4S0SD

Structure of human pregnane x receptor ligand binding domain with adnectin-1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
94
structure length
90
Chain Sequence
b'DLEVVAATPTSLLISWPPPYYVEGVTVFRITYGETGGNSPVQEFTVPYWTETATISGLKPGVDYTITVYAEMYPGSPWMDIQPISINYRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear receptor subfamily 1 group I member 2
molecule tags Immune system
source organism Homo sapiens
publication title Developing Adnectins That Target SRC Co-Activator Binding to PXR: A Structural Approach toward Understanding Promiscuity of PXR.
pubmed doi rcsb
total genus 11
structure length 90
sequence length 94
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-01-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4s0sD00
1RIHL 3I2CL 4JY4B 4QWWD 1CD1A 1JWMA 1PG7X 3G5VA 2QSTA 2VLLA 4LOUC 1PG7L 2J8UA 3MGAA 1CVSC 2A6DA 2J4WL 3D2UA 2CIIA 1DUZA 2Q76A 1J1XL 3GBLA 4XBGA 1SYVB 5E56A 3SGDI 3BPOB 4NKIL 3ILPA 3W82A 3C8KB 3ELAT 1EJOL 2VQUA 1JJUA 1KCRH 1XGPA 3DV4A 5IQ7H 4Y1AD 4G8GA 4X0KA 2DYPD 4K7PL 3P0VH 4LRIC 4R7DB 1MWAA 2F8OA 4KY1H 4JM2B 1JHLL 2BFVH 3RA7H 1T7YA 4CW1B 2OTUA 3BISA 1AJ7L 2X89D 1UKTA 4GRMB 3TBSA 2R39A 3WD5H 5E9DE 1NPUA 4ZO8A 1FLTX 5IGXL 1IQDB 1HOCB 4LSUL 1AGBA 3C8DA 3Q6GH 4PJGF 3BKJL 4XHJC 4YHZL 1AFVH 5LVEA 3NN8A 3X17A 5FHAH 1JHKH 1S7RB 4QRPB 1KENL 2BRQA 4WHYG 2HMIC 4UDUB 4ZOCA 1UB5A 5D1ZB 5C0FA 1ZGLM 3WXWH 2I9TA 2DS4A 3EYUH 5I1JH 1JN6A 5KSAA 3MYZA 4QKXB 4UILL 12E8H 1ZGLP 4NC2B 5D1ZC 4GLRH 2LTQC 1VPOH 4WV1C 2C4XA 4HF5H 1YNTA 1P7KA 4PP2A 4L5FL 5GQBA 4K7FB 1BVKA 5DJAA 3ZDXF 1KJVA 4LKXB 2DQDL 3AMLA 3BE1H 4J8RA 2Q8AL 3ARUA 3ALPA 2DYPB 5I15L 3EGSA 2I5YH 5I75B 2VXSH 4J4PD 3DYOA 5FCUL 3BDBA 4LSVL 4TVPL 1QRND 3QIBD 4HWNA 3IDYB 4R4BB 5ITFA 4RGNE 3G5YB 3HZKA 4JFDE 3R8BB 5IVXB 1ORQA 1GGCH 4QOKE 1KPVB 1GPOH 4UNUA 4X7TA 4Z9KB 4UTBL 1IMHC 4HC1A 1V5JA 2SEBA 5M95B 4POUB 5BXFA 1EBAA 2QR0A 4XXCC 5E5RB 1HINH 1MCLA 1S7RA 1ZA6A 4QRPA 3IKCB 3WE6A 5DJDB 1A6TB 1GL4B 2VLKA 3X14B 2X9XA 1EGJA 4P2QE 3ZDZE 3C6SB 2R1XB 3BW9A 4JPKH 4ODSL 1WFNA 3T0DA 2FDBP 4QRTA 2F53D 2FO4B 1P69B 4ONGL 1AFVL 1OLLA 3MJ9H 4P59L 5F9OL 3WHXA 3FB5B 2AV1B 2O5YH 5IB3B 5KJRH 1O0VA 2R2BA 5T1DL 3G5XB 2ITCB 4YBQD 4N0YH 4WRLA 4QTIH 4OD1L 1NBVH 1RZKC 4N9OB 5MP6L 3C5SB 5JUEL 3NTCH 4HKJA 5CHNB 3LHPL 2Y7QB 1KSRA 1LK2A 2ICWI 2A6KA 3GRWL 4NZRH 1RUML 5E08H 3HAEA 1I7RB 1FNSH 1UXSB 4YDVB 5CIPB 3KDMB 1JTTA 5JW4R 3VFSB 5E2TH 2IBZX 4AQ1B 3GSQB 1CDGA 5BRZB 2DQDH 2Q8AH 4U4BA 5IBLC 4IHOB 2DDQH 1BLNB 1KEMH 3SDXF 4ONFH 5TF1L 2A77L 3DXAD 3IETA 4DFIA 1RIHH 1GGIL 3I2CH 4L4TE 1HCFX 2BSTA 1U8JB 1NBYB 1Q94A 4P2RD 5DD1H 4AEHH 4R4FL 4U2ZA 1YN7B 1QSFD 3O3EB 3L3OB 3O11B 4Q0XH 4TSCH 2GTWB 4I0PA 5ALBH 5F7MC 5F8RC 3DOSA 5FA3B 1TTGA 5DS8A 4WUKL 4I48A 4JKPH 4K2UH 4WFED 4KHTH 3S7GA 1DQTA 4N0UA 2BX5A 5DA4A 3JV5A 1QOKA 3TCXA 1VFMA 1MELA 1ZSDA 1FJ1A 3DX6B 1NCUA 3M8OH 4O51B 3QG6A 3MNZB 3VWJB 2CKBB 1XIWC 4JJ5B 1XGPB 2DQTH 1MFNA 1IKFL 4JFHD 3O2WH 5F88A 5I1HL 4LDLB 4QT5A 1YECL 1KTKE 4QRRD 1T0MB 1WGOA 3B43A 4A6YH 1GH7A 5CIPH 4HXBH 2EC8A 5DDHB 1UQSB 3ARSA 1XF5A 1BJMA 2EO9A 4X7SL 4LRNL 3RWIA 3NACL 3UJIH 1I8KA 1OTSC 2GITA 1BOGA 5T5FH 3KPPA 3IDYC 3MREA 4KDTC 5BMFH 3ZT5A 2LU4A 2BOCA 4Z7VF 2YC1A 1HH9B 4JCMA 4LIQH 4QHMB 1OT2A 4Z7UB 2J4WH 1A1OB 4Q9QL 1JNLL 4GRLA 2FJGA 4XZUB 3OKMB 3HZYA 4WI7A 1OOAA 3FQUB 5DO2D 4DCQA 2VDOH 2FLBT 3GMRB 3PWNB 1I3GL 2JJSC 3QAZB 2ZCHH 5LGHH 2XKNB 5F89A 3BVNB 4K3JL 1INQB 3KR3H 3AU1A 3LB6D 4N8CH 2BVUA 4KK9D 2HMID 1KIQA 3NBNA 5J11C 3LRSA 3DVNA 1NCWH 1FFOB 3SKNA 3GSXB 3MV01 2DTMH 3N85H 4Q2ZA 4BFEA 5L2JB 3PWVA 3RBSA 4OD2A 1NAKL 1I9RL 4GXVH 1T1WA 4EJ1C 4I8DA 5C0CE 4U6YA 3PIQA 2IH3A 3TVMD 1FSKB 1MIML 2PYEE 3KPQA 1H15A 3M8OL 4BQ6A 3C9NA 3TNNB 1KLGA 3VFOA 4XCFH 1A7PL 3ARDC 3JV4B 1MAMH 2Z31C 4JDZB 1U95B 1ZT7A 5DURB 4RFNB 3MRIB 2OR9L 1G7QA 3L3IA 3TJHD 1T4KB 3JSSA 1OPGH 3RVUD 2EDFA 4N1HB 1SVCP 3BMVA 4TN9A 2NTFB 5C0BB 4Z7QF 1CYGA 3EFFB 1KCSH 1OSPL 2D0GA 2FHBA 3G6AA 1XGYL 2VLJA 1IQWL 1BVLB 5C0DA 2EYRA 1HOCA 1CL7H 2XWJA 4OIBA 3V0AC 3C09B 3NCYS 2YA2A 1LP9B 3C5ZB 2O61A 1QQDB 1ZHLB 4OZFG 5FF6B 5I8CA 3IU4H 3DX9B 3L3HB 4B7LA 1MJ8L 2D7MA 2IBBA 3GSWB 3NFNB 5MENB 4FQJH 4EXKA 3QQ9C 1I4FB 1DN2A 3L9RB 5HHPA 2OZ4L 1H8OA 4WWKB 2R56L 3EIFA 4AM0B 1MOEA 4ALAH 3SKOB 3BAEL 2R0LH 5ECJE 4YIQB 4M7KL 5IBTL 3RVXD 2Y07L 1ZGLA 5KJRL 4ONOA 2EIDA 4ESKA 4FABL 5J11B 4I9WD 4E5XA 2HTLD 5F9OH 2VLJE 4XNMB 5F70A 5GRJH 3F58H 3MLPA 3GI9H 3KS0H 5CSBA 5C0CA 1BD2B 1QSFA 2NW2B 3MMEB 4KHTL 2KPNA 4N90D 5CEZH 3QXDA 2BVYA 4GRLC 5LAXA 4KJQC 2R29L 3LH2H 1RV6X 2VSDA 1U8QB 3VWKC 4Z77B 5ESAB 5F93C 5L7XH 4Z76A 1QPXA 3TBWB 3T0EC 4QXGL 3G5ZB 3X13A 4V2BA 2B4CH 3QIUD 4O2EB 5CINH 2BY0A 4YK4C 1FC1A 4RA3A 4DWHA 3B3IA 4KAQL 2NW3A 2X09A 5GISL 1UWGL 3RGVB 3NFPA 4GKOA 5E2UH 5ICZB 4NNXB 4JFPB 3BPCB 4JRXE 1T20A 1T0PB 2UYLA 5EBGA 5A3ID 3Q6FA 3H9YA 4NT6B 1UJ3B 5FOJA 1GHFL 3EO1B 4P3CH 2I07A 5B21A 4HUVB 5KANG 4P2OD 2NXYD 3DXAB 5ILTH 3NCMA 2GK0B 4WDIB 3MV8B 3VWJC 5FHAL 2CGRL 1CD9B 4OZFH 4EDXA 1CGSH 2D0HA 4WO4A 3HE7A 1DLHA 3GJEB 4TULH 4UIMA 3QXTA 3DPBA 5EORL 5D2LF 1MFCL 4BH7A 3D85A 1DBBL 2OK0L 