2UY6A

Crystal structure of the p pilus rod subunit papa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
216
structure length
216
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLEPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPRSEKANVLQIALQTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERIPLASMID CHAPERONE PAPD PROTEIN
publication title Crystal Structure of the P Pilus Rod Subunit Papa.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 43
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2uy6A01
3KPMB 2MQCA 2EIEA 2VE6A 1NBVH 1J0YA 4UOW0 5KVEH 3LS5H 5ESQA 3TFKD 1KEML 4BSVA 4XMLH 2ZUXA 1IGMH 4MQXD 1HXYA 4JZJC 3F7YA 3CLFH 5GZND 1NAKL 2R0ZL 3QEGL 1F8TL 1KB9J 4WUUB 3GSNH 5EA0H 1T21B 3O2WL 2VLKB 4XC3L 1BFOB 4S1QL 4U1LB 5DJDA 4GQPH 2AQ3A 4OZHB 2BNUB 3X3GH 2OX5A 1RZJH 4KV5E 1U93A 1YYLL 4H1LA 3UPAA 3HC3H 3N9GH 3QWOA 4JFED 1UJ3C 1IEBB 4FTVD 1T2QH 4GBXA 4PRPA 3HAEH 1QR1B 2IFFL 3FHQA 2NZ9D 1B88A 1XGQA 4LF3B 4N0RA 3KPTA 1WZ1H 5FA3A 2EECA 3QR2A 5EUKA 2EIDA 3I75A 3NZ8A 2UUDH 3DBXB 3QI9C 1R24A 2DIJA 2R69H 1JFQH 3H42L 2ZCHL 2LVEA 4NO3A 3QDGA 1MQ8A 3GSQB 4ERSH 3VFMB 5BVJB 4D0CB 4PLKC 5DD3H 1I7ZB 4LVHB 5BVPL 3VFVA 3FT2B 4Y4HC 5DR5L 3EZ8A 4JY6B 3PQYD 5ICXB 5D7LD 3VMPA 5DUML 1KLGA 1HSAA 2L7JA 3G5ZA 1WAAA 4JE4B 1NCAL 3IJHB 3MYJB 3BQUA 1F3RB 1ZLSH 1X5YA 2AEQH 5IBLD 3B3IA 5KS9F 5J12B 1R3LB 3CFJB 2JJWA 2P7TB 3TN0B 1CF8H 2NY1B 4OZFA 3HI5L 5CEZL 1MCOL 5I1KL 5JNYA 1X5JA 4PJIE 3HN3A 1NDGB 4M6NH 3QZWB 1SVZA 4UTBH 4ELMB 3IT8D 3BP6B 4P2QE 2VISA 2AJSH 1ZSDA 3BAEL 3PL6C 3WS3B 1H3UA 2YMXL 4XXCA 1WTGT 1H0DB 4RX4A 3QUKA 5D7JB 3Q2CA 3IDNB 3GGWB 3IAGC 3FO9B 4PJGF 3CSPA 1J0ZA 3P4LA 4S1SL 2Y1VA 5LXGH 1MFEH 3MUGA 4PJAB 3AS0A 1MCBA 2IGFH 5ABDE 3UTZB 4W6YB 1KJ3L 1XR8A 5ISZD 4HKXA 4OV5A 3RZCC 4GXVH 1MCFA 1QNZL 4NN7C 1XH3A 2NXYC 1Q9WA 4JHAH 3O8XB 5DK3A 1I7TB 3QEQB 4Y4FD 3VH8A 4X8JB 1FO0B 2PYEE 1I85C 1D3CA 4RAUA 4GG6F 5I6XC 3RRQA 2YRLA 1G7QB 3W11C 3V0VB 2DQDH 1R5VA 4FMFA 4V1DB 4Z7VE 4JPKH 4RGMC 3WE6B 1DQLL 1IAKA 5I73B 2X4QB 1ACZA 3D9AL 3FAWA 3PP3H 1NUNB 4QWWC 1Q0YH 3SDDA 2F54D 3O0RL 5F9WB 4JM2C 1U58A 4XNXL 2J8HA 3HPLB 4P23A 5HYJA 1N6UA 4WNQB 1UXWB 2C26A 5HYQB 1VGKB 2F5AL 3CFCH 4OFIA 3BT2L 4BQ6A 2KBGA 2APFA 4KTEH 3FMGL 4BZ1H 2W07A 1GHFL 4I0PA 4OGZA 2ATPB 1FBIH 1QLFB 1UM6H 3IYLW 1T22A 2DOCA 3AS2A 3EO1B 4P4KA 5GS2D 1G7IA 5D1QB 3HI6L 4QGYA 3IKCA 4JM2D 4L8CB 1L7TL 3TO2A 1GVIA 1T7YA 2Z9TA 4U4BA 3QNYA 1YEGL 2I60H 1EDQA 2XFXA 3L5WA 3MNWB 1G7PB 3K74B 5F9DC 3MLXL 3LKOA 1KJ2B 1T5WA 4G9DB 4X5XB 4YK4C 3CFIC 5HY9B 4ZYKB 5JHDB 2QQQA 1KPUA 1WEJL 5FO9A 1SQ2N 4F7EA 4HJJL 4QHLA 1NEZG 5DQ9A 1RZFL 1YEKH 3AU1A 3WKMH 1TETL 1AFVH 2F58H 2NTFA 3MV7E 4JVPA 3C08L 2CUIA 3EYOB 4LVOC 4FQIH 3MJGX 1RZKH 5DS8A 5SV4A 3LCYA 5DA0B 4K8RL 5FGCB 3O9WB 2K7QA 4JRXA 4Z76A 4LLMA 4NP4L 3IDXH 3GBLA 5C08D 4ZUWB 4XGZA 3ARSA 2V7HA 3L3GA 4P23C 4LLUA 4WTWA 5KVMC 4PRIE 4YO0B 3SKNA 4IRJA 1EPFA 2J6EH 2OL3L 4Y5VC 4UDTB 5DUBA 1T03L 2IANE 1VGEH 1SJHA 1CXFA 3MODH 1RUAH 3MGTA 4I0PC 3PIQB 4HK3J 5E2WH 5D72L 4KMTH 3ROLB 1MLBA 2BHUA 3D18B 3R1GH 1ZLVK 4TUKH 4AG4H 4P4KC 4JFPB 4L3EB 2DQTL 3BKCL 3PP4L 4LPYA 5HDOA 4I13B 4JAMA 4LRNL 2NX5B 1WK0A 4GFTB 1FGVL 3FQWA 2IPKB 4NQCD 5DMGC 5AD0B 3LKQA 4MXVF 2BRQA 1QBBA 1RZIB 2WUCH 1CBVH 4AEFA 5CZKA 1PX3A 4R8WH 4UV7H 4YXKL 1RHFA 5FUOH 5T5FL 4BFEA 2Y07H 4K7FB 4NDMB 5E9DB 1MFAH 4MD0A 5IM7A 3MJ7B 1QFWI 2GJ6A 1WVZA 1YUHA 3MROA 1T5XA 4G6MH 4QOKE 1AGFB 5CSGA 1S7TB 1OLLA 1UH2A 2QHRL 3QFDA 1C16A 1OW0A 4M8VA 3OJDB 4MZ3A 4KUCD 3BSZH 4PV9B 1TZGL 2PR4H 2PXYA 4H20H 2Z93A 1T7VA 3D85A 4ZFZB 4YFLF 4UZGA 4OTXH 3L5JA 1AQDA 2IC2A 5IEHB 4PJBE 1GZQA 3IJYB 3HFMH 1DE4B 1T20B 3S7GA 5A2KH 4FQ2H 4FQHA 5D9SA 5FEBA 2JK5A 3NMEA 2IQAA 1U8OB 5EU6A 2VH5H 3LZFH 4F9LA 2G9HA 4M7LH 5SWQB 2BOBB 1NGYA 4NSKA 4O2FB 5EBMA 3VXRE 5T1LB 1AKJD 1UEYA 1VEPA 5ESAB 4EDXA 3TGXA 3T3PF 2W0LA 4XWGL 1UWGH 4WEBH 3UTOA 1A7BA 4K71C 5HI3C 2O93L 4N9GB 1PDKA 3OB8A 2GFBA 2XACC 4P2CG 5DVKA 3MV9D 2W0FB 5DMYA 4LKXA 2IAMD 1JWMA 3I6LE 1LEIA 1Q9OA 2I27N 1KOAA 5HYSG 1QVOB 3UYRL 2AJYH 3TBVB 3K4ZA 1JCKA 4G5ZH 4JANB 1GAFL 4MXWL 3KR3H 4LCYA 2ZUTA 1NEZB 4FXGA 4KXZI 5DJ0A 3NIGF 1U8PB 3FOMA 5T1MA 3ZKQD 4YQXL 2R2BB 1F3JB 1JGEB 5IWLC 4J7RA 4OM0H 4WFFD 3P4MB 1S5IL 1UENA 2RHEA 1BAFL 1JI2A 2J8UB 1M7XA 3STBA 2AXGA 1NEUA 4PJDE 3MNZA 5JIIA 3BDYH 4KDTC 1IGFL 3CFEA 3C2AL 1P2CB 5AEAA 4F57H 5JTWA 2HT4C 4LSVH 3P77B 1WF5A 1JZ6A 2O26U 4NC1E 2FHBA 1XZ0A 3JWNC 4X5WA 4Y0GA 3RA7H 4EI6B 3D39E 5IVXE 3MBXL 3NA9L 2D4DA 1N4XL 5ALBL 1B0GB 1RUKH 5I1GL 3U9PL 5LWYL 2DB8A 3MRGA 5L88H 4PUBH 5GRJH 1D6EB 4OFVA 4DQOL 3UTSD 3AGVA 4GG8B 4FN0A 3MRDB 5FCSH 1Q9KB 3V4UL 4LLWB 4EQ2A 1A1MB 3H0TB 3K8KA 3G6JF 1CZ8L 3ARGA 4XPAL 2JB5H 3QISA 4M4PA 2CUHA 4PGCB 4EBQL 5HHVL 2C4XA 4JFFA 3QP3A 4R7NA 2ZNWA 4PJFF 5L0QB 3UO1L 1LWRA 3OGCB 3N85H 4JFOA 5DWUH 5EU4A 1DLHB 3UTPD 3H9YA 4JG0H 3S3PA 4OZIB 2AK4B 4CNIA 5GS1B 3VWJB 4Y5XA 4DFHA 5FYJH 2ZUQB 5GHWH 1KIRA 2XKNA 2YEZA 3ZSSA 3EHBD 2ZOLB 2VERN 2WP3T 4YPJA 2H9GB 5IJVB 1MIMH 5C0FA 4U1KB 4XBEL 4Z18A 5KSUB 4FS0A 1JPFA 3ARDA 1T0PB 3I2CH 4R3SB 3PDDA 