3V2AR

Vegfr-2/vegf-a complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
198
structure length
185
Chain Sequence
QHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPLVNRDLSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vascular endothelial growth factor receptor 2
publication title Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/signaling protein
total genus 29
structure length 185
sequence length 198
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR01
1S78D 4G6AC 5IJKC 4WV1B 3MXVL 1ETZB 4PREA 4H20L 3JTTA 5D7IE 1RD6A 5GS2H 5F71A 1HHJA 1J11A 3BH9B 5F88B 1RJLA 4IDJH 4WEUD 5KVEL 3U36B 2IQAB 4IJ3B 1YY9D 1NEZG 5IVXA 3DO3A 3IGAB 5I74C 3RVVD 4FP8H 3IU3A 4I18B 5FHBL 1QA9B 1F8TH 1QSFB 4PV9B 4UQ2B 4C59B 4M00A 2B4CL 5T3ZL 3UPAA 5IESL 3MV8B 3A6BH 1EAPB 2IANE 1AKJB 1JWMA 4PJ8A 4PJDB 1JHTB 2IPKA 4JRXB 1N7ML 4ODVL 1NGQH 1NPUA 2B2XL 1CU4L 4S1SH 5T5FL 1FG9C 3V6FB 4YUEH 5FYJL 1BOGB 2DQEH 4R97C 1KJMA 3F7RA 2H2PD 5D7IB 3QJFB 4G3YH 5B3JE 3KYOB 2JF1A 3PV6A 1H8SA 1ERNA 5F96L 3KPLA 2F5BL 4ZFZA 3MLXL 1T83A 1UT9A 4ENED 1RY7B 5FYKE 1YNLH 3O6FA 1B3JA 1JL8A 2OL3A 5IB4B 4F80A 1WFNA 5IB2B 4QHKI 2ZUQC 2EYTA 4FQIH 3QRGH 1P9MA 3C8KA 4BSWB 2IANB 2NQCA 5LXGL 3GJFK 2JK5B 5TH2A 3MLYH 4OZHF 4FN0A 5D2NC 5EIVA 1EJOH 2EDXA 3QHZH 2NY4B 1FORH 1I85A 1VPOL 5FKAB 1N0XH 3BMWA 3DVGA 3GJFH 2XA8L 1U8MB 2L7JA 3AAZB 4Q6IA 3CH1B 1RPQA 2FD6H 2DWDB 2VXVL 3QPXL 4UNTA 1AGBA 1YEKL 3DX7B 1AY1L 4JVUA 4XPTH 2Q3ZA 5JHLL 1ZWIA 3UJIH 3P3YA 4WNQA 2BSTB 3FCTA 4KUZH 5FA4A 3V2AR 5ICZA 3S8WA 5JMOC 3QUYC 4NBYB 4H5SA 3R4DA 2ZSVA 4UV4L 3FO2B 3I50H 2WWKO 2DJUA 3KYNB 3SN6N 4LHUA 3T3ME 5IG7A 5EUOE 1NGZA 1JYWA 5GSRA 3SCMC 4LAJH 3JWDH 1A9EB 4TULH 3MBED 1NC2B 3WXWH 4P2CG 4CVZB 2ZPKL 2XACC 1A1OB 1HHKA 1WC7B 1F3JB 2WAHA 5CSZB 3QDMA 5K9QI 1MFAH 2YA0A 4NZRH 1J5OH 4XWOD 5HYJE 5J6GA 4R4FL 1CBVL 4ZUVA 3UTSA 3QXWA 4YDKH 2DL9A 2X1QA 2GSIB 1NKRA 4S0SD 4DN4L 1ZT1A 2PCPB 3C5SA 3OKLB 3V6OA 3MA9H 3LN4A 3S36H 2ZCLL 2E6QA 1E4JA 4M9OA 5EUOB 1MCFA 1T89A 1XF5B 3ULUC 4ONHB 5C2UB 3P4MA 5EBLA 3JTSA 4L4VA 3C08H 1CDCA 4G9FD 2R2HB 2VDMH 5I73B 2FWOB 1KG0A 3P11H 2XOTA 4M7KL 1J9CT 5TF1H 3K46A 3VFMB 2R29L 3D0LA 3L3IA 2NY6D 1J8HD 1SYSA 1I8IA 1NC4B 5HYJB 3DBXB 3O0RL 3JV4B 2YPKA 3MV7A 1MFCH 1WBYB 5HTSA 5BOZG 1A1MB 1GGCH 3EW3B 3FRUB 4XXCA 1BJ1J 3MCLL 2FHBA 4LARL 2QQKL 3FRPG 4FMKA 1YN6B 1ZLUK 4QHKJ 3BP6B 1HYRC 4GMSL 4JQIL 1CLZL 4ZMAT 4YHIB 2BSRA 4W81A 1B2WL 3NN8A 5GHWL 2JELL 3OMZA 5L88L 1ZLUH 2AJUH 7CGTA 2P43B 5TE4L 5I75C 4Y4FC 1QRND 4GRWF 1CDHA 3HS0A 1X5LA 1DFBL 3BOVA 4KQ3H 4RMWA 5DHYB 2Q76B 4LKCB 1UXWB 1UM4L 5F6HI 1S7SB 4HS8H 3D3VD 5KG9B 3ARFA 5BV7C 1E4WL 1CXKA 5IVOA 3SDXE 5GZOD 5DS8A 3K1KC 1OLLA 3MLTA 4LDOB 4PJDF 3PWLB 3NVQA 3TBSB 4HGKC 4ZUUA 1AQDA 2FZ3A 1JTPA 2AQ3A 1MY5A 3GSVB 5DJ2A 4N9GA 4S0TD 3BFOA 4U7MA 4PB0L 4V1DA 2VAAB 3DYOA 4ELKA 1NUDA 1DBML 1JGDB 5D7IF 3UBXI 5KVEH 3MRHA 4LSUL 3SKJL 5DRWB 3B8SA 4JFFA 3PGCA 25C8L 5FHBH 4XVTH 4BFBD 4OFYA 1MWAB 4QTHA 4Z7UE 2B4CH 3WNOA 1GGBL 4QRPD 4OTXH 1O7SA 4K7PY 4QKXB 2Y25A 4W70A 5IB3A 1RU9L 3U4BH 2N4IA 5F7EH 1NUNB 4Y2DB 5DTFA 2QV2A 5EOCL 2BNQD 5T1LA 3SDXB 3ZE1E 7FABL 3RVXC 1FGVH 4BSJA 1KJ2L 5CJOL 2GT9A 2D7MA 4G42A 5DWUL 3WIIL 1W0VA 4N0RA 2OK0H 1FSKC 2VQ1A 4Q0XL 1I1CA 1YYML 1FGNL 2EDTA 1DP0A 4Z78B 5TQ2H 2ORBH 2X10A 5B3JF 1RZGB 1VDGA 2BSED 2NYYD 5FCUL 3KG5A 3K2UL 2VXSL 4CNIA 1NDMB 3HLAA 4Z7UB 2V17H 2H6PA 4MJ5A 4PRBB 5KOMC 4XVSL 2R1YA 1RJZB 3SGKC 2Y06H 1T7XA 5LXGH 4MNHB 5DEZA 1I4FA 5BS0A 3NCBB 5E6ZA 3R0MA 4R8WL 1EV2E 4PRHE 3A67L 2BVOA 2PO6A 1C08B 2BZDA 2C7UB 1IAII 2X6MA 4OD3L 3O3EA 2R56H 3MA7B 4K94C 2XA8H 2ESVE 5FV2A 4LPCA 2HMID 5DD1L 3QPXH 3MO1B 5DJYA 3EYSH 1ZVYA 3JVGA 5JOEA 4DKDC 4OFIA 2BRRH 1EDQA 5DD0H 3SDCB 1I1AD 3LN9A 4JN1L 1MCLA 4MD0B 1RMFH 5E1AA 5ETUA 3NIFE 4ETQA 5C0BA 1AIFB 5C09A 1U8JA 3V5KB 1LE9B 4JY5L 1OB1A 3DV6B 2CDFB 4RA0C 4ONFL 3O8XB 5CCKL 4YHKH 4QTIL 1KACB 5I8EA 1MCPH 3Q5TA 4KTDL 4TSAH 4U6HA 4P9HC 1CDBA 5KTEH 3EYVA 3LRHA 1MHEB 3I02B 4PRHB 2FX8H 5K9KA 4KROD 1BMGA 2D4FA 4JDTH 4PJGF 4RRPG 2IG2H 3T3MF 5F6HJ 5GGVL 1S5IL 3DMMD 3MXWH 3SE8L 3GBMH 1K2DB 1CFNA 1DVFB 5E2TL 5BCAA 1AO7A 1JGUH 2ESVB 2F8OA 5LBSH 1KGCE 1ZLSL 4X6EA 4UV7L 4NRZA 2VDNL 3V0VB 5MP6H 4OLWL 1FYTD 1UA6L 3BSZH 4O58L 1K4CA 4GAGH 1HCVA 1X4YA 5E2UL 1NFIA 1SY6H 1P4IL 2X4UB 4ZS7H 3IKCA 1MSPA 3NAAH 5A2FA 3L5IA 1Q9KA 4XNUL 3OGCB 1X6LA 2R2BA 2X7LA 3I75B 2XNAA 3V4VL 5JPNB 5DJXA 3X12B 2VDKL 3HR6A 3RVTC 5JA9A 2CKBB 1FFQA 3W82A 5I16B 1MRCH 2CLVA 4J8RB 1I3GH 4XP9L 1OAKL 1L7TL 3P9LB 4GW1A 2XZQL 1INDL 1BAFL 2M8XA 4OIIH 5I8OH 1B4JH 3S37X 1J1XH 1UXSA 4G7VH 2Y5TB 5DYOA 2RB8A 2J88H 2ZKHL 4JAMB 3UBXB 1JUFA 3P40A 2MWCA 4JFPA 3U0PB 1NAMB 4X80H 2WBKA 1WBXA 3AU1B 4QRTB 3LKPA 1G7LA 2VQUA 1NMCB 4O5LH 1ZGLA 5TGBB 4PGEB 3DX8B 3VXSD 1T66C 1MLCB 2FBJL 5D2LF 1WBZA 5C0NC 4ZOBA 1R3IL 4PJ7A 1VKXA 4JR9H 2JELH 4XAKE 5D7JB 3TBWB 5L88H 2P8LB 3FKUS 1NJ9B 5E8DH 4M8QA 4YR6A 4NJAL 4MAYC 3LS5H 3H3PL 4CVUA 5D7LA 3BQUD 3G04B 5K59E 1R24B 4RGMB 1XGRB 1A14L 5CEXA 4LLQA 1S9YA 3BD4A 2OI9C 5FIEA 4GRWH 3EOBB 3O3AB 3DUHA 5GGTL 2MTPA 3RQ3A 