3V2AR

Vegfr-2/vegf-a complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
198
structure length
185
Chain Sequence
QHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPLVNRDLSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/signaling protein
molecule keywords Vascular endothelial growth factor receptor 2
publication title Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 185
sequence length 198
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR01
3N1GC 1SEBA 3CIQA 3FB5B 4OZHA 5GRZA 3PXHA 5E2WL 1A4KA 1OM3L 1E28A 2E7BA 1C08B 4R4FH 5J6HA 2UZYB 1KF9B 1J0IA 5ISZA 2MNUA 3NGBB 3SDAD 1RFDL 1N7MH 1OGAD 2CH8A 4OLYH 3RFZC 4HS3B 4PG9A 1EEZB 1XZ0B 3UTTA 4YXHL 5C7XH 4N0FA 2WLYA 4U6YA 1IM9A 3GUTA 1MCRA 5B4MD 1JGDA 1FORL 2BSSA 3ZYIA 4X0KB 3PWUB 3DX9B 2P5EA 1DQLL 1IAKB 2Y07H 1NGYB 1YQ2A 3GKWL 3MLUH 3QXWA 5CSZA 4NKMA 1PLGH 4FFVD 3E6FB 3OQ3B 4G8GD 5FGRA 1W72B 4XCNB 4Q6IA 5GJTL 1R3LA 3L5WB 1MI5E 1YEEH 1QLFB 3IDJB 4QRQA 1AGFA 1J0JA 3QEHB 3ARXA 3TC9A 4XCYB 2P24B 3SDXB 1F90H 3WUWA 4CJ0A 2HMID 1NKOA 1R5IB 3IFOB 3GDBA 4DN4H 4XMLL 4M00A 3ARVA 5BO1L 3STLA 3DSFL 4X99B 4OQTH 3KS0H 1SJEB 3X11A 1FG2A 1U41A 4MQ7A 2VL5B 2DD8L 3UYPA 4WVRA 4OIBA 3QCTH 4OT1H 3STZB 3LHPL 1YEDA 2BMKB 4OZFB 2CIKA 1A6AB 3SDCD 2LTQB 5DFVC 4LVHB 1MIEH 5SX4I 5T1LD 1L0YA 5GS2D 4M9PA 5ALBL 5CD3A 2XZQL 3H7BA 2Z4QB 3P11H 4WW1B 2VLJA 3O2DL 5IG7A 5F96L 4LPXA 4F9PC 5EO9A 5HI3C 1S7RB 5A2LH 2HT2C 4YDVB 4LNVA 3VWJC 1FJ1A 3H9SB 3GHBL 4BQBA 2OTPA 3SE4A 2NYYC 3D39A 3W9DB 1NPUA 2APVA 4LSQL 5GS1A 3RIFF 3L95A 3O3DA 3EDEA 2HRPH 2IBBA 1WZMA 3MJ9L 4L1HA 3TIDB 3KLSA 1YYML 2HFGL 2W0KA 4D0DA 1G0XA 3DTXA 4I48B 5HYJD 2VNCA 6FABH 2HJLA 2Z92A 3UDWC 4NFBA 5EU3B 1U6AH 1BQLH 4L4TE 1F97A 4OZ4B 1BQSA 1ZKAA 5DHXB 2PCPB 4KRLB 1A1MB 5TF1L 5D7JD 1NC2A 4DKFL 2G5BB 1Y6KR 1MWAB 4QNPE 2V6HA 1IZJA 4QRUA 5T3XE 5CEYB 4TOYH 5F1NB 3SDDD 1YMHB 5EU6B 1P7HL 4X7TB 1MJUL 2HTKD 4MA8H 4AJ0A 2NW3B 4MXVF 4APQD 2MCG1 4JHWL 1KIPB 4R9HA 2VOTA 3X12B 1H5BC 1OAYL 1Z0NA 4PJXB 4PRPB 4DOHB 1T7ZA 3U6RB 2WNGA 2I60L 4NZJA 4L8SA 1LILA 3MGAA 4L29A 4Y4HC 5B22A 5CHNA 3RY4A 4FMFA 5MENE 3GRWA 2O5YL 5E8EA 3B3IB 4U6XA 3ULVF 4W70A 1HQ4B 3V0AC 1LMKA 2UY6A 4FABH 5LCVH 4WU7A 3I3DA 3RA7L 2FX9H 1I1FB 4NQCE 4M7KH 3OB0H 1GZQA 1WK0A 1LP9B 3MYJA 1QNZL 2P7TB 4LIQH 2VDMH 4MSWA 4XP6L 1EX0A 5DYOB 2A9NL 2ZPKH 3HAEA 1EHLL 3VXRB 4NOBA 1UYWL 2P8MB 4JFXA 3WUZA 2D7NA 4HPOL 4JDVA 4OJFL 1T5XA 4XRCA 5GGQH 2NY5L 2H32H 4LSUH 4S1RL 3LEXB 3ZDYE 3IVKA 3P4OA 4WI4A 1N64H 2XA8L 5ADPL 1UH3A 1EPFA 4NQEE 4I0PA 2H41A 1RHHB 3BH8A 4WFFD 4YHKH 2HH0H 4MZ2A 1XF3A 2MHAA 3E8UH 1NJ9B 4UAOC 3HS0A 3RZCD 4Z7QF 4IS6A 5I1HH 4F7PA 1A3RL 3QNXA 1QRNB 4WUUB 2PYEE 5FKAB 2CK2A 5CJBA 3MNWA 1ONQB 4TVPE 4R26L 5EG6C 1HYSD 4HX1B 4JG0L 1X5LA 2QSCH 1CGWA 1QFPA 2F5BH 1H9VA 1U8QB 2UV3A 3OXSB 1I3VA 4GRLA 4RGMC 1FCCA 1Y6NR 43C9B 3O6FA 5DR5H 5C09A 1HCVA 4NQVA 2Q8AH 1OAXH 4MLIA 2J12B 1NEZB 1KGCD 3LS5L 1JWUB 1KEGL 3D0LB 4MD0B 5FYKU 4CMMA 1QYGL 3B9EA 4RMRA 4PS4H 1NUGA 1MCKA 3S5LA 4DZ8A 4XVTL 3TESA 1U8HB 3QDAA 4XCFH 4DJMA 5GZNC 4JFEE 3IF1B 3ZMRA 5HHOD 3BKMH 1P84K 1JHTA 5BOZG 4G5ZH 2YBRA 1NFDA 4G6FB 4KK8D 1YEJH 2DQHH 4R6UA 5FKPA 1T1WB 4ESKA 1EZVX 1BAFL 4DGIH 3GSOB 1FFPB 3GHEH 2WWKT 3CVHH 5DD1L 4NZTL 5D2NE 1KELL 5IFJA 4UIKH 3AGVA 1MHPH 3MCKA 3BPLB 1B3JA 1NBZB 4YNYB 1I3GH 2GEEA 3E3QE 5ANMA 8CGTA 1HHHA 3OXRA 5DD3H 5FIEA 4JFPB 3U9PH 3L3JA 2ITCA 4AQOA 2GSGA 2HVJB 2APXA 5FOJA 3U1SH 1ZHBB 2AERT 4XNXL 4JRYB 3ECBA 2R29H 5DVOA 3ILPA 4PJEB 5A2FA 4OD3H 2IPUG 2VYRE 4YK4C 3V5KB 4KU1A 3VXTA 1L0QA 1Q94A 1OF2A 4RWHA 4YE4L 4L5FL 4Q9QH 1XGTB 4QWWC 1P4LB 2DLEA 3BYYA 4NWTL 2CMRL 5A2JH 1KPRB 2VUYA 2FGWL 1BBJA 3SOBL 3QDJA 4AG4L 3GJFH 5JZ7D 4KV5F 3PWPD 4M6NL 5T5FH 4F2MA 2XYCA 3WSQH 5BRZD 5KJRH 3IFNH 1F11B 3TN0C 5IB5A 3DO7A 1I1YB 5LGJB 3A67H 5DVKA 1WIOA 3CSPA 2H9GA 3WIFB 1IAIM 3G6AB 4Y5XB 5EO0B 4HIXL 3TJEH 1R5WA 4FTVD 3LRSB 4M6OL 1F3JB 2XRAL 4TTDD 4Y4KA 4XH2B 1QSFE 3RBSA 3B5HA 5SWSE 4L8DA 4K7FB 2GTZA 1HNFA 3TBVA 2AEPH 3X3FH 1B88A 3DV4A 1YC8A 1BM3H 4ODVH 3QIBB 4LLWA 5F88B 4KHTL 4PJAA 3MREB 5A16A 1CICC 3FRPA 3T2NL 1CFNB 1CVRA 1J86A 1VACB 4Y4FC 1II4E 2R69H 3MA7B 4JHAL 3T2OA 3VWKC 1C16B 3WCYA 3OV6A 4W6YB 3LQMA 3PWNA 4QY8A 5DWUH 4E41D 1XIWC 3FT3B 5IWLA 1S78D 3GI9H 2Y7QA 4X5XA 2NZ9D 2BHUA 4DVRL 3FOMB 3W0WE 3IDIA 1C12A 3BKCL 4YDLC 2HT3C 3A6BL 3ARZA 3HPLB 4NNPH 5EWIH 5F7NC 3NFSH 1CLCA 1CFTB 4G9DA 2JK5B 4P2QA 5F70A 3K4AA 3A0OA 3QWRA 2FH8A 3T0XA 4OZIB 3QZWA 5CBAB 1E4JA 3RX7A 4H5SB 4RFOL 3VXSA 5JHDD 5IW6A 2ZSVA 4N0RA 4PJIB 2GFBB 4FQLH 2PYFA 4WI5A 4KTEL 1AO7B 5GPRA 3IDUA 4LVOC 4RGOH 5EIQA 1YEGH 3N06B 5HHPB 5GSRA 1KCSL 5IIEB 2XXMB 1NCCL 3KPRE 3OSKA 3L5IA 4J4PC 4OUUA 4K3HA 2BRRL 1RUQL 3BDXA 4FMKA 4IOIB 4H1LG 3KHQA 1CDJA 1J5OH 1GAFL 2I9LA 3PWJA 3Q5TA 3VXUD 4OV6F 1YPZB 4YGAB 5F44A 4HJ0C 5ITFA 3QFJB 3MRBA 2VXSL 5DRNA 3DURB 3RKPA 1JPSH 1G7PB 4MJ5B 3ELAT 4KDTA 4ZD3L 4MNQA 1FLTX 1EGJA 4POZC 2E9WA 1MCHA 1U3HD 1MFCL 4K55A 3V8OA 3B9KD 1MLCB 5DUMH 3VFWB 9CGTA 3BEWA 3QFDB 2CRMA 4Z7VF 2Q20A 1T1XA 2IBGA 3GM0A 3QJFB 1KN4L 4MHHG 5J6GB 2Z31D 5EOTB 