4DP4X

The 1.54 angstrom crystal structure of reduced (cui) poplar plastocyanin b at ph 6.0
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
VDVLLGADDGSLAFVPSEFSVPAGEKIVFKNNAGFPHNVLFDEDAVPSGVDVSKISMSEEDLLNAKGETFEVALSDKGEYTFYCSPHQGAGMVGKVIVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of the poplar plastocyanin isoforms PCa and PCb sheds new light on the role of the copper site geometry in interactions with redox partners in oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Plastocyanin B, chloroplastic
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4dp4X00
3FQ1A 4DP0X 5F7AA 1FFTB 1JXGA 1PMYA 2YXWA 3ZX1A 1J9QA 1GR7A 2FTAA 3NJMA 2I85A 3IBOA 1CYXA 2BP8A 2IDFA 1L9QA 3N55A 3TU6A 2HX8A 1ZIBA 4CSPA 5EHFA 1BEXA 1NIBA 1ZPUA 1HAWA 4HCFA 6PAZA 1PNDA 1L9TA 2VW7A 4E9WA 1KCBA 3RYMA 1OCCB 2WO2B 1KGYE 2QDVA 4DP4X 1A4AA 2YAHA 3NSYA 1SHXA 3JTBA 4YSQA 2BZ7A 1QHQA 4HAKA 1MDAA 4A2DA 2XV0A 2BP8B 1ET7A 1L9PA 2UXGA 4YSPA 2EINB 4HZ1A 4AZUA 5I5MA 2UXVA 3WKPA 1MZZA 3WNIA 1AS7A 3QJTB 4AKQA 2BHFA 4YSSA 4G72B 3WKQA 1AANA 2XUWA 2AZAA 4A68A 1KCWA 3SBQA 1JZJA 2CJ3A 2FQEA 2HRHA 3NJLA 1OE2A 3D12B 1NPJA 3NJGA 1CC3A 1BXUA 2OJ1A 3OM3B 1MG2C 1NWPA 2YAPA 3CDZB 1QLEB 4F2EA 4BK5C 4P5RA 1X9UA 2R7EB 3OMIB 4YSUA 1N70A 1R1CA 2AFNA 2PCYA 4W9ZA 2XV3A 1J9RA 5B1KA 1BAWA 1E67A 4FA7B 1TEGA 1VLXA 1WA0X 4X4KA 4A67A 4QKTA 3UADA 2PPAA 1MG3C 1NINA 1PLAA 3FSZA 3AG1B 3NJJA 3OD3A 3QJUB 2CCWA 3ZBMA 3EH3B 4YSOA 3FT0A 1CUOA 2AVFA 5I6PA 4EF3A 1FWXA 2XLLA 4KNTA 1AZNA 1NICA 3L45A 3EH4B 1OE1A 1AAJA 4DP5X 4A2HA 2VSMB 3IEAA 2BW4A 1KBVA 2GIMA 3SQRA 3TA4D 2HXAA 2PP8A 4ENZA 1ET8A 1SFHA 4K9JA 2QT6A 3BQVA 3AG3B 3X1GA 1AZRA 1A65A 1IUZA 4DP2X 4E9VA 1ZV2A 1SHWA 1RCYA 4E9XA 5IY5B 1OF0A 3QJQB 4HHGA 1NWOA 3PLYA 2GI0A 5AZUA 4G70B 2GC7C 2IAAC 3ABMB 4A2GA 1GS8A 3H4HA 4KNUA 1FA4A 3JT2A 3X1BA 4A2FA 1ZDSA 1JZEA 3NSCA 2YAFA 2B3IA 1EZLA 2XYBA 2XX0A 1BYPA 1PCSA 1AG0A 2GC4C 4Q89A 4HCGA 4M3HA 2TSBA 5ANHA 1W6WA 2EILB 2YAMA 5B7FA 9PCYA 4NB7A 5I6OA 3PAZA 2J55A 4CSZA 1ASQA 1AIZA 3CVCA 3QJVB 1KYAA 3X1EA 2FT6A 3AW5A 3FU8A 2PPDA 3S3DB 3EHBB 3FSWA 2QPEB 4MFHA 3UACA 3IN0A 1J9TA 1OCRB 2IDQA 4DP1X 4YSCA 3N2JA 1AS6A 3OQRA 3FQYA 3X2QB 1PY0A 1AQ8A 1I53A 3BVDB 2BP0B 2P80D 3T9WA 3T6VA 3WI9A 2AZUA 3AY2A 3CG8A 3KW8A 1KV7A 4JKNA 2FT8A 1ADWA 3SBRA 1JZFA 4WTQA 3ASNB 4JHVA 3U25A 4DP7X 4DP8X 3PAVA 2VMJA 1GY1A 8PAZA 1JERA 4BXSV 2GHZA 4GY4A 4NAJA 1ZIAA 1GS7A 2QDWA 1SDDB 4BWUA 1V55B 4DPAX 2BWIA 2FJSA 1SNRA 1GY2A 3QQXA 2LLNA 4BDVA 4Q8BA 1GSKA 3S8FB 1SFDA 4GP8B 4YSEA 2XXFA 4DPCX 4F7KA 2N0MA 2VN3A 1MZYA 2UX6A 2WSDA 3QJSB 2IWFA 4GP5B 2IDSA 1OCOB 2XX1A 2FT7A 4UANA 4DPBX 3MX0B 1GW0A 4TXVB 2YAOA 2XV2A 5B1JA 3PCYA 1B3IA 2HX7A 5AKRA 1W8EA 3IE9A 4JHUA 5TK2A 1JOIA 1PZCA 3HEIB 5B1BB 1AS8A 1J9SA 4E9RA 5LDUA 1M57B 3ABKB 1ILUA 2IWEA 2IWKA 3FSVA 4AKPA 1BXVA 1ET5A 1BXAA 5B7EA 3V9CA 2W88A 5D4IA 2PCFA 2OV0A 4YSDA 1BQ5A 3X1NA 3NJFA 2BW5A 1OE3A 2IH9A 4UAHA 3FPXA 3X1FA 4GXFA 1SJMA 2H47C 2DWSA 1A4BA 2XXGA 1ID2A 3FYEB 1GS6X 1AZUA 1WS7A 3FU9A 1E30A 3FQ2A 3G5WA 3PPSA 4ZK8A 2PP9A 1A3ZA 2UX7A 5FC9A 1AG6A 2FQFA 2FQGA 2IDTA 3S8GB 1XB8A 2FQDA 5I6LA 3EF4A 1AZBA 3FPYA 7PAZA 2H5UA 1CYWA 3FU7B 2R7EA 2VW4A 4KO7A 1M9WA 2E86A 3C75A 2RACA 1TU2A 1A8ZA 1NIDA 2MRYA 2XU9A 1ZDQA 3NJIA 4KNSA 4KO6A 4DP6X 2GSMB 4P5SA 2HZHA 2Q5BA 1AACA 2HRGA 2ZONA 3QJRB 1TKWA 5TK4A 2H3XC 1EHKB 1AOZA 1HFUA 1N68A 4HHWA 4YVUA 3UGEA 1ASOA 3QPKA 1WA2X 1WAEA 1URIA 1JVLA 3EH5B 4PCYA 4BWTA 1IBZA 4PAZA 3ABGA 2PLTA 2EIMB 2VM4A 3SBPA 1XMEB 1OCZB 2IH8A 2I7SA 1CURA 1NIAA 2GB2A 1L9SA 1RKRA 3CZUB 3PXLA 3ABLB 2OCCB 1NZRA 5PAZA 4YSAA 3AG4B 3NP3A 2PPFA 1ASPA 4HIPA 2J5WA 4L0PB 1IC0A 5I6NA 2YAQA 3WNJA 1NDTA 3NSDA 4RH4A 1AZCA 2YQBA 5I6MA 5B3SB 1T5KA 1WA1X 1KDJA 2I7OA 1L9RA 3S3CB 2BZCA 3H56A 4AKOA 4YVNA 1A4CA 2FNWA 4F2FA 3OMAB 1RZQA 2UXFA 3ASOB 3T6ZA 5D4HA 5B7MA 3HB3B 4NERA 1KBWA 1ILSA 2J56A 3GYRA 1PZBA 1XB3A 3T6XA 2BO0A 2DWTA 2CUAA 2VW6A 5PCYA 1AR1B 3NJNA 2JFCA 2BP0A 3NSFA 2WO3B 1IKOP 2DYSB 1WS8A 7PCYA 2P80A 1JZGA 2VSKB 3FSAA 2IDUA 3AG2B 1E65A 1UATA 4HALA 1JXFA 3IN2A 1JVOA 4QLWA 5I5IA 1V10A 2YAEA 1ETJA 1KDIA 4G71B 2TSAA 2DYRB 4E9YA 3T71A 1HAUA 3CVDA 1TEFA 1PLBA 2J57A 1JZHA 2JKWA 4BXVA 5I28A 2YARA 2XVBA 3UABA 4DP9X 2X88A 3NP4A 3FYIB 4GP4B 1NTDA 2A3TA 2ZOOA 1PNCA 4YSRA 3WIAA 2ZWNA 3UAEA 5AFAA 3DTUB 2QPDB 1JZIA 1IBYA 3KW7A 5E9NA 4A66A 1GYCA 3PAUA 5B1JC 2W8CA 5A7EA 4UF7C 1BYOA 5B1AB 2DV6A 3ERXA 1JXDA 4BDVB 4G7QB 1M56B 3CVBA 2HLEB 4G7RB 3GXUB 2Y69B 2AANA 4WKXA 4FAAB 5I6KA 2NRDA 3FU7A 3V9EA 2BWDA 1DYZA 4HCIA 1BQRA 1J5DA 1PAZA 2GBAA 1XB6A 4KO5A 1X9RA 5F7BA 2XWZA 4YSTA 3DKHA 2CALA 1J5CA 1W6LA 2Q9OA 3AZUA 1BQKA 4E9SA 1V54B 3S3BB 1NIEA 4KOCA 4KOBA 4W1TA 2EIJB 4N4YB 3ZDWA 2HX9A 3TASA 3TBBA 3NYKA 3MBWB 4E9TA 3H4FA 2FWLB 3NJKA 5I5JA 4G7SB 1PLCA 2PPCA 4YL4A 1OV8A 3GDCA 1L9OA 1RZPA 4AI7A 3OMNB 2CAKA 3WG7B 2MTAA 2EIKB 1DZ0A 4AX3A 1SF3A 2ZXWB 1NIFA 3TBCA 1YLBB 4A2EA 2YXVA 1E5YA 1SF5A 4E9QA 2PP7A 3ZIYA 2JXMA 2B08A 5I26A 1NPNA 4BWWA 1OOWA 3NT0A 1QNIA 1E5ZA 4M4RB 1PZAA 2VM3A 3CDZA 3FS9A 3DIVA 4GYBA 1F56A 5D4JA 3NJHA 6PCYA 2UXTA 1PF3A 3T6WA 4N8UA 2DY2A 1SDDA 4KO9A 2CBPA 2Y1AA 3UAAA 2PPEA 2X87A