3H9HB 4X83A 5CJBA 1KPVB 2HRPL 4XX1G 1I8MB 4Q97A 1SEBB 3N1QC 2VZ1A 4OIIL 4IJ3B 3U46A 1WJ3A 2DWEA 3UAJD 5JW4R 3JXAA 1F97A 3PGCB 3JV4A 1YJDC 5GS3A 4O2CB 2XWTB 3CZJA 3ARGC 3QXTA 4MD5A 5KVGH 4RA3A 4YE4L 4MMXC 1UM4H 2GT9A 3EYQC 5KS9E 1NGQL 4WHCA 1YQVH 3UROR 5KBNC 4KPHH 1JNLH 2R2HA 3P11H 4W70A 5I1JH 1Y0LB 3WLBB 1HH9B 2EIBA 1FG9C 4PRBB 3HG1E 3CXHK 4PJ9B 4GRLD 2I25N 4AYFA 1LO0L 1OAZH 3D69A 1OAYL 1MRCH 1M6OB 4X6EB 4Y2DB 4M8QA 4JR9L 5E94B 3FQUA 3ZYJA 3UJTL 4K9EC 3EYQD 4PJGE 3VXTB 2CK0H 2A73A 3DPBA 1XIWB 3FB5A 3LRSA 1PZ5B 1HI6B 3I50H 5DRWB 4I2XA 1G9MC 5T1KD 2HMIC 1G6RL 1NMBL 2V9RA 1ZEAL 5E2UH 1HQRA 5BZDB 2F5BL 4FZ8H 4NO0D 4EVNA 4XRCA 1WITA 2OI9B 1FJ1A 1F4XH 1HNGA 4Z0XB 3OXRA 1SEQH 2EH7H 5J1SC 4IIQA 5HGHB 3HRZB 4APQB 4JKWA 3I02B 2ADIA 4GG6E 4D9QE 2EDEA 5D1XC 1Q94A 1CLZH 1FVDB 2JJTA 5GS0C 3QT2A 4OI7A 2A38A 4LPVA 1TCMA 2XTJE 3TO4B 4X6BA 5HDLA 2DQJL 4Z7UB 4CADA 5MEND 2G5RA 3VG0H 1FPTL 1AE6H 3MRBA 1AXSB 4K23L 4KJQC 3M1BA 4UV4H 5DZNA 5I76A 3ULUD 1NFDB 1OM3L 5LVEA 4HKJA 2C3VA 1JTPA 1VESA 32C2B 3C6LA 4OLXH 4IRZL 1LEGB 2EE6A 3TO4A 1ZS8B 1OSZA 1SYVA 1FNEA 2XWJB 1FZMB 5F7NC 1M1SA 3ILPB 1EMTH 5GS0D 1KIPB 5TDNB 3VRJA 2OXGA 1ZMYA 2P44B 1U92B 2MHAB 1J8HA 4ODXB 1R5WB 4QXGL 2ICES 3GM8A 1JRHL 5CSZB 3TJHD 1CFVL 4JO3L 4CN4A 3U30B 3DXAA 1RVFH 2R2EA 4R26L 5I0DA 4Q7DA 1CLOL 4KY1L 1KFAL 1J5OL 1PLGH 3AREC 4WIQA 2CDGA 1JL8A 4OCRH 5IFHH 5DRZA 4DGIL 3VMNA 4MNQB 3SDCC 4IIQC 3VGHA 1F2QA 4I5BA 2R4RL 2C4FT 3LN5A 3F58H 1E28B 1JP5A 2H3NB 4MA3A 1YMHB 4NWTL 4H0HB 3FO2A 1ZVHA 2CLRB 4JDTL 3B9KA 4J8RB 1T0MA 3UPRB 4KI5F 2BSED 4OLWL 1U3HB 4N8CL 2C9AA 3T0VA 2AXJA 3QXWA 1MUJA 1TDQA 3C6LC 2YR3A 4H5SA 5CIPA 2DMCA 3SDCD 2Z35A 4R90H 2ZJSH 5JW4M 4CMMB 5MHSE 3OB0K 3TNNB 1Z0NA 3MLZH 3ZKNC 1KJMA 4OZHF 4XWOC 3VGGA 5I74B 3VFPA 3EDFA 3DUUB 4WWKB 2F8XC 2ESVB 3C5SB 1YDPA 3T09A 1OTUD 1V8HA 4MSWA 4XNMB 5ACZB 1Q0XH 3EYVB 3WXWL 2H2SD 4TVPL 5E6YA 1MFCL 1WZMA 3K4DA 3TBSB 4JLRB 4F7PA 2YPLE 4JRYA 2MPAH 5D2NC 3VFOA 5L7XL 3S4SA 2BY1A 1K6QH 2IFGA 4Z7QF 4TULL 4MXVE 1T83C 3O6FC 3WO3B 4WI6A 2AS5M 2G75B 4U1SA 5DMKA 5TF0A 3QUXA 2J3SA 4NGHL 2FBJH 3KPRB 2ITCB 5GGSY 3NPSC 2BNRA 3QUZD 2ZOKB 2NY0C 4YGAB 5I15H 2A0LC 4CU8A 5FECA 1IGJA 1L6XA 3BKJH 5E4EC 1FL6B 5C7XL 1JPTH 5FYLH 2A9NH 1OP3H 3LSOA 1RFDL 3QA3B 2EYSB 4PJIA 2VOTA 1OAXH 1HQ4B 2DQFA 4U0RC 4L4VB 2OQJA 3RFZC 4P2QA 1F42A 3BH9A 1TZHB 4O2EB 4LASH 3OAYK 1Y6KR 5HDQL 2R8SL 2HTLC 2NY0D 4XNUL 4ELMF 5BRZE 1CG9B 5DJXB 3G6AB 2PTTB 3HNVH 1MCEA 4ZAKD 1MHPH 3QO0A 2WINB 4HCRL 5E95B 1C5DB 3P9MA 3ESUF 2GIYA 4MJID 1MFBL 1J05B 4N0UE 5CEXA 4PJAF 1BX2B 2PO6B 4EUPH 4JKPH 4KDVA 3EDEA 3LDBB 3T3PE 1KENH 2AK1L 1S9XB 1VERA 4I1NB 4XH2B 5CD3B 4TPRH 2R23B 5L8KB 4GUPA 1DBMH 5E00A 2NY3B 2PYEA 1DP0A 4QRTA 4I4WA 1EHNA 1KXQE 1S7WA 1XF2A 1MCNA 3O4LD 2XZAH 4NQDE 4HGWB 3SGJC 1FN4A 1SHMA 4XNQA 3BJ91 2EXYC 3HUJB 4KAQL 3CMGA 2PW1B 3T4AA 3FT4B 5L2KE 1UM5L 5FCUH 4YNYB 4G6AC 4X6DB 4P5KB 3DVFA 3HZMA 1DQQA 5DQJA 1VB9A 1O0VA 3NIGE 4WWID 2J12B 2VKWA 5DVOA 3DVIA 4OF8A 4X80H 1RD6A 1P53A 1KULA 2R4SH 1BLNB 4FQJH 4P9HC 4OM1L 1PSKL 5IV2A 4GSDL 1W72A 4HWBL 2I07A 4QCIB 2A6JA 1ORSB 1KEMH 5J1AA 4OIBA 1B3JA 1EEUA 1P7QD 1LDPL 3PWLA 1QLEH 1OAUL 4MNGB 2WMPA 5DJZA 5FDWB 8FABB 1RUPL 3QJFA 5JO5B 1NAKH 3QEGH 3VCLA 1VACB 2P24B 1F8TH 4XC3H 3CSGA 1MWAL 3X14B 1LILA 4QTIL 4YHLL 1OT2A 2VDKL 3LQZB 1OQOA 3SE3C 2FJHB 1LE9B 1YYLH 5C2UB 2BHYA 3K0WA 3E6HA 4NRYB 5CS7A 5J56B 3G6JE 5T3XD 3TIEA 3MGOB 4MS8D 5CGYD 2AEIT 2BVPB 3B5TA 2IFFH 4Q2ZB 3UYOD 2BY2A 3U0PB 3MRPA 1UA6L 3DRTA 2NNAA 4CW1A 4PJFE 3KYNA 4JPIA 1A6TA 1NDMA 1I9JL 4MD4B 4XHQA 3H42H 4PRIA 5IT2L 2FL5B 2ZCHH 4D0DA 3HI1A 4JDZA 5E5RB 4DOHB 1FLTX 5H94B 4NKMB 5K33A 2L0DA 5BVPH 1OTTC 4MXQC 1LQSR 5DR5H 1CXHA 1ZHKB 3MREA 3FB6B 5DUMH 5GRWA 3FFCD 5FO7A 3D5OF 3FQNB 1NCAH 5GXBB 4KRLB 3PHOB 3JVGA 1T3FB 5J6HA 2XNAB 3O11B 1A64A 1Z2KA 1ZLUK 1AGCA 1NFIB 4BM7A 4Q9CA 5CEZH 1MCOH 5I1KH 3BZ4B 1F6LL 3QQ9C 1X5LA 4OQTL 1OTTD 4G8EB 4OGYH 1HWHB 3KVQA 4U1HB 4PD4J 4PRNB 4F2MA 3IDGA 4QOKA 4OLUH 1RJYA 3PG2A 4EI5B 3QIBC 1KCVL 4LU5H 2Z0BA 3GJEA 3OAZH 3BGAA 4GH7B 3UEZA 1N5AB 4N0FB 4S1SH 2XWBB 4S2SB 5EPMA 1CL7L 5E8OB 4NKDA 4ZO8A 2BCKA 3VFUA 5E2TL 1KJ3H 4WU7B 3ARZA 4ODUA 3ZHKA 3OR6A 4BZ2L 4F7CB 1U8IA 4MMZC 2G5BA 4H26B 5IQ9B 1KPRA 4U1JA 1XFPA 4QXTB 4G9FE 3T0EC 3MRCA 2XQBL 3VXRA 3V8OA 4I3SL 4ODSL 1YYMH 2Y5EA 5B4MD 4JQIL 1DQLH 5C8JB 1JPGA 1XF1A 2FDBP 3D9AH 3FQRA 3UBXG 3RIFK 1J7VR 4AL8L 1K8IA 5GQBA 3SKMA 3O0RH 1IQWL 3WDHA 2F74A 4XNXH 3LV3B 5HYEA 4QXUL 5FUCE 4Y7MA 1DVFA 2PN5A 3X11A 3ZYOA 4C56D 1JWSA 2F5AH 3BT2H 1S7UB 1F4YL 5E7BA 2PYFA 3FMGH 1FSKB 1GHFH 3MCKB 4IRSD 4K94L 1I9IH 3GB7A 3REWA 2FO4A 1I3RA 2ARWA 4OFDA 5KVFL 3HI6H 3WFCL 1S8DB 4LPUA 1L7TH 3HMXL 3H7BB 4H1LG 2CLZB 1YEGH 2EYTB 2GITA 3LRGA 4JFDB 2X10A 5KOVC 3EFDL 3BEVB 2X44D 3MLXH 3W81A 4E0RB 4EXPX 4HFWB 3EO0B 2HJKB 2WLZA 1WEJH 4PJDA 2CPCA 3ULSA 3KPSB 4HJJH 3SJVB 2X89A 5F7HA 3V9FA 5HGAA 4NNYA 1NPUA 1TETH 1AP2A 1KG0A 3C08H 2YC1B 5E5UB 3THML 5E8PB 1S9VA 4UBDC 2ZG3A 5HI4D 5K9JL 5F7LB 2VQ1B 3D39A 5H35B 5IVXA 3SKUD 5MERA 4L8SC 4K8RH 3BHBA 3RGVB 4POUB 2VZVA 3GKZA 