3DV6B 5DZNA 2ADJA 1YY9C 1B2WL 2NLJA 5I16B 3H2WA 4J1UB 2F58H 1JGLH 4IRJC 5D72L 3RUGF 1EO8L 1MREH 1FO0H 3BE1H 2FH6A 3RL1B 1XGRA 2OS7A 4JM2D 3UBXA 3KYOB 4JANB 3OKKB 3N50A 2E3VA 3RI5F 3QYCA 4G43A 4PFEA 5JW4Q 1IGJB 1X5HA 4ETYA 1NBVL 4J3SA 1OP3K 2EH8H 3QDGB 4XB7A 3JWOL 3I85A 1BQHG 5EBMA 4ZPVA 5HHVL 3RJDA 3TLRA 1SJHA 3BD3A 2IGFH 1OD9A 1D6EA 4PJBB 3BKYH 3LZFH 4NO0A 2F74A 5I15H 3KPSE 3T1WA 5GRVL 1NC4B 5KVDL 2AJXH 1G0YR 5MHSD 1A1NB 5HTSA 4CL7A 1A7RH 1E27B 4Z95H 4S2SB 5C0NC 4R4FL 3BN3B 5IGXH 4N8CH 3T0ED 1A9BB 4N8PA 3SDXE 1M7IA 1N7ML 1S9WA 2VZ3A 5IP4A 2BNQE 4WIQA 5EBWB 3B9AA 1NMBH 2GUOB 2Q86A 5C0AE 3S36H 2DI9A 3VG9C 3MLYL 1FGVH 3P0VH 4RMTA 3TJHC 5E24E 1IM3A 1UXSA 2ATPA 4NO3A 5IT2L 1ZLUH 2Y07L 3SBWC 3K0WA 1AH1A 2VKWA 3MLUL 2YD4A 1PLGL 3RWIB 3U82B 4LDLB 2DTMH 4NCC1 1MAJA 4KI5E 1ES0B 5D93B 1CQKA 5I1KH 4NQDE 5CP7B 1ZT7B 5FO8B 1F90L 5AG8A 5C0DA 2HKHH 2AKRB 3WS6C 2IAND 4M4RA 4Z0BH 1I9JH 1Q1JH 3ARWA 1KTLA 4OQTL 2OZ4L 1XT5A 2P49B 5I73C 5C6PB 3I6KB 5HPMB 3D39B 4OT1L 4TSCL 5MEPA 5KS9A 4S1DC 4OZGB 4ELMB 1QLRB 4QEGA 3AS0A 3KJ4B 2NR6C 3PV7A 4ZG1A 4HMDA 5IROC 1RMFH 3JVGC 3PWVB 2C4FU 1BJ1J 5KANI 2R1XB 1MCCA 1PKQE 1QBMH 4HLZH 3TBSB 1Z5LB 2Z92B 2FJFB 1FGNH 4JFOB 2A6DB 3LQZA 3UTZA 3GZKA 3SDAA 4ODXA 3MGTB 1CE6B 3MLTA 5DRXB 5DJ6A 5EU6E 3DVGA 2FHFA 3CSYA 3UROR 4C57C 3VRIA 3L3IA 2HRPL 4CW1A 3HUJB 3BO8B 2ADIB 2AQ3A 3PQYD 1FVDA 5JXED 3MV8D 4PJXE 1JPGA 3HR5B 2PW1B 1KIUA 1H3PH 2AABH 2AK1H 5D7KE 4Z5RA 3S35X 5IF0B 1JL8A 4ODUA 1OY3B 5KVMC 1U6AL 1FNEA 4OD2B 3V0VB 4W6XB 4G8GA 1R0AH 1H15B 2ZZUT 3IKCA 5BS0D 3NN8A 1RUAH 5CGMA 5KTEL 2V7HB 1IBGL 4OBSA 4F80A 3DETC 4KUCD 5IEKA 4TOYL 2X4OB 1KV3A 1LP9E 3SCMD 2CXKA 1EK3A 4PRHE 1N5AA 2BJMH 4MA8L 1GZQB 1JRHH 3RPIB 3TT1H 1TJHH 5IBTH 1WISA 2QV2A 3FRUA 2OI9C 2APWA 4LHQB 3ZTNL 4EKXA 4Y5YC 3WMSA 5DEGA 3UC0H 4ZMAT 1KLGA 3SDCA 4LP4A 4JGMA 2X4RB 4PJ7E 4JM2F 1BFTA 5T1LA 2MOVA 1M6OB 2DMKA 4DVBB 4FABL 1NEUA 1KLUA 5DRZA 4R0LA 4M7KL 5I71C 1RZ7H 5IBLC 4BZ1H 4XVUD 1A6TA 4LIQL 1G1CA 4DQOH 1IGTB 3ZZ1A 5KSVA 5GGUB 3WUWG 2ZPKL 2UYLA 2R56H 2NY1B 3E2HC 2QHLA 4G7YH 3WLWC 4X8JA 2ITDB 1QBLH 3F6LA 2VDOH 4FOMA 4MB3A 5T3ZH 3TO4B 3UTSB 3VXMD 4P2OB 4H20L 4HPYH 4LSUL 5HYJA 2LABA 5BZWA 2UWEE 1PDKA 1N64L 4JFFD 1KLFA 2FX8H 4WWID 1U8IA 2CIIA 5DJYB 5BJTA 5FF6A 5CJOH 2NNAB 2CXGA 2DBJA 1HHGA 5F1SA 4N8VB 5EN2A 4JJ5B 4OF0A 4YHKL 1I1AB 2HH0L 4OGXL 3E8UL 2OM5A 1S7XA 3N9GL 5D7JA 4RMSA 1U8JA 5I1HL 1RUML 2X9WA 1TFHA 1P69B 1HKFA 3SDDA 5AWNH 1UJ3C 2CR6A 4ZTPL 3IETA 5DTFA 4APQA 1UFUA 5GZOD 1NFDB 5F7FA 5IB2B 1PYWA 1BFVH 3NGBC 5DR5L 3LKSB 2Q8AL 1WWAX 2VE6B 3ARGB 5J06A 3IFPB 1A7QH 1ORQA 3MV7B 1UB6B 3BZDA 2XZCH 3QUYB 4XXDA 1R5VA 1Z3GH 2HJFA 4PS4L 1I7UA 3JTSA 3UJTH 1PSKH 2GKIA 3GGWA 4D0BA 1M1SA 5F1IA 4PB0H 3HE6B 4EDXA 1S5IH 4G5ZL 2DQHL 4PJ5B 1S7WA 3ROLB 3QQ4A 2Y5EA 5KAQG 2J8UF 4HC1H 1UM6H 5A2IH 4J6RL 3C2SA 2D03H 4NBYB 3GHEL 3EYVA 3CVHL 1AI1H 1LEKB 3SGKC 3LQAC 2BVEA 1P84J 3JUYA 3FFDB 1IKNC 1KCRH 4ZUVB 2WK2A 2FNBA 2ARJA 3FQRA 4UIKL 5BVPH 5AAMA 3V8CA 4TPRH 1I3GL 3O9WD 3KDMA 1QVOB 1Q9LA 4JQXA 3WXWL 3WNKA 5FDWB 1X5AA 4MWFB 2EXWD 4YEFA 5T5NF 1BBJB 4JO1H 5CCKH 4LARL 3KXFB 4LBEB 5EUKB 3U1SL 1MY5A 5DK3A 4QTHB 3FTGB 2VSDA 2R29L 2R8SH 1K85A 1UWXH 2LTQC 4LVHC 1SY6A 4X4MA 4KKBD 3ULVL 1JE6A 1JF6A 2Q3AA 2VR5A 3FFCE 3BPCA 1TQCB 4Q9QL 5H37G 3OKDA 3QNZA 2VIRA 4H26B 1G1YA 5D1QD 1YEHH 3V4UL 4C54A 4LPYA 4UINH 2X4SB 3HAEG 1CDGA 2ID5A 5T5FL 3KPNA 4V1DB 3WSQL 3C60B 5KJRL 3CXDH 4OI7A 4OGAD 5IQ9A 3A67L 5CMAB 4HWBH 5E2VH 2WZPD 2X89D 4P2CG 4KUCF 4LOUD 1XGUA 3TJEL 3VFNA 4U3CA 2PN5A 5EZJA 4Z7WA 5HHOA 1G9EA 1VEMA 4BUGA 4I77H 4I2XE 2W9EH 5C08E 1OQOA 2X44D 2ICWI 4Z7VA 1MCQA 4C58B 3ORJA 1I9IH 1HWGB 4WTWA 5EBLB 3PGDB 3RWEA 5HYEA 3E0GA 2B39A 2YPLD 3VRLF 2MWCA 4ODVL 4BQ6A 1Q9KA 1EUTA 3AU1B 1R3HA 1A0QH 1YEFH 1RK1B 4U1NA 3BXNA 1RJZA 2W59A 3RVWC 4O4YH 4TNVK 2YC1B 2R2HB 3MGOB 2V2XA 1J10A 3S5LG 3TNNA 2VDNL 3H9ZA 3VFGH 5GS0H 4OFPA 5F89B 2G2RA 4KHXH 2VRAA 3BPOB 5E95B 5JW4M 4LAQH 1I1RA 1MF2H 4JCLA 2H8PA 5JOFA 3QUMA 4NNPL 4MX7B 4WI9A 4HH9A 3QUXA 4Z76B 1VGKB 5DQJA 3MMEB 4PP1D 4XPBH 4U6HA 1YPZE 5F7EH 2CO6B 2EZ0C 3D2UD 3PWPA 4XBGA 3X17A 4P9HH 5BRZA 1KT2B 4G9FB 2N1KA 3MXVH 4W4NA 3AXLA 1F4AA 1LD9B 4U1MA 5GIRB 5AUMA 2Q76A 4L1DA 2AJZB 4LCCA 4FQLL 4AK1A 5IMMB 3ARDD 3BD5A 4RGOL 1JPTL 2DBLH 4FTVA 3WEXB 3SE9H 1KB5H 2DWEB 1XCQB 4Q9RH 5GRJL 4M43L 3FONB 1IEBB 3QQ3A 3ETBF 5DS8A 2H32B 2OLDA 3DIFA 1J5OL 3JV6B 2LFGA 2HJKB 3QDHA 2VAJA 2DRUA 2PKDA 2HFTA 5DO2C 2YD1A 4X6CE 1JPSL 4DZBB 2AV7A 5TFSH 4UQ2A 4OZHE 4UUJB 4NKOB 5DUML 4ZO6A 4D9RD 5EC1B 4NN7B 4HV8B 4E41A 1TJGH 2HN7A 4PJ9B 5ISZE 3QDGE 4RISL 1VKXB 1KCVH 3B83A 5GRXG 4ZUTA 3WIHH 4GG6F 5DMGD 3UTTE 3G9VA 2A77H 5F6IB 2FSEA 1DBKL 4UIMA 2BSED 4XZUA 2E7MA 2F58L 2MQ3A 1JGLL 3QEUA 3TT3H 1FO0L 3BE1L 1AD0A 3T65A 1HSAB 2WV3A 1FYTD 2CUMA 1RVFH 2X4QB 1BD2A 1RZFH 1ZE3C 1U8PB 1J0ZA 5JHDA 3FRPG 1BVLA 3I02B 5E00B 1X9QA 1QG3A 2EH8L 1T80A 1ITBB 2GK0B 2VKXA 1UCBH 3OG4B 1S9WB 4OAWB 3BPLC 3TVMD 4U1JB 1OP5K 5LGHH 3CVHB 1U8NB 3BKYL 3LZFL 5DFVD 3K8LA 5I15L 4F7CA 2XACC 2CLZB 4P2YA 3PWLB 4LCYA 1L7TH 1DN0B 3VXUA 