3V2AR

Vegfr-2/vegf-a complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
198
structure length
185
Chain Sequence
QHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPLVNRDLSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/signaling protein
molecule keywords Vascular endothelial growth factor receptor 2
total genus 29
structure length 185
sequence length 198
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR01
1J9CT 2PW2A 5BZWA 1BQLH 5C0ND 4MLIA 1CFBA 1E4WL 5MEND 1I4FA 3GIZH 1O0VA 1ADQL 4JQXC 3QIWB 3RWFB 1SBBA 3VG9C 3QH3A 2AEQL 4HEME 3F7QA 1I3RA 3P73A 5KTEH 1ZKAA 4XTRD 4AEIL 4U1IA 1DDHA 2VJXA 3FQUB 4P5TB 4P9HC 4U1NA 5GSVA 1KIQB 3BOVA 4LKXA 1P7QA 3QUYD 4UUJB 3U46B 4BYHA 3TZVD 1I1FB 3BO8A 5TH2B 1DN0B 1D3CA 1YEGL 2GY7B 3SE8H 5J8OA 3OAYK 3IGAB 1QLRB 1JZ3A 15C8H 1WZKA 2VAAB 4ZQKB 1NGZA 3QFJE 1RULL 3OZ9L 1DSFL 1HNFA 1AGDA 4XI5D 3NCYS 1Y0LB 3SO5A 2YD5A 1M71B 2X4OB 2FEDD 4X7SH 3R1GH 3TYGL 3WNNA 4PB9L 3PWJB 4OQTA 4P0DA 2X05A 4PGJA 3OXSB 5GGVL 2Y06H 3UCRA 3IAQA 4E0RB 3KPOB 2WMPA 4ODHL 1W72L 4JO4L 4LDLB 5F8RC 4RQQA 1ROWA 3CSYA 2G2RB 1S8DB 1UWGL 2O5XH 5E08H 2LVCA 4XVTL 1N4XL 3NIGE 4G80A 3CVIH 4KUCD 4OBSA 4BJLA 1UYWH 2CJUH 3IS0X 3Q0HA 2OX5A 1GVIA 1VEPA 5F93C 2OTPA 3SDYH 1AR2A 3TZVB 5JLZB 3VGBA 1CE6B 3R4DA 4PJHE 3KVQA 1QSFB 3DVIA 5F1IB 3U4EA 4PRHE 2FL5B 3ARTA 1RUPH 3J7HA 3BSZH 3MXVH 4ZTOH 2R2EA 4GRWE 4ZXBC 3AU1B 1RUAH 4B50A 4LEOA 5DJAB 3QNZA 4HSQA 4UI2A 4EBQH 5EH1A 1EPFA 2MQCA 1V7MH 1N2RA 1U95A 4N1EA 1J05A 5K9OA 1HNGA 4U1KA 5CJXA 1SJHA 2LAAA 4NQEE 4W70A 4Z7VF 5A3ID 1F4AA 5IHUH 2Z92A 3G6AB 5EBWA 2H6PB 1EBPA 1RI8A 3DRQB 3KWWB 4R0LC 4RAVB 3MTRA 4HC1A 5B39B 1LE5A 4KKAC 4ZUUB 1CLZH 3MRQA 4HGWB 1RIUH 2XTJB 4F58H 3BYYA 1R0AL 1FL3B 4GAGL 1XF4B 1V7NL 2LVEA 1J10A 2MPAL 3GHBH 3WKML 1YC7A 3OB0K 3PHQA 3T3PE 2IALA 4LVEA 4EN3D 2X4SB 1ORSB 2PTTB 3TNMA 4XRCA 4AENA 3MJ9L 1A6VH 1Z9SA 5L2KE 2GJ6A 1T0MA 4HWEH 2NNAA 4FXGB 5CWSA 3RWEA 1NEZB 2GK0A 1MI5B 2BMKB 2HMIC 3SOBH 3WDIA 1KN2L 3IDJB 2O5YH 4HWUA 4OZFG 3OAZK 3CUPB 2B1HL 5KSVB 3DX8A 1VFAA 2YSSB 1C5CH 2WM0A 3VA6A 2KL6A 3DECA 1T22A 1CZ8H 3BGFB 1MY5A 2QSVA 2Y1VA 4RRPG 2ZJSH 1RZGB 2ZUXA 3BKMH 1BGXH 1S5HA 3SDAD 4QRRB 4WI5A 3BRDA 3CVHH 1IILE 2D7NA 3Q1SL 1MJUH 1KCVL 5ESVA 5IMLA 3BT2H 2F54D 2VKWA 6CGTA 4DVRL 1A7QH 1IM3B 3VFMA 4NC1E 3A6CH 5LBSL 4O2EB 4LCCC 1RZIB 4R2GB 3GBLA 5ESAB 1QLFB 3H0TA 3OF6D 2DLFL 3CU1A 3HKFA 4FQIL 2IPUG 4YGVA 2V5SA 3GSXB 4WFFE 4PTUB 4S1RL 2YD9A 3U1SH 5TGBB 3MX0A 1ZLSL 4I4WA 3UMTA 1JCKA 3VXQB 3UZEA 2F53D 1CICA 1SEQH 3GSWB 4A2MA 5JOPE 5HHPA 3OKKB 2ZSVA 1L7IL 4K07A 3KLHD 3MJ9H 2CH8A 3VWJC 3QJHB 4WGWB 5AAMA 1EHLL 1NUFA 4X80H 4Y2DD 1KB5A 1MIEL 2D7QA 5T33L 3LD8C 2HKHL 4F7MA 1ZHNB 3N1QC 2EICA 4DZBB 1MNUH 1WC7A 1G6RA 4WO4C 2A1WL 5BW7C 2EYSB 5F1SA 1IQDA 3J8F7 3EO1B 2F8VA 2PTVA 2FJHB 2D4FA 4PRBA 3RVXD 1FNGA 4OI7A 4LFHD 1JF1B 2DQTL 2H32H 2CDGA 2PR4H 1U36A 2IALB 4LLMB 5TDOB 3CZJA 4M1GH 5A43C 1S7XA 3TBYB 1OTSC 2BVPA 3QCUH 3IYLW 1NCCL 2OJEB 2EDOA 2CIKB 1F4XL 5K9OB 5CIPA 1QRND 4R4NC 3EO0B 5BQ7B 1AGFB 1QBML 4IMKC 4P57B 5IHZB 5E1AA 5B8CC 2VLJD 5DQ9A 4NO3B 5H37G 3LQAH 3P11L 5C0RL 4L4VB 1DUZB 1Q9KB 3SGKA 2OL3H 4KUZL 3SGDI 4WRLA 3EOAA 1CD1A 5CEYA 3KYNB 1MCKA 1U6AL 5B8CA 1B0GB 4PJBA 1GZPB 5BJTB 1DE4B 1U8IA 3HE7D 3TJEL 3ILPB 3UTTD 5D71H 5JMRA 1DQDL 1S7TA 5SWZD 1FVEA 1SEQL 4RDQG 1YNTA 4P48A 1B2WL 5DHYB 3CFEA 3GO1L 2A0LC 3CDCA 1QBLL 3N50A 1JHKH 4QHMB 1E0OB 1HDMA 5HHVH 1LO5A 1FZOA 2JF1A 4GRWB 4ALAL 1FJ1B 4WY7H 3RI5K 3WNPA 3W0WA 1NH6A 4M9OA 2R0KH 4GAYB 1BAFH 3L3DB 3C09C 5F7UA 4ODXA 3GI8L 4MCYB 5IG7A 3HNSL 5FO8B 1UB6A 5T1KD 1HH6B 5TE4H 1P5UA 3I3DA 3NCYP 3VWKB 5KSBA 5AUMA 4IRJA 4HJ0D 1UACL 4HKJB 4D9RD 3OL2A 1WIUA 4OM0H 4MHHI 2XXCB 3U2SA 2YWZA 4ZO7A 3WCYA 4XVJL 4WIQA 3CX2A 1YYLH 4Z7VB 4JN1H 3OHXB 4LMQE 5JOPD 1MQKH 4KROB 1XZ0A 3HR5B 1JP5A 1TJIH 4QRPD 3RDTA 2HFGH 5HGHA 5CHNB 3CCHA 3W2DL 1D6EA 3KLSA 2A73B 2IPTH 4X4XB 1KCSH 4WW2A 2E7MA 2X89D 4K7PH 3VI4E 4V1DA 2BVPB 1QVOB 5FA3B 2H3NA 3PGCB 4AY0A 2GJZB 3UEZA 3LQZB 3TWCH 2CIKA 4PJFA 1T6WA 3UTPE 1K2DA 3FO2A 3Q5OA 5KSBE 3MRBB 5E8EB 5CJBA 4FXLA 4JRYE 3NBNA 3IF1A 1JYWA 3QI9C 5EU3A 3LEYL 3QWRD 4U05A 3QDMA 5I8CA 3PG2A 3V4UL 3WNMA 4L1HA 2ZNXA 5C0AA 4HHAA 3CXHK 4KJWC 1FNGB 3HMXA 3FJTA 5IQ9B 6FABL 4PJCE 4KGLA 5D4QA 1QLRA 5DMGC 2NXZD 5C0IB 3VRLF 3BP4B 3PP3H 5DDHA 3ZE0E 1HN1A 4M6OL 4YJZL 1FAIH 3RTQC 3PIQB 2C26A 5GGVY 5GRWA 1TLKA 1NKRA 5FO7B 3RY6A 4A6YB 1IGYB 3OB0H 4TOYH 1U8LB 3WJLA 1ZEAL 1KELH 5DK2A 1FNEB 1CGTA 4OF8A 4FTVE 4LSVH 2FYYB 3QBTB 1RZKC 5D7KE 4P4RB 4UB0H 5IBTL 2ZUTA 1N8ZA 5IVOA 1S7UB 4D0BA 4MA1B 4PJGE 5EA0L 5DA0B 1LK3H 2FGWH 3MRRB 5GRVL 1YNTB 5GRVK 5D7JD 4WI4A 3HNVL 4QTHB 2BHUA 4LLWA 5F1KC 1EFXA 1A6PA 3DMMB 2UVEA 2ZOKA 4KFZC 1BFVH 2F53E 5LJYH 5F96L 2VLJB 2EO9A 1I8KA 3SCMA 2CGRH 3I6KB 2DF3A 2Z9TA 3B2UD 1AR1D 4XAWH 1Q0XL 2D2OA 1FZJA 3KPTA 3LKQB 1CD8A 3PHOB 3HE6C 3VD7A 4OM1H 4PJEB 3WHE1 3CLEH 3V6OE 3W5MA 2NNAB 2DMBA 5JR1L 3ECBB 1EAJA 5SWZB 3BPCB 2NY4C 4PJXA 1MIMH 5DUML 2IPTL 4GT7A 3FN9A 1BEYL 4JO3L 5KW9H 1A14H 4ZUUA 4AMKL 5HYQA 2BNUB 4XWGH 3L3IA 1RSFA 