chains in the Genus database with same CATH superfamily
1QBLH 4FNPA 4HJGA 5BUGA 3QJHB 3RL2A 4X5WA 2YRBA 1X5AA 3D34A 5ID0A 1RUKH 1B2YA 1SJHB 1YPZB 4M93B 5A40E 4P9MH 4Y5YA 3TJEH 2W94A 2EXWC 1WZLA 3KR3H 3GTNA 3KPPA 5E1AA 5FO9B 3CNKA 1QR1A 2YA0A 5KSUB 2WLLB 4LO9A 5E08L 4XMLH 4JDTL 1YDPB 2XZAH 5D6CA 1QO3B 3RPIB 5A6LA 1OP3H 3HG5A 2BY2A 4HK3J 1N8OE 3KNBB 5E6ID 4TLKA 4PJ7B 1LO5A 1IGYB 4HIQA 4KDTA 2QDVA 3LPGA 1MY5A 1AGEA 1RI8A 3ZKQD 3SKOA 1BA9A 2KDGA 4DEPC 4ATWA 4NXSA 4JFEB 1XL6A 4DOHE 1FIGL 2WLMA 4HXAH 4AZUA 2DDQH 3MRFB 1T83C 2IQ9L 3O41B 2Y7OA 1QSEE 4X5WB 3F62A 2SODB 2WZPD 3DK0A 3WUWB 4M5YH 2HKAA 4V1DE 1E4WH 3B9AA 1JG9A 4GW4B 3RY4A 2YPVA 5GZOA 5HHXH 1JZJA 2CJ3A 2FQEA 2HRHA 3BUQA 2P5ED 3I85A 4ZFGL 1BG1A 4KH2A 1DQIA 5DUML 4K3GA 1JI1A 2K9FB 1OE2A 1E5AA 1FIGH 4YK4B 3TJHC 4Z8FH 4WI2A 3ZVVA 2QKIC 2A99A 4I1NB 4Y5XA 3VJ6A 1RUPH 2VLME 3QQ4A 4CN1A 4PCKA 2BY1A 2YAPA 3HI6H 2J2ZB 5FGBA 4AG4L 3V52H 3OMIB 2R7EB 2DLHA 1N70A 1R1CA 2AFNA 3GSWB 4HFWB 3S5LB 2X0VA 4JJHA 3GUTA 5B1KA 2F54B 2D0GA 4BCYA 3F64A 5A2JH 1J0ZA 5FA3A 2BVOA 4AVIA 5GGSA 5FECB 1U36A 5HVHC 2CDFB 1KZYA 3T3PB 4HLEA 3T3MF 2LU4A 3BHBB 3UO8B 1WCQA 3RIAF 3O45A 4J3UA 3QJUB 1LDSA 3MBXL 2YD5A 5DFAA 1NGWB 1M7IB 2WOYA 3BLPX 4X8JB 3RQ3A 3MRBB 1GHFH 5DSCA 4NAQA 2E3VA 3MFFB 1MF2L 4JFZL 4DUXA 1MFDH 1W9XA 2XY2A 2ZKHH 2ZOKA 4LSSH 5DJ0B 2NY3C 1JNNL 1UZ6E 2HG5B 2ADGA 3RWDB 1CTMA 3W39B 1IGIL 1WK0A 4L18A 3P3RA 2F5BL 1LEKA 4BGDA 2O5ZL 3B4NA 4XNXL 3I6LE 4CVWA 3E6HA 3HN3A 1M3IA 3BESR 3IJ9A 4QHKJ 1ZGLM 4LSTL 1I7TB 3IT8D 3QIBD 4R3SA 3IYLW 4B50A 3CX5K 4UILH 1XR9A 4P5TD 3FMGH 1KJMB 5KVEH 3M1CA 5AZUA 3U4EB 4MA7H 1E5BA 3Q6GL 1FNEA 2EDFA 3NEEA 3MRDA 3Q7JA 4N28A 3EUUA 2VWEE 2ZSWA 2UZYB 4RBPH 3RX9A 5DRXB 4HXBH 4ADIA 2NY3D 3K8LA 3O6FA 1UM4H 1F1AA 3LKSB 4FQLL 2R0ZL 4K3EH 1M71A 2BY3A 2XZZA 4UT7H 5BPPA 4TNVF 4RMQA 3CAFA 2ZPKH 3LN9A 3OR7A 3MOAH 4CSZA 4LVOB 4DUVA 5L0QC 2F74B 1NAMH 2CGRL 3SGKA 4GI6A 1GJUA 1NGZB 4UZUA 1KPVB 2O26U 2F5AL 4G43B 3IDIB 3S97C 3MRIA 3GGWB 5F70A 4POUB 1JHTB 3CIQA 2WMPB 2ID5A 4KY1L 3O3AB 1BVKA 3ALXA 4ZOCA 1DE4A 4I13B 3U0PA 2QBWA 5ERWB 1WCBA 1EBAA 1EZVY 1ULVA 1AXTH 4PJFA 4XAKD 5D72H 5DDHB 4AIEA 1Y18B 4QT5A 4GFXA 3L5HA 4QRSB 5KVGH 4U33A 1JERA 4O02B 2WXFA 3KYKL 1OW0A 3WFBH 3ZDZE 4CN4A 2BCKA 3GBML 5I15H 2EO7A 3OJDB 3HG1A 2OJZH 1N67A 3MLYH 2P8LB 4XRCB 5I1KH 3GO1H 1ZLDA 3ALWA 3IB4A 4PJIE 4YSEA 2I9LB 3EXLA 2GSGB 2VJXA 5KVGL 3QRGH 4L8CA 3L3OB 5DMKB 1CDGA 5IJCC 5JHDA 2FT7A 5BZZA 3NFPA 3ILPA 4XN8A 5CJXA 3VD1A 2RH0A 2XV2A 1Y6KR 4B7IA 3UROR 2BC4A 3WTUA 3TO4C 3DETD 3MXWH 2HT2D 1N7MH 1GGIL 1ILUA 2W0LA 3QEHB 1WZMA 1ZPLA 2IWKA 2VERN 3GBDA 4TSBL 5DZLA 4WTXA 1GXEA 4WI6A 4FQXA 2R4RH 3ESUF 4LSVH 3OF6A 5HJBA 3QXDB 4MX7A 2FWOB 2R8SL 2A5UA 3QRBA 1HN1A 2M8XA 1UD8A 1S8DB 1DVFD 2DWSA 4IDLA 3H9ZA 4ZK8A 4AYMC 4LKCB 1AHKA 1BVNP 4OF6A 3O2VH 2VO5A 5E94A 4UQ9A 3P1VA 2G5BA 4YUEH 2VUYA 3GMOA 3UEQA 5JXAL 2IADA 3D3VE 2VTFA 5DA0B 4QHLA 1RJCA 2EECA 4JO3L 5DEZA 1SYVA 2ZUSA 3QEUB 5BQ7A 3FFCD 4QNPF 5IVXA 2JB5H 3QDGA 4HISA 1J0IA 1NANH 3QZWA 1IGCH 2Y6TE 1ZLSH 1FZJB 4FJYA 3N1MC 1CVRA 2BNRB 2DI9A 1RK7A 2VLJB 2VWEC 2JCCA 1Z32X 5L2JB 3UP1A 3K3QA 3WN5C 3OVUB 2FWSA 5EU5A 5IFJB 1E3ZA 1H6UA 1RUAL 2NYKA 1AMXA 1N18A 2JB5L 3FCBA 3G5ZB 3ISRA 4QXUL 3V6ZA 1R3LB 4LSRH 4JFDD 4MAYD 4Y5VB 2O1AA 1KB9J 4KTGA 3MO1B 3D39B 2NUPB 3MX0A 2IEPA 3SZKC 4N8VB 4WCYH 1HKFA 1NLDH 4WJKB 5TPWL 2HT2C 3BO8B 4N20A 2DD8H 1YN7B 3A4FA 3QUYD 1DBKL 1G4RA 1U8HB 4IOSA 3F7VA 1RMFL 4D9LH 3FUFA 3MV8D 5IB2B 1RIVH 1UXMA 1FZJA 1Y1UA 4XMPH 4HUVA 2F53A 4PGZA 3VXSB 3NSDA 3AADB 1IMHC 2GY7B 2MOQA 4MNGE 3L3KB 1ONQA 1Z3GL 4ODVH 4PVMA 5T1LB 1MHHB 5I8CB 2WWMD 4W9FC 1OCWL 5C9JB 3BZFB 3FTGB 3MRHB 3KXFA 2FNWA 2YS4A 1A9VA 4Y4FB 2Q76B 4XMKH 5FB8A 4Y2DA 4IM8A 4GB9A 5CP3A 5KUMA 4IRJA 2WVSA 4L9LC 5HI4D 5E2WL 4I0CC 4G9FB 4Z7UB 2GTWA 2BWQA 1KGIA 2DWTA 3L81A 3PIQA 3L4VA 1QKZL 3LQZB 2HVKA 3ABZA 3CVHL 4KY2A 4M00A 3MRPA 4QRUA 2NY2B 3O3BA 3TCXA 4EOWL 4CILA 1KY6A 3L95A 1QX1A 1AR1B 4MVBD 2CBTA 1KC5H 2OMYA 1SBBA 1TJGL 3ELQA 1MAML 1ZANL 2OYKA 1IRAY 1EXUA 1WZ1H 3CZJA 3IFNL 1H15A 4RX4D 5E8DL 4AC4A 1M7IA 1UATA 3IS0X 3LIZH 2F9BT 3L54A 2PW1B 3QIUD 5FKPB 4KFMA 2B1HL 3QQNA 4BKTC 2H8PA 4GRLB 4HC1A 1IM3A 3J27A 3OHXC 1P0SE 4WU5A 1DHKA 3ZJAA 5BS0D 3GHPA 4KHXL 3UCRA 3FB5A 5BZWB 1G1KA 5DHVH 5DMKA 3UIZA 5BO1L 5GGSB 2F18A 4I48A 1AR1C 1H9DA 3QEHA 3ZXAC 1UXSB 4JVPA 2R1XA 5EF3A 2HWZL 4FQ1L 4BK5A 3BMWA 4HC1L 3O2DH 4L3ED 5CZRA 4ZNEE 2RTTA 2CU9A 2PO6B 3VFTA 2Z3FA 5TF0A 5CWSA 1UXWA 1AYRA 1VGKB 3GKWH 1W0YT 1DBBH 3OZLA 4MJID 5DC4B 3K6IA 4YBQD 2EZ0C 3QORB 4L4VE 4PJXE 4G82A 1EERB 3U7YL 1JXDA 5ERWA 1XZ0B 4PJDB 5J8OA 3ARDC 2QGBA 4V2CB 2N01B 4KROC 5HBBA 2O5XH 1GGCH 3CXDL 4C56E 3PS6A 1FCGA 4ZFGH 3LPOA 4PD4K 1CLOH 4L8BA 4I7ZC 3UJJL 1KOAA 5EPMA 2WYIA 1E27B 1D7FA 1A6TB 4UTAA 3DV6B 2LTQB 3AZUA 3DVNA 2MH4A 3RWJB 5I17A 1BQKA 4TVPD 4I1PA 1CXFA 5KSBB 5J12B 1UD3A 4N4YB 5DK2B 4TLUA 3L4ZA 2HX9A 1YN6B 3SKNA 1KG0B 3MBWB 1IJ9A 2GQHA 4YX2L 4UTBA 1A66A 2ZYRA 4NM8H 1GIGH 4GQPH 1DFBH 1RZ7H 5I1GL 4O00A 3O6LH 4G7SB 2RIKA 