1A7RL 1CE1H 1QQDB 1E4KC 2YEZA 4LFHD 2HT2D 4Z0XA 1OCWH 1FL3B 3M8OH 1W0WB 5IGXL 4N8CL 2BVYA 3VWJD 4BQ8A 3S3JA 1DQJB 3JTTB 5EUOA 2NYYD 1BZ7A 4ELKA 5HHMB 1LO3L 3QZWG 1TNMA 1BF8A 4KGJA 2AS5M 5EPMB 2VLJE 2NXYB 3B9KA 1AQKH 1GSMA 1FGVL 2BHYA 2R2BA 1RUKH 4MAYA 2ICWJ 3BFOA 1TVBA 4HDIA 5AYQA 3MR9A 4KKNA 1A8JH 3E6HA 3I6GB 4NYLB 3D39E 2Z31A 4Y5XC 4C83B 3GJFB 4AMKL 4WWKA 4NSKB 3JSSA 4S0SD 1L4IA 3R06A 2DTML 2P8PA 2WANA 4TNVF 3UMTA 3O45A 5HYQA 5I1KL 1I3UA 5SWQA 2FX7H 5H35B 3EGSB 3STBA 1JWMB 2N56A 2IPTH 4YZFF 3DYPA 3RNQB 2OMBA 5JORB 2L4OA 1Q1JL 5JQ6L 1QO3B 3QIBC 5IESH 3NH7L 5T1KD 4O51A 4X4XB 2A74A 3MUJA 3HUJE 4Y4HD 3GO1H 3I75A 1OGAB 5GISH 4DUXA 3BZEB 1RK0B 4XPTL 5IVNA 3UX9B 2P8LA 4PGCB 4UV7H 1G0DA 1KIQB 1CIUA 1VCAA 4FXGB 3PV6A 2QEJA 2NY7H 2V7NA 3LDBB 1QBML 3LVEA 3T0EA 4WI3A 1ORSA 2CRZA 1FGNL 5GGSA 3UBXG 1MRCL 2DQJH 4WJ5B 1G9NC 3V4VH 5TQ2H 3ALWA 3RPKA 3BJLA 3DSNA 4KK5C 3V0WH 4OKVA 2DM3A 4N5UA 1UACH 4OB5H 3WKNA 3VFTB 5JA8B 2AXFA 5D2LF 5HHXH 4XAKD 3RY6A 1H3PL 2AABL 1LEIA 3FO9A 2AK1L 1HKLH 1A4JA 1RIVH 2R4RH 2VXVH 2Z8WC 4WW2B 3KPQA 2Y5TA 5I1EH 3HC0B 5F9WC 4J3TA 1RUAL 2Z91A 2CDFB 4GG8B 2ZNXA 3RWJA 4HIHB 1YA5A 5EB9A 2NY5C 1FVEB 5SX4H 1NUFA 1K3ZA 3I9GH 3MRGA 4KRPB 4YHIB 2BJML 1N2RB 2FJHA 4GUPB 2IANA 1JRHL 1RY7B 5IBTL 4MD5A 1WCBA 3MJ7B 2J8UA 4OM1L 2P47B 1ED3B 4I3GA 3PGCB 1JYXA 1AGCB 5KZCB 4N1HB 2VLLB 5F1KC 3U4EB 2OTWA 5GZND 3B6SA 5TH2B 5C9JA 3O3AB 2ERJB 1RZ7L 3T1FA 3U2SA 3VG0H 3MRQB 4BZ1L 3NPSB 4JFHD 3MRPB 5KVFH 2F54D 1VSCA 1JK8A 1QR4A 3O4LB 3O8XB 4CVXA 1YMMD 2R56L 4G7YL 3MRMA 4OFKA 3QO1B 1QBLL 5FYLD 5SX5H 3UZEA 3MUY1 1NFDE 3PQYA 3SDDB 3WJJA 5JXEA 3W39A 4TNWK 1P1ZA 1T6VN 4J8RB 2BSTA 1I4FA 2BDNL 2FX8L 2ZOKA 1FO0B 4ERSH 1CF8H 3K46A 3DNKA 5DEFB 5CJOL 1F58H 5CZXC 2VH5H 5IBUG 2D7QA 5BS0A 1HDMA 4HUVB 2JELH 1JFQH 4JKPH 5ANME 4YHPA 1FH5H 2BNRB 3SCMA 2IFGA 4QWWD 3KNBB 5AWNL 1BOYA 2CD0A 2W0FA 4QCIB 4RMWA 3MV9D 4L3EB 4WGVB 2FBOJ 2ZCLH 5DGQA 4RA0C 1BFVL 2C3VA 5FA3A 4D94A 1A3LH 3C9NA 3IDYB 1JN6B 3KPMB 5DC4B 3IU3B 1A7QL 1RIHL 5DQ9A 2XZCL 4CNIB 2MPAL 2E27H 1Z3GL 3QSKB 3UJTL 1PSKL 3C8KA 5F7DA 3QDJE 1F6AA 1MAMH 3CX5J 3EFFA 1U8KA 2XWTB 4PB0L 5JIKA 1S5IL 2D31A 1MQKH 2HYMA 1TXKA 4H0GA 2E7CA 4HC1L 4GRMB 4LEOA 2VSCA 3ZE2E 4NRZB 2D03L 5DRWA 5D93C 3RZCB 4QHNA 5E8PA 3DGGB 1IQWH 3WS3A 1KCRL 3S37L 4BZ2H 1CICD 3VXMA 3D48R 5AZEL 2GJ6D 4TPRL 4O02H 3V5HB 4V1DE 4XP4H 5GGTL 3LPFA 4JFFA 3DROA 4X6BA 7FABH 1L6ZA 5DF0A 1L6XA 1RZGB 1I75A 3GMQB 1MHHB 5DHVH 3NBNA 5CCKL 1XIWD 3C6LA 1F02I 2I25N 1D5BA 1KXTB 3R8BB 2KBGA 4PJAE 4OLXH 3O6KH 4ZAKB 3U46B 4LLDB 3QR2A 3H9HB 2R8SL 2XXCB 5MEQA 3O3BA 1S7SB 2WBWB 3KJ4C 2HT3D 4M6AA 3VFNB 3OL2A 1BFOB 1AY1L 4UV4H 1YEHL 1FN4A 4HIEB 4JO4L 2V5SA 1J12A 1FV1A 2JJUA 3CXDL 3GI8H 4GMSL 5HVFB 4G8IA 1LDPH 1KOAA 4WY7H 1I8KA 4HWBL 3U48A 5ICXB 5E2VL 3O41B 4P2QE 2HLAA 2XZZA 4F15B 3S36X 3RGHA 2D2OA 3RUGB 5BVJB 4J4PD 5I30H 3EDJA 3VXSE 4I77L 3SDYH 2W9EL 1NMAH 1BHGA 3RIAK 4R96A 5HJ3B 2X70B 2WBJB 3G5XA 4HJ0D 4LHUB 4XX1G 4KJQC 3B2UC 2DL9A 4B53A 2EIZA 4GG6A 2AJYL 1I8MA 2GTWA 4OF3A 1YEFL 5FA4B 1IQDB 3DO3A 4POZD 4LKXB 3P77A 4F9LC 3DUUA 1J1XH 4O4YL 3CFKB 4XPHL 3I84A 2FHCA 35C8H 3VFGL 4L3CB 5GS0L 4UU9B 3TH2T 4KHXL 3TBYB 4MNQE 3F7VB 4LAQL 4YDJB 4GXUN 2L0DA 1IRAY 1WC7A 3BUYA 3FT4B 2B4CH 3I50L 5FV2A 4JKMA 3S4SB 3CFDA 3UYRH 4P5MB 2NTFB 5CUSL 2C1OA 4IRJD 3VD5A 3VRJA 3C09B 4QT5A 3DLQR 3T0VA 4RZCB 5D1QA 2BY1A 3O6MH 3S88L 5F7EL 2KH2B 4ENEC 3O2VH 3ZL4H 4U49A 4P9HL 3U9UB 3KPLA 4TULH 3RVXC 5IFAH 3Q0HA 3MLXH 2AQ1A 3RBGA 2NY1C 1OB1B 3PHQA 2DS4A 3P9LA 3TO4C 2X89A 1OAUL 4P2OC 3ZSTA 3REWA 4ETQB 4GS7B 1XF1A 2DBLL 3RWGA 1T5WA 3SE9L 1KB5L 1NCDH 4P3DA 2I26N 4Q9RL 1TTFA 1XR9B 1U91A 1NCNA 1UENA 1ACZA 3IGAB 2VABA 2X6MA 1I1AC 1S3KH 1CDYA 4YBLB 5BXFA 4JFYA 2FEEI 5C0ND 1AGBA 1YNTA 4QXTA 3HCVA 3JWOC 4Y0GA 2G75B 3FQXA 5TFSL 1FFRA 2W9LA 4HZAA 4WFGD 2UY7A 3VGBA 3AFLA 3TJHD 5C0CD 1IL1A 1YZZA 3VMPA 2ZKHL 1TJGL 2WINB 3QEGH 4IMKC 4N68A 3ARGC 5CEZD 2VQ1A 3HA0A 1BJ1H 4YHZH 1KCVL 2Q6WB 4PJ8D 3QUYC 3WIHL 4X7SL 3DXAB 3RTQB 3LRHA 4LLMA 4QXGH 4JRXB 5J11B 1C5BL 3WHE0 2ZSWA 4HKZA 5IB3B 2DQEH 1JGUH 5D1ZB 4M03A 5JPMB 5L2KD 5FUCE 3MRRA 1IVLA 1QACA 4Z78B 3HE6C 4Q58C 2DYPD 2QADB 4MXVE 5GGSY 4DWHA 1QFWI 4M3KB 1RVFL 5D7LA 3D2UA 3GMMA 1RZFL 3OKEA 2ADGA 1AGEA 5JW5A 3J7HA 2IG2H 1M71B 1P7QD 5FGBC 1FNAA 1MELA 5TDOA 2GSIB 1MCOH 3ARDA 4ZTOH 3ULVE 4RRPA 1CT8A 1TETH 5LGHL 4S1DD 2Z93A 1U3HB 1AE6H 2CDGB 5FYJH 4LGSB 2NR6D 3Q6GH 2OMNA 1D5XA 4NHCH 4MQTB 5A1AA 3LKQB 4AEIH 1CE1L 4K9EL 2APFA 4G6JL 3E6HB 2DQCH 1OCWL 3M8OL 4P23B 1I8IB 4K7PY 3N0PB 4P2RD 5DJXA 3U0TB 5KS9E 4UILL 3MOBH 4NDMB 3BGFC 1T0PB 2OJEB 1TQCC 3V9FA 3BW9A 5LXGH 4FQHB 3RIAF 3MBEB 1RZKH 1S9YB 1AQKL 5JNYB 4JM2B 4FQ1L 3DWTA 4XC3H 3F12B 1W0VB 1J0KA 3VI3F 3C60C 2YRLA 3V5DA 1CLYL 2XI9A 3HG1A 4PGDA 3HZYA 1OGAE 5CKGA 4OF5A 4Z7QE 2VC2H 4AY0A 1UWEH 3DI2B 4A6YH 3FCTB 2VTFA 1OSPH 3F58H 4Q97A 1H3WM 2KDGA 4EUPG 1PGRB 2FX7L 3DETD 3BP6A 5TE6H 1FYTA 2IPTL 2ESVB 2C3XA 3RWFA 4G8GE 1NCWH 4ZQKA 1CS6A 1OGTA 3EOBA 1G7MA 4Y89A 3M07A 2PTTB 2B5IC 1T83C 4XVSH 4PREB 1U8MB 1ETZB 4LCUA 5HYSB 4QOKD 3BEVB 