5CUSL 2DQHL 4RA3A 4DKEL 3FO2A 2ADIB 5DJ8A 5ALBL 4ZMZA 3PHOA 4JG0L 1GOFA 1UQSB 3QRBA 1DVFD 3B9KB 1B4RA 1B2WL 4NENA 1Y18A 2DQTL 2WBJD 1G7QA 1KBGL 1FFTB 4NERA 2OULB 1Q9OB 1ZTMA 4MMYA 5FUCC 3OKKB 5T33L 4XVJL 1ANUA 4N8VA 1U8HB 1P84K 4L4TA 1KOAA 2HVJB 3G7TA 4RNRB 3IPFA 2EVFA 3HC4H 2QPSA 4ACPA 5ESAA 1MFCL 3GINA 4I77H 4E41E 5C0DA 4DT2A 3CUPB 3JYBA 2UWEA 4X7SL 1DVZA 4F8PA 1CTOA 4U4BA 5BJTA 2Y7QA 3O3BB 4JZNA 5MP6L 2CPCA 3MRKA 1AGFB 4AQOA 3HLAB 1P7QD 2XRAL 3NJKA 2A3TA 3RVUD 4E41D 4ZMXA 3HN3A 1MCNA 4F1ZA 5CXPA 5I1GL 1TQCB 4ZPTA 3ZO0A 3K6SA 3LRLA 2ZOLB 1PZ3A 5F0JB 2YQ2A 3DV4B 1F1AA 3TZVB 3QUYC 2ZCHH 5E9DE 5IVOA 4LEEA 1QNZL 5T5FA 5LGJA 4XAWL 4GRWF 3H9SE 4NM8L 5E9DD 3K8KA 1R5WB 4YDMA 5FB8A 3QQ3B 2B3IA 3FU7B 4UDTA 1MWAB 2OJZL 5ID1B 4OJFH 1M6UA 4H0LC 1E9QB 4Y5VB 1T6VN 3H9SD 5F9WB 3QGVA 1I1CA 4NO2B 4JDVB 4DN3H 1HOEA 5D1ZI 5GS3A 2DAVA 4NO3A 2LW3A 2VKXA 1SDDB 2XTJC 3HAEG 3GSQB 3S5LB 2Z7YA 3D51A 4K3EL 3EBHA 2QFPA 4MA1C 1SBBA 2D9QB 4OCRH 1JPTL 3C5ZC 4W9HC 4YHZL 1UM4L 4GXFA 3VWKC 2P80A 4JMXA 5I1DA 5FCUH 1U2YA 3ME0A 3E9TA 4DK3A 3MX0B 2GFBA 4ICXA 1ILUA 4L23A 1MG3C 3QXAA 3AT0A 4ODTH 3FU9A 2ZG3A 2J2ZA 1JDDA 1KB5B 4HOZA 2YAFA 2ADFH 1MLBA 4N28A 4Q52A 3PAUA 3F3HA 2HZHA 4JO1H 2DMKA 2HJLB 4XMTA 5DA4A 1ZHBA 4QMEA 2JJVA 5EO9A 4DHLA 2K4WA 2R2HA 2Y2TA 4UV7H 4FAAB 1KGYE 4HJGB 3VUAA 1S5IL 2DQCL 3QULA 4ZW3A 4M3KB 4UANA 3MTRA 5E5MA 4HUVB 3IE4A 3FB6B 2X10A 1XD0A 5D71L 4N5ED 1N59B 5KUMA 15C8H 3BP5B 1EFQA 4Z23A 3S7GA 3QS3A 3DJRA 4NPJA 4JJ5A 5DJAA 2XX1A 3BMWA 1TNMA 2TAAA 3WFDH 4IOSA 4K07A 5GRUH 4OD2A 2XNAA 5EU4A 1T7VA 1FCCA 1MJ8H 1QUNA 4FXKC 4P9HL 1X7QA 4Y89A 3WMQA 2D7MA 3QG7H 2WLIB 2VLLA 5D7JA 1AMXA 