1ZHBB 4RAHA 4NN5C 3LEVH 3OKYA 3MGTB 3RY5A 2D7MA 5IMMA 4LSPL 1JRHH 4JG1L 2NY0D 4PBXA 1T22B 4MB3A 3BKJH 4MXWL 1ACYL 3QXAA 5E8OA 1QHOA 1XGTB 3T2OA 3WHXA 4GBXB 3U9PH 5EU5B 3F58H 4OI9A 4J3UA 3S35H 5DMKB 3SDDB 4TSAH 4HWNA 5IB4B 2FGWL 1PZ5B 5LAXB 5D1XD 3P4MB 4I18C 3FO9B 1N6QH 5HGAA 1Q9OB 3BD5A 2XG5A 2PYFA 3AU1A 3O4OB 2AEWA 3WIHL 4M43L 3MUJA 3DJ9A 4P99A 2NY4B 4YPGB 4I4WB 3SGJA 2VDQH 1A9BB 3PL6D 4N8CH 2R9HC 5LGJA 4JHAH 1JBJA 4XNUH 3RHWK 5FFLA 1F2QA 1L6ZA 3JV5A 1IKNA 1ZEAH 4O4YH 2FEDC 3ZHLA 2XFXB 4WFEE 35C8L 5D6CA 4DW2H 2H45A 1QTYT 3ARBA 4CL7A 5DJYB 3LN9A 3ARFC 4LLQB 1GC1C 1K5NB 1NFIA 1MFCH 1YYML 5CZKA 3VFRA 2HG5A 1MHEA 3BP5B 1NANI 1IMHC 2VQUA 2Z31D 1AH1A 4P3CH 8FABB 1PKQA 3HC0A 5FA4B 1V3KA 3VG9B 2CMRH 4YBHA 4AMKH 1W8OA 4WENB 1TPXB 3AS2A 3GEWB 1A7RH 5KW9L 4LLMA 3KS0H 2V9RA 2P8PB 3BQUC 1T80A 5D5ME 5BV7L 1X7QA 3D18A 1MI5A 3TBWA 4U1SA 3L95A 1SEBA 3BUYB 4FZEL 3KDMB 2VR9A 2QSQA 3O41B 4L4VE 4NRXA 3KYAA 3FRPG 4RRPA 3S34H 1MCPL 3TT1H 4YPJA 4BZ1L 3L3GA 2W92A 4XNYL 5JUEL 4JKLA 1CFNA 1WAAE 3WLWC 1PLGH 4Z95L 1ND0A 1XCTA 4V2BA 3UYOD 2OZ4L 1CD1B 5KSUB 2VLRE 1H8NA 5D1QD 4YNYA 1TJGH 4RMSA 3ZO0A 1CICD 1ZV5A 1ZVSA 3O4LA 4D8PA 1I8MB 3VXNB 3LKPB 3QZWB 4KKBC 4GW5A 4PJAE 4I0PC 2X4PA 3I6LD 5JDSB 5L9DL 4Y4HA 1E6JH 1BVZA 1NMCC 4ELME 3NCMA 3G5ZA 3C8HA 3OAYH 4WU5A 1ZLSH 2DLTA 4JKMA 3MA9H 2HFGL 3KYOA 3E1F1 4XVSH 3WJJA 3T04D 1U58B 1NC2D 4KHXL 4ZS7L 5F72S 2HVJA 2VDNL 4LSVL 3T1FB 2VXTH 3E6FB 3GI8H 4JQVA 1BD2D 1YC8A 1U8IB 4S11A 3NZ8A 3OKKA 2Q6WB 4H5SB 1OAKH 5ACLA 4PRIB 1B0RB 3QDAA 4PJCA 4ZDHB 4KV5F 3UAJD 4LNVA 4TNWK 3TO4D 5A16A 3DRTB 1FNSL 4N0FB 2RHEA 4ZAKB 4UBDC 5J6GB 2DIAA 4Z0BL 3NOIA 3GMOB 4FFVD 1OGTA 5FB8A 1B3JA 1T1XB 3QFJB 4WFHD 1X4YA 3P4MA 4NQUA 5DURB 3SKOA 5SWQB 3I6GB 3X12B 2WBJD 3EDEA 1OVZA 2P8MB 2Z31A 1QFPA 1KXVC 4Y8DC 1FVCA 4QHLB 5EWIL 2CKBL 3TBYA 2UWEB 4ODBD 5I0ZA 2AJYH 4FS0A 4MNHB 1AXIB 2D3VA 4XI5C 1JNHA 4HS3A 5DTFA 5IB1B 4FFYL 1T7WA 1CYGA 1S78C 2XZZA 5A2LH 1AP2A 1LO0H 4OV5B 1JFQH 2F19H 5I1EH 1U6AH 2RQ8A 1I1RA 4UDUA 4N8VG 4KTYA 4RAUA 1IT9L 5INCB 2HJFA 3HE6B 2FZ3A 5C08B 4XMKL 1WEJH 2ESVB 4NCDA 2DBLH 4JFHE 4AEFA 3FQNA 3QUKB 1DCLA 1PKOA 3JUZA 5DZOA 2CSPA 1ONQB 4PB0L 3TBSB 3OR7B 4YFEA 1JJUA 4QOKA 1DFBL 5DF0A 4LSRL 5KJRL 1HIML 4XRCB 1KTDA 4AENB 3NIFF 4NC0B 4IOFD 1UM6H 4Y1AB 4EXKA 1FZMB 5H35B 4J4PD 3TT3L 3GKWH 3HI5H 3B9VA 1V7ML 2IQAB 1Z5LB 4QXTB 3QUXA 4QKXB 4YHMH 4OD3H 3P9MA 1MJ8L 5AZ2L 4MD4A 3QPQC 2AS5M 3JTTB 2NY0C 4OZFB 3BIKB 4MQXD 2NY6D 4W68A 1HH6A 2BK8A 5IB3B 1SY6A 4YHIA 4FQ1H 3S37H 1ZLWH 3O6FB 3NN8B 3RL1B 3LPWA 4Z0BH 3KLAB 4FQPA 1XR8A 3ZTNH 5IVXA 4QXGH 2EE9A 4Y0GA 2A77H 2XTLA 4A6YA 3AROA 3VFTB 1OGTB 1BZ9B 3QCTL 3VWJA 1DLFL 4LPXA 4HKZA 1MCNA 3F5WB 5C8JA 5GHWL 5E70A 1G7LB 5GSRA 3WO3B 1YN7A 5ICYB 1RZKL 4IRZL 4MWFB 2NPLX 4N8VB 4ZS7H 1VCAA 2YUXA 4G9DB 4KHXH 5DMGD 3WKNA 3O2WH 4OFVA 4G8EA 4EUPA 1RK0A 2G75B 1KCRH 5H8DA 3TIDB 4AT6A 3BN9D 4HAFA 1AXTL 2NX5A 4PRIE 5E9DB 3U6RA 3LKRA 3SOBL 2HMID 4I2XB 3QHTC 5IWLA 3HZYB 3WLBB 4JM2D 1UEMA 2Q3ZA 4YE4H 5GJTH 4P4KD 1R5VB 4OFDA 1U8QB 4NKIH 4G7VH 2DI7A 1C5BH 4XWGL 5L6YH 3VFNA 2BY3A 3LB6D 2IMNA 4X5WA 4MJ5B 4NM8L 2Z31B 2UZIH 4X4YB 3LQMA 1JF1A 1BF8A 4POZC 5T33H 1JPGB 5I15H 1QR4A 3BHBB 5ESQA 3V0WL 3IT8D 4NZRL 1EO5A 3PWPB 4AM0B 5JA8B 3C60D 3CC5B 4V1DE 4QHUA 2SEBA 5I1IH 3MO1A 5IHUL 4NNPH 5T1DL 2A9NH 1BM3H 4S1RH 4O58L 3F12A 4WDIB 1HSAA 4JPVL 1BJ8A 1UJ3B 3B3IB 5JOFA 5DK0A 1BVKB 2EC9U 1OM3H 1ES0B 2JIXB 1Q9KA 5CGTA 3GSQA 1EFQA 3L5WB 4EDXB 1VFMA 2HFFB 2X42A 3WUWB 5EC2A 3ULUC 4P2QE 3CFCH 2VXUL 3PL6A 5ISZA 1Q1JH 4KTEH 4OGAC 5BVJB 3H3PH 4LU5L 1VGEL 1K6QH 2H32B 2DQUL 3U82B 5KN5B 4XCCH 2P5WD 4R6UA 5CKAA 5I2IA 3RGVB 4K8RL 5ETUB 5I75B 4ZOBA 2R2BB 4Y2DB 3S8WA 4QRQA 4BH8A 4XNMB 3LSOA 4OTXH 3HC0B 2P5WA 5E08L 2JKXA 4I5BB 3C5JB 5I66A 2RGSA 1HCVA 4R26L 3IGAA 3SDYL 1WWCA 2APBA 1B0GA 3BEWB 3QA3A 1RHHB 1KENL 4BK5A 3Q2CA 4Q9RL 2DAVA 5CGMA 3EJZC 2Y07L 1OB1B 4X7EC 4CAGA 4BFBD 1UCBH 4KRLB 3S35L 3S37L 1BZ7B 1HHGB 1GPOH 2VDRL 3GFUA 4POZD 3I3BA 1ZT7A 2DQEH 4PGCA 4GG6F 5IOPA 3BKJL 4HV8A 1HH9A 4WO4A 4P4KA 2DQCL 4YEEA 2VH5H 2CLVA 1G7HA 5HPMB 2H1PL 5ID1A 3SN6N 2IF7A 3LS4H 2ICWB 2E3VA 3UP1A 5D96B 2HFTA 4Q6YA 2O5ZH 3GMLB 4MA8H 5I1IL 2BSED 4GBXA 4NSKB 4H26A 3OKDA 1VHPA 4G43A 2VABB 2DOCA 4AQ1B 4K55A 4LRNH 5GGRY 4HBQA 1KCLA 4HQQL 2B2XH 3L1OH 1FNAA 1S7WA 2IH3B 1LO4H 4MS8D 3WFCH 3MOAH 4RFEA 4Y5VC 5AZEH 2D0FA 2F74A 3O6FD 3ULVD 5FYJE 1MCHA 1QYGL 3MRMB 4EN3C 1ADQH 2Z4QA 4F7CB 3ULVF 4DWHA 1IC5H 2CK0H 2WUCH 5DUBA 1F6LL 2HKFH 2FJGB 3VMOA 2WINB 4GW1A 1KFAL 2OJZH 1RUQH 5BO1L 4N0RA 5E6IC 5T1MB 1TETL 4KC3B 3CC5A 3PNWA 2AVGA 2X4RB 1IM3A 3VFMB 1MJ7H 4W6WB 1YNKL 2XWTA 1L7TL 3TJHD 3W0WB 5I1HH 3FB5B 1QG3A 4BQBA 1NAML 2F5BL 2Q86B 2FEEL 1H5BA 1CF8L 1IEBA 4OF7A 3PWVA 2HVJB 4B7LA 1WT5C 3IDXL 4OZGE 4RBPK 3T3ME 3WE6A 3RJDA 3P0YL 2A83B 2HFFA 2W59A 5IFHH 1A1MB 2YA1A 5IB2A 4HPOH 1QHPA 3ILQD 4NQVB 4BQ9A 1A3QA 4TVPD 4DCQB 3I6LE 1DP0A 1G0XA 4M61A 1OB1A 1U3ZA 4ZS6C 2R0LH 2AJVL 2ESVE 1F13A 2GFBA 5E8DL 2VZVA 5HGGS 2B4CH 2VQ1A 3K2MC 3V4PH 4XP6H 4DTGH 1YUHA 1Q1JL 2JCCE 3BPNC 2J6EH 4WJ5A 