1SEQL 5FUOL 2CDEB 2NY3B 3GO1L 5D96B 2W92A 5M94B 4BK4A 4AIXA 2P46B 4BZYA 1NDGA 1QSEB 1DE4B 3X13A 1A7PH 1T22B 1NMCB 4E42B 5TDPA 4KDVA 3TGXA 1T2XA 4M5YH 2AXFB 4F9PA 3SKNA 5IBLD 4PBXA 2NY7L 1A4JB 1HQRA 3BPOC 1G84A 2HFEB 3LKNB 3VWJA 1OAKH 1WZKA 1UA6H 1D5IL 1BQUA 4U3HA 2DQJL 1T4KB 4BSWB 4XHJC 3V4VL 5ETUB 5TQ2L 4E0RB 1J87A 3CFBA 4U2ZA 4GQPH 5EO1B 1NBYB 4YFDB 1UACL 1SYSB 2FWOA 4ISVB 1KPUB 5FDYA 4GKNB 3T4YA 4AIOA 3QUKB 3DRQB 5IM7A 4WI2A 5HHXL 3NA4A 1HKLL 2R4RL 3HLAA 1U42A 3UDWA 2BP3A 3UYOD 3WXVH 1YJDH 5E9DD 4G8FA 3VJ6A 1JF1A 5I1EL 3D9AL 3OPZL 3UJIH 1IEAB 3IRZA 2SEBA 2AW2A 5HYJE 4NM8H 1BIHA 2XWJA 5E8NB 1FPTL 4JHZA 5GS3A 3UZVB 3I9GL 2I5YH 1KB5B 4KV5E 1KPVA 4GRWF 5EU7C 3B9VA 3EYOB 4HBCH 5HGDB 3IDGB 1H5BA 5EU5B 5B39B 5T1KA 4S1QH 1CYGA 3AS2A 4PRBB 5CIPH 2EDHA 2BOBB 1WBYA 5DK2A 4Y4HA 1FBIL 4XMPH 5L8JB 4O00A 1G6RA 5HGGS 1EEYA 4XX1E 5LBSH 3EYQC 4G7VH 4NN7C 3MNVA 4MA1B 3PHOA 4PJ9C 5GSVB 5DSCA 2Q1EA 3KLAA 3MV8B 4KH2A 4C56B 2BSTB 3SGJC 3VG0L 4RAVA 1SBBA 5GRWA 1DDHB 4LU5L 2FYYA 4MNGB 5KVFL 3PABA 5F6IC 4XNYH 5IR1A 1R3IH 1REIA 4RQQA 5C8JA 1IAOA 1T89C 3NOIA 5EFIA 5FOBA 4WDIB 1NGWA 3QUMH 1DQMH 2G9HA 3L7FB 5EOCJ 1MUJB 4PJFF 4Q9CA 1M7XA 3WFBH 3MUGB 4NQSA 3QDMD 4G42B 4KY1H 2HTLC 1AXIB 1PX4A 3ULUH 1F58L 2C3VB 4PRNB 5FA3B 4J7RA 2VH5L 1BZ9B 5E4IA 2JJWA 2JELL 4X6DF 1JFQL 1JZ8A 1EIBA 3W11C 2A6KA 3VDAA 1FH5L 4DCQA 5DHYB 1EEQA 3VW3H 3NCYS 4YO0A 4PJGF 4I4WB 5T1MB 1LNUA 2X4UB 4NUJA 4WFFE 2OL3A 4EUPH 2W0LA 4POYA 3NCBB 1B6DA 3H9SD 4X4ME 3SGDH 1K8DB 3WLBB 4PY7B 5IVXF 3S8WA 2WP3O 5C0FA 3REVA 2OBGA 4L4VB 2YPKA 5E6YA 2NXYC 2P5WA 3ZTJG 4KMLB 3VDCA 2XFXA 5ESQA 1JV5B 5F1OB 4YHNA 3TBTA 1GGBL 1MAML 3HI5L 3M17B 5SWZA 2EYTA 3GSNA 3UXFA 3H0TB 1KGCE 1U92B 1MH5B 5IVZB 1MQKL 1S7VA 3S34H 2F54A 3U0PB 3U4BH 3VU2A 1YMMA 1KIRB 2YMXH 5HHOE 2UUDH 3BHBB 3OJ2C 4BZ2L 4Y16D 3OJVC 1MFDH 3MNZB 1GOFA 3BOVA 3RNKB 4O02L 5CEZH 3VFMA 4XP4L 4Z7VE 2V2TA 1A7NL 1F4XL 7FABL 1CD1B 2IPUK 5HDQL 1S7UB 3L3KA 1MHCA 5E7BA 3V6ZA 4PRPD 4EDWH 1XH3B 1JYVA 3MROA 4ZXBB 4OLXL 3O6KL 4XNZB 5L9DH 4HS8L 5DEZA 2YHGA 32C2B 4NRXB 3DMMB 4M7LL 4YQXH 3RUGE 5BZDB 2JB5L 3BH9A 2YUXA 5ID0B 4GAJH 4XP1H 1CG9A 4Q2ZA 3QRGH 5IMKB 3LDBC 2EZ0D 3DI3B 3QI9B 4M5ZH 1X6NA 4XC1H 4KPHH 4FFVC 1JYNA 3TN0A 1BEYH 3GI8L 5LGKA 4PGEA 4KZDH 5E8OA 3VXRD 1LDPL 4WY7L 2CO7B 3WL9A 4YGVA 3N1QC 2K9UA 3DX8A 3MYZA 4X5LA 4GG6B 1KSRA 5D9SB 4D0CA 3LN4A 3MLWH 4FNLH 3WD5L 3PWPE 3PUCA 3O9WB 2V9RA 5BRZE 5IB4A 5I30L 1ZWIA 1JMZA 3SDYL 1RJLA 3PJSA 4WW2C 1NMAL 1GH7A 1H0DB 1RHFA 3G08A 2M8XA 3T4AB 5HVHB 5DO2D 2FL5B 4FTVE 1EVUA 4MD4B 2VAAB 4QKXB 3SO3B 5ID1A 1S9KC 1N4XL 4NWUH 5MEOB 3FQWB 3K4ZA 1QRND 3ALXA 3GB7A 4QYOB 4RDQG 4WUUD 3TO2A 1BLNA 1J8KA 1CICA 5H94A 2OSLA 4Y4FA 2FIRT 1TZGH 1KYOK 4Z8FH 3GMNB 1KJ2H 2GJ6A 2ARWA 3VWKA 4A2MA 4KRPC 2YRZA 4HWUA 4P3WA 2R2EB 3QJHB 1J1XL 4XNUH 1QEWA 4OD1H 1UQSA 3FAWA 4PLOB 3MXWH 35C8L 3M1BA 1D6VH 4HUWA 4OFDA 5F93C 1A2YB 5I0DA 4KKAC 5DLMH 5ACZA 5CILH 5E08L 3BI9X 4NT6B 4LF3A 2RGSA 2B4CL 3REWB 5C0RL 4E41E 3UYRL 4JLRA 5ESVB 3JWDH 3QG6A 4FFZL 2QQKH 4S1SH 2ERJC 4PB9L 4G6FD 4EXPX 4XHQA 3QEQB 2ZCKL 2GW5A 3NPSC 2R9HC 5HGBA 3QXDA 3ZL4L 5C0JA 3ROOA 4DGVH 3I3BA 2AEIT 3AM8C 4TULL 3MRHA 3U7WH 4PLKD 1GCFA 3O8XC 4X9HA 4X6EB 4F7EA 3ABZA 2YPLB 4HKBA 1FL5B 4CRPA 2QKIB 3P4MA 2EH7H 5DXWA 2XKUA 1JPFB 1NCDL 2M1KA 4DEPB 2V17H 2F19L 4J4PA 3BP7B 5JHDE 4JY4A 2X7LA 4OV5B 3TYFA 4JVPA 5IMLA 4NQCA 4WHYH 4RNRA 5FGSA 4JRYD 1S3KL 3PHSA 1V3LA 5FCSH 4HHAA 3MRDA 2YZ8A 5DJAA 4ZODA 1MCDA 1T2JA 1XF4A 1U9KA 1OARL 3GMLA 2R1YB 5D7SL 4J3WA 1XF2A 4HUNB 2ZSWB 4YPGB 2Q87A 5E1HB 4PRDA 4FQJH 1UXWB 4C4KT 3V95A 3VXUE 5C0IB 3KWWB 4U05A 3CXHK 2C3GA 4JFQB 4PV8B 1T21A 2XTLA 4HT1L 2ZG2A 1J11A 3IDYC 1FZJA 4YHZL 1FFOB 3LKOB 3KGRA 4EQ2A 1KB9J 1HHJA 1R3KB 2LU7A 5TDOB 4QXGL 1YYLL 3MBXH 2Y23A 4P49A 3HFMH 3T0AA 2YD5A 1JGUL 1I3RB 5D70H 4ODWA 4IRJA 2GJZA 2HVKB 3T2QA 2H6PB 3PNWB 5DJ0B 3S96B 1S9VA 4ZFFB 4OCRH 4F3FB 4AM0A 2IH3B 1C5DB 1ADQA 5E94A 3QHFH 5D2LB 1LVEA 2IG2L 5JOEA 3RZCC 1B0WA 3QIBD 4LLYB 1RV6X 4XNMB 2JCCB 3EDKA 5MERB 2HLFD 1MCOL 4ZTOL 4NN6B 2CKBH 3VFSB 1Z0MA 4P46B 1DVFB 4HAGA 3TH4T 3G5YB 3B5GA 3C8DA 5FYJL 4NC2B 4Q6YA 3Q6GL 1G7HA 2PETA 4ORGB 2KUTA 4JFEA 4PTUB 4F37F 1Y0LA 3FOLA 4ZAKC 2EYSB 2DQCL 1DBML 2O61A 3D3VD 5DHVB 5DVNA 2M26A 4EI6B 1ZLWH 2W60B 4Y5VB 3MOBL 8FABB 4Q9BA 3BZ4A 1G7QB 4XWOC 4KK5D 1CL7H 5FO9B 3CSBA 1JNJA 5MHSE 4O9HL 5LXGL 3SE8H 1RZKL 5GGRB 1ZMYA 5C0CA 5J12B 2Y06H 3AAZA 4WNQB 3MJ8A 4ZSOB 1T0MA 1K2DA 1SJVA 2DKUA 3T0EE 1WWWX 4ZFOL 5JMRA 2IQAA 3SBWA 2A38A 2A6JA 2VO5A 3GJEA 2L7UA 3OKLA 1XGPB 1UCTA 2VC2L 1AO7D 1CXEA 1UWEL 1D7FA 1X4YA 2K1MA 5IKCA 5KVEH 4A6YL 2F9BT 1SMAA 1MSPA 3DJ9A 4X7DC 4F15C 1OSPL 3F58L 3TVMB 5L2KA 3SPVB 2A9MH 4HUXA 3CAFA 3ULSA 4JN2B 2DYPA 1E0OB 4RFEA 4BH7B 5TDPB 4EIZC 2RBLA 1DLFH 3WS6A 2WBJC 1TZHA 3W5NA 3QFJD 4UI2A 5DI8B 3DUSA 2X4PA 1P6AB 4XVSL 4UTBH 4R90H 2IQ9H 2CRIA 1A1OA 2IBZX 2Q3ZA 2B1HH 1A7PL 2FEDC 5AYUH 2IANE 4PGZA 2DB8A 4PJFA 3T77B 5ICZB 2BCKB 3LN9A 5C1MB 3OWEA 5IROA 3JVGA 4M5YL 1MCBA 3C6SB 3LS4L 4M1CC 2J8UE 3LV3A 4WU5A 3CUPA 2FIKA 3MRNA 2IALA 1OAKL 4G8FB 