4X5LA 4NN5B 3VFGL 3FUNA 3BLPX 3HG0A 3AS2A 4KX8A 1DQVA 1MEXL 3SDDA 2Q20A 3INUL 4M03A 2E7HA 3ETBF 3WFEH 4KKAD 1S9YB 2WOYA 4NC1C 4DPBX 3GBML 4RGNC 2ZIDA 4PJDB 5KOMC 2ICWJ 3LMJH 4OTXL 4XVSL 3PCYA 4OUUA 4XWOC 3V10A 1HILA 1JNHA 1KJ2H 4Z7UE 4HIJB 1AZCA 3ZE1F 3KPRE 4JFFE 3RVWC 4K7FB 1CICD 3C75A 3VGDA 3D2UA 2J5LB 3T2QA 5FA4A 3OR6A 2OL3L 4XCEA 3VFNB 4P46A 5HYQB 3LXUX 5ABDE 3KPRD 4JFFD 1M7DB 4X6FB 4F80A 3GXDA 4CC1A 3UGUA 4PW9A 1U58B 3OZLA 3UYRL 3ZX1A 5B22A 4EN3D 3T8MA 3L3JB 5JIQA 2WLJA 1B2YA 3MO1B 3MREB 2A9MH 5AB1A 5A40E 5E2WH 3K80A 4IMKC 3U36B 5IMKA 2A74C 2ZKHL 3NCYP 3BGFC 3S3JA 4N8CH 4EIUA 5DJYB 2C1OB 4KK5C 2XFXA 5AW0B 2XQYA 4HFWA 4M6AA 3TTSA 4M6NL 3NRQA 1L5GA 4AIZA 4KVCH 4ABUA 5IVXA 3L4YA 3FSZA 1Z1WA 4NGHH 5C0BB 4N2MA 4BFOA 1YNTF 2PYEB 3B83A 3D33A 1GZPA 1PLBA 2QHRH 1SM3H 4TN9A 4KK9D 3FL7A 3T0EC 4PJIB 4WVRA 4I4WB 3NCEB 2NDFA 5AEAA 1WAEA 1OCOB 2V3DA 4WIQA 3BE1H 2FR4A 1ZHLB 2LT9A 3NJMA 5IW1A 1NFIA 4G6AD 4GUQA 1J9CT 4MNGA 5AVYB 1CU4L 1A1NA 2KPWA 4GMTH 3A4FA 2ED7A 3BEVB 5F7KC 4BHUI 1JPFB 3NA9L 4PV8B 4U0QB 1OSZA 4WAFA 4YSDA 1FVEB 2DLFH 1SOXA 1Q9KA 1BOYA 2VN4A 2ZPKH 4U3HA 1HI6A 4JPKH 2ADGB 1G7HB 4TXVB 4LLVB 1C5CH 4X80L 2JI1A 2HLEB 2WYHA 1TFPA 1KF9B 2VIRB 3CVIH 5DRWB 4UQEA 2CHZA 4A67A 4EI5C 2QQLH 5EEYA 3QJTB 2FATL 3KBPA 4PBWD 3RWJB 4F7MA 3RVTC 3IJHB 3U4EB 1INDL 3CJJA 1OCRB 1U6AH 4XCYA 3HI1B 2XVLA 3BKJL 4KU1A 1BEYH 3LDBB 1PZ5B 3K72A 3ZR5A 4WI4A 4BE5A 2J44A 5I5RA 3REWA 2CH8A 4IM8A 3PWUB 1KY7A 5K1JA 1CDGA 4G3YH 2Z4QA 3IU3B 4OIBA 4Z7OE 1RIVH 3NJNA 1CLZL 1LWJA 4FULA 4PWIA 4OV6F 5I6NA 1EEUA 1U2HA 5DRZA 4RCAA 5EZIH 3STLB 2FCBA 2JKNA 4E9SA 5J5EA 4F37F 2AAVA 3Q2VA 1XGRA 5DSCA 5KUKA 2EIJB 