2EE2A 6FABH 5EBGA 5CHNA 3TA3C 4NQSB 1PG7L 1RUKL 2R1WA 1WCBA 4A6YH 3I6KA 4U1GB 4XP5H 5LGHL 1NBYB 1BP3B 4URTB 4NN7C 4OLUH 3TBTB 3V4UH 5BMFH 2BVUA 2FIKB 3VXSB 2AQ1A 1PJ9A 5C09D 5J57B 5ACZB 1VFBB 1K6QL 1OL0A 4JRXA 4PIRF 4XPTL 4L8SA 3LIZH 4HIXH 5M94B 3QUML 1B90A 1OAXH 3BXNA 3HRPA 5FYLD 1TETH 3O45A 1RHFA 2RBLA 5DQJB 3SDXB 4KJPD 2OJZL 2PR4L 2ZG3A 3HRZB 5INCA 2X44D 3N1MC 5C0GB 5FYKH 1OW0A 4ZNCD 2QQNH 4S2SA 5GXBB 4OLXL 1A9EA 3BIKA 1BFOB 2YSSA 1KIRA 1KULA 1MNUL 5D2NC 4ZAKC 4PYHA 4WEBL 4OLWL 5ID1B 5H37H 3HE7A 3DXAE 5EZIL 1BFVL 2Z8SA 1I85A 3RGHA 5F6IB 2RFXA 4NQDD 2MMXA 3U0PA 1A14L 4ZD3L 1HKLL 3OKOB 1VEMA 3S88H 3TFKD 3UC0H 4X6CE 2WINA 3ARBC 5DSCA 3U0TA 3CFDA 1T3FB 4ZAKA 3IDGB 3CU7A 1FDLL 1FNLA 5IBLC 5KSAC 1AGDB 5ID0A 1NCDL 3FOLB 3O6KH 1U2CA 3NFNB 5T5NF 3RX5A 4QTIH 1CTNA 5LAXA 3VJ6B 4CMMA 4Y5XA 5IVXF 2VXVH 4UQ2A 4BSJA 4HXBH 1AO7B 4JFYA 1MRDL 1P1ZB 2I25N 2WK2A 2YD7A 3AMKA 3H9SE 4PG9A 3REVB 3B9KA 4KKBD 4HUVA 1DBMH 1HSBB 3UTTA 1EXUA 1XH3A 5DLMH 3NA4A 3MV11 5HYJD 1KF9B 5KVDH 4OV5A 1NFDE 1U2HA 3S9DB 2FO4A 4RZCA 4HX1A 2NQCA 3RZCB 4CVXA 5JXEA 1M6OA 3DROB 4JPWH 1D7FA 3HPLA 4JANA 1CQKA 3UO1H 1G7QB 5I1CL 4N0UB 1WCBB 3CCHB 3MV8D 5GSRB 1DE4A 3EHBD 5I1HL 4TRPL 4DKDC 4LPCA 1L6XA 1Q9WA 2R39A 4EUPB 4J8RB 4HFUH 4OZHE 4P23B 2WBJA 2BVOB 4HJ0C 3K81A 5FM4A 4YBQD 1L9MA 4PJ8A 5D1QB 3QUYC 1YMHB 3UJTL 3MREA 1JI1A 3MODH 2Q8AL 5I1KH 2CDFB 4PGZA 2XA8H 1JPTH 1TJGL 4EUPG 1MAMH 3QI9A 4UNUA 3P0VL 4NWTH 4Y4HC 2YRLA 3VXRD 3O11A 5DURD 4ZO9A 1YA5A 2RCSL 3P4OA 4MCYA 4CN6A 5DT1L 5IB3A 3WFCL 3L7EA 2DM4A 3WXVL 5IBLD 3QDMD 2DL2A 1RK1A 1MQKL 5KS9F 1MCPH 1JRHI 1T04B 3EFDL 2V2XA 3T3MF 5CD3A 3JTSA 1ZVSB 3W81A 1JV5A 4PD4K 5E1HB 3QQ4B 4I18A 1A7NL 4FZ8H 2Y5TA 4XWOD 4Z7VE 4C56E 3WD5L 4JZOA 1BBJA 5E8PA 4PV8A 1AXTH 4XHJC 1M71A 4V1DD 5F7FA 1F97A 4FNLH 4DKEH 1AQDA 3QUMA 2E7HA 3VXRB 3C2SA 3VFVB 4X6EA 1T21B 1A02N 2OMNA 5DRNA 3ARGC 5SX5K 1NAMB 4L3ED 4YHZL 1BVKA 1CGSL 1ND0B 1XCTB 1S9XA 4I77L 1NGQH 1VENA 1XIWC 4G9DA 4J4PC 3KXFA 5KSBB 2ADFL 3FKUS 5JORA 4B41A 5I1CH 1F45A 2A6DB 1YJDL 3ARZA 4U1MA 3ZDXF 1Z0NA 3FONA 4R4FL 3ZKXB 3CFDB 3H6JA 5DR5L 4OZIA 3TZVA 3RWGB 4HX1B 1IGFH 4Y5YC 3HI1B 3LRSB 3SPVA 4M6NH 2HTKD 1ZGLB 1U8HA 2VERN 5EU7E 4EI5A 3TIEA 1XF5B 3DX9B 4ENEC 2ZUUA 3IFPB 1X5HA 3KPSA 1RZKH 5DGQA 3NAAL 4YBQC 1G7HB 5HPMA 4OLEA 4NCC2 2YBRA 3IFNL 2CQVA 1MLBB 4F9PC 1A7QL 3O3BA 4PG9B 3KPQB 4HJGB 2VDKL 4XGZA 3DHJA 3NA9H 4KQ4L 5DHVH 1MRDH 3STZA 3OGOE 4FQLH 3EYSH 4QF1A 5DQDL 2VXVL 1BQHA 4O9HL 5CEZH 4OUOA 3N1GC 3NFSH 4FMFA 4I48B 4HUXB 2IG2L 4U7KA 2W9EL 5A1AA 4OFPA 1AXSB 3WD5H 3FT2B 5FM5O 3GM8A 3V7MA 3PXHA 4LLYB 4JDVA 1INEL 1URLA 4S10A 3VXMB 2WWKT 3VDBA 1LILA 4N0UA 2BSSA 2O5YL 4GMTH 7FABH 3JZ7A 1U42A 2IC2A 2Q87A 4PJHB 1KTRL 2D31B 2OTWB 4YDJB 1M7DB 5J3HD 1QFOA 3PWNB 1RIHH 2EO1A 2IBGA 4DN4L 1S7XB 1NBZA 3L3OB 2Y5TB 1HQRA 3CD4A 5DD3L 4LHUD 1RZFH 2OJEA 5CIPB 4MA3A 3C09B 4CU6A 4XTRC 5DEGA 1I7UB 5ITFB 2R2HA 1UM6L 3QUMB 4NQTA 2R4SL 4OD2A 4WO4D 1HHIA 5K9KB 3MLVL 5E2TL 1AY1L 1FRGH 1UH2A 3C8KA 5TF1L 4PJEE 3BPLC 1WITA 4JLRA 1VKXA 4Z7UA 2C3VB 3QFJD 1JGDB 1I7ZB 2KZWA 3T4YB 5FUZH 5J1AB 5FYLL 4KKLD 2LE9A 5AYUL 5HYJB 1FL6B 4FQHB 4GBXD 1IKNC 3A6CL 5LBSH 3NH7L 5KSAD 3BT2L 3K8LA 2IFFL 2XFXA 5A16B 1OAQH 2F19L 3PGDA 5I1EL 1TQBC 1U3YA 2EC8A 1GGBH 4KRMB 3EYSL 1INQB 3H42L 4JFEA 2VITA 5IVXB 1L7IH 3QFJA 1LE9A 1MQ8A 2NR6C 2XPGA 3W11D 3DBXB 3LAFA 1RURH 4JO2L 4WJ5B 4XCNB 1JHLH 5BS0A 1F3JB 3QZWG 1MAKA 1S5IL 4LLUB 5I1GH 2Y7QB 2WW8A 1FH5H 3LB6C 3QXVA 4M6NL 4KDTC 3VU2A 1PY9A 2DM2A 2OSLB 5IF0A 1MJJA 5JIPA 1X5JA 3GGWA 5JO5A 1EHNA 1H0DB 3MRDA 3NCJL 1JHTB 4JKKA 4JHAL 4TSBH 3KS0J 2NXZC 4Y5VA 4LHJB 1T1WB 2H8PB 5DJ0B 4WHYH 1NKOA 2VDLH 3FAWA 4JO4H 1DVFB 1CXKA 3PHSA 3B9EA 1JNNH 5SX4I 1FG2B 2ICEA 5MEOB 3REWA 1B0WA 4LCUA 4HWBA 1NAMH 5D5MB 3ZYIA 1Q94A 4NQSA 2AK1L 3TCLB 5DWUH 5KSUA 4I9WD 5TH2A 5IJVB 1CBVH 1WK0A 4JKWA 3WFHA 4Y2OA 1ZT4B 1Y18B 3T0DA 4MNQA 4AEIH 4LL9A 2FIKA 4PBWD 1RULH 2GT9B 3DVNB 1NLDL 3MFGB 4CVZB 2V6HA 3ILQC 5DSCB 3IB4A 2BRRL 4AM0A 3UTQB 1PQZA 3OB8A 2BOCB 4Z8FL 7CGTA 1FL5A 3GSRA 2Z8RA 4APQC 4HK3N 5GGQL 4JDVB 3GSVA 1KPUA 4JEGB 1MCEA 4LBEA 5F6HJ 1HHIB 3VXUB 2HRLA 3P9LB 5EZIH 2CMRL 3FFDA 1EEYA 2DQDH 1D5IH 2MTPA 1FNHA 5KVFH 3ARGA 3SO3B 2H26B 4BFIB 4XPHH 5MP6L 3E2HC 3OJMB 1OAYL 3TN0C 2IAMD 2PETA 1A1OA 4NQXA 5T1KB 2APTA 1K5NA 4KKNA 3DI3B 1XGRB 5I73C 1G9NL 4R0LB 4GSDH 5CCKL 5C3LD 3BKYL 3O6FC 3NFPB 4M7LT 4KWUA 5MEPB 1RY7B 3F5WA 5SWQA 3SGDH 3QNZB 5F6HI 3TBTA 1CLYL 1QLEL 4RISH 3SDAC 5IW3A 3NCEB 3S6CA 5DUPH 1A7PL 3BWAB 4TSBL 1FNSH 5EFIB 1RURL 4JO2H 4LF3A 1S9WB 3QUZB 5I18H 1BOGA 5JHLH 3OZ9H 4HIHB 2DDQL 5IBTH 5I6XC 3T4AB 4QO1A 3OQ3B 5I16B 4L3CA 1J0YA 1QFUL 1YEFH 5IHBA 3H3PL 3HPLB 5DJ8A 3ARSA 1D5MA 4BH8B 1HWGB 3IJSB 5F3BA 4TTDC 3ZT7A 2YD4A 1G7IA 4YZFE 4X7DC 4W4OC 1LEKA 4K8RH 4Z76A 1UG9A 5EO9A 2VZOA 3W82A 3V0VB 2W60B 3AREB 3MOBH 4PB9H 1JZ8A 2BC4B 2OR8A 3GMQA 3QULB 3MV7D 3RNQA 2G5BA 1OAQL 3FQWA 4MJIA 3QG7H 1FNFA 1ZXQA 4GKNA 4P2RA 5C0JB 4Z9KB 2OXHA 4UIKH 2LFGA 1XCQB 5DRXA 2EIDA 3RVTC 2ED7A 2XQBL 3TA3D 3MV8A 1Z5LA 1TCRB 2A38A 1X6LA 1JN6B 1NMAL 