3WO4B 5KG9A 1I7RB 4BA8A 2CQVA 1NGPH 3C09C 3GSRB 3MRFA 4YR6A 1VFBB 5L6YH 5DZOA 4MJID 3QA3A 4PJDB 5DJCB 2I9TB 5IV2A 3DVFA 3D0VB 4RRPG 1B0GB 2HG5B 3OHXB 5IMOA 4PJEF 4KTYA 1RZIA 4CADA 4ZYKA 3WXVL 4O2FA 1YJDL 2BSRA 3OKNB 5CZXD 3AB0B 4GS7C 5IVXA 2CLVA 2RCSH 4BFIA 1U58B 2EDBA 3GSVA 3PQYE 3HKFA 5LG1A 1T0NB 3MV8E 4NM8L 3R0NA 5FECB 4Z7NF 3ARBB 5F72S 4MCZA 3OKMB 2I5YL 4YBLC 4OCXH 1PQZB 5BS0E 1ZHNA 3NTCH 4NM4H 4NC1E 1T2QH 2YXMA 4P48A 4S1QL 3QIWB 2ICWA 4QOKA 3P3YA 3DX6B 3L6FA 1T1ZA 4EVNB 2VDLH 1JHKH 4M61B 4XMPL 1ZGLB 3L3DB 1FNFA 1KXVC 1UM5H 5LBSL 1JZ2A 1NGWB 1H3TA 4DAGH 1HSBA 4LVNB 2Q7NA 1EXUB 2WIIA 1NLBH 3F7YA 5B38B 1S8DB 3G6DL 5J3HC 4ZUWB 3KPRA 1E6JL 3OZ9H 2XNAB 4L4JA 1YECH 2I07A 1FVCA 2VXUH 1MVUB 3HE7B 5DUBB 5K9JL 4D8PB 1CR9H 4RAHA 1MRDH 3RTQC 3VD9A 3P9MA 1QBBA 1P9MC 1X7QB 2HFFA 5FO7B 3VRLE 1DLHB 2AJ3B 3CFCL 5I19L 3WHXA 4OF7A 4YIQB 2A6IA 4XNYL 1R3IL 5D1ZC 3TCLA 2YWZA 2DAVA 5F97E 5CEXB 1YUHB 4UDUB 1DQML 3BIKA 3IS1X 2QADC 4ZUUA 5CJXC 3PXJA 1I7TB 1TTUA 1QA9B 2CPCA 2XIDA 1UVQA 5ESAA 1LEGB 1I9RH 4L8CB 15C8H 1H3UA 4DK6A 2EYRB 2VLRB 5CJ8A 4HG4J 1IGYB 4HXAH 5HGHA 4M93B 5E9DA 2DQUL 3VXME 2CLRB 1GYAA 5FHAH 2NX5B 1XFPA 1U3HC 3DBXA 4B7LA 1UH4A 1Y18B 3LD8B 4JFFE 4LFHG 3PP3H 1V7MH 4OZIF 5DK0B 2V5MA 3FB5A 3VW3L 1UJ3A 4YHNB 5C07B 1ADQL 2CRYA 1KFAH 4G80B 1N5YL 1C08A 3EYFB 3ARTA 4P23C 4PJIF 1ERNA 4BSJA 3ZO0A 4ZUSB 1LK2B 1KTKE 1DEEB 4HS3A 1EEZA 1XZ0A 1U8LB 1ZT1B 3P2TA 3MBEC 1SBSL 1WFOA 4JM2C 3O81A 5GXBB 1MCFA 3ME0A 4X0KA 3PWUA 4ZO7A 3DX9A 1IGCH 3EO0B 1E4XH 5HY9B 1IAKA 2X4NB 4FN0A 1NGYA 3FL7A 1LGVA 2RFXB 4H8WH 3Q5OA 1CGYA 3JV5A 4U6VH 3B2VH 3VI4F 3E6FA 2YRPA 1W72A 4XCNA 1FL6B 3S34L 3L5WA 4ZFOB 1QLFA 3IDJA 3U4BL 3B2UD 4MHHI 3SGKA 3QEHA 1CWVA 1KN2H 4XCYA 2R2CA 1IKNA 2ICEB 2P24A 3SDXA 2YMXL 1QR1B 5L88H 1G7LB 4A6YB 1R5IA 3IFOA 4XPFH 1MFDL 1F4YH 4OCMC 3S6CA 5CEZL 1UZ6F 3MV9B 4X99A 3CMGA 3C5ZB 1XCTB 1JMXA 1SJEA 4EDWL 4GG6E 2VL5A 2NY3C 5L9DL 5D96C 5IHUH 3STZA 3R1GH 4KTDL 4A2LA 2BMKA 4MCYB 4OZFA 3MLPA 1A6AA 3MRIB 4TUJB 1G7IB 1YQVH 1JWSB 4LSSH 1BIIB 1NMCC 1WBZB 4WTXA 4JZOB 2Z4QA 1QHOA 4LRIC 2MSPA 4WW1A 4ONOA 4FS0A 2CGRH 3AY4C 2EEAA 1S7RA 4EOWH 2N7AA 3QRGL 5FYKH 1HZHL 4ENED 1HOCB 4YDVA 4M5ZL 4OLZH 4KRNA 4NZUH 1K4DB 3H9SA 4KPHL 1BEYL 3D25B 1RPQA 3W9DA 4KZDL 2NY1D 5I66B 5GS0C 4PJBF 3TBWA 2P45B 3UTSD 3HRPA 1CZ8H 4P2OD 5K9QI 3TIDA 2W65B 2PO6B 3MLWL 4I48A 4FNLL 1IC5H 4XWGH 3NZ8B 4GXVH 4HKXB 3TA3B 3LKRB 1IC7H 5EU3A 4OFYD 3HNSL 1I1AD 1XIWB 4OZ4A 1NLDH 4P9HC 3IDNB 2W0PA 2PCPA 1HWHB 1A1MA 5JPNB 3HZMB 2G5BA 2DICA 1MWAA 4PY8I 4NWUL 5CEYA 2DM4A 2ZWLT 4HK3N 5F1NA 1YMHA 5EU6A 4X7TA 4K94H 1TZGL 3CLEH 4Z8FL 4U1HB 4ZO8A 4LSTH 2NW3A 4PGJA 2XG5A 1KIPA 4XNUL 3FN3A 3X12A 4HZLB 4OD1L 2YPLE 4PJXA 3Q2CA 4PRPA 2FZ3B 3ARGD 5GRVK 3U6RA 4UNTA 5AEAA 2DN7A 3MV7D 3MRJB 3S3SA 1D6VL 1CFSB 3QUYD 1OP5H 3WDHA 4QHKI 3B3IA 3WIIL 5DLML 3QCVH 4HKBB 3UPAA 1NFIB 4MA3A 5CIPB 5J1TC 4MA1C 3HRZB 1RZ8B 1QFUH 1I1FA 4YZFE 3JWDL 2QQKL 1N6VA 3HE6D 3QH3B 2H26B 4S1SL 1LP9A 4N0YL 2P7TA 4JY4B 4JFZH 4PJ5D 43CAB 5ICYB 1N0LA 4DGVL 3BQUB 5DYOA 5FV1L 3U7WL 3UPRB 1HXYB 3VXRA 4RSVA 4OLUH 4OZGF 2P8MA 4PGBA 4ELMF 5TF0A 3LEXA 3QQ9C 2VL4A 4PRDB 5CLWA 4HLJA 4WHDA 5ABDE 1JJUA 3KXFD 4U3XA 1RHHA 5D7IB 1U93B 1NJ9A 2ILLA 4JGJA 4AH2B 3OR6B 5DA0B 1AP2B 2F53D 3VH8B 1QRNA 1JTTA 4WUUA 5FKAA 2RQ8A 1ONQA 4H25B 2IH1B 5CJQH 2YKLH 4R2GB 4HX1A 3L9RB 4FQJL 5HYIA 3OXSA 1U8QA 5D2LE 3VFPB 1F42A 1C1EH 4CU6A 43C9A 4JR9H 4XTRC 4DN3H 25C8L 3C60D 4LPTA 3RL2B 4YBHA 3BESR 4K9EC 4KROB 3D0LA 4MD0A 1CLZL 5JHLH 4EUPB 1JUFB 2VLKB 1DQTA 3LKPB 1G6RH 3MBXL 3CXHJ 4PPTA 3IJSB 1U8HA 4D9RE 1F5WA 3IF1A 5D70L 1W0YT 4X6FB 2IADB 5JIIA 5INDB 1YN6B 1TNNA 4J3VA 3RWHB 1T1WA 4AT6B 5DJZB 4ONHB 4XCEB 3GSOA 3QHFL 3IRPX 1S7QB 1FFPA 4GBXB 1VEOA 1AKJB 1MFEH 3TWCH 2YD2A 3HNVL 4UMGA 2CKBL 3NABH 1NBZA 1FYTE 4YNYA 3S9DB 5KBNC 3HC4H 4JFPA 1QP1A 5IHZB 1A7OL 5F7MC 4D9LL 1CXFA 1J8HB 3VMOA 2B2XH 2HVJA 3GSWB 4N0UB 1YN7B 3V6FB 4LLVB 4PRIB 1ZHBA 4JRYA 4ZXBC 4Y7MA 4XNZC 1E4KA 4HKJB 5F3HB 4PJEA 4PJ8B 3U0WH 1KXQE 3P0GB 3LQAL 3V5KA 3DMMC 3BDYH 3V52L 4XHJD 2JE8A 1XGTA 3C5JB 1FC2D 1CL7L 1P4LA 5L2KB 2UZIL 1F3RB 1KPRA 3SE8L 2VITB 3SKMB 1TCRB 2Y06L 2AGJH 12E8L 3CFJB 3QI9C 1QFWH 3BRGC 3RQ3A 4PJCB 1F11A 4G9FD 3O2DA 1MHEB 1I1YA 5LGJA 1P7QB 1T6WA 2OR9H 3WIFA 3G6AA 4Y5XA 2VXTH 5EO0A 2C5DC 4HJJL 1YEIH 4QHUB 4PY8J 1AIFA 3ARQA 3EO1B 3WKMH 3LRSA 2FCBA 3SJVB 4NUGH 1F3JA 4CAGA 3O9WC 2HA1A 1EV2E 1DUZB 4XH2A 3MJ9A 4QNPF 1WFUA 5EOCH 3L7EB 5TDNB 5IHBA 4K7FA 1EO7A 1DLFL 4M48H 5HVHC 1W8OA 1MPAH 4P5TD 5TJWK 2QTEA 3SO3C 3QIBA 1EMTH 4LCWD 2D7PA 5F88A 4P2RB 4QHKJ 2AJSL 4XGZB 2BVOB 2IALB 3MREA 4KKBC 3W2DH 1B9ZA 3O3EA 4LEXH 1CFNA 1VACA 1NAMH 3MA7A 4UTBL 4R90L 2IQ9L 3EYQD 1C16A 4X6DB 1RI8A 1FG9C 5AYUL 2F8XC 3EHBD 2A2QT 3G6JB 2H2PC 3FT3A 1KJ2B 1QPPA 3PIQB 4PJGB 1EEUA 4IHOB 1CIDA 3FOMA 1F2XK 3KYKH 2O93L 3SE3C 4KC3B 3MRLB 4MXWH 1AXSB 4LOUC 3HPLA 1HK6A 5I1IH 5DJ2B 5IVXB 1RIUL 4PTTA 1CFTA 5IJVB 4BFIB 1NGPL 2JK5A 4X7EC 5GGVY 4QRPB 1VERA 5L6YL 1KNOB 1MCIA 1PAMA 3RIFK 4OZIA 2MQ0A 5CBAA 1K5NB 1AR1C 4XAWL 4H5SA 5E2TH 1MEXH 