4DP4X

The 1.54 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin B, chloroplastic
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp4X00
4GP4B 3FU8A 3NJMA 3EHBB 4DP6X 4QKTA 3EH3B 3PAUA 2PP8A 5I6PA 1L9RA 3OM3B 2FJSA 1NZRA 3T71A 5B1BB 3CDZA 2X87A 2H3XC 1JZHA 1SDDB 1WS8A 3ZBMA 1AG0A 4KO6A 4YSRA 3C75A 4WKXA 1J9SA 2GI0A 1SFHA 4WTQA 1GY1A 4KNSA 1BEXA 3T6XA 4DP2X 2B08A 1J9QA 1ZPUA 1MZZA 3SBQA 4GXFA 2ZOOA 2A3TA 5B7FA 1NPJA 3WNIA 2Q9OA 1JZJA 5EHFA 1NIFA 2DY2A 4M4RB 3S8FB 3FQYA 1PAZA 4GP5B 4YSEA 4DP4X 4FA7B 4DP8X 3N2JA 2GSMB 2XV3A 3DKHA 4NAJA 1E67A 5I6KA 1ASPA 1IC0A 2PPDA 4G72B 2XV2A 3BVDB 3OQRA 5I6MA 4W1TA 1EHKB 4BXSV 1OCCB 3QJRB 4YSPA 1OV8A 3IN0A 2IDQA 5B3SB 2CJ3A 1WA0X 1ZV2A 3BQVA 3KW7A 5B7MA 1M9WA 1YLBB 1DZ0A 2GBAA 2PPEA 1ASOA 1TKWA 2B3IA 3T9WA 1CYWA 5A7EA 2R7EA 1PZCA 4F2EA 2JFCA 1SJMA 2UXFA 4BK5C 1R1CA 1OE3A 4BXVA 1L9TA 1NPNA 2GB2A 3H56A 5ANHA 1ETJA 3NSYA 2IWFA 4JHVA 5F7AA 1NIEA 2VSKB 2DYSB 4HHWA 1CYXA 1NICA 5I26A 5B1AB 3PAVA 3FT0A 4YVNA 1E30A 3HEIB 4E9XA 2QDWA 3X1EA 4DP7X 1XB8A 3X1FA 4GYBA 1NIBA 4HIPA 5AZUA 1SHXA 4ENZA 1KCWA 1OCZB 1SDDA 3FSVA 4YSCA 1BXUA 1PCSA 4W9ZA 1JZGA 1L9OA 4DPCX 2TSAA 1HAUA 4YSDA 4G70B 3X2QB 4BWWA 3WIAA 1A4BA 2EIMB 2HLEB 4HZ1A 2YAFA 2VN3A 1FFTB 1RCYA 1J5CA 1E5YA 2AVFA 3PXLA 1MG3C 4AZUA 2XV0A 4HHGA 3ZDWA 1FA4A 4A67A 4E9YA 3PAZA 4E9SA 2J56A 3MBWB 4P5SA 2ZXWB 1URIA 2DV6A 1JXGA 3ASOB 3UABA 4E9WA 2PPAA 1GW0A 1CUOA 1BXVA 3FSZA 1KGYE 2MTAA 3NJJA 5TK2A 3AY2A 4CSZA 3NSCA 4Q89A 5I5JA 3X1GA 3ABMB 2XVBA 1XB6A 2IWEA 1E65A 4M3HA 1JVLA 1BYOA 1PMYA 2VSMB 2UXTA 4E9TA 1L9SA 4KOCA 3NJLA 2CAKA 4E9VA 1VLXA 2HRGA 3NSDA 2BP8B 6PCYA 2XXGA 5I5MA 3G5WA 1A65A 1PNCA 3TBBA 4JHUA 4TXVB 3WI9A 2QPDB 1NWPA 2BWIA 2JKWA 2FT7A 1TU2A 2XXFA 2I7SA 4HAKA 3NP3A 1IBYA 3AG3B 2ZONA 5TK4A 4A2GA 2TSBA 3FU7B 5PCYA 2XX0A 3WG7B 4YSQA 4BDVB 3AG2B 1PY0A 1KBWA 3WKPA 1W8EA 3GXUB 5B1JA 4A68A 1I53A 2PLTA 1NTDA 3AZUA 3TBCA 3OMNB 2RACA 2PCYA 3UAEA 3FQ1A 1F56A 4KO7A 4E9RA 3FSWA 2FT8A 3U25A 1A4CA 3CVBA 5F7BA 1MDAA 4N8UA 4RH4A 5D4HA 3WKQA 1OCOB 1IBZA 1PLCA 5IY5B 2XYBA 3CG8A 1BQRA 2EINB 3QJUB 3RYMA 6PAZA 5PAZA 2AZAA 5I28A 3JT2A 3QJQB 3FQ2A 1OE1A 2YQBA 1V55B 3TA4D 4AI7A 3NSFA 4FAAB 4GY4A 3QJSB 4MFHA 2YAMA 1JXFA 2WO3B 2VM4A 3EH4B 1JZIA 4DP1X 4G71B 3FPYA 1ILSA 3UACA 1J5DA 2VW7A 4DPBX 1X9RA 4DP0X 2HX8A 4KO9A 1GS6X 1HAWA 1ILUA 1FWXA 2PPFA 2AZUA 3ABKB 2Y69B 3DTUB 2BWDA 1SFDA 2E86A 4G7QB 1ET7A 1GYCA 1L9QA 4HCFA 1UATA 3NJKA 4KO5A 3FS9A 1W6LA 2J5WA 3V9EA 1A4AA 3CVCA 2YAHA 3EH5B 4GP8B 3NJFA 2NRDA 2HZHA 1W6WA 1AS8A 1AZUA 2BP8A 2DWTA 4KOBA 2OV0A 3N55A 3SQRA 4YSUA 2IDUA 3H4FA 1AS6A 3L45A 4KNTA 1JXDA 1AAJA 4A2HA 3PPSA 1M57B 2H47C 4A66A 1J9RA 3FU9A 4YSOA 3ZIYA 1NDTA 4YSAA 3DIVA 1WAEA 2UXGA 3FU7A 1KYAA 4BDVA 2YXVA 2QPEB 1IKOP 3TU6A 1AR1B 2FWLB 3S8GB 1V10A 4YSTA 3ERXA 4AKQA 3QJVB 2PP9A 2HX7A 1IUZA 4QLWA 1NIDA 1PZBA 2W88A 2YAQA 1QLEB 1KBVA 3GDCA 1EZLA 3IEAA 9PCYA 2IWKA 4JKNA 4AX3A 2UXVA 3FSAA 4A2EA 2GIMA 2BO0A 1A8ZA 2BW5A 3T6ZA 3EF4A 1BAWA 1RKRA 4HCIA 2VMJA 1OF0A 2UX7A 3AG4B 4NB7A 1BXAA 4UANA 1PF3A 7PAZA 2I7OA 3QJTB 4X4KA 2XWZA 2J57A 2UX6A 2BW4A 1JVOA 4BWUA 1GY2A 2VW4A 1BYPA 5I6LA 3T6WA 3SBPA 3D12B 1NINA 2FQEA 2AANA 1JOIA 1T5KA 1KCBA 3JTBA 2YXWA 2XUWA 4G7SB 2Y1AA 3OMIB 1ET8A 1ADWA 1ZIAA 2JXMA 2XU9A 3TASA 2LLNA 3QPKA 1AQ8A 2GC4C 1WS7A 2PPCA 3AG1B 2IAAC 1AZBA 1AIZA 4L0PB 1NIAA 1PZAA 1AZNA 4YSSA 3HB3B 2MRYA 3MX0B 3NJHA 3S3CB 4UF7C 2QT6A 1GR7A 3IN2A 2BP0B 1OOWA 2EILB 3ABGA 2J55A 2FQFA 1JERA 2DWSA 2VW6A 3S3BB 2CBPA 1SNRA 4A2DA 1N68A 3X1BA 2BZCA 2QDVA 3PCYA 2YAEA 4K9JA 3UADA 4CSPA 2VM3A 1E5ZA 4UAHA 1ZIBA 2EIKB 1TEGA 3ABLB 3CVDA 3H4HA 2FTAA 1L9PA 3T6VA 1AG6A 1KDIA 1XMEB 5AKRA 2GC7C 3SBRA 1QHQA 4DP9X 3UAAA 3ASNB 2IDTA 1M56B 2AFNA 3WNJA 1KDJA 1WA2X 3OMAB 4G7RB 1CURA 2X88A 2YAOA 1AZRA 1JZFA 3KW8A 5B7EA 2CCWA 1XB3A 4HALA 3NJIA 2IDSA 2N0MA 4F7KA 1BQ5A 1ID2A 1DYZA 2H5UA 1A3ZA 2FNWA 1HFUA 1TEFA 2P80A 1ZDQA 4EF3A 5LDUA 2Q5BA 2FQGA 1CC3A 3NJNA 1AANA 1AS7A 3X1NA 2WSDA 1NWOA 2W8CA 2WO2B 4P5RA 4E9QA 2IH8A 1KV7A 3CDZB 4NERA 3PLYA 1MG2C 2IDFA 4AKOA 1SF3A 2FQDA 1B3IA 1RZPA 5I6NA 1PLAA 3NP4A 5AFAA 1ZDSA 1PLBA 3OD3A 2HRHA 5B1KA 3QQXA 1AZCA 2GHZA 7PCYA 8PAZA 2PCFA 3NT0A 2I85A 1OCRB 3GYRA 1GS7A 1SHWA 4YVUA 3IBOA 3NJGA 1JZEA 5D4JA 4KNUA 2ZWNA 3UGEA 2BZ7A 4ZK8A 2CUAA 1SF5A 1V54B 2FT6A 5I6OA 3FYIB 4PCYA 4PAZA 3AW5A 2P80D 3ZX1A 2BP0A 2CALA 3NYKA 1OE2A 1X9UA 4AKPA 1QNIA 1RZQA 1ASQA 2DYRB 3IE9A 1MZYA 2HX9A 4HCGA 3S3DB 4A2FA 1N70A 1PNDA 4BWTA 2PP7A 3FYEB 1AOZA 4N4YB 4YL4A 2HXAA 5B1JC 1WA1X 1J9TA 2XLLA 5FC9A 4Q8BA 2YARA 2YAPA 2BHFA 3V9CA 4DPAX 2R7EB 2EIJB 2XX1A 1GSKA 2OJ1A 4DP5X 3FPXA 1GS8A 4F2FA 1ET5A 3CZUB 1BQKA 1AACA 2IH9A 5E9NA 5D4IA 5I5IA 2OCCB
chains in the Genus database with same CATH superfamily