1SHMA 3UYPA 3KDPB 1XF3A 1L9OA 1T0MA 1UB6B 5BCAA 1R5IB 2AXFA 2JKTM 5DRZB 1A1NA 1BZ7A 4UM9D 2K6YA 4EO5A 1SF3A 1A7RL 1D5BA 1G0XA 1NKGA 4JGMA 1CIDA 1KJ3L 3W5MA 1OB0A 1A14L 3ZHNA 2PP7A 5E23A 3RI5F 2O4EA 1ZMYA 5GRYA 4R3SB 4KV5E 2F8XC 1ZA6A 2CDEA 1W0VB 2VM3A 2RQEA 3QXAB 3GHEL 3ARUA 1CGVA 1IC1A 1JV5B 1NCWL 1UACH 1E5CA 2KI6A 4HSQA 2FWUA 5D7SL 3VWJD 2CM5A 5AKTA 3S96A 1CFNA 1OWWA 1YY8A 4XPGL 4UQ3B 3WTYA 2LFEA 4BV1A 4MS6A 4LSTH 4O02A 1YECL 4W4OA 2IALB 5EUKA 4RIRB 5BO0D 1I9JH 5IJVB 5I1LB 3DPBB 1PZ5B 5IK3A 3IGLA 1AY1L 1HESA 2PUQT 4TOYL 4YHOL 4BA8A 1BECA 3D30A 2DQUL 1RLBA 3BN9D 1DJWA 1MW1A 2B4CC 2IFFH 3APDA 4WUKH 5EOCL 2Z8WC 2QVKA 2VLMD 3HVNA 4M8QB 2JSFA 4P3DB 3UH8A 1N59A 3KYMA 3S5LA 5FW6A 4HJEA 1M42A 3H3KA 4N9GB 5MENB 2XWXA 4EUPA 3VU2A 2UY6A 2JI1A 1U8PB 3QG6B 4NQDD 4Q6IC 1QHQA 4LLYB 2R0WL 4A2DA 5JW3L 1CXLA 4FG4A 4YSPA 4K0OA 2WANA 2PCPB 4RX4A 5AYUH 4TSAH 4OCMC 5E8PA 4NPKA 3DX9B 2LAAA 3WNIA 2XVGA 3LYRA 2J6EL 4ES8A 3V95A 4XX1G 3FQNA 4NWTH 5TDOA 4PFEA 2ZX6A 3QFDA 4KK9D 1A6UH 3FCSA 5DHEA 3V52L 3W0WA 4A1RA 1LMIA 2P24A 2JLPA 12E8L 2BPBA 5EU6E 4D9QE 3TEUA 4DN4L 1FIEA 1IEAA 1NL0H 2G3NA 5GZOC 1NCHA 3TIDA 5IB3B 1KV3A 4TSAL 4XNDA 4MD0A 4YE0A 3L4XA 3GXPA 5F0LB 3MROA 4N6QA 4F2EA 1QLEB 5ITFA 1SY6H 1JGUL 5E5MA 3GPSA 2JB6A 5F72S 1CBVH 3DUUA 3NPZB 4JPKH 2G9HB 3EYOB 1TEGA 1CL7H 5IVZB 3LEYH 4NUQA 4ESKA 5BOJA 5DVMA 2A1WH 4QKTA 1DL7L 2CR0A 1B4TA 4XE0A 1KYUA 1Z9SB 2BCMA 3UJIL 4C55A 5JPNB 3P4MB 1EMTL 2JJUA 4LQFL 4KK6D 3JUYA 3OD3A 4M5ZH 4H1LA 4HIJB 2WQUA 1ICTA 1PDKB 1BJMA 1LYQA 2AK4E 5I66A 1J8KA 2X4RB 4LHQB 1B0IA 3IFPA 4N1HB 4AIOA 4FQPA 4GO8A 4JY4A 3EH4B 1NOFA 4FMKA 4XO8A 4N9OB 1OE1A 5CIPA 2F15A 1QR1B 1MFNA 2R27A 5T1MA 2Y07H 2F54A 1XDTT 2K6ZA 5IHUL 1YMMB 4JFDB 4LSDA 4WGVB 5EU3B 2APTA 4PJHB 4MNHA 5C07E 5I19L 2AGJL 3APFA 4IBSA 4X6CE 2VLKB 3MRRA 1QMUA 1AZRA 2WXNA 3W82A 3R1GH 1JGDB 5HVGB 3WY4A 1KLFB 1I8LA 2VXUH 3R4RA 3HNVH 1JCVA 4X7SL 3TBTB 2DD8L 1HHKA 1RZIB 4U1MB 3QUML 4QRPE 3H4HA 1JGDA 1IO4C 1CBJA 2JK5B 1MFVA 4ODHL 4EI5D 3GLDA 3KJ4C 1OP4A 5JIQA 1ODUA 1XCTB 4NQCE 2BHUA 3FQXA 1UWEH 1C8PA 3WFEL 1M53A 2RBLA 2YPVL 1J12A 1PCSA 1CL7I 5FHAL 1R0AL 3HUJA 4WW2B 4X7DC 1R34A 5BRZD 3GMNA 1E4KA 4HCGA 1MI5A 2EILB 1J8SA 2W80C 3QDMA 2H6UA 2ZWZA 2H1XA 1MRDL 1QRND 3MNVB 5C0BD 4ZMZA 1LO5B 1XF1A 1NMAL 3WEOA 4FJ6A 4OM0H 3RAJL 1YC8A 3TO2B 2CHNA 4G6KL 2CMRH 3HAEH 4ES9A 3MACH 3DRQA 3BT0A 4P9ML 32C2B 4WNJA 1T6VN 2Q7YB 1NDGB 3FQYA 3BRFA 2DMGA 1F4XL 3BN3B 5DJ2B 1DO6A 3NIGE 3QIWA 1IQWL 4UOQA 1YEEH 4Y2OB 1BF8A 4X8CA 4RDBA 2GT9A 3LKPA 5KANI 4WFGD 4XPAH 2B5IC 1JNLH 5TE6H 4E41E 2GBUA 5HGDA 2YZ8A 3IMUA 3WSQH 4QYOA 1OXYA 4JHWL 5LXGL 2H41A 2PWEA 1QQDA 3C5JB 1YNKL 4FXKA 1YEKH 2X6CA 4CDHA 2QDWA 2CHWA 1SDDB 4DPAX 4F58L 2BWIA 4L1SA 4N85A 1EWHA 4S1DC 1P5VB 1IIIA 1P1ZB 3O9WB 4IGBD 4K7PH 5FWRA 4YHNA 2IQAA 3RU8L 3ZTDC 4B9IA 1O7DC 2X4PB 4L0ZA 4OFYD 3N40F 2FZ3A 4FYRA 2MKLC 1KTCA 1BF2A 3A47A 2FL5B 4NP4L 1OHZA 2BS8A 5F7MC 3KWXA 3IDXL 3CC5A 1OCOB 3R18A 4R83A 4JHBA 2ADYA 3E6FB 2NMSA 3GSRA 4HGWA 3BUYB 1CLVA 1WAAE 3LDBC 3IE9A 2QLVB 4JHZA 4OIIL 3TV8A 5MEQB 3H9SE 4QRTB 5HYQA 4ICWA 4I9XA 4NKOA 1T7VA 4OBSA 4ZUUA 1NFIA 3KLSA 4IYKA 1QBMH 4NN5B 4Z8FL 5IOPB 1ANUA 4KVCH 4KKBD 3QEQA 4IU2A 3H3PH 4RA3A 3BUIA 3R8BB 2DI8A 3VXSE 5T3XE 5JXAH 2XWBB 3HI1B 4N0UA 3G9AB 4OFQA 5EOTB 5EEYA 3BAEL 5D7KD 1UJ3A 5C08A 1QRKA 3BP7A 1ZHLB 3HTLX 4JCMA 5HHPA 2GTQA 3DOIA 3NJFA 3PGDB 5F3BA 4U3SB 4UAHA 3MRLB 3LY6A 1WT5C 2D7TH 1FVEB 5MI0C 4A7VA 4TPRH 3MLUH 1AZUA 3K1DA 3PPSA 4GQ9L 3LVEA 2HN7B 1A3ZA 5C0AA 2VCOA 1MIMH 2BNRD 4ZS7H 5MHSE 5DQDH 2FQGA 3KLQA 4MJJA 5HYEA 2HTLD 5I1IH 4CC0A 1HXKA 1XB8A 2FQDA 3KHQA 2C3VA 4FZEH 3BRDA 4HAFA 2COQA 4PJDE 3DPBA 4ORGA 1URLA 2X4OB 4HIXH 1QI5A 2WLJA 1G7IA 5DZNA 1R33A 5GGRA 4A38A 4LCCC 5H37A 4NRXB 2B77A 1HCFX 4AENB 4Z7VE 4NZJA 4GBXA 1A3LH 1EIBA 2VAJA 4LPWA 1GGCL 2WBJC 1CFVH 4K5OA 3RJDA 1XH2A 3BKCL 3WV0A 2FR4B 2G60H 1G7LA 3C60A 2WAQA 4PWFA 1CXIA 4CADB 5E1IA 4DW2H 5BZWA 3MRNB 3GRWL 4XN5A 2JKRM 2VJ0A 5AVUB 2HFFB 3NCYP 1G9ML 2BOBB 4XP5L 3ATFA 1BM3L 4G8IA 2KDYA 3SDXE 1A3LL 4ZTOH 3U36A 5B3JF 4U3CA 5L88H 4M61A 4NKMA 4R0LB 4DEPB 1TR7A 2J1ZA 2R29A 3ILQD 4OJAA 3O11A 4BSWB 3HJ0A 3VMOA 3SYAA 1CD1A 2M2DA 1IFHH 1S9WA 2KBGA 4JRXD 2VDNH 1NDTA 2RFXA 4HS8L 2YQBA 5F89A 1WDAA 2DJMA 1JGVL 4LLVA 1QR4A 2WWOA 2XXMB 5EZIH 2G0LA 3RBSA 3ZE2B 3WE6B 2F1BA 1D2OA 1JFQH 3NRQA 3LNDA 2V9UA 1JD7A 3RWJA 2WLIB 5T1DH 3OTTA 2QKIB 3GLAA 5C0GB 5HYSB 2ATPB 1E4XH 3F6IA 3HB3B 3GSNL 5F9OL 1E27A 1IKNC 2N4IA 4WDIB 2RJMA 4Y2DC 2X4OA 4DTGL 2CJSA 2BO0A 2DF3A 3GBNH 4JDEA 1DVYA 2BP3A 4OCYL 3FF8A 3SDDC 4E42A 4L4TA 4AE1A 4GXVH 5E94B 1MI5E 3FCUB 2WO3B 3GT6A 4UQBA 4GSRA 3K8KA 4UM9A 3CSTA 2DWYA 4QTFA 3QIWD 5DVNA 1I1AD 4IJTA 2YD3A 3P0VL 1ZS2A 5EO9A 2V2XB 5F89B 3T8XA 3IAPA 4EI6B 5JXEA 3A6CL 3O2DL 1G1CA 1MQ8A 2VO8A 2MJWA 4LHUA 4JFQB 4OR1A 1CR9L 4Z3GA 1QHOA 5KW9L 4XR8C 1NA8A 5DVPA 2OXHA 2XICA 2GAZA 1MLCB 1NCBH 4OZGF 3EZ8A 5DUMH 1KLUA 3TH2T 3HE6D 3NP4A 1E4XI 5D1QE 1UCBH 3QXVA 4QRTA 5HYQB 1LE5A 4JFZH 3K5RA 4Z7OB 1A1MA 4YSRA 1GA2A 4OI9A 2BNQE 4DEUA 5I75C 4E5XA 1IAIL 2AABL 3GB7B 1BQLH 4Y4KB 1PZUB 5D1XB 