3V2AR

Vegfr-2/vegf-a complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
198
structure length
185
Chain Sequence
QHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPLVNRDLSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vascular endothelial growth factor receptor 2
publication title Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/signaling protein
total genus 29
structure length 185
sequence length 198
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR01
4UOW0 4Z7UE 4OI9A 5K33A 2BNRA 1M05B 5FOJA 1E6OH 2VH5H 4HGKC 2XPGA 5DVOA 3BFOA 2I26N 3TPKA 3U0WH 4W6YB 4LKXB 3T2OA 3VXUB 3GRWA 2F53D 4HIHA 2IPTL 3EO0B 1KJ2A 3BT2H 3QUMB 4I77L 3R1GH 1QVOB 3IYLW 4GQ9H 4LPCA 4U7MA 4AYFA 4KKAD 2VDML 1EAPB 4G6KH 3O9WB 4CL7A 1QNZH 2XTJD 4KK6C 1A0QL 4S2SA 5EORH 3RWDB 3DX7B 1LE5B 4G5ZL 4L8DA 1I7RA 1XAUA 3H3KA 3NTCL 1BAFH 3FQUB 4RGNE 3VXRD 3SDXF 4XVTL 4DOHE 4L8BB 4JFDA 4YQXH 3PV6A 5ISZA 2VE6B 3MV8B 3NPZB 2AABL 3HC4H 1CZ8H 3WFDH 5F3BA 4KKNA 4NQCB 1KEGL 1MHHA 2AI0H 1SM3H 1ZGLM 1HSAB 3MGTB 4HGWA 4PGBB 1JHKL 3DYOA 4P46D 4P9ML 5C08D 3UTPD 2X4UB 3CVHH 3DO3A 5CZVL 3WKMH 3B3IB 4ZFOA 1MFEL 2PXYA 3ZHKA 2X1OA 5FHBL 1Z5LA 2RCSH 2OP4L 3H42L 4LSVL 3DECA 4Y4HB 1DQML 2VDPL 5L9DH 3HMXL 3U9UA 2HT2D 4U6VL 1S7SA 4NP4H 4NQDA 3REWB 1JGVL 1RY7B 2FX7H 5JR1L 4M6NH 1M05A 1SY6L 4HCRL 3WEXB 3HCVA 1I8MB 4L4VD 1K2DB 4ISVB 4PRHB 1FYTE 3LQAH 2W59A 2EDEA 4LKXA 2VXUL 3VXUA 5LVEA 1BQLH 2ZUVA 1RUAH 2KQMA 3EO0A 3QUMA 1OWRM 1I9RL 4NZTL 1DBJH 1QVOA 4YDKH 3PUCA 1QSFB 5IHBA 4OLZH 4NM8H 1EAPA 4V1DD 1H3UA 1MJJB 3O9WA 5DMIL 3RWDA 3DX7A 1MWAH 4KHXH 1KN2H 4NC1E 4WI4A 4XP4L 1X5YA 3FQUA 4Y2DC 3FQNA 3T2QA 3R8QA 4L8BA 5C0JB 2R0ZH 2XFXB 4JM2D 1QRNA 1BIIB 1FC2D 3ZKXB 2VE6A 3MV8A 5I76B 1K3ZA 3ZLQC 4FQIL 3TM6A 3C2AL 4NQCA 4JHAL 3NACL 2YN3A 1QBLL 1HSAA 3MGTA 4PGBA 2YD9A 1MVUA 4PPTA 4ACPA 2X4UA 1RUKH 2J8HA 3WNLA 4EI5B 1XF5B 4NUJB 3RX7A 1QEWB 4M7KL 4JDTH 2NY2B 2EKJA 3CC5B 1T03H 3GJFK 5FUZL 5JTWA 4Y4HA 2V5YA 2F54B 3DYMA 4EKXA 3S96B 2I5YH 2BVOB 3I84A 1VCAA 3REWA 1I3UA 2VH5L 4JHWL 1EAJA 4M7ZC 1K2DA 4ISVA 4LF3B 4PRHA 3ZHDA 3U0WL 1YEJH 2CK0H 3V4PH 1IFHH 1RHFA 4M61B 1YMHB 1BQHB 3BT2L 4JJHA 4FXGB 3QEGL 3T4AA 3R1GL 4QXTB 4WCYH 1RZKC 2IBGA 4GQ9L 1E28B 1QSFA 4JPIB 2JK5B 4G6KL 4M3JA 2IQAB 2EDKA 1MJJA 4LMQE 4OF0A 3V6ZA 1N6UA 1ODAA 1AR1D 1HI6B 2UV3A 3VFRB 4OAWB 4TOYH 4X9BA 1WZMA 4EVNB 2YD5A 3X3FH 4NN6B 1BAFL 1B2WH 1NDMB 4HJ0D 4PJFF 4XGZB 5IB5B 5D1XD 2Z35A 3SDYL 4MD0A 4OBRA 4NKOA 4OGXL 2HT4C 2LU3A 4DN4H 1S5HB 5C0JA 2XFXA 4JFQB 1BIIA 3WFDL 5I76A 5CCKH 1UT9A 3MCLL 2ATPB 1QLRB 4NHCH 5DT1H 2AI0L 2QADC 1A7RH 1WWWX 4ODWB 3IDYB 2APTA 3CVHL 5C0FA 3G04B 5KJRH 2HWZL 4J6RL 1JF1B 4EI5A 3QDJE 1XF5A 3RUGE 1JYXA 1QSEE 4NUJA 1NKOA 1QEWA 35C8H 3NABL 3QUYB 3CGTA 3DRQA 1KSRA 5L9DL 4TUKL 5J6HB 2OMNA 4NP4L 3TIEB 2F54A 2Z0BA 3CX2A 3ILPB 2BVOA 4JG1H 2OZ4H 3ROOB 2FX7L 1YQ2A 4M6NL 4ZD3H 1VFAB 5J13C 1NUDA 3GO1L 3GSNB 3T8XA 3LQAL 5CILL 4LF3A 3VE0B 1OAZH 3HAEG 4Y16B 5JW4N 1MIEH 3JTSB 2V5SA 3IDXH 2IAMD 2VLLA 4NWUH 4M61A 2VISB 1YMHA 1BQLL 3EHBC 1BQHA 3KYMB 4FXGA 4GW5B 4GG6B 1DBJL 4QXTA 4Y0GA 3QEUB 4KJYB 1E28A 3FQWB 3MJ9H 5C0IB 4OLZL 4JPIA 4FQCL 5E2WH 2JK5A 2VWEE 4E41E 4LARH 2IQAA 3LPWA 3KXFB 4I9WD 2OSLA 1HI6A 1MWAL 1KN2L 3RGVB 4OAWA 3VFRA 4EVNA 3MREB 3GEWB 1NDMA 1W8OA 3S36H 4AENB 1IC4L 2BRQA 1S5HA 1MF2L 2NY4C 4JFQA 2AXFB 3NH7H 4PJCB 2NR6C 1KLGB 4N0CC 3RVUC 1FVDB 1IMHC 1YQVH 2ATPA 4HMDA 3WS6A 3WDIA 3QNYB 1IEHA 1KOAA 3ZHLA 1T66D 1OP3H 4ODWA 2R0KL 5E4IA 2MHAA 3BEWB 3QAZC 1RUKL 4WI8A 1FFPB 4FOMA 1JF1A 4LVOB 4OGYH 4JDTL 1J0ZA 1J87A 5JIPA 3DNKA 1T03L 1OL0A 3QUYA 3DHJA 3HA0A 2IH3B 2HLAB 4U3HA 2RR3A 3C8HA 1NUGA 3TIEA 2I5YL 3IDNB 1DQLH 4Y1AB 2C3HA 1WV7T 3ILPA 4X7DC 5FUCC 3ROOA 1IM3B 3U2SB 1VFAA 2V2XB 1EHAA 3BHBB 3GSNA 2CK0L 3V4PL 1IFHL 1JNNH 4S11A 4HWEH 2VISA 5KTEH 4OFDA 4LEOA 2Y5EA 5D9SB 3S6CA 3TF7C 2EE2A 4PRAA 1ZHNB 4GW5A 5EBWB 5ITFB 4F57H 5MEOB 4GG6A 3CSPA 3RWHB 4BFBD 4DEPB 4KJYA 3FQWA 3AS3A 1A14H 4MWFB 3MRHB 1BD2D 3LS4L 2D0HA 2DLGA 1IVLA 4MXVE 5HY9A 4TOYL 3TWCL 3KXFA 3X3FL 3RGVA 3WIHH 1B2WL 2FHBA 5HHXH 1KJ3H 3RP1A 4AENA 5JHDB 4P5TB 3TO2B 4DN4L 1RFDH 4M93C 4MMXC 1KLGA 5CCKL 3DTXB 2WBJB 3BZEB 2XNAB 1Y0LB 4NHCL 5DT1L 2COQA 1QFOA 2HFGL 2DLFH 1F2XK 3IKCB 3QNYA 4WW2B 1P7QB 4OZGF 2N7BA 3O8XB 5TQ0H 1RAMA 3SGEI 1X5FA 3BRGC 2VIRB 1A7OH 1C5DB 1YUHB 2VZUA 4PG2C 5E7FA 5KJRL 4Z7VF 5J9PB 5I1KH 1MELA 4APQB 4J3OC 5DEFB 4IOFD 5I71B 3QXVA 4X0KA 5C0AD 3ARBC 2IH3A 2HLAA 4G8GD 3IDNA 4JG1L 2OZ4L 4NWTH 4XTRD 2PKDA 3DX6B 3DO7B 4ZD3L 2B4CH 1IM3A 3QIBC 3U2SA 2V2XA 4Y19D 5T5FH 4JFEB 3SDXA 1TZGH 2DBLH 1MHEA 3Q3GB 3GSRB 2CO6B 4NWUL 1HXMB 3HE7A 2YPLB 3EAKA 5D9SA 4RFOH 1T7ZA 1BMGA 1PYWB 4KH2A 3B9DA 1ZHNA 5EBWA 5ITFA 5MEOA 4KVCH 3RWHA 3MJ9L 5T5NG 5L2KE 5E2WL 4N0FA 4MWFA 4LARL 3MRHA 2OM5A 3VJ6B 2BVQA 2EO1A 1B3JA 4HMEA 4K8RD 3VWKC 2NCMA 3S36L 3I9GH 4OB5H 1EGJA 4JN1H 2ZP0T 3KHQA 4X7TB 4JE4B 5IVXE 3AREC 5SWSD 5JHDA 2B39A 4P5TA 1BFVH 1I1AB 3TO2A 1KCRH 3NH7L 5EA0H 3PWPD 4YWGH 1IKNC 5JPNA 2W0FB 2W0LA 4GBXC 3DTXA 2WBJA 3BZEA 3MRKB 2XNAA 1YQVL 3P4MA 2D7MA 2YA1A 