4S0SD

Structure of human pregnane x receptor ligand binding domain with adnectin-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
94
structure length
90
Chain Sequence
DLEVVAATPTSLLISWPPPYYVEGVTVFRITYGETGGNSPVQEFTVPYWTETATISGLKPGVDYTITVYAEMYPGSPWMDIQPISINYRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear receptor subfamily 1 group I member 2
publication title Developing Adnectins That Target SRC Co-Activator Binding to PXR: A Structural Approach toward Understanding Promiscuity of PXR.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 11
structure length 90
sequence length 94
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s0sD00
3JUYA 2VDML 3O6MH 1NEZG 4OCRH 5TE4H 4XPBL 3U7WH 1GGCH 5J56B 1MCRA 3RUGB 1GGBH 1LP9F 3HMXH 1KPUA 5IGXL 4WEBL 1SMAA 3HR6A 1P9MC 1JGDB 5ISZB 3KYMA 2HFFA 3ZDYE 2J6EA 3HFMH 5C8JA 4D8PA 4HJGA 3NFNA 3KXFA 3P4LA 1YYML 4LVHB 2B39A 4NO2B 1UC6A 3L5WA 1XT5A 1CICC 1U6AH 2P42B 1AO7D 3F58L 3C09C 1DCLA 3UBXI 2Z35B 2GYSA 3HZKA 3TVMC 4OFIA 4LCCA 1FFPA 1FGVL 3D3VE 2H1PH 3CLFH 4LKXB 3RPKA 4QXGH 1OSZA 3KPSB 3L6FB 1BBJB 1BD2E 4R90L 3VG9C 5TQ2L 3ISWA 1F90H 5KAQG 3GSWB 4UU9B 5TDNB 3T0WA 2R1WB 4D9LH 1G7IA 3BI9X 4R3SA 2QR0A 3WYRA 1I9JL 4HIHA 4K3HA 1UYWL 4PGDA 4PJBB 1G9NL 1DBAH 1EAPA 2DM7A 1MELA 2P43B 1AIFA 1BFVL 2AXHA 3DYMA 3MNZA 1AI1L 1DBML 5D2LA 3MRHA 4IRJA 4G6MH 5F7HA 3S4SB 3FO9B 2CUIA 1A7RH 5DRNA 2ADGB 4U6YB 3U0PB 3UROR 1AQKH 5D2NE 3U9UA 3CXDL 5DD6B 6CGTA 1QQDB 1P7QB 4HWZA 4ZTPH 2F54A 1MPAL 2N1KA 2DQEH 3TO4B 1C5CL 3THML 1MFAH 1S8DA 4MNQB 2CKBA 3PGFL 4IMLB 2WW8A 1T1YA 4OZ4B 5HI3C 4PG2A 2XV6B 3DUHA 4JFDA 5FDWB 1DANT 4M5YH 3QFJA 1CLCA 4JFFE 5I1CH 4AENA 4XP9L 3PHQB 4HEPG 4HJJL 5DEZA 4GXUM 1YNLL 5I74B 3OR7A 1AY1L 3RQ3A 1RV6X 2UY7A 3MJ7A 3MV8D 1ZLWH 5C71A 1R6VA 3MLVH 3MXVL 4HXAL 4WI5A 43C9A 5GS1A 1S78D 1WEJL 4R8WL 5F96L 3WIFA 4QWWD 4P5TD 2JJSC 2E5EA 4Y1AB 5DFTA 3TYFA 1FYTB 5D1QB 1Y18B 5HHMB 4ESKA 3MUZ1 1BM3H 4XT1C 5E08L 3LN4B 1OTUD 2D0GA 3CMOH 4Z7WE 4PG9A 2Q8BL 4DN4H 5B8CC 4PJIE 2LQRA 4FP8L 1DFBH 3CCHB 1M71B 4JKPL 5DMIH 3L3KB 4RBPK 5TQ0L 4AH2B 5IT2H 1UH2A 1W0VB 3MRMA 4L1DA 4BZ2L 1XH3B 1YEKL 3AU1B 3B2VL 4X0KA 3MJ9L 3BKML 3NFPA 1WBXA 5HI4D 4P9HC 1A9EB 2VIRA 1KCSL 4R7NA 1CD9B 3MLTA 1F3DH 3P0VH 3GI9H 4IJ3B 2R4RL 4JQIL 3VXRA 4I0PB 1FZOB 3MOBH 4HK0A 4X80H 2IPTH 2QQNH 3G08A 1I85A 3NFSH 2OYPA 5AD0A 3FB7B 2PNDA 3A6BL 4R26L 4Z78A 3TLRA 4MJ6B 2FZ3A 4G8GB 4ZS7H 4NRXB 5DD1H 1MY7A 1KC5L 3BIKA 5E0QA 1KXVC 3TBWA 2V7HB 1RAMA 5EFIA 4PUBL 2PW2A 2Q7YA 5CZXD 3SGJA 4LHUG 1EBAA 4Y19D 5CD5D 3SDDD 4Y7MA 4XWOD 1G7QB 1WFTA 3QEQE 1VFAB 4I1NB 5TGBA 3HAEB 2HLAA 5BJTA 1X5FA 3LB6D 3ULVE 5JHDE 4HKXA 3TM6A 5IOPB 1EEUA 2C3VA 3QUYA 1GOHA 2R15A 1F4HA 5ACZB 1AGEA 3W39A 3TA3A 3K4ZA 2YPVH 1A02N 4X6CA 4NN6B 3CZFB 5I18H 3WFBL 1BP3B 3ZE2F 5INDB 4GAYB 1CDCA 4JKWA 3NA9H 5IJVA 4ZO7A 1F8TL 3QDGD 4QTIL 1MH5B 1U8LB 2VO5A 4FMFA 2I27N 5IWLA 5HVHC 5K59F 2HVKA 5IK3B 1FORH 1OAYH 3IETB 3N1MC 2R2EB 5D1ZB 1LO4L 3KWWA 3O2VL 5GS0D 1U8NA 1EZVX 1D3CA 1CQKA 1WC7B 3FB8A 4BUGA 1RHFA 4QWWC 3V0VB 1LDPH 5E8DL 1X7QA 3FT4B 5I71C 1K2DB 3PWNB 4K9EH 3SDXE 4PJEE 2ZSWB 3VFMA 4OIBA 1OTUC 4Y4HA 5A1AA 1ZAGA 2P5EA 5GGTH 5FHAH 4HPYL 3NIDF 1T2XA 2GFBB 5ABDE 2NXZB 1R3JB 4PRHA 2ZUYA 3D39B 4HBQA 1XGTB 3VI3F 2ICWB 3RY6A 4JM2F 3H3BC 5FAAA 4A6YB 3SGKC 2DQHL 3REWB 4LSQH 4WTWA 2VZTA 3I02A 3W9DB 3PQYE 1JWMA 3K1DA 3MR9B 2YR3A 4X9FA 3VRIB 5HI4C 2PO6D 4FXGB 4HHAA 5I1KL 4U3HA 5DQDH 4N0UB 1RURL 2FIRT 2XWJA 4S1QL 1PX4A 5C3LD 3QRGL 4DW2H 2PYEA 2VKWA 4HT1L 2YHGA 5JO5A 1FNSL 5HYEA 3CFCL 4XPGH 1I7RB 2B5IC 5LBSL 4QF1A 2BSTB 4LGSB 2DDQH 4DTGH 1OLLA 3FOLB 4GG6A 1DQLH 3BIAX 1J0ZA 3FB6A 3OKOB 4M3JA 4JZOB 4X6DB 4NP4L 5F8RC 1T4KB 4NUJB 3GO1L 1EEQA 3LN5B 4QRPB 1PW3A 5FYKE 4KKLD 4EVNA 5CZXC 5CD5C 1OF2B 3SDDC 4Y4FD 4XWOC 2VXQH 2YRLA 4M8QA 5J13C 3MRBB 3LB6C 4HBCH 5F7EL 1HINH 4YGAB 4URTB 3LKRB 5GRYA 2F5AH 3KXFE 1CFVH 4S2SB 3U48A 4P48A 5T1KB 5CD3B 5DLML 3BZFA 1N8ZA 1BOGA 1F45A 5AYUH 5EO9A 1ZS8A 4Q6IC 1T22A 1AD9B 2OR9H 4L8CA 3A6OA 5DEFB 1XR8A 3RI5F 4RNRA 4XBGB 1OAXL 3LRHA 4HPOH 3LEYH 5C0RL 5GS0C 5F9WB 1MCOH 2R0LL 3QIBD 4LCUA 1FFRA 5CUSL 4BZ1H 3GMRB 4LPTA 2HKHH 5SV3A 5JR1L 25C8H 3U6RB 1EGJL 2Y06L 1RJCA 4FZEH 4F33B 1A6UL 5D2LE 4NO5B 5LCVL 5JUEH 4WFED 4LP4A 4GAJH 4IHOB 4RFEB 4X6FA 1TQCB 1J8HD 4N1EA 1D6VL 1MCWM 1GAFH 3EDKA 4XP4L 1BQHA 3WSQL 4P4KD 4YBLC 4MVBD 5E9DD 2F54E 1GHFL 3UTTD 3L1OH 4JZJC 3OX8A 4RMRA 4V2CB 2BVYA 1WFNA 5DSCB 5EC1B 3FO1A 2LE9A 3M1BB 4YWGH 1RZFL 5E2TL 2PO6C 4RGNE 5DK2A 2Z8VC 4JFDE 3QFJE 1MHPL 3O0RL 1ZVYA 4J3OC 3ULVH 1I9RH 5C0EA 3FONB 4PY7B 2VISB 4V1DB 1WTGT 1CD1A 1UB5B 2LFGA 4S1RH 4FN0A 2BZDA 2RCSH 3GSUA 1FZMB 3MCLL 3TJHD 4L3EB 5I1EL 4QTHA 5F97E 1BVLA 4RCAA 3VGFA 1ZT7B 2FEDD 1Z9OA 1A1OB 1G9ML 3VXMB 1MF2L 2OI9B 4M43H 3HA0A 5HYSB 1R24B 2BFVH 5ISZD 1LO5A 1LGVA 5EU6A 5DDHB 3OPZL 4M62H 4M02A 4G3YL 4WJ5B 3DX6A 1CFTB 1WZLA 4UDUB 5MP6L 2IAMA 3U9PL 3BSZL 4ZYKB 1HQRA 3D5OF 4KJYA 2HVJA 2P49B 3LSOA 3HZMA 2ICEB 1BIIB 1G6RL 4U6HB 1RJYB 1YNKL 3F7YB 3KLAA 4PJCB 3MLRH 4C54A 4NQXB 4J8RA 2PCPB 3VFOA 5JMOC 5JOFA 1IKFH 1UCTA 2JJTC 2V5YA 