2UY6A

Crystal structure of the p pilus rod subunit papa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
b'AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy6A01
3C60C 4M6OH 1RUMH 1N5AA 3MRJB 4PGDA 5ILTH 3P0YL 1U8OA 4H25A 3E8UL 1I8LC 4B5EA 3K8MA 3A6CH 3DGGB 15C8H 2AXFB 2YPVH 1RMFH 2APVA 3MGOB 3FO2A 5IV2A 6FABL 1MCCA 3V2AR 1CDYA 3JV4A 5EIIB 4GBXB 4OZFA 4XWGH 1HWGB 5KS9F 5AZEH 4Z95L 5EA0L 2B1AL 3DX6A 5E5UB 1IBGL 2X2YA 3FB7B 4MAYB 4JEGB 4TULH 3DUSB 5FECB 1MFNA 2EXYC 1TTFA 2R9HC 3UJIL 2UZXB 5IB4A 1P7QD 4MNGB 3SDAB 2P5EB 5AAMA 4LSRL 1FRGH 3QWQB 4MNQD 3RWGA 2MCPL 3OB0K 3DUUA 1BQLL 2IQAA 3BRGC 1T0PB 3MV9E 3QDME 3HN3A 4MJIA 4DGVH 3TZVA 3ULVH 4AL8L 2ZP0T 4HPOH 3VD7A 1F90L 3VD9A 4QHMB 4UDUA 3PL6C 1KXQE 5INCB 3RWHA 1T7YA 3SDCB 1IGJA 2EDBA 4CVXB 5DJZA 2DQJH 3MLTB 5F9DC 5GGRB 4XCEB 1DE4A 3QUXD 4MB5A 1HNGA 2AQ1A 3W39A 4ODHH 1DP0A 2HFFA 4L3EA 1IM9A 3MRGB 2IADB 4M61B 3UC0H 1A3RH 2XNAA 3NABL 4Y4HD 4KRLB 4OCLC 3JWNC 3PWJB 1U8HA 2VUYA 2VXVH 3MLWL 4CU8A 3KLAB 4WO4B 5MEOB 3HI6H 2PO6D 1PZ5B 3KPMA 2EXWD 4X9GA 1UG9A 3K74B 4WHTB 3MRJA 4MD0B 2C4FT 4HIXL 4RMQA 4QRRD 1UQSA 1MH5B 2B8OT 3N1QC 4G8FB 2P46B 3DGGA 2AXFA 2OR7A 3CDYA 3GI9L 1QBAA 2W91A 3JV5A 3EO9H 5JHLH 3MGOA 1CICC 4PG9B 2HKFL 4HBQA 1OQXA 2EDQA 4GBXA 1TENA 2Q1EA 5CSBA 4G7VH 1IFHH 1CDUA 3FB7A 4MAYA 1PZUB 4EDWH 1HHGB 3KPNB 3DVIA 5FECA 3BYYA 5L88L 1UB6B 1E27B 3CGTA 4FTVE 1DL7H 4PBWD 3SDAA 2XRAH 4MNGA 4WW1B 4HKJB 2P5EA 4HBCL 4D3CH 2APWA 3D48R 3R8QA 4EUPG 1T6WA 4J4PD 5JW4R 4N0RA 4NO0B 5E9DE 1JFQL 3GM0A 4JHZA 4HGMA 4NUJB 1NAMH 2DICA 1GIGL 1I8KB 4L4TD 5GIRB 4PG2A 5J0BA 4OSUL 4QHMA 2ICEB 3CXDH 3SDCA 1MCLA 4CVXA 5M7QA 2GEEA 3QPQC 3EJZC 3MLTA 3DXAD 4X80L 5GGRA 4XCEA 4UAOB 1SY6A 5B39G 2RHEA 4OZHB 1RJLB 4L8SB 3S35X 3MRGA 2IADA 4M61A 1QRNB 2D0HA 4KI1A 4M5ZH 3U4BH 4PJIF 1JL8A 2HRPH 3PWJA 1KV3A 1JV5B 2J8UB 3EOBB 2APXA 4Q2ZB 1QQDB 2GAZB 3KLAA 1P7KB 4WO4A 5MEOA 3FOMB 4JQVC 3C2AH 1PZ5A 2VLKD 1JF1B 4JCMA 4Y19D 3ZSSA 1A6UH 1MCOH 4O2FB 1N5YL 1IQDB 4WHTA 1WLHA 2ORBL 1A5FH 3QWOB 5I1EH 4MD0A 4S1DD 3DUHA 1SYVB 1CTOA 4GJTB 3O9WB 1U8JA 3CH1B 5HHXL 4JPVL 2IPTL 4PJ8B 5BRZD 1IL1B 3W2DL 4JO4L 2K7QA 4LNRB 3MBEC 4QXUL 4YGAB 2X41A 3P2TA 4EI6B 2VDRL 3PWLA 1B90A 5A3IC 1HHGA 3KPNA 4Y0GA 5ESAB 4CN4A 3VI3E 1UB6A 2ENYA 3BD4A 4WW1A 5ENWB 5SWQB 1V3JA 4HKJA 4PJ5B 4EUPB 5GRUL 3TFKC 1QLFB 1QFUL 4GMSL 5FCSH 1FYTD 1CD8A 4AK1A 2C3WA 4NUGH 4Z7WB 4NO0A 1WEJH 1II4E 4NUJA 3G6JE 4NKIH 1PG7H 1I8KA 1S7UB 3C09C 1MAJA 3MMEB 5GIRA 5FM8A 3BMWA 1JNNL 2ICEA 5EBLB 1U2CA 1A6PA 4QXTB 4PV9B 3QEQD 4JFOB 4ODXB 3BZDA 3O11A 2FGWH 5FIEA 2BVTA 3P11H 4OZHA 2ZKHH 5F70A 5L2KE 4L8SA 4X4ME 1TZHB 1H3UA 1QRNA 3V8OA 4MJ5B 4PYHA 3GHBH 3EOAB 5L7XL 5TE7H 1JV5A 4CU7A 2A1WL 2J8UA 3EOBA 1BM3H 5I8CB 5TQ0H 4HLJA 3VE0B 5LVEA 4Q2ZA 1QQDA 1P7KA 3FOMA 1IC4L 1FE8L 4FFWC 4NOBA 4HH9B 1JF1A 3PQYB 1NAKL 4JY5L 4OGXL 1QPXA 4WEBH 4YBHA 4O2FA 1X5KA 1IQDA 1KULA 3T0EC 1OAZL 3QWOA 5TF1H 1FGVL 1IC5L 1SYVA 4GMTL 3SOBL 3G04B 4KHXL 5GGSY 3O9WA 5D2NA 3CH1A 3EYUL 5B22A 2V5RA 3M8OL 1T5WB 2Y1VA 5IROA 1DBJL 4YNYB 4PJ8A 2LTQB 1IL1A 2P5WB 5ITFB 5SX4H 4BQ6A 3GMMA 3QXUA 3TH2T 5E95B 4GT7A 4LNRA 4Z77B 4EI6A 3KLDA 3QDJD 3Q2CA 4N8VB 5D1XC 5JW3H 2C4FU 5HYJA 2XOTA 1YY8B 5ESAA 4JM2C 4D94A 4MXWL 3IXTA 3S37L 4PUBL 3U48A 2NXYC 2W9EH 1AO7D 5ENWA 5SWQA 2EZ0D 1SEBB 3HMXA 4PJ5A 4EUPA 3L3IB 4A6YB 4FQQA 5A2FA 1QLFA 2VXQH 1TTUA 4V1DD 5C86A 4AJ0A 5MENB 4Z7WA 1OP5K 4K94H 5F3HB 3E0GA 3SGKC 1ND0B 1S7UA 4Z7NE 3MMEA 3OPZH 4IHOB 2JCCB 4NM4L 4KKNA 3ZHLA 5EBLA 4UQ3B 3CZFA 1A64A 3GIZL 4QXTA 4PV9A 1BOYA 4UUJB 1NMAH 3IDJB 3P77B 2O26U 4ODXA 1ZHNB 3U79A 3PG2A 4YX2L 4HJGB 4YJZL 5HBBA 4U6VL 3FHQA 3DYOA 5KSBF 1TZHA 1CLYH 1D6EB 1MCWM 4UILL 4MJ5A 5HVHB 5I8OH 2Z31B 5C07B 3RY6A 2F5AH 3EOAA 1CFSB 3DOSA 4MA7L 1ADQH 3RVUD 1YYMH 4IDJL 5I8CA 3RUGF 3B9AA 3VE0A 4YWGL 1N64H 4NNXB 4AT6B 4I77L 2VQ1B 4HH9A 4UTBL 3QP3A 2DIJA 1MFBH 4KI5F 3E3QC 1MFCL 2DWDB 4IJ3B 2J6EH 4PJ7E 2BFVL 1A21A 3CDCA 3G04A 5HI3C 4POYA 4Y4FC 4DFHA 1S9YA 5BV7H 2FYYB 1T5WA 4YNYA 2P5WA 3MRNB 5T1KB 5ITFA 2Z35B 4ZFOB 2H2SC 1B2WL 5ECJE 4Z77A 5FDYA 5IVXF 2XZCH 2X9YA 2XWTB 1ZOXA 1UM6H 1JZ8A 2Y06L 5EOCH 5ETUB 1YY8A 2NY5L 2DQHH 4ETYA 3BHBB 4LVHC 4QCIB 3S4SG 5ID0B 5DD3L 1Y6MR 3B2UC 5DHVA 3TBYA 3L3IA 4A6YA 4QRTA 4M6OL 1RUML 3DO7B 3QUZB 4EI5B 3EFFB 3SBWA 5DFVD 4YIQA 5MENA 5CILH 5ILTL 3L5WB 5F3HA 3KYMA 3A6CL 15C8L 3A6OA 2YPVL 1ND0A 1RMFL 1QVOB 3WUWB 2NXZD 3V6FB 1WT5A 2JCCA 4UQ3A 1ITBB 1GCFA 1IM3B 4XWGL 4Y88A 4DKFH 5AZEL 2P44B 3P77A 4P46B 2R0WH 3I6LE 4HJGA 4P4KA 3C60B 4Z7UB 4TULL 1J8HB 3ZKMD 4F9LC 4YZFF 4LHUD 1D6EA 3RTQD 1RUAH 3PP3K 1U8QB 1UXSB 4RX4D 1KCUH 2Z31A 5C07A 1FRGL 3STBA 4FRWA 4OJFH 1AXTH 3ZTNH 4H8WH 4NNXA 4K8RC 4AT6A 2VQ1A 3TT1H 4WW2F 3ZE2E 1YYLH 4DGVL 3ULVL 5HHQB 5JHDD 4HPOL 4KROD 3THMH 4N8CH 2DWDA 2FLBT 1KT2B 4LDLB 5EUOE 2R2EA 5I2IB 1XH3B 2AJVH 5AEAA 2DQJL 5IVNA 2FYYA 3X14B 4HDIB 4NJAH 2GSGB 3MRNA 5T1KA 3CJJA 3MLXH 5MHSE 2DS4A 4ZFOA 1YQVH 1CDHA 2F58H 2ZWLT 4ODHL 4QY8B 3UC0L 1A3RL 4UT9H 2MQ3A 2GY5A 1MRFH 2XWTA 4JRYE 4P4RB 1BGXH 