2UY6A

Crystal structure of the p pilus rod subunit papa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy6A01
1OOAA 2NZ9D 2FJGA 5J11C 4MQ7B 1A6AA 3GKZA 3QI9C 5E8PB 3FO0H 2NY3D 2Y4SA 2GHWB 1D5XB 1XGQB 2QSVA 4K8RH 4OCSL 1U8IA 4XCCH 5ALBL 3NBNA 2D7NA 1RVFH 1ZHKB 5IJKC 4M9OA 4X6BB 1H3PH 5C6TH 4EXKA 5CSZB 1MJ8L 1WBYB 2DI9A 3H7BA 3MV7D 1I1AA 1GGCL 1QFHA 1CE1L 3CPLB 5HI3D 4U1HB 3VGEA 1D6VH 4I48B 3D6GA 3T08A 1AJ7L 2FHFA 5I1AA 4NIKB 3S36L 3SDCC 3U4BH 2VAAB 3MRDA 3UTSD 1YZZA 4U7KA 4MJ6A 1FLRL 3DARA 4R6UA 1I8KB 4XC1H 4M7KH 3G6DL 3R06B 5IMLB 2Z92A 4JPKL 3X12A 1BVLB 2FBJH 3TCLA 3GMRA 2NY6C 2JJUA 4N8CH 5HHOE 4CVXB 2Q86B 2NW3A 2GSGB 2NXYD 3ZKMD 1ZWIA 3C5JA 2J6EA 4B7LA 5K9JH 3RTQD 3L9RA 4BSWA 1FRGL 2G2RA 2I26N 3ROOB 3QWRD 3MLTA 4I4WB 1FNHA 3BPCB 4CBPA 3U0TB 1KLUA 1N6VA 3SGJC 3WUWG 2VLKD 5JPMB 3IYLW 4PJGA 1MRDL 1ZEAH 4QRQA 1QFWM 2ENYA 3MLPA 3U2SB 3BD3A 1IT9H 1RK1A 4X7TB 3S4SB 4ELKA 4L4VB 1F90L 3DX6B 2A9NL 3EKCA 5ACZA 4W6YB 1U8OB 4PTUA 4DZBA 1KCUH 5ADPL 1UZ6F 4ZAKA 2DLGA 1U8JB 4ZFFA 4WEUD 5ICYA 1HZHL 3L1OH 3OXSA 5HGAA 3KLDA 5C08E 4OCMC 2GITB 1ZHBB 2WQRA 5L6YH 4LF3B 3LS4H 4X6CF 1EMTL 4P5TA 4NYLA 3TO2B 1A6UL 3ZHLA 1JRHL 2YWZA 4XPAH 1HQRB 5IB5A 3D87B 2DQTL 1T03H 3LKOB 1AO7E 2DQJL 3GEWB 4PJFA 2GTZA 3GMQB 5J8OA 1GOFA 2C9AA 2QR0B 4U1SB 1Q8MA 4KQ3H 3BH8B 3QG6A 12E8H 4RFNC 4U6YA 3NGBB 4XPFL 3T3PF 4QHNA 1HKLH 2D7MA 5ESAB 1DLHB 2GFBA 4IIQB 1WFOA 3QFJE 3TBVA 4GXUN 2LU3A 3DO7A 3BPLC 1ZKAA 3T0EA 3DUUA 4PJ5D 1F4YL 4POZD 2PXYB 2V7HA 1ZT1A 2P8LB 5JW4Q 4PS4H 4R4ND 5FK9B 1H3UA 4WGVB 3P30L 1R5WA 3ZKND 2YRPA 5D2NB 2FO4B 2C5DC 3OJMB 4P4KD 3F8UB 4QHMB 1MLBA 4KUCD 5I1LA 1CF8H 1KIPB 4M43H 4WUKL 1F4XH 2DL9A 4JJ5A 4OFDA 3IXTB 1FN4A 3TNNB 4NCC2 1AI1H 5E99L 5JUEL 1PG7L 3QQ4B 4YHOL 3TIEA 4XNXH 4G3YH 2HJLA 1JI2A 2F53A 4JVWA 3MV7B 4FMFA 3L3DA 3PV6A 4KWUA 1MCRA 4WY7H 4JRYD 2NCMA 3SEPA 4K7FB 4P2QD 4NN7C 3PDDA 1EEZB 3ESVF 5HGBB 3UTSB 1ZV5A 2GT9B 3EGSB 1MAJA 1LEIA 4HCRL 3DXAD 3MRHB 5DHVB 3V7AG 1HXYB 4HKXB 1DDHB 1INDH 4RAUB 1S7UB 4YO0B 3MV8D 3F6IA 1JUFB 2DM4A 5EU5B 1CR9H 5CIPB 1OAUL 2NXYB 2E9JA 5JW3H 3GHEH 4UIKH 4H20H 1JNLL 1SJXA 2DYPA 2HWZH 2ITDB 1QRND 3JBG7 3MBXH 3PWPA 3RTQB 5IWLA 3W2DL 1L9NA 1HKFA 3KPMB 5EBLB 2DLHA 1OP3H 3OAZH 4FQXA 1UM6L 4WU5A 4KY1L 4FTVD 5J4MA 4Y1AE 5BRZD 4JFHD 5JNYA 1UENA 2VLKB 1ONQA 4HS3A 3S5LA 5KZCD 2JIXA 5EFIB 3WIIL 1OAQL 5KOVC 4A2MA 1EEYB 3QNYA 5FF6A 5KSUB 4FQ2L 5I6XB 4Q6YA 4P3CL 3VCLA 4FFZL 3MRCA 4M9PA 5SX4I 1MCDA 1FL6A 3GMPA 4K3GA 3KYAA 2R1XB 4QGTA 2BSSA 3QCTH 1QLEL 4AEHH 3G04B 3QEQE 2BY3A 2CLZB 1WITA 2X9WA 3SJVE 4P48A 2H45A 1F3JB 4HCRA 5DSCA 4NCC1 4Y4HD 4F8QA 4P57B 5GRWA 3I75A 3MCKB 2ADJA 1KJ2H 4R8WL 1SQ2N 4ZFZA 2OJZH 1AC6A 3E1F1 3DOSA 3EO1B 2DQDL 1FC2D 4U1JB 1IM3B 3JWNC 3WDJA 5A16A 3GI8L 1MH5A 2CO7B 1F6AB 2BJMH 5IOPB 4OLXH 3UBXG 3BMVA 4LRIA 5I2IA 3MV11 3SO3C 1DR9A 1ZT4A 5I1DA 2XKNB 4D3CH 1MQKL 1YEEL 2DB8A 5BQ7A 1UWEL 5CZVL 1YQVH 2R2BB 5IHLB 4F9LA 1IGFL 4XBEH 3TF7C 3FRPA 1QRKA 4MLSA 4Z95H 3HNTL 4PJ5B 3JVGC 4QY8A 4XPTL 1II4E 2I07A 3IU4H 1RUQH 3R0NA 5IEHB 1BBJB 1I1YA 5JHLH 4IOSD 2ZG3A 4I18B 5HGHB 5I74B 3GSVA 4WFGD 5EOCH 4P4KB 2B7DT 1ZLWH 1YY9C 1RIHL 1SYSB 4ODUA 1ZHNB 4GRLA 4HDIA 4ZSOE 5GSRA 1E4WH 1KTDB 5F7DA 3KAAA 1TQBB 2AXGA 2YPKA 4LEOB 5IQ9B 1ZA6B 4W6WB 3RZCD 4O51A 1AO7D 3MCLL 3BRGC 3GJFK 4LVNB 4NZDA 1ZLUH 2HFTA 2L7UA 2BMKA 1XGUB 5T1MB 3RDTB 4Z7VF 4QXGL 4GRWB 3BI9X 3V4UL 1OTUD 1DCLA 5I73B 3BP4A 5CZKA 1P4BH 2DJUA 3LKQA 4P2QB 1YC8A 3DMMA 5TE6L 3H9HA 2VLMD 5D96B 4GG6F 4FFWC 3DXAB 3OGCB 2ERJB 1MIEH 2VB5A 4XH2A 3T77A 4JFDD 5JXED 2BVOB 5HDQL 1U3HB 1NC2A 1S7TB 1N0XL 2OSLA 1C5CH 2VH5L 2G5BB 5T1DL 4L3CA 4IMLA 4PUBL 4LVHC 4HGKC 1Q1JH 4N0CD 2CGRL 2YPLE 3DX9A 5T1KA 3QCUH 5C0AA 4FTVB 1Q38A 4D9QD 5GGUB 1ERNA 4ZD3H 5BRZB 5EG6C 4MMZC 1FZKA 3DHMA 4LPXA 1Q9LB 4OCXL 1I1FB 3K0WA 2PW2A 3JV5A 2J8UF 2WZPD 5EOTB 4TPRH 1RULL 1EXUB 5E8NA 4S2SA 2OJEA 2QHLA 1X9QA 3PL6C 5T1LA 1UCBL 2E8YA 3IFLH 4ORGB 5DWUL 4WO4C 4Y5YC 2YN5A 3OKMA 2R4RL 4JZOB 4TQEH 2YA2A 1SJEA 1Z0MA 5DHYA 4BFBD 3ARUA 1OAYH 3KPSD 4MAYC 3HZYA 5JXAL 5HVFB 4Y4HB 3O6KL 4KQ4L 4QO1A 3SDCA 5D7JC 4GKSA 2AABL 1S78C 1CGSL 2ZPKH 1BEYH 2WUBL 2D4FA 3NA9H 2Y72A 3WSQH 1R3IH 5DJYA 3BQUB 1G6VK 3E8UH 4NNYA 2WBJC 5BZDA 4ZPTA 1GZQA 1MHCA 4Y1AD 1J9CT 2HT2C 5IJVB 4HLZH 5IEKA 3H9SE 4PB9L 5EU4A 1AR1C 1AQDA 1FFOA 2G5RA 1A1OA 1ORSB 1CQKA 2NTSP 3VG0H 1ED3A 5B39A 2EH8L 4OCNC 4PJXE 1OLZA 2H8PA 4HIXH 3ZT5A 4X4XA 3MV9A 1WTLA 5ID0A 1T83C 1KXQE 4MQXD 3SGJA 2PTTA 1QA9B 4HJJH 1FORL 2HFGL 3CSYA 3MOAL 5IF0B 3VH8A 3W82A 5GRXG 3AS1A 3S96A 2J4WH 4FQLL 3U0PA 5FB8B 1CFTA 3DGGA 3QUML 5C08B 4Z7VA 2XN9A 1R5VA 3HNSL 2AXFA 5FKAA 4OCWL 4N9GA 4ZUUB 1RZ7L 2A6IB 2VDQL 4GG6A 4DGIH 3GSXA 5J6GA 1KYOJ 3QXUA 1CBVH 3MLXH 5A2KH 7CGTA 1XH3A 1AO7B 4O00A 4MQSB 3BN9D 4MS8C 2BHYA 4FNLL 1OT2A 2DQHL 4CN4A 1HDMA 2E27L 1NCAH 4ETYA 1TJIH 5D7IE 5MHSE 1BBDH 1N4XL 3HZMA 3BP7A 2W92A 1FPTH 4APQC 3MA7B 4KRLB 4YXKH 3GMNB 3MZGB 1WQVT 3QIWA 3MACL 4NQTA 4DN3H 3QFJB 4DUWA 3O11B 1XGRB 5CEXB 1WC7B 2HTLC 2OXGA 2AP2A 1GYAA 5I1KL 3VXOB 