3KPSD 4E5XB 4PB9L 4QY8A 3RPIB 1DQDL 3QDJD 4ZAKB 2X1PA 3VXRE 1HOCB 3RZWA 4LDEB 1QRNA 4LRIA 2RJMA 3LD8C 5BZWB 3MRIA 3R1GH 1OCWL 5I30L 3OR6B 3QIBC 4KY1L 4LBEB 1NCBL 3ARGA 8CGTA 1S7WB 2FX9L 3KYAA 3OG6B 3LHPH 1FNGA 4WV1B 2AK1L 1K9TA 1S7XA 3IFNL 4ELMA 4Y4KA 4K7PY 4G6AD 1URLA 3ZYOA 3MRDA 4D0CA 3BRGC 4NQSB 3OJ2C 2P47B 5EBLB 1L9MA 4M1DL 4OCYH 2Q87A 4P46A 1FQ9C 1S7UB 2OQJA 4Y8DC 6FABL 1P7QD 4XC1H 1DUYA 3VXPA 1H0DB 5GS2D 1MRDL 4P4KC 4POZD 4RMSA 4YDIH 5HHOA 4MVBC 4U1JA 1ZA6B 5FYKH 3MCKA 1E4WL 3TO4D 3DWTA 3GSRB 1XAUA 4MNQD 2X4RB 1MHEB 1JRHH 1GGIL 3MA9L 5D1XD 2A2QT 4M6OL 1UM6L 3G6JF 1CFNA 4X6CE 4TSBH 5HHPB 3P40A 4KKBD 2DRUA 5C7XH 4YIQB 1K4DB 4M7LH 2DQCL 1NFDA 2DIJA 2V5MA 5IB5B 3RRQA 5I2IB 1UACH 5KVFL 2VL5B 3NPSC 4U1MA 5EUOA 2L4OA 1ERNA 2BDNL 1N0XL 1YDPB 1YEFH 3TJHC 4L4VA 5LGJA 4HUUB 1FCGA 3SO3C 3GZKA 2NPLX 4P57B 1YN6A 2P24B 4YFLI 2GK0B 1XZ0B 3DX9A 5FA3B 2IF7A 3PV7A 2HJFA 4Y1AD 1FYTD 1D6EB 4M6ML 5D1QD 1D9KC 3UDWC 3VJ6A 2ADIA 2FEDC 1OARH 2VLRA 5HHMD 1T1WA 3IJHB 5D93B 1GGYA 5H94A 4RFOL 4DGIH 4WW1A 2P5EE 3MFFA 3GHEH 2BNRD 4XVUD 4PRHE 3O11B 1HIMH 4W6YB 3S36L 2VTFA 4RMWA 1FNAA 4X4YA 5C0CB 3MRLA 2L7JA 1T0NA 4K94L 2LAGB 3SDCD 3QNYA 1JTOA 1FVEB 4LVHC 4Y5YB 2HTKD 4MA3B 3IXTA 4L9DA 3DETD 3RAJH 5AG9A 1FDLH 5EA0H 3LS5L 4NO0A 5E94B 3V4PH 4P4RB 1AD0B 3TV3H 2OZ4A 4Y16B 3IYLW 1HHIB 3UTQB 1MCDA 1UXWA 1ZSDA 4O51A 1AKJD 2JELL 4M6NL 4WI9A 1IGCH 5IB4A 1JJUA 2PYEE 4G9FA 4L8DB 3EDFA 4I0PD 4Q74A 2B1AL 5M95B 2W0PA 3K2UL 2Y25A 2CKBH 2ICCA 1A64A 4OZHA 1MJ7L 1YEHH 3EYFA 3V6OA 4ONGH 1E6JL 3BH9A 4JO2L 2AK4A 4GG6E 3EFFA 4G8GD 2CO7B 4NQEA 3WMSA 3AM8C 3VFUB 1P53A 4D0DA 1FNEA 4RWYH 4JHBA 4G6AC 3MODL 2V7NB 4WRLA 1A6WL 2RFXB 3WFEL 2XKUA 4OAWA 2Q86B 4KMTL 1KJ2A 2WM0A 5FCUL 3QCVL 5BOPA 4I3RL 5E03A 3ZTNH 2YBRA 2X4TA 4POZC 1PAMA 3BZ4B 1I8MB 3MUGA 3LRSA 3TO4C 5C0GA 3WLBB 3VRJA 5D1XC 4YDLB 2FL5A 3SE9H 1KIPA 2I9LA 1KN4L 1CLZL 3SKUD 3PWUA 4KKBC 4S1DC 4LLUB 3PG2A 3LCYA 3V2AR 5GGVH 4Y5VA 3RTQB 5E5MB 2A6IA 2AKRB 4OD2B 5JOPE 5I74C 5JPMA 3UTOA 2DICA 1RIHH 4J2XA 1JF5A 3L5IA 5D1ZD 5ESVB 4PYGA 4IOIA 1ZEAH 1C1EL 4XVSH 3BQUC 4I77H 4NBZB 2V2XA 2IBZY 1CF8L 4MZ2A 3TZVB 3BJLA 3HPLB 5F89A 1J1OH 5D1QC 4H88H 4HKZB 5F3BB 4XNQB 3B9AA 4JN1L 4QKXB 4MD5B 3D0LA 3B6SA 5F7DB 5AZEL 3EO0B 3O45A 4PJ9A 4KTEH 5I76B 3VXSA 4XVUC 4ZUTA 1JHTB 5HGAB 4KAQL 3V5KA 3WUWB 5L7XL 4AK1A 4X5XB 3I6KB 1K5NB 5DJCA 1IGTB 5JLZA 3TFKD 3SDCC 4GRLA 3MV7B 3SQOL 3DETC 5GSRB 2IQ9L 5C0ND 3FOMA 2DI9A 3K8MA 4PJ5A 5LGHL 3K8LA 3QH3A 1RZ7H 3BP5B 3DV6B 4XMKH 5FF6A 3JV4A 4NJ9H 5F1KC 5DJAA 5HPMB 4XHJD 1FL5B 2EYSB 1UKSA 3QI9B 2Y23A 4I0PC 2MCG1 4OGYH 3KAAA 1RMFH 2PR4L 2R69L 1JPSH 3KHOA 3QPXH 4W70A 4YPGB 1TPXB 3DIFB 4C56A 1J11A 4XNMB 1U95A 2VSDA 1EMTH 5FO9A 3C87A 5CZVH 5D96B 2HWZH 1NMAL 1CL7H 4L9LB 4XCFH 4GOSA 5DQJB 1RHHB 5HI5D 3CSPA 2IH1B 4I4WA 5GRWA 4RAVB 2YXFA 1GJIA 3VFGH 4ACPA 4NZJA 5EU6E 1MHCA 2Q8AH 2N56A 4AIOA 2HRPH 4L3CA 1SBSH 3B9KA 1N5AB 1A3RL 2PXYD 4PJAA 4UINL 3QEGH 3RWIA 1OQOA 1XR9B 3QA3B 2RIKA 5J4MA 4NN6C 5ESAB 2C1OA 5FA4B 5T1KD 1E27B 4WUUB 4KUCD 3Q48A 1FJ1A 5DTFA 1IC7L 4Z8FL 5ACMA 1EO7A 5AG8A 3MNVA 1MJ8L 1HK6A 2CLVA 2E7BA 1HH9B 1QYGH 1OP3H 4OZIB 3BYYA 4GBXA 4F7EB 1JPGA 2OSLB 3VH8A 3FMGH 1QRNE 2XXMB 5F1OB 3FRUB 4FXKA 3TNMB 2ERJB 2J4WL 4PGJA 4AM0B 1RULH 1NSNH 2CDEA 3WNLA 3T0XA 4ELKA 3FQUA 4ELME 3CUPA 5FOJA 1UJTA 5CILL 3I3EA 1YYLH 4N90D 2A6DB 3WD5L 4Y2DB 3FCTB 2D03H 5C3TA 4WHTA 4LVOB 1KJ3L 1JRHI 3QBTB 2ILLA 2DQTL 1QBMH 3L5JA 1E28A 2XPGA 5HHOE 3OL2A 2C3HA 5DHVB 4ZPTB 3DI3B 3GJEB 4NRZB 3TFKC 3PJSB 3O3BB 1LP9B 5D7JB 5C0NC 3I6LE 2AQ1A 2CRIA 2DF3A 2F74B 2W07A 5EU4B 1PZ5B 2J8UA 3TBTA 5JW3L 4V1DD 4WHYH 2DQUL 1AGCA 1RUPH 1FBIH 1M6OA 1NFDE 3GMPB 3WO3B 1K8IA 4F2MB 5EUOE 1NFIB 3GDBA 1YEIH 4JFOB 4O2FA 5F9JA 4H26A 2R2HB 3O81A 2BOBA 4L3ED 4L4VE 4KMQA 3MLPA 2HKFH 3T1FA 1L0YA 4N0FA 2MHAA 3PIQB 4GRWE 1UWXH 3V95A 4GMTH 4C58B 3DX8A 1CD0A 2QSQA 4F37F 3TNNB 2VLRE 5EOQL 3VXMD 4WCYL 4KJPD 5HI5C 5DS8B 4OLYL 4OQTA 5H2BA 1NCNA 1IVLA 3LKNA 4V2BA 1SVZA 1ZLUH 5AWNH 5C70A 3BFOA 4PY8I 2CRYA 1N7MH 2PXYC 4QRUB 2IG2L 5IHBA 2GJ6B 1MCEA 4KV5F 4NQTA 2BK8A 5FGCB 3QO1A 1F3DJ 3OKMA 2OBGA 1J87A 3QG7L 2BC4A 4I18C 2IANA 4NCDA 5IB2B 4ETYA 4Y5XA 4JFXA 4D9RE 4YQXH 2V5SA 2NY6B 2NY7L 1IGIH 1U58B 1ZHLB 2EC9U 3F8UB 4UOW0 3AY4C 4ZAKD 1J7VR 3VI4E 4G9FE 3BP7B 1ITCA 1OPGL 1U41A 4RAUA 4X6EA 8FABA 1KTDB 1UVQA 5F9WC 5E4EB 3V9FA 2XN9B 4K07A 1FZKB 2AQ2A 3MV11 4OZHE 3GNML 4ZUVA 3V6OE 4HXBH 3GGWA 2PF6A 1JWSA 1PYWA 2AK4E 2EDJA 4K2UH 1IFHH 1C08B 3EIFA 1KB5L 4NQEE 2UV3A 3HNVL 4LSVL 3QULB 4OV6F 3LPWA 1U8OB 3IKCA 5D7IF 5DWUH 1CCZA 1A47A 3KGRA 1RUAH 4U05A 1TQCC 4WFHD 5CHNB 5GGQL 1IC4L 1P7KB 3HNSL 5GGRY 1OAZH 4LKCB 1P9MA 2VLMD 4UQ2A 3VD7A 1JFQL 5EZLB 2CLRB 1NLDH 1BQUA 1J1PH 1LO3H 1T21B 5CEZL 5C09A 4ZNCD 3DTXA 1LD9A 5I1HH 1JNHA 3CPLA 4DKFH 2EE3A 3S98A 2BJMH 4XH2A 1CICA 4LSPH 4PRIA 1A9BB 2KZ1B 4TRPH 3RNQB 5GJSL 5JW5B 3TVMA 2XKNA 3QG6A 4I3GA 3ZDYF 3NPZB 1A6TB 4CVZB 3GSVA 32C2A 3STZA 2KZWA 1U8JB 5DJ6A 5K9QI 5E2VH 3AS3A 1QRKA 3IDMB 1M7XA 4FFVD 1JZ6A 2YXMA 1IKNC 2VLJA 2D7TH 3WJLC 5KW9L 1JGLL 1INQB 1Z5LB 5J11C 1YQVH 4UB0H 5FGBC 