1FZMB 4WO0A 4HMDA 1GYCA 4A66A 1NC2B 3MOBH 1LE5B 1F58H 1BYOA 1T7ZA 3I75A 5EIQA 2KZWA 3QO1B 1K8DB 2XKNA 1UD6A 3EYSH 4BDVB 1BIIB 1LO2L 3C6EA 3TO4D 4B3VA 5IM7A 2C4FT 2PW2B 4GKLA 4UILL 4DGUA 1UKSA 3FU7A 2VR4A 4IBZA 2AJZA 2UY7A 2WB7A 1ZTXL 2FUQA 4M29A 3FRPB 3ZE1E 2VL5A 1KIRB 5F1NA 2OTPA 2XWZA 5I1GH 4DSYA 3IETB 2H1LM 5AB0A 4KOBA 5EDXA 5BXFA 3BEVA 3IDMA 3X13B 4J8RB 3IXTA 3MCLH 4O2EA 3KDMB 3OC8A 4P04A 2BSDA 4BCZA 1Q94B 3GZPA 4JFYA 3BQUA 1NCAL 3VD5A 3HRPA 1JNJA 5CCGE 3MU3A 2YD7A 4PJCA 4HOXA 2VKXA 1CE6A 3B7SA 4O9HL 4NOFA 5I5JA 5F3FA 4J8RA 4KRLB 4O2EB 3FNKA 3P2TA 4FJZA 4NXKA 3NIGB 2VISA 4N3UA 1C5DB 5A3IC 3WBDA 4TLTA 4NRZB 2VN5A 1DZ0A 1MCBA 1KLUB 1YMHB 2IOOA 1NIFA 1G6VK 1QZ1A 1SUHA 2HTLC 3BKMH 3U7WL 2JJSC 3KPRA 3DXAB 3IDJA 3MLRL 5KYUB 3EGDA 5CMAA 2YPKA 2MSPA 4TUUA 4H8WC 5GZOD 5FYKH 4BWWA 2CA4A 4GRWB 3BIBX 2GUOB 2QZ5A 4EZMA 4OM1H 2EH7L 4RGOL 1IKNA 5FUOH 1KELH 1PAMA 4P4KD 4F2MB 4OGZA 5AOJA 1R0AH 5K59F 4N8PA 3FRUB 1SMAA 1D5IL 2P5EB 3O9WA 3LPFA 5SWZB 3TGXA 1ZTMA 3GI8H 5D7IF 4OLUL 2ENYA 3B5TA 1QNZL 5KSAD 1FZKA 1E6JH 1IIKA 1F6FB 1SMOA 2IH3A 4M7LH 4IBUA 3ZX1A 5I1KL 1ZA3A 4OCWL 4FQQA 5GSRA 4QCIB 2IPTH 2N59A 3B3BA 4XOBA 4G11A 1RUML 1AXSB 3ATBA 1KTRL 4KKCD 5JDSA 4Z95H 2OULB 2UZIL 5IF0A 1NBQA 3DI3B 4N0CD 4YEEA 4OKVB 2HX8A 3EJZC 1PEWA 3D33A 1YEEL 3RILA 1C08B 1FPTL 3F04A 4PMFA 3MV7A 1F4YH 3KCPB 4WCYL 5KANG 3VE0A 4C4UA 4PCTA 3RYMA 3JV6A 1RJLB 3NQKA 3GBLA 2VDLL 5H94A 3WENA 4JQXA 3FFDB 4HU8A 5E4EC 1FUNA 4YZFE 4Y16B 2WXIA 4XI5C 4X9IA 4Y5YB 2X6MA 4UV7H 5C0AB 1CXKA 4B0MM 5AVWB 3K71A 1FC2D 4PI0A 3WLBA 2YRLA 1Z3GH 1KXTA 5DWUL 5I1AA 1HSAA 3QJTB 2RHEA 3GJEA 4M43H 3INUL 2VH5L 1IAKA 43CAA 2Z91B 4IRJD 5C2BH 3KLKA 1BVNT 4PS4H 3ZDXF 4OB5H 3IRPX 1AIFA 4UTBH 5E9DA 4FTVB 1D5ZA 1HJCA 3STZA 1X9LA 3ZYOA 1L3WA 1A6ZB 4ZUUB 2W0KA 3ML9A 4Z7WA 2OSYA 3CDZB 3WNOA 4RQQA 4MZ2A 3KD4A 3EGXB 1HEZA 1WFUA 3KWWB 2Q3XA 2ZCHH 4P5MB 4MSWA 1T1ZA 2ZZUT 1DDHA 2VLRE 3O4LA 4H8WH 5EZLB 2Z7YA 3PGFL 4JKLA 5GQBA 5ISZE 4LU5L 1DSYA 1U9KA 2LVEA 4NJ9L 2WWKO 4Q7DA 5DF0A 5MERA 1EJOH 1PZSA 3H0TA 4YHPA 4ZI8A 5EZPA 4P2OA 2BP5M 2JQZA 4PWIA 1QEWB 4RZCB 1ZD6A 4GXUN 4AQOA 4M6NH 5C0IA 1U8MB 1EO8L 3AAZA 1BDYA 3D0LA 4PCSA 3DXAD 3FQXB 2OMXB 5SX4I 3RX5A 3W2DH 3ZE2E 4KZEH 1UYWL 3IVKB 4GNKB 2BVQA 3KGRA 1YQVH 5CO1A 1AAJA 1YNTB 4NCC1 3HBPA 1MCRA 3L7FB 3CLWA 4H5SB 4L37B 2ZXBA 4U49A 5CGYC 5FK9B 4URKA 3U0WH 4FFYL 4UOW1 1I75A 4L4VD 1SFHA 4S2SA 4L9LB 5F7KC 1TZOA 3T0XA 5B1CA 3T4YB 4X4XA 1FF5A 4GSDL 1A64A 3IDUA 2OL3L 4MNGA 2Q1EA 4PI2A 3CN1A 5CNHA 4F7MB 2X4NB 4I1RA 2PMZA 3TPKA 4WK4B 1RCYA 1OT1A 4LNRA 1OSPL 1RK1B 1DQKA 3OLIA 3Q3GA 3HMWL 1A7PL 3WL9B 4HIXL 2IAAC 4NQXA 4NQQA 3IF1A 4UZGA 1ZA6B 2WB1A 3FCGA 2YAFA 1Q9OA 3P3SA 2CHXA 4JKWA 4ZW6A 2YGPA 2QFRA 3L3IB 3OHXB 4G42A 4FQXD 5D1QB 3GSUB 3RWDA 1ZT4A 5ANHA 1JWSA 4X7FC 5B7FA 4A39A 1KYFA 5E0QA 1NC2D 3M07A 5IQ7L 2D7PA 3C6LC 5CUSH 2IANE 5E1AB 3SY6A 3L13A 5BVJA 2M1KA 3OJMB 2Y5EA 4UI2A 4K9EL 3HC3L 3X1EA 1SJHA 1DQLL 1FL5B 1BZDA 3FUDA 3S3DB 2ED8A 4ADGA 3EHBB 2IQ9H 3QWOA 3DUUB 1U8CA 1CWVA 2FVNA 2WNGA 3MQIA 4MXQC 4PYGA 4XC1L 5J6SA 3CZFA 3G6JA 1FAKT 3V6OA 2QQKH 1JAEA 5L2KA 2DWDA 1N8ZB 2A6KA 2DQUH 3B2UC 1S7UA 3ARPA 2BP0B 3BVDB 3HN8A 3OHMB 3MYJB 3T6VA 5I73B 2IMMA 5I71B 3HIZA 3BH9B 3RNQB 3DO7A 1JZFA 3CFJB 1E9OB 3QNFA 4JHVA 5FYLL 5IB4A 4LVNC 1GY1A 2JJWA 4BUQA 4OFPA 2CK2A 1SUJA 3EJPA 1GS7A 3HI6L 4XPGH 5AOIA 1JRHI 5C07B 1G7JB 5K1VA 2VM9A 1SNRA 3RWIA 4P23B 5KSBE 1B2WL 4ZUTA 3GMLB 4LHJB 6FABL 1M05B 4M8UA 2HUHA 3MXVH 2X4SA 4K73A 3C6SA 3N44B 2YC1A 3MLWL 4ODBD 4Y8AA 2XVKA 1SM3L 2F2HA 4E36A 5IQ9B 3QUYC 3DJTA 1MIEH 1I1FB 3TN0D 4FKKA 5IJKC 4FXGC 4XBGA 4JG0H 3GBEA 2DLEA 4PIBA 4JZOB 4YDLC 4M6OL 1LQBC 4ZUSA 3HZYA 4X5XA 4XPTL 3DHMA 4WTZG 3EW3B 1B2WH 3OAZH 4A7QA 5ABZA 2ICEB 3D52A 5BRZA 3O4OB 4HJIA 4LCWD 2JCCE 5CHNA 2D3JA 5LDUA 1NOAA 1CDHA 3U7YH 3FRPG 4LVHC 4JPWL 2DYPA 2CKNA 3MV9B 1ET5A 1HYSC 2R69H 4HWBL 3SDXA 2O6CA 5I66B 3JV6B 1DVFB 4G83A 1WQVT 4R4ND 3NA9H 3S36H 1I1FA 1I1AC 1LM8V 1PY9A 4J5VA 4KKAC 3VWKC 3ZKMD 4XNXH 5BVPL 1NCNA 4BE6A 3MLSL 1JK9A 1YNLH 4DQOH 4WI8A 2XPGB 4NDMB 4XNMB 3HBZA 1PX8A 1EEYB 4U2ZA 1J05A 3NJXA 5F88A 4DGIL 3VFRB 3BVNA 2EC9T 4FG6D 1UD2A 4B5EA 2OW7A 1MWAH 3EF4A 4MNQD 5I8EB 3VI3A 2IH1A 2WZ5A 4ZFFB 4L48A 2F7IA 1FFOB 4HUMB 1FV1B 2BOCB 2YBRB 4OUUA 3B8YA 2CIKB 3S5YA 4HG4J 1R3HA 4MXWL 1I8IA 4JM4H 5AW1B 3F7PC 3UAJD 4B9JA 4TNFA 5C09D 2EXSA 1NFDA 2PABA 2V5SA 2B1AH 1OSYA 3LJ3A 5JHLL 4KNQA 4TOYH 5DI8A 2CD0A 3ULSA 3X12B 3A21A 4HKXB 2JV6A 3CN4A 3VTTA 1R3IL 1A0QH 2PO6A 2Q2EB 3VFTB 3QRFM 2NY0D 4A7GF 3GSOA 3L3GB 2P43B 3L6FB 4U4IA 1X7QA 3MPCA 1VEOA 2OAAA 1ADQL 1DEEB 3FUMA 4PWJA 1EDQA 3V6OC 1BHGA 4PJXF 3ABLB 3NCMA 1KT2A 3Q6FA 4LHUG 1ZHNB 4Y5VA 2VR3A 3O6ML 5LB1A 5TDPA 2Z91A 3RI5K 3ARGB 2PWDA 3RWCA 4QRRA 1TZGH 5ICYA 3PP4L 2E59A 4DTGH 3NTCH 1ETZB 4PJBF 4RFNB 2ATAA 1K4DA 1RU9H 1RZFL 2BZCA 1KN2L 1D5XB 3BZEA 2V2WA 5I19H 1ZT1B 1BQHG 3CSPA 3CSBA 4F2FA 4PVBA 1P6AB 1U3NA 1ZJAA 2KT6A 4UTCA 5EOCH 3V0AC 5GHWH 1SXZA 4N2CA 3GYRA 1IE5A 2H2PD 3RJOA 4AYFB 5EBLB 3VFGL 1FNFA 2ZWLT 1SPDA 3GSVA 3EFOA 2YZ1A 1JWMB 2EXYD 4U1NA 1AKJA 1CI5A 1YQ2A 