3SCMC 5BMFL 5E4IA 4JRWA 4JHWH 4YPGA 5KAQF 4G9FD 1MF2L 2LE9A 1CD1A 2D7OA 3JTSA 5HBBA 5DJ6B 4ZUWA 2A0LD 2J8UA 4G8GD 4HEPG 3FCTB 3LH2H 2ICWA 3QUMA 4WV1B 4F37K 5EZJB 3TBSB 1XF5A 1JNNH 4PRPA 1EH9A 4HHAA 1P4LB 4KRPD 3H42H 5J9PA 5IFJB 1BAFL 3SGDI 1U8MB 3E6HB 3TEUA 2XQBL 1NBQA 4G43B 5T3ZE 4NP4H 4QXUH 1GZPB 3MFFA 4F8TA 5J7CC 3IJSB 3RHWK 3RAJH 5GHWH 3AGVA 4NQVB 4KVCH 5LCVL 4Z78A 1XR9B 1FZOA 5F7FA 3OJDA 2FR4A 5F72S 4JG1H 1QSFD 5MP6L 2FATL 4R90L 2DQIH 2LVCA 1IAKA 1RJLB 2D9QB 5ENWA 2WP3T 4CU6A 3BZEA 4KUZH 4PRDB 1IGJA 2QLVB 2JB5H 4HT1H 4WW1A 5EBMB 5KVFH 4RGND 3P9MA 3BW9B 5CCKL 2R2HA 5ICZB 1I8IB 5I18H 2E8ZA 4WFHE 2YPLD 3TA3C 2EDLA 5B38G 3FO1B 3HE6C 1QPPA 2H26A 1M6OB 5ISZE 3P0GB 4Y1AB 4X83A 3CIQA 2IBBA 1WWCA 5B22A 1CFNB 1HH6B 3MRJB 4D2NA 2NLJA 3SQOL 3NCYP 2VDLH 3OR7A 4YHKL 5GGTH 5K9OB 5E24E 4TNWK 4NQUA 2X7LB 4WI8A 4XCNB 2YD4A 1NMCB 3P9LB 3RIAK 3CGTA 4DK3A 3SJVB 3F7YA 3L3IB 4JFEA 5F9DC 3TZVD 3RY4A 4S1RH 5E8DH 1A7OL 5D1XC 2E6QA 3BZFA 1RUAH 1B2WL 4I2XE 4D9LL 2HJKA 3SOBH 3SDAA 2XRAL 3WDIA 2D0GA 4LK4A 4K3HA 1EZVX 1EFXA 4MX7A 5FHAH 3RUGE 3VFTB 3VWKD 2IALA 2LABA 1FL5B 1FP5A 5I1CH 1OSPH 2Q76B 3LEVH 1ZSDA 5TQ2L 3IDMB 1FGVL 4A6YL 2XWTA 3H9SD 3WIFB 1NCCL 3QEGL 4NDMB 4JM4H 2RJMA 1D5BA 3D39E 3NPSB 4CDHA 2EDNA 4P2RA 1FZJB 4YHIA 1R5IA 2IBGA 4LAJH 5KANI 1MCOH 1E4XL 4F7PA 3GNMH 1JP5A 4XMKH 3NCYS 5C7XH 1LO4L 4I5BA 3EFDL 4M62H 5JW5A 2ORBH 3WFEH 5LGKA 3G6JE 3SHSA 3C8HA 3VWJC 5I8EA 4L3ED 3TNMB 1LDPL 3CFDB 1QO3B 1FYHB 1DUYB 3LQAL 2FHCA 3JVGA 4ZSOB 3UJTH 4LAQL 1DVFC 3MO1A 1G7PB 3CSPA 4N5ED 5IQ7L 3TV3L 1YPZF 4N8VG 3LKPA 1TJHL 4KRPB 3OZ9H 2XG5A 4G42B 5EIIB 3L3HB 1LO3L 3W11D 3THMH 2HFFB 5MHSD 5J1AB 4O02H 4JFOB 1HINH 1UACH 3V4PL 2P8MB 3DRQA 4A6YA 3BEWA 3Q6GH 1DANT 4PV9A 1X5AA 1KLGB 4LARL 4QTIH 4AMKL 1X6NA 4OTXL 5JOFA 3LEYH 3KPTA 3KXFA 3QISA 1NFDF 1H0DA 2UZYB 1WAAE 4HIHB 2HRPL 1EZVY 1DANU 1E27A 3SBWC 1OCWL 3UAJD 5EOCJ 3JV6A 4CW1B 2X4PA 2CUIA 1XGPB 3HC0A 4MNHB 3Q48A 3I50H 1DQMH 4XP9H 1BFSA 2IFFL 1ZHLB 2BFVH 2YPLB 1FAKT 4XPHL 3VXNA 3AFLA 3V7MA 1GC1L 2O61A 5EZIH 3CLFH 3EDFA 1ZGLA 5L7XH 1OP5H 5FECA 4JREC 2Q1EA 2R1YA 3ULVE 2NX5A 1NBVH 1ND0A 1RHHA 1KUMA 2H32H 1R0AH 3ES6B 4NBZB 2DKUA 3DBXB 3NCCB 4U1KB 3SN6N 5H94A 3DYPA 1REIA 5HYSA 4KU1A 5E7FA 1MUJA 5DLMH 4HKBA 5F1OB 3TZVB 4KTEH 1QD0A 4RRPA 1FFRA 3BIKA 3P4NA 3ZDYE 2KQMA 4WW2C 3PL6A 4JO1L 1G7IA 2APFA 5KG9B 1Y6KR 4MYWB 4WO4A 1ZA3B 4LSTL 5LVEA 3VXTA 3K1KC 1KENH 2VDMH 3VWKB 4BKLB 4YDIL 3BWUC 4MAYA 1VDGA 3O45A 1CGXA 4FXGB 4WFHD 4XVTL 5DA4A 5EBWB 1OP9A 1BWMA 1A3LL 1GAFL 5K59F 2EECA 5D7JA 2FEDD 4NC0B 4DGVH 3GSNH 1X5XA 4K71B 3GKWL 1VA9A 3H9SB 4PGCB 3I2CL 1DFBL 3P4OB 5JZ7C 2OQJA 1KPVB 1TVBB 4NQEE 3VFPA 4PJXB 4YR6A 1FO0L 1A7QH 3EO9H 3LMJH 3ULSA 1QEWA 3IDUA 4RNRA 1F02I 5FKPA 3ARZA 1YPZA 1UXSA 4JFFE 1NBZA 2XTJE 4KK9D 2HKFL 1JJUA 1G7HB 5DMIH 1T5XB 4QNPE 5MEND 3RY6A 3VDCA 3U9UB 4OGZA 1T83A 4ZPVA 3DSFH 2X4SA 1T1WB 3EO0B 5FXCH 3OXRB 1MOEA 3OTTA 1KIUA 3RU8L 2BVPB 2XFXA 4CADA 1T4KA 2E9WA 1WBXA 3ZYZA 3IDXH 5DMKA 1NFDA 32C2A 3VFMB 5FUZH 43CAB 3CH1A 3Q6FB 2A6JA 5TE7H 1I1AD 5D7IB 1OWWA 3PHQB 1U93B 3MBEC 1QHPA 1U2CA 5D7LE 4ZDHB 3MSPA 2FECI 3QUZB 4X8XA 5F6HJ 4H26A 4X6CE 3HC4H 4JHAL 4RISL 5ESVB 2ZCKL 1JIBA 3QQNA 3FFCA 1MRCH 5IIEA 3LHPH 4NRZB 3VFWB 2X4QA 4FN0A 1FO0A 3FB6B 4ONGH 3PG2A 5BV7C 3AAZB 4OD1H 2IQAB 4HLZG 1KXTB 3NIGE 1U8LB 2PO6C 4N1CA 1NDGA 4XP4L 5ILTH 4MDIA 1FQ9C 2AJSL 3JTTA 3L7EA 2J88L 3C6SA 4JFQA 4R97C 3W0WE 1GGBL 2H6PA 3SCMA 4ISVA 5DJ8A 4ALAL 1AXSB 3ARPA 4IRZH 3GSWA 3BPNB 3LZFL 4U1NA 3RPKA 4YGVA 3LVEA 5C0DB 2B1HL 3D18B 5KSVA 4OCRL 3VD3A 3V6BR 3MA9L 3QWQB 3K8LA 1L7TL 3QNXA 1U8KB 3WJJC 4XB8A 1TZGL 3LOWA 1BZ9A 2NY0D 4DCQB 4JFZH 4UB0H 1B0WA 3IJYB 3S37L 1WBZA 3TVMC 1F4HA 3D3VA 1FNGB 2K9UA 1A7BA 4WWKC 3T8XB 1KPRB 3X13A 4K55A 4JPIA 4ZAKD 2RHEA 5DD5L 2P7TB 4N90D 4X5WB 2CRIA 3TM6A 5K9QG 4QOKE 1MQ8A 2EC8A 1OARL 1K85A 5E8OB 3HRZA 3GIVB 3TPKA 4WTZG 3TBTA 1WCBA 2OMBA 4P5TD 4RWYH 5F7EL 4XNYL 5C0GA 2GQHA 1W0WB 3QQ9D 3VE0B 4ACPA 2ICES 4LHUA 2BC4A 5I1GL 5C0IB 1AHWB 4ODSH 5GSVA 1XIWB 5E5RB 2ICWI 4R4FL 1U2HA 1DBKL 1MIMH 3FT3B 4J6RH 3NCEB 3HC3L 4QF1B 2WINB 1A9EA 4H1LA 1NMAL 5IB1B 4Y16C 1LVEA 1HHIB 4YDKH 1N6UA 3TA3A 2VZVA 4UBDD 1PX3A 3QUYC 5M94B 1ZGLP 1MEXL 5FCUL 3X3FH 3C08H 3T0ED 5D1ZC 4NZRH 3P0YH 1RZKL 3TYFB 3MCG1 1B6DA 5HY9B 3GBML 3HNVL 2PCPA 4LU5H 5ESQB 3GJEB 4HS6A 5HHXL 3V5HA 4UTBL 5IFAH 5MENB 4HWNA 1MCWM 4F57L 1U8HA 1PJ9A 5FYJE 5C0EA 2LVEA 1N2RB 4I2XB 4LBEA 3M17B 5INCB 3WV0A 1DQJA 4CL7A 4KZDL 4XX1G 1U3JA 5DO2C 1T20A 1HHJA 2FJGB 5FYKH 2F54E 5HYFA 1A6AB 1OW0C 3EJYC 3RUGB 4F15C 2BSED 1FVDB 3QB7C 1E28A 1SBSH 3FFDA 2QL1A 2FIKB 1IQDA 5D1XA 3FAXA 2W91A 3LKRB 4AQ1B 1C5DA 2F53D 3QDMA 4LOUD 2B1AH 1I1AB 2MJWA 4NQED 1SEBB 1QFUL 3K8MA 4JN1H 1UWXK 3MLRH 1EJOH 5GGSB 2GEEA 4LLWA 1S8DB 3D39B 4ODHH 5CSGA 3ARYA 3MRDB 4KI1A 1LP9E 2GJ6A 4CJ1A 5LXGH 4TUKL 2AJUL 3FO2A 3O9WB 5BVJA 4MJ6B 1DBJH 1S7XB 2KKQA 5EIVA 4EQ2A 4NO2B 4UT6L 4WW2F 2MCPL 4D94A 2BOBA 4EJ1C 3G6JB 1S5IH 3K46A 4NSKA 4XTRC 4JR9L 5BO1H 3MOBH 4U3XA 4AEEA 