4PRPE 1L6ZA 5BQ7B 5L8LB 1HESA 2YHGA 4M7KL 1AI1L 2HPTA 4XP6H 3P40A 3K6FA 1BD2E 1M2OA 4KK5C 4B96A 2BFVH 2PXYC 4FA6A 5K9QG 3Q13A 2X87A 2V8LA 4X9BA 5C0AE 2ZNWA 4P2QE 5ITBL 3MNWA 3RILA 1A1NB 1ZLVK 3DX0A 1AP2A 5FV1L 2CE6A 3K7UA 4H8VA 1VFBA 4HFWB 1HWHB 4KPHL 4TSAH 4C56A 4F33A 3Q6FB 3O3DB 4JY6B 3OLIA 4NJ9H 1NGWB 3MGOA 1NPJA 1RHHA 2DH3A 3DXAE 2H45A 1FORH 3MLVL 1N7MH 5DD6B 4G9FE 1S78D 2DY2A 5I1GL 4NOBA 5GPRA 1G43A 5DD0L 2FX7L 5JOPD 1YN6A 4NZUL 4MJIE 4ECNA 1UC6A 1SXNA 4G9DA 1OANA 4KMQA 4ZMPA 5IOKA 2Z8WC 4WU5A 3CZNA 1A1MA 2F19H 1TVHB 1N2RA 2DJ4A 4GSDH 5K59E 1CB4A 1JMZA 1NAMB 3TO2A 1XTLA 4G8AC 1PX8A 1IC0A 2VC2L 2RHEA 4I7ZC 1FC1A 5L88L 3KPRA 2BVOB 4Z7VF 2X2UA 2WXMA 2I5YH 2O5YH 2OXGB 2X3AA 3PJSA 3KPOB 5JQIB 3AADB 5IBTH 1OSEA 1SEBA 2WN3A 4U6HB 1ZLEA 1ZV2A 2P8MA 4EI0A 3O41A 4H8HA 3OGOE 1LE9A 4HV8A 1MSPA 2ZPKH 4IMKA 4H13C 2GVYA 4F7MA 3VSTA 3PL6B 4QPEA 1JWUA 2UZXB 1TQVA 3KYOA 2AEPL 4E42B 4BFIA 2F54E 3NIDB 4OCYH 4UZGA 1ECZA 3SJVE 1IGIL 5ANHA 2QJDA 3H3PL 3KLLA 1ZTXE 1J7VR 1LWJA 3QQ3B 3HI6L 1OSYA 1F45A 1KXVC 4BELD 4HHWA 3V4PL 1OGAB 3I6LE 1NCJA 3QUYA 7TAAA 4NQCB 3FUNA 5EN3A 1WBXB 5F7MC 2HPOA 1UASA 1KPRA 4Y89A 1FL3A 3GRGA 4XN1A 1R47A 4NSKA 4UU9A 2F53E 1OCZB 5EU7C 1UA6H 5TDOB 5AAWC 3CFUA 2GT9A 3ZMRA 4I0PB 5BVJB 4NNPL 4R3SB 2CKBL 1RIVL 2FECI 1A9EB 3Q0HA 1TJHH 4X5WB 4CGTA 3ZDYF 2QSCL 4G7YL 3WE6B 1YEJH 3FK3A 1RUQH 4NHCH 1MN4A 4ZQKB 1F4AA 1HOCB 2VLLB 4HUCA 3HIZA 4KVPA 4M7ZC 4QMEA 5GSVB 4OFVA 2BSDA 4NQDB 2AVFA 3W81A 4KZDL 3WEAA 4IOIA 3VI3A 1WFMA 5GGTH 1INDL 1CFQA 2XWXA 2HT2C 3OB8A 3UAJD 4F58L 3WEMA 3UBGA 2VERN 3MRHA 3UABA 3DYPA 1Z0MA 3LYRA 4NZDA 4X99B 1K8IA 2DWYA 3SY6A 2MTAA 1NEUA 5E8EB 4M00A 1FUNA 4JPVH 1BV8A 4JPQA 1E65A 1UH4A 2OJZH 1F6FB 4YHNA 1MFNA 2CLZB 3CZLA 3ECUA 3LZLA 3QEHB 4OF5A 2JI3A 4R4BA 1NFDF 4Z77A 1FO0A 1I7RB 1X5YA 4XWOD 3MCKA 1TLKA 4PGEB 5DYFA 2A77H 2WTRA 3L7FB 3IMRA 3T1FB 2OMWB 1LILA 1L7IL 1LO3H 5HVGB 3AGVA 4I3SH 1CTNA 1BVLA 3MMEB 1GPOL 3Q5YA 4EZJA 5C0NC 1WVZA 5JHDA 3BIKA 3ARUA 1CXIA 4C4BA 4HAKA 4EUPG 2WUBH 3DBXB 3COOA 1E4HA 1Y1DA 2GJZB 3PWPB 1XL4A 3GPSA 1KBWA 2EZ0C 4LE8A 2J5LB 3MRDB 4UQ9A 3I2CH 2VDMB 4HP5A 2BHYA 3LKOA 4JAMB 4KXCA 1JV2A 3X11A 3BKCH 1O6VA 1TTAA 2BIOA 5FGBC 1FJ1B 3KL0A 5TQ0H 4AEIL 1W0VB 4JDTH 4RMTA 2PW1A 2KC0A 3QHTC 2Z92A 3TV8A 4XB3A 3N0AA 4OJFH 1MCWW 3GHEL 1HL8A 3PL6D 4U0QB 1Q0YL 3SZ6A 4NQEE 2YD1A 5BZZA 3ECQA 1QBBA 3QJQB 4NIKB 4JB9L 4LT7A 1YNKL 4XCYA 4JFHE 1JGVH 2K70A 5DJ0B 2WKOA 3NQKA 4PG9B 2QKIA 5GZOD 3TO4C 3S88H 2EH7H 3I6GA 1H5BC 3X3GH 3HAEH 1L9MA 3QIUC 1OGAD 3QDGB 4UMGA 1DANU 3OXRA 4NQCD 4MNQE 1O5DT 1QSED 2Z31A 1T6WA 1KEGL 3DIFB 5HI5C 2I27N 5D7KD 1ILUA 1FWXA 4I88A 2N01B 1ZHKB 3O3EA 4ZOCA 3WE1A 5DJ8A 1EEYB 2ZYIA 2DLEA 5JW5A 1A1OA 4I0PD 4LCIL 3QRBA 4L9LA 4W68A 1BM3H 4JDEB 3UTTE 1I7UA 2WINA 4ISVB 4ZMVA 1MQ8A 3GMPB 3MXWH 3WFDL 5EUOF 4GQ9H 3W5MA 2VC2B 4DKFL 4ZOBA 5EORH 1B0GA 3P9LA 4GP8B 3RWCB 1D6EB 2XG5B 2BP8A 4TLKA 3MLTA 2QFRA 3QIWC 4TL4A 1QUNB 4MNHB 4LCYA 4A2HA 1K72A 3GSOA 1J9RA 4NQDD 4GRMA 2IAMA 3L81A 5CIPB 2UXGA 4PBXA 4LHQB 4YHYC 2K45A 4Y1AE 3VX0A 2W94A 2D2OA 4JX0A 3VI3B 5CD5C 4XNQA 3A6CL 4P46C 4URTB 2FNBA 1SHSA 4WO4D 3T04D 4MVBC 3BUYB 3V4PB 4P9MH 4TVPL 1HI6A 2BJMH 1ZHNA 1GGBH 3K8MA 3VXMB 1FNEA 2GG1A 3IB4A 1J0ZA 1EXUB 3TWYA 4TNWF 2IWKA 4HG4K 4OGZA 3F58H 5FUZH 5TJWK 1JI2A 3HUJE 1EUTA 5DJYB 4PJAA 2FK9A 3AG4B 3AT8A 2VABA 3KWTA 1G1CA 1R5WA 1BXAA 2CKBB 2YC1A 3BZFA 2DB8A 4Y7OC 4ZD3L 3WTWA 1UXLA 2E6JA 4IS6B 5BRZD 4ZMQA 3SYQA 2DQUL 1WF5A 2ZJSL 4NHUA 2XHNA 3SKMB 1N6VA 4P2CG 4XAKE 5BXFB 1KJMB 3K74B 3F62A 2GAZA 1DQDL 5FF6A 4WJ5A 2AANA 2BPBA 1R6VA 1UM6H 4I48B 4MDIB 5IROC 4AIXA 4DHLA 5T1KA 3FU3A 3I02A 1EERB 4IU3A 3FBKA 4DCQA 4LEOB 2PW2B 5D5MB 4WV1A 4ODSL 4BUQA 3WFEH 2JJSA 5KSUA 2N1TE 2JF1A 4JLRA 2KLRA 4LSTH 4FFVC 4ZPTA 4K7PX 5GGUB 1JZ7A 1N0XH 2DOCA 3PREA 1EHAA 2JKTM 4S0TD 5FYLL 4ZZFA 3TO4B 3N5AA 4LSQH 3QIUB 4L4TA 3U83A 4ZMZA 1I8LA 2ADIA 3KPNA 1GZPA 3GK8L 3QFGA 4PJGF 1CIUA 5F6HJ 5JA8B 5EZLA 2X89A 3JTSB 5BJTA 3NJHA 4JPKL 4BE5A 9CGTA 1RZIB 1B0RB 5FXCH 3LIZL 5GRVK 4W81A 5JOPE 1HHKB 3QDGD 1OOWA 3OX8B 4B5ZA 4XMKH 1YUHA 3UBFA 2G2NA 1EJFA 2NY6C 2QDVA 2WYHA 5ESVA 3ME0B 2KZBA 4W70A 5CJOH 5TF1L 2OTUA 4CSPA 2ZP9A 5BZDB 3ZSTA 2MPVA 4UAHA 5HDQH 3ZL2A 4PB9L 3S35L 2EIKB 3EYFB 3VRLE 1QRNA 2WW8A 4GW1B 2VSDA 3QIWB 4RX4D 2MNUA 4E9LA 3VQ2C 5KVFH 2VZUA 3KVPA 3H9SB 5FYJD 5BS0A 2YUXA 4JG5A 2APVA 2HFGH 4JZJC 3L3OA 4N87A 5LBGA 1DQKA 1TITA 2EIZA 5LGJB 1KDJA 4MCMA 4ONFL 4YHYB 1OSZB 1ZE3C 3BWZA 4HALA 4JO1H 3WOVA 1U95B 3KNBA 4BFOA 1U8OA 2C8NA 2O6CA 2ZP8A 3T3MB 3HA0A 1FO0H 3QRGL 4P46B 3F65A 1IILE 2K7PA 1DLHA 1S7WB 3FCSB 4NLAA 5E2WH 3X1NA 2R2BB 2IH8A 2NUPA 4OIIH 4G6ML 1LO0H 3AMKA 2CO1A 3AROA 4AK2A 4MYPA 4XPAH 4EVNB 2X0UA 5FK9B 2MQ0A 3EG9A 4JG9A 4ZX6A 2D7MA 3VXMD 1OAUH 3S36H 4PY8I 5FHBH 2IO5A 3U36A 5I1DA 1X6NA 4D9LL 3EBHA 3P4NA 3JTTA 3MRBA 3DO7A 1RUAH 5C0ND 1MHPL 2I85A 3MTXA 2YQ2A 5IQMA 5I16B 4IBUA 4KNQA 1FVCB 3GLZA 1P7QB 1VFAA 2Q8BL 3V0GA 2EZ0D 3BFWA 2LAAA 1XF3A 5JUEH 1ZA3B 2BP0A 1KBGL 5D7SH 5AOJA 5HDRA 3MSPA 2YD5A 3MI6A 2EKSA 4QHMB 5DWUL 3BC9A 3ULVH 3KGUA 2ZAGA 3SDDA 1P7KB 4JM2F 4KJPC 4FJZA 4HWNA 1HJBC 4Z7AA 5F1IB 3H9HB 1NANI 2NW2B 5D1QC 3CHRA 4MWFA 4RRPM 4TLSA 1AKJA 5T3ZH 4MTMA 4Q8BA 2QQLH 4AG4H 1PZSA 5BO1H 1E4XI 4KHXL 3SCMA 1NJ9B 2A1WL 5B3JE 1KWGA 3MOBH 5AVUB 4PTUA 3TO4D 3BKML 4H0GA 