3V2AR

Vegfr-2/vegf-a complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
198
structure length
185
Chain Sequence
b'QHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPLVNRDLSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vascular endothelial growth factor receptor 2
molecule tags Hormone/signaling protein
source organism Homo sapiens
publication title Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb
total genus 29
structure length 185
sequence length 198
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR01
3U4EA 3BXNA 4FQHA 3ARBA 4I0KA 1LD9B 2EO9A 4PGBB 4R8WL 1F90H 3CXHK 5DF0A 1H3XA 3FO1A 1D5ZB 1TVHA 5ESVB 4M43H 1MWAL 1CGYA 2E9WA 3I50H 2Z31C 3QUMH 8FABB 1MY5A 2K1MA 3SPVB 5J6GA 1WAAF 2I60L 2QTEA 4K7PL 1XF5B 4MA3B 1YEIL 1QTYT 2IAMD 5C08B 1RUMH 3WLBB 1NUNB 4ETYA 1OPGH 3MUGA 2FLBT 2C4FU 2WBJB 4LLQB 1KEGL 1K4DB 4JRWA 3SKMB 3DXAD 1XGPA 4JZJB 4PY7A 1D9KB 2E7HA 5FXCH 3PWPA 3RVWC 4OFDA 4EUPG 4IRJB 5JPNB 3GNML 3BEVB 2ICCA 3L5IA 4JFOB 3VCLA 4OD1L 4PLJD 2EDBA 1C5DA 1ZHLA 3LSOA 4O5LH 2LVEA 1ZT7B 1CFQA 5DS8B 2H9GA 5T1KD 3MNZA 2X42A 1INDH 2CDEA 4QTHB 5CUSH 5E9DB 2EEBA 1U3HC 1A6ZA 2XKSA 4MNQD 2I25N 5DMGD 1Z9OA 1NAMB 3MNVB 5KSBA 1A6UL 4OIAA 5ELIA 3FHQA 4ELMB 1QD0A 4GXUN 2X4SB 4X7TB 3G5YB 4YEFA 1JGVH 1NJ9B 4XP1H 1XGTA 2OSLB 1IGJB 1IAIL 1S78C 3O11B 4PBVC 1MF2L 1D6VH 1HQ4B 3H42L 5A2IH 5EBMB 4PJFB 5DJXB 2DWEB 2IG2H 4KK9C 4QOKE 3HE7B 4ZFOA 3TNMB 5L2KE 3S3SA 1FLTX 2FATH 3MMEB 4GW5A 3G6DL 3QI9A 2HRLA 4WUUA 3QQ9D 3VFGL 2CR6A 3MRPA 3QIBC 1WBYB 4RDQG 3KJ6L 1LO3L 1FNGA 2NX5A 3ARSA 5FYKL 4XHQA 3L6FB 4HGKC 2I26N 2BNUA 1ITCA 3BT2H 4N0CD 5C0AA 2XKUA 4MXWL 1UJ3A 2DI7A 1S5IL 1P9MA 3F7RA 5A2LH 2ZZUT 2HT2D 3IF1B 4B53A 2FL5B 2AJXH 2OYPA 4NCDA 4APQB 1HHIA 1T0MB 4OAWB 5E4EB 5IR1B 3NZ8A 1Q1JL 1IGIH 5LQBL 1NBQA 2VSDA 4RGNC 1SBSL 1ORQA 3C87A 3JWOC 3HG1B 3S3PA 2EDTA 3PXHA 2BSRA 2FSEA 3WNOA 3PP4L 3CNKA 5DUPH 1AGDA 4MA7L 2F5BL 2VXTL 4LLWB 2D0GA 4E5XB 1ONQB 4FQCH 4PB0L 3QDAA 5CGTA 1IZKA 3FN0L 2HVJA 1X44A 1S8DB 1AXIB 4Z7WF 2Y07L 3P9MA 4QRTB 1IC7H 1FL6A 2W0PA 4JANB 5CJOH 3BPNB 4L8SC 1JRHI 3DIFB 4J3XA 3QR2A 1J7VR 4Q6IA 3OL2A 1NDGB 3ALWA 1JNJA 1FGVL 4K8RD 1KIRA 3EYUL 5SWZB 4Z18A 2BX5A 1OF2A 1KIPB 2FO4A 1IAKA 3RX5A 4APQA 2O5XL 2CDGA 1CU4L 1KENH 5GGRB 3ARDC 4U1HA 3FO2A 3SGDH 1KJVA 5EORL 4UT6H 5KOVC 3QUXA 4K2UH 3MLTA 1IM9D 1NAML 3B4NA 5KSAC 1ZT1A 2HT3C 1LO5B 1FFQA 2JELH 5DQJA 5JXEA 3O4LD 2FJGB 4WUUD 3NH7L 4R2GC 5F7WC 3SDYH 3VGGA 4LSQL 3PDOB 1K3ZA 4YWGL 2VYRE 2QQKH 3BN9C 3L7EA 2FBJH 3OXRA 