4EDWH 5IFHL 2Y36L 4KMLB 3QXVA 4QHLB 5FO7A 2DYPD 3C5JB 4NC1C 1D5IL 3D9AH 3PWPD 4JCMA 3STBA 2VUYA 4BSWB 3O3DA 2H3NB 4KFZC 4YXHL 4G8FA 4JO2L 2F8XC 3RWJA 2Z4QA 3WBDA 3NH7L 4KHXL 3FT4B 4GKNB 1T7XA 4U1MA 1A7RH 4HUXA 4PP1C 2BHUA 2C4XA 1DVFA 5DD6A 4QWWD 4TULH 1A8JH 3HG1A 2NY0B 5BS0E 4NBXB 1C12A 2R9HD 5DJZB 4EUPA 1NGQL 4FQCL 4G8EB 2PN5A 3BOVA 4DZBB 3RZWA 2NXZC 3IVKB 1BGXH 3WL9A 1XT5A 2KBGA 3MLVL 4ZFFB 3EYSH 5ICYB 1VGEL 2A1WH 3NAAH 4F33B 3WLWC 3MZTA 3VXPA 2ITCB 4TUOA 1OLLA 3VXSE 4YAQB 3MRNB 2VDOL 3DYOA 4GKOA 4P23C 4P5TB 1A3RH 2VR5A 3VRIB 3I85A 4XVJH 4XMPL 4Y5VB 3CX5J 4NKIL 3PQYE 4XNZC 1DQLL 5EORL 4PD4K 4GW4A 3SBWA 2XA8L 4MA8H 3OKLA 5TDPB 3T2NH 5C0CE 3CVHL 3ARFC 3EOYG 3QG6B 1HI6B 3CFEA 4U6YB 4D0BA 3MLZL 4JN2A 1HEZB 3VGGA 1ES0A 1J10A 1I9RH 4YGAB 5GISH 4KROB 4PJHF 3TBVB 3S8WA 1GXEA 3MGTA 4XVSL 1CLCA 1ZXQA 5CIPH 3MNZB 4QRUA 3VI4F 2V7HB 1NEZA 3C09C 4YZFE 4M02A 4OZGF 2EIZB 5J89A 4Z7OF 3D5OF 3EZJB 5AG8A 3ALPA 3DVGB 1KT2A 1YDPB 2LV4A 4HBQA 4L5FH 3T0DA 3C2AH 1Q94B 3VW3H 4GG8B 2XOTA 4GRLD 2MQCA 3CSBA 4XP6H 1KNOA 5I1IL 3TIEB 1PAMA 4JY6B 4LLMB 3AMKA 4WW2A 2F53B 5DK2B 1D9KC 1KCLA 5JA9A 2C1OB 4NO3B 1TLKA 4OGXL 3ARBC 4I1NB 2AI0H 3BT2H 5EIQA 4NQEB 5D7SL 5C9KA 3C5SA 3GBNH 4HSQA 4G5ZH 4QYOA 1F58L 3CVHA 5F1IA 3DMMD 1FNEB 3UYPA 5F21B 4MB4A 1IC5H 1W0VA 3BPOB 4N1EA 5EUOE 1EHNA 3VXQB 4AEFA 1LE9A 3OX8A 3P3YA 2XA3A 1A1NA 1JTOA 2XTJB 4PTTB 4OZFB 3V7AE 1MELA 3QXDB 5HHVL 5I1HH 4LP5A 4NNPH 1NGXB 3ELAT 3D0VB 4UOW0 5BV7L 5BJTA 4YDJA 3WLBB 5HDBF 5H35A 1NC2D 3QIUA 2VLJA 1I3VA 2WIMA 5ADOH 5IBTL 2ZCHL 1QKZL 3MXVL 5HYQA 1G7LA 2DYPB 3WN5B 3HPJB 4JB9H 1IAMA 4LGSB 4OF3A 3O3UN 3TH3T 2EYTA 4K23H 1JZ8A 1DQDH 3RJDA 1LD9B 1F8TH 1DN0A 3LIZH 4J3SA 5C0AD 3SKOA 3V0WL 2OK0H 5JNYB 3STLB 3MRKA 3HKFA 1ONQB 4HS3B 4K07A 1T89C 5DQDL 3TPUA 5D7LB 5CBAA 3QI9D 4NPYA 4N8PA 4TOYH 4UDUB 1OAXH 4X6CB 3VXUE 4NUGH 1KELL 4X4ZA 3TT3H 1YY8A 3MRFB 2BSSB 2ZUXA 3EOAB 5IT2H 4CMMA 3IDYB 4HS8H 4U6HA 3PUCA 3K4DA 3MBEA 1IEBB 2FEEL 4MGXA 2XV6B 4P2OC 2W0PA 3PIQB 3GIZH 4PFEA 5DQJB 3UTOA 4RMSA 2GJZB 3NFPB 4HKJB 3SDCD 1GGIH 3UTTA 1KCSL 5SWSE 3FL7A 5KVGL 3T0XA 1CT8B 3W0WB 3ETBF 3RNQA 5D9SB 4PJHA 1M7IB 5GZNC 1KJ3H 5TE4L 5L2KE 2PO6A 1YNKL 1X7QA 4GRWH 3L95B 5IB3B 3CFBA 1JNHB 1UYWH 4OFPA 3ALXA 1IFHH 2Z31C 2NY6D 3VRJB 2PF6A 1IGYB 1A6WL 3ZT6A 1G6RB 4QRPE 5I2IB 1ZT4B 4QRRE 4PRIA 1PKOA 1MHHA 3QUKA 1PSKL 1AP2A 2EYRB 4AK1A 1S9VB 1FGNH 3Q3GA 1NCTA 3BDYL 2I60L 5GGRB 4MJIA 2V2WB 1DBML 2JE8A 3EUUA 4NJAL 5C0JB 4BSVA 1O0VA 2UY6A 2XN9D 3VXSD 3IRPX 3QZWA 3EJJX 4S11A 1QBLL 5F88A 4ODUB 3L3GA 4WWKA 4GRLB 3ZKSD 1RQ5A 3WHE0 1T5WB 3X14A 4H0GA 2VDNL 2YPKB 1Z9SA 5K33A 5I19L 3NFSL 4PJEE 1QVOA 1RIUL 5AWNH 4TTDC 5LGJA 3BWAB 4GMSH 1ITBB 1VPOL 5KVDL 5C0CD 1VB9A 5JO5A 3L6FB 4I0CC 4UMGA 3FQUB 5IGXL 2MQ3A 1MPAH 1HSBA 5H2BA 5E5MB 2WK2A 1XGYH 2C1PA 4G80A 1AGCA 3OHXA 4QTHA 4YX2L 1Y6MR 3ZDXE 3OF6A 4GMTH 4PJCF 2ADGB 2VDKL 3O2DH 4RA0C 3DTXA 3O41B 3BVNB 5AZ2L 4Y16A 2EIDA 4P59L 1AKJA 2VLRA 3KLAA 3U1SH 4OAWA 3MJ8A 2OSLB 2EDJA 4E5XB 4KGLA 1M71A 3H2WA 3OKNA 5E2JA 4K94C 3BGFC 1U91A 4E41A 1CLOH 4PRPD 5GQBA 5IVXE 1AY1H 2IPUG 5C0AB 5K9KB 4O4YL 5ICXB 1DE4B 1TIUA 3MYJB 3ISWA 5SX5K 5J11B 1OW0A 3QI9B 4KJYA 1BD2A 5EOQH 3V4VL 1FAIH 4L8BA 1LP9B 1HK6A 4HPOL 4U6VH 3MJ7A 5T5NG 4XAWL 4LDLB 1LEKA 3TO4B 3T2OA 1NAML 2PYFB 1IQWH 1YJDH 5D72L 5FV1L 2Q7YB 1SMAA 1G1CA 4OZ4B 1CXLA 3HZYB 5LQBL 5ACMA 2OP4H 3NTCH 4XC3H 4PREA 4TVPL 5JLZB 3TC9A 1TETH 4XGZA 3SDDC 2P8PB 5DJ0A 3GI9H 3C5ZC 1TMCB 4XNMA 1MFCL 3MXWH 1C1EH 3EFFB 1EVUA 3CUPA 3BE1H 1MCKA 2HN7B 3CMOH 1ULVA 1R3KA 4K3DL 2NY6B 3EYFA 2R0ZL 3U30C 4PRNB 2ID5A 3WS6A 2HKHH 5IEKB 1KULA 5I8KL 1A1OB 1IKNC 3WUWB 2YKLL 2BRRL 1IVLA 3MUY1 2H8PB 4FQJH 1RJZA 5BS0B 1WZ1L 2A6DB 4YXLH 4JZJC 4JG0H 5HGDB 4JCLA 3NIFF 25C8L 5IG7B 4AENB 5GRZA 1FVCA 3WEXA 4JFED 3U6RA 4WDIA 1NAMA 4G7VL 4MDJA 4R26L 1EDQA 2IAMC 4MD0B 5DD1L 1I4FA 5E9DE 3VXSB 3MRMA 4YUEH 5C07A 5TPWH 1YNLL 4XAKE 1G7JA 4MJ5A 4ZTPL 1DQTA 4GG6B 5L2KD 5J6GB 1Z2KA 4PJCA 3KR3H 1F42A 3PQYB 1SYVA 1XH3B 1J8HE 4Q74A 5DEFB 1J18A 4YNYB 4M61A 2EDOA 3HAEH 1V7NL 4UNUA 4Y8AA 1QBML 5C0CB 2DIJA 2AK4E 2YK1H 1U8PB 1BQLH 4WFFE 1BM3L 2P44B 2FGWL 2ZP0T 1VSCA 3ARGB 4KMTL 1JHKH 2R69L 1IKFL 1VGKA 4DKEL 3S7GA 3G6AB 1CLYH 1A0QL 4LSVL 1KG0A 4BYHA 3PP3H 3EOTH 3WFCH 3OAUL 4K3JL 2MFNA 3A67L 3ARFA 1UJ3C 4RFNB 3RP1A 5EPMB 4LPTA 2VLLB 3QDJA 5DD0H 4OZIE 5DUPL 3QJHA 4HEME 2J8UB 2YBRA 3BPLB 1F3DH 4LASH 4I3GA 4Z7NE 4ZNEE 1ORQA 3KPLA 5TGBB 1NGYB 1UH3A 3QEHA 4H88H 3WO3B 1KB5B 4PRPB 2YSSA 4JDVB 1KTRL 2UZXB 4NJ9H 3HI1A 1K6QL 1JHLH 5T33H 3REVB 2DI7A 1E6JH 1JPGA 2ARJA 3FQWA 4U1IA 5C3TA 1YUHA 1AD0B 2KPNA 3P0VL 3MFFB 5CUSH 5T5FH 1QYGL 4LHQB 5FUOL 2ZUQB 5IW6A 4ONOA 3PV7A 1WFNA 2G60L 5EUOB 1HCFX 5DVNA 1D9KA 3KPPB 2OTWA 4U1LA 5DJCA 2VN7A 3HZKA 1ACYL 1IMHC 1QOKA 2DWEA 1IAKB 3BZ4B 3ET9F 4HQQL 2YPVH 1OGAA 1CL7L 2HAZA 2JJWA 3DURB 2X6MA 4HXBH 5HI4C 2JJTA 1AIFB 4C57C 2PYEE 4FFWD 5E03A 3CK0L 5TDNA 3PDOA 3S36X 1OF2B 5CJBA 1CXHA 2B4CL 5DMYA 1XCTB 3BKJL 2DTML 2QQKH 1FYTA 1IAIM 4UDTA 2H26B 1EO5A 3WYRA 