3FB5B 5ETUA 3S4SB 1EH9A 5E8DH 3BHBA 2VXVL 4QCIA 3UJJH 1XIWD 2IJ0C 3PL6B 3HI6L 3OAZH 4IRZH 4CRPA 3DO7A 3QUZA 3QNYB 4EI5A 3EFFA 3FZUC 3L5WA 2IAMC 2GYSA 4H88H 1QVOA 3EO9L 3WUWA 5JHLL 3V6FA 5EDXA 2XI9A 3CFDB 1UCTA 4PJDA 2EEDA 2PYFB 1IM3A 4GXUN 1IGFH 4P46A 4G7VL 1IFHL 2VITB 1EGJH 1KOAA 1IQWH 4EDWL 2FGZA 3C60A 4Z7UA 2ZSWB 1J8HA 3DYPA 2VISB 1DL7L 1RZKH 1RZGB 1U8QA 2XRAL 3NCFB 1UXSA 4G6AD 2P8LB 4XTRD 4ZSOB 1F58H 2MWCA 1QBBA 4D3CL 2MCG1 1WZKA 2BRRH 5CSZB 2COQA 4NKDB 1CICB 2D2OA 1A2YB 1T66C 1G7IB 2VZTA 1U8PB 1HN1A 1NAML 3QUKB 1HXMB 4LKCB 4X99B 5DT1H 5HHQA 1HH6B 4YK4C 1YMHB 1J1OH 3CXDL 3IXAA 3WEXB 3QIBC 5I2IA 1XH3A 3FHAA 4YHYC 3FRUB 2V5TA 1IEBB 4K9EC 3X14A 4HDIA 1J0IA 2GSGA 5ICZB 1P9MC 2HTLD 3MV7B 4OIAA 1J5OH 4QY8A 4NRXA 3WUZA 2W0KA 4M5ZL 4LSSH 3U4BL 4P9MH 1WICA 2HRPL 4P4RA 3CSGA 1S7WB 2YD4A 2A74B 2V5YA 3FB5A 3S4SA 2DI9A 5E8PB 3VXUE 3PL6A 1M7XA 3C2AL 2YK1H 1G7MB 4Q74A 1A6UL 1MCOL 3QNYA 3UTZB 1A5FL 1QNZH 1EO8H 5I1EL 5GGSB 1FNHA 4JDZB 2XICA 1FL6B 2FBJH 4KKLD 3SQBA 2JJVA 4YE4H 1NGQH 3ZYOA 1RULH 3CFDA 2ITDA 1XR9B 1G0YR 1OTTD 5SX4I 2PYFA 1DBBH 2CUMA 3KLSA 4TNWF 4WI3A 4JGUA 3VWKC 2VITA 3U9PH 4LAQH 4R3SB 2GJ6E 4YUEH 4I9WD 2VISA 1YUHB 1LDPH 1KGCE 1OTUC 1RZGA 2GTZB 2P8LA 4ZSOA 5D6DA 4HD9A 1ZS8B 2Q8BH 4NKDA 4B53A 4NUGL 1CICA 3J8F7 3WE6B 1A2YA 1WEJL 4PJCB 1G7IA 2WMPA 4UDTB 5KSAC 3BVNB 1U8PA 3MBEB 2DN7A 4NKIL 4U2YA 3QUKA 1HXMA 1PG7L 4UI2A 4X99A 4GRLB 5SWSD 4XXCC 4IEFB 1HH6A 1JGUH 1YMHA 4W81A 5ISZB 4NBXB 1G9MH 4BKLA 3WEXA 1ZAGA 4JFEE 3FRUA 1I9EA 2FGWL 1AR2A 5ICZA 4HMDA 2B4CC 5C6PB 1U3HD 3MV7A 4J3VA 3P11L 3B9KC 2ZKHL 4Z18A 5IF0B 3QI9D 3HE6D 3D39E 4GAGH 3AS2A 4OLWH 5E99H 1K2DB 3GHBL 4N9GB 3OWEA 4X7SH 2OYPA 2A74A 2X1WL 5TE7L 3MTRA 5E8PA 4P23C 3MXWH 4XXDB 3C09B 1BM3L 5EU6E 5TQ0L 1NCUA 5DO2C 3UEZA 4Q0XH 2W9LA 1FN4B 3MA9H 1G7MA 2NW3A 3LSOB 4WEBL 2B7DT 3MNZB 5GGSA 3CFKB 5TF1L 4OT1H 1IRAY 4JDZA 3N9GH 1FL6A 3OKMB 3RPIB 3RL2B 2MPAH 5JIKA 4DQOH 2EDKA 2J88H 5JW3L 4JQVA 1S7VB 4R3SA 4U1HB 2R23B 2VLJE 2WP3O 3T0EB 2WWKT 1YUHA 4U1KB 3DWTA 2W9EL 2GTZA 3AC0A 3GSNH 2DLFH 4ELME 2A0LC 2VXQL 5DMYA 1JGEB 1ZS8A 4HXBH 4W68A 4XP5H 4X7EC 4C57C 3WE6A 3Q1SH 4K94L 1BHGA 4XVTH 3PGCB 4X6DB 3BVNA 2WIMA 1XZ0B 3WFBH 3MBEA 1EO5A 4GRLA 5D1XB 5EO9B 3OPZL 5ISZA 5IVOA 1A1MA 3K3QA 4C58B 4JM2B 4WENB 1BX2B 4MJID 3X13B 1NMAL 3TZVD 4PLJC 2VKXA 3H3KA 2NXYB 4U3CA 4J7RA 5EUKB 5IF0A 2FBOJ 4J8RB 4APQC 3AAZB 3C5ZC 1CLYL 3ILPB 2PCPB 3PHSA 1S7SB 1K2DA 4N9GA 3RDTC 5I8OL 1JZ6A 2F5AL 1RK1B 2DJ4A 3WHE0 1ADQL 1YYML 4L3ED 1IM9D 4XXDA 2HMID 1N59B 4NNYB 1S9VB 2BP3A 3VXOB 1N64L 3A6BH 5F9WC 1FN4A 1FPTH 3LSOA 1QR1B 1QSEE 3T65B 1MFBL 1LEIB 3OXRB 3MNZA 4N90D 2HYMA 4G8IB 3CFKA 2J6EL 2F9BT 3U1SH 1X5GA 2VLRE 1KB5B 5BV7L 3OKMA 2E7HA 3RL2A 1J86A 4KRNA 3KLHD 2ID5A 2XZCL 4AIZB 3KPSE 1EBPA 1UM6L 5I1IH 5EOCL 4U1HA 2DQHL 2KPNA 1H0DB 3T0EA 2JK5B 4N0YH 5CJ5A 4PJEB 5D71H 2WQ8A 4OD2A 4U1KA 5C3TA 4PGEB 4MAYD 1GZQB 4Y4FB 1LO2H 2VDLH 3DETD 3MUGB 1JGEA 5IESH 2JF1A 5IW1B 2BOCB 5CILL 3AM8C 3FRPG 1FVEB 5C92A 1J7VR 2P5ED 3PGCA 4X6DA 4N0CD 1XZ0A 4GG6F 4DGIH 5FHBH 1P6AB 5D1XA 3LMJH 4UQ2B 4NKMB 5EO9A 5GGQH 2W1NA 3RX8A 1T2JA 1MREH 1N3NB 3W0WE 2BSRA 2A73B 4GG8B 4JM2A 2HP4A 4LVHB 1BX2A 3X13A 4DKFL 4FZ8H 2QJDA 2R0WL 4NWTH 5EUKA 3SDCD 3BW9A 4XCCH 4V2CB 1CD1B 4J8RA 3AAZA 3ILPA 5E94B 1RUAL 2EYSB 3HA0A 1A02N 2PCPA 5A2JH 2APBA 1S7SA 4X5LA 1OT2A 2DKSA 1A47A 1KCUL 2YD2A 1OP3H 3SGKA 1RK1A 4HIJB 1U93B 5ALBH 1FNAA 4OJFL 1AXTL 1N59A 4NNYA 3ZTNL 1S9VA 4H8WL 3VXOA 3VDCA 4ZS6D 3DMMD 4Y1AE 1X4YA 3TT1L 1HHHB 1J0HA 1QR1A 1YYLL 1VDGA 2X4OB 4MYWB 2OR9H 2PR4H 3T65A 1LEIA 4FXGB 3THML 3OXRA 1VA9A 1U41A 5IP4A 4N8CL 2DL2A 2BNQB 3ARBC 4WO4D 3UJTH 3ARGC 3BJ91 4QHNB 4TVPE 4C4KO 2AJVL 2H26B 3P73B 5ADOH 1KB5A 1FO0B 2VB5A 3GO1H 4NJAL 2ICWJ 3MLXL 2AXGB 4HIIB 1YQVL 4WHYG 2F58L 5F7HA 3QDGB 2O5ZH 4UT9L 3ORJA 3SE8H 1MRFL 4GFTB 5EZLB 1BGXL 5DXWA 5E8DL 2DKMA 1H0DA 2JK5A 4PJEA 3UJJL 3MR9B 3NVQA 4PGEA 2CO6B 3MO1B 1MJ8H 4Y4FA 1DDHB 4IRZL 2BNRE 1CGSH 3MUGA 5IW1A 1Z6JT 2BOCA 4ZO7A 1NKOA 2VDPH 1VFUA 2E9IA 2OX5A 4H88L 4UQ2A 4NKMA 2J5LC 4NO0D 3HC3H 1K8DB 1N3NA 3WS6A 2IBBA 2N7AA 2A73A 4GQPH 1DQDH 2RJMA 3MC0A 4GG8A 2MSPA 3HUJF 4I0CC 1IGFL 1XCTB 2CUIA 1BIIB 5HDBF 2JB6B 2DQCH 1EGJL 5JA9A 1IQWL 2J8UF 4LLAA 3VXRB 1CD1A 2VXUH 2EEBA 5E94A 4IDLA 2EYSA 1RZKL 3DTXA 4RBPK 1F58L 2IAMB 2MTPA 4HIJA 2F8XC 4U05A 4M6NH 1U93A 4W6WB 2BRRL 3EOYG 1QRND 5JOEA 1YJDC 3QHTC 4OUUB 5JIIA 1HHHA 1BD2B 2ZUUA 4HW6A 2X4OA 5DT1L 4FXGA 2APTA 2BNQA 5CJXC 1J1OL 3WXVH 1X6NA 4KAQH 4QHNA 2H26A 3P73A 3GI8H 1FO0A 3BQUC 1YN6B 4I0PC 4K7PH 1NMBH 1VENA 5HJ3A 4HIIA 4LSUH 3O9WD 4HK3N 1J5OL 3QDGA 3V6OE 2DIBA 4LSSL 5J8OA 2W38A 2EDWA 4P9ML 4CVWA 4PJ8D 1P1ZB 5ICYB 2HAZA 5EZLA 4ODBD 4I3SH 1NCDH 2YOCA 3TYFB 5MP6H 4YK4B 3MR9A 2XV6B 2VSDA 3GBMH 5IWLC 3MPCA 5BCAA 3QIBB 3MO1A 2YK1L 4YHYB 1DDHA 4UOJA 1GGIH 3RKDD 4IIQC 3FRPA 1QNZL 1EO8L 1J11A 1QUNA 3ZE0E 1EAJA 2CDFB 4PJ5D 4XZUB 2FBJL 1QO3B 3HZMB 3CNKA 4HMCA 4Y16C 4YE4L 1MJJB 5J1SC 1NGQL 3DRTB 1RULL 3BIKB 4PY8J 1DBBL 5IBLC 4GW1B 5AZ2H 1OAYH 3LV3B 