3K8LA 5D1ZA 1AKJD 3TNMA 1OCWH 3UPRB 5FO7A 4JLRA 3JTSB 4E41A 5L8JB 1LVEA 4HXAH 5FHBH 3DROA 1HQ4A 4TQEL 3WEXA 1P84K 2D7MA 2OK0L 4E41D 4KRPB 1QQDB 5DEFA 5GIRB 5E00A 3FAXA 1S7WB 3INUH 4IRSB 1X5IA 3SDCC 2IBZY 3FB7B 3QAZB 4F7MB 4UT7H 4OZ4A 1CD0A 3VGAC 1T1ZB 3O6FD 3GSQB 5EO0A 1C08A 5E94A 1X5LA 4OV5B 3VXQB 2W07A 4A2LA 1IAOB 4QHNB 4G8GE 1MIEH 5F7FA 4BYHA 4DZBA 3RA7L 1GGBH 1MVFA 3WDJA 4DGIL 1JN6A 1KT2B 1NKRA 3B3IA 3MV7E 3RWJB 1FSKC 2R23A 4OGYH 3DURB 2X1PA 2CDFB 4Q97A 1I1FA 3RTQC 3CK0H 5HD8C 1C5BL 3LEYH 4LBEA 4H8WL 4QRQA 1CQKA 3E6HB 5DSCA 4X80L 4X5LA 2VH5H 4Y5VC 4PRIE 4WV1C 2MTPA 2MQ3A 3MODH 4JFOA 4GJTB 1BAFH 2KDGA 5FYJD 1ED3B 3ROOA 1XGRA 5SWSB 2APBA 5BVJB 1GC1C 4NO0B 4D0CA 2Z4QA 5J13C 1FC1A 5LVEA 4HFUL 4N9OB 4XPBH 2NPLX 4G9FE 3VFWA 2YD9A 2WBJA 1XF1A 2VLKB 4KHTH 4MXWH 4S1QL 4MMXC 4D9QD 1KJMA 4RGNE 1WZLA 1B88A 4GAFB 3MV01 4JFZL 3WLBA 3ZYZA 4G6JL 1K5NB 2YN5A 2ID5A 1SYVA 3T65B 2BP3A 3MROB 1V05A 5HHOD 5I30H 1ONQA 3ZHDA 4C57C 4X8JB 2X44D 2XY2A 2UVFA 1MFBH 3ME0A 1U8IA 1RQ5A 4P3CL 4Y1AA 1M6OB 3K81A 2V5MA 1DQDH 3GIZH 5ESVA 4LLMA 5ESAA 1NGQH 1P4LA 2UYLB 3AAZA 5HBBA 2DRUA 4OZHE 4HIIA 1S9XB 1DE4B 5INCB 3SDXA 1OGTB 1OTSC 1I9JH 2VL4A 3HI1A 5E6ID 5FA3A 1G7HB 4KWUA 2ZOLA 4HJGB 1WITA 5JIIA 3VFOB 4U6TA 4GKOA 2J88L 5GZNC 1U58B 1WK0A 3F58H 5C0AB 4LRNL 5HYQB 1CIUA 1OT2A 5KAQG 5D8JL 1N2RB 3T0XA 2JJUA 1HSAB 4GAYB 3QB7C 4M8QA 4XP4L 2BOBA 5F96L 4XRCB 4JZJC 2BCKB 4PJBF 3CVIL 5DO2D 5C9JB 1N59A 3WNKA 4GG6A 1HN1A 1H3PH 3KAAA 4JY5L 3UTTB 2A0LD 5M94B 4LGSB 4WHTB 3IXTB 3BPLB 4EN3D 4YHLL 4JKWA 4P2RB 4JG0L 3CSYB 4G8FA 1I7ZA 3WUWA 2X4OB 1MI5A 4Q9QL 1QLEL 5CZXD 43C9B 4PJ8B 3P9LB 3NZHL 5FK9A 1PZ5B 3QJFA 4X4YA 4XNQB 2RJMA 5D96C 2JIXB 3D48R 3QDHA 4KJQC 4OI8A 1G9NL 3PQYA 2D2OA 4UQ3A 2CIIB 3MRMA 5K9KB 2XACC 1OGAB 3K2MC 5I8CB 1SQ2N 4KU1A 3CSGA 2VDOH 5DURD 3BGMA 3UO1H 3N1PC 1MCDA 2N7BA 3WUWG 5DK2B 1QLFA 2EEAA 4HT1H 3LEYL 1MFAH 2GJZA 1U6AL 3QPXH 1IGIL 1NCNA 5LQBH 1NLBL 3LSOB 1S3KL 5J12B 2ZKHH 1V3LA 4H25A 5CHNB 2W59A 2A6IB 3BPOB 4I8DA 2CGRH 4OCWL 2D4DA 1Z9MA 5CEYA 1QRNB 1LO0L 2VQUA 4JFYA 2DQHL 4KJYA 1R3IH 3UXFA 1BPVA 1CGTA 4KTDL 3IKCA 1RULL 2YRZA 1CXFA 3H3KA 5CD5D 4RIRA 2CR3A 5C0JA 1N0LA 1DQLL 2GQHA 4HS8L 1WEJH 3VXRA 5JHLL 2OJEA 2X9XA 1SEBB 3MFFB 3SDCA 1H3TA 5C3TA 1V7ML 2HKFL 5HDLA 3FFCB 3SDCD 2VLME 1A1MA 4DN3L 4UNTA 4FXKB 2HT4D 4UINH 5DQ9B 5ITFB 2WBJC 2QLVB 4HWZA 3QIWD 4M93C 5C0BD 1PW3A 4UU9B 4ZQKB 1U92A 1YPZA 2CQVA 4IRSC 5IKCB 4DKAA 3NN8A 5ADPH 1I8MA 3EKCA 1OM3L 2BVTA 4PJ8D 4Z76B 2H6PB 4NUGH 5EULV 4ZUVB 5GGSB 1U8PB 