2H9GB 1M7IA 3SDXF 2X9YA 3U7AA 3ZHLA 4N0YL 4P4KB 3O9WD 2IH1A 4XP4L 1DE4A 3STZB 3E2HB 3L1OH 3X13A 1KJVB 4LLYB 1GOFA 4PLJC 3OAYH 4QOKE 1H15B 4YC2B 1EX0A 5DZOA 3ULUH 3RTQA 2WINB 1UH4A 1CK0L 3H7BA 3MLWL 1T2XA 3U1SH 4L8BB 4ODWA 3B8YA 4F7MA 4DZ8A 2XN9D 5DQDL 5HDQH 1CCZA 1CD1B 2Q1EA 4Z7UF 3SGDH 1X9QA 5H94A 2Z92B 4HS6A 1KENL 5K9OB 1OF2A 1MIML 1P4BH 4N68A 1BX2A 1FNHA 1PSKL 3ZE1F 3EOTH 1KB5L 5I1IH 3QPQC 1JPGA 1FGNH 2HA1A 3UTZB 1EGJL 1AR2A 2VLRA 1U93A 4QOKB 3LEXB 3LRGA 5CGMA 3CDCA 1T04A 4XH2A 5A2KH 3QO1A 4UDUA 4MQSB 1AHWA 4LSPH 3OAUL 2EDQA 1KN2L 3H9HB 4MXVE 1SM3H 2FO4B 2P49B 4HUUB 3MJ7A 5I8KH 4EQ3A 2ADIB 4M6OL 5BV7H 1HSAA 4JY4A 2R15A 5HYQB 5C0IA 5JUEL 1CI5A 4JFEE 1EUUA 1TTFA 1GAFH 1H0DA 3S4SA 1IGCH 4CN6A 3ARDC 5HHXL 3X14B 1XF3A 1KN4H 4F7PB 1MVUB 5DVKA 3HNTH 3CPLA 1I3RB 4LP5A 3T04D 4QTIH 3NIFF 4KTDH 2VLMD 5IT2L 2VLKE 1JWUB 3QEQE 4RGND 4RFNC 4WI2A 4X99A 3BP4B 3OV6A 1HKFA 1MI5A 5IR1A 1KC5L 4HH9A 4UQ3B 4X7TB 1WT5A 3EFFA 1GZQB 5IQ7H 4WHTA 3KPPB 4KK5C 4NKMB 2K9UA 5E2TH 1OOAA 1F6FB 1ZLSH 1MCBA 3VFGL 3EDKA 4GXUN 2OR9L 4O58H 3BI9X 4JFEB 1UCBL 3TVMB 4DW2H 3GK8L 5IVZB 3QXTA 3VG0H 3M17B 5E2UH 1FVCA 4FOMA 2L7UA 3PDOB 5IMKB 1IKNC 2F58L 4JO4H 1KCLA 4HKJA 4U7KA 4H1LA 2VLKB 1V3KA 1PYWB 4LHUG 1QLRB 3QEQB 4RGOH 2CMRL 4PG9B 3CDFA 3AY4A 4KJWC 3UEZA 4JDZB 5KZCD 4MVBC 3G5VA 3BIAX 1K9TA 4J3SA 4XP9H 1L7TH 3H3KA 5C71A 3BW9A 4XP5H 1D6VH 5HDBF 4NM4H 4UDTB 1CE1H 4K94H 4QRRD 1MIEH 3TCLA 4ZPTA 3H9SD 2CDGA 1GRWA 5FF6B 4Y4HC 3G5YB 4FQLH 3PWJB 2A77L 3C5JA 2OYPA 1RIUL 1G0XA 4G6FD 4P2QD 1V7MH 3C09B 4I4WA 1J7VR 3FMGH 2ZKHH 4LCWE 3W9EB 3EJYC 3F7PC 2YK1H 5ISZD 3WHE1 3N50A 4NO3B 2ZP0T 4Z6AT 4K8RD 1JZ3A 3GFUA 2J5LB 4D3CH 3CJJA 5FKPB 3TNMA 1PLGL 3HZKA 5D93C 2UYLA 4U1JB 3EOAA 5D6CB 3AMLA 4P9HH 5DUBB 3K4DA 1DLHA 3RDTA 5I1HL 1R3IH 4O2EB 1K85A 4QHLB 3WJJA 3SDDD 3QNXB 5SWZD 4JKPH 2F19H 2J4WH 4XNZC 1HXMB 2J12B 4NJAH 2LU3A 4G5ZL 3BO8B 4NOFA 2JCCE 1JNJA 1H3GA 5C7XH 2EEBA 2EDBA 1RIVH 5JW4M 5IFJB 1F4HA 3MNWA 5GIRB 5HY9A 4B7IA 3ZHDA 4MJIA 4AEHL 4LCWB 2APWA 4NHUB 1RVFL 4WY7H 2HLAB 2ZCHL 4KJQD 1RHHB 1YYLL 4NQEA 1AXIB 2HFGH 5HHPA 2NY0D 3KLAB 4HUVA 3G08B 4Y5VB 3HE7A 5GJTL 4NO2A 1T6VN 1MCEA 3MLRL 2UY7A 1ZA3B 3C6LB 5CWSB 1MNUL 4J6RH 4HKXA 3PWPA 1NBVL 3KYMB 3PABA 1WWBX 4UOJA 5CJXC 2JCCB 2F53A 4R7NA 5DEFB 4G8IB 5FUCE 3C9NA 3DLQR 4P3DA 1IGJA 2WQ8A 5H8DA 3N1QC 3QCUL 3NIDE 5EZJA 1KTDA 5D1QC 3QP3A 3FN0L 1CL7L 4OFVA 4KK9D 5CLTA 4GKNA 4APQC 4XBPB 4F9PA 3GKWH 1MIMH 1GYAA 3IJSB 2AXHA 2DWEB 3RVUD 4ZFFA 1JI1A 2Q8AH 5HJ3A 5DRXB 4WWKD 3T0ED 5CINH 4M1GH 3PWUB 4S1DC 3OHXB 3PHSA 4U6XB 2H32B 4V2BA 1JPST 2VWEE 4YHMH 3BZ4A 4PUBL 4CAGA 2R9HD 4OQTA 2ICWB 5D71L 2YN5A 3HI1A 4ERSL 3RIAF 3E0GA 1AXTL 3QRFM 1E6OL 3AC0A 2LU7A 3QO0B 4P2OC 4HWBL 1E4XH 4HKBB 1KN2H 1AXSA 2XWJA 3TO4B 2E9JA 1CXHA 5F7UA 1OPGL 1YNTB 5DUML 4ZXBC 2AK1L 3T1FB 1KCVL 3G6JA 3QYCA 3WLBA 4LSTH 2EKJA 2XZAH 3O6KL 4YHYB 4DGVL 1MJ7L 3TZVA 4Z7WF 3MRFB 2K7PA 1IAKB 1EO7A 3P9MB 4YPJA 5DK0A 2HVKB 3MRRB 3GJFA 3D9AH 3ARED 3LY6A 4WUUD 4HT1H 4CW1A 4ODHH 2OM5A 3KS0J 3CX5J 2YPVH 3BJLA 5FM8A 4FQJL 4HIEA 5FB8B 1NMAL 1WV7T 4HUWA 4MSWA 3NZ8B 3PV7A 1Q9LA 4XP1L 2WK2A 1YEDA 2E7CA 3C60D 5B38A 3INUH 1B4RA 1KLUB 2P5ED 4KVNL 1QSEE 4KK6D 1KC5H 5T1KB 2F74A 4XPHL 2DOCA 3MLVL 4I0PB 4XNQB 2BNRE 4KQ4L 5ALBL 4OSUH 1QOKA 2GJJA 2RBLA 3RWIB 4Y5YA 3T77A 4LLDB 4GAJL 2UZYB 1I7ZB 4L4TE 4FA8A 2OR9H 3DXAD 1N64L 3ECBA 3GK8H 2AS5M 4WW2B 1MCNA 5EU7E 4YXKL 1CE6A 3V5DA 1U58A 5K9JL 4U3CA 5J6HA 3DPBA 1FE8L 4JVWA 2V9QA 5C0DA 1G7HB 2BY2A 4HCRH 5C08D 4K7PH 3LS4H 4WUKH 2CMRH 1QSEB 3GIZH 1FL5B 3MRIB 4JM2A 3HE6C 5E4IA 3HUJF 1M4KA 2BNRB 3WFCH 5LGHH 3PJSA 1HXYA 3GMMB 2F54D 4Y16A 5EO1B 3IDMB 1FJ1A 1XCTA 3UCRA 3Q1SH 2AJYH 3ZYOA 1B0RA 1S9VA 4L4TB 4IRSD 1RIHL 1IQDA 1MELA 5FDYA 5D70H 1CTOA 4MCZA 4PB9H 4WI3A 3IF1A 2NX5E 3NA9L 1TETH 3HR5A 2ZUVA 3N1PC 3OR7A 3T8XB 4IIQB 3PWNB 2I9LB 5CMAB 1UJ3A 1ONQB 4OUOA 1XZ0A 2OJEA 3GMQB 1EFXD 3SDAD 1EO8L 3NPSB 2AJSL 2YD1A 1JGLL 5F1IB 3VH8B 5FK9B 4AM0A 5HD8C 3LN5A 5FA3A 4Z76A 3CFBB 2V2WA 1U3HB 1SBSH 2JB6B 4H88L 5F1NA 4HV8A 4M6ML 3GSRA 4G5ZH 1A7QL 4BELD 3CVHH 5T3XE 3WHXA 1T5WA 1KCUH 3GMPB 1R5VA 1WIOA 1Q94A 1A02N 4NWTL 5D9SA 4NKQB 4ACPA 5DC4B 5SV4A 3FQXA 2DI9A 2JCCF 3LZFL 1C5CL 2NX5B 1U8IA 4R9HA 3OWEA 4AEHH 3TNNB 4XNXH 1V7NL 4MQ7B 2Z91A 4K8RL 5DMJB 4MWFA 4X4XA 4LNRA 2KKQA 5DC0A 2Q6WB 4KUCD 4YEFA 4XAWH 4I48B 2HVJA 2MHAB 4DN3H 1E6JH 5BVJA 4YWGL 5DLML 3GSNL 4I0PC 5HHQA 2NMSA 1D5ZB 3RVWD 1MNUH 5DI8B 5FO9A 3TP4A 1S7WB 4G9DB 1G7JA 5GS1B 5D8JL 3SKNA 1CGSL 1Z0NA 1A7OL 3GMNA 5D1XD 3TV3H 3KYKL 5KSVB 5E8OA 4G8GD 4G8EB 1EHLH 3S5LG 4GW4A 4L9LB 1CL7H 3MPCA 2E7LC 1T03H 3MOBH 1MCIA 1J86A 1LK3H 3F65A 4JGUA 1BECA 3HTLX 2E7HA 2M26A 5L7XH 5FOBB 2DQIH 2AJXH 3RBGA 1OTSC 4OLXH 3QEUA 4HH8A 2X4PB 5FFLA 4HIXH 3S5LB 3T2PA 4DZBB 5EU3B 5F7DB 1BLNB 2GAZA 2AK4E 3RWGA 4UT7L 4P46B 4HZLA 4PGCA 4JGMA 4BQCA 3QI9A 3Q6FB 4ERSH 1K6QH 3QAZB 3Q6GL 4AT6A 4U1LA 2R0WL 1I1YB 5CJBA 3GMOB 4XMPH 2A2QT 3I2CL 1KCVH 3HA0A 3RI5K 3VXTA 3QFJE 4ODTL 5CKGA 5F3BA 3S35L 4WFGD 1DEEB 3DUSB 2VH5L 1S9KC 1FP5A 1A6AA 3PGFL 3LIZL 4QXWA 5DD5L 