3G04A 2A77L 4NP4H 5K9OA 3QQ3A 3QFJB 2CUMA 1NCCH 4JQVA 4Y16C 3W0WB 4JB9L 5GGQL 3OKNA 2OL3H 4OGXL 3PWJA 1WQVT 3U36A 4ZDHB 1T03H 5E6IA 5H2BB 4I9WE 4OZFG 5D72H 1QSFB 2BDNL 4UMGA 2LABA 4UBDD 1S7VA 2GUOA 4KI5E 1T66C 4FTVB 1AXIB 4NO5B 1YEHL 2LU3A 5SWZB 2DQTH 3BKCH 1E4KA 3PP4H 4AENA 4M1DL 5J3HD 4NO2B 4HDIB 4JZJB 4OAWB 2AEPL 5EBWB 1FGVH 1CVSC 1A8JH 2WBJA 4ZSOB 5C0EA 4HKZB 3H3KA 3ARYA 4YXKH 4HUWB 5T5FH 4YHNB 1LHZA 1MRFL 2VLRD 3MA9H 4OZIF 3BN9D 3CFBB 1F4HA 4WJ5B 1T1WA 5E03A 4WI3A 2NY7L 4M9PA 3GMNA 3HE6C 4OZHE 4JZNA 1VADB 1E6OL 1UJ3B 3D0LA 1CDYA 2ZSVA 5D7LB 5LKNA 5HHOD 3CFKB 2FATL 1P7KA 2BFVL 2QHRH 4LCCA 4PJ5B 5KJRL 5GRVK 1QQDB 2FJGA 3NCBB 1CI5A 5IF0B 3VH8G 3QI9B 5DVMA 3RHWK 5I8EA 1TZGH 3CPLB 2HT3C 2X1OA 2RFXB 1FHGA 2EEDA 4Z7QE 2BERA 3GUTB 1FZOA 1U95A 3Q6FB 3JV0A 1P9MA 3UBXB 4Y4HB 3VJ6B 3CZFA 2FSEB 3GFUA 2EDTA 1IE5A 1WBXB 3RWGA 3S96A 4ODHL 1CT8A 3Q3GB 4JGUA 3I6KB 4P2OD 4JREC 2P5WD 6FABL 4OJFL 1VPOL 5KS9A 2V7NA 4BSVB 4HS6B 4UB0L 2BRRH 1G7HB 3MA7A 1E4XI 3WJLC 5E2JA 2HT3D 1HXYB 5A16B 1YC8A 5T3ZD 4QXWA 1F4WL 5B3NA 3MRHA 3ZO0A 2KQMA 4XWGH 1DLFL 2LTQC 3HG1A 4E5XA 1EFXD 1BQSA 2AV7A 3CDGA 4IOSD 5GRYA 12E8L 1A4KB 4IS6A 5ISZB 1TTUA 4Y4KD 4PGDB 3MV01 1G7LB 4YR6A 1WCBA 3R8QA 3PL6B 4ELME 4F37F 3VXMB 3QJHA 3GK8H 1U41A 3CX2A 4PJGA 3GSNA 4DEPC 1H3XA 2LU4A 2N1KA 3QCUL 4P5TA 3NCYP 5B21A 1CIDA 3MBED 2AEWA 2HLFD 3UYRH 5C9JA 4XP1L 4JCMA 4LCCC 4HHAB 1GAFH 1MELA 1XGQB 5FA3B 1B6UA 1NAMA 4M62L 2LV4A 3DMMC 4PJAE 1WFOA 3BWAB 4PRAA 1F11A 3HAEA 3RZCB 2VAAB 5J4MA 4NN7B 2VL5A 4HAGA 4PJCF 3PWPB 4YQXH 1B4JL 2NXYB 4RMRA 1P9MC 3IDMA 3VFVB 2C3GA 4J1UB 4GG6A 3DIFB 3KG5A 4BJLA 2XZZA 3V5DA 1MHEA 1S5IH 4YAQA 5I6XB 2X9YA 3TPKA 1BAFH 3NCJL 4NCC2 5CGMA 3UTTB 5ITFA 2NR6D 3CJJA 4TSAL 4NN5C 3DYMA 1IGFH 4RGMB 1SJVA 4B7LA 3LAFA 3C2AH 4QRQB 4Z7UF 3QCTL 4L5FL 4V1DE 1NBZB 1GZPB 1K3IA 1KTLB 2DF3A 2GJZB 3MRMB 5HHPB 1FVCA 4XPBL 4MDJA 3T1FA 4OCNC 3TEUA 3BIAX 1BHGA 1OF2A 1NFDF 3MBXH 5CAYB 3NA9H 1I7RA 1N4XH 5ALBH 2VISB 4KK9C 5D7KD 4CKVX 5I1GH 1ZHNA 3U9PH 4AJ0A 5LWYH 3FB8A 3KAAA 5ILTL 4PJ7F 2GKIA 3BKYL 2BVQA 1BJMA 4GS7C 4DQOH 2Q86A 4KHXL 3V4UH 1ITBB 2AW2A 2VXTL 1NJ9A 1CZ8H 1YA5A 1RZJC 4XPAH 1A6AB 4EBQH 1I9EA 4KKBD 5HHVH 4D9LL 4U7SA 2NY4D 4GBXD 4PRPD 4U2ZA 3TPUA 3TIDB 2KZ1B 3UO1H 4DKAA 3VRIB 5I17A 4OV5B 2W60A 4U1MB 3WN5C 2YD6A 1XH3B 3W5NA 4YK4B 3K81A 3RVVD 1QRKA 1WFUA 2YD7A 4HULB 5C6TL 2V2WA 2CXKA 3KS0H 4LIQL 4BSJA 3QDGD 1YY9D 5JHDE 5I8KH 1ADQL 4LQFL 2HA1A 2HJFA 3VE0B 1PY9A 4XBEH 3BP5A 4YDLC 5C07B 4LVOB 3TBWA 1TJGL 1J0KA 4FQXA 2VDLH 3L3DA 4FXKA 3KHQA 5EIIA 3C5ZA 1R3JB 2QADD 6CGTA 1PQZB 2AXHA 1AIFB 3U48A 3L3HB 5FGCE 2HRPH 4P23B 4AK1A 4JJ5A 3D0VB 5F89B 1JWUA 3CLEL 4OIIH 3O6LL 3QDJD 4ZUTB 4XP6L 4Y5VB 4XT1C 2DD8L 5FUZL 4YHKL 2YKLL 1PBYA 2JIXA 4I0PB 3DX7A 1MH5A 1EIBA 5TE7L 1G0YR 4P4KB 1Z3GL 4YE4H 4AMKL 3VXSB 4NCDA 2YPLA 2OR8A 1NGQH 2VMFA 1ZT1A 4NRZA 4KZEL 4ODWB 2NX5E 1ZT7A 1C08A 4QRPA 4M7KL 4WW2C 4PRHA 2DI8A 2BY3A 1KPUB 2CK2A 1JE6A 1IQDB 5GRXG 4F7EB 4N8VG 3VXQB 3IU3B 1OAYH 2W65A 2L7UA 1CFTB 1HHHB 4QHLB 5ESVB 3LKPB 5DQ9B 1PG7W 5F9JA 3UJTH 2Q76B 1HHGA 3QNXA 1IM3B 3ULUL 3FTGB 5EOCL 4ZFFA 3C5ZC 2X9XA 4HG4J 1G6RH 1KT2B 1NMBH 5MEQA 4PTUA 4QHKI 1ZEAH 1EVTC 2XIDA 3VDCA 3OKOA 5BRZA 2F5BH 3SKNB 1SY6A 4ZUVB 4X7TA 2X4OA 1OHQA 3T0BA 3P4NB 4QY8B 4QRRD 4BH8A 3SDDD 1BOYA 4KHTL 5DUBB 1S3KL 1J86A 1NUFA 5HYJD 3DROA 4LFHG 3MGTB 5L2JB 4ZPVA 1LGVA 1YEDA 4D9RE 2DQCL 4DGYL 3DO7A 4N0UA 4EIGB 1X7QB 1PKOA 2DQJH 3B2VL 1FPTH 3RJQB 2LFGA 1JGUL 1ONQA 2NY2C 3QYCA 4DCQA 3A6CH 3FB7A 2XRAL 1GC1L 4HUNB 4K23H 5J11C 3LKQB 1JNNH 1OM3H 2UZYB 4UIMA 1QFHA 4HLZG 4LRIC 4IRZH 4LPWA 4K71B 4OGAD 2DLIA 4PBWD 4PJXF 1MIEL 2A6DB 4ZOEA 4TRPL 4HFUL 1T1XB 2GEEA 3LVEA 1I1YA 3BMVA 5IMOA 4X4XA 1P1ZB 4XNYL 4PRDA 1CGYA 1YUHB 5BQ7A 3F7VB 43CAA 3KWWA 5L2KA 4WY7L 3HUJF 4QXGH 1KSRA 1JRHH 1N5YL 3LKSB 4KJWC 1AR1D 3TC9A 1CFVH 5LAXB 4JO3H 2AXFA 3QXAB 3BKML 2OMBA 3M45A 4JDVA 4R26H 4U33A 1RURL 1CLOH 4KY1H 2PETA 3D3VE 3F5WA 2ARJQ 3RWDA 5IB5B 3TVMA 1KFAH 1NKRA 1RZKC 1BD2D 1J5OH 5DLML 1W8OA 4JRXD 4DGIH 1B2WL 3W39A 5HVGB 4X4ME 4HUXA 4CVZB 2Y06L 1QOKA 4IRJD 1KLUB 4GAFB 4NWTH 2LVCA 5DJAA 1FFPA 4JDTH 5IGXL 2J8UE 3VFNA 1MQKL 3DETC 2NXZC 4WHDA 1NGYB 4NSKB 1NCBH 3CUPB 4JO4L 4WCYL 2ZUYA 4OLWH 1R3HB 1WLHA 2ATKB 1ZVYA 4G8FA 4PP1D 4O02L 2ICWA 1NANH 1XEDA 5FKPA 4EN3A 3EJZD 1H3GA 3TYGL 1JI1A 1WC7A 5C9KA 1KJVA 1FAIL 5ANMA 3WEXB 4R7DA 3ZHDA 1JWMB 5MI0C 3KYKL 4M1GH 1BQHA 4NHUB 3BVNA 1A3RL 4RFOH 1QACA 4NBXB 4KKLD 3L3OA 2DYPA 1ZHLA 4MAYC 3T4YA 2PTVA 4N8VB 1A4JA 1VEOA 2GJ6D 4JKLA 3WXWH 3RIFF 1KN4L 1MFCH 5C0BB 3GEWB 5IIEA 3RWJA 3EOTH 2BVOB 4MAUL 5L7XH 4ACPA 4DK6A 5C0DA 2YD5A 4P2YA 3WFBL 3K2UL 4IM8A 3EW3B 2YA1A 3FRUB 4RGND 2PXYD 4NGHH 4Y19D 3D85D 3O45A 1U8JB 4K2UL 4OZIE 2AK4E 2O5YH 1N59A 5HI5D 1DN0A 4N68A 3KXFA 5IMKA 1WCQA 5LGJA 2VB5A 1V5JA 1IGCL 5IMLA 4MJ5A 4WV1C 3CFEB 2DLEA 3CMOL 1QFWL 3FQXB 3MCG1 2VRAA 3QUYA 2IH3B 4G3YL 5JHLL 4NNPL 5EU6D 5C7XH 2C1OA 3QO1A 2H26B 4HUVB 1RFDH 5E8NB 4G42A 3CU7A 5DF0A 4NUGL 1MLCB 1CS6A 1I1AC 3VFGL 4HIEA 4GLRI 5C1MB 3FQTB 4HEPG 3PV6B 3BH8B 2ZNXA 2R8SH 4XNUH 