3EOAA 4UDUA 5I5IA 4L3CA 3TH3T 3TEWA 2J88H 3ULUE 2PP9A 3VJ6B 1EAOA 1PY0A 4TUJA 4JQIL 4PRHB 2Z7UA 4D7BA 4BKSC 3IMBA 4NQCB 2ITEA 3MUGB 3HFFA 3PDOB 3QIWB 5D70H 5DJXB 1MRFH 5IK3B 2QFRA 3THML 4BIKA 3ULUD 4PWJA 1T5XB 3A67H 3BPLB 3DXAA 5F89B 1UXSB 2JB5H 4PY8J 4HX1A 3MACL 4Y4HA 1ZT7B 1G6RA 4PRBA 5ADOL 1H15B 2ZAIA 4PGBA 5HJ3B 4D3CL 3PPEA 2P42B 4MCMA 4Z7QE 2V9TA 5CWSB 1TQBC 4YGVA 4S1RH 5C7XH 2BIPA 3V6FB 3BQUB 4DERA 4UOQA 3ECBA 2BOBA 4HV8B 3HLKA 5EIQA 3X11A 3V4UH 4OFYD 1NDMA 5ENWB 5H94B 1L0QA 2NYYD 1JIBA 4FE9A 5MEPB 4L5FE 4YMPA 5FS5A 5HI5D 3GKWH 2YRLA 3K6NA 4PR5B 1MCJA 1DR9A 1NBYB 3MXWH 3JV4A 2QDVA 4R97C 3IDIA 4PB0L 4LF3B 3SKUD 1U3HA 1U8IA 2EC9T 2JFCA 2XKNB 3ZL4H 5AFAA 3LD8B 3LN5B 4AQZA 1M9WA 2ZD0A 1GRWA 2O5ZL 1CL7I 2CMRL 3WHXA 2DJUA 3GJFK 3TEZA 3C09C 3I6GA 3NBNA 3TYGL 4OVVA 1KCBA 1T1ZB 4HLEA 4N68A 5GHWH 1NCJA 4JFTA 3OWRA 4D2NA 4IKNA 4WV1B 1UB5B 2ZNWA 1HK6A 4KZEL 2WC7A 4RDBA 3S0PA 3MCLL 4X7DC 4MHHI 4GG6E 2OZ4H 3MLSL 4ATTA 3JTTB 3OXRB 3QNXB 3CK0L 1S7RB 5HDLA 2QTVA 5CEXB 1ZT1B 4DGYH 2F54B 5IB1B 2ZCLL 4XWGH 2YD5A 1N0XH 2YSTA 1REIA 1FBIH 2OPCA 1JZ5A 3TL5A 4F92B 2D4FA 4L8SA 1HZHH 2HMID 2WBXA 1R5IB 5DHYB 2YRPA 4L29A 4ZSOE 2BIIA 2ICEA 4CL7A 1Q1PA 4XBPB 1KLUA 5L2KA 1FRGH 2RR3A 4X99A 3JV0A 4I2XA 4YHOH 3DMMA 4KUCD 1SHWA 2H32B 4DN4H 4OSUL 4LDEB 4GRLB 5FIEA 4I1NB 1QSZA 4PRAB 3TBSA 5IEHA 4XPHL 2ZWNA 3BUDA 3T65A 1RU9H 3ZDXE 2P4AB 1L9NA 2R4SL 5DK2A 1QASA 5D1XC 3WE6A 5K69A 3D69B 5CD3B 2OMTB 3TEUA 4HZLB 4L0PB 3ZTCC 1FV1B 1F58L 2FAUA 4NX0A 3CZEA 4P49A 2VDLL 1KTBA 1GGIL 4GOSA 5CFAA 5C9JA 4HUMB 1N2RA 3FOMA 4R4FH 5FCSH 2J4WL 2CXKA 2ZF9A 2DBJA 1MVYA 1DL7L 1WZ1H 3CBKB 1CB4A 4KZ0A 3D4GA 4POUB 