3PGDA 4TSCL 5BXFA 3HFML 1SJHA 3HUJF 3N06B 2BK8A 3V52H 4KRNA 5I9QC 3KYOA 3RGVC 2NX5D 4JDZB 3SQBA 2DOCA 1N7MH 1BVKB 3DI3B 4M8QA 5HJ3A 3UTZB 1KJVB 3NACH 2P5EE 5L9DL 3G08A 1GGYA 5F7UA 2HTKC 1DLFH 4Y8DC 1WEJL 3VMNA 3CFIC 3WNPA 4FFVC 1CGUA 1T89A 1NGWB 5F1KC 3F7YB 3QA3B 2FH8A 3KYKH 3HPLA 4GW5A 4GH7B 3BZFB 2UZIH 2P45B 1UB5A 3PL6D 4S1SH 4ERSL 4WO4D 2YXFA 5EUKA 2UUDK 1JWSB 5L2KB 2IALB 1IAOA 3U7WH 4MAYD 4P2OA 2ZWLT 4BSJA 1UC6A 3B5TA 1K2DB 3O4OC 4KV5E 4NNXB 1NLBH 3TH4T 3IFOA 2YWYA 5D7JD 2AJZA 4QRPB 1S78D 5F89B 4FQHB 4ZXBB 4FZEL 1CFVH 4NM8H 4HD9A 1D5BB 4QRRB 3LV3A 1GSMA 2AK1H 1D7FA 2P5WE 1L0YA 3WFBH 2WBJD 1VCAA 2CDGA 4Z0XA 1X5JA 4NZJA 2HT2D 3SGEI 3TT1L 4BZ1L 1AR1D 5D6DC 3U82B 5CJQL 1RK0A 6FABH 2NY1C 1RIVL 1KV3A 1X4YA 4KH2A 5CWSB 5C09A 5E9DD 5FGBC 2W65B 1CK0L 1JWUB 1BECA 2YC1B 3BXNA 4XAKD 1DSFH 3FMGH 4J3TA 1J1OL 3HZVB 3SPVA 3D1MC 3LPGA 2UVFA 1J8HD 1MWAB 4K94L 2CSPA 4F2MA 4GKZB 1PD6A 4PJEB 5I1JH 2ZOLA 4RMQA 1MI5A 1NLDH 4WUUA 3LQZA 4G6AC 3SKJL 4JO4L 4NZTH 4RAVB 2FD6L 3QO1A 4MS8D 4UU9A 1JZ3A 4PV9B 4LGRB 3T4YA 3L5WA 1MY5A 5JOFB 2AV1B 3NN8A 3LSOB 3OPZL 1MHPH 4GUPB 4APQD 4DFIA 1CLZH 2IPKA 3HI6H 4ZYKA 5L88L 1UWGH 3NVQA 3HUJA 2VQTA 1JN6B 3LRGA 4OIIL 4YLQT 5I15H 1EO8L 1IZKA 3UBXA 4YHNB 2HTLD 4LSSL 2ESVE 4N0YH 2FLRT 3PE9A 3SCMD 4PGEA 2OR9L 3ZL4L 3C60C 1PKQA 3HC0B 3NFNB 1A6VH 1JE6A 2ZOKB 4LMQE 2FEEI 3O2WL 3TJHC 1MVUB 4KDWA 4PLNC 1UKSA 3VFVB 5JDSB 1S9WA 3CJJA 4GS7B 2CUHA 4JANB 1LK3L 1TCRB 1RZ8A 1HXMA 4LVHB 5C86A 1CG9B 4NM4L 1T1XA 4J23A 4PG9A 2CK2A 4RGOL 2J8OA 3C6LC 4P5KA 2GCYA 3KPRE 1UZ8A 5HHPA 4LSQH 5BVPL 2EKSB 2MMXA 1KCRH 1A02N 1JFQH 1A4KB 2Z35B 2ZUVA 4NWTH 4HF5H 5SWZA 4AM0B 1NSNL 3C8KA 3P4NB 2DQFA 3GSQA 1TTFA 1CDCA 2R29H 4WO4B 5JOPE 2XZAL 2WIIA 4Y5YB 3S34H 3CNKA 3RFZC 3G9VA 4A2LA 1U8NB 3MUHL 3VRLF 2MHAB 4I3SL 3O45B 1UM5L 4JFPB 3VMOA 3U36A 3REWB 4BJLA 2KZWA 1Q9OA 2YZ8A 4LHUD 1A7PL 3C9NA 4XNQB 1I7RB 2V5SA 2CXGA 4I77L 5D7JB 3T3MF 1T3FB 3SDDA 4DKFL 3QIBC 4R2GC 3PXHA 2FIRT 3VU2A 3C5ZA 2QHRL 2DD8L 4U1GC 1EHLL 1CD9B 3FO9A 4HPYH 4YR6B 3BSZL 4QRSB 3TA3D 3U7AA 1QEWB 2WBJB 3HE6D 3B9KB 4MD4B 3QWOB 1G9NH 3E3QC 2XZQH 3O0RH 5FKPB 4PR5B 1AE6L 2BNUB 1TQCB 4O2CA 1NBZB 1W72L 4PY8I 4Y5XC 5L2JB 1IKNA 4M6NL 4WU7A 3P11H 2OR8A 4NHCL 5ALCH 1FFPB 3I6GA 3GB7A 4JZJA 4U2YA 5E9DB 4GRMB 3GRWL 2BNQE 1YMHA 5E2WH 4UINL 4K8RL 4ODVL 2PNDA 2EDXA 5EO0B 3IDIA 5CSBA 2Q8AL 4FZ8L 4M4PA 1H3PL 4LSDA 2ZJSL 1J8HB 1R24A 5D1XD 3UZEA 3IGAB 5IP4A 2G9HB 3HS0A 4JQIH 3QG7L 2AK4B 1CGVA 1JPST 5KVMC 4MNGE 2APXA 1MHEA 1A64A 2E7MA 3MRRA 2OTPA 1F3RB 3FB7B 3G5ZB 5E2UH 4CN6A 2RFXA 3D25B 4NO5B 3SKNB 5D1QC 2GJ6D 4GAFB 4OM1H 3O4LA 1XF4B 2EZ0C 3CXHJ 4PJ8C 4APQB 3JXAA 1NDGB 3DNKA 3FT2B 1Z9LA 1S3KH 1W72A 4P46B 3VD5A 2BP3A 3S3PA 4DEPB 3HE7C 4XI5C 2I9TA 4YBLB 1PQZB 1Q9KB 1MLCA 4ISVB 1I3GL 1UJ3A 3RL2A 2X89A 2W0LA 2ZSVB 3GRWA 3GSWB 4U1NB 2CJUH 3PP4H 3VWJD 1JGVH 2FZ3A 3U48A 4HFUL 3K8KA 3OKYA 3ZYJA 1VFAA 4OZGE 3TBYA 5A2IH 4P49A 1NL0H 3BISA 4JDTH 1DVFD 2EICA 3E0GA 4KAQH 3HG1D 2FGZA 1AGBA 2O5XL 3OB0K 3H3KA 1WBZB 3RIFK 2X1XR 3QULB 1U95A 3HAEG 3T0WA 1OTSC 3KNBA 3I6LD 4LLDB 5EZLA 3MGOA 1KEML 2NY4C 1DBBL 5IB2A 5E1AA 4JHZA 5HYJE 3MUGA 1VADA 4LVOC 3AREA 5L6YL 3QJFB 2PYEB 1D5MA 2GK0B 3KPQA 3D48R 3JUZA 3U9PL 4GW1A 1A6PA 1BOYA 2B0SL 2ESVD 4OZHF 1BIIA 5HXMA 3HRPA 2A6KA 1F3DJ 1YYLL 4O58H 3RY5A 3V0VA 3U0WL 2YUXA 3DRTB 3VXME 3I3DA 3IJHA 4LHUB 2BC4B 4JGUA 5B38B 12E8L 4I9WE 1JPFA 1IILE 1NJ9B 4GBXC 4HUWB 5ITBH 4DTGH 4OSUL 1D6EA 2C7UA 4UT9L 1KLFA 5TQ0H 1NC4D 4IBLT 1N5AA 2P5EB 1HH9B 3TA3B 4G6ML 1TJGH 15C8H 4WTXA 4RGMB 3WKMH 3HE6B 4IRSB 3L5IA 2DQEL 4PS4L 5C0BE 5F9AC 4LSUH 2PCPB 4ETQA 4M5YH 5IV2B 3FB8A 4O2EA 4EI6B 2EE9A 1HIMH 3DIFB 3RGVA 4Y2OA 4OD3H 4Z18A 3A6BH 5TF1L 2CLRB 2HRLA 4HUKB 3K81A 4LBEB 3L5JA 1CF8L 4DJMA 5JHDA 5B4MC 4OCSH 5JOPD 3DV6B 5ALBH 4XX1E 4X98A 1A6TA 1AI1L 4OV5A 5C70A 2HFEB 1S9XA 4HJ0C 5F3BA 1I85C 3FFDB 1FZMA 1MJ8H 1HQ4B 1V3LA 5TDOA 3IF1B 2ZUUA 3M8OL 4UQ3A 1JF1B 5IVZB 4H25B 3OKKB 1Q9WB 4LPUA 5J6HA 1FVEB 1C5DB 2V5YA 1TVHA 3MUZ1 4WY7L 4FP8L 1AJ7H 3S36H 4KZEL 1XF3A 4Y19E 4PRHE 1F4WL 1DZBA 3K7UA 4OLYL 5FM8A 1QSEA 4FS0A 2R56L 4NKDB 1FLRH 3ILPA 4P9HC 4ZOBA 5DURD 1UCTA 3G6DH 3MMEA 3UZQA 4JE4B 4DZ8A 1H5BC 4LCWA 4HXAL 5E4EC 3L7FA 5L8LB 1NUDA 2VXUL 3WIHL 4AT6A 2DKSA 5JZ7D 2CDFA 3ZDZF 3O3AB 2CO6B 4LCYB 3IDGB 4H20L 2VLJD 5E8EB 1KF9B 1FRGH 3MBXL 3A6CL 4UAOC 5GZOC 1FBIL 5D6DA 3O3DB 2F19L 2VNCA 4P2YA 3EHBC 3PWVA 3PJSA 3VWJB 1I9IL 1C08A 1MRDH 1CL7I 4N8VB 5I16B 4X8JB 2L4OA 5E00A 1JZ5A 3FONA 4B50A 4XBGB 4QT5A 4U49A 5DRXA 4NC1E 1F90H 2A9NH 2GK2A 3N0PB 4MNQA 5MEPA 4OZHA 1KJ2B 1VFBA 5DZOA 5ADPH 2Z91B 2JCCE 2IEPA 2F74A 3PNWB 5EU7C 1HZHH 3BJLA 3CX2A 2F58L 3MBED 1QR1A 2FJHB 3H3PL 2OL3B 3M1BA 3BEVA 3P4MA 3WIHA 1FSKB 3V5KA 1EMTH 2RCSL 3UTTD 1JRHH 4K2UL 4Q2ZB 2DQTH 2ESVB 2VXVH 4Q9QL 1AXTL 3E6FA 2PO6D 1IGIL 3FOLA 2BJML 4OLXL 4PBWD 5AAWA 1G1YA 4KK8C 4XPFH 1PY4A 5E94A 4HIIA 3UJJH 3VFNB 5CILL 3SE3C 5KN5B 3C60A 1NC4B 4NO0A 4D0BB 2P47B 3ZO0A 2FB4L 3JWOH 2IANE 3A6OA 4PRID 3LRSA 2UYLA 4G6JL 4L8SC 4L4TE 