2X1OA 1J12A 4DP5X 3ZO9A 3QIUD 3ELAT 5D7LB 3FQWA 3BHBB 4XNUL 4ZXBA 3LKQA 1LM8V 5ABZA 4XNXH 4D3CH 5I5IA 4XOBA 2OCCB 3UZEC 1UCTA 4ODXA 2O6EA 4L5FL 3L4TA 5HI5D 3F84A 3DX6B 5H4ZA 2M2DA 4UM9B 1IGMH 2HVKB 1QVOA 2X4TA 5EZIL 2ZKHH 5IB2A 5IV2A 4XP1H 4LPYA 4H2AA 1Q94A 1U3HC 1CD9B 1DVZA 4BEIA 4QYAA 5CP7B 5LGHL 4ZMWA 1IIIA 4P2RB 3MJ8B 4PBDA 3U6RB 4KNSA 1F2QA 3MUUA 1AHMA 4PJ8A 3UJIH 3QIWD 3WN5A 2GSIA 2ZOOA 2XC8A 3TFKC 3IKCB 3H9SD 1CFMA 2BCMA 2X4PB 3DX7B 4D8OA 3P2DA 3NIDE 3ZZQA 4PJEB 4RAVA 4LLWB 1CU4L 3EFDH 1U8JA 4V33A 5CD5D 2GTQA 2ZCHL 3ARBB 3EJUA 2E9GA 1NEZG 4P46D 1M6OB 2R23B 4PIRF 2XFXB 1OGAE 2P47B 1NQBA 2VMCA 2NNXA 4HA1A 4NQCE 3T0WA 5TPWH 5I6MA 5ECJE 2AABH 3UBXI 3HG1A 1WISA 2C3XA 3FKUS 4FI7A 4OSUL 3GXNA 3IN0A 5C6TH 1N5YH 4LXFA 5D7KE 5DMGC 2F0CA 2EH8L 4X5QA 1G1YA 1ORQB 1M9WA 1T04A 4XX5A 4YS4A 5F7DB 1ASOA 4LLUB 2YOAA 4K5LA 4Y16C 3T2OA 4XAWH 4YR6A 3WJJA 5JZ7D 1T03L 1GTNA 1LHZA 2IPKB 2EICA 1CF8L 1CE6B 2UZPA 3QFDB 1OE3A 4GEIA 2AC0A 1ORSB 1CF1A 2R4SH 3T1WA 1UT1A 3ATFA 4EI5A 2DYSB 2BDNL 5I26A 5B1AB 3PAVA 3HRZB 4HJEA 4AMKH 5JHLA 4LDOB 1XAKA 1RUMH 2F74B 4J6IA 3MRRB 2N1KA 5D1QB 4NQDE 2FSEB 4XCNA 4NT6B 4AM0B 4X83A 1R0AL 5C8JA 3HR5B 3O6MH 4FFVD 4W9GC 1A3QA 4Z76B 3OKYA 4GRLC 2AQ2A 2O5XH 4LLMA 4UQ3B 1FZMB 4ZTPH 5C0CA 2XXMB 1YZZA 1HINH 1IGCH 2BCKA 4MSWB 2HFFA 5DZPA 2AI0L 2QR0A 3DVIA 3L3GA 5E1IA 5IJBC 1HZHH 1L9OA 2IGFL 3LRLA 3NFNA 2TSAA 3LPGA 4ONHA 3N1FC 4UBDD 3ZR5A 5HHPA 1A6PA 1E90A 4M02A 3TCTA 3MU3A 2GHWB 2AJSL 3LKPA 4U6YA 3NCFB 4X6BA 3RJQB 1PGRB 4XPHH 3V0AC 5AAPA 5B38G 4WI0A 3KXFA 4JGNA 2VN3A 4QHLA 1OAQH 4JRWA 3SGJC 1U3HB 5AYUL 4ELDA 2PTTA 3CK0L 1FRGL 3DHMA 5BZWB 3UTPD 5IT2L 3HKZA 2VQ4A 3KWUA 4OZIF 1AFVH 4QHNA 2UUDH 1QR4A 2W9DL 3OAZH 1MHHB 1XXFC 2J56A 3R0MA 3R1GH 1A6ZB 3AU1B 1UWFA 1B9KA 2DI7A 3IRPX 4NNXA 5BRZE 1LMIA 3CX5J 1CDJA 1GW0A 2ZF8A 3O3BB 3BIAX 3PWPE 3RDTC 3OB0H 5CJBA 4ONOA 4P2RD 3ZUCA 4OF3A 1IL1A 3NSCA 5C0BB 4EDWH 5CMAA 4NNYB 1HKLH 2K3TA 1MCPL 3I75B 4HK3J 2J7LA 4Z0BL 2WNGA 4MXQD 4DKTA 1QEWB 1MAMH 2EXYD 3MUHL 1E3FA 1G9ML 1T7WA 5LNGA 2QSTA 1MCRA 2BZDA 5DXWA 3CH1B 3WHXA 4JO4L 3VD3A 3AQDA 5CWSA 1T5WA 3D9AL 5B39G 1MRDH 1UD8A 4TXVB 4CN6A 4DIXA 2BRQA 4HKZB 3M6DA 4RGNC 4A7TA 2APTA 3MLUH 1KY6A 2YA1A 3IGFA 4JRLA 5KG9B 1SQMA 2JKWA 4M5TA 2FT7A 3K80A 4GPVA 1KB5L 3ARBD 3LEYH 3IMBA 5TK4A 4A2GA 5FM8A 3P73B 2CJSA 4CVZB 2F18A 1JGIA 4A55A 5EC2A 1NC2A 1T1XB 3A4EA 3QDGE 2VTFA 2D3LA 3RL2A 2Y5EA 3ROOA 4AV5A 1YPZF 4Y16B 4MB5A 1OD9A 4J3SA 1KTBA 1IKFL 2PR4L 3B9EA 3GIZL 5F1KC 4KDWA 5I1CL 2AK1L 4NZTL 3P0YH 1BSIA 3FUHA 4MDRA 2B1AH 4JPWL 5FYKL 4HBQA 3QHFH 1IB5A 1YNTA 3KLAB 2R2EB 4NO5A 4IHOA 5I28A 1XD1A 1P5VB 1OE1A 3IGAA 4OUUA 4AI7A 3T6QC 3ESNA 4LVEA 3FOLA 1LVEA 5FYJE 3WCYA 4BFBD 3RZCA 3ELQA 3NZ8A 3HG4A 1J10A 1J87A 1MHEA 2YGVA 4MFHA 7CGTA 1I8MA 1Q0XH 1NEZA 3E8VA 1FFOB 2CA4A 2QSVA 2XWBA 3RL1B 4N3TA 4BV1A 2BSTB 5HHXL 4DP1X 4JK0D 4KJPD 1ILSA 3GSWB 1L0XA 3ASWA 5IHBA 4GRLB 1IAKB 2LU5A 3E8UH 5D1QD 5T33H 4U1KA 2XWTB 4MZIA 4PB0L 1RJZB 4MZRA 3ABKB 4XP4L 2Y69B 4YDMA 4PW3A 3GJEB 1WQVT 3N6YA 4WDIB 4XNAA 1GGYA 1OT2A 1G9MC 5INCB 3FF7A 3VGBA 3FONB 3OAYH 4EBQH 2AJXH 4ZYKB 4G5ZH 3RIFF 5ISZB 3LN5A 1ZSDB 3E6HA 2C9QA 5GIRB 2D7OA 3ESPA 5LBSL 4I3RH 3VXME 4NUJA 1OTSC 2XN0A 1SN0A 3MV9A 1F3JA 4N0UB 5CBAA 1IC7L 1A6TB 2DI8A 1O5PA 4MCYA 1H9DA 1VHPA 5KTEH 3O3AB 3NH7H 4DEUA 1VKXA 1M57B 1U3HD 3EDKA 4XBGB 1P7HL 1NEPA 4U3SB 5H35A 1MFEL 4Z78B 5AVTB 4QXUL 5I66A 3EJZD 4NCC2 2HKAA 3L9RB 4AV4A 1IKOP 3X14A 5I23A 5IB4A 3ERXA 4W4OA 3P69A 4MA1B 2F8OA 1UUSA 1UUNA 1AJ7H 2CNYA 4OFPA 3TFKD 5HHOB 2F5BL 5C0BD 3ZGHA 3LN4B 4HUXB 1Q9LA 2JNZA 4BK5A 4KXZH 1KBVA 2ZCKL 3GXDA 3STZB 5EF1A 1RUPH 2CCLA 3CUPA 5D5ME 3VQ1C 3QJOA 1H3XA 4RGNB 2FATH 2FLRT 1IEBA 3TNNA 5DEFB 5B38A 2HG0A 3IDGA 2BMKA 1MJUH 3UTSB 2Q87A 4OLZL 2WQSA 4FXKA 8FABB 1RVFH 3MQIA 1HHHA 1YMMB 1CD1A 4GFXA 3GTVA 4HIIA 2GK0A 5FR3A 1D5MB 4NKOB 5EOQL 1XDTT 3WGUB 5JPNA 5DS8A 4EDXB 5JOFA 1JXJA 5DMGD 3SQBA 2C3HA 2FUQA 5EU6B 3K4ZA 5DHXB 2XYCA 3J7HA 1ZWIB 4O2EB 4JG0H 2AXJA 4RZCB 4Y16D 1NMBH 2D7QA 4ODVL 4Y4HB 2JI1A 4IMLB 2NQDA 5SWSB 5IVZA 2VITA 2A6DA 5JHLH 2JXMA 2WBWB 1U6AH 3KJ6L 4MX7A 5HD8D 4LFHD 1OSPL 3VGEA 3AM8A 3BD5A 5B39A 1QTSA 4HAGA 2YD6A 2WB1A 2AQQA 3OZ9H 1PZAA 4IBVA 3KPMB 3H9SE 1AQKL 4KTEH 3D6GA 3RA7H 3B2VL 3QBTB 4L3EB 1ANUA 1GGUA 2E75C 1X5KA 5DO8A 4R7DA 5ALCH 4ABWA 3OKEA 3DMMB 35C8H 4DW2H 1AQDB 3QYCA 4OQ1A 2EXTA 3LRSB 5JLZA 4RA0C 3T3ME 3HZ3A 4J27A 3MRKB 2MCAA 2PWDA 3KLHC 4NBXB 3L3DB 2B2XH 3AAZA 5IMOB 2WWMC 4KRNA 3UPAA 2NNAB 2E0PA 1Z2KA 1KB5B 1PZ2A 3TESA 4O4YL 5DURB 2OMTB 3P3YA 5F7YC 4L8CA 5GGSY 5ISZD 1XH2A 1KDIA 3E9UA 5AKRA 5L6YL 4OTXH 1S5IH 4IK6A 1XH0A 4DP9X 1T20A 2IDTA 2WXIA 1A4KB 4ODUB 3RTLA 2YLKA 2ZUSA 2XSKA 5LXVA 4FQCL 2YAOA 2XJKA 2RFXB 3FTYA 3K2UL 4KROC 4FLQA 4LGSB 4JO3L 1KOAA 4HDIB 1YEDA 3UFIA 1OKEA 1DUZB 1U8KB 1YG9A 3GJFH 1ZVYA 4F7TA 4EF3A 1KEML 1MWAL 4ETQB 2MCPL 5JPMA 1UD5A 2VMEA 3Q9QA 4Y19A 4RFEA 2H0JA 1SF3A 1IFHH 3MACH 4DO4A 5HHOD 2GIYA 3H2QA 3HVNA 5E9AA 3DV6B 1F4XH 3QR1A 4LOFA 5E9DA 2R8SL 1SBBA 3IMWA 4LL1A 3BP5B 