1SM3L 4NRYB 2HTLD 2ZOLB 4PJIA 5E6ZA 1IFHH 2GFBA 1IT9H 4LPUA 1AO7A 4E9LA 3IJYB 4M7ZB 5HHPA 4Y5YB 5IIEA 2V5YA 2RCSL 3BGMB 4JPIB 3W11D 4XAKE 3MZGB 3GFUA 5K9OB 4IOIA 1YNKH 2Y72A 4Y19B 1KJVB 4HWZA 3GIVB 1YPZA 4J3UA 1UG9A 3QFJA 4UQ3B 4OCXL 3EOTH 2QSTA 1E6OH 3DURA 4BSVB 4M6MH 5EORH 2V5RA 4NM4L 1T2QL 2VZ1A 2G5RA 2E5EA 4I3SH 2LV4A 4JB9H 4OTXH 1G7PA 2YD9A 3RVUC 4MJ5A 1ZS8B 1Q9OB 2VDLL 1JHKL 5HHMD 4AENB 1WLHA 1UM5L 3Q3GB 4U1IB 2FB4H 3TCLB 2BX5A 5C0BB 2NXYD 4DAGL 1MLCA 4JY5L 4F7MB 3BIKB 4P0DA 3VFWA 1P7KB 1NLBL 3QFDA 3TP4A 2Y4SA 4RGNB 1FLRH 4LGPB 5HDLA 3QJFA 2VXUL 5I1LB 5J6GA 5IW1B 5EOTA 3DV6A 1J7VR 3IJHB 3H3BC 5TQ0H 1N6UA 2MCPL 4D2NA 5I16A 1TVHB 3GJFK 3VXPB 3GSXB 4J1UA 3F7QA 4GSDH 4PP2B 5FCUL 3RL1A 4KXZI 3KYOA 2CUIA 4JANA 5HDOA 4AZ8A 3OKKA 5T3XH 2JLLA 1XEDA 1UJ3B 2WLZA 4JFHE 5SV3A 1IGJA 5JLZB 1I9RL 2F54E 15C8L 5T33L 4UT7H 1YMME 3QDGA 3L3HB 2I27N 4HXAL 4LQFH 2ZCHH 4NN6C 2OQJB 4NP4L 1WV7T 4NBXB 5FYLE 1MCSA 1S9XB 2ORBH 4PJBA 2HP4A 1DVFC 3MUHL 4P46C 2E7LC 2Y36H 3CCHB 3ZKXB 1OTSC 2Z0BA 5JUEH 1NC4A 1ITCA 1BREA 1Q8MA 1V7ML 2F5AH 2CKBB 1KCUH 2WBKA 1PBYA 3OKOB 1A1NA 1E27A 4LHJB 1X3DA 4MAUH 1LO5B 1KFAL 2WWKO 4S2SA 3CZFB 3QAZB 1A9BA 1EAPB 4QRRB 5DMGC 1N3NB 4Y5VC 1WZLA 5EBWA 1NGXB 2GUOA 2MKWA 1PY9A 4M1DH 5J12C 3WE6B 3MV9E 4NPYB 1IGCL 5DA4A 2VISB 3K80A 3QDMB 5I74B 5HHNB 3QG7H 2A83B 4DUWA 1NCUA 3CK0H 4U6VL 4Z9KB 3D5OF 3RWIA 1PG7H 4I5BB 3SHSA 1OWRM 1FP5A 2XPGB 4IOSD 3NZHL 1ZHLB 2OJZL 4IM8A 1ES0A 3V7AE 1J05B 3TVMC 1KN2L 5CP7A 1FE8H 1ZT7A 5FO8A 5L88L 1AJ7L 5J56B 4X8XA 1EZVY 1EA9C 2FR4B 1F4YL 4KRPD 4TVPH 2AKRA 5CLTA 5C92A 1PY4A 3HB3C 3ARPA 3CPLB 1TJIH 1JBJA 1T7XA 3BN9C 3U7YH 1A6VH 1MJ8L 4MNHB 4OGZA 2QHRH 2EKSB 1BOGB 3I6KA 5HPMA 5IHUL 4H88H 3ARFB 3R1GL 2ED7A 3TBWB 4KQ3L 2IJ0C 4KKAD 1FZOB 2GJ6E 4NIKB 4OZGA 4ELMA 1QLRA 5KZCD 1DBJH 4LSSL 3H42H 1ZVYA 3A6CH 1CU4H 4ODHL 2R0ZH 4K71B 3PWVA 5EZIL 3HMWL 2CGRL 5JR1L 2R1XA 4EOWL 1BJMA 2C3HA 3TBSA 1Z5LA 2FJFA 2R9HD 4JFOA 2A6DA 1J0HA 5GHWH 3MFGB 3OAZH 4NZUL 3QHZH 5CZVH 3MGTA 1CE6A 3WO4C 1JHLH 3O4LD 3O8XD 5DRXA 4PD4J 3Q48A 2X1XR 3HUJA 3BO8A 2EICA 3PDDA 1CK0L 2ADIA 4WRLA 2X9XA 4QHMB 2B4CC 4Y16B 2EDJA 3L3GB 5BMFL 4HUUB 4XWGL 1CFBA 3HR5A 2PW1A 4X9BA 5D5MB 5IF0A 1IC7L 2BY2A 4JZJB 2XOTA 3V0VA 4OD2A 3A6OA 4JHBA 3FB8B 4UOW0 3AB0C 3ZYOA 1G9NL 1H15A 3INUL 5GJSH 3QO0B 3TNMB 2V7HA 2BVPB 4Y1AB 3SKOB 4BK5A 4YHOH 4FQXB 4EZMA 2BNRD 5DUPL 2X4OA 4IEFB 4MA3B 3D69B 3ARBC 4ZDHB 3BP4B 4K94L 3CLEL 1TIUA 3HZKB 2FLBT 3JWNC 4LSTL 4F9LA 4F7TB 4L3ED 3VI3E 3RPIA 4KAQH 4K3EL 3IXAB 5D1XB 2YSSB 1RUPH 3QIWC 3GBNL 4JE4B 3RVTC 3FAXA 1ZVSB 2QSQA 3UTQB 1EAJA 4P59H 5TPWH 4LVNC 2X4RA 5F3BB 4PGBB 3QCVL 4KVCL 1EFXB 4IRSC 1M6OA 2ED8A 2GK2A 2XN9B 4DVBA 2I24N 3DHJA 4MQXC 3FQUB 4AIZB 1QFUL 1JZ5A 3EYSH 2EO1A 4WHTB 4EXKA 2C1PB 5KSBB 3HE7C 1MAKA 2W1NA 3VFOB 5FXCH 4JFZL 1WZ1H 1UM4H 4CMHB 1DUYB 3IT8D 1VFAB 3MV01 1IGTA 1MCPH 5GGUA 3TV3H 2AK4B 2EEDA 1XR8B 4OLUL 2EC9U 4HF5L 2ITDA 2J5LB 4P3CH 3TO4A 3UTSA 3BDBA 1N6QL 2GY7B 4P2OA 1RU9L 1I85C 2YUVA 3R4DA 4UB0H 5DJYA 4UOJA 4B0MM 2NNAA 4OZFG 4OFYA 4K3JL 1PKOA 4N8VA 4M93C 4JJ5A 1I1AA 1HYRC 2D0HA 3QPQC 4ZAKD 4G8EB 5FAAA 2NY0D 2CJUH 1YEKH 2NXZB 1I7ZB 3LD8C 3ZHKA 1JF5A 1BX2B 4XWOD 5INCB 1EJ6A 5AD0B 1T66C 1CDUA 3KVQA 1C1EL 4WW2F 4E5XB 5IB2A 4JR9L 3LKSA 4IMKA 2VE6A 3ARGA 3VD7A 2AEWA 2K3TA 3MACL 3IFPA 4EI5B 2VN4A 3MV7A 1J18A 1KJMB 1UB6A 3QRFM 2E9IA 5F7KC 1XF5B 5JHLL 3QUYA 3RKDC 4M8QB 2YN5A 4WFGE 4GKOA 3QWOB 5C0CE 1JIBA 4TRPH 1DBAH 3HE6A 3PDOB 5CEZE 5ILTH 4GRWE 1DFBH 1RZKC 3NCYP 4PJ5A 4EJ1C 3ROLA 3RWCB 3FB6B 2WBJD 4HFWB 4LVEA 1ZANL 5K93A 4LHUD 5FGBA 3RI5K 3SY0B 4K2UH 1LEKA 5I75B 2FEEL 1MFEL 3TWCL 3T09A 3FFDA 5L2KE 4JQVC 4ZUVA 4OFVA 3D18B 4R7NB 1FIGH 2YA1A 2JIXD 2AV1B 3EBAA 1QVOA 3HC4L 2DI7A 1Z9LA 5FDWA 4MWFA 2FEDD 3EIFA 1LO4H 4F8TA 2B2XL 3C5ZC 2EDLA 3KXFA 1MLBB 1NCBH 1CCZA 4LBEA 4NZRH 5EUKA 3S35L 4QTHA 2AJUH 3KYMB 4KJYB 3FTGA 4M1CD 4NKDB 1DP0A 4DKEH 4JFDB 4OQTA 2B7DT 3HC3L 2OZ4A 5KSUB 2J1KA 1AIFB 1ZOXA 3BDYL 5IK3B 1UKQA 4LP5A 2DQTH 1GPOL 1WT5C 2M2DA 4PJFE 2YD3A 4H26A 4G3YL 2DQGH 2X4SA 4XMKL 2W91A 3OF6A 1CFVH 2AGJL 4V1DA 3FJTA 5EOQH 1QFWL 4P2RE 3C60A 5GGVH 3KJ6H 3F65A 4PJHB 4X9IA 3LEVH 4LSPL 5CMAA 2OR9L 1IGFL 5I2IB 1PD6A 4FXLA 1DL7H 1YEIL 4X6DE 3O3EB 1A14H 2PO6C 3DECA 5F21B 3LCYA 4NUGL 1B6UA 2YA2A 3OX8B 5T3ZD 4PJGE 3TA3C 3CMOL 3ZKQD 5IOPB 1QUNA 2GT9B 5EOCL 4URTB 3KR3H 4XP9H 1HI6B 3OAUH 2R1WB 5EBLA 2ICCA 3PGDA 4YC2B 1UZ8A 1W72H 5IVXE 1CFQB 1NGQH 3D3VB 1TQBB 1T83A 1YJDC 3IXTB 1EERB 3W2DL 3AU1A 4HFUL 2C4XA 4U33A 1W8NA 4JREB 1RK1A 2DOCA 5DMJB 4PTTB 4Z7UB 1ZXQA 3DVNB 1NEZG 3TCXA 2YC1A 2R2HA 3MGOA 2QLVB 1P4IH 4PJ7F 1N8ZB 2DLFH 5J3HD 1JZ6A 1JGEB 3H3KA 4QOKE 5E6ID 5F89A 3T3MF 3FQNB 4KVNL 3DXAD 3RTQD 2H45A 3BAEH 3KYKL 4JRXD 4MXWL 3CFEB 5F9WB 4JQIL 1WTLA 4QRSB 4MA7H 1R6VA 5D1ZD 4MX7A 2XTJD 1IC1A 4Z76A 1VGKA 3MMEA 1UEMA 4TUKL 3B9DA 4JDZB 2QADD 1INQB 3O11B 1C5CH 3BQUC 3AS1A 4P4KD 1KT2A 1T03H 4G9FA 1WWCA 4LSDA 5E2TL 5EU4B 4HWZB 4ODSH 3RGVB 3ZHLA 1LD9A 3UAJC 5GIRA 4YX2H 2DJUA 2AJZA 1IFHL 1IT9L 2QJDA 5IMMA 4CVZB 2YXFA 3WEXA 1FAIH 2DWEA 1XCQA 