4ORZC 4KJPC 5ENWB 5JDSA 2OI9C 4YFLF 3O4OB 4E41A 3CVIH 3OAYK 4NC1C 4OLWH 3PP4H 4GKSA 1KBGH 4K8RH 4IDJL 5DVKA 2UUDH 4YHPB 1KG0B 1T7VA 3CVHA 5TDPB 3PUCA 5I17A 1G7JB 4LLYB 1DLFL 3VXSE 3SCMC 1WBZB 4JR9H 1YEEH 1DBKL 3MNWA 4FRWA 1XGUA 2X5PA 1GPOH 2BSRA 5C0CD 5C07A 1IC5H 3NN8B 3TYGH 3RA7H 2FX7L 3PV6B 1ZVHA 3X3GL 3P4OA 2EDOA 5C6PB 1T3FA 15C8L 4OIIH 3HCVB 3RIAK 3PHOB 4ODTL 4PJ5E 1FL6A 4Y16D 5F7FA 1S7RB 3LVEA 1MRFH 4JHWL 4Q9RH 4LARH 3F7PC 4M48L 3BEWB 3W82A 4ZSOB 1FFQA 2EDDA 4ZAKC 3QUKB 4EBQL 4FQQB 4JKMA 4MLIA 2X9XA 2XZQH 4JRYD 1CL7I 4R4BB 3MUY1 1A3LH 4NM8L 4C56E 3L3GA 2A9NH 2E8ZA 3MBEC 4PP1D 5HYJE 1EEYB 3MRKB 1RVFH 2JJSA 4WV1C 3BOVA 4XNUH 5EIIA 2AI0H 3OF6D 4DVRH 4AT6B 1YY8A 2H9GB 3VDCA 2ZOKA 4K7PL 1CE6B 5IHLB 2DQIL 1WAAA 2YOCA 2H45A 4F7TB 1U93A 5B8CA 2OK0L 2X9WA 1MEXL 5ALCL 1TETH 4XI5C 2B2XL 4HUXB 4NHUA 1DBBH 2CKNA 2EH8H 2IPKB 4PJAE 4JRWA 1RZKH 2HJKB 3MACL 4Z7WF 5B38G 3SDYL 3IJSB 1SVCP 3HLAA 4LPVA 1LK2A 3IDXL 3U46B 5CSZA 1UGNA 4JM2B 2YA2A 3O6LH 3BPCA 1AO7A 2EDWA 3F5WB 3RTQD 1PSKH 4JKKA 2XRAH 4HCRL 2P1YA 4HUNB 1F4YL 1QKZL 2DJSA 4KROB 3UZQA 2BRQA 2QQLH 3NCCB 1IM3A 4LSTL 4DQOH 1P4BL 1EZVY 4XPTH 2W9EH 4G43A 5H8DA 1J18A 2OXHA 5HVWA 1AFVL 4ZUUB 1U0QA 4P2CG 5HHQB 3I6GA 5BXFA 3QUML 1C16B 4HF5L 4XHQA 3MLSH 2P4AB 1CZ8L 2AAVA 3W0WB 4FFVC 2WK2A 1G9EA 5E5UB 2X4SA 5CEXA 5HGDA 4E0RA 2R23A 4U1LA 2XG4A 3ARXA 1WJ3A 4RA3A 5F7KC 5D93C 4ONFL 2IEPA 3MGTB 5DFVD 3VRLE 4PLOB 2C1PB 2MTPA 1G1YA 2Y72A 5F7YC 2QKIA 1CT8A 1FPTL 2NNAB 3QUXB 1EA9C 2ZCLH 3GRWA 2BVEA 1PX3A 4NZRL 4XWGH 5DRWA 3CDYA 1JUFB 2X4QB 3RX7A 1A2YA 4JN2B 2FNBA 3RHWF 1OP5H 3RKPA 3CFJB 4YXHL 2J88H 2X4NA 4KWUA 5DMKA 2XTJB 2DB8A 5D6CA 1KJ2H 3QWOB 4Y16C 1J05A 2F15A 1A14L 2J8UE 5J12B 2V5RA 3FO2B 5CJOL 1IAOA 1U3HD 1DVFB 3DECA 1HI6B 3ULVF 2F5BH 3QI9D 4MA7L 3GBMH 4U6XB 1JPTH 1KELH 2X4UA 1TTFA 5BVPL 3O6FB 4OB5L 3DURA 3MV8A 3OKNB 4PJ8D 3I75A 5JORA 4R96B 5DMJB 3HS0B 2X4PB 2GY5A 5B39G 3MREB 4I48A 3TN0C 1A4JB 2JIXB 2C4XA 2EECA 4PP1C 1JGVH 4P5TA 5FOBA 5EOTB 4JZNA 5E8OB 3DGGB 3AMLA 2IALA 5HHXH 1U8MB 1KOAA 1ONQA 4QRRB 1W0YT 1QFUH 1LEIB 3FAXA 1JE6A 4DCQB 3B83A 4R2GB 5CBEA 1RU9L 3LQAH 4PP2A 4YZFE 2VC2H 4GT7A 1LWRA 4DFIA 5HSFA 2AJZB 2MPAH 5T1MB 5FK9B 1KIRB 2HFEA 2GQHA 3VE0B 4OD1H 3P77A 4MAYB 3SGKA 2MOVA 1OT2A 5BV7L 1I75A 1QFHA 3G5XA 4M7JH 4WUUD 4NM4H 1R0AH 1KNOA 3QCUH 4X9HA 5K9OB 3ESVF 2IANE 2N7AA 5FXCH 3RTQC 5BRZB 2QQKH 2YSSA 2VOTA 1KB5B 3QYCA 5CINH 1F02I 4J3TA 4IEFB 5ITFA 3VXQA 3C8DA 3C5SA 3P4MA 1B0WA 3ECBA 5E00A 3HC0A 3T04D 3O8XB 5IQ9B 1OGTB 4OUUA 1QUNA 4YHLL 3BKJL 5E6YA 4XPAL 5TE7L 3QNXB 1OP3K 1HXYA 4P3DA 4HS8L 1MREL 2ZUUA 5D71L 3NZHL 3JSSA 5JIHA 2BP3A 4NKOA 3SGEH 5I1LB 5I1IL 4XAKD 4JVPA 5DFVC 4JRXB 2EYRA 3DROA 5GGUB 2K1MA 3H3PH 2ITCA 1NDGA 1LO2L 5GRJH 1P4LB 4Y2DD 5E24E 2AEPL 3D69B 4Y19A 3SDDA 3AS0A 4W68A 1Y0LB 2ARJQ 3S34H 3KLDA 1RJLA 3TWCH 1ETZA 5L88H 2QSCH 1IL1A 1KPRB 2OJZH 3L3DB 1MIML 2GTZB 5C09E 1W72A 1OM3H 1NCCH 4TULL 3HG1B 5D7JD 1JGUL 2BVOB 4UNUA 4P3CL 4GRMB 3D85B 4PRDA 4EOWL 4PREA 3H7BB 1J5OL 2XFXB 4PJ7F 1FFOA 2F9BT 4PRIE 3S97C 2W92A 4Q6IA 1CU4H 4RMVA 2I60L 1U3HC 3QI9C 4PRAB 3O6ML 2NY5H 2AV7A 4F7MB 1G9MC 4AQOA 5TE4L 3U7WL 1GGCL 3WHXB 2Z4QA 1GGBL 3HMXL 4PJ8C 1TPXC 1SJEA 5T1LB 3E8UH 1KGCD 4KH2A 2AXFA 3HFML 4YR6A 5L2JB 3DVFA 4HC1L 5D96C 2VLJE 3V5DB 4PTUB 3ZMRA 4MSWB 3UBXB 3GMQB 3K1KC 3MV9B 4L9LC 1YPZA 4X8JA 3T09A 1ND0A 5KVDH 2X6MA 4MX7B 5E2UH 1XGYH 2ENYA 1BVZA 1UWXK 3RWCA 1U6AL 1C5DB 5A43C 2ARJA 4E41E 4CVXA 4QO1A 3G04A 4NT6B 2H1PL 3CLFL 3TIDB 3GJFH 4QXGL 1EX0A 2EC8A 2FSEA 5IB1B 4X9IA 5FKPA 2ID5A 4X99B 2GJ6D 2A74A 3C60B 1F90L 2L0DA 5C07E 1WISA 3QQ3B 4H25B 4JZJA 4P23B 5D2LF 1ZLUK 3BP6A 1BIHA 5ESQA 5ADPH 4ERSL 1BWWA 1DBAL 3WNNA 3L5HA 3ARTA 2PO6A 1QP1A 3OKDB 1IGYA 2NY6D 5IMLB 1QBLH 3IJYA 2B1HH 4ISVA 3PGDA 4FQXB 5FYJE 4G6ML 1A7RL 2QHRH 4JLRA 3VCLB 1AQKL 2YC1B 2ERJC 1UCBH 1ZHKA 2FIKB 4XRCB 5IB3A 4ZTPL 1KCKA 4NRYB 3TBVA 3IRPX 3BDYH 3BYTA 1SEQH 1PBYA 2OJEB 2DQEL 2C3GA 3KYOB 1S7TA 5IBTH 1MFAL 1F11B 1SYSB 1V7MH 5EG6C 4P2YA 3IFPA 4GKNA 4CMMB 1MFCH 4OM0H 4M5YL 3HB3C 1B90A 1WAAE 4WVRA 1ZHBB 5I1CL 5FO7A 3P9LB 3V6FA 3E6FA 4TUJA 4ZFFA 4NBXB 3HKFA 4MQTB 2EDLA 1FG2B 3O2DA 5KOVC 1CFSA 2VLKB 3TT1H 4LVNB 3MLVL 4MXQD 1M7DB 3IDUA 3UPCA 4YLQT 1OAQH 1JTTA 2A73A 5D7JC 3AB0C 4ORGA 4OQTH 3N06B 4WW2B 5C0FA 3S96A 3QUMB 4U1HB 2IMNA 1AO7E 2Q20A 2FHFA 2DD8H 3RWEA 4EUPG 1BM3L 2Y5EA 4HUWB 2JJTA 3DX7B 4Z7OF 5IBLC 1OTSD 1OVZA 1X5AA 4DN4L 1NAKH 2F53B 3JWOC 1ZANH 4I3SH 5EU5B 2P8MB 4HUVA 1DFBL 5IEHA 3E6HA 1NGWB 5DMIL 1CVSC 3QIBA 2FGZA 4W4OA 1I7UB 3WIHL 5IT2L 4U1KB 2D7NA 4OGAD 4XBEH 3WNPA 1BZ7A 5FB8B 2BHYA 2GCYB 4K94C 1R3KB 2HLFD 4EKXA 1QSFD 2BNQB 4IDLA 2BERA 3NCJH 1WGOA 4W81A 5DK3A 1KJVB 3S88H 3LPFA 3ARYA 5FFLA 3P0VL 3GI9L 1E4KC 4N0CD 4P4KA 4U1IB 5E9DA 3MOBL 2DTSA 4X80L 3UTTA 2UUDK 2EXWD 5I15H 2IPTL 4E42B 2QQNL 2DM2A 2DTMH 3MLYH 3EGSB 3NFSL 4MCYB 4N0YH 4OIAA 5T3ZD 5EU7C 5CSGA 3D2UD 4JG1H 1TCRA 2Z31B 3MJGX 1C7TA 4ZS7L 3U4BH 2NY6C 4HS3A 5DD1L 3UTZA 2B0SH 1LILA 1QSVA 4JAMB 1UA6H 4LK4A 3MXWH 3PWLA 4NGHH 3QCTH 1D5XA 3MV8E 5CGMA 4X6CF 3EOAB 1VSCA 2R0KH 4JPIA 1BBDH 4N5ED 