4HKBA 1UQSB 4NKIL 1INQA 5A3IC 4N8PA 4KGLA 1FL3A 1UB6A 3SCMA 1UEMA 4R97B 3ARGB 3PHQA 4HCRH 3GMPA 4PS4L 1TNMA 2RCSL 3MLTB 2XQYG 1DDHA 5C09A 5JLZA 4JFFB 2XZCL 1MFBH 4X98B 2XY1A 5I8OL 2HVJA 4M4RA 4OCSH 3L7EA 4GW5B 4HS3B 1Q9LA 2L4OA 5JORA 2J4WL 4KK5C 1KIRB 3KJ6L 4X99B 4G9FA 1AY1L 4W4OC 4JGJA 4YDVB 4PB0L 3CVHB 5C0FB 3FRPA 2CLVA 3OKMA 1MCLA 1UG9A 4KAQH 4M6OL 4QRSA 4MCZA 5SWSB 3QUYC 4K3JL 4DAGH 1DTUA 1ZA3A 5MENB 4Y1AB 3ZTJG 1JK8A 1EBAA 3VGAC 3B43A 4Z0BL 3JBG7 1E4WL 1CFQA 4OM1H 5T3XL 1HKLL 4WI5A 1PSKH 5D1XB 1BVKB 1IC4L 3K46A 4GSDH 4O51A 4HWBH 3FCTB 1IL1A 2UV3A 4OI9A 5IW1B 5EH1A 3QXDA 4Z7UE 1LDPH 2X4RA 3NFSL 1OAUH 1ZE3C 3OX8B 1RUPH 2HJLA 1NFDE 4HD9A 3HCVB 1RIVL 1YY8B 2BNQB 5CBEA 1MWAH 2PCPA 3ZZ1A 3GIVA 4QTIH 4YHLH 4FNLL 2VDKH 3RDTC 3T77A 3GMQA 4PJ7E 4MDIA 3VFWB 1CDCA 3MV8A 2P47B 3S4SG 3DV4A 3E6FB 5GRUL 2JLLA 2A73B 5TQ0H 4DFIA 3HNSH 4I2XB 4JFZL 3HB3D 3VFSA 4YHIA 1UA6H 1A1NA 3STLA 1FLRL 3LEYL 2Z8SA 3ARDD 1I9JH 4W81A 4XRCB 1FJ1B 3GSRA 3OXRB 3AREB 3DOSA 1DFBL 3RDTD 1H15B 1AHWC 3SDCB 4ENEC 4IIQB 4XC1L 2NW2B 2ADIB 4U6XB 4MNQE 3MRQB 4FFVC 1CE1L 4XX1E 4EJ1C 5CINL 3OBAA 4CADB 2AV1B 1KB5B 1BZQK 2WBKA 1ZANL 1O5DT 3C6LB 3B9AA 4YHYC 2VSDA 4WUUA 4ENED 2QLVB 1T21A 2VLKA 3Q0HA 2AAVA 4WI8A 2HVKB 4U1LA 5JIKA 1A3QA 4OZHA 2BNUA 2OXHA 4NNXB 4YH6A 3MFFB 4Q9RL 1RQ5A 1DEEB 5GGSA 1IEBA 1KCVH 4K3DL 3BUTA 4I18C 4U31A 1QR1A 1V3LA 3ULVD 2EDJA 5F7UA 4Q9BA 2ESVE 4LARH 4PJ8C 1QTYT 4LF3A 1CL7H 2UY6A 2C3HA 3BW9B 4HJ0D 3ARBC 5J06A 1QFOA 5FGRA 3NZHL 3DBXA 5D2NB 4LKCA 2EEAA 5D96C 2J7LA 5E2TH 3GNML 4TSBH 3O6FB 2A83B 3GSQA 5BVJA 1NSNL 3V52L 1MRDL 3VFMA 3ZT7A 1FH5L 4D0CA 5C0AD 3F6LA 4BZ2H 2AGJH 3NPSB 4H88L 3FT2A 1MJJB 1FYTA 3LN5B 4JY6A 2DBLH 2B4CL 5ICXA 3KPRE 2F53A 2NY0B 4ZNCD 3LB6C 5GS2H 3IJHA 3MYJA 5EWIL 3S5LB 2XQBH 3VD5A 3ZMRA 4GJTB 5E4EB 1X5IA 4I3SH 1R3LA 3CFJA 3JV6B 4JQIH 2P7TA 3TN0A 1TNNA 4U0RB 3T2NL 2HFEB 4MJIB 3SKJH 2JJSA 4AL8H 4H5SB 5F6IC 1HINL 4PB9H 5FM5M 1NDGA 2OZ4L 4QXUH 4ELMA 1VFOA 3BP6A 5DDHB 4ZFOA 4NQSA 4CN1A 3QDMD 1MCWW 4GW4B 1D9KC 3M8OH 4LDEB 3CXDL 3WS3A 3TO4D 1L7IL 1H0DA 1Q8MA 5D7JA 3CAFA 1F4YH 3QQ4B 3IDNA 3GGWA 3FO9A 5JPNB 4K94H 3O4LB 2FLBT 4PJAA 2AJVL 4XCYB 1NC4A 1O7SA 1J8HD 5KVFH 3RVXC 3UTZA 3WFCH 3SDAD 3HMXH 4AT6B 2VLJA 1IKNC 3BJLA 5CZVL 2KDGA 2JE8A 3DXAD 4U1SB 5GGRB 3EFDH 1X5XA 4PJXE 4CU6A 1OD7A 5AWNL 3O8XA 1I7TA 2XQYK 3UPCA 3QEQA 3I3EA 1FO0A 3KJ4C 4WHTA 1T7XA 2XG5A 4C4KO 1MCWM 1G7QA 1WAAF 3V0VA 3WIFB 1E4JA 2O5ZL 5FO8B 5GRVL 1FFQA 3HUJE 2R29L 4V1DA 5EO9B 4AH2B 4M93C 3WE6A 5IJKA 3THMH 2X4QA 3BDBA 3B9KD 3U4BL 3WIHH 4WW1A 1QBMH 4ZS6C 3MR9B 1P7QB 1TITA 4U7MA 2A77H 2VITB 2X1PA 3EJYC 4S1DC 2ERJC 1UXWA 5HYQA 2BP3A 4JB9H 5HHXL 4F9PA 4OGXH 1Z9SA 3GI9L 2B2XL 1PVHA 2AJZA 2UYLB 4V2CB 4OCXH 2ATPA 4G6FD 5BV7L 1QLFA 2BDNH 1NCTA 1YMMB 4ELKB 3EO1A 3V0AC 3D48R 5D1QA 5CEXB 2Z4QB 4ZS6D 1YEHH 2XZQL 1S9KC 4M1DH 3A6BL 4L8CA 5C0IB 2VDNL 7CGTA 1KEGL 1IT9L 4U1GC 2AEPH 3MNWA 4OZGB 3X3FL 1L0YA 4MNGE 1G7PA 3C5JB 3C60C 5CEYB 4KJPC 4QHMB 4X5XA 1KJ2A 4G9DA 4OD3L 4QRTB 5HY9A 4EUPA 5I19L 4ZYKA 1MRFH 4Y89A 1XF2B 3BYYA 1AJ7L 2NY7H 4OT1L 3QUXD 5F7FA 2WW8A 1E6OH 4GT7A 4MYWB 3C9NA 3IXTB 5T3ZL 1BFSA 2FATH 3NCMA 2DM3A 1F02I 3OR7A 5KJRH 2H41A 2K7PA 4GKZB 3A67H 1FIGL 4PPTA 3O9WA 1S9WA 1F58L 2E9JA 1X5ZA 1EEZB 4ZUWA 1XGPB 1A3LL 3SEPA 4LPTA 5JXED 4KKCD 4YO0A 2FEEI 1UWXH 4C83B 1FNFA 3SQOL 4UDTA 4F9PC 4LSTL 5CD5C 1IZKA 4P2QD 1GGYA 3VXOA 4Z8FL 1EO8L 1LEKA 1IAIM 3PIQA 4FG6C 4KK8D 5D7IB 5FYKU 4ODHH 3ROLA 2DQGL 1HHKA 3D18A 4I0KA 6FABH 4OJFH 1VPOH 4JFPA 4L3EA 3MRFB 4JFYA 4UB0H 2UZIL 2NX5A 1TQCC 1FCCA 4KWUA 1F4WH 2K1MA 5FB8B 2IPKA 3P9LB 4R0LC 3VCLB 4JKMA 3SGEH 5AD0A 1DLFH 1IAMA 4LNRB 1UXSB 4XI5D 12E8H 3VFRB 4K7FA 5E9DA 3B83A 3MJ7A 3CDFA 3K1KC 5F1KC 2QSVA 3QIBB 2PYED 3QCUH 3NCCB 3TIEB 1XCTB 1S7TA 4XAKE 4XP1H 3V0WL 3MRPB 1X44A 2NNAB 4M62H 3KYNB 4JPIB 3H7LA 4QTHB 4ZFZA 4M1CD 4L4TE 1D5ZA 3EYSH 4EQ3A 4KRNA 5IEHA 3IJYA 1B4JH 1DE4A 5HYIA 1T20A 2HT2C 5GSVB 4DWHA 5K9KB 1S7RA 3BPCB 3RIAK 1S78D 1CIUA 3X13A 1WBYB 4RIRA 5FO7B 3S36L 4I0CC 1U8OA 3T0EB 1CYGA 3NCJH 5CGTA 4M43H 4XTRD 2WZPD 5DO2C 5CBAB 5SWQA 4TSAH 3RTQC 2BOBA 5F21B 2W92A 5KVDL 2XN9B 4G8GB 4O2FA 4WI4A 4JZOB 5T1LA 2E7BA 3QCTH 5ESAA 4L5FH 3QDHA 5D6CB 5EIVA 1URLA 4W4NA 3WS6C 4XPBH 2ZCLL 4KZDL 4HK0A 4N9GA 1ND0B 1OLZA 4KK6C 1RU9L 2W0FA 2Q3ZA 3I3BA 5ILTH 4J4PC 5DO2D 3BKYH 1IC5L 2ZSWB 3WSQL 3RY6C 3GJEB 4KHXH 3TBVA 5M7QA 5CJQL 3DV6B 2VXTH 3B5GA 4JANA 1KGCE 3MV7D 2EDRA 4D9LH 1MHCB 1D5MB 3VGBA 3QHTC 3VFUB 1ORQA 4PBVC 3WUWA 1U8PA 5D6DA 2XICA 1XF5B 4NUJA 1WISA 2R2BA 1F3JA 4Q0XL 3QUMB 4JFDE 1RJLB 1T04B 4X4MA 5AAWA 4OV6F 1EHAA 3VW3L 2P43B 4PRID 5C6TH 4LIQH 1KPRB 3P4MA 3KYOB 1U3JA 2J8UA 2IAND 1ADQH 5D5MB 2GTZB 4LQFH 4KKNA 3KPSE 3SJVE 5HPMA 4QEGA 4ZMAT 3B2UD 5KSBA 1TJGH 1P2CA 4ZNEE 3P77A 4RBPK 4NWUL 2OK0H 3H9ZA 4O00A 1KLFA 1OL0A 3HE7D 4L8SB 1L9MA 4UQ3B 4EI6A 3QSKB 5FDYA 5D1ZA 4Y16B 2XA8L 1B0GA 3CLEH 3QFJE 3W0WE 1B4RA 3O6LH 4HIJB 3D2UD 4XP6H 2Q7NA 2P45B 1EO5A 4H25B 3WHE1 1A9EB 2DD8H 1D6EA 3IJSB 1HEZA 4GG8A 2VXSL 3MRDA 3SO5A 1Q9KA 4LLWA 3GDBA 5TE7H 3H0TA 5F1NA 2FO4B 