1Y0LA 3EYSL 5FYKU 2QEJA 4JGJA 4YR6B 3FB8B 3IKCA 1P7QA 1DBBH 3O8XA 2VLKE 1GPOH 2VIRA 1GGIL 2H9GA 2J8OA 1YUHA 4N9GB 4F7MB 5BZWB 5J9PA 4NFDA 5DJXA 3QDGE 2RAMA 3DMMB 4OGYL 2BNQE 4APQA 1AXTL 1L6XA 5DEFA 1AO7D 2W65A 4G3YL 1MVFA 1LD9B 1MFAH 1JYNA 1A3QA 1YY9C 4LPWA 1NC2B 5KVGL 2NY1B 4QRRE 4B5EA 3DX6A 3JWDH 5CGMA 4JFEA 3KGRA 4IRSC 4QGTA 1L0QA 3Q3GA 2IF7A 4YAQB 1JNNL 4HWEL 1HXMA 5KTEL 3UTZA 4F9PA 1O5DT 4D9LH 4ODSH 1U92B 3O4LD 1PYWA 1HNGA 4RGNC 1ITBB 3PWNB 1IBGL 5HHOE 5B39G 1A14L 4PJBE 3MBXH 1IC1A 1NGQH 3TJEH 3OSKA 3VJ6A 2R0WH 4EQ2A 3WIHL 5I1EH 4JKPH 5J6GA 4ZXBB 1NUFA 4LLWA 4QRPB 5HHXL 1KJ3L 2Y36L 4X4MA 3RL1B 4PJXB 4YDIH 4X7TA 1RFDL 1VADB 1EMTL 1I1AA 3TA3B 1GGUA 3RIFK 2WBKA 3TZVC 5BS0B 3IDIB 4P0DA 4DVBB 3MRKA 2D7TH 5DFTA 1RULH 4HXBH 1N5YH 1A7NH 4PJ9B 4I3RH 3LV3B 2DLFL 2QSCH 5TQ0L 3FB8A 2H41A 4HUUB 5GJSH 2OL3L 1A7OL 1JNLL 2X9YA 5D70L 5I1KL 4N9GA 1X6LA 5BZWA 1UWEH 4G6JH 3N9GH 4O00A 4FQ2L 5E1AB 3MRDA 3O45B 3O6MH 4JO3H 3GIZH 1LD9A 2R9HD 4ZUSB 3AVEA 5CJ8A 5GZOC 43C9B 1NGPH 1NC2A 4GMTL 1L9NA 2JF1A 2PF6A 1RZIB 2HG5B 2UYLB 2Z4QB 4N8CH 1TZGL 2DBLL 3ARGB 2WQRA 1EEQA 2WQ8A 4YAQA 3T0EA 1ZSDB 2WLZA 3UPCA 4JZNB 4RFOL 4WO4C 2IALB 1U92A 1T80A 2OI9C 4KVCL 4G8IB 2CKBB 2OJZH 4LRNH 3PWNA 2YN5A 5GS0D 2E8ZA 1CE6B 4C56B 3P11H 4YFLF 3G5XA 2OLDA 3AU1B 4ZXBA 3I9GL 3KNBB 3QUZC 2DMBA 4JN1L 4MZ2A 4LLDB 3RL1A 3RY5A 3SGEH 4PJXA 1X3DA 1BFVL 4GRLC 5EA0L 3LN9A 4YWGL 3MRBA 3TA3A 2H32B 3GMRA 3NN8B 4CVZB 5HYJE 3MSPA 4MNQA 5E7BA 5BS0A 3IDIA 4DQOH 3HG1E 4Y4KB 2NXZB 4NYLB 1YN6A 4PJ9A 5T5NF 3IAQA 2R4SH 3LV3A 5H35B 1DBBL 2E9WA 1GPOL 4U4BA 4HUUA 3SDDD 4C57C 3SE4C 5IBUB 5DUBA 5J06A 5DXWA 1EO7A 3EJYD 2HT3D 1E4KA 2MQCA 3BUYB 3Q5TA 4OCWH 5DWUH 5E1AA 1WT5A 5HSFA 3O45A 3T77B 5FFLA 1NCTA 1JPTH 4HQQH 4ZUSA 4N0UE 4JR9H 3UDWC 1BJMA 2J3SA 4FQXD 43C9A 1WWBX 5SWZE 4NJAL 1RZIA 3JWDL 2HG5A 4HEME 2GJ6D 3SO3B 3FFCB 5KVFH 2FX8H 2Z4QA 3AROA 3H3BC 3ARGA 2VJXA 1H3XA 3RWIB 3FT3B 4D9LL 5ADOL 5A2JH 3U48A 4XX1E 1ZSDA 3OKDA 5F88B 4JZNA 2IALA 3TT1H 1CGUA 5L7XL 5GZND 5HVFB 3ZT6A 4RRPA 4G8IA 1XIWB 2CKBA 4PJDE 3TH4T 4OZGB 3QWRA 4RMRA 4ALAL 5CWSB 1CE6A 4C56A 4B53A 1XGPB 1EFQA 5I1EL 4JKPL 4W6WB 3L3IB 3AU1A 3QHFL 1MREH 3KNBA 1LO0H 4LLDA 4U7SA 1AC0A 3S34L 4LSPH 1VSCA 2H32A 1HHJB 3DVNB 4ONHB 4CVZA 1LO3L 5ETUB 4MJ5B 2XOTA 2D7TL 1FNEB 4HXBL 1A7NL 4I3RL 4Y4KA 5D7IF 4NYLA 2QSCL 3S8WA 4LOUD 1XZ0B 5H35A 5GJSL 4U6HB 1IL1B 4NGHL 3DV4B 2FDBP 4S0SD 1BLNB 2GT9B 4WFFD 4G6JL 1OTTD 1QA9B 3BUYA 2X05A 2BY1A 3GMOB 3O6ML 4JO3L 4MVBD 2JJSC 2RQ8A 3T77A 2Z8WC 5JMOC 4MJ2A 1GOFA 4D9QD 3K8KA 1CLCA 32C2B 5EWIH 2E9IA 4N8CL 3FFCA 1J11A 3SQOH 2VWEC 2HKHH 5C3LD 2YS4A 4M9OA 4U33A 3FT3A 3RWIA 5IHLB 3DURB 2BK8A 4U7KA 5F88A 5E4EC 3KVQA 1JMXA 2NX5D 1T1WB 1D6EB 4LRNL 3KPRB 3PIQB 1XIWA 5IK3B 1MCIA 4OZFG 4OZGA 2AAVA 3P11L 4H20L 2IBZX 3HTLX 5CWSA 2XZQH 1XGPA 3L3IA 3GJEB 5JORB 3F7RA 3K4AA 3OGOE 4YUEH 9CGTA 4AG4H 1QFUH 1U9KA 1PFCA 1GOHA 1HHJA 3KPQB 4HPOH 4ONHA 5ETUA 4M62L 2KQNA 4MJ5A 4UV4H 4DQOL 1HKFA 1FNEA 2WAHA 2JB5L 1N0LA 5FYLL 4Z7WE 5C0BE 1I7ZB 2APXA 3H7BB 1CLYH 1A6VH 4U6HA 3ZYOA 3WFHB 2ZWLT 2NTFB 4KVNH 5KSBE 2CJUH 4LP5A 4G8EB 4YO0A 5JXED 1BLNA 2GT9A 4R90H 1QA9A 3VXSB 5DWUL 5D2NE 2B20A 4N90D 4JDZB 4JVPA 3QJFA 3WJLA 3OV6A 4DTGL 1JPTL 4HQQL 1U6AH 4Y5VC 4JR9L 2X10A 2GW5A 5BV7H 2HFFA 32C2A 3BMVA 3CVIH 1QG3A 2Q1EA 5C09E 5F9OL 4RGMC 1HXYA 3TFKC 5ALCH 3B2UD 2VLJB 4CNIB 1AFVH 1N7ML 3QULB 1GSMA 1EO5A 3TT1L 4FFZH 4WFGD 1H8SA 2HMIC 1D6EA 3WHE0 3PIQA 3OKMB 1KC5L 3MJ8B 5LGJB 3O3UN 4S1SH 3W0WB 2P5WB 2J4WH 4OZIE 4ZO6A 2P43B 4UNTA 1RV6X 1MREL 1DSFH 2EYSB 1AIFB 1LO0L 4EN3D 5JORA 1F11B 3BAEL 1CE1H 2RJMA 5GJTH 3C5ZD 4LSPL 3TYGH 1NANH 4M7ZB 4Z8FH 3PNWA 4KI5E 4F80A 3M17A 5HHQA 3EJJX 4ONGH 3KPQA 1DVFC 1FG9C 1P2CB 1N5AB 3UCRA 2CLRB 4NZJA 1J05B 4O02H 1ULVA 2NTSP 3BVNA 1I7ZA 2X5PA 3DOSA 5HD8C 4LLQB 5C92A 5F97E 4MHHG 3WFHA 2NTFA 4L9DA 4G8EA 2VZTA 1KB5H 5FO9B 5HJ3B 3THML 1BJ1H 1QBBA 4ZUTB 5TJWK 1QQDA 4IIQB 3VXSA 5TPWH 4Z6AT 1RUPL 3LHPH 4ZNCD 1XEDA 1DUYB 1RZGB 4DJMA 5HGAB 5BRZD 4K3DH 3I85A 1L7TL 3L3KB 1FO0L 2PYFB 5EU5B 1OD7A 2BHZA 4NN7C 4PIRF 3RIFF 1LK2B 3SQOL 4MNGE 5JQ6L 2QADB 2HKHL 4OF5A 5EH1A 4HJJL 5F9AC 1SEBB 2VLJA 4I2XE 1DQJA 1NAKH 4OD1H 3VU2A 2O93L 1J0JA 3QULA 3KS0H 3MLSH 2IGFL 5CGYC 4RAHA 4N0YH 3V79C 1RU9H 2HN7B 4TNWK 2B5IB 5KSAC 2D0FA 4FXLA 4FG6C 5DVLA 3TPUB 4I4WB 3MJ8A 5LGJA 2XZQL 5D7JD 4M48H 5KAQG 5JLZB 2V9TA 2P5WA 3W0WA 1IT9H 1UJ3C 1FGVL 3ARZA 1PW3A 5D7KE 5I6XC 3BI9X 1FRGL 1OGAB 1AIFA 2EYSA 4YUEL 1JYVA 1F11A 2ARJB 4AG4L 1QFUL 1CFVL 4CVXB 4JZJB 4NFBA 1M7DB 4HPOL 4LAQH 5J89A 4UV4L 4H1LG 1P2CA 3PXHA 1FAIH 1N5AA 2CLRA 4IDJL 2YZ1A 4P2RE 2V5RA 3WUWB 5ESVB 1CLYL 1A6VL 1T22A 4LLQA 2CJUL 3QSKB 4PD4K 5I75C 1G7PB 2XV6B 4WUUB 5FO9A 4ZUTA 5LXGL 5DA4A 3LB6D 4RIRB 3IS1X 4IIQA 1AJ7L 2X4RB 1QHPA 1DUYA 1RZGA 1U6AL 2APWA 5HGAA 2NY4B 3EYUL 1FVEB 1ADQH 3LQAC 3L3KA 2UVFA 4OI8A 3CVIL 5EU5A 3MV7A 1LK2A 3UBXI 3E0GA 4UBDC 3GMPB 1SEBA 3SKOB 3NZHL 3QHZH 2OQJB 3QAZB 5EU6B 4XHJC 3CLEH 3ECBB 2HN7A 3VG0H 1IEAB 2J6EH 3TPUA 3VRLF 3GSQB 4I4WA 4S1SL 2VDOH 1DFBH 1GIGH 1MHCB 2J4WL 2YXMA 5JLZA 