5FOBA 1INEL 5GIRB 2X6MA 1I8IA 2F1AA 2FZ3B 3ZUCA 4EF3A 4MTMA 1N19A 1F6AA 2IGTA 3OPZL 2VUYA 4LOEA 3VI3B 9PCYA 2J7LA 4XC1L 2AK1H 3QCUL 1UZ6F 3GJFH 4FQJL 4P4KA 1Q90A 2QSTA 5D9SB 4DVBB 1SZNA 4Z7WA 4BUHA 1J05A 4PJ5A 2DBLH 1I3UA 2FBOJ 2H8PB 1A4CA 1I1AD 5K39A 2DMGA 2HKFH 3BAKA 4UOZA 3M6DA 2FGWH 2J43A 1MAMH 4AL8L 3ULUH 1XGTA 1TXKA 1Y6NR 3GHEH 4WSGA 2PR4H 5I17A 1CLCA 1QD0A 4RIRB 4WO0A 3ZYOA 1LP9B 5F70A 1JXJA 1M7XA 3FO9A 5AVSB 4O2FB 1ZVSA 4LBEA 4Z0BH 1CXIA 3TIDA 5CZXC 4P9MH 1F1DA 3MUUA 1BAGA 2HG0A 5GJSL 3D18A 3JTBA 3VFRA 4DP6X 1X5JA 5FYJL 1N67A 4Q7DA 2C9UA 3KPNA 1AKPA 4Z5RA 5C0FB 5CJ8A 4XCFH 2NT0A 3MJ8B 4F8OA 1JPSH 3MLUL 4YE4L 3IT8D 4LMQI 2E6QA 2G30A 3PV7A 5CP3H 1DJXA 3ZMRA 1O5DT 4QRTB 1T0MB 4L5FH 3T3PB 4JRXA 5HVFB 4M61B 1SJMA 4DKDC 3GS4A 3MROA 5F7LB 4HU8A 5CLZA 2GG1A 4MAYC 4N2KA 2YXVA 3ECWA 3N1PC 1TQVA 3LNHA 4HFUH 4ZFQA 4KDVA 3VXNA 1BLNB 4X2UA 2Q10A 3M17B 4IBSA 3LQMA 4UAOB 2NY3B 4HK0A 3I9GH 3QUXD 3MA7B 1G1CA 5C08B 1RH8A 4PJFB 3SDAD 1CFVL 2PKDA 4LCIL 2AEOA 3VXSA 1IAIM 1WP6A 2I9LA 3CC1A 4G42B 4QI3A 1A3ZA 4G1EB 4R8WL 3N1GC 2C4FT 2X89A 5GGTH 4JN2A 1TQTA 1QHPA 4JO2L 2PXYD 4BH7A 3EJUA 3WD5H 5C6WH 1QR1A 4DVRH 3N43F 2A2QT 2FEDD 4MJJA 1A0QH 3QR0A 4XNXL 1CPUA 4KAQH 4LNVA 1G84A 5I73C 3RFZB 2BIQA 1BCIA 3IJYB 4E9WA 1T2QL 2EEDA 3ILPB 2Y72A 1NLDL 1CXHA 1UJ3A 2GSMB 2CCLA 3SDCB 3ZKSD 2X1OA 1F3JB 4FFZL 4KHTH 2OMXA 4ZOAA 3AG1B 3L3DA 2EUWA 1JPGA 2DEWX 4LMQE 3S3DB 1T4KA 1GC1H 3BISA 3G04A 1PG7L 5TDNA 4GB9A 4DKFH 2IALB 3B2XA 4FFYL 2VR4A 3S5ZA 3UYPB 1FGVL 3FT2A 3VQ1C 1EAQA 1G1YA 1VPOH 3GBLA 3WNKA 3MRHB 1DEEA 2WVVA 3LEXA 4QYOB 3S34L 4P59H 5FK9A 5I15H 3HUJF 4IIQA 2QMKA 2DQGL 4JQVA 1CL7H 2QQQA 2X3BA 