3QR2A 2MWCA 1NBYB 1RZFH 3P30H 3KPRB 5J12C 3R1GL 2R1WB 2FWOB 2DMKA 1ACZA 1NEZB 5DJXA 4MJID 1FE8L 4R7DA 4PJ9C 4BQ9A 5EA0L 2BXYA 4KK6C 3WXWL 2ED8A 4WUKH 1S9KC 1NH6A 5JR1L 1FV1A 3TVMD 1KT2B 5F1NB 3C6LA 1E4WL 5E99H 2O26U 1FDLL 1PG7H 4WWKD 4YHOH 3QDGA 3QO0A 1GVIA 4JM2F 2XZCL 5EZOL 2R23A 1M4KA 1T04B 3AROA 4WCYL 3UBXI 4QXTB 5DRZB 2AEWA 4AL8L 1I7ZB 5LWYL 1FFNB 3UYOD 3BKYL 4RFOL 5F96L 1AXIB 4K7PX 3DX7A 5D4QA 4HCRH 3CVHB 2DIAA 5F1IB 2DLIA 2L0DA 5DURB 4ZFOL 1UB6A 2W0FB 3V5DA 1W0VB 3ARDB 3DVIA 5B3JF 3OF6D 2YRZA 1S7WA 3QIBA 2ZG2A 4OF7A 4AH2A 4Y16D 4XNUL 2VLRD 4NRXA 3GDBA 1JNLH 4Q9BA 2WUCL 4YDJB 1ZVSB 3QUYD 4PJDF 4ZUSA 2GTWB 2VLJB 3VFRA 3W2DH 4BH7A 2BNQB 2ZSWB 3ZT7A 3DHJA 5D1ZD 4S0SD 3WE6A 4OF5A 3IDNA 1UM6H 2EIEA 5GRYA 4Y5XA 4NQDE 4R4BA 4E41D 1A2YA 3MJ6A 4ZD3L 4V1DE 1IEAA 3EYVB 1S7RB 2JB6A 1OAQH 3HTLX 4LSRL 4XCYA 3LKNB 2OXHA 5DO2D 4B5EA 4FQ2H 4BH8A 1T0NB 1CFSA 4P3CH 4LLVB 1R3HA 1EV2E 3EJYD 1CVSC 2NR6C 2A73B 4PRHD 2D31A 2BSRB 4UUJB 4Y19D 3BP6A 1QLEH 2QJDA 5I17A 1OB1B 2X4TA 4IEFB 3QUXC 4Z7UE 4TRPL 2H9GA 3ZHDA 1YY8B 3LN4A 1CE6A 4GT7A 1J7VR 5IVOA 1BZ7A 3QHFL 4MSWB 4ZFOA 3MBEB 3GGWB 4Y88A 3BHBB 5D6CB 3V95A 3SKUD 1GGTA 1J0IA 4R8WH 4KKBC 1LO2L 4FA8A 3UTTB 3GUTA 4X7FC 2DQDH 5ECJE 1BEYL 2OCFD 4MZ3A 4C4KO 5TF0A 3WSQL 2X09A 2NW2A 3RNQB 3EIFA 1SM3L 4PJHB 4OLEA 4PJ8A 3GBLA 1X5KA 1X7QB 1M7DB 4KDTA 1HSAB 5E0QA 1C8PA 4XTRD 1G7MB 2AQ3A 1W2KT 5DK3A 4JKPL 3HE7A 2X10A 2MNUA 3OGOE 1AGFB 2KDGA 4P3WA 4R97B 1MQKH 4K7PY 1YEEH 3DVFA 3RPIB 1UWEH 2VQUA 2LTQC 2BVQA 4OZGB 5CZVH 5IHUL 1IGFH 2WNGA 4MAUL 3UPRB 4MD5B 1X5IA 4PRIB 3HNTH 4DN4L 1ETZA 2XQYG 1P6AB 4XPTH 1S5HA 4JM2A 5DUML 5J56B 2EDTA 2X4UA 3BO8B 4OKVA 5EH1A 4NZUL 5ITFA 2CRYA 2J4WL 3VI3F 4PP1D 2ENSA 4MJIB 3BJ91 4PBXA 3RBSA 5HYJB 3KPOA 2X4RA 1KIQB 5JORA 5IR1A 1UXWB 1XZ0A 4I8DA 1IL1B 4LCUA 3TVMB 4BSVB 3U4EA 4LKCA 1G0XA 4JQXC 5F9OL 3WHXA 5C07D 3UTQA 1KGCD 4NQCE 4PJAE 1HHKA 4XRCA 2NXZD 4LQ1A 5FDWA 1WIPA 4L9LC 4U33A 4XCEB 1Y0LA 5H8DA 1CICC 3O2VL 1X4ZA 5F9WC 3WLWD 3RWGA 1WZKA 4HUUB 1YYML 5LGJB 4QXGH 3V4UH 4JLRA 1FPTL 5TE6H 4WFEE 4P23D 4PJDA 5EO9A 5FDYA 3O3EA 5AUMB 1L6XA 3Q5YA 4C56E 4DN3L 4ZO8A 4X6FA 2IAND 2B20A 2DIBA 3EDEA 1JGLL 1WZMA 3I6KA 1FJ1A 2CKBL 3TN0A 5C0BB 4GBXA 1VEPA 3ARFD 5HDQH 1K4DA 4P9HL 3VFUB 1HOCB 2GSIA 5CINL 4MXWL 2VH5H 5I76B 1CDGA 5DYOA 3F7VA 3QDJD 5IM7A 4HWZA 4EVNA 3DX8A 2DM3A 3QUYB 4X6EB 4PUBH 5BCAA 2EDYA 4TNVK 2VDPL 2IGFL 5D1ZB 1JK8A 5ELIA 2CGRH 5DQ9A 5HD8C 3NZHL 5ABDE 4LIQL 1R3LA 1P1ZB 5D2LF 3UTPD 5DUBA 2XXCB 3CXDL 3INUL 1TZHA 3DI2B 4PGBA 4OCXH 2CD0A 4QXUL 5FCSH 1RULH 4MVBC 4HUVA 4YQXL 4D0DB 4F15B 4Y19B 1S7QB 4PRHB 1UCBH 2CKNA 4ZO6A 5DWUH 3ULUC 1I85A 3FRUB 3ZYIA 4AYFA 4KJYB 3MNWB 1P6FA 4H8WC 4JY4A 2R4RH 4KTDL 2XWJB 1NUNB 2P48B 3PF2A 4PJ7A 4JG1L 5JXAH 3MJ7B 1D9KD 3MNVB 4KI5C 1OAKL 3O6KH 4KQ4H 5T3XL 4YDVA 3ARBD 4XVUC 2CKBA 4X0KA 4XWOC 2AABH 2UWEF 2X1PA 1KJMA 4HT1L 1OGAD 4F3FA 4WNQB 5C6WH 2WUBH 1CQYA 4X4YB 5KW9H 1H5BA 4EI5C 4HMEA 2SEBA 4MA3B 3PABA 5FHBL 3MRPB 3T0BA 1S9YB 1KPUA 3QQ3A 5ANMA 5DVOA 3MRGB 4PB9H 1TTUA 2JJSA 3EYFB 3BUTA 3BX7C 3L3JA 2EH8H 3HLAA 2NY2D 4HKZA 2VDLL 1XGTA 1P7QA 1R3JB 1LMKA 1OSZB 4M8VA 3TIDB 1W0YT 4FQPA 1RJZB 3ARSA 3L5HA 5FYKE 2HFGH 3MOAH 4YHPA 3IAPA 3B6SA 5AD0A 1I3RB 3IFPB 4FQLH 5FA4B 2JKXA 4BZYA 4Z7WE 3WD5H 5TFSL 3QUMH 3WEXB 4N0UE 1T7ZA 4MXVE 3HNSH 1RUAL 2WWKT 4JFYA 4KJPC 1KB5H 4CMHB 1KYOK 3V6OC 1J1XL 1RZ7H 1I9EA 2VDQH 4QCIA 4H5SA 4HK0B 3I9GL 5D5MF 2Y5EA 1MAML 2DMCA 4FNLH 5GGQL 5CD3A 3VG9B 2DQHH 4Y4KC 3LEVL 4Z0BL 4PJCB 5J57B 2E27H 2FYYB 2R39A 3RVXC 4P2OD 3H0TB 4YHLL 2C3GA 3BP5A 1N4XH 3ZE1F 5I66B 1CFBA 1FLTX 5HTSA 3CZFA 2ZUTA 3L3OB 1TPXB 1EX0A 1E4KA 4P23B 3MACH 4OGYL 3FQTB 5GZND 4F80A 2EDDA 1TDQA 2IANB 3WKNA 5BMFH 4XNZB 3D85B 4S0TD 4L4TB 2Z31D 1KG0B 1V8HA 1MCPL 2HJFA 5D2LA 3ECBA 3QPQC 3WS3A 4E0RB 3WFEL 3IKCB 3PWNB 3FQRA 5FOBA 3RL1B 1NQBA 3A0OA 2A83A 4UT7L 3QJHB 1NGZA 4L8SA 4G9DA 1BP3B 3G5YA 3UJTL 3PWJB 1XF2A 4HH9A 4MCYB 1JZ7A 5IKCB 4KVNH 1BAFH 2F5BH 2IADB 3OR6A 5D2NE 2XWBA 3QEHB 3C09B 3WFDL 5EU6A 4PJ9A 1XCQA 2W60B 1LEGB 2GY5A 4FFYL 3FQXA 3VFSA 1J12A 1PZ5A 1I7TA 2UWEA 2ARJB 1UACL 5BZWA 4ODTL 4U1IB 4YFLI 4PLKC 3DJ9A 4HJGA 3P4LA 1IM9B 1AGEB 3VA6A 3MV7E 4RZCA 4P3DB 5FYLE 5MP6H 2FATH 3S3JA 4R90H 4TTDD 1D9KB 3PWLB 3HZKB 4OD2A 3ARBB 4TUJA 5IMMA 3CFKA 3FHQA 4EBQH 3NGBC 5DEGA 4R0LA 2A74B 4IIQC 3TYGL 3QAZC 5CCKH 4WHTA 3SDXF 1YMME 4PJIF 3RNKA 1DQML 3GSUB 5DR5L 4XP9L 4FQXC 3PDOB 2AEQL 3PHOB 5EN2A 4NQDB 5BW7C 3O8XC 2PXYC 2GAZA 4ZTOL 5ID1B 4V1DB 3IXAB 2K3TA 3HMXL 3JWDL 3VGDA 2VABA 3QNZA 3OKOB 1BFOA 4G6KL 2NY2B 3SQOH 5BXFB 2DBLL 1HILA 1IGCL 4YHKH 3DVNB 3KYOB 4FXLA 3S5LG 5KANG 1K9TA 5D5MA 1DN2A 4PB0L 3IS0X 4Z7UB 1MJUL 2APWA 5F7WC 1A7NL 4F9PA 2AJVL 1B2WH 4D9LH 2IF7A 3J8F7 4GO6B 2XRAH 4K7PH 3N85L 3QUXA 5KJRL 4M00A 5BOPA 1OP3K 3OAZK 4F37F 1K3ZA 4JFXB 3OKEA 3RWFB 4NFCA 1G0YR 2FSEB 2VDRH 1RJYB 5TQ2H 4YWGH 5CBEA 1FGVH 2X4OA 1T1ZB 4P2OB 4R96A 5DJDA 4A6YH 1JTTA 4M7ZC 2EXYC 3N50A 3QEGH 2G75B 2BY1A 2YHGA 4TSAH 3GSOA 4B7IA 3ULUF 2BVUA 4Z6AT 4J1UB 5FO9A 