2ZG2A 3AVEA 5DJZA 1HSAA 2D2OA 3KLAA 4KTDL 3CFKB 3TN0C 1WITA 4QOKA 5DO2C 3T77B 3K1DA 4NJ9L 3WFBL 4RAUB 4JPKL 4ODSH 1DCLA 4LDOB 5CMAB 4I2XA 4XI5D 3LB6C 3O6FC 4RX4A 5GRUH 2DI7A 4LCWB 4JZJC 3UBXA 1LE5B 1AGCB 3QIWD 3CJJA 1T1YA 4HWBH 5C3LD 4FZ8L 5D8JL 1C5DB 2BMKA 1M7DA 4P4KD 3A6BL 3V0VA 1MQKL 3S34H 4PJ5B 5GRUL 1A22B 5GS0H 4ODXB 4U1HB 3S4SA 3PDOB 4LLDB 2CLZB 5EO0B 1G6RL 1DLFH 2YKLH 3GI8L 4X6DE 3VFVB 3UP1A 4U1SA 1BAFH 3IKKA 3KAAA 3ARDD 3T0EA 1BD2E 1T21A 5DJCB 1G1CA 5D72L 5EBLA 1WWCA 1D5BB 3OKNA 1V05A 4FHBD 3NIDF 15C8L 2JCCE 1G9MH 3ULUC 1AQKL 4HLZH 3BSZH 1EMTH 1FNSL 3ULVD 2CGRH 4P3DB 2A9MH 4KKCD 5JIIA 5FKAB 5ID0B 4FN0A 1H8NA 3BUTA 1JWUA 2DLIA 1XGQB 4JG1L 1RZ8B 4HH9A 5C0BD 3ET9F 1B4JL 5I1LA 1IGIL 3L9RA 1I8LC 5HGAA 2DJUA 1YC7A 2X9WA 5D9SB 5EBWA 5B8CA 3SJVA 3PWLB 3ECBB 3O41B 3GSWA 1CZ8H 1MNUL 2X4QA 3LPGA 4M1CC 4PIRF 1VERA 3OB0H 4G8GD 4XCEA 2WIIA 3C6LD 3TFKD 3VJ6B 2W1NA 5DHYB 1JHTB 5AYUH 3EO1A 3VXOA 3VXSD 5IWLA 4PTTB 3JTSB 3BH9B 3T0BA 4J3UA 5CZKA 5EZJA 1A02N 1SJHB 1L6XA 1UACH 2FR4B 3X11A 1ZLUK 2R29H 3PHOA 2NYYC 3KJ4B 3SGEI 4TSBL 1JF1A 4GJTB 4GG8A 3MV9A 3OXRB 1T3FB 1A4JA 1IM9B 2D4FA 3FQUA 5I71B 3KPSE 5D7IF 4L4JA 3R0NA 5KSAC 4PJIF 2IFFL 2WWKT 3HR5B 2P5EB 1BEYH 1GOHA 1QD0A 4QHKI 2GT9A 3ARGC 4JE4B 5DJYA 5B3NA 3T4YA 3MNWA 4MD5A 4GMSL 1HI6A 2V9QA 3VFWB 1OAKL 3VGDA 1RJYB 5DWUL 5ESAA 3MR9B 5FCSH 4ENED 3LQAC 4K3GA 3STZA 2OMBA 2MTPA 1X5ZA 3SCMB 2VMFA 1C8PA 3W81A 5C7XH 3DX8A 2H32H 5T3XH 4LEXL 5I18H 3KHQA 2ZUSA 4DKEH 4BUGA 1DN0A 3GHBL 3KYNB 1QFWH 3UO1L 1G7JA 3WL9B 4BK4A 5ABDE 5ID1B 3CFDA 2FEEI 3GBMH 4HV8B 2IG2H 3ARXA 1MQKH 4OQTH 3TBTB 4RFEB 3TH2T 3KNBB 5IF0B 1JPSH 1S3KL 4PRNB 1MJJA 5DA0B 1S9VB 5GHWL 4GFTB 2APXA 1KCVH 3SDXE 3LQZB 1JPGA 1R3LB 2HLAA 3V6OC 3WS3B 3IS0X 1L4IA 1QQDA 4BZ1L 5F7NC 3B9KA 1IT9L 3T0EB 2CDGA 1VGKA 4Z95L 5KS9A 5F3BB 2K7QA 1FQ9C 1Q9WB 1XGTB 4OZ4A 3QO1A 4ZUUB 5EZLA 4QXWA 5D2NA 3VGAB 1RZGB 1WJ3A 4I18C 2H9GA 1FH5L 2HJKA 1A7RL 3P9MB 4NQEA 4MXQD 5DQ9A 5JOPD 4LSRH 2EYRB 5JPNA 1JNNH 3DYMA 2ZKHH 1K85A 2D7QA 4FQLH 2DQCH 1ONQB 2WLYA 1QKZL 1MVUA 2VZ1A 4XI5C 1YNLL 1QPPA 4OFYA 2Z92B 2W9LA 5D7JA 1D5IL 4ELKB 2COQA 3ARDA 4OZHB 3OAYK 2WUCH 2YMXH 3IFNH 3MRKA 1IC5H 1HNGA 5B8CC 5BQ7A 3TJEL 5JW3H 3U6RB 5TE4L 5C6TH 3KPLA 1RUQL 5A16B 3B5GA 2ICWB 1U95A 4HGMA 3MLTB 1P4IH 4HJJH 3C5JB 2XV6B 2ESVE 5EO9B 1EV2E 3KPRD 1K9TA 3IFOB 3KPQB 3MO1A 3DTXA 1M05B 3DMMD 5F7DB 2MSPA 1A7NH 1IC1A 1TJHL 3GKWH 3QUMB 5A2FA 4LLVA 2VZVA 1G7PA 4L3EA 3WUWA 5INDB 4ZUSB 3FT2A 2A1WH 1TNMA 3B4NA 2NXYB 3MV8D 3T0WA 4U1LA 5ISZB 2AEPH 4QHUA 12E8L 2BSSB 4MD4A 5T5FL 4JFYA 1CFQB 1ZT1B 4POYA 1SJEA 4YDVA 1EGJH 3AU1B 1RZFL 2VABA 3VXMA 3VW3L 1HYSC 2VXVH 4PJ9B 3V9FA 4FNLH 4N5UA 3T2NH 3KYNA 3LSOA 4IRSD 2ZKHL 1UM6H 3F7QA 1YPZA 5DEGA 1KACB 2R56H 4JR9L 1A7RH 3SCMA 5BZWB 5I1KH 4MAUL 1E6JL 4M1CD 5DMGC 1DE4B 3W39B 1YNTB 5EIIA 2DM7A 3OKDA 3IDXH 3U79A 2P5EA 3WCYA 2YMXL 3IFNL 1B4JH 2A38A 2W0FB 2YA1A 1BREA 5AG8A 5D7IA 1XR8A 4JHAL 4N1EA 4PJGE 2KH2B 1HI6B 1CG9A 2VN4A 1EBPA 1DQQA 1UG9A 1YNLH 1HHJB 1FYTD 4GBXC 2EECA 2MOVA 2Z31A 4JZJB 4F37K 4YZFF 1IEAB 4EEEA 1ITBB 3RWJA 1H8SA 4WU5B 5EULV 3Q5YA 5AG9A 2FB4L 3MNVA 3QPQD 5F88B 4KROC 4YBLC 2IALB 5TF1H 5E8PB 3G6DH 2AABL 4HMCA 5E94B 1F2XK 2CKBH 4X6CA 5I17B 3MRQA 3WNMA 2QADD 3T0XA 1IAIL 3MRLB 4WTWA 4PJEE 3TM6A 3L3KA 1YEKH 3OB0K 1SEBB 4HS6B 1F8TL 2R1YB 4OZHF 5IJVA 1BECA 5IVOA 4NFCA 4IDLA 5IW3A 2OTWB 3UEZA 4KK8C 4PLNC 3ARQA 2AJZB 3CDCA 3MRMA 4MJ5B 3EKCA 5BW7C 3MGTA 3PL6A 3EZJB 1U3HD 2OJEA 8FABA 1NEZG 2DJSA 4OGZA 4UV7L 3TZVD 1WWAX 3L7EB 5L6YH 3RY4A 3C2AL 4P2QD 2YD8A 3V95A 1TQCB 1VACB 5JPMA 1DVFB 2VZSA 1B2WH 4KI5E 1S7SB 2VC2L 1NANH 1OGAB 5BV7C 4XGZB 1EH9A 2IBZY 2DD8H 3HPLA 4ZD3H 4X5XB 3S35X 2CK0L 2FECL 2BZDA 3TIEA 2E8ZA 2ATKA 3PP4L 3SCMC 1CDCA 5EU3A 3IU4L 5HYFA 3MLXL 2HFFB 4CAGA 3P9LA 2IH3B 3CLFL 4AG4H 2B5IB 1OF2A 2EE3A 4O58H 5AUMB 1D6VL 2JCCA 3M17A 4JZOB 4APQD 4F80A 2OTWA 5CCKH 1NFIA 4NN5B 4PD4K 4FQHB 2CMRH 1IGTB 3KLDA 3BI9X 4MZ2A 5DJDA 5JA8B 3PXJA 5IHZA 5CMAA 4H20L 1TJGH 3WUZA 1FDLL 3LD8B 3ZKNC 5H37G 3H0TA 4MNQB 4XNQB 3GMPB 4IDJL 1CD1B 2VDLH 3OXSA 3RZCB 2NNAA 1RIUL 3BRFA 2C5DC 3D0VB 3H9SD 1E27A 1DR9A 1MCKA 4YHNA 5GGVH 2AXGA 4W70A 3LKOA 4L3CA 1NGQL 1U8MB 4XP4H 5DHXB 4FQIL 4JFZH 2FJGB 3TBYA 4NQCD 2FGWL 1GGUA 4OUUA 2HN7A 4U1GB 1EAPA 2BY3A 4U1MB 2CRZA 3AM8A 3PJSB 4O2CB 5L0QB 4U05A 3K7UA 3SJVD 2YK1H 4YJZL 4Y4KD 1RU9H 4KMQA 4V1DD 5C0AA 2X4NB 3OV6A 1J5OL 1IAKA 5L2KD 3TNMB 1J86A 3LSOB 2NLJB 2ADFL 2GYSA 2YN3A 5CJQL 5KN5B 4PJCB 1FL6A 3PGDA 2NY5C 2PETA 4P9HL 1G9NL 2EKSB 4XCYA 4JZJA 4R7NB 5DK2B 3M1BB 4XAKD 5DMJB 5EUOB 1SMAA 1W8NA 2QQQA 2EDXA 4EOWH 3B9EA 2XZQH 1A6ZB 2IGFH 3D6GA 1YMMA 4U1NB 43CAB 3FQWB 1U2HA 3VXSA 1MJUL 1KF9B 2FEDC 4HBCH 4OF6A 2XTJE 3C60D 1JHTA 3ZE1E 4JQIL 1OSPH 4P23B 1QFOA 4CU6A 4TSAL 4EVNA 3RVWC 2IMNA 5C71A 5EBMA 4GBXD 4HIJB 1R3HB 3F7VA 1BIHA 5DT1L 1U3ZA 4F9PA 5EBWB 5B8CB 1JZ6A 3VFSA 1T83A 3T2NL 4N5EC 1IGMH 1OP5K 3UYPA 1BEYL 2X4UB 1QLEL 1YJDL 5EB9A 4N0FB 3ARPA 4NRYB 1ZVSB 2GSIB 1ITCA 2XYCA 3QR2A 1RZGA 3NCFB 3TN0B 5AUMA 4KHXH 3OQ3B 4HKXA 2XTJC 1B0GB 1RFDH 2Z35A 4NNPH 3NH7L 4M8VA 4M02A 1AIFB 1C5BH 