2UY6A

Crystal structure of the p pilus rod subunit papa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy6A01
4X6CA 5HI5C 1ZT7B 4JM2D 3ZYZA 3CFCL 4UOW0 4LGPB 3NCBB 1XCTB 1HHJA 3OZ9H 3FO9A 4YR6B 3CSPA 1NANI 1XF4A 4FP8L 4JG0H 1G9NL 4S1RL 3P0YL 3MTRA 4IHOB 1BVLB 1SQ2N 4LIQH 3V0WH 2EDWA 1MCFA 3QWOA 4PP2A 5IIEA 1LO4H 3BPNC 3RWHA 1ZANL 4EN3A 5HBBA 2AV7B 5IHUH 5C08E 3FN3A 5E5UB 2QTEA 5JW4Q 3QQNA 4W4OA 4NHCL 2ERJC 4ELME 3MLYH 4YPGA 5GJTL 4YFLF 4KMTL 2FGWL 1U8MB 3T8XB 3O2DH 4BH8A 2A9ML 1G7PA 2ADIA 3Q6GH 4EVNB 2DWDB 3GSQA 4JO4H 4G8GB 5DGRA 4UBDD 4M7LH 1CXLA 4NYLA 1KEML 1KG0B 1ZEAL 2PYEE 3O8XA 3S36X 2JK5A 5EC1B 4Z7OF 3KR3H 4OZIB 2DQJL 4OZGE 5L88L 2DD8L 4FFZL 1SMAA 2XV6B 4PTTB 1ZGLM 4CVZB 3ZKND 4HUUB 3QCTL 2DI8A 4XX1G 1A5FL 3HAEH 5IK3B 2GK0A 3QXTA 3VG9C 1I3GL 4RGOL 3EJZD 4KKCD 2CIKB 2OSLB 4E41D 5IHZA 1L9MA 3L5WB 2NY1C 4GKZB 4P5TD 3O9WD 3O6FD 3ZSSA 5E5RB 2CKBB 1NBZA 1CG9A 2KQNA 4XPHL 1U91A 1I1FB 4K7PH 4FA8A 3L6FB 1YECL 3P2TA 1JPGB 3CFBB 3QNZB 5I1GH 5IEKB 3GJFB 5KG9B 3TT3L 2BNQD 4IS6A 2QADB 1QPXA 2IANE 4DVBA 4L1DA 3ARDB 1TFHA 4XH2A 1OPGH 4W6WB 5F88A 2EDNA 5K9QG 4TVPE 5E8NB 2XG4A 3AVEA 1D5MA 4OUOA 3MRRA 2C5DC 3JV4B 3MRCA 4R4ND 1II4E 2Y7QB 4FQXD 4K8RL 2KKQA 4C58B 5EOTA 2EYRB 1HEZB 5E6YA 1BZ9B 3MREB 4OD3H 3SE8L 5FV2A 5HGGS 2GK2A 3N85L 3EO9L 5DK0B 1HHIB 1WBXA 3FJTA 4U0RC 4F9LA 4C59B 1UKTA 5IMMA 5E70A 4CMMB 5D1QB 3DBXB 2H2PD 5BS0B 4TUKL 5DMIH 4AT6A 1A7OL 1HINL 2I5YL 4ZS7L 3DUUA 3UTPD 1XF5B 5TDPB 5DR5L 1J8HE 1YNTA 5L2KA 3VW3H 3AAZA 3INUL 1AHWB 4NBXB 3PHQB 1NBVL 1A3QA 2HTLD 5HHPB 3NPSB 3A67H 2A6JA 3P77A 4ELKA 4JM2B 4X99B 2CIIA 1MAJA 2YPVH 2K1MA 1QR1B 3T1WA 5E8OB 1J1PL 4LPUA 3WJJC 1ZV5A 4YDIL 3KYNB 3GI8H 5CBAB 5C0DB 1CS6A 2VLKA 1N8ZB 3SPVA 1SEQL 5GGTA 1QSFE 3MUY1 1M71B 3Q1SH 1DVFD 1ETZB 1JMZA 1YNKL 4LMQI 3EYVB 4LCCB 1EAJA 1T1ZB 5DJYA 1UJ3B 4OCYH 1XGPB 2NY2D 1P4IL 1B88A 1F8TH 1MFEH 4NHUA 1P5UA 1BVZA 2H6PA 1KUMA 3H3KA 1NBQA 3V6FB 3UAJC 4FXKB 2VC2L 5I19H 2PUQT 5CEXB 4JO2H 3VWKD 2EIEA 1HH6A 3PWUA 4MWFA 2VSCA 1EK3A 3Q0HA 3VH8B 3WV0A 2MQ3A 3VXPB 1GZPB 1FFQA 4M1DH 3MC0A 5EDXA 5FA3A 2V9QA 1UH2A 4LVNC 5DVNA 4XTRC 4LBEA 5EU7C 4E41B 4JANA 4R0LB 4X98A 4PLNC 4P5TB 1FYHB 1YEFL 3CCHB 3O9WB 3O6FB 1BM3H 3EO0A 1A7RH 2FYYB 3TBYB 3MRLA 3QUZA 1CFSB 2E9JA 1PSKH 2FO4B 5DHVA 5D5MA 1IJ9A 4FQQB 2VDLH 3SDXA 4W4NA 2BNQB 1AGDB 4U1MB 5D7KD 4R96A 5E2TH 4GT7A 5AUMA 1TLKA 4XCYB 3QO0B 5CKAA 4Q58C 1JGDA 3VWJD 4LEXH 4QHLB 5IW1A 2VDPL 3PXHA 3WUZA 4RFOH 3AUVA 5LWYL 4FQXB 1H0DA 3C6LC 5IF0B 1AR2A 4GG8A 3OKKB 3BEWB 4UNUA 3MRHB 4MNHA 2ED8A 3TBWA 5TQ0L 3I9GH 4HW6A 3BQUC 4ERSH 5FDWA 3R06A 1T6WA 2FIKA 2OJZL 2WAHA 5HHOD 2W92A 4HC1L 4LNRB 4K7PY 3V0VB 3P4NB 1ED3A 1UACH 3JV5A 2DQFA 5I76A 3HC3L 4R8WL 4XVUC 5TDNA 1S7TA 4XCFL 4DKFL 1KLFA 1I7UB 3X11B 5KVFH 2IBZX 1RK0B 1YJDH 2ENYA 2ZKHL 3N9GL 4M6OL 5FKPA 1BZQK 4XBPA 2ZSVA 5DRXB 4X6FA 3VGEA 3F8UB 5HYFA 2VITA 3GHBH 1ADQL 5T3XL 1VGKA 3O3UN 4OZHA 3MOQA 4QTHB 2D9QB 1BF2A 3TJHC 4CW1A 5IW6B 2NY3B 5HVHB 3HS0A 3BGFC 3BGMA 4XCCH 3QFJD 4KHTL 5INDA 3OKEA 5MEPA 1OCWH 1DVFB 5JQ6L 2A6KA 3QUKA 1VGEH 3DVGA 4NWUL 3S5LA 1WBYB 5ISZB 1AXTH 4WFGE 4PRIE 4MB4A 5I1CL 3BZEA 4NQVB 1OM3H 1S5IL 2CD0A 1XR8B 2HLAA 4OM0L 1MFCH 3GMQA 3UPAA 3FQRB 3NFNB 3LH2L 3C08H 3ZTJG 3MJ9H 3MNVB 1FP5A 1SVZA 3JWOC 2XTJD 4ZFGL 3VWKB 4XT1C 4TULL 5KW9H 3C2AH 3BDXA 4MB3A 3HI6L 2PXYD 4I18A 3S3PA 5CGMA 1FO0A 2YD9A 2VISB 3KJ6H 5HPOA 5A1AA 2AI0H 3ZHDA 2YOCA 3AXLB 3U9UB 1JL8A 3IFOA 5DDHA 2XKSA 5BMFH 4XP9L 4MJID 4OLEA 1N0XL 3QO1A 1KB9K 3QIUA 5L8LB 1R3HA 1CD8A 4WO4A 1OWWA 3F6IA 3VXQA 5GGRY 4R2GD 3DROA 4O58L 4PUBL 1FL3A 5DTFA 3C8HA 3LD8B 4MSWA 4PV9B 1QQDB 5HD8D 3CDYA 2A0LC 2GSIB 2ED9A 1B9ZA 1YEDB 3NPZB 1J05B 4F7TA 3WFDL 1PQZB 2Q7NA 5F70A 1REIA 3O6LL 3PDOA 4MA3A 3V6OC 3VWJB 5D2NB 4P46A 1M7DB 3REWA 4ZTPL 5GRVL 3D39B 4P3CH 2EDOA 2IAMD 4X6DE 3MOBL 1BBDH 5CKGA 2QHRL 3V95A 3HZMB 3HMWH 2Q6WA 1A6PA 4P57B 5IG7A 2VZ3A 2BY1A 3B2UD 3SGEI 5DVMA 1TDQA 1BQLH 3MYJA 4N1CA 4YK4B 3PIQA 1QRNE 4FXLA 2ATKB 3GIVB 1MCWW 5SWQB 3MPCA 5HHOB 1JGVL 3M17B 1FHGA 1HH9A 5DZLA 2VLLA 2XY1A 1C5BL 2ADGA 1T21B 2F53B 2XWBB 3PGDA 3QWQB 2R9HC 2DKMA 2VDMH 3QQ3A 4N8PA 2W9DH 3TBTA 2Z8VC 2G2RA 3RVVD 1WF5A 3VD5A 3RWEA 4J2XA 2B0SH 1XF3A 1FH5L 3V4VH 5F6IC 3F7PC 3KNBB 4MYWB 4TSBL 1YA5A 4HUVA 1GH7A 3PDGA 3GUTA 5D4QA 1HSBA 3IDMA 3ROOB 4DKEH 5EU4A 4HWZA 4HDIA 5F1IA 4U49A 4JDZA 1H8SA 1GGIL 3NA9H 5AZEL 1ZHKA 2EKJA 3T4AB 3LQZB 3QFJB 5FYKL 2VLJE 3MLXH 4ZD3H 3B3IB 1AY1L 4QF1B 1B0GA 4LPYA 3RY4A 4ZFOA 4XPAL 5GXBB 5J4MA 2VN4A 1OD7A 1U8KA 1YN7B 2WSKA 4L4TA 4NO3A 3RL2A 5I1DA 4DZBA 3C9NB 4M62H 1RJZA 4OFKA 3D0LB 5JIHA 5IJVA 4G9DB 2XNAB 2V7NA 3I75A 2XTJB 5DRZB 4L3EE 5HYJB 5DRWA 4DTGH 4K55A 2IBZY 1IAOA 1VFMA 5E2WH 4XMKH 4QRTB 1G9MH 2P44B 4U1KA 3IKKA 4D0BA 2H2SC 1FZKA 4MLIA 5I8EB 4A2LA 3VI4E 4L4VD 3LV3A 4KJQD 3EFFB 4CDGC 1PLGH 5HGDA 5B39G 4NSKB 5FECB 4MJIB 2BNRD 1MLCA 3IDIB 1VKXB 4DOHB 5FUOH 3ILQC 1A21A 2BVUA 4HKBA 3HZVA 4R2GB 5D7JD 1FE8H 1F6FB 3K2UL 4IDLA 3IU4L 4V1DD 4LDOB 1BBJB 5J8OA 4NQXA 1JZ6A 5DD5H 4LEOA 4XP6H 