3SDDD 3U46B 1CU4L 4D8PB 3MR9B 4M5ZH 3RHWF 3HMXA 3C5ZD 3LMJL 4PGDB 1D5ZA 1E4XH 4QLRA 4KI5F 1LO4H 4IS6B 4ZOCA 3EFDH 3F12A 3RWEB 2Z31B 5CFHA 4Z0XB 5EC2A 1MCWW 3FQNA 4W6XB 3U79A 3FRPG 4RQQB 3B8SA 4QXWA 5EC1B 1LDPH 1UVQB 1K8DB 2ILLA 4M7JL 3QEUB 1OPGH 4PJ5E 3K2MC 3FTGB 1TVDA 2FJFA 4LAQH 3EW3B 1I7UA 5IHZA 3TV3H 3N1FC 3HA0A 3ZE2E 1U36A 3UJIL 1TJHH 1SMOA 4NQCB 3WHE1 4PJAB 3ALWA 5JPNA 4C83B 1LO3H 2C3VA 4ZOEA 3IKKA 2HG5A 4NHUB 3HR6A 4DUXA 1K4CB 4FXKA 4KRMB 4KKCC 1RZGB 3MRIB 5TE7L 4ZQKA 5MERA 4OIBA 4TYUA 5ERWA 2IAMD 3VGAC 4JQXA 1FG2B 4KGJA 5D93B 1CD0A 4LARH 2BSTB 4C56B 4TNWF 4AMKH 4L9LA 3SDXA 4PJIA 2AERT 1CICA 3FN9A 5MEQA 1HHGB 4ONGL 3T4YB 3ULUL 4Z77B 4JRYE 4X9FA 3O4LD 4OQTL 2HP4A 3L3KB 4P2QE 2HRPH 3NN8B 4P9ML 2AQ1A 4LLYA 4ESKA 1A22B 1ZLWK 5T5NF 4Q7DA 3DV4B 1K5NA 1NGPL 3PHSA 2MTPA 3KPNA 4PY7A 4FG6C 2X2YA 3VFOA 1EFQA 5CJXA 2KZ1B 2IFFH 3UYRL 1MFEH 4XPHH 1INEL 2VIRA 5E1HB 3MV8E 4I0PA 1ZLUK 4E42A 1J05B 5GRVK 3GMMB 1EERB 3L5XL 5D71H 3RWDA 2AAVA 4U6XB 2Q20A 2YZ1A 1A6ZB 3ZSTA 1QRNE 5I74C 2XNAB 4HX1B 3ZLQC 3STZB 4F7CB 4X9HA 2VKWA 3MRBB 3QT2A 4FTVE 1FIGH 1HXMB 1BQHA 2VQ1A 2CK0L 4JFHE 5BRZE 1TQBC 5FGRA 1BFVL 3RVUC 4HBCH 1T1XB 5FYLD 4PG9B 1MFBL 1A21A 3QRGH 3CDCA 3U4AA 1QLFA 3FOMA 3RDTC 3GMOA 1RZJL 5EU3B 2CR3A 5DI8B 4U4BA 4LSTH 4OQTA 2DQFB 1EUUA 5I73C 2Q3ZA 1OGTA 3GSQB 3KWWA 4YDIH 3LKSB 3KLSA 3MLUH 1JV5A 4ODXA 5D96C 3V6FA 1MNUL 1YMMD 2BNRA 4XVTH 1INQA 3X11A 4DFHA 4HFWB 3KYMA 2DM2A 1A3LH 1GAFH 4ONHB 2ERJC 1I1RA 5KSAB 3GKWH 3GSRB 5IBLC 3I2CH 1DFBH 2JELH 4HUMB 5HI4D 2AQ2A 3R4DA 1U3HC 2O93L 4EI5A 4F7MA 4PRBA 2NNAB 3VXRA 3NA4A 4ZUTB 4YBQC 3X3FL 5B39G 1P4IL 2WWMC 3H9YA 4J8RA 2HKFH 1I3UA 1S7VB 3U30B 4JRXE 4R3SB 2YUWA 3AU1A 2E9BA 4DVBB 1CXIA 5CP7A 4XZUA 4Z7WB 4ZS7L 1CZ8L 1F45A 1JGEB 4N0UB 4MQ7A 3RGVD 1NFIA 4KXZI 5E8PA 3VH8G 1D5XA 1XGQA 4JPWL 1J5OL 2YUZA 1RU9L 3AXLB 3RU8H 2BCKA 5JHDD 1ZHKA 2HTKD 1DUZB 5IW3A 4X6BA 5FA3B 3AVEA 2W9DH 4FFVD 4J7RA 2VERN 4WFGE 3CPLA 1U3ZA 1U92B 4U1HA 4I48A 4S1QL 3V6OA 4JGJA 3HI5L 2PR4H 5IMKB 2IAMB 3OV6A 2VAAA 5GS3A 3MODL 5F3HA 4KMQA 3MLRL 4X7DC 3TJEL 3KDMB 1BF2A 3QIWC 4RISH 1FNAA 2ZCKH 4M6OL 4Y2DB 4Y4KA 4HG4K 3R06A 2OS7A 3MRRB 3VA2C 1QSED 5C3LD 2D0FA 3BQUC 4LCWD 4JVPA 4X7SL 4OF6A 2PETA 3F65A 3O6ML 4CVXA 2Q86A 5C9JB 3R8QA 2GSGA 1CS6A 2VLME 4NKMA 5BO1L 4CNIB 2J88H 3NABH 1A9BB 3BDXA 3JV4B 2ICWJ 1CGYA 3K80A 1E6OL 1GGBH 1IAIH 1LO5B 1YEDA 3ROOA 4NKQB 3EDJA 4ALAH 4I4WA 1AQKL 1PEZA 1NFKA 5KBNC 1B4JL 3LZFH 3BPCA 3U0TA 4JFDE 4YDLC 1MLCB 4OCYH 3E2HB 1NDMB 3HMWL 2B1HH 4H1LH 4P2CG 5JPMA 4OCRH 2P49B 2NY1D 2LQRA 2IH1B 3U2SA 5DXWA 2NY3B 4JAMB 3WXVL 1TZGH 4X7TA 3S4SA 1A7RL 4L4VA 3DX6A 2X4NA 5F9JB 1U8OA 2R8SL 3S37H 4D9QE 3ROLB 2P46B 5KS9E 1U8JA 1H3GA 1CDIA 4X9IA 3HHRB 5DD5H 4Q97A 1U95B 3EYSL 3QXWA 1OARH 1ZHBA 1CDUA 3NAAL 4LF3A 4G6AD 1HQRA 3G5VA 2EDFA 2F5AL 1D5MB 1FNFA 3KPQB 3LKOA 4YEEA 4ONFL 4XNYH 4X4MA 1WIUA 3KPSE 1YMMB 3P77B 3GMQA 4X99B 2P43B 5I1GH 4J12A 1EHAA 3BH8A 2JTDA 2PW1B 4F7TA 4R4FH 1DBKH 3MYZA 3HC3H 5ESAA 1QLRB 4WI3A 1DLHA 1NPUA 4X5XB 4IIQA 4PD4J 4ELME 1NMAH 1JPFB 4YEFA 1D6EB 4OFYD 2EYSB 1JNJA 4ODWA 1F00I 4XPGL 5BW7A 1MEXH 3O8XA 4WV1C 2PXYA 2P8LA 1N5AB 2FL5B 2QQQA 5FK9A 3GBMH 3HNVH 3TJHD 4XCFL 5HHXH 1TXKA 2FO4A 4UTBH 4F57H 3VFGL 2AW2A 4LSPL 4L8CB 4F7EB 4KZDH 1KIPA 1U8QB 3SDAC 3IXTA 4WJ5B 1PYWA 3TNNA 1A1MB 5DD3L 1QACA 3QQ4A 3B9AA 4KJQC 1QBBA 3C6LD 4HIJB 3IAGC 2CQVA 3QDGD 3BRFA 2VKXA 4UQ3B 4HC1H 4YE4L 1QFUH 4K7FA 3SE9L 3BT2L 2Q8BL 2I9LB 5HGBA 1ADQH 4Z7QF 4G5ZL 5KAQG 3EGSA 2GT9A 3BKCL 1IARB 3MRHA 5DHVA 1HXYA 2OL3H 1DL7L 4U0RC 1QSEB 2XKUA 2GUOB 1IC5L 2AJUH 1T0PB 2P24B 1TCMA 2W1NA 3AUVA 4RAUA 4TUKH 1S7UA 2R2EB 4QHKI 3O4OB 1DEDA 3MMEB 5FUCE 4UT6H 2MCPH 4LCWB 4LLQB 4JRXD 5EU5A 4JR9H 3QIBD 4R2GD 4WEMB 1NUGA 4GRWF 5IK3B 4AT6B 5C0FB 4RMWA 5I8CB 5IFHH 2Y36H 2ATKB 2ITDA 3AMLA 2IPTL 3RTQA 4QHUB 1P84K 4HGWB 3CFJB 1NMBL 5EBLA 5IVNA 4PJBF 1D5IH 2WLZA 4G9FE 1GHFH 4RMRA 4JO2H 1DQDL 2VLKA 4U3CA 3AY4A 1WJ3A 4JKMA 5EFIA 3LIZL 4G8GE 2I27N 1EEYA 3LDBB 4Z8FL 3NH7H 3PJSB 4KHXH 5JTWA 1ZMYA 4Q58C 4O2FB 2E6PA 1Z5LB 2R1XA 3FONB 3G04A 2OI9C 1NGQH 4FQCH 2CLZA 2E5EA 1JF5A 2VE6B 1K8IB 4NT6A 4OZHB 4I13B 4HZLB 5INDA 5CKGA 4P4RB 3M07A 4JRYB 1VGEH 5J0BA 3MCKA 1URLA 3I02B 1YNTB 1YEFL 3EO1A 3P4MB 4U1JA 1IM3A 4Z5RA 3V5KB 1QSFE 2VR4A 4X5LA 4LEXL 5D1QD 2I25N 3GO1L 1F6AA 4XMPH 3SKMB 1JGUL 2AEPL 3LQAC 4NKIH 2EE6A 4DUVA 1G9MC 1DQLH 2EZ0D 5EORH 3MV8B 4PJ8D 5HHQA 1RMFL 2XA8H 1IFHL 3FOLB 2DTSA 3CVHH 4RGNE 2XKNA 2XPGB 3T09A 1B0GA 3V6ZB 1QRNB 3MLZH 2FECL 1IGML 2R2BA 5CEZE 3HE7D 4XI5D 2D7QA 4BUHA 3BAEL 5FGSA 5I1EL 3BYTA 3P40A 5GRUL 3VDBA 1X5ZA 3FJTA 2EXWC 5IEHA 2VRAA 1BBJA 2UYLB 5KZCB 1FGNL 4N0RA 5HGHA 4X7EC 3FB5B 4P4KA 4DOHB 1IRAY 3DUHA 3V8OA 5C8JB 2VISB 1ZHNA 5DJXB 3GK8L 3UCRA 1KTDA 3V2AR 2RB8A 3O6FC 3MLWH 2EDRA 4UQ2B 4LEOA 2D0HA 5IQ9A 1ZA6A 2HMIC 4RRPG 4KC3B 4LNRB 1OTSD 2OR7A 1XGUA 2NY4D 2DS4A 4U7SA 1AGDB 5T1MA 3RDTA 3SGEH 4Q6IB 1U0QA 1GPOH 5AWNL 2R23B 1WSST 1YA5A 1OP5K 1XR8A 1EIBA 1GC1C 5D7SH 1OAZL 3BH9B 3NIDE 1F58H 3DXAA 