3W81A 3N1QC 2ARJA 4NFBA 4XGZB 2MIZA 4F7CA 4JGMA 2VR8A 1KULA 2P44B 5IF0B 1RUQL 3E1F1 4NKIL 5HI4D 5J11B 5JXAL 2FX8H 1E50A 1D5MA 1XB8A 2UZPA 2RH0A 3UZEA 3ZZQA 3CMGA 1M71A 2CDGA 1IGYA 2EH8H 3A6CL 3GDBA 4F91B 1CDUA 1LO3H 3PGDB 2C1PB 5C0RL 2W5PA 1SYSA 3WKPA 2H7WA 2XZQH 3OXSA 2XIIA 1DVFA 4KRLB 4LHUG 1TSRA 4Q9QH 1KELL 1Y0LA 4K94H 3TFBA 2B1AL 3PU7A 2WBJA 4G6JL 4M1GL 5AALA 3UO1H 1E4XL 2HAZA 3CLFH 4L8DA 2G2PA 4PLKD 1NUDA 4U7SA 3CXDL 4N6QA 1T21B 3HMXH 3MJ7B 5FUZH 1PFCA 2NSMA 3PGCA 4Z0XA 1P9MA 1UFGA 3X14A 2BSEA 1T3FB 2P1YA 3I74A 1BZOA 5AD0A 2WXFA 5LVEA 2VB5A 3FYEB 5B1BB 3WXVH 2ZT9C 1QLEH 3KWWB 1BJ1H 1ORSA 4E2OA 3CCHA 4Q9RH 2QEJA 4JZJA 3LQZB 5C92A 4PLNC 3O9WD 1P7QA 2H1PH 5D7EA 5AYTA 4EQ3A 3K2UH 4AQ1C 3BAJA 3P4OA 4U1SA 2B4CL 5EBWB 5IFAL 1E5BA 3X12A 3FSOA 4FCAA 3ZUNC 4KQ4L 3O0LA 1BQSA 4NKMA 1UKQA 3QFDB 2OTUA 2AQ3A 1OAKH 1ONQA 5FAAA 4DO6A 4IBVA 1OCWL 1QLFB 3T77B 3IWUA 4PBDA 2X4OA 1YUHA 4NI3A 3R1GL 3K6OA 2DRUA 4ZUSA 1N64L 5FO9B 4KJYA 3F83A 5LBSA 3KGUA 3L9YA 4PGCB 5E9DA 1E9PA 3V52L 5IB2B 2IH3B 1OLZA 3EYSH 5CMAB 1T0PB 2MEJB 4MNQE 2BHZA 4XP5H 1ZWIA 1L7IL 1W6WA 2XG4A 3COOA 2WWNA 3H9SA 4LEBA 4GQ9L 4BE6A 1JZ7A 4H8WH 1BPLB 1BZDA 4DUXA 5DDHA 1AFVH 2OJEB 3DO4A 3IKCA 4Y9EA 5E6SB 1RJYA 4MNQD 2P48B 2XN9B 4KFMA 4ZRGA 3FRUA 2QKSA 2FGZA 4KTDL 1FZMA 4DCQA 4LARL 3Q43A 2FWLB 1IBGL 5EZJA 3VG0H 2UZXA 4UT6A 5HGDB 1J8HB 2UVEA 3GRWA 3RA7H 3HAEB 1WCBA 3UADA 2GUOA 4K9EL 4MD0B 1YNLH 4ES9A 4YPGB 4DAGL 2AK4E 2DH3A 4J6RL 2DM3A 4PVNA 3V0VB 4PG2C 3OX8B 5DT1L 1J12A 4KNTA 2CGZA 5J6GB 3HZMA 2DQ6A 1BP3B 1XGPA 2VSKB 2GJJA 1JHKH 5I1IL 1AHWC 4OZIF 2AK4D 1NH6A 4FLQA 3NFNA 4WUUE 1NCTA 2BDNH 2JVUA 4HSAC 4X6EA 4R2GC 