3FB6A 3FQTB 3VXUE 2UYLB 2BC4A 5GQBA 4UTAH 4JDVA 1P4LB 4PJCE 1F42A 3IFNH 1B0RB 4LFHD 3BO8A 5H94B 4C54A 2R39A 4PJHA 4CVWA 3S88L 1G7MB 1RZKH 3QEUA 1ODAA 1FZMA 3Q3GA 4WCYH 4WWKC 3VFNA 4OJFL 1ZA3B 1INEL 5ABDE 3ZT5A 1YQVL 1FBIL 2W0PA 1F4HA 2VQTA 3GRWH 1RZGB 2R23B 3RX5A 4FTVD 1FRGL 5I1JL 4EUPG 5L9DL 3F58H 1E4XH 2EEAA 4KDVA 1OLZA 2GJ6A 1MHHA 3G6JE 4MGXA 3O3AB 4F8TA 5DUPH 4PRHA 3BD3A 4NO5A 5LGJA 1Z5LA 2ZPKL 5CINH 2DIBA 4KGJA 3H9HB 1NFDA 4U33A 4YUEH 1OP3K 4GG6F 3MNWB 4Z9KB 3QHFL 5C0BA 3FB8A 5A40E 4KTEL 3OBAA 3U30B 4N0FB 3AM8C 4LRIA 1PYWA 3BJ91 1B4JH 2OQJB 4X7EC 2VL5A 32C2A 3CPLB 1P5VA 1N5YL 4HS3B 4GAGH 5FHAH 1AE6H 4L29A 4PJ7F 5GRJL 3V5DB 1N3NB 2Y07H 2QKIA 3FFCD 2H26A 1ZT1B 3IXAA 3QRGH 1DTUA 4M6NH 3C09B 3W9DB 1MNUH 3L3DA 3HAEB 4JPIB 5D7IF 3RHWK 3EDEA 2CRZA 1VEMA 1HZHH 1MVUA 2WK2A 5I18H 1AR1D 5IVZB 1TENA 5HHME 5I1HL 1NCTA 1RUPL 4HKZB 5F7KC 5GSRB 2Z9TA 1BWWA 2SEBA 1AO7D 4R3SB 2B1HH 5JLZA 1FORH 4N8VB 5IVXA 1FFOB 5KSAA 5T3ZH 4ETYA 1RURL 2EC8A 1ERNA 1GGCH 2W59A 4R7NA 4OAWA 5EUOA 4OLZH 4M48H 4L4VB 3IDJA 3L3HA 5F89A 5TE6H 4L3AA 1WCBB 1T2QH 2BNRB 1TVHA 5GRVK 3QQ9D 4D0DA 3EGSB 3BN9C 4K3EL 3HI1B 2NY4C 5GS0D 2VZUA 2D7MA 4H25A 3ARXA 1SYVB 3L1OL 3LS5L 3O3BB 1FYTA 5D7JB 1GIGL 4PJGB 2RHEA 3PV6A 2Z31C 4GQ9L 4V1DB 2H32A 1UWEH 5GGSY 1KN4H 4LQFL 3VGAB 4FQCH 1MH5B 4OUUA 2YRZA 3RBSA 1CDBA 4UV7L 1D7FA 1KNOB 5E0QA 1LO0L 3KPSD 3VFUA 1I9RL 3VA2C 25C8H 5EORL 4WHTB 5I1IL 4ODXA 2VUYA 4G8GE 4EIZC 1BQHA 5I8CA 4PJ5D 5SWZD 4OGZA 1YN6A 4PJIF 3SCMC 3FT4A 3CDCA 4OZIE 4MZ3A 5L6YH 4FTVB 1UEYA 2R1WA 3ZE1F 3BYTA 4HUKB 1T2XA 2HG5A 5KJRL 2I27N 5DHVH 4QYOA 5MI0B 1C16A 2MJWA 3ZKSD 3OB0H 4S1DC 5EOQH 5I8KH 4NRZB 1S8DA 1XIWA 12E8H 1LVEA 3VXRA 3LKNA 4MXWH 2C4FU 3RIAK 1KJ2A 3HI5L 4YHPA 1C5CH 1HHGA 3OGCB 4AIOA 2FSEB 2AABL 3D85A 4LSPL 4PR5A 5HDQL 1HI6A 5IBTL 4CNIA 2P8PB 3LN4A 1LEGA 3RWJA 3PHOB 2BXYA 5IWLC 5GJSL 1N5AA 1MCNA 4KK9D 2AEQH 4IJ3C 1TITA 2GTWA 3DX8B 1ZHNA 3BJLA 1GHFH 3BWAA 3GJEA 3OR7B 3VXNA 2O5XH 4E42A 1DQML 5CBEB 4B41A 1ZK9A 3FFCB 4GRMB 4LAQH 4O51B 1DDHB 3L9RA 1CL7I 4P48A 5F1SA 4AIZB 2X4SB 1GC1H 3UTSD 4XMLH 5A2IH 4JAMB 2BHUA 3OJMB 2ITDA 4MMZC 4KKAC 4IMKC 3S96B 1MREL 4FQHB 1CICC 2FZ3A 4MA7L 4XCNB 4EJ1C 3M8OL 4LGRB 4RZCA 3QJHA 5FFLA 4FQJH 5GRUH 4S1SL 1R5WB 1HHHB 4XPTH 3GMMB 2JJTC 5BVPH 5ITBH 1AO7B 2HJFA 5BS0E 4YHKH 3K74B 1QFWH 3QI9C 1CLYH 2ORBL 3BHBB 1N64L 4NDMB 3RFZC 2XI9A 1HNFA 1SMOA 1U3ZA 3MLVH 4J3XA 5IVOA 3HNTL 1T03L 1K4DB 1CZ8H 3IXTA 4KWUA 5EU5A 1WZ1H 2Z93B 4G7YL 4NNPL 1C5DA 2PCPA 1R24B 3IDYB 1HCVA 4XP5L 2YS4A 3ZKXC 5I71B 2HT4D 4O5LL 2VDOL 3BZ4B 4JHWH 3TH2T 5LJYH 4U31A 2VZOA 5HI3C 1AI1L 1EPFA 3H6JA 1Y18B 2C4FT 1W2KT 4QHMB 3MV01 1F90H 3JUYA 4MD0A 4YZFE 3DURB 5A16A 4JFXB 1ZTXL 5TDOA 5EBWB 3RTQA 3QRFM 3MCLH 4HWEL 5CAYB 2BFVH 2J6EH 1T22A 1YPZA 2R0KH 5E6ZA 2UWEB 4PJ5B 5E03A 5SWZB 4MS8C 3WS3B 3X17A 2HLFD 3D0VB 1EHLH 2ESVB 4LDLB 2OP4L 3PXJA 4I0PC 5TFSH 2BXZA 4OTXL 2FX9H 5TPWH 3L7FA 2O61B 4ODVL 2IPTH 3BSZL 5C7XL 1WV7T 3UCRA 1OTTC 3UP1A 3VJ6A 1MCSA 3FONA 4UINH 2OR9H 4E41E 4CMHB 4CVXB 3U9PL 1KJ3L 2VXVH 4FFWC 2G5RA 5FB8B 3UXFA 4PGZA 4F33B 1RHFA 2HVJB 2JELH 2YPKA 5T5NF 2RFXB 5DJDA 3M1BA 1WICA 3RGHA 4O2CA 4JM4H 1XGYL 4QXGH 1RZ7H 1MWAA 2BNQE 4AG4L 1BZ7B 1MCIA 4Q6IA 2IFGA 3E2HC 4Y88A 3AS3A 3STLA 1NGQH 4QWWD 4NRXB 1FNEA 5KS9F 3WNOA 4ODUB 1FGNH 3MLRH 1NAML 3JUZA 1MF2H 4OLUL 4XXDA 4BFGA 4HK0B 1I4FB 3LB6D 4KJYA 5C07D 1HQRA 2HKFL 2KUTA 3FO2B 4PRPA 4TUOB 1OT2A 2GSGA 4TTGA 2CSPA 3BD5A 3U4BL 1MEXH 4EN3D 4JQVA 2I60L 4ZO8A 4WHDA 2BHZA 4U6XA 3IJYA 1C12A 3UJJL 1A9EA 4R4FL 4Y4KA 5FOJA 4HIXL 1CFQB 5T1LD 4MAYA 4Z7UB 3C5SB 5KVEL 4I5BB 3STBA 4QHKI 4LARH 3FT3B 3CFCH 4WI3A 5HTSA 3UTPE 2G75A 4FG6D 5E8EB 4KUZH 5L2JB 4FP8H 3KJ4B 4S1RH 3P0YH 4U05A 1OP5H 2CDEA 1KB5L 1AGFA 1X5ZA 1U8IA 1T4KA 1ZANH 2C7UA 3O2VL 3LSOB 3B8SA 4BZ1L 1FZJB 1HQ4A 2MPAH 3QFDA 2OTPA 4NHCH 5I6XC 5I75B 4BJLA 2ICWJ 4XCEB 5CD3A 5GJTH 5JXEA 1Q9OA 2EDYA 2AJXL 3KPPA 2A9MH 2BX5A 4MNGA 1MFNA 1OW0A 2ENSA 2PO6A 4C83A 1PEWA 2ITCA 1KEMH 4OZ4A 3O41A 3LQAC 2DQJH 5L88H 2DD8H 2BNUA 3P9LB 5AYQA 3GO1L 1K8IA 4RAVB 4LSVL 1KELH 5DJCA 2NNAA 3QXAA 5BVJA 1I7ZA 4RAUB 3QCTH 2HT2D 2G60L 5IMLA 1KCVH 1DUYB 4PRDB 1IEBA 1GGBL 2JIXA 3HB3C 4JFHD 4KXZH 1I3GH 2VLRA 2NXYD 3MJ6A 3RJQB 3THML 5ESQA 1J10A 4WHYG 4JFZL 4XVSL 4NQED 3S3JA 1BQUA 4ODTH 4P2CG 5DJAB 1MCJA 3DMMA 2FJGB 4HLZG 2DIAA 4OT1L 3OXRA 4XMPH 3TO4A 2IMNA 4AENB 3R0MA 5KOVC 4JKWA 4Q2ZB 3NACH 3ARDC 4HBQA 1A2YA 2NMSA 4YDJB 3MLTB 4EDXB 2IJ0C 5E6ID 4RQQB 3TBVA 5IQ7H 5IHLB 4LKCB 1AQDB 4MB5A 4UI2A 5D7KE 1DBJH 3IGAA 4G6KL 4QCIA 1NUDA 5E99H 5FGBC 2VMFA 1E27B 5ACZA 3RHWF 2ZSWA 5GGSB 2MCG1 1E28B 5B22A 4BKLB 1NLDH 1X5HA 4BM7A 5D2NE 2JB5H 1UADC 1EXUA 1HHJB 3D39E 5KZCD 1F5WA 5ENWB 5T3ZD 3RVTC 5C07B 1ZWIA 3CC5A 3IF1B 1U2HA 3QWOB 1A7OH 4PP2B 5IIEB 3RWHB 5D1QC 5DR5H 4LLWB 4F9PA 3QNXB 4QXUL 4P9HL 2WQ8A 4M8VA 3INUH 5HHOE 1J0IA 1NBVH 4YPGB 2FJFB 5JUEL 4TQEH 5T1LB 4M6AA 5FYKU 3SDDD 1TCRB 1AHWC 1G7PB 4JPWL 1NGXA 5TE7H 1DQLL 2X89D 2F53E 1J1PH 2IBGA 3NPSC 4RMWA 4Q7DA 3NCYS 5IBLC 