1QPPA 3MR9B 4UQ2B 4M5YL 3EDDA 5F97E 3RTQA 4LGPB 1PSKL 1NMBH 1V3JA 5FK9B 4QNPE 2CPCA 5CBAA 1TVBA 2AK1H 4JM2A 5H94A 1FQ9C 1DANT 1W72B 4Y4KA 3B9KC 4XMKH 2AEPL 5C0BD 3VGAB 3MRCB 4K3JH 5K59F 1CI5A 2P24B 1LDPL 4KZEL 1T66D 1U0QA 1VPOL 4H26B 3BQUD 5KN5A 2NY5C 4XXDA 1EGJH 3DX7A 1PEWA 4Q9RH 3EKCA 1OAUL 5F21B 3RJQB 4G6ML 1RZJL 1P2CB 1WC7B 3CLEL 3L7FA 4KMQA 2Z8WC 4Y2DA 4C55A 1NLDH 3ULUE 4HGMA 1KPUB 5IJKC 1IQDB 2QADD 3MFFB 3VD5A 4QHLA 2OCFD 5E00A 4L8CB 4JHZA 5BV7B 3MRFA 2VDKH 2VH5L 2CR6A 1YEFL 3IDMB 1HILB 5DC9B 5JORB 3QHZH 3T0ED 3CVHL 1EDQA 1RK0B 2QSCH 4DK6A 2IG2H 4XPFH 3WIFA 3CGTA 3QXWA 4Z78A 3MRJB 5C07B 4U3HA 3V6ZB 4J3TA 1KC5L 3WYRA 1YUHB 4OUUB 1OLZA 2EDFA 1TZHA 1E4KC 2HKFL 3QEUB 3IU3A 4FOMA 4JE4B 4XPHL 3W0WE 4I77H 1YNKH 3FFCE 3GO1H 1UKSA 3CX5J 4RSVA 5FYJD 4NSKA 1VB9A 1BLNB 2A9ML 3MBED 1MJ8H 2FGZA 3BN9C 4UOW0 1RUQL 3P30H 5BO1H 5D70H 2QQLH 1CS6A 2VLJE 1ZOXA 5BXFA 1MEXH 3HZVB 4MJ2A 1OHQA 3N85L 3VXUD 1S7SA 2ZKHH 3LPFA 4TUOB 1DBAL 3PV7A 2YK1L 4X6BA 1SJEA 1J1OL 3MBEA 4XNZB 2HN7B 3ZT6A 5FM5M 4JM2B 4QEGA 3TT1L 5D7IE 3FONB 5JNYA 5BV7C 2HFEB 1FRGL 3KGRA 4JCLA 5DO2C 2X1WL 1H3PH 4JRYD 4FZEH 4AYFA 1F3DJ 3OKLB 1C12B 4CBPA 4U6XB 4R7NA 2BZDA 1SVCP 4Z7VA 4PB0H 3DO3A 1IEAB 3AMLA 1MFEL 2KQNA 3T77B 1OY3B 5IKCA 1QO3B 3UZQA 1JNLH 2EIEA 5HHMB 4DKFL 3UBXA 4I5BA 1NDGB 2Y23A 4NNYB 3CSYB 3QXDA 1ZTXH 2AAVA 1NCBL 4G80B 1MJJB 4GKOA 1S5IH 5GIRB 5D7LE 5HHOA 2CJUL 4YE4L 5HHNB 5BW7A 1Q9LB 2YC1A 3UYRL 3DX7B 4LCWA 1KJ3L 4N0FA 4Y19E 1N4XH 4QOKE 2AJXL 4PRPE 1O7VA 1F3RB 4PJEF 5D7IA 4U1JA 1GAFH 3TNNB 1KB9J 2XKUA 2MHAA 1TQCC 1XZ0B 3HR5A 3FB6A 4OF5A 2YMXL 3BDXA 3QDGB 5JHDE 2E6QA 5HPOA 2N7BA 1TZHB 4WHYG 1JPFB 5D1XA 2FCBA 2XQYG 3EOTL 3NMEA 5F6IC 3U4BH 5I1LB 4XPAL 1N0XH 1CD0A 2PNDA 4Y1AD 3UZVB 3JWOC 4P46D 5EOTA 1QRNB 4POUB 3CFJA 4XB8A 4HXBL 2HTLC 4LVNB 1JWSA 1K3IA 4HPYL 1SEBB 5GZOC 4G43B 1HHHB 1JNHB 1BM3L 5IB1A 4RCAA 3SGKC 3VXUE 4TTGA 1H3PL 4ELKB 5BRZB 1DQDH 2C9AA 4YUEL 3UTSE 2BSRB 2NCMA 4HKBA 4JZNA 2BNRD 3MRQB 1ZAGA 2OQJB 3BGMA 3RA7H 1WWWX 5FYKD 3ARGB 5EC2B 1KOAA 4F58L 1F11B 4M03A 3FCTA 3QNYA 1A6TA 3VXOA 2E8ZA 5FCUH 1R3HA 5CEXB 2APFA 3RPKA 4G7VL 1GGIL 4ZPTA 3QIBA 3MACH 5FV2A 3L3HA 4U6XA 3OG4B 2NY2C 4EI6A 4M5ZH 4UAOC 5EULV 2CDFA 2A9MH 3AGVA 5GGUA 4KY1H 1MCJA 4X6EB 3U1SL 2LABA 4P9HH 1FLTX 4Z7WE 1T83A 1IL1B 2FX9H 5JUEH 4XBGB 1NEUA 5DD1H 1JWMA 1KG0A 4G5ZH 5ELIA 4PRID 4W81A 5IIEB 3O6FA 5IEKA 2P42B 3CSGA 4NQVA 2CDEA 3RL2A 4LPVA 4QTHA 1GGYA 2HVKB 4NZUH 4PTTA 1FFNB 3P4NA 1BVLA 2XTJE 4X7CC 4JFDB 5FHBL 5JW5A 4DUXA 3TIEB 1A4KB 4P5KB 3HZKB 1A7OH 3C8DA 2IAMA 2QHLA 4MQXC 4H0IA 43C9B 2DJSA 2R1WB 2YUWA 3TH3T 3OSKA 2OBGA 4F33A 4Z5RB 2UYLB 3N06B 5IW6A 1KN4L 4N0CD 5I1LA 2FBOJ 2DL9A 4H25A 1FFPB 3D69B 5DZLA 4ZODA 2AABL 2DLEA 1FBIL 1E6JL 1V05A 4NUGL 3GSRB 3OMZA 2NLJB 2PO6D 4L9LB 5CGYD 2H9GB 5DMIH 3SDCC 1KACB 5D71L 5SV4A 4MSWB 3WFBH 4YHLL 4EN3B 3AS0A 1ZHKB 3RX8A 1NAKH 2JTDA 4UOJA 4NGHL 1Z3GL 1KFAH 4H8WH 4N8PA 4UAOB 4HUUA 3QDGA 3PJSB 2DM7A 4M3JA 2F74B 1IC5L 2CK0L 2WUCL 4RQQB 4MYWB 1LK2A 2VDPH 3VRJA 4M6AA 4I0PA 1MPAL 4QRRE 3PUCA 1KGCD 2JLLA 2P8LA 1OTTD 4K3GA 5E8OB 4HMEA 3BP6B 1UXWA 2G5BB 3H3KA 4OCXH 4P3DB 2E6JA 2Q1EA 1X5ZA 1E4XL 5KSBF 4Q9QL 4LSQL 3S3SA 3WBDA 3EYUL 4KDWA 5ITFA 1E4WH 4D0CB 1BWWA 2UUDH 3FB5A 4F3FB 4F8QA 5F7LB 1LO0L 1SMOA 5CEZE 2GTZB 4KDVA 4WW1B 3M8OL 4R7DA 5E5MA 3F12B 3VGGA 3KPNB 2PCPA 1E27B 1A1NB 1KLFA 2DWEB 1PG7H 1KB5H 3SY0A 5C0CB 1Q0XH 3VXSA 2EDHA 5HDQL 4Q6IB 4YDKL 3T08A 1FFQA 4Q0XL 4DTGL 1QFUH 1AQKL 4HCRL 1I9RH 3BZFA 4JB9L 3V9FA 4BSWA 2IANB 3TBWB 1OF2A 2GITA 3GJEB 3QIWA 1NDMA 3ZL4L 3KG5A 4D0DA 1KC5H 3MUY1 1NUNB 3VFTA 2ZUQB 3U4EB 4ZYKB 4JFDA 5T5FL 5IFAL 3B83A 4MJ6B 3KPSB 2V9QA 1ZSDA 2R0KL 1D5ZA 3HPJB 4Y8AA 1MLBA 2XZAH 4XP5L 5LGHH 1QSEB 2C3VA 5GGVH 2AJZA 3UJIL 1U95B 1I75A 3ULUD 3MLWL 4Z7UE 5C09B 1UFUA 2GY5A 4GOSA 4GQ9H 3DUUB 4Y19B 4TVPH 1EHXA 3NGBC 1UVQB 3DYOA 1UM4L 1R3LB 1JF6A 3MRNA 4JRYA 3RVVC 4PLNC 1F42A 1EBAA 2YS4A 1H0DA 3ULSA 4PP2A 3O45B 4ONHB 3G5VA 1AC6A 2DQJH 5HDOA 2D4DA 1JYVA 3WL9A 4M8QB 5K93A 4ETQA 4G6MH 2VITB 1G6RB 3QI9B 2MOVA 3VFOB 5F9WB 5M95B 1NGYB 1ZA6B 3S96B 5D7SL 1YPZA 1EIBA 3DGGB 3EW3B 2VIRB 3S88L 5AYUH 4E41A 4GG8A 2KH2B 5LGKA 5D7JC 5CAYB 1I9EA 5ESQB 2B1AH 5ECJE 3ZZ1A 1T0MB 3I3EA 3LEYH 4K7PY 1Q0YL 2FHCA 4RGOL 4HULB 5EZOH 2HH0L 4KTEL 1AGFA 3E2HB 1A5FL 5HHMD 5EU6D 4XWOC 5AAWA 5BXFB 1K4DB 4FFWC 5T1DH 1RPQA 1H3TA 5ISZE 1E4JA 1U58A 4IMLB 4M8VA 2XKNA 3C87A 3CFBA 3HB3D 4FFZH 1I9RL 3DNKA 4LSSH 4PRPB 3DSFH 5F9WC 2P5EA 3SE3A 2JIXA 4LDOB 3RFZC 2VLLB 3K4AA 1T2JA 4KK8D 3D1MC 3GHEL 3V5DA 1EEYB 4PJIA 3DIFA 5HYJE 4MD5A 1R3KB 4XZUB 5DT1H 1JTPA 1VFUA 2ICWJ 3QWRA 1A6ZA 3MREB 2V5YA 4YUEH 3UTQA 2CXKA 4QYOB 3PNWB 1MEXL 4MXQC 3O3DA 1P7KB 5T3ZD 3BP7A 3QEGL 1MCBA 5GS0H 3QG6B 3PHQB 4TSCH 1E28A 1OSZB 3GSXA 4P2RD 2DWEA 2PN5A 4GAJH 4HG4K 1ED3A 1TENA 4P2CG 2JELL 1N0XL 3WV0A 3BEWA 1H15A 4ETYA 3ARXA 3QQ4A 3BPOC 3CH1B 1K4CB 4OIAA 4OF0A 1UCTA 3Q1SH 3DETC 4LIQL 4JFQA 2R8SL 3QYCA 4NQEA 1EH9A 2FB4L 4JRYB 4GMSH 5HHXL 2CRMA 2XKSA 2C1OB 2ZJSL 5DJ0A 2AKRB 1HXMB 1T4KB 4LU5H 4ZXBD 3ZTNL 5HVHB 1LK3L 