2VDRL 1I3RB 4PGCA 1QSFE 3HMWL 1Z3GH 4AMKH 3MOBH 2BOCA 5SWZE 3S35L 4KZEH 1BZ7A 4D3CH 4D94A 2GITB 4NZUL 4L8DB 1BBDL 2EDBA 1DLHA 4M7KH 4DUXA 4WFEE 3C6SB 2D9CA 3GSWB 4OZIA 4GRWH 5E7FA 5GS1A 3VWJA 5CCKL 4ZSOE 1RI8A 2D7TL 2VDQL 2YPKB 4M02A 4HLJA 3HE6B 1EZVY 2ARJB 3TCLB 2WIIB 2H9GA 5IJVA 3L9RB 2BJML 4U1KA 2JCCB 3HHRB 5KSUA 4YX2L 3HAEG 3RKDD 4ORGB 3ULUH 3A6OA 4WRLA 4R3SA 5EOCH 1BWWA 4PJ5E 5CLWA 3VXRD 4OF5A 4P9ML 3H9HA 1KPVA 5K9OB 2D7OA 5D1ZC 1I8MA 1HILB 1SEBA 3M07A 5GS0H 3WL9A 2HKHH 1L4IA 4WTZA 4PJEB 1D5IH 4KHTH 1S3KH 4LVNC 1F45A 4R2GD 5EZOL 1H3PL 1DVFD 1YZZA 4U0QB 3I6LD 4JREB 2RGSA 2DQCH 4DGYH 3NIDF 2WLYA 4KJYB 3TYFB 3MLYL 2ICWI 3B2VH 1JGUH 3G5VB 2XRAH 1GC1H 2LTQB 1W0VB 5F93C 1Y0LA 3WLBA 1HH9A 3OL2A 1MIEH 4TRPH 4HFUH 4PJ9A 5DA4A 5IROA 3HZVA 4Q6YA 3FO0L 4DEPB 4XNYH 5CWSB 4BK5A 5IW3A 2ZSVB 4Y2DA 5E94A 3VXME 1MCJA 1OP9A 3VXTA 1JZ4A 4LCCB 3F65A 2ENYA 1GPOL 1XIWA 4HEME 1HI6A 2X89D 5DRWA 3DMMB 1S9YB 2D7MA 3EYUL 3MUY1 1FQ9C 3BKMH 1BQLL 2SEBB 5I8EB 3QIUC 1RURH 4HXBL 2FD6L 2OJZL 5BZDA 1RY7B 1JGDB 1H8OA 3D39D 3MC0A 5I8CB 5DLMH 4ZOAA 4LLDA 4K8RC 3PWPE 1B2WH 4P2RB 4MX7B 3I02A 2Y06H 5ENWB 1FVDA 1WAAE 1D5XB 3BOVA 2P1YA 4NN5B 5IGXH 3UTTE 1SJXA 1MQKH 5E6ID 4Z7UA 4JO4H 4WCYH 5EUOA 1UWEL 1AXSA 1UGNA 1EUUA 5I1LB 4L3AA 1HZHL 1NFDA 4LP5A 3P0VH 2YD2A 2EZ0C 2MKLC 3R0NA 2O61B 1LEGA 2JJVA 1ZS8A 4BKLB 4IS6B 3TYGH 4YR6B 2D0GA 3O4OC 5IROC 2XWJA 5GJSH 4R4FL 5LGHL 4LPXA 1FAIH 3RBGA 3ILPA 2WBJD 3QJHB 5DHXB 1KIPA 5TDNA 3KPPB 4GS7B 5DSCB 1QG3A 3DYOA 3KYKH 1U92A 2MHAA 1A3RH 2IBZX 5EOCJ 4KROD 4M03A 1UACL 1R5WA 2N7BA 2CJUL 2CIIB 4Q74A 2EEBA 4C58B 5CSZA 5KZCD 1JUFA 4HWEL 4TSCL 5LQBL 3FFDA 4ZXBC 1KN4H 4K7PL 3L95B 2QL1A 3HAEB 5E70A 2VIRB 4MAUH 4M6ML 5BMFL 3WN5B 4XAWL 4LSSH 3WFBH 3K2UH 4L9LC 1OGTB 4B50A 4PY7B 4OZ4B 1F90L 4MNQA 1KN2L 2LU7A 3EYFB 2D9QB 4QRUB 4K2UH 4YAQB 4UILH 5EO0B 1E28A 1YMHA 5IOPB 1RPQA 2CLRA 4J8RA 4YDLB 3UPRA 1IGCH 3P30L 4M5YL 3IFLL 1R6VA 3CMOH 1QFWH 1SJEB 5C07E 1U3HA 5JHLH 4NNPH 4MDJB 3FHAA 2OS7A 4NUGH 5KSAD 4UT9L 3RWEA 3VFGH 4CMMA 2BSSB 3TNNA 1ZHNB 3H8NA 3HG1D 2EO1A 2DWDA 2R0LH 2BVQB 1Y6NR 5FGBA 2QBWA 2QQKL 3DUUA 2B8OT 4WWKA 1OB1A 4Z77B 2ESVA 3C5SA 2COQA 3TA3A 5IUSA 5KG9A 1RZ7L 4PS4H 4ZO6A 4XNMA 1BPVA 3MLRH 5ACZA 3EYVA 4P5TD 4WHYG 2XZCH 4DJMA 3VXSE 4JLRA 2WWMC 3OMZA 3GSUA 4RZCA 5F9OL 1VFMA 2W60B 3CSBA 3P3YA 1E4XL 4WW2B 1HK6A 4RMSA 2G75A 5L9DL 1I8LC 2J4WH 3KPRA 1DANT 2ITCA 1OGAB 1QSEA 2ZOKA 4QRRB 1I1FB 4MWFA 3ZLQC 3BP5B 2W91A 5DD0L 4M6OH 2OCFD 4D9QD 3TBWB 1JHLL 1FL6A 1ZAGA 4K3JH 2XTJD 4N5ED 4LLQB 5IB2B 2FGWL 3LIZH 3VDBA 2DQIL 2YWZA 1J12A 2EYSA 3C5ZB 3QA3A 3RNQB 4P9HH 4L4VA 1H5BC 1YPZB 4HW6A 3FO1B 4Z0BH 1TZHA 4O2EA 1PKQA 1N6QL 5D71L 5FV1L 1PYWA 4KXZH 1E4WH 3VXPA 3AM8C 1CG9A 3MRIB 5DJXA 2UUDK 3G6AA 5T3XH 4G7YL 2PTTA 5I16B 1HKLH 4IOFC 1IC4H 3TA3C 1C5DA 2X5PA 1A0QL 2VWEC 1J05A 4PTTB 4DZ8A 5TF1L 1BX2A 2NY2B 2PO6A 1G7JB 1XT5A 1ZTXL 5J11B 1IEAB 5CD3A 1S9XA 1LK3L 3NFSH 4XH2A 1C08B 5C0NC 4QRPB 2R23A 2H2PC 1BQHG 1EERB 4UUJB 5DJCB 2O5XL 4PRHB 2H32B 1NBQA 2HFFB 4OLZL 4HZAA 4HIXL 2DTSA 4FNLH 1YQ2A 3ZKMC 1UH3A 2D31B 4HGWA 1MJ8H 1WIUA 2PW1A 3RX8A 5GRUH 2ZCKL 3QULB 5HD8C 1A9BB 4JFZH 1UZ6F 2V5MA 3OQ3B 4P5KA 4X6DA 5CMAB 4ZFFB 1FZJB 5EC2B 4XB7A 3RU8L 1FLRH 5JW5B 3LEYH 4FQXD 1QA9B 4MA7L 4UTAH 2CH8A 1DFBH 1IBGL 3NGBC 5MHSD 4XC1H 2A6IB 3DROB 1QLRB 2QSTA 4ZPVB 3VFTB 3ULVL 5GZOD 1CE1H 3DVGB 1MAJA 5CINH 2NXZB 2F19L 1ORSA 1MI5B 2JIXD 4ONOA 2M26A 1LNUA 1OY3B 3TV3L 4MNGA 2VO5A 8FABA 5FDWA 3BDXA 4F33B 1ZANH 5I66B 4C54A 2YPLD 1VACA 2P24A 2QSCL 3QEUA 4OZGF 3VXUB 3JSSA 3X14A 3C8DA 2E9WA 5IMOB 2DQHL 4X4XB 5IVNA 1VFBB 2NTSP 4NZDA 4WO4D 5T33L 5D70L 4PRDB 5MI0B 4Q9RH 2FJHA 5IVZA 1LE9A 3GMRB 5BQ7B 5IBTH 3REVB 4NRYA 2R1YA 4K3DH 4MAYB 3OG6B 3MGOA 5ID1A 2Q1EA 4Q2ZA 3U0PA 1NKOA 1P5UA 5J6GB 5I71C 2CD0A 4NQEB 3NZHH 3F5WB 2FHCA 4MD4A 3GSXB 5C0BE 3GNMH 5H94A 3FRPG 1KCUL 4JY4B 1NSNH 2P49B 1MRDH 3V52H 1FH5H 4NKMA 3RWIA 4H88H 2ZP0T 4HUXB 3MRRB 5JDSB 2B4CH 3P40A 5BRZD 1ZHKA 4LAQL 3FB6A 2VLLB 2V6HA 3KPLB 3FQNA 1FFPB 3PHOA 1T3FA 4WV1B 5EWIH 4YJZL 5D7IF 1EK3A 2XNAA 2DM7A 2EICA 3O11A 3V5HB 1NFIA 2PF6A 3AB0C 2FX9L 3T2NH 1ZLWH 3BZ4A 4RWYL 1I1AB 2MCPL 4X9IA 1HINH 5GSRA 4CL7A 4LCWB 4G8EA 2OZ4H 1MPAL 3WIIL 4XPHL 2WK2A 1ZKAA 4U1HA 5ANMB 5M95B 4NPYB 4PRNA 1IARB 4KC3B 1BQHB 3CXDH 3SE8L 1L7IH 4HX1B 3FN0L 1Z6JT 3VD4A 2ILLA 4NQDD 2X4SB 1N5AA 4KQ3L 4N0FA 3ZDYF 2XWBA 5BCAA 1HCFX 1SVCP 3NIDE 2AJVH 2Z91B 1TCRB 5I1HL 5L2KD 1QBLH 3MV11 5E8OA 3RWJB 4HPOL 4JFFE 1CDIA 4XCNA 4PR5B 4P46D 2AKRB 1DZBA 1CFBA 4WU7A 3B5HA 5CZVH 1K85A 5IB3A 4E41B 5AWNH 4F7CA 2B1AL 4H26A 4Q9QL 2F8VA 3KLSA 3VI3E 5IQ9A 3TVMD 1N59B 4TN9A 3QIWC 3KXFB 4QXTA 5IMKB 1MNUL 5LGJB 2X4PB 3HZKB 2O5ZH 1O7VA 3QUYB 2R29H 4OIAA 2YD4A 5C8JA 1IM9B 5SWSE 3U4BH 1X5HA 1JBJA 2Z31C 2FHFA 3VGAB 2I9LB 4Y1AE 3BEWB 2JELL 5ADPL 3LV3A 4EXKA 1U8HA 1A7QL 2DDQL 3QIWD 3H3PL 4HKBB 4JKKA 5DTFB 5HHXH 4FA8A 1S7UA 1JYXA 2B2XH 1FL3B 3ZE0F 4EN3D 1N8ZB 3KNBB 3MCKA 1C12A 4Z5RB 4ODTL 3VU2A 5BV7H 5C70A 5C09B 3BPNC 4U6HB 4PGBB 2DYPD 2XZQH 2G2RB 5JOPE 3A6BH 1S8DA 2VDNH 1GCFA 1KEGH 1IT9H 2CLZA 