1J1OH 1VEOA 4JM2C 1RZ8A 3K1KC 4M3KB 4YDIH 5LQBL 2VL4A 1X4XA 3ZDZE 3CLEH 2D7TL 3IJSB 2KPNA 2UY7A 5E00B 2DOCA 3ARQA 4U7MA 3MV9A 4MJ4A 5D7LA 2ZNWA 1YNKH 3VFVB 5HVFB 5MP6H 4QRUB 1U3JA 1YYMH 1JZ8A 4FN0A 1IGYA 5JMOC 2MNUA 2IH1A 5IHZB 4KVCH 1UJ3C 3EDKA 3QFJE 4KVNH 1JZ2A 1QYGL 1XGRA 2R56H 4XZUA 5ITFA 5BRZD 3QUZD 1F4XL 5J6GA 2EDTA 2OX5A 2V7HB 4UBDC 4MJ2A 1ZGLP 5E7BA 3MRIA 2ZOKB 5FK9A 2BY2A 3QZWB 1S7UA 4HUWB 1VADA 1QFPA 3F7YB 4CVUA 3VFMA 1T7VA 4JFOB 2V2XA 5DD3H 5DURD 5C6PB 2XTJE 2EDQA 3IJHB 3EJZC 4KKCC 5IESH 4NQEB 1EEYA 4XI5D 4R0LC 7FABH 4Z7VB 1IVLA 4P5TC 5I16A 4PP1D 4YHML 1TCMA 4JY6B 2DQDH 4OSUL 4K23H 4XNXL 5AWNL 3SDAD 3TCXA 2FWOA 4U4BA 2F5BH 4UIMA 4R97B 4MJIE 3MRQB 2PKDA 2DLEA 4HXBL 4DOHE 2NLJB 2V5MA 2H9GA 1K3ZA 2A74A 2HFFA 2VDPH 4K9EL 3JWDC 1W0WA 5T1DH 2NY7L 1NCBL 2R0WH 5E6IB 1WFUA 5DJ2A 3RVUD 5TH2A 5DWUL 4R4NC 3P77B 4P2QA 5TQ0H 1SJXA 4M1GL 1M05A 5JIKA 4HX1A 5E7FA 3HLAA 4XPBL 4HC1H 5KZCB 5I1LB 3V4UL 2YA1A 5JR1L 4PB9H 3RBGA 1QR4A 4CL7A 1SEBB 1ZKAA 5EUKA 3HC3H 4R8WH 1YYLL 2BSED 1KCUH 2H2PC 1KJ2H 2ZKHH 3N9GH 1QLRB 3WXWL 5I17A 5C0JA 4AEFA 5GS1A 2ZUSA 1NFKA 5AD0B 3SDDB 5HHQA 1BREA 4KZEL 4MQ7A 3CFIC 3MUZ1 1ADQH 3MODL 1R3LA 3WBDA 3MLUL 4LIQE 5KVDL 4B50A 1PY4A 1DN2A 2H6PB 3QPXL 1KPRA 2VZ1A 4UQ2B 4A6YH 2E7BA 3B9AA 4DGIL 1A0QL 4YXLH 3GIZL 3T4YB 1HKFA 1HKLL 4KHTH 1WEJL 1HH6B 1P1ZA 3JBG7 2NY3C 1YEIL 2AEPL 5HVHC 4NWUH 4QRSA 5B38G 4LL9A 2ARJB 4NZUL 3PWJB 3ZL4L 1DVFC 2COQA 3TYFB 1CFTB 3DRTA 1W8NA 2BK8A 3T1FB 5C9JA 5L7XH 3SDCC 3CLFL 3MXVL 3GMPB 2GCYB 4JANB 3IKCA 1MHEB 5ID1B 2HN7B 4OM0H 5HGAA 3QIUD 2IBBA 1FFPB 4J3VA 2ATPB 2DLFH 1KFAH 5E5MB 5BRZB 2OL3L 3MRLB 3T77A 2B4CC 2YUXA 3QUZB 3QA3B 1U58B 4P3DA 5DHVB 5D5MB 3QEQA 4TNVK 3S4SG 3TESA 4F58L 3SDXB 3HI6H 4GAFB 1QFUL 4G3YL 4U1GB 2ICWA 3WIIH 3VWKC 2ZUQB 3SN6N 3TZVC 1EVUA 3HRZB 4U6HA 4AEHL 1MY5A 3K8LA 5DURB 3T08A 5E2VL 1EDQA 5DMKB 3EOBA 4XP9H 3QB7C 4RNRA 2YSSA 4UTBH 1W8OA 3R8QA 1V7ML 3BIAX 3TVMC 4MNHB 4PJXA 2DBLH 3TBWB 5FDWB 2QR0A 4PUBH 2IF7A 4L4VE 4FMKA 2YZ1A 5J3HC 1PJ9A 2NXZD 2DQTL 2FIKB 3VFWB 5K9JL 3SDAB 3ZMRA 5CP3H 4P2RA 5DA4A 5JZ7D 4KZDH 2BNRE 1JTPA 3BKML 1MAKA 1CGSH 2GUOB 3LD8C 5IR1B 3WKML 3O6LH 2OTUA 4X7SH 3L3KB 3V6BR 1S7TB 1FVCA 5IQ9B 4ZTPH 1OAKL 4PJGE 2UZXB 3PABB 2QHRH 3QDJA 1NCDL 4R6UA 3UPRB 3VWJC 4V1DE 5D2NC 5FKPB 3MZGB 2BVYA 4PGDA 3GZKA 3QG6B 2ZSVB 3HE6A 1KULA 2AXGA 2J3SA 2VITB 1MUJB 1KJMA 1CXIA 3EJYD 3RGVB 1OY3B 3F12B 2EE6A 4ZQKB 4OZHB 3UC0L 3MLWH 4HIEB 5EIQA 2VB5A 2DMKA 5KN5A 2G9HA 2V5SA 3MRJA 1EA9C 3HS0B 4UAOC 2CLVA 3BGMB 4POYA 2W1NA 4O4YL 3AY4A 2W0KA 3OKEB 5MEPB 2XZCH 2OLDA 5T5FL 3W5NA 2A6KB 1UYWL 5HDBF 4ZO7A 2CO7B 3R4DA 1U8OB 4PLJD 2EDRA 4FTVE 1FH5H 4HIHA 3WFHA 2NCMA 3ULVH 3BZEB 3IDXL 5J89A 1S9KC 4ZDHA 3V52L 5DD6B 3BP7A 2B1AH 4L4JA 4HFWA 1MWAH 3O2WH 1RUAH 4OF0A 2IALB 4KPHH 4BQ6A 3TCLA 1NQBA 4N1EA 1SJVA 1D9KC 3PWNA 1GGIH 4BFEA 1BOGB 1K4CB 3LDBB 1OGAA 4YXKL 2H3NB 3GI9H 5ICXA 1UQSA 3RVXD 2IH3A 3OV6A 1AY1H 3BAEL 3WS6A 4DGVL 4J6RH 4XPAH 4RFEA 1MELA 3OWEA 3C60A 3U6RA 4LLVA 3DX6A 5HDOA 2DDQH 5LCVL 3HA0A 4QNPE 4M5ZL 4BQCA 1UT9A 1ES0A 1I3UA 3LZFH 5IB2B 4TTDC 4KRPB 5IMOB 3VG0L 3QO1B 5JPMA 3QIUB 3CSBA 1R3HB 4QRRD 2DAVA 3VXTA 3GSRA 1TVBA 5IB4A 2YD6A 4S10A 5LGHL 2QLVB 3FFCE 3K4DA 4JDTL 5CZXD 5D7IB 1FL3B 4OD2B 4Z0XB 1OAZL 4MSWB 4NBZB 4W6YB 1FZOA 5B39A 3D1MC 4C56B 2XTJC 4MD5A 1N2RB 4O2EB 2Y36H 4X4YB 3QBTB 1I7TA 4MA3B 1F3DJ 4ELMF 1V7NL 1JZ4A 3KYOA 3QAZB 1WZKA 4W68A 1X7QB 5CEZH 4XPGL 3KPNB 1AO7E 1S7QA 1L0XA 3LRSB 2BSSB 2EECA 4PRNA 3V5HA 4ZSOA 1AJ7L 3MYJB 4HUXA 1ZVSB 2FO1A 4JJ5A 3RNQB 3PIQB 5ETUA 5J1AA 2DQUL 5MEQB 3IU4H 4ISVB 1BJMA 2NXZB 1NAKL 1UM5H 3CU7A 4OZGF 1P9MC 5CSGA 1I1YA 1KXQE 1H3PL 3ARGD 1N6QL 1HH9B 3DYMA 1U6AH 2VLLB 3ARWA 5HD8C 4BSVA 2WP3T 2WNGA 2DTML 1H3WM 1RZJC 4GG6A 4BQ9A 5F7UA 4Z77A 5KSBA 1JHTA 2Z91B 4EUPA 5C0CD 5INCA 4Y19A 3BN3B 4APQA 3SE4A 1C7SA 1TMCB 1INEH 4NT6A 4ESKA 1FBIH 2F54D 4CUCA 1BQSA 3E3QE 1MCDA 5EU4B 4H1LG 4HDIB 1RULL 5C0BD 1FRGH 5I1JH 2HMID 5T1MB 1T20B 4JDZB 3F7QA 2X4OA 4NKMB 1DUZA 1ZHKB 4U1JB 4ALAH 2UWEE 3CXDH 4PJ5E 5SWZE 5MEOB 4M4PA 3HPJA 1NUGA 1F3JB 3C87A 4ZFOB 4OF6A 2IQAA 2ESVE 3MV7A 1I3RB 4NO3B 3MRNB 3PP4L 3UDWA 5I1DB 4LVOB 4DZBB 3RVVC 5C6TH 1UM4L 5I0ZA 4OCXH 3MRBB 3HG1D 1P7QB 2R2BB 1Q72L 4U1SA 3TWCL 3QHFH 2ZJSL 1SHMA 3RI5F 1U8PA 1A7PH 2YK1L 2E27H 2V7NB 4PJAB 3FMGH 2Z0BA 5DRWB 4QHNB 3JXAA 2F8OA 3U30C 4F57L 4I2XB 5C0AA 1S7XA 1KXTB 5GRJH 1NBYA 4NIKB 1A1OB 1YDPB 2HFTA 2PW1A 4J3TA 3LV3B 2NX5D 2EDLA 3HPLA 4YHLH 3G5VA 2XWTB 3C09C 1U93A 1M7XA 3RVWD 2E8YA 4QRRB 4NQDD 1HXYA 2D03L 4YX2L 5I1HH 4OQTL 2NZ9D 3HZVB 5SX4I 3PJSA 3W2DH 5C1MB 4PREA 3PDDA 3F65A 5JHDD 4XVTH 1WCQA 1KV3A 3T2QA 3UTSE 5DD1L 4LEOB 3TNMA 1G0DA 3FB6B 2YC1A 3FZUD 1MJ7L 2BC4B 3HNSH 3LKOB 2FJHA 4JDVB 4P99A 4RGMB 5F7EH 4Z7QE 2Y25A 3TA3A 1WISA 4DVRH 4WEUD 4Z7UE 3UBXI 4PJIA 4KJQC 5EZJB 4ZOAA 5DHYA 3WEXA 4OV5B 1FZMB 3NZ8A 3L1OH 3LS5H 4LPTA 3OAUH 2MQCA 3VFNB 1GIGH 1H15A 2NYYC 4GQ9H 1VPOL 1SBSH 4ZNEE 2K9UA 1B4RA 5D7JC 2Q1EA 1IMHC 5CZKA 1QNZH 1UCTA 3ARGB 1BD2D 3VRLE 4JO3H 