1XCTA 4NPYA 3IGAB 1OTSC 4Z8FH 1BIIA 1JF5A 2JB6A 3U9PL 3HZVB 4LAQL 2DI7A 3FT3B 1LD9B 5HHNB 3VXRA 4YUEL 3NA9H 1LDPL 3LN4A 4L8DB 3I3EA 1KENH 2D31B 4R6UA 3CU1A 2IAMA 3VRLF 2Q8BL 2NY6C 5KSUB 3G5XB 1P5VA 3BESR 3WD5H 4OUUA 3NPZB 2DOCA 1BD2A 5F97E 3SPVB 1C1EH 1JGUL 5DMGD 2IWGA 3VWKB 5IKCB 3NIFE 3VU2A 1G9ML 3FT4A 1ZLUK 3PQYD 1YMME 5GQBA 4L5FH 1LP9F 1YN6A 3IFOB 1P4BH 3L3OB 1V7NH 3RNKB 1CLZH 5FGSA 1IC7H 4GAGL 2XKNB 2HJKB 2P5WD 4I5BA 4N5ED 4OLWL 5E99L 1NCBH 4AIOA 5ICYA 5KSAB 4X7SL 5CZVH 3QUMB 4ORZC 2H1PH 1NGWA 3MXWL 5T1DH 3MGTB 4NN7B 4PP1D 4Q0XL 2ARWA 3MA9L 5C09E 4RGOH 3UTTE 5EORH 3PGFH 5JPNB 4JGJA 1BJ1H 2ICCA 1B9ZA 1P9MA 2NY3C 4OT1L 2CDFA 2Y7QB 3B9KB 4WY7H 3N9GL 4KJPD 2VNCA 3MRMB 1QO3A 4X7TB 1B88A 2P7TB 3HZMA 5F1OB 4KKBD 1VACB 5EOTB 4ONHB 1MJJA 3DRTA 3BIKA 1D3CA 2MPAL 4XPAH 3RJDA 5E1HB 4DQOL 4P23B 5FF6B 1LE9A 4GW1A 2J88L 4KRPC 4Y2DD 3LV3A 4JB9H 3IGAA 2CIIB 3QNZB 1IMHC 4Z7QE 2YPKB 3HZVA 5ICXB 3FT3A 1LD9A 1HK6A 5HHNA 5T3XE 3BISA 4L8DA 2D31A 2ZNXA 3GSNL 2DLFL 2X42A 1JTPA 4HXBL 4XP5L 3T0BA 2OCFD 3LB6D 3NIDF 5KSUA 3G5XA 5IM7B 3LN5B 5ANME 5IMOB 3O2WH 2NZ9C 3EJYC 3Q1SL 4XVTL 1I7RB 5GRVL 1RUPH 2Z31D 1H3VA 5C07D 3WFBL 4NQVB 3SPVA 4JZNA 3QAZC 3U7WH 4HPYH 3HMXH 3VWKA 5IKCA 4JFQB 1UKQA 5F7DB 1MJUH 5AG8A 4HV8B 4UB0H 3WIHA 4F7TA 3IFOA 3L3OA 2V5SA 3RNKA 2YD5A 1A7BA 5CZXC 1EAPB 3C8DA 3ZDZF 4TNVK 2CPCA 4NRZB 4X6CF 2XKNA 5IHLB 5T1KD 4PRBB 5KSAA 2ZNWA 1FFOB 1N0LA 3QUMA 2VOTA 3DSFH 1IKFH 4XXCA 5F1SA 3R06B 3OX8B 3MGTA 3RY5A 3A6BL 1FPTL 4QWWC 1MIEH 3HKFA 1T83C 2FR4B 5JPNA 3BXNB 4LF3B 2MQCA 4PJDF 4DN4H 3U1SL 5L8LB 2Y7QA 3B9KA 3ETBF 3MRMA 4X7TA 1CGTA 2P7TA 4APQB 3C5ZB 3I6KB 1YEJH 2CIKA 3QUZD 1VACA 5EOTA 4EI5D 5IR1A 1T0MB 4ONHA 3NCJH 4KRMB 3RDTB 5HPOA 2OTPA 1ZWIA 2QKIB 4P23A 2HT2C 1TXKA 3BO8B 3QEHB 3QNZA 2CIIA 5F9WB 5EZJB 3CFCH 2PTTB 2YPKA 8FABB 3O81A 2YUWA 5ICXA 5I1IL 4QRPB 1S9XB 5DMJB 2YPLE 4N0YL 1BQUA 1G7JB 5D71L 4JAMB 4P46D 2D7TH 2C4XA 3V4UH 1LO2L 3C60D 2VDLL 5E0QA 1J8HD 4DKEH 5IESL 4FTVB 1PQZA 2BXZA 5DFTA 4G9DA 5IM7A 3LN5A 3OR7B 1AKJB 1F2QA 1I7RA 4YPJA 3VDAA 4NQVA 4DGIL 4KUZH 5FHBL 3LMJL 5GGQL 1X5IA 4G6KH 1MREL 3L3KB 5ELIA 2ILLA 4HV8A 4FZ8L 5IG7B 4NWTL 5FYJD 3K1KC 3OL2A 1IGIH 4XCCL 2HTKC 1EAPA 2EXYD 4KV5F 1TQBC 2R9HD 4NRZA 1P5UA 5C70A 4PRBA 1JI2A 2WWMC 1ZGLB 5CGTA 1FFOA 3LN9A 3N85H 3TBVB 5ALBL 2RR3A 1H5BC 2VO5A 4D9QE 5J6HA 3KPRE 4L8BB 3OX8A 3ULUH 3QJHA 2NY4C 1GJIA 3G6AB 4PJHB 3U0PB 2NY7H 4G9FB 2YC1B 4HAGA 2O61A 1IC1A 4TRPH 2OR9L 1C12A 2PR4L 2VAJA 3BXNA 4X98A 1INDH 1IEHA 4LF3A 2DB8A 3PL6D 3UJTL 1K3ZA 2AEWA 1G7HB 3RWFB 5BO1H 3UTSE 5ADOL 1E6OH 4APQA 3C5ZA 2VDQH 3I6KA 4K3DH 4RCAA 1CFVH 1T0MA 3GO1L 3RDTA 3BN3B 3L95B 3UYPA 1IKNA 2ICWB 2O5ZL 5J3HC 1MCEA 3BO8A 2HT4C 1OCWH 3QEHA 3C5SB 4NQCE 3SE8L 5EZJA 2PTTA 4K3EH 4QRPA 1LEKA 1S9XA 1G7JA 4MZ3A 4JAMA 3ARBB 3ARGB 3P30H 2R1XB 5BS0B 1VFMA 1MJ8L 3OGOE 1CGSL 3ARXA 4OZIB 1JHKH 4FTVA 3H6JA 4MZ2A 5IEKB 3OR7A 5C71A 1AKJA 1I3RB 4ONGH 5JTWA 2VDPL 3BRFA 4GRWE 3B5TA 4QOKB 1CICD 3L3KA 3HC3L 2X4NB 3GIVB 1DQDL 4NCC1 4DZ8B 1T7ZA 2BSTA 4YDIH 3FN3A 2DQCL 4JVUA 5IG7A 1EK3A 1DEEA 2IC2A 3ES6B 4JG0H 3TT3H 2VXUL 4P57B 3AM8A 1Z3GH 5D4QA 5A1AA 1ZGLA 3MV7D 4RAVB 1KC5H 4M6NL 3TBVA 1MFAH 5T3ZD 2J5LB 2QADC 4L8BA 2NQCA 3G6AA 5DK0B 3U0PA 1XFPA 4G9FA 2YC1A 2P48B 3AREC 1HKLH 2V5MA 2H32B 3WXVL 2D9CA 1SJVA 4KAQL 1G7HA 3RWFA 1C5BH 4X9FA 3PF2A 1M71B 4FQHB 3QPQD 3EJZD 3GI8L 5HSFA 1UB5B 1MCSA 4K7PL 2A6KB 4HWNA 5D72H 5EBMB 1NFDF 1NMBL 2EEAA 3L95A 4LSUL 1E4XH 3WNKA 2ICWA 3SDXB 1ZA6B 3OKOB 5FYJH 3C5SA 5IFHH 4RWYH 1IARB 5DC0A 2ZG1A 4I3SL 1NCDL 2AGJH 3LPGA 3N1FC 5F71A 5MP6L 3GBML 3DGCR 1TETH 3ARGA 4M7KH 2R1XA 4O4YH 2QLVB 5DSCA 5BS0A 2OL3H 3QRFM 2C3GA 3D9AH 2W0FB 5F7MC 3UAJC 2XTJC 3BQUB 1GGIL 4I0PB 5C0EB 1NC4B 4G8EB 1P4LB 5IEKA 1PG7W 3DARA 4KDWA 4FXLA 1D5BB 4QOKA 2X4NA 4OQTA 3GIVA 1I1RA 4KDTC 5FYLD 4N8PA 3MBED 3VFRA 1NUNB 5AZ2L 1OAYL 1UXWB 4F3FA 5DJ0B 2UY7A 4Z8FL 5CWSB 5E7FA 5ISZD 2MKLC 5A3ID 5CJQH 1T3FB 4MCYB 2EDJA 3I3DA 2K7PA 4P2RE 4KPHH 3O3AB 4IIQB 3NA9L 4MXVF 3OQ3B 4P57A 3GGWB 1KENL 2BY0A 3IFNH 4KKAC 5I0DA 3TFKD 4RAVA 3SE9H 3FCTA 4Y16B 5T5FH 4L4VB 5E2WH 1CN4A 3WD5L 3DBXB 5D6CB 2GI7A 2I25N 4ZTPH 3F7VB 5DK0A 5BJTB 4PRHB 4LCCC 4HG4J 1C1EL 5GJTH 2FIKA 4NQUA 1K8IB 5D5MF 3X12B 4WFFD 2XA8H 1WWCA 1M71A 4FQHA 1DVFC 4L5FL 1MFDH 1UB5A 3F58H 4P2QE 5F8RC 1NMCC 1P4BL 1V7NL 2A6KA 5EBMA 2Q20A 3U6RB 5D70H 1NC2B 2W59A 3RPKA 2NY6B 1CLZL 3BIBX 4OIIH 3SDXA 1ZA6A 4N68A 1IC7L 4NN6C 3OKOA 4NZUH 4R8WH 1BEYH 5CP3A 1NCBL 4Z7VB 5CSGA 4EEEA 4KGJA 5CZVL 2H1PL 1QFHA 5T1DL 1XAUA 1TFHA 4CU6A 5CJXA 4ORGB 3NAAH 2I26N 4FFWD 5DD1H 4NZTH 3JVGC 4RGOL 1MELA 5EORL 5T3ZH 2W0FA 3PGFL 1W0WB 3BQUA 3T0ED 4I0PA 2G9HB 5C0EA 1NC4A 4G8EA 1P4LA 1U36A 5EN2B 2FDBP 5J6GB 2R4SH 4I2XB 1RVFH 4JM2F 1RJZB 4WY7L 1EHNA 3SKMB 4NQDE 1D5BA 3HFMH 2ADIA 4OLVH 4MMXC 1RJYB 1N6UA 4XPAL 1CGXA 5TE6H 2X70B 3HC0A 3M17B 3P4OA 5GSVB 1UXWA 5D1XD 5IWLA 2CRMA 4JB9L 5DJ0A 4PLNC 4XNMB 5CWSA 4M93C 4GXVH 1T3FA 4RIRB 4MCYA 2EKJA 4JM2D 1YEKH 3O3AA 4IIQA 2NXYD 2NY3B 2DDQH 4JM4H 4HK0A 3AMLA 