2EYTA 3G5YB 4JFDA 3SGDH 3X3FH 4MA8L 1QR4A 3NTCL 2YZ1A 4POZC 5J9PB 4HFWA 4OD3H 2Q8BL 2HJKA 5I19H 4PBXA 2BNQE 3RDTB 3WNKA 1AJ7H 4YBLC 5F9AC 2Y6SD 2Q3AA 3SJVA 2CLVB 3OKMB 3F7PC 4YC2C 4GKSB 1DL7L 5D5MF 4ZNEA 1YC7A 4XVSL 5T3ZH 3ARVA 3RNKA 1IJ9A 5E8PA 4YBQC 1HH6B 3VD9A 4P59L 2VQ1A 3NVQA 4I2XE 1FIGH 5EB9A 5H35A 2VKXA 3RGVA 2OP4L 1F58H 4POZD 4TVPD 3EFFB 3F62A 5HVFB 5FYKL 3W0WA 3MOQA 1A3LH 1NGXB 1SBBA 1AHWB 1JTTA 1CFQB 3SQOH 4LSTH 3ARQA 5BO1L 4ZDHA 4Z8FH 5H2BA 1EO8H 1CTOA 4O51B 1G1YA 4PGJA 4MVBD 3UX9B 1QSFA 4LSDA 5F7YC 3KLHD 4FTVA 3EOBB 3ARFC 4NO5A 4P48A 5SWZA 3SCMD 2DQEL 4NO2A 1NC2B 4HDIA 2UZIH 4OAWA 5BS0B 4HWBA 5EBWA 4YHYB 4YGVB 2ENSA 5TFSH 5AZEL 4ZSOA 2Y23A 4LCUA 1ULVA 2EXWC 2PCPB 4HUWA 4YHNA 1JPST 3QHFL 3CFBA 4WJ5A 4KRPD 1JZ2A 1A2YA 3P73A 1VADA 4ISVB 3MV8B 5DFVC 1Y6MR 5D7LA 1W72L 4G9FD 4I18B 4ZUUB 2J5LC 3CFKA 3WO4C 1XGYL 4PJ8B 4PJ5A 3V0WH 1QKZL 1QQDA 3UC0L 1KXTB 3ARBB 5IFJB 5IF0A 4LNVA 4RMVA 5D96B 4MQXC 2PUQT 3CPLA 3LMJL 2RFXA 2W9LA 5GZNC 3GUTA 1WWWX 2WWKO 3RVTD 2CKNA 1OP5H 3Q6FA 3MLPA 4ZTPH 1KELL 4Y4HA 1KTKE 5KANI 3VJ6A 5DFVD 3Q48A 4L3CB 2FSEA 4HPYL 3MMEB 1WBXA 4RISL 3S36H 2APVA 4H1LH 3EJJX 1JZ7A 1EJ6A 3Q3GA 4HWNA 3I6KA 1CGUA 3LQAL 4HS6A 4GKNB 5KVDH 1G7HA 2P42B 4KKAC 1DEDA 3HS0B 5A16A 2NZ9C 2Z8RA 2J88L 4XP4L 2CDFB 5F6IB 3DYPA 2ZCLH 2HTKD 4P3CL 1QUNA 4V2BA 1YEEH 2NY6D 2E7LC 1MF2L 4NKQB 3V4PL 3TLRA 1A4KA 5ISZA 3H9SD 3PWVB 4PGDA 1G7LA 4J3UA 1D9KB 3PL6A 1RU9H 3VXMA 5GGSB 1IC5H 1JZ8A 2CR6A 5TQ2L 3GMMB 3TT3L 3WSQH 3LPGA 4KKAD 2E7CA 1J10A 4LDLB 5CJQH 3PJSB 3CH1B 4HHAA 4NQXB 1ZT4B 5IBLC 4EUPG 3UXFA 2X1WL 4LKCB 3BWAA 4OZFH 4B53A 3IGAA 4U49A 3GBML 4JRYE 3BIBX 3MUHL 3RZCA 2VAAA 2Z8VC 1A5FL 3MO1A 3PWPA 1XF4B 3EO9L 5GIRA 5AUMB 1XR9B 1FYTB 4J1UA 1MCCA 3VW3H 3KJ4B 4C4KT 2F53B 1I85A 3DIFA 2D2OA 4X4YA 1JTOA 2BNRE 4MJ4A 3UTTA 1DR9A 2E8ZA 5CLTA 4O4YH 5HHNB 4I9WD 2Y7QB 1ES0B 4X9BA 1G6VK 1QRNB 4M93B 1ZV5A 3BRDA 4BSWB 4QRQA 4YIQA 1N64L 4KI5D 1UZ6E 1NBZA 1GZPA 1KTLA 2GJZA 3MRMA 5HHPA 3G9VA 5DD1L 2CIKB 4PJHB 1EAJA 4JM2A 3UDWC 3AC0A 3JWDL 4Z6AT 2XA8H 2ERJB 4ZFOB 3RWHA 4NQSB 1DUZB 1FVEB 5BZWA 1BEYL 4AIZB 4ORZC 3ZL4L 1T0NA 4Y4FC 2VXSH 4F15C 4OCYL 2DLHA 2OLDA 3OHXB 3GO1H 3IDIB 3IXAB 1ZA6B 1W0WB 5LBSL 2VDRH 2FR4B 3O6KH 1A6AA 1NC4B 2RQ8A 3HMWH 5IBUB 1YMME 3TIDA 3S35H 4U1GB 2VLJB 1NBYB 3VRIA 3X17A 4LOUC 1NLBL 4NZUH 4JVUA 3ECBB 1BBDH 4U1MA 5I1AB 3C60B 4ZUSB 1BWMA 5FYKE 5EOQL 4OZGE 3B8YA 5CCKH 1I7UB 4WHTB 5DFWH 2D7TH 2VDQH 4HJGB 2CDEB 5JUEL 2APTA 2HFGL 3VE0A 2BJMH 5C07A 2FEDC 3OJ2C 1RK1B 1Z9MA 4LOUD 4UAOC 4WW1B 1R3JA 4Y8DC 4BQ9A 1PQZA 1AIFA 1U8KB 3L3HA 4P9MH 4FQLL 1A6UL 3U7AA 4IMKC 2M2DA 3K8MA 3D0VA 1FZKB 5F89A 3TN0D 2NY1D 3LS4L 4G6KL 3WIHA 5CJXC 4LLAA 4ZUTA 4Y5VA 4X0KB 5A40E 4TTGA 2AJZB 2FEDD 2I24N 5EZOH 1H3PH 1I4FA 4Y5YA 5D7IE 2R1XA 5D7JD 3VXSA 3MLYH 1JGVH 3TZVC 2H32H 1TQCB 3MRLB 4K94C 1HWGB 4RFEA 4R0LB 4ODWA 1DBJL 2Q7YB 1YEFL 4LK4A 3HLAB 4EUPB 3SN6N 5C0CB 2Q6WB 3CCHB 1IQDA 4NKOB 4LEOA 3VXQA 3IU3A 3C8KB 5DUPH 4U6VL 1CFTA 1HHHA 5ESVA 3LKPA 3O8XD 3C9NB 3LKNA 3OPZL 3D25B 5E6ZA 2Q76A 3TJEH 3WUWG 3TZVD 3QG7L 3SY0B 3ZDYE 2B39A 1IM3A 3OR7B 1GPOH 1WFNA 3FTGA 2HG5B 1A7PL 1II4E 2EH8L 1S9WB 1NL0L 3EYUH 1KT2A 4N90E 4V1DD 1BQLH 3VWKC 5AAMA 4HXBH 2FD6H 1YPZF 3KPNB 2OJZH 5CZXD 5KANG 4ZUVA 3B9VA 3P4NA 4QY8A 4XP5L 3QDAA 3VXOB 1LEKB 3P9WB 5L2JA 3AMLA 2XKUA 4BQBA 1LO4L 1P4LB 3R06B 1BJ8A 2IAMA 1HHKB 2E5EA 2YD3A 1IFHL 4R9HA 4Y5YC 3RTQB 1U8MB 3T0EE 1B0RB 1VKXB 1X7QA 3IAQA 3UYPA 4JFYB 3VWKD 1HN1A 2XN9E 4G8GE 1QEWB 1HZHH 2EE2A 5D1QD 4XBPB 2IWGA 1CU4H 1NGPL 2A6DA 2AP2A 3GIZL 1T1XA 4FFWD 1OP3K 3ARTA 4HWZA 1P1ZA 4R4FH 5LGHH 4X6FA 3OKLB 3ZE0E 1YN6B 3ZYZA 3F7VA 3DX9B 5JHDD 3Q5YA 1H3WM 4M7JL 2M8XA 4HC1A 3LPFA 5IW6B 4XPGL 3LKSA 1MVUB 3GI8L 1U2CA 4HWEH 4TSCH 2P8LA 4MCYA 5LAXA 5LQBH 3QXAA 3GMOB 3QAZC 4KVNL 3FOLA 4K7PH 1V7NH 2EDOA 3MJ9A 1D5ZB 4M6MH 5IB5A 5BMFH 3C87A 4XAWH 3VA2C 5IWLA 3WXVL 3BZEB 1S7RB 1F90H 5GISL 1KN2H 3ARXA 3QWRA 3X13B 4P3DB 1BECA 4RIRB 4CVZA 1MJUL 1WWCA 3GSNL 5HTSA 4FHBD 5GGVL 1KLUA 2IAMC 4F8TA 5C0JB 4PY8J 1N6VA 4KDTA 5D5ME 3P30H 1U9KA 4M5YH 3IFLH 3VD3A 3CUPA 2VR9A 4N0YL 1LO3H 1R3HA 1NAML 4WTZG 2ED7A 5FOJA 3BISA 4JHWL 2EYRB 2ATKA 2XI9A 1CD1B 2Z92A 3I6GB 3ZKXC 5IEKB 4HK0B 1GSMA 2NX5D 4X5LA 1QFUH 3DJ9A 3WEXA 2VUOA 5LGKA 4NHUA 3CX5K 2QQKH 2FEEL 1F5WA 3D6GA 1PZUB 1N0LA 3U9UB 4N8VA 1WIPA 1RZ7H 4RSVA 3BP7B 2IMNA 4NJAL 5C0BA 2XV6B 3AMKA 1ORQB 3WUWB 5F9OH 2BVOA 2FLRT 4NUJB 3BGFC 3NPZB 1VSCA 4X7EC 4XHJC 5L9DH 3FRUA 2P5EB 2XTLA 1EEQA 1QHPA 1U8JA 4K55A 4P57B 3SPVB 5EU7C 1FCGA 4NIKB 1TPXC 1WIOA 3OKDA 1L0QA 5DJ2B 2PW2B 5HPMB 4AY0A 3P4OB 5KSBB 4Q58C 4WUKL 1WUNT 1JHLH 4D9RD 3FQXA 5FM4A 2IH3A 4UOW1 5D93C 1EHXA 2FGWH 2H26A 4HUVA 2DQIH 3LHPL 1QHOA 5E8NA 5TE6L 1MLCA 4XHJD 5D1ZB 3W9EB 1H3VA 2IPTL 3O3DA 5FF6B 1MFEL 3EDDA 4K7PY 4JQXC 1MEXL 3FQTA 2YSSB 1CFSB 1N6QH 3PV6A 3BH8A 5D71H 2E9BA 1TTGA 4DKFL 1UQSA 4LVNB 1HEZB 3KDMA 2QTEA 4GRLA 2E6JA 1X9QA 5DI8B 3LD8C 4G7YH 3T0DA 3EHBC 3BMWA 5F1NB 4TYUA 1R3IL 5DD5H 1ZGLP 1D7FA 1A0QH 3MLTA 5E56A 1LDSA 2BOCB 4HQQL 3OAUL 1IEHA 4X98A 5TF1H 3WV0A 3VG9C 