5JHDD 2ITCA 4R3SB 4L4VA 1OB1B 4Y7MA 5BMFL 1ZXQA 3IJHB 1S7XA 4F9LC 2XXMB 1G7IA 3FAWA 1QSVA 4P3CH 1JCKA 3IAQA 4UU9A 4UT9H 3O3AA 4RCAA 5TE4H 4JFQA 1LGVA 3TNNB 2I07B 1N6QH 3R8BB 1FZOB 1ZVSA 3VWJB 5D7SL 3U83A 1JTOA 4KVCL 1XR8A 1C16B 4PP1D 5MEOA 1Q0YL 1JZ3A 4C54A 3HC4H 4LPUA 4L3EE 3MBEB 3NMEA 1N5AA 4BUGA 3P9WB 1BFSA 5ICXA 2M1KA 1MEXH 5EU6A 2GJZB 2CRIA 1N64L 1INDL 1HHKA 4DW2H 1NANH 2ZJSH 4KMTH 1QOKA 3L3KB 5ISZB 5T3XH 1R5IA 1BJ1H 3DMMB 3SJVD 1XF3B 1J12A 1JYVA 5IIEB 3DX9B 3TEUA 5D1ZC 2VQTA 4NQVB 3FQUB 4UDTB 3LH2H 3IU3A 3VXSE 4TSCL 3HS0A 5LGKA 5D4QA 2F5AH 5JW3H 2JIXA 1XEDA 4OKVB 4TPRL 4X6BB 2NLJB 4G7VH 1MSPA 2IMMA 2R0ZH 3VFSA 1N3NB 4Z7NF 3QJHB 2K3TA 2VR4A 5IQ9B 1A3LH 4M7LH 3LB6C 2B1AL 2VC2L 5K59F 4WGVB 4PJIF 1PGRB 4X5WB 5HHVL 4Y16A 2VQ1A 1PFCA 3BW9A 3DBXA 2P8PA 4OLVH 4XAWH 5JQHC 4K71B 2CO6B 5E5MB 4F37F 4JKPH 1Q8MA 2WM0A 5BV7C 5HPMB 3JV5A 5DJ8A 5FK9B 2V5RA 4JZNB 3RTQD 4JREC 2BCKA 3X12B 5DTFA 2OLDA 4ZAKB 1H3UA 4JFZH 3E2HB 3U7WH 4HLJA 25C8H 1RIUH 2XQYG 5JNYB 1WWCA 2H41A 1F3JB 3UTPD 4MJIA 2ZUQB 4NHCH 1F90L 4WHTA 4QXTA 1P6FA 1AGBB 4HX1B 4R97C 3NIFF 1HWGB 4D0DA 4CUCA 1NLBH 1FJ1A 4OD3H 4BQ8A 5A2KH 4GG6B 3CUPA 1JV5A 1OAYH 4XXDB 5L7XH 5FA3B 3P4OB 3QDJE 2MPAH 4OSUL 4QY8A 3BISA 3GSNB 1DBBL 2YUZA 1MJ7H 4J1UA 1FVEB 3MOBL 5EUOF 3WFZA 2VAAB 4Z7OE 4J6RL 3AS1A 4I3GA 5I8OH 3KR3L 1MCWM 4OJFL 3ZDYF 3FB5B 4NOFA 3MBEC 2DTSA 3F7QA 4KAQH 3RVTC 4NZTH 2J8HA 3DX7B 5INCA 3SDXB 3WSQH 1D9KD 3Q2CA 4XPHH 3W9EA 3TIDB 5DFTA 1P7QB 1RZJL 2FHFA 5DRZA 3RRQA 2YEZB 1HKLL 2RFXB 2BVQA 2NY5L 1TQCC 3RDTB 3ARED 1QNZH 5F21B 4FQJL 2AK4A 1TCRA 5SWSD 2JLLA 3QIBA 4LASH 4Y4FB 5LCVL 1ES0A 4XZUB 4XC3H 3OKOB 3IDMA 2E7LC 2AK4D 5SWSA 3S35H 1E4KA 5HJ3A 1U8MB 4KROD 3MRLB 2P5WE 4HKBB 4MQSB 2W65B 1RJLB 3NTCL 4HF5L 1Q9KB 1H0DA 4Q9RH 1WFTA 2DDQL 3C5ZA 1G6RL 4WFFE 1IAII 5JUEL 2NY7L 5LKNA 1BQHA 5T3ZL 1IEBB 4AL8H 4S1DC 5DJ0A 1FAIL 4DGYL 4K94C 1CXEA 4HMEA 3TA3C 4OLEA 1JF6A 2PUQT 4YFLI 1A7BA 1ZANL 2P5WD 3IETB 5EORH 4ZUWA 3RPIA 4FFWD 4F7MA 2F58L 4JPIB 2R29L 4LIQE 1FZKA 4M5YL 4Y5YC 1NCTA 3D2UD 5CP3A 3UJJH 2AK1L 3BPLC 3LDBB 4XXCA 3V6BR 3RIFF 2AEQH 3VMOA 4HS3B 3OAZK 4PRIA 5DEFB 4WENB 3QQNA 4GS7C 1INQA 1JZ2A 5LWYL 3JTSA 5FDYA 4OV5A 2VO5A 2Z92A 3MV7B 5C07A 1T1ZA 5EO0B 2LVCA 4NDMB 1MJJA 5I66B 3HMXA 1TPXC 5JA8B 1IQWL 2WWMD 4WWKD 3IVKB 2F9BT 5EUKB 3WD5H 3GMPB 4WI7A 1YPZE 3U0TB 2X4QA 1U2CA 3UTSE 1CLYH 2X09A 4WEUD 1I1AC 5TH2A 4OCNC 3WE6B 1EHLL 1LO5A 4H1LB 2R29H 1MVUB 3PP3H 2DKSA 4X83A 2WP3T 4NP4L 5D2LF 3SGKC 4Z8FH 2PR4L 4M4RA 1A0QL 1ADQA 1J8HE 3SN6N 3RWEB 