3QJFA 2W9DH 3TT3H 4CVUA 1HEZA 5DJ8A 4LLWB 1EZVY 3DSNA 1QBLH 3DIFB 5CBEA 1WQVT 2C3VA 2XFXB 3HRZA 4L29A 5E2UL 4PJBA 4K55A 2EYTB 4QWWC 3ARTA 4Y4HA 4HGWA 3RDTD 3KWWB 1T04A 1TPXB 2ICWJ 3KYOA 3WFDL 3DVGA 1L7TH 4DUVA 1CCZA 4HK3N 3MC0A 4HEPG 1AGDB 3HPJA 4EUPA 5HYSA 3N1MC 4GRWB 2C3WA 2DM2A 2ID5A 3PGFL 3QB7C 4BQ9A 5BMFL 3ARBB 4G9DB 2KQMA 1NLBL 1U8LB 2JCCF 5FYLL 3LDBC 1WBZA 1M71B 1IAIM 5DRWB 3MBEB 1D5IH 4J23A 1KTLA 5DI8A 3PG2A 1U42A 3VRJA 3CNKA 3CMGA 5T1MB 4UU9B 2YRPA 4HCRL 4ZFZA 2XXMB 4PY7A 4X7CC 3V5HB 3D85D 1QEWB 2DBLL 3DVNB 4NQXA 4KMTL 1T2XA 2BVEA 2HTKC 5CJXC 3RU8L 4UDTB 2DIBA 3B9VA 5FYJH 4M9PA 1AHWA 3TT1L 5EOCH 3QFJE 3FFCA 3LRSB 4K94L 2YPLA 1NAMA 5IFHL 5TFSH 1KCRL 3FT3B 4P5TD 4YXLH 4PJHF 4ZQKA 2BSRB 4U6HA 4ZFFA 1EX0A 1R5WA 3UTQA 3RVTD 2RHEA 5I1DA 4ZOBA 2A6IA 3CXDL 1SJHA 1HHJA 5HHMD 4LASL 5D1XA 2AV7B 1HEZB 5DJ8B 2WUBL 4QHMA 2H3NA 1N5AA 3CVHB 1U8OB 5HHVL 4TTDC 5D7IB 5GSRB 3VJ6A 1K8DA 4RISL 1B0RB 2MKLC 1UT9A 4PJ7A 3NABL 4MQXD 1LP9F 2FJHA 4X80H 4NJ9H 1NJ9B 3WFBH 3WSQL 4RGOH 3ESUF 1MCPL 4CW1A 5INCA 1KB5B 2X4TA 5FKPA 3KYAA 2DQUH 4XCEB 1IZKA 2VZUA 3NVQA 1QBBA 1MRCL 3A0OA 3C60B 1DZBA 3QHFL 5LJYH 5I1LB 2NY4D 1OAKH 2V9RA 4RGNC 5C92A 3MV11 3WFHA 1TCRB 3QFJA 5FKAA 5ID0A 5CZVL 1JF5A 4TUOB 4JFYB 4RWHA 5SWSA 1X7QA 2IFFH 3UTTE 3EYFA 5JIKA 4DTGH 1YNKL 1F90L 1FORH 2VKXA 1RZ8A 4HH9B 1HSBA 3K3QA 1NUFA 1F4AA 2X89A 3UTPE 2DN7A 4HUUA 4YFEA 3DROB 4NKMB 3MNZA 1ZT4A 4GBXA 4X6EA 4FQIH 3W11D 3BZEA 4Z0BL 5LWYL 3WUWB 2EYTA 1WZKA 4OM0H 3HG1A 4ZS7L 3OAZH 1TZHA 3SQOH 3HZVB 3UCRA 4OUOA 4M7ZB 5GSVA 2OI9B 2HG5B 1KT2A 3MXVL 3C60C 1PZUB 3TVMA 5E4IA 1DBKH 1CLZH 5D2NC 5FV2A 3UTSD 4KVCH 2GY5A 4X6FB 2HJFA 2J12B 5IEKA 4WV1A 1IGCH 3TBTA 4ZS7H 3LIZH 1BBJB 4Z7OE 2FIKB 1I7RA 4YC2B 1ZVSA 2IEPA 4KK6C 4O02L 3INUH 3L7FA 3V7MA 4DUXA 5SWSE 5LCVL 3UTTA 4I18A 2X4UA 2ESVB 2VN7A 3D69B 4OFDA 3WDHA 2C3HA 3MLYL 5I1HH 4FABH 4J3SA 4Y5XC 2PNDA 4MB4A 2DQGL 5D1XC 3QJHB 1RVFL 3FOLB 5IBTH 1A3RH 1ZHKB 1OP5H 1UC6A 5H8DA 4XTRD 4JKKA 1I75A 1LO3L 3F7YB 1OB1B 3GBNH 4X6CF 2OTPA 1LNUA 1E4XL 3IDIA 1BQUA 3LRGA 2XTJD 4FQ2L 5C0IB 1AXSB 3MLWL 3P4OB 2B1AL 1ZT7B 4GKZA 2KZWA 5ALBL 3D3VB 2CRMA 4ZFFB 5E9DA 1EVUA 4HLJA 4U1NA 1M7DB 3ARED 4D9QE 5L6YL 3CFBB 7FABH 1ED3B 4KGLA 5HHQB 3GMPA 5FYLD 1LO2H 2UZIH 4XCCH 4PRIB 4P5KB 1ZLVH 5DR5L 3WIHL 2UYLB 3VFPA 3HLAB 3E6HB 3E6HA 1PLGH 3JTTB 3FO1B 2WQ8A 5I8OH 5D8JH 4OIIL 3PHSA 2D3VA 2APWA 1CFTA 1Y0LA 4K23H 1OGAD 4WJ5B 3WDIA 3O9WD 1RJZA 4JFPA 5HI5D 3F6IA 4AH2A 1EERB 1MLCB 1U8LA 4RAVA 3HI5L 4FFZH 3MJ6A 3BJLA 4KY1L 5IFHH 4YHKL 5DJ2A 2HFFA 3VWKB 3WNOA 1AY1H 4M48H 2MCPL 4YZFE 1U3JA 1H0DB 4LCCC 3VXPB 4P2RA 4ORGB 3BKCL 2G9HB 5C08E 2BOBB 5E1HB 4KRPB 1H3WM 5D6CB 1KBGL 4R2GB 4D9LL 1U9KA 5F1SA 1JZ8A 2ZSWB 2I25N 3STBA 1SBSL 3CC5B 3V52L 3VH8A 2P4AB 2X4SB 5SWZD 1C08A 5DVMA 5MP6H 1HH6B 4GMTH 4JHWH 4RMVA 5SV3A 3V4VH 4P5TC 4YDLC 3BH8B 1KIUA 3T08A 1AXTH 2CLRB 4P4RA 1MF2H 3RVTC 2DB8A 4L8CB 3V6OE 1NKOA 3HI6H 2YXFA 1A6UH 4JFOA 3BP4A 1XGUB 3REVA 3O8XD 5K59F 1EHAA 1CGXA 2Y72A 4Y4FD 1ND0B 3TVMC 3CDYA 4E41D 4KQ4H 3PWUA 2VOTA 5KOMC 3S5LG 3QG7L 3K4AA 3C8KA 5IJKA 3BZEB 3BE1L 2Q6WB 5TQ0L 4F58L 1AO7D 1FZMB 4NRZA 1FHGA 1X7QB 3CMOH 1K2DB 4Z7VE 5EU5A 3I50L 4O00A 1NDGB 3HC4L 4ETQA 4UIKH 4S1DD 2R1WA 4HIIA 3ARBD 1HXMB 4JHZA 1INDL 1K4DB 4DGVH 4PB9L 2HJLB 2VSCA 5BVPL 5F9WB 5F44A 4FFVD 3KVQA 4JRWA 4F7PA 4WHDA 2R0ZH 3O3UN 5JHLL 2AJXL 2GKIA 5D7SH 1WC7A 2XY2A 2AAVA 3W5MA 2DL2A 1J1PL 3W11C 4ODVL 2CD0A 4LLUB 1JF6A 2YD4A 3BQUD 2OJEB 2AJ3A 5IEHB 3OZ9L 2GUOB 2ICEB 5EUOE 2EH8H 1QNZL 4U6HB 2XWJB 4G6FB 4PJCA 2DI8A 3C9NB 3TNNA 3JWDC 1JWSB 3QQ9D 3ZLQC 2G75A 3HA0A 2LQRA 1YZZA 5DZNA 3L5HA 4NZJA 2AK4B 3CGTA 3ARWA 4YHYB 2YPLB 2R2CA 1UJTA 5E2WH 2Q20A 4RBPK 3V7AE 2R1XA 3BW9B 4XCNB 4MB3A 2ED7A 2APTA 2WP3O 5FO7B 2HTLC 4NQXB 5SX5H 1JIBA 1CI5A 3VRJB 4Y19E 2CDEA 5E2TL 3T8XB 5E9DB 4GRLD 1JGDB 5LAXB 4Y19D 3Q3GA 3T3MF 5ID1A 1Q9LA 4OTXH 5E6YA 3V5KA 3V5KB 5K9JL 5EOTA 1RZJH 1D5XB 3DI3B 3T0AA 2BOCB 1XR8B 5AWNH 4I5BA 1R24A 4HMDA 3T0ED 1TQBB 5TFSL 1GZPA 2H1PH 2VL4A 3ULUF 4PJCE 3VXME 4PJAE 5GJSH 3RWDA 1A6WH 3UXFA 2UWEE 2XZZA 1KJMA 2YPKA 3LY6A 5T1DH 1UQSA 1MAML 4WO4C 3MRKB 35C8H 2RCSH 4LPCA 3TESA 2IFGA 4BZ2L 3DVIA 1YMMD 1T20B 5H94A 5HGBA 1BM3H 4GW1B 3OGOE 1VCAA 5C70A 1BBDH 3CK0L 3QUML 3VWJA 1JGLL 5JORA 1UFUA 3T04D 2WW8A 2NW3B 4OZGE 4P2OC 4OZIE 2XRAL 5E24E 2HJFB 5D7IE 4PJIB 1D5ZB 3QNXA 1CICA 4Q74A 4YXHH 3SDXB 1P7QB 2X41A 1P5UA 5F1OB 4OI8A 5CBAA 4ELMB 5AD0A 1W8OA 2DIAA 4PGEA 2CXGA 1FIGH 4GRLB 5EDXA 2FL5B 2V17L 3VG0L 1LEGB 1X5KA 5I74C 4HS8H 3MREB 4GG6F 3O3AA 4TVPH 2C1OB 2VLRB 1CDIA 2MPAL 5FYLE 4XP9L 5J8OA 5HYIA 1OWWA 1G0YR 1F2QA 4AENA 4EI5B 1WFOA 5A16A 1ZEAL 4HHAB 4Q9QH 2YS4A 1UB6A 5ETUA 4PG2A 3SKOA 1T6WA 4KPHL 3BZ4A 4WWID 4RMQA 3S97C 1A4KA 4URTB 3OJVC 3MRJA 4NM8H 2XA8L 3UJTL 4O51A 4FMFA 43CAA 2RQ8A 3BWAB 2VITB 1FAKT 2BY2A 3STZB 2VQ1A 3MJ8A 5GJSL 2B2XH 5A40E 4ZUVB 4BZ2H 4E0RA 3MRRA 4TQEH 4Q58C 1G6RH 1G7HB 4X4YB 3VXUD 1TVHA 1ETZA 4PJ7F 1YUHB 3O9WB 4JN1H 2VUOA 4J12A 4EZMA 3QCUL 5I1DB 3U2SA 5IB1A 3PWJB 1DFBL 4X4MA 1IAKB 1Z9SA 4R4ND 3BPOC 4M9OA 1KN4L 1RUKL 1UWXH 4KZDH 5MEQB 3I75B 4WEBL 