3GK8H 1F90H 1G84A 2G60L 5GQBA 1DSFL 1QR4A 3PF2A 2X4OB 5DGQA 2E5EA 5F7KC 1OGAA 3SJVA 3ULVD 2PO6D 2ARJA 4NPYB 3UTQA 2UWEE 4Z8FL 4CVXA 4JZJA 1IKFH 3MLVH 1M7DA 4LSQH 3T0VA 4WV1C 4XAKD 1T7XA 5E2TL 3ILQD 2NY3C 5C0DB 1WFOA 4ZOCA 3EDKA 2OMBA 3IS0X 2ERJC 4O02L 4GXUM 5EN2B 1MCFA 4MYWB 5J1TC 3KPNB 5ESVA 5HHME 5CSBA 3CFKB 1BECA 1KB5L 3AB0C 3BPOC 1SHMA 1G7PA 5FYLE 4URTB 4RIRA 3SGDH 3LHPL 5HDBF 4BUHA 5E9DD 5MHSE 3SDCC 3L7FB 4PBVC 5FB8B 2EDLA 2X4RA 3RKDD 5JOPD 4P4KC 4YHKH 3DHMA 4K3DL 4M93B 3PL6D 3WN5B 1FVEA 2DYPD 1E0OB 2D7QA 2HYMA 4K7PL 1OVZA 1YN7B 4K07A 3TBTB 1LMKA 2RGSA 3LN5B 4NRYB 4XHQA 3GMPA 3MGAA 3U0TB 2FD6H 5D1ZD 3SKOA 4OD1L 4XNUH 4B7IA 2VERN 3N1QC 4HSQA 2BVYA 3MLSL 3CFIC 2OQJA 1HOCB 1RK1B 2G2RB 4N0YL 1GL4B 1RU9L 5ALBH 2UUDH 3ECBA 3O4OC 1IEAA 3UJIH 3GSQA 4OCXH 4M48L 4F7TB 1MHCA 1IT9L 3ARBB 4LRIC 5CUSH 3MPCA 4P2OD 3UTTB 1G1YA 1UQSB 1P4IH 3J8F7 2X4OA 2QQLH 4LHJB 4NPYA 3QIBB 2M8XA 3VH8G 3TO4B 2ICWJ 2ZUQC 1W8NA 4RZCB 2EC9T 4NKQB 2JELH 5D5MF 1FAIL 5C0DA 2QV2A 4RMVA 1QKZH 4RFNB 5EN2A 5KAQF 3SDAD 1R5IB 3KPNA 5BZDB 3CFKA 5I0DA 4EI6B 3JSSA 4QXGH 3D18A 1WIUA 2GY5A 1U8HB 4FABL 3VWKB 4J3VA 1JZ5A 1EUUA 3L7FA 3TCLB 3AREB 1JZ6A 5KW9H 1ADQL 5JZ7C 3EOBB 3WN5A 2YMXH 1XGYH 3LDBB 4YHIB 4GBXB 5GIRB 1YN7A 5HHPB 3LN5A 4HBCL 5FM4A 1Z0NA 4NRYA 5IFJB 4OSUL 3U0TA 3SY0A 5I66B 1YEHH 1LDPL 4LSUH 3QHZL 4MD4B 5MI0B 5HYFA 1HOCA 4N8VB 4Z7UB 1RK1A 4PG2A 2G2RA 3VG0L 1YEKH 2F53E 2J6EL 5IBLC 3RDTD 3BP5A 3STZB 2QSQA 2VDOL 3MBEC 2EH7H 2HFEB 2IAND 3EUUA 3N06B 1NCWL 4F7TA 1FGNL 3ARBA 1MFBH 2UVEA 4K8RH 4PGEB 3UTTA 1P4BH 1VA9A 1UQSA 4QEGA 2P1YA 3GSWB 1KB9K 2VN7A 1UC6A 5B4MD 1R0AH 1Q9OB 3QIBA 1FPTH 5HYIA 3TO4A 1EIBA 1IKFL 2AERT 2IBBA 3MLVL 3HUJF 4IRSB 4RAVB 3CPLB 3CU1A 3WIIH 4RZCA 3VXRE 4WI9A 2ZCLH 4AM0B 4PGJA 5ID1B 1FYHB 4F7PA 1FCCA 1CXHA 4H0GA 3ZDZF 4RGNB 2C9AA 4DOHB 1AGDB 1R5IA 4KXZI 4FP8H 5BZDA 4MAYB 4PTTB 4PLKC 4KROD 4ZUUB 4EI6A 2WWMD 1U8HA 5C08E 3UTPE 3VWKA 4M1CD 4YHKL 1BIHA 3AREA 1IAIM 5DHVA 1J5OH 4MB4A 1OP3K 5E03A 4HLJA 3EOBA 1IKNA 2ZJSL 3O2DH 4YHIA 3TZVB 4GBXA 5GIRA 1CLZL 2BY0A 3MRNB 5HHPA 3VXME 2BC4B 4MJ4A 1CGVA 5C71A 4PRID 2FD6L 5IFJA 4XNUL 2BSRA 3SGJC 4Q9QL 5I66A 1BBDL 4FNLH 4MD4A 1WISA 4WWKC 4Z7UA 4QHKI 3REVB 1DTUA 3GGWA 5JHLH 1B4JH 2FX9L 5KOVC 3INUH 3QFDB 5F9JB 5E56A 3STZA 4FQQB 1Z9LA 2HFEA 3QBTB 4H5SB 5CUSL 6CGTA 1MSPA 3RWGA 1P4IL 4PGEA 3ULUF 4HMCA 3CMOH 4PG9A 1KJ2L 2QQLL 4KDWA 4HXAH 4PD4J 3GSWA 4GW1B 1Q9OA 5E8NB 3WL9B 2AXJA 3CSBA 2W91A 1T0PB 4EOWH 3CPLA 3FMGH 2LABA 5ERWB 2JELL 1QFPA 2DQJL 3B9KC 3BD5A 4AM0A 4M7JH 4Q6IC 2B2XH 2HVJB 5D2NC 4WO4B 5IWLA 2FH8A 4LHUB 2OI9B 1NCUA 4IRJA 1HQRB 4XPTH 5K59F 4MAYA 4TNWF 1YEFH 4PTTA 4QXGL 1PX4A 4JVUA 3QH3B 3FB7B 4ZUUA 4HUVB 4YZFF 4NO3B 4P2QD 1IQDB 4TSAL 5H37H 2FRGP 5C70A 4GRLB 4ZS7H 3CDYA 2FR4B 5KW9L 5I1AB 4RAUA 2YMXL 1XGYL 4ZFOL 5F7YC 3HI5L 3NA4A 3TZVA 3OKEB 5EPMB 1KV3A 3MRNA 2BC4A 4KJWC 4HIIB 3DXAE 2YEZB 5HI3D 3BX7C 1YEHL 3C2SA 4OZHE 4UOW1 2AJZA 4R4ND 3DETC 4RSVA 3QO0A 4CJ1A 4PRPD 5DSCA 4M7LT 2V7HA 3REVA 1H3VA 5GS0H 3NFSH 2XN9D 5F9JA 4KI5C 3JV5A 4FQQA 1MFBL 12E8L 4U0QB 4U6XB 5DD5H 2HTKC 4PJ5D 4EUPH 4JN2B 1MCPH 2A9NH 1FPTL 4GW1A 5E8NA 4GXVH 3WL9A 3K8LA 4G80B 2DLHA 3WIIL 1Z3GH 3BOVA 4CAGA 1E4JA 5DRZB 4WI5A 2HVJA 4WO4A 2UZXB 1QD0A 3BN9D 1TJIH 3P40A 4IMKC 2GIYA 3MLRH 1BZ7B 5CLTA 5F93C 1U93B 2HH0H 1HQRA 4JQVA 3RTQD 3S3PA 5CFHA 4GRWH 5D2LE 3L3JB 1MCOL 3DI2B 4LKCB 1WCQA 3LD8C 3QH3A 3FB7A 4HUVA 4PUBH 3BQUC 3BUTA 2VKWA 4NO3A 1A7QH 5HI4C 1TTFA 2P5ED 4DGIH 2DQGL 1IQDA 4EEEA 3EO9L 3VD3A 2VAAB 2X7LB 1G6RB 1UACH 2FR4A 4NQEE 4KAQH 5I1AA 3JWDC 2VZOA 2IMMA 1I1RA 1CCZA 1T5WB 1FNLA 3QDJB 3RUGB 1ZHBB 2V9QA 3OKEA 5EPMA 5ILTH 1U8QB 1P9MA 4M9PA 2EDWA 2NLJB 4Y4FC 2VLRD 3DX9B 4HIIA 2YEZA 4Z0XA 4FNLL 4RWYH 3L5WB 2AV7B 4KRMB 3VRJB 3SE4A 4Y88A 4QF1B 1F6LL 1B4JL 3INUL 4CU8A 2EDTA 4JKWA 3K0WA 4X6CF 2GCYB 4JRXD 4BH7B 3MV9D 3RWFB 3T3PF 1RHHB 1YNTB 2SEBB 4QHNA 4U6XA 3UDWA 5CZXD 3MZGB 5D8JH 1DBAH 4I9WE 4HS8L 3Q5YA 5IVZB 4EOWL 1QHOA 4ZMAT 4G80A 4R2GC 4E41B 1N26A 1GYAA 4M7JL 5DRZA 4PR5B 2B2XL 3ARDD 1EBPA 2ICEB 3A6BH 3SQBA 5E99H 2H2PD 5J12C 3MUY1 4GJTB 2OK0H 1BZ7A 3QDMD 5CIPB 2ZKHH 1MAMH 1YEFL 3L3JA 3U0PB 4LKCA 4HWZB 1KXVC 1MFDH 2Y1VA 3QIUD 3JVGA 1MCSA 5E6IB 3FOLA 3O81A 5D4QA 3QRGH 5H2BA 3MA9L 2VAAA 2X7LA 1G6RA 1F8TH 2ICWB 2EEDA 2OX5A 5SV3A 8FABA 5EO9B 3QDJA 3RUGA 2ZPKH 1ZHBA 4LCCC 4DGVL 4YPJA 1U8QA 1QACA 4NRZB 4XP9H 1A6AA 2E7MA 2NLJA 2ED9A 3BKCH 1KB9J 3DX9A 3L5WA 2AV7A 1V7NH 1OGTB 1W72H 2IFFH 3SOBH 5I1JH 3VRJA 5D5MA 5GS3A 4QF1A 3NFSL 3O11B 3CCHA 4MD5B 4U1JB 5T1KB 5IESH 2ZCKH 3UMTA 4PREB 1XR9B 1XGRB 3QG7H 4JHBA 2GCYA 1HDMB 3DUSB 4BH7A 3RU8L 2JJSA 4Y5VB 1B0GA 2X4NA 1RHHA 4AIXA 2SEBA 4X5WB 2BY3A 1NUNB 5DEZA 1WEJH 1SBSL 2A9NL 3HFMH 3KPSA 1DUZA 4GXVL 1HYSD 4K94H 5IVZA 1Z3GL 3OJ2C 4N68A 4E41A 4K7PY 1UENA 3CAFA 4X80H 3QEQD 4PR5A 4UDTB 2ICEA 3MLPA 3VXUD 4OLWH 5IIEB 1TJIL 3MLRL 1DDHB 2K7QA 5I8EB 2XWJB 4D0CB 3U0PA 4PUBL 4RWHA 4OLVL 4HWZA 2R1WB 3W11D 4JFDE 1UH2A 1SBBA 5ISZE 2DI7A 1ZLSH 5E6IA 4HK3J 1UACL 5TDOB 4C4KT 4HAGA 4KAQL 3MACH 1PY9A 2ICWA 3DJ9A 1RMFH 1Z9OA 