4DP4X

The 1.54 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp4X00
1ET5A 2PPAA 2EIMB 3S8FB 1PF3A 2XV0A 1HAWA 4M4RB 1IC0A 1SF5A 1JXDA 1I53A 1JZFA 3FS9A 3T6ZA 2HLEB 5F7BA 4E9TA 1PZBA 3CVDA 2XUWA 1AG0A 5EHFA 1EZLA 4EF3A 1BQ5A 3PAUA 5IY5B 5PCYA 3T6WA 1T5KA 2XYBA 3NJGA 3JT2A 1IBYA 2IH9A 1DZ0A 2CUAA 2I7SA 1W6WA 3WKQA 2J56A 5I6KA 4K9JA 2Y1AA 3X1FA 2XVBA 2FQEA 2YAFA 3QPKA 2EIJB 1JZIA 4YSSA 1GR7A 1L9QA 3C75A 4AKPA 1AZBA 1OE2A 4W9ZA 2BZCA 2DWTA 1GS7A 3NJHA 2HRGA 1MDAA 1VLXA 2IDQA 2UX6A 4KO9A 4YSDA 1NPJA 2UXVA 2VSMB 5B1KA 1QHQA 1NIAA 5B3SB 2OV0A 3TBCA 1L9TA 1E5YA 4YSOA 4KNSA 1CYXA 1PZCA 1MZYA 4PCYA 3AG3B 1WA2X 4DPBX 2FQGA 2VW7A 1OCOB 1PLBA 1GS6X 4HZ1A 4L0PB 5B1BB 1PLCA 3NP3A 3X1BA 2VMJA 2YAOA 4AKOA 2VN3A 2X87A 3WG7B 1NZRA 1ILUA 1YLBB 3FSWA 3T6XA 4CSZA 2JKWA 1PCSA 2XV3A 3NSYA 2HRHA 2J55A 2IWEA 1RZQA 3PLYA 2BZ7A 2DYSB 4WKXA 1SHWA 3QJRB 3UADA 3CDZB 4GYBA 4G7RB 1PLAA 3UGEA 3ZIYA 3ZX1A 4X4KA 1SFDA 1X9RA 4DP7X 2EINB 1OCCB 2AFNA 1ID2A 3ASOB 4DP6X 2RACA 1JERA 2FQDA 3NSFA 2XWZA 4KO6A 2BW4A 4A2EA 1A65A 3QJTB 1R1CA 3IN0A 3IEAA 1JZEA 4GY4A 4YSAA 3SQRA 4BWUA 3AG1B 5I28A 2QDWA 1RKRA 2W8CA 2PP7A 1A8ZA 4BDVB 2DV6A 4YSRA 2E86A 5AZUA 5I6MA 1JOIA 3CVCA 2QPDB 3S8GB 3OMNB 3DIVA 1JVOA 1KCBA 3FU8A 3PXLA 1M56B 2UX7A 2FNWA 1MG3C 4GP8B 5TK2A 3FU9A 2IDFA 2ZOOA 3QJQB 2BW5A 1NDTA 2PP8A 1V55B 1SJMA 1NTDA 1WA1X 2PPDA 3PCYA 4KNTA 4G7QB 1W8EA 4E9WA 3NJKA 5AKRA 1OV8A 1UATA 1X9UA 2QDVA 1GS8A 1BQRA 5E9NA 3PAVA 4YVNA 1F56A 2CALA 2YAPA 1W6LA 4HIPA 2YAHA 4ZK8A 4NB7A 2X88A 1JZJA 3DKHA 1CYWA 4DP8X 1CURA 7PAZA 1A4CA 2VM3A 2H3XC 4P5SA 1XB6A 4BXSV 1AZUA 1SHXA 1J5DA 2XXGA 1IBZA 1CC3A 5D4IA 4FAAB 3BVDB 1NIFA 2PPFA 2IWFA 1B3IA 3S3BB 1J9TA 2YXVA 5TK4A 3UACA 1AZRA 1TEFA 4HCGA 1AR1B 1GYCA 2QT6A 1ET8A 3EH5B 4YSQA 1RCYA 3T71A 3QJUB 6PCYA 2DWSA 3NSDA 2MTAA 5FC9A 1KBWA 1ZIAA 2XV2A 2GI0A 3IBOA 4G71B 1WS8A 2AANA 1HAUA 2B3IA 2P80D 1JZGA 3BQVA 4RH4A 1M57B 2YAQA 1AAJA 2BP0A 3H4FA 4WTQA 1WAEA 2ZXWB 2GSMB 1AACA 4TXVB 4YSEA 1JZHA 1J9RA 7PCYA 2A3TA 2R7EB 2FJSA 4ENZA 2QPEB 5I5IA 3IN2A 2CJ3A 1OCZB 2BO0A 3ABMB 3EH3B 1BXUA 3UAEA 1V54B 2JXMA 3ZDWA 5A7EA 4N8UA 3CZUB 4DP1X 4F7KA 5I6NA 3V9EA 3FQ1A 3FQ2A 1JVLA 3UAAA 4BWWA 2BP8A 3CG8A 3RYMA 4E9QA 4BK5C 3AG2B 3ASNB 4DPAX 3OMIB 2GC7C 2CAKA 3NJLA 3WNIA 4AZUA 2WO3B 2XXFA 4E9SA 1TEGA 3QJVB 5F7AA 1NIEA 3QQXA 4BWTA 1A3ZA 1A4BA 1BEXA 2HX9A 1OE1A 3T9WA 4AI7A 4AX3A 3V9CA 1E30A 2I7OA 3WIAA 3WNJA 4DP9X 4CSPA 1L9SA 1TU2A 3SBRA 1WS7A 1RZPA 3ERXA 2ZONA 3EH4B 1QNIA 1EHKB 2GB2A 1BXVA 2XX1A 4YL4A 1GW0A 3OMAB 4JHVA 2VSKB 4G72B 3X2QB 1V10A 4A2DA 5I5JA 2GC4C 3QJSB 1ADWA 1ASOA 1KBVA 1AIZA 4HAKA 4YSCA 1AOZA 2HXAA 1NPNA 2HX8A 2N0MA 4HCIA 3AZUA 3OQRA 2YARA 4G7SB 1L9OA 5I6PA 2DYRB 1XB8A 2GHZA 1AS7A 4W1TA 2UXTA 3NJMA 3U25A 1KV7A 4A2GA 1BXAA 1HFUA 3NJNA 1AZNA 3OD3A 4QKTA 3AY2A 1XMEB 2FT8A 3TU6A 2FT7A 5I5MA 1AANA 1N68A 2XX0A 3FYIB 2EIKB 5B1JC 5AFAA 1AZCA 1A4AA 5D4JA 2IWKA 4DP5X 2YAMA 1SF3A 3FSZA 1E65A 4BXVA 4E9XA 5LDUA 1BYPA 2FT6A 2JFCA 1URIA 3ABGA 2BP0B 3UABA 3EF4A 1AG6A 2AZUA 4E9VA 2NRDA 4M3HA 4KO7A 2XLLA 3MX0B 4GXFA 2TSAA 3HEIB 1OCRB 1SDDA 2YAEA 4GP5B 4YSUA 1KYAA 5B1JA 2AVFA 2BP8B 3ZBMA 3FU7A 3ABKB 3TA4D 4E9RA 1OOWA 1BQKA 4JHUA 1BAWA 2IAAC 2OCCB 1ETJA 1E67A 3GYRA 4KOBA 3NYKA 4DP4X 2FTAA 4DP0X 1PY0A 3NJJA 2WSDA 3FPXA 2BWDA 4HALA 1OE3A 4F2EA 4AKQA 2TSBA 2LLNA 2CCWA 1ET7A 2HZHA 2PLTA 4KO5A 4E9YA 3KW8A 3GDCA 3EHBB 1SFHA 4UANA 4KNUA 3SBPA 4QLWA 1KCWA 3FSAA 5ANHA 2YXWA 4YSTA 2IDTA 2GIMA 2OJ1A 3PAZA 2DY2A 1IUZA 1GY1A 5B7FA 5B7EA 3NJFA 5B7MA 1NWOA 2PCFA 3AG4B 5I26A 8PAZA 2J5WA 2BWIA 3TBBA 5I6OA 3FYEB 4HCFA 2Y69B 5PAZA 3HB3B 3MBWB 3S3DB 3H56A 5D4HA 4A67A 1FWXA 2PPCA 3X1EA 3N2JA 3NT0A 1CUOA 2IDUA 1ZPUA 1AS6A 1AS8A 1E5ZA 2EILB 4FA7B 1KDJA 2VW4A 3H4HA 2I85A 2Q5BA 3D12B 2YQBA 2PCYA 2IDSA 4UAHA 3S3CB 1NWPA 3WKPA 3DTUB 1FA4A 2FWLB 1ASQA 3ABLB 6PAZA 1MG2C 1NINA 2H47C 4N4YB 1DYZA 4HHWA 1IKOP 3T6VA 3NP4A 3FSVA 1WA0X 4PAZA 1J5CA 1J9QA 2PPEA 1ZDQA 2ZWNA 3SBQA 1JXGA 1N70A 4A2HA 2XU9A 2GBAA 4HHGA 1BYOA 2IH8A 4UF7C 3WI9A 4G70B 2HX7A 3N55A 2CBPA 1OF0A 2P80A 1SDDB 1JXFA 4YSPA 2R7EA 4P5RA 4A68A 4Q8BA 3FQYA 3G5WA 3KW7A 5B1AB 1PZAA 3FU7B 3GXUB 3NJIA 4A66A 1SNRA 1ILSA 2BHFA 4Q89A 1XB3A 2UXGA 1ZIBA 9PCYA 2AZAA 5I6LA 1L9RA 3OM3B 4JKNA 2VW6A 3CVBA 4DP2X 4MFHA 3X1GA 1M9WA 1QLEB 2FQFA 1PMYA 1KDIA 3X1NA 1ZDSA 4NAJA 1L9PA 2H5UA 4F2FA 1MZZA 3NSCA 2MRYA 3CDZA 4A2FA 1AQ8A 1PNCA 3JTBA 1PNDA 2J57A 2W88A 1GSKA 2WO2B 1NIDA 3FPYA 1FFTB 1PAZA 1ZV2A 4KOCA 1ASPA 3TASA 2UXFA 1NICA 2VM4A 1TKWA 4YVUA 3PPSA 2Q9OA 1GY2A 3FT0A 1KGYE 2PP9A 4NERA 1NIBA 2B08A 1J9SA 3L45A 4GP4B 3IE9A 4DPCX 3AW5A 4BDVA
chains in the Genus database with same CATH superfamily