1FYTB 4WWKD 2JJVA 4P2QB 4NZJA 3WN5C 1FO0A 4MD4B 3CUPA 3IDUA 1RFDH 4JPIA 4GFTB 3EO1A 1D6EB 5IJKA 3T0EC 2ITCA 4YDIL 4HJJL 4J3OC 5BZDB 4ZXBA 5J56B 2G60L 4TNWF 4UOW1 5MP6H 1U3HD 4Q0XH 1OD9A 2A77L 3QPXH 3U7YH 3R1GL 1QYGH 3ARED 4DKFH 4U6VH 5AZEL 3OXRA 1YY9D 1G9NH 4ORZC 4TSAL 5FKPB 1GYAA 2J7LA 5CBEB 1I7RA 3S4SG 4KV5E 3QDJD 4LOUD 5CJQH 3UPRA 3QIBB 5E5UB 2NY0B 4LVHB 3QI9D 4XBPB 3BPCA 5DRWB 3X17A 5EPMB 3BAEH 2BY2A 3FRUA 1Z9OA 4Y4FD 3HZMA 1X5LA 4QRPB 3WS6C 2XN9B 1YECH 2A6IB 4TPRH 1G9MC 4E5XB 1TJHL 3PQYA 3DV6B 1YMMD 1CDIA 4NC1C 4FQQA 5DFWH 1DFBH 3FZUD 3MJ6A 1G9ML 1A9EB 2YD1A 4YHIB 1RJCA 4Z76B 2C4XA 3VWKA 3ZDXE 1NCAL 1FO0L 5IROC 3ORJA 4HMDA 4MCZA 3VXME 4NWTL 5D8JL 5F96H 1U8KB 2HVKA 3HI1A 4NGHH 3JWDC 1MWAA 4ODUB 4OLYH 1EEZB 4JCMA 3A67H 2EYSA 2L0DA 4FQLL 2BCKA 2VDOL 4OB5L 5EZOL 5FYJL 2H1PH 3D85D 3UTTE 1MCWW 3BSZL 1GHFH 4S0TD 4JRXD 2D31A 3VH8B 1I3VA 2FIRT 5H94B 4OZHF 4FABL 7FABL 3B9AA 4M62H 3RA7L 5TQ2H 3MQIA 4U1HB 4YO0A 5FUCC 3L6FA 5BQ7A 4APQA 3H9ZA 3O2VL 2YKLH 1ZA3B 4IHOA 1WQVT 3RVTD 4HEPG 1YEEL 1BVLB 4OD2B 1A3RL 4KK5C 4GKZA 5EU3B 2WWKO 1INDL 4IIQA 4K7FB 5HBBA 5F88A 4HFWA 4WFHE 1LEKB 3KLHC 3QUZD 4UTAL 3V7AE 1RJYB 4PY7B 3ULVC 1SM3L 2F58H 1UXWB 4IDJH 5JQ6H 3NZHL 3BPNB 5BCAA 3GSOA 4YHPB 5DRWA 1FJ1A 2IANE 1LE9B 5IESL 1NGXB 4UV4L 4EUPH 4I0KA 1NCDH 3SE8L 1ZS8B 1QUNA 1X5KA 3DVGB 3UTZB 5ITBH 1BPVA 1OTTC 4G5ZL 1FNEA 4EKXA 3VGHA 5FYLH 5IK3B 3FQUA 3QDJE 4NYLA 2OZ4A 3IAGC 2OK0H 1I1FA 2NW2B 3BO8B 4ZD3H 2WAHA 3TA3A 2HN7A 2ARJQ 5GS1C 5HYJA 1KCSL 1PYWB 2OZ4H 5FGRA 4MMXC 4IRJB 5SV3A 1T5XA 1T2XA 1U8JA 3QEHB 4FQXC 1GGTA 1KSRA 2LU7A 3PV6B 1A47A 4NO2B 3UJTH 3T0BA 2H8PA 3RUGB 2PO6C 3P4NB 1J8KA 1BBJB 1WCQA 5MHSD 4RDQF 5GISL 3DMMC 4XP9L 1U3HB 1L9NA 1I7TA 3BZEB 4JFFA 4IDLA 2VRAA 3HG1A 3QUMH 3ZT5A 4X8XA 1A7NH 4FZ8L 2AERT 1R0AH 3M17A 1ZSDB 3KPOA 2BFVL 3GSNB 1QO3A 4X4XA 2Y7QA 3GSNL 3QRGH 2GUOB 4KRPB 1UWEH 1OP5H 3S7GA 3WFEL 2J88L 4Z7WA 3KNBB 3FOMB 1M7IA 5E6ID 1JPSL 3ME0A 4JKPH 2RCSH 5FF6A 5KVEL 2BOCA 3H8NA 5A40E 1NEZG 1BJ1H 1CIDA 5J3HC 3UBXG 4NQCD 1MHPL 4CN1A 5C0BE 3N85H 4OZIE 3O6LH 1E4KA 2JJSA 1HHGA 3IFLL 4D0DB 1UWXK 1S7WB 1FG2A 1H3UA 5MEOA 4MHHG 4GW4B 1F90H 3QQ9D 1QFHA 5SWZE 2OL3A 1CL7I 3EDJA 2Q7NA 5IJVA 5KVGL 1CLOL 4PRDB 4TRPH 2ADFH 1S7QB 1TVHB 4PJAB 3CMGA 1I1AC 5TQ2L 4NFCA 2X5PA 3VW3H 4PY7A 3CFKA 3NIFE 4IJ3C 1G7PA 1PVHA 3FQWB 1F4YL 1R3LA 5A2JH 4DVRH 2IGFL 2NY6B 5J12B 2XXMB 2YRPA 4X99A 1OOAA 1IC7L 1MFEH 4O51A 4WUKH 5JDJA 4JFXA 3IJYA 4FNLL 4C56A 3C08L 1QKZL 4DZBA 1JMZA 1EGJA 1F00I 2ZOLA 1U93B 1V7NH 4K8RC 2NW2A 1N6UA 1GGCH 2BSSB 2VXTL 1REIA 3O4LB 4OV6F 2HLAA 3T65A 3VXSE 4PJHA 4S1DD 4KK6D 1CE1H 3GNMH 4OCSH 1N6VA 2HJKA 1JK8B 3QDGD 2NZ9D 1DBJH 3PP4H 4PJIF 3TT3H 1M05B 5DJZA 1IM9A 4K71B 4Y1AE 3OJ2C 3LIZL 4HIXL 5D8JH 1AKJA 1KJ2H 3NCBB 5FV1L 5C2UB 4PP1C 2PYEB 1WTLA 2OI9B 1I8KB 4MQTB 2NMSA 3AXLB 3G6JA 3LKNB 1HYRC 1IAKB 1FZJB 2Y9RT 3CVHB 3HG1D 3V52L 4U6YA 4NPYA 4PJ5E 3ZTJH 3CLFL 1C16B 2GK2A 5DUMH 3X3FH 3BRFA 5IFJB 2CKBH 3LZFH 2EC9T 2HTLD 2DQFA 2XWBB 4ZOEA 1S5HB 3VGEA 4ENED 5F7YC 1CDUA 3BYTA 4LEXH 4PJXE 3O2DL 5I16A 2MCG1 2G5RA 4GQPH 1MHEB 3THML 5ADPL 3U30B 1I7TB 4L4TD 3GIVB 4MVBD 3BZEA 1FZOB 1RIVL 1OTUD 4D9QE 2N7AA 3DX9A 3E3QC 1UZ6F 5E6YA 5CBAB 3ULVL 2VIRA 5C2BH 1FBIH 3MOBL 3QIUA 5DXWA 1WFNA 4PJ8D 5EBMB 5ILTH 5DJ2A 2X89A 2UYLA 1RUKH 4ZQKA 4A6YL 1BFSA 3VXTB 4X5XA 5GRYA 1MLCA 3SJVA 3TYGH 1T1YB 5E03A 1UT9A 1A7OL 4O00A 4QT5A 1QR1A 1BBDH 3LS5L 5E8NA 4DOHE 3RVXC 2FECI 3QT2A 1JZ5A 4LIQE 3FO9A 4M7ZB 3VGAC 4K3EL 35C8H 2FZ3B 5C08A 4DW2L 1EZVY 5IV2A 2CD0A 1DBML 3IJYB 4S1SH 4Q7DA 5GRZA 2EDQA 4XMPL 1KBGH 1A4KA 1IAOB 3LEVL 4OCRL 5EUOA 3SKJL 3ULVE 4NRYA 4M6ML 3DX8B 4IRJD 1IAIH 4WV1B 4TSCL 3DIFB 1QNZL 4JFPB 5FUZL 4NOBA 2MPAH 4OLWH 2QR0A 1ZVYA 1JYNA 3VI4F 4UT6H 1KIPB 1AY1H 1KTLA 1S9YB 4J3WA 1M05A 5DJZB 3RIFK 3TEUA 3UPRB 4TN9A 3V6ZA 3EZ8A 1A6VL 3W0WD 2NLJA 4L9LA 3SBWC 2R1YB 5IVZB 1YDPB 2MKWA 3BP7B 3D9AL 3DI2B 5C07D 4KKCC 1ZK9A 2LU3A 3WXWL 4JHBA 4J1UA 4DGVH 3KPNA 1MHCA 3IDMA 5KSAA 5TJWK 1W0YT 5KG9A 1GZPA 3K8KA 4JAMA 1U3HC 3GM0A 3Q5YA 1IGJA 3D39D 4BZ1H 2DI9A 4UTBH 4JGUA 2P5EE 1NJ9A 3QFDB 4LASH 1JZ6A 2WBKA 2C4FU 4PTTB 1KCUH 2CXGA 3HB3C 4PJFE 1YMMA 1KV3A 1OT1A 2Y25A 4RNRB 4UDUB 4XBEH 1DJSA 1EA9C 3JWOL 3BAEL 2I24N 4F2MA 3LQAC 5HI4C 4JANB 3BQUB 4F7EB 2YEZA 3IU3B 5F7NC 5JA9A 1MPAH 5T3XD 1WZ1H 4JDTL 2UWEA 5C0BB 3MV7E 3V7AG 4V1DB 5EN2A 4KI1A 5L8LB 4J8RA 1MLCB 3CFJB 4ZO8A 1ZT1B 4YIQB 5T5NG 1IE5A 3QEQB 1MRCH 1NEZA 2DWDA 1UACH 2UUDK 5GGRB 4LF3B 4HS8H 3OPZH 1GAFL 2B5IC 4R90L 4YXHH 2AXHA 4QWWD 3OKNA 4NO3A 4TVPL 4TNVK 1KENH 4ODTH 3FO0H 3MRLA 1DUYA 4KJQD 3FQTB 3EOBA 2X70B 2EH7L 3E6HB 4R96B 1YJDH 4UB0L 3G5XA 3AC0A 4L4TE 4WFED 1AFVL 2RR3A 3SO3C 1G7IB 4OZGA 1ZTXL 3KPSE 5DEZA 2F8OA 5D7LD 3U36A 1CK0H 2DS4A 1A6UL 3ZL4H 4XP1H 4EVNB 3CFEB 3UTSB 5E5RB 3OR6B 1AE6L 1AO7D 1R24A 2R56H 2XZQL 3MLXH 4PREA 5SX4H 5C92A 3QIBD 3HG1B 2ZG1A 2HT4D 4Z7NE 2Q76B 3RPIB 5BVPH 3RZCC 4UDTB 1CU4L 4LQFH 4N90D 3NVQA 3JTTA 5D2NE 4OGZA 4LASL 5FK9A 1I3GH 1Z6JT 1S9VA 1PEZA 4NQDA 4BSWB 1C1EL 5DWUL 5F7DA 3H7BA 4AT6B 2A1WH 5I1DA 4YHYB 