4OF0A 3QIUC 4HUWA 3SQOL 1DJSA 2G3MA 4LCWA 3JV4A 4QOKB 2J4WH 1JZGA 4YE4L 3AS2A 1QACA 3FSAA 1KCVL 2VERA 2ZCLL 2WXPA 5B4MD 2B2XH 2ZE0A 2FBJL 4OGAC 1GZHC 2ZG3A 1QFUL 4YFLI 1YEKL 2BNQD 2A9DA 4LLMB 2AJ3B 4GLRI 2E8YA 4AYSA 4BH7A 4F15B 1P7QD 1IM9D 1PLBA 4G9DA 4WI3A 3PV6A 3SYCA 4W6WB 3BGMA 3ZSTA 2NQCA 1BVLB 4U31A 3VI4E 3U4BL 1J1XH 3FT1A 3P73A 4Z7QF 3Q48A 1AD9B 1U3HD 2ADFL 4GRWH 1WEJH 3SY0A 3C8KB 3VXMB 1ODAA 4O58H 2HVKB 4UQ3A 2DTMH 3QUMB 5E9NA 4L3CB 3VFSA 4AQAA 4MS8D 4BIKA 2JIXB 1OANA 4UV7L 3KPLB 2AK1L 4NS0A 2L4OA 3WXVL 1XF2A 1PKQB 3NN8B 3PWPA 3QDJD 5TH2B 1GGYA 5GRJH 5HDOA 4Y8DC 3WO3B 4AV4A 4U6TA 3CVBA 3O81A 4PGCB 1DANU 2RB8A 3T0EA 3KM2A 4YBLB 1S9VA 2CUHA 1UWXK 4F9LC 4B7LA 3B2DC 4O58L 1XL4A 4FQCH 3VXMD 2H8PB 5T1LA 4QTHA 1AI1L 1ONQB 2CJTA 4F27A 4FADA 1T20A 5AD0A 4ETQA 2LGNA 1S5IL 4WO4D 5F7BA 5T5NF 2O93L 1HIMH 2IADB 4X80H 3EJYC 2WYHA 3RX8A 4FMFA 3GXTA 3P3YA 3PQYD 5JLZB 4NN6C 4W1TA 4D0BB 1NEPA 4X6DB 1CE1L 3MNWB 1AP2B 5D96B 2G0KA 3QHFH 4L3CA 3H4FA 1S5IH 5AOLA 5IVXE 5C0DB 3LMJL 4FI8A 4KXDA 4EN3A 2WKGA 4EZLA 3PDDA 3RY6A 2WWNA 3G08A 4MDJA 1OV8A 2Y06L 1J5OH 1I9RL 3C2SA 1BREA 3OMNB 4RGOH 5FUOL 4R0LA 3TF7C 3I3BA 5E9DD 1RZ8B 1T66D 4LASH 2CSPA 4Q56A 1NGPH 3BYTA 4P23D 4NKDB 5HGAA 3M6DA 4HHAB 1SF5A 3LN5A 4AQ8A 1ED3A 1FFNA 3L3KA 4E9QA 2R56L 4WU5B 4BHUA 4EXPX 1S78D 4BKLA 1I9RH 1BOYA 1OOWA 3BJ91 4BJLA 1TVBA 5DEFB 2CBQA 1V3JA 4OZGA 1JGEB 4HS3B 4UINH 3S35X 5LDSA 3WCYA 3VSUA 1INEH 3DX7B 4RBPK 4W6XB 4XPBH 5L8JB 1CICB 1NCDL 3SPVA 1BLNB 5FFOA 3VCLA 1TJIL 4AK1A 1NC4B 4PJ5D 2J3SA 2OR7A 1FFTB 3H6JA 4PN6A 2FB4L 1TETH 5JHDE 2OL3A 2VZOA 1HYRC 3IBOA 4DWHA 1JGVH 3QUXD 4IOFD 1VB9A 2MCMA 5ISZD 3QUZB 4NZRH 1F11B 5I8KH 5IFJA 3H9YA 4I85A 3ULVD 2EDJA 4PR5B 1JPFA 3N42F 4XWOD 1VKXA 1CI3M 1MHCA 4R2GB 4DESA 2HKFH 2DJSA 2HFEB 3RVTD 1DUZB 2J7LA 3AJ7A 4MLIA 4L1HA 3WIHA 1FGVH 4ZQTA 4U3XA 4OFVA 1NIBA 1S3RA 2DQFA 4ZOEA 3OG6B 3P54A 4E9WA 2WLNA 2Z35B 4JDEB 5HHQA 3LNFA 4TL5A 3UMTA 4JPIB 3ZMRA 1XGRB 1LO0H 2C3WA 4OD1H 4PJ9A 1DUZA 3Q43A 4Z0XB 1SHXA 3IGKA 3O3UN 1MKFA 3ZO0A 1MCQA 3RUGB 1JTTA 1YY9C 2XV0A 4RA0C 3SPCA 3ZUNC 3DYOA 3LZFH 3S5ZA 3WIIH 2X1PA 3V2AR 5K9QI 1FNGA 3FO2A 3KPSD 4PP2A 5D2LA 3G3LA 3GSQB 2VDNB 5IGXH 1ZV9A 1AANA 1A7QH 2Q76A 1CXEA 3F12A 2XHNA 1E4XL 1P7QA 3I6GB 4GRMB 4WU7A 3CGTA 1MHPL 4OFIA 4PY8J 2CKBL 4L3AA 2GG1A 3IMTA 3UC2A 3O9WD 3S7GA 2Y7LA 1LNUB 4ZRGA 2B3RA 4UNUA 3S98A 4P2RE 3FQUA 2QTVA 1FNSH 1B0RB 2NUTA 2HJLA 4G8IB 3O6KL 3X11B 4E5XB 4KXBA 1E6OH 4MZIA 4N2AA 4W9ZA 3GGWA 2XV3A 4Z7OF 2WC7A 4DCQB 1R24A 1UVQB 3VG9B 2W5PA 4NI6A 1KCUL 2CGZA 2E7BA 2EDDA 1NCIA 3PHOA 1KB3A 5DJ2A 5HTSA 4LCWB 2E6JA 4MCZA 4XAKE 1JN6B 3MRCA 4ZD3H 4R0LC 3D4YA 1FH5L 4D7PA 4PUBH 2E6PA 4YXLL 4Z0BH 5BJTB 3FZUD 3EH3B 2WVVB 3LSOB 1XCQB 1QRNB 2DQ6A 5C0BB 4IMLB 4ERSL 1KIUB 4EF3A 3FOMB 3TA3D 4OGYL 5DZJA 3SD5A 4NHCH 4Y19D 2F61A 4OQTL 2VDNL 4IHOB 3U9UB 2XQBH 1OP3K 3S36L 3ET9F 2EVFA 4QPEA 4U6YA 2I07B 4PJEF 2BC4B 3FQRB 1D7BA 4ANKA 2Q86A 4QF1A 3APCA 3S5LG 4YHZH 3S34L 5L4FA 4D0CA 2WJ7A 4M6AA 3F2LA 3ORJA 4KKAD 4OQTH 3VWKD 4BFOA 1BM3H 4TMPA 1SHWA 4KWUA 4L5FE 2NSXA 2HPOA 3QZBA 3DV4B 3VM5A 3T2QA 2LW3A 1UGNA 1YEFH 3ZYZA 3ABMB 4HD5A 2A7BA 4KUCF 3MN8A 2ICWI 3MRRB 5F9WB 4EDWL 2AJ3A 3FBKA 4JM4L 4P06A 1TXKA 1YHPA 3QUHA 2VIRA 1Z7JA 4JN2B 1AG0A 2GC4C 3ARYA 5EZIL 1UM5L 3TCLA 5JIDA 1F3RB 4OLUH 2LT9A 4NUJA 5I1JL 4YFDB 5GZNC 2ZSVA 4WW1B 1AIZA 3KE0A 5C0DA 3B9KD 4CBZA 3D9AL 4FL4C 5EC2A 2ZD0A 3CVIH 7TAAA 4CMHC 4HUXB 5D6CB 4ZFFA 2A6JB 1KEML 3KPSB 5FS5A 5TQ0L 1SN5A 3TF4A 1PY0A 2ZPKL 2ZIDA 5IMOB 4WJ5B 2WVUA 5CZXC 2JVUA 2ZXGA 2FDBP 1J0KA 1K8IA 3AY2A 3GO1L 4Y1AB 4BYHA 3OF6D 1F58L 2N56A 2WCSA 3MFFA 2VLJD 2F08A 3T0DA 4ENED 2X9XA 3LKRA 5B8CB 1WAAA 2EEXA 4NAJA 4JG0L 2J88H 3FHAA 1ES0A 1SOXA 2OQJA 5E5UB 5C0RH 1H3VA 3VW3L 3RWHB 3MROB 2Y5TA 3IGFA 1A3RL 3HNSH 1BEYL 1N2RA 3E2HC 1LO4H 2B59A 2VXVL 4ZUWA 5FOJA 4PGDB 4D9QD 5JHDD 2HLAB 4QRBA 2QLYA 4HLZH 2ZUWA 1DBMH 1PYWB 4XCFH 3QFDB 5HD8C 4L29B 5BV7H 3IGAB 4PGJA 3MA7B 3LXUX 3QXUA 4L8SB 4LHUD 3TH4T 3D09A 1KT2B 1KGCE 3T65A 1AO7D 3LRMA 1L7IL 1PZCA 1DEEA 3ZY7A 4FNQA 1J9SA 2AK1H 5DS1A 2P5WD 1M57B 2FYYB 5FYJH 3KLHD 1ZT7B 1PSKL 2X4SB 3AT8A 4AKPA 3CWGA 1K2DB 25C8L 4EI5C 1H5BB 2HSIA 3V9CA 4XO4A 2YKKA 4N26A 3BLBA 1ZHKA 1NGWA 3EH2A 4MAUH 4XVJH 2FD6L 4PJ8A 4KRMB 1CLYL 1WS7A 4JFDA 3QYMA 1NFKA 3KPNA 3HLKA 3KXFE 3M8OH 3VWKA 2CK0H 2VH5H 5K1NA 3B56A 1DZBA 1S7QA 1AGEB 3EFOB 4D9RE 3D3VA 4HPOL 3IFPB 2J1WA 3A6BH 3G6DL 1XH1A 4ELKB 1EO8H 4KO7A 3GI8L 3ZZSA 5IW6A 3THML 2PCFB 3QNYA 2GJRA 5TE7L 5IQOA 4AIXA 3S35L 3KZ8A 2AS5M 1KCSL 1A6ZA 1AQHA 3R19A 3HC4L 4IRSD 3EAKA 5E2TH 5FM5M 4XNMA 4M5TA 1JIBA 3MUJA 1DQQB 4L3EE 5K9JH 1TOXA 5TK4A 4XCCH 4GAJH 3EYOA 1KTBA 4HHWA 4OLVL 4D9LL 3QJHA 4YDJB 1I1YB 2IAMB 1P5UA 2IOMA 2A74B 4GSDH 4PJBB 2QQLL 1QLEH 5DD0L 5DCCA 5SWQA 1FPTH 5GS1C 3C5ZD 3WO4B 3IPFA 4JFEA 3NTCL 1VEPA 1UXLA 1EFXA 3CDFA 4RMVA 3L5IA 5DHMC 5TGBB 3Q06A 1QFPA 4TVPH 2ZG1A 3EOTH 4LL4A 4P9HH 5D1XE 3ETTA 3X3FH 2DIBA 2KMWA 3BAIA 2WXLA 4R8WH 5DD0H 3UXFA 2J5WA 1GCYA 5H37G 3P2DA 1MCNA 4IKNA 4Y5VC 4XNQB 5E8PB 1IM3D 3HZVB 2NY6D 4GO6B 1A4CA 2OX5A 1JHLL 3QUKB 3SE6A 