4YBLB 4MZ2A 1GOHA 3CFEA 3CK0H 3TBVA 4P5TC 1CZ8H 1T0PB 3IDGB 3ARBA 3FQRB 4BZ2H 3VXPB 2AK4B 2EECA 1CG9A 2IFFL 4CMHB 5CILH 4XP1H 3QIBC 4Y0GA 1F3RB 3WE6A 2VDPL 5JORB 3KPSA 2VL5A 4PJ9B 5DMKA 1FVEB 4OZFA 1MHCA 3CFIC 1CVSC 4XPHH 2Z31B 1XGPB 5FYLD 1V05A 4R4NC 3QFJB 3JBG7 4UILL 2BHYA 4CDGC 1JRHH 5GGQL 2B0SH 3EDEA 3MV8D 4KKAC 1KB9K 4N8PA 3T65A 3QNYB 4ISVB 5CIPB 1J1OL 1AKJD 4K71C 1RSFA 5J1TC 4JRXD 3UMTA 3S4SG 1HNGA 1N64H 1DUZB 1GH7A 2J7LA 4PR5A 3OJVC 1CFQB 5K9JH 4BK4A 4QGTA 2FJFB 2ED9A 4HX1B 3MRGA 4TN9A 4QRQA 3T3PF 1RV6X 2NZIA 4PIRF 4YH6A 5JLZA 4D9LH 3IDJA 3PHQA 1WEJL 3ZE2E 3QUZB 4U6TA 5EOTB 4CU6A 1YPZE 4JFXA 3V7AE 2MKWA 4MJ6B 4JQXA 2W60A 2X4NB 5FM4A 2YKLL 1MFEL 1F2XK 1ZEAH 4DGIH 1P84J 3FOMB 5EO9A 4LGRB 2IAND 4QF1A 4R96A 4LBEA 1BZ9B 4K3EH 3NABL 4MS8C 4FXGA 4F7CA 3VWKA 5HXMA 4Y4KC 4I13B 3V7AG 2NY4D 3NA9H 2JB5L 1DQQA 5LVEA 2AW2A 4TOYL 5IROA 1GVIA 4PJAA 4HF5L 5IB1B 4GKZB 2DM3A 2BC4B 4NN6B 1DBKL 5B21A 5TE6H 1X4XA 2OJZL 4K3DH 4NZJA 4JG0H 5DD6B 1EHXA 5CAYB 4XX1E 3RIFF 1CTNA 5FYKD 1YPZB 2YS4A 4IEFB 2E7BA 1A3LL 3SY0B 3QEHB 2R8SL 2MKLC 4YHOL 1S7UA 1A7QH 5J12C 1ZOXA 1R3KB 3FAWA 4J7RA 2EYRA 4L8DA 3O4LE 4XX1G 3DJ9A 4M1DL 1XF2A 1IGFL 3DRTA 2PXYC 5T5NF 2YC1B 1NC2D 1Y6MR 1F3DJ 4RNRB 3UTQA 3FHAA 2VUYA 1KPUB 4B53A 3MLUH 1FG2A 1RZJC 4FXLA 3GSNH 1J0HA 4XPAH 4YBHA 4Y7MA 4X5WB 1TVHB 5EU4B 2X4RB 5L2KA 2CH8A 1ES0A 5TE7L 4LRIA 4PGJA 3FT2A 2FRGP 1CGSH 4ZG1A 1WCBA 3O81A 1UH2A 4LPXA 1L7IL 4OUUA 1BD2E 4PJBE 2YPLE 4X9IA 4XCYB 3O4LB 3SO3C 1NL0L 4RZCA 3VMOA 2ZNWA 2DLHA 1M6OA 3TN0C 5T1DL 4F2MA 5E94B 2DKMA 4LQ1A 4LGSB 3RPIA 5F6IB 4PJEA 3FFDA 4M6AA 3DTXB 1SJEA 3FHQA 1U3JA 4FQ2L 3W11D 3UROR 4D0CB 1IAOA 2CXKA 3K80A 1NC4D 4GBXC 5HYJD 3X3FL 1KJ2A 1NFDE 1DANT 4BKLB 3JWNC 5JPMA 5E00A 4IRZH 4U1IB 3FQWA 2EIBA 5CJQH 2NR6C 3OZ9H 1N5AB 3MRNA 4I3GA 3MZGB 4H0IA 1Y6KR 1MHHB 1QQDA 1D9KC 4BSVA 4UBDD 3P0GB 1NCNA 1BD2B 4PJBB 2V2TA 2YPLB 2QSCL 1D6EB 4OKDA 2HFEA 4BZYA 1DQLH 4KJPC 4ALAH 5FDWB 4X0KA 1ED3B 4UMGA 4HULB 1JTTA 2XTLA 4ODTH 4Z8FL 1NLBH 1EA9C 4XBGA 1T1XA 3MODH 1HHHB 4HUXB 5DD5H 3MR9B 5DFVD 4F9LA 1A0QH 4Z7VA 1P1ZB 3P77A 5DJCB 1NFDB 4P3CH 3SDYH 5AZEH 5HHOA 1NBZA 2FJHB 4J1UA 3H9ZA 1JP5A 4PJFE 5BZWB 4N8VB 1R3HA 2ADFH 3WIFB 3KPNA 3QJHA 4IBLT 1G7QA 2IQ9L 4H25A 5H35A 3EO0A 4MCYB 1M71B 3LPWA 1HQ4A 2P7TA 1TQCC 5MEOB 5IKCB 4L8CB 4RMRA 5EO0B 1LK2B 4OGYL 2APBA 4UB0L 2ERJB 4JFDE 4G6KL 1U2CA 1OQXA 4Y2DD 2IPUK 1OHQA 2LV4A 3D2UB 2OQJA 3LH2L 3SGEI 4NN7B 4LFHG 2A9ML 4F37F 4OF0A 1YEGH 4IM8A 2OBGA 3NGBB 2JJSA 2EZ0C 3WFDL 1I9RL 3IETA 3QQ3A 4PJFB 1A6ZB 3GMLA 1FFOA 5B38G 3LPGA 4LCIL 1IM9B 3G6AA 1GGIL 3AXLB 2VDQH 5EB9A 1TZGH 5J56B 1MCJA 1DQTA 2Y4SA 5FYLL 2YBRA 5AD0B 1EXUB 4O2FA 1YJDL 2X41A 1D5XA 2DD8H 3H0TA 3BIKB 2ZUUA 3S3SA 3TA3C 3ZE2F 1F90L 1ND0A 1MLBA 1YPZF 1OAXL 4DKFH 5D72H 3TM6A 1QBMH 4JFDB 5IV2A 4IDLA 3C6SB 1U8PA 3MBEA 1OSZB 3SQBA 3RY4A 3DVNB 4M4RA 4QNPF 2J8HA 1HEZA 4ZNEE 2AXFB 1HHGB 2XKUA 3CGTA 3VXRA 5GRXG 2YN3A 4PLNC 4ZYKA 4FQCH 3ULSA 3BEWA 1DBKH 4OCWH 3VWJA 3DX6B 5AYUH 4M03A 1CICB 3ZT6A 3SDCD 3P4NB 4QYOA 4NT6A 3BGFC 1S3KH 1JIBA 1T0NA 5F3HA 4XGZB 2O5XH 4R2GC 3AB0C 4AIOA 3MBXH 5LQBL 3O8XD 2VITB 1HSBA 1KV3A 4ODUA 5JIPA 4ODSH 3DETC 3KWWB 4FNLL 4RWYH 4KY1L 4JPWH 2YEZB 3QIWB 4G9FA 3PDDA 2GK0A 4ZODA 1A6VH 4CVXB 1VEPA 5I1LB 4K9EC 4PRHD 5F93C 5HGHA 1BF8A 4TSCH 3KLHD 2GJZA 4HJ0D 1P7QB 1CXLA 1KLGB 2AQ2A 3W2DH 4DQOH 1J8HA 2UUDK 1U8QA 1R5IB 2ESVD 4TVPE 3SJVA 4OZGA 1KEGH 4JO1L 5E6IC 2EDYA 1O7VA 5GGTA 3GO1H 1BHGA 3ZKQD 2UUDH 3VFOB 3IVKA 3TFKC 2C9AA 2X9XA 1UKTA 5FYKL 1IGTA 1RURH 4MA3B 2GSGA 5C0AE 2F9BT 1DLFH 1GGTA 1FL3A 3B9AA 4PY7B 1KIPA 2HN7B 2F5AH 4JFOB 2OR8A 5C0EB 4M48L 3ARQA 4FFYL 4JJ5B 3QIUB 1YQ2A 2Y72A 5DR5L 2GTZB 4WFHE 1FZJA 4M02A 1QRNA 4LLVB 1NBYB 3KDMB 2GITA 1VGKA 3P4OB 4E0RB 3BWAA 2ZUXA 1LVEA 3BN9D 2D9CA 2LU4A 2ADJA 1YECL 3ULVC 2KDGA 3B9KB 4JHZA 3D3VA 5GGUB 3WFHA 1KGCD 1UZ8A 5CZVL 1RZKC 3CSBA 3MUGB 2UWEE 5EDXA 2PW1B 4KV5E 1TPXB 1A22B 3TGXA 2AKRA 1F2QA 2OZ4L 2J3SA 1YNKL 2VNCA 4BUGA 1JWSA 3O4OB 3TYGL 5C0AB 2HFTA 4S1QH 1KB5A 1AD9A 4OLVL 4BQ6A 4FRWA 1OSPH 3TT3L 1JZ8A 3VG9B 1NFDF 4JZJC 5DMIL 3UJJL 3MRDA 1BZ7B 1IVLA 5DGQA 3UTPE 2R1WA 1MHPH 3QUXC 2QKIA 2QSCH 3VGDA 5DDHA 4NKDA 1TZIA 4QRPA 4NC1E 3RGVB 1LQSR 4Z8FH 5D7JD 4X4YA 5JR1L 5EBWB 5DJ6A 1N5YH 2BNQA 5ENWA 2VQTA 3SBWC 4FZ8H 2UWEB 5H37G 4RBPH 3T2OA 3VJ6A 1IT9L 1I1RA 3UJTH 4RFEA 1NCWL 1A2YA 3IFNH 1VHPA 3REVB 1E4KA 3MJ9L 1JNHB 1RZJH 5LCVH 4Z7NE 4YDVB 3EJJX 5E2JA 3TH2T 5JXAL 5I1CH 4ELMA 4P4KD 3FO9A 6FABH 3KHOA 3ULVF 4MNGE 2VMFA 1S7VA 3RPKA 4EI6B 3NTCH 3U83A 3BPCA 1AE6H 1F00I 4PJFF 2Y36L 4XAKD 2X4QB 1FNEA 3MUZ1 1JE6A 3O2DH 5DQJA 1GPOH 1WISA 3LB6D 2X5PA 5F1OB 4ZFOB 3SE4C 4LSQL 2HRPL 3VFNB 1HILA 1M7DA 1RZIA 3LH2H 3P0YL 3L7EB 4KJWD 3RWDA 2FNBA 2FSEB 1Q0YH 2AJ3A 1I1AA 1AJ7L 4U6YA 1M05A 1I9RH 3U30B 3BJ91 1Q38A 2BJMH 4K7PX 3LKNB 3L5WA 5E9DA 4MNGB 1YDPB 2AV1B 2HT4C 4FQXC 1JHLH 1W72B 4KAQL 4X6BB 3MUY1 4QOKD 5CBEB 1MWAL 4KRPB 4M4PA 1JZ2A 1KPRB 2G5BB 4IS6B 2GK2A 1AGCB 5INCA 2K7QA 5J3HC 5JOFB 3W5NA 2CIKA 5AWNL 1IC4L 2HFFA 3B43A 3L95A 3SKOB 4P23C 5JQ6L 2ZZUT 1Z6JT 