1IKFL 1BZ7B 2DJSA 1ZTXH 4GW5A 4HS3A 1LK3H 2BC4B 3KYAA 5JIHA 3D3VD 1LP9A 2O5XH 1AD9B 3L3KB 1YNKL 4PLJD 4X99A 4PGEB 2EDFA 4YDVA 4OLZH 1Q0YL 3ZTNL 4ETQB 1OAQL 4HIXH 3UAJC 2K9UA 3CVHA 1FC2D 2P4AB 1CICC 4XZUB 2E7HA 3LN4A 5SWSA 4CVUA 1MOEA 5F6HI 2ZCKH 4N9OB 1J0JA 3V4VL 5MENA 4Y1AA 4WI2A 3RU8H 3QIUB 4ZODA 2X4UB 1UH4A 2YRZA 3T2QA 4MA7H 3WL9B 3QRGL 1SM3L 3E3QC 2ICEA 5KN5B 3DGGB 1IBGH 4CVXB 3B4NA 1IGTB 4GRLC 1CICD 3RVWD 4G7VL 1S7XB 4YHZL 4P2RE 3SGKC 5D1XA 3ULVH 3IVKA 1BVKA 2RB8A 1CXLA 2OL3B 1XGRB 3FCTA 2F19H 3L3IB 5IW1A 2AJUL 1EAPA 4UI2A 4RMWA 3FAXA 3TV3H 3OX8A 4RAVB 1YEKL 4KVCL 2QSCH 2FBOJ 4RDQF 5FGSA 3HCVA 1YY8A 1SY6L 2BNQA 1NANI 3O4OB 3MSPA 3HZVB 2VYRE 2DQHH 4CN6A 3UTQB 3P0YL 5D70H 3GHEH 3KPOA 4KH2A 4HH9B 3VFWA 2AK4D 2HAZA 3BD4A 3VWJD 2H1PL 3VXNA 3E6FA 1BVLB 2XYCA 3HNTL 1I3VA 4ZXBB 4IHOB 4CGTA 1KNOB 3GJFB 3ULUC 3FONB 4L9LB 5ID0B 3AREA 1KCUH 1H15A 4LLDB 4WU5B 3SDCA 1FIEA 1KV3A 2JF1A 2NW2A 4U6XA 4JO2L 3MRQA 4FABL 4LAQH 4NT6B 1M05B 2WUCL 3QNZB 3PHSA 4LHUB 2GHWB 2V5RA 2Y07L 5JZ7D 2AV1A 1KB5A 5EUOB 4TNVF 2ZPKL 4BQ8A 3TJHC 2C5DC 2FX9H 2YA0A 4YHPB 4G6ML 4B0MM 4OB5L 4RWYH 3K1DA 4N0CD 2HVKA 3DUSA 1MPAH 3OF6D 3WIIH 4XPHH 1FAKT 1GC1C 4M3JA 2CXGA 4NNXA 3MFFA 3ZTJH 4X7SL 4H20L 1JHKL 5ACMA 3SE8H 4GMTL 1DEEA 4OTXL 4PJ9D 5EO1B 1RUQL 5F7DB 1GXEA 3HFML 5BXFB 1RV6X 3W82A 1JUFB 3IFNL 4KQ3H 3BPLC 5I9QC 2W0PA 3FFDB 2GK0B 4Y2DD 2A6KB 4WENB 3BW9A 5I1HH 2P8PB 4IDJL 2OJEA 3O6ML 5D2NA 4N5UA 2VXQL 2VH5L 4HPOH 15C8L 2DMBA 1T83A 3CVIL 3IF1B 2A83A 3O6FA 3QHZL 5CIPH 5D7SL 2UY7A 3JWOL 3GM0A 2I9TA 3Q6GL 2EIZB 2B1AH 1MJJA 4Q9QH 5K59F 4F37K 1OGAE 2C3XA 1MNUH 4QRRE 3S5LA 2QEJA 4UIKL 2VSCA 4APQD 4AIOA 2GSGB 2EO9A 1RZ8B 3JV6A 1OTUC 1HSBB 2D03L 2HFEA 2VR5A 4MJIA 1L6ZA 2CKBL 1BOGA 1H5BB 2H2SC 4XVUD 4I48B 2A1WL 3RWEB 1YPZE 2JELH 3AXLB 5ADPH 1VEMA 5DDHA 1A7QH 3H3PH 2DWDB 2YZ8A 4GW4A 2OSLB 3ARPA 3ZHLA 2MTPA 3QUZC 3QQ4A 4Y8AA 4HIHA 3X12B 2Y5TB 2I26N 5JPNA 1OB1B 5JXAL 3O4LA 3TA3B 4YXHL 5KG9B 4XCYA 5TDPB 3WFZA 1LK2B 1RUML 3M17B 1A6VL 3GSUB 4RZCB 4AT6A 1KTDA 4W6XB 3HC4L 5GGRA 5I30L 4MA8H 3L7FA 4QRPE 4U6TA 5AG8A 3NTCH 4WEMB 3TH2T 2Q8BH 4PRHE 1DANU 1QSEB 3RA7L 4MQSB 4FQCL 3OWEA 4MWFB 3SGJA 3MRJB 4MNQD 3WIFA 1LD9B 2YN5A 2HN7B 5FO8A 1DL7H 4ZAKC 1F00I 4XVSH 5EO9A 4AH2A 5L88L 4A6YL 1CD9B 2HRLA 5D4QA 3MJ8B 4P59H 2UZXB 3UZQA 3UBXI 3MR9A 1P7QA 2OP4H 3ABZA 1U3HD 1BGXH 1KUMA 2VITA 4QHKJ 4PJHF 1PKQB 3BIKB 2ITDA 5EBLA 1PYWB 3V6ZB 1JVKA 3NGBB 3VXPB 3B9EA 2GTWB 3WYRA 5BO1H 1HYSD 2UYLA 4EDWL 1I1RA 3FT3B 3RY5A 1KIUA 4LP4A 1A7RL 1YMMA 4ELKA 1BQUA 1EEYB 2E7MA 4TUOB 1M7DB 4DZ8B 2Z4QA 3O3AB 4OF3A 2DQEH 4WWKD 1MI5E 5C0IA 2ESVD 1UFUA 4JGMA 1L9NA 4OZGA 3C5JA 3SE9H 5CEYA 4QHMA 3ZE1F 4JN2B 4EOWL 4F7TA 2QJDA 1BVZA 4HUUA 3VXUE 3QHFH 1KCSL 3SE3A 4XCCH 3SKOB 4GLRH 1CLYL 1UJTA 5BJTB 1JF1B 3KPRD 5E5MB 2ZUSA 2BZDA 3ARRA 3IXTA 5JW4N 4HXAL 5EDXA 3IRPX 1XGYH 5I71B 4GKZA 4JPVH 3UC0H 1MFDL 4RFNC 4QO1A 4LSRL 2F9BT 1EEZA 4YBHA 4NQEE 4I3RL 3LMJH 1XGPA 3SHSA 1I8IB 1GGCL 2DTMH 3G9AB 5ALCL 4AIXA 4C83A 1G6RB 1KELH 4PREB 4HPYH 4RISH 3DGCR 8CGTA 5D7IA 4DUVA 5E1HB 3LQAH 1NFKA 5SX5H 1GGIL 5BOPA 3MRFA 4NQDB 4MS8C 5CGYC 1LNUB 4PGZA 3AB0B 2NLJB 2J88H 5FB8A 3ZT6A 1TVBB 3P2TA 3P9LA 2EE9A 4LLYB 2R0ZH 4WI7A 4XP4H 3U2SA 3CSYA 1WWBX 3O2WH 3QEUB 4P3CH 1QO3A 2PO6D 4FFYL 3EIFA 4JN1L 4LNRA 4S1QH 3V4PH 1UXSA 4R4BA 3VFRA 4LCWE 1FRGL 5DZLA 5IVZB 3EUUA 4IMLB 5ANME 5EZJB 3QIBA 2NY3D 2EDLA 2R1YB 5TQ2H 2Y25A 3TT3H 5F88B 5GGUA 1XCTA 5ID1B 3G08B 2EH7L 3IETB 4K07A 3MLUL 2ADFL 3MOAL 3EOAB 2R9HD 2VLME 1Z9LA 5C92A 9CGTA 4QTHA 3PGDA 2WNGA 1MSPA 3C8HA 1AGBB 1A5FH 2R2CA 1AE6L 3EO9H 3RWIB 5GSVA 2G60L 5K9KA 3BPCA 4E41E 4UV4L 1WBYA 3QIWB 2VDML 5GGTA 4WFHE 1A7OL 3T0EA 5E1AB 3DLQR 5TDOB 5TGBB 4R4ND 3KXFE 5CBAA 3MZGB 3JTTB 4GRMB 2XN9A 4G8GA 3QB7C 2HFTA 4JZOA 4LEXL 1N64H 4IEFB 3HI5H 5D6CA 1S7QB 2Z31B 2HH0L 5EOTA 5DD1H 1WZKA 1N26A 5GSRB 2E27L 3JWDH 1ND0A 1OWRM 4PJFB 2IALA 2BSRA 3BAEH 1BEYH 2QR0A 2YMXH 1IGIL 3ZL4H 2ZSWA 4I77L 2DIBA 4OCYH 1PLGL 3QEHB 4N1EA 2XG4A 1N3NB 5LBSH 5B8CC 3DV6A 3NOIA 4MB4A 5I2IB 3BPNB 3VA6A 2X41A 3F12B 3F58L 5EFIB 5C09E 1MHCA 1D5MA 1U36A 3ET9F 2J8OA 4XCNB 5B4MC 3LN9A 5DQDL 1NLBH 5IB3B 1XF5A 5IB4B 1QNZH 4XBGB 1F3DJ 3QUMA 1RJLA 5EOQH 1T04A 2GI7A 5DZOA 4RRPA 3BXNB 5JA8B 3LEVL 4MQ7A 1U8QB 5HDBF 4YBLB 3KYOA 3BZFB 2IH1B 4PY8I 1J0IA 1DQJB 4YC2B 5D5MA 5JUEH 4Z95L 2GTZA 1LE5B 2HFGH 4GO6B 2GCYB 3TBTB 4G43B 4IRSC 5CUSL 5DEFB 2A2QT 2K3TA 3MLSL 4FQ1L 2B4CC 5FYJE 1N7ML 5JW3L 5HHMB 1ACYL 4L8SA 5HVHC 4UQ3A 2OR7A 2VC2L 5DGRA 4FQLH 4RNRB 1RIUL 3DI2B 1A6UH 4Y16A 3CGTA 1U8HB 3K3QA 1BBJA 3I84A 3LS4H 4JFXB 1K2DB 3F7QA 4G6KH 4HIJA 1F4AA 4XP9L 3MUJA 4H25A 1A9EA 1FO0L 3IJSA 1K6QL 1DBKL 1C12B 3ARFB 4EI5D 4XAKD 1J9CT 2NYYD 4ETYA 5HI4C 4L8DA 1DBJH 5BS0E 3W9DB 3SGEI 3C6SA 4UU9A 3GSWA 1JYNA 4QYOB 2YUVA 4L4TD 5DC9B 1V3MA 1AO7B 2YPKA 3HE6A 1RJZB 5I75C 4R96A 2ARJA 3TCLA 4TQEL 3S34L 2WIIA 3L9RA 2J8UF 1RZFH 2JCCA 3OPZH 4OCLC 4MNHB 3MV8E 2J5LB 3RNKB 2N56A 2OTWB 3WO4B 3QG7H 1CD0A 5KSBF 5FKAB 4ORGA 3EDKA 1A7PH 1EGJL 3P0GB 2EH8H 5J3HC 1NL0H 3WNMA 4CVWA 1A14L 2WWKT 1WGOA 