3ATBA 1BP3B 4EN2A 3RTQA 2FH6A 4RGND 3GM8A 1C12B 3HPLA 3V6BR 2ZSWA 3MUGA 5DK3A 2DF3A 2EO9A 4GAJL 4J3OC 3RPIB 4FMKA 3UTSD 3VFTB 5K9QI 1A7NH 4MAZA 3DVFA 4DVBB 3DUSB 2FD6H 5AKTA 2J43A 3PWUA 2F9BT 5LAXA 3DX8B 4IRJD 1H19A 4X6EB 1YMMD 1PKQA 4YHPA 4NZFA 5D7LE 3K2IA 5H2BB 3QUXB 3LQZA 3GNMH 1VESA 3ZX1A 1J1XL 3NACL 1DBKH 3KDMB 4XP6L 5JORA 4X0KA 1FH5H 3UTPE 5EU6D 2BFVL 4AEHH 3IE9A 3QJZA 4AIOA 5KSBF 4IKNA 3UH8A 1JFQH 3VFSA 2WLIA 3B7UX 3GMMA 4PJDF 3FO1B 1CQKA 3MRJB 4YL4A 4Y4HD 3OR6A 4LLDA 1JE6A 2DL2A 5SWSD 1U3JA 3L5XL 2I24N 4P2RE 3HLAB 3CC5B 5IHUH 5IQ7H 4LAQH 1TKWB 1ERNA 3DJ9A 2G2RB 1HX0A 2BSCA 3QWOB 4NJ9L 4JEGB 4EIBA 2NY2B 5BOZG 1BMGA 1FORL 4NDMB 3GMQB 3CZUB 3L4YA 5MP6H 1PY9A 4L3ED 5EEYA 3QIBA 5E7BA 2BSRA 1MJ8H 5IESH 2CK2A 2ZWLT 4QKTA 2OMXA 4C54A 5J12B 3DMMD 4PJEE 1X4ZA 2D9CA 2CRZA 1DQLH 5F3HA 2F19L 5E6IC 1L0YA 2IFFH 4HK0B 2B9BA 3JWNC 4PSRA 2ADJB 2J1WA 1DVSA 4WKZB 1NCWH 4BKLA 3A23A 2I5YL 2M83A 1SJHB 3DSNA 2Y36H 4PY8J 5IBTL 4BFKA 5K1NA 4DZ8A 2I25N 4RAUB 1S7RA 5DURD 1F42A 1MZZA 4FNLH 4ES8A 1R24A 4L4VB 2ZPKL 2VDNH 3GEWB 3QS3A 4KROB 1PFCA 5DI8B 3CX5K 1J1OH 4QYOB 5CJ8A 3IMVA 2WVTA 2VLRA 2HG5A 4FYTA 4L48A 1NIFA 3PDGA 1KGWA 5ABAA 1MXGA 1MPAH 1P7BA 2DQHH 3MR9B 4X8JB 5SX4H 5GS1A 2A4EA 4PJHA 4TQHA 4QNPF 3BZEA 3BD4A 3QPXL 1OM9A 1ETZB 3SDXF 4N85A 4B95C 4LCWA 4GW5B 5H94B 1EHLL 2YRZA 4MHHI 3O4LB 3QORC 1CGUA 3M8OH 1CDIA 3GMRB 3ZHFA 1UURA 3AVEA 3QE5A 5D1QE 5DJZB 3UJJL 1UENA 1FE8H 1UA6L 2FHBA 2V9TA 5L4IA 5B7MA 4KKCC 3CJJA 5FWQA 5MENB 3EDDA 3LEXB 4UINL 2EEDA 1TJHL 3IM1A 1A6AA 2X4QB 1CYWA 4OLVL 1MH5B 1LEKB 5HDWA 1DJZA 4JREC 5JIHA 3DJSA 1YEJL 3E0GA 4TN9A 4GKLA 4K55A 1HE7A 2A6JA 3H7BB 2GW5A 1RUQL 3QNXB 3SZKC 4NHCL 1ITBB 2BVPB 2DLHA 2NDGA 5H37G 3TLRA 3CVHL 2XPGB 4KFZC 5C08A 4ACPA 4AJ0A 4XXCA 2GFBA 2LVCA 1TZAA 5T5FH 2X6UA 3QUXD 4POZC 4ANKA 4NFDA 5GGTL 2KPWA 2CMRL 1DBAH 4WTXA 1BJ1H 3P4OA 5DK0B 5BV7H 5DRNA 1SDDA 2FEEL 4N0CC 4P9HH 3L3IA 4GQRA 2YWZA 2MKWA 5FKPA 1G9EA 2WVUA 4Y2DC 4JPVL 3EYUH 5KAQG 1MWAB 1W0WB 2YPLD 3D0VA 1PFOA 1FFNB 3VD0A 5C0BE 3BQUA 3K0YA 4J3UA 1KN4H 4HPOH 5D1ZI 2NY2D 3ARDA 3QQDB 2L7QA 2A77L 1IAOB 1KBKA 5DEGA 1C16B 1MXDA 2VO5A 1LO3L 3L1GA 3EF7A 3NRFA 1FFTB 4I3SL 5E6IB 1B4RA 4M6NH 3FQTA 1SYVB 2ENSA 3D18B 1D5IH 3KLHD 1QQDA 3CFBB 4GKZA 3PXLA 2XV0A 2WUBL 1LO5B 3QUHA 3PUCA 3CFQA 3HZYB 3P30H 5IP4A 5CP3A 4MB1A 4K5MA 4S1SL 4J8RA 5FECA 2HJLB 3WIHA 3MA7A 4AQAA 3DARA 3GHPA 2WSKA 1KLUB 2FZ3B 4J4PC 1ZGLB 3CSYA 2CJTA 4JL1A 2XVBA 5E95B 2HFEB 1BYOA 2P28B 3NVQA 1LD9B 4JDTL 1L9SA 1MW3A 4OD1H 4L4VD 3Q5OA 3LD8C 4L5FE 1NGYB 1P4LB 2VRAA 4XMXA 4F3FB 4MAYB 4OJFL 4KROD 1DANT 5CNHA 5DMIH 4PRNB 3TWCL 1U8IA 4UOW0 2QGCA 1RJYA 2VB5A 1XGQB 1ZA6A 3T4YB 5K39A 3CDYA 4QIRA 5LO7A 1JGVL 4ZX5A 3S5LB 2QQKH 4Q0XH 5I8CB 5IF0A 3V5KB 2EH7L 3S88L 2E7MA 3AG3B 3L9BA 3LKNA 3S3PA 2CLVA 1XCTA 4XE5B 4DEWA 1NOAA 3V0FA 4AQOA 2BIMA 2VSCA 4AZ8B 2O26U 3O4LD 1M71A 3IJYA 1H3GA 5E5LA 2VZ1A 2X1WL 4E5XG 5DJCA 3C5SB 3ZDXF 4PHZA 3BPCB 2N7AA 5ESAB 3BIBX 3P0GB 1BWWA 3W1ZA 3QJXA 4JREB 5MEND 3MRNA 4GKSB 4JUSA 2CDEB 1BM7A 3L13A 3QFJA 1HH6B 5DJ2B 5E99H 1SJXA 3V4VA 5PAZA 3D4YA 1HXMA 3LRKA 4NEHB 1ACYL 1B90A 3JT2A 3FQ2A 5ISZE 4IBQA 2FBJH 1EGJA 4HS3B 2YIHA 1A4JB 1M7IA 3NSFA 4BUHA 4GY4A 1RSFA 1HH9A 2R69A 2JK5A 3WJMB 1MUJB 4UTBH 4N0UE 1P5UC 4RRPG 2V2XA 4ATTA 3AS0A 3RWJA 4D9QE 3NCYP 2VCOA 3N41B 5KS9A 4JN1H 3GI9L 1MCSA 5HI3C 2L3BA 5AKVA 1J18A 5M94B 3T2NH 2QVTA 4PBWD 4Y2DB 5EN2A 2C9XA 3AABA 3D0AA 5I0DA 3ARPA 1JGDA 3FT2A 3BLPX 3EJRA 4JDVB 1BOGB 2BWDA 4R26H 3OWEA 2NY3B 3VB8A 3PNWB 1M2VA 1U30A 4APXB 2L4OA 2Q0ZX 1I7TA 1L9QA 2MQ3A 4P9ML 3WAKA 32C2A 3FS9A 3V6OA 1GGBL 5HHOE 3RY6A 1DJWA 2HTKC 3LEVH 1EAQA 2E8ZA 4S2SB 3ZKSD 2Z8SA 3A67H 2XWRA 4TV3A 1A6UH 3G9VA 4KOBA 3F58L 4JHAH 5AYTA 2W5PA 4FN0A 3K6DA 4RGNE 1F8TH 3TA3B 4BH8A 2D0FA 1R19A 2DRUA 5E6ID 2QV2A 4XCCH 3UTSE 4G80A 1JPEA 5FPIA 1ZTMA 4HOMA 4JDZA 4A7UA 1HQRB 3ISRA 4LGRB 4CVXA 1YMME 3WFHB 4MJJA 4BDVA 4YHML 5EDSA 3LSOB 4YGAB 2QPEB 3ATAA 1IJ9A 2IH1B 3FF8A 2D4FA 4NLHA 1VACB 4X2UA 3NESA 1UM6L 3K72A 1TJIH 3LD8B 3VRIA 2HX7A 3PGDA 1EEZB 3FCUB 5EU6E 2DIEA 4W6XB 1KPUA 3IK2A 4FADA 1SXBA 3WFEL 4DGIH 1G6VK 2E27H 3BW9B 9PCYA 1M05B 1KT2A 1QATA 2Y4SA 4LSTL 3ZL4H 5SWSE 4HH8A 2VH5L 4MAYD 2VQ1A 4AENA 2YD8A 1N0XL 2OS7A 1X5HA 2IBZX 3F8UB 2R27A 4FG2A 5CR8A 4N0YL 2NT0A 3AQXA 3KYNA 5IR1B 1Z5HA 5GRZA 4PU2A 1WWAX 4I8DA 43CAB 1MEXH 3WFBL 1W8OA 3CMGA 5KOVC 3RAJH 3B56A 1GH7A 3G5XA 3O0RH 4L3EE 4WUKH 1RY7B 2BNRA 1DJIA 2ZZUT 3NEOA 2BSBA 4N2BA 2AK4A 4KKCD 2RALA 3IBEA 2YXWA 3BWUF 3V7MA 4B0MM 2A0LD 5CJOL 3GSQA 3B7RL 3INUL 3VXQB 1ZKAA 5FKAB 3V0JA 5GS3A 1NCIA 1OF2A 5HDQL 1EAOA 3HRPA 4K5NA 5IW1A 2HFTA 5DFVC 3LXUX 3F6LA 2LLNA 5JQ6L 1AGBA 5EOTB 1FL5B 4U1IA 3VCLB 1FSKB 1P5UB 2X1PA 4HWEL 4IMKC 4JFPB 2IVFC 4L0PB 2APWA 4POZD 2HFGL 1UZ6F 2DWXA 3CBKB 3ABZA 1S9XB 1BVOA 4CU6A 3WKMH 2QHRH 5AUMB 1S7SB 4GNKB 2QT6A 4JO1L 4MQ7B 4PI2A 3T0XA 4CW1A 5I1LB 3S34H 3ZYIA 4ZFZB 5HBBA 1FO0L 3GXMA 4YAQB 1MW1A 3K1KC 4A2DA 4E2OA 1G4RA 1V27A 3MRMB 4E5XA 2ARJA 3BEVB 5E2WL 4LPVA 4XGZA 5I30H 4Y9CA 4WSGA 