3PGCA 1P7KA 4CN6A 3IDNB 3LCYA 1KIPA 3QI9D 3LQAC 5DURB 5FYLE 2VLRE 1ZA6B 2IH1B 3VXRE 4V2CB 1AO7D 1T7XA 4WI5A 3LZFL 5TGBB 3MRNB 1JL8A 2B5IB 1ZA3B 4J6RH 2V2TB 1UZ6F 1EMTH 3RIAF 3C08H 4U1KB 3QCTL 1SJHB 5JR1L 5GGRA 3LD8C 4G43B 2PYEE 1IC4L 1TJIL 4Z77A 5D7JA 4O58H 4KQ3L 2V17L 4XVUC 2O26U 2IPKA 3E3QC 1FNSL 2DQTH 3DRTB 4MJ4A 2W9DH 3VXUB 4Y4FA 1PKQA 4J3TA 3WN5C 2XWJB 3L1OH 1P7QD 1A3RL 3U4AA 5CEXB 2YPLD 4I3SH 5GGVL 5HVHB 3V5HA 3TA3B 1E4WH 3E6FB 5I9QC 2VOTA 2YSSA 2AI0H 2HVJB 4I1NB 5GJSH 1T7ZA 2EIDA 1LHZA 1II4E 2EDNA 2JJTC 1EMTL 4RZCA 2M2DA 1IEHA 1SJHA 4M43L 4H8WC 5IG7A 3O3EB 5EFIB 3R06A 2JJWA 1FG9C 5C07D 1W0WB 3AM8C 3FFDB 3QEQB 3UTTE 3C5SA 1R0AL 3DI3B 1ZEAL 3WXVH 4RMWA 5I1AB 1UYWH 3L3HA 4I18C 4WFGE 4QTIL 3H7BA 3QUKB 4Y4HB 4HIHB 4L3EA 4FTVD 4MD4A 1CFVL 2FGWH 5IESH 3IDJB 4OV6F 2JJSA 4F80A 4RISL 3QEQD 3HE7D 2B1HH 4GW5B 1EO8H 1V8HA 1I3RA 2BNUB 3HE7A 4PJAF 3SOBL 3C60A 3KPPB 3IDYC 3L6FA 1ZLVH 5KTEL 5F1NA 3GNMH 2NY0D 3HI6L 5DTFB 5CMAB 2VRAA 1CFNA 4YXHL 4K8RH 5GGRY 1FORL 4JN2B 1AO7A 3IXAA 3HNTH 3OB0H 4OFYD 2OR9L 1X5GA 5E5MA 5FM5O 3GSNH 1UM4H 4HBCH 1ZWIA 3U1SL 1KCUH 3EUUA 2EKSA 1BZQK 5JO5A 5C6WH 2UZYB 4TTGA 5GGTH 1YN7A 4L9LC 5FYKE 1HIML 2IFFL 5F7UA 4HK0B 4GKNB 2A9NH 4JDTL 4OD2A 1IAIM 3BJ91 4Q9BA 1AIFB 1U95B 4PP1C 3BDYL 1EDQA 2A1WL 2YMXH 1YEGL 3CXDL 3I02A 4IRZH 2BDNH 5EO9A 1LK3H 1TJGL 2AQ1A 4CVUA 3KWWB 5IMKB 3IDGB 4I5BA 4OCMC 3QH3B 4Y5YB 2VWEE 1O0VA 3VGAB 3DXAB 1AY1H 1BQSA 2ED8A 5ABDE 4PJCF 4CAGA 5KSBE 3FO0H 3U0PB 4FQIH 3WFDH 4H0IA 3SE8H 1FAIH 1MNUL 4M6MH 2J6EA 5EC2A 4PGZA 5IOPA 2O5ZH 3QUZC 4CW1A 4LCCA 1F11A 2BNQB 5C08A 3EOBB 1OAZH 3LPWA 3G6JE 1CYGA 3D3VB 1CXKA 4OZIF 1KLFA 2VJXA 2YR3A 4KRLB 4ORGB 3KYOB 3QUZA 1VERA 3QISA 2JCCB 4LLQA 1F4YL 2JB5H 4PJCE 1FRGH 5I1DB 4NC1C 3EYSL 1RUAH 2OI9B 4K07A 4HWUA 1YY9D 4HKZA 5DD5L 1UM5L 3HZYA 3RI5K 2MJWA 3WIIH 4MHHG 4AG4H 3WHE1 4PJ5D 3WFDL 1ZHBB 4LLYA 5MI0C 4PRPB 3MPCA 3S37H 4ZSOE 1UADC 2JJVA 1JWSA 4Q6IC 1CLYL 2P5ED 4NN7C 4NYLA 3PNWB 4K3JH 3TBVA 4KXZI 4P49A 4CU6A 4MQ7A 4YNYA 3C60C 5JW5B 3U9UB 2Z8RA 3ZT6A 4EVNA 1MH5B 1YEKL 4WCYL 5T3XD 2MWCA 3EFDL 4NKDA 4LOUD 1EA9C 1RFDL 2D31B 2JCCA 4HUWB 4WFHD 4MJIB 4YHZL 3KYOA 3OWEA 1AGFA 4XC1H 4Z7UF 2F19L 5HDQL 4YHOH 3TCXA 4ELMF 1MCJA 5T1MB 3IGAA 2XA8L 3RGVB 1J0IA 5IMMA 3PWNA 3HLAA 3BP5B 2EIZA 4NKMA 2Y7QA 4KKBD 3V6ZB 2NW3A 2F8OA 3TC9A 1BLNB 2NY6B 3N50A 5IMOB 1Q0XH 2GSGB 2V9RA 4BQ9A 3KPSB 3QHFH 1RD6A 2J6EH 3GM8A 2CSPA 4Y1AE 3LS4L 2P5EE 2DM7A 4QRUB 1L0XA 1AI1L 4WV1B 5CGYC 3S4SA 4HSQA 1F02I 1QSFB 4H1LG 4OLVL 1Z3GH 1JPSL 