5GRWA 4E41B 1ROWA 4Y16A 5GS2D 5EFIB 4L4VA 1FZJB 4LCWB 3O2WL 1CI5A 3DBXA 3JWDC 3I6GB 5D6CA 5JW5B 1RUPL 2XT1B 3F7VA 5BJTA 5KSVB 4KRPB 1NCTA 4F2MB 3U7WL 4HPYL 1K8IA 3X12A 1T7WA 3HMXL 1TPXC 1A4KB 2L7JA 3OB0H 4M00A 1MJUL 5CIPB 3IAPA 5SWZB 4UB0L 3S3SA 1TZIB 3GSRB 4DGYH 3V9FA 5F9JB 3U6RA 1G0DA 1NC2A 1UCBH 1J1XH 1FFRA 4XPGH 4J12A 3J7HA 4HHAB 4ZOCA 4M8QA 4C56E 5E5RB 3QAZB 3DSFL 1IKFL 1Q1JH 1MWAB 5JW4Q 4ORGA 1WAAF 4OM1H 5GS3A 1LK2B 1MIEL 2ZPKH 2WLZA 1W0WA 2G9HA 4MQSB 5EN2A 4DN4L 5J6GA 4I2XA 1RJZA 5HI3D 5IBTH 2LV4A 4Y4FD 2CRZA 1AE6H 3B8YA 1YEJL 2DQFB 1RJYA 3BP5B 2C9AA 3NCJL 2BZDA 5K9OB 2AK1H 2LABA 4Y4KC 2H2SD 1FP5A 2X70A 4CMHC 4XAKD 3M17A 1T5XB 1S8DB 1KCSH 2VWEC 4OGYH 4XNMA 3CFCL 1RY7B 5I76B 1FH5H 4RIRA 1LWRA 1GZPB 5DHYB 2FJHB 4G43B 1N6VA 2C3HA 2D7TL 5C0GB 1ODAA 3B2UD 4TSAH 3ULSA 3V4UL 1EEZB 4E41A 1SQ2N 2V9RA 3MRBB 4DKEL 5EFIA 1IILE 2AJ3B 1FZJA 3BP7A 2XQYK 4LCWA 3UYOD 3I6GA 5JW5A 5D7SH 3V6OC 4DEPC 5KSVA 4OD1H 4KUZL 1NFKA 4F2MA 2VUOA 1F3RB 4M4RA 4G6KL 1VPOH 1A4KA 4GKOA 3BZEB 5H8DA 3EZ8A 1XF1A 2ZOKB 3CFIC 5C0CB 5CIPA 2IPUG 5SWZA 1OHQA 3GMPB 1TZIA 3GSRA 3S5LG 4QHKI 5EUOA 4JFFE 2BNQD 1VFBB 1IGIL 3VFMB 1A7RH 2CGRH 4PJGE 1LQSR 4HHAA 5HHVH 1K4DB 3CK0H 1KYOJ 4XNQB 4AMKH 1A6ZB 4A2MA 5DI8B 3IU3B 3N85L 5D7KE 3QDGD 3FONB 2UZYB 1OT1A 5D2LE 4U1LB 1MWAA 3ULUL 4K8RD 1UJ3C 2NY7L 1LK2A 5GS2H 3H3BC 4TRPL 1OSZA 3QXTA 1VHPA 1INDL 2EDEA 2AJXH 5JOPD 3O8XC 5BO1L 2EKSB 5I1HH 1E6OL 1TQBB 2VDQL 1QFOA 2X4RB 4K3DL 4LSTH 1X3DA 4UT6H 2DQFA 1CFVL 3BP5A 5K9OA 3LKOB 4Y5YC 2XWBB 1BVLB 3BUYB 1UWGH 1H5BB 1T5XA 4ZO6A 1S8DA 1E4XI 5DK3A 1OCWL 4HGWB 2NY4B 2P42B 3K80A 1VEPA 4K3EL 1TTGA 4AEIH 5I76A 1T83A 1MIMH 1GZPA 4JFYB 4JVPA 2N4IA 4NIKB 3ARFC 5DHYA 4XPBH 2FJHA 4G43A 3WDJA 5C0GA 3MLUH 3P30L 3BN9C 1WIPA 2WUCH 4ZUWA 4CL7A 2DLHA 4NNPH 1AXIB 1EEZA 4UOW1 3MRBA 1JHKL 4PFEA 3VXRD 3SEPA 3IDUA 3KPLB 2AJ3A 4JVWA 3FZUD 4NC0B 4ONGL 1U8MB 2IAMD 4FFVC 5I19H 1NCWH 1MI5B 4P3WA 1MFEH 3BZEA 4QTHB 4AEHH 2ZOKA 2DKUA 4LCIH 4MB4A 2P24B 1JZ7A 2WBJC 5C0CA 1BD2D 3S5LB 5DS8A 1ZT7B 3HPLB 4YDIL 3AUVA 32C2B 3DURA 3JTSB 3VRIB 3MJ6A 1VFBA 4NYLB 4W6XB 4WU7A 4JREC 4JG0L 3TT3L 3VFMA 2ZJSH 1Z3GL 1K4DA 3JV6A 3VH8B 4XNQA 1JGVH 1A6ZA 1WIUA 5DI8A 1KC5L 3IU3A 1BP3B 1MFAL 1MCFA 3FONA 3T3PF 2R0KH 4U1LA 2V2XB 1T66D 4JG1H 1QR4A 1ZLWH 2EE6A 3SDYH 4NDMA 1G7PB 1HKLL 3C6LC 2DM3A 1U8KA 2F19H 3QIBD 1XEDA 2P8PB 1C5BL 2EKSA 3H9SB 4CN6A 3HG1B 2X4RA 5EBWB 5MEQB 4YDJB 1Z9LA 4P9HC 5D72L 5KVFH 1X9QA 3EDEA 3LKOA 2XWBA 1BVLA 3CSPA 4P48A 3ULVE 1E4XL 5TE4H 1H5BA 4S0TD 2QADB 4CADB 5FYJL 4HGWA 4F8QA 1I8IA 5IFHL 4RWYL 5KZCB 2AGJL 1FO0H 3AREB 4JFYA 1DLFH 3SQOH 3O2DA 2E7CA 4CDGC 1TETL 3O41B 4M7KL 4O4YL 4RDQG 2VLJB 2OL3L 5HVFB 5C0DB 1WZ1H 2V9QA 1KPUB 3D9AL 1RSFA 9CGTA 3WBDA 3EYFB 2F8VA 3KPLA 4K8RH 4WJ5B 4ELMB 3KXFB 1QEWB 2QL1A 3QO0B 1MI5A 3RVWC 2OJEA 1EUUA 1OP5H 1FCCA 3VI4E 4QTHA 1F02I 5H35A 2P24A 2ZCLH 3S5LA 1ZT7A 3HPLA 32C2A 1JPST 2E9BA 3JTSA 4OCXH 3VRIA 3VWKD 3WFDH 5CJQL 4EJ1C 4NYLA 2XTJB 4KPHL 4JN2B 1OTUD 5DVOA 3IFNL 1JRHH 4HUUB 3VH8A 3TNMB 1OPGH 5FA3A 3SE9L 4XMLH 5T5FL 2V7NB 5E2WL 1RIVH 2V2XA 5BOZG 5KSAD 4ZTPL 1A1NB 3BYTA 4UBDC 5GJTL 4ACPA 4YEEA 1G7PA 3IFLH 4C55A 1KTRL 4KI5C 1JUFB 2XA8L 2ZCKH 3MUJA 2YD7A 5E70A 1QSEB 2GUOB 3MV8D 3HG1A 3CLEH 5IVZB 1MFDL 3F58L 5EBWA 3CXHK 3S98A 5HHOB 5KTEH 4YDJA 4N0UB 1D5MB 5D70L 5IUSA 1FSKC 3B9KD 2VIRB 4KK8C 4OIIL 4CADA 1L7TH 4NZUL 1I75A 1BEYL 1HXYB 4R8WL 3NPSC 3WL9B 4IRJC 3KAAA 4XP9H 4LCCB 3AREA 1ZT1A 4P23D 4JO2H 3QISA 2HFGH 4WHYH 5JNYB 3O41A 1PYWB 1IT9H 5DO2D 3NAAL 5DD1L 4B7LA 1KN2H 4NZTL 1LP9E 2VLJA 5C0DA 1KPUA 5T3ZL 1DVFB 2I24N 3EYFA 1NMCB 1T04B 2IFGA 4WJ5A 2HT3C 4Z78B 3CFEB 1QA9B 2H2PC 4ELMA 2R4SL 1RVFL 5J9PB 3KXFA 4HZAA 3HFML 1QEWA 1FL5A 4NN6B 4OLVL 3QO0A 4NCC2 3OB8A 2RBLA 3I50H 4MNQE 1ZHLB 4OM0H 2E7MA 1ZTXH 3HHRB 4HIEB 5TE6L 3DLQR 4ZOAA 1X5HA 1R6VA 4LLWA 4GXVL 2ADFH 4NN5C 1YEKL 4JN2A 2NX5B 2DDQL 4JM4L 1Q94B 2XIDA 4HUUA 2A0LD 1C8PA 5DZLA 2V7NA 4IOIB 4MD4B 2VYRE 4KDTA 2XN9B 1A1NA 3LAFA 5HDOA 4QEGA 4WW2C 5AWNH 1XGUB 2V7HA 4DWHA 4M1GH 2X5PA 4M93B 1JUFA 2WW8A 3FAXA 5CS7A 4HQQH 1N26A 2VAAA 5F89B 1KPRB 1QSEA 2J4WH 2GUOA 5IVZA 4PLJD 1BF8A 4TNWK 5HHOA 4DGYL 3W11C 1D5MA 1UCBL 1J1XL 3ZO0A 3G5VB 3NIDE 4U0QB 4R4BB 4XPGL 3O0RH 5I1JH 2VIRA 4QRRE 2OI9C 4APQD 3C5ZD 3K4DA 4Z7OE 1ZVSB 4FQLH 1HXYA 3RDTD 3B6SB 1F4WH 2AV7B 1OD9A 3WIHH 2PXYC 1OGAE 1TPXB 1Q1JL 5KJRH 5JNYA 1CXFA 1PYWA 4OM1L 2ZPKL 4QRPD 3WNLA 1DVFA 1FIEA 1WFTA 3RA7H 2OXGA 5KVGH 1T04A 4Z78A 3R4DA 3CFEA 1QA9A 4I18C 2VSCA 5CHNB 5IBTL 5J9PA 1AE6L 1HDMA 1DBKH 4FTVD 1JWMB 5J56B 5F88B 2AK1L 1AKJD 4HIEA 3NN8B 1XGYH 1D5IH 2VLLB 3FTGB 2FH6A 4U1MB 1KCSL 1FHGA 4OGYL 3CAFA 4OCYH 3VFWB 3JVGA 1FH5L 3SN6N 5LQBH 3IKKA 2DQUH 5D1QC 3QIUC 1G6RB 2ZUQC 2NX5A 1I3VA 4R2GC 4TSAL 1Q94A 3VXTB 5GXBB 3DXAE 4Z76B 3QYCA 3EOTH 4Y4KB 1CGVA 4JDTH 4C59B 2OLDA 1YZZA 4IMLB 5D7SL 4CMHB 1F6LL 2XN9A 3CXHJ 4WUKH 5C8JB 4OD1L 4YHOH 3S9DB 1N2RB 3GNMH 2RFXA 3P9MB 2PTVA 1XGUA 5F6IC 1VPOL 4Y1AA 1Z0NA 4D9RD 3SGEH 5F89A 1DN0A 1KPRA 4G9FD 4UU9B 1XGQB 2VLKE 