2X10A 5C6TH 2BC4B 4NHUB 2C7UB 3FONA 1IEBA 4HIJB 1A6ZB 2GCYA 3LSOA 4Z18A 2H32A 5C2BH 3JV6A 2XKSA 1J1PL 5I1DB 2HJKA 5E9DE 3MFFB 5C0GB 5ITBH 4NJAH 4P23D 2A0LC 3VXOB 3EOTL 1E6OL 4M6ML 3C2AH 1RURH 4LCWA 5EORL 4AEHH 4FQ2H 3ULUC 4DZBA 4I3SL 3MODH 4JB9L 4OTXL 4RMQA 2YA0A 1O7SA 4R2GC 1EHAA 3FO1B 2DQIL 3HMXH 2FB4L 4UUJA 3MBED 1T20B 4NKOA 1Q0XH 5EC1A 4HV8A 1UWXK 3GKZA 4MJIB 4J3OC 1WAAF 4PJ9A 2WAHA 2XQYK 4WENB 3S98A 1VKXA 1FLRL 1G9MH 3O6LH 4KROC 3SGJA 2C4FT 2IEPA 3IKKA 1KG0B 4I3RH 1VGEH 5FYJU 5I1JH 5C0EB 3QXTA 3RX8A 2FO4B 1T89A 1LHZA 4GSDL 3TFKC 5HHQB 5LAXB 3CSGA 1HSAA 5E8DH 3F7PC 5T3XL 2X4QA 4R4NC 2ESVD 5DC0A 4ZS6D 4HIIB 1U8PA 2BRQA 1N59B 4GBXC 3I02A 3H8NA 4U1LB 4Y8AA 5E00A 2P5ED 1UEYA 1ZTXH 1RZJH 4ACPA 2GK0A 2ZCHL 4O58H 4ONFH 4Z7OF 4OAWA 2D9CA 2NY3D 3NIFF 1XGQB 4U1JA 3CC5B 3NA9H 4OLYL 3VFRB 5A43C 3CVHA 3PL6B 1U8NA 2UZXB 4UT6H 1QSED 2Y36L 3EJJX 4FFWC 3RHWF 3QDME 5C7XL 5JUEL 4C59B 1V05A 2F5AL 3PF2A 5D4QA 2CLZA 2Y1VA 4OCSH 3PWLA 1DN0A 2EDOA 1LWRA 1QQDA 1RQ5A 4MAUL 1FL3A 2BVQB 1W0WA 2DM7A 4PJ8C 3ARUA 3O3UN 1RJYB 1DQJA 3JTTA 1MJJB 4GO6B 1YEEL 2VZTA 5GS0D 3QHTC 2GYSA 5EPMA 3EDFA 5EZLB 1TVDA 2ZG1A 3CDGB 3QNYB 4DN4L 3B8YA 3H9SE 5DURB 3TPUB 3I6GA 4NYLA 3QG7L 4LPWA 1D5MB 1DBBH 1OM3H 3FQTB 3VE0B 4C83A 3GJFA 3CK0L 4KGLA 4NSKA 3DRTB 1PG7L 4OF8A 1VHPA 2FRGP 2PF6A 1U3ZA 3QCTL 2DWDB 1HHKB 1M05B 4XPAH 3UEZA 4U7SA 1MIEL 4TUOB 5H35A 3EGSA 1JWMA 2NW2B 3RNQA 4P4RB 3NVQA 3P11L 4UT9H 4TVPL 5JORA 5TGBB 1TJIL 1QO3A 5HDBF 2J6EH 1A6VL 4X4XA 2J88H 4LASH 1VEPA 2EDRA 2QHRL 4NNYB 3CLFH 1KJ3H 4H1LH 2J8OA 4PIRF 1OGAA 1EFQA 4H88L 3BZEA 3IDMB 1NDMB 1RK0A 3S3PA 4CGTA 4B41A 2NCMA 5KN5B 4PGCA 1DBJL 1BZQK 3CH8A 3H42L 1UC6A 1KIQA 1NAMB 4JY6B 3A6CL 4FXGA 1CU4L 2QQLH 4PRPE 1LDSA 6FABL 4C56D 4DOHE 3J8F7 4O2EB 4P5KB 5BW7C 5I8CB 3CU7A 1PZUB 1BECA 2DI8A 1Y6MR 4HK3J 4FQQB 3EOAB 4WO4B 1BQLL 3I6LD 5GHWL 3QHZL 4WJ5A 1JHLL 1HXMB 5KSAB 2DD8H 3U36B 2A73B 3ZHDA 3LHPH 4P57B 3VFTA 4J12A 1TPXB 5F9OH 4RAUB 3QQ9D 5FB8B 4WUKH 1T1YB 4HBQA 2X09A 1MI5B 3JWDC 3MUZ1 1S5HB 1JTOA 5C9KA 5F96H 4WW2A 3VXRE 1A6WH 2GAZB 2BERA 4GJTB 3OB8A 3HC0A 4JKLA 3BMVA 5HI4C 4M7ZC 4X80H 3LB6D 3MO1B 2CDFA 3GHBH 4GG8A 3H9YA 4YHOL 4HIHA 1ZGLM 2YUWA 4GW5B 1DANU 1FVEA 2VMFA 1ZA3B 2DM2A 5K9KB 1FRGH 5LCVL 3K1KC 2FX9L 4YHIA 4GUPA 1N2RA 1YYMH 3K81A 4KAQL 3FN9A 3GMOB 4XTRD 3UJJH 2ENYA 4ZFZB 2VZUA 3MC0A 2VDML 3SGDI 3MJ7A 1RUPL 1QRNE 1ZA6B 1P53A 4WUUE 4MJ4A 1ED3A 1MCLA 4L4VD 3PGCA 4KUZH 1AGCA 4OBRA 2ATKB 2VLLA 3U4EA 5GGQL 4OKDA 3VXNB 3OAYK 4K8RH 4RGNC 5TH2A 1XGYH 3O3AA 3EYSL 1WGOA 5FM4A 3MRQA 4OCWH 4JO2H 3ZYJA 2ICES 1WZ1L 4JJHA 3MRPA 1FC1A 1UM4L 4JHWH 3AM8A 1MCPL 3O6FD 3TV3L 5C09D 3O4LA 3O8XA 4HK0B 5AG9A 4UNUA 4X9GA 1OLLA 2I60H 2PUQT 3BD4A 3QO1A 1DQDH 4GAYB 1MFAH 3OJDB 4P3CL 1FFNB 4L4TB 4J8RA 2QSCL 1FO0A 1WIPA 2F5BL 5E2JA 4FA8A 5DEFA 2W38A 4YAQB 3QUZB 1L9MA 5D6CB 3ZKSD 1TZIB 3C5SB 4ZXBD 3EJZC 1FDLH 1OAXL 4NKQB 3NFPB 4HUVA 2A9NH 1DQQB 1YEKL 2CJUL 5EDXA 3DMMD 3ZKXC 2BNRA 1EHLH 2EO9A 3RZWA 5IHLB 4X83A 3NCEB 2JB6B 1H3VA 4XCFL 4HPOH 3KNBA 1FNSH 1YDPB 4MS8D 2DLHA 4OJFH 4F58H 1NAKH 4QCIA 4JRYE 3BKML 4L3EA 4YDKH 5MENB 3NFNB 3PDGA 1FSKB 2XA8H 5ADPH 4PJEE 1YEJL 3AMKA 3QAZC 3QI9D 2ZNWA 4HCRH 4CVWA 1JN6A 4DGIL 3KPMA 3IU3A 4CNIA 4R4BB 3NCMA 3V6OC 1JVKA 1AD9B 5IEHB 3VGAB 1MHPL 1X5XA 3CH1B 3D87B 4TRPL 1KEMH 5I74C 1F45A 2XWTA 5DD3L 4LDEB 1DBAL 3U9PL 2VWEC 5ILTL 5E0QA 5BV7H 2B1AH 4XPGH 1B0RB 3JV4B 5DJ8B 4YHMH 4GRMA 2XICA 3V6BR 4NRZA 3KPPB 3RZCA 4K2UL 3D85B 4OD3L 3DGGA 3LS5H 3TF7C 4U1GB 1KEGH 2F53B 1ZT4B 4NQEB 1QYGH 1FIGL 5DJDB 1Q0YH 3BGFB 3Q6FB 4QRTB 5ADOH 1UKTA 3V5HA 1URLA 3QPXH 5J1AB 1RZGA 3GMQA 1MHHA 5I18H 1LO4L 2PYEB 4MLSA 2H2PD 5E5MB 5J89A 2AJUL 3IFNL 4ZAKA 3U46A 4LLDA 1UADC 3KLHC 2CKNA 4FHBD 4KK6C 3ARFC 3MOQA 3H9HA 1LE5B 4DKEL 3ARRA 4RX4D 1S7SA 1DTUA 4NZTH 3EO9H 4O2CB 2DQTL 1BFOA 1LO0H 5E4EB 4K71C 1LE9B 2DQGL 2AAVA 3QEQD 1TDQA 3KYAA 1H3GA 1CFVL 4HIEA 1AR1D 1JGVH 3D3VE 5EOQL 3G9AB 4KQ4H 4ZOCA 1WWBX 3KJ6L 3GEWB 4YFEA 3LEVL 2AEPL 3X3FL 1UZ8B 3ZE1F 1BM3L 5ICXA 1DL7L 2B5IB 3O41A 4OLVH 1A14L 4Y16C 3LN5B 4JZNB 2R69L 3FO2B 4OZIE 4N8VG 3O4OB 4N5ED 3RUGA 5BVJA 4BKLB 1ZVHA 5D2NB 5DWUL 1U2HA 2F15A 4JZJC 3DX7B 5J1SC 4PJIE 4XP9L 3OAUL 5HJ3A 2X70A 4HGWB 4AG4H 2WBJA 1AO7E 4UOW1 2VLMD 4LHUA 3GI9L 4G6AC 1PG7X 3MA9H 3JXAA 1KACB 1NGQL 4FQXC 1INEH 4LMQE 5JW4N 5EULV 5MI0B 5L2JB 4OF6A 2X41A 3RVUD 3UTPD 4Q7DA 4AL8H 4OM0H 4BH8B 4GKSB 1U8OB 5FA4A 1IQDA 1WF5A 5EWIL 3NFSL 4JCMA 1EBPA 2RJMA 4LKXA 5FFLA 3CFKA 1TLKA 3BVNB 1OAQH 1P4IL 3QFJE 4I18B 5D1XC 2DLFL 1VPOH 4H0IA 1M7DB 1VENA 3VI4E 2EDXA 5JQHC 5I17B 4L3CA 4NQXB 1FYHB 4UU9A 4MMZC 1F00I 1LO2H 1T3FB 3TBYA 3ES6B 2W07A 3F7VA 2BOCB 2LU3A 4YDJA 3BAEL 3BZFB 1FIEA 4NO2B 3KYNB 3FT4A 1ZSDB 3S4SA 1YEGL 5K33A 4P5MA 2NTFA 4XBPB 4P99A 4LSVH 2LU4A 4RZCA 5BQ7B 1UZ6E 4QF1B 2GCYB 3LSOB 4CMHC 1DN2A 3U9UA 2H2SC 1HN1A 1GGCH 4ODSL 4X4YB 4P5TB 1OB1A 4UBDC 3WYRA 2J5LC 3KAAA 4LCWB 4ALAH 5SWSB 4IDJH 2AP2A 4ETQA 3T3PF 4MJIE 4P46D 1DVFD 2AXHA 5C6TL 3BKCH 5LJYH 1XR9A 2DLGA 1OTSD 3IGAA 1OPGH 4WTZA 1ACYH 1CTNA 4NCC2 1T7YA 5C2BL 3KPOB 3HI1B 