4ONGH 5GISH 1XH3B 3E6FA 4JO1H 3JWDL 3L3GB 3QYCA 3KVQA 4MJ6A 3D87B 1HILA 1U2CA 4NO5B 1H8OA 4F7EA 2UUDK 5EORH 5C09A 3SKOA 4WFED 1J87A 5C0CB 1NFDB 4CN6A 3D5OF 3R1GH 3O6KL 1EO8L 2F54B 2Q7YA 3QH3B 1EEUA 4I3SL 5C0BB 1U8NA 1D5ZA 5KJRH 2FEEI 1I8MA 5JDJA 4OCLC 3UTQA 1AGCB 3X13B 5DO2C 5D6CB 5MI0C 3C5ZA 5IKCB 4L29B 4K2UL 2YPLA 2QKIB 3HI5H 3WNMA 2H26B 1QSZA 4GUPB 4QXWA 2AABH 5DI8A 4L8CB 5HDQH 1HCFX 3HG1B 1DE4B 5HI4D 2OJEA 1MFBL 5IBTH 2RJMA 2BVQA 4H26B 4DCQB 3JTSB 4JHZA 1MHCA 2CRIA 5GJSH 1GJIA 2ADJA 5DS8A 4WGWB 1OTSC 5MHSD 3S3SA 5IOPA 4HIJA 1S7SA 3TN0A 5K59E 4X5LA 1P4BL 1F4WL 4OAWB 1RK1A 3E8UL 1IC1A 3IDJB 3SE3C 2EH8H 2R2EB 2NX5B 4KTDL 2VH5H 3G04B 4TNVF 4JEGB 1KIRA 2R8SL 3K7UA 4U2YA 4D8PA 4NQDB 1CFNB 3M8OH 2P48B 1WT5A 4S0SD 2B4CL 2OBGA 2WUCL 2AXFB 1AR1C 3PV6B 5C07E 1NEZA 5JHDB 2XQYK 2Q8AH 1N64H 4Y1AB 1OT1A 5ICYA 1MLBA 3PL6A 5FCSH 2DQEL 3UYOD 2EIBA 5B3NA 2JJSC 5GRXG 1T03H 1MQKL 1EFXA 2JJUA 3GJFK 1A6WL 2AJ3B 5F21B 1EHXA 4G7YH 4NNPH 2A38A 3U36A 3RTQD 2P7TA 3ZTJH 3GSOB 4NUJB 5E2UH 4XP5H 3BXNA 3QQ9C 4DAGL 1BQHB 5I8CB 5K9KA 1SY6A 1YN6B 2ICCA 3OPZL 4Z0BL 3GHEL 2VDOH 4HK3N 4O5LH 5F72S 1J8KA 1Q9KA 2MHAB 3UYRL 3WJLA 1A3LH 1AQKH 5I71C 3SBWA 3T0VA 1AI1H 4Y89A 5DK2B 2FECL 1BD2B 4IRSD 3WIFA 4LLMA 1C16B 2ILLA 3RNKB 4WNQB 2A73B 5HYSG 3TO2A 4KKLD 3GBNL 2AV1A 4IEFB 4HG4K 2FLRT 2VAAB 4JR9H 2XZQL 1G6VK 2X09A 4PS4H 4Y4FA 3RPIA 5CJBA 1KJ2B 3E3QC 1FVDB 1OSZB 5C0RL 4HWEH 5FXCH 4ZUSA 1HHGB 2QV2A 1A7NL 1FNGB 4S0TD 4LPCA 4LCWD 1YJDC 2OCFD 4DUVA 3ULVD 4DN3L 3LN4B 4M7KL 3RWJB 2P47B 5KS9A 2OP4H 1T0MA 2BSTA 1GXEA 1N5AB 2QL1A 3MOAL 4G8EB 3FB7A 1VA9A 3CX5K 4ODVH 4XNMB 4A6YB 4TSCH 1CFVL 1JFQL 3T0ED 1A1NA 3GBML 4JFHE 4LHUD 5FO9A 3JV6A 4E42B 1FC1A 1KBGH 3KPQB 3G9VA 3LMJH 4Y2DD 3U1SH 2D2OA 4E9LA 5D1XA 3PNWA 3VFOB 4CMHC 4NQEE 5IGXH 3P30L 4B53A 2ITDB 2NW2A 4Z7VE 5ESVB 5I1KH 2BSRA 5F97E 1XGYH 2FZ3B 4RZCB 1S9XB 2V17L 1YY8B 3CFEA 4GH7B 5CHNA 1KIPA 1QA9B 4OZFG 5F9WC 2HJFB 3HRPA 4IDJH 5EPMA 3DOSA 4KK9C 1NAMH 2EE9A 1YMMD 4HS6A 2PW2B 4W81A 4YDVA 3U0TA 1UB5A 1L9NA 4JVUA 3HFML 5IEHA 3ARBA 3GGWA 4RIRA 3U4BH 3BP4A 3IXTB 5EU5B 3ARFA 4Y5VB 4FABL 3CVHA 3DRQB 4WEBL 5CEZD 5IW3A 1NFIB 5JXED 3LAFA 5T3ZE 3O11B 5KVEH 4GOSA 4PTUA 4FQ2L 5FCUL 3DX9B 2PO6D 1GOGA 2CO6B 4I4WA 4OLVL 3NIDE 4H20H 3FT2A 2FX7L 3H3PL 2XQBH 1KB5H 4JGUA 3KYKH 5E4IA 1F02I 1QKZL 3SDYL 3UROR 3KJ4C 4Q0XH 5BO1L 3W0WD 4WI7A 3EHBD 1IC4H 5TDOB 1IAIM 3RTQB 2BCKA 2HWZL 2JIXD 4TUJB 4I48A 1G7IB 1WAAA 2VLRD 1IZJA 5I75C 4LRNL 1OARL 2HT4C 4P9ML 4MDIA 5FM4A 2JCCF 4IRSB 5KVGL 1BIIB 3L7FB 5DJ8A 4ZPVA 1RVFL 1KIUA 4FQ1L 5EBLB 3GMRA 1ZAGA 3VI4F 4HPOH 4O2FB 3TJEL 1CDIA 4N90D 3NAAL 3D3VA 1RV6X 2BOBA 1YMHB 4PJBB 4CADA 1XF2A 1NCWH 3TO4D 2YPKB 1GGBH 2APBA 4LCWB 4WJ5A 5BRZE 2K3TA 5CUSL 3OKLA 5IM7A 5D5ME 1KACB 4XGZB 3RWGA 2G5BB 3SDXE 1LO3L 1MWAB 1CDCA 4XVSH 4BSJA 1KTKE 2VDQL 2Q8BH 1FNEB 1EAPB 4NJ9H 2NTSP 3T0EB 3CFJB 5ID0B 1O7SA 5DD0H 4LHUB 4PJCF 4NQCA 4JG0L 4DW2L 1MI5A 2K7QA 4Y2DB 2Q76A 3SGKC 2BY3A 4KJYB 4RGNC 4X83A 4Y16D 1PX4A 2GSGB 4BSWA 5IHUL 2CDFA 4OKVB 43CAA 3MROA 4GFTB 5EG6C 3DGCR 4U6XB 3IJYB 4EUPH 1KXVC 4L8SA 3MUHL 2C3WA 4DZ8A 2X9YA 3O2DL 1QLEH 2W9LA 5JOPD 4X6BA 4ZUTA 4JO4L 1U3HA 1HOCA 4M7LL 1PD6A 1T80A 4RDQF 4Z8FH 1ZS8B 1YMMB 3MRPB 2G75B 4L8DA 4QWWC 3EOAB 1TZGH 4PRAB 1YUHA 2AJUH 4FQLH 2Y23A 4IIQC 5IV2B 3DV4B 4X0KA 3CUPB 1K2DB 4XNYL 1TNNA 1U8IB 1CL7L 1IGFH 1T4KB 4LLDA 4KU1A 1G9MC 2C7UB 3MV9D 1HQ4B 3ELAT 4UU9A 3QFDB 1YEKH 4P9HH 3DVNA 4HHAA 4IRJA 4CDHA 4DUXA 1NCUA 3CZFA 3KPOA 4OZHE 5JUEH 3AMLA 2HKHH 5DEGA 2FHCA 5ESAA 4LSTL 2RCSH 2ITCB 1MRDH 3T65A 3QXVA 4H8WH 2YD1A 3EAKA 4K7PL 2WP3O 5ERWA 4KH2A 2VXTH 4FG6C 3RX8A 4PGBA 3W0WB 1TZHA 2YA0A 2F74A 1RIUH 4BYHA 1A6AB 2OI9B 2N56A 1T1YA 3LQMA 1IEBB 2JIXB 3O4OC 4LLUB 3EDFA 3C6SB 2VLRB 3PQYA 1X5FA 3EKCA 4P5KB 1RZKC 3W82A 1T3FA 1I9IL 1Z9LA 4NQTA 1UH4A 3EOYG 2XA3A 1HNGA 4OD3L 1B0WA 3GMOB 4MDJB 4Q9CA 1BJ1J 1UB6B 4NPYA 1CT8A 5EBMA 1CIUA 3U2SB 4OD1H 3TIDA 4N8CL 2EYSA 1MPAL 5FUZH 2W0FB 1WC7A 4HGKC 3MBED 3RY6C 1A2YB 5J6HB 3VW3L 3MRKB 5D7IE 5DA0B 3TBVB 4JN2A 3A67L 2Y06H 4C56E 3G6AA 1O5DT 1C8PA 3QXWA 4UILH 2YPVL 4P2QD 4UB0L 2ZSWB 3MJ8B 1VSCA 4KV5F 1EXUB 3G08A 4OSUH 4XNXH 5AWNH 3ZE2E 1MSPA 5IBUG 1NCNA 3KWWB 3UTOA 1T7WA 1INDL 4IOIB 4D9RD 4Y16B 4HXBH 2X4QA 4JFED 5BOPA 3Q1SL 4R97C 4K9EH 4PJDA 5D71L 5D96B 2NY7H 1L6ZA 1N6UA 5DQJA 1NH6A 1F6AA 2P5WD 4QRQA 2H45A 1GGUA 3T2OA 3KPLB 4B7IA 3GSNH 3P0GB 5DWUH 1F8TL 3PG2A 1WITA 4G9FA 4U6YA 3QPQD 5E6IC 1CDUA 2UVFA 1MFEL 4M1GH 3G5YB 1SJEA 1QD0A 5HY9B 3H0TA 3VGGA 5JQHC 4MCZA 3BP5A 4OGXH 5I19L 1TTFA 5JR1H 2CGRL 1MIMH 1G1YA 1UWGH 4N9GB 1JYXA 2X4RB 4N68A 4RFNB 1R5IA 1WWCA 3MV9B 3VDBA 4G43B 1UXSB 1AP2A 4M1DL 2ZUWA 3BPCB 2P24A 3NCEB 4I77L 1S9WA 2E9WA 1QO3B 1QHOA 4MD4A 4YHIA 3HCVB 3AFLA 3OB8A 3SDDC 1XGRB 4HWUA 4XZUB 1PSKL 1T0NA 5ITFB 3DTXA 1A0QH 3WJJA 1AXSA 3QUXC 2EZ0C 1NANH 1JF1A 3VDAA 3MRIB 1XGUA 1FNSH 1XFPA 1WWBX 1XT5A 2AEPH 5KSVB 5E2TL 5J0BA 1VADB 1OL0A 5DJ0B 4K94H 3ZL4H 2VABA 3MGAA 4UUJA 4RFOL 3VFMB 3GK8L 4PJAE 5GS0L 2V2XB 3VXOA 3S4SA 