4NO0A 2WGNB 3ZU8A 1HNFA 3T6ZA 5JYLA 4JNXA 1WBXB 1QPPA 3INOA 3QFJE 4E2OA 2ZXEB 4F7EB 1CGTA 4G6AC 4X6CF 1CGUA 2D3VA 3EG9A 3WS6C 3RTQA 1V7NL 1R5VB 4ZG1A 4BZ1A 1UA3A 1XT5A 5I6XB 2BP0A 3NSFA 3SKOB 4JFFE 1N9PA 3SDAC 1IKOP 5KYXA 1N6QL 5AVRB 1WS8A 3QORD 1VGEL 2BNRE 2QEJA 3QIUA 3LZFL 5J4MA 1VGKA 1U58B 4KVCL 3N1FC 2PO6D 4HIJA 3N41F 3SGJA 4U0QB 1S5HB 3HG3A 2V9RA 3CSYB 2TSAA 3P4MA 1QLFA 2DYRB 2J8UB 3EGDB 1TEFA 5CMAB 4OZFH 3KL3A 1WVZA 1BGXL 1D6VH 1MY7A 2Y0SA 4BXVA 1Y0LB 3WTTA 4YR6A 4O51A 4HBCL 3TFKD 2K0RA 3SOBL 1CK0H 1IGML 1K5NB 1PNCA 3TT1L 4LCIH 4FULA 2V6HA 4UQAA 4AG4H 5EO0B 3VXRB 1EO5A 5HPMB 1P2CA 4KHXH 2GYSA 4N2MA 1IBYA 3BX7C 3SDAD 4FMVA 5ISZA 1DO5A 1C5CL 3NDYE 1K5NA 4OIAA 4OCRH 4LOUD 1MVFA 2AQ3A 5C0CB 1IBHA 1HIML 4KKQA 1Y1DA 1XR8A 1EHLH 4Z7NF 5F7DB 1A5FH 1I1CA 2FEDC 4FTVE 2NTFA 4POYA 2OI9C 4UBDC 1BAGA 2Y1VA 1VACB 5GGRY 1JSYA 4R90H 2Y9RT 1YNLL 3HR5A 1J5CA 3C08L 5D6DC 5L7XL 3K6SB 4QOKD 4F91B 2AK4A 2WNXA 4N9GA 5MENA 4TRPL 4WV1C 1HNGA 4R9HA 1GTFA 2XKNB 2LOEA 3UDWA 4JFED 4JREB 1ROWA 4LFHG 4QHKI 4ZYKA 1U8CB 2W91A 5K9OB 3TBVB 5J9PA 4ZO7A 5DLMH 3BDXA 2OJEB 2X2YA 3NCCB 3C08H 1DCLA 1MCEA 1DVQA 3FO9A 3EHBC 3L3DA 3DGDA 3NCJL 3RUGE 4ZX6A 4PJAF 1J7VR 4M1DL 4H1LG 3TESA 5EN3A 5KVFE 3UBFA 3POHA 5KBPA 1U3HA 3OKEB 1IM9B 3Q2VA 1OSEA 4ERSH 3ZKND 2JXMA 3VD0A 4Z7VA 5K5YA 1MF2H 1S3KL 3P0YL 4G8EB 4LVNB 1QNIA 1XF4A 3GSNH 4U1IA 5IESH 3CDZA 4RISH 3V5DB 2XG4A 4DGYH 3TJHD 3RKPA 5EBGA 3A6OA 4IBQA 3TNMA 1PF3A 1T5XB 2UYLA 4CJ0A 2WINB 2Y22A 5EEUA 4EOWH 2QGCA 4KO9A 4G9FE 4WWKD 3NZ8A 1P6FA 2X87A 4E42B 1PJWA 3PV7A 4JM2B 1OLZA 2GK0A 1JXGA 1I7RA 1J9QA 4W4NA 3KYOB 3MCKA 3NJMA 3HVDA 5HHQB 2BVYA 4J2XA 4N0RA 4ABUA 2BP8A 2IBZY 2MPAH 3SGJC 4P2OD 2QKIA 4A63A 5HYSA 1MJJA 3RVWD 3V0WL 2BVQB 2HPTA 3UPCA 2OMXA 5LGYA 3QEQE 4S1SL 4LRNL 3VFMB 4HCFA 4PJAA 3RPBA 1DP0A 4RNRA 3O0RH 1BFVH 4H8HA 3GBNL 1U8OA 3OLDA 3DGCR 4ACTA 4FKHA 2IH3B 3DMMA 4NI3A 5C0FB 1I1AB 1S7TB 2ILLA 3NSYA 3BP4A 1Q9KB 5IIEB 3QR1A 4M5SA 1RZGA 2H1PH 1QFWL 3MXVL 1OQXA 2KQNA 3QXTA 3ZLQC 3DURB 2UXVA 1KYOJ 1KTDB 2BSSA 3DIDA 1NC2A 2MIZA 1KEMH 1YEDA 5DJDB 4YSSA 1TQBB 4X6CA 3NFPB 4AGPA 4PJ6A 4JR9H 1EEQA 4APXB 4Y9GA 2H1PL 2ZKWA 3W0WE 3EJSA 4J1UA 1LWHA 4ZMYA 3NJGA 1HDMA 4GBXB 3U46A 3RUGA 3G04B 2J73A 2P52A 4QY8A 3QC6X 4LARL 5A2AA 5DYOB 4BK5C 3QWNA 4LQFH 3Q5TA 1WICA 3MLTB 3IRCA 1IAIH 1IV8A 1HKLL 2AABH 1U92B 1J1OL 3VO0A 3H9HA 1NCAH 4Q9QH 3OR6A 4PLKD 4EIZC 3HUJE 1YVLA 4GAYB 4XMUA 1YJDH 5T33L 4IJ3B 3FB5B 3TOPA 1NINA 1ORQA 1WG3A 3HUJF 1QFOA 3CFIC 3TWCH 5GGVY 1NM9A 4BHUI 4ODXB 4IIQA 1CFQA 2C9QA 1I85A 5LGKA 1JYNA 1EXUB 1G5AA 2VDKB 1Q0EA 3ZDYB 4BFIB 5E6ZA 4L5FL 2XWBA 3THMH 5FYKL 1AZNA 2ROYA 4DAGH 4XWOC 2BSED 2QR0B 1K8IB 3KL5A 4RFNC 1UTDA 3EJJX 3JWNC 5IMKA 5JNYA 3IAQA 4B9CA 3EDEA 5IV2B 4I4WA 1XX9C 1XGTA 5GS2H 3QFGA 2YN3A 5JR1L 3RZCC 2W95A 5AB2A 5JZ7D 5C71A 4BFBD 4X7SH 4ZDHB 1INDL 2OSLA 2YFOA 3GNMH 4ZZKA 3FO1A 3LMJH 1B4JL 1UUSA 1PZDA 2JIXA 3BQVA 4NNXB 5HHOA 2BM3A 4HCRH 5AAMC 4HVBA 3H2WA 5A2BA 1WP6A 1ZVNA 3LKNB 5AUMA 5C7ZA 1CD9B 5JHBA 3QPXH 4FLSA 3MC0A 1P9MA 2ITEA 1RULL 1RZKL 1RUMH 1HHJB 3FUNA 3DX7A 3TCLB 5ANMB 2GC7C 1MLBB 2GUOA 3MRKB 2W9DL 1EANA 2YIHA 4NQTA 3ZKXB 1FA4A 1DSFL 4OY9A 4BKLB 2APSA 3R06B 5C09E 3E6HB 4QMEA 2B3IA 1ZHBB 2KC0A 2WXHA 1K9TA 5DC2A 3AREB 3QIBA 3HPJA 5TQ2L 2AEWA 5C0NC 1JZ4A 1Z9LA 3MNWA 4M62H 2RALA 2ZUVA 4NRYB 3SE4C 1MFEH 3AXLB 3FUEA 4OT1L 4H88H 3SDCD 3ZGHA 5IROC 3OJDA 3APNA 3D48R 2ADJA 1VESA 5GGRB 4QHNA 4IGBC 1COBA 3UACA 1W8NA 2ISDA 4V33A 4ELMA 3G5VB 4AUYA 4EXKA 5F9AC 1M1XB 3L8QA 5C1MB 4YZWA 1U33A 1MHCB 1T5WB 2D73A 2E4TA 3I9PA 4WKZA 5C0AD 1A4KA 4CMMA 2P80D 4W9IC 2X12A 5D5MF 2XBDA 4GI9A 3VQMA 5HYIA 1ZANH 3UG5A 1PKQA 3NN8A 3PWPB 5TH2A 4DZBB 5GGTL 2PR4L 1RVFH 3WNNA 4PREA 3F7YA 4C83B 4G6KH 5FLVA 4AYID 1OALA 2NX5D 3L9RA 5C09A 5CCKL 1CDYA 4XTRC 4N8CL 4QRRE 2XC8A 5FUCC 5DHYB 1BZQK 1HH6B 1UZ8A 1VF5C 4LIQH 3DWTA 4O02L 3ZHKA 1TSHA 5J57B 1ZXKA 3QPQC 3T0BA 1JF5A 5I9QB 2H0EA 4F57H 7CGTA 1DQMH 2B4CL 4WK2B 1MZYA 4HC1H 4PJAE 3RUGF 1ZGLA 2RFXB 3Q2WA 4DPBX 2JJVA 3A3YB 3ZO9A 3WUWA 2FJUB 5EBMA 1SEBA 2OW6A 3BFWA 35C8L 1AZZC 1SXCA 5EWIH 3K72B 5F0PB 1LE9A 4PG2C 2GFBB 2OLDA 3S6CA 2FL5A 1WZ1L 1Q1PA 3IFNH 1KJVA 3PWPE 3SCMC 1AO7E 1WBYB 3NBNA 2OXHB 4XOEA 1BX2B 1F2QA 4NYLB 4LIQE 1QZNA 3M1BA 3MREA 3C87A 4F9PA 1MNUH 4WNQA 3N40P 4JG5A 4TULL 5IMLB 4YSDA 3CHSA 1XGUA 5IHUH 5F7NC 4WRLA 3GSVB 1NGPL 2B9BA 4NUGH 1HHHB 3FYEB 2XXGA 4XO5A 2AI0L 2R56H 1E30A 1P7KB 3T2PA 3STLA 2PP9A 4PJIF 5TE7H 4RFOH 4Z7NE 5IJDC 2FQFA 4L4TB 4KKNA 1P53A 4X83A 3BC9A 3RBGA 3F58H 3FUHA 4TRPH 3GMRB 2GJZB 3O0LA 4XVSH 2OYPA 3K1KC 2QR0A 4MJIB 3P11L 1B9ZA 1U8LB 1OSPH 4JFXB 3RLSA 3ZDZF 3QHFL 4RAVB 4WFFD 4JRXA 5FUCE 3EGSB 2F58H 1Y18A 4QT5B 4BQBA 3QH3A 3GRWH 1UJ3B 3QB7C 5ITFB 4AVKA 3RA7H 3C75A 4YC2C 3D4CA 3JVFC 5EORH 5MI0B 2X05A 2J44A 3P9LB 3QUZC 4M93C 2WINA 2WSPA 1Q1JH 4FF9A 4FNRA 4ZSOB 2DYPB 3NRFA 5GS0L 2HZHA 3IJ7A 3MRIB 3Q8AA 2C1PB 3W9EA 2VITA 1NAMB 4EIUA 1RHHB 5CZVH 4PTUB 2AEQL 5BZDA 3SE4A 1KCUH 4HYTB 5SV3A 1TVDA 2D7MA 1JTPA 5E99H 4M1GH 2P7TB 4XVUC 2VC2L 3IFOB 4EEEA 1WAEA 1ZLEA 1QAWA 3GXIA 4U1HB 3Q1SH 3RTLA 