2CJUH 5E70A 2EIMB 4NC0B 5BXFB 5DLML 1VADA 3TESA 3IXAA 4FNQA 1DL7L 5CMAA 1UM6H 1KB5H 1EFXB 1KENL 1B2WH 2CR0A 4QD2E 2WLMA 2VR6A 4ORGA 3ROOA 1U8HB 3T6ZA 5F7BA 4AMKL 1DEEB 1RSYA 2FL5A 3DJZA 3NIGE 5ERWB 2AAAA 2JELL 1EQWA 1FORL 2XYCA 4OH2A 1BD2B 1NAKL 2NCEA 3BSGA 2VABB 2XYBA 2EYTB 1QLEL 2V5TA 1AGEB 2ADGA 1G9MH 3JSSA 4QTHA 1JHLL 1GL4B 1I8AA 1NEUA 1VERA 4K8RH 3RZCC 4MD4A 1RIVH 4XAWL 4GAAA 2UYLA 3HE7D 1JZIA 1JNHB 4ILDA 4JKMA 4GG6E 5E2VH 2CJSA 3QZWA 1EJOH 3QFDB 2W94A 1N8OE 3EYVB 3N0AA 5IJKC 4QHLB 4GRWB 1FV1A 2Z0UA 4CDGC 3NJHA 3Q1SH 4AQOA 4XWGH 1CGUA 4UV4L 1F18A 1ZEAH 1F11B 2V3EA 3OJDA 3L6FA 2FB4H 2OXHB 2V9UA 4YXLH 1FFNB 5C70A 4H2AA 2CBTA 2QMKA 4WHYH 4DW2L 1U9KA 3WNPA 2GY5A 1XCQA 2UWEE 3IDXH 4XN2A 3QORB 1MHPH 1H15A 1VZIA 3OSVA 1A1OA 1FO0A 5EUKA 4ZUUB 4JRXB 1UT9A 3MV9B 2YD8A 2JKWA 4OD2A 3U6RA 4J3OC 5FO7A 1TSHA 3D50A 2PYEB 1H6TA 1K9TA 1KBPA 3BDXA 1CZ8H 1NFDB 3N44F 4MB3A 4F8OA 1N6QH 2NR6D 2CO2A 3PFQA 4N0FB 2WVVB 4P2OD 4Z7QF 5I1IH 1CU4L 2XY2A 1TITA 5DRWA 3QFGA 4XWOC 3SGKA 3L4VA 5F0JB 3LOWA 4KMLB 1JWSB 4N24A 5HYQA 4Y1AB 3T0EB 1XGRA 3O6FD 2XWZA 1TKWB 2A4EA 4XCEA 5GGQH 2VZ3A 5JHLL 5IW1A 5JYMA 4Z6AT 2BHZA 1XHHA 3EUDA 5F97E 3GZPA 4GY4A 1F6AB 3LH2H 3AG1B 4JFXA 4YHIB 3MOAH 4ZAKC 3BH4A 1XTMA 2A0LC 2WXQA 3WFHA 5ELIA 4R97C 1AXTL 3B3IB 1MRDH 2DWDB 4FXKB 5AB0A 1EAQA 4M8QB 4Z23A 5J5EA 4MHHI 1XH3A 4UV7L 4D9QD 4P2QE 1CFSB 2ESVE 4U1IA 2K9FB 4MASA 1HH6B 1IQWL 4DOHB 4WNSA 2ZAIA 2ZP8A 4X6FA 5AKSA 4DVBA 4P8QA 3RWGB 1KNOB 3O8XD 4X7TB 3DA0A 3SJVB 1IGMH 3GI9H 1N6UA 4BM7A 1A25A 3FB7B 3QDJE 3I9PA 1T20B 4HFWA 2YAPA 5DT1H 2ZSVB 5EBMB 3BUBA 4G6AD 5GQBA 2DEYX 2NXZD 3FRUA 2CO6B 2OJEA 4ZK8A 3MRDA 1A7OL 2F61A 4NB7A 2WUCL 3HZMA 4GW1A 1KEGH 4P04A 2H3XC 4LDOB 5A3ID 1YNLL 4GS7B 4NQQA 2XWTA 3GSRA 4H40A 4NN5B 5GGTL 5J3HD 2Z34A 5HI4C 2PCPB 2WUBL 3V4VH 2F54A 3IFLL 3QFJB 4PP2A 1ZMYA 2EYSA 3BVDB 1DP0A 2XQBH 5INDB 5J6HA 1IFHH 1MEXH 4YGVA 4JLRA 1M9SA 2FX9L 5TK4A 3MLYH 4WJG3 4GMSH 4PJFB 4L1TA 2FYVA 4QRTB 2QT6A 5CHNA 3FF8A 3CJJA 4GRMA 3BLBA 4AC4A 2V2XA 2YMOA 5HHVL 2NY5L 3TFKD 3ATEA 4HPHA 2BNQA 4C59B 5JXEA 1CQYA 2X4QB 1ZKAA 2Z7YA 4NIKB 2QQNL 1DVYA 1W16A 2E9IA 3QYNA 4JZJA 1OWWA 3LS5L 4GEJA 3EXLA 1ZHNB 5LBSL 3U82B 3OLIA 4X5WB 2Q6WA 4YSEA 2F1AA 1KCLA 1UENA 4Q7DA 2AJ3A 5D8JL 4PJ7B 4ERSH 2XWJA 1PZUB 3BZ5A 2GUOA 2PR4H 1FVEA 4K15A 4XBGB 3CXDH 3DJSA 3NMEA 3G9VA 3QEQD 4HSAC 1TMQA 5D1ZB 1I1FA 5AAMC 1LO2H 4X7FC 1E2VA 4BWWA 5FYKL 4XO9A 4LHUA 1JWMA 4BK5C 3K71A 5HPOA 3HHRB 3BEVB 2P9RA 1KC5L 4XH2A 2ZKHL 3AABA 1BVKA 1DN2A 3IE4A 4FG6D 3MREB 1QVOB 2C3XA 1WH0A 4NNXB 3V52L 3HS0B 3WNMA 4Z7WA 1J0YA 5CGBA 1U36A 2VRAA 4UAOB 1VJSA 5TPWL 5KSVA 4U7KA 3KXFA 2I7OA 3TF4A 4WW1A 2VWEE 3JV4B 3LKRA 4ZW6A 3AMKA 2VLKA 2W9DH 1V7NL 3EGSB 4OGAC 5DC9B 3UTSE 5IQ7H 1R3HA 2NLJB 4X5RA 5G2NA 5JHAA 4IJ3B 4G72B 3RWJB 5IROC 4LRIC 4NC1C 5JPMA 4HUWA 1IGTB 1UKTA 3WO4C 4MAYD 4Z7IA 1BFSA 1A66A 2H6UA 3M07A 5JHLA 4LL9A 2VZ1A 3PU7A 1IAKB 5IQ9A 2X0UA 1E9QA 3FQWA 1RK0A 4P57B 3RI5F 1FNLA 1KPRA 4JCWA 4LLQB 4YXHL 1NL0L 2ZCLH 1KLFB 4WUKL 5CCKL 1JPGA 5ISZB 1BWMA 1E9PA 2LVEA 5E8DH 3MRNA 1PG7H 1V3LA 1KV7A 4IIQA 1J1XH 1HFUA 1HT6A 3NJNA 3CN4A 2DQMA 1LYQA 3KWWB 3O3UN 4WWPA 3DX6B 2VXSH 5F7EH 4YNYB 5DRZB 4BK8A 5FYLH 2IOIA 1XTLA 3Q3GA 2F19H 3UTTB 4R7NA 4DZ8B 5J13C 3K1DA 3BFOA 5CFAA 3VH8A 1YEDA 5AOMA 1L5GB 3Q2WA 1HNYA 1LK3L 4HH9B 1Z2KA 3Q5OA 4MTMA 2XWBB 5TQ2H 4MXWH 1KCSL 4LOUC 3ZL1A 1RZGA 3QNYA 3MXVL 4MVBC 3S5LB 4RAVA 4HDIA 3CSFA 2Y2YA 4Z7WF 3L08A 3GS7A 5DU7A 3ECBB 4FQLH 1CGYA 4LXFA 3PJLA 1AXSA 1FYTD 3A6CH 3GMQA 4WF7A 1AO7B 3V6OE 4CW1B 1QNZH 2C1PB 1LEKA 4NI3A 1HQRA 2F5AL 2LU3A 1A6AB 2HKFH 2JKJA 4G8EB 4WI7A 1AIFB 1RU9L 4Z76A 5T3XL 5JW5A 3D85A 3WN5A 3WTVA 1U2HA 1YJDH 2V17H 3QH3B 4M5YL 1NGYA 5D1XB 1N64H 4MSWB 4BHUA 1TQTA 3G6AA 5E00A 2SEBA 4A7SA 4UNTA 5DHYA 4NUJA 5GGTA 4PJCA 2OCCB 2OMVB 1AD9B 3GRWH 4L8CB 4L8SC 2ICWA 5ITFA 2GJ6E 1OT4A 5JOEA 3MLVH 4QOKD 2BJMH 1UM4L 1KJVA 5I15L 5ICYA 1DVXA 2BSTB 3QUZB 2ZCKL 2UWEF 3RNKB 1BD2E 3OV6A 2B1HL 2MOVA 2P1YA 4ZMWA 4NQDA 1OM3L 3FULA 3UBGA 3FNKA 4AKQA 4HIJB 3PHSA 4QNPE 4E9YA 2HUHA 2EDFA 3LEVH 1CDIA 1OGAD 2X4UA 1JVKA 1UHVA 4YSTA 5ANHA 4Z3HA 4YBLC 4AEHL 5IW3A 1OP5H 3ARFB 4LP8A 2YQ2A 3FAWA 4RGOL 2D7PA 1PQZB 1WCBA 5C97A 2AP2A 2MQ0A 5SWQB 4FGMA 4PG9B 5LBSA 5GGUB 1A14L 2R1WA 3O4LB 3PF2A 3QQ3B 4GRWE 4BFJA 4HJGB 8PAZA 3M1OA 1QI4A 1E2WA 2PWFA 3PDOB 2Y7SA 4ZOAA 5CWSB 3FO0L 2Y69B 2N0KA 1E4HA 1TO4A 2DMBA 4PM1A 4ICXA 2Y24A 5C9JA 2VJXA 4DT2A 1S46A 1UH4A 2ZICA 2NQCA 2F74B 4J4PD 4PJAA 1L0PA 1JYXA 1GJIA 4FXGB 4XPAL 3QJHA 1ZPUA 5ALCL 1C12A 2R0KH 1DBBL 4LCCB 1BZEA 4JRXE 5ADPL 3MV9E 2Q5BA 4NQSA 2YQBA 1DVQA 2GK2A 3L4ZA 4MQTB 2YXMA 4R90L 5FA4A 3CLFL 1JPEA 5FCUH 5DUML 2VDMB 3DPDA 5CINH 3MRKB 2H8PB 5J6GA 1TTCA 2PYEE 4JO2H 5T1MB 4J39A 4HK3J 3KCWA 3OQ3B 4R4ND 1B0RA 3X3GL 4YHOL 5J56B 2Y36H 2DTML 5FGRA 2OMYB 4Y1AE 3T0EE 1YDPA 1DBAH 2D0HA 2A7BA 3DX9B 1F00I 1N59B 2XV6B 5E6IC 3WI9A 3TH4T 4G43A 2W65A 1VEPA 4GXVL 3BGFC 5F8QC 1UFUA 1UD3A 12E8L 2MQGA 4RFEB 1JDCA 1EWHA 4AQ1A 2P5WA 3UPRA 1FAIL 2OFQA 3U9UA 5K39A 3C2SA 3CFDB 4MS8C 4QF1B 4Q0XL 3SD5A 2WD0A 2DM7A 2XTJC 4N2DA 1G9EA 4N26A 5GPRA 1OF2A 4W4OA 1H5BB 2HB0A 4LSUL 4XZUB 4K7FA 4NUQA 3HLAA 5I6LA 2EKJA 5E8OB 2EDHA 3V7AG 4DAGH 5K59E 3ZDZF 3CVBA 2XFGB 3FBKA 1UZ8A 5SWZA 3GSXB 3HN5A 1MI5B 4DOHE 4V2CB 1IAIM 4LSQL 4A38A 4ZMYA 3A6OA 1ZTMA 1BMZA 4QIRA 3SJVE 4MDRA 3TL5A 1IEHA 3CDZA 4PTTB 5I17B 