2AJYH 1XGYL 4PJBA 3OGCA 5DDHB 3BMWA 1KN4L 4GMTL 4G7YL 4OUUA 4UV7L 1DQQB 2BVOA 3B2VL 3Q5TA 4L4JA 1U3HA 4JRXB 2N56A 4KKNA 3SO5A 1EK3A 1YQ2A 5HHVH 2VL4A 4GBXD 2G5BA 3RY6C 5BV7H 1DJSA 3ZTJH 2CDEB 2B2XL 4U1GB 3VD4A 3U1SL 3PWUB 3B83A 5IBTH 2ZCHH 1QKZH 4X6DE 3MXVH 2EE3A 2KH2B 1EAJA 1ROWA 1KCVL 3NMEA 1MCEA 3CC5B 2YR3A 3T65B 5ACLA 4PV8A 5GGUA 2D03L 4B41A 2EDQA 1QFWL 2FX9L 5KSBE 3OL2A 2O5ZH 4L3EE 4M3JA 4OM0L 3V0WH 1GJIA 1AY1L 1Q9LA 3IU3B 4F58L 1I1FA 3UC0L 1A2YB 3N9GL 2H41A 2FO1A 5EOTA 4RWHA 5DQDH 5J1SC 2J5LB 1CD8A 3DROB 5B4MD 1WV7T 3B2UC 4ORGA 3RZCB 1KELH 5EOQL 4JKKA 2JF1A 4JZOA 1MAKA 5DC0A 4HJ0D 2E7LC 2YD3A 2YD6A 4U6VL 4RX4D 1PX4A 2BRQA 4Y4HA 3LN4B 3QYCA 2VL5B 5HHOA 1BFTA 3FAWA 1O7VA 1ITCA 2N1KA 3NTCL 4XC3L 2Y06L 4WI4A 4W4NA 5KVGH 5FO8B 1TETL 1A4JB 2VITB 3MRLB 3BQUA 4XP1L 3GUTB 3NZ8B 3GI9L 4DKDC 5D1QB 2JJVA 5TE4H 3H3BC 5EDXA 4XMLL 4JFDB 4M7LT 2NW2B 2V2XB 5IJVA 5B3NA 2NTFB 3ZKXC 1ORSA 1LO0L 1F2QA 5EO1B 5F7LB 3WDHA 4FQJL 4KPHL 5GZOD 3N1GC 1PSKH 1P7QD 1EEUA 1PFCA 5IF0A 1FH5L 5KS9B 3EHBD 4M4RA 3BDYH 2I60H 2DQGH 1ZT7B 2VSDA 1ZLSL 1C5BL 5C08A 5ITFB 4AQOA 1JWMB 1DBMH 3B9VA 4R7NB 1L4IA 3GM8A 3EOBB 3ZE0E 3HAEB 1N8ZB 5AYUL 4ZUUA 2A6IA 1FC1A 3UPAA 1QBLH 2R0LH 4LRNL 4YUEL 3QUZC 3DLQR 3P73B 1VACB 3WO4B 4LCUB 1AO7A 3KPSB 2VDNH 4YIQB 3UTQB 1VKXB 5I19H 3W9DB 3NFSH 2AV7B 2NY4B 5FDWB 1RIUH 1VPOH 1Y0LB 3MA7A 5KVDH 3U7YL 3RWGB 4ELMB 2YK1L 4HAFA 1BQLL 3W81A 3D0LB 5IGXH 5CEZD 2IWGA 3QFJA 4LHUG 4JLRB 3O11A 1XGRA 5CEXA 2FDBP 4PJDB 4YX2H 1RURL 3NCJL 4H1LG 1TENA 2YEZB 5JXEA 4KK8D 3T2QA 5DJ6A 1J0KA 3EYOB 2IPUK 2V5TA 2MPAH 3B4NA 4P59H 1NCUA 4Y4FC 1FIEA 1A47A 1BIHA 5EBGA 3FCTA 1HYSD 5IMOA 3TWCL 4WV1A 5DYOB 3CLEL 2OZ4L 3MROB 5EZJA 6CGTA 3B43A 1P4LA 5GS1C 5IFJA 1Q0XH 4WHCA 5MENE 1U8MA 3E6HA 4B53A 4Q0XL 2M1KA 4G43A 4DGYL 2IQ9L 5EU6D 1GZPA 4PJ9D 1PGRB 3IJSA 4K3EH 4KK6D 5DMGC 1JHLL 4XXCA 4NQVA 4QRTB 5LGHL 3LEXB 5DS8B 5T5FL 4FQ1L 3V4VH 4EDXA 4L29B 3ESUF 3LN9A 4DW2L 4HPOH 4JY4B 5DRWB 4XAWH 1RJLA 1U41A 1NAMH 3BIAX 4GAYA 1NCBL 3EDKA 1YEHL 5D72H 5F1SA 5DTFA 1JGDB 3UMTA 5LQBH 1AHWC 2Y1VA 4PRDA 2XY2A 1XIWC 3ARQA 1RZKC 3JZ7A 4TVPH 1UQSB 1WZLA 3D69B 2CKBB 2QKIA 1LGVA 2VXQL 3C8DA 2HLAB 3BW9A 3KLHC 5ICZA 2COQA 1Z9MA 1I8IA 4MCZB 1MFCH 4M1GH 4LL9A 1MFDL 3V9FA 2ICEA 3FO1A 4G9FB 4IDJL 2OZ4A 1M6OA 5E4EB 5MI0C 2SEBB 4Y1AA 4K3DH 4OQ1A 2FX7L 1F2XK 4G8GB 3ARXA 1CFNA 1HH6A 3MRJA 1G9ML 4NGHL 4BFIA 3CDGB 2BRRH 5GS0C 2F15A 2X7LA 4J3XA 1WZ1H 1QBAA 4XCNA 4UAOB 3NACL 4JPVH 3P9LA 3QEQA 4RBPH 1IC4H 3AC0A 3SJVA 3L3IA 4EIGB 1C16B 4PJGE 3B6SB 3RWIB 1NAKL 1FL3B 3MLSL 2EKJA 4G7VH 4R26H 1WICA 5DD1H 4ZUVB 2NR6D 4IOIB 3VFTA 5CMAB 4S1SL 3MREB 1YNLH 1FL5A 3QUXD 3RWHB 4ZTPH 1QSFB 2Q76A 4N90E 1H8SA 3O9WC 5C0RL 4Z76B 1V7NH 3WIFA 1CXKA 1TFHA 4NDMA 4RGNB 1RZIB 1T80A 4XWGH 1HNGA 1BM3H 1M05B 3QH3B 3LN5A 4KKBD 5GPRA 2FGWH 3RWCB 4KMTH 1KTKE 1FZJA 5C2BL 1IKFH 4DKEH 1IEHA 5LG1A 1PZUB 1O5DT 4HH8A 4LSVH 4PJFE 1F11B 3RVVC 1MFNA 1JYVA 1P7KB 2CMRL 3OAUH 3A67H 1YEKL 3DECA 4K3JH 5FM4A 4LCIL 1YEGL 3OAYH 2Z93A 2HJFB 2IC2A 3ECBB 5DRNB 4PJXF 1QO3A 5FOBB 1DUYA 5DUPH 1PBYA 4ZSOA 5HVHB 2DDQL 3T0EE 1NEZG 2LU4A 2EC9T 3BGMB 5DZLA 2DQUL 4IHOB 4L8SB 3G5YB 5EIIA 4HH9B 4MXQC 5JIHA 3B5HA 1K6QH 1NCDL 5I1JL 3Q1SL 5C1MB 1MY7A 1FNSL 1EUTA 2EC9U 3O6FA 3GMLB 1JI1A 2P8MA 1VHPA 2R0KL 3P0VH 5HHME 3M45A 1KLGA 1QYGH 3AS0A 1HHHB 5BZWB 5FUOH 4XP5L 1T7VA 2G60H 1ZANL 4HJGB 1N64H 2F53E 3T1FB 4YHML 1CICD 4RZCB 4Y5VC 4D9RE 1ACYH 4LCCB 4NKOA 3H6JA 5D7IF 4EQ3A 4HIHA 3GJFB 4N0FB 3VGBA 1CL7H 4TUJB 5E08L 4XBPB 3OKDA 1UGNA 3QIUC 4CW1A 3FKUS 3ULVC 4JZNB 3PGCB 4MNHA 4X6DB 2QEJA 1ZHLA 2YPLA 5DJ2A 1XAUA 2A9ML 4NQXB 1MCSA 2VN4A 4KROC 3NCMA 4CRPA 3BKJH 4CVZB 1KTLB 4J2XA 5KSBB 4CJ0A 1B0RB 4L3EB 4P5MB 5EN2B 3T4AB 1H15B 4TSCH 2KQNA 2IH3B 3HFMH 1FHGA 5LAXB 2OTUB 3KYNA 3QNZB 1BOGA 3PWPE 3CDYA 5ETUA 3ES6A 2QADC 3DBXA 5L9DH 2ED9A 4U1KA 5JMRA 4NN6B 1UZ6E 4LLUB 5HD8D 1WEJH 1L7IL 1I8MB 2HVJA 3TZVA 2HYMA 3RVWC 5L0QC 2V7NB 4HWUA 5DT1L 5EWIL 5KG9A 4J3OC 4YPJA 1ZA3A 4MVBD 1NUFA 4JY5L 2V2TB 3QCVL 3ULUD 4ERSH 2E7LA 4BKLA 1SHMA 4FXGA 5EBWA 3S34L 5KTEL 3X3GL 2X1QA 5KVEH 2BNRD 4S1DC 3MV01 4KI5D 2NPLX 3RI5K 2XXMB 2V9TA 3F5WB 3H9SA 4PGCA 4XVUD 2XTJC 3P4OA 3T3PE 3ZTJG 2BZDA 5CBEB 1KPVA 1TVBA 4XWOD 3ZZ1A 4PJXA 1JF6A 2EE2A 2JK5B 2PUQT 4ENEC 2DJ4A 4FZEH 4FQIL 4EI5D 5FO9B 3ARWA 3EYUL 4FABL 4M7LL 5I71C 2X70B 1P2CB 3MRQB 3VXRD 3EAKA 1Y18A 1G9NL 1G7HA 3TT1H 5CEYB 4BZ1H 1CIDA 2ADIA 5CJQH 1RIVH 4OLUH 1T1WA 5F97E 5AG9A 3EO0A 2LTQB 2F8OA 4NFBA 2EEDA 2BVPA 3KJ4C 4MA7L 3DSNA 2DRUA 5E2WL 4MHHI 1J1OH 2EDHA 3QPXL 4GFTB 5T3ZL 3VFMA 1Q0YL 43CAA 4K94H 5HPMB 2AJ3B 3QZWG 3SY0B 3UDWA 1JHTB 5JPNB 5D7IA 3G5XA 1U93A 2HT4C 2N7BA 3LY6A 4ZDHA 2LAAA 4KJPD 1UH2A 1EAPB 3QUZA 2EEAA 5ERWB 4GAJL 4ZG1A 4JO4H 5ESVA 3RUGF 1N59B 2ADFH 1TZIA 5A1AA 2FD6H 2WSKA 5D8JL 4NRZA 2MKWA 3VFWA 2D7PA 1QFWI 4HIEA 3AAZA 5E2UL 4Y4KD 3VJ6B 2BOCB 4MLIA 3RVXD 1CICB 1U8LA 4NUJA 4OM1L 4OFIA 5JQ6H 1YN7B 4HV8B 4LQFH 1UA6H 3OPZH 8FABB 3T0AA 5L88H 5DC9B 1RUKH 1PEWA 4OIIH 1VFUA 1S7SB 3R8BB 2Y5TA 