4PFEA 3MBXL 3SPVB 4F57H 2BVTA 3F8UB 3BKML 4BZYA 4HQQH 1LO4H 1BZQK 4S1QH 1HHGB 5I1EH 1L0XA 5ITBH 1MCCA 4NRXB 1DDHB 4P5MB 2FX7H 5KG9A 1UYWL 2BJML 4Y4FB 3O4OB 4LGRB 3OMZA 3O6FA 4NC1E 3ARFB 4Y5VB 5A2KH 2X4QB 2IH1A 4N8VB 1A6AB 2AI0H 3C6LC 2AK4D 1KJVB 4JRYE 5C7XL 3FMGH 2Y06L 5GGQH 4OZIA 4LKCB 3BPNB 4DQOL 1KJ2B 2X44D 3K74B 4YHIA 4HUWA 5MEPB 3V4UH 4PJGB 1NGWB 4ZTOL 5I1IH 1FNEA 5J1AA 2AJYL 4P0DA 2ZCLL 5D2LE 4JJ5A 2CDEB 4FP8L 4KQ3H 4PGJA 1W72H 4GG6A 3UYRL 1KV3A 2E6QA 4ODUA 1FN4B 1CU4H 1TITA 4QXUH 1A4JB 4M1GL 3EO9L 3OR6B 3GJFH 3GSNA 1NFKA 4ODVH 3GSRA 3SY0B 3GSOA 2VE6A 5I8KL 2V5MA 5FUZH 3FO0L 1CT8B 4FQXC 4XMLH 1OF2B 1N0XH 5KVFH 3U2SB 5EC1A 4NKDB 4I3GA 1YJDC 2AJSL 4WW2B 5E6IA 4WNQB 3DBXA 1MWAB 2B1HH 3V0WH 1GC1C 4OAWB 1F58L 2XG5A 5E1AB 3CUPB 4F33B 4OLUL 3OJMB 4JN2B 5CIPA 4XAWL 1G7LB 4H20H 4JFXA 2ADGA 3QUZD 1NGXA 2LAGB 5FYJD 1YDPB 1YDPA 4F2MB 3VD4A 2XNAA 1H3VA 32C2B 2QQKL 1T03H 1QHOA 2EDHA 2GFBA 3EYQD 3HAEG 8FABB 1LK2B 2YEZB 4N68A 1YEHH 4MWFB 4H88L 5GGSY 2L7UA 4HSQA 1IGIH 1N6QL 1KPRB 3DV6B 5KSUA 1NCDH 4KV5E 4IRSA 5EZLB 2AJVL 4QNPE 4CMHC 2NXZC 2VLLB 3G6JF 4LAQL 3RTQD 4Y5XA 1JGEA 3TJEH 2HVJB 1KBGH 1JE6A 2MHAA 5HGGS 5JW5A 4PGZA 2DLEA 3EO0A 2IWGA 3L6FA 5IIEB 4JY6A 1CU4L 1P2CA 4QXUL 3QWRA 3HE7D 2OR8A 3MV8A 5FYKL 4Z7VA 1N59B 3VFVA 2XWTB 2WAHA 1NCCH 1U2CA 4GRWF 5KVMC 1RK0A 4JPVL 4HFUL 4GSDH 1Q0XL 3ARZA 3BEWB 3Q6FB 1H3XA 5GS1B 3WL9A 1G7JB 1IGFH 3U4EA 4KZEL 3LQAL 4JO3L 5ICZA 2XNAB 3RWCA 3QH3B 4JM4H 3RKPA 3KYKH 5MI0B 1RURL 4YHLL 5KTEH 4ODHL 1ZKAA 4C58B 4EOWL 2BVPA 5ICXB 4K8RC 2FD6L 2IG2L 1S7XA 4PUBL 3RVVD 2YPKB 3JWOH 3NCBB 4PP1D 4WFFD 4MD5B 2D03L 4O4YL 1UM4H 5CP3A 3WKML 2D7NA 1HQRA 4JREC 4KMTH 3DMMC 1AGFA 3HHRB 3EDJA 1BQHB 3CDGB 5EWIL 3AS1A 2EIZB 4G8IA 1V8HA 3GHBH 2E6JA 4NKQB 2MQ3A 4XNUL 1DL7L 1RU9L 3O3BB 1JRHL 4R4NC 2JIXB 3H0TB 4U1LB 3V6ZB 2EEAA 3B5TA 1VGEL 2YSSA 3K80A 4HUNB 4Q2ZB 3FAWA 3SGDH 3EHBC 2AJVH 3RPIA 4HJ0C 3EJYC 2MWCA 3MLUL 2GSGA 5I19L 5EO1A 5ADPL 3VH8G 3QUKA 2EYSA 2CUHA 3HE6D 2B2XL 4GAYA 2C3XA 5HBBA 5IP4A 1KIQB 4F8TA 1N8ZB 2RJMA 5IMMA 2DQGH 1G7PB 2HLFC 4PRIA 4LARH 1IAII 2EDYA 1X4XA 1CR9L 3KJ6H 4MJID 3BVNA 2R69H 4JM2A 1K6QH 3VU2A 5DMGD 5HGDB 4MLSA 3OGCA 4LCYB 6FABH 4OKVB 5HGAB 4KVCL 3DV4B 4LIQL 3GMNB 5JDSB 1JZ2A 4IJ3B 1JGVH 1WFTA 1I9JH 1G7IB 2VJXA 1IGCL 1IKNA 3VDAA 4R9HA 3WMSA 2APVA 1TDQA 2GFBB 5H37H 5K9QG 3P11L 4ZG1A 4MGXA 3FQRA 1AGDA 1ZS8A 3EBAA 4LSPH 4EUPB 2NY5H 3MRDA 1ZXQA 3FOLA 1JVKA 4UT7H 5IMOA 3L7FB 5HXMA 4OAWA 1F4WH 1FGVH 3GKWL 2QHRH 4NHCL 5F1KC 3P4NA 3CXHK 5J7CC 3CD4A 1VGEH 4QT5B 3O9WA 2OJZL 2NX5A 4IIQC 3BAEH 2Q3AA 1CL7I 4HJJL 3OJ2C 5F7YC 2CQVA 2G5BB 5JLZA 3IGAA 4D0DB 2PYEA 5IMLB 3VXRB 4FXKA 2X7LA 1CXLA 5BS0A 1TZHB 4RDQG 2ITDA 4WU7A 4P23C 4HXBL 3WSQH 4Y5YA 5GSVB 4GW1A 3SGJC 2R2HB 5B4MC 2X1WL 3HC0B 4UINL 2JJUA 5EA0L 2YBRA 1WEJH 5CUSH 3FQNB 5FM8A 3O0RH 1A4KB 1HDMA 5DTFB 3HG1E 5I30H 4JRXD 5F7KC 4XRCA 1S78C 3N1PC 2ARJQ 1RULL 1BQHA 4R26H 2WSKA 4XVUC 3FRPG 2ZNXA 4QTIL 2AXJA 5C0AE 4JFEE 5CKGA 3T4YB 2UVEA 1FVDA 1MCQA 4XVSL 2VWEE 2EXYC 5DR5H 3VFRB 3VXPA 4AIOA 4JFED 2IPKB 2BVPB 3PWPE 2JB6A 4PREB 2BC4B 3I75A 2X4PB 1X5JA 1A14L 3QEQB 4PJEA 1N64H 3NCJH 2A6IB 3NA9L 4PJ7E 4F57L 1TVBA 2FYYA 1LO2L 4DUWA 1FG2B 3KPNB 5HD8C 5D1XB 3LEXB 1MI5D 1R5IB 1QFWL 3DNKA 3UO1H 3T3PF 4O2EA 2Q7NA 3VE0A 4TULL 4PLJD 3OZ9H 3HG1D 3GHEH 3MUY1 3JTTA 4MA1B 2RGSA 3L5WB 4OB5L 3X3FL 4M6AA 2RFXA 3WO4B 4JDVA 3RVVC 4XAWH 3I9GH 2XKNA 5F89B 1KELL 3ZO0A 3KXFD 5HI4C 5ACZB 2XACC 2HVKA 3V5HA 5JR1H 4HX1B 1QR4A 1Z9LA 1RUAL 4QXTB 4IOSD 5L7XL 4D3CH 4QRRB 4L3CB 5DYOA 4JQVA 1M71A 2HJLA 4IRSB 3EGSB 2EH7L 3SDCD 4HIHB 3HN3A 1MFBL 1NFDB 3F7YA 4LLAA 3D0LB 1O7VA 3ZTJH 4BFIA 4YXHL 3O2DL 3QDAA 1AKJA 2IQ9H 3NACH 5HPMB 4Q9RH 3EJYD 3ZHKA 1Z0MA 5IHZB 4WU7B 3UTTB 5JW4Q 4PJDB 5TE6H 4MZ3A 5JPNB 4JPWL 3RWFA 4P2OA 2X7LB 3PNWB 4HUXB 4M93B 2CLZA 4XX1E 1QLEH 3D25A 2BP3A 2ITDB 4U1SB 3RL1B 1XCQB 5HY9A 1J8KA 5C6TL 1U8KA 1ZLWK 4M6MH 4DK3A 2AXFB 4WFFE 3TV3L 5I76A 2YN5A 4JGUA 5M94B 3VGGA 4OM1H 4PJ5A 1AH1A 4HEME 4AL8L 1I1YA 3OAZK 3VXRD 1CE1L 2IANE 3MRHA 2XRAH 2BVQB 4MXVF 1Q9OB 1AP2A 4D0BB 1Y6NR 3QQ3B 1I3RB 4I4WA 2MHAB 1QBMH 3SE4A 1AGCA 5IHUH 3V6FB 2PCPA 4JO1L 4NBZB 4N5ED 4LGSB 1J05A 5GGVY 3IFLH 4QOKB 5DRZA 3KYMB 2E5EA 4XBGB 4XWOC 4J1UA 1TTFA 1G9EA 3SO3B 4KROB 3D85B 3MRBA 4JRXB 4RISH 2D9QB 4HWBL 3CFJB 4QCIA 1MLCA 3A6BH 3BO8B 2K1MA 4MDIB 1XF4A 1KCUH 1DDHA 1EXUA 2LV4A 2FEEL 4HFUH 3IYLW 1CFNA 2EH8L 4RGMC 2GK0A 4KJPD 3IS1X 3BWUC 1FRGL 1PQZA 3FQWA 3C6LA 4C56E 5T1KA 3JWDH 4MA3B 1A7OH 3QUYA 3K4DA 1OAUH 1JK8A 3FB5A 1R3KA 2FSEA 2I9TB 3CZFB 5EU6A 3OXRA 3ZT7A 2W9EH 1N3NB 1OARH 4PJ8C 5JIPA 5LXGH 5IT2H 4ZO9A 4OKDA 1T2QL 1UA6H 1CLOL 3DO3A 2VQTA 4L4TD 1OP9A 4Z76B 2WM0A 4E41B 1NMBH 1V3MA 4ZDHA 2V6HA 5HGHB 4JO2H 1BOYA 1NMCC 4IOFC 1QFUL 1N59A 1Y18A 4FTVE 4DOHE 4G7YH 1OT1A 2OR7A 1BD2A 2NW2A 5JXED 4MSWB 5DHVH 1MHEA 3SE9L 2XN9B 4R2GC 1S7QB 2E3VA 3F5WA 5JHDE 4UU9A 5CWSA 2ICES 1UZ6E 1UEMA 3CLFH 4LSQH 4OUUB 4AG4L 4E9LA 5E2JA 3WO4C 2AEIT 2HTKD 1KPRA 5KG9B 1QFWI 1JYNA 4E42B 1VHPA 5JQ6L 2VAAB 5F7WC 1XCTA 4YPJA 1RIVH 1KXQE 4X7SH 5K9OA 4M4PA 1NGXB 5JW4M 1JN6B 1WAAE 3N1QC 