1E2ZA 1SLVA 3DXAA 1SM3L 5AVVB 2EP6A 4NQTA 3JBG7 3ZE1B 3W11D 5HVFB 2H9GA 1FYTB 4H1LG 1NICA 4LNRB 4BE5A 3PPSA 3SOTA 4J2XA 5HI3C 4G1EB 3OLDA 1KGYE 1UOKA 2P8LA 5FO9B 1KF9B 2XQYK 3ZGHA 1RIHL 3SDAA 5F3HB 1DDTA 2EC9U 1FL6A 1IM9B 4Z3FA 1FVCB 2Y2WA 4KWUA 2PPAA 3LKSB 4OCYH 1JPFB 1X4XA 5FIEA 2Z31A 2WN2A 5MERB 4ECNA 1OPGL 5T1DH 3IF1B 1T5XB 3FQNA 2DQ6A 4OZFH 4PD4K 1NUDA 1HYRC 4WK2B 5CP7B 4AYMC 1CBVL 2ZP0T 5DD5L 3B9KA 4FYQA 2CO7B 1TJHL 5KS9A 2VN6A 3FTSA 4QDGA 1PEWA 2E7CA 4NQXB 3HRZC 4OLXH 4PJFE 4OFYA 3O3EA 3P54A 3CVDA 3HPJA 5ESQA 1JGLH 1K72A 4NKQB 5C0IA 2VAAB 3W2DH 3DV6A 3QIWA 1A1MB 4A7QA 4O2CB 1UYWH 1WC7A 5PCYA 4PJBB 4TNFA 1T5KA 2FGZA 4NUMA 4L9LA 3ULVL 2KLTA 3L3KB 3VWJA 2IH9A 3HUJA 5D1QA 2XZQL 4M7JH 4HJ1A 4WTZA 3T0VA 3KVPA 3N41F 3VXSA 4NM4H 4WFGE 2G9HA 3S35H 5BV7B 1VKXA 3WTSA 5IJDC 3WENA 4NEHB 3WIIL 4KI1A 5AW7B 1QHQA 3S96B 4Y5VB 5B3SB 2VSDA 4L4TB 4M6OL 1E5YA 4YSOA 3INUL 3LIZL 2XN9D 5JPNB 2E7LA 1K6QH 1MZYA 2FQGA 3FN9A 1PLBA 3MOBL 3B9DA 2FSEA 1RZIB 4GG8B 1INQB 4IK7A 4XVUC 4A55A 4Q9QL 4OT1L 3X1BA 4CKVX 4JGMA 1BAFL 2N3JA 5IQLA 4GPVA 2C3VA 3QNZA 5KUKA 2DQGL 4RQQA 4G8FA 4M1DH 4ZQKB 2BOLA 3QS2A 1PYWA 5FK9B 1PLGH 2Y6SD 3ARZA 3IDNB 2IWEA 2YZ8A 4FADA 1ZGLA 4N2MA 4XP1H 5H94B 4NQVB 2M1KA 3JWOL 1TVDA 3FCSA 5SV3A 4S2SB 1PLAA 1OXYA 1UGNA 3RBSA 4ACTA 3SKJL 4XP9L 4BQ6A 4DP7X 3WTTA 2CLRB 3GZKA 4DGUA 1H3UA 2WLNA 3GBMH 3GT6A 1UB6A 5G4MA 1BVOA 2XKNA 4A7GA 3VFVB 2VJ0A 4HVBA 5IHWA 4BIKA 3MLTB 5FB8B 2C8NA 2PW2A 4G9DB 1GZPB 4H88L 2YR3A 4WUUB 5EIVA 4JQVA 5I30L 1RURL 4ABWA 5I0DA 1S7UB 3RFZB 2W59A 3FH8A 4K7PY 5B39B 4XVSH 4KI5C 4YSRA 4PJIA 2FZ3B 4PWEA 2IOOA 2QPDB 4IGBC 3S37X 5JR1L 1ZT7B 1G0YR 5ISZE 1PD1A 2YSSA 4HJ0C 2IPKB 4CVWA 4F15C 3ARDB 5TK2A 3TNMB 3VWKC 3FU9A 3RTLA 5GS2D 5T1LB 4LL4A 4S1SH 4DETA 3CC5A 5F1KC 4LARH 1NCAL 3FB5A 4PRPD 3P02A 3BKYL 3C5SA 4LCWA 3UTTE 5AAPA 1I4FA 3D51A 3GSWB 2QSVA 4HISA 4E9WA 2WLLA 3MYJB 1TZ8A 4OI9A 1GXEA 4U1KA 3EYQC 1JGDB 4MNGA 2WBJC 4ZFFB 3BE1H 3LNEA 4DUXA 2XBDA 4YDVA 1YYML 1FNAA 1TJXA 3MA7B 1IKNA 4W68A 1K8IB 4QRPB 1X5YA 4YO0B 4ORZC 2Y2TA 3UBXB 1MCOH 5TDNA 2WQSA 1KBKA 1AO7E 1F42A 4LDLB 1CFMA 4OFIA 3VXMD 5IB5A 5HD8C 3V79C 1U8OA 2P49B 1JZJA 4Y9EA 1QUNB 4PJHB 1V27A 2PXYB 3ZK0A 2JJTC 5I73B 2Y1VA 1YEGL 1AGDA 3TN0A 5GJSL 5D1XE 1K8DA 3CSYA 1T0MB 1WP6A 3K3QA 1H8OA 4D7PA 5E9DA 1KLGA 3C60B 4F33B 5JOPE 3CUPA 2NUTA 5KVDL 5GS0L 4U7SA 1E4XH 4I0KA 2IAMB 1FRGH 2FHFA 3EO1A 3KEHA 1PZ3A 5DS1A 1O6TA 2L7QA 4MQ7B 3TS8A 3KM1A 2IGLA 4YE4H 2A1WH 4PJIF 1MHHB 1U41A 1A5FH 1FZKA 4S0TD 4FYSA 1J0JA 5ACZB 3SGJA 1WS8A 2P80D 2B14A 4U1JA 4XCNB 1NKGA 3EJYD 3BUQA 5FW8A 2XETA 1OSPH 3NH7H 3RVTD 2DBJA 1WZLA 5AVRB 2QZQA 4XE5B 1CDYA 5IVOA 2VKXA 1UA3A 4AT6A 2CA4A 4TXVB 3BISA 1GA2A 3RJQB 4W93A 1NCCL 4PV9A 3O4LE 3C6LD 3OKDB 3GO1L 4PVMA 1G7PA 4ODBD 5L6YL 1EUUA 5FDWB 3QHZH 1FG2B 1TCRA 3WIHL 4AIXA 5DI8A 1G7HA 5GS3A 2H6OA 3QCTL 1Q1JL 2B1AL 4K9EH 4B41A 1JSYA 4YDJB 4LU5H 3ASNB 2CLZB 4MCNA 4L4VB 4J3WA 1QABA 3GZQA 3UJIH 4Q14A 4OB5L 5JIHA 4AZUA 3VYNA 3S8WA 3LIZA 1ETZB 1OAKH 2X9YA 1JK8A 4PY7A 1KTDA 4BWTA 5D9SA 5ICZA 4Y4HA 1T22A 2X4NB 3NCEB 4IRZL 4F58L 2OXGA 2HLAA 3VG9C 1JMXA 3L3GB 4DGYH 4LNVA 5F9WC 1Z0NA 2AV7A 2EE0A 4U6HA 4GIPD 3TYFA 5EZJA 1GJUA 1O6SB 1YVLA 3ERXA 3HG1A 4AQAB 3UYPB 1QNIA 2WIMA 1TZHA 4FYTA 3S3JA 4HUCA 1BXVA 4XNYH 1GW0A 2RFXA 4I88A 4M8VA 5CEZL 2H32A 5IQNA 3UC0H 4O58L 4NPYB 2D31A 4OLZL 1SXSA 3BVVA 5HDBB 3WAKA 1G7JB 1OD7A 3ARYA 6FABL 4YEFA 5HGGS 1QASA 4TUKL 3ULVF 2F54D 4HWBL 1Q0YH 4OGXL 4YZWA 3IXAB 4CADA 4OZGA 1ID5I 5C0CA 5E2WH 4HLEA 2IALA 5F70A 4W1TA 3RTQB 1JN6A 1QBLH 2XJKA 2FL5B 4F93B 4KXDA 1EXGA 4MCYA 3L7EB 2ED8A 3T65B 1CL7L 1TTAA 2NDFA 4FNRA 4DO6A 4Z7OF 5FGSA 1KY6A 5LQBH 2BNQD 4XPHL 5JXED 1MI5E 4QTHB 1LD9B 5C07E 3CZSA 1BF8A 1P7BA 3EDJA 3OGOE 3TNNB 4Y9CA 3M1CA 3JUZA 3OLEA 1I7TB 1QSEA 5KEZA 2YAMA 35C8H 4PYGA 4XP4L 3EOAA 2XY1A 2VMDA 4JKPH 4UQ3B 4FFTA 4LVHB 1FV1B 4XO5A 5FLUA 5C09A 3BD3A 3WJJC 1TPXB 3ZE1E 4AVJA 3MBEC 1ZWIA 4K2UL 1VGKA 8CGTA 4W9KC 4K5NA 4I9XA 3I02B 3OJDB 3PJNA 2BP3A 7CGTA 3L6FB 1GJWA 3QO1B 1EJFA 2BCKA 5JDJA 1SEQL 2YAEA 3L1GA 3IJSA 1O75A 2HRLA 4KHXH 3WNNA 4GKSA 1UWEL 2ZT9C 3VFSB 3APFA 1SDAB 4KV5E 2DN7A 3ZDXB 5HGAB 4IRJA 3PXHA 1BAWA 2AW2A 1DCLA 2H45A 1UM6L 1CLVA 2A4ZA 2IG2H 3WXWH 2CXGA 4OD2B 3ENEA 2Y1ZA 3U6RB 3L3OB 2EO1A 1FAKT 4X6EA 4PQXA 4W9GC 4JPKH 1XZWA 2YMTA 4OZGF 2VLKD 3I6KB 3HZ3A 4PJBE 4AIOA 3GJEA 5DRWB 3UZVA 4ZTOH 2AS5M 1ET7A 3AROA 1SUJA 4KK6D 4WNQA 5HYQB 4K8RL 1XGRB 3EHBB 3GMOA 3RKPA 5EOQL 1RIVL 3BCFA 2R29H 3WMSA 1D9KD 1J8KA 2YA0A 3FU0A 5E2VL 4LPTA 4ALAH 2KERA 1DQIA 3C09C 1LHZA 1IBHA 3AS1A 1XXFC 3EIFA 1MFBL 2AV1B 3WFHB 2CNZA 2BFVH 4JO4L 4PN6A 5FF6B 1BG1A 3VXPA 4XWGL 3NCMA 5E5LA 5K9KB 1ZEAL 3FO9B 4BEIA 5KAQG 1KJ3H 5GJTL 4YH6A 4YXLL 4L4TE 3WIHA 4PVLA 1I31A 1KJ2L 4XO8A 5DD3H 1A2YB 3JVFC 3I6GB 4U1IB 5E4EB 1A6UL 1WBXA 4HEME 3LQAH 1MHPL 1NCDL 2VW4A 3PL6B 3G5ZB 5EIQA 5EC2B 4UAHA 2BIMA 4GFTB 4IJTA 2EKSB 4OR1A 5IR1B 5CO1A 3L2MA 4WEBH 4CC4A 1S9WB 2XN1A 1EXUA 3NFNA 5CJXC 1DYZA 5HY9A 2JKTM 4L3EB 2OULB 2QPSA 3HC2A 4W9DC 