5C0AE 4P3DB 5L8KB 4HF5H 1DVFB 3O6FD 5EO9A 2X6MA 3OAZK 5ILTL 3PHSA 4G8GE 4X4ZA 3OKLB 2WM0A 4M43H 4NQCD 3UP1A 4NRZA 3G5YB 4X6DE 4BYHA 3IDMB 3HUJA 2CXKA 1U0QA 2DIAA 3TBYB 1KG0A 3D69B 4M00A 4WEBL 1C12A 4ZYKB 1OGTA 4MXQC 1H8OA 4PY7B 1NSNH 4Z9KB 4UDUA 3WFCL 1KLUA 4MD5A 3HMXA 4U1JA 5T1KA 4PREA 1HN1A 1XR9A 25C8H 1XGRA 4NQDE 1HDMA 4OM0H 2Z93B 3O2WH 4HH8A 4Y5VA 4ZAKD 1KJVA 1T20B 2GFBA 1YC8A 5FDYA 1SY6A 4X5WA 4N5EC 3U7WL 5D7LD 2VTFA 1FNSH 5BOPA 1DBAL 1KIUA 4NN7B 4DUXA 3MLYH 5CZKA 5CD5D 5L2KB 1JPST 2VRAA 2C5DC 4M6OL 5SWSE 1X5XA 2VUYA 2M26A 3A6BL 4Z95H 4UDTA 1S3KH 3PWPE 1AE6H 2HAZA 5F7FA 2WIIA 5IIEA 5IVXB 1DDHA 5I8EA 2ZKHL 1N8ZB 5KSAB 5DQ9A 1MAML 2YD7A 2DAVA 2XZZA 2XWJA 3EDFA 4KKCD 1NCBH 4D0CA 1WTGT 3T3ME 1UJ3B 1QPXA 4S1DC 2R1WA 5I6XB 1ZVSB 2LFGA 1QRNE 1IE5A 4R97C 2R2CA 3QRGL 5DO2D 4PJHE 1F8TL 2VLKB 4AY0A 3BRFA 3QI9D 1SJHA 1ZE3C 3VDAA 3QDGB 4P3DA 2C3GA 3L3HB 1DVFA 2BNQB 3OKLA 4YBHA 4XP9L 3QRFM 2DQCH 3BKCL 3G5YA 3CVHB 3CH8A 3IDMA 1YY8B 4UB0H 1V7NL 3SOBL 2IFFL 5I1JL 1EBAA 4KKAC 4ZYKA 5A2KH 3IDGB 4PY7A 4QRRB 4POZC 1Q1JL 4X6EB 5IESL 2ZCKL 3AS2A 2VITB 3QG7L 3O4LE 4WJ5B 4ZNEE 5C9JB 2Z93A 1IGTB 3NZ8B 4XNZC 2XYCA 5E1HB 1T20A 3OL2A 1WEJL 3TCXA 3PP4H 4MX7B 3CZJA 4XPBH 3VH8A 5HHOB 4XMLH 4K94L 4PJBB 5L2KA 4JY5H 4QXWA 3OJMB 1BEYH 2OTUB 2DD8L 4OCSL 1J0YA 1ACYH 3K2UH 3MRIB 2H8PB 5E8PA 2ZG2A 4P46C 3ARUA 4JFFB 4OCMC 3ZKND 5IVXA 5D7SH 3D87B 1D6VH 4HUWB 4CMHC 1MWAB 1C16A 3X3GH 3CFCH 3O41B 3E1F1 5LGHH 3SKUD 1ZLSL 2F58H 4UTAH 3ARTA 1F3JB 3HHRB 4NQUA 5ACMA 2VLKA 5GHWH 3RWJB 1RMFL 5EDXA 2D7PA 3ARRA 2EC8A 2DWEB 4WV1B 3L3HA 2BNQA 1F4HA 3MR9B 4O58H 1N3NB 4M43L 4P23C 5E2VH 4GW4B 3CVHA 1YY8A 4LGRB 2EXYD 3BPOB 2X4SA 5C07D 3GMNB 4QRRA 4L3ED 4OTXH 4X6EA 25C8L 2YA0A 2ILLA 4WJ5A 1A6PA 5C9JA 4P4KB 1FHGA 2YBRB 1CDJA 4AEHH 4JM2C 4X8XA 4ERSH 3ULVH 2KZ1B 1CBVH 3U30C 2NY6C 1JF5A 1NMBH 5D1QD 4MX7A 3MLYL 2CR3A 3CIQA 1AI1H 5A2IH 4PJBA 4AEIH 1UZ6F 2OTUA 5CMAB 3MRIA 4Y16D 4Z95L 2H8PA 3UZVB 1AE6L 3EJZD 2CUIA 2DQUH 2F9BT 1X4XA 4YBLC 1HH9B 4JFFA 3W2DH 1KJMB 3BKMH 4BJLA 2G75B 3O4OB 4HUWA 1BFSA 2DLEA 1MWAA 1NCBL 5HYJB 5I8CB 2V5TA 2BXYA 4KMTH 3ARQA 3HG1B 1NC4B 3O41A 4I0PD 4BSVA 4EIZC 4GRWE 4X5XB 3EDEA 2H2SC 4X6CA 3VMPA 3HI6H 3WLBB 3U4EB 1OARH 3RWJA 4MJID 2ZUQB 4R7NB 5ICZB 1JGUH 4PB0L 5FAAA 3EFDL 4KV5E 4WV1A 5I8KH 2AEQH 3PWLB 1OAXH 3S88H 4JDVA 1N3NA 2DQCL 2ORBH 2O5YL 3ETBF 1GGYA 5FV2A 4PRBB 3V5KB 1NMAL 4GW4A 1CK0H 1MCWM 4UB0L 1ZEAH 1MEXH 3ARYA 4WWID 3IGAA 1EDQA 3BH9A 5JO5B 4N0UB 3B83A 4RDQG 2DQFB 4RMQA 5GS1C 4AT6B 5SWZB 3GMNA 1AR1C 3ZE1E 3B5TA 3O3BB 2NXYD 4P9HH 5DC0A 1TTGA 3HNVH 3PWUA 3B6SB 3EBAA 2XA8L 1WWCA 5F1IB 3EOAB 4KHTH 3QUXD 1IILE 2WP3T 4OIAA 3MRPB 3PP4L 1E4XI 3Q6FB 4M5ZH 4Y1AD 4XPBL 4N1EA 1KPVB 1WFTA 2DOCA 4EDWH 4XMLL 2EXWD 4JY5L 4LBEB 1BEYL 1TMCB 1ACYL 3K2UL 2Q7YB 2GJJA 1ND0A 1W0YT 3QPQD 2FSEA 3BMWA 4NM4H 4UZGA 4BZ2L 1HH9A 1D6VL 1KJMA 3MBEB 3TVMD 1T89A 1WF5A 5HYJA 5I8CA 4LRIA 3CFCL 5DJ0B 1UGNA 1A6UH 2CD0A 4NIKB 1ZGLP 4KUZL 2NY0C 3HG1A 1D5XB 1NC4A 3MMEB 2F58L 3G9VA 4X5XA 5GHWL 3BZFB 3U4EA 3FL7A 1YNKH 3AM8C 1I85C 4YXLH 5ICZA 4FFWC 1YYLL 5E2VL 4D9QE 4PRBA 3V5KA 4Z7OE 2A9ML 3NA9H 3ROLB 2R8SH 3VWJD 5JO5A 3O8XD 4N0UA 4LU5H 2DQFA 2R15A 4FQ1H 2EZ0C 4AT6A 4ODHH 4O5LH 4OTXL 2R4RH 4X99A 2XKNB 1JGDB 3H9ZA 3R8BB 3O3BA 2VXTH 3HAEH 3H7LA 3B6SA 4WU5B 2OZ4A 1UXWB 5F1IA 3EOAA 4ERSL 3LKPB 3ULVL 1CBVL 3SDXE 4UNVA 3MRPA 4AEEA 2Q8BL 2W60B 1KPVA 5HXMA 4HKZB 2BHYA 4LBEA 3GMMA 4AEIL 2Q7YA 4R4FH 1RIVH 3S35L 4RQQA 2YPLD 4JY4B 3MJ9A 1PGRB 1WFUA 1WBZA 4WWKB 4Z78B 4D3CH 3BKML 4RGOH 1TIUA 4LPVA 2WANA 4UU9B 5LBSH 5E5MB 5J8OA 1PD6A 1EHXA 4KMTL 4AQ1B 3VXTB 5DJ0A 5LKNA 1J0KA 5IROC 1D5XA 1KCVH 3ZKMD 4GAGH 1G7IB 2BVTA 3MMEA 4Z7WB 3GKWH 5C0BB 5CEZD 2VMFA 5DJ8B 1II4E 3WNNA 2VSDA 4PJ7E 3BZFA 2YPKB 5KSBB 3D2UB 5JUEH 2R2HA 4PFEA 1CXLA 5T3XD 3O3EB 5I8KL 2AEQL 3S88L 3B9KB 4Q6IB 2ORBL 3TBWA 3MRMA 5D2NB 3UXFA 5I15H 2OL3B 1CK0L 3ROLA 4AMKH 1IM9B 3RVWD 3PHOB 4YBQD 3GJFH 5FM5M 3VW3H 3GDBA 5F96H 3ULUD 2XKNA 1JGDA 4OFVA 4P9HL 2X89D 3DMMD 5C09B 3IF1B 1PG7X 4H25B 3HNVL 1CFTB 4KHTL 4WU5A 1UXWA 1RIHL 3LKPA 1M71B 4XBEH 1JTPA 4JKKA 3S3JA 1MY5A 3PGFH 4JRYA 1JZ8A 4HJGB 1E27B 1WK0A 1UFUA 5J4MA 4LLMB 3S4SG 1WVZA 1T2QH 4JRWA 3KLAB 1JWMB 2MTPA 4OZIB 4F58H 2QBWA 1VFMA 2HA1A 4WWKA 4L8CB 4Z78A 2I9TB 1AGBB 3CXHK 1U8KB 4UU9A 2W38A 3D39D 5FKAA 3X11B 5E5MA 4DN3H 3WO3B 3WIHA 2O5XL 3KPLB 1EH9A 4NSKB 3VXTA 3JWOH 3ZE0F 2ED7A 1UM6H 3MX0A 1G7IA 4Z7WA 4QRPD 5FA4B 5DJ8A 3PABB 3RZCD 4JJ5A 3VD5A 4OLUL 3IFLH 1X6NA 1YNKL 2YPKA 5KSBA 1U3HD 3D2UA 4YXLL 3H2WA 4QXUH 1KEMH 3O3EA 4GFTB 3B9KA 4FS0A 4Q6IA 3R4DA 5D2NA 2XZCL 5F7LB 2R8SL 3UTOA 1IM9A 4CW1B 4NNPL 4LU5L 2LTQC 3PHOA 4RMUA 4FQ1L 4MB3A 3TNNB 3P9MB 2EDDA 4O5LL 5KSUB 3LD8B 3BQUB 4OGZA 5I1IL 1WZ1L 2BMKB 5ADPH 2A6JB 5C09A 2VXTL 3T0AA 3IF1A 3I3EA 4MNGB 2QL1A 4H25A 5DUMH 3NBNA 1CFTA 3HC3H 3HE6D 4HHAA 4I2XB 4XCFH 3T2NH 3C60D 3WHXA 5TQ2H 3MRLB 5DC9B 1EZVY 3LIZH 3MFFB 4DKAA 4PJFE 1YC7A 3OTTA 3OJVC 4HJGA 1E27A 1NEZB 3QQ9D 3T0EE 4FTVA 2J8UF 3NCFB 4MS8D 4CDGC 3SE8H 4Y4FB 1U8MB 4LLMA 4R4FL 3FCTB 1CICA 2NZ9C 3KLAA 