4OIIL 3ES6B 3UADA 1LO0L 1KCUH 4KH9A 4ZTEA 4M5YL 3K6SB 2IH3A 4BGDA 4K8RH 4CA4A 3EFOA 2NY3D 3A47A 4XPAL 3APDA 1UZGA 3RI5F 2O30A 2YD4A 5F96H 4UIMB 5C92A 4AQZA 1OAUL 3S36L 5HGDA 5FHBL 3HB3C 4PMFA 5BZXA 5CP3H 1E42A 4UDUB 4PJ7B 1RLBA 3JV0A 5AVVB 2EDKA 4M7JH 4LNRB 4ZOAA 3WIHH 3OMAB 3TA3D 5EDXA 4R7LA 4RRPA 5D72H 5I8OH 2YMXH 3FRPA 2IDSA 3DGGA 1JN6A 4LMQI 4NM4L 1HL9A 2FB4L 3TNMA 3MNVA 1Q1PA 2JKIS 2P80A 5D8JH 3VU2A 4ALAL 5I17A 1UB5A 3BOVA 5D7SL 4FGMA 3JBG7 3LNHA 3MNWB 1CBJA 1AP2B 1YQVH 3QVAA 1VFBB 1ES0A 3ARGA 4AUYA 1VZHA 4C56B 1ZDSA 1NAKH 2OI9C 1NMCB 3MREA 4F33B 4HPYL 1ACZA 3CZGA 3MGOB 1WITA 4JHZA 1RHHB 4AG4L 1N4XL 2Z0BA 3GWJA 4W9FC 5BO1L 5A6IA 2ZP0T 4AQ1C 2FJGA 1NBYA 1WEJH 2NX5B 3MOBL 4OLXH 4TRPL 4P5KA 1YN6B 5D4JA 2QADC 4G9DB 4XNXL 4RBPH 4D3CL 4WU5B 4IBSA 1A1MB 2JI2A 2K6WA 3HC0A 1N2RB 2BHUA 3V4VH 3LHAA 4GG6F 1MLCA 5D7JD 3TO2B 4G11A 1IGML 4JM0A 4N26A 3KPRB 3FN3A 2ZKHL 1EGJH 1MZYA 1WFJA 3LNDA 3PJSB 3NBNA 5I0VA 4R7XA 2R69H 2D3NA 1FYTA 1SEBB 2ICEA 3V7AE 5KAQF 4K2UL 2P8MB 3O9WA 4U1MA 3O41B 1UB6A 1LE9B 3EBIA 4HV8B 1E9PA 5K1VA 1P1VA 3FFDA 1KCLA 3UYOD 4F7MB 3ZR6A 2X6AA 4M1GH 1JWUB 1YQ2A 3KYOB 3KGTA 2YEQA 3Q8AA 5EUOB 3V9CA 4WI7A 3L9YA 3FOMA 3PQYA 1OTTC 4L4VE 4Y1TA 2QV4A 4ZUVA 2AJZA 2BNQA 3LS5H 2VLJA 4GAYA 4ZUWA 1YEGL 2NW3A 4I4WB 4XVJH 3BVNB 3EFDL 3QUYB 4LP5A 5LBVA 3EH3B 3ULVC 1X7TA 4G82A 4Y5VA 1LYQA 5KZCB 3OM3B 5ILTH 2QKIC 2BVEA 1KPRB 4G5AA 1FVEA 2QLYA 1FL3B 3TOPA 3BMVA 2IFGA 4NSKB 4UU9B 1MQKH 2P8PA 2NSMA 4ZMYA 5TPWL 4KO6A 4NI6A 4YE4H 5IK3A 2AABL 2HTKD 4WFHD 3QPQC 2GT9B 5CLZA 4A7VA 3VFPA 3O4LE 4JFSA 3NFSH 5DD3H 5C3LD 3BH9A 2WNWA 4MQXC 3L2LA 4RGMC 3CD4A 1B0WA 4HJGA 4HJJH 1GCYA 4U6XA 3EJQA 4N5EC 4PS4L 4NFBA 1A8JH 1MWOA 5MENE 3I3BA 4XAWL 4L9LC 4OY9A 4HXAH 3EHBC 3S8FB 1ZEAL 4IDLA 1OQXA 2WJ7A 2Z35A 1HXKA 4IW4C 4QI3A 2R4SL 2B15A 4IOIB 4UT6L 2P24A 2MWCA 2BRRH 3LS4H 3PHQA 5FYKU 3GUTA 4O2FA 1CFQB 1QSFB 1HYSC 4P5TA 3DSFH 2Y3NA 2AJUH 2L04A 4NQVA 4X7TA 4TUUA 1RUML 3HHSA 3RGVA 4OM1L 2OI9B 2G9HA 3MRHB 4JY4A 4BFRA 3V0HA 3QJRB 4J7RA 1K8IB 3BD3A 1CTMA 3O6ML 3FB7A 4R83A 5E8PA 3BUQA 2O5XL 4C56D 5C1MB 4ZTPL 4YHNB 3MODL 4Z77B 4R4BB 5A16A 1HINL 1FO0B 3MCKB 5MI0C 2QADB 1DJYA 1YYML 1KTRL 5EA0L 2WTRB 5E56A 5AOMA 4UOJA 5GS0H 2F7QA 2NX5D 1UM4L 1VCBC 2RQEA 3BYYA 3UGXA 5T1LA 1QBLH 1V8HA 2OTPA 1BVLB 2DD8L 2XFGB 3I6KB 5TTRA 2V7HA 4CKVX 5E5UB 3WEBA 5JHDB 3BIKB 4Y4FD 4KMTL 1OAQL 4YMPA 3CSPA 5KJ7E 3OF6A 3IDYC 5E0QA 2BVTA 3D85A 4YDKL 3AJ7A 3JWNE 1KJ3H 1AFVL 4NO3A 5DVNA 4YH6A 4U7KA 2D2CC 1WLHA 4JO5A 2J2ZA 3FQ4A 3KM2A 2QGBA 3KPRD 4OVUA 3LKOB 4DKDC 4GO8A 5GRYA 2F68X 1JV2B 5KVDH 3X11B 5K9JH 1P53A 3GLEA 3U4KA 4UOZA 2I07B 1Q90A 2R83A 4XTRC 2PW1B 2CO4A 2Y2YA 3AWGA 4W9ZA 5D7EA 2Z92B 2QVKA 5IVXF 4EE2A 3LCYA 5JMRA 2Q8AH 2BWQA 4UYQA 4WW2C 2G3ZA 4G8EA 1HKLL 1WZMA 4WV1C 2JJSC 3SPJA 1MAML 5CCGE 4H20H 3A6OA 4ENEC 3EZJB 4S1RL 4HQQH 4X9GA 5JIPA 5C0RH 5GGVH 1UEYA 2QKIB 3W2DL 4PGJA 3I6GB 4EAEA 1J5CA 4TQEH 3UAFA 1G4MA 3OXRB 3QUYD 4S0HA 1MG3C 3QZWA 1I8LC 2HKHH 1ZANL 3LEYL 1FA4A 2Z31B 2LLLA 5KZCD 3HMWH 5DEJA 3NDYE 4XB8A 2DLGA 4RGMB 2J25A 4E9WA 3DYMA 1F58H 3O3EB 4G8IA 5DJ8B 3DUHA 3WXVH 1OEZW 4BQ9A 1A1OB 5I5JA 4DGYH 2YOCA 4L9LB 4WTWA 1XB6A 4CUCA 4HVBA 1I7UB 2WINB 5I71C 1PMYA 1MCDA 1BZQK 3W0WD 3OKMA 2B1AL 3CN1A 4LRNH 4HUVA 4RDBA 1B0GB 3P9LB 4G8FA 5EO1A 4HS8H 5EO9A 2BP8B 2XZAH 3MLTB 4I2XA 4Z95H 5J6GA 1TTFA 3GBLA 4RWYL 3V79C 2IWGA 1MCOL 1QABA 2MOVA 2YRLA 4LCYB 4B97A 2OMUA 3Q5TA 4CBZA 1XCXA 4LRIC 3GSOB 1TU2A 3L3OC 1SM3H 5CGBA 4GRMB 2C1OA 1FAIL 2IAMB 3LXBA 1B6UA 1QSFD 1ZLSL 2YN5A 4O02A 1ZLUH 1USQA 5DUMH 3FUEA 2ZX6A 4XNQB 4NZ8A 1TO5A 3E8UL 4MA7H 5T33L 2QMKA 1F56A 1KC5H 5MI0B 4UNUA 1E0OB 3CPUA 1F86A 4R97B 1HI6B 2CG9X 2ZX8A 4Z3JA 5K59F 1U8NA 1FNEB 5T5NF 2ADYA 1IAIL 3GXTA 1WAPA 2B77A 1JNHA 1DVUA 2FHFA 4MD0A 4G5ZL 1BQRA 3B83A 2QADD 2NQCA 3OG6B 5KBLA 4I3RL 3MBXH 3IDYB 3FXIC 4PJAB 1K85A 1ZVNA 2VABB 5EO0A 2YC1B 3SPCA 3BZFB 5KTEL 3NH7L 2EDFA 3RG1C 3CFMA 1PDKA 4NHUB 3DX4A 2GAZB 1A3LH 5FF6B 2EDJA 1USZA 1Z5LB 3LXCA 4WJ5B 3DDFA 1U8MA 5J4MA 5T1KB 3I02B 4LVOC 4IU3B 1XSIA 3BUDA 1SZNA 3WIFA 1IX2A 3ZN6A 5M7QA 4WV1B 2P5EA 5KSUB 1AJ7L 5TE4H 3VE0A 5JXEA 1GYCA 4JLRB 3SDDC 1OTTD 2O5NA 1R4XA 3JV4A 4MASA 5ADPH 1M7DA 4ZPTB 1S6NA 2QQNH 2VO8A 2E6QA 4JPSA 3V52H 3Q05A 1DJHA 3MNDA 1TTCA 4HWZA 5F9OH 3HBGA 4PRAA 2DL9A 4WWOA 4L4TB 2J8HA 1HSBA 5E1GA 4X0NA 3ULVD 1WZAA 2ADIB 2X3BA 3KPNB 1MJUL 1GZPB 3SCMC 5T1JA 1CLCA 3L45A 5EZLB 5BJTB 3L7EA 3KCPA 1QEXA 1T1YA 4ABUA 5T3ZD 4KDVA 2JKLA 4FQLH 1CGSH 1WAEA 1MRFL 4ZXBC 4YDVA 3RNQA 1UH2A 1YUHB 2Y7MA 2Z31D 1J8RA 1Q1JH 3EFFA 1TCMA 2XRAH 2QPUA 2VDKH 2ATKA 2XPYA 3QUML 5ESVB 5I71B 4MQXD 5F71A 3S8GB 3JVFC 1TR7A 2Y1VA 2OTUB 1ZT4A 2PP9A 3HTLX 1MFVA 1OZTG 2BOCA 4QLWA 5DVPA 1QRNB 2X40A 5J0BA 5A2FA 1SMAA 1JBJA 2LFEA 4HZLA 3W3BA 5BS0B 3VFOA 2I26N 1WZ1L 3HNSH 5AVWB 5BMFH 3FBQA 2BY3A 3L3OB 2HTLD 1MVFA 1T5XA 3TCLA 3HCVA 5J1SC 2EIZB 4PJ8C 3JUZA 4NPJA 1E28B 4G2AA 3ZRFC 2UX7A 3OLEA 4JZNA 4KTEL 3RA7L 1WIUA 1K6QH 3KNBB 1U8OB 2PYED 5EBMA 5JIIA 3QJTB 1CLOH 5ALCL 1JK8A 2IAMD 3QR2A 2BY2A 