1HILA 1PX4A 2UWEB 3PWUB 3UJIL 3AY4C 1KJ2L 4M5ZL 4QF1B 4PJEA 4XP5H 5MEOB 2CR3A 1X4XA 4KTDL 3H9SB 4Y4KA 2X09A 5K59E 3BN9C 3QPXL 1ZK9A 5E8EB 3ZDZF 3PUCA 4JFEB 1XF3B 4KJYA 2YS4A 5BW7C 3QG6B 3TYFA 3WJLA 1MFNA 4LRNH 2VJXA 1CR9L 3G5VA 1KGCD 25C8L 5BV7C 4ZOBA 1QD0A 1W0VA 1ETZB 4BZYA 4OF6A 4XVJL 4LCUB 1C5CL 3NFPA 4WUUE 2VLKE 2YXFA 1A6WL 3CD4A 3GIZH 4JFDD 4X9FA 1A2YB 4NN6C 3P73B 1OTSD 5CWSA 1PD6A 3PQYB 5AYUL 1P6FA 4U1IA 2XXMB 3B8SA 4JPWL 1MWAB 4M7JH 3RL2B 5IKCB 4P5MB 4U2YA 3GJFH 3KPSD 4P2OC 4XPGH 3SJVD 5FA4B 3GI8H 3DMMA 1S9YA 3T04D 2SEBA 4KVNH 4WEUD 3S3JA 3RWFB 1JGDA 3VGFA 1U8NB 2P46B 5SX4I 5I1DB 5I8CA 3RGVD 4CMHC 4RMQA 3WXVH 4XMPL 1QLEL 3J7HA 5GISH 5INCB 4P2RA 4MX7A 3ALXA 3QFJD 3W0WD 4Y4KC 1FYTE 4JM4L 5DJ6B 1MJUH 2F53E 5ENWA 3JTSB 3V6OC 1MVFA 1W0YT 1D5XA 5GGVH 3EGSB 1FFOA 2AABL 3MBEC 2HLFC 2ZWLT 1QSFD 4N0YH 1QRNE 3WJJC 5MP6L 1NAMH 5I1LA 1WTLA 4LGRB 4JHWH 3L6FB 1K4DA 5SWZD 3VGEA 5C3LD 2O61A 4PJHE 4BKLA 2ZUVA 4RGOL 4WFED 3LRHA 3Q1SL 2MSPA 4DVRL 1WBZB 3KPPA 5DSCA 5I0ZA 5H37G 1CXIA 4Y4FB 5MEPB 4F15B 1JMZA 2CIIA 4LCIL 4PYHA 2NR6C 4MXWH 3JUYA 4WDIA 2B5IC 4H8WL 4NJAH 3IGAB 1B0WA 3L95A 5FFLA 2VIRA 4PJ5D 2B1HL 3V6FB 3WN5A 3MO1B 5HGDB 1QPXA 1ZVSB 2F54B 2VLJE 4I8DA 1OGTA 1NLDL 4PY7A 5GIRB 3QI9D 4OZ4A 5EN2A 3ZE1E 3EYFA 4QRUA 4X4YB 1XGUB 2MKWA 2IADB 3QDJA 1AGDB 3QEQE 5CJOL 5EO0A 5HYFA 4PLKD 1CFNB 2BVYA 5IOPA 4Y4HD 4OGYL 2FX8L 1UVQB 2V2XB 2EC9U 1R3KB 4WUKH 1SJEA 5IP4A 4YIQB 2EDKA 4UAOB 2YK1L 3NH7L 4OLUL 2CSPA 5EUOF 3AS1A 3LHPH 4KKBC 5TE6H 4LU5L 5ITBL 4JM2B 1C7SA 2NY4C 4GBXC 5CKAA 5F3BB 2IPTH 2BSSA 3KLAB 3RWHB 1MEXH 1VFUA 5FYLE 5BZWB 3WFEL 1P4IL 2DMKA 4OLEA 3RVVC 4DKFH 3DX6A 1T0NB 3KYMA 4NZRL 4BUHA 1YY9C 4XXDB 4X7FC 3PL6D 4Z77A 3VXMD 5I18L 1R3IH 5ERWB 5GGVY 3U4AA 1YNTB 4HQQH 3TZVB 1I9RL 1CD8A 3OAUH 3QQNA 5HHQB 1IKFH 3BQUC 4HMDA 2QADC 4X7DC 1Z5LB 4WW2A 1YYML 1ERNA 5C08B 5T5NF 4LQ1A 5ECJE 3V5KB 1YNKH 1OGAA 5DHVB 2FZ3B 3RZCD 2QV2A 5C0CE 4QRRA 3PWPD 3ZTNH 1OAQH 1I8KB 2NXYD 3WMSA 1I1FA 4U3XA 1DQTA 2FYYB 1GL4B 5IB2A 5EBGA 4LLQA 5FOBA 3W11D 3UTTD 4XXCC 3BQUD 2P48B 3V4VH 4YXLL 3RNQA 3STZB 1T2XA 1YPZA 1I9IL 3VWKB 1TIUA 3CC5B 4NQCB 3NFNB 3FO1A 4L8BB 3QRGH 4XCEB 1SM3H 4TVSa 4EZMA 4QWWD 3U6RB 1IGYB 3MRIA 4YLQT 3U83A 2C7UB 4QT5B 5I16A 4G7VH 5ELIA 4YHZH 1I4FB 3IKKA 4LMQE 4Y5YB 4HUKB 4RX4D 1FGNL 2R1XB 3ARUA 4M00A 5J0BA 4PTTA 5DC4B 3PDOB 4L3EE 1AGEB 1CK0L 2AJUH 3WNPA 1G7JA 4RFEB 5IR1B 1IEAA 1IRAY 3S6CA 4KVCH 4LRIA 2FH6A 4UUJA 5DJCA 1G9NL 4NZTL 4NFBA 2H32A 1SY6H 4YEEA 2QKIB 1LO0H 1BD2A 1AD0B 2HFFA 4LEOB 1G9EA 1V7ML 5E9DE 4PG9A 3P0YH 3SDDC 2D31A 2FIRT 3LKNB 1NCCL 4JR9H 3LEXA 1UKTA 1Q1JL 2H1PH 5EG6C 1EJOL 3QULA 2CQVA 1A9BA 3HNTH 2CO7B 4JHZA 5CMAA 5AZ2L 1FL5B 2FWOB 1FZJA 4N1HB 5EC2A 5C07D 1I3GL 5JR1L 3QAZB 1AKJB 5JW5A 4LSUL 1QA9A 4FP8L 4HAFA 4CBPA 4NM4L 4WHYH 5HGBB 4OGAC 43C9A 1CXKA 2A6IA 4P23D 1K5NB 1QLRA 3MV9B 2H8PB 5HDBE 4TTDC 3VFTA 1LO2L 4JO2H 1JIBA 1T1YA 4FABH 3T1WA 2IAMB 2A74B 2J6EA 3UP1A 3DVGA 2ORBL 1AH1A 2FB4L 3MA9L 1MI5A 4I0PD 4CAGA 5C6PB 1TVHB 4Q6IA 1AR1C 2ZPKH 4P4KD 2X2YA 4X9GA 4F33A 5I66A 3VXSD 4S1RL 4OB5H 3ZKXB 3NABL 3VXUA 1JMXA 4OFKA 3MGAA 5DMGD 2WM0A 4TTDD 4HWZB 1VFBA 4X6FB 4XCFL 1U6AL 4X7SH 2DL9A 5CEZE 2XOTA 1JHKH 3GMRA 4Y19A 3REVA 4GMTH 2X7LB 3QPQC 4MAYA 1INEL 1RUQH 2HWZL 4IRJC 3O81A 3IFNH 4ONHB 2P8LB 2XPGA 4MCYB 5J6GA 3OKEB 4X6DF 1TTFA 4QLRA 2PNDA 4MJ6B 4IDJH 4NQEA 3FOLB 4M48L 3O6MH 1K9TA 1NCUA 2VXQH 3I9GL 2W9DL 15C8H 3BWUC 5EZLA 3U79A 3GSXA 3BGFB 4PYGA 5E99L 3CVIH 3QHZH 4PP1C 5IQ7L 1G7MB 2BRRL 4JY4A 4LGPB 5D7SH 3BUYA 3JWOH 4BH7B 3Q6GH 3EJZC 4MZ2A 2R4RH 3MRRA 2P5EE 3QPQD 5JDSA 4OKVB 3CFDB 3HRPA 2VLLA 3MRKB 1TPXB 3KPLA 4RWHA 3UTSB 3B9DA 4IDLA 2APWA 4WV1A 5B38A 5SV3A 4KKLC 4UIKH 1SMAA 3V5HA 3GMLB 4N8CH 5D93B 3V8CA 5KSBE 1CE6B 3GK8L 4Q6IC 2VQTA 3NA4A 3NCEB 2VTFA 2D03H 2CKBH 2Z92B 1I1AA 3O3BB 3U4EB 2A1WH 1YEIL 1JHTB 1OW0C 4LCWA 4ZOCA 3T8XB 4HGKC 3D3VB 4NPYA 3H3BC 1GGUA 4RGNC 3F8UB 2PXYC 5HI3D 3LD8B 4HX1A 3BFOA 3ZDZE 5HI5C 4YDJB 2X4SA 3K80A 5JXAH 4YXHH 5I1CL 1UWXK 3DO3A 3I3DA 2Z91A 1TCRA 2FNBA 4TVPH 1RUMH 2D7NA 1CDBA 3VG9B 1A6VH 4MB5A 2DN7A 4PR5A 2WBWB 2AKRA 2WUBL 3BO8B 4TULH 4F9LC 1EFQA 3HC4H 5ICZB 5I30H 4E41A 3QCVL 4W4OA 5F3HB 4M7LT 4FQCH 3MLVL 1IAII 3OKDB 4MLIA 4ZG1A 1SMOA 2BY0A 2X4PA 3RUGA 3QWRD 1CICB 2VZ3A 2BK8A 3HZKA 3BGMB 4GAYB 3W2DL 2B0SL 2D3VA 3PXHA 3DECA 1IM9A 4A6YH 5KW9L 2VABB 3PXJA 3T65A 2OTUB 1QYGL 2HT4D 3O3DB 2I9LA 3BEWA 4HH8A 2V9QA 5HXMA 2KZWA 5TPWL 1KYOK 5HDQH 4QHUB 2KQNA 1FG2B 3KDMB 5DTFA 4D0BB 2DLTA 4GRLB 3OKYA 2AVGA 2BXZA 2X6MA 1N8ZA 4EDWH 3KNBA 1CGTA 1IC1A 4Z5RA 5J1TC 1A7RH 3Q5OA 4H0IA 4U6HA 3NN8A 5I8KL 4PGBA 2ICWJ 4IOIA 5KSVB 1VFAB 1LO5A 2G2RA 1K4CB 1AC0A 4ZQKA 2AK1H 3KLDA 4HZLB 5DHYA 5T1KB 3G5YA 4HF5L 5F7WC 1LP9B 4PV8B 3O2DL 2VDLL 1X4ZA 5C0BD 5J9PA 4EOWH 3BX7C 3I85A 4NO0B 1Q72L 2BVTA 4HT1L 2FJFB 3ZKSD 2R0WL 2E8YA 1KCSH 3RDTA 5EC1A 4M7ZC 1CLYH 3G6DL 1Q38A 4GRWB 5INDA 4GKSA 4NFCA 3LN4B 4YHOL 2RAMA 1UM5H 1QBAA 3BP4B 3EKCA 4HXAH 3DVNB 5DJYB 1HH6A 4NM8L 1MFDH 3TBYB 1FNSL 3GHBL 3ARWA 2W9EL 4LSRH 4R97C 3EFFA 4LFHD 4I3RH 1NGXA 2ICEB 1GGCH