5EZJB 4LCWB 3OBAA 4L3AA 4OGYL 1BOYA 5HHOE 2CLRB 4FQCL 1KGCE 5I1KL 4L3EE 1YDPA 3RWHA 3VXMA 5D2LB 2I60H 4FP8H 5DJXA 1D5XB 3BD4A 1P7HL 2X4TB 4PJBF 2HH0H 1MOEA 3HNSH 3ES6B 1RIHL 3TFKC 3VFGH 1BIHA 2IAMB 3PWPD 2M2DA 5D7JB 3JV4A 4XGZB 5HJ3A 5J89A 1ZGLP 2VQTA 3V5KA 2KDGA 4LAQL 2G75A 3F6IA 5E2VL 5T3XL 1RUMH 4L5FL 4PJAF 1AGCA 5KVGH 3BVNA 1FSKB 4XVJH 3QQ3A 1B2WH 3MJ7B 2Z35B 2AJUL 5GJSL 1J18A 3OKNB 4P2QD 5J13B 4F80A 3BPLB 3TJEH 1FYTD 3DGGA 5J1SC 4U1NB 2FEEI 1G9EA 4I1NB 1RJLA 4N8CL 1ZVHA 4LDEB 1ODAA 2CKNA 3T65B 4I9WE 1T7ZA 3BHBA 4ZFGL 3O3AA 5EN2B 5CEXA 3WHXB 3WFEH 1OM3L 3PGDB 3O6ML 2V7HB 4KK5D 2IQ9H 4K8RD 2YR3A 4P2RB 2SEBB 5C0JA 4KVCH 1JHKL 4EI6B 3BKYH 5JHDA 4JREC 5HYFA 4O51B 3M17B 1P4BH 2W1NA 4H8WC 3EYQD 5I30L 3GB7B 4M1GL 1EGJL 4G9FD 2BNUA 2LU4A 4HUWB 1AJ7H 4U0RC 4PRHD 1UB6B 4LLVA 4LSPH 3VFWB 2P24A 1UB5A 2GTWA 1NCTA 5IIEA 4HCRA 2HWZH 4GW1B 3FB8A 2A9NL 4K7PX 5CJOH 5ADOH 4F15C 3LQAL 3P11H 5D72H 5C0EA 4ACPA 2I27N 3BMWA 3BN3B 2X4RA 4NBXB 1AKJB 2BOBA 3OHXA 2K7PA 1P7KA 2FL5A 1KIUA 3RGVD 5BS0B 1T20A 1GL4B 4MQSB 3K8MA 1J0IA 4JDZB 3W2DH 2W9EH 5KS9E 4LEOB 5DJAA 3TN0D 4YWGH 5EIQA 3MLUL 1P4LB 4KROC 4TTDD 4WU7A 1INEH 4BA8A 4QHUB 2RB8A 5GHWH 2DQFB 1WEJL 2QV2A 4I13B 3ARDD 3ZDZF 1W0WA 4K94L 2JIXD 1NAKL 4CVWA 3V4VH 4ONHA 2FHBA 2VDLL 4LCWE 5DHXB 4F3FA 2P47B 3U79A 3HI6H 3AS3A 4CW1B 1LE5B 3ZLQC 1W0VA 3DROA 2ZZUT 5CJQL 2ATPB 5EO0B 3GMMB 2GI7A 5ANMB 3FT4A 4M3KB 2WIMA 3DUHA 3QEQE 4K71C 3FFCB 4FXKA 4N0UE 1HHKA 4M1CD 5D7JA 3QJFA 1KJVB 1P5VA 3MRIA 4PPTA 5C0CD 2NY7L 1N3NB 3I2CH 1KCKA 1X9QA 3EYQC 3IKKA 2BY0A 4U1HA 2HTKC 4XCEB 1I7RB 2GW5A 1A4JA 5IW1A 1AIFA 3I50L 1U8LA 5T1LB 2Z8VC 3IDJA 3ZDYE 5DRZA 2B0SL 3L3GB 3H42H 2YPKA 4D9LL 5IEHA 4S1QH 4G9FE 1UXSB 4OJFH 4WW1A 4ZAKD 4RGMC 1F4XH 2YN3A 1DQML 1ETZB 2E9JA 3GHBL 4JQXA 2P5EB 4PG2A 4CJ1A 1WBZA 2IQ9L 1J0KA 4JHWH 2DJ4A 2AV7A 1CLZL 3C60C 3R8BB 4P46C 1CGYA 3MUHL 5LWYH 2OM5A 1R3KA 4XZUA 1F11A 4WWID 3RGVC 4HUNB 5JMOC 2QJDA 4R4BA 4MAYC 4JPKL 1IAMA 2QSTA 4Y4HB 4LLWB 2O61A 3G04A 1K8DA 3IDNB 3LDBB 2EDDA 2QEJA 3KAAA 1IGMH 4LNRA 3MLSL 2IQAA 4KUCF 2Q8BL 3BP5A 5KJRH 1MIEH 4HWZA 1D5MB 5B38A 2A6KB 1GOHA 5IKCB 3QG6A 5BOZG 2KBGA 4J1UB 4KKAD 3B9KB 5EOCJ 3QUZC 3NACL 1HEZB 4H1LH 1QACA 4M7ZC 1P4LA 1NLBL 1CICB 4AG4L 4LVOC 5D7LB 2EXYC 2J8UA 1FLRL 3L5JA 2VAJA 4IOFC 2XA8L 4L3EB 1B6UA 3S97C 5SWZA 3BWUC 3QJHA 2C3HA 1P7QD 3KDMA 3MBEC 5DD0H 5EIIA 2F15A 3T0AA 4NBYB 3TVMA 3INUH 3L5HA 5GS0C 4OSUH 4OFYD 2MHAB 4UV4H 1G7QA 3GBMH 1Q0YH 1VDGA 4YDLB 2VC2H 5CEZL 4U1LB 3OPZL 4HPYH 3ELAT 5B21A 3BISA 1WWBX 3FFCA 4FXKB 4ZXBB 4IOSD 1C7TA 5ALCL 1CF8H 4BSVB 3WMSA 2PUQT 5KOMC 3VXNA 3STZB 1I9IH 4NO0D 3KJ4B 4K23L 1CICC 2JELH 4HK0A 1MJUL 5ERWB 5DYOB 1FYTE 1TQCB 2ATKA 4XXDB 1BHGA 2NX5B 5E9DA 1DEDA 3IDYC 4X9HA 5TE7H 3QUXB 1U91B 3BRGC 4GRLB 1X5GA 1ZHNA 5EU4B 2BJML 4Y5XB 5IK3A 3W9DA 4XNUL 4NO0A 4F7PB 3CXDL 3E6HA 4R96A 5CEYB 4JAMB 1XGQA 3HNTH 2EYRA 4JGMA 5E2VH 5L8KB 4PLJD 4PFEA 3WFDL 4QOKB 1W72H 2EXWD 2UWEE 1KJVA 3PDDA 3DPBA 5FKAB 1NL0L 3D39B 3QPQD 5TF1H 3FL7A 1JK8A 2GFBB 4JY6A 5CSGA 1LNUB 2QQNL 4P3DA 2YZ8A 4ELMA 1VPOH 3TGXA 1T0NB 2VUYA 5DHVA 4OIIL 4QXUL 3N1FC 4Y2DC 4G42B 2HT2D 4WTWA 3P9MB 3FHQA 5HD8D 4D0CA 4R90H 1EEUA 5BZDA 1N26A 4NZRH 5E9DE 1DQLL 4HGKC 4JFOA 3KPRD 2YUZA 3HUJA 2VL4A 4NN6B 3V5KB 5BV7H 1IFHH 2Q20A 4M4RA 5MEQB 2Y72A 1FGVH 1BD2B 1D9KD 4YR6A 1F02I 3BJ91 4LVHC 2FLBT 1J1OH 4I2XA 3JWNC 5CJ8A 1RJZB 4JN1L 4Z78B 1JGEB 3K46A 5CUSL 3OJDA 1TMCB 1UJ3C 3LMJH 2YD8A 4XP6L 1LEIA 3IJHA 4K2UH 3O3EA 5HYSG 1DDHB 1OPGH 2DTMH 3MRPA 3H9HB 2X70A 4JG0H 5DC0A 3MLTB 3OF6A 2JJUA 3D0VB 3S3PA 2AXGA 3VCLB 2PYEE 3HAEA 1WISA 4IRZH 1FFRA 2XWJA 3QNXB 1BQHB 5HYIA 1T3FA 2J8UB 2ZCKH 4DQOL 4JZOB 3UXFA 1Z3GH 1JHTA 3CMOH 3KYKL 1MWAH 4ALAH 1EEZA 4PREB 1FC1A 4ODTL 3PWJA 4GRWH 4I3RH 3K1DA 1O5DT 1VGEH 3GSUA 2EXWC 1DVFA 4PRAA 4HC1L 1CL7H 4HG4J 5J1TC 3VFNB 4TUJA 4IJ3B 2ESVD 4HZAA 3B2VL 1HH9B 4WO4B 5EUOB 4H1LB 3BIBX 3QXDB 4I0PB 2AW2A 2PXYA 1U8JB 4ZUSB 4FRWA 1CGSH 2X4QB 4GSDL 5JIHA 3LRHA 3MROB 1K9TA 1PQZB 2GIYA 1QR1B 1QSFA 3CXDH 5F1IA 4RFNB 3MLZL 2I9TB 3TWCL 5GPRA 4NM4L 1F6AB 2BCKB 4NKMA 4E42A 1MCQA 2GTZA 3GIZL 4KU1A 1QFWL 1T7XA 2KZ1B 5L8JB 4H88L 2GHWB 4LARH 4CADA 4CKVX 2WP3T 3VH8A 4RFOH 4LGRB 5ACMA 5MENB 4QRSA 3FOMA 3ETBF 1WBYB 1SJHB 4XAWL 1DANU 1LMKA 5J0BA 2DBLL 3BX7C 2QR0B 3O4LD 1KXQE 1GZQB 4XT1C 4OZIB 4M7LH 1ZT7B 4RNRA 1OP3K 2VE6A 1YN6A 4YX2L 3U7WH 5IR1B 1XF5A 4FFYH 2WQ8A 5F70A 1A5FH 3AFLA 3ROLA 3TO4A 1MWAL 4K7FA 2CGRL 2FWOA 4LHQB 3IXAA 3T2NL 2BVYA 2XT1B 5HY9B 2AXGB 3VCLA 1T5XB 3LKQA 3DUSB 4NDMA 2C3GA 3I2CL 2DQEL 3QO1A 3I02A 2M8XA 3IRZA 2V7HA 2AJ3A 1IAIL 4W6XB 3ECBA 2APWA 2EDNA 2Y07H 1NGXA 3MO1B 3CSPA 5EC1B 5J9PB 3OJDB 2VMFA 3BH8B 3DVGA 3DMMA 4UILH 5F9OL 1ZLUH 5EO1B 4K2UL 4JFXB 1ULVA 4LPYA 4WI2A 4L4VA 2L7JA 4LCUB 4TUJB 3IFLH 3RWCA 4PRNB 5DQDH 4Z7UB 2FBJH 3AY4C 3MGTA 1UB5B 4CMHC 3ARRA 4N5ED 1EHAA 4U7SA 4NJAH 3EGSB 2AXFB 3MMEB 1Z2KA 1C08A 2EKSA 2IPKB 4KVNL 1BD2E 4PJGF 3PL6B 1GOGA 5L2KD 2OP4H 1GSMA 4XCYA 1VA9A 3QCTH 5F44A 2VISA 4PJXB 3VMPA 3WN5A 1INQA 4O58H 4H0GA 2R2HB 1XEDA 2M26A 1OGAD 5DQJA 