1OTUD 1JWMA 4OZIA 2F8XC 2EC9U 2Q3AA 3NFPB 4GSDL 4L8CA 4RGOL 5LBSL 1O7SA 1OM3H 2I9TA 3H0TB 1U8KA 5FGCE 3X11A 1CGYA 5C6PB 2DLIA 1HIMH 4XPGL 3KPLA 4NSKA 4PJEF 3N1GC 4GAGL 1G0DA 4P2RB 3GKWL 3OB8A 3STLA 1I8IB 5FA4A 4DK3A 3FQTB 1XCTB 3PABA 1FFRA 4MNQE 4DWHA 4R2GB 4XC3L 4JANB 5JW3H 4YXHH 1EFXB 4JG0L 2DF3A 1D9KD 2BFVH 2IADA 5J12B 4YK4B 3KS0J 4AMKL 4HPYH 5ICYB 4IMKA 3WLWC 4CW1A 4XMKH 5DJ2A 3VW3L 2FJHB 3O6KH 3P9MA 5F96L 5BXFB 1EEZA 5KSUA 3ES6A 5EB9A 3BQUA 2BMKA 2A6JA 3MRJB 4MNGA 2Y4SA 4ZUWB 2CUMA 2ZCHL 1CFQB 4I2XA 1Z9SA 2DMCA 3HNSL 3MRLA 5ANME 4YGAB 5IB1B 5I1DB 1HILB 1HHIB 3MFFA 4KK8D 4LLYA 4XBEL 3WHE1 3LY6A 1KLFA 3PGFL 5AG9A 1U41A 5GGVL 3ULVE 4V2BA 1T2QL 2HJLB 1ROWA 5FA3B 1U8MA 3FCTA 2YRZA 4F58L 1QBAA 4YHML 3DRTB 2AEIT 5HPOA 3NFPA 2JCCF 3C09C 5E2JA 2UWEB 5ESAB 2LVCA 3H0TA 5EUOF 1E6JH 2P8LB 5C1MB 3TIDB 3JWOL 4Q2ZB 1JF6A 3V7MA 4KJQD 1KIRB 1D5MA 4P2RA 1OAYH 4AL8L 1P5VA 1Q0YH 2K9UA 1I8IA 2I24N 5HHMB 3FQTA 1XCTA 3K8MA 4X9GA 1CL7I 3MJ6A 3O2VH 1EFXA 1RSFA 4PP1C 3RFZC 3BGFC 4KZDL 1C1EL 4H88H 3O3AB 1ZTXL 5ICYA 4TSCH 3ARXA 1GC1C 1NDGB 1JYWA 4NFCA 4Q9CA 5K9KB 2Y5TB 2FJHA 3QUKB 3QCTH 5BXFA 1MIML 3BRDA 5ADPL 4KK6D 1Q72H 3MXWH 5DUML 3MRJA 4PRNB 4ZUWA 4WUKH 4XCFL 1CFQA 4BUGA 4F33B 3QIWD 3LKSB 1C08B 4W70A 4WY7H 5IB1A 1HILA 2CMRL 5I1DA 1LO2H 4L5FH 4HWBH 1NPUA 2WV3A 3MJ7B 4PJ8A 4W6XB 5FHAL 4L4TD 3RY6C 3UX9B 1DEEB 4J4PD 2WINB 2HJLA 1FFOA 3QJHB 5FA3A 1GGCH 1U8PB 2L4OA 4UUJA 3MCKB 2W9EH 3DRTA 3QZWG 3EJYC 3U46A 1BREA 3FO2B 3GB7B 1OM3L 1LO4L 1ETZB 2VL4A 2UWEA 3KPRD 5ESAA 4Z7VE 5GSRB 5SX5K 5ELIA 3OKKA 4LCWA 2P8LA 3TIDA 2Q6WB 1JMZA 4JFHD 1FCGA 2F8VA 1KIRA 1BZQK 3AFLA 4ELMF 1AGFA 2FATL 3LKOB 4X9IA 1L0YA 3BGAA 4KKLD 1HKLH 4YXHL 2Y7QB 1F6FB 1NAMH 1CWVA 1QSZA 4KKBD 2N7AA 4HPYL 3OZ9L 4P2YA 5GZNC 3SHSA 3QXDB 3O3AA 1NDGA 3UBXG 4ZDHB 5EU7E 5K9KA 3V4UH 2Y5TA 4BA8A 5J56B 3ZZ1A 4LVHB 4N1HB 4JO2H 1JK8B 4DK6A 1S9VB 5IVOA 5DFWH 1HINL 4ORGB 4R97B 5JXAH 2AW2A 4F33A 1FO0B 4Y2DD 3WDHA 1C08A 2G5BB 2L7JA 4Q7DA 5D72H 3MJ7A 3VGGA 4Y8DC 1A5FH 4YE4L 2F53B 2HJKA 2MWCA 1DEEA 3S3SA 1FP5A 4H8WH 5IMOB 3QJHA 2AXGB 1U8PA 5F3HA 1ZLWH 4AH2B 3BKJH 3MCKA 2GK0A 1JPGB 1MH5B 4OD3H 3IRPX 2YD6A 2K7PA 2E7LC 3GB7A 1FVCB 5IW6B 1ETZA 4G6FB 1QYGH 1E6JL 5EBMB 5GSRA 4BSJA 3GIVB 4I0CC 4KUCF 3VXRB 1A4JA 5IBTH 2Q6WA 1HK6A 3ISWA 4WHCA 1OAYL 5MP6L 2W9LA 1X9QA 4LVOC 4OCYH 4X7SH 4OJFH 3MROB 1F3DJ 2MJWA 1V7ML 3O2VL 2OS7A 1UJTA 1Z9MA 2PTVA 4P46B 5C08B 1MY7A 2EDOA 3F5WA 1PG7H 4H88L 4PP2B 4Q0XH 1R3KB 1JFQH 2XQYG 3QXDA 4CMHB 4NNXB 4ZDHA 2AKRB 3QCTL 5HHNB 1UM5H 1G9EA 5IQ7L 5H37G 3HE7C 3VXMB 1VGEH 1JK8A 4WUKL 4R3SB 5IMLB 4WTXA 1LEGB 1NCDL 1IAIH 1X5ZA 1XFPA 1QZ1A 4S1RH 4DEPC 4L5FL 2HT4D 4XCNB 2G5BA 4OZFH 3B2VH 4P23B 2F53A 5CAYB 1XGTB 5IMOA 1GGCL 1WSST 4FQHB 4YC2C 3AS1A 4P5TC 2W9EL 4Y5XC 2EIZB 1JL8A 1JPGA 1MH5A 3LKQB 4XI5D 4R26H 4BQBA 4OLYH 3W0WE 1FVCA 2JJUA 2UY7A 5IW6A 2HJFA 3QG6B 5EBMA 3GIVA 4CUCA 3VXRA 3SBWC 2VDQL 4LPTA 2DKMA 4BFGA 4JM2B 1T7VA 4ZQKA 3VXOA 1DCLA 5TE6L 1OGAD 3P4NB 3ZT7A 3UJJH 4MLIA 1KXQE 3B2UC 1HKLL 1OY3B 3MROA 4E5XB 5I17B 5KS9F 3GKZA 5I71C 1NAML 3O3DB 4PLJD 4P46A 5C08A 3BH8B 3EHBD 2Q8AH 4YBLB 1KB5B 1LEKB 1R3KA 2J8UA 3MLWH 2HTLD 1KCUL 1A1OB 3ZL4L 4NNXA 3V4UL 5DHYB 5I9QB 2AKRA 1LK3H 3C08H 1Q0XL 1I7TB 3QFJE 4WUUD 4JO2L 2L7UA 4LVEA 2Q87A 4F9PC 2FH6A 2BVPB 4PRPE 1G7MA 3G6AB 1XGQB 3Q6GL 3NCYS 5JXAL 3DXAB 1LEGA 3KLSA 4JB9H 4OZHB 1G7JB 3C5ZC 5D72L 4L4VA 3MV7E 3EIFA 4XCNA 3WD5H 3MLZH 5F8QC 2NY4D 4HIEA 1A5FL 1U36A 3FB6A 1UH4A 3MYJA 2F15A 3WSQH 1IGIH 4P23A 1RJLA 1WJ3A 1QBMH 1XGTA 4PJ5E 1I4FB 5LCVH 3FRPG 1HQ4B 3K1KC 4FQHA 4OD3L 2EIZA 5GS1B 3LKQA 5EU6D 3D48R 1WGOA 2NY7H 4CRPA 1QYGL 4NT6A 4M4RA 3QG6A 5DDHB 2DS4A 5IBTL 3SJVE 2D9QB 1LO5B 3UAJD 4JM2A 5DRNB 2BX5A 5KSVA 1C7SA 3P4NA 3F58L 4OCYL 4X7SL 4OJFL 5D2LB 4OF6A 2P5EE 5I19L 3BYTA 1HZHH 5I17A 4XNYH 3GMLA 2WUCH 4Q0XL 1INEH 5T33H 4PLNC 1PVHA 4YPGB 1KB5A 4WI7A 2AQ3A 4NQEB 2XT1B 1A1OA 1UM5L 2M2DA 2VLRE 3QEHB 2CRYA 5EO0B 4X6FB 2EECA 4PV9B 3CFEB 1BBJB 1I7TA 1I1CA 3T0EC 3DVFA 2P44B 3G6AA 1XGQA 1IAIL 3A67H 5EUOA 1OLZA 4OZHA 4XVJH 4OKVB 1G7JA 4I48B 5BVJB 4JRXE 1BFTA 4R96B 1CU4H 1BQUA 2I60H 3V4VH 3ARVA 3NGBB 3LPFA 2G5RA 3S4SA 4YHOH 3EOTL 1CT8B 1HQ4A 1JNHB 5D7IE 1KCKA 1MJ7L 1YZZA 5DK2B 4R26L 5GS1A 5CKGA 2I07B 1FFNB 2IC2A 3N85H 4ODVH 3LB6C 5LQBH 1CYGA 4YHLL 4WGVB 1I1FA 5DDHA 2GUOB 3F65A 3P73B 5F6IC 1PLGL 3NCYP 5D1XA 1UCBL 4H1LH 3QDME 4DZ8B 5GGTH 1S7WB 1LO5A 3VMNA 1SMAA 5DRNA 2DJSA 2CDFB 3GSXB 1YPZF 1EGJH 3UJJL 5B38G 1A9EA 1BWMA 2V7NB 1UEMA 5D2LA 3WE6A 3L7EB 2QKIA 1Y18B 5CLWA 4U1HB 1A9BB 4XB7A 5GGVY 1F13A 2Q8AL 3QQ3B 4LCIH 3VFNB 4LSSH 1ORSB 3MLWL 4I0KA 4YPGA 2WSKA 1VFBA 4JVWA 4LASH 3S5LG 3WKNA 2VQUA 2NW2B 4BH8B 3V95A 4P48A 2AXHA 1LK3L 5HBBA 3C08L 3W9EB 3QEHA 5EO0A 1TCRB 4X6FA 1BBJA 3V5DB 3ARSA 1JPFB 4WFED 4NKIH 2PO6C 3QXUA 1ADQA 1F4XL 4FRWA 3BDBA 1ZLUK 4OKVA 5E8DH 2FJGA 2P4AB 4I48A 3WD5L 5BVJA 2NW3B 3MLZL 5SX4I 3AM8A 3I2CH 4R96A 3WSQL 1IGIL 4FQPA 4BFEA 2IAMA 4P3WA 3ILQC 1AY1H 4GBXD 3VGEA 4MA3B 3SE3A 1QBML 4ELMA 5HDQH 5LCVL 1DQTA 4J3WA 1H5BC 2WUBH 3DARA 2J6EA 2XPGB 2QQKH 2NY7L 