1FYTA 2H45A 2O5ZL 1XGQB 3B2UC 2R4SH 2MCG1 3WS3B 1XGYH 2BMKA 4RFOL 2PKDA 4YO0B 5D7KE 3TO2A 3MUJA 5E4EB 4XI5D 1HDMB 4RIRB 3T0DA 1LEGA 5ID1A 1LEKA 3TH4T 5CD3B 5DUPL 3J8F7 4Y19D 5B8CB 1XIWB 4O02H 2HJLA 5D5ME 5GJSL 5I0DA 4U6VH 2XYCA 2RFXB 1YQVL 3QNZB 3FT4A 3BPNB 1BFSA 1Q0XH 3PL6B 3EO1A 1AGDA 2ZSWB 1KTKE 15C8L 2WBJC 1QFHA 4U1HB 4NNXA 2GKIA 3O41B 4UAOC 1AI1L 2NY3C 5DRZA 1IC5L 1UM5H 2R4RH 1OGTB 1HHIA 3TC9A 1NGPL 5EC1A 5MERB 1TFHA 2DIAA 5I17B 3TESA 5IQ9B 4HUNB 2XWTB 1EUTA 4JFED 4YXHH 3VMPA 2CUIA 4MB4A 4HHAA 2UZIL 3IB4A 5J9PB 4LSVH 4X4ME 5DVOA 5D5MB 3OJMB 2A73A 4J3UA 2JIXA 4NQDA 4P99A 2HWZH 3M45A 4FFYH 4PYGA 1KCRL 1W0WB 1VFBB 2OX5A 1WFTA 1BP3B 4KGJA 4YBQD 4A6YH 3QEQD 4M3KB 3IAQA 5GS0D 2B39A 1EO5A 3BQUA 4HC1H 4NKOA 1VACA 2ADGB 3JWOL 4TNWK 4LSRH 3DVIA 4KJYB 3U7YH 9CGTA 3NPZB 5IFAH 3W9DA 2BERA 5J1AB 3ZTNH 4MQTB 4C58B 5IHZA 4RMQA 4YAQA 4OCXL 4KV5F 3O9WA 3QHFH 4ZXBD 1HIMH 4I3SL 4XCCH 3UJJH 4XPGH 3CU7A 3HNSL 3FB7A 3ARPA 4G7YL 2HKFH 4IMLB 4PJCE 1I7UA 4IRJB 4ZAKB 4ZTPH 1R3LA 1CLOL 4XXDA 2CKBL 1IARB 2A0LC 3ZHKA 3MRPA 3WN5C 4K9EH 3V4PH 3GHBL 3BPLB 4GLRH 4YQXH 1MFBH 4EUPG 1AD0A 3UTTE 1FPTH 3VFUB 1TIUA 2YD5A 1BBJA 3IJYB 1IFHL 4PG2C 5DJ0A 1IJ9A 4P5MA 5FA4B 1K5NA 4YE4L 1EMTH 3BUYA 1GSMA 1U8NA 3QISA 3ZZ1A 2XWBB 3MJ9H 4H5SB 4U2YA 5IBUG 4XVJH 4KKLC 4LCWD 5D96B 5GGRA 4LQFL 5FGSA 1NAML 2KQMA 3Q3GA 4JFYB 4HG4J 5JXAH 5I8CB 1JNLH 4FXKA 2ZOLA 4W68A 5IG7B 1LD9B 1T22B 2M2DA 3QCTL 3GIVB 1YEHH 4UT9L 8FABB 1IL1B 4MJ4A 4Z7NF 3Q48A 4PJCB 3SQOL 1HWGB 4PRNA 4WW1B 3C6LD 3LV3B 1BGXL 1JZ5A 3QUMH 5IBUB 4H26A 2CR6A 3EOYG 1ZVSB 5BXFA 1QZ1A 3LKRA 3UTTB 4RQQB 1NGWB 2GTWB 3BT2L 2HRPH 4UZGA 1LHZA 4XVUC 4KKCD 4NOBA 2HTLC 2Q8BL 5I1DB 1VADB 3MROB 5ACZA 4HUMB 4CMMA 1FRGH 3LN4B 4GMTH 3SPVA 3MYJB 4PJ8C 2JKXA 5C9KA 1BVLB 1OAUL 4NQSA 3LQZB 4RMVA 1UB6B 5ALCH 4QHUA 1UWXK 3MJ6A 3JTSB 4IOFC 3K1DA 1G7PA 4R26L 2GQHA 2QQLH 2D0FA 1AC0A 4KAQH 3QG7L 3V95A 2X44D 4I5BB 3QQNA 4O2CA 1FIEA 4Y5XB 4NQCE 1T83C 3GHEL 3F7QA 4N0UA 2AJZA 2R2EA 5IM7A 3O6FC 4G6ML 1UKSA 5FUOH 3WKNA 4NUJA 4HIHB 4R7DB 2BNUB 3TO4D 4GKSB 4N1CA 4WCYH 3KJ4B 3T4YA 4HLZH 1PD6A 3NH7L 1P9MC 5L6YH 4QCIA 4LVNC 2JLLA 1L9NA 4RFOH 2BHZA 1X5IA 2PTTA 2WWMD 3QDJD 4LKXB 1Q1JH 1FO0H 5EOQL 2Y07L 1I85C 3BAEH 3QZWA 4XCFL 4DTGH 1NCAH 4Q6IC 3WO3B 4PLOB 3ZKMC 1MRDL 4PJ5E 2IH3B 2X4TA 5I2IB 1I7RB 4LLUB 4KTYA 4D0BA 4NQCB 5ESVA 4GAYB 1I8MA 4HWEH 4HKZA 3OR6B 5D5MF 5I76A 1RAMA 1H5BA 4CGTA 5T1KD 1X5YA 3RL2B 5I6XB 4OD2B 1IKFL 3VFSA 4EI5B 4QRRA 1I75A 1P2CB 4L3AA 4I0PD 3H9SA 3VD7A 1T1YA 4N9GB 1NGPH 1JV5B 1E27B 4RAVB 3WFEH 4P2QA 1CT8B 4L3CA 4RWHA 3QWQB 5FGCE 5ISZA 5A40E 3BYYA 2XV6B 1PQZB 1ZS8A 2R69H 3DIFA 3BVNB 1JPSL 2G9HA 5HYIA 4PJ5B 1DQJA 3I6GB 4LMQI 3BKML 1I7TB 4KGLA 4HD9A 3GSNA 1DBAL 3SDDA 1KSRA 4W6YB 1WWWX 1YN7A 2DTMH 2P5WA 5SWZA 1ZLVK 2O5YL 4JE4B 4BQ8A 1QSED 5EA0H 3UP1A 3OKMA 5ESQA 5C07E 1U0QA 3PHOB 3OKNB 3T2NL 4JN2B 3V6OC 3VGAB 2EH7H 1DANU 3U9PL 2NW2A 2BNRD 3KPTA 4I9WE 4WDIA 1NH6A 2XFXA 2C4FT 1WZLA 2O26U 2IALA 5TDPA 3MJGX 1T89C 4X6CE 1BZQK 2VABA 1X7QB 1D5BA 5FGCB 4NRXB 4YXLH 2Y7QB 3ET9F 2A1WL 1C5DB 2NY6B 4PP1C 4U0RC 1NMBL 5E2VH 4DEPC 32C2A 3SGJA 2VXTL 2FYYB 1A7PL 1Y0LB 5GS0L 2FR4B 4XXCC 5C07B 2VDRH 3GSQA 2CKBH 4P5TD 4OM0L 2NY2C 3GSOA 4JDVA 3FB5A 1QLFB 2I60H 3U0TA 2Z4QA 4OF8A 4F7TA 4X6CB 1KPVB 1NDGA 1IFHH 3QIBD 5IEKA 4C56D 2YWZA 5DQ9A 2NX5D 1A7NL 3JUYA 4WWKA 3JV6A 3T0EA 2E27L 4NRYB 3RBSA 5C0JA 1BM3H 3ARUA 2VZ3A 5EU5B 2ITCA 3VFRA 3WL9A 2H1PL 3MGTA 3BH8B 1X44A 1UM6H 3TYFA 4S2SB 4EBQL 2H26B 1P7KB 3ARFC 3N85H 3HG1D 3QCTH 5EBMA 4W4OA 2OMNA 4DVBA 4KK8C 2BY3A 1FDLH 3MACH 1INQA 4TQEL 2EYSA 3BZEA 5H2BA 3KPOA 4EJ1C 3TWCH 1PDKA 5ANMA 3OXSA 1BGXH 4KI5C 1QO3B 4F33A 5DJZB 3ARZA 3E3QC 5C86A 1GXEA 2DQDL 2YRLA 5T3XD 1HQRB 2PW2B 1IZKA 1LWRA 1Z9OA 3O3BA 1DDHB 5I1GL 3KLDA 4P59H 2VZOA 2Q8BH 5TDNB 5DD3H 5EORL 1IEAA 4YHLH 5EC2A 3RKPA 1XGTB 2G75B 1OTTC 3KNBB 3AREA 1T4KB 4WUUA 3OG6B 1HOCB 4OAWA 6CGTA 4C57C 4PJXA 4H8WC 4LMQE 3DRQB 4P0DA 4PJ7E 3GBNL 2KH2B 2VYRE 4JREB 3VD3A 5IW1B 1ZMYA 3HC0B 2NY5L 3T0XA 3C60A 1X6NA 4A2MA 2P5EA 4P46D 2AGJL 2VDLH 5BVPH 1T1WA 4PV8B 4YHZH 1LNUB 2DBLL 5HI5D 3TIDA 1EHAA 1QG3A 4NQVB 2FGZA 1GIGH 1YEJL 3V79C 4PGZA 4TUKL 3GEWB 2W9LA 5I9QB 3ZKXB 5C0CD 1TJHL 2MCPH 1ZHKA 2DN7A 5ACLA 1NGYA 1P6AB 4AG4L 3CUPB 5DO2C 2QL1A 5JDSA 2PO6C 1IGML 4KI5F 3JXAA 4PJ7B 3VRIA 3HCVB 3L3KA 2PTVA 2W9DH 1K8DB 4ESKA 3JVGC 2AK4D 5HYSB 3HI6L 1UEYA 3B5TA 3TH3T 4DVRL 4U1MB 2AEPL 3DSFH 2VO5A 3ZTJG 2B1HH 2A6DB 3ARGA 2EDLA 3G5XB 3ZYJA 3JZ7A 2Z31D 4KRMB 5DK2B 2DQJH 3QFJD 3U48A 3PE9A 4APQB 3IDNA 1XR8A 2A9NL 3PXHA 3L3GA 1X5ZA 5DC9B 4KROB 3ALWA 1AFVH 1EEYA 1DQML 2EO1A 3DMMB 4OGXL 3RNQB 3X13B 4TVSa 2D03H 4NQXA 5LWYL 2D31A 1JPSH 4LVHB 4WU7B 3VDAA 1EFXA 3SDAA 4OCSH 2YXFA 4UINH 4AIZA 4Z7OE 3WO4B 1K4DB 3GB7B 1DBAH 1CF8L 4R4BB 4AMKL 4UTBH 2NTFB 1PZ5A 4OI9A 1GZPB 3QEGL 3GUTB 1HK6A 3CCHB 5BO1H 2CK0H 4OZHA 2OL3H 2WP3O 3T2NH 3QUZD 4DKEL 4XHJC 1FZOB 1UACH 1QNZH 4DFIA 3RHWF 5HPMB 3VXSE 5DRNA 5IMMB 3BDBA 3OXRA 4ODBD 3L5JA 1JPGB 2G2RB 4LIQE 5AUMA 5ID0A 4GW5B 4GRLB 1D9KD 1VFAA 4FMFA 3IDYB 5IB5A 1OL0A 