1BM3L 5FYKH 1YA5A 2EC9T 1YN6B 1Y18B 3ELAT 5F93C 4PR5A 3BVNB 2XT1B 5IMLB 1VEMA 4PJGA 1J5OH 3N85H 2V5SA 3QXDB 2V7NB 2ICWJ 2HJLA 4G6MH 3TLRA 3G08B 2P8MB 2A9NL 1QUNA 3EO1A 4KK6C 3ULSB 4CADB 3CH1B 5IVZB 4OLWH 3QO0B 1KCVH 2R8SL 3SGEI 3V4VL 3QHZL 1A7PL 4FXLA 1QPXA 1QBLL 2YRLA 2PXYD 3T08A 2GSIA 3JSSA 1FPTL 3O2VH 2X9YA 1HYRC 3GSUB 4X6DE 1C16A 3L5WA 5GPRA 3GMNA 5DGRA 1TQBB 1ACYH 5KSAB 2H2SD 3S88H 3QEUB 3SKUD 3LN4B 2PW2A 5IHUH 5HYQA 4KKCD 4BQ6A 1OAUH 1NGZB 1VGKA 1MI5E 3TVMB 3B6SA 4OF6A 4P4RA 4Y4KA 2X5PA 2YWYA 5HHXL 2EH8H 4KJPC 3MRJB 3QUKA 4UIKL 5JW5A 4MAYC 1NMAL 1I8MB 4M3KB 3C5SB 4P2CG 4GAJH 1HOCB 3PL6C 5EFIA 5FYKD 1EJ6A 4E41E 4NQDA 3T4YB 3U30B 4OJFH 3CCHB 3RVVC 1AGEB 2NYYD 1J1OL 1YDPA 4ELKB 2OJZH 3EW3B 3T65A 3S3JA 2B2XL 1U9KA 3JWOH 1CDBA 3RA7H 5GRJH 4ZPTB 4PBXA 2OP4H 2NY1C 5I16B 4U2ZA 3F58L 2YOCA 4P46D 3ZE0E 4HULB 2FX9H 3OR7B 3IU4L 5C0RH 1J8HA 4ORGA 2VDNH 2XIDA 3W81A 5K9QI 4JDVA 2GITA 3OKMA 4X6CB 2BC4A 4HIEB 1T1YA 3MSPA 4Z77B 1T4KA 4PTUA 4TQEH 4RFEB 5KAQF 2VXVH 3WKML 1OPGL 3U2SB 2A6IA 4YAQB 3I6LD 4D9LL 1BAFL 1KELL 4YPGA 1ZSDA 1MQKH 5GQBA 5LG1A 3NFSH 3WFCH 1I1CA 3ZE0F 4GRWE 4NQXA 3DV6A 5DJ6B 3ZDZF 2YK1L 1UB5A 3RWGA 3TZVA 4OZGA 2FWOB 4L4TB 3OKKB 4A6YH 4DFIA 3KYAA 3ZHLA 5C07E 3CFJA 2Z31A 4GAGL 1YECH 1DDHB 4K94H 3KPRB 2PTUA 2VLJD 2AEIT 1T6WA 1DN0B 3EOTL 4R8WH 1OTTC 3EYQD 1QVOA 1XGYL 1MFBL 5FUOL 1ZLWK 4B50A 5C0IA 5JA9A 5EO1A 5C09E 4GRWF 1FLRH 1T89A 4TNVF 1E6OH 3BKYH 2R4RL 3S9DB 5DDHA 3LIZL 1NGPH 43C9A 5C2UB 3QFJE 4R26L 5B8CC 3QUMB 4R4BA 3T4AA 5FO7B 1PJ9A 2BNRB 1KB5H 3QNYB 4N90D 1BQLL 3RUGE 4Z9KB 5DRXA 3B83A 4OZFA 5EBLA 5FAAA 1P4IH 3K74B 4U6HA 3WXWL 1MF2H 3SE9H 1CFNB 2Q7YA 1H3VA 4MJID 4RA0C 3G5VA 1D5BA 4Y2DC 1XIWD 3OJDB 3BEWB 4PJEB 1R5WA 4OFYA 5I8EA 5GRWA 4RAHA 3SDDA 5CJXA 5I75C 4OZIE 1M1SA 3UTZB 1JYXA 4HMDA 1T0NA 1I9EA 4NO5B 4NKIL 3D1MC 1ZANH 1J8HD 3VU2A 4AEIH 2IC2A 4JFFB 1DCLA 1FNSH 2DQTL 3HI1B 4MJ2A 4QRRD 1W0VB 2DLFL 3EJZD 4RX4A 3CSPA 4XC3L 4EOWL 4HIXL 2WQ8A 4JREB 2HG5A 4TNWF 1V3KA 3C5ZB 2HLFC 3IJYA 5F89B 3FQNB 4PRPD 1S9VB 4H1LH 1Q94A 5DYOB 3TO4B 4YPGB 2EH8L 1BD2B 5HGDA 5TE7L 1JPTL 2MKWA 3W39B 2B2XH 1T1YB 3PWLB 3IDMB 3U9PH 3RY5A 4JHZA 4JQIL 4P9ML 5KOMC 1QFWL 3S5LA 3K3QA 1AD0A 3RVUC 4FQLH 2BSTB 4M6NL 1XFPA 5DT1H 4RGMC 1T5XA 3ZT5A 5CSBA 4UV4L 3L3DA 5B39G 4PY8J 4NN7B 3DX7A 1QZ1A 5J11C 4EKXA 5KVMC 2EXYD 5E2UH 5J0BA 3WNMA 3OKLB 5TDNA 4WHCA 5GHWL 2I27N 3S5LB 4XWGL 1CTNA 1R3IL 1WICA 1NBZB 1DEEA 2F74A 4EIGB 5EOQL 5IHUL 1D6EA 1NEZB 3MRNA 2D03H 4WU5A 3BT2L 4FTVB 2XRAH 3LRSB 3BGFC 2I5YL 