3SCMD 5HYSB 3QEQE 2I07A 1FFNA 2Z8SA 2E9BA 5CEYA 5MEQB 1N2RB 3VGHA 2NXZC 2GUOA 1KJ2B 3P73A 5JOEA 3MXVH 3TEUA 3WJJA 4MA7L 2I27N 3DVIA 3WFEH 4BQ6A 2FEEI 5JIKA 2CDFA 2FZ3B 1YY9D 1B0WA 4QHKJ 5CEZH 1BGXL 2VXQH 3GSXA 1WLHA 4U1LB 4ZFZB 4OT1H 2V7NA 1HSBB 1T1XB 4K55A 5T3XH 4IRSD 5D1ZC 3L7EA 2BNUB 1Y18A 3KPTA 1UYWL 1A9BA 4JFDB 1INEL 5T33L 4EJ1C 3VFNA 1ORSA 4RGND 2P7TB 2NW2A 4BH8A 4P9HC 1FZOB 5C0AB 3W9EA 2YHGA 3ULUH 5DC4B 3IJYB 1TCRA 4G8GB 1NFDF 1MLBB 3VI3F 3V5DA 1X44A 1JPFA 2VL5B 4X6DB 2WWKT 1LGVA 4XVJL 4N1CA 4CN1A 4ZFOB 3P0YL 2EDHA 2VZSA 1Z5LB 1IQWH 2NW3A 1CU4L 4J1UB 4QRUA 1YECL 2I60L 1KULA 5BMFH 4Z0BH 4R9HA 4XC1H 1FZKB 3BXNB 4MA3A 5HVHB 1IC7H 4NQDB 5D7LE 1BVKB 4NZUH 1KN4H 2LTQB 3HCVB 3MV01 1CG9B 3X12A 1MJ8H 5DMJB 1RPQA 2GI7A 4ODVL 3N85L 5AZ2L 1U8JB 4KDTC 5HYSA 1FZMB 3BESR 4XRCB 3K4DA 1DN0B 5LQBL 5JQHC 4Z7OF 5MEQA 5JW4Q 1N2RA 4GKZB 5FV1L 5AYUH 1FYTD 2J88L 5SWSB 1TFHA 1UWGH 4MA1C 1SMOA 3MYZA 3PWPB 3E8UH 4ZSOE 2FZ3A 5CJQL 3GNMH 4U1LA 4ZFZA 3PP3H 3H9SD 4DAGH 2Q20A 1HSBA 1T1XA 5EU7C 1XF4B 5FYJL 1DN2A 2PNDA 1GHFL 1ZKAA 3VD7A 3WJLC 2BNUA 2GK2A 3FQNB 2MCG1 5CJ5A 5FCUL 1QRNB 4LCIL 1I1YA 5F1NA 1KBGH 4LHUD 4PJHB 4LASL 3UBXB 4IBLT 1WZKA 3RDTC 2P7TA 1J1XL 5DI8B 1FZOA 4KY1H 5C0AA 1LP9F 1TVHB 1TXKA 3IJYA 4G8GA 4CBPA 1MLBA 4JQIH 1MVUB 2VL5A 4X6DA 3QPXL 3Q48A 3QUZD 3KYKH 5E8DL 5FYJU 4GRLD 3MNWB 1NCAH 3I2CL 2AJSH 5I16B 1I9IL 3CSYB 4J1UA 4Q9RH 3IJHB 1YYMH 1AY1L 1FZKA 5JW4M 5DD0L 3BXNA 3O4LB 1H15A 2AVGA 4NQSB 4W4OA 4PJ7F 1BVKA 3QZWA 1ZHLB 3G08B 1CG9A 4KROC 3RAJH 5K9QI 1U8JA 2Q7NA 1FZMA 4XRCA 1DN0A 2ZUXA 3DPBA 2X4TB 3OKNB 4CGTA 4GKZA 5ICXB 3RVXD 3T4AB 4M1CC 5SWSA 4RMTA 4UNUA 3GHBH 5IFHL 2DTML 3MLXL 3PWPA 1T0NB 2Z31D 2VXQL 5D71H 3UTSD 1MFCL 1IC5L 1FH5L 3V6ZB 1W2KT 1EX0A 2XZAH 3TV3L 1XF4A 2ZSWB 4G7VL 4NZRH 3NOIA 2Z35B 4MD0B 1A4KA 3BE1L 4NKOB 1PZUB 2MCPH 1T2JA 1J1PH 3C09B 4PJHA 4M03A 5SX4H 3IB4A 3UBXA 2VYRE 3DGCR 1PDKA 4ZO7A 3ULUL 1T7YA 5DI8A 5IFAH 1D3CA 1TVHA 3MTRA 1MRCL 3VRLE 3K81A 3FZUD 4K3EH 4AEFA 4N9OB 5C07E 1S7QB 2GTZB 1LILA 4U1SB 4XPHH 5C0FB 4NN5B 1MUJB 4L3EE 4CU6A 1MJUH 4N8PA 4ORZC 1IQWL 2JKXA 3MNWA 4OM1H 1I75A 5I16A 1ZGLA 3DRQB 3CSYA 4XC1L 3FN9A 3IJHA 3MLUH 1IC7L 1QSED 1EVUA 1T0MB 3BGFB 3O4LA 4NQSA 1H8NA 3HN3A 3MRGB 1F4YH 4ZNEA 4JAMB 4NZUL 3RNKB 2DQIH 2XA3A 1NBVH 4PJGF 2B1AH 1E6OL 1ZHLA 3T8XB 3G08A 1UWXK 1HH6A 4TN9A 3CFBA 2VLLB 3JWOC 3MRFB 3UZEA 3WNKA 5AYUL 2X4TA 3OKNA 5ICXA 4EUPB 1EV2E 5HDBE 1UWGL 2D7NA 1Q9KB 3GMQB 4TPRH 2Q76B 3I6LE 3EFFB 5KZCB 4PB9H 3L3OB 4UOJA 1T0NA 5TE7H 3GNML 1QNZL 5EORL 2OSLB 4IIQC 1J8HE 1S7TA 2ZSWA 1RZ7H 3PV7A 1FFQA 4R4NC 4OBSA 4JFPB 1UM4H 4MJIE 5FK9B 1MCQA 4YQXL 4GRWB 1KBGL 5IKCB 5GRVK 3HC4L 3BJ91 1CZ8L 5DLMH 4OGAC 4NJ9H 2PYED 4ONFH 2EIDA 4KY1L 3L3DA 2RIKA 1SM3L 1JN6B 5IGXH 5EO1B 3U79A 3MFGB 2K3TA 4JQIL 2MHAB 1Z6JT 1S7QA 2GTZA 4U1SA 3KYKL 3WKML 1MUJA 3KLDA 4WHYH 2ZOLB 2RCSL 2B5IC 2AJSL 4Q9RL 1L4IA 2XIDA 1YYML 1J1OH 1YPZA 15C8H 1T0MA 5I18H 4MLSA 3WO4C 5D5ME 3MRGA 4JAMA 3RNKA 5DD3H 3PE9A 4JZJC 2F5BH 3RAJL 1I9EA 4F2MB 1X5JA 5E8OA 4LEOB 3MRFA 1RUAL 4PRAB 3RX8A 3OJDB 4GKSB 3T2PA 4EUPA 1AHWA 3GHBL 3KPSE 4YDKL 3MRRA 1Q9KA 3GMQA 2Q76A 3EFFA 3L3OA 5D71L 4NM8L 1GJIA 5HY9B 4O2EA 2XZAL 3RY6A 5EFIA 1J0HA 1FIEA 2EE6A 2JIXD 4LDOB 4KHXL 5F7DB 4NZRL 1FORH 1R24B 1NGXB 2MCPL 4JFPA 3SDDA 2R0ZL 5FK9A 5IKCA 1J1PL 1S7RB 4LCUB 1JP5A 4R0LC 5FYJE 3ULVF 2HMID 1P1ZB 5IFAL 5GXBB 4F15B 1JN6A 1WZLA 3QCUH 5EO1A 2ADGA 4K3EL 1CLOH 5CZXC 4FQXA 4NZDA 1MJUL 1EEUA 2YD1A 2GJ6A 2ZOLA 2PTTB 3LSOB 3QQ4B 3WDJA 1CDBA 4X0KB 3AXLB 5DVMA 3MLUL 3HUJE 3PGDA 1W72B 2CDEB 3FRPA 2DQIL 1GCFA 2B1AL 4KUCD 5SV4A 3ZDZE 5DA0B 3OXSB 5HD8D 1TITA 3SDXB 1MHEB 1YEJL 1KT2B 4F2MA 3HE7B 3TBVA 1WIPA 4DFIA 4RX4A 3QIUC 3CK0H 4X7CC 4ELKB 5I74C 3OJDA 4WCYL 4GKSA 5DQDH 4TPRL 4OFYD 4D9RE 4PB9L 4PGZA 2ZUUA 4N0FB 5TE7L 5EC1A 5JNYB 3EKCA 8CGTA 2AK1H 2APFA 2BVQB 2M1KA 4U1IA 4C54A 1AKJD 5F7DA 1R24A 4MMZC 1NGXA 1QP1A 4YC2B 1Y6KR 1RURH 3DSFH 4Y5XB 4D94A 1EJOH 3WN5C 1KCLA 1RZKH 1S7RA 4LCUA 5JPNB 5DLML 2E7LA 2EKSB 4PJ7B 4NJ9L 1GGBH 5IEHB 3P4MB 4ONFL 3MRQB 5KSAD 5DF0A 4FG6D 1P1ZA 1A7RL 5IGXL 1KGCD 2C4FT 4OIIH 3QB7C 2H9GB 4PJAF 1CFBA 4I3GA 3ULUE 5DJXB 3I3BA 1RI8A 1SYVB 3LSOA 2PTTA 2XQBH 4UMGA 3QQ4A 4LEXH 35C8L 1B4RA 2W65B 1KIQB 2P8MA 2F5AH 3AXLA 1J1OL 3QDGD 2H1PH 1ZK9A 2VDNH 2LV4A 1YMMD 1W72A 2CDEA 2NX5A 3ZE2F 5DD3L 1ZWIB 2VOTA 3OWEA 2Z8RA 3TO4C 3LKNB 4X5LA 3OXSA 1Y6MR 4YFDB 1N4XH 1OAZL 1FE8H 1WBXB 2I9LB 5K59E 1MIEL 4EXKA 1KT2A 3IDXL 3W11C 5L6YH 4JPWH 4K3HA 3UTZB 1E4WH 1UVQA 4EN3B 4G42A 4YZFE 4ELKA 4RFNC 1U8OA 1TNNA 3C5ZB 3D39E 3DV6B 1OWWA 3WNMA 3M8OH 5JNYA 2OBGA 5C6WH 3JBG7 3AUVA 5J6GB 5T1DH 5HHOD 4U3CA 4LLWB 1FORL 5KG9A 1KF9B 4UIKH 4Y5XA 2BHUA 4HKBA 3F62A 5JXEA 3S5LA 1FJ1B 4WHTA 3LDBC 3QXWA 2EKSA 4KK5C 4XCEB 4K2UH 4PJ7A 4N5UA 5IEHA 3MRQA 4TULH 1T5XB 5FGRA 3SBWA 2DI9A 4R8WH 5D6DC 5BRZB 4ZAKC 3RWCB 1D5IH 2ZNXA 1CLOL 7FABH 4TTDD 2QHLA 5MI0C 4TTGA 1OTSC 1IGJB 1INQB 2ED8A 3GBMH 3LN4B 5CD5C 1SYVA 5CJOH 2IJ0C 5IJVB 4QYOB 3MRDB 1KIQA 4XPFH 2B7DT 2YUXA 1DQLL 5IVNA 2NY3D 2JJTC 4WW1B 2ADFH 1K4DA 1ZWIA 4XP5H 