5FA3A 3RI5K 4FQXC 5I1IL 1UXWA 1R3LA 1E4KA 3BWZA 4DFIA 3MRDB 4PW9A 1QZNA 3QXAB 4JCMA 4P06A 1NCOA 3BQUA 3C5JA 3MNZB 2YUZA 3GMMA 2ZG2A 2GJZA 3D85D 2E9BA 3T8VA 2G75A 2X6BA 2WQUA 3NDYE 1C8QA 4ZQTA 2DJ4A 4WUUE 3LH2L 1Q0XH 2R7EA 4PP2B 4A68A 3FN0H 1TVBB 5GS1A 4KDWA 4ODWB 4EUPH 4S1DC 1UJTA 3N0PB 3CFCL 4GKOA 4GSDL 4HWBA 5B1AB 5D5MB 4O51A 4YGVB 3T2LA 2YRZA 4FFYH 5CZKA 1I8LC 5DUBA 3WEXB 3X14B 1HNGA 1MRCH 2IPUK 2J43A 4AG4L 1AGBA 5CHNB 4AJ0A 2EDEA 4G5AA 1ZIBA 3FCTA 3U48A 2PNDA 3WE6A 2EXTA 2V2XB 3V0HA 1BCIA 4KFMA 5JHDA 4NQDD 1BZ8A 3GIZL 2WKLA 3QDJD 4JFOB 3QPQD 1YEIH 2E9WA 5E5MA 1IAIH 2BNQB 2O5YL 3EYOA 1JGEB 3SOBH 1QLEB 2EH7H 1NC4B 4YHMH 4G7VH 4DKEL 1UADC 4JZJB 4F2FA 3E3QE 3GI9L 1HWHB 1KXVC 1OK8A 2Q6WB 3REVB 2WJ5A 3ZDYF 2Z8RA 1PNCA 1G7MA 2BY1A 2AJ3B 2WPGA 2MPAH 1K4DA 4KQ3L 4NJAL 2WWMC 4H8QA 1R3IH 2FJFA 2OR8A 1ASPA 2GTZB 2Y25A 4QRPE 1VZGA 3BC9A 5DT1L 2VM4A 2EVHA 1P6FA 1AJ7H 1I1FB 2Q9OA 2DLFL 3N42F 3TJPA 3J27A 3QG7H 1FZOA 3RWIB 4LHUB 4HCRL 4PJHE 5TE7L 5FYKD 2D7TH 2WW8A 4AIZB 3ZN6A 3D0LA 1IEAB 4KKCC 3JTSB 4YWGL 2QSCL 1EAOA 2BMKA 2XQBL 2UV3A 3D2UA 1IFHL 1MEXL 4NO5A 5AVTB 5EU4A 3VGAC 5F9AC 3KXFB 3PHAA 4WLCA 1HIML 4GMSL 4N25A 1MHEB 3E6HB 3WFBH 2OI9C 3NRQA 1NOAA 1CXFA 1Y1UA 4JFZL 1JWUA 4P5MA 5F6HJ 4FJZA 4JN2A 5FAAA 4TUOA 2P43B 4LLAA 5FKAA 5JPMB 3BZDA 4WTWA 1GR7A 2BZDA 1C08A 4YFLI 1E9QB 2P5WD 3C75A 3HG2A 4L8DA 4AKPA 1RK0B 3MPCA 4ERSL 3LXUX 3ULUE 3TO2A 4K7PX 1GS7A 3UJTL 3CXDL 1RULH 1R4XA 3BT2L 1F4XL 4HKXA 1THCA 4FZEL 4J8QA 4QHKJ 3TWCH 4B9PA 4D8PA 4B5ZA 1E9PB 1URLA 1LO2L 3EBIA 4NSKB 2H4EA 3VFPA 4IIQB 1LE9A 1BLIA 3QUKA 2YD7A 2LOEA 5AUMA 4HUVA 3LV3A 1UWYA 4L4VE 3WJLC 3S0PA 3U0WL 3OZ9L 3OAYH 3B1TA 4NHUB 2OP4L 5HDQH 3VYPA 4X7CC 4WU5A 3Q3GB 4TQ8A 3QDGB 4RDQG 3DETD 5E0QA 3VH8B 3S2CA 2OMNA 3PGDA 4PI0A 3T6XA 4CSZA 4D2NA 3SE4C 4APQA 3QNYB 5I23A 5C0AA 4PV1C 3DXAD 4IOSA 1K4CA 4NZUH 1FE8H 2A83B 2W9DL 2ARJB 3GMQB 3KLQA 2NZ1A 3G04A 4XODA 5FYLE 4Z3JA 1NGWB 2EINB 4OZ4B 1BMWA 1LEKB 1HQRB 2Z35A 4I0PA 4K3GA 2ATPA 4XGZA 1M42A 1IC5H 3E1ZA 4Z95H 4Z76B 3Q6FB 1KUMA 5HDBE 2YSTA 4M7ZB 2Z31D 5T3XD 5IMMA 5CUSH 3UZQB 2NOYA 4QT5B 5E00B 4FLOA 2SEBB 3B5GA 2XRAL 3KHOA 1XD1A 4PJCB 4PUBH 3B9KD 3H8NA 4PGDB 2VWEC 3CVCA 3BWUF 3FTYA 1H0DA 2ZCLL 4X5LA 2UZYB 4LPYA 3ETSA 1G9NC 5F6IC 5BO1L 4OFYD 4MB5A 4G8IA 4K5PA 4KTDH 1PG7L 1DJYA 2FNWA 4GP8B 2Y22A 4NT6B 1XFPA 2D73A 4ODXB 1I9JH 4QRFA 1OSZA 2ZKWA 3SY6A 5TF1H 5KVFH 4UINL 1IBGL 2VXTL 5EH1A 2X0WA 5F7EL 3VWJD 2VQ1B 5L4FA 3KYKL 5DURB 5CD5C 5D1QD 5FCSH 3F12B 4UILH 2X4UB 4KKRA 3L9YA 3T1FB 4QYOB 3VXSD 1WAAE 1N9PA 4MXWL 1WCBB 3OC8A 1UCTA 1UWFA 2R1WB 4NZRH 4PJBF 4UU9A 5F7HA 1VAHA 3IAPA 1D7BA 3LY6A 4GQPH 5I16B 3A6CL 3P9WB 4U1SB 3F2LA 3I3BA 4M62L 1DQLH 1QNZL 2E4TA 1GGTA 3JYCA 2GJ6D 3DKHA 3T0XA 5HTSA 3TBYA 7PAZA 1A4CA 1N0LA 4PJAB 4HCRA 2OTWA 3ZUNC 4N8PA 1YJDL 3PE9A 2ZKYA 1N64L 3MSPA 1C12B 3ZDXE 4K73A 5E9AA 4KJQC 1QSVA 1ETB1 1AD0A 3NUKA 3LJ3A 3O3AB 2BJML 2VAJA 3DRTB 4R7XA 3WFDH 5EU6A 3O3DA 3BCDA 3SYAA 1SJHB 5DJ6A 1P4UA 4AYID 3WUWB 4D3CL 4NCC2 4MNHB 4HS3A 32C2A 1V3MA 1ZIAA 2GTWB 4PJ5A 5HHOA 2KH2B 1O7DC 2W5PA 4CMHB 3GGWA 3U83A 1YDPB 4KRPC 2VXQH 2AVGA 4QAWA 2YKKA 3DOHA 2VO5A 4BFIA 1DSWA 2YAQA 1S9VA 2EDKA 5DLLA 3F65A 4DN3L 4XNQA 3VI4B 1YMMA 5FKPB 2PWGA 1BIIA 2E74C 2UY6A 4YZFE 3H9SA 3MJWA 4YR6B 4L0YA 1IZJA 1CPUA 3OF6D 4U1NA 1IIIA 3O0LA 4UM9A 5C3LD 2QKIA 3DPBA 4PRIB 2X3CA 4QTFA 3TH2T 1ZJAA 3RU8H 3PP3K 1VESA 2NTFA 3RG1C 1I82A 2VR3A 1KXTB 3FOMA 4N3UA 5IHZA 1JMZA 3BAJA 5DSCA 2W38A 5HYSA 4DTGH 2EXYC 2WO4A 1RQ5A 2CAKA 3THMH 5SWZB 1HHJB 4Q6IA 3BFWA 4LCWD 4MQSB 2XQYG 2H1XA 1F1AA 3T08A 1KIPB 2RH0A 1RUAH 1LO4L 4JL1A 2YRPA 3QWQB 3T9WA 2VLMD 5L9DH 1OD9A 4AI7A 2H6PA 5CINL 5CGMA 4XN5A 4OF5A 4JO2L 3PIQA 5DRNA 4HZAA 1I7RB 2P3YA 4L3EE 3QI9C 4N90D 5F21B 3L9RA 1GYAA 1MWAH 2BNRA 5CZRA 4ELMF 1D7FA 1THAA 4IRSC 3A67H 4OLUH 3X2QB 1HH9A 1XZ0A 4O5LH 4LCVA 4XCFH 4YOKA 5GRWA 1DBAL 3SDAB 3V0IA 2LU4A 3D0AA 1FL6B 4X0KA 3LH8A 1KYUA 3S4SG 1R3KA 3TN0D 3CQQA 1ASOA 2B4CC 1VDGA 4R7DA 4F91B 2C9AA 3FQNB 2VL5A 2Z3FA 4RFNC 5E9DD 5EOTB 2PO6A 2LHAA 1XR9A 4ADGA 3TVMB 2EIZA 3UTPD 5D5ME 3TEUA 5KS9B 4BK4A 5INCA 1M7DB 4N8CH 3L5WA 3TA3B 4LSRH 3EO9L 5JA9A 3RL1A 2YUVA 5IB1B 3LD8C 3QIWB 1X9LA 3HE6A 5I74C 1AZNA 2QQQA 2C9PA 3UX9B 4DAGL 2CR6A 1YEJH 4RSVA 1J0ZA 3FYIB 3ULVD 1QFHA 2XX0A 3HUJB 1KWGA 4D0BA 5DHDA 1Z9SB 2CDFA 2HN7A 3L95B 5LB1A 1QEXA 1KULA 3QUYC 2W9EL 1UOLA 2HA1A 4ZUVB 3L9BA 4OQTH 4ISVA 1R47A 1UM5L 4LMQI 5LDUA 1IMHC 2G9HB 2DQHL 5LXGH 5CLTA 3Q5TA 2WHVA 5HYJB 1XIWB 2DB8A 3L5XH 1S7SA 5I71C 3ZKMD 3FMGH 3HHSB 4F5CE 1GZQB 4PP1C 1IC4H 1MJJB 1SDDA 1UWGH 4B6ZA 4GBXD 4YSUA 4L18A 3DJTA 3NGBB 1SJVA 3L4WA 2XA3A 5CLXA 3VFNA 4OCYL 4WI5A 4NENA 2VGLM 4BFGA 5KYUB 3RE0A 2FSEB 4HKJA 4JY4A 2P46B 4FMFA 3AU0A 3H7BB 4Y4HD 1EAPB 1P1VA 1RZ7H 2WXGA 1QHPA 1M71B 1U42A 2NY0B 1WUZA 2C3VB 3EBHA 1A9EB 1SXBA 3G5XA 4X7EC 4G8FB 2DIAA 1UEYA 1I3UA 2KLSA 4X80L 5AKTA 5F6HI 3RWEB 1HXYA 1BBJA 1FL3B 4HIHB 3P77B 1UYWL 3OKKB 1LO3H 2LLNA 1D5IL 1S7RA 2IPTH 5CZVL 2XKNB 4GS7C 5BMFL 4M7JL 1OT2A 4F7MB 