4DTGH 1LEIA 4DZBB 3KG5A 4GMSL 3NCYS 4F7PB 1IAOA 3ETBF 5IVXB 1HHGA 5ICYA 2JB6B 2X1XR 1O5DT 3GEWB 4JCLA 1QSED 4IRJC 5LXGL 3BYYA 1KCVL 1F3JA 2XG4A 4O2EB 3BZEA 2NY6C 5E6IA 4M7LL 2WV3A 2Q8AH 5IVNA 1UB6B 3H9SB 3LKOA 1DQJB 3UJTL 4YHYB 4JM2C 3EZ8A 4UILH 2GK0A 4S1DD 5EBLB 2XQYK 2CKNA 4LVHB 1PY4A 1R5WB 5I8EB 1GZPB 2CXKA 5F7KC 4PGCB 4FABH 2P8PB 2Q7YB 3QO0A 1INQB 2VQ1B 3BW9B 3DBXB 3OAYH 5JOFB 3ULVC 2OL3H 4UNVA 4OZFB 1NGXB 1BZ7B 3TN0A 4QTHA 4JY5H 2NLJA 2UUDH 1A21A 1R3KA 2W9DL 1IEAB 2R1YA 5DJDB 1HXYA 5E1AA 5I2IA 1VFBB 5JLZB 4Q9QH 3JV6A 4IRJD 3N06B 2QKIB 1U93A 2ZUVA 5C0IB 1LP9E 4LNRB 3BP6B 2A77L 4ODUA 2AXGB 1J1OH 3MRKA 5F72S 5FB8B 3VD9A 5IBTL 4Q6IB 3MYJB 2JJSC 1YEDA 4RBPH 4FG6D 2NW3B 1BWWA 1N5AB 5J7CC 3MJ7A 3MUGB 1IT9L 4LF3B 2LFGA 1P2CB 5SX5H 4NKIH 4QRPE 3T0EA 3QQ4B 4XNMA 5IFJA 2F5BH 2VXTH 2P46B 3IFOA 2CLRB 3SPVA 3C8KA 5J6GB 3ZLQC 4G42A 3BMWA 4KV5F 5DUBB 3PWVB 4UOW1 2AJ3A 4Y2DB 2W0FA 3LQZA 4XB7A 4PRAB 2Y07H 3OKYA 4Z7VA 1ZTXH 3UROR 15C8L 3MREB 1ZLSL 2B5IC 1WZ1L 4KAQL 4ZUSA 2F53B 1DQTA 3HTLX 5AUMA 4G3YH 3FT3A 1RPQA 2C4FT 2FZ3A 1T0MA 1RJZB 2ARWA 2EIBA 1B4JH 5BXFB 3TO4D 3OGCA 3VXSD 1TETL 3MRFB 3IF1A 3TWCH 4JRXA 3P0YH 3PNWA 1I75A 3STLA 3WN5A 2R2EB 6FABL 4DAGL 4KUZL 1FO0H 3HR5B 3DRQB 4NQEA 4Y4KD 4QRRB 1L4IA 2UV3A 3TCLB 5C0CA 4Z5RB 3IFPB 1DQML 3UTSA 1G6RA 4Z7UB 3O3UN 1E28A 4GRLB 3MRIA 3UJIH 2CKBL 4Y4KB 3RKDC 4MJ5A 1YC8A 3SDAD 3TVMA 1KEGH 2HWZL 2DLIA 4P5TB 4PIRF 5TJWK 1D5MB 3OJ2C 1AD9A 3IB4A 4BSVA 1DQQA 2AJVH 2ESVD 3MCG1 1FYTB 3UYPA 3VW3L 3TT3H 2IBBA 4PJFA 2CLVA 4JFXB 5IJVB 2BNQD 3X3GH 5KS9F 1HSBB 43CAB 3AS0A 4DGVL 4ZAKA 4P4RB 4X4XA 5DC9B 5HYJB 2PO6C 3HAEA 5B3JE 2OSLA 4G6KH 4Y5VB 4GG8A 4NO2B 1RMFL 1R3LB 1SJEB 4X5XA 1YNKH 2Y36L 3EHBD 3LEXB 1NBVH 5IV2B 4IDLA 3SKJL 4NQTA 5HHVH 1J10A 4YHIB 5T1KA 2R0LH 1JK8A 4DCQB 3ILQD 4JVWA 5CUSL 3S35X 4U0RB 1N3NA 5C2BH 5C6TL 4JAMB 2B4CC 1A6UH 1A8JH 2ADIB 3JWDC 4HQQL 3IU3B 2HJFA 1QYGH 3ECBA 4NOBA 1EK3A 3NCJL 1CN4A 3TN0C 4LAQL 2NY4D 1T5WB 3GMMA 2DYPA 1QBML 2E7CA 2VZSA 1J05A 1FV1A 3T0VA 1MHEA 3QFJA 1LO4L 2VDKH 3M45A 3OTTA 1ZGLB 2QHRH 4MZ3A 4AL8L 1UVQB 5E56A 3DTXB 3BJLA 1MCWW 3EJYD 4NKMB 2NY0B 3KPMB 5AYUL 4OF7A 2PTTA 5F1IA 3RGVA 4PJ7A 2EDKA 4BELD 1WCBB 5IF0B 1JK8B 3DHJA 1BLNA 5E9DE 3WLWD 3O3BB 3WMSA 1RZ8A 3MNWB 1Z0MA 1A2YA 3OJMB 4JVUA 4FP8H 4YUEH 5AYQA 2P8LB 2R56H 5LGJA 4Z0XB 2H26A 3V52L 1XCTA 4DKDC 2J88H 4Y4HD 1TTUA 3S7GA 1JVKA 1NCWH 3RWHA 4GUPB 4N8VB 1AHWA 4YFLF 1Q38A 4CNIA 3GRWH 4ZOCA 4MCYA 1U8KB 3DVIA 4JJHA 4H8WH 1OP5K 3TBVB 5DXWA 5T3ZD 4MJ5B 2WWMC 1IC5L 