1GGTA 1JYNA 4QHLB 4LDLB 1IQWH 3SKMA 2WLYA 5KSVB 2RBLA 4OFYA 3ILPA 3L7EA 1D9KA 2QJDA 4UOW1 3UDWA 4XPHH 3V5HB 3ARQA 2C4FT 2YPVL 3W9EA 5I18L 4BSVA 1H3PH 1WITA 5BV7B 2GT9B 3DGCR 5AUMA 3HZVB 2R1XB 2EEDA 4QRSB 1JGDA 5EB9A 3SDAB 1U8KB 3B3IA 1FORL 1OAYL 3CDGA 3EYUH 4MXQC 1U3YA 1E4XL 1UWEH 5IKCB 3U2SB 4Q2ZB 5DF0A 5DJ2B 1PGRB 4TUOB 4NO2A 4HAFA 1LDPL 3LEVH 3TPUB 4IIQB 5HJ3B 2Z35A 3CVHH 3QDHA 3UYRH 1KJMB 3QEUB 4K9EL 1FIEA 1HSAB 3TCXA 3U7AA 2BY1A 4EJ1C 4LKXA 4KROD 3UBXG 1N26A 3KPSA 3W9EB 3L6FA 1BBJA 1S9XA 4RZCB 3S35H 3PXJA 3QDJA 2B4CC 1G7LB 5IMMB 4AEFA 3GSWA 5TDNA 1N5YH 2R1WA 3SGEI 3W0WD 4PLNC 2IBGA 3EDJA 2ZUQB 2Y6SD 5GZOC 4PJBA 4E9LA 4NN5C 4LSQL 2X41A 4OGAC 3QPQD 5BW7C 4NKDB 3AM8A 4JJHA 4LCWB 3WJJC 1BFOB 1H15B 5DGQA 4XAWH 1KEGH 2DMCA 4OZFG 5E6IB 2HLFC 1AGBA 1A4KB 4HLZH 1ORQA 3S4SA 2ZOLB 3FO9A 5DQDL 2OMNA 2FH6A 2Z93B 4U6YA 3WFHB 4Y19E 3U0PA 2XIDA 3JWDC 1Q9KA 3BUYB 4DW2L 3LQMA 4XMLH 5DD6A 5C86A 4PTTA 1GZQB 1P7QA 1QQDA 4F7CB 4NFDA 3T3PE 1EUTA 4N0CC 2VABB 4RGMB 4XPGL 2GK2A 4ZOBA 2YRZA 2EXWC 3TO4A 4KHTH 1RSFA 2W9DH 4MNQA 2DDQL 2XTJD 5D1XA 4IMLA 5FGRA 5HPOA 4OZ4A 3PGCB 3TO2B 1DQLL 4F58H 3MV01 5FDWA 4H1LG 5J06A 3GK8H 1RUQH 1LNUB 3PHQA 4Z76A 1XGQB 3BMWA 2VZ3A 2X09A 5LGKA 3O6FD 5DZNA 3U30C 2VXQL 4YC2B 3OJDB 2JIXD 4WFFD 4P9HH 4OKVB 4N5EC 4HBCL 2FR4B 3BXNB 1I1FA 1BOYA 2D9QB 1HINL 4Y1AA 3QIWC 5KVGL 1FYTA 2F5AL 5D1QA 2EDTA 1Y18A 2ZJSH 4BQ8A 1QBBA 1CFVL 4QRRD 1KF9B 3K8KA 1TENA 1KB9K 2KQNA 3V6ZB 5DYOB 5AYUL 5BQ7B 1JL8A 4ZXBB 5I16A 4P2RB 5C08B 1ZT4B 5EBMB 2OR9L 2BNRA 3C8HA 1MFBH 4KMLB 1PKOA 4MAYD 4AH2A 4OCNC 4HPOL 1M4KA 1W0VA 1ZA3A 4CVWA 3L9RB 4QXTB 1MCOL 3SDCA 3AU1A 5BRZD 1A9EA 3BPNC 1KXQE 4BZ1L 5B3JE 4JDZB 2EYTA 2HKHL 3DO3A 4WY7H 4G7VH 25C8L 5E8NA 3GRWH 4JY5H 4NKIH 1KIQB 3MLXH 4FZEL 4LAJH 4M7LT 1H5BC 1AKJA 1X5KA 4XGZA 5JUEL 3DO7B 2A83B 4GAJL 4I0PA 1FZOA 1Z0NA 4ZD3H 2QV2A 2OLDA 1IGMH 1S5HB 3O8XD 3VWJD 1GAFL 4GQ9L 4DKEH 2K7PA 1ADQH 3FB7A 4FQ2H 4X5LA 5TF0A 3RGVB 4UT9H 4Z95H 4L4JA 4DGYL 3QPQC 4G8GA 4GKZB 2YPKB 4YWGL 3HMWH 3REVB 1JF1B 1SY6A 4LL9A 1U3JA 3SHSA 3ULVL 1G7QA 1I9RL 2QADB 1EJ6A 4QOKB 1E4JA 2CPCA 1PKQA 1VFAA 3HAEA 4O2EA 2OXGA 4S1RL 5ERWB 2RCSL 5IOPA 3HG1D 5DJYB 3EKCA 1NCWH 5GSVB 2XTJC 3CZFA 1QFWI 3D85D 3L3IB 1IM9B 5D7SL 4AJ0A 3CSGA 3QXTA 4CW1B 5INDA 5J12C 5J9PB 4BQCA 2DL2A 3HC3H 2WINB 3X13B 1MH5A 5KS9A 3CFIC 5IK3A 3O6FC 1HKLH 4M43L 2PW1B 5DA0B 1QSEB 4L8BB 5T1LD 4RGNC 3WFZA 2BFVL 3VW3H 2CH8A 1BQLH 5I6XB 4M62L 4WIQA 3HZYB 4MDIB 1WC7A 4MJ2A 1HILB 3V0VA 1UB6B 1RIUH 4CU7A 3FT4A 3LQZA 4WUKH 4TVPD 3MV9D 2FB4H 1ITBB 1K2DA 1I9EA 3PWNA 3DV4B 2ZSWA 4R7DB 1Q0XH 1IAIM 3MLRL 2MNUA 3NTCL 1N0LA 3EOYG 1YEDA 4WFEE 1IKFL 3T4AA 3B9VA 2GFBA 3BGMB 1A6AB 1R3JA 3OTTA 1XGRB 2VDRH 4HG4J 5D7KD 4A6YA 4MAYC 4GW4A 3C60D 4HFWA 2UZYB 3P73A 4MJIB 5E9DE 4P23D 4LSUH 4UDTA 3UTTE 4ELMF 5ILTH 1QR4A 1X5HA 2EH7H 3R1GL 3W9DA 3ZYJA 1KENH 1VDGA 3MR9A 2NY4B 4TNVK 4FXGA 1N59B 4CUCA 4KKCD 3LHPL 3TC9A 3J8F7 1ES0B 2DL9A 4N0UA 3BHBB 4FQXD 1NMCB 3DXAB 5ID1B 4J3XA 1R3IL 1QD0A 1Z3GH 1HHJB 3FN0H 4I8DA 4EI6B 1W72H 4OCYL 4QCIB 3KPQB 5CLTA 4F8QA 1I7RA 5SWZB 2X89D 1XGPB 1KCRH 3VWJC 1RD6A 4XC1L 2BNUB 2GITB 3ROOB 4YDIL 2CIKA 3FOLA 3U0WH 5FYKL 3UTSA 5GGRB 1KCUL 1KTLA 5F1IA 1FZJB 4JZOA 1JRHL 4NQVB 3DHMA 1T4KA 4NUJA 5IEKB 1NFDF 3LN5A 4JPWH 1TJIH 1LE9B 4TSBL 3PF2A 4CADB 5JQHC 1ZLSH 5LVEA 3Q3GB 3Q6FB 1OF2A 5GS0H 5C7XL 3D3VB 1NANH 1Z2KA 1WWBX 1C5BH 1MCHA 1WZMA 1JYXA 3TH3T 4M7LL 2VLKD 1UACL 4N8CH 1IT9H 3LKRA 1YEFL 2PXYA 1UEYA 4XVTH 1GZPB 4U1NB 4MGXA 5I1JH 4S2SA 5I73B 4RA0C 5T1KA 5CD3A 3NMEA 1IQDB 2I9TA 4I18A 1OARL 1LHZA 5JTWA 4YDKH 3OGCB 4YK4C 1AD9A 5GZND 4DGIL 4YDJB 5DEFA 3KPSE 3AY4A 3BPOB 1TQBB 5C92A 3QDJE 3GHEL 5I1AB 5FV1L 5SWQB 4NNYB 4LOUD 1B2WH 5D2NB 1HIML 4RIRA 3G9VA 1GC1C 3UCRA 4PJBE 1I7TB 4LLDB 1PEWA 5C1MB 3GMRA 4JY4B 4M1CD 5I0DA 5D6DC 3F7QA 5F9DC 5DRZB 3RAJL 1FDLL 3E0GA 5EA0L 5J57B 1MWAH 4F33A 4TN9A 1JCKA 1RZGA 2BNQD 3B5HA 1AC0A 4I2XA 4NO5A 4YHKL 4M4RA 3V4PL 2WWMC 2AERT 3TV3L 2R4SH 2OTWA 2DLFH 4HQQH 3GSXA 4OZHF 4OI9A 1IGCL 2ZUTA 4HULB 2VR4A 3C60C 5EO0B 4XP6H 4OI8A 4MXWH 2CKBL 1MCCA 4P23C 2A38A 4Z0BH 3ARBB 2YD5A 3OG4B 4U49A 5EC1A 3M1BA 1TIUA 4MNQE 1L9NA 4G5ZH 3SKJH 2Z31D 4KKCC 3MJ8B 1NBYB 5L2KB 1JNLL 1CGTA 3O2DH 4GW1A 3FONA 4RWYL 4PY7A 3R8QA 1BVKA 4V1DA 4FQXC 4Z7WB 3WNMA 4K3DH 1FZMA 1JNNH 3T2OA 4L3EA 1FC2D 3ZTNL 3VD3A 2DWDB 1XCQB 3KJ4B 5I75B 4RMTA 1IKNA 3WJLA 4X98B 1NH6A 4Y1AE 3RU8H 3FQRA 1IJ9A 1ZT7A 1FYTE 4CN1A 4Z7UB 2YD8A 3D48R 5HBBA 2EE9A 5IJKC 3SE9L 1A1OA 1N64H 5HHME 2A9MH 5FGBA 3VXMA 3F7RA 4LPWA 1T66C 1GCFA 5FECB 5IV2B 3MRFB 1AGFB 4KFZC 3S9DB 5GGVL 4Q58C 3MJ9A 2X40A 5HYSA 1R24A 3QAZC 3RVUD 4F3FB 5DDHA 3Q5YA 2BNRE 3ZSSA 4NOBA 4WJ5A 1HHKB 4LVNC 2R2CA 1HHGB 1CFTA 5ELIA 4UDUA 1ZEAL 1WTLA 4XVSL 4ZYKA 4I77L 1F6AA 5DRXB 4KRPD 2ICEA 1BIIA 2YWZA 4JQVC 4U6HA 4WW2C 5HHNB 1RJYA 4UQ3B 3F7YA 4NQXA 2ED8A 1KFAH 4H88L 4JGMA 2PCPA 5IIEB 4GW5B 3ZKQD 5GZNC 2UWEB 4ZAKA 2IBBA 1HOCA 4KTEL 3TPKA 2VQ1A 3GKWH 5BZWA 3QEQB 4LOUC 1BJMA 2CIIB 3OR6A 1IEAB 2DJ4A 1D5MA 5AEAA 4LCIH 1S7WA 3MBEA 4ZG1A 4M1CC 4Q6YA 3T2NH 4WV1A 3N1QC 4G8GE 3DVIA 3JV5A 