4WO0A 1AMYA 2GIMA 5FHBL 3ROLB 3BP5A 4WWKA 5EU5B 4NM4L 1NWOA 2DJUA 1V3KA 5C0CD 1FGVH 2DZEA 4LEOA 2ZXEB 3KNBA 3IDYC 2X6MA 3RWDA 1HC1A 2JCCA 5HDBF 2GJPA 1CS6A 1PSKL 2APXA 5D4HA 4FG0A 3PWVA 2E7BA 3E7JA 3KE0A 3RKDC 4DESA 4KH2A 1K6QL 3K0WA 2C9RA 3L1OH 3IVKA 3P3TA 3VI3A 4LCYA 1AS6A 3CC5B 2D4FA 3FB5B 3H9YA 5I6XB 3U0PA 4FA7B 1WWWX 3QDGE 1I4FB 5K1VA 1QSED 1J8HB 4Y4KB 2IJ0C 1RXLA 4U1KB 4UT7H 4M1DL 1JK9B 2CRYA 1J5IA 1QR1A 4MRBA 1C5BL 1MCFA 1JV2B 3MKGA 3HMWL 2CHZA 1ZLUH 3RWCA 3TXAA 3GJFB 4K5OA 1USQA 5DA0B 5CJQH 3T6VA 2OS7A 4PAZA 4F7CA 3N1MC 4N0RA 4JY6A 2O4EA 1MKFA 1N70A 1WAAF 1LXMA 3TV3L 1P5UC 4X4XB 5AAWC 1LP9B 1QPPA 2F8OA 3T6QC 3ZSTA 3L13A 4L1BA 3HS0C 1K8DB 4LEXH 4N87A 3CSYB 3P2DA 4I8DA 4GAJH 4IRJD 1JXFA 4Z1PA 3BSZH 2H26A 4UAOC 5IV2A 4XP6H 5JQIB 4GQQA 4LOFA 4BFEA 1IKFH 3VVWA 1PD0A 5GS0D 4YHLH 4P5TD 4EKXA 3OKOB 4G6JL 4B0MM 4WJ5A 2A6KA 3K4DA 2Z9TA 2B9BA 4IJ3C 1CFTB 1SDYA 3NEXA 4DP2X 4P46D 5HDRA 2OJZH 1NLDH 2X9XA 5C0EA 4U1JB 4ZMAT 1I8KB 3LPOA 3ZQ9A 1P9MC 1CG9B 3FN3A 5HHQA 4HQQL 3KEDA 4FP8L 4PD4J 1LE5A 3VI3F 4X7SH 4AT6B 4O2FA 2CIIA 1DDHA 4A2FA 3QZNA 2YFNA 3HVDA 4CJ1A 3BE1L 4MNQA 4TVSa 4PV9B 3SYCA 3UFIA 4OAWA 3SDXB 5EB9A 4L37B 2WOYA 1H9DA 2NXYD 5D55A 3U4AA 3S34H 1EEUA 5AEAA 2OAAA 1MCOL 3TIEB 3OJ2C 2V2TB 1GY2A 1G7HB 3SQOH 3FT0A 4CL7A 4ONFH 4Y5XA 1GGIL 5MEPB 1PEZA 5FO8A 4PJAE 3AW5A 4PWJA 1ET5A 3QZWG 4BZ1H 4JFDA 4OUUA 3VJ6A 1KBGH 2QHLA 1XF4B 3NK4A 3O8XC 2CGRH 2X2JA 4Y4HB 1T22B 2VMCA 4K7PL 2DM2A 4M43H 4BUHA 4HMEA 4NHCL 1I53A 3KYOA 1MCPH 4OZFA 2BVPB 2RMNA 2VN5A 4YDKL 4MA3A 3L3HA 1BPVA 3QUXA 2YD3A 1BXXA 2IV9A 4MD5A 4U6HB 3TYFB 4G6AC 4YE4L 2A1WL 3HG1B 4EF3A 3LZFH 1A5FL 2FHCA 1BQ5A 2AJYL 1V05A 4XPFH 4Y0GA 1IE5A 4N5UA 4HP5A 1F6LL 3LEYL 3NJGA 5H37A 4E2OA 3RHWF 4TNEA 5JIKA 2YS4A 2H32B 3NN8A 3RX7A 5A3IC 1JDDA 3BQUD 4OIFA 2X3BA 2Q8BL 5CEZD 3BLPX 3F7PC 1OSPL 5J3HC 3VI4E 4RMRA 1QP1A 4CADB 1KIQB 1QSFA 1A3LH 5KYWB 4U33A 2A74C 4PRIE 1PVHA 3I2CH 4JW3A 4HOMA 4NS0A 1WV7T 3LRKA 1JN6B 2CPCA 4G80A 4NKOA 5D2NA 5E2TH 3UTQB 3L4UA 3Q01A 5C0BA 1UKSA 4OJFH 4MYWB 4K9EL 1F3JA 3TFKC 5AW3B 4LU5L 4NAMA 3WE1A 4KJYB 2O26U 4C55A 2WQWA 3UJIL 4L23A 3H2WA 4GUPB 4L3FA 2WLKA 1IGIH 2XN2A 1MFDH 2HVKA 1OAKL 3WTUA 4JFVA 3CXHK 3A0OA 3UXFA 3P3YA 4FQJH 4F7PA 2JB6A 3K74B 4RGNB 4A2LA 2HRHA 3KPQA 1KPUB 5TQ0L 3ME0A 5I76B 2IDCA 3LRHA 3D3VA 3ZHNA 3I75A 3MQIA 5CP3H 5C09B 1NBYA 4IBVA 3C08H 1JZ5A 1FFOB 1VGKB 2NW3B 4LZKA 3O3BA 4WGVB 1AC0A 1ID2A 2W0PA 4XNYL 4PW4A 3P4NB 4HAGA 3UC0L 3VQ2C 3IJSB 4NI6A 4GKSB 4FG6C 3GKWH 4LCCC 1AVAA 4XHJD 3HI6H 4A37A 4A6YB 4FKKA 4KROB 1Q0YL 4NNPH 4X9HA 4BDVB 43CAB 4BE6A 5IUSA 4P99A 3D2UD 1ZHBB 3S97C 1A7NH 5C07D 3EYUH 2X89A 4PJDB 5E2WL 2J1XA 3OMNB 1ZHLA 2FAUA 1JVOA 3B2PA 3VXQA 3VDCA 3AS0A 2QQLH 3CZFA 3GMNB 1P2CB 2Z8VC 4J5VA 3CN3A 4W9EC 4LKCB 1JPSH 3KPMB 3GJEB 1IC7H 3UZVB 2WWNA 1TVHB 2YLKA 4N68A 1NMCC 3Q44A 4WNQB 2J5LB 4WEUD 4H44C 4F20A 4G7QB 4K8RD 1OCWH 3KGTA 1CR9H 5AKRA 2R2EA 4RAUB 2B9AA 2C9VA 2DIBA 3KR3H 3WKNA 5JHMA 5EOCJ 3TP4A 1HOEA 1RL1A 4JKPL 3H9HA 5HYJE 4K71B 3DC0A 2HTKD 4G6KH 3B5HA 4NNYA 2V7NA 2X88A 2DF3A 4AYEC 1LO0H 4PGBB 1ORSB 4OZIB 4P5SA 1H6EA 4KHXL 4WQOA 2F18A 2P44B 3IS1X 4PJXB 1J11A 1TQSA 3VRIA 1EV2E 3B1UA 4OLVH 2D9CA 4IBZA 4WW2A 3H9ZA 3EJCA 1I9EA 3C8KA 5C0ND 2ZOKB 3ZW3A 4S0HA 4JFEB 3FFOA 2BSRB 5MI0B 3SE3C 2ZNXA 5C0AD 4IOSD 1TEFA 5J89A 4JPKL 3ARPA 1NCTA 3U30B 4YSQA 2FHBA 4TYUA 1CD8A 4X8JA 1MFNA 5FA3B 4R26L 4ANKA 1ZS8B 4IU3A 1QRND 2JMRA 6PCYA 2AXGA 3F6LA 4ZTOL 3QEHA 4CUCA 4F9LA 1KYOK 3JWNH 3S88H 2CBOA 1DVFA 3ARGB 3GMMB 5SV4A 4Y16A 4H20H 2G75B 3KS0H 4Y88A 3GRGA 2XZZA 2ZXWB 2IADA 1TEYA 2CHWA 2DPKA 3BD4A 2R7EB 2FJSA 1BZ7B 4PJGA 4R3SB 3TTSA 4A04A 2CDGA 4WFFD 2A6IA 2BFVL 3APDA 2PTVA 1CFQA 5C0DA 3GMLA 1ACCA 2C34A 1UD4A 1XGYL 3FQ2A 4PREB 1KJ3L 1ZT4A 1NFAA 3RYMA 3WFEL 4JMXA 3K6SA 5JHDB 3HG5A 5F44A 2O61B 1M3JA 4WNJA 2FE0A 4MZ2A 5AYUL 5DFAA 3RUGA 3BUPA 5DZVA 4JG1H 4G83A 1G7LA 1J8HE 1JFQH 1NLBL 1AP2B 3MV7B 3N43F 1DO6A 3AB0B 3SN6N 4CVUA 4WTXA 2QADB 1GMIA 1F5WA 4WEBL 1XQ4A 1KGCE 4O02L 4AJVA 3VSVA 1WAPA 2ZONA 1QUPA 5GZNC 3CDGB 2R56H 2O72A 4PGZA 4D9RE 5FR3A 3F62A 3P0VL 1JZDC 4JHVA 1CJYA 4J4PC 1Y07A 4J3OH 1OAXH 3PYCA 4M9OA 2JIXA 1RUMH 5KG9A 1BQLL 1LP9E 2B39A 5C0JA 2XFXB 3H2PA 2YD6A 5E4OA 4MMXC 4LQFH 1KBVA 1ZY9A 5TE6H 3D0LB 3LKOB 2N0MA 3R19A 4HCIA 4Z7VE 2I9LA 3HG0A 4N0UB 3FN0L 5IB4B 4YAQA 3N3EA 1F4WH 4NO5B 5D7SH 4FFYL 3AQZA 4P4KD 2ZSWB 5EU6D 4HKBB 4ODSL 4R4NC 3KLHD 4JREC 5FM5M 5GGRY 2ZUVA 5FWQA 1I9IH 1R75A 1TZIB 3OD3A 1EFQA 1YEIL 1YPZB 5AVYB 3UEQA 5HHOD 4UIKL 4P2QD 5BRPA 2EH7L 3D4CA 3D33A 1MFEH 1JDAA 3L3JA 4G7VL 1ZLVH 3K6NA 4U3HA 4Z5RB 2WZ0A 2C9UA 3OLGA 4LASL 3RUGF 4JUSA 1E65A 3LN4B 1I1YA 4I77H 4CGUB 3H9SD 1E28B 4LSSH 4B3VA 1H3VA 2C1OB 2GHWB 1HDMA 4L8DB 4XMKL 3SDXE 3LX9A 3TO2B 4UM9D 2CGYA 3DUSB 3UABA 1RZKC 4JFUA 4XP5L 4Z78B 4HKXB 2Q10A 1YQVL 5AW1B 3DDGA 3O9WB 1AJ7L 3TZVA 1BW8A 2DQFB 1OP4A 3QG7L 4IU2A 5IM7B 3VM7A 4IDJH 3QUKB 2DBLH 4ZUWB 5AUMB 3RJDA 2D7TL 4PRAA 4X6DB 4QJ3B 5L4MA 1HZLA 4QWWD 3SODB 1KJ2B 4MA7H 3FU7A 1I1AB 5KTEL 3EUUA 