3TBYA 5DA0B 1DLHB 2E4TA 5I6LA 3T6WA 1C9SA 2NUPB 5F7WC 1DQJA 1A02N 4HGKC 1UXMA 5I9QB 4HUNB 2B2XL 3CFJA 4GLRH 4NZJA 3EG9B 1A7RH 3L1FA 3QWRA 4UQBA 1VERA 3QC6X 1RZJH 2UZIH 4WFHE 3U36B 1MFDH 2IMMA 4WI9A 4F1ZA 4ZFGH 3CFTA 3P4NB 3JTTB 3MRBB 3DO7B 2DMBA 1LL1A 4MLSA 4L1SA 5C0EA 2VDRL 1EZVX 4G42A 4TNWK 4XHJC 4JNXA 1S5IL 4K4KA 5GGRA 1VFAB 1TTGA 2XA3A 3WJJC 2A4CA 4PJ7E 4UV7H 3KH4A 3MBED 3FTSA 1XF3B 5I76A 1R5IA 3O3UN 2BP0B 3WMQA 3QI9A 3SYOA 3ABGA 1ROCA 1JERA 2EKSB 4XTRD 3SDDB 3J8F7 5T1KD 1SDAB 2XJLA 4PJIA 4F5CA 3E9TA 4JR9H 2RQ8A 4QGYA 5IVNA 3HNVH 3WD5H 1L6XA 4MWFB 1AKJB 1IFHL 4ORGA 3PG2A 4NZRL 3F05A 4ENED 3SCMB 1F4XL 4UZUA 2ERJB 1RXLA 4PTUB 4C56E 4L4TD 3FFCA 4PCKA 3FQWB 4FNSA 4ZXBB 2E9WA 3LKQB 2PWHA 1AD0A 1A7NL 2NX5E 2IPTH 5E1HB 4ODXB 3TZVA 3TIEA 4KQ4H 4F7KA 4S0SD 1G6RA 1DVXA 4PVNA 5LDUA 4MAUH 3B2UC 3GNML 5IV2B 2PF6A 3EKCA 1DBKL 4NERA 4MMYA 3VD2A 4PLKC 1I8IA 4YZFE 4B50A 1FH5L 4P99A 1FNLA 2UVEA 5LWYL 1HEJC 2VL5A 2CHDA 3CXHJ 3PHSA 1XTMA 1JFQL 3KPRE 2R51A 2ADGA 1QFOA 4QXTA 1BJMA 1CT8A 4J39A 4PJ8B 1QRND 3C60A 3ZE2B 3WN5B 2GSIB 1ODUA 4LHJB 4O02H 3VFWA 5IHUL 5IQ7L 5BS0D 2CIIA 2XXCB 5L9DH 2EADA 4Y9FA 3T5WA 5HGBA 5EUOE 4HU8A 3WHE1 3ZZSA 4CU7A 4RAVB 4E36A 5J9PA 2BZ7A 1U8JB 4FQ2H 5MP6L 5I6OA 2WXQA 5DCCA 5CGYC 5TFSH 3C6EA 1DEDA 4FEIA 1MJ8L 5IESL 4OI7A 3HUJF 2GCYA 3EUDA 2CALA 2WXNA 3NYKA 1DVFA 5EFIA 1R3JA 5BNXD 4MZ3A 1G84A 3HG1B 2HX9A 1R3IH 1T0PB 5DO2C 1NCWL 2C1PA 4F27A 5FS5A 1WA1X 1UA7A 2VJ8A 3VTMA 4KRPC 1T04B 5I2IA 1DFXA 2YAPA 2HJKA 2VXQA 1DN0A 4YFDB 5F89B 4FNLL 2OCJA 4TULL 3VRJA 5BVPH 2EIJB 2XX1A 2VDNL 3IFOB 4R96A 5E5MA 1J1OL 1DBBL 4Y5XA 4XBMA 4DO5A 5IHHA 4HW6A 3HI5L 5E9NA 4EI5B 1K9TA 4BRJA 5DHMC 1MPAL 1WFIA 4AJVA 4CL7A 4DP6X 1T22A 3RZCC 2TAAA 4XCNB 1Z32X 3VI3E 1THAA 2WCSA 3PV6A 4I18A 4YLQT 5C8JB 2IXQA 3A3YB 1QSFE 3SDDD 12E8H 1LEIA 5KVFE 1JZHA 1XF1A 3UP1A 1CFSA 3C75A 3M8OL 5C9JA 4LLMB 1J9SA 1E4WH 4ABQA 4PLOB 5D2NA 5C0CB 1GY1A 2BCKB 1AKJD 2HFFB 1WG3A 1FE8L 3T6XA 2QR0B 1J9QA 3L3GB 2VE6A 4ELMA 5KSAA 4FXLA 2IALA 3NFNB 3SCMD 1NGQL 4ONHB 4GRWB 5HHPB 3V4LA 4TTGA 3WNIA 1H6EA 3LKPB 4U6YB 1VPOL 1YEEL 3QXDA 4WI0B 3KXFB 4KXDA 4ZXBD 3LDBC 3VRLF 4QHLB 2R0LH 1YMHA 3IDUA 3NZSA 2PTTB 3BRFA 5F1NB 3SO3B 4FA7B 3B9KA 4QHNB 3DC0A 3QQ4A 2VDRB 3Q2NA 3I74A 5JHDE 1IIKA 2JELH 5ID1A 4NNXB 5JXAH 4M93C 3RU8L 4QXWA 3FQXA 4LP4A 2YQGA 5GJTL 1X5JA 5DTFA 3K2MC 1G9HA 1NKRA 3AGWA 3BDYL 3L5WA 3H9ZA 3T08A 4GXUM 4UIKL 1IL1B 2AVGA 4Y2LA 1B2YA 3C09C 3OSKA 4P9HL 5CMAB 2PXYA 3BVWA 4X98A 4PJ8D 1CS6A 3E38A 4MCZA 2CHNA 4PH8A 2M1KA 3GJFB 4NKIH 1ONQA 3WHXB 1SJMA 2UXFA 1BZ9A 1KN4L 4HMDA 4HPOL 5CWSB 3TN0A 4ZUTA 4BK5C 3H2PA 4M48L 1ETJA 2P44B 4LZKA 4YBHA 4Y2OA 2B20A 3ULVE 3LN9A 4BRVA 1SPDA 4M6NL 3A22A 4FXKC 1S9YA 1ACXA 3L3JA 4LPUA 3LXAA 1GJUA 2BSSA 5ACLA 5T3ZE 2L7UA 5EC2B 3AUVA 1KPVA 2FYYA 1S2EA 1NL0H 3RL2B 3P30L 2A6IA 2I32A 4HIPA 4XCEA 3ROOB 4ENZA 5LKNA 1KCWA 5JPNC 4J2XA 4OZ4A 4JY5H 4YSCA 1J9CT 2C3GA 1IT9H 4XPTH 4XHJD 4U4IA 4F8TA 3UO1L 1GKEA 1ZPLA 1YNTB 4L3AA 2NSXA 3FL7A 2LE9A 1FL6A 4YSDA 4G70B 4IHOB 2UUDK 3OAZK 2PYFA 3CQQA 4OUUB 1E6JL 2OKMA 2I60H 2HLEB 5DVOA 2D3VA 2ZT9C 2ZWYA 3FOLB 3RZCB 3NZ8B 1HEZA 1RPUA 1MHEB 1I8MB 3MVSA 1NEZB 1MOEA 1ZS2A 4IOSD 4EI5D 5B3JF 3OB0K 1FHGA 1UKTA 1DHKA 1LP9A 1M4KA 2QQKL 4Q0XL 4E9SA 2H3NA 1OARH 2YKLH 4P9HC 4U1KB 3BAIA 1E4KA 4PWKA 1OLZA 1FNAA 5DHVA 3WXWH 3B2MA 4KTGA 1KXVA 1SXZA 3TH4T 3BWSA 1SMDA 4IDJH 4CVWA 4AL8L 5C0CD 5FA4B 1Z1WA 3ZK0A 3LN5B 3E6HB 1ZGLM 2V9QA 1S8DA 3LDBB 1J5IA 2GIXA 3S7GA 4JFEA 1FNHA 4NUJB 3LKSA 4LLYA 3MV9B 2N0KA 4QJ5B 1F3JB 5F0PB 3G5WA 5J6SA 5CBAB 4AYID 4WGKA 1R34A 5SWQA 3JWOL 5BUAA 1F90H 2FAUA 2YSTA 4MCYB 3M1OA 4NGHH 1RMFL 3OZKA 4U1JA 2FBJL 3B2UD 1VKXB 3UYRH 2RGSA 2XVGA 4M93B 4M1DH 1BPLB 2KQNA 2WLHA 3ILQC 4PJAE 5HPMB 4PLKD 5H35B 1GRWA 1VJSA 3HE6A 5C0JA 1PS3A 4ELKA 5I66B 3A6BH 3S0PA 2VDNB 3MJ6A 2NDFA 3B8SA 3X14B 1UXWA 2Z91A 4PJFA 3NIDF 4JN1L 5IB4B 4L0YA 3AZUA 5A6LA 1HDMA 5I8EA 3T2NL 2AGJH 1BJ1J 4XZ4A 1XMWA 3U25A 4KQ0A 4R26L 1Q9LB 2P45B 1GMIA 3CFNA 3CUPB 4BHUI 5F3BA 2HKFH 1AOHA 2NY4C 1IEBB 1S3RA 2BSED 3BT2H 4W6WB 3TNNB 1KENL 2EEFA 5B38B 4RQQA 2OX5A 2RR3A 4P4KA 2P7TA 4FXKB 4K7PH 3VW3H 1E5BA 1P6WA 5I8KH 2BIIA 4FAAB 1FZJA 5F7HA 4WRLA 1FFQA 5AW1B 1F8TL 1HHHB 3SGKA 4OZHA 4L4TE 1CD1B 3ULUL 4ZO9A 2P43B 4JFXA 1A2YA 3VFRA 4HIIB 2GK0B 4XCCL 5BCAA 5JPNB 3OAYK 4M3KB 4OB5L 5DS8B 1QBMH 3N04A 4DPBX 5JOFB 1XVSA 4G8GA 5DO2D 4AL8C 1F4WH 3SQBB 3IPBA 4OCLC 3TEWA 4ZMNA 1HAWA 4XXDA 1CIDA 3QEQA 3NABL 1SFDA 2IV9A 3ZL1A 1F4YH 5IVZB 2VITB 2A6DB 1K8DA 4Z0XA 4KO5A 2JXMB 4MX7B 1IC1A 2CBTA 4DGIL 1WD9A 2YA0A 3JSSA 5FGBA 2OR8A 5B39B 1QRNE 2P8LA 3WMPA 3ZL4L 5K5YA 2WXGA 4P5MA 2DWTA 2G5UA 5BV7B 2OV0A 3RZCD 5BS0E 5GHWL 5TDPA 3SQOH 2NXYC 1CE1H 4U4BA 4R7DB 1C5DA 3VFGH 5JQHC 3C08L 3FU9A 3OKEB 3ZZ1A 1MEXL 5EOCH 4GSXA 1FZOA 3RAJL 4UILH 5DZNA 3O0RL 4WUKL 2GJ6A 3V8OA 4AW7A 3QIBC 2RIKA 4FRWA 5G2NA 3VSQA 3AXIA 4LQFH 4AYDC 2KT6A 2JKXA 2EQDA 4H8UA 4OF8A 3OJ2C 2G3XA 3HE7A 1O7VA 4OZGA 1QZNA 5IQ9B 3OKKA 2H7WA 4KZCA 2APXA 1CL7I 1WBYA 1RZGA 4L8CB 1NGZA 3MCYA 