2OR9H 4NKMB 3CUPA 4PJFB 3LKNA 3DYPA 2JE8A 1WBXA 2I9LA 3DWTA 3F7QA 1OP5H 1VKXB 3T0EB 1L6ZA 2GY7B 5IWLC 3U7YH 4KJPC 4EN3A 5BVPH 5DO2C 3SDCD 4F57L 2LAGB 4IRJC 3C5ZA 3DV6A 4P4KD 1ZLWK 3QI9C 2FB4H 4TVPD 1N6VA 1P4LB 4MAYC 5LWYH 2AS5M 1T1ZA 2AK1L 3G5XB 4OZ4B 2L0DA 1I3GH 1JRHI 5FGCB 3HRZB 2BSSA 6FABH 4JFFE 1DR9A 2A0LD 3MRBB 1EJOL 4QGYA 1TCMA 3GMRB 4IDLA 5AD0B 1S78C 2BZDA 1FJ1A 4MNQB 5DTFB 4XCEA 5GSVB 2YD4A 1YN6B 1T5XA 5F6IB 4OIIL 1T7WA 2JJWA 4X6CE 5BRZA 3RWCA 1GAFH 1NC4D 1INDH 5DUBB 1OAUH 3T3PE 1RZFH 3QXTA 4P59H 1INQA 1IGJA 2XQBL 4JHZA 3LN4A 4LEXL 2P24B 5IJVA 2OTWB 4FQJH 2F5AL 4QYOA 5EIVA 2H1PL 2B1HH 2VDNL 2YD8A 3QO1A 3BWAB 3HKFA 1T6VN 4NWTL 3ZKNC 1P7HL 3X13B 4WW1A 5ANMB 2B4CL 4HIJB 5F89A 4NKMA 5T5FL 2CKNA 4PJFA 5D7JA 1LE9A 4QWWD 1N4XL 4CN6A 1IGFH 3V0VB 5EZIH 5L6YL 5SWZD 1E4WL 1VKXA 3OKDB 3FN3A 4NC1C 2PO6B 1A8JH 3L5JA 5BO1H 2R39A 5C7XH 4JQVC 1P4LA 3M8OL 5JZ7D 3KPMA 4GRMB 5HI5C 4OZ4A 4Y5YC 5T1DL 3HRZA 1NGZB 4LSTH 5AEAA 4OB5L 1KTLB 3RX5A 1AQKH 1H5BB 4B7LA 4UIKL 1KCRL 2EXYC 5FYKD 4X4YB 5GGSY 1CD1A 5AD0A 1BOGB 4WFHD 1YEGH 5DTFA 5E9DB 4TULL 5IBLD 4DKFH 1P9MC 4QOKD 2Y25A 5GSVA 2D03H 3F6LA 3MBED 1CS6A 1D5IL 3QWOB 7FABL 2FCBA 3LQMA 5L0QC 4LMQI 2AEWA 5D1QC 5C6TH 2V2WB 3OAZH 3GBML 5DEGB 4XNXH 2P24A 2DKSA 5D1ZB 2OTWA 1TETH 1MFAL 1S9WB 3EJZC 5C0NC 2R56H 5GISH 3DX8A 1VDGA 2C3WA 3BWAA 3FOMA 4F8QA 3Q1SH 3X13A 5ANMA 4HIJA 4LK4A 3PXJA 2R69H 3V0VA 4Y89A 1O0VA 4Z7NF 1LEIB 1F4WH 2DQEH 4I0PC 3U7YL 4ODSL 4NKDB 2V17H 2CLZB 4LGSB 3HLAB 5BVPL 3AC0A 2PO6A 4W68A 5HPMB 3G5ZB 1MAKA 3MBXL 3RPIB 1NGQL 1UADC 3TJEL 5DMKB 4GRMA 1I3GL 2A1WH 2R0WL 3N1MC 4Z7VB 1MPAH 5F1SA 1NGZA 3L5HA 4JPKH 3JVGC 4YDIL 1KTLA 3SDAB 4MDJB 1H5BA 3OAYK 3QNXB 4X4YA 4HKJB 2MPAH 1BOGA 3CDCA 4I1NB 2NXYC 1IGCH 3PWVB 1RULL 3ZT5A 5E9DA 1N5YL 4RNRB 5K9JH 5AAWA 3QUXC 4C59B 3QWOA 4MA1B 1TENA 3PL6A 1INDL 4HIXH 1OAUL 4G8FA 1RZFL 2DYPA 4YO0B 2V2WA 3BP4B 4P59L 5C0BD 1UWEL 2EXWC 5DEGA 3N9GL 1U42A 1F6AA 1I3VA 2YUZA 4FQJL 2E9JA 4KMQA 3QJFB 5D1ZA 3GIZL 4HUXB 3RGHA 4KK9C 1RJYB 1S9WA 3B9KD 3QPQC 4DCQB 1OT2A 5CJXC 2CIKB 1NGPL 4FFYH 4U1KB 5F71A 4HAFA 2LAAA 3RDTB 2HFFB 5J7CC 1ZT4B 5M95B 3TVMC 1HXYB 3HAEB 1IGFL 1JRHH 4P2OA 4RCAA 1IAKB 1KIPB 1LEIA 2YC1B 1JE6A 5F7UA 1GVIA 1HYRC 4NKDA 2CLZA 3M45A 3HLAA 1FC1A 1OOAA 5BO1L 5C7XL 4DVRH 4JRYE 1K8IB 1QLEH 2OJZL 5HPMA 2AJUH 3G5ZA 3CJJA 4X6BA 3RPIA 4X8JB 4TQEH 5FECB 5DMKA 4OQTH 1N0XH 3FONB 4JM4H 4N0RA 4Z7VA 1EPFA 4LSTL 4M4PA 4RA0C 1NL0H 5JOFB 1BQHG 1EXUB 1SQ2N 1P53A 1T83A 2A6KB 5LJYH 5E6IC 3SDAA 3VWJC 4MDJA 1JTOA 3QNXA 3PNWB 4KROB 3M17B 5TGBB 3JTTB 4HKJA 5HHQB 4PGCB 1A1MB 4KDTA 1YEGL 1PEWA 4GQPH 4DKFL 3PWVA 1OSZB 2D03L 4RNRA 1J18A 2R4SL 3BVNB 3LZFH 3D0VB 2JLLA 4LAJH 2NNAB 3U4BH 5DFVC 3ZDXF 1KUMA 5C6TL 2GTWA 2HTKD 1F5WA 4DUWA 4XNXL 3BP4A 2GSIB 3OB0K 1QQDB 4OCWL 4Q74A 3CLFH 4PRIB 4U1MA 3P30H 1FBIH 1M7XA 1GH7A 5E00B 3VFUB 4HUXA 3BP7B 1MHPH 1S5IH 4KRLB 1RJYA 2FECI 2R56L 4DCQA 2KH2B 5GISL 2CIKA 3GJFB 3Q1SL 5MENE 4AZ8A 3WMSA 4U1KA 4U1GC 2RBLA 3RDTA 5KVFL 1ZHKB 1G1CA 1ZT4A 2FX8L 4L4JA 2R69L 1TJGH 1ED3B 3HAEA 4ZFGH 2DM3A 1F4WL 1DQJB 2DQEL 1IAKA 1KIPA 3VXNA 2YC1A 1RQ5A 3JV6A 5TF0A 1SVZA 1VEPA 3D9AH 2HFTA 2X1XR 1K8IA 1JWUB 3DLQR 5J57B 1JGEA 3QR2A 1N59B 4FTVE 5I1HH 4X8JA 2A1WL 5FECA 4A2MA 3FRUB 3FONA 1MPAL 4X7FC 3DBXB 1FSKC 1J0IA 5JOFA 4Y4FD 1EXUA 5C0CD 2FWOB 2A6KA 2JJVA 3FTGB 5ABDE 2QTEA 3D0LB 2MPAL 1ZANH 3JTTA 5TGBA 3ULUC 3FQXB 4PGCA 1A1MA 3Q0HA 4ENEC 1IGCL 3WNPA 5K9JL 3RA7H 1OSZA 3C87A 3NIGF 3BSZH 5I30H 2NYYD 3D25A 1N6QH 4G6AC 4Q58C 3D0VA 1T22B 4U6YB 5F7WC 4HIXL 4P5MB 2NNAA 1HNFA 5J11C 2BSED 4IJ3B 4G6MH 4PBXA 1G6RH 2GSIA 3U1SH 4PRIA 5CKAA 5DRWA 1URLA 3QFJB 3G6DH 5E00A 4XPAH 3VFUA 3BP7A 2V9RA 3ESUF 1T4KB 4UV7H 5C3TA 4PRPB 1UZ6E 4JQXA 5C0RH 3RZWA 2OR8A 4EXPX 4FFYL 3GJFA 5KVDH 2GSGA 4FZEH 4MAUH 2YD3A 5EWIL 5DJAA 4EDXB 1ZHKA 3MV7B 3FO1B 1ED3A 4HZLB 4LQFH 4PJ5B 3OQ3B 2W0PA 2DQHH 1A3RH 3MOQA 2BXZA 1QLEL 2AJUL 3PDOA 1VFOA 1JWUA 1QOKA 1U3HC 2J1KA 1N59A 3QISA 1XR8B 4TQEL 4HLZG 3G5VB 4OQTL 1N0XL 3FRUA 5LG1A 3W5MA 4BSWB 3DBXA 4RMSA 3SJVB 3WO4B 3OKYA 3MZTA 4I77H 2FWOA 3UTQB 3FTGA 4HV8B 3WNOA 1QO3B 5I8OH 3LRHA 3OXRB 4Z77A 3D0LA 3VGDA 1DLHB 2R1YA 3FQXA 1CDHA 5CIPH 3P2TA 5GRJH 3N1PC 5K9OB 2P5EB 3PP3K 3HE6C 4G5ZH 3L95B 3TN0D 1QR1B 3LZFL 3G6JE 4PBWD 3KAAA 3JZ7A 4PRDB 4U6YA 4KVNL 4P5MA 5HYEA 1K3IA 3EYQC 5T1MB 1OCWH 4R90L 4MS8C 3CLFL 5HDLA 3P30L 5HHMD 1CTOA 2VLRB 5DD1H 1B88A 4QHLB 3VA6A 4AQOA 2BJMH 1OTUC 5FEBA 2FLBT 3VA2C 3VDBA 1MHPL 1S5IL 1S7XB 3QFJA 5FYLD 3FT4B 1T4KA 4JLRB 4KTEH 2H6PB 4PRPA 1NBYB 1JHKH 4ZUVB 2PUQT 4YDJB 1V8HA 2J7LA 4R0LB 5MHSD 5BV7L 3K74B 2A6DB 3TC9A 4EDXA 4JRXB 5BCAA 4OI7A 1TJGL 5ALCL 3FO1A 4LSVH 1DQMH 1AFVL 3HMXH 4HZLA 4PLOB 4PJ5A 2XY1A 4GMSH 4M5YH 5E6ZA 3D9AL 4FFZL 5D7IB 3BIKB 5B39B 4K3GA 1TPXC 4NQVB 1RK0A 4ZS6D 4HCRH 1D5BB 1XR8A 5JDJA 3G5VA 4MSWA 1D9KC 4BSWA 3A0OA 3SEPA 1CE1L 3QDMB 1I9RH 5GJTL 4NZTH 3TYGL 4HV8A 4F8TA 2KZWA 1ZANL 1QO3A 4ONGL 4LCWE 3OXRA 5HYQB 1YEDA 1DLHA 5AUMB 3ULSB 3RA7L 5K9OA 2P5EA 4XB8A 3QIUB 3BSZL 5I30L 5I74B 1N6QL 4XBGA 4DW2H 3L95A 4XP4H 1QR1A 3W81A 