3MJ8A 2LLGA 4F7TB 3H53A 1HZKA 2IMMA 1T5WB 2Y23A 3V0GA 1ETJA 4DFHA 4I7ZC 4JPVH 3DIFA 5ABDE 5JXAH 1X5IA 3WNKA 4APQB 1U8CA 2FBRA 2ZYHA 5DMKA 2WZPA 2BY3A 2ZWYA 3W11C 1K4CB 3WFBL 2P8MA 3HG1E 3U46A 5DK3A 1GGCH 4H13C 4UOW1 4W81A 1RVFH 2BNRD 3MRQB 5I1DB 1TU2B 4OI8A 4I3SH 4TNVF 4I0PB 2ATPB 1GTNA 3CWGA 4R5XA 1IGCH 3AGWA 2HAZA 1XH0A 5DFWH 1IUZA 1W2KT 5ANME 4TLSA 4DQOL 5IMMB 5GSVA 1JV5B 1N0XH 4F57H 5IEHA 4QLRA 4BZ2L 1X7SA 2PCFA 3CXFA 1S78D 4BQBA 2PO6D 3DBXB 4P3CH 2VDRL 3SCMA 1RULL 3NZ8A 2WLIA 2DLTA 2EUWA 4HGKC 3B37A 1SYSA 3PWPA 3HE6D 1RLWA 4HG4J 1CUOA 1GGUA 5DS2A 1Q90A 4HIEB 5HDQL 5J12B 2VDLH 4HUNB 4LLYA 5E8EA 1OOAA 1AHWB 1VACA 2AKRA 2LTQB 2FH6A 3D12B 5E6UB 3R4DA 4L5FH 4D0DA 1OTUD 1NUGA 3S3CB 4FL4B 4I1NB 5JIDA 1HEHC 4Q52A 4MX7A 4QRSA 3DUHA 4MA1C 1LO5A 5KVFE 5C09E 2WYZA 1FE8L 5CLWA 2P7TB 4P23B 3X3FH 4O02A 2WQVA 4FNSA 5D7IB 3CGTA 1QHOA 4YN3A 2J1WA 4S0SD 1XSKA 1U0QA 3NA9H 1IC5L 1T2QL 2D03L 1RZ8B 3QUML 2GK0B 2GBAA 3D2TA 1MLCB 1MAMH 4OCXH 4UF7C 2OTWB 4QXGH 1AKJB 1AE6H 3CFEA 1W0WA 1FL5A 1RJLB 2Y07L 3QRBA 3BVUA 1RY7B 3CV5A 4XCYA 3WD5H 1HQ4A 1IEBA 1FCGA 1NC2A 4PUBL 3STZB 1XF5B 1AD0B 3IMSA 4R2GB 2Y6SC 4OF0A 1BIHA 4OV5A 4PJDE 4EUPA 5E99H 2IEPA 4FFYA 4F8PA 1A1NB 1BJ1J 1J8RA 5EF2A 4ZPTB 3T3PF 1I9JL 4ZSOA 3MA9H 3P9LB 2N59A 3MFFB 1XF3A 4JFFD 4OLYL 5TF1L 2CK2A 2XNAA 4PJ5B 1FGNH 1FSKC 4Z7NB 1BGXH 1RSFA 4HJSA 2H1PH 2NNAA 3PGFH 1GC1C 4XNQB 2J6WA 2GABA 1YMMB 2YWZA 3NSCA 2BSDA 4FS0A 1WSST 3I85A 1PTZA 4WWKD 5KUMA 4PRBA 1WFTA 1MIEH 4NZRL 4WK0B 4Y2NA 3LHAA 5EEYA 2J6EL 2VDKH 2LR4A 3FPYA 1HL8A 5HHPA 2K3TA 3DPBB 1BP3B 2R4SH 1TXKA 4PW3A 1B0GA 3DV4A 1F4YH 1F13A 2ITEA 2VDPB 3FOMB 2VIRB 2VUOA 3OXSB 1BYNA 4M3KB 2UZPA 5DSCB 3W9EB 2R0LL 4WTZG 5JLZA 4OZIE 2APBA 4PJXE 3MBXL 4QCIA 4Q6IB 2Z7UA 5AB9A 1QKZL 5DGRA 4GMTL 1HSAA 2B77A 2Y7QA 1J1PL 1CE6A 1MCIA 1A4JA 3AXHA 4M4RB 1SF5A 3V6FB 4JFEE 5E7FA 2H6PB 2VXUH 5I0XA 3IJHA 5BZDB 2F58L 2KPWA 5BNXD 1IM3A 5DRNB 5C71A 4MJ6A 4N6RB 1EZLA 2YRLA 3FUKA 2FYYB 1CDCA 3GF8A 4LEEA 3T6WA 1N67A 3GC3A 2HFGH 3A5VA 5EFIA 3ESVF 4BZYA 4Z3GA 1HH9B 1WIUA 2I5YH 4GNKB 5CXPA 3CMOH 1UB5B 3QIUD 5GRUL 1K5WA 4X0KB 2VKWA 2XVBA 2GUYA 4HS6A 2YA2A 4NKDB 4RMSA 1UD5A 1K3ZA 4MBRA 5BRZA 4AK2A 4R7DB 1KTKE 4H25A 4R0LB 4WENB 3ZRSA 2ZJSH 1HJBC 1OE2A 2GSGA 5T33H 2PO6B 1XR9B 2XBZA 5DRXB 4BZ2A 2MNJB 1HZHL 4L3CA 5FUCC 2XXMB 1FIEA 5IVXB 3RU8L 3WKMH 5EEWA 3RL1B 1RZFL 4U6VH 1RUQH 2VSMB 1CVSC 1XSIA 3SGKC 1LK2B 3MLWH 4KNSA 2MNWA 5GXBB 4Z7VF 3KBEA 3THML 3WJMA 3C5ZA 3EJYC 4HXBH 2Z4QB 4L0PB 4ESKA 3RVTC 1GH7A 2CDFB 2VLRB 5LN4A 3S36X 3IXTB 1BSIA 4FABH 5IBLD 3MV7E 4HIIB 5L9DL 2YIHA 1SHMA 4WY7H 3GHBH 3STLA 4MNQD 1HCVA 5J6SA 4EXPX 3PLYA 4OF7A 5F1NB 4FFVD 1B3JA 2EACA 2XPGA 4AH2B 2C4FU 3MZTA 1HI6A 2MKLC 4MWFA 3UGEA 4I18A 4RRPM 4GB9A 1AMXA 1S7SB 3D69A 4OLUL 3MRJA 1OP5K 2BVEA 1P4LA 4XCFL 2I27N 4AQEB 4JJHA 3GIVA 3POHA 5LAPA 2GAZB 5LBGA 2ZXCA 4BGDA 3IN0A 4JFDD 4U6YA 2A73A 2OMBA 3ES6A 5F0MB 5I28A 1EJ8A 4HKJB 3TURA 4KZDH 2DEWX 2FO4B 4N0UE 3D9AH 4UOZA 1RJCA 1UACL 2CKNA 4KTEL 5BQDA 4PRHA 3GSUB 5T1KA 3B34A 4JPQA 5BJTB 2FEEI 1P4IL 4MYPA 3QUXD 2G30A 2GYSA 4YHNB 1C5DA 4OD1H 1AHMA 1MG3C 1BBJB 2V37A 4E9LA 1A6TB 1UKQA 4M61A 1M53A 2CM5A 2ZOOA 4QHPA 1YPZE 2EABA 3QJQB 4AENB 3HFFA 4WKZA 1YEJL 4CU8A 2BIPA 3Q48A 4YIQB 3VTMA 1KGXA 4Y19A 4FJYA 3FT1A 4ZD3H 4ZT1A 5A16B 3KYMB 3RGVB 4FLRA 4P05A 3NPSC 5D6CA 1LEIA 2O5NA 4OJDH 4BFBD 1ZK9A 3IGFA 4J6RH 4LLVA 5LXGL 3U1PA 5CIPH 4MLIA 4BQ9A 4QXUH 1UZ6F 3EJZD 1ZVYA 2YPLA 2GT9A 4LEOB 3A4DA 2J6EA 1UD6A 4PFEA 1R17A 1ADQH 1CTMA 5C0BD 2BVQA 2RR3A 5CD3A 2ZWKA 3P11L 4DP8X 5JXEC 2WXIA 4X6DE 5EA0H 1T89A 2IFFH 1WZAA 3SPCA 4BXSV 1AZUA 3IETA 5IMLA 4LCYB 3SB3A 3FO2A 2R69H 2XXGA 4HBQA 4JZJC 3RHWK 3HS9A 3RZCB 5CCGE 4V1DA 1RZ7L 2X53A 4FQQA 2KZWA 4JL2A 4F8TA 3BI9X 4PJ8D 3S3BB 5CLZA 4ZI8A 4N0YL 3UACA 2BWQA 1JGUL 1WHOA 1TZAA 2HTLC 3D3VD 4FERA 2X4OB 3LSOB 7TAAA 5DZNA 1N4XL 2ENPA 4YC2B 4EZMA 4AQZA 2ICCA 1LO3L 2MWCA 4ACPA 3CH8A 1NBZA 2GI0A 1IGFL 2PMZA 5CR1A 2HYMA 2IPTL 4JY6B 2EDXA 3MTRA 5DJYB 3BQVA 5KVGH 1F3RB 1AAJA 4HF5H 5FUOL 4ONHB 3DO3A 5IMKA 3VG0H 4ENZA 4GUCA 5K9JH 1BZ9A 1PCXA 3BWSA 3F6IA 4NWUH 3V5DA 3HKZA 3AC0A 3UAEA 2NNFA 1Q9KB 2JXMA 5A7EA 2DWEA 2X89D 4JAMB 1A7PL 5DA4A 4ZRGA 2IH1B 3NACH 3GEFA 1EO7A 1MPAH 4XXDA 2AGJH 1DBML 3GBEA 4WJ5B 4CU6A 1JRHH 3DHUA 1WLHA 2J2ZB 3PUUA 3P4OB 4OJAA 1UT2A 3T04D 5DUPH 3L1OL 1TQUA 2EVIA 4C4BA 5JPMC 1L9NA 2WTRB 5F7AA 1NIEA 3MODL 1VFBA 4OIAA 2HX9A 4ZG1A 3CTTA 4PY8J 4HETA 1DLFL 2WYTA 1LE5B 4AL8L 1J88A 3V9CA 4O2FB 4R4FH 2CIIB 1DDHB 4N8VB 3SKNA 3WNJA 1UQSB 2B59B 4W70A 4ZAKB 4CSPA 4ZYKA 4WGWB 1RHHB 4FA8A 2AEIT 1FNSH 3A21A 1G4MA 1QLFB 4WV1A 5F2FA 1M05B 1OWRM 4D0CB 2F8VA 5D7IE 4IIQC 3RAJL 4POZD 3GB7A 3WS3A 3IMBA 2K6YA 4V2BA 5F9OH 2IQ9L 1MWAA 1OIOA 4ZMPA 5I5JA 2BVYA 3OXRB 1A4KA 3D07A 2ROXA 1HE7A 3BKCH 25C8H 1YEHH 2LE9A 4KVPA 3QDMA 1M7IA 4AM0A 2Q86A 4LEXL 2C3GA 4CMMA 1OK0A 4Q6YA 4QO1A 4U1HA 1HHKA 3BSZL 1QR4A 5LLIC 4XP6L 4PMEA 1DJXA 1UG9A 4GLRI 2EVFA 3BLKA 1S3KL 2QTVA 3KYOB 5ID0B 1IKFL 3N1GC 3HI1B 3L3HB 2WTOA 3WN6A 1U8IA 