3HPJB 5ITBL 4NJAL 5F9JB 2NXZC 3QXVA 4XCCH 4PJBE 3C2AL 1RURL 4FQ2L 1P2CB 3GRWH 4WEMB 3MODL 2G75A 1CL7I 4HJGA 1V7NH 3VFVB 4WV1C 3HMXL 3P9WB 4P9MH 1MREL 1AHWB 3AVEA 2ZUXA 5DMIH 1OT1A 4NO0D 3WN5B 5E1AB 2WINA 3BWAB 4DGYH 3RVVD 3W0WB 2BRRH 3TIEB 3VGDA 3V4PH 3VFUB 3WNNA 4EI5C 1G9ML 3O6LL 5H37H 4PLKC 2Q6WA 4JO3H 1CVSC 4HS6B 3DXAA 1A9EB 2VXQH 3RTQA 4I3RL 3WNPA 4JRXA 1P9MA 1VGEL 3HAEH 1GZPB 5I1JL 5IB3A 3W9EB 3QULB 4FQCH 4TYUA 5JW3H 5D1ZA 5JPMA 2IGFL 1HH6B 1KTDB 1A47A 1P5UA 5JDJA 4Z78A 3VCLB 2Z35B 5E8DL 5CJXA 2MTPA 1N0XH 1MFCH 4L9LB 2AJXL 4JEGB 1M71A 1SHMA 3HB3D 2WUCH 4KKLD 2R23B 4Z95L 3ALPA 5I75C 3BN9D 4H8WC 2JJSC 2GSIA 3BMWA 1ZTXL 1RZJL 1R24A 1TMCB 1ULVA 4O58L 4ONFL 4HC1A 1G7JB 3V2AR 4PR5B 3FT2B 4OFIA 2WQ8A 1NMBL 4UT6L 4MJ6B 1U3HA 3S36L 2CDGA 1WVZA 3P0VL 1EO8H 2KL6A 3MLZH 1IJ9A 4ZOBA 2Y25A 4W4OC 3NCJH 4OCSL 3LKQA 2UVEA 3QIUB 4NO5B 5GGTA 3LEYH 4P23A 1I8IA 2DQFB 3U0TA 4Y2DB 2NY4B 4N90D 4OZGE 3G5VB 4NDMA 4ELME 2OJEA 1BVKB 3IU4H 4FQHA 2H3NB 3MBEA 1HH9B 1S9YA 4X98A 5JNYA 4JM2A 4TQEH 1CLOH 4KXZH 4LLQB 3F12A 1W0VA 4OIAA 3VGHA 1NGZB 4JG1H 5KVDH 3CZJA 3GSQB 2HKHL 4Z0BL 4R3SB 1I9JL 1DBBL 1YY8B 3GSUB 2OYPA 2E9JA 3FCTA 4K23H 2HLFC 1MRFH 4XPAL 1AGDB 4HWBA 1QSZA 5B8CB 2MJWA 3ARBD 5HYFA 3OGCB 3MLYH 2ESVA 1RMFL 4UT9L 3OTTA 5ERWB 4YC2C 1IAII 2EDYA 5IT2H 1O5DT 2PTTA 3IYLW 3SO5A 1JNHB 2LE9A 1VADB 3KPSB 1TQBC 4FFYH 2J6EL 3QIWD 4PREA 1U8MA 1ETZA 5HYSA 2J88L 3MJGX 3BEVA 4LASL 3RVTD 4IIQB 3CLFL 1KJ3L 2CDEA 4XNQB 4AEEA 4JREC 3WFEH 1QSEA 4LLUB 1DE4A 4ZPTB 4IRSD 1T22A 4X5WB 4E42A 4MQXD 2APTA 4K94C 4LRIA 2QQLL 2BNQB 3AY4A 5DC9B 3HE7D 3MTRA 5DDHB 4HUMB 1MIMH 1F3DJ 1V8HA 2HFEA 5F7YC 5C0AB 3LKNA 2JCCF 1BMGA 2Y6SC 3WFHB 2LAGB 2QL1A 4LNRB 3G04B 3X14B 1R0AL 1T4KA 4BSWA 2QR0B 5HXMA 5ETUA 2OZ4H 2FJGB 4E0RA 2ZUSA 3B43A 5EO1A 1NBYA 4J3XA 4TSCH 2KZWA 5C3LD 3EYUH 1SYSA 4ISVA 5F9OL 4BELD 1GXEA 1KPUA 4GKNA 4WUKL 5JDSA 3QUKA 3DRQA 3RGVC 5M7QA 4ORZC 2VLRD 3RDTB 1FZKB 4GW1B 3TT1L 1WIUA 4NQDB 1TJHL 4HEME 1A6WL 3QPQD 1ZEAH 1IEAA 3UTSE 5HSFA 4X80L 5DD6B 3WO3B 5LVEA 2PW2B 2NX5D 3QP3A 3UC0L 2XY1A 5E8NA 4CBPA 3ISWA 1L9NA 2YD8A 5BCAA 1S7TB 1FRGL 5C07D 1KB5A 3DUHA 1T66D 3TPKA 3EYOA 5FYJD 5HGDA 4OSUH 3IDGA 3WFDH 5EU5A 3UJJL 4F33B 5B39A 4BFGA 4GT7A 4PRBA 2BOBA 4DQOL 3KLDA 5L7XH 3RKDD 2PR4H 4KUZL 1MJ7H 5T3ZL 1PKQB 2VDOL 4TN9A 5KTEH 4I13B 1IBGH 4NZDA 1NH6A 4HPYL 5GSVA 1E4XI 4K8RL 3MV8A 4C56A 1XGYL 2XKNB 4NC0B 3ARSA 3MV7E 4OCWL 4MVBC 1DDHA 2BY0A 4JO2L 4R97B 4CJ1A 1IE5A 1IILE 4MNGA 1CXKA 4UNVA 3ZTNH 4WDIA 3WIHA 3L7FA 1DQDL 4MDIB 4U31A 1MFAL 1FNGB 1HEZB 1MUJA 1MFBH 1MCWW 1T04B 4PJ5E 3MUGA 3FB7B 3S97C 4GLRI 4M62H 4G42A 4KRMB 1CGVA 3AREB 3C5ZD 3SKJH 4QHLB 4S11A 4PRNA 1FDLL 3GMRB 4RIRB 4PRHB 1BZ9A 4HWNA 3PL6C 3TZVB 1IGIH 4PJDF 1EGJH 5DHYA 5KS9F 4LGRB 1U95B 2PXYB 4N9GB 1Z9OA 1FNSL 3KXFE 4F58L 1NAKL 4I4WA 4H20H 5T1MA 2X4UA 1C7SA 1UGNA 3G5ZB 4YDKL 4U1KB 1AC6A 4JKWA 5B3NA 4PJ7B 1K3IA 5CD5C 1K8DA 2F53E 5I1CH 4HCRL 3WLBA 1PEWA 1UM6L 3MJ6A 4PY7A 4GKZB 4OGXH 2DIBA 1AI1L 4L4VA 3N9GH 4YFLI 2IAMB 1JV5A 2PO6D 5BVPL 1RUMH 3M17A 4XI5C 1V3MA 4HSQA 1KEML 3TA3D 3H0TA 4ZTPH 1U92A 5BV7L 1MH5A 2DMBA 5IVZA 4JO1L 2B1AL 1CD8A 4XPGL 4PLNC 2ZJSH 2BNUB 2LAAA 4YHML 5IB1B 1CD9B 3U0PA 2AXJA 2NY0B 2UWEB 1KIRA 3BISA 5A2KH 4IMLB 2VN7A 3P73B 2NZIA 3EOYG 1FAKT 3BHBA 4KDWA 5JO5B 3B5TA 3MNZA 1Q0YL 5CWSB 3RNKA 5ADOL 4EN3B 3QPXL 1CD1A 1WCQA 1S7UA 3IS0X 4UINL 1QFHA 5I18L 3RX5A 1XH3A 4ZXBA 3P4NA 2X4TB 32C2A 4MJ2A 4NRXA 4AYFA 4R7DB 4J6RH 2DIAA 3DMMA 5BZDA 3EO9L 4H1LB 5ID0A 1LO0L 3SEPA 3T8XB 4HMCA 2A1WH 4MDJB 1AFVH 3NAAH 5IMKA 3QXAB 2FECI 2XWBB 5K59F 3WXWH 3QI9A 3BQUD 4WO4C 1JGVL 3RJQB 4KQ4L 1FQ9C 4LDOB 1I9IL 4LARH 1P6FA 3UAJD 1D9KB 3HZVB 5KSAC 1QZ1A 1A6PA 5D9SA 4OLVL 1TPXC 1A0QL 3ULVH 2EEBA 1NANH 4AQ1B 2JIXB 3O9WA 4G9FE 3RWDB 3QUXD 4FZ8H 3MLVH 3V4UH 1SVZA 2F8VA 3W82A 5JA9A 1H0DA 4LIQE 2Q7YB 3T4AA 1ND0B 1ZAGA 2EDDA 2A0LD 2FL5A 2NTSP 4MD4A 2VAAA 3MA9L 5MEOA 3FQWA 4QYOA 3ULUD 1INEL 1MF2L 2OTUB 3MSPA 4AL8L 4OM0L 4R2GD 2AXGB 4RBPK 3GMNA 3MRKB 2PTVA 1GC1H 2R2EA 3QJHA 4XPBL 5EU7E 4YHYB 2P43B 1OAQL 2MKLC 1VPOL 1BQHB 3FFCB 4LCWE 4FQIH 4KROD 4B50A 3MXVL 1OD7A 1A2YA 1TCMA 1LO2L 2VLKD 1AR2A 5I8EB 4RX4A 3SE3A 4NT6A 1K8IB 3ZE0F 5KVGH 5H2BB 4YXLH 5ESVA 4LSVL 4PUBH 3TFKD 1HNGA 2RB8A 3QEQA 4Z6AT 4R4ND 4JPKH 1ZK9A 4CU7A 4GBXD 1GGCL 1ZHKB 4X6EA 3HN3A 1AKJD 2YPLA 4I1NB 2VDNH 1FL5A 4I2XB 3MRCB 2QKIA 5C08B 5EIIB 3MOAH 4ALAL 4IDJL 3GBMH 1OAZH 3D1MC 3TEUA 1JPFA 5HD8C 1UB5B 1SJXA 4HJGB 3RAJH 2BVUA 2OP4H 4FFWD 2IPKB 4ZO9A 3BP7A 1J8HD 5I1AB 5I76B 4OV5A 1GGIH 1OPGL 1WFTA 4UTAH 4PRID 1ACYL 3QUZC 3T2PA 3OR7B 2UUDK 4RA3A 2OK0H 1KBGH 1BD2D 4IDLA 4UDTB 3F5WB 1KUMA 5E6IB 5EC2B 4GW4A 5LQBH 4XCCL 4HGMA 2R1YA 1BPVA 3GRWL 2A77L 4YPGA 5EZOH 1CXLA 2MMXA 4PRAB 3L3OB 2XTJB 4DFHA 5GS2H 1V7NL 1UXWA 4HWEH 3TT3L 1JPTH 2PTUA 4P9ML 5C0IA 3KWWA 1FSKC 5DMIL 2EKJA 4HLZG 1FZMB 5GRJH 1NUNB 4M43H 4JFQA 4PV8A 5MP6H 4DGYL 5HBBA 3V4PL 1GJIA 4P4KB 1FFOA 3LKOA 4JO3L 5HHME 1CXHA 4Q0XH 1R3KA 2VXQL 4NNXB 5J9PB 1R24B 5HGAB 3VGAC 4FQCL 1UCBL 1I3RA 3SJVD 5JW3L 2HVKA 1PZ5B 4XBEH 2H6PA 3PNWA