3MRIB 4QOKB 4OLXL 2DM4A 1MH5A 1PG7L 4H0HB 5EG6C 3U9UA 2VKXA 1U6AH 3C2AH 1KJ2L 4KI5E 1EUTA 3VRLF 3Q0HA 2J8OA 1QBBA 1LEKA 3TA3A 4M7JL 2H3NB 2IPUG 4XI5D 5F9DC 5HI5D 4WFEE 1CGVA 2BXZA 4NQCE 3NVQA 2RAMA 1OTUD 3EO0B 4YXKL 3DYOA 3GDBA 1T0PB 1W72A 5ALCH 4XVJL 2EE6A 5F7DA 4N0UB 4XNMB 3HI5H 3DVFA 1HI6A 3EYOA 4L29A 2FBJL 4OFPA 4GRWH 1B0GA 1GGCH 2EE2A 3D0LA 3JV4B 4NRZA 3MRCB 5GS2D 5BRZA 4IJ3B 1E4KC 3RNQB 3R8QA 3TH4T 1OP9A 2CDFA 4CKVX 2PNDA 1JYNA 2R4RH 4U1SB 4K9EC 4KHXL 5EOCL 1A4JA 3B5TA 4WDIB 3GFUA 4LQFH 1CVSC 3RY4A 3AB0C 4F7CB 4ZTOH 5GSRB 3C8HA 5A3ID 3GSWA 3MRBA 4F7TA 3MYJA 4LSVH 5JLZA 2IALA 3O41B 4DUXA 3MCLL 5HHOE 4RMTA 3CFBA 3MLYL 3CU1A 5E24E 5FGSA 5KS9B 4WWKB 1UCTA 1BZ7A 4XCNA 4ZFGL 3GMPA 3INUL 5E2TH 4HUUB 5I2IB 2ZWLT 4HJJL 2ZUYA 4PG2A 2YD1A 1A1NB 1XF4B 1KB9J 4NWTH 1UYWL 5GRUL 4G9FD 1ZT4B 5D1QB 5C09A 3S37X 4HK0A 4TVPD 4L8CA 3OXRB 5BW7C 1J0ZA 2D3VA 3IT8D 4AJ0A 5D7IA 2EXWC 4L8DB 2AGJH 3VGBA 1HCFX 1X5YA 2ESVB 2G60H 1T20A 2E3VA 1FGVH 2GIYA 1NFDB 4OIBA 4RAUA 1JMZA 2AXHA 4YR6A 4ZDHB 5CAYB 4NIKB 3C60B 4YX2H 3MA9H 4W4OA 5CEZD 4LLUB 3MV7D 3GHEH 4NJ9H 5D1XA 4U0QB 1EPFA 3IDUA 5IJKA 1L9NA 1CWVA 3QEGL 3VFOA 4PFEA 1HXMB 3BZDA 4XP5L 1OAKH 3FO9B 1OF2B 2ATPB 3H7BB 4AEIL 5FHBL 4I48B 1MCHA 5I1KL 1OQOA 3BRFA 3ZE2F 1DUZA 3U46A 5H94A 4NP4H 4FQJH 2R0WH 4TRPL 1UZ8A 2OL3B 4JANA 3QDGD 1TTFA 4BKLA 1U8IB 3L7FB 5C0CB 3TCLA 2M26A 3EIFA 2YPVH 1T2XA 3ZE1E 2BVPA 4LRIC 1YYMH 5F7LB 3QUYC 5DMGC 3MC0A 2Y5TA 3WV0A 4MWFA 4ZTPL 5GXBB 1CR9H 5EU7E 1RZ7L 1I9RL 4EN3B 4MAYD 1E4XL 5JORB 3BGAA 4RZCB 2AXFB 1JUFA 3MXWL 5K9OA 4MDJA 2UZXB 3WNNA 3VFWB 2CMRL 4WUUE 5HDQH 3DV4A 3FB8A 2YSSB 5DC4B 3V5HB 1P4BH 3RNKA 4PGEA 3GJFA 3FB5A 3QG6B 3PWVA 5D1QD 5B3JF 1EFXA 4XBEH 1YNLH 3T8XB 4CMHB 3QQ3A 3ISWA 3VMNA 2NXZD 4K3DL 1CQYA 4NUGL 1QLEH 4R0LB 1P2CA 3WS3A 4WW2F 4KQ4L 3FRPA 4U1KA 2FIKB 3QCUL 3MLXL 4HIJA 4X6FB 3H2WA 5IGXH 3CGTA 1ZA3A 4M9PA 3MJ8B 4ZODA 1VGEH 4K3HA 4HMCA 3RU8H 4Q0XH 5FFLA 1CDHA 2DQGH 2J8UA 4HEME 4LEOA 1U3HB 4U6VL 3SDXF 4U7MA 5DWUH 1IGJA 4GG6E 1CZ8H 4B7LA 5DJDA 1FL3A 3IAGC 3C5JB 3TVMD 2DQIH 3D39A 4URTB 1YYLH 4NZUH 4JHWH 4QGYA 3STZA 3VWJC 2ESVA 5EUOB 2E8YA 3QUMA 2J5LB 4KUCD 1H9VA 4WY7L 5GS1B 3BO8A 5I66A 5DRXB 1NGQL 4PJBA 4FFZH 2MFNA 1MCFA 4NDMA 3FT4B 2P5EA 4ODXB 4AH2A 3VG0H 4GG6F 5DI8A 2H9GB 2YRPA 2DWDA 3VDBA 5T1LB 4PJ7E 3JBG7 3MLTB 3MACL 3FQUA 1OHQA 5B8CB 1DBJL 4KMLB 2XN9E 1UC6A 3CVHL 3HPLB 5E6IB 3VCLB 5ISZD 1NQBA 5IFAL 3N0PB 1JHKH 2BHUA 4UIKH 3CDCA 4UZGA 1JFQH 3V6OE 4M93B 1FE8L 2FNBA 4JHWL 4HPOH 2X4RB 3CDGB 1OLZA 3IDIB 