4LSVH 4LQ1A 4Y19E 3NMEA 3U82B 3G5VA 4R4BA 1YQ2A 3WFHB 4HC1A 1A7RL 2CGRL 1ZVSA 5HHVL 3VI3F 3CK0L 5TPWH 1BFTA 3B6SA 4AMKL 2AV7A 4DEPB 5BRZE 4L9LC 2EECA 1V3LA 3RGVC 3G08B 1DN2A 3T2NH 4MS8C 4QRQB 1CWVA 1OB1B 2P43B 5CEYB 4OV6F 2DLTA 4P3CH 3S3JA 3G6JF 5E8EB 3ARBD 3ARGD 2AJXL 4XI5C 2FL5B 1EHLH 5CHNA 5BS0D 1JPTH 1Z9OA 5I1HL 1UGNA 3PDGA 4TPRH 4LSTL 4UT6L 5F88A 1FYTE 5EIQA 4BYHA 1UWGL 2CK0H 3QZWG 3NN8A 4ODSH 2VLLA 4L3AA 4QHLB 3FTGA 2X1PA 3QPXH 4U1MA 3OMZA 4QOKD 1UJ3B 1I7UB 3VFWA 4AEIL 2G75A 1MIML 2Y23A 1EPFA 1G6RA 4XPBL 1ORSB 3MLUL 2WUCL 3O8XB 3QEQE 4NNPL 2QSQA 3VXTA 1A8JH 2C1OA 5DF0A 2XQYG 1WTLA 4Z76A 5MEPA 4Y2OA 1OW0C 4ZG1A 1T1YB 4Y4KA 4Y5YB 4IMLA 5C8JA 5I19L 3CMGA 3SKJH 5K9QI 1NCWL 3FN9A 1N2RA 1MFEL 4AEHL 4LKXB 2E27H 4LCIL 3RIAF 5CEZH 4UU9A 4GSDH 3D2UB 3ARFB 1XGQA 3IRPX 3WJLC 4OZGE 5KW9H 3O6KH 3WFZA 3BX7C 4IS6B 3WFHA 2CDEA 2ZJSL 3RWDB 4FQIH 1JGVL 3V6OA 3TJEH 1JRHI 1F4YH 3OV6A 4U1GC 3TCLA 3G08A 2R0KL 4HWBA 3BMVA 3NZ8B 4JE4B 4JG1L 4QRQA 3L5HA 3QDJE 4TN9A 1OB1A 4ONFH 2WBJB 3SDYL 1QZ1A 3FN0H 5E8EA 2F19L 3MJ8B 3UTTB 2FL5A 3S3PA 1WCQA 4Z7NF 4JREB 3ZKXC 4PB9H 2QSCH 1AO7E 3BQUD 4I0PD 1NC4D 1F6AB 1SJHB 1NFIB 1PAMA 4PP2B 5KVFL 5DFWH 4RISH 5E2VH 5TE4L 2NY2C 1A4JB 4QHLA 1I9RH 1QLRB 1UJ3A 3ESUF 1BZ7B 1FO0L 1MQKH 3BH8B 4HX1B 1DLFL 3C6LB 3SQOL 1ORSA 1FAIH 5L8KB 2J8OA 4IOSD 4X8JA 1Q9WA 1WZ1L 1YPZE 1NFDE 4CNIB 1QPPA 3EKCA 4K8RL 3NCYS 4D8PB 5TJWK 3UZQA 1T1YA 4KMTH 4Y5YA 5LWYH 4PJ7F 4WDIB 4Y16D 4J3UA 4L4VD 1DQQA 5J13C 3MNWB 2PUQT 5BQ7B 4QGTA 4QT5B 4LKXA 1PY9A 1PW3A 3D2UA 3ARFA 2ZCLL 4PRHD 5IBLD 5TFSH 1OTSD 4K7FB 2BMKB 3NFPA 4OCXL 1A7NH 5CJOH 3WFDL 5GS1C 1NGYB 4IS6A 5IB5B 1CVRA 4PJAE 1IAMA 3ABZA 4WWKC 4X4YB 1J0YA 4L8CB 1JRHL 3RWDA 3V0AC 1NC2D 4JPKH 1H9VA 1OPGL 5ID1A 2NY6D 4XMLL 1MCJA 2ZCHH 5LG1A 1RIVL 3NZ8A 2BNUA 2LU4A 3RZWA 4KC3B 3MUZ1 2WBJA 4WEUD 2L7UA 1FL3B 3T2OA 3IFLL 4B50A 3MJ8A 3UTTA 2ZCKL 5B21A 2UWEE 2Y6SC 1WIOA 1WWAX 2PW2A 3CLEL 4U7KA 3ZL4H 5KSBB 3GHEH 4LHQB 1SJHA 1F6AA 5KTEL 1NFIA 4PP2A 3RWIB 4HH8A 1CGUA 3MLVH 4R90H 2Y25A 1A4JA 3HC4H 5A43C 4F57H 1L7TL 2H32H 1ZA3B 3RUGB 1QLRA 3SDAC 3V0WH 2CKNA 4DVRH 4XP9L 3Q3GA 3BH8A 5I1DB 4EIZC 5HGAA 1BFVH 4JO2L 3C6LA 3QG6B 1Q0XH 2HFGL 4ZPVB 1IT9L 2VL4A 1KN2L 4XB8A 1J0KA 3EBAA 1YJDH 4HEME 4CNIA 5I8EB 5CP3H 3I6LD 4PG2C 2NY3D 3ZE2F 4D8PA 1FSKB 4E41D 4U33A 4WDIA 3OKYA 5EUOF 5DVNA 3BI9X 5IVXB 3NPSB 3I50L 3MNWA 4LCWD 5BQ7A 4IRJB 4OM0L 4QT5A 1ZTXL 3V8CA 5GRZA 1Z5LB 1Q38A 1OGTB 4W4OC 4KRPD 4K7FA 2BMKA 4JPWH 1G7QB 2D4FA 2ADFL 5JHDE 4X7CC 1U9KA 2IMMA 5IB5A 5JMOC 3QHFH 5SWZD 1HI6B 4LSPH 3VW3H 4L8CA 4YO0A 4OLUH 4LVEA 5DJ8B 2AI0H 3F7PC 4OCNC 4X9HA 4QTIH 3QXVA 2NZ9D 3EJYD 4F9PC 3UYRH 3KPRB 1FL3A 2HLAB 2BVYA 5AWNL 4K3JH 4M1GL 2GITB 3VD3A 2XY2A 4HQQL 4LRNH 4I3RH 2J4WL 2WIIB 4NN5B 4X9BA 4BZYA 3SGEI 3DI3B 4O2CB 5F93C 3DI2B 5EOQH 3RWIA 1YC7A 1V5JA 4DJMA 3O0RL 4R7DB 5CZXD 5I1JL 2MHAB 4MX7B 4XWOC 2OJZH 2F53E 2R56H 1ZA3A 5FUOH 4FQLL 4X6FB 3RUGA 3CVIH 1CXHA 2NY5C 5KOVC 1KEGH 3TWCH 1F4WL 3LRHA 4LVNC 3RZCC 5HPMB 3WIHL 1I4FB 3OKKB 5I1DA 3QG6A 4WW2B 5HDQH 3DX9A 2VN4A 5KJRL 1QFWH 4QWWD 2YPLA 1TDQA 3WYRA 5I8EA 3FJTA 4PGBB 3RA7L 5JOFA 5KVGL 1P84J 4G3YH 3Q5TA 1JMZA 4TQEH 2AEQH 3PV6B 2ED8A 2OI9B 3MJ7B 1DBKL 1G84A 4EN3C 2C26A 4U1JB 3CVHB 2H6PB 4IRJA 2VXTH 1J1PH 3VXQB 3O2VH 4LPWA 2Y07H 1Z5LA 5F7WC 3V4PH 1OGTA 2HT2D 1XGYL 2PXYB 1D5IL 3ARDC 4GRMB 4OCYL 1G7QA 2EDOA 4WTXA 1GOGA 5LQBL 2DQUL 2FSEB 5C0CD 2BSSB 3HI5H 2VN7A 3NCCB 1HI6A 2WZPD 4JKWA 4I18B 2YD8A 1YDPB 4I1NB 5DJ8A 3EOTL 1DQTA 3F5WB 4JDTL 4RBPH 5D2NC 1IGTB 4WUKL 3KPRA 4YHOL 3MROB 2HLAA 3GNML 3B9VA 1J8KA 3PP4H 2GITA 1I1AC 4WFGD 3ZT7A 2WIIA 5D1QB 3HTLX 3TBTB 3QIUB 1F3JB 2ZUQB 4LSVL 4O2CA 4R2GB 4FQCH 2D4DA 2BHZA 3R0MA 1ZT4B 5JDJA 4R7DA 2HTKD 2MHAA 1I3GH 4MX7A 3U9UB 1GOHA 4M9OA 1MLBB 1W8OA 2V2TB 4X6FA 4ONOA 4ZFFB 2WWMD 4FHBD 5TPWL 4P5TC 4MB3A 4U7MA 3VD4A 5HGHB 5HPMA 1B6UA 2FJGB 1I4FA 4LDOB 3TC9A 3OKKA 4BUHA 2Z4QB 1FZOB 3UO1H 3O45B 1T80A 2BVPB 5F6IB 3T2NL 1SM3H 2NY4D 5LAXB 1YEIH 5AUMB 4EOWH 3F7YB 5E56A 1HINH 1JZ5A 3VRJB 4P3CL 4PGBA 1B0RA 2ZG2A 4R4FH 4I9WE 1EHLL 1JPTL 5FUCC 2KBGA 3PV6A 3MJ7A 4JKPH 4TPRL 2DYPA 4D9LH 4PJBE 4U1JA 3WNNA 3CVHA 4WVRA 4WTZG 3VXSB 1JBJA 2QQNH 2ENSA 1L9MA 5DJ6B 3VXQA 2CK0L 1L4IA 5J3HD 2PXYA 4ODSL 3RGVB 2HT4D 2VDOH 1DZBA 1MI5D 1CIDA 3QPXL 4GRMA 3HR5B 1CIUA 4HT1H 5SWSE 5L6YH 1BIHA 1CZ8H 4BFGA 3RY6C 2FSEA 2BSSA 5DVLA 3KPQB 3BOVA 2DTMH 43CAB 5JQHC 4I18A 1T6VN 5E00B 4P2RB 1YDPA 2VZUA 4NFBA 5C08D 1Q8MA 4IM8A 3WHXB 2ICWI 3IYLW 4LNVA 4X6BB 1R3IH 1ZSDB 3GSQB 1ETZB 3F5WA 3T0VA 1UJTA 1IGTA 4YHPA 3SKJL 3ECBB 3IF1B 2UVEA 1CK0H 1HIMH 4M7ZC 3VXPB 1AGEB 2E27L 1W0VB 4UTAH 1EVTC 3GSUA 3PDDA 5CEZL 4GSDL 5D1QA 3TBTA 3QIUA 1QD0A 1F3JA 2CQVA 5KW9L 3QIWC 2NW2A 3O6KL 4FZEH 4JQIH 4RWHA 1ZT4A 1ZLUH 3H9SD 4LLDB 3HG1D 4P2QB 4YBQC 3U9UA 4S1QH 5H37G 5F7KC 4MLIA 3T08A 2HFTA 1MLBA 3LIZH 2V2TA 4ZFFA 2P47B 4FQIL 5HGHA 3TJEL 2FJGA 4ODVH 4DK3A 2Z91B 1F4YL 2Z4QA 5DA0B 4H1LG 3O45A 2QADD 2BVPA 1URLA 1LO0H 1T89C 4ELMF 5LAXA 1H3XA 5AUMA 1HQRB 1SYSA 5KZCD 4ONFL 