5JZ7D 1X5AA 5JIIA 4OCYH 4NNPL 3C6LA 3MGOB 4YXLL 1F3JA 3AXLA 3LKNA 3MACL 2CUIA 4MB5A 1R3IL 3S36L 4XBGA 1P7QB 3U46A 4C4KO 3TESA 3CXHJ 1S9VB 4JPVH 3RBSA 2OYPA 2ICCA 3HE7B 5FF6B 1AR1C 5I15L 4GAGH 12E8H 3BH9B 3ARWA 3H7BB 3ZTJG 4OD3L 2NY6C 3CDGA 5KTEL 1PFCA 4PRHA 3MV01 5FYKL 3PABB 1PAMA 2OK0L 2YD2A 3ARGD 5KVMC 2I9LA 1U8KA 4WUUD 1R5VA 1YYLL 5DD3H 1G84A 2Q7YB 4AJ0A 4C59B 2NY4D 3V0WH 1I1AB 4WI7A 2VXSL 1OAXL 2A6KA 4M00A 2J4WL 2XRAH 1H5BB 1IEBB 1JTOA 3B5HA 3WNKA 4U3XA 2CLVB 3WS3B 1JMXA 3RNKB 2OTWA 5TE6H 4O9HH 4ZPVB 3LV3A 4WW2B 3VDAA 1A1MA 1KT2A 1YY8B 1H15B 2NXZB 2WWMD 1N2RB 2XY2A 2R0ZL 1BJMA 3CFKB 3MV7B 4HIJB 4U31A 5LGJB 1IEHA 2FLRT 2OTUB 1M4KA 4MA1C 3V95A 3IFNH 3HN3A 2ADIB 2MQ3A 3K1KC 5T1LA 1HHJA 4OD1L 2ZNWA 4OQTL 1UQSB 4DGYH 4IHOB 2ARJB 3WDJA 1ZHKA 2VYRE 4HKXA 1TZGH 3GKZA 2IBZX 3GBNL 1DUYB 1YQVH 3DMMD 5DMIL 3DTXB 1UM5H 2IGFH 5D5MA 5HDBE 4EIZC 4WCYH 2CRIA 4PY8I 2VN7A 3DOSA 2EE3A 3VFSB 2E27H 1R5IA 3MCKB 1NBVH 5I19L 2DLFH 2WIIA 2EDEA 3D3VB 4DJMA 4FQ2L 1ZWIB 3ZE2E 5T1KA 4I0CC 4GAFB 4Y4KD 4YAQB 5CSZA 1S9YA 4OTXL 2I5YH 1R24B 1UH4A 4HZLA 1OGAB 5B38B 4XNMA 3ZYJA 4MJ6A 1DTUA 5HGDB 1FAIL 2QQQA 4LBEB 3UTPD 4X7TA 4NKQB 4HUWA 1RZ8A 1QSEA 4KVCL 3P4OB 5KSVA 4KAQH 1TVDA 4DOHB 5KG9B 1DL7L 4XNXL 3PXJA 1PLGL 3VFPB 1C8PA 1HSBA 1HCFX 1NCAH 2NTFA 4X6DA 4O5LL 3UDWC 1PYWA 4K3DL 4AIZA 3HUJF 4NJAL 5TE6L 3IDGA 3IVKA 4G3YH 3U9UA 5CWSB 1KN2H 1F2XK 4O2CB 4ZOCA 5F89A 2J3SA 5DI8B 4PS4L 4M8QA 2J4WH 2XRAL 3ZKMC 2J5LC 3MUZ1 2WWMC 3AM8C 5L9DH 4M7JL 1RZIA 1H9VA 4BQ6A 2VXQH 2AJUH 4KK8C 3VGDA 3EFDH 3QIUB 5INDB 3WS3A 3O2VH 3WFHB 2BVTA 4R97C 1J5OL 3R06B 5IM7B 2GJZA 3W9EA 3BE1H 3HA0A 3VWKC 5JTWA 3FB8B 1X3DA 4FQIH 1B6DA 1MREH 2XTJD 3G6DH 4PJIE 5J11C 2CUMA 4NHCH 4NOFA 4PRHB 3RZCA 3T0XA 1KEMH 3GSUB 2ZUVA 4OCYL 5DVMA 1SQ2N 2FR4B 1UCBL 3MPCA 2XZCH 3SKOB 2BSTB 4YK4C 3DTXA 4G8GE 5KSAB 3EYFB 4JDZA 3SDXE 3JV6B 3G5XB 4JJ5A 1ORQB 4KI5C 4TQEL 4E41B 5BMFL 2GEEA 1JGUH 4M7KL 1N7MH 4ONOA 4DFIA 2QQKH 4X9IA 4PGEA 1CQYA 5C0AD 1I1CA 2BVOA 3O8XC 2BERA 2F53A 4P2OC 2C7UA 3HLAA 5C08D 2AQ2A 4X6FA 2P7TA 3F58L 5DEFB 4ZSOE 5I8EA 5MEPA 5GJSH 4OGXL 2BXZA 2XKNB 3CFBB 1IQWH 3GJFB 4IS6A 5MENE 1YJDC 3ZHKA 1YEGH 2ATPA 3QHFL 1MAJA 2UY6A 4HPOL 1KXTB 2ZOLB 4XPBH 3MRFB 4MJIE 2G2RA 3UC0L 3DYPA 1KJMB 4P2OA 1G9NC 5F7HA 3QP3A 3UTTB 3U7YL 4M43H 5FEBA 1BOGB 1WJ3A 3AVEA 4OZHB 1OD7A 3EUUA 5DFVD 4LLQA 2BNRA 1PSKH 4O2CA 3DSFL 3B2VH 3EIFA 2I9TA 2AK4E 1DBKL 2CLZB 4ZNEA 3KPSD 4FFZL 4Q58C 2NY1D 3DHMA 3GKWL 4OM1L 3PDGA 5C6WH 1KPRB 2WLYA 1NAMA 4I3RL 2XNAA 3S37X 1G7LA 2FWOB 5EU6B 1AD9A 3TBVA 2JB6A 4MNQD 3KYNA 4GRMA 4C83B 3DX6B 3HMWH 3C5ZA 2GJ6D 3EHBC 3FB7A 3O3UN 3WIIL 5DD5L 5HHOB 1H5BC 4KZDL 3OJVC 4RFNC 1J1PH 5D1ZD 3FTGA 3SDXA 4OCWL 2BXYA 3HZVA 4P3CL 1IGCH 3CIQA 3QEGH 2RAMA 5GJTL 4PRAB 2WANA 5C0GA 4P2QA 2AJSH 1S7VB 3MLXL 1U8QA 5JW5B 5E8DH 3GIVA 4HWZB 3IFOA 4XBEL 4OI8A 5IMMB 5E94B 1DN2A 3L3DA 4YNYB 4HJGA 4KKLC 3DVFA 1ZLVK 1YNLL 5IROA 4XVTH 1YEDA 4ORGA 4YHYC 2G60H 3V4PL 4BZ2L 3U0WH 4D3CL 4P5MA 4ODHH 1FVDA 5GS2H 3FOLA 1O7SA 2DIJA 2P7TB 1OT2A 4EN3A 1NC4B 2X9WA 4R8WH 4RMTA 1HSAB 1UWGH 4TUOA 4HIEB 4M7LL 5E00B 3KPLA 4L8CA 1LGVA 2E5EA 5KVDL 4K94C 1DBKH 5CKGA 3MNVB 4NBZB 4IEFB 3VFWA 4QOKD 1F8TL 3SGEH 1A6TB 3VXOB 1VESA 5C6TH 3ROOA 2XV6B 1MFDH 3MOQA 4XCYB 4K9EC 3KJ6H 2IEPA 2HG5B 1OP9A 3HNTL 1K8DB 1K2DB 3PABA 4PUBH 4DK3A 1CWVA 4JFZL 1SYSB 4GKSA 2DMCA 2MCPL 1RMFL 4LP5A 5D2LA 1GGBL 4DKAA 4DUVA 2V17H 4HGWA 3O6KL 4ODSH 2V7NB 3GSVB 3ES6A 3TO4C 4O02L 2CO7B 3EJZD 3QAZB 1JIBA 1FVCB 3B43A 2EYRB 2DICA 4PR5A 3TN0A 3LS4L 4P23A 2EZ0D 1X4ZA 2BMKA 4PJ8B 5D1QA 3I84A 1E4XI 5BS0E 1G0YR 1FC2D 2ICWI 3L5XH 3MLYL 4RA0C 1JFQL 5I17A 5CILL 3EAKA 1T5WA 4Q2ZA 4J3XA 2VLJA 3NFPA 3PL6C 1J8HA 5K9QG 2OQJA 3BD3A 4NKOA 4IM8A 2GJJA 5ANMA 4N90E 5B22A 5DS8A 1ORSA 3I75A 4PJ7B 1P6AB 1CLCA 3U0WL 4BZ2H 4HCRH 4JB9H 4WI6A 1GOFA 4XXCC 4XMLH 3MV7A 4RBPH 3GMLA 5C09A 5IF0B 3ULUH 3B9KD 5JDSA 5MEQA 2ARWA 2ZG2A 4HK0B 4KI5E 5ESVB 2R2CA 3G5ZB 4WFFD 3VRLE 1HINH 1S9WA 3N0PB 1T1WA 4EQ3A 4JN2B 1IEAA 4XMPH 1BECA 2P4AB 4G9FA 1OGAA 5KZCD 1OARL 3K4DA 3ESUF 2DQJL 4DAGH 4MA7H 1YMME 1IGCL 4ODWA 3FFDB 4ODSL 4HUKB 1ETZA 2IH1A 3EOAB 1RMFH 1MHPH 3EOBB 1WAAF 5C08E 1T03H 3IDYB 1A7PH 4OBRA 5C9KA 1FGVL 4MNQB 1RVFL 5FOJA 4F7TA 2FSEA 3P0YH 3KJ6L 4PGBA 1CLYH 1QLEH 2FJGA 4RISL 5E6IA 2PXYB 3IAPA 2KKQA 3RNQB 4L8BB 1EJOL 1XR8B 2EIZB 5EUKA 4MQ7A 4FQJL 2UVFA 3KR3H 2ID5A 5GZNC 3UROR 3OV6A 3TNNA 1XCQA 1XGYL 1EZVX 1MJ7L 3MV8E 5HHQA 3D9AH 1TNMA 4MAYA 3P40A 1RAMA 3ZKQD 4KJQC 1MVUA 3PWVB 4GAYA 3P9LA 4JR9L 4PRPA 1MFAL 1A7BA 4R8WL 5IVXE 4RWYL 1CFSA 1F4YH 5EU7C 4PJ5D 3FO1A 2VZUA 3AY4A 25C8H 3MRKA 5HVWA 3IXTA 1CDBA 3SKMB 2Q3AA 1KG0B 3RKDC 5MHSE 2V2WA 1EAPA 5FHAL 2OSLA 4QRUA 4G7YH 5EOCH 1EX0A 5AZ2H 1J87A 4MAYD 1AGEB 3N1PC 4PP1D 4X6CF 3P0GB 1A64A 4Y5YA 4Z7NF 1NUGA 2ZUYA 2GJ6E 5C86A 1LO3H 3H9HA 5BRZD 1BQLL 5D93C 4AL8L 3QWQB 4DUWA 5I0DA 1NBYA 2AGJL 5IW6B 1KTDB 3FCTB 3QNYB 2XICA 2X09A 4PJEA 1N3NA 5D7IF 2BC4A 3GMQB 4H1LG 4H25B 4G6FB 1ZANH 2PW2B 3TN0B 1KLGB 5TPWL 1GC1L 2W9DH 5DD1L 1CFTA 2DWDB 4FG6D 4MZ3A 4P23C 2P45B 5ERWA 