2VC2H 3DUUA 4XMLL 1I85C 4OF8A 6FABL 3AXLB 4LLMA 1K6QL 4ZD3L 3HMXH 1RUAH 5EBLB 2PYEB 4L3EB 3P73A 5BVJA 1YYLL 5GGTL 4DEPC 1A9BB 5E8DL 2UZXB 4M03A 1OQOA 2GJ6B 3JWDL 5GJTL 4MQXC 1U0QA 2VDNL 4OBRA 4ALAL 2O61B 3TO4C 4WFHD 4IHOA 4OGXH 4Y2DC 2Z35B 5AWNL 3HCVA 5BV7B 3EYFB 1D9KD 3B2VH 2A73A 1AI1L 3FB7B 2NQCA 2ATPB 4AIZA 1YEIL 4M6OL 3UTTD 4QRUA 5F97E 3FRUA 4P2OB 2BFVL 3O2VL 2DLGA 5TGBB 1GGIH 3P0VL 4NKOA 2AQ1A 3AROA 2I60H 4LSSH 4GH7B 1EJOH 1CD8A 4WIQA 5ITBL 5E5MB 4PRHB 1DBJH 4JN2A 4FFWC 3T09A 3BYTA 3DUSA 2GY7B 2BJMH 3EDEA 1CLCA 3HB3C 4LRIA 4X6FA 5IBUB 2PTTB 4P9HH 3B9KC 4G80B 5CJ8A 1WK0A 1WEJL 1AHWC 2YRLA 1U58A 2AV7A 2IAND 2YZ1A 2PYED 4NM4H 3QIUA 1TPXC 4OCWH 4PS4L 1WT5A 1DANU 4FQQB 1G9NH 5FIEA 4IMKA 1VFBA 4LVNB 3GRWH 3QDJB 3VRLF 4G6MH 2J88L 4ZPTB 3TPUB 1X5YA 2YK1L 3MUGB 3SO5A 4KXZI 1EFXD 4PLOB 1E28A 1P7QA 2QQLH 3BN9D 1IGJA 4LVOC 3VE0B 4Z0XB 5CLWA 2DOCA 4ZAKA 4KK6D 2XWBB 1NCTA 1YYLH 2IAMA 5GGTH 4Z7UE 3UC0L 4X99B 4X6CE 3DO7B 4HV8A 2CJUL 1JPFB 1QSEE 4KKAD 2GAZB 3RX8A 4Y4FA 3TBWA 4TSBH 5C0AB 4XB7A 4DGIH 4F7EA 5TF0A 2DQFB 5MEOB 5FXCH 4U0QB 4GAFB 5I8EA 4UTBH 3MBEC 3VXUE 5DZOA 1L7IH 2AERT 3BGMA 4AEEA 2KZ1B 3CH1B 3CH1A 3FQXB 4DGYL 3TH4T 4NNYA 2YD5A 4L3EE 5FGBA 2ARJB 2XXCB 4Y2OA 3AB0C 1DE4A 3W39A 3WBDA 4KDTA 1B6UA 5CCKL 4P46D 3HAEH 1IL1A 3GZKA 3EOBA 4Y4HB 1YPZB 4OQTA 3SE9H 3HNSL 4LARL 1RUQH 1T0MA 3DHMA 4PJ8D 2V2WB 5HDBF 2EDRA 3NH7H 3UPRB 4Z0XA 2VLJD 1AXTL 3PHOB 4X4YA 1F4XL 5JW4N 1LEKA 4L5FH 2B4CC 1K2DA 3BZFA 2Y4SA 3ZE2F 2CUMA 2DM4A 4ZUVA 2XKSA 3SDDB 1JI1A 1YN7A 3O11A 3SHSA 5ISZA 1BBDL 3CK0H 3MCKA 3OAUH 3EFDH 1FG9C 3RDTB 1UZ8A 4KK5C 4ZUSA 3EAKA 1KTLB 5T5NF 1YJDH 2DD8L 1N2RB 3LMJH 3E2HB 3NGBB 5BRZA 2R2EA 4FXKB 3VXRA 5ETUB 4XPBL 5MEND 5ACMA 5EO9A 4PRBB 4Z95H 4JHBA 4X7FC 3BX7C 1KC5H 3VFTB 2ICWA 3FB6B 4NGHL 4OF7A 2R9HD 4FG6D 3W9EB 4LCIH 2GJJA 3OX8B 3VH8B 5EOCJ 2IAMC 1LP9E 5TDPB 5IJKC 5GGSA 3WO3B 3KWWA 4Z7WF 5F9JA 1ERNA 4NM4L 2G2RA 5HYJD 2A6JB 2F5BL 3QDGB 1GYAA 5C07A 3CFEB 3ZL4H 1NSNH 1S9WB 3WN5A 4OCRH 3DJ9A 1ZS8B 4ZXBA 1CBVL 1LHZA 3V4PL 3PV6A 3UZVB 5GSRA 1QP1A 2JJTA 4NQVB 2A73B 3I6KB 4WUUD 1P84J 1JFQH 3LD8C 3RY6A 3BPLC 4PRAA 3MGTB 3PL6B 5T3XL 1C5CH 5F71A 3QIBC 1QSEB 2LFGA 2AABH 4OCXL 4P2YA 4NQUA 25C8H 4ETYA 1Q9WA 4PJXF 4M61B 4GG6B 3LQZA 4CVXB 1MCNA 5IV2B 4FXLA 1F3JB 4L4TA 1CICD 5GGRB 4P3WA 5KSBA 4JFDD 4JB9H 3SDDA 1KPUA 4JFOB 4NZRL 3PUCA 1FP5A 3ARBC 4DKFL 5I17A 2F8XC 2YPVL 4MAUH 4P5KA 4GQ9H 3F7PC 2LAAA 1F6AB 1F4WL 4X7TB 1FO0B 5GJTH 3TGXA 1C08B 4C4KT 1G9MC 3ULUH 2P5WB 1NAMH 2WBJD 4ODTL 4Y1AA 3CU7A 1HXYA 2HA1A 5C1MB 5FA4A 3EOBB 5CSGA 3MV7E 4OLYH 4K9EC 1LGVA 1XH3B 4WEMB 1K8IB 4M6NH 4YXKH 1ZWIA 2ARJA 2VZOA 4L8DA 1HHGA 4PJDE 4YBQC 5EFIB 1OL0A 5K9KB 2V2XA 4NZDA 3KPOB 2V5RA 5KSAB 1E4WH 1HINL 5CP3H 3EW3B 2BHYA 5FYJE 4H0GA 3HC3H 3OBAA 2FLRT 5GGUB 4CJ0A 2FWOA 5DDHA 1AC0A 4ZUTB 2NCMA 5DMIL 3NN8B 4PRDA 1EFXB 5E8OA 1P6AB 5C07E 2FBOJ 2JCCB 3MLUH 4HCRA 1M7IB 3ZTJG 1CFQA 1ZT1A 4NN5C 5J6GA 1BF2A 3K1KC 3LN5A 4S0SD 3MJ8B 2J5LC 3TBSB 5CEXB 4PV8B 5L88H 3VI4E 2P49B 4GMTL 3TO2A 4FRWA 4MB5A 1K3IA 1UENA 4XWGH 4EN3B 3QDGE 2FGZA 1ND0A 1C1EL 3DGCR 3MOBH 4OCYH 2HYMA 2X05A 1A14H 1QR1B 4F15B 4NKMA 3OX8A 3FFCD 3O2WL 1FZKA 3DUUB 2IGFL 1JPTL 2X2YA 3R1GH 4DJMA 1MHPH 2QHRL 4NHCH 4GAJH 1INEL 4KRMB 1SJXA 1BPVA 1PD6A 2YD2A 3GIVB 3MUHL 4BYHA 1LO4L 1FVEB 2ADGB 1N5YL 1QFPA 2EIEA 3I84A 1K5NA 2ZCKL 3SDCA 4K7PH 4O5LL 4QRUB 1KXVC 4Y8DC 1NGYB 4G9FB 5C0CD 5DJ2B 1XF3A 4UQ3B 1B0RA 3KXFA 5DJ0A 3M07A 3IGAB 4AH2B 5D7LD 5E8PA 3GBML 2ATKB 2L0DA 4ZFOB 4FTVB 4NO2A 1JPSL 4KDVA 4Z5RB 3DHJA 4AZ8A 3PXHA 1R5WB 3UTQB 3F6LA 3QEHA 4LDEB 3MFFB 4KK9C 2R9HC 3DGGA 1S5HB 3HZMB 4M62L 3BIAX 4PJDA 3TO4A 4X9HA 3GSNB 1D6EA 2SEBB 2Q8BL 1MCIA 5I1CH 4I2XB 3FQXA 5SWZA 1AKJB 4M43L 4XPFL 3T3PE 4MJ6B 4WTXA 4MJIE 4EI6A 25C8L 4JFDA 4YPGB 5TDOA 3SDDD 5HYJB 4H1LG 4Y19A 1I7TA 3QUYC 1CXKA 5JDSA 3PHQA 5BJTB 5IFAL 5IHLB 4K07A 3H42L 4PGDA 1BGXH 3WKMH 3IF1B 3VXQB 2YXMA 5HGDA 3FHQA 3WXVL 3BT2L 2VISB 3AFLA 3ZKMD 3NFSL 2XQYG 3QJHA 2P7TB 4PJFB 4RFNC 3QFDB 3OKEB 2OS7A 4JDTL 2DLTA 2WNGA 4PRPA 1CICC 3OKKA 4WDIA 3CSBA 3GJFA 3GSNH 2I9LA 4FQHA 2I07B 4OCNC 5GRJL 1T80A 4MQ7A 4UMGA 3DXAE 3NA4A 4X98B 2Y5TB 3N9GH 1WTLA 1KN2H 4RRPA 5CBEB 3UYRH 5DJ6A 1Q72L 3FQTA 5ERWB 1U3HB 3L1OH 1W0YT 1EHXA 5EU6B 4O58L 5I19H 5FUCC 2H2PD 3MRFB 4LHUB 3KPRE 4YR6B 4HUKB 1IEHA 5KVGH 1TLKA 4R0LA 3IDJB 1U8KB 3X13B 4UAOB 2R0KL 4QHNA 1NDMB 1S9WA 4TRPL 4PY7B 3RWHA 4U31A 1A9EA 1ZLWH 4G5ZL 4I77L 2H6PA 1NCNA 4DTGL 4GT7A 4MDJB 1CFBA 1I85A 4E0RB 3SDCB 5H35B 3WIFB 3QDMA 3K46A 4ZUWA 1HKFA 3WLBB 4YE4L 4A2MA 1CXHA 1VA9A 2O26U 3A6CL 4YQXH 3B2UC 5E6IC 2CXKA 1ZTXL 2QJDA 5DRZB 3DETC 1X4ZA 1UB6B 1CFSB 1ADQH 4WCYL 1IC7L 5CGYD 4P4KB 5ISZE 2YKLL 4R3SB 5L9DL 4X4XB 4R26L 3CXDH 4O2FA 3RA7L 5E8EA 2IQAA 3SKJL 1N6UA 3BHBA 3KPRA 3B9KB 3BQUA 3UTSB 5C09B 43C9B 3E3QC 1ZT4B 4GBXB 4X6EB 2GTWA 3QPXL 4I0PB 4KKLC 4NGHH 3T1FA 5CZXD 4BH8B 1QSVA 4FZ8H 4MJIB 4XCFL 5ESQA 2GW5A 4CMMA 1AR2A 1QFWM 4OFPA 3V6OA 1T5WB 3QIUC 4NQDA 3M1BA 1QRNE 4QTHA 3DROA 1TJIL 3VXUB 3BEVA 2NX5D 2XZAH 4KRNA 1GOGA 2KUTA 5DFVD 3EYQC 2NY6D 5DVOA 1FG2A 3KPNA 2EIBA 3TNMA 5E8NB 