3NJMA 1D5MB 2X1PA 5F96H 2Z91B 3MN8A 1A7RH 2ZZUT 4C57C 2V2WB 2BXYA 3IRPX 4Y2DA 3A4EA 3AY2A 3EOTH 3N50A 1ZAGA 4PJ5E 4Z7NE 1NLDL 3CFKA 1N68A 2GEQA 2YKLL 3WN5C 1DVFD 4FQHB 5DDHB 3ZMNA 1ML0A 5C08A 2GG1A 3HC4H 3DRQB 4S1QH 2OMZB 1WG3A 3L16A 2ZYIA 2FT6A 3QZPA 3ILEA 1QSFB 4CA4A 2ITCA 2V7HA 5HHMD 4Y8DC 3IU3A 3GQFA 2AZUA 5EZLB 3QXTA 1MJ7H 4MJIB 1T21A 1I8MB 3MX0B 4FA6A 2CK0L 1BECA 2DQUL 5HHNA 1I85A 4OFKA 4TQPA 3QPQC 1KYAA 4NP4L 5LWYH 4GAFB 2B15A 2NY5C 3CFQA 2XWXA 2AVFA 2BP8B 2OMXA 4BZ1L 3GHEH 3C8HA 2R2HA 2HVKB 3HAEB 4BFOA 1WZKA 2W92A 4FLSA 5DF0A 4J28A 1VGEH 2JB6B 3P69A 3KYNA 1A6VL 1GPOL 1SMDA 1CDHA 3WELA 3QIBA 1GYUA 4KZ0A 2F7IA 2X3AA 3V0JA 4F3FA 1YZZA 3I75B 3E8VA 1NDGA 2F5BH 3IPBA 2QMJA 2VDLB 5JW3H 2IH3A 3RPBA 3JXAA 1X5JA 2JIXD 2Y7MA 3KDPB 3LKPB 3SBPA 1Q9LB 4WI6A 3WYRA 4AVIA 1GAFL 4FTVD 4M6NH 5ABZA 4OIBA 3TT3L 1YEKH 3LS4H 1E8XA 2XSKA 5LN8A 4H8UA 3V8CA 2JTYA 5AZ2L 2YN3A 3NRPA 4TLUA 4BH8B 1E90A 3TT1H 3GXNA 1TETL 2F2HA 3RRQA 3BKJL 4HWZB 5EZIH 1ONQA 3I2CL 3V6BR 4K94L 2FGWH 5IVXE 3U36A 5LUMA 5K9QI 2NY6D 1BLNB 2NX5A 4A67A 2KS0A 3X1EA 1BQHB 2NY2D 2P5EA 1TZGL 1I7ZA 5EN2B 2IOMA 1KYDA 1PFCA 1AS8A 2Q2EB 1HCZA 2YC1B 4XMXA 5CSBA 4WAFA 5ESAA 5IFAL 1MFDL 5AW5B 1HKLH 1N10A 2DL2A 2VLRE 4R7VA 2I85A 5EUOF 4JPIB 3V9FA 4CVXB 4EN3D 5EU7E 3P3RA 2HJFB 5C2UB 2X7LA 3BKML 1D3CA 43C9B 1ZTXH 2R2EB 4AQ1C 2MNUA 1DR9A 5AWNL 2CUMA 4PGEA 4ES9A 6PAZA 4RX4A 4H8PA 4AXWA 2ICEA 4M93C 2VDNL 3LCYA 2DDQH 3R1GH 2VE6B 4W4OC 3EG9A 5DHVA 3BO8A 2BIQA 5TF0A 5DJZA 3TZVD 3FSVA 4TM9A 3VFWA 2IBZY 3MVSA 2OYLA 5A6IA 5HPMA 1NPUA 2EDRA 2OTUA 3UL4A 3AACA 3DUUA 4JFSA 2A4CA 2CO4A 4JVPA 4OIIH 3SY0A 1WTGT 1DQDH 4I0CC 2CBPA 3VRIB 4E41A 5EO9B 2KI6A 4TULL 1XGUA 4WW2B 4P5RA 2J8OA 2V8LA 3G5WA 5J13B 4X4ME 3AY4A 4QHNA 4LHQB 3BSZA 2RA1A 4A66A 2PW1A 3LKQA 3QISA 3KPRB 2QV4A 1D7CA 4FFWD 1LJMA 1VF5C 3ZO0A 3IT8D 4X8JB 3D18B 3IDIB 1JPSL 4PJEA 4FRWA 3MJ9H 1CXIA 3SDAC 3U2IA 2Q3AA 5ILTH 3GLEA 2COVD 2JKLA 3W0WB 1KDIA 4EZKA 4FQ2H 2Z31C 3MDJA 2IANE 2XTSA 3I6LD 2XT1B 4Y16B 1IGJA 1MZZA 3ARBA 4AGQA 4AUYA 3AREA 4JRLA 5KSBA 2G60L 3IMWA 1U6AH 2IGFH 5CU5A 1LMKA 3B9KC 3KR3L 2B3RA 2J57A 4PJGB 1M2VA 3DOSA 4O2EA 5BOPA 3EYSH 5DWUH 3SCMD 1RJYB 4HFUH 4L8SB 3TASA 4P59H 3MO1B 4FI6A 3N40P 5FLVA 4G6KL 4JR9H 2MCPH 3KGRA 3VFMA 3QIWC 3ZZQA 1F58H 1ZT4B 3PWPD 3MLXL 4G8GD 4L9LC 2B08A 2F08A 3AXLA 3L45A 3U4BH 3VWJC 4NP9A 4Q6KA 1U8QA 4Y4FA 5DVNA 3KBFA 2DLEA 1KB3A 2FWSA 4KTYA 2BNUA 1WZ1H 4UMSA 5D1QC 4HBCH 5I1GH 3X11A 1G7LB 4BZ1A 1Z7JA 1HAWA 5EO0B 3RY4A 1XL6A 1D2PA 4YBLB 4K3DL 4RMBA 1JZFA 2P24A 1U8NA 3FS9A 2O5XH 5EEUA 2H3NB 1W9XA 4XNZB 1T03H 4J3VA 5CSZA 2W0KA 3HC0A 5EHFA 2CRZA 1ZLSL 2J12B 3PAUA 2G5UA 3CHQA 4WHYG 2UZIH 3UROR 3FQXA 4HMCA 3CFJA 4JRYB 3NGBC 2AC0A 4ETQA 3GMRB 3S88L 4HHAB 2E7LC 2J56A 4W9CC 3S36L 3MCKB 2Q87A 15C8H 4H20L 2SODB 3KPNB 4R84A 5AVQB 4R6UA 2YFOA 4G42A 4N1EA 4XTRD 1PZ5A 5E2UH 5CF3A 3EOBB 3TIDB 3ULSA 1NC2D 4G7YL 5E2JA 3BAIA 2GI7A 2A9NL 5KSBF 1J05A 1GCFA 4NO0A 2TRHA 2JQMA 4Y5YA 2ROYA 1VSCA 3T8XA 5KBDA 1S5IH 3PV6A 4GQRA 3GXMA 1KJMA 3DVGB 4IS6A 4KY1L 1PZCA 1RUPH 1KMGA 4WI4A 1TSRA 1KGCD 3TBSB 2G4GA 3CSGA 2R8SH 2E8YA 5E08L 3KPLA 3G9AB 2LW3A 4JG1L 3G3LA 3WTWA 1CICA 4OM0L 4JQVC 4NRYA 1JFQL 1WZMA 2JWYA 5E6IB 4LSPH 1I1YB 1SXCA 2ENSA 5BS0A 1O9VA 3BGFB 1CCZA 2BZ7A 3M17A 3EDFA 5J0BA 2KL6A 5LG6A 4YHZH 3NFSL 1HEJC 1KN2L 2ODHA 1X9RA 4QRRB 1D5ZB 1IU1A 1NUNB 3TLRA 1PJ9A 4K3EL 2AEQH 3VX0A 5EEXA 3ESMA 1LLAA 3BD5A 1RUML 4M6AA 4PRAB 3VM5A 1DUZB 4ODVL 3C6SA 3IFPB 3RGBA 4UUJB 3B2UD 2EUVA 3CFNA 2FX8L 5TE6L 2NY3D 4TVUA 1RKRA 3MJ8B 2PTTB 3KPSA 3V6ZA 2Y0SA 4EIBA 3GXDA 5AYQA 4MCZA 3P2TA 4N2BA 4L1SA 4OJEH 2Y6TE 3DIFB 5D7SL 2X38A 4EBQH 2QHRH 1DFXA 1HJCA 3QG6B 1IKNC 1M56B 2EYRB 3J7HA 3BVNA 3E9UA 3MUY1 3OHXA 2N1KA 3BUIA 4B9YA 4LGPB 3DYPA 5IJVA 4RFOL 4RETB 3R8BB 3W3BA 1USZA 3LZNA 1ZPLA 5DJCA 1FPTH 4GKNB 3RX9A 4BA0A 1W8OA 3CPUA 5K9OB 1N5AA 5DD0H 4ZS7H 1HILA 2NQ3A 5LG1A 2AK1H 3TN0C 1CD1B 1M7UA 1MFEL 2ZPKL 3JT0A 4GW5A 3MXWL 1MVFA 4HPYL 3ORJA 1NFKA 5DZAA 5BRZD 1Z9LA 3QQ4A 5C0RL 4NQCA 3M1BB 5GSVB 4I77L 4JG0H 3LPGA 4LE8A 4LSSL 3AUWB 2ADIA 3WLBB 5GGVL 3E2HC 3NZ8B 1DQJB 3FT4B 2WLIB 2XI9A 4MJIE 1PY4A 4N1CA 1SYSB 3A24A 1UURA 4IDJL 2DBLL 1MAJA 2JSFA 4XBPB 1D6VL 2VDOL 3BMWA 3SGJC 3SDDA 3ULVC 1HNFA 2J8UB 3C5ZD 4JNXA 4MA7L 3RY6A 1IBFA 4AUJA 5E8EB 4M5ZL 4XN1A 3WY1A 2YA1A 4P2RA 2AKRB 1XF2A 1WWAX 2WYHA 3STBA 4JPVL 4XI5C 2GJJA 1Y7VA 3KLAA 3VRLE 5CEYA 4YMPA 2B0SH 4Y2LA 4QRSB 1H3PL 1VCAA 1X5KA 1NCBH 2L7EA 3MNWB 3W9DB 4ZMLA 5HYSG 3FT2B 1W0YT 1GGCL 2XWCA 4JM4H 4HJIA 4O02B 4KRLB 3MRBB 3WIFA 3ZKMC 4YX2H 5KJRL 1P4BH 3RWFA 4I3SL 4L5FE 1OB1A 4OZHA 5GISL 3OKMA 4FQCH 2VR8A 1R5VB 4I87A 4LFHD 5E94A 3NFPA 4AGLA 1QYGL 3SPIA 4BKLB 3CFEB 5AOIA 1OL0A 5FO2A 4Y4HC 4F57L 5C8JA 1N0XL 4YFDB 1KXHA 2X05A 4B3EA 4BFFA 1JYWA 1KPVA 2I60H 1J87A 4XCYB 1EERB 1HQ4B 1IEBB 1NC2B 2CQVA 2D7MA 2G3ZA 4PRHD 5T1KD 4E42B 3K5SA 4HUUA 2HKHL 5F1IB 3E9TA 4DGVH 2C9SA 1KFAH 3QXDB 3JWOC 1U92A 5G4NA 3QWNA 5AENA 2WAHA 4LBEB 2GC7C 1EDHA 2XNAB 2VLLB 2HJLB 5D7JD 1T1YA 1NMAH 5I1KH 