4BSWB 3KL0A 4UQ2B 1XD1A 3VSQA 3QYMA 4WJKB 4MDJB 4WUUD 2R29H 3I84A 3QXUA 2HUHA 1NFDE 2VTFA 4FYTA 2ZUYA 2C3GA 3LX9A 1PKQB 1V55B 3JVFC 1NBVL 4B3VA 5KJRL 3Q1EA 3AB0B 5ICUA 3TFKD 4K71C 4YO0A 3TZVD 2PYFB 4G6KH 3ATDA 2L3BA 2EDMA 4Z7VF 4C56B 1DJSA 4IOIA 4HQQH 2D31B 1WFOA 4I18B 1E3FA 4U6VH 2E9IA 5HYJE 3CX5K 1IC1A 3ARWA 4TOYH 2XIBA 3EJJX 5ID0A 5ERWA 3GZKA 1T22A 3MI6A 5D1ZA 4HS3B 5E8OB 1ZIBA 3FONB 4QGTA 3GEFA 5L2JA 2HVKB 4K15A 3QNYA 3NN8B 1CICA 4AW7A 2F8IA 3HBPA 2W81C 3LPPA 4HUUA 4PGDA 3AWGA 1FHNA 3O11B 1JRHH 3RX7A 2O72A 1Z6JT 3CFKB 3RY4A 4Z7UA 1R34A 1RUML 3GXMA 4EUPA 4M56A 1LO5B 1KTJA 1T0NA 1EGJA 1UCBL 3EAKA 3ZHNA 4EN3A 1CLVA 1HSAA 1KFAL 4LVHC 3KWXA 5F88A 3ARXA 3PFQA 3B5HA 1SXNA 1PPIA 3H2PA 3MDJA 3OHMB 2XWBA 3HE7B 2HH0L 3SE3C 3KJ4B 3WOVA 2GT9A 5HDBF 4OZHA 4YXKH 5H35A 4F5CE 1JYWA 3TURA 2HJKA 1EMTL 2B0SH 2GK0A 5FHBH 3GSWA 5ITBL 1AOZA 2IWFA 2Y9RT 1VAHA 3S6CA 1QKZH 4WK0B 4LCWB 4R90L 3DJ9A 4OM1H 4N85A 3B9EA 4X5XB 2IDUA 2V2WA 3BKCL 4KGLA 5GS0L 1KYOJ 5I18L 2VLJB 2YO3A 5DEFA 6FABL 2OZ4A 5D7KE 1E4JA 4W9DC 3ZSTA 3X3GL 4CVWA 1L7TH 1TQWA 2WM0A 5DJDB 5ADPH 4XMXA 3JYCA 5AG8A 2N7BA 5D7KD 2JV6A 4DZBB 3BZ4A 4LAJH 3MLWL 4GW1B 4HEME 1A1OA 5JYLA 2HRPL 4L9LB 1NUGA 3DRQB 2WLHA 4YDLC 4LGPB 2VDOL 5ACLA 2V6HA 3D3VE 1ADQH 1ZJAA 4G5AA 4FYQA 1CK0L 1OOAA 1SXBA 3ULVE 2BW4A 25C8H 3I2CH 3GLDA 2EAEA 3D3VD 2VT0A 3IDUA 3QUZC 5KSUA 5EU7E 2WIIB 3ULVD 5AOJA 1NEZB 2ID5A 3L4VA 5ICXA 3ARBC 5IG7A 1UA6L 5IUSA 2VE6A 4X0KB 1FPTH 4QHUB 1GW0A 1XIWD 4LL1A 4HWBL 1FL6B 4KZCA 4Z8FL 3KNBB 4WCYH 3MODL 1I4FB 5AW7B 1QACA 1WC7A 3BHBB 2AXGB 3KS0H 4X5PA 1CYXA 4HIIB 1D6VH 2XWTB 4XPBH 3GMOB 4ONFH 4X6DA 2AI0L 2WLLB 2NLJA 2X09A 3D07A 