1BECA 2QJDA 2ZUXA 2HFGH 3FB5A 4YXHH 4MAUL 4I2XE 1IBGH 1EEYB 2OL3H 3I9GL 1P84J 1CGTA 3CDGA 1T66D 2AW2A 3SGDI 1F45A 3U83A 1KEGH 3D25A 4G80B 2HT3D 4G3YH 4JCLA 1R0AL 4F7MA 2FWOB 4P2RD 1G7JA 5I1EL 1BX2B 4OF8A 1FG2B 4AEHH 4G6MH 4GO6B 2JJVA 4JM2F 4QRRE 2DYPA 4NC1E 3MBEB 3P73B 2ZUQC 2HFFB 3HR5A 1YJDL 1LD9B 4HMDA 1JI2A 1W0WB 4L5FL 3NZHH 2CXKA 1RU9H 4EI6A 3H9SD 2ZCKH 4YO0A 4Z78A 1SY6H 5TH2B 3HE6D 3PP3H 4P2QB 1U8QB 1A3RL 1UM6H 4MXQD 1C08B 1PG7L 5DVLA 1M05B 3DHJA 4U6VL 5FO8A 4YZFF 1RJLA 1YNLH 4LPWA 2YD8A 3O3DB 3WKMH 5GGVH 2C26A 4JFEB 5FAAA 3SDAC 1OCWL 1DP0A 3N1MC 3I85A 4ODWB 5DT1L 4LSRL 3MA7B 3TIEB 2L7JA 1YEGH 4LOUD 3NCJL 3HC0A 2P5WB 1GC1C 1JV5B 4PJ8C 2JB6A 1MCOL 1SJHB 2E9IA 1OM3L 1IKFH 3QJFA 1AIFA 3C6LA 3S5LG 3QDMA 1AKJD 1MCLA 1MFCL 3RVUC 3V0AC 1CK0L 2FB4H 4L8BB 3GNML 1BLNB 3C08L 3BQUA 4BZ2H 1KPRB 5KW9L 5D6DC 3RGVC 3QR2A 2GHWB 5C0CE 2Y4SA 4QHKJ 1NFDE 4ZXBC 3SKNB 5T5FH 2GYSA 2CRYA 4OCWL 3ZT7A 3LKRB 4LDEB 2UUDH 4QRSB 2F54E 2AI0L 5IB3B 1F11A 5C0BE 2RR3A 4XRCA 3O4LB 1BHGA 1IARB 3DRTB 5BMFL 1HE7A 3IDXH 1XGQB 1NMAL 5C9JB 3P4MB 3IKCB 1IAII 1XGTA 1IGCL 2XA8H 4EQ2A 3T77B 5I2IA 1HYRC 3OKYA 3CFKA 3ZHLA 4ODSH 4YXKH 4BQ8A 5C08A 1NDGA 2OZ4A 1T5XA 3OKOB 2ICWB 3LDBC 3BAEH 1DCLA 3HG1E 2OR8A 5F1KC 1T1XA 3U7YL 4U6HB 4PG2C 1Z2KA 3VFGH 4P3CL 2P1YA 3LIZL 3CVHH 3HMWL 3EOBB 1PW3A 4Z18A 3O45B 2XXMB 2QQKL 3VG0H 1P84K 4RNRB 4QY8B 2PYEA 1AGEA 1BVKA 4KRPC 4OZGA 4PJXB 3UBXG 4JY4A 2MWCA 1EIBA 2QR0B 1MJ8H 4YWGH 4WDIA 4X4XB 5JW5B 2NX5E 1BFOA 1OAZH 3WSQL 3GSVA 4P2RB 4UT9H 3WUWB 4M4RA 5LAXB 1N26A 3HZYB 3QWRA 1EEZB 5E1HB 4NQDE 5MERB 1FVCB 2VDML 5TF0A 1MCEA 2W9DL 5DZNA 2DM4A 3L3JA 1ZVHA 4M43L 5JHLL 3HMXA 2P8MA 3H9SB 5JHDE 2B0SL 2YWZA 1CBVH 4GAJH 2DJUA 1AJ7H 4HCRL 3QAZC 3HE6B 4Y19D 2EKSB 4APQD 1JJUA 2HVKB 4YIQB 3WHXB 4G8IB 1GRWA 2HJLA 5FDYA 4XWOD 4DKEL 1RJYB 3C5JA 1KJMB 2IANA 4RBPH 4ZPTA 4XC1L 1NAKH 2M8XA 1V3JA 3L95A 4Y5YB 1NAMB 3S35L 5FM5O 2D4DA 5EO9A 3IRPX 3MLXL 4ZD3L 5D9SB 1A6ZA 3V6OA 3VDCA 4WHYH 1A4JA 3G5ZA 5I1AB 3BE1L 1FL6A 4M62L 3X3FH 5C0ND 4HJGA 3NABL 1BD2E 1AKJB 4HLZH 1PG7W 2HJKA 1RULH 1X44A 4EI5D 4DTGL 3FQWA 1RIVL 3EJYC 3RWFA 1J11A 4WFEE 2VNCA 1J8HA 5E2WL 2AK1H 2OTWA 4XMKL 1KB5B 5GGVY 5C0AD 3VFPA 3NMEA 1UKQA 4RFEB 1FCGA 1CDGA 1FSKB 4N5ED 4KROC 5B8CB 4ZTOH 1PLGL 2LE9A 3BW9A 5JORB 3ULUL 1WBZA 4PLJC 1JIBA 1JWMA 5ALBH 2B8OT 5JDSA 5LVEA 4PIRF 4OLYH 2ZJSH 4LVOC 4H0IA 3VXTB 5IB4B 1TVBB 1KPVA 1WZMA 4ZFFA 1FE8L 4RMRA 1QSFA 2DQGL 1MJJA 3FQNB 5DD5L 2CDGA 4NM4H 5B39B 1FNAA 3UO1H 4UTAL 3IFNL 3RVXC 5GGQL 2A83A 1P2CA 1I8LC 5ELIA 4Z95L 3QIWD 3TA3D 1F2QA 5CWSB 4D3CH 3LEYL 3KYOB 1KTRL 1CU4H 2NR6D 5MHSE 3V7MA 2PF6A 4WCYL 3LY6A 1S9YB 3DUHA 1UVQA 1OAUL 1HHKB 3IAQA 1IQDB 1S9VA 1JUFB 1RIHH 1TZIA 4HJ0C 4JRXD 4NC1C 4QOKA 4Y5XB 1J7VR 5ADOH 1T5WB 3ZDZF 5DD1H 3WL9B 2QQNH 1I1YB 2Z92A 3AB0C 3FL7A 5EA0H 1IL1A 1MJ7H 5IROC 3T0DA 2O5ZL 5DUPL 4JFPA 3CXHJ 2X7LA 1JF5A 4RGMC 4N0RA 5CINL 4JFDD 1NGPH 4GKNA 2P4AB 5GSVA 4EUPB 3O6ML 4Y19B 4QRPD 2D7NA 4YUEL 1JPST 4LAJH 2P49B 2OMNA 3ILPB 3WFEH 3OXSB 5KBNC 1B4JL 1ZHBA 2D31B 4JPVH 1DUZB 3BH9A 3N1QC 4GAGL 2VJXA 5FHAL 1GZQA 1AE6L 1LK2B 3ARGC 4NQUA 3C5ZD 4MX7A 4QT5A 3QRGL 4M6NL 1MNUL 1NC2D 4HV8A 3MRFB 1J18A 3SGEH 1HZHL 5I18L 1MQ8A 2XTLA 4WWKA 1INQB 4EI5B 4NNXB 4PJBE 4Q9RH 1R5VA 2Q3ZA 2B1HL 2HMIC 5EWIH 2VR4A 5T3ZL 1Q0XH 4ORZC 3TN0D 4LCWE 5C0AB 1GGCL 5DC9B 3ULVE 1FPTL 1JZ3A 4OLZL 5TQ2L 1NBYB 2VE6B 4D94A 5D8JH 3PE9A 1VFUA 5TE6L 3FO1A 1OAXH 3VFRA 3NN8A 3NFPB 1T2QL 4RMVA 3G5VB 3DXAD 1U93B 4M6MH 3T0EE 5AG8A 4R7DB 1BPVA 2FRGP 1EO5A 4HH9A 1JNJA 4Y4HC 1X5JA 1KN4L 5FOBA 4W70A 4FQCL 4G42A 2NY0C 3AM8A 4KQ4H 3TNMB 1P4BH 2YC1B 3PWVB 1F4WH 4PRIA 5T1KD 4YE4H 3E8UH 1UZ6E 3QIWB 3TA3B 5BV7L 2X4UA 4P49A 1FVEA 1X5LA 3OTTA 25C8L 3BWUC 2XKNA 4XP4L 1IGIL 3T0WA 1YMME 1H15B 3RVWC 1CD0A 2P8LA 4JRXB 3RDTB 3LEVH 2D0FA 2NZ9C 3RWDA 1CE1L 3RAJH 4HIIA 4QO1A 5EOQL 5I8KL 4PJEA 1OTUD 4QHUA 5CEZE 5J9PA 3HN3A 4Z5RB 5D1ZC 5FYLH 3FZUC 4O9HL 1A47A 1WIUA 4JFDB 3WDIA 4LSUH 4F7EB 2Z35A 3ESVF 4X7TA 4QRPB 4WV1B 4DAGH 1KLGA 3GSNB 3OHXB 4XX1E 2Q7YB 3UYRH 4P5MA 4UDUA 1AC0A 3WNLA 2Z31A 3W0WE 2AEQL 1I8MB 4WI2A 3DX7B 4OKDA 3SQOH 3NCYP 4X6DA 1GHFL 5D93C 2BRRL 1G7QB 4J3OC 3MUJA 3GBNH 4QTIH 4AM0B 1CGVA 5DYOA 4QKXB 1K5NB 4M7LT 1KLUB 3C5ZB 2VO5A 3MUGA 2XZQH 4LAQL 3ZYOA 2VLRE 4NO2B 4BFIB 5EIIB 1GC1L 1J0YA 5C0RH 1XMWA 2JCCB 1NC2B 4XMLL 4PG9A 3CMOH 4N5UA 3W9EA 3QQ4B 5DI8B 3JTTB 1YEEH 5C0FB 3F5WA 1T04A 2BVQB 4M7KH 3HZKA 4WW2B 4UOW1 4U1NA 4N90E 3SCMA 3MOAH 4O00A 4XPTL 2BMKA 5A3ID 5F7WC 5BVPL 1J1XH 2VQ1B 4GRLC 1QFWL 3P4OB 3B9KD 4YH6A 5IOPB 2F5AH 5DSCA 1OQXA 1S78D 1LP9A 3MLVL 1RK1B 2OXHA 1NEUA 3MFFA 4JRYA 4ZUUA 1J0JA 5F3HB 3ARBD 3VA6A 1HWGB 3RU8L 3DXAB 3VXMB 4PJFB 4D8PB 5LGKA 3S34L 1YC8A 5DJZB 2V17H 4PLOB 1DN0A 2ICES 3F7VB 4ZG1A 2OL3B 4Y8DC 4U1LA 3UJIH 2CUIA 4OF5A 4EEEA 5AYUH 5IWLA 4BK4A 3AU1A 5T1KB 2AKRA 2AS5M 4PY8I 2ADFH 1FO0L 3HFMH 3MV8A 3BKJH 1MJUH 5SV4A 2X70A 4FABH 3MCLL 3MNZA 3FQXA 3U36B 5JOPE 2J6EL 5BW7C 1E6JH 2R0KL 4L3EA 4WW1A 4Y5VC 3LN9A 4IMKA 3RZWA 2YKLL 5K9KB 