3LCYA 3S37X 3ARED 3VRJA 1VGKB 4LP5A 3FN0L 2ED9A 1WT5C 4XCFH 2OZ4A 1RK0B 3LKPB 2VLJD 4DW2H 3HNTH 4PB9L 1FZKB 2QSCL 4KKCC 5GPRA 1KCRH 3ELAT 4RZCA 3N0PB 2BHYA 4NWUH 5HI5C 1SJXA 3VXSA 4P4KC 4RISL 5DJ6A 5E2VL 3KXFD 2I07B 1N5AB 3QUXC 4U1GB 2BERA 3RGVA 3F65A 4YGVB 1I9RL 3QBTB 2SEBA 2JLLA 1ZXQA 4H25B 3HR5A 4NZJA 1E6JH 3FFCE 5IHZB 1MQKL 1MVFA 4JFZH 3BE1H 3KPQA 1FAIL 4OLEA 43CAA 4D0DB 4MJIE 5E00A 4P2RA 1KTLB 3ZKXB 4BH8B 1M6OB 2XTJD 3UAJD 3SO3C 1CYGA 1QFWM 3ZYZA 5D93C 4PGJA 3U2SB 4X6BA 4KMTL 1ZSDA 3TLRA 3GSQA 1U3ZA 3ZKSD 5IHUH 2NY2B 5LWYL 3O2DH 3ECBA 3IF1A 4M6AA 3T0WA 4L3EE 1AGEA 1W0VA 4PJFE 1NJ9B 3MYJB 2CUHA 5TFSL 3EDFA 1A7NL 5CJOL 4N90E 4HKBA 4LLDA 4JGMA 4P2QA 2AJYH 1YECH 1OW0A 5I75C 1AXSB 1N6QH 5HHOD 5GGVY 4PRPB 4KKAD 3RWHB 4JPKL 1PBYA 4N5UA 5E5MB 4GW4B 2Z91A 1MHHB 3SJVB 4HSQA 1XGPB 1AQDB 1R0AH 2ZCHL 5J13B 1O0VA 1KLGB 1HQRA 4H0GA 2EIEA 3WJLA 1CDBA 4DUVA 1S78C 1CQKA 3EGSB 5GS1B 5GGTA 1RK0A 3LKPA 4TOYH 1T22B 1FZKA 4PD4K 3OF6D 1DVFD 2I9LB 4WWKB 1UA6H 3ZL4L 3GHEL 4WTZA 4LDEB 3KGRA 2J2ZA 1HH9A 3IU4H 3MLVL 4R90L 1TJGH 2I07A 2GCYB 3HC4L 4F57L 4YGVA 2P5EE 4XBEH 1K6QH 1UQSB 5JZ7C 3V0WL 4DVRL 5IHZA 1BFVL 4U31A 1Q0XL 1C5CH 4F7MB 4D0DA 1KTLA 4BH8A 1K85A 1QFWI 1M6OA 1YJDL 3VXNB 3MBXH 4RRPG 3L5XH 5I74C 2NX5D 3U2SA 3HLAB 5JIPA 2ZZUT 4XVUC 1GH7A 4YH6A 3A0OA 1QSFB 4P2YA 4IOFC 2Y5TA 2YSSB 4RMSA 5E8OA 1F8TH 1Q0YH 5BZWB 3D0VB 1ZVHA 1NJ9A 2XN9D 3CDGA 2CR3A 3MYJA 3MRCB 4HUXB 3K7UA 4S1RH 1Q9OA 3PV7A 2DM7A 5DUPH 5I73C 4JPWL 4ODUB 1MY5A 4PJ9C 3QHFL 5JXAH 4LSPL 2P45B 4JFFB 4YHIB 4ESKA 1AXSA 3VW3L 1E4KC 1OY3B 4PRPA 4TVPD 1JVKA 2PN5A 3QXDB 4OLUL 3G9AB 1SBBA 5E5MA 2X9WA 4GW4A 2AI0L 1ZKAA 1MHHA 3SJVA 1QTYT 4QTIL 4JKKA 1XGPA 2UYLB 1AQDA 4GG6B 5IB2B 3C8KB 4UNTA 4RQQA 1KLGA 3NBNA 3UYRL 1I85C 1NBYB 1NANH 2F54E 4KH2A 4G5ZH 4K3JL 1AI1H 5HGDB 1ED3B 3EGSA 5GS1A 1ZLVH 4LP4A 2A6JB 4LRNL 4I3RL 1T22A 1R3HB 6CGTA 4WWKA 2I9LA 3ZHDA 2Q76B 3STZB 5EOQL 1WZMA 5BMFH 3WS3B 3R8BB 1BZ9B 1NL0H 2GCYA 4BQBA 2OJZL 4RSVA 2R56L 1HQ4B 5FUOL 3CVIL 3GJEB 1TQCC 1KEGL 3TWCL 2YWYA 1KSRA 1U8JB 3IJHB 5D6DC 5F6HI 3IKCA 1CFQB 5HDQL 4F7MA 1QFWL 3T77B 3WO4C 3MLYH 1VCAA 4YHKH 3VXNA 1U8IB 2X4UB 3ARWA 4J1UB 3PWLB 4G3YL 4UMGA 2WBWB 2VABB 3HLAA 4CN1A 4W70A 4TQEL 2AEQL 5EOCJ 2PKDA 1V3MA 3N1GC 1QSFA 4OZHE 2YSSA 1BF2A 4YFEA 4LVNB 2VXTL 4YXLH 1J1PL 3RZCB 5BZWA 3O2VL 1QRNE 2Y07L 3D0VA 3V52H 2E9JA 3V4PL 1YNLH 3MRCA 4HUXA 3WLWC 1K5NB 4ODUA 1CGWA 1RURH 5KOMC 3EYSH 1WBXB 1GPOH 5D7LB 3HI5L 4JFFA 4YHIA 1PLGH 2HVKB 1JPSH 1CE6A 2GY7B 3QXDA 4XPHH 4PJGA 4EN3B 4GG6A 2UYLA 3MODH 4BK5A 5IB2A 3C8KA 4ZFZB 3LRSB 3O11B 2DMBA 2B5IC 4CJ1A 4PD4J 4HKZA 4W4OA 1NBYA 1LO3H 3ARDB 5ESVB 3ZE0F 3NCMA 1AQKH 1QFPA 3RRQA 3HUJB 2ATPA 5HGDA 2BX5A 4OF0A 3PP4L 1ED3A 5HYIA 4ZNEA 1KLUB 3PNWB 2A6JA 4A2LA 4CW1A 1R3HA 3MACH 4ALAH 4OF3A 2FIRT 2DQDH 2Q76A 3STZA 4FQCL 1H8NA 5HYSG 5DQJB 1LK3H 3ROLB 3VFUB 3WS3A 5F7NC 2EIDA 1BZ9A 2FJFB 1I3GL 1FLRH 2FRGP 1HQ4A 5DJYB 2BVQB 4F9PA 4FA8A 3GJEA 1UC6A 3DIFB 4TUJB 5D2NB 3IJHA 4Z7WE 4H20H 3UO1L 1CFQA 1AFVH 5GZNC 1LHZA 1SM3L 1F3DH 1WCBB 1I1AB 1YEIL 3GMMB 4EOWL 4AG4H 4X4XB 3IS1X 3T77A 5CD3A 1HINL 5F1NB 4RRPA 1U8IA 2X4UA 3JWDH 4GRLC 4J1UA 5HYJB 2VABA 4R4FL 1NQBA 3O8XD 3PE9A 4NBYB 1DUZA 5CJ8A 1KFAH 3NIFF 4JKPL 3IXTB 2EDLA 4D9LL 2A2QT 2MOVA 4P5TB 2QQNL 3RZCA 1D7FA 4FQQB 1EBAA 2VDOL 3HI1B 1FGNH 3E6FB 1K5NA 4MD5B 4HT1L 2P8MB 4XNUH 5IQ7H 5L6YL 1CZ8L 4I48B 1A7QH 5GS0D 3CX2A 1WBXA 3ARFD 3D2UD 3T3ME 5D7LA 4WI7A 3IETB 2HVKA 2DTML 3BN9D 3PQYE 3VDBA 3CZFB 2E7BA 3I9GH 4NM8H 3QCVH 4LL9A 4EN3A 4YAQB 1TZGH 5FO8B 5B39B 4ZFZA 5TF0A 3LRSA 4FFYH 1R3IL 3S34H 4FFVD 2P5WE 3ARDA 1G6RH 1WVZA 5ESVA 4KZEH 3HUJA 1CK0L 1HIML 5DJAA 1KLUA 3PNWA 4UTAL 3UPRA 2WBJD 1CE1H 1MLCB 3WHE1 3LVEA 7FABH 5HYSB 4FZEL 1U42A 2CR6A 4JQIL 5DQJA 3UTTD 3ROLA 3VFUA 2IH3B 4Z7QF 1R3LB 2FJFA 4AM0B 4S1QL 1KXTB 3LIZL 5DJYA 2BVQA 1NAMB 4OLZH 3DIFA 3MRHB 3MV11 4TUJA 4RFNC 4ODVL 1X6LA 1S9YB 4EXPX 4M7ZB 5F7YC 1LO0L 1WCBA 1I1AA 5I15H 4X4XA 2FEDC 5F1NA 3TO4C 4JCLA 3B43A 3ZDYE 2JCCE 3C6LD 3QIWB 3EYQC 4R96A 3S8WA 5I71C 1G0XA 3E6HB 4D0CB 1LP9B 4XCFL 1WBYB 4MAUH 4DW2L 5EPMB 3HNTL 3DX8B 2NMSA 4Q9CA 1I9JH 1KCRL 2XQBH 3ULUE 3V5HB 4NWUL 2Q87A 5JR1H 1WGOA 4P5TA 2N1KA 2BK8A 1INEH 5DHVB 3TBYB 4QRTB 2R2HB 3VA2C 3CFBB 3HI1A 4MNQB 3E6FA 4YIQB 5C07E 5I1AA 2BC4B 4MD5A 5LJYH 2P8MA 1I9IH 1E6JL 3KYMB 4HULB 4I48A 5BOPA 1ACZA 4JFZL 5DEGB 3BE1L 3IETA 4L1HA 1S7XB 2CH8A 5CBAB 3V7MA 2HLFC 3TIDB 1QG3A 4K23H 4YAQA 2FEEI 5FO8A 5B39A 3D18B 1KUMA 3V6ZB 1PDKA 4P4KB 3QUXB 5BXFB 5IHUL 2B20A 3O2DL 5FGCE 5DJ2B 3RVWD 1G9MC 2CXKA 1VGEH 1JGLH 1MLCA 1G1YA 5CCKH 1X44A 3TO2B 5HYSA 4MQXC 2AK4B 1BOGB 1NKRA 1HYSC 4TUOB 1CDGA 4U6XB 1Q72H 2IH3A 3SO3B 1R3LA 2ED7A 2AJYL 1YECL 4AM0A 5D93B 1N6QL 1JHTB 1NAMA 2KZ1B 2AERT 5GS0H 2R2EB 3MRHA 4QRRB 2ADGB 5E4IA 3FT2B 3FQWB 1R0AL 2Z92B 3L5IA 4QO1A 1Q9KB 4K3GA 4N1EA 1OGAB 4M1DH 4UBDD 5IMMB 3RQ3A 4CUCA 3QIWA 1NANI 3E6HA 4D0CA 1LP9A 4KI5D 2FO4B 1WBYA 3WS6C 2G5RA 4TOYL 5EPMA 3PWUB 4RFEB 3DX8A 4P2OC 3EYOB 5I75B 1UA6L 3QEUB 4Z7UE 3V5HA 1H3GA 