3GB7A 3RKPA 3G08A 5B39G 4PAZA 3GJFA 5FYKE 4ADGA 2Q86A 5A16A 1NL0H 3CFJA 4OGXL 2EABA 3V0WL 2Y5TA 3D34A 4FZEH 4N0UB 4YDVB 3ZPDA 5C0BD 4GP8B 5L9DH 5FYKD 3W5NA 3QI9B 1C5DB 5J0BA 4NZRH 1NCAH 2R4RH 1U3HC 1MWAH 1VDGA 2JIXB 5GGRY 3WKML 4BHUA 4JAMA 4EOWL 5KSAB 3PWLA 5CEYB 1DQQB 3CDGA 3IDXH 1AC6A 4MBRA 3IF1A 5I0XA 1HQ4A 1AR1D 1U8QB 1PW3A 4PGZA 4WW2B 3WNPA 3E6FA 4QWWD 1X44A 4U1KB 3NH7H 2YARA 2XCMC 4OZ4B 5I8KL 4JKNA 1RZKL 4JHUA 1JD9A 2WMPB 2FO1A 1E3ZA 3ORJA 3DVNB 1O6SB 3ZKMC 3KLHC 1A14H 3QJXA 2Y3AA 5C0EB 5KVEE 1HCYA 4Z3HA 5LDUA 4JO4H 5D5MF 3IVKB 1YO4A 5CP3A 3AM8C 2OTPA 3S2CA 3P3UA 3K4AA 3BZFB 1G7PA 2ODIA 1EFXB 5A3IC 1CE6B 1VZHA 1U4FA 4RDQG 5LBGA 4JPIA 2UZYB 2IBZX 2ICEC 3TBTA 1Q0YH 1SXCA 4U1IB 5AUMB 5IOPB 1AAJA 3APCA 1X5IA 3IDMA 1KXTB 2VLKB 3UX9B 4U0RC 1XQ4A 3S48A 5D2LE 1HJBC 1Z9LA 5CZVH 1KGXA 3ZL2A 2OK0H 2H3NA 2YIHA 5E1IA 2XI9A 4FQIH 5L4JA 1QBAA 1VRSA 3JWDL 2YSSA 4Z9KB 3RYMA 5JIDA 4AE1A 5GRVL 4PJXB 5GGTA 3RUGB 5IQMA 3QR1A 3DO3A 3MGOA 3UZVB 2JTYA 1UWGL 4F7PA 1EZVX 5JPNA 4GG6A 3SGDH 3Q5OA 1NINA 1HWGB 2DS4A 2AJXL 3I9PA 4PRHE 3RL1A 3ARUA 4N2LA 4NQCE 3KMDA 1IUZA 1B90A 3NMEA 1XZ0A 1S9WB 3ET9F 3N44F 3TV3H 1NCWH 3VE0A 3BUTA 4MD5B 1F41A 3IN2A 4PRDA 3P54A 1TJIH 5TD4A 4PRHD 5CZRA 4JFWA 1D5ZA 2QR0A 3FB5A 4NQCD 4X8JB 3B7TA 1FFRA 3B37A 1FI8C 3DX7A 3QIWD 4ZSOA 3V9FA 3POHA 1NPUA 5B38B 1I7RB 4JHAL 4LNRA 1PJWA 3UC0L 4XI5D 1JF1B 2Y0SA 4I48A 4P4KC 3ULVH 5LBVA 3PL6B 5IJVB 4PWEA 1MF2H 4C47A 4X8XA 1MW3A 1AZVA 4Y2DC 5IROC 5IHHA 1VFBA 2AMUA 1MRCH 5CN1A 4Z95L 3BQUD 3U9WA 4CADA 1PSKH 4BQ6A 1NCCL 1FFPB 1KG0B 2AJYL 2FBRA 3UTTB 5IKCB 3H6JA 1MREH 5D2LF 4IRSD 2KLSA 3P11H 4QRQA 4AYFB 1IM3B 4KNQA 4G6ML 