3OJDB 1CICA 1EHLL 2ZCHH 5FCUH 2R0LH 1JTOA 4YAQB 3KGRA 4ZS6C 1A6TA 4HEME 2DMCA 5TFSL 3SKMA 2JJTA 2IPTL 3MV9E 4PGEA 3QI9A 1SM3L 4XAKD 3WIFB 1S7VA 1S7RB 1U95B 1LWRA 5ANMA 2OR9L 4QNPF 4UNVA 5BO1H 3D3VD 3FRPA 3RPIB 1CN4A 4F15C 2VXVL 5E1AA 4K7FB 4MA8L 2JELL 3MLPA 2NY6D 5I30L 3U7AA 2GY5A 2BVEA 3B6SB 1U92A 1CVRA 2W60A 4M61A 1Z0MA 3KXFD 2FBJL 5DUMH 4QXGL 1RZ7L 3VXUA 4NKDB 4LRNH 3RZCB 4NP4H 4ORGA 4PJCA 1IAMA 1O7VA 3DIFB 1EJOH 1S5HB 1TNMA 2VR9A 4YFDB 4Z76B 5KVGH 2B5IB 2PTTB 4FQ1H 3LPFA 3H8NA 1HXMB 4JRWA 3JWOH 1P7KB 2PYFB 4MCYA 5ACMA 4IRSC 4NQCD 1EJ6A 2EDBA 2GAZB 1V8HA 2AERT 2C1OA 5F7LB 4X8JB 3BMWA 4NWTH 4QXTB 3VRJB 3MGOA 4J12A 1MEXL 3LRHA 4NKIL 5GGUB 4KI5D 4OIIL 5CUSH 3HMXH 1U36A 1BJ1H 3GEWB 3DSNA 4JHAH 1EVTC 3ZYIA 5EZLA 5IB1B 4ONHA 1T1WA 2VDQH 3G6JA 4LARL 1KIPB 1RUMH 2Z4QB 2VIRB 3FCTB 2R29L 4PGJA 4I0PA 3B9KB 1JVKA 2GITB 4ZUVA 3MSPA 1U3HD 3DHMA 1NC4A 2R2HA 1JYWA 1BAFH 4KUZL 2WINA 4HS6B 4DW2H 4JFFD 4WU7A 4YDVB 3T0EC 4HKXA 4PBWD 2WLYA 4J8RA 3ARBB 4ZFOL 1IGTA 4RIRB 4NKQB 3BP4B 1CWVA 3BZFA 4KTYA 4Y2DC 2MPAL 4P2QE 3IAGC 3SY0B 4H1LH 2A2QT 4NKOA 5F96L 1DBKH 5BZWB 1U42A 3LS4H 2DL2A 4OLWH 1ZXQA 3ZDYE 4YHOL 1HYSD 4D9RE 1JGUH 4JFEE 5HI5D 4KMLB 2UWEF 4X4MA 2P5WE 4XNZB 3OB0K 1KTLB 4XNYH 1CL7H 3A6CL 3GMNA 1KELL 1XEDA 4LKXB 2LAGB 5K33A 1ORQA 4K7PX 4UDTB 2BCKB 2BVOA 1KCVL 4HF5H 5I73C 4LLYA 1Z9SA 1PBYA 4U3CA 2C1PB 1H8NA 4E0RA 1GGYA 1IM3A 4WUUD 4ZODA 1D5XA 3QDGD 1L0YA 3SO3B 4LSTH 4ODTL 3KYMA 5HDLA 5FHBL 4TSAH 1BFSA 1ZT7A 1X5XA 3O4LE 1BEYH 5HJ3A 5EB9A 4G6AD 1XCTA 4CADB 1G9EA 4XMPL 4YR6A 2AJZB 3D2UD 2YXMA 4KDWA 5ILTH 2NY6B 3NACL 1BVLA 3I3DA 1AH1A 5IM7B 3TP4A 2OI9C 3KXFB 5IQ7L 1I9IH 3ARYA 4JFQB 1DBJL 5E99L 3SHSA 3MJGX 5EO1A 3KPRA 1NLDL 1U8MA 3T8XA 2JB5L 4EVNA 2DWDA 4WFFE 4NQCB 4Z7QF 4N8CH 1I7RA 4HH8A 2Q76B 4Z7UF 1MPAH 1JRHI 5EC1A 1IC7H 4S2SA 4BSWB 4OZIA 4L9DA 4PJXE 3BYYA 3V6ZB 4U7SA 4GMSH 5FA4A 4TQEL 4RMTA 4HUUA 4P2RE 4DZ8B 1A1MA 3MX0A 5TE7L 4UB0H 5DMGD 4ZUTB 2CIKA 1U3HB 2OSLA 5DFVC 3VRLF 4PJ9C 3U82B 1J1OL 1DR9A 4L8DB 3BUYA 2AXHA 4JFFB 5JTWA 2WWKO 3CLEL 3H9SE 2CKBA 1INDH 2R4RH 5JXAH 3G9AB 4X0KB 5I74B 1WTGT 4LLDB 3WIHA 5D71H 1OQOA 3ZZ1A 3L6FA 5KG9A 3GJFA 2CPCA 2YMXH 4Y16C 5MP6L 1TPXC 3DVNB 1YYML 5E8PB 3ARDA 1G1CA 1IM9A 3KPOB 5D96C 4PBXA 1P7HL 1DLHB 4KVCL 3Q5YA 5E8NA 4HFUH 4AK1A 3SGJC 1I9JL 1M7IB 1DQQB 2FCBA 3A6BL 3JV4A 4FS0A 4KVNL 5FGBA 2R56L 2Y7QA 3QXDA 4HAGA 2EYRA 4HXAL 1HEZA 2CGRH 1BZ9A 3MREA 2EXWC 4OCRL 4LLAA 3V7AG 5DK0A 4OLXL 5FYLD 1TZHB 2I25N 5KTEL 2F74B 4XHJD 4KHXL 4LSSL 4CMMA 3DBXA 5DD3L 4I77H 3H3BC 1XF5A 2ERJB 2R2CA 5TDPA 5JW4M 4WUUB 5ICZA 5IESL 1RSFA 1EMTH 1DQJB 3QDGB 3ET9F 2Y6SC 1AHWA 7FABL 3PHQA 5K59F 3TBSB 5HHPA 2EXYD 4Q9QH 4JM2A 4X99A 2DQDL 3MJ7A 4K23L 5F7FA 2GY7B 2F5BL 1GOHA 5E8OA 3V5KB 1G6RA 3D2UB 3GB7B 3UTTD 3LKPA 3KYNA 5CBAA 5C0DA 1U41A 2DYPD 1WC7B 5T1DL 1F2XK 3GK8H 5GS0H 2R0WL 2F15A 4M5YH 1M71A 3JZ7A 4EOWH 3RUGB 3VG9B 3S8WA 4XTRD 1FL5B 2GFBA 4MAUH 4R4BA 1UJ3A 4X5XB 2A9NH 3QCVL 3G5XA 3ARUA 3H7LA 4KJWD 5HVGB 3ZTNH 5DHXB 1CD9B 1R0AH 1ZHLA 5AAWA 1B90A 4PB9L 3RX7A 5I1EH 1KYOJ 5GS2H 1K9TA 3B5HA 3V6FA 3BDYH 4FXKA 1OP5K 2X4QB 4F7CB 1KCUL 5CEXA 1KJ2L 4GW1B 4MJ5B 4L5FH 3D18B 4XNQB 4YFEA 3OGOE 5CIPH 3MBEC 5DQJB 4AEIH 5JW4N 4WENB 2FEDD 5CEYB 1GZPA 3WXVH 1A3RH 3C6LD 1PG7H 3QDMD 4KKBC 4E41A 3MO1B 5CP7A 2VQUA 2MFNA 2YEZB 4R0LA 4CAGA 3H0TB 3T3PF 4U6VH 4P5TA 3CCHA 2R0ZH 4MCZB 3VMPA 4A6YL 2V2TB 4YXLL 1T2JA 2WQRA 2FYYA 3BKYL 1CFSA 5KSBE 3P9MB 1MRCH 2FO4A 4Y19E 5DT1H 4FQQA 4LP5A 1IC5H 4LSRH 4WTXA 2XN9D 2BNQA 1QBML 1AGDA 1B2WH 1D5IH 4U1MA 3NCJH 2NY2B 1MCOH 3GKWH 2C3XA 1A9BB 4XCYA 3R0NA 1ZGLB 5L7XL 3M45A 1VCAA 1CGUA 5GIRA 4MD4B 1CK0H 3GNMH 3QIBD 2DLFL 1KFAL 3QPQC 5IF0A 5B38B 1T0NB 1OF2B 4IMLA 3BEWA 3MRHA 1AXSB 3KS0J 1IGJB 3ME0A 3LVEA 3TJHD 3WIIL 3PGFH 1X6NA 4OCWH 3H9YA 3X12B 4UQ3A 4WRLA 2CUMA 4LNRA 4OCSH 2FGZA 3V0VA 1WIOA 5IFJB 3P4NA 3O0RH 4Z7VF 4JVWA 4OZFH 1W72H 4YQXL 1NMAH 2E7CA 3S4SB 7CGTA 5C2BL 1I7UA 3X11A 4UTBL 1RK0A 3E6HA 4CJ1A 2PYED 1IGCH 2DBLL 5C0AE 5EZOH 3L7EB 1S7WB 3OF6A 4Z7WB 4XC3L 2MTPA 4WTWA 2X4TA 4EXKA 4L9LB 4JFYA 3VFTA 4KZDL 2CQVA 4HWBA 1CGSL 1G7JB 1IGMH 3UTTB 3U7YH 4LHQB 4X7SL 1MHPL 3QWRD 5CMAB 2DYPB 3UBXA 1ZOXA 1OGTB 2CMRL 4JZJB 3LIZH 3I50H 2AK4D 1TQCC 1DVFA 4WY7H 5J06A 2QQKH 4P23D 4CU6A 4DJMA 4LVNB 5GRZA 5ISZA 3WNPA 4Z78B 4HMCA 3SDCA 1EHAA 2WMPA 1OP9A 1R6VA 5GPRA 5D7SH 2GT9A 3NIDF 1KYOK 4GXUM 4NQVA 3VRIA 3WYRA 2IAND 1JK8A 2AJSH 2CUHA 3WSQH 1XR8A 5C70A 1F58H 3MLWL 1C1EL 3FQRA 3EDDA 3NFNA 1RJLB 3VCLB 3MNVA 2A0LD 2XZCL 3VWKA 5C3LD 3H2WA 1HDMB 4MNQA 3TZVA 1TETL 4WFHD 4JRXE 3DJ9A 4M43H 5JHLH 2LQRA 1MVFA 3HC0B 4M9OA 2VISA 4KDTC 1MCHA 4HCRH 2JB6B 2JLLA 3ULVL 1KF9B 2VXUL 1CQKA 4S11A 2XZZA 4I0CC 2B1AL 1WVZA 3AXLA 3C6LB 3I6GB 4OFYD 2UV3A 4JPKL 3QDMB 1MWAL 1KPUA 1OAQH 3O2WL 4U0QB 1RUAL 3TVMA 4KPHL 4XC1H 5E9DD 1IAKA 3J7HA 3S35H 3GI9L 2BHYA 3SOBH 1Y0LB 4JFDE 5KAQF 4GLRI 3FKUS 3LHPL 4X6EB 2HFEB 4U7KA 4Y5YC 4QRPE 3HUJB 3P0VH 2EO9A 4XBEH 4J6RL 3PWLB 2XN9B 1QQDA 4PV9A 5CGYD 4LQ1A 2DDQL 2ZG3A 3DGGB 