4ZQTA 3ULUC 2O6PA 3HS9A 1FV1A 1VRSA 2UXVA 1T20B 1OXYA 3MV9D 4ZS6C 5I18H 3CXHK 1TZ8A 5GGVY 4L0ZA 1RKRA 1CVRA 1P84K 5JHMA 2WTOA 4PRHA 4RCAA 1SBSH 3DVNA 4R7VA 1AO7A 4J12A 1YEDB 5C70A 2I7OA 3ZY7A 3WKML 2ROXA 2J57A 4F7TB 1GMEA 2MKLC 5FB8A 5JPMB 3CN3A 4Y19B 4M6MH 3VWKA 5A2IH 3QCTL 1ZV5A 1AE6H 2CRIA 3MLXL 4RFEB 4W9LC 3EH1A 5IMLA 2CUMA 5I30L 2NY4B 5HTSA 2Y1AA 3ZQ9A 3O2DA 5I24A 5E4OA 2PN5A 5E9DB 5HP5A 5J7CC 3MLYH 1ET8A 3QUKA 4O00A 3ARYA 3RTQB 4JS7A 3HPLB 3U6XA 2C7FA 4ZG1A 3MUGB 4ZI8A 2H1PH 1YC8A 2GSGA 1TFPA 3S2AA 3BX7C 4FX5A 3WIHL 4P0DA 2WMPA 4B9IA 3PWUB 5I73C 5LAXB 4GKOA 1PKQB 4YHPB 5D72L 5I8OL 3KL3A 4C55A 2HP4A 3CXFA 3LQZB 4HIXL 1NMAL 5JORB 5D8JL 4X0KB 1YDPA 4XXCC 1T89C 3X12A 3VFSB 5ICXA 2WLIB 3GMMB 4WY7H 1IFRA 4YDLC 1Q9OA 2CO6A 3OR6B 3D1MC 4LLDB 4WLCA 4M7KH 5FX3A 1NAKL 3T6VA 4F57L 2G75A 2NXYB 1PSKH 1Q38A 3GJFK 1DEEA 1T21A 1DR9A 1MFBL 3IJEA 3ZE2E 5ITBH 1O9VA 2XQ0A 3WDJA 2V3EA 3KVQA 4OLXL 4EIUA 2C4XA 1JZFA 1JPTH 3BQUC 3QIBB 2BSRB 3NJIA 1E40A 3QDJA 3F7VA 4FCHA 3ARDC 4GS7C 2OMXB 1NCTA 4ICXA 4KJQC 3SN6N 5KVGL 5F3HB 4UDTA 1ZDQA 5DEZA 2FQGA 2PUQT 1OWRM 1IKNC 3V4VL 1NWOA 4PV8A 4BQ6A 3AC0A 3F7RA 3VGHA 3LNFA 5I1GH 2VWEC 5DD0H 5KYNA 1PJWA 1U8CA 1SLVA 3BH4A 5F9AC 4BKLB 4NZUH 4W9DC 2FQDA 2R69L 3DSNB 3EO1A 2B7DT 4I77L 3HG1E 5DHDA 3TEUA 4DZ8B 1S7RB 1KYFA 2DQDH 3U7YH 1R24B 2RMNA 5HVHB 4IGBA 1UJ3A 4M1GL 4HEPA 1TNMA 3FQNA 3G5ZA 2VLRB 3ILQD 2HG5B 3MRPA 4LEEA 1CFVH 5IFAH 5JHBA 1F1GA 1ZHBB 3B1TA 3LS5L 4GI8A 5D5MF 5GS1B 4D2NA 4P49A 4PJHB 4XVJL 3WTVA 3TH3T 2A9ML 4KX9A 3BZEB 5KYUA 5CIPH 5FCSH 3SPVA 4LSRH 4CN4A 1BBJA 2Z6FA 4LCWB 4CAGA 5E08H 1BDYA 3AS3A 1JGLH 1BIIA 3ZXAC 4UV4L 1PD6A 3RBSA 3IRZA 1IGIH 4X80L 3FYEB 1MQKL 5DMKA 3HI6H 2NY4D 1UADC 1SGKA 3R4RA 1UVQA 1HSAA 2JTYA 1Y6KR 3NFSL 4PM1A 5DD3L 2E5EA 1S7QA 3RTQD 3RX5A 5C0CE 1A6AB 1TJGH 1ZCRA 3FQUA 3NFPA 4HJJL 4HJSA 2X0VA 1INQA 4M29A 4GRWE 1FNFA 2A6JB 4HXAL 3T8XA 4XMPH 3CPLA 3SODB 2EE3A 5C08B 4NNPH 2BS71 2JB6A 1RIVH 2YQ3A 2GFBB 3O0LA 2EYRA 3A4AA 4NO0A 2EVHA 2QSCH 4G7YH 2DYPA 1PQZA 1DQIA 2BRRL 3LS4L 1CI3M 1XGPA 2TRHA 3ZT6A 3P4OB 3T71A 5B1BB 5DRNB 3U4AA 5FLUA 4F8LA 3V2AR 1SDDB 1IEAA 3RB7A 5FW8A 3K6OA 3QZPA 3L3IB 3N1MC 3FTXA 1NH6A 3T0EA 1SFHA 4LMQE 2X41A 3FU5A 5L2KA 1QTPA 3BCDA 4K23L 2YBGA 4CC1A 3D0VB 3BJLA 4GQZA 2W80C 2NXYD 1R3HA 3BQUB 5EU5A 1YN7A 2JCCA 3RPBA 4FG6C 4PHXA 1LXMA 1QHPA 3ARDB 4GS7B 3ZZLA 5GS0L 5DEGB 1PAZA 1Q9WA 3RY6C 2OSYA 4FLOA 5CLYA 3FQTB 3CN0A 3QIBD 1UACL 3ENEA 1QQDB 5L8KB 4GKZB 1YRKA 1TPXC 2R1YA 2OSWA 1F1AA 1NCBL 4Z7WF 2X70A 5I6KA 1ASPA 3JYBA 4CMMA 1YY9C 3LQMA 3SE3A 1KJ3L 1U33A 2LU7A 4J8RB 5FECB 4PJXA 5ANMA 3MA7B 3VO0A 2VR5A 4AQAB 5KVDL 1GPOH 2A6KA 3C8HA 3CSYB 1D2PA 5SWZA 3DIDA 3FNKA 3TS8A 1GXEA 1WIOA 1WA0X 1J0KA 1H0DA 3GHBL 1WICA 1DUYA 4RESB 4UCFA 2GBAA 4S1DC 1DTUA 4LCVA 2Q8AL 4NAMA 1F3DH 5A7EA 2BXYA 2JKSA 4M4PA 3CXDH 1U8IB 4XVUC 2JFCA 2VLRD 2WXHA 5DFTA 1RJYB 1ZA6B 2Q3ZA 4H20L 5K39B 4AEIH 4LSSH 4ZMOA 3VYNA 3O2DH 5C0RL 2B16A 2A9AA 3LKNB 3GHEH 5CZVL 4RIRA 3ZTEA 2CLVB 1XCTB 2YEZA 1Q0YH 3HEIB 4TQEL 5C7ZA 4WW1A 5JW4N 3EBGA 5CILH 3ATEA 3N1GC 2Y2TA 2H2SD 4PJ6A 1JRHL 3SDAA 4JB9H 5FO2A 1N8ZA 1YNKH 3HMWL 1U8QA 3CIQA 3IJYB 1KIRA 4HJUA 5AZUA 1FVDB 1YNLH 2OPCA 5I1AA 4HJ1A 5DJCB 1IV8A 4BSVA 1F58L 4J1UA 5GJSH 2J1YA 5J1TC 1BXUA 3BAEL 5IMKA 2ICWA 5GS0C 3WXVL 4DGYL 3MRNB 3QFJB 2J21A 2KLSA 2Y3AA 3UXFA 4FHBD 4ATWA 3V4VB 2YGPA 4OJYA 4DPCX 1KEGH 1DLFH 1HXMB 3Q43A 2YK1H 3Q8BA 4LRNL 4ADJA 4WFGD 3QCUH 1RPQA 2XZAL 3BZ5A 1M7IB 1KLGA 4LSVH 5CU5A 5E6UB 1HH9B 5AALA 4DN4L 2JK5B 4J2QA 3R8BB 3MV9E 3O6KL 5C08D 1T4KA 3EOAB 5C0GA 2V2XB 1P2CA 2EDDA 4X5LA 3F7YA 3RWJB 3WTXA 1SM3L 1XZWA 1OWWA 4DKFH 3E80A 5KS9B 3IGLA 3PXHA 5J1AA 5J56B 1CDBA 2ZXWB 1URIA 5EN2B 2H4EA 2Q20A 3OBAA 1TENA 5DUML 1JGDB 1CUOA 3FT2B 4MA7L 4HZAA 4QO1A 2IOMA 4TPRH 1LNUA 4DO6A 5I5RA 5TK2A 2O4EA 4PJEF 1M2VB 5KANI 1ZAGA 1KC5L 1LDPH 2DKUA 1I7TB 1L9NA 4X6CA 3R7RA 3RUGA 4HS6A 32C2B 4YHIA 3ZE0B 5HYQA 3UIZA 2WLJA 5E2JA 1BECA 5A43C 3ALPA 3BQUD 4OBRA 5C7XH 2JKJA 1LWHA 3H2WA 3ARDD 1HKFA 1TPXB 2W38A 4BH8B 5HDLA 1FHNA 3MBXL 4JHUA 5I82A 4TVPH 3NDZE 1DQMH 1NCNA 1PCXA 3LNEA 3MJGX 4OCXL 4G80B 4K8RD 4ZFQA 4KKAC 4JDZB 4X8XA 4CVXB 2TSBA 3ORJA 3WG7B 4BDVB 5AD0A 1EJ8A 5FGRA 4QOKA 3SGJA 2VAJA 5GS2H 1T0OA 2PCYA 1H6TA 3K72B 3VRIB 1VFMA 4TUKH 3PGDB 2DMCA 5EIIG 5F1SA 3CVBA 2CA3A 1KPUB 4HWBA 3T3PB 5IHZB 5TE4L 5IY5B 1KT2B 1RZKH 3QB7C 4P05A 3QQNA 1A14H 3SDCA 1ZE3H 2QQNL 2VQ1B 2V3FA 1OY3B 3ARGC 3MV7A 4GAGH 4AENB 1NUGA 5IZ7A 5IREA 4AYFA 2HMID 3K3QA 4O5LL 4WK4B 5F9OL 4IEFA 3KYNB 4ZZKA 4XMTA 3KBPA 4MMXA 3SKNA 3QJSB 4GUOA 2EVGA 4GO6B 2ZICA 4B9FA 2DTMH 4QRPA 4FFYA 1SLWA 4WFFD 4WFED 3G5XB 1WUNT 2B5IC 4UB0H 3UACA 5FYLH 1CGSL 2P5WA 2ZOLA 3C8KA 2PCPA 4N9OB 4OKDA 4QNPE 2AK4B 1Q1JL 2B3RA 1N18A 2VDKL 3GK8H 4ZJ9A 2GBUA 3FW6A 5EMYA 3UDWA 5IFHL 1N10A 3GSQB 2ED7A 4Q4IA 1EQWA 4OLYH 3RFRA 1OF2B 3LIZH 3IKKA 4PRDA 1COBA 4MCNA 5IW1B 3EYOA 3QFJD 4P3WA 4BFGA 2MTPA 1AGEA 2J5WA 3ARTA 3V9EA 1AGBB 2ICEC 1P4IL 3O9WC 3BPOB 4U1IB 2EC8A 3VI4A 1AZUA 4E0RA 2AQ3A 2OXHA 4PB9H 1I3VA 