2ZPKL 3V8CA 3MOBL 2BNUA 3LKPB 3OAUL 4JM2F 1F11B 3S96B 3L5JA 1V3JA 1C7SA 1JZ4A 1QRKA 2J8OA 1EAPB 4G6ML 1WWBX 1NFDA 2OJZH 5I1AA 3MJGX 2FATL 5J6HA 4U1KA 2XOTA 1JPFA 4XNYH 5J12C 2ZOLA 3E0GA 3TN0D 1UWGH 1UYWH 5DD6A 1IM9A 3FT3A 3TWCL 1JNLH 2FJFB 1Q9KB 3FQTB 3N9GL 4ZO6A 1J0ZA 5DUMH 1JF1B 2OQJA 3L5IA 3O6FD 1IBGH 1TTUA 3PQYA 1SYSB 3PWVB 4XH2A 2VIRA 2PYFB 2IPTH 3LVEA 3S37H 4OJFH 4PG9B 4ZAKC 3QIWC 2QR0B 5L8JB 2LABA 4JPIA 4NO3A 5DMYA 5JO5A 5F9DC 3D3VA 2V5SA 4FQPA 4LK4A 1W72A 1JWSA 1GZQB 1MAKA 2O5ZL 1GC1L 4LLWA 1NCAH 3SDDC 1J87A 4N8VG 4C56A 2Z91B 3VFMA 2DWEA 3T65B 3RIFF 3W9DB 2ED9A 2PW2A 4YGVA 3QCTH 3KPLB 5ADPH 2IMMA 2BNRB 4XC3H 4AMKH 2R0WL 4H1LH 4PLKC 5CEYA 1UVQB 1J18A 2WLZA 4U3CA 5DD3H 4Z8FL 2Z8RA 3RNKA 4JB9L 4NWUL 1NMAL 5IOPB 4NCC2 3FN0H 3GIVA 4HBCL 2MMXA 3PQYE 2NR6C 3VXTA 3MRCA 3HI1A 2YWZA 4Q7DA 2VXUL 4XXDB 4R90L 4JQIH 3S36L 1MJ7H 5TPWL 1C16B 1SVZA 5FGBC 3OKYA 5JMRA 3QUZA 5IB1B 3X11B 3EJZD 4LL9A 4Y16C 5IK3B 43C9A 1FH5H 1PLGL 1PGRB 1WAAF 2UWEA 1JI2A 5CFHA 3KLHD 2DDQL 4XCCL 2H2PC 4ODHH 4PJAB 4NZUL 4D94A 2Z4QB 3WN5C 5FHBL 8CGTA 1P1ZB 5TJWK 3TFKC 3O3EA 4MAYD 4G7YL 4HUUB 4HD9A 3S3PA 1J5OH 1YC8A 2W38A 3DECA 4J3VA 3GSVA 1I7ZA 4YK4B 1N4XH 3TT1H 1N5YH 4L8CA 1QO3B 5E94A 1VB9A 1CFSA 1P6FA 5EU3B 1DFBH 1MAJA 3GIZH 4POZC 2NYYD 4ZXBC 1FFNA 3QZWA 3EOTH 1VADA 2FZ3B 3BP5A 1UA6L 1N0LA 1S7UA 1RPQA 4P57B 2ZWLT 5ICYB 3DETD 5CWSB 4LF3A 2YEZA 4GS7C 1JZ5A 5KBNC 3SE8H 4YUEL 3ARGD 3EYSH 5FV1L 1MWAH 1A6ZA 2QSVA 2OL3L 5EU6D 2V5YA 1H0DA 3ZHLA 4PTUB 2VDKH 2Y36H 5E2VL 3CAFA 4AY0A 3HR5A 2AJZA 3MRMB 5CZXC 1TJHH 4RQQA 3BRDA 2EKSA 2H32A 3LKSA 1G9NC 1EAJA 5IFJB 5I2IA 4KKNA 1FDLH 4IOIA 5L9DH 1RMFL 4Q6IA 3R06B 4NO5B 4QRTB 3U83A 3GJFB 1YEEH 5GISH 4C56B 3QIWA 5GIRA 4OM0L 1LK3L 3RGVA 1J88A 4XNYL 3FO2B 2B4CL 3SDAA 1W72B 4KWUA 5JHDA 1B88A 5T1KB 4ZUTA 4GW4B 3IAGC 4G8FB 4LHJB 1PSKH 3ARRA 4OZFA 2WQRA 2DWDB 1IFHL 1NMBL 3IF1A 1KJ2H 1T7ZA 2EDDA 5MEPA 4LRNH 4V1DA 5C0AD 2JIXA 5KVDL 1EEUA 2YOCA 1FNEB 1BQSA 4M8QB 3ECBA 3PWLA 5I9QB 4EBQH 4M6NL 4YXKL 4JO2L 3G5YA 4JREB 1QSFB 3LOWA 5DRXA 4LSTL 4M1GH 4M7LT 4WUUE 4BH7B 5EU4A 4XPGL 1QHPA 5DD6B 2FX8H 1OB1A 1CGTA 2XZAL 1IGML 4MXVE 2UUDH 1HQRB 3RJQB 4NQSB 5ANMA 3W0WE 4Z7UA 3N1GC 1MFDH 4CVZB 3UPCA 1NC2A 4OFKA 5F9JB 2JJWA 1C7TA 2J6EL 2DF3A 5CD5D 5IVNA 4P5TA 5E4EC 4ZFGH 4KU1A 1DEDA 3QDJD 1MIEL 5CS7A 4ELKA 4PJ9A 3CCHB 4Z18A 3FRUB 2HRPL 5KSVB 4PLJC 4F2MA 2VB5A 4NKIH 3K8KA 2PF6A 1EZVX 1MFBH 2VNCA 5E1AA 2BSSA 2Z0BA 1I9EA 5I2IB 5BV7H 2XI9A 3O0RL 2GUOA 1JFQL 4OLEA 1QG3A 3BT2H 2P24B 5HI4D 1X5IA 4ZOEA 3VGEA 3JVGC 2WINA 3QUMA 4PJHA 3G6DL 3EYOB 1KEGL 1WICA 4BM7A 4L9LB 5ACLA 2OLDA 1NUGA 1LQSR 5JHDD 3FAXA 1GAFH 1I8IB 3SDCC 2V9TA 2PO6B 1O5DT 3Q5TA 4YDIL 1YMME 3B8SA 1JGEB 4NCC1 4AL8H 5I9QC 4QEGA 1T7WA 2ZOKA 1DVFD 3B5HA 3WNNA 1S9KC 5E2VH 1RI8A 5B38G 2J8UB 2NY3D 4HULB 3WJLC 1BVZA 3BP7B 1T5XA 4D9LH 2H45A 1DUZB 1K4CA 2Q76B 4NO0A 2W65A 1F97A 1J0HA 1HIMH 1V7NH 4N9GB 1MI5A 3UPAA 3V2AR 1M1SA 1H15B 4MMZC 1JWMB 4QNPF 4YWGL 5CLTA 1IM9D 1KIRB 3L3JA 1P7HL 2FJHB 2YUXA 4P59H 3U46A 2AJUH 1AC6A 1G7MB 4DVBB 3PL6D 4DAGH 3GEWB 2RFXB 2VLKE 4FS0A 4XVSH 4GUPB 1EIBA 1JUFB 3EOTL 4HIEA 4U0RC 4NRXA 3GUTA 1IILE 2QQLL 4GW4A 1C5BL 1I1AD 1UADC 3WEXB 3GSXA 1X9QA 4MA7H 4L4VB 1T1ZB 4YAQB 3T3ME 4XBPB 1PSKL 4V1DE 5CJOL 4RBPH 3BPCA 1UM5H 4NYLA 3LN4B 4UB0H 5D2LA 1NEUA 1UWEH 3QEQA 2J8UE 1FC2D 2E7LC 1GGCL 3MNVB 1G1YA 1EFXA 4WUUA 3MRPB 5JZ7D 3WLWC 1WV7T 4OGAD 3CC5A 2JB6B 4H25A 5HJ3A 1E28B 4MAYA 3H9SB 2E7LA 1MHHB 2X1PA 3DX7A 3QWOA 1F58H 4OB5H 5INDA 3MV7B 5C07D 2UZYB 1A1OA 4X9BA 5DHVA 1GZPB 3LKNB 4NWTL 3OR7B 2D31B 4LFHG 3MJ7A 1BFSA 2B5IC 3MRRB 3WXWL 1MEXL 2QSCH 5DSCA 1QEWA 3V52H 4RIRA 1HHKA 1SY6H 4DVRL 3QH3A 2WZPD 4APQB 3RUGA 2AEQL 3G08A 2EDOA 4G3YH 1A3RL 3PHQB 5BJTA 5HYSB 4J8RB 3UBXG 3RIAF 3BZ4B 4NO3B 3OSKA 4NKOB 2WUBH 1DQJA 1S7TB 4JEGB 3O6ML 5DVNA 4LSUH 1AD0A 1EO5A 4JFFE 3DLQR 1TVDA 4S10A 1CDUA 4I9WE 4Y16B 3T0VA 2EDTA 1OQXA 1XIWB 3VRIB 4LSPL 5ISZD 1Z2KA 1IGJB 5IQ9A 4WUUB 1T22B 1ZANL 2BNQD 1PG7W 2VDML 3F12B 5SV4A 3UBXI 1YEDB 4ERSL 3QDHA 4KTEH 3ZSTA 2GJ6E 4GSDL 4PJHB 5J3HD 5IW1A 3MODL 1EHLH 1XMWA 2BK8A 3I02B 1TFHA 2J8UF 4L9LC 4XZUA 2NY7H 5E00A 4KVNL 3PDOA 4KC3B 4GAJL 5IQ7L 3ROLB 5EPMA 1JPTH 4YDKL 1CICB 3CH8A 1CDBA 1P9MC 5C09A 3UTSA 3DUSB 3ARDB 2VL5A 1R6VA 1XR9B 1F11A 5CP7B 5AYQA 1UCTA 2A6JA 2M2DA 5CD5C 2VAJA 2P47B 2W0LA 4PRNA 3CCHA 1YPZF 1PY4A 1SEQH 1U8PA 3G04B 3CUPA 3Q1SH 5D7JB 2R1WB 4HIIB 3NAAL 4R96B 3C5SA 5FM5M 1JRHH 3MROA 1XF1A 1DN0B 1EK3A 5IEKB 1AGEB 1UZ8B 3AY4A 4OSUH 3QNYA 2F9BT 3L1OL 5F6HI 2Z91A 5C0EB 3D48R 1N2RA 1DSFL 1YEDA 4M1DH 1AO7A 4O9HH 4HKBA 4P2CG 1T66C 1FCGA 3OR6A 2CDGB 1D6VH 5EUOA 1ULVA 4DFHA 5LCVH 1WISA 4PGEB 2BSTB 3P2TA 4BFGA 2DWDA 2HLAB 3G9VA 2VDLL 4HT1L 3KYKL 3AXLA 2B39A 4H25B 5HJ3B 3VGHA 4GG6E 1EHLL 1KCUL 4Y4HC 5DJ6B 3MLSH 5B3JF 1DVFC 4P2QA 3GMRA 3PWNA 1UJ3C 3KR3L 1ZANH 4MQ7B 1C12B 2Q1EA 1NH6A 5KVEL 4Z0BH 4MA3A 1RUPL 2DLFH 3KPSB 5DRNB 5DSCB 2EZ0C 2J5LB 3ORJA 5GS0D 2XZCH 2EEDA 3C2SA 4ZTOH 3FO9B 1ACZA 4Y88A 2I24N 4HZLA 4KTYA 4QHNB 2FEDD 3VGFA 3CFJA 3MR9A 2EO1A 5KW9H 3W9DA 1Q8MA 4L9DA 4NC1C 5F6IC 1HCVA 1I1AC 1D5XA 