5ACLA 3BE1H 1YEDA 3ES6A 5D5MF 1N4XH 4I8DA 1J05A 1PQZA 3LZFL 5DMJB 3SDXF 3NABH 4FNLL 3VWJA 5D2NA 2E8ZA 1MRFL 2A6DA 1M7DA 3D39A 2VLMD 1L0QA 3QIBB 3TH4T 4JB9H 1E4KC 4P57A 1NPUA 1DL7H 4GXUN 5FO7B 1E4WH 1RIVH 2LU3A 1MOEA 2PXYB 3TFKD 2WBJD 2CKNA 2JCCE 1ORSB 2ATKA 3GIVA 5EZIH 2Y36L 5SWQA 3BGFB 1NJ9B 3M17A 1JYVA 1ZLUH 3ULUH 1TJGL 2EYTB 1M1SA 2F53A 2XWBA 1FJ1A 5CEZL 1FSKC 1QLFA 5B8CC 1AGEB 1NCAL 1BVKB 2DQGH 3KNBA 3BIKA 5F8QC 4QOKD 1PEZA 1UM5L 4HKJA 1D9KA 3S7GA 2BDNL 3ROOA 2OYPA 4BZYA 1UH3A 3H42H 1U6AL 3DXAE 4NCC2 2YD2A 3VXME 1YQ2A 4PJFE 3I2CL 5GGQH 2R1YB 3SEPA 3T4AA 2IAMB 2W65B 4Z95H 1ZLWK 3LQZA 2ZUTA 4EQ3A 1LE9A 3LEYH 4P2OD 2AK4B 3Q6FB 4OZHF 3B3IA 4RA3A 4QF1A 4G8FB 4P23B 2X4NB 4J4PD 4ODBD 1H3GA 1OAUH 4GW5B 1YN7A 3C9NA 3SE9L 2EH7H 3C5JB 2I9LA 3ILQD 5DC4B 3D0LA 1JF6A 3L95B 3FFDB 3QG7H 4G9DA 1LE5B 2KDGA 4Y5XC 2XNAA 3T04D 1QBBA 3W11C 4UZGA 4ALAL 5HYJA 1UWXH 3CXDL 4FQIL 1CXHA 4ZFZB 2O5ZH 2AQ1A 1A6ZB 3LKQB 4QRTA 4H1LB 4HK3J 4M8QB 5I8EA 5DQ9A 3O6MH 5C6TL 5ADPH 1RHHA 4OCXL 5EOCL 3WLBA 3ZDXE 3K80A 5B3JE 5FECA 3IDIA 1NGZB 1A7PL 3NGBB 4K07A 2E27L 5E9DB 5F7NC 5HGBB 3FMGL 1VKXA 5JOEA 2BVPB 5FM5M 3RWFB 1P9MA 3VFPB 3FQTA 2UYLA 3PV7A 4P4KC 3BW9B 1P4LA 5D2LB 3FN0L 4YHLL 1B0RA 3GKZA 5IUSA 5DJ6B 5H94A 1TTUA 4P9HC 1I8IA 2MCPH 2X40A 4YBHA 5E8DH 5DEFB 1G7MA 4HULB 3DVFA 3W2DL 4I3RL 5IFHH 1V3KA 1FIGL 1T0PB 3HC4H 3MACL 3ZE2F 4ENED 4XVTL 2WBJB 1HSAB 1ZA3A 1CGYA 3STZA 4EI5C 3RQ3A 4AIXA 4XP1L 2CDGB 4AMKH 1TVDA 1RZGA 2R23A 5DRNA 1FPTH 5AZ2H 3HNSL 5TQ2H 4LNVA 5I66B 3PWPA 5GGTH 4C4KO 2R4SL 5F7EL 2RGSA 3WIHH 4DVRL 3VU2A 4CN4A 3H7BB 2FBOJ 3QUMA 4N5EC 3O3AA 3VFSA 1D6VL 3OAUL 1BP3B 1CD1B 1IAIL 4PRBB 2FLBT 2F58H 1U8LB 3H9HA 1VERA 4GBXD 4IM8A 4P2YA 4PV8B 1SBSL 3OJVC 1TZIB 4QOKB 4GXVL 1WWAX 4HSQA 1Q9WB 3MNWA 4JZNB 1QNZL 4JQXC 4LMQE 4JO3L 4ONGL 5B4MD 4KV5E 5GISL 4N0FA 4ZMAT 1EZVX 3ROLB 4U1IB 2OQJA 4JO1L 4WHCA 5GS2D 2W9EL 9CGTA 5BV7H 3NCFB 4LCYA 4JQIL 4P2OB 3PGCB 2ICEB 4D2NA 2IPUK 1G7LA 5DQDL 4XP4H 3QIWC 1XCQB 4GKNB 1N3NA 1IGIH 3V5DA 1CXEA 1ZT1A 3R1GL 1N7MH 2NR6C 3W9DA 3BN9D 2NY4D 4U1HA 4ZAKC 4JPIA 2OXGA 1F13A 2P45B 4HS8H 1CE1H 5EOCJ 3HE7D 3RDTC 2Z31D 1RMFL 4NGHL 1RUQL 4HKZA 4XHQA 5GSRA 1AD0A 2J8UA 2XXCB 2DS4A 2IFFL 4KRNA 1GZQB 1G6RH 4O9HH 3AMKA 4MX7B 4N8VA 5E2JA 1FFOA 1WAAE 3NIFE 4PJAF 4MQSB 4KFZC 4L4VA 4K9EC 1FFRA 4XAKE 4IOSD 3LN5B 1M6OB 1WCBA 2VAJA 2BNRA 2HP4A 4WV1C 5KSUA 3HI1A 4NRYB 3D3VE 3SCMD 3B2VH 3RKDC 3U4EB 5D7JA 4PJGA 2BRRH 3Q2CA 1JWUB 2HYMA 2PN5A 3EOTL 1MH5A 2EH8L 3KXFE 1CIDA 2VH5L 4JRYD 3FO1B 3VFRB 4XAWH 1KNOA 4NQSB 4P4RB 2ZCLL 1PKQA 1JZ5A 5JPNB 1I1AD 3BEVB 5IB5B 4WHTA 4NQCE 1QEWB 4WW2C 2AAVA 4HH9B 2XPGA 1FFNB 4J7RA 2Q8AL 5FOBB 2NY5L 4N0CD 4KI5E 3OR6B 1DFBL 5A43C 4FTVA 3SO5A 4F2MB 5J11B 1LDPH 2E9BA 5CGTA 1NEZG 1FV1B 1KC5H 3MV8D 4YJZL 4NRZA 4WI8A 2X4UB 4P3WA 3CVIL 3RU8H 3E0GA 1HWHB 5DLMH 1RZIA 4K94C 1FNHA 4ZOBA 4LGSB 1U9KA 5E2UL 2R15A 4LF3B 3S34H 2VYRE 3U0WH 2BJML 3OGCA 4GBXB 4JFFE 4NM8H 2FSEA 5EU3A 3TV3H 2P8LB 5HPMB 1A3LL 1AQKL 1LEKB 3LRGA 2P8PA 3PHOA 3IDNB 3O3EA 1NFDF 3QI9D 5GGRA 4PJEB 2WIIA 1Q9LB 5J9PB 1Q0YL 1FO0H 4UV4H 3KPSB 3DX8A 4JR9L 2NW3A 1H3XA 4PS4L 3SE3A 1WTLA 1ZLVK 5CBEA 4YHYC 2Z35B 4M1CC 2DQHH 2D7QA 4GRMA 4X9HA 5CIPB 4O51A 1DDHA 4AIZA 2XG5A 5HHVH 2X4SA 5T5NG 3JVGC 1VACA 2YKLH 1KENH 2NY4B 2I07B 1LK3H 3KLAA 4JAMA 4OCNC 5HYSB 2ZUVA 4P5MB 5SX4H 5IMKB 3BH8B 3CFDB 3KPMB 4FQHA 3HE7B 5C71A 1SM3H 3OKMB 4I0KA 4KKNA 5HHNB 2PR4H 4TSCL 2HTKD 1R5WA 4Q9BA 5HI3D 5C8JA 3GMMA 4QLRA 1AO7A 3AGVA 3TEUA 2A6IB 4HWBH 1AGBA 2EDXA 1KBGL 1OTUC 3MUGB 2JJSA 3LMJL 4NDMA 5DUBA 3U1SL 2UZIL 4WUUE 3ALWA 1H3VA 4HLJA 4MA8H 3QUYD 4PD4J 5I30H 4PG9B 3QDGE 5IGXL 1CLOH 4F3FA 5I1KL 1K4DA 4GQPH 2FBJH 1T04B 2WIMA 3HZKB 2Z93A 5EUOF 1R24A 3ARED 4MS8D 1EZVY 3SCMB 5IJKC 2A1WH 2ID5A 4IDJL 1YY9C 2D0HA 4I0PD 1T83C 4L3CB 3RZCC 4XWGH 2N4IA 3BZ4A 1LGVA 2LTQC 1NC4D 4ZUWB 1NLBH 3EYOB 3B8YA 5DSCB 2NQCA 1LP9B 3WO4B 3AS0A 4TOYL 1Y18A 4JRYB 3RUGE 2I26N 3UTSB 4ZUUB 2KZ1B 3N1GC 2L4OA 3B43A 4NKIH 4OIIH 1D5BB 3ULUD 4OZFB 3DURA 1W72B 4FFWD 4FZ8H 4JFXA 1I1AB 1WK0A 1LMKA 5EBWA 1FG9C 4LU5H 4OBSA 5IT2H 2B2XL 1DN0B 5TE4H 3MRGB 1IFHH 2UWEA 4PJ5A 2R29H 1H5BB 3WS3A 2GI7A 3D0VA 3AU1B 2ESVA 8FABB 4H20L 4IJ3B 3O8XD 3ALPA 4YDKH 3B9KC 4G5ZL 2XQBL 4DFIA 1F4AA 3KYKL 1L4IA 3MV8B 4Q0XL 1A4KB 3GMLA 1IC4L 2X70B 3FRUB 3LEXB 5FYJU 3FQXB 5F96H 4CVXA 3S97C 4YEFA 5FB8A 4F33A 3GSWA 2HVJA 4YHOH 5DEZA 2OK0H 3TLRA 3ULSB 3VI3E 4PGEB 1CXFA 1BZ7A 2CLRA 1S7VB 3MJ9A 5CJOH 5EC2B 4HPOL 2P5EA 3TH3T 4NRXA 1X5IA 3A6CH 5ANMB 5HSFA 2PETA 1NCWL 2AJVL 4WI4A 4XNZC 1R3KB 5E1AB 4HK0A 1I4FA 3QULB 5ALCL 5J1SC 2X1PA 2BVTA 3FO2A 3WHE1 4RAHA 1SYSA 2MQ0A 2W60B 1URLA 2WM0A 4M61B 2H8PB 3V4PH 1J5OH 1UZ8A 4UT6L 5FYLE 2VXQL 2GIYA 5JO5B 1CFQA 2Q8BL 4ONOA 2V2WB 4NJ9L 5FHBH 5F7YC 4Z7UA 3KPRD 43C9A 4I5BA 5DD0L 3T09A 3KDMB 1Y6NR 3SO3C 4MCYB 1NCCH 4NJAH 2B39A 4PD4K 3EO1B 4KJPD 5E8EA 5L2JA 3WO3B 4Y8AA 3QUYB 4ODHH 5SWSA 1MFDL 2QADC 4JLRB 2ZG1A 1CFBA 4Z7WE 5L2KD 2NY6C 5EBGA 4JG1H 3NIGE 3S37H 1GPOH 4WU5B 1FZJA 3HB3D 1SBBA 