1U36A 3BEVA 5FCSH 4ZSOA 4X6CF 5BQ7A 2DMCA 5IHUH 4P9ML 3QFDB 5E08L 2AI0H 1T04B 2PYEA 4W6WB 2V7HA 3I6KB 3FB6B 3KPRA 4RSVA 1KIQA 1KLFA 1SVZA 3Q2CA 3LHPL 3VFTB 3IFLH 2VIRA 3EHBD 3UYPA 5DXWA 5SWSE 5GS0H 4FFZL 5EZIL 1G6RB 4M93B 3UZQA 5HHVL 3U4EB 1A3QA 4JY6A 1TMCB 5D1XA 4WU5A 1S5HB 1R3JA 3VXME 3LRSA 1HH6B 1RZ8B 3QDHA 3VXSB 5KVGH 1T2QL 2XTJC 3QA3B 4FQ1L 3WEXA 5GRWA 2ARJB 3IXAA 1IGYB 1NAKH 4CUCA 1N4XL 5F9AC 4X5XB 4KFZC 4TTDC 5EBGA 3VCLB 3DSNA 1G7IA 5IK3A 5D1ZB 4NNPL 1TQBB 1JF1B 2ICEB 5C6TL 5IGXL 2GCYA 4AEEA 4JM4L 3C5ZB 4OLUL 1ITCA 5IR1B 4JKKA 1QACA 5SWSB 2AV7B 3L9RA 4D0DB 5ICXA 4LDLB 3S7GA 3RUGE 3RWFB 1GC1C 3EJZC 3VXMB 4U33A 5J11B 2BCKA 4DUWA 5DEGB 1ZT7B 1TZHB 3F7VB 4EDWH 4YGAB 2EZ0D 2DQHH 3O4LD 3O2DA 4LVHC 3RTQC 4M5YL 1V8HA 2AAVA 4M7ZC 5GRYA 4PRIA 1DSFL 2GUOB 5C0GA 4CJ0A 5JO5A 3MNVB 1DBJH 5ITFB 5I15L 5IIEA 4WV1A 1ZANH 1ETZA 3ALXA 3QQ4B 4C4KO 4HPYL 4QRSB 3TA3D 1AQKL 4YDLB 1TITA 4F58H 3NCJH 4NGHL 2LTQC 1XH3B 2C3HA 2NY5H 3T09A 3RUGB 5CEZE 2DRUA 3BH9A 1ZHBB 5F88A 4L3EE 1QSVA 1IEHA 4PJ7F 2DYPD 3U36A 2IQAA 4G8FB 3IGAA 5T3XL 1MAMH 3WSQL 3DNKA 4HXBH 4I18A 4NCC2 4F8TA 4TUJB 3L3JB 3ZE0E 1QA9A 2YPLD 1XT5A 1QSFA 4PV9A 1QBLH 4LLMB 4UQ2A 3SKMB 4MJIE 4OCYH 3IDXL 2H3NB 2VLME 3MV8A 4KMTL 3T0AA 1RUML 1EAPA 1AKJA 1AHWC 3MRKB 4PJDA 1JHTA 4JRXA 3LVEA 2E6PA 3H2WA 1FLRH 4MDJB 4M5ZH 2MFNA 4OF5A 5C2BL 3V6FA 1BOGA 4OM1H 5HVHB 4AY0A 1DLHB 3MRQB 2H32H 5HHME 3KYOA 5FEBA 1EVUA 4UT6L 1L6XA 5BJTB 4L3EB 3HI6H 3DGCR 4RMSA 1R0AL 2MQ3A 35C8H 5IB4A 5DHXB 3UAJD 5IB2A 4OGAC 2A6IB 5FUZH 1KBGL 3KR3L 5DT1L 3TFKD 5CSBA 4BSWA 3QQ9C 2QR0B 1I9IL 1YMMD 5A3ID 2JK5A 5ACMA 2W0PA 4MA7H 4MQXC 4PRAB 4IMKA 1C1EH 3EDJA 3WHE0 1KUMA 1WT5C 5HVWA 4NBXB 1DQMH 5FKAA 1YUHB 1U8MA 3QZWG 5CZXC 1BBDL 3AAZA 3CH1A 5HHMB 2DWDA 4LSDA 3CZJA 1JYXA 3DX7A 5KANI 2CRYA 2FB4H 2QTEA 4HK0B 4K2UH 4LPUA 3ULVD 4PGDB 4C4KT 3REWB 2BSTA 4KKBC 2WIMA 1IM9D 4Z7OF 2K3TA 3GI9H 1KJ3L 5FO8B 4DKEH 3FO2A 3TT1H 3ABZA 4WO4B 3V7MA 1J0JA 4LVOC 5E56A 4L8SB 3T0BA 2JJTA 5CD5C 1NCCL 2AEIT 3HC4L 3AY4C 5FYJU 3O6LH 1A9EA 1A3RL 1NC2A 4CVZA 3H7LA 3FQTB 3HMWH 3RNKB 3HMXL 1A1OA 3BHBB 4P9MH 1WC7A 2N7AA 2C4XA 1F3JA 5CSZA 4YHPB 3EUUA 4FQQB 2OZ4A 2HKHH 4YDIH 1D5IH 3AS3A 1QYGL 2GSIA 3RU8H 1QFOA 1CICD 1S9WB 1SBBA 5I18L 3TPUB 2PCPA 1Q9WA 3OKLA 4QY8B 4YX2L 5T33L 4FG6C 4HWNA 5EUOA 5F7YC 3D5OF 1NEUA 3V4UL 2DQUL 4MA1B 1N8ZB 1XF5A 2ZUSA 1NSNL 4ONHA 3RJDA 2XRAL 3FB8B 4HPOL 3NFNB 3RDTC 1JPTH 2HJKB 3QIWD 3WJJC 2ZNXA 2R2HA 1VA9A 1N4XH 2P24B 1I8KB 2FWOA 4HXAL 3O2WL 2X9WA 1CDJA 3VFMA 5CS7A 1P7QD 1RUKH 1KEMH 3HRZB 4KU1A 1BQHG 1NC4A 5HYJA 3DBXA 3JV4A 3FN9A 1J0ZA 4PJHE 2ED8A 1QFUL 1FZKB 3H42L 1A1MA 3MJ9A 2R1XB 3MRCB 3LEYL 4I3RL 1YZZA 1YN6A 1JF5A 3CC5B 4M61B 1JBJA 1U8KB 3QULB 1BQHB 3U7WH 4YHIA 5INDB 3WUZA 3HE7C 3RUGF 3QIUD 4GQ9H 1IQWL 4DGYH 2CGRL 3QUMA 5KSAB 4NFBA 3EZ8A 3RIFK 1CE6B 4M5YH 4Z7QE 3WFBL 1J05B 1FFRA 3A6OA 3BKYL 5DHYA 2HT4D 2Q76A 3FRPA 1SQ2N 4M62L 4F15B 4LKCA 2FHCA 1UXWA 1JI2A 1RUPL 3B9KD 5I15H 4U1GC 1S7SA 5KG9A 1Z9MA 4TVPD 4KI1A 3GSXA 3LQMA 2XIDA 4PJHB 3BWUC 3PWLA 3LSOB 3TBSA 5DMGC 4L1HA 4F9PC 5J3HD 4YZFE 1K3IA 3SE9L 1OVZA 3F58H 3GSVA 2IAMB 2AXGB 2VAAA 4KVCL 5L0QB 3T0VA 3HPLB 1JGDA 3RX7A 4OIBA 4GXVL 1J0YA 3RA7L 4AEIL 5DRWA 3B2UD 3JSSA 3IFPA 1U92B 4WFHD 1MWAA 2DBJA 3VXOB 4D94A 1IC7H 1ZTXL 2I5YH 3RAJH 2WBWB 3OR7B 1U3YA 4MNQD 3FONB 3ZE0F 1FIGH 4MD4B 1ACYH 3WDIA 4Y2DA 3D0VB 4ZOEA 1ORQB 3SDXA 4ZD3L 4X9FA 1ZV5A 5EFIB 4XBEH 1S8DB 5A2LH 4NHCH 3OPZH 2EEDA 1D5MB 4HBQA 2B5IB 3DYPA 3TZVC 2NY3D 4FFWC 2JE8A 4MDIB 4MXWL 1L0YA 4Z78A 1FAIL 2IBZY 1QFWH 4M7JL 1RZGA 1UWGL 3UTPD 3DUUB 1NDMA 4EN3B 4Z7UA 3V5HB 1CS6A 4PRBA 3LMJL 1HINL 2MPAL 2Z8RA 1RK0B 1RJZA 2HLFC 3B83A 4JCLA 4MNHA 1MCOL 3RWEB 3P0VH 1N0LA 4UTAL 1A4KB 5JIIA 1SEQH 1C08A 2C7UA 3GMRB 4LDEB 2KZ1B 3SE3A 3MA7A 3IJHB 3HZVB 2YOCA 1BBDH 2F54E 3OKYA 4GSDH 4QXUH 3MO1A 3VI3F 3QDGE 4G43B 2HH0H 1K3ZA 2GW5A 2ZCKH 4Y5YC 3SDCA 3DXAB 3WDHA 2C4FU 1FNGB 4MD0A 2EDWA 4OIAA 5IOPB 4L5FL 1AIFA 3V5KA 1LE9A 3E8UH 3DV6A 2CDFA 3O8XA 1BIIB 1KJ3H 4F15C 1YY8B 4R0LB 5C08B 3OB8A 1LP9E 1U6AL 4Z0XB 1MHEA 5TPWH 1EH9A 3G6JF 4PRHA 12E8H 3ALPA 4JM2C 4NJ9L 4C83B 5F7FA 1MPAH 4NZTL 4TTGA 1K2DA 1DVFA 2GIYA 2F54B 3QDGB 4Y16C 4XC1L 1WUNT 3MLZH 2P8MB 4ORGB 3V0VA 5DFTA 2A0LD 4XRCB 4IRSB 4LLWB 3ULVL 5E5UB 4U1LB 4ODXB 4P57A 2DKUA 5JW4R 3GSWB 1RZKL 2X4UA 1TCRB 2DQGL 4L1DA 2YD8A 3D39E 2ARJQ 1Z9LA 3OGCA 4Z0BL 3WD5H 1UJ3C 3D85B 1XIWD 1LP9B 2J6EL 3I75A 1F4WH 5F3BB 4F37K 5JPNA 3X12A 4WEBL 3V4UH 2DQUH 1A6WL 4JANB 4QXGL 3PL6D 4HPOH 2CKBA 3N1FC 3SGDI 2GHWB 5I16A 3DURB 4J8RA 4MLIA 2X05A 2XXCB 3P9LA 1OTUD 4M1CC 1OWRM 2VERN 4CADB 3O3UN 1X5KA 4WI4A 4G8GE 3UYRL 3ZL4H 5D7KD 3ZDZE 3ARTA 2VRAA 5I74B 3R1GL 4Z5RB 4JAMA 2OSLB 2ITDB 4PJIE 1LO5B 3UBXA 1C12B 4XVUD 1NAMA 3D39B 3U0PA 3GJEB 3AU1A 4QRTA 5TGBA 2NZ9C 5AAMA 4PGEA 1KELH 3DX8A 4LPYA 1F42A 1U2HA 1MLCA 2FL5B 3U79A 4KRNA 4PJ8D 1LO3L 2EKSB 5D2NE 3Q5YA 4NKIH 3IYLW 5KOVC 3TBWA 2P8LA 4LCUB 5EIIB 1NJ9A 2BDNL 3T2QA 2GI7A 4R97B 5JQHC 4N5UA 5GGSB 1S7RB 2JJUA 3AFLA 3G04A 3EYOB 1R24A 1J8KA 1XGRA 3QUKB 1AR1D 1F4XH 4G8GB 4X98B 5ADOH 