3HRZC 3NSJA 3M1OA 2KLTA 4WO4B 1MFBH 5E7BA 5HSFA 3JWOH 3FMGL 4N4YB 4AEFA 1XGQB 3OZKA 4TF4A 4U1JA 3D39E 3IWVA 4I3RL 1BFVH 1NGZA 4NJ9L 2Z0BA 1XH3A 2YMXH 4YSCA 1IQDB 1OF2B 2GI7A 2OX5B 5E4OA 5E6IC 4MXVE 2EO7A 4TLUA 1JGUH 5F7DA 2GJ6B 3SJVB 5FYKH 2NXYC 5JLZA 2C7UA 3QH3B 3C6EA 3D39D 3GDCA 4Y8DC 3EH5B 4A6YL 4AQEA 1EEZA 3FS9A 3L3IA 4RH4A 1XB3A 2HLFC 1YQVL 4NI6A 1JTPA 1NGYA 2YGVA 4FQXB 1ZANL 1YCSA 3FQXB 5LAPA 4FMKA 3FB7A 4U49A 5FF6B 3HMXA 5IHBA 1Q4NX 4TUOB 2CO7B 4UTAH 2VDLB 1A6AB 3GXFA 1P2CB 2IQ9H 1ZA6A 3GUTA 1YDPA 5IBTH 2CQVA 3U0WH 4S2SA 1CVRA 1LK3H 4AYID 1EDHA 4PP1D 5BRQA 5I8OL 4JCWA 4MAZA 3DK0A 4X98B 2CKBL 4H0HB 5EBMA 4GAYB 3KL3A 3MU3A 3O4OB 4MX7A 3GWJA 5LKNA 1CWVA 4GPVA 1OARH 4EMZA 1QEWA 1U8JB 2G5RA 4HIXL 5CJXA 5IIEB 2KDYA 4GRLD 2LLLA 4ALAC 3GHBH 3C9NB 5C0IB 5KVEH 4HPHA 3CFMA 3UGEA 2IMMA 4MKMA 5FUOH 3SQBB 4JPWH 4NKDA 2E74C 2FT8A 2Q76B 3LKNB 3CSGA 2OAAA 5FO2A 1X4YA 1A7BA 4P5TD 4LLYA 2H47C 4M8RA 4LSQL 2VZ3A 3ZRFC 1XF3A 4I0PC 3SDAA 3VI3E 3WKYA 1C1EL 3GPEA 5DC4B 2AEIT 1DDTA 2L4OA 3Q6FB 3BPOB 4M6MH 4NQEB 5E4EC 5IB5B 1YN7A 2OA9A 2X4UA 2AS5M 2W65B 2PXYA 4OIIH 5CEZL 2DB8A 2LVEA 3PGFH 5DHVB 3GMLB 3ZVVA 5GSRA 5JIMA 4K7PH 4X6CF 4F7EA 1KCUH 1S3RA 1T89A 3I02B 4Y2OA 4GMSL 4PG9B 1KTKE 2A5UA 4YHNA 3IK2A 5C2UB 1L9SA 5EO1A 4GUPB 1TPXB 3RWIB 4HJIA 4Z76B 2IFGA 5JW4R 3MRLB 4DJMA 1U8NA 1JWMA 5TPWH 5ACZA 1JP5A 4HGKC 1ZLDA 4K5PA 3W37A 1LP9E 1IKNA 4AJYV 3FCGA 4RZCB 4WWID 3VFOA 3GSRA 1OAZH 4C59B 3TN0D 3F2LA 5JIIA 5ECGA 3G5WA 2OW6A 3ILQC 4FQ2L 4JQXA 4HOXA 1IC7H 3GZQA 1CXLA 4PJGE 5ICYB 4E9TA 1OT4A 3UZEC 1I8KA 4JR9L 3BW9A 3Q2NA 4PJBE 4J4PD 4YHKH 2FJHA 3WG7B 1IAKA 2HFEA 1INQA 1X4ZA 1KV3A 3QZMA 3ZT6A