4NN6B 5IMKA 2JB5H 1JNHA 3PGFH 2ADIB 2QQNL 1WIUA 2PR4H 1YPZE 4LMQE 1UXWA 4YHPA 4EN3D 5CEZE 1IFHH 5CSZB 2CRYA 2H8PA 4ZSOB 5GRYA 3VXUA 4NWTH 5FUOL 1VADB 4CDHA 5C0BE 5I73C 5KVGL 3H3PH 4Z7VB 4LLVB 3MOQA 1I3RA 4I4WB 1A6WL 1CE6A 3PWPA 5GZND 3U36B 1KCSL 3DMMA 4JPWH 2FB4H 3O6LH 4NNXA 4GRMA 5KOVC 4K3EL 1IT9H 1U8IB 3BHBB 1KTDB 4XP6L 3MBED 2EXWC 5CJOH 4YHLH 4NSKB 1AXIB 1LWRA 3BKYL 3QRFM 5ANME 1Q0XH 4EQ2A 4M7LL 4KUCD 1WVZA 3RU8H 4PP2B 1PW3A 1PJ9A 4U1IB 5EN2A 5TQ2L 4LBEA 2ZG3A 3PV6B 3QEGL 1XIWD 4KKBD 1S7SA 1T1YB 2ESVA 4AIZB 5I75C 5SWSD 4HWEH 3AUVA 5HPOA 1R3JB 5GPRA 5C0BA 4FZEH 1S5HA 2A0LD 4EUPH 1URLA 4I13B 3MPCA 1NCWL 1WCBB 2ATPA 2JB5L 2FL5A 3S3JA 1OTSD 3V4UL 2NY4B 5FYLH 1NDGA 1S9XB 3GHEL 5CEYB 5DJCA 3U0TB 2VH5H 4OKVA 3E3QE 4ONHA 4YDIH 4ZNCD 1MUJB 4HG4J 2L7JA 1GPOL 1FZMA 4NRZB 1CDJA 1P53A 1SEBA 4HS6A 1SJVA 3IDNA 1N8ZA 1W0WA 1T2JA 3MRQB 4G8EA 1M7XA 3ZHDA 1CE6B 1OTTD 1F4YL 3OHXB 4YEFA 4LAJH 3ES6A 1HSBB 2D0FA 4TYUA 1BVLA 3CFDB 4XH2B 4OLXH 2Y36L 3A67H 4D8PB 3QIWB 1N0XL 3MODH 3RL2A 4F37F 2H41A 5FUZL 4KTEL 1OAXH 4B53A 4PRPE 4RSVA 3O4LA 5TDNA 1TCRA 1U8NB 3KPMB 1TETH 4Y5YC 1KB5H 1OSZA 2VDPL 1YY9D 3L5XH 1SM3L 5I30L 2XN9A 4IEFB 4NN6C 5F96L 2YD1A 1L0QA 1PBYA 3DXAA 1EUUA 1HQ4A 1BFVH 5J9PB 2AP2A 2XICA 5CILH 2H3NB 4G9FD 5C0CB 3UAJD 5GZOD 3L3GB 4RMSA 3O6KL 3TJHC 3MRPA 4Q0XL 3HMXL 2VLRD 1LMKA 3DGGB 5T3ZE 2XIDA 2PO6D 1J0IA 3E2HC 3NGBC 2NY4C 3D69A 4HC1L 4RGND 5H2BB 4HWBA 5DJXA 1G9ML 1HXYB 2E27L 4PJ9D 2AI0L 2Z9TA 4KPHH 1NFDE 3NIFE 3T4AB 2I27N 3QEUA 4I1NB 1RIVL 4XT1C 3S37L 1KJ2L 5EWIH 4PTTA 3ES6B 1ZLUH 2VABB 2NMSA 2CPCA 4X80L 1TQBC 4HDIA 3AREB 2PYFA 2K3TA 4N0RA 3ZKXB 4M5YH 2NY0B 1NBQA 1PX4A 4GAGL 4PREA 1FFQA 2VQ1B 4OQTL 5GS0C 1CTOA 5BRZD 4OCRL 5EU6E 3TYFA 4CUCA 2PXYA 5C2UB 2XTJB 1UGNA 3O2VH 1TXKA 3KPRB 3PV7A 1IQWH 3OL2A 4G42B 5D1QA 5HHOD 2BY1A 2HKFH 2JIXD 5CJBA 1I7TB 1HHHB 3JVGA 3CXHJ 3D2UB 1LNUB 3P4NB 4EN3C 3VXRE 1DANT 4LCUB 4LNVA 3LZFL 3EOAB 4WWKA 1ZHKA 4CADB 4XPBH 3TC9A 1R0AH 1INEH 1T89A 3MRGA 1F5WA 4QRSA 4YIQA 5CKAA 4PJ8A 3QULA 3RIAK 5CD3B 3QBTB 1QRNA 3QIBA 4FQ1L 1T21B 5GGVL 2VL5B 3H7LA 3QI9D 4MX7A 4KRPD 2V7NA 5FF6A 5GZNC 4OZIF 2O93L 5TE7H 1E6OL 4OIAA 4FTVD 4UI2A 3VFTA 3ZDYF 4XTRC 4WNQA 5D2NB 1A6VH 1AIFA 2Q7YB 1CTNA 2CUIA 4TUKH 4GXVL 4AQOA 4GXUN 5ADOL 2EXWD 3QHZL 5DUBB 4PR5A 2LU3A 3VWKD 3FONB 2OMNA 3RWFB 4HKXB 2EC9T 4JAMB 4KV5F 4HPOL 5DS8B 4GMSH 3QG7H 3X3GL 3TN0A 1DL7H 5HPMA 5H94B 5HGBB 4WI9A 4GAYB 3AREC 3O6LL 4LSQL 1K5NB 3P73B 4OCXH 1U92B 2XT1B 3IXAB 1FGNH 1C5CL 4LOUD 3KNBA 5IF0A 2O5XL 5JPMB 4QXGH 1AHWB 2D7PA 4MD0A 4M5YL 3B8YA 3J8F7 5CSZA 2W0PA 3V4VL 4G6KL 5LBSL 5SWSB 3QFDA 2DAVA 5HSFA 1KJ2A 3HZKB 5IVXA 3RFZC 4FFYH 5HI5C 2D9CA 1BMGA 3O8XB 1Q9LB 3WDJA 3OKLB 1QR1A 2F54A 3CDGA 4ZFZB 1LD9B 2R4RL 1PEWA 1U93A 3RP1A 2F58H 2IBGA 5DURD 2GI7A 3LQAH 5DD5H 4F7MB 4XX1G 4H1LA 1EFQA 3BIKB 2YD6A 4NNYB 4WJ5A 5DGQA 2D31A 1ES0A 3QXAB 1P7KB 1CDHA 4WHTB 4UV7H 2V7HB 1HIML 2GQHA 4XHJD 4J3WA 1S7VB 5MERA 1GOFA 1OTTC 5GRVL 3RWCB 4PRHE 3PGCA 5BS0D 4MHHG 1JYVA 3PGDB 4LSDA 5C8JB 2IF7A 4Q6IB 3BD4A 2YRZA 1UCBH 2WK2A 4R7NA 1Q9KA 1WBXB 2NY2D 3QXUA 1GC1H 1A0QL 2NLJA 1INDH 3AM8C 4K23L 5GHWH 4WUKH 3S8WA 5BOPA 1H3TA 1CVRA 4PJEB 5EZJB 5I0ZA 4YHPB 4OJFL 4P4KC 1WF5A 5M7QA 3H9ZA 4RGOL 1BZ7B 2DKUA 2W0FA 5D1QC 5IIEA 2X70A 2R23B 3T0EE 5E2WL 2O5XH 1CQYA 1U3YA 5EOQL 4DN4L 1K8IA 2YC1B 1QBML 2HN7B 1OVZA 5ICXA 4GUPA 1RUKH 1S7WA 3RAJH 2DJ4A 4YX2L 4K8RH 3VD5A 4PJXA 3ULVC 3O8XA 4S1DC 1G84A 4LCIL 1MFEH 2ZOKB 4J1UB 4P3DA 2X40A 2LVCA 4LP5A 1OP3K 2P8LA 5JUEH 4Y5YB 3VFNB 4F7CA 4I48B 3I6GB 3TA3B 4WHCA 4X8JA 1F3JA 4LIQE 4RCAA 1X3DA 1MCOL 3FZUC 1UB5B 5I8KH 5AEAA 1J0YA 1FJ1B 3DX6A 3R8QA 4JG0L 5IB4B 5HHME 3S98A 3W0WA 4HAGA 5F7FA 4PJAA 1RZFH 3C5ZA 4WW2A 4DKAA 2F54D 1JYXA 2R15A 4P9ML 2NX5B 3QEGH 1YMHB 3DURB 1W72L 5IK3A 3HCVB 4BUHA 4UIKL 3IETB 4D0DA 4NQVA 1Z0NA 2AJYH 1DBKL 3VW3H 2PTTA 3C5JA 2B0SL 3KXFB 2LU7A 5DJ0B 4FOMA 3GSQA 4BZ1H 2YR3A 4G6KH 1YY8B 1ZA3B 5LBSH 1N6QH 3RL1A 3GMQA 4MA8H 2Y5TA 4XNZB 4LEOA 3ETBF 3PNWA 1JGUL 1WBYB 5C0ND 5HYSG 5IM7B 3B2UD 1TZIA 1ZHNB 3TCLA 5DXWA 1F3DJ 1II4E 3VA2C 1TIUA 3LS5L 3QI9C 5CGYC 5EA0H 2M8XA 3THML 3PJSA 5DEZA 1DEEA 2IANB 4PD4J 2WWKO 2H9GB 1HSAB 1WIPA 2HFEA 4Z7UF 4UBDC 5FGRA 4KRLB 1U3HA 3MLWH 3SGKA 4KKLD 3VDCA 5TE4H 2VDRH 4G6FD 5IB3A 4OZGA 5A2LH 3HS0A 3O3DA 3QA3A 1BF8A 3MRNA 5IMMB 3WFZA 1WWWX 2FO4A 35C8L 1T7VA 3BDYL 2WV3A 4LLYB 1RAMA 5IR1B 5GS0L 4MNQA 3VXNB 3IJYB 3OKEA 5JHDB 3VG9C 4U6VH 1WAAA 2UWEF 4Y4KB 4WEUD 4RFEA 4HDIB 1IJ9A 4RDQF 1UJ3A 2H8PB 1TETL 5KVEH 1RZJL 1NBZB 3Q5OA 3S9DB 4LP4A 4TSCL 4FQJL 4K94H 4NPYB 2O5ZH 1QBAA 2MQCA 2XA8H 5EOCL 1AJ7H 4UQ2B 3MV9D 2Z31B 2CKNA 4G9DA 3CSYB 5EC2B 3D39E 5HVGB 4EI6B 2BC4A 3MXVH 4YFLI 2CKBL 1FL5B 1RJYA 2P5ED 4X7DC 4R8WL 4X5WA 3SE3A 2C1PA 1FE8L 3TO4B 1QSZA 3HNVH 5TGBA 3TBYB 4I0PC 3TWCH 1CGSL 1MCOH 1I1CA 4F7TB 5EG6C 3QEHB 1KNOA 2DTSA 4WFGE 2ENYA 3ARFD 1W0VA 1QTYT 2ED8A 3NCCB 3C08H 3LS4H 4CBPA 3CZFA 4NJAL 2FH6A 4LNRA 2C9AA 5LQBL 5K33A 4OGYH 4YX2H 3IRPX 1OGAE 2XN9D 3C6LB 4M62H 3RI5F 1GSMA 1UM6L 4QYOA 5J0BA 3UJJL 4G7VL 5GRZA 1OARL 4HKBB 3ZTNL 5IJVB 1WCQA 4PLKD 3AAZB 1EGJL 5C0GB 