2YRPA 5L2JB 4PRDA 2Y6SD 3RIAK 5TE4H 4N5ED 5T1MA 5I0ZA 5IJKC 4G6ML 1C5CH 3D18B 5TPWL 4WFEE 4FQIH 4C58B 4GG6F 4YGVB 2VLRA 3I50H 4QHLA 1QUNA 2A83B 3G6DL 4JHAH 4XPAL 3JV4B 3AS0A 1QBLH 4G9DB 1S7XA 3LEVH 5KANI 3FT4A 3CU7A 5KVDL 4JLRA 4U2YA 5C0RL 1G9MH 4QTHB 2H6PA 1FL6B 1NBYA 4ZUVA 4MAUL 4YDJA 4R0LA 2A6DA 2X9XA 4MQTB 4JRXA 3D6GA 3MV9A 1ZVHA 2OR7A 4IOIA 3P4LA 1NAKL 1HHKB 4M02A 3SY0B 1ITCA 5FUZH 1FNGA 4XNMA 3RVTC 1YEEH 4PJCF 4LQFL 2H45A 4LNVA 2DQHL 3NCMA 1A3RL 2GAZA 1SYSA 3HZYB 3GM8A 5D7IA 3BIKA 3QWQB 5B39A 3OPZH 4NQVA 3BP5B 5FCSH 1D5BA 5L8LB 4JHWH 1T89C 3MRCB 1K4CA 3QEQB 3ARDA 3AMKA 3QA3B 2VLMD 3QEGH 2VR4A 3QDMA 4CADA 1J9CT 3N50A 5I8OL 5B3NA 4LAQL 1SEQH 5HYQA 5GRJL 4POZD 3UPAA 5AUMA 1S7UB 3ULSA 4G6FD 1XGUB 4F7PB 3QIUA 3BJLA 3SDYH 2F19H 3QIWC 3L1OH 4OGXH 3O6LH 4L9LA 1I8LC 5L2JA 5DS8A 3O6FB 1OCWL 3B5GA 1Q94A 2D31A 3MUJA 1NAMB 3MCLH 4J4PC 5DD1L 4GUPB 4YGVA 2BJML 2A83A 4CN4A 1AD0A 3JV4A 5F7HA 4G9DA 4KTEL 5DHVB 1F00I 4QTHA 1FL6A 3ARPA 1EUTA 2HWZH 3JWNC 2XWTA 1CGXA 4J6RH 4XXDB 3CZFB 4CU7A 1F3DH 1OHQA 3NABH 3MLTB 2BSRB 1HHKA 4TUKH 4ZAKB 4B41A 4KU1A 4P3CH 4GMSL 4M5YL 5D7LB 3VXMD 3EO1B 4HWBA 3HZYA 3CLEL 3LKRB 3WS3B 3ZE0E 3GGWB 3GO1H 2EDQA 4KKLC 1WAAE 4WW2F 1DFBL 4YNYB 1GIGL 1NBQA 4XNQB 5CILH 3MRCA 3GK8L 3QEQA 2D2OA 4UTBH 1U3YA 4DKDC 1F90L 3RWGB 3V0WH 1W0WB 3QA3A 4KKBC 4P23D 4PG9B 2XTJE 1PSKH 3GI8H 3H9SE 4RRPG 1T04B 3B8SA 4ZSOB 3SKNB 2ENYA 4FQCH 4LSQL 5BJTB 4C83B 4QRTB 1S7UA 1XGUA 1LE5A 4DW2L 2FECL 4MA8H 3FJTA 4IRJB 4KDVA 5B21A 1IC4H 3QI9B 5TE4L 2D3VA 1MF2H 5F8RC 2NY6D 2YSSB 3O6FA 5FIEA 1C5CL 3C6LD 1NAMA 3I50L 4GUPA 1MCCA 2YRLA 2J8UE 2Y07H 3LEVL 3O0RH 3LMJH 4NO0D 5DVKA 1G9ML 1QLFB 4QCIB 4RAUB 2R0KH 3U82B 1J12A 4OUUB 4J8RB 5IBUG 4XXDA 3B3IA 5T1LD 3CZFA 1NH6A 1JZ3A 5J0BA 1FNHA 3MLTA 5D6DA 1YEEL 2AJZB 5EOCJ 4ZAKA 4L4VE 3QO0B 5D7LA 5DSCB 3EO1A 2V7HB 2DM2A 4OLEA 4PJEE 2E7CA 5ALBL 3DXAD 3FN0H 2H2SD 3OPZL 4TVPH 3LKRA 4OZFB 3WS3A 4YFEA 3WEXA 3D85B 3UJIL 3CH1B 1I8MA 4OCXL 4YNYA 4KRNA 4XNQA 5DHXB 2YR3A 4G9FD 1W0WA 1AD9B 1WCBB 3Q5OA 1K8DB 2JJTA 3UTSE 2AEPH 4V1DE 3FFDB 2ESVD 3D3VD 1T04A 4ZSOA 3SKNA 3NIDE 1SEQL 5BJTA 5FKPB 4C83A 1K5NB 3LS4H 4BQCA 1A2YB 4QRTA 4PJIE 3TWCH 3GBLA 1QKZL 1DP0A 2F19L 1MOEA 1IZJA 3L1OL 4DGYH 3O6LL 1FDLH 4MQ7B 3QI9A 5F9WB 4UIMB 3VGAC 2YSSA 3FO0H 4Y5YB 1UKQA 1R3IH 3OF6A 2KBGA 2Z9TA 4BKLB 1NGWB 2MQ0A 4XWOD 2HFGH 3PQYD 2B4CC 1JIBA 1QLFA 4QCIA 4XI5C 5C07B 2BP3A 2VN4A 4L3EB 4OUUA 4Y8AA 4J8RA 1C7TA 1CQKA 2DMKA 5E2UH 4PJXF 2JCCE 3BD4A 4NQED 3CC5A 2BCKB 5EUOE 1CICC 4LSUL 4Z0XB 4P3CL 5L0QB 4AIZB 3IT8D 2NY0D 4U3XA 4WHYG 3S96A 5D1QB 3FQRB 1IAOB 1ES0B 1YEKL 2PW1B 4OZFA 3D85A 2EH7L 3CH1A 4S0TD 4UTBL 2MNUA 4FFWD 3V0WL 4K8RL 1P4BL 4PLJC 5KVMC 3B4NA 4QHNB 1AD9A 1Z2KA 1WCBA 2UY6A 1K8DA 3OG4B 4UQ3B 1PSKL 2HTLC 2X9WA 3GI8L 1R0AL 3FFDA 5SX5H 5FYKH 2XWBB 1A1NB 2FL5B 1P69B 2DICA 3QDHA 2EZ0D 3K80A 2ZCLL 5FKPA 4I0PB 1K5NA 1XMWA 1A2YA 1J8HB 1XT5A 4KRPD 4MA8L 4QKXB 4XGZA 1NJ9B 5IB5A 3TJHD 5IM7B 1YEIH 4MJIB 4FP8L 2PYEE 4MQ7A 4UIMA 1B6UA 2C4FU 2QHRH 4H26B 4LGPB 1V3JA 2N4IA 4XT1C 4Y5YA 5EUKB 3HB3C 1QLRA 3NIFF 1JJUA 3EYSH 1SJEB 2VZ3A 2Y07L 3VFWB 3VMOA 4BKLA 1NGWA 1AGEB 3O0RL 3LMJL 5CSZB 3FOLB 5H2BB 2ITDB 1J5OL 3UYRH 5C07A 1MI5D 1GGIH 3HZVB 3G04A 1D7FA 3O2DL 8FABB 4L3EA 5DURD 1WC7B 2NXYB 2AK4D 4WGWB 1OW0C 1AXTH 2ZUWA 3S97C 1A6AB 2KUTA 3PWJB 4G3YH 4D0BB 2BCKA 3DUUB 3UAJC 3QUXB 5J6HA 1CIDA 4YHPB 4AIZA 5D1QA 5D5MB 3FQRA 2HKFH 1CTNA 3FN0L 1IAOA 5K9QG 2LU4A 1ES0A 4TVPL 5KVGH 3RIAF 1KCSH 5JHLL 3CCHB 2PW1A 4ELME 4NRXB 5DUPH 1MCLA 3VE0A 4Y16A 1A47A 3IRZA 3JTSA 1B0GB 1OP5K 2X4NB 3CMOL 1EVTC 2AEPL 1BVZA 4HXAL 3KYMA 4KXZH 4UQ3A 3VCLB 3EYVB 3KPSB 1DUZB 3QEUA 2BNRD 1JZ4A 3TVMB 1IBGH 2XWBA 5DK3A 3KG5A 2A73B 1A1NA 5C0IA 3FMGL 5C0GB 2FL5A 3GZKA 4H1LB 2BRRH 3N1FC 4I0PA 2CR6A 1J8HA 3MREA 4LFHG 2Y36H 4YK4C 4DGYL 1NJ9A 4U6TA 1FDLL 4XPTL 5IM7A 4GG8B 4MJIA 4OQ1A 5FDWB 1EMTH 3FHQA 2PW2B 3CNKA 5KOMC 2AXFA 4PJCA 1U3JA 4H26A 3LPGA 4JFZH 4WI2A 3IDUA 3FO0L 2ICES 5GRYA 1R3IL 5EUKA 1FVDA 3ARWA 1BP3B 2MOVA 1J10A 1SJEA 1BOYA 4WNQB 2YPVH 4DZBA 3IVKB 3VFWA 1AGEA 5CSZA 4ZS7L 3VWJB 3MO1B 2ITDA 2PR4H 1M4KA 2VDRH 43CAB 2OL3H 4JFDD 1JNLH 3BEWA 5FF6B 2DL2A 4PJ8C 2KDGA 3HZVA 2EYTB 5D70H 1FFPA 5ISZD 2VQTA 1VPOH 4BFIB 1WC7A 5E2UL 4FQ2H 1EHLH 3PWJA 1UB6B 4D0BA 1RIUH 3KLHD 5JW5B 3DUUA 3BPNC 3HUJB 3QUXA 4XXCA 1BVLB 1KG0B 4R7DB 1MCHA 4YHPA 4M6MH 1C12B 1B90A 4Y1AA 3V8OA 5EIIB 4UDUB 4GMTH 1KLUB 2PTUA 1OP9A 5GS0L 1A7PH 1CXFA 2PXYD 3BHBA 4PY8I 4NRXA 1V3MA 1KJVB 2GFBB 5CJXA 5DD5L 4NQDD 4U1GB 1BD2E 1MCPL 4NO5B 3VCLA 2E8YA 5FYKL 3EYVA 5FO8B 3TVMA 2A73A 5C0GA 1IZKA 3IFOB 4H1LA 3HNTH 5GGTA 3WXVH 3OMZA 3W9DB 3IJSB 2WIIB 5EU4B 2FYYB 2F74B 4L8SC 5HGBB 3K2MC 1YEIL 3ARFC 4MCYB 2HH0L 5MERB 4U31A 4GG8A 5DQ9B 2QHRL 3QP3A 5FDWA 1KGCE 2PW2A 4AJ0A 5E95B 2KL6A 3O9WD 4D2NA 1A7QL 1VEOA 3LRSB 4DGIL 1FSKB 4WNQA 3GSVB 3IVKA 5GS2D 2NZ9D 4WW2A 1OF2B 1DANT 3VWJA 3MO1A 1MCKA 2ZSVB 3WUWG 3UYRL 2AJYH 43CAA 1SJHB 3TBSB 4B50A 5FF6A 1C5DA 3SCMC 1QRND 1C8PA 1U2HA 3ZDYF 1L0XA 2EYTA 2VUOA 3MV8D 4BFIA 4MQXC 5B3JF 1YMME 5HTSA 1VHPA 1UB6A