3G04B 2JB5H 4P57A 4NQDE 1TXKA 3MV9B 8CGTA 3QQ3B 3VFRB 3IU4H 1U91A 4MNGA 3C6LC 3HRZA 3THMH 5ADPH 2VE6B 4JZJA 1TNNA 4ODXB 1YEIL 4P5TD 5DD0L 1IGIH 1J8HB 3O4OC 4LEXL 3WSQH 3GRWL 1MCSA 3D87B 2W0KA 1LO2L 1JWMB 3G6DL 5EBLA 4QHNB 2PO6B 4LGSB 5I9QC 1FH5L 5HVGB 2W0LA 3BZFB 3LEXA 4PLJC 1HYSD 2NY2B 1MCLA 1U8NB 1J5OH 5CINH 3GJEA 4FABH 1I9JL 5CGYC 3SDCD 4QXWA 2OR9L 2A74B 5I6XB 4HBCL 5FYJH 3HAEH 5EU6E 1FFOB 1KJ2B 2XN9A 1QEWA 4JM4L 1KJ2L 2JE8A 5ICXA 1MCCA 2B20A 2PCPB 3VGFA 2X7LA 5EU6A 4XC3H 1U41A 2VLRD 3LKSB 3OKEB 4LLVB 1HILA 2VTFA 4HF5L 4TULL 3CAFA 4P2OB 2R29H 1FO0H 5JO5B 3C5ZD 3MMEA 2YHGA 2RIKA 2P5ED 3ULSB 1NFIB 3MA9L 2HT3C 5IB5B 5JXEC 4QTIL 3ZSSA 3L7FB 3QDMB 3HMXL 5I8CB 4YEFA 2P46B 5HHQB 3KYOB 1NC4D 1S7VA 1DZBA 1PKQB 4OUUA 4G8FB 5C7XL 2H2PD 1I1AA 2ZUSA 3SDXF 3I6GA 4YDLC 1AO7A 4ISVB 1NGPL 2A73A 4CMHB 5F9OH 5A3IC 2P8MA 3C6SA 1HKFA 4MB4A 1XGPB 3HFMH 3IDIB 4HUVB 3DX6A 5I1JL 4MNQE 4PGEB 1SJXA 2VDML 2W0PA 3VA2C 4OFKA 3D39A 5IT2L 4WU7B 3SGEI 4JJHA 4Y5XC 4ZDHA 4P5MB 3AB0B 3ET9F 5HDLA 3VE0B 4OZIF 5EC1A 5J9PA 4NKIL 4NNXB 5FDWA 2MQ0A 3MJ7A 3G5VB 5K33A 3L9RA 2DKMA 3MV8B 4KXZH 3QWOA 2ARJA 2X1OA 5D7IB 2DB8A 1QA9A 2J5LB 1KCVH 4H20H 1NGYA 3CK0H 3S96A 3FB6B 1BIIA 1CG9A 2VLLA 1JPST 4WV1A 2YPLA 1KNOB 3RZCD 3HC4H 3V5DB 2PTUA 2HLFD 2J12B 3JTSB 1UGNA 3MCG1 3T0EB 4YXKH 1JTTA 5AG8A 2EDLA 1CDGA 1LNUA 3RP1A 3QIWC 5E8PB 1NCNA 1YMMB 4HF5H 1QOKA 1K4DA 4KAQL 4OFIA 4LSTL 4G42A 2UZYB 3F7YA 5EUOE 4AH2B 4U3CA 4E42B 5DO2D 2J8OA 3MRGB 3U4AA 3V5HA 2F54E 2YPLE 4WNQA 2YWYA 4OLVH 2W0FB 1TCMA 4R4FH 5KAQG 5DVOA 1WBZB 5IVNA 5LCVL 2E6PA 2UWEF 2OR9H 1OTSD 4KKCD 1B0RA 5SX5H 1MUJB 3EYOA 3QEQA 5C0AE 4K9EL 4K3JL 4AIZB 3GMRB 1SY6L 3KJ4C 1MWAB 3IVKB 1GZQA 2LAGB 3QH3B 3H9SB 5F9AC 1LEIB 3WEXB 4EI5C 2NXYC 3HG1E 4ZUVA 2LTQC 3EO9L 5DA4A 5F7EH 2HYMA 3BKCL 1FORL 4Z6AT 4KJYB 4OZFH 1TZGL 4R9HA 1OCWH 2VR5A 1QSZA 3UBXB 1B4RA 4ZFOL 3KYKH 5JOEA 1A3LH 5E2UH 4MLSA 4LSRH 3WHE0 1EJOH 3RWDA 3M1BB 4MNHA 4XP4L 1BF2A 1LVEA 4NT6A 1PW3A 2L4OA 2NYYC 4E41D 4B5EA 5F71A 4HLJA 4N68A 1DQJA 5FDWB 1CU4H 1T7YA 4LQFL 2DQHL 3O8XD 2J6EL 3U2SB 1YECL 4YH6A 5EO1A 2DKSA 1HQ4A 5ANME 1R5WB 4P2RE 1MFCL 3MRLB 1MI5E 1KIQA 1EMTL 2EDKA 1BX2A 3E8UH 2XYCA 5I18L 5DGRA 5EG6C 3RBGA 5JHLL 4QWWC 3CVIL 5EIVA 4YHKL 2E7LC 1PY4A 4CUCA 4ZUSA 3MLYH 4BQCA 4XCEA 2XACC 5FUOL 1D6VL 2XA3A 4OT1L 3GSOB 3BGAA 3EO0A 3UTSA 2FATL 3HFML 4NZTL 3FO2B 4HT1H 4G9FB 4ONGL 3FO0L 2V7NA 4ELKA 1N6QL 4FTVD 5HHVL 5HGDA 4J7RA 1MELA 3U7WL 3O9WC 5E56A 2GCYB 1SHMA 1UZ8B 3SKNB 4CADB 5E2WL 3OX8B 3P77A 5CP3A 1QFWI 4GMSL 1TZIB 1CG9B 1CFSB 2QSCL 1XGYH 4N0CC 5IBUG 2E9WA 2I07A 4XCFH 4HXAH 1A8JH 3LHPH 1S7TB 4NFBA 4Y16A 3CH8A 4AQOA 1I3GL 2R69L 4HK3J 4NRXB 4F57H 1ZA3A 1YEKL 4NP4L 1TJHH 5GS0L 5SWSB 4O02H 1U9KA 3GMOA 3RVVD 1CFNB 3F7YB 1QBMH 4HKZB 3ROLB 2R2EB 5F3HA 2DQUH 3V6FB 2UZXB 4DVBB 3HTLX 1YEJL 4R7DB 4UT7H 5E5MB 5TE7L 4IOIB 4PJDF 2XNAB 5IG7B 4P49A 5J1AA 3T4YA 4PLKC 4RX4A 3D3VD 3F6LA 3IXTB 2XG4A 3EFFA 2BDNL 3A0OA 5AUMB 4Z7QF 4HS6B 1AGCB 4Z95H 1CBVL 4TVPE 4OLXH 2Z92B 5ALCH 3WN5B 4M7KH 3MRRA 4L8DB 4Z7OF 2QKIB 5F7WC 1EFXB 4MNGB 4UMGA 2ERJC 3RWCB 4Y89A 2Z0BA 4DZ8B 4X0KB 3IFOB 3ABZA 5HGHB 4OAWA 4HT1L 1LK2B 3O2DH 3MLRL 3TA3B 4JFFE 4F8TA 4WUUE 3NTCL 5EA0H 2HFEA 1Y6MR 1FFPA 4LPUA 3VXTA 3PHOA 4YDKH 5I73B 4HH8A 1D5IL 3SHSA 1B4JL 4PJ9A 2HAZA 2BX5A 2IBZY 1LP9F 3SKJH 3LN4A 2DD8L 2A74A 2X4UB 4X8JB 5EORH 3VXRA 5C0DB 4GRLA 4YGAB 1QLFA 1T2QH 3BFOA 4S1SL 4TOYL 2J6EA 9CGTA 2R4RH 4Y7MA 1R5WA 4K3EH 1V3LA 3T1FA 1A1NA 4HHAB 4RGNC 2E8YA 1E4XH 4Q9QH 1ZHBA 2N4IA 4MDIA 5E94A 5IQ9A 1CZ8L 4HIJA 2V2WB 3MA7B 4PUBL 2UV3A 4BFEA 3K74B 5BVJA 3C9NA 3S5LB 3GHEH 3M07A 4GXUM 1W0WB 4Y4FC 3QO0A 3QDME 3OAZH 2WUBH 5I2IB 3IKCB 1SY6H 4NUJB 1IGYA 2X9YA 1JNNL 3MJ8A 2CKBA 4LCCA 3S5LG 4JFEE 5DK2B 1FFOA 1KJ2A 4NZDA 2YOCA 3JWDL 3VDCA 1F6AA 4OF3A 3CZFA 3VXUA 2ORBH 3LY6A 2OL3B 5GRJL 2YXFA 1MVFA 2ZPKL 4LCYB 2JB6B 5INDA 5TGBA 5J13C 4WFGD 3ARBD 4RGOH 4OLZL 3WLWD 5IGXH 4MWFA 4GG6A 1YQ2A 5E99L 4F7CA 1RHHA 4NQED 1A4JB 1FIGH 5C0RH 3QUYA 4YBLB 1K8IB 5CMAB 5LQBL 1CIUA 3EYVB 4XXCA 3GRWA 4RAUB 4X99B 2ADGB 1CFVL 4U33A 4LVNC 1I8LC 2EDJA 3CDYA 2OI9C 1W0VB 3VXMD 3VG0L 3OG6B 4AZ8A 4B7IA 3ARDC 3L7EB 4BM7A 4JG0L 3TP4A 3GMMA 3SE9L 1JGLH 3NPSC 4ISVA 5JR1H 1H3VA 4HWBH 1HIMH 1CVSC 1P4IH 4M93C 1QQDB 1KNOA 2AJZB 3VRJB 3ZE1F 5JXAL 2FO1A 1EO7A 2V5RA 1KCRL 2WIIB 5KVEH 4J6RH 3MLWH 4FQXA 1MF2H 3LOWA 2W38A 1FZMA 1FG9C 5JIKA 5TDNB 3RUGA 4IBLT 4R3SA 2EH8H 3QUZA 1AIFB 4LSDA 3BXNB 2WBWB 3GSNH 4U0RB 3NAAH 1W2KT 4IMKA 4LLDB 1UENA 3STLB 4X6FB 1NC4A 5DEFA 3UJJL 4WY7L 3FN0H 3CK0L 1S3KH 1I1YA 1KEGH 4U6TA 5MERB 5T3ZL 4G8GA 5IQ7H 1T5WB 2IPUK 4KMTL 4Q2ZB 3AAZB 1GCFA 4DEPC 4YQXH 4U2YA 2N56A 1YN7B 5KOVC 4UUJA 5ICYA 4J3SA 4IIQC 2ITCB 3VFPA 4PJIB 3W39A 3NIDE 2ED8A 1PGRB 1RV6X 2NY5L 5D7LA 2YPVL 3O0RL 5LXGL 2NTFB 4OIBA 3V0VA 3FAXA 5L2JB 3DETD 2EZ0C 4RA3A 4HKJA 2D9CA 3UPAA 1D5BA 1QBLH 5L7XL 2BNRB 1PZ5A 2MJWA 5HTSA 4X83A 3TYFB 4ZFFA 2CKBB 3N9GH 4ZYKA 2AV1B 5TDPB 3TO2B 3ULUF 3V8OA 3EYUH 4C4KT 3PQYB 2CRZA 5J11B 1DBJL 4J23A 4N9GB 4DEPB 15C8L 3DXAD 1MCDA 3MV9D 4OCSL 4JFED