3RGVD 1NGQH 4Y89A 1XGUA 3MZGB 4H0HB 3REVB 1X5GA 5I76B 1ODAA 3BWAA 3CIQA 3S34L 3VA6A 3S36X 1IKNC 3RVUC 1LEKB 1Z5LB 3QUZB 3GB7B 2HWZL 5E5MA 1K4CB 1CLZL 3TBVB 1UZ6F 5KSVA 1P4BH 3CMOL 2AS5M 3C60A 3QSKB 3QDJE 2ZG1A 1YQVH 1CR9H 1CD0A 4MJ2A 1DVFA 9CGTA 2BOBA 2PTVA 1NDMA 1PDKA 4IRSC 4X5WB 4UOW0 3KPOA 1BFOA 1NCCL 1R24B 4YEEA 4OLVL 4BSVB 4X6DA 2AV1A 5EU4B 5K59E 2FATH 4KI5F 5DVLA 3RRQA 2P43B 2VO5A 4QRPE 3RKDC 5JW3L 3GSRB 5DK2A 2DWEB 3VFMB 1EUTA 1NEZB 4G42A 5DEGB 4HS3B 2CK0H 2CK2A 2VLKD 4ZQKB 1CT8A 1SQ2N 1ZA6B 3WE6B 3F65A 4NPYA 1XFPA 1EDQA 4Y4KA 3D39B 1VGKB 2DQUL 3MCKB 1I1FB 1CK0L 1XIWA 3CU1A 3VRIA 4ZXBD 1EEQA 4LMQI 2E8YA 3QUYB 3DMMB 4XP1H 2WWMC 4M6ML 3I85A 1CGVA 3QUKB 4MCYA 1DQJB 1S7TA 3HS0B 1YEFL 1FL3A 1XZ0A 5FDWB 1LK3H 2CDFB 2EDNA 4NQCA 4PG9A 3U0PB 4MQSB 1WUNT 3FT2B 4PY8J 4F9LC 5F96H 5DI8B 3MBEA 1VFBB 5IG7B 3OKMA 4FQXD 5HDBE 1KB5L 2VDPH 4UBDD 2VWEC 4OTXL 2CO7B 4LVNC 1AQDA 4ISVB 1OGTA 3V5DB 1J8HA 3H7BA 3MJ7B 3MUZ1 3B6SB 4MD0B 3WN5B 4HXAL 3HMWH 4WCYH 3IT8D 3RBGA 5L2KB 4D9RD 4PRHA 4HFWA 5FFLA 4X7EC 5I8EB 4LF3B 4YHML 5IROC 3TP4A 3IFLL 1MLBA 4NP4L 4NQTA 4RWYH 3AB0B 1I9RH 1DBBH 2GTZA 2OK0H 4XCNA 4M93C 4ONGH 1FFPA 5IB2A 3LEXA 1UH2A 3G6JA 1JMZA 3ARYA 2BNUB 3LKPA 4LEOB 1I1YB 1NUDA 3HE6B 6CGTA 2P8MB 1JK8B 3FB7A 4GG8B 5DMKA 3UTZA 3LN9A 2NXYC 4CMHB 3X3FH 1TJGL 2G75B 2YPVH 3MA7A 4DOHB 3JTSA 4XPFH 3OJDB 5D5MF 2V7HA 3VWJD 4EDWH 5F7HA 5C0GA 3GJFK 3QG6B 4WI6A 1T1XB 1I3GH 2GJ6D 4F7MA 4NDMB 1L6ZA 4JGJA 2E6PA 4QF1A 1CN4A 3QUXB 1NGZA 4PTUA 2VLMD 4MLIA 4APQC 1RMFH 4R6UA 2NY7L 4P4KA 1QBLL 4CNIB 2YWYA 1QVOB 2ZSVA 5JNYA 4NFBA 3WFEH 3MLXH 4XC1H 1GRWA 2IQAB 1F00I 3S35L 4YDKH 3SGJA 3TYGL 4F7PB 4HIJA 1W0VB 3O2DH 4DGVL 2X4SA 3JZ7A 3ZKND 4TNVK 1BX2B 3WS6C 4JDTH 4D0CA 2FX9H 4UTAH 3I50H 2VYRE 4TVPE 1FBIL 1RJLB 1XGRB 3D9AH 4HAFA 1KUMA 3IAQA 2BVQA 1OPGL 4NN7B 5J4MA 4FQCL 4JVPA 5AD0B 4LHQB 4U49A 3GK8L 3LKRB 2Y5EA 1A47A 4K3EH 3VGAC 4MSWA 4JGMA 2ZUYA 3CPLA 1DSFH 4YGVB 2OI9C 4PJIA 1NUNB 2E9WA 5CHNA 3SBWC 2W0KA 3BKJH 1A1NB 5C0JA 4GW5A 1H5BC 1T83C 1YEFH 4HK0A 4XPAH 2Y07H 4XPTL 3FN3A 4C83A 2VLKB 4PJFE 5DD1L 4RA0C 2Q86A 3HRPA 4CGTA 3HI1B 4OLXL 2IPTL 5IQ9B 1KEML 2FRGP 1MCPH 4HJ0D 2ZSWA 1A6TA 3PGCB 4MQTB 3X14A 1IBGL 1IGYA 3GKZA 3VFRA 1DLFL 3GI8H 3MRNB 5FK9A 2I9LB 4S1QL 4RX4D 1AQDB 3AMKA 3V6ZA 1FYHB 3PABA 2J8HA 4FQQA 5A43C 2XZCL 1MJ7L 1YEJH 4KVNH 4I5BB 1OD9A 4PGBA 2WANA 3QDGD 5E7BA 4YHNB 2NY6B 2BNQA 4M8QA 4JFDB 4YPGA 4XNXL 5DEFB 2NTSP 1JBJA 4HPYH 4HPOH 3ZT6A 4WFEE 4MCYB 4HZLB 4TNWK 3I3BA 4TUJA 5DQJB 4X9GA 3TYGH 1S9YB 4I0KA 2NX5E 4ZS6D 2FO1A 1EEZA 4EUPG 3U0PA 1Y18B 3ILQC 4Y8AA 2ZUQC 1R3IL 1Y0LB 3GMMA 1D6EB 1TZGL 5DLMH 2QKIB 2XKUA 2QL1A 5SWZB 1U92A 3L95B 3MJ9A 1IAMA 4JANA 1QSEA 1F4HA 5HHQA 4Z5RA 5T33H 1IQDA 2X1QA 4LHUD 1RIUH 4MJIA 3KS0J 5F6HJ 3QCVH 2Q7YA 4PJIE 4M7LH 1B9ZA 5IEHA 5FM5O 3GMOA 1AR1D 1A3LH 4PR5B 5DUBA 5CJXA 4FTVA 5J89A 3BGAA 1EXUB 5HHNB 2DTML 3TLRA 4P23D 4K3JH 4KJYA 4OF5A 2GEEA 4LLMB 2VTFA 3O4LB 1IC7H 5E99H 4C55A 4XNMA 2A77H 1KEGH 1XF5B 4LCWE 1YEJL 2H2SC 5I74B 3RDTC 3MMEA 1KLFA 2Y1VA 2CIIB 3UTPD 1XGRA 1RJLA 4IMLB 3MRJB 1F45A 3IU3A 2W9DL 1MH5B 4XAKE 2HT2D 3F7VB 2MKWA 3HC3L 2F19H 4JY4A 3CFCL 2JTDA 3Q0HA 4XPHH 5FGCE 3GMNA 4WW1A 4DZBA 1YA5A 2YBRB 4MHHI 4ZTPH 4OZ4B 1Z5LA 3BFOA 4U7SA 1S78D 5F21B 2B0SH 4OCSL 5SX5K 5DUPH 4JHAH 2JELL 3LEVL 5EH1A 5AAMA 3SKMB 2EE9A 3ZDYE 3MRLA 4I2XE 2F74B 2VLME 3TV3H 3UTOA 5HDLA 2QADB 2EXYD 1U6AL 2JJVA 3QI9B 3CVHL 1E4KC 1BJ1H 4FQXA 4Y5XB 5FECB 5ERWA 4H26B 5E9DD 1A2YA 1RZ7L 1VENA 5D7LA 2WMPA 3NZ8B 4W6XB 5L0QC 4W6WB 4E42A 1FL6B 1IAOA 3BJ91 1ZMYA 4F7TA 3AGVA 2LTQB 3QPXH 2DMBA 1OAQH 4LCWD 4G43A 1Z3GL 4MWFA 2Q87A 1K3ZA 3VRLE 1I7UB 5C08A 4JFFD 5A2JH 3JBG7 1MRCH 5EIIB 4Y1AE 1UH3A 2HRLA 4ONFL 5FDYA 2V2XB 2A2QT 3SEPA 4JDZA 2F19L 3JV6B 4RRPG 4MDIA 4H1LB 4G6JL 3OWEA 4JVUA 1G7QB 2CRIA 2D03H 3L3IB 2PXYD 5FCUH 3B6SA 3STLA 1YQVL 3JV4A 1E4JA 5GS2D 1U8OA 2QTEA 5DRXB 5BOZG 4XRCB 5KSBE 1RJZB 3O45A 4HWZA 3JV0A 3NIFF 4GRWE 4DW2L 1J05B 1HKLH 5EO1B 1LE9A 3QCUH 1ZGLB 3WJJC 3ZE0E 3MSPA 5I66A 3QEQE 4Y4HD 1FFOA 3SKNB 1Q0YH 4PB0H 3MQIA 4OD3H 4BQ8A 1A1MA 4NHUB 2YSSB 4XVJL 5I1KL 1UH4A 4DGIL 4CVXA 3EJJX 1M6OA 3QIUB 2A83B 3P4OA 4ZFOA 5KAQG 4L8SB 2AJXH 1S8DA 3ABZA 3DX9A 3L3HA 2ZUWA 4KTDH 4ZMAT 3KLSA 3AS0A 3RGHA 4PRAB 2AXFA 4PJCF 1T1ZA 4YAQA 2IH1B 3G5ZA 4N8VA 1NLBH 3MLZH 4YBLB 4LVOB 1E4KA 1IEBA 2HKFL 4YNYA 1CWVA 2AXHA 4HUXA 1XGQA 3HPLB 3TCLB 2BRRH 3BKYH 3I6LE 5ALCH 2Z92A 3UTSE 4U7KA 3NIGE 3MTRA 4JFXB 3U48A 1XR9A 4I0CC 4A6YB 3H42H 2AVGA 1TZIB 4EIZC 5FHBH 2OM5A 4KROD 4U6VL 4J3OC 3P9MA 4NQEB 3V8OA 3SE3C 4XWOD 1DQML 1L9MA 1XT5A 5D1XD 1KT2B 3P30H 1HXMA 5DYOB 4CVWA 3TT3L 2QADC 1IARB 1YUHA 4HQQL 2GJ6A 4QLRA 4UNTA 2DKSA 4YFLF 3QI9A 4K3DH 4CL7A 2AK1L 1U8IA 1AQKH 4LCYA 5IB5B 4CNIA 4KZDL 2ADFH 1LDPL 2R2EB 2VE6B 2P5EE 1B3JA 2HFGH 2ZJSH 1C5DA 1MEXH 1HILA 3WV0A 5BS0B 3EYSL 2R0WH 1U3HC 3U7WH 3T2PA 2VKWA 2OSLA 1JNNL 3L3OA 4JN1L 4W6YB 5J12B 1XCTB 4ELMA 1PKQA 2F53A 2P8MA 4WW1B 4JZNA 3MA7B 4GQPH 4HIHA 2R0LL 1NGWA 4YHZH 3QCTL 2ADIA 1JNHB 3D9AL 3VG9B 4ZFOL 2A6DB 5FAAA 5IGXH 5L2KE 4GO6B 3E6FB 5DK3A 3G6JB 1N4XL 5I1GL 4Q9RL 3GMLB