4X6CB 1J8HE 3RHWF 3JWOH 5FM5O 4BSVB 3DX7B 3IU4L 1TJGL 2G5BB 2R2HA 4KK8D 3CFBA 4YEFA 2XKUA 4MNQA 1T89A 4XBEL 1K6QL 2BC4A 3BKMH 5JORB 4IRJD 3T0XA 1H8OA 5CLWA 2JJWA 4ZODA 4GUPB 1T1WB 5DEGA 3DRQB 1C5CL 1T2QH 3S36H 1RV6X 1WITA 1RZFH 4PJDB 5EU5B 3BAEH 1S7XA 2FEEL 3NZHH 1EHXA 5CBAA 4POZC 3TIDA 5FYJE 3MBXL 2HT3D 3L5XL 2C1PB 2H2PD 3D18A 3V6ZA 1I8MA 4B41A 2X1OA 3QUXA 5BXFA 5KANI 3GFUA 3GKWH 5DJ2A 1JTOA 1GRWA 2VDKH 1BWWA 3STLB 1F8TL 3ZKQD 3JBG7 3SCMC 1Q0YL 1XMWA 3TIEB 1OD7A 5K9KA 3KPRD 4S1RL 5DUPL 3TO2A 3BD5A 1EJ6A 2AK4A 5SX5K 1DSFH 1BOGA 5E7BA 3F7QA 1MAKA 2B1HH 3HAEG 4TUOA 4U6XA 5JXAL 3H0TB 1JIBA 5I74B 4HF5H 5K9JH 1JJUA 3U7AA 1JHTA 4RGNC 3IXAB 4MHHG 1UACH 4QRRA 2ADGA 3FT2A 3FQWA 2FATH 2Z92A 1EMTH 2Z8RA 1Q9KA 3TEUA 1R5VB 1OGAA 4NRXB 5IMMA 3QWRA 4NQEE 5I73B 1MCDA 4G5ZL 1AI1L 4GRWF 5DD0H 2FO4A 4BJLA 4EVNB 4PJ9B 3PWUA 4RFEA 3P40A 2OMNA 3EYOA 4F58H 3QEUA 3TV3H 3P3YA 4X6CA 1A6TB 2ERJC 3W11D 5BMFL 2R2BB 1FLTX 4BSVA 5E24E 1V8HA 3DX7A 2G5BA 4HWZB 1NL0L 4ZSOE 4ENEC 4J4PA 3PWPB 5JORA 2I27N 3BKCH 1NSNH 4GUPA 1T1WA 1KJMB 2OXHA 2PXYD 4HFWB 3VFNB 3DRQA 1RU9H 2ITDB 2AKRB 2KH2B 3MLYL 5EU5A 3F7RA 4U3HA 4YHKL 4ZNCD 2DQIH 2C1PA 4UIMB 1J18A 5I30H 1EO7A 5LCVH 4JLRB 5F7UA 2FB4H 2YA0A 3MV7E 1XR8B 1YY9C 1RIUH 4N0FB 1NGXB 3EYVB 3STLA 1TQCB 4YXLL 4JFDB 3TIEA 5T3ZE 3JZ7A 3V52L 4QYOB 1YNLL 3REWB 5CP7A 4NBZB 5ERWB 1VEMA 3HAEB 1RURL 3EYSL 3WO4B 4HGKC 4OZGB 5D1QD 1GPOL 3QIUD 3H0TA 4JRXB 4Y19A 5IMLB 1PLGL 1JPSL 2OTUB 4R2GD 3ILQD 4BKLB 3GUTB 5C0AE 1FAKT 3GRWA 4XPHL 1F45A 2CSPA 4NGHH 3MODL 5CLTA 1TJHH 5BRZA 2WV3A 1AC0A 4TUKH 1R5VA 1LO3L 1AQKL 2WUBH 2OP4H 2ZUYA 5DK2B 3EW3B 1CU4H 4EVNA 4LCUB 4IMKC 4PJ9A 2P1YA 4DAGH 3MACL 4YFLI 3T4YB 1FQ9C 4MA8H 4ALAL 1ES0B 4UOW0 1E4KA 2DQDL 3GB7B 5FYJU 1A6TA 4L9DA 4LPCA 4S10A 1LK3L 2R2BA 3RI5F 3ARVA 2NW3B 4KUCF 4WV1C 5DEFB 4HWZA 5C0FA 1FLRL 1LO4H 2X89A 3S96B 3OTTA 2B5IB 2LU3A 3VXSD 3PWPA 1I85A 4H20L 2J6EA 1KJMA 4HFWA 3RGVD 3VFNA 4PJCE 1AFVL 4MS8D 3MLZH 1HSAB 4DOHB 4AG4L 2R1YB 2AKRA 5TDPB 5ISZE 1EHAA 5HYFA 2NY0C 3JWDL 4CMMB 3QDAA 4XI5D 3FQRB 4UIMA 5C3LD 4P2RD 1NFDB 2JJTC 5DLMH 3EAKA 4JLRA 1KFAL 2XTLA 1C08B 1D9KC 1F2XK 4N0FA 1XR8A 1W72H 3KDMA 1NGXA 3EYVA 3EDKA 1LMKA 4JFDA 2BCKB 1NUDA 3IDNB 4FMFA 1FC2D 4QYOA 3REWA 1FGNL 5ERWA 4XNUL 3HAEA 5IQ7L 1A7QL 4WFFE 4OZGA 5E4EC 4JRXA 5IMLA 4ZAKC 4PJXF 2OTUA 2UUDK 4GKNA 4NN7C 1A1MB 1E4WH 4PJAB 3GUTA 3I9GL 4NM8L 3QCVL 4P2QD 1TZGL 5E6ZA 3S34L 1PGRB 4FFYL 5D7JC 1A3LH 2ZOLB 4L1DA 4OLXH 4PRIB 1G6RL 5FYKD 4KZEL 3IDGB 5DK2A 4W4NA 4LCUA 1UM4H 1CE1L 3QO1B 2ESVB 2L4OA 3VFTB 3T4YA 6FABH 1ES0A 7FABL 3GB7A 5JDSB 2UWEB 4U6TA 3W5NA 3T0EE 3SE4C 2RB8A 4HKXA 5DEFA 1N0XH 2NZIA 3IDXH 4LAJH 3QQ3B 4YQXH 1T7XA 2VZ1A 3S96A 1G1CA 4OLZL 2WAHA 4MLSA 3LKRB 1F4AA 2V17H 4HMEA 4NQTA 2IANE 3VGFA 4DK6A 4OLYH 4DKAA 4X6DE 2GIYA 5D5MB 5I15L 1LDSA 1HSAA 4KU1A 2R1YA 1AD0B 5TDPA 5J12C 4HIHB 1A6VH 4LLUB 1RZJC 1JNHB 3RY4A 4WFHD 4CMMA 2GKIA 3FQRA 4FQXC 2E5EA 4MAUL 1NFDA 2W0LA 4GAYB 2G60H 4F7EB 2FHBA 3CMOH 1I9JL 2EC9T 3ALWA 2XQBL 2XYCA 1C08A 1XCQB 2V6HA 4OD2B 2E6JA 5JR1L 5ADPH 3QCTH 4RFNB 1INEL 2VR5A 4KJWC 5DMKB 2BCKA 3WIFB 2NY2D 1IE5A 4HUMB 3IDNA 4LMQI 2RAMA 5C0BE 1GC1C 2OZ4H 3PXJA 1HHKB 1I9IL 3PDOB 3TO4B 25C8H 5I71B 3DJ9A 3T2QA 1OL0A 2BSRB 4PJAA 3K81A 5ACZB 2ADJB 4LARH 2NCMA 5JO5B 1W2KT 4K23L 3MQIA 4N1HB 2IH1B 4PRPD 4G6MH 2ZOLA 3F6IA 1NDGB 4G6FB 2AS5M 3WNOA 3BSZH 3BW9B 1WWBX 4PRIA 1EGJA 1RD6A 3SJVD 4HLZG 5CBEB 3KHOA 3IDGA 4XC1H 1VGEL 1JGLL 3QO1A 5CCKL 2ESVA 3VFTA 1CXLA 1IKNC 3FB8B 1PEZA 5FFLA 4I8DA 4QXWA 5GGUB 5A2KH 3GDBA 5JDSA 5CINH 2UWEA 4QLRA 4PLKC 2G2RB 3D6GA 3E3QE 4PJEE 1Q72L 3M1BB 4M1CC 5H94B 3QQ3A 4WWKD 4Q9BA 2WANA 2YA1A 2VZSA 3V7AG 1GGBH 5GS0L 3BWUC 4QXGH 3LKRA 1CG9B 4JHWH 2EDYA 2F53B 2ZSVA 4OF8A 3T09A 2X9XA 3KYOB 1DTUA 1SBSH 3OKLA 1MHPH 4XAKE 3QB7C 5D5MA 3TP4A 1BJMA 1MQ8A 3O4LB 4M1DL 1AD0A 1U3JA 4HIHA 4LLUA 2CMRH 1JNHA 1CF8H 4LOUC 2MQ0A 3FQXB 2D03H 1AR1C 4PYGA 3RIAK 4GAYA 4F7EA 2Y6SD 5FYKH 4GBXD 4KQ3H 4FMKA 3O6MH 1XCQA 2DI8A 3NOIA 3JWOL 3L5JA 1QLEH 2R69H 3RVVC 5IW3A 5DMKA 3RWJB 4RX4A 3WIFA 4FQJH 1QSFD 5LXGH 3UCRA 5DRZB 5GGTH 1HHKA 3BKML 3SDAD 3PDOA 4PJGF 2F15A 1AGDB 3TO4A 1WC7B 4HCRA 2E6QA 1T2QL 3S36L 4UNVA 5I16A 4V2BA 1RZFL 5D2LF 5ACZA 2ADJA 3BAEL 3NZHL 4P2OB 4XBPB 5JO5A 2BNQE 4LLYB 5DQ9B 4JFFD 5K33A 3MCKB 4XNYH 3D25B 2IH1A 4CBPA 3B3IB 2OK0H 1NDGA 5AAWA 1HSBB 4J3TA 2L0DA 2YS4A 3GKWL 5DGQA 4NZDA 5CBEA 1FORH 3LQAC 2VDKL 3DTXB 3L6FB 3QDGE 3ZLQC 3C9NA 4OZFH 1A14H 4MDIB 4TSBH 4KWUA 3PABB 1OWRM 3FB8A 5E2TH 3GSNB 3QRGH 5GGUA 1IZJA 2AEIT 5KVMC 1DSFL 2G2RA 2B1HL 3M1BA 4W6YB 5DJXB 2KUTA 5H94A 4HF5L 5JOPE 5K9JL 4QNPE 5EB9A 2AW2A 4HJJH 5C0IB 1UACL 3GSWA 4C54A 1CG9A 2F53A 3C87A 1QHPA 3KYOA 3JUYA 2FATL 1BFSA 1EMTL 3SCMB 1U8NB 5HJ3B 2W0PA 5H37H 5IMKB 3BP4B 1KB9K 3IDYC 3O4LA 5DUMH 1M7DB 4ZUSB 2QHRH 5DD0L 3FQXA 5F7LB 3FOLA 4Z9KB 3PWNB 1EEQA 4F58L 1MRCH 1BQSA 3TV3L 4RGNB 4B7IA 1U0QA 1KIQB 2XPGB 3VXRE 4XVSH 5DUBB 3RWJA 1G9NH 4BH7B 4XWOD 4LVOC 5DRZA 2X4QA 1QP1A 3RZCD 1WAAA 35C8H 1AGDA 3BKCL 3C08H 1NSNL 