1NJ9B 3VFNB 5E6ID 2ARWA 4EXPX 5SX4H 1BAFH 1MRCH 3QQNA 4KPHL 1RZ7L 2BY3A 4XMKL 5EBLA 5GJTH 1S7UA 4RDQF 1PKQE 2O5YH 2XNAB 4OGYL 1BEYH 1RMFL 3LEXB 2J7LA 2OL3A 4UT6H 3QXDB 3VFRB 1JPSL 2FX8H 3QPXL 3GSRA 2X4RA 1MHEA 1INEH 4O2CB 4TQEH 4UBDD 2O5XH 2G2RB 2EDBA 2LTQC 3CU1A 5HHPA 1EMTL 2Z31C 2DWEB 1Y6NR 2HWZL 4WNQB 4XTRD 2MSPA 1CL7L 1CR9H 4KTDH 4XCFL 4YIQA 3C6LB 2Y7QB 3D87B 5KS9E 3FT3B 4LLWB 5IB5A 5I2IA 4LDOB 3C5ZB 1YDPA 3M07A 4HUKB 4KDVA 4XP1H 1Q72H 3VFGL 3SGDH 4QXUH 4Z0XB 2Q8AL 2WP3O 1LO0H 2HRPL 4G8FB 3ME0A 3FB5B 1SBSL 2GK0A 2BHUA 2FO4A 3UYPA 3P9MB 3OZ9H 3QEGL 1QVOA 3DNKA 4D2NA 3SY0B 5JHLH 4H0GA 4JPVH 3IJHA 2VWEC 4WTZG 3ABZA 2IJ0C 2GI7A 3PABB 4KK8D 4B41A 4ZXBD 2P7TB 1EIBA 2DLIA 2EICA 4P2RD 1LMKA 1G7MB 5C08D 4AEEA 4B53A 3RVUC 3PWPB 4P5MB 3O11A 1X5GA 1QYGL 5CP7A 1A1NA 5C0CA 1F6FB 3FMGL 5JW4Q 5JZ7D 1S9WB 3VRLF 3O41B 4KRPC 5FYLH 3EO1B 4IIQC 4IOFC 2J2ZA 5E94A 2FWOB 1ZVSA 1RULL 1NSNL 5E2JA 4P4RA 2ORBH 3OWEA 4Y16A 4N0UE 1DQMH 4DZBB 5GS2H 1XF3B 1YYLL 4X4XB 2OMBA 5B22A 5FUCC 4YHNA 3MLWH 4MA1B 1A22B 5BCAA 2D03L 4PJHF 4PJ7B 5LJYH 4JRYA 2A0LD 3TN0A 1QBML 3KYMB 3RGVD 1DN0A 4ZOCA 4OLVH 5C8JB 2X1QA 3UTSE 2EEBA 1LK3H 3VFUA 1S7VB 3S6CA 3OF6A 5H37H 1NANI 3ULUD 2FATH 4ODHH 5E6IC 1FN4B 3EJZC 2AJXH 2V7NA 4BKLB 4TUKH 1DEEB 2RFXA 3HZKB 3GBNH 1CBVL 2QADD 1FFPB 1RUPL 4BFGA 3GMNB 1FBIL 2DI7A 2YD2A 3ARVA 3ZHKA 4RGMC 2IFFH 3BZ4A 1I8MA 4X7FC 1YEIL 3WLBA 4HV8A 4EEEA 4UBDC 2E6JA 2HKFL 5DMGD 5I0ZA 4G80A 1IM9D 4XCNA 2FH8A 3BP4B 5I9QC 4P46C 5DQ9B 4YZFF 4LLUA 4YHOH 4GMTL 2QSVA 1QR1A 1AIFB 2WWKT 4N68A 4XTRC 1H3UA 1MJUH 3FQXB 3RTQA 5E5MA 1JIBA 3LZFH 4OD2A 2CK2A 3BW9B 2F19H 3RVWC 1DEDA 2Z92B 4XMPH 4YC2C 2ATKB 5DRNB 4ZNEA 4AQ1B 1FHGA 4Y88A 2OTUB 4QRQB 5AWNL 5TDOA 1RK1B 3NCFB 1QBAA 3HPLA 4H8WC 2NY3B 1N7ML 2AABL 2R1YB 4X6BB 5IVXB 4HKZA 3HRPA 3KPPB 5F3BA 4XNQA 1MQ8A 1S8DB 1A21A 5E95B 2WSKA 4KK8C 4S11A 5F7DA 4I2XE 4YQXL 4ZXBC 3EO0A 4FQLL 4N90E 4AENB 5I76A 2VZVA 1IGIL 1GSMA 1JHTA 5HGAA 3JV6A 3C9NB 1EHLH 3OXSB 3WUWA 4R97B 4Z5RA 4HKBA 4MJID 3MJ7B 1K5NA 4D94A 3LRGA 1FNFA 5JZ7C 2AJUH 1U36A 4BYHA 1VPOH 5GSRA 2FGWH 1SY6H 4HXBL 4K7PX 2R0WH 4QHMA 4K2UL 1IFHL 3VXTB 1JP5A 3DV6A 1U9KA 3LDBB 3TYFB 1W2KT 3HAEH 2NR6D 5HPMA 2D2OA 4PJGA 1FL5A 3DXAD 1U3HA 2ADJB 4V1DE 2EYSA 5DWUL 3QI9A 3L3HB 1RUAL 5KG9B 1F58H 5JW4R 4JG0H 1F4AA 5SWZD 1Q0YH 4YPGA 4PJ8A 1OAZL 3DIFA 4L3EE 2A0LC 5EC2B 1HQ4B 2VSCA 2LAAA 3DI2B 2H6PB 2WBKA 4XNMA 5C9JA 5IQ7H 3KNBB 4HEME 4KZEH 4HGMA 1J1PL 1LO3L 2FO1A 2ZUSA 4L9LA 3ULUC 3ZE0F 5DQJA 4XCEA 5I1HL 5ETUB 3VXME 3AAZB 4MZ3A 4DKFL 5HYQA 2BJML 2IH1A 2IMMA 4LSPL 4TRPL 1H3WM 2QADC 3MO1B 4NC1E 2W1NA 3QHTC 5DD5H 2ZWLT 2M26A 4PRNA 1FLRH 3HI6H 3RWDA 5E2VL 3LN9A 1N5AA 1XR9A 3QA3A 3LH2H 5L9DH 5CFHA 2OX5A 2CRMA 5ESAA 5DMGC 3KJ6H 3G08B 5FA4A 4WUUA 2D7TL 4X5WB 5IMKA 3WEXB 1YQVL 2FZ3B 4UB0L 4JFZH 4YFDB 5D4QA 4A6YH 3AC0A 1KUMA 4LASH 3TBWB 3CVIL 1ZOXA 4LNRB 1F97A 1HH9A 4OLWL 4OZIA 1KBGL 4K8RL 1AJ7L 3OXRB 5I6XC 3FRUA 2VITB 2BHZA 3E2HB 3TNMA 4JR9L 1YEEL 5TGBB 4AM0A 1IGJB 3UPRB 4MWFB 5SX4I 2GKIA 1IC5L 2XA3A 1T0MB 3MGOB 2C3VB 3QEHB 3K0WA 3RA7L 2XI9A 2PTUA 2ZCKH 1QSZA 4X6CB 4M03A 4OIIL 2CLZA 2J8HA 3CDFA 3MX0A 4YPJA 1D5IH 4P59H 1MRFL 2YK1H 1FNLA 4Q9RL 1JZ2A 4Y2DA 3FCTA 4LARL 4JCMA 1AXSB 1VFBA 1EH9A 2VLME 4DUVA 4OSUH 2YN5A 4ZPTA 1T6WA 3ARBD 2HH0H 2XZQL 3KWWB 3FRPA 1JF6A 1FRGH 3GJEA 1U8QB 1UJ3C 3PJSA 1A3LL 4NRZA 3BIBX 2APFA 1I8LC 2A9NL 5D7JA 2DBLH 3H9ZA 1GOGA 1WAAF 1RVFL 4HIIB 4WI2A 5T1DH 1CK0H 1FE8H 1X7QB 4XNUL 5L2KD 1PZ5A 2AI0L 4DVRL 5HDBE 3MPCA 4MCZA 1E0OB 1FGVH 2NR6C 1CTNA 1NMCC 3VFMB 3SGDI 4CVUA 2X70B 4MXVE 3ZT5A 4Y4HB 4JJ5A 3GMPA 3OKEB 5ITBH 4F2MA 1NFIA 2GJZB 1NEZB 5TQ2H 4JFOA 3N1GC 2R2HA 1L7IH 2VNCA 4BSWA 3UYOD 1TETL 3BKYH 4PGEB 1KYOK 4RSVA 3PIQA 2MMXA 3H3KA 4JFFA 1UYWH 4NUGH 5JNYB 1DBBL 3GEWB 2EDEA 1RZKL 3SE4C 4L1HA 5INCB 4KZDL 2EE6A 3WLWD 4NIKB 5DS8A 4HKJB 3DYPA 5HVFB 1PSKL 4HHAB 2XRAL 3SJVB 4MAUH 3BT2H 1WT5C 1UKTA 2XWJB 3W11D 2DQGH 3HNTH 1CXKA 1GL4B 2QQLL 2IBZX 4DQOL 1U8HB 4XPTL 3HRZB 4UTBH 2W9EL 1E4KA 2CMRH 4QRUA 3RBGA 3FFCB 2GJ6A 1CDBA 5C0CE 1T89C 4HMEA 4BZYA 4QF1B 3MLSL 5I73C 2HJLA 3QFDB 5KSBF 5SX5H 2XZCH 3ZHLA 2MCPH 5IB2A 1HDMA 1K3IA 1L7TH 5HVGB 1TZIA 3FB6B 1UZ8B 4UV7H 4QEGA 2O93L 1U58A 4ZPVB 4F9PC 1ZHLA 2BY0A 1FO0B 5MHSD 1TQBC 3BP7A 1NLBH 4DOHB 4NNXB 3B9EA 3V0WH 1GYAA 3ALWA 2ZCLL 3SE8H 4JRYE 2CK0H 4XWGL 3MRPA 3VGAB 3ELAT 5BVJB 4BA8A 1CXIA 1C08A 3CNKA 3U83A 2FECL 1QO3B 2J88L 5J6HB 5E08H 3OKLB 4AIXA 4J4PD 1OGAB 5MEND 1N8ZB 1KJ2L 3EOTH 4L3AA 5CHNA 1ZS8B 4CU8A 1DSFH 3MLUH 1P7KA 1MAMH 2F5BL 3GBML 1JPTL 5C0IA 1KELL 2ZSVA 4N1CA 1XR8B 4D0BA 1HCVA 5LXGH 2UYLA 2HMID 4NO3B 3ARBC 3HN3A 4HLJA 1T21A 1G6VK 3E1F1 3OJMB 3STBA 4TSCH 1X3DA 1YEKH 2BXZA 1JGVL 3QT2A 3VG0H 3RNQA 1A9BA 3D1MC 5KJRH 3CFDB 3C6LD 4GO6B 4W4NA 4CVZA 1QFUL 1NGZB 1XF2B 1U8JA 1LQSR 2FJGA 4JQIH 1CS6A 3C5ZD 3LQAL 4RQQB 1HH6B 3CXHK 4ZNEE 2VC2L 4WWKD 3IDMA 5K9QG 5J3HD 2MPAL 3KJ4C 2LV4A 5I75C 3F7VA 3EYVB 4OD1L 1Z5LA 3OMZA 3MRNB 5BW7A 1NAMB 4X8XA 4KXZH 4M7JL 3WJJA 4NM4L 1R0AL 5ENWA 4OM1H 3WLWC 3QCUL 1MCNA 5DK2B 1QSFA 2QQKL 2APWA 3E3QC 5IBUB 4JREB 4YHPA 4BK5A 4QT5A 