3W9DA 5IVXA 2FB4H 3RWGB 2JK5B 2JKXA 3LKRA 4AQOA 4ORZC 4P23B 3G5ZB 1CL7H 1OAUL 4K7FB 3T0BA 1ZSDB 3DSNA 1AJ7L 3SE4C 2J2ZA 1KFAL 3LKQB 5M7QA 2D7NA 1BQHB 3LQMA 3WHXB 4I18A 4LVOB 4R4FL 3ULVL 3P9MB 1MRDH 4PJIB 2Z9TA 1LILA 4KPHH 1V7NL 1I1AD 3O8XA 5HJ3B 5DMIH 3KPSD 4N0YH 1A9EB 3JVGC 3BP4A 2VDRH 1X5XA 3TO4C 2VLKD 3MLVL 3I6KA 2DI8A 4U31A 3O4OC 5I1KH 1PQZB 5JPMA 4HJJH 4QXGH 2X4PB 4MNQE 4M03A 4RNRA 3UEZA 2UWEF 3GBMH 3VJ6B 4NO3A 5L2JA 1FQ9C 4MA1C 3F8UB 3R1GH 1YDPB 1FFNB 3QDGB 1ZVHA 3L5HA 3BHBB 3OV6A 1BFOB 3L5JA 4ZD3H 1XGUA 1JYWA 4PJEF 5CBAB 1RIHH 1FVEA 1AQKL 1AC6A 4LSTL 3VI4E 5ENWA 4JFFD 4DVBA 2RHEA 1FNGB 1KN2L 4L3CB 2F58H 5LBSH 2FATL 5GRZA 3VXTB 3P0GB 2Q8BH 1SJXA 3GK8L 5E2VH 2PXYA 5FF6A 4K94L 32C2B 4C4KT 4JQXA 4I48A 1ZHNA 3PIQA 3VH8A 2F5AL 2ADJA 2XKNB 1XIWB 1JHLH 4PD4J 1NFKA 3QPXL 1AHWB 1UKSA 5I75B 4WI8A 1J0KA 2NY2D 3D18A 1I85C 5B38B 3B6SB 3GMNB 1FJ1B 2FDBP 4MDIA 4GSDH 5E6IC 1ZK9A 3NA9L 1RIHL 4LSTH 1OARL 4OKDA 4ETQA 1BJMA 1WFOA 3BP7B 1WISA 3C6SA 4CRPA 4KDVA 1LEGA 5I76A 3X12A 4YHNB 4WRLA 5IHLB 5BS0B 3O3DA 4KDTA 4MB3A 3GSVB 3TYGH 1MJ8H 2J4WH 1TZGL 3QDMD 3TJEH 2QL1A 5HYSG 2VZVA 3EHBC 2V7HA 5ACLA 3AXLB 3QDMA 5IK3A 5C8JB 5AWNL 5F6HI 3ULVE 3PE9A 2P4AB 4JFHD 3QIWA 2OS7A 4OBSA 1KCLA 4WFED 4JM2B 3VRIB 5GGUB 2LAAA 3QUYA 2GY5A 5CSZA 2JCCE 4LVHC 3LY6A 4ODTH 4PD4K 4NFBA 3QXDA 3PV6A 4LCIH 4LGRB 3FOMB 5JPNA 4X7CC 3K8MA 3U0WL 1HEZB 4G7YL 1KTRL 4KFZC 5IK3B 5C8JA 3MBXL 1CL7L 1PG7W 1EXUB 4M6AA 2X7LA 3FMGL 3QIUD 4HCRA 4WDIA 2C3VA 5F44A 2Y7QB 1OAYL 3WD5L 1A14H 1NGWB 2PCPA 1UACL 2N4IA 1P5VA 1UWXH 1UKQA 1YEFL 1GZQA 2F53D 4Y4FD 4DCQA 4KC3B 2LU7A 3I2CL 5IMOA 1CK0H 2Q1EA 5I15L 3MFGB 1RK0B 4OB5H 3TBWB 3D9AH 5AZ2H 1TPXB 3NFPB 4NFDA 1R5VA 2ZSVB 2IPUK 4X4XB 1JBJA 3IJHA 3W2DH 3VXNA 1ZOXA 1U8PA 1L0QA 5E9DD 2I07A 2JELL 3MV11 5L6YH 4M61B 1CICB 5KW9L 4TUOA 4LCUB 3CD4A 3QBTB 4IJ3C 3GMOB 3TO2A 5C08E 1LEKB 2FECI 4QCIA 1A3LL 4FQPA 1A6TA 4Y5XB 1B0RA 5DMKB 1JGUL 4Z5RA 4X6DA 1SJVA 1YNTA 2VXSH 2NR6D 2XTLA 5ALCL 5GSVB 2ZCLH 1A6WH 3G04B 2ZSWB 4BSJA 1PX3A 4IOFC 1TDQA 4F58H 2LTQB 1U3JA 4MD5B 1LDPH 4P5KB 2YUXA 3BH8B 1JHKL 1N6VA 2KPNA 3LB6D 1GYAA 5EIIB 3UPAA 4S1RH 3MFFA 4WO4C 4TUOB 1MRFH 3OKDA 3MOAH 1MREH 4HH9A 5DC0A 3VFNA 4WWKC 4ZAKD 4XC1L 1C5BH 2A6DB 2M8XA 4JFDB 5HHOB 3VA6A 3RZCC 1EHNA 2Z4QB 1FGNH 4LCWE 5FUCE 4LHQB 1XCTB 5FOJA 2VLRA 4R4FH 3SDXE 5LGJB 5TE7H 1AQDB 3I6KB 4OZHA 4X99A 3JWNC 3B8YA 1EZVY 1MWAA 5I18H 4NJAL 5ETUB 4JG0H 5MERA 4XAKD 1NC2D 4M7ZC 4CGTA 1BP3B 3D3VA 4QF1B 4YQXL 5BV7L 2BVUA 1G7MB 1YQ2A 5EC2B 2C1PB 1ULVA 4