4BZ1L 3GXIA 3FT9A 1K6QL 1X7QA 3PJNA 4CW1B 3CFDA 1XF2A 1I4FA 1E50A 2UWEA 5JW4M 4E5XB 2ARJB 4AYGA 4XGZB 1P6AB 4W9CC 2A38A 3VWJD 2AHIA 3KWWA 1WHPA 4Y19E 1GCFA 1H9VA 4NPYB 2IH3B 5BRPA 4AXWA 3SYCA 2WZ6A 3EFOB 4IYKA 1NSNL 2IBGA 1BD2A 1UCBH 1CICA 4YBQC 3L4UA 1A7RL 1JPST 2X38A 3QGVA 2ZXEB 3C5JA 5HGDB 5FHAH 2Z1KA 1MFDL 4EZKA 4ZFGL 3M86A 5E9DE 4G6MH 1WE5A 2YO3A 3PXJA 5BRQA 1A8ZA 4X8CA 4OF0A 4PBVC 3EF4A 3IFPA 4RGOH 2C9AA 3QW9A 3IDMA 4JHBA 4JFZH 3FRPB 3DGGB 1FLTX 1JN6B 1F4HA 3D05A 4FQ1H 1YY9D 1UOWA 4XMZA 3TNMB 3MNVB 4KI5C 4G9FA 2BVUA 1UB5B 4ZUUA 1PKQE 2VW4A 4J3OG 1KGCD 4JANA 1T5KA 2YFNA 1OM3L 3WL9A 4HETA 4CJ0A 1ES0B 3ARGB 3RGVC 4JR9L 1WWWX 3U1QA 4W9HC 1JZ5A 3MREB 4XVUD 3HNVL 3WD5L 1KBGH 2NMSA 5IQNA 3QPKA 3ZSSA 2FJGB 3FB5A 1NBYB 3LZNA 2GC4C 3EDFA 1FBIL 2IAAC 4P5KB 1J1PH 4IU2B 4JKPL 4FZEH 4DGVL 4JFYA 3PWVA 3NPSC 1B2WH 2WP3T 1BZDA 5E6RB 2IPTL 3HC0B 1XZ0A 4TNVF 4P59H 2QVFB 2OW7A 2X4UA 2C7UA 1IGTA 4KHXH 5C6WH 5IMMA 4KQ4L 4L18A 1XR9A 2XKNA 4GMSL 1MLCB 3QG6A 3NIFB 4UT9A 4HU2A 2D0GA 3BISA 2CBPA 3K1DA 3QDMA 1OZUA 3AWEA 4MAUL 4XNZB 4B9ZA 5GS0D 3QCVH 1VEOA 2FWSA 4K9JA 1FYTB 3M07A 4QXGH 2ICEB 1E5ZA 4LLAA 1CXFA 4OFKA 3O9WB 4U1MB 3NCCB 1MI5A 1UB6B 4H44C 4FFZA 4L5FH 1E9PB 3FFDB 5AW8B 5J06A 5AVYB 2WBJA 4OFQA 1QR1A 4HJIA 3JWNG 5LBSA 3P77A 3DX1A 4O02L 1HOEA 1RUKH 3FOMB 1QHQA 3PQYB 5LGHH 1T6VN 4ZUVB 2AJZB 2BNQB 5L9DL 3IJSA 5GISH 1EAJA 4PP1D 4GAYB 4N86A 2NW3B 3KW8A 4NOFA 4ZUWB 3VXUA 4XOCA 1CGXA 1V7NL 1XB3A 2VLRE 2MNWA 4NAQA 2XQBL 2FX8L 4FQ2L 1NCOA 3AWFA 5TFSL 4Y5VB 1IAIM 1RIUH 3GSNA 3U2SB 1FVEB 5A2BA 4PJHE 3IJ9A 3KWXA 4NBZB 3V5DA 1MCCA 3DX9A 4LB8A 4WI2A 2IEPA 3F2LA 4GQQA 2P8PB 5TDNA 3I9GH 2GBVA 5IB5A 4LCWE 5IK3B 3MAWA 1OTUD 2GITA 5AVRB 1EBPA 3VFPB 2CO7A 1R3IL 2EIEA 2ZCHH 4LK4A 5LHDA 5D9SA 43C9A 2MSPA 3BH9B 3RURA 1MCQA 1JNNH 4HJGB 3DRQA 3PY9A 4YDJA 3Q3GA 4RBPK 4U6XB 2R0ZH 3EYQD 3L6FA 3UC2A 4BIKA 1ZXQA 1C8PA 4F9PA 1JTPA 1PY4A 5A6MA 1CVSC 2VDKB 3C9NA 1DO5A 4KKAD 2A74A 3NJGA 4JM4L 1MFUA 1FCCA 3QR0A 3GFUA 3KM1A 5AAMA 2EH8H 2Z35B 4HWBH 4WFGE 1T7YA 1AIFA 4WCYH 3MX0A 2NY0C 3GUTB 2P24B 1K5WA 3PHQB 1DVQA 1FGNH 4O2FB 2I9TA 1ZLDA 2P80D 4P5TB 4NQVB 5C08E 4KAQH 4X7TB 1CF8H 2XIIA 3HHSB 4HIEA 2CGZA 3RGVB 5L2JA 1FAKT 1I85A 1L0QA 1VB9A 4JY4B 4C59B 1A22B 3QA3A 5JDJA 5GRJH 4PJCA 4FQPA 1SOQA 4FTVA 3FB7B 4FFYH 3ARGD 2K8QA 2EVFA 5F0MB 4DTGH 1KELH 1QFPA 4ZAKA 1U4EA 1Z9OA 3KLDA 5A16B 1ZOXA 4G1MA 4OV5A 4KTDH 3VXTB 4R8WL 1Z9PA 1I82A 2CJUL 2V7HB 4WEEA 3D39B 4X7CC 3OHXA 1JYXA 2V9RA 2R0LL 3OAUL 3DECA 2IGFH 3GRWA 3PAUA 3D85B 3S96A 5F0JB 3NA4A 5EPMB 4NO3B 1S9VA 2JSFA 2VWEE 2J2ZB 1NZRA 2DM7A 2AJSH 3VACA 5JXAL 4AK1A 3MCLL 2HVBA 3G08A 4Q9CA 3AS1A 1FYTD 4GAFB 4MNQA 5ENWA 3O9WD 5DC4B 1FRGH 4U3HA 4PJBA 2ZWSA 5D1XA 5EZOH 4G8EB 5C0AD 1WFNA 5D7IB 4NKIL 3PQYD 1DQVA 2ZYHA 1WAAA 2BNQD 3FQYA 1G7LA 1JK9A 3CIAA 1JI1A 3CU7A 1RP9A 4N2CA 5F3FA 4AV0A 3QZWB 4TTDC 4YDIH 1IJNA 4WFFE 4NAJA 3US9A 4WFEE 5FCUH 1JVKA 5HGAA 1SRDA 3OKOA 3WEOA 4G8IB 4LLQA 5EUKA 1E8ZA 2A2QT 3T2LA 2CJ3A 1XHHA 4JY5L 4BSWA 3PRZA 1IT9L 1KYOJ 4XPTL 2NLJA 5GQBA 3OKMB 1N3NA 5SX5H 4HUVB 1U9KA 3R8QA 5EO1B 5EO9B 1Z5YD 3BI9X 4I2XB 4NM8L 5IHWA 2F7RA 5J6GB 3QFJE 4FQXA 1IE5A 3DWTA 2WN2A 5E8NA 4KI5D 4ANWA 3SB3A 3GIZH 2PR4H 1TT6A 2OMUB 4XO8A 1TU2B 2BVQA 4JPWH 5JIKA 5FYKH 4WWPA 3KPPA 5I0ZA 3AMLA 3BVXA 4P5TD 2LVEA 4O02B 3TJEH 1XB8A 3IDNA 5GRUL 3RGVD 4LBAA 1OARL 1OCWH 4ZDHA 3U0PA 4XPBL 3A24A 1E9QB 4F91B 5AW5B 1H6UA 3HZVB 5KS9E 3POCA 2OR7A 4FEMA 5E94B 1X5ZA 4MNGA 4B9CA 1QTYT 2R0WH 3VM5A 3WENA 1YSOA 1U8NB 5HHXH 3X13A 4BZYA 4IDJL 1BFOA 3QORA 1G6RL 1JNHB 4MD0B 1NLDH 4K9EL 5G55A 4PB0H 3ZE0E 3V6OE 4XP4H 3KGSA 3IAQA 5EO0B 1FG2A 3BUTA 2NCEA 3EJCA 1F90L 4FFZH 2VZVA 4YPGA 1IM3A 3D33A 3D39D 3HLKA 3OJDA 4NGHL 5FO9A 3UYRL 3OF6D 4PPTA 1PDKB 1SYSA 2XTJB 4PVMA 1HILA 2VN6A 3D85D 5LBSH 1F97A 2Y72A 3PAZA 1UD4A 2IADA 3R7QA 1LE5A 1KB3A 1U8MB 2DV6A 2G60H 3BVTA 1U8LA 3MNZA 1IC7H 3WJLA 1TUPA 2ICES 3WIFB 3QI9C 4DKEH 1KGCE 2VXTH 5EV7A 2P5EB 2WQ8A 3NJJA 3VE0B 2OL3A 3IU4H 1AR1C 3JV4B 5KW9L 1MFEH 1M7DB 4KK6C 5H4YA 2UXTA 3GSNH 4KY1H 5BOJA 3E1F1 2ILLA 4QXUH 3TEYA 4OKVA 4WF7A 4HWZB 3T3PE 5LJYH 2HRGA 4PRAB 5E03A 1E7VA 2C4FT 5FO8A 3BT2L 1HSBB 4M5ZL 5E8OA 1ZLUK 1HXYA 4K7PL 3VW3L 3P1VA 2F5BH 3L7EB 3KCPB 5KJRL 5EEZA 1OK0A 1T1YB 3D8MA 4GSUA 3OR7A 2ZCKH 4J3OF 4RWHA 4YDVB 3RNQB 2VXQL 1D5ZA 3EFFB 4JRXA 1QBML 2OLDA 4XX1G 2ATKB 4DN3L 5CJ5A 4OLZH 1F4WL 1ZLVH 1MDTA 1ADQA 5CKAA 3CSGA 1ZT4B 2BNUA 3II2A 1U58A 2VXUL 3U1PA 1KB9J 3CNKA 4K9EC 2FEDD 2BOCB 2ZQKA 2AK4E 1QD0A 4Z23A 4MRBA 4Q52A 3PDOA 5EOQH 4U1GC 4B5EA 3JZYA 4A6YA 3K6NA 2XYBA 2VDQH 4FXTA 4HZLB 5FOJA 3VFOB 3QJUB 4LOEA 3U1SH 4DERA 2AQTA 3TCLB 1T5XB 1E27A 4DGUA 3HCVB 3C60C 2KMWA 2NY1D 3MCG1 3VAEA 2XG4A 2PO6C 4JZNB 3V0VA 4BA8A 3WTTA 3CVHA 3H6AA 2KPNA 3SQOL 2F2HA 5KVDE 5EBMB 3VFGL 3AT0A 3ZKQD 2VOTA 2VLMD 3TBYB 4ZO6A 5EOCL 1SLUA 5DVMA 1X9RA 4MMZA 2N7SA 4UILL 4DP0X 2X4NA 3EJPA 1D5XA 3NCWA 1DQJB 3EXJA 5DQDL 1AQKH 2JJTA 5GSRA 5I6XC 3B2VH 1NCDL 4HSAC 4LQFL 4OCWL 2ZUYA 3CFJB 1OLLA 2XBDA 3BSGA 3KAAA 2CCVA 4PI0A 3PYCA