1NFDF 3P73B 3SBWC 5CS7A 1NMAH 3L2NA 3FK3A 4HS8H 3BP5B 1U2CA 1C16B 5E2UH 1XMEB 4PRDA 5LBSA 2E7CA 5ACLA 5LO7A 3GIZH 3OZ9H 3HMWH 5GS1A 1DQJB 3CZUB 2EC8A 4L4TD 4S0TD 1U8PA 2NY0C 4WEBL 3GMQB 1N5AA 5J13C 3RL1A 2Y4SA 1OT2A 4PS3A 4MB3A 1GRWA 1KIQB 1QWNA 3QUXB 2FHCA 4P3DA 2LU3A 3U4KA 3C8HA 4HOWA 2FJHB 1FNHA 1JNLL 5DJDA 1GGTA 4JEGB 4X4YA 3EG9B 4AL8C 4KKZA 5C3LD 5IFHH 5DMJB 1R19A 5ADPL 3M1OA 1QSFB 3U6RB 5DU7A 2M26A 5BNXD 2MKWA 3IK2A 4YK4C 5IQ7H 1KB5B 1OGAA 1OB1B 3K91A 2X44D 3AQDA 2PXYC 4XX5A 2W60B 5FW8A 5J13B 4H26A 1CU4H 4KZCA 3OZKA 3CZFB 4TUOB 1B0GB 3QCUL 1LP9F 2BFVL 1I3UA 3OXRA 4HEPG 5PCYA 1PU0A 4Z5RA 1EJFA 2ARJA 1QO3A 3BVNB 3ULVH 3VFRA 2JFCA 2IJ0C 1JF6A 4K94H 4TUJA 1FC1A 1SLVA 2YUWA 2R4SH 4HIEA 5KSUA 2IBZX 2PYEB 3IKKA 1MUJB 3MRQA 3WHXB 3F7KA 2OTUA 1R3KB 4NZ8A 1DUYA 5DJZA 5DR5H 2KLSA 4BUGA 5A6MA 3T8VA 1S46A 1TSRA 3WEXA 4YGAB 3EFDH 4PS8A 5CEZH 2VDOB 4H8PA 4JG1L 3SE9H 4JZOA 1E9PA 3C5SA 4J3WA 5GS3A 1A47A 2C9XA 4HKBA 2H45A 5A7BA 1B0WA 3BGAA 2BS9A 3U4AA 3TBYB 4CC1A 3J2PA 4RMTA 5IB3A 1TQTA 1T2QH 3G6AB 1N64H 2FSDA 1PFCA 3FTXA 2VDQL 3ZT6A 2XTJD 3IJHA 4PB9L 4XPTH 5DJ8B 2VAAA 1MW2A 1UOWA 1JZIA 4PJHA 2QV2A 2QPUA 5EO1A 2B0SH 4Y9BA 1KIPB 1IBFA 3VX1A 4U4BA 3S88H 1BVLA 4XN4A 4HQQH 5HI4C 6CGTA 2CH8A 3MFGB 5AKVA 3QDJB 1CO1A 1L5GA 2AANA 4HWBH 2WQRA 5DRNB 4PRBA 2V8MA 5DGQA 2Z8VC 4ODUA 5EFIB 5HVHB 5A16A 4NKIL 1ITBB 2UWEA 3KPRD 3TBSB 3VFWA 3MR9B 1PDKA 1WF5A 2I5YL 2HVBA 2OJEA 4KO5A 4P4KA 1R3IH 1W0WA 4AUUA 2QVFB 1TTCA 1X5HA 4Y4HB 5D2LF 2BK8A 5AW9B 5J1AA 4EIBA 4F33A 3KBPA 5CIPB 1MREL 4JUSA 1RPUA 2WM0A 3HRZA 3EH1A 1MW3A 1GZQB 2G75A 4C58B 1UG9A 4W4OC 3R0NA 3X14B 3TASA 3UC0L 5KSAA 4MRBA 3NYKA 4LE8A 3E8UL 4U1NB 4OUOA 4UT7L 3QCTH 3MNVA 1D5MB 3AS0A 1ACCA 2F53D 3MJ9H 1RY7B 1G7MA 3CDGB 5BOZG 4I18A 4Y4HC 1G6RB 4FQIH 4JE0A 4Z3EA 3V4PH 5LWYL 3MR9A 5I0ZA 4W9KC 3RL2B 2X10A 3BKYL 5ICYB 4FI7A 5AZ2L 1ZK9A 2NLJA 4I0PD 3DHUA 4Z77A 4YJZL 2XFXA 3NT0A 1ZHNA 3AU1B 3VACA 5J5EA 3WFEH 1NJ9A 2YWZA 4YDMA 4PW3A 1A22B 1VFMA 3CFUA 4HWZA 5F6HI 4KQ4L 1WZAA 1BSIA 1JRHH 4L4JA 3GMLA 5EUOA 3UYRH 2Y3AA 3HOGA 4KKRA 5HDWA 5C07A 5ELIA 4I18B 1R17A 5D2LE 3PNWA 1R5IA 1A3RH 3B2PA 4U1GB 2Y7MA 5IW6B 2F54E 5CLWA 1N3NB 1TZGL 3LQMA 2DQGL 4EVNA 3QNXA 4QO1A 4J3OD 5SWSE 3PWVA 1PQZA 3HNVL 3ME0B 4PTTB 1R9FA 2P8PB 1OTUD 2AEPL 2F8OA 2Y72A 3L16A 5GRWA 3ULSB 4HKZA 2QVMA 1I7ZB 3V4VL 1L9QA 3UAFA 4BEIA 3O3DA 4ZSOA 4CSPA 5CJBA 3NIFB 3TZVC 5KYXB 2BMKA 2VABA 1BOGA 3EYVB 3L4TA 4OGQC 4DZ8B 1JMXA 1V3MA 3P40A 6PAZA 4AJYV 5ACZA 2RMNA 1GGIH 3SE8H 1KCBA 4JFHE 3V4VA 2F53B 1KGYE 3OLGA 2VZVA 5AWNH 1AFVL 1H5BA 5E0FA 3WHXA 3UGUA 3CLFL 4MA1C 4N8CH 4X9BA 1A4AA 3ARXA 5HYJA 2CBOA 1L0YA 5J6HA 1A6UL 2HRPL 1U8HA 2K3HA 2OYLA 3QZOA 3OXSA 4R8WL 5DS8A 2JQAA 1E4HA 3SD2A 2BSRA 5KS9B 1FVCA 1OGAE 1G5GA 1EZSA 3SE8L 1OGSA 2EYSA 3ESVF 4OIBA 2F1AA 3BUPA 3GJFH 2NXZB 4P5MA 2D8KA 4AKQA 3HKZA 5IB5A 3WKQA 3F3HA 2WXMA 1HL4A 3L08A 1G9NL 2XUWA 4PV9A 3QI9D 1Q0XH 4NX0A 3O8XC 3N41B 2OMTB 4U6VL 4MNQB 5KVEE 1A25A 1ORSA 2IPKB 1AI1H 2YPKB 3CZEA 5KVFL 3II3A 4X7TA 1NPJA 3FU5A 2R1XB 4Q6KA 1CC3A 3GSXA 2YRPA 1F3DJ 3CVHH 4XE5B 3LHAA 1ZSDB 3ZE1B 3EJYD 4P5RA 4Q52A 3UTSE 5C2BL 2HJKA 3MVSA 4ZTEA 4L4VA 4PJXA 2VXTH 3I3DA 4QHNB 2EEAA 4KTEL 3ZQWA 5I30L 3BP5A 4NSKB 4MQ7A 2PYEA 4F1ZA 4JFTA 3X13A 3STLB 3GS7A 4Y4HA 3HFFA 3LHPH 5IF0B 3TFBA 4HPOH 3JTSB 4QD2E 3OKLA 1AMYA 3RIKA 3VGEA 3CX5J 3NFNB 4CW1B 3TWYA 4KNTA 1KYOK 3D4GA 1RERA 4X80L 3NABL 4UBDD 2FBRA 3LB6C 3QQ3B 4AGNA 4AVHA 4KZDL 1E7UA 2H26B 2HVJA 3MYJA 1BLIA 2R1WA 1TZHB 4EPSA 1TJMA 3OKDB 4LQ1A 1KBVA 5GJSL 3SQRA 1UB5A 3EGSA 2HKHL 3WGVB 5DK0A 4MSWB 2OP4L 1NFDE 5I1CH 4HDIB 5ESAA 2WN2A 3N06B 4QXUH 4XP1L 3BVWA 5IR1A 2N1KA 2EQDA 5GGUA 3OAZK 1TTUA 1WFNA 1AJ7L 1ZV2A 2WQSA 2K45A 5BUPA 3E8VA 3FRUA 3V0JA 4FQJL 3RWFB 4OZ4B 4OV6F 4HMCA 1O9ZA 5AW6B 4E41D 3MHZA 3ETBF 1CFTA 5DA4A 1XGTB 5L2KD 4DKDC 3IAGC 4F2MA 5I1CL 1QRNE 5C0BE 2G4GA 1A6AA 4XVTL 5IMKB 5JNYB 4QF1B 4P9HL 3NZUA 4JDTH 3M1BB 3MREB 5H4ZA 4QRSA 2MQCA 4LHUB 1WBYA 1K72A 4FCHA 4YNYB 1KN4L 5EBWB 3QRLA 3FF7A 3WFDL 1GOFA 3TONA 2DQFB 1JXKA 3BAXA 4HIIB 4ZX3A 1NCDH 3KGTA 5DD1L 3ZYIA 3CPLB 3TNNB 1BZ9B 2E5EA 4XNZC 3CMOH 1H3TA 2QZQA 3PAZA 2WMPA 5CAYB 1IM3B 4U1KA 2X0WA 3RWGA 1BQHB 2XDHA 3BWUF 3IBEA 2V4LA 1GAFH 4G8FB 1TUPA 2YKLH 1KG0A 2PPDA 2K3TA 5TDNA 4PV8A 1CK0L 4JFYB 4RAVA 4RGMC 4CA4A 2MPAL 4I2XB 5FYKU 1SJXA 5DMGD 5KJ7E 2YA1A 4AEIL 1KB5A 1OGAB 4KROD 4CKVX 5IM7B 1BZEA 5IQLA 2HKFL 5IHZA 1KBGH 1I8LC 4N2HA 3VFPA 2NY2C 1IC5L 3LQZA 4QRUB 2ZICA 4DKTA 3QNZB 3I9GL 4MJ6A 4LLDA 5D7JA 1XGPA 2VMJA 4HUXA 3A6CH 2L7QA 1UADC 3JSSA 4ZZFA 4C47A 1BQHA 3PGCA 1HOEA 1LP9A 5K39B 2YO3A 5B3NA 3B2VH 2CPCA 2LLNA 4BDVA 1GSKA 1WIUA 2ALAA 1R47A 2J6WA 4KC3B 2XXFA 4PH8A 3US1A 2D31A 2IG2H 4HXAL 3CC1A 3RFZA 1H9VA 4PRIA 1HINH 2DMKA 3BFQG 3WOVA 2QHRH 5KZCD 3D07A 4LAQL 4F7TA 2VLKD 3EGXA 4D2NA 4QKXB 2HX7A 2ODIA 1TNNA 4S1QH 3B2VL 5C3TA 4RMUA 4TNVK 5F93C 4I48B 5IOKA 3UCQA 1HDMB 3KWUA 2DM7A 3U6XS 3TEZA 1LO3L 2JQMA 1T1XB 2NW2B 2VZTA 3IJSA 1HJBC 3D5OF 2DWXA 4FN0A 4PJ9B 4LPVA 1J9CT 4X42A 1UOKA 4K9EC 5B7EA 3O4LD 1EJ8A 5D4IA 3MUZ1 5IBUB 1AGBA 1O6SB 4F2ME 