1KIRB 1AXSA 3HCVB 2OR9H 3ZL4H 5C0DA 3BUYB 3D18A 3QPQD 4DQOH 4Y4FA 3S6CA 1ZTXH 3G6JF 1U3YA 1U8KA 2CLVB 3QFDA 3RWDB 4RFEA 1PLGL 2W9EL 1KFAL 3FZUC 2YOCA 1LK3H 5HHMD 4OLZL 4DCQA 5J3HC 4PY8J 3MLYL 5GS1A 3IJYA 3B5GA 1U8IB 2BDNL 2PTVA 4UNTA 4BK5A 5FYJU 2NY5L 5C0AE 4GJTB 5E2TH 4RGOH 1KPRA 5GS0L 5DVKA 3H7BB 2P7TA 4X5WA 5BVPH 4D9RD 2Y7QA 5E8OA 3AS3A 1NSNH 2B8OT 5I1AB 1QLFB 4PLKD 5I8OL 1JPTH 4EOWL 1GIGL 1J0YA 3SE4C 1RUML 3KWWB 1T2XA 1W0WA 4I3SH 4O58L 2Z92B 4DVRL 5ISZA 1UM5H 1AHWA 1INQB 3X12B 1XIWA 3TCLB 3FT3A 3GMRB 1A7PH 1WAAF 4ZS6C 2EH7L 2Q87A 4I77H 4QF1A 2WINA 3WS6C 2NW3B 3UZVB 4DKFH 1MFAL 4MQTB 1ZWIB 3AB0B 2QHRH 2DD8H 3BIBX 4DTGL 1EHLH 2Z8RA 3L9RB 4EI5B 2VYRE 2G2RB 3MLTB 4FQXD 1P9MA 3TYFA 1TJGL 5HY9A 5F7NC 3O8XD 3WKML 1KLUB 5ESQA 2PXYD 3KS0J 3GJEA 1F4AA 1KN2L 1AFVL 3F6LA 4UOJA 4J8RB 2JIXD 2WMPA 4PJGB 3UO1L 1N2RA 4I2XA 3M17A 4M6NH 4QRQB 3AU1B 3ULVF 4Q9RL 1I8LC 2YMXL 4XZUB 1RK1B 3MV9E 3HN3A 4FHBD 4ELKB 1WIOA 3RUGA 1NFIB 3GRWH 5ACZB 1YECL 4RDQG 1FVDA 4UINH 4PTUB 4ODVH 2FIKA 4ZAKB 2BCKB 2Q8AH 4FZ8H 2Y07L 3LKRA 2ZJSH 3OXSB 5HGAB 1X6LA 3TO4C 4IOFC 4Z7VE 2XN9E 3ZDYF 1SEBA 4AIZA 3QG7H 2H1PL 5GGSA 1S8DA 3D39A 4NYLB 5FYLH 4GG6E 5IB5B 5F3HB 1T0MA 3O9WA 1S7XA 4PJFB 3NCFB 2GTZB 3EZ8A 4Y4KB 5FGCE 1J8KA 1BQUA 1V3KA 3CXHK 4NO2A 2B5IB 1Q72L 2EXYD 3G6JA 5DF0A 4QHNB 2GFBB 5L8JB 3LS5H 3RX5A 4NKMB 4QHLA 1TITA 3DO7B 3T0EB 4IMKC 2D9CA 3DUUB 4OF8A 1YEDB 1I3GH 2H3NA 1ZT1B 1LK2A 2R15A 3ULVL 1R5WB 1HWHB 4BQCA 1I1CA 4QNPF 5F70A 4CVUA 3FT4A 4OT1L 4GKNA 4HFUH 2J8UE 4XB7A 5CGYC 4NWUH 1MLBB 5I1LB 5HHMB 4JJ5B 2YA1A 1FN4B 2CRMA 4KDVA 4G8IA 5DJZA 4QKXB 2O5XH 2X4NB 4G8EA 4PRPE 1J1PH 3FHAA 2NY7L 3ZYOA 3DPBA 3PP3K 2HJLB 3IVKA 4M3KB 4HWEL 4LPWA 1KEMH 3L3DB 3PV6B 4KKCD 3WCYA 1WAAA 4BZ2L 2BERA 1DBBH 4YHYB 4AEIL 4F33A 1V7ML 2ITCA 4OB5L 3DO3A 4M1DL 4XXDA 3S35X 4YAQA 2CXKA 2JJTC 3MRNA 4UTAL 2KL6A 2GYSA 2V9QA 3O3BA 3U9PH 3VRIA 2B0SH 1LEIB 3ARGC 3OJVC 1T2JA 3G5VB 4Y5VA 3W39A 4ORZC 1QUNA 1YYLH 3S88L 2QSQA 3U0WH 2VXVL 3NIGF 3UEZA 4UILH 5TDPA 2DN7A 1HI6A 4F7TB 1F6FB 1HEZA 4OSUH 3UJJL 4HGMA 4UT9H 3QAZB 4X9GA 35C8H 3PWPB 4FG6D 1TTGA 1YEIL 4G6MH 3JWOL 4FQXB 5T1KD 3MNZA 4WU5B 4ODWB 3O8XB 2DQEH 4HULB 3BD5A 1YC7A 3S5LB 1RZFL 2JIXB 3WFHA 4GAGH 2EIZA 2N7AA 3QNYB 5FF6B 5TF1H 3DVGA 1YDPA 1MRFL 3VCLB 1Q94A 5E6IC 3MRCB 4RA3A 1FL6B 4GG8A 3GMPB 1J88A 2WM0A 5T1LD 1PYWB 5DZNA 4DAGL 4X7CC 3RVUD 2ZUQC 3MGAA 4JFEE 4JY6A 4LLMA 2MCG1 5DSCB 5DK2A 3M8OH 2DQCL 2C1OA 4NO3A 2X1OA 3SDYH 3RDTD 2B4CC 3I75B 4NQEA 2ADJB 1U6AL 4FP8H 4ZFZB 1ZOXA 4KZEH 3WNLA 1F4WH 1FNEA 4AG4L 4OLYH 4OKDA 1G7QA 2R56H 5A16B 1IGTA 1T6WA 4N5UA 3VXQA 1MH5B 4JFFA 5GXBB 4PTTA 4HXAH 4OZFA 3RIFF 3WIHH 2VXUH 5IBLD 3QXDA 4M7ZB 1NGXA 3D0VA 2DLFL 1U3HD 3WLBA 5I1DB 5BQ7B 4P2RE 3MV9D 1U58A 3WN5A 1UG9A 3HPJA 1ZLVH 1MJJA 2K7PA 5F6IB 4YBQD 3A6CH 4EXPX 4QY8B 4M48L 1FBIH 2I07B 2WWMD 1G6RL 1LD9A 2APTA 3O6LL 1I1YB 5C92A 2F19H 1QR4A 4RSVA 1I9IH 3STLA 3BYYA 3GSVB 5E56A 5D7LA 3VDAA 5F7YC 5IBUG 2YD1A 4UDUA 4U05A 5GJTL 5GSRB 4HDIB 4X6CA 5F7DB 2AXGB 3VD7A 3MRFA 4L8DA 3EOAA 1UJTA 3MOQA 4O51B 4YJZL 4WEBL 1IEBA 3HR5A 4NT6B 2BMKB 5INDB 5FIEA 3PIQA 2F58H 3H3PH 5DQJA 4W70A 3VGAB 2GJZA 3NFPA 4HKJA 5FM5M 2R4SL 3OWEA 5HHOD 3BP4B 3LKQB 1N6QL 3DMMB 2QSCL 4OGAC 2F9BT 1CT8A 3H9HB 3QIWD 2RCSH 4K9EC 4OLVL 3W0WA 4K2UH 4CVWA 3LPFA 4ZXBC 5D9SA 1LP9F 1M7IA 1KEGL 4Z5RB 3KXFE 5FM5O 3L95A 3BQUD 1X44A 5IB3A 4Q9QH 1JNHA 2VZ1A 1AXTH 1IGIH 1SY6L 4XH2B 2E7BA 3T77B 3VRJA 1IGYA 5C0NC 4LFHD 1G6RA 1ZS8A 3RA7L 1NC2B 5L8KB 5HHQB 3WJLC 4L3CB 5CILH 4IMLB 4NFDA 1B0GB 1IC7H 2J12B 5GRJL 2QSTA 2FB4H 1X3DA 3QXTA 2EYRA 3DX9B 1S9VA 4G6JH 1B9ZA 3JSSA 5T1KB 5FAAA 5CJOL 5JQHC 4GQ9L 5FYJL 3S98A 5GGRA 2AKRA 1ZGLM 1FZKB 3R1GH 4QOKA 2V2WA 5FOJA 2PW2B 3LD8C 2NX5E 4FQQA 1FE8H 2K1MA 5EA0H 5C08D 5C0JA 1RFDL 3LPWA 3WXWH 5E8NB 4S2SB 2OJEB 5F7KC 2R0WL 5JR1H 1HE7A 2O5YL 1N26A 2W0KA 5T1LB 1T5WA 1FDLH 3OKMB 9CGTA 2DBJA 1SJEB 5DHYB 2GKIA 2XZCH 5EZOH 1PW3A 3CZJA 3BWAA 4BA8A 1OD9A 4NQSA 4WCYH 3SDCB 3L6FA 1SY6A 3KJ6H 5DEZA 4AL8H 4GKSB 3FQUA 4TN9A 5LWYH 3SE4A 4WHDA 1XR8B 5E5MA 1IJ9A 3BKYH 4RFOH 5F96H 3QFJD 4EN3C 5DJYB 2VC2H 2I24N 4KKAC 2I5YL 4NNYB 2ADGA 4PJBB 5BZDB 4ZPTB 1GZQB 1MHCB 2BVYA 2LAGB 3QDHA 3O41A 3BVNA 2ED7A 3BESR 1UH4A 3LQMA 5EU4B 4OUUB 1KBGH 1AQDB 1FFOB 5DJAA 1ED3B 5B39B 4O9HL 4XNUH 4E5XA 4X4XB 2WUCH 3MV9B 4UIMA 5ID0B 4GS7C 2F54A 4KK5C 5AZEH 1XMWA 2PTTB 5D70L 4JO3L 4MWFA 1YPZE 3CVIH 3B3IA 1DP0A 3CSYB 3VH8B 3DWTA 2OX5A 5K9KA 4PV8B 3S96B 5ICXA 3SE8L 1DE4A 1I8LA 3EDDA 4YZFF 5I0DA 5CP3H 3U0PB 4CU8A 4LSRH 1CFTB 3MYJA 3DGGB 4OV6F 4Z7VB 2XN9B 1R5VB 3SDAD 3QI9A 1KXVC 2FLBT 2AXFB 3FN0L 5FKAB 4N9GB 1EFXD 4KJQD 3GSXB 5IJKA 1LP9A 3UX9B 5C2UB 4TRPH 1NFDE 3TO4A 3W5NA 3F58H 5JW4M 2PYFA 3WNOA 5FGCB 2MKLC 1HDMB 2Q7YA 4OZ4A 3QHFH 1JPSH 1T2QL 3HZMB 3BP7B 3MJGX 5JLZA 4S10A 5H37H 5HHOB 3CMGA 2P8PA 3QIWB 1LO2H 4P2RD 3FFCE 3K74B 2IFGA 1MCJA 5KW9L 5EUOF 3ABZA 3I3EA 3EFFA 1SM3H 1DBAL 2HN7A 4YPGB 1MCBA 1CFQA 2XQYK 3B9KC 4WWID 5DGRA 5E2VL 3T2PA 1CD1B 3JTSB 2HLFC 2ZCLL 4K8RC 4PRNA