1T1ZA 2BFVL 4OV5B 3EOBA 1S7XB 3O3AA 3S88L 2B4CC 2IPTL 2H9GA 3ILQD 5C6WH 4PJIB 4JFXB 1ZE3C 4KPHL 1HZHH 2C3WA 4P4KA 1JYVA 1LDPL 4AL8L 2DDQL 1KCSH 4ZTOH 5E5RB 3STZA 1OT1A 3K4AA 1KJVA 4LLYA 5D2NB 3ROLA 4LRNL 4G6JL 1H15A 2WINA 4X6FB 4IRJD 4ZAKD 4L8BA 2A83B 4Y89A 3QI9C 5MEQB 3RJQB 5IBLD 1CD1A 4TVPL 4GRWE 5I30L 1N59B 1U8HB 1A21A 4FQPA 4DAGH 5K9OA 3VRJB 1BFVH 3BKCL 2RCSL 2EH8H 4QLRA 5CUSL 3QUYB 5DZLA 2NY1C 2CD0A 2FX9L 1DN0B 3P30L 4TPRL 2Q20A 3C87A 1R6VA 1FAIH 3UTZA 3DOSA 2ZOKB 3ULUE 1DL7H 3IS1X 4QOKA 1CLYL 3ARBC 3LEXA 3QH3B 3SCMB 1TENA 5EU6E 1DUYB 5EZOL 4UI2A 1QTYT 4LEXH 5EOCJ 1MCOH 2W91A 4JKMA 2AJVH 4IOSD 3HB3C 2BXZA 5TQ0H 2C5DC 4GRWB 3H9HA 1PY4A 3SOBH 2EDHA 1MJ8H 3UTTD 4HUUA 2ADIA 3I6LE 4XWGH 3UTSD 2YD2A 3MOAL 1Z3GH 3V52H 5C9JB 3R0NA 3JV0A 1RZFL 2FCBA 5F70A 2VR9A 3CVIL 2DLFL 3X14A 5HGAB 4F7PA 1MVUA 1JFQL 2E9BA 1I3RA 3P9WB 2FIKB 2I25N 4L4VD 5EU6B 4F3FA 1RUAL 4LU5L 1HWHB 3I9GL 4ORZC 4ZPVB 3FO0H 3K8LA 2YZ1A 3CAFA 3IS0X 3BDYL 4OQTH 1C5BL 2C3VB 4UQ3A 1MQKH 1GZQA 4ZFOL 3DVFA 1LP9F 2LAAA 2Q86A 3KPPA 4NKMA 3B2VL 5E8NB 3MRLB 5CBAB 3MV7D 4JQXC 4OBSA 5E24E 2BVQB 3LQAL 4Q9QH 2CRIA 2BSSB 5F72S 4WHCA 4YFLI 2WZPD 3QXUA 4LGPB 1KXVC 1Z5LB 4O4YL 5JW4Q 3TVMA 3PUCA 4XCEB 5CSGA 5IVZA 3M17A 3T4AB 2R0KH 4EQ2A 1CXFA 3VWKC 3PDOA 5IMKA 2YRZA 2IMMA 5E99L 1TVBB 5IROC 4Q74A 1CFVH 1W72L 3HZMB 5I75B 4Y4FB 2VLKA 1PYWA 1U91A 1QLRA 3QEQA 4ZS6C 1T1XB 1OP3K 5MI0C 1MEXH 2DICA 1A6WH 2QADC 4NQCD 1AH1A 4I77H 4TSBH 4PG9A 3WLWC 1RFDL 5E5MB 4JDZA 5BV7B 3LD8C 1A6UL 1PG7X 3LEVL 5DHVH 4KK8D 2P8PB 2HJFB 1NBZB 5FECB 4PJGE 4UDTA 4EI5D 3RWJB 2FJGB 3RY5A 1BFOB 1N6VA 4YPGB 5FF6A 4XNYL 5FGBA 3G5YA 4KI5D 3PWJA 1P7HL 4EOWH 3ZDYE 1G7MB 4KHXL 2QSQA 1E28B 5IJVB 3B4NA 2P4AB 4CU8A 1A5FL 3W9EA 3WJLA 5I1EH 4NZUH 3FL7A 4NO3A 1N6QH 4YHNB 3ZDZF 1ORSB 1PFCA 3CXDH 5FKPA 4XMKH 4PJ5D 1HYSC 5DGRA 2YRPA 2DQTH 4PJIF 4U1JA 1JHKL 5D6CA 5DUBA 1RZ7L 3EYFB 2J1KA 5JHDE 2X89D 4O2EA 4QHLA 5KVFH 5BW7A 1E4XI 1FL6B 3QNXA 1C7SA 1XGUB 3PQYE 2YA2A 2Z9TA 5JXEC 3VXRE 3BO8A 2LQRA 4JZNB 4LRIC 1SMOA 4PJGB 1BEYH 2YMXL 5IFJA 1FSKB 3QQ3B 5EN2B 5GIRA 2Q87A 3E6HB 3HC3H 5B39G 2OP4L 5B4MC 1ZT4B 4LCWA 5E8PB 4NHUA 4HGWB 1OW0A 4OD1L 2G60L 4UU9B 1WJ3A 1S78C 2HLAA 1RHHA 4JZOB 5F7NC 3KLAA 4N8CH 3G08A 2PUQT 4OKVB 3V6BR 4Y5VA 1NLDH 4XP6L 4OV6F 5JHDB 2QLVB 1U8PB 1WZ1L 4DCQB 5ERWB 5B39B 1ZA3A 3C6LA 3CDGB 4NPYB 4F8QA 5CWSA 3PQYB 4MD5B 2FECL 3KYMA 4JG1L 4PBVC 5C07D 5KN5B 2JCCA 5D2LE 1YY9C 2X42A 3BGAA 4G8IA 3RVVC 5BRZE 3PP4L 4OJFL 1CFSB 4I9WD 1RI8A 2W0KA 5TFSH 3VA2C 4N1HB 3NA4A 1LEIB 4OFDA 5KVMC 2ZJSL 1F4YH 4ZUTB 3TLRA 4XBPA 3CMOL 2DAVA 3IJSA 4JB9L 2DWEA 1T0MB 3BKCH 3O45B 5C0BD 5C09D 3UZVB 5DRXA 3M8OL 3PF2A 4JO3L 4ODUB 3PWUA 3OHXA 4F9LC 4FZEL 2H2PC 4U6XA 2H32A 3MXVH 1G9NL 2VLJE 3GRWL 5F1SA 1P6FA 4H20H 4JPIB 2ICWA 3GNML 5A1AA 4ENEC 1BQLL 5D2LB 3ULUF 2CRZA 4NWUL 5BRZB 3QO0A 4HKBA 1B0GB 2VE6B 4JPVL 3TO4A 3NMEA 4WGVB 1LO0L 1YNTA 4PJEF 2XG5A 3T1FA 3AM8A 4ONGL 5T3ZH 3VW3L 5IESH 1VSCA 2ATKB 3QWRD 3MRFA 1FCGA 1FH5L 1IAKA 1RZFH 3P9MA 1JK8B 1N7MH 4ODVH 2HVKA 3MRRA 2OTUB 1I8LA 2C3GA 3VXNB 2B2XH 4IOIB 1CU4H 2VLJB 1P4LB 5T5FH 1PG7L 5FYJH 5H37H 1PKQE 5CZKA 5GXBB 4X5LA 1OGAA 2KBGA 1QLEL 5FB8A 3NZ8A 2VSCA 3WFZA 5F96H 3QB7C 2JJSC 2F5BH 3MLXH 4WI8A 1KLUA 3DX9B 1C5BH 5T1KA 5A2IH 4HJGA 3QWOB 5K9QG 4XNQA 5L8JB 4OF6A 2IGFL 3WXVL 3WV0A 2VTFA 3GGWB 3RWIA 4Z7VF 4LLDA 1I7ZA 1MREL 4K3JL 3FO1B 3MBEC 2YD3A 5HI4D 2CJUL 4WW2A 1VPOH 1PKQB 3EAKA 1UQSB 4AEFA 3ROOB 1G7HA 2VXVH 4XWOC 1UWEL 2AEQL 2J8UE 4MAYB 1YEKH 3NACL 1AY1H 1G9ML 5C8JB 2D7TL 3VWJC 2RAMA 1WVZA 43C9B 1QSEA 5JHLH 2QJDA 1FL5A 5HVGB 3MRIA 1RFDH 2W07A 5KVDL 3VFPA 2E9WA 4ZFGL 2OI9B 1A6UH 2BNRA 4OZFH 4JQVA 1CD9B 2XXMB 3FZUC 5EO1A 1CL7I 1QBBA 3IDMA 3NFSL 4UV4H 3UO1L 3MCG1 4RISL 1JGEB 5E95B 5CP3A 4L4TA 4LEOB 1Q9OB 4APQD 1ZHLB 4HFWB 2PETA 5DVNA 3BRDA 4PTUB 4CDHA 1DN2A 3L3DA 1J0IA 4LF3B 4R90L 1PEWA 5E9DE 1MH5B 3T8XA 1T5XB 2BVUA 3QG6B 4IIQA 3PWNA 2ZPKH 2I9LA 5CMAA 1ONQA 3ZDYF 1OAYL 2J8UB 2UVEA 3GMQA 3ZYZA 3CLFL 3NCCB 4OT1L 1INEL 4KHTL 1VEMA 4JHWL 4R4FH 1CBVH 3KJ6L 5F1IA 3VH8A 5FK9A 5L9DL 4DN4H 1U3HA 5E2WL 3V6ZB 2JB6A 4WFED 1A7RL 3CZFB 2ZCLH 3ES6B 2BY0A 5M94B 2W92A 5E6YA 3GMPA 1CGYA 4J4PA 2WNGA 4X9BA 3MMEB 2NX5A 3L5WB 4N0CD 5HDBE 3W0WE 2NXZC 2FATL 4GRLD 2QEJA 5L2JA 4MQ7A 5GZNC 2V5SA 3UBXG 5IF0B 1MCCA 1F11B 4M7KH 4BA8A 2YD9A 5GZOC 2R29H 3F8UB 3D1MC 4I48A 2MHAA 3UX9B 1ZXQA 3O0RH 2FEEI 4MA8L 1HCFX 1FVDB 3BE1L 1D5ZA 3L95B 1J18A 5DI8A 4BH7B 5JZ7C 1S7WA 3MCLH 4G9DA 4H8WL 1GGYA 5GS1A 4LARH 4HBCL 1HI6B 2QQKH 3RKDD 2FH8A 4BQ9A 5GGRY 2RJMA 5CJ5A 1JRHI 3OKOB 2BMKB 2BOBB 2Z93B 5KSVA 1JGVL 4GMSH 4QHMB 4G8EA 4JQIH 5SWQB 1CLZH 1CVRA 3DGGB 1B2WH 2X2YA 4L9LA 5GHWH 3GZKA 3W0WB 3ARDB 5TE4H 4DFHA 3IAGC 1DFBH 1NANH 2ICCA 4OGAD 4YLQT 1XCQB 4YFLF 4Q6YA 5D1ZD 2I24N 3FT3B 4GG8B 5IW6B 3QQ9D 1UM4H 1T21B 4RFNB 4I2XE 5J13C 1E4WH 2X4PA 3GRWH 3GM8A 1T20B 3S5LA 3C5ZD 2D7PA 3NFPB 4MQXD 1MI5D 4DZBA 5EU3A 5KW9L 5F7DA 1BLNA 4JCMA 2XKNB 2EDEA 4PRPE 5SWSD 3EYUL 1E4KC 4P46A 3CVHB 5IEHB 2EIZB 4D2NA 3Q6FA 4PB0H 1I1YA 3VXMD 3MV9E 3ZT5A 1DBMH 2R0ZL 2NYYC 