4Y19D 1A3ZA 2NNAB 2AXWA 1TYRA 3VGHA 4NC1E 2DQEL 2NY4B 3G08B 4MKMA 5FGBA 1YNTB 5TGBA 2F53B 1FJ1B 1WPCA 2KQMA 4G9FB 4J12A 3ZE2B 1UFGA 1HXMB 3LEXA 4OCWH 3BH9B 3S98A 2YPLD 2NYKA 2Y5TA 3O41B 3X3FL 5L88L 3EZJB 4R96A 1MELA 2ZUTA 3FQTA 3SDCD 3ZHKA 2CIKA 2VSKB 3RZWA 5F88A 1N8ZA 1V10A 3TTYA 4F15B 4M1GH 5JLZB 1DQMH 3VD1A 2OSLB 2D4DA 4LVNC 4MAUH 4QXGL 3ZZSA 1U3HD 1IL1A 4I2XB 1AE6L 5D1ZI 1T7WA 2HXAA 3VFRB 1HSAB 3ASWA 1ULVA 4V1DD 5KYXA 1CE6B 3HE7A 2NYYD 4RGNC 3WD5L 4X5XA 2HSIA 4ELKA 3ALPA 1U3NA 4K55A 1FN4A 2GHZA 5E99L 3BXNA 3ZUCA 3KPRE 1MREL 2WBJB 1IM3B 5A2IH 3OAYK 4MJ6B 3T77A 1WJ3A 2CWRA 4APXB 3ZZ1A 2G3NA 4I3RH 2OYKA 1T1XB 3KJ6H 2FT8A 5JDSA 1U95B 1FGNL 1GGBH 1AANA 1T4WA 1G9NH 4NOBA 3W0WE 1ZJBA 2H1PL 3PGFL 4I85A 4OCRL 5D4JA 4OI7A 4ZX6A 2AXJA 3CH1B 4IRJC 4LP5A 5CGYD 1S7VA 2Y5EA 1OT1A 3SYPA 3OL2A 1QLRA 3FU3A 4JRWA 2PETA 1MIEL 3ABGA 2BP0B 3BIKB 2VDKL 3FQRB 1KB9J 4AC2A 5GS0C 1SXAA 3G5VB 1AG6A 3C8DA 2R4SL 4M3HA 1C5CL 5CCHE 3RIAK 2VDRB 3KPPB 2D2CC 2G2NA 2NR6A 2TSAA 4GSXA 4P2OA 2D8KA 2DI9A 3TF7C 3BP6A 1NBVL 1QFOA 4J1UB 3PDGA 2OCFD 2ADFL 3BPNB 4JBSA 3WL9B 4B95C 3BUDA 5C0GA 3B9VA 3RNQA 3HCVB 2BSBA 2YMXH 4E9RA 3O6FA 4NRZA 4J3OF 2K8MA 1BFVH 3BWAA 2N1TE 4IBQA 1YECH 1DBKL 4HMDA 1TUPA 2NXYC 1JTTA 3Q8EA 2V3FA 3NIDF 3UYRH 4U05A 1TZOA 4OV6F 4P2CG 4AGMA 3J07A 3ECUA 2PLTA 3QBTB 5GGRA 2HFGL 4JRYE 1KN4H 1P4LB 2X28A 4LT7A 3IFOA 2FD6H 3QUMB 1S7QB 4TVPE 3SKUD 2A73B 3P9MA 1MFCH 4RWYL 3ES6B 3OKEA 4ZJ9A 1IAOA 3V0DA 3NJFA 1P7HL 4IMLB 4ZUTB 3VXTA 2ZJSL 5T33L 4B9GA 4LHJB 1MOEA 1H19A 4H26B 3UGXA 3GSQA 5E1QA 5LGKA 4EIUA 3U30C 1C5DB 3RB7A 5F9WB 4M61B 3CFIC 4ANWA 1E4KC 3H42H 5SWSE 4Y2DD 3MLWL 3PWLA 3OKLA 3DGGB 1CK0L 3BQUC 3QQ9D 4WKZB 4HXBL 3FFCB 3FQUA 1N12A 5C08D 3E8UH 4GQ9L 4ZPVA 5DMIH 1PL3A 3O6KH 3NG5A 3CQFA 4AWJC 2HFFA 2WN3A 2IDSA 2ITFA 1SLXA 3A22A 4PYHA 3MLUH 2AK4A 1SZNA 5D6CB 5GS1C 1RJZB 4QXWA 3GHBL 4N2LA 2Z64C 2YD9A 1OHQA 5BVPH 2VZVA 4LLVB 2EE6A 1HKFA 4PB9H 4UB0H 4Z7UA 4MHHG 2GT9B 4QRRE 3HG4A 1WEJL 3NP4A 2X70A 3I84A 4XNBA 2XTJE 3V0VA 4HOWA 4PCKA 2BVQB 2DKSA 2ZTBA 5CD3B 2YBRB 2G2RB 4GRWH 2BCMA 1X7QA 1QFWI 4LVEA 5DC4B 1EK3A 2F7QA 2Y3NA 4BH7B 3T3MB 5MHSD 1T04A 1Q4NX 1UUSA 3AAZA 3IETB 3N55A 5E1IA 4TSBL 5IK3B 4CBPA 4KZDL 5EIIB 3ZR6A 3FRPG 3PHQB 4JO8A 1R5IA 3AB0C 1WWCA 4FQQB 4KKPA 5FDYA 3GZOA 5HGDB 1C16B 4XXWA 1JHTA 1JF1A 3QIBD 1XB3A 2B4CH 2WWKT 3IFNH 1I3RA 2DI7A 4PJ9D 3MBEB 1LVEA 3IPEA 3KPOA 2XPZA 4O9HH 2PTUA 4X9BA 2WM0A 4Y9GA 1MLBB 4Q9RL 1NBZB 4F80A 4I13B 5IHBA 4KZEH 2V6HA 4ZD3L 1W8NA 3VRLF 4NAJA 5JOFB 1E3FA 2ZCHL 1NMBH 1P5VB 2CCVA 3Q2LA 4OCSH 4OZFG 1KZYA 4JFPA 2HJKB 2CLVB 1AQ8A 4FE9A 4XPBL 2PUQT 2G3MA 2JXMB 4QXUL 2B7DT 4JK0D 1P7QA 3RWHB 3SPHA 3RFRA 1ADQL 3NA4A 3ZKNC 2FUQA 1Q9OA 2PP9A 5C92A 1Q94A 5GZOA 2P5ED 3U9PH 5EA0L 2IFFL 2J8UE 4B53A 4K8RC 2CMRH 4NKIL 4R4BA 3BWUC 3WGVB 1T66C 4MAYA 2R4RH 4ELDA 3NABH 2WSPA 4FG4A 3TPUA 2YPKA 4QI3A 5C3IA 2R0ZL 3B3BA 2X4SB 4TF4A 4UNIA 5MENE 1PZBA 3C09B 4ZYKB 5DZPA 1U8PA 2YEZB 3VQLA 1FBIH 4WV1B 2HTKC 1WRFA 3WTXA 3EO0B 4DKFH 2WXOA 3GUTB 3JT2A 4OFVA 1MJUL 2BOBA 4FMVA 1FIGH 3WKQA 3DROA 3PXJA 5KVGL 4EI5A 4UQIM 1ORQA 2IBBA 4HJEA 1T1ZA 2ILLA 4HF5L 3D1MC 3TBWA 3QDMB 1M7IB 4E41D 1XGPA 2Q86B 4YDLC 3OG6B 2A77H 3EH2A 4GFXA 2Q7YB 4NM8L 3EFOB 4JCLA 4QO1B 4U1HB 3VG0L 5C0NC 1AZBA 4CNIB 3BP7A 3KVQA 5F7UA 4APQC 3UP1A 4ODUB 2DKUA 1VLXA 1BJMA 1A22B 2FX7H 3WHE1 1E3XA 3MUGB 3NACL 4MBOA 1MPAL 4KY2A 2NSXA 1S5HB 2AGJL 1I3VA 3IDUA 4NWTH 2LAGB 2I07A 1UH2A 1BF2A 4ZS6D 3ZHFA 2Z1KA 1UASA 2GVYA 3KG5A 3QULA 4HU2A 4G5ZH 4I0PC 3QXVA 4FQXB 4JPWH 7FABL 5DJXA 4GXUM 5AVUB 2ZOUA 3GPEA 3ARBD 1BVLA 1YNKH 4J7RA 1IBDA 4WFHD 5FV1L 5AW9B 5HP5A 5HGHB 1ILUA 1QMUA 4UQEA 3LRSA 3E6FA 3VDAA 2F53E 2XIBA 5KBNC 2XV3A 3FU5A 1OAQH 4ZFQA 4G9FE 1JZ8A 3ZE2E 3D39A 2D9QB 1HL4A 4L1LA 4KI5E 2F0CA 4PWIA 1JNLL 3GHPA 3VTAA 2ARJQ 5FUZH 1F6FB 1T21B 5F9OL 5HHNB 5IW6B 1E40A 5J12C 1MY5A 4Y4FD 1BMGA 3BUYA 1M2OA 4QHUB 4A2EA 5JO5A 3CCHB 2DH3A 3BKCL 1YEHL 4I2XE 1F97A 3QJOA 3NAAL 1H9VA 2R2HB 3GS4A 4I4WA 2NZ9D 1KG0B 4P9HH 1AGFA 2DEXX 5I6MA 1T0PB 2IFGA 1ZVHA 5E1AA 3KYNB 3E38A 2WB7A 2AJZA 3FU8A 4HLJA 2BX5A 5EPMA 4F3FB 2MSPA 1F41A 1U58A 5DHMC 4U1LA 4C4KO 4FKEA 1HOCB 1N7ML 3SKOB 4JDZA 3EOTL 2BW5A 5J1TC 1NDTA 2IH3B 4X98A 1W0VB 2WLZA 2EXWC 5TH2B 1WFJA 5KBPA 2BHUA 4H1LB 4YDMA 5K5YA 3LAFA 5DQ9A 4F1ZA 4A7TA 1OV8A 3RX8A 3B5TA 1SJXA 3LQMA 1FYHB 3B6SA 3M7OA 5IFHH 2YEVB 3CHPA 3ILDA 3S4SA 2OYPA 1FF5A 3GTVA 1BPLB 2F15A 4NO0D 4X4YA 1ONQB 3KLHC 4AMWA 4RBPH 5CIPA 1CBJA 1SEBB 5JQ6H 1XCXA 2NX5B 2IXQA 5LGHH 5A6MA 3M7FB 4W4NA 1ADQA 1U91A 1HN1A 3DX4A 3KL3A 5F7MC 1XV8A 3E1F1 5G55A 4XPTH 4ODHH 5ESAB 3GHEL 3TCTA 1NGPL 3ZXAC 3SD2A 3MRGB 4QTIL 4UZUA 1CICD 1KXQE 2VB5A 3K5RA 2X7LB 4WI0B 5IF0A 3DURA 2QSTA 1YN7B 1ES0B 1T1WB 1PS3A 4FQIH 4N85A 5BS0D 5F9JB 2O30A 2GCYA 4HZLA 1J9TA 1M1XA 4J27A 1LQBC 1H8SA 3L3DA 2QKIC 2XTLA 3B56A 4N2IA 3RIKA 1KIUB 2F5BL 3EG9B 2BOCA 4XN4A 3TYGH 5AZEH 2H41A 5DJZB 2KUTA 3REWA 3NSDA 4WFED 4PVBA 4QGYA 2BPBA 5CBAB 2P8PA 3WUWG 1U8LB 2FATH 2OTUB 1MVUA 4QWWC 4XOEA 1M57B 1I1RA