3PWVB 3PWPD 5TDPA 1G7JA 4LLYA 5ADOH 1WBZA 5CINL 1BECA 3DMMB 3QUZB 1J0KA 2R29H 3PV6A 1SM3H 3NA4A 3PHOA 5J6GA 4KTYA 3D2UA 4NKMA 3D18A 1IZKA 1S7RA 2CQVA 1HEZA 3V4UH 2F8OA 4DFHA 2OL3H 4PBVC 4PJGE 2NLJB 2X10A 3KPMB 2DYPB 3H3PL 2GAZA 2AW2A 4FQQA 5GRJL 5FM4A 2C26A 1E6OL 4AG4H 4LHUB 4R4BA 1JZ7A 1T20A 3TWCL 2AVGA 3LKQB 3C2SA 2G5RA 3BZEB 4K71B 5L88L 1EEYA 3MRKA 2QSCL 2XZAL 2OJZL 3QIWA 3UC0H 1OM3L 4AT6A 4RGOH 3HZMB 2H9GA 1EFXB 4J4PC 5FYKU 4G42B 5GRUH 4F7TA 2EC9T 3B9DA 2XQBH 2NY5L 1NCAH 4MNGB 4CKVX 5B3NA 1YPZF 2IPKA 2HMIC 2VDQH 2J3SA 3E8UL 3MGAA 1T03H 1AXTH 2HJKA 1WFUA 3BE1H 3FHAA 5DJDB 3IJSA 3S37H 3PDDA 4WUUE 3U46A 5K9JH 1QA9B 3F5WA 3RL1B 2IC2A 3C6LC 3I50H 4JHZA 1S7XB 3KPNA 1RURH 4DAGH 5KVDL 4PJFF 5E2UL 5EIVA 1XGYL 2VXUH 1KN2H 5GHWH 1H5BA 4C83B 4AY0A 3MRDB 3DOSA 2PETA 3C5ZC 5CJ8A 4OZIE 4ZUUA 4LLMA 4WWKC 5J3HC 4XX1E 3WN5B 3VXNB 5E6ZA 3W0WA 5B3JF 2NY3D 1DUYB 3VXPB 3KYKH 4U1JB 2WP3T 3B2UD 1RK0A 5K93A 4LP5A 1UZ6F 3DUSB 5ADPL 4N5UA 3RWFB 4Y8AA 3MGTA 1CFNB 4MS8D 4JB9H 4XAKE 1M7IB 3BISA 1S9YA 3N85L 1A0QH 5E4IA 2C1PA 5CBAA 5F3HB 1QBLL 2B1HL 4OFKA 2NNAA 1HWGB 4F8TA 4OT1H 3LMJL 4ZUSA 2QEJA 1RZIB 3STLA 2QHRL 3LKOB 1O7VA 1BREA 2X4QA 4PRPB 4N9GA 1UCBL 2NYYD 1X4ZA 2NTFA 1YN6B 4JFQB 4GH7B 4H20H 3BDYL 1KYOJ 3QWOA 1SEQL 3VJ6B 2ADIB 1D5ZB 3DRTA 5IBTL 1ZGLM 2VLRB 1V7ML 1CGYA 3FO2A 1QEWB 5IW3A 1T7YA 1HI6A 3FJTA 1T1ZB 1MFCL 5H94B 4OM0L 2GUOB 1G7HA 5GGSY 1IZJA 3O6FA 4MA1C 3ARFB 4K55A 1PY9A 3OKNA 3DLQR 4R96A 2X4PA 1A4JA 1R3HB 2JIXA 1KGCE 2R0LH 4K7FA 1CIUA 5EOTA 4X4YB 1IMHC 3S5LB 1WV7T 3DGGA 5JR1H 3ARZA 1T0NB 5CEYA 1FIGH 1A7NH 1OAQL 2PN5A 2YRPA 3NIFE 1U8MA 3S3JA 5M7QA 3IXTB 4QRRA 3G5ZB 4OQTL 4ZO9A 1MJJA 4OCSH 1F2QA 3H9YA 3BGFB 4DCQA 4GMSH 5A16B 1T2QH 2JJVA 3NAAH 4XXCC 2DD8L 3FAWA 3S3SA 1ZSDB 3GSQB 1MIEH 4MB3A 2AJZA 5T1MA 2ATPB 5FK9A 1KIRA 4IOSD 3WSQH 4MAYA 1NAKL 4I3SL 1ZANL 5HY9A 5F44A 2GJ6E 4MQXD 1HE7A 4U2YA 4OZHB 2XXCB 2NY0B 5FGCE 2N7BA 5K9KB 1VFUA 1XEDA 1R5VA 3BH9B 5K9OA 1I7ZA 1II4E 1QHOA 2J1KA 2DS4A 3EFFB 5EU7E 5BRZA 3G6AB 4XBEL 4NQEB 2G5BB 3SQBA 1Q9LA 4NN7B 1HNGA 3T2PA 5T3XL 1MI5D 1NC2B 3UTPD 2EDHA 3QIUB 3MTRA 3S88L 3L7FB 5IBUG 5D5MB 3VWJA 1OGTA 3KS0H 2NY3C 2BVTA 3QNXA 4OBSA 3B2UC 2YD7A 4JFYB 4OV5A 3QR2A 3QXVA 5C0GB 4N1HB 1EPFA 1ZGLP 2DTML 5I1LA 3MLYL 4N0YL 1GH7A 4MS8C 2V2WB 5I1GH 4FQIH 4JG1L 5GGUA 2E7CA 1P4LA 3U4BL 4F57H 4Y5VB 4C4KO 4CBPA 3DBXB 1Y0LA 1LEKA 2B0SL 3R4DA 2G9HB 2HG5B 5FKAB 4GJTB 1UA6L 4R97C 3MXWL 2F8VA 1QPXA 1FYHB 4NGHL 3QCTL 2VZUA 1GVIA 1SMOA 3L3DA 5F9AC 3ARSA 1JV5B 1U2CA 4M93C 3BSZH 2GTZA 2R0KL 5F6IB 3HG1A 2W9LA 1EEZB 3Q2CA 2BVOA 5EH1A 1BBDL 4KKAD 4BFEA 5JA9A 2A6JB 2EIZB 1IQWL 3D85A 4GRMA 5HYFA 4JGJA 2KL6A 5D9SB 4MA8L 3H7BA 4XPHL 5HHVH 3OBAA 3ARED 5FO8A 3OKYA 1H3PL 4Y4HD 4PRAA 1UH3A 4U0QB 1NQBA 2ZUXA 1WWCA 3VXSB 3GHBH 4ZUTB 1MLBA 5C0BB 1B0GB 4KXZI 3V5KB 4PJDA 4DKDC 3EYUL 5L2JA 1IAKB 3V5DA 4LQFH 1UWEL 4PTUA 1BLNB 4G9DB 4MSWA 4HJ0D 4J3SA 3GMQA 4G6JH 3MV9A 3L95B 4Q9BA 5D6DA 2ICES 3H9SB 3EYOA 3CLEH 2Q7NA 3LEVL 4DWHA 3FOMB 1C5DA 4PJ5B 1C7SA 3CVHL 3UYRL 1QSFE 3SJVD 1S78C 3PL6B 4M1DH 5FF6B 3JV4B 4NT6A 3N50A 5DJAB 4P5TC 5CGTA 4PJBF 4ZDHA 1KEMH 5IB1A 4WI4A 3S35L 4X99A 3FFCD 3C60A 4MQXC 1P4IH 1N5YL 3K46A 3QQ3A 4H25A 4P23A 2E7HA 3UX9B 2M8XA 5D70H 2HT2D 1U91A 5CCKH 3ZDZE 2VAJA 1KTRL 1R5WB 2VQTA 5T3ZE 4K3JL 3OKDA 3JTSB 4FMKA 1N2RB 2Q1EA 1JZ3A 4XAWL 1KEGL 2G60H 4NZTH 3IU4H 3EDEA 5SX5K 3HE7B 4FQXA 4Z77B 2P8PB 3H2WA 3UAJD 4KVCH 3U36B 4OF5A 4Z7VF 3VCLA 1V3KA 3FO0H 2RGSA 2YC1A 3E2HC 2X89A 4XMLL 2FIKA 4XRCA 1MHCB 5JXED 5DI8B 4KK9D 4KK6D 2VDPH 4NRYA 4ZFZA 1SEBB 3ES6B 3N1PC 3O3AB 3VMNA 3ALPA 3RWIB 4CDHA 4JE4B 2OJEA 2A1WH 3BPLB 4KHTL 1F11A 3U7YH 3QJHB 5IJKA 3M8OH 5IM7A 1CGXA 1OGAD 4CMMA 4F58L 3JWOH 2NX5D 5DTFB 2WIMA 1FNHA 1UKQA 3GK8L 1ZHBA 1RUQL 1H3VA 3P9LA 4S1SH 2O61B 3TBSB 2X7LA 4J1UA 1FG2A 1O5DT 1MOEA 2CLVB 2VLKA 4GBXB 1M7DA 1SQ2N 4YNYB 4P9HL 4KKAC 4JQVA 2GIYA 2KH2B 4WW2A 3GJFB 3QUMA 3T65A 2VDNH 3ZKND 2ZJSL 3AREC 3BN3B 3S5LG 3FQUB 3ZYIA 2CSPA 1EK3A 1U92B 5DT1H 4XCYB 4EDWH 1P6FA 1WK0A 2AXGA 5EIQA 5EU5A 4LLQA 2P8MA 1DLHA 1Z9SA 1NGWA 4HMDA 1MFBL 3HTLX 2PTVA 3W0WE 1I7UA 4U1KA 2H32H 5ID0B 4HJ0C 3C5JB 2GY7B 4PJHB 5FB8A 4GAFB 2GCYA 1R3KA 5EBWB 4LCYA 2ZG3A 1ZT1A 2BNQA 2FBOJ 2QHLA 3TEUA 4R4FL 4G7VL 4WY7L 2CDFA 3GRWL 4JY5L 3ZKXB 1KJVA 3MLXL 2VN4A 3PDGA 5FCUH 4BH7B 2BVPA 1CXFA 1M6OB 5L6YH 1B6UA 2VRAA 4U1IA 1K8IB 3DMMD 4ZD3L 3QUZD 1IGML 1MAJA 4W6XB 5F9JB 3VD4A 4E42A 2ZG1A 4X9BA 4DKEL 2HT2C 3EGSA 4MCYA 1ADQL 2CJUH 2KDGA 4FQ2L 4KI5D 2XTJE 4Z95L 1CLZH 3ZDXF 2Z31A 5FM5O 4NHCH 2IFGA 4BH8A 4KGJA 4LPUA 3HMWL 2DYPD 1D5BA 1CXLA 2E6PA 3DSFH 4UI2A 5GRXG 3UAJC 2BSSB 1T1XA 4LHUD 1A1MB 1J0HA 1IBGH 3BH8B 3EOAA 5C0JA 1MHHB 2JK5B 1KT2B 5JXEC 4KK9C 4KK6C 4WFFE 4QHLA 5KSVA 3MRCB 3QZWA 1A8JH 3INUH 5AZ2H 1HHHB 2ZNXA 3V5HA 5A3ID 1R3LA 5KS9F 1EFXD 1NCWL 3QO1B 4QRRE 2B4CH 3UXFA 1NKRA 4HIJA 3RX8A 3V7MA 1JWUA 3HC3L 3UEZA 3QXAB 3GMOB 4CL7A 4IS6B 4KAQH 1KPVB 1WUNT 1U8KA 1HKLL 4LLVB 3GB7A 5DURB 1B0RA 5IKCA 1S5IH 1BQLL 8FABB 3U2SA 4Q2ZA 1UVQB 5A2IH 1AP2B 4KKLC 5DJ2A 1KLGB 4K8RD 4HWBA 4TUOA 3CIQA 1RIUL 2FJFA 4Y4FC 