1XGTA 2EC9U 3WKNA 1WC7A 5SWSB 1RU9L 1E0OB 2FX9H 2AQ3A 3IFPB 1U6AH 3VFPA 4UV7H 2F5BH 3P4NB 4P2OA 4XBPA 3U0TB 4LLYA 5DQ9A 1KCVH 5D7LD 2DQEH 2DQIL 4NPYB 2Y9RT 2ERJB 3MCKA 3D25A 2K9UA 3B3IA 5I30L 5LCVL 1HSBA 1WFOA 4O51B 5CKAA 1FG2B 1UEYA 3LN4B 4EN3D 3QI9B 2FB4L 3L9RB 1RIUL 3L6FA 1AP2A 4MDIA 1OAUH 1QBMH 3ARDD 3PABA 3OKDA 3GSNA 4R4NC 3ULVF 3ZE1E 4FABH 4FNLH 4H0IA 4Q7DA 2KDGA 5DJXA 4DCQB 3VXME 2X4SA 3CIQA 4G8GB 5BW7C 2HA1A 3RAJH 5C0IA 1KEMH 1ORQB 3FT4B 5E6YA 3ULUC 4NGHL 1MUJB 3SCMA 1TJHL 1U8NA 4TUKL 4OFVA 1H15B 3BP4A 5IMKA 5I17B 4I0KA 5CAYB 1YN7A 1M7DA 4JQXC 4UZGA 4ZUSA 2WUBL 2OP4L 5CJBA 2ZUVA 4LSDA 4I5BB 5CD5C 1D5ZB 1CU4L 1I1AD 3F8UB 4O9HH 2XXCB 3MRDB 4BFBD 4DAGL 3PWNA 1NGWB 3VI4F 1AGBB 4MA8L 2UV3A 3HRZB 4EQ3A 1SY6H 5HYJD 1KIQA 2XPGA 2AEPH 5DUBA 3KVQA 3HPJB 4BH7A 1CFNA 3FKUS 4FOMA 3GKZA 1LO4L 3JV0A 4P5TD 5AD0B 2XG5A 4MSWB 3L7FA 4ZUVA 3D0LB 3UBXI 1QBLH 5SWSA 3MLZL 3FFCB 4YXHH 3OZ9H 2E8YA 3IFPA 2W92A 1LE9B 3P4NA 3U0TA 3NCEB 2EDTA 3MJ9A 2VDNH 1GVIA 2I5YH 4MJ4A 5D8JH 2Z93B 4LRIA 4WV1B 5DLML 1U3HA 4O51A 4WCYH 1FG2A 1ZHBB 3QI9A 2YEZB 3L9RA 1W72L 3U46B 3MZTA 2DMCA 4HUVB 3RNQB 1JE6A 3UPAA 3NACH 5L2JB 2XXMB 3MRIB 2DIAA 4PIRF 4PJFB 1S7RB 4OI7A 4KFZC 1EFXB 1R3KB 2NY0B 4JZNB 1XF2B 4DCQA 3WLBB 5I1LB 4DUWA 4G8GA 1KB9J 3MV8E 5DVMA 1E4WL 3ZZ1A 1ORQA 3K4ZA 1CD9B 1D9KB 4F7TB 2WINB 1MUJA 3H2WA 1A3LL 2PYEB 3K46A 5I17A 1H15A 1ZMYA 1WISA 4OLXL 4HEPG 4WI6A 1J87A 1KIRA 1D5ZA 2EDNA 2ITCB 2V2WB 1UM4L 3MRDA 5E4EB 1AGBA 3QIWD 4ZAKB 5EU4B 3HRZA 3KPPB 4CDHA 3P4MB 3QNXB 3HPJA 1N0XL 3QQ9C 3IDXL 3TJHC 2VXSH 4YBQD 4YQXL 2YWZA 3BH9A 4LIQH 5D7JB 1CCZA 2VZVA 1CTNA 3ZKNC 1CD0A 3TGXA 2EO9A 5AD0A 2V17L 4MSWA 4S1SH 3D0LA 4OLYL 1Z0MA 2CIKB 5IR1B 2EIZB 5MEND 4MXQC 3FFCA 4IMKA 1ZWIB 1S7TB 3BKJH 1A6VL 4I3GA 5C6TH 5B3JF 5J4MA 3RIFK 2EE2A 2Z93A 4WV1A 2G60L 4YHZH 3CMOL 4KKCD 2OTWB 5CMAB 2AXHA 1ZHBA 2YEZA 5HI5D 1UYWH 3U46A 5ADPL 3QCTL 4HUVA 4P4KD 3RNQA 1PQZB 3H7LA 5L2JA 3MRIA 4G9DB 2C7UB 2JIXB 2OZ4L 4Q58C 4PJFA 1S7RA 1CDCA 5BZDA 4OGAC 4XP6H 4Z7OF 5J12B 3DMMB 4E9LA 25C8L 1EFXA 1R3KA 1XF2A 3WLBA 3U4EA 5I1LA 1J10A 3HE7C 5HTSA 2YKLH 4FQXB 4EUPH 3MXVH 2AK4D 3MV9B 2JJTA 3QDMB 4LARL 4NT6B 1D9KA 3TCXA 2WINA 1GGYA 3DV4B 2IPUK 4G6ML 2M8XA 2PYEA 1DLHB 1WUNT 3BSZL 5JXEC 4YFLF 1I7ZB 3ZYJA 5EU3B 2YUZA 4M62H 2ITCA 4XC1L 2YXMA 3VGAC 2F54B 2V2WA 4Z0XB 1OGAD 2R39A 4RMWA 4MQ7B 3QWRD 3MLSH 2BY1A 5EU4A 4ZAKA 5EIIA 5J6HB 3L3HB 4QRPE 5CINL 2GJJA 2O5XH 3KPPA 3QJHB 3P4MA 5K59F 1NDMB 3QNXA 2O61B 4DFIA 4MJ2A 1C12B 3DUSA 4X98B 5D7JA 4JFXB 1GGBL 5FAAA 5CEZE 4QXGL 4JHWL 4YDKH 1U2HA 3GEWB 4MA1C 1SBSL 2EIZA 1MHPL 4X0KB 3MOQA 4F7PB 3MUHL 1CXKA 1S7TA 3WMSA 5GGVH 4U49A 2CMRL 1S78D 1CF8L 3NFNB 3VMPA 3SE4A 1MHCB 2D03L 5FEBA 1LEKB 5FYKL 4KQ3L 2OTWA 5CMAA 5INCA 4XHJC 3RVXC 3O6ML 4JFHD 1QLEL 2R69L 5KAQG 1J05B 4Q9QH 4FQJL 2J1KA 5LXGL 4ZPTB 3DO3A 1HCFX 2C7UA 2JIXA 5GGTL 5JZ7D 2DBLH 3FO9B 3GK8H 3DMMA 4D9RE 5E9DB 5T5NG 1CS6A 4PJHE 4FQXA 1OOAA 1NLDH 4G9FE 5DHVH 3S35H 4A6YH 3MV9A 3QDMA 1QSVA 5D7IF 4NT6A 2B0SH 2BSTB 5EO1B 4JY4B 3RBGA 3DV4A 4XNYL 1DEEB 1LILA 4XVUD 2OK0L 1S5HB 3KS0H 1DLHA 3V4VH 1LVEA 1MH5A 3B2VH 5FA4B 1I7ZA 4G8FA 3M45A 4IOFD 1FORL 1E28B 1NGPH 5EU3A 3DPBA 4E0RB 4PG9A 1A14L 2F54A 2VLME 4TSBL 4Z0XA 1HEZB 2V9TA 3UTOA 5K93A 4MQ7A 5E2TL 3L3HA 3QRGL 5FHAH 2GT9B 3BFOA 3Q0HA 5EULV 2GW5A 4N8VG 1NDMA 4PJ9D 2DWEB 1UKSA 3OG4B 3AS3A 5BS0E 4HJJL 4JFXA 4OZIE 1N8ZB 1E27A 5D96C 1S7QB 1UM5H 4YDLC 4MNHB 4HG4K 5DR5H 2X89D 4X0KA 4F7PA 4Y5XC 5F1KC 3PWPD 5DUML 4QOKE 3PUCA 4ZQKB 2R29H 3QFDB 2QHRL 1I3UA 3NFNA 1MHCA 1NGZB 5FV1L 1OVZA 4GS7C 3I02B 1MRCL 4CGTA 1NEUA 3MSPA 5DSCB 4M48H 1H8SA 2OM5A 4XVSL 3P9WB 1J05A 4OZGF 3UZVB 2HJFB 1G9NL 4BK4A 4ZPTA 1RJLA 1OWWA 1J9CT 5FDWB 2D7MA 1REIA 4LGRB 3FO9A 4JFDD 4CKVX 3IDYB 35C8L 3C08L 4KTYA 4RAUB 1ZLWK 5E9DA 1ZHKB 4YHNB 1ONQB 2FX9L 1R5IB 4JR9H 1BZQK 1BQHG 3G6JB 2GAZA 1U6AL 1KTKE 5DD5H 4UV7L 2F5BL 5FKPB 3VFRB 1UWXK 3K8LA 4MMZC 4F3FB 1KCVL 5EO1A 2DQEL 4JRXD 4JY4A 1TITA 5DDHB 2YD6A 1ZEAH 3ARQA 3UTPE 5L0QC 4ZOEA 1S5HA 1HKFA 5FA4A 4LVOB 4G80B 4POUB 1PVHA 2BJMH 1E28A 5L2KB 4CJ0A 4E0RA 3SDXE 1M05B 4NKOB 4D2NA 1OAUL 1QBML 1HEZA 3FCTB 4JHBA 4G7YH 1BECA 3WLWD 5LGJB 3LEYH 2GT9A 4FABL 4FNLL 5L8JB 2DWEA 1I1CA 2FIKB 3MA7B 1A9BB 3I75B 3TA3C 3GMNB 1R3JB 4O00A 5D1ZC 1J12A 1N8ZA 3RAJL 1KEML 1VERA 5GSRB 4OD3H 1S7QA 4EQ2A 5IB1B 2R0LH 4MNHA 4XP4H 1OAKH 2X1XR 1YPZF 3GZKA 1UENA 4LU5H 3L3GB 2E9WA 1FFQA 3BD3A 1KJ3H 1IGMH 3PHOB 4GKZB 5ABDE 3B9EA 1MJ7H 4XGZB 4ZQKA 4PREB 5T1MB 3QFDA 2JB5H 4AY0A 3GRWH 4KXZH 4Y2DB 4BZ1H 1M7IB 1NGZA 2A6DB 3NGBC 4O9HL 3WUWG 3WNPA 1ZK9A 4RA0C 1X5JA 3TNNB 3I02A 3WCYA 1SY6L 1T1ZB 4JFOA 2AEPL 2HJFA 3DHJA 2D7NA 2GFBB 5HHME 5FDWA 4PJAF 4TTGA 4KK5C 4L4VE 2ADIB 4RAUA 1JTTA 1QBLL 1ZHKA 1ZVYA 5GZND 4YHNA 1BQHB 1ONQA 4YXHL 3OZ9L 1R5IA 4PRHE 3G6JA 2ARJQ 4NC1E 3HC0B 5FKPA 1M1SA 3P4OB 2DM2A 2APFA 1L0YA 3PQYA 2VDNL 4GRLD 5DDHA 1MCQA 5LKNA 2I5YL 5D8JL 5HGGS 1DBMH 4J6RH 4WCYL 3QHZH 3BUTA 3BGAA 1KJ2B 4G80A 3SHSA 3BGMB 2UWEF 1HCVA 4HK0B 5L2KA 4JJHA 4X4MA 5FGCB 1R24B