3AREB 2WWMD 3WE6B 1QLEL 5EZLB 5HYIA 3B5GA 4X6CB 1FNLA 4XCEA 4OGAD 3UTTE 4PGCA 5DC0A 2VRAA 2H41A 4Z8FL 2DQCH 3FO9B 1A7QH 1NC4B 1JGEA 2F19H 5EFIA 1TZGL 1XF4B 2WINB 2AJUL 4FQLL 1K85A 4WU7B 2VLKD 5CILL 4HKXB 5LG1A 3EYSH 1IGFL 3C8DA 4EN3B 3T3MF 3P9LA 1YEKL 4RAVA 2JF1A 1D6EA 2LU7A 4Z7NE 4RAUA 1IM9D 2HKHL 4OIBA 4M7ZB 4POZD 4BH8B 1DUYA 4PRDA 2ADIB 4AL8L 4AH2A 3GSQB 3ARTA 1PX3A 2RCSL 4NYLB 1MRDL 2E7LC 4H8WL 3O8XB 1YPZF 2JK5B 1IE5A 1WLHA 2VXTL 5M95B 4HUNB 1T89C 5CJ8A 5DJAA 5FM8A 1IZKA 3SGKA 4ONFH 4X8XA 1RIUL 1K6QH 3QDME 5I74C 3UZVB 1RZJH 4LCUA 5CCKL 1TXKA 2GK0B 2HRPL 2ZZUT 4LCCC 2XRAH 4Q2ZA 4HZAA 1IM3B 1T7YA 1DEEA 4PJBF 1I9JH 3A6BH 3MLTA 1D5XB 3HUJE 4RQQA 2EDHA 5C2UB 1NBZB 1AD9A 1VDGA 1CG9B 2XN9E 1AQDA 4DGYH 1CDYA 4HXAH 4C57C 1U91B 3ULVF 4AJ0A 4OCRH 5I9QB 5IBLD 3C8KA 4LVEA 1E27A 5K93A 4IS6B 4OD1L 4HGMA 3ARSA 1E28A 3CNKA 3I02A 5GGSA 4BKLA 4DVBB 2VDRH 4H0HB 5HJ3B 4OLXH 4IIQA 4XH2B 5KTEH 4YHZH 5F88B 5ENWA 5LKNA 5FUZL 4KHXH 4LSSH 5C07A 3ZKNC 1D5MB 3IF1A 3KHQA 3QUMH 3MRRB 4D9LL 3MRCB 1N6VA 2NXYB 4HPYL 1ITBB 1G7HA 5I6XB 2L7UA 4PLKD 3KS0H 4XVJL 4LLWA 3RIAF 3QNXA 5EOTB 2Y06L 3BDBA 3WHE0 4UILL 2H32H 1BGXH 2FJFA 1Y6KR 5EO1B 5T1LA 3O9WC 3O6FC 1WBXB 3KPRB 1KT2A 5HXMA 1TCRA 3B4NA 2MOVA 5EO0A 5IMMB 1UZ6F 6FABH 1I7RB 2WLZA 4AT6B 3DUUB 4G6AC 4S2SB 3IJSA 2CH8A 1YNTB 5E00A 5L2KB 3AAZB 5FA4B 4GMTH 1GCFA 3VFVA 3GSNL 4QRUA 1CF8H 2A6JB 4FQXC 4JZOA 4ELKB 1A1MB 5IHBA 1B6DA 5IBUB 2CIIB 3WFBH 3QCVH 3KLHD 3S36H 3QHTC 4OGXL 3OL2A 4B7LA 1FAIH 3BUYB 2DRUA 2OR7A 2AK4E 3GRWA 1MIML 2VLKB 4M93B 1VFOA 1UWGL 3SPVB 2WUBH 1ZLWH 2V7HA 3BI9X 2ZOKA 4HEPG 1VFAA 4XBGA 5H2BA 5DJYB 1QUNA 4GJTB 3RY6A 3QZWA 4HUWA 5F6HI 1IM9B 3F7YA 1KOAA 4FMFA 3KLSA 4P59L 3VE0A 4EIGB 3MRDA 4JFOA 4NHUB 2HTLC 1W0VA 3P11L 1MFAH 1O0VA 2YRLA 3BOVA 3CAFA 3QXDB 3GSUA 5DMGC 3IJHA 2YN5A 4AQ1B 4LVHB 4WFHE 3V6OE 4OI7A 4NQEA 1EHNA 3BKYH 2GKIA 2XIDA 4XXCC 5F71A 1FNSL 1J88A 1OHQA 4Z7VA 3PWUB 4MWFB 3W81A 5BV7B 4OI8A 1YEHH 1EO7A 4XPFH 4JY6A 1QBMH 4K94L 2WV3A 2WBWB 3MRQA 1NUNB 3DO3A 5FA3B 5E9DE 4PY8J 1QPPA 2IQ9H 4LBEB 2AQ2A 2NLJA 1A7BA 4X98B 5H37G 2HFGL 2NY2C 4OCMC 4DEPB 5ICZB 4YXHL 5FF6A 4WO4D 3EO0B 1IBGL 3K46A 5E6IA 5FYJH 4ACPA 3SJVA 3JWNC 4GSDL 3OF6D 3IU3A 1IEHA 3K2MC 5T33L 2FD6L 1KEGL 1KJVA 3EIFA 3MJ7B 5D2LE 3TPUA 4R96B 1G6RB 2X5PA 5AUMB 5I1LA 5CD5D 2VLME 4G6ML 5GHWH 3LKPB 2NY3D 1JGDB 3OAYH 4P46D 4YLQT 5IW1B 2DM3A 1SEBA 3NZHL 4XHJC 1RU9L 4YQXH 3VD4A 3U0PA 5C2BH 5L0QB 1DBBH 1H0DB 1DEDA 2ZCKL 3IVKA 4GG8B 1QLRA 2DM7A 1SY6L 1NKOA 3NH7H 2GQHA 2GFBB 4PYHA 5ISZD 3SDCD 4R4BB 1UM6L 2YR3A 3TT1H 3R06B 5AD0A 4XC3H 3SDDA 3WDJA 3G5XB 4HJJH 2X89A 1ZHLB 3I6KA 1ED3B 2EXYC 3QUXA 3K3QA 4I3GA 1YNLL 2DQFB 3T2PA 4L9LC 5I76B 5GGVL 1MHPH 5TDNB 4UQ2A 1A8JH 4EBQL 1ZMYA 2CMRH 4MNQD 3T4YA 3TZVD 2QSCH 2APFA 1YEGL 4QOKE 4XBPB 4JZJC 4X6FB 1ZLSH 2ARJA 2DKSA 1IKFL 3PWJA 4RWYH 3TYFA 1CFTA 2FB4L 1VGKB 2IGFH 3T1FA 2PTVA 4YK4C 5CP7B 3TVMD 3GMPA 2GCYA 1MHEA 3WCYA 5ID1A 1ULVA 4BZ2L 2HN7A 4CW1B 1C1EH 1FFPA 4KJWC 2ATPA 3LOWA 5E5MA 4R26H 5J3HD 5BRZA 4KRMB 3QA3A 1U58A 5INDB 1FN4A 1KB9J 2M1KA 3QUKB 3DVGB 3S5LB 1JRHL 1TETH 3C2SA 3ZE0E 3OJ2C 3V8OA 4NBYB 4L4TD 5H8DA 4FFVD 3HRZA 2VXUH 2X1WL 2OS7A 3CH8A 2HLAB 4JPKH 1G0YR 2FEDC 5GIRB 3GMQB 3D39D 5DMKA 1CYGA 2XA8L 1TJIL 3QEHA 3OX8A 1EGJA 4ODSL 4U3HA 4IMLB 2R69L 3ZYJA 1K3IA 3LHPH 4I18B 3RWIA 4WWID 2VWEE 1FO0B 4FZEH 4ZYKA 1RD6A 3VFWA 4UQ3B 3SDAA 3LPWA 3LKSA 1NDMA 1CTNA 1Q8MA 3NVQA 3VFGL 4WUKL 2GUOA 5IR1A 3EYFA 3IFOB 3K8MA 5DDHB 3L3KA 3CVHL 4FNLH 2F53D 1MRFH 5F9OH 5IQ9A 4TRPH 4PJ8A 3TYGL 3IDGA 3PABA 3E6HB 4WO4B 3UPRA 5AAMA 3VXQB 3DROB 3QG6A 3ALXA 1MJ8L 4YWGL 1R3JA 3HNVH 3QIBC 5DTFB 2X4TB 1MUJA 1D9KD 4JFYB 4UT9L 3VFTB 1BOYA 5D6DA 3RGVA 3F12A 1OLLA 4ZQKA 2PXYC 4F7TB 1RFDL 3PDOB 1PAMA 4HIEA 4ZXBA 4P46B 1BF8A 3REWB 1CDHA 3UBXB 1TJGH 3RRQA 3UZEA 2Q6WB 5MENA 5IG7B 1CBVL 2P43B 4GAJL 1FAKT 3ZDYF 3QEGL 1U8OA 1YEJH 1NCAH 1OWRM 4TTDD 1J86A 3SDCB 1UGNA 3RL1A 3DV6A 2N1KA 4K3GA 2D7OA 2GT9B 5DD6A 3VRIB 1JK8B 3QHZH 4R2GC 4JN1L 2BDNH 2LV4A 2IALA 1EBPA 1NSNH 4TPRL 2ADGB 2GJ6D 1BOGA 1GAFH 1K4CA 3I2CH 3PGDB 1QZ1A 3AS1A 5HYJD 2H3NA 5C0GA 3QQ3B 4MNQB 3TZVB 1L7TH 3TBTB 4PRHD 2G2RB 4PG2A 3RWEB 4K3JH 2IAMC 1XF3B 3X3FL 3B2UC 4P23C 4HUVB 2J6EA 1C7TA 3GUTB 1HSBB 1KPUB 3IDMB 3DLQR 4PJEE 5F1NA 3SE9H 1N59A 4HWZB 5IB2A 5IMOA 3TVMB 5F1IB 3KPSE 1IAKB 3EFDH 3SGDH 4PJ7A 1YC7A 4RMQA 5BJTA 3PHSA 4Q74A 1FLRL 2AK1L 1IEAA 3O81A 3U7WH 4FQIH 3MBXL 5D7IA 3X14A 1B0GB 4OD2A 4Z0XA 2C3HA 5F8RC 1ZLVH 4CU8A 4K3DL 4C56A 1U8KB 4L4TB 1ZE3C 4N0UA 1N2RA 4O2EA 2E6JA 3RL2B 1EV2E 4ZTOL 3ES6B 4NN5B 3BVNA 4X4YA 4LSDA 3T2NH 1RJZB 5EOCH 5ALBL 3I3EA 5IJVB 2A6DB 4OLYL 3NBNA 4M03A 5LBSH 3WUWG 1X7QA 2Y9RT 3KPNA 4R90H 3LRSA 2GJZA 1W0YT 2BSSA 3BX7C 3I75B 3BKCH 4X80L 1I1RA 4DWHA 4DN4H 1ZVSA 3RNQA 1IAOB 3NGBC 4OM1H 1ACYH 4NM4L 3K4AA 5BCAA 5MEQA 5KSAD 2FH6A 3F7RA 4ISVA 4U1KB 5CJ5A 4D0BB 1A6VH 3WMSA 3UO1L 1FZKB 2EDDA 1KIQA 4UAOB 4PJXF 3PWPD 3KPTA 1LILA 1T7XA 4G6FD 5CGYC 4D0CA 4D3CL 5HGDB 2DICA 5CJXC 3FN0H 3BMVA 1FJ1B 1MLCB 2FNBA