1YJDH 3TPUA 2IPUG 3JUZA 4IIQA 3CU7A 4TTDD 3GGWB 1JMZA 4WUKL 5HJ3A 3DHJA 5LGHH 1JWSB 3JWDH 2FB4L 5BRZE 1KJMA 3QEUA 5MI0B 3ZKNC 1HSAA 4NFBA 4FZ8H 3CFEA 1Q0XL 2ZCHL 3P0YH 3I2CH 3CC5B 4RZCA 3RIFK 5IMMA 2GSIA 2YA1A 2R69H 4I13B 2JTDA 4K3EH 3ARRA 2VDRL 5T3ZH 5T5NF 3BDBA 2ED9A 4M7KH 1XCTA 4IM8A 1NGYB 3EAKA 5F70A 1EVUA 2WUBH 4LSUL 5ILTL 2EH7L 4NKDA 4YGVB 5C09B 1KENL 1Q94B 3GSOB 1H15A 4H0IA 5E6IA 3V8CA 4WU5B 4RDQG 4XH2B 1VACB 3NCMA 2ZOLA 2BOCB 4JREC 3TVMB 2XKNB 4W4OC 4XNXH 1BJ8A 5EORH 5AAWA 3BUYA 1GZQA 1Z3GL 3FN0L 5DJ6B 5E8PB 1W72L 3DMMC 2HFGH 4PRPD 3QUZC 4U6VH 1KCRL 2MKLC 3V4VH 5D7LA 3HG1E 4HDIB 4KI5C 3PGCA 2YEZB 5CJBA 4HWUA 4QRTB 4NPYB 1LNUA 2FHBA 4HC1A 4LGRB 4JPWL 1M05A 1TJIL 2D9CA 3BMVA 1XGQA 1JK8B 5ANMA 5TF1H 1ZLSL 3ARFD 1H3TA 3Q1SH 3FT2B 4MMZC 4GKSB 4AIZB 5IF0B 3OJDA 5EO1A 1TVBB 1OOAA 3CVHB 4LAQH 3M17B 3K80A 3CH1B 3N9GH 4K71C 4N8CL 4K23L 5FEBA 4KUCF 4OKVA 2FR4A 4NQDB 1IT9L 5I8EA 4HIEB 5DA4A 1MCBA 4PJDE 1XGUB 3BKCH 2J6EH 5C07B 4XVTL 5A3IC 5I19H 3EYQD 4TVPE 5JA8B 3MV9E 5DUBA 2VR9A 3H9HB 5I1JL 4Z7NF 2JB5H 5DYOA 4LRNL 4ZXBA 2VUOA 4P2RA 4YDKL 5C08A 1MUJB 5EBMA 2CGRH 3OAYH 2FEEL 2LU4A 5D7KE 5CWSB 3L9RA 4QXTA 2DIBA 1B2WL 3LS4H 2NY0D 4K8RC 2GW5A 3EOBA 3L3GB 1VEOA 4JDZA 4FQCH 3WFDH 4JFPB 4U7SA 1KIQA 2DOCA 1YY8B 1MWAL 1FVCB 1W8NA 5KSAB 1NC2D 2A83A 5IHZB 3QWRD 5E8EB 3QIUD 2DLFL 4HQQL 1S5HA 3WN5C 2JE8A 4P3WA 4D9QD 4U7KA 1ULVA 4XP6L 2R9HD 4MXWL 5C6WH 4Z0BL 1AQDB 1QZ1A 2YPKA 4KJWD 4G5ZL 3SKJL 3REVA 5BO1H 1CFQA 1LK2B 3O2DL 4OLYH 2W0FB 3BRDA 3O6KH 2R0ZH 3MJ6A 5ERWA 4ONHA 2VLKE 4K3DL 4G43B 1JNNL 4U2ZA 2YD6A 5GSVA 3X3FL 4DZ8B 3L3IA 1IM9A 5IP4A 2WUCL 4XZUB 3RU8L 4B7IA 5CJXC 4PGZA 4U1LB 5C0AB 3NCBB 5J9PA 5TFSH 4A2MA 2WINA 2VDKH 4YHZH 1N64L 2A9ML 3WIHA 4PGBB 3X13A 1RZKC 4UILL 2NMSA 4OLUH 1HKFA 4KI1A 1YEJH 2C7UB 4X83A 5KSBB 3HC4L 3ARFC 4UNTA 3NZ8B 1Z6JT 4L8BA 1DQQB 2MJWA 3IAPA 5C0BD 1TZHB 3TH4T 3NH7H 3D6GA 1HILA 1UB6A 3VFVB 2CDGB 1A2YB 1B3JA 3EYQC 3H9SD 4J12A 3DV4A 3QNZB 4R7DA 2X4NB 5DMKB 3BGFC 4PYHA 1DR9A 4OGXH 1KFAL 5D6CB 2BNQE 3PL6D 2EXYD 4RMUA 1JGEB 3RVTD 4B0MM 2FD6H 2C5DC 3BGMA 4CMHB 1A6AA 1XGRA 4IRZH 5E70A 2SEBA 4XCCH 3MRRB 3F65A 4MJIA 3MV8B 3GKWL 3L3JA 3VD9A 1QLFB 2NY0C 1UJ3A 3MMEA 1I8LA 3JVGC 3R06A 4LCIL 4U7MA 1T04B 2NXZD 1N59A 3QJFA 5FOBB 1H8NA 3JBG7 4YHIB 3D39D 5I71B 4NN7C 3BHBA 3BVNB 3A6CH 3HE7D 1BAFL 1MRCL 3DXAA 1WCQA 2OCFD 1HHJA 4EQ2A 4QCIA 3KPQA 2HTKC 2AJSL 5SWZA 3PDOB 2OR8A 1OD9A 1XGPA 3IF1B 4X7TB 4EDXB 5DD3H 2GITA 2O5YL 3ROOA 1BEYL 4P2OB 4UT6L 5HDBF 2R9HC 3P77B 5EWIH 1JGLH 4DK6A 2CXGA 2FX8L 5GGRA 1FZJA 4IJ3C 1EV2E 4Y89A 1INEL 3DVNA 4TQEL 4NQVA 2O5XL 4KRNA 3SE4A 5IEKA 4PR5A 4OFPA 4KJWC 1LE9A 2VWEE 3G5XB 4LMQE 3FQTA 2VH5H 2AGJH 3Q3GA 4KTDL 1XF4B 1P2CB 4BELD 1TNMA 1TDQA 5HYJA 2RHEA 1WT5A 5L0QB 2YSSB 1GC1H 4MD4A 4C4KT 3WXVH 4TVPH 5ITFB 1TVHA 4QRPD 4EN3B 2VAAB 2DN7A 4WENB 4XP1L 3P4MB 2KPNA 1Q72L 5IESH 5F6IC 1GZPA 3GI8L 4QXUL 1T89A 1LO0L 4LQ1A 4U1NA 2PTTA 3PP3H 4BJLA 1EJOH 1G6RB 4YXLH 1LVEA 1B4JH 1IQDA 3OZ9L 3JTTB 3T77B 5JHLL 2EDQA 3RIFF 4JPVL 4JHWH 1YC8A 3OGCA 4FQ1L 4OZGA 1MFDH 4YDJA 1NL0H 3TJEH 4F9PA 4PB0H 5IFAH 2ITCB 1S7SA 1NDGB 1JYWA 4Y19B 5FUCE 5T5FL 3TBYA 1TZGH 4M4PA 3FTGB 1Q9OA 1ETZB 5HDQH 3A67H 4LLDA 3IDNA 4JY4A 1NC4B 5IR1B 2W60B 4RRPG 5FYLL 1AHWB 1W72B 5DRZA 3HR5A 4HLZG 5D1ZC 3RX5A 4K7PH 2ORBL 3PL6C 2EXYC 1MCQA 4XP5H 1DQML 4ONOA 1J8KA 1WBYB 4O00A 2AV7B 1ZGLB 5EO0A 4RFNB 5K33A 2Z4QB 1SJEB 3ARBA 3GUTB 3MACH 5D7LE 3SBWC 2AXFB 5ALBH 4FG6D 4OLVL 2NXZC 3IDXH 2H3NB 1RZJH 3L3OB 1LK3L 1NBYA 5L2KA 1YPZB 1IGFH 3WE6B 4ODHL 3HE7C 1IILE 3RWCB 2AJXL 35C8H 1EXUB 4DUWA 5ANME 4TUKL 1GOFA 3GBNL 3WIIL 2PYFB 3G04B 4NSKB 4P2QB 2E9WA 1G7PA 4FFZH 1YMMA 2HRLA 2DWDA 2IADA 4PJFB 5FKPB 2L7UA 4NYLB 2IFFL 2X42A 2NY5C 4XHJC 1X5LA 2V2TB 4Z7UA 1ZV5A 2Q76B 3CDCA 1DUZB 4WFGD 1CE1H 1DL7H 2VL4A 5B38B 1L4IA 1UWGH 5FECA 4YHOL 5IV2A 1AGFA 3O4LB 3MROB 1MJUL 3K7UA 4GXVH 3B8SA 5TPWH 3LZFL 4P2RE 4F3FA 5C08E 3IJYB 4ISVB 2F19L 3VFPB 1HHKA 3T2QA 5DURD 4XMPL 4GSDH 1HHGA 1OP9A 1MWAB 1MCIA 4ODVH 5T3XD 2NW3B 3BDXA 4JLRB 4X7CC 5C2BH 1I4FB 1I3VA 2BVUA 3RDTB 4ODXB 3VMOA 3GMMB 2VR5A 5HHNA 4UQ3A 3UPAA 3TBVB 3OAZH 5IIEA 1S9VB 1K4CB 1H8SA 2UWEA 3IFPB 3AVEA 1SYVB 5ICYB 3KS0J 5LQBH 5CKGA 5FO7B 4MHHG 3V6FB 2NY1B 3E6FB 3OSKA 3BWAA 2CIIA 1AR1D 1EHLL 2O5ZL 1PQZB 1G9NC 3ZSTA 4JANB 2PKDA 4P9ML 2VXSH 3RWGB 4PJGF 2UY6A 1VPOL 1DTUA 1SY6L 2P46B 2BRRL 3VFNA 3ULUE 1T83C 2R0WL 2DQFB 4UIMB 3S96B 4J4PA 1DZBA 3QO0B 5MENA 3TVMD 1RU9H 1P5VA 3HHRB 2X9YA 4MB5A 1IC1A 1BF8A 2JJWA 1AH1A 1C12A 1F58L 4JG0L 3LEXA 1NMBH 2DMBA 1NBZA 3BEVB 3QXDA 3VFRA 4PBWD 1Q0YL 4O2CA 3LD8B 3VXUB 1DQJB 2G2RA 2WBWB 5GGSB 3OAUH 4FG6C 5B39B 5IQ7L 5J1SC 4AMKH 4KZEL 1TVDA 3RWHA 4BFIA 3C6LA 4O4YL 3CFKA 1OT1A 4RMQA 4KV5E 4JEGB 3LKPB 1I3GH 1V8HA 4ALAH 1BPVA 2AJVL 3VWKB 3FT3A 4KK5D 2NW2B 3TH2T 2M1KA 3QXUA 4HWBH 3C5ZA 5DD5L 4Z0XA 3HI6L 4WWKA 4NQDD 4OTXH 3FB5A 3U1SH 1KLFA 5DXWA 1TITA 3P9MA 2W59A 1ZWIA 5D71H 2EDFA 3LH2L 3UTTB 3CAFA 3MFGB 3OV6A 5L9DL 3KJ6L 4IMKC 5M94B 3IVKA 2ZP0T 5CMAB 1RUKH 3PABA 4OZIF 3ROLB 1TCRB 3IAGC 2P44B 3MRJA 5IFHH 2P7TA 4LEXH 1U8PB 4UMGA 