3ELAT 5KYWA 4HJJL 5A1AA 3SCMD 1E2VA 4QWWD 3DVGB 4LPCA 3JWDC 4BGLA 1T03L 4ZFOA 4N1EA 4WI7A 2ATPA 2ICEC 2UX7A 5DK3A 4Y19A 3KLDA 2IGFL 1FVDB 3RKDD 5EA0H 1HOCA 1X6NA 5IESL 1CF8H 1FH5H 2X7LB 1SDYA 2UYLB 5AL0A 2AQRA 3FPYA 4I3SH 3FOMA 4EAEA 5GRVK 5TFSL 2V2TB 1G43A 4ZDHA 5HGGS 5J12C 4U1SB 1H3WM 3FU7B 3TL5A 1T0OA 2FWOA 3GLEA 4XAWH 2E86A 3HZ3A 2NXYC 4HLZG 5T3XD 4WNQB 3KEDA 3CHPA 1OZUA 2X6BA 3FTYA 4EIGB 1UCTA 2FYVA 1HQRB 4J7RA 1P4BL 3ALPA 2WK2A 5D1XA 4JQIA 4A6YB 4LPUA 4ODWA 4LLUB 4DK5A 3BKYH 3ESMA 2AC0A 4PLKC 4WI0B 3L48A 2QSQA 1HVXA 4FHBD 3QULA 5T33H 5T5FH 3F7VB 2XWTB 4PJ7F 2XZAL 4KKBC 2F6AA 4PAZA 1FI8C 2KH2B 1BAFL 3GMPB 3SBPA 4A6YA 3MMEA 2E7DA 3CIAA 4LEOB 4NQUA 4XRCA 3NSJA 1Q9KA 5IIEA 1WFJA 5ETUB 5J3HD 2OCCB 1EDYA 4KKLC 2IQAB 4PV9B 2VXSH 3WNJA 1G7PB 4XNUH 3U2SB 2X2IA 2EUVA 3RDTA 5SV4A 1LEKB 1C7TA 3GNML 4LCCA 5ICZB 2O5YH 5CN1A 3LKPB 4APXA 4JR9L 1JE6A 5IHZB 4GBXC 4JY6B 5FEBA 4BSJA 4OFYA 4HOZA 4PJBE 4HDIA 1K4DB 3C6LA 5ESAB 3FFCE 4QTHB 3GF8A 4NUMA 4FGMA 2W07B 3EO0B 3CDCA 2VYRE 3QYCA 5K9OA 2GI7A 2G5BB 3ZQ9A 1G7QB 1UC6A 3NJNA 4WW2F 5C9KA 2X53A 2BIMA 3QQ9D 3D08A 1F45A 3WAKA 1RVFL 4UQDA 3LEYL 4UAOB 5HDBE 3ZIMA 3L1OH 4GS7B 1K3IA 5JQ6L 2ZSWB 3D8MA 1ETJA 5FV1L 4KUZL 4EN3D 1KFAL 4PB9H 1HILA 3K2IA 1DDTA 3QCVH 4IKIA 3OKEA 2YSSB 3FQWA 3PNWB 3BDBA 2YUXA 1BWWA 4HKXA 3VQLA 43C9B 2DOCA 3UPRB 3OL2A 2P3YA 2DW5A 4DPRA 2FZ3B 4GP4B 4K3JH 4YPJA 3GLZA 1NFIB 4HPYH 4OLZH 4DQOL 5DC9B 3ZYJA 1JUFA 2VLKE 5LHDA 5D1ZC 2GK0B 2ZX5A 2AHIA 1QA9A 1EZVX 3PWJB 1ZSDA 1S9XB 2Y07L 2ZUUA 4ZX5A 5HYFA 2F7OA 2X4TA 4NLHA 2R9HC 4ZUVA 4K3JL 3CFKB 1W72L 1H3XA 1IGCL 4TVSa 4R7NB 2GT9B 3IXAB 1X5ZA 3FKUS 2Y69B 3BVTA 4GBXD 2Y6SD 2X70B 4JX0A 2NRDA 3W11D 5I6KA 2XPGA 4NDMA 3ZL2A 1G7IB 4OJEH 1H19A 3QWRA 3QZLA 2ENQA 5LNEA 2B1AL 3MTRA 3U79A 5I8OH 4WEUD 4XNQA 3MGTA 4XVJL 5HGDB 3ROOA 3KPMA 5E1GA 3JTSA 1GGBH 1M7DB 1UYWH 2EKSB 2PYFA 4JO1H 3IJYA 4E9SA 3HMXA 4R96A 5CSGA 5G55A 5HGBB 1Z9SA 3VXPB 1BM7A 4OFDA 4R7VA 5BW7C 1NLDL 5GRVL 1TLKA 5FA3B 4OGXL 5C08E 4IQHA 2R0LL 4M6MH 4LL9A 1WGVA 3BT2H 4GKOA 1DBJH 4WO4B 4HKJB 3TBSA 3VFWB 3BYYA 4TUKL 3L3HB 1FGNL 1MAKA 1P4UA 4M02A 4XB8A 3CQQA 5CJQL 3S35H 1A6VH 3SPIA 1MRDH 2AK4B 2XPZA 4AI7A 5JPMC 4D94A 3V7MA 2ARWA 2VLRA 3VGBA 2G30A 3WG7B 4AMKH 4WZ9A 4AX3A 3LH2L 5I1EH 1OTTD 3C5ZC 4M03A 3DK2A 2OR8A 3PXJA 5CFHA 5CSZB 1II4E 3ARWA 1EA9C 4M1GL 3RE0A 5AVVB 1VADB 1DN2A 4WHYH 3HCVB 4C8XA 3WAJA 5E5LA 3DIVA 3D85A 4K5MA 3BVUA 2IPTL 3DOSB 3W9DA 1SXBA 1FL6A 5CSZA 1L7TH 1KJ2A 2DM3A 1GTNA 4OV5B 1Q9WA 5DD1H 3ISWA 3VRIA 1I7TA 4PJGA 1FVCB 3GBMH 3V0IA 1P2CB 1TENA 4HT1L 5AG9A 3RA7L 3C5JA 4FXKB 4ATTA 4Q9RL 3ZTJH 1AQKH 3EJRA 4R97B 1GSMA 2FK9A 3LAFA 3H9SB 3MRNA 5JXED 3JQOB 1DQML 2B4CH 1XIWA 2I85A 2OA9A 4MGXA 5AW2B 4APQB 4R26H 3GMMA 3HPLA 4KJYB 1ETB1 5FOBA 5HHVH 3VD2A 4N0YH 3Q1SL 4C4KO 7FABL 8CGTA 1NUNB 2XQYG 2ZP8A 4PY8I 1T21A 1PNDA 1EAOA 4FXKC 3TZVA 3U4BH 4H1LH 4KHTH 4BSVA 4ETYA 5L88L 1NBZA 2HT4C 1I7RB 1J5IA 4C57C 3MV8B 2YAHA 4ZQKA 1G9NH 2XPYA 3DJSA 5C92A 1MVYA 1MFBH 4L9DA 3C9NA 2YN5A 1MDAA 4WNSA 4P46D 4YHLL 5IVZA 4X7TB 4UTBL 5F1IA 3O9WC 5IFHL 4DKFH 5BS0B 2XJLA 3O2VL 4HX1B 4X4YB 3F01A 4F7MA 3JWDH 2VQ1A 3ATDA 4P4RA 3T77A 2Q10A 3NQIA 3EFDL 2HJFB 3PWJA 1E6OL 1C12A 1JFQL 3Q1EA 1ACXA 3BPNC 1DLHA 1LK2A 5DQJB 1X6LA 3C6SB 4QTIL 1XF5A 5E2WH 5SWZD 5T1KB 1W15A 1HTYA 4OLEA 2X0UA 3TA3B 1QSFE 2AKRB 1TZIB 3V4LA 3QG7H 1BD2E 3OM3B 1C12B 3U30C 1MG2C 2NY2D 5DXWA 3JWDL 1NPUA 4PRNB 3SDYH 2TRYA 2MQ3A 3WDIA 5AKSA 3BH8B 4HGWB 5GJTL 2A6JA 2R4SL 4IBVA 4OI7A 1CDUA 3GI9L 3GFUA 4I3RL 3RP1A 3MLUL 1TQCC 4HD9A 3SDCA 3AABA 2JJTC 4P2QE 3L4WA 4X0NA 1QD0A 4R96B 2IGFH 4G5AA 1BP3B 3FSZA 1M7DA 4U2YA 2C4XA 3LXCA 2O5XL 3CXDH 3NJJA 4Z7IA 1A7RH 3BP6B 4GQQA 3ULVC 1DLFH 3ARBD 3QNXB 4I3RH 4QO1B 5FGCE 3FT0A 3G6JF 4RIRA 3LZRA 3ISYA 4P46C 1IEBB 3IMWA 1JGLH 1IQDA 4UT9L 3V55A 3V4UL 5IG7B 3UTTE 5HVFB 2LFGA 2D7OA 1P4BH 4LSQH 3RHWF 3QZPA 3ZDXE 4EBQL 3RFRA 4ENZA 3PNRB 1I3VA 5K93A 4PYHA 2GUYA 2A9NL 1FYHB 1RAMA 3EFFB 3AU1A 4TNWF 2DLIA 5MEPB 3ARBB 5I74B 3AG3B 1XD1A 1Y6NR 2VC2H 2I24N 4MWFA 3WTWA 1S7RB 3MJ9L 3D25B 4BKSC 1PX4A 3KJ6L 4B9ZA 4JL2A 4E9VA 4KH9A 4K3DL 1TETL 3NVQA 1CT8A 2WYZA 3GD1C 1IGIH 1IEAB 3T0EE 1NM4A 1Z0NA 3D2UD 1UT2A 5IW3A 2KLRA 4JQVA 4KNUA 4MKTA 1XXFC 5KVDL 4JN1H 5EH1A 2KS0A 1TCMA 1ZDSA 1JZEA 1XTLA 4J4PA 4NCDA 2IBBA 4S2SB 5BZXA 2EXTA 2Z31A 3KJ6H 4H25A 4AUJA 5CD3B 4R7XA 3LV3A 5DD6A 1UGKA 1YN6A 1BFSA 1R3KA 5DJZB 1NEUA 3DROA 5IEHA 5EC1A 2AMUA 1IL1B 4FXGA 4JQIL 2FX7L 5C6WH 2SEBB 4Z7AA 1TTAA 4OZHE 2ZWKA 4KAQL 3AC0A 1NC4D 3WY3A 2QPEB 2JTDA 4DEWA 2V2TA 1W8OA 4G9FA 3N2JA 4R4BB 5C7XL 4JY6A 4MVBC 4EMZA 1I53A 3P9LA 3T4AA 4KGJA 4YDIL 1EEUA 5SWZA 1KF9B 2F8VA 5K59E 3T8MA 1KV7A 2CO6B 3ZRSA 1FO0B 2FT8A 4U1LB 3ASNB 4DK3A 2NY3B 1JZ3A 1BFVL 3LQAL 1FFPB 1RZFH 3DVIA 1E8ZA 1YCSA 3ARVA 5SX5H 2XZQH 2PF6A 4QXTB 4OF7A 2APXA 3QQXA 2PTUA 3RIFF 4R7NA 3W56A 3STZB 1NCBL 1QPKA 4G3YL 4NRYA 3KPSA 4NWUL 1GZPB 3VGAC 3MMEB 3B1TA 3HBGA 5FYJL 1QWHA 1MJ8L 1PLGH 2WSDA 4GSQA 5KJRH 2R69L 2AJUL 3E3QE 3LZPA 5CILH 4ZW8A 1THAA 3R4DA 4WWOA 3KPTA 3JYCA 2VRAA 4ODTL 3RVXC 4FFWD 4LCWE 5I75B 4MBOA 1IBD