4LSUH 3KGRA 3GMOA 3SKJH 3U9UB 1LO4L 4HZAA 1AGEA 2OTWB 1MJUL 3G5ZB 3VRLE 4KZEL 4KDVA 25C8H 3EYQD 3IFOB 5HYEA 1WTGT 5HI3D 4F57L 1OQOA 2HG5B 5BMFL 1GGBH 1DEEA 4UIKL 3DUSA 1HKLL 4AK1A 3MRMA 1CGVA 2EXYD 3SEPA 1RU9H 5IHLB 4LLAA 2HRLA 4Z95L 2HT2D 4I2XB 5EOCH 4EUPH 1O0VA 2HMIC 3IDGA 1IM3B 4L9DA 3FQRA 1BOYA 1UYWL 7FABH 5DFWH 3VXPA 5DSCB 2AK4A 4PRPB 3IKKA 1F02I 2QQNL 2VLLB 1KJ2H 3F12B 5CJOH 1I1AC 5DWUH 4UIMB 3WIIH 5JORA 1H8NA 4PJ9A 3VE0B 3VXQB 3O6ML 3MV9B 4Q0XH 1YYMH 1FVEA 4Y4HB 1FFNB 2Z31A 4Y19E 4U05A 1XGPA 2GY5A 1WFOA 2QQQA 3MRJB 1FN4B 5FCUH 3QFJA 3K2UH 2VXSH 3GSUA 5KJRL 3B3IB 3M1BA 4XVSH 1TNNA 3FQNB 3QNYA 4ISVA 4NM8L 4K3JH 4R8WH 3DYMA 4N5EC 5D93B 4J23A 5CEYB 1DUZA 2CJUH 2HYMA 3A67H 4F7EB 2W0LA 3HMXA 4GT7A 5I71C 2YR3A 4OD3H 4V2CB 3MYZA 4Z7WE 1CFQA 3RDTD 2FJFA 2B7DT 2RQ8A 1IGIL 5DD1H 4XNZB 3VFVB 4HIJB 4HX1A 1QVOB 4CVWA 3U6RB 2Z8SA 5CEZD 2D7TH 3RL1B 2ED7A 4L3ED 1OAZL 4JN1H 3FFCA 3QUZA 2J8UF 4Y19B 5EOTA 5DJAB 3MRBB 5DJ0B 4E41E 4ZFGH 2ZUTA 4MJ6A 4JY5H 2V5RA 2X4NA 3MFGB 4ONFH 1EEQA 5CCKH 3WNKA 4MJID 5AG9A 3FOMA 5CP7B 5J1SC 3UO1H 3X17A 1BZ9A 3S37L 1KB9J 1CGXA 4R90H 1BFTA 3O2VL 2GJ6E 2DM7A 4Z7WB 3SE8H 5GGVH 1S5IH 5GS2D 5TDOB 2EDNA 3STBA 3O3DB 5ESAB 5IB1A 1AP2B 5HHMD 4GKZA 2WUBL 2BC4A 4UV7H 3CFCL 3UDWA 2VDNH 4LCYA 4OLWH 1UA6H 5DD6A 3R06B 3DV4B 2F53D 1IILE 4UUJB 4NUGL 4Y2OA 1DCLA 1YPZA 5D1QB 5F9OL 4E41B 2HTKD 4BZ1L 1P4IH 5GRUL 1A7RH 3SY0A 3QEHA 1JN6B 5A2JH 5IMLB 4WI6A 5KSBE 3LKQB 4XNUH 1OY3B 1RULL 5I1JL 4IHOA 1R3KA 4WO4D 3HUJE 3V4VH 1MCKA 5CHNB 3BP7B 2VDKH 1GC1L 1REIA 1DBBL 5F7MC 2GJ6B 4WTZG 4X83A 4RAHA 2I9TB 3BQUC 2YC1A 3W81A 1MUJB 1OAKH 4RNRA 2UY6A 1TJGL 3T1WA 2CUMA 3X11B 2XZQH 1INDH 1BAFH 1PY9A 2EDKA 1KPUA 1HE7A 1I1FB 1QR4A 5BZDB 4J3WA 4QHNB 2V9TA 4P2OB 3CLEL 4POYA 1SEBB 1U95B 4HQQL 4X5WA 1TVHA 5EU4A 1FQ9C 4ZXBB 2X4RA 3O9WC 1QFPA 4HBCH 5KSBB 3IU4L 2NW3B 4NCDA 1JNNL 3HUJB 1XFPA 3KXFE 3ARYA 5EZLB 4X4ZA 2FBJH 1EEZB 3WNNA 5E94A 4DUXA 4YIQB 2Z35B 4QT5B 4OLYL 5I1AB 2DM4A 4OCRL 4MAUL 3H3PH 3HNVL 3K8MA 3DTXA 2AXJA 3VXUE 4XC3L 4DK6A 1NFKA 1A14H 1WFUA 2HLFD 4D0CA 2I27N 2SEBB 5GGTH 4BKLA 4U1IA 3EO9L 1G6RL 3QT2A 1N5AA 1MHHA 3LCYA 4JHBA 1LO2L 5SX5K 1FZMB 4N0YH 3IDIB 1BD2A 3KXFB 4PJBA 2YPLA 1WWCA 1D6EA 1JPFB 1CFTB 4XP4H 3IXTB 5FHAL 1QUNA 4LIQL 1MJUH 1QBAA 5SX5H 5FDWA 4LAQL 1ED3A 2EEAA 3OKEB 4F57H 5KSAD 1CK0H 3MLWH 2Z8VC 3VRLF 1J1PL 4JFHE 4FABL 4NYLB 3VXUB 1HHHA 4MJ2A 4HUXA 5DQDH 3JV5A 4JFZL 3MR9A 3CDYA 1NGXB 3LKSB 1P1ZA 5DJCA 4GXUM 1NFDA 1SJHB 1WIUA 5L8KB 3NZHL 4XT1C 1KENH 3HE6B 4EDXB 3ZKNC 4D8PB 4R3SB 1PSKH 5GRZA 2FJHA 4WDIB 1P5VA 3QDJE 5BZWA 2IAMD 1KB5H 4XZUB 4Y8DC 1CXEA 3WIFA 4OCLC 4JFQB 5IMOB 4WJ5B 3MGOB 4MCYA 1M71A 2P45B 5JTWA 1EGJH 2M1KA 4E42A 3F5WB 5MEOA 5F9WC 4RGNC 4LHJB 5IKCA 3Q0HA 3KPMB 5EO0A 5DJDA 1E0OB 1LK2A 4NM8H 5D7SL 3RZCA 4Y1AE 1X5FA 3OAUH 4XTRD 4ZUWB 4HFUL 2R0LL 3RI5F 3D2UA 2VZ1A 3NOIA 3AGVA 4M6OH 2E8YA 3IRZA 2CKNA 4NSKB 4XPBL 3G6DL 3TJHD 3KPQB 4PYHA 1OM3L 4K07A 4PJFA 1A6ZA 3QDJB 4M1CD 5JUEH 1IM9A 5GRJL 3QR2A 3LDBC 3AXLA 2ATPB 3CSYB 5HHXH 5FV1L 4C54A 4P2RE 5AD0A 1EXUA 2VC2L 3S34L 3BIKA 4TRPL 4EN3D 3F7YB 2HAZA 1KIUA 4YNYB 3TPKA 3MQIA 1VERA 1N26A 5IT2H 4U3XA 2XQBL 4Y1AB 3B6SB 4JFDA 2NNAB 3S37H 3C6SA 5ADPL 1OSZA 1H5BC 1S7TB 5JNYA 3V0WL 2W0FB 5DHVA 4JGJA 4PJXE 2AXFA 1HHGA 3TJEL 3OG4B 4X8JB 1FV1B 2YD6A 3CU1A 1UEMA 1KIRB 4WRLA 5CEZL 3VFGH 3DX6A 4OF3A 1CICA 3QXAB 4HAGA 3UC0L 3P4NA 1PJ9A 1UCBH 1ZSDB 3OF6D 5M95B 5ABDE 5GSVB 4K8RC 4AIXA 1NCDL 3T3PE 4P2RB 3OKKB 2F58H 2VR4A 2YWYA 3BKJL 4UOW0 2VITA 5ILTL 4X7SL 1IEAB 5ICYB 3BZDA 3S36X 5I1JH 3KWWA 2DQCL 4JRYE 3VGBA 2YEZA 3QIWA 2A74B 3SDDC 1OARL 4PGBB 5T1MB 5I1LA 5JDJA 3HI5L 5KSBF 2V7NB 5AEAA 2CIIB 2D2OA 4PJXB 1C16B 4JLRB 4ZNEA 3ZTJH 1P7QA 1KLGA 2X1OA 3BP5B 5A16B 1R5IA 3W39B 2X70B 4NO0B 1TJGH 3QDGD 4IDJL 2XI9A 3RWHB 3WS6A 3QI9D 1ZA6B 3VFOA 4FP8L 2A77H 4MA3A 1RIUH 3VH8G 4C56E 5JMRA 1F8TL 1WAAE 3L3OB 4PY7A 5LGJB 1K8IA 4KKNA 4JFOA 4BFGA 2NY0C 3A6BL 4ZNCD 4JJ5A 3IU4H 3QIUA 3HG1E 4JRYB 3D85D 2GTZA 2YHGA 1NGQL 1FYHB 1PLGH 2NY1D 3SGJC 4LLVA 1NBYA 3KDMA 5I1HH 2DQEL 2YUZA 3P4OA 4LPVA 4RDQF 4E0RA 4G6AD 1MFNA 2X4OB 4P5TB 5C92A 2BXYA 3GBLA 4G3YL 3ZDXE 5TJWK 3B9KA 2QHRL 1F6AB 3L6FB 5GGUA 4NNYB 1ODAA 1N2RB 3MUGA 2PW1A 3QIBB 4GOSA 3QBTB 4KK9C 1YNLL 1S9XB 4P4RB 3N0PB 3RVUC 1YEFL 4C56B 5C0AA 3BX7C 4LOUC 5HGGS 4WWKC 4FQIL 4KTEL 3T0EC 3QRGL 1IRAY 1G6RH 4YK4C 1RVFH 1R5WB 2ZCHH 1YYLH 3D39D 1LE5B 3HG1B 3BGMB 2VISB 1BZ7A 2VR5A 3MLYL 5T5NG 1EJOL 4W4OC 4K71B 3QHZL 5GJTH 1FORL 5D6DA 2R9HC 1N0XL 3MLRH 4LCCA 5MENE 3RGVA 5GPRA 5I19L 2FD6L 2WMPA 4JVPA 5EBWA 2DQFB 1NBVH 3MLPA 1A8JH 1RK1B 4XPTL 3DROB 3MV01 3P4LA 2UWEA 3S96B 4HGMA 3UJIL 3QCUH 4YFEA 2JJVA 2NXYC 4HW6A 2Y23A 2WQRA 5FYKU 4KUZL 2DLGA 3NZHH 3FN0H 3REVA 1YMHB 1JNHA 5C0CE 2DTSA 4YDVA 3I50L 1V3JA 4GJTB 2YD7A 2X4SB 3WKML 1SJVA 3AREC 3MX0A 3CFJB 3UTOA 5ID0B 4EI6A 3JWDL 4POZC 4TULL 5MENB 4Y4KB 4PUBH 3HAEG 2X4QA 3C60C 4ZO9A 5D71H 4M6NL 3HPJB 2W1NA 4KK6C 1KYOK 1U8LB 1WLHA 4ZFOA 1J5OL 1AXTH 1E6OH 2COQA 2MNUA 4HUKB 4HWBH 4YDKL 3LKOB 2VN4A 3VFNA 1QD0A 2R0LH 4Z9KB 1OPGH 5DUMH 