1F3JB 4HX1A 2DQJH 3UTZB 4TYUA 2VN7A 4L4TB 4P5MA 4LASL 4YBQD 2CUHA 1HXMB 2VE6B 4QHNA 1UENA 1MVUA 3GSNA 3I3BA 3NPSB 4MJIE 1V3LA 4ODWB 1FLTX 3O3DA 3X12A 2APBA 3EO1A 1H3GA 2IQAB 1JHLL 2FWOA 3SKMB 4QYOB 3IU3B 3W81A 5E7FA 1J1XH 1D9KB 1EDQA 2ZCKL 1HCFX 1DJSA 1RJZB 4DZBA 4BSVB 1XF3A 3K3QA 1I1AB 5KSAD 4F7PB 3DXAE 4X4XA 1D5IL 4P59L 5FYJU 2YK1L 3Q6GH 5GRZA 4PGCB 5AUMB 1S3KH 4PJ7A 5EUKB 5SWZE 4DVBB 1LE5A 4ODUB 1AR1C 3GIZH 4JFHD 1CGSH 1TJGL 3B3IB 4OSUL 4R6UA 3UZVB 3CDGB 2F8XC 4HC1H 2HH0L 5JXAH 3J7HA 1FRGL 5DD0H 1S7VA 3VA2C 2DBLL 2C9AA 2ZZUT 5T1DL 1CK0L 1FE8L 1FN4A 5KVEH 4JPKH 4BKLA 1BMGA 1HYSD 1YMHB 1DEEA 2FBJH 4XXCA 4UIKH 4H8WH 3GMNA 1ORSB 4JHAL 5JIKA 1S9XB 5ITBL 3UO1H 1JTPA 1NPUA 3BJ91 3C08H 3QDJB 1CGUA 5HDLA 3NIFF 1L7IL 3BKYL 2BMKB 2JB6B 3RI5K 5FUZH 3TCLA 4DUXA 3BP4A 4NUGL 4ERSH 5DQ9A 3ULSB 5DJZB 4GRWH 5C0AD 1I9IH 2ZKHH 3FQXA 4ZFOA 2RB8A 1PG7H 4B5EA 1GIGH 3CJJA 2VZOA 4ZODA 3VA6A 1X6LA 3BW9A 4OZGE 5JMRA 4KK5C 1AGBB 4OD3H 1ORQB 2Z92A 3QRFM 4MAUL 1MCKA 2ATKA 3BT2L 1JHKH 3NBNA 2DQGL 4ODSH 1KLUA 1LEGB 1Q9KB 2OTUA 1BZ9B 1ZK9A 3HNTL 4QRQA 3EJJX 4PJIF 1RK1A 4PTTB 1DE4B 4UTBL 5HXMA 2CMRL 2R1YA 3I85A 5J1TC 1YECH 4X6BA 3MOAH 1DP0A 5IVXA 3KPPA 3LOWA 2JCCA 4QNPE 4MD0A 4Z7VB 1K8DB 5D1XB 2XZCL 3SOBH 2MCPL 3IDYB 1CG9B 1L7TL 1CFBA 3QSKB 4NDMB 3TZVD 4CAGA 4UV7L 2OZ4H 1CLYH 3C9NA 4Z76B 3B8YA 3OXSA 2EKSB 4YBQC 4QHUB 4TOYH 5A40E 5EN2B 5JOEA 5I8CB 1NLBL 3EBAA 5DUMH 4ZFGH 3KG5A 3IDGA 3ULUH 3V0WL 5HGBA 5E99H 1R5IB 4AL8H 4HD9A 1L6XA 4FFYH 3SE8L 3BQUB 2CK0L 1I1FB 1F6LL 2VXTH 3VXTA 2W0LA 1JBJA 2J5LB 5L2KE 3G5VB 5DMYA 3FN3A 3ZL4H 4OLZH 1ODAA 2ADJA 5KSAC 4OJFH 3L3HA 3P11H 3MRQB 5EPMB 5KG9A 3HI1B 3EOTL 4Y5YC 3MV7D 1DSFL 5I16B 2Z91B 3MLUL 3C6SB 2CXKA 2Y5TB 1MAML 5A2KH 3F12B 2BNRB 2V6HA 5EC2A 4P2OD 1HQ4A 1YMME 1AGDB 2H6PA 3RVVD 3KNBA 5LXGL 3DUUB 2P8LB 3WIHH 2Z9TA 1ZA3B 4JY6B 2DLHA 4QHKI 4Z7UE 1NGPH 4TSCL 3SDCB 2VLLA 5ETUA 3AAZA 3FFDB 3VG0L 1ZE3C 4CRPA 1HYSC 2EYTB 5KJRL 4HZAA 4HW6A 3MO1A 5E8NB 3E3QE 1INDH 5KBNC 5TJWK 1EERB 3GIVA 3D0VA 1AKJB 4EUPB 4XGZB 1T5XA 4EN3D 1XF1A 2ESVB 2QTEA 2XQYG 3O3EA 1PLGH 4X5WA 4L5FH 5I66B 1JI2A 3WEXA 2D3VA 5KSUA 3MC0A 3PP3K 1NGQH 2YS4A 4OM1L 3SDXF 4M9PA 4PJEF 2UWEE 1N4XH 1JYVA 4LNRA 1MI5A 4YDLC 5MHSE 4DJMA 4UTAH 4QGYA 4Q9QH 3OXRA 2KBGA 5ADOL 3ZDZF 2VITA 1A7OH 1PKQB 4M61B 2V9QA 4XNYH 4O2EB 1IGJA 1V7NH 3UPRA 4MWFA 1T0MA 1NC4D 3MGOA 3QEHA 4NWTH 4YUEH 3T1WA 3IDJB 2R29L 1S7QB 4S0TD 1A6ZB 1SM3L 4MDJA 1FL3B 5IROC 1G0YR 5MENE 2JJUA 3V4UL 3TZVC 4CMHC 4M5ZH 4ENED 1H3XA 5IW1B 4LMQI 2R2BB 1AXSA 1T6VN 2OL3L 3LKSA 5KS9B 4XXDB 2B8OT 3X14B 3V52H 1SBBA 3V7AE 4AG4L 1E4XH 3T4YA 4XNZB 1U8QA 4J23A 3ZTJH 3EO9H 3QWQB 4HIIA 4BUHA 3CSYB 4YAQB 2YN3A 4OCXH 2CR6A 3LQZB 3UC0L 5H35B 4RGOL 1GGUA 3AREA 1UM5H 1DBJH 2WIIA 2X70A 5CJQH 3AXLB 3OKEA 5GRUL 4FQHB 2GJZA 1YEDB 3CSBA 1NEZA 4P2QD 3T4AB 5CAYB 5JQ6H 1VA9A 2XQBL 4UV4H 3SN6N 1VADB 4P2OC 5EU3B 4PGEA 1NCAL 2YD9A 3RVVC 4GW4B 5JNYA 4HFWB 3P73B 2VDQL 3B5GA 3SKOB 1T03L 1AXTL 4UDTB 3QDGA 7FABH 3BE1L 5INCA 2D0HA 4OCRL 4TSAH 3S37L 4HGWB 3K2MC 2YPLB 4HKJA 3O4LD 4N9OB 5K9JL 2NQCA 3SJVA 3I50L 3KYNB 3HUJA 4QGTA 5L0QC 4DAGL 2GSGB 5GHWL 3T8XA 5KANI 1A6PA 2VXUL 1KN2L 5MEQA 3PWPE 1U8HA 3HRZA 4EN3C 1FV1A 3MSPA 3FFCA 3GBLA 3WO4B 3RDTD 5JPNB 3K74B 1Q1JH 3S4SG 4WI7A 1EUUA 1YA5A 1QHPA 4OFDA 3QFDA 5ICZB 3KYKL 2CIKB 3UTSB 1YZZA 1DDHA 4G8IA 1KTLB 5F1IB 1ROWA 1UZ8A 5J7CC 1LDSA 5D72H 4ZPVA 5MEOB 4JB9L 3RIAF 1FO0A 2D4DA 1A0QL 4I5BB 2AJ3B 4D9LL 4OZFB 3OAZK 1WLHA 3PHSA 4NNXA 2NY1D 4OLXH 4FFWD 4NNPH 2O26U 4PJ7E 1V5JA 2Q6WB 4OT1L 4U31A 3RL2B 5JXEA 4P49A 5JW4N 5CP3A 5BVJA 2DLGA 4LSSH 4G8EB 2PXYB 5H37G 1QNZH 3WFCH 4B50A 5KVGH 1AHWC 4Y0GA 1ZHNB 1QO3A 5EULV 3G6JB 4Q97A 5EZJB 5J6HA 2E9IA 5CIPB 3OKLA 4H20L 1OGAA 1YUHB 2XN9D 3GMLA 4GG8B 2NX5A 4KJQD 4PJXA 2VDOH 4I18B 4LU5H 3ZZ1A 2I9TB 4ENEC 4N8PA 4O02H 4H1LB 5TH2B 4YO0B 1L6ZA 1U3ZA 2R56H 2E8YA 4RFNC 3R8BB 5BZDA 2XWTA 4NO3A 3QHZH 5ACLA 3VXUD 4Z7QE 3SKNB 5GGVY 4Y2DC 4RIRB 3RWJB 2X4OB 2VDLH 2I25N 4Y4FA 4LVOC 3OHXA 3CFDA 4G7YH 1XF5B 1FIGL 1A7NL 4YBHA 1JPFA 3VWKD 4PV9B 3MYJB 4OCSL 4KUZH 2HTLD 1NGZA 3S35X 2H2PD 1XF2A 1RZGB 4GMSL 4I2XB 4MJ5B 1T2QL 3NAAL 4RQQA 5T33H 2OTWB 1HH6A 3GSXB 4YEEA 1YY9D 3P4NB 1TCMA 1MIEL 4GQ9H 1EBPA 3EFDH 2E3VA 3EYVA 4EXKA 1N6QH 3EJYD 3MRNA 1QFWH 4DGYH 3CMOL 1I8IB 3QDMB 5IVXE 1NAMA 2JCCE 4X4ZA 5GIRA 3VFSB 3MBXH 3RKDD 3PWVA 2FRGP 4GW1B 4J7RA 4L4TD 4HWEH 3ZLQC 1BVKB 4PFEA 1JZ4A 4P5KB 3L5XH 2P5WB 4YX2H 3WL9B 3DMMA 4APQB 3QUZA 3RDTC 2X1XR 3CH8A 3VGBA 4Z9KB 5DJXA 2BVQA 3ZHDA 5D7SH 3P0GB 1J8HA 3HAEG 4OFYD 1D9KD 3FQRB 1N6UA 5J11B 5DJ0B 3KVQA 3MA7B 1I1AD 1U8IB 2X1WL 5I1GL 1RIVH 3WXWH 2NLJA 3KPMA 3HPJB 2DYPA 4FQIL 2XY2A 3R0MA 4F57L 2NY1C 4FFWC 2W65A 2GEEA 4LHUA 4NFCA 1N3NB 5BMFH 3LKQA 3BZEA 1H9VA 3SCMB 2RQ8A 4Z7OE 2OTPA 3IFOA 4GUPB 4L29B 4GLRH 1F6AB 1EFXA 1WZ1H 5D8JH 1KCLA 2RAMA 2YD4A 1ED3B 5E4EC 3D9AH 4G42A 4MNHB 4KJQC 3NTCH 1FAKT 5HHVL 3V0AC 5A2JH 1VGKB 1BX2B 1P1ZB 4PJDF 3FKUS 3PNWB 3DVGB 1CVRA 4MNGA 1WCBB 4ZQKA 5E56A 2VQ1B 2B20A 3GHBL 4MQ7B 4J3UA 5DJDA 1D5MB 2LVCA 2D7QA 4LQFL 3RUGA 2OM5A 3MBEB 3NA9L 1XFPA 1JN6B