4WVRA 2AK1H 2D7OA 3L7EA 2FSEA 4PP2B 3HAEB 4XPBH 3G6DH 3S36L 5C0CB 3O6KH 1CD0A 1C8PA 4JKWA 4QXTA 4WU5B 4DGVH 1MJ7H 3QUYD 4W6XB 5J12B 4DK3A 4JO2L 4FFVC 3LKNA 2D0GA 4MNGA 4FTVA 1ITBB 1YDPA 2AV1A 4HIIB 1G6VK 2V5YA 3C08L 4OCMC 1W72A 4X6BA 5EPMB 2C1PB 2H8PB 2VDML 3WUWB 2DLIA 5CBEA 2W65B 1RJYB 3SCMD 3D25B 3P11L 1KPRA 2G5BA 5TF1L 4IS6A 5I1KL 2PXYB 2YSSB 4FQJH 1NMAH 1AGCA 1U8OB 2ZG1A 2KUTA 5JOFA 4KVNH 1MFCL 3ARGC 2Z8WC 3SKOA 2GFBB 4PBXA 1GGCL 3MLVH 2IBZX 4NN5C 4KQ4H 1O5DT 1XGQA 5AG8A 3WS3A 5ALBH 3BXNB 3FOLB 2CDEB 4HDIB 1KTLB 4YO0A 4PJXF 2BCKB 5CEZH 1XF4B 4GAJH 5SV3A 5J0BA 1HDMA 4RIRA 5IWLA 3SO3B 5MHSE 5CD3A 4YXKH 5B8CA 4L29B 1XIWA 3TN0B 3ULUD 5F9JB 4PTTB 5FM5M 4KQ3L 3SDAC 2RFXA 4K7FB 4P2YA 4HWZB 1FNFA 1FE8H 3QNZA 5B4MD 5EU6D 3L7FB 1UVQB 3PL6A 2ZSWA 3STLB 3I3BA 4GLRI 5IIEB 4X6DE 4MMZC 4HS8L 1OARH 5F21B 4U1HA 2WIIB 4PY8I 3HI5H 4GS7C 1G1CA 5J57B 1U41A 3O41A 2MQ0A 4GBXB 3U82B 4GUPB 4E9LA 2QBWA 1NKOA 3I6LD 1OGTA 1FFPB 1Z9SA 5MERA 1OD9A 2APVA 4QNPE 5I17A 5JW5B 5IQ9A 1D9KB 5C0FB 2XWTA 4QWWC 1RIHH 4U3HA 5BOPA 2X40A 4XVTL 5CGYC 1WK0A 5J9PA 5F89B 5D5MA 4OTXL 2XZCL 3F62A 4Y4FD 1W0WA 2E6JA 3U4BL 1WAAF 1Q8MA 1VFBA 1QP1A 1EO8H 3N1GC 4X6DB 5F7EL 3FTGB 2IADB 1Z0MA 1NEZB 2AJSH 3RVWC 1JGLH 4U1NB 5J7CC 2FLBT 3UPRB 3L3HA 1FGVL 3MLSL 3OX8B 3WNLA 5D1XC 2QHRH 2ADGA 3MV11 3BD5A 4H88H 4AQOA 4M6MH 5F8RC 4O51B 4NDMB 5HHOD 2OK0L 3FQUB 3OKDB 3LAFA 5EULV 2B8OT 4KJYA 2R23B 3ZDXF 5TQ2L 3HZYB 2ORBL 5J1AA 3V9FA 4NWTH 2NPLX 1YEFH 3LZFH 5F7HA 1C5CH 4YJZL 4X4MA 1VFUA 2V17L 4KTEH 1V7NH 4ZUSB 4PRDB 4K8RH 3ILPB 2Y06L 5HHNB 1TQCB 1A4JB 3BISA 3GRWA 3PNWB 3MFFB 3MREB 3ME0A 2CXGA 2PYFB 4IMLA 3D6GA 3TF7C 4N9OB 2Y5EA 4YWGH 4IRJA 3C8DA 4OLZL 5DLMH 4ZAKA 5I0ZA 1VEOA 2R56L 5I19H 3W5MA 2D0HA 43CAB 5JXEA 3EYSL 3VD9A 3K81A 3RWCB 5D8JH 1CGUA 3RVXD 2BRRL 3D48R 5DD0L 3VFUA 1A7OH 3MJ8B 1OAQL 1RMFL 3IJYA 3KYKH 2CLZB 4XPFL 4KUCF 3E6FB 3D69B 4YHKL 2XWBA 1EFQA 3TBYB 1MCPL 4TSAL 3BPOC 3WKMH 4JFYA 1EEUA 5KTEL 4A6YB 4WV1C 4EUPA 5I8CA 4BH8B 1LD9A 1T22A 3TA3B 1BVKB 3GIVA 8FABA 1IL1A 2FX8L 3DO7B 4JDTL 4PJCA 5HGDB 2IG2L 5JHDD 4XCNB 3MXWL 4WW1A 3GBML 1F5WA 1JGUL 3LV3A 5GQBA 4PY8J 5LBSL 4NO5B 4W4NA 1FBIL 4UT7H 3PQYD 2DYPB 4U1KB 4M6NH 1LILA 1ZVSA 4M7LT 1XEDA 2XPGA 2PTUA 3VXRD 5MP6L 3UTTA 3BSZL 4IJ3C 3Q6GH 4RQQA 1DR9A 1NGWA 2GTWA 2R0WH 1ZHNB 4GAGL 1EK3A 3D18B 5J06A 4I18C 3VWJD 1YJDC 1SY6L 2AERT 3BGFB 1VADA 2EIDA 3I2CH 3MROA 4N0FB 4ZS7L 5I1DA 5KS9A 1Q9WB 3NAAL 1YMME 4R2GB 3AB0B 3S35H 3MYJA 3QXVA 1BVLA 2VH5H 3FZUD 3LQZA 3PWVB 4N8VG 3PGFH 3LIZH 4JO2H 1UB6A 1PX3A 1MRCL 1I3GL 4I5BA 5JOPE 2C26A 3MNZB 3ULVE 4Y5XA 2P42B 5I1KH 2IFFH 4OIIL 2VDPH 2KZWA 4AENB 5E6IB 5I8OL 3SJVD 1B4JL 1Y18B 1J1XL 5BRZD 2AQ1A 4G7VL 4AJ0A 4HIHA 4R7DA 2BNUA 4GKSA 5FO7B 4P5KB 4WENB 2J88L 5IW3A 4AH2B 2YUVA 1YMMB 4UILH 3PIQB 4X80L 5GGQH 3U46B 4OZIA 4O5LL 2DB8A 2CRMA 3PGDB 4LKXA 1J1OH 4IMKC 2NY4C 4ZDHB 5IP4A 1J10A 4JR9L 3RVTD 1A9BB 2VLJD 5E8DL 3QUMB 2IH3A 2WWKT 3LS5L 3GI8L 4G80B 2NXZD 1I7RA 4LLUA 5I2IA 4NQCA 4GAYA 2D7NA 5GZND 1CDYA 3OR6A 2GEEA 1PAMA 3L5XL 3GSXB 2C1OB 4QO1A 3RL2A 4DOHE 1WEJH 3BUTA 4OD2A 4EI5A 1FLTX 4BFIB 4X6DF 1P2CA 2YKLH 1MFEH 1JV5A 1E27A 1WIPA 4FQHB 4RAVA 2JJTC 4RAUB 5JZ7D 1P69B 1CT8A 4JZJB 1OT2A 3L1OL 1PQZA 3IFPB 3NABH 3QUXB 4HLZG 5MEPB 4QGYA 1T66D 3BVNA 3ULUL 2JB5H 4PJ5A 4BQBA 5C0ND 4TOYH 3I6GA 4Y8AA 2V2XB 4U1SB 3U1SL 4HF5H 1I7TA 2XZCH 3U2SB 5HDQL 3OSKA 2X89A 4MAYD 2OJZH 2I07B 4JHAL 3TIEB 4DOHB 4YFDB 2OS7A 3TBTA 3PHOA 4K3GA 3OKNA 1P4BL 4JN2A 3MLSH 1A3LH 5CKAA 3I3DA 2R8SH 3CFKB 4YHOH 1GGUA 3EOTL 1LMKA 5I1IL 1EBAA 1FO0B 1XR9B 3VFWA 1TXKA 1S7QB 1G0YR 1X7QA 2BVPB 3OL2A 4NRXA 4M1DH 1IGFH 2B1AL 2Y7QA 5I73C 4FHBD 1JMXA 2UVFA 2ENSA 1C5DA 4PLJD 1JVKA 3N06B 1I9EA 3W11C 4LSPL 2WLZA 4XNMB 1A6TB 4PS4L 1SYVB 2FYYA 4OZ4B 2L0DA 1Y0LA 1SM3L 2FR4A 5I8KL 2PNDA 5C07A 4OLZH 5BV7L 4YDJB 3CFDB 1NCUA 1QLFA 4UBDC 4WEMB 5TE7H 4GG6E 2Q7YB 4X6CA 1JZ7A 1HH9B 1CFBA 1KPVA 1L7IH 1OAQH 4B50A 1GAFL 1IGCL 4XPFH 2A6JB 1NL0H 4HS3B 3QPQD 1KN4L 5T1DH 3HNTL 4FQXB 5E9DD 4MNQE 4NRYA 5EU5A 5E8EB 4ZQKB 5B22A 3KLSA 5DFVC 4TNWF 3BH8A 1KT2B 4S2SA 2H26A 1P7KA 4S10A 4E5XB 4FQ2H 3RX5A 1MAJA 5IQ7L 4A2LA 3X3FH 1CXIA 1MJJB 2A38A 4N5ED 4OF7A 5EUOF 4Z18A 1QO3A 4P23B 1FBIH 5DZNA 2XG4A 3CD4A 4WTXA 5DJZA 1CQYA 4GG6B 1N3NB 5I66B 4JRWA 1HQRA 2PW2A 1EGJA 3BZFB 4DW2L 1DDHA 3VG0L 2I26N 4P57B 2CLRB 2P1YA 1VENA 1IEBB 5TDNA 3PDGA 4Q2ZB 3QWRA 4JO4L 3W0WD 2VAJA 4MNQB 3ARDD 1XGTA 2G75A 1MRFL 3QXDB 3KNBA 1T4KA 4CN4A 4Y2DC 1HOCA 5DJ8B 3E1F1 4RGOL 2N1KA 5LAXB 3DRQA 1W8OA 2WBJB 2D9QB 5IW1A 3HC0A 4UAOB 4EKXA 2XQYK 2NY3B 4XP5L 4KK5D 1D6VL 2OTPA 4NM4L 1CE1L 4K94L 1MIEL 2O61B 5J89A 1JF6A 2EICA 4PV8A 1LNUA 4FQLL 1W2KT 1G84A 1YEEL 4NQVA 2IQ9H 2KPNA 1V7ML 3FMGL 3ZO0A 4TUOB 2YK1L 4GRMB 5EUKB 4D3CL 1U9KA 4OGYH 3CUPA 2JIXD 4NQDD 4UB0H 3OJDB 4G6KH 4P9HL 2CSPA 1JMZA 3SE3C 1AGFB 3HCVA 4JKPL 3MCKA 2F19L 2J4WL 4D9RE 5A43C 1K8DA 1T3FB 2A9MH 2CUHA 3GI8H 1A1NB 4PRPD 5HYSA 4MVBD 2VXQL 2V5TA 3SDCC 5C7XL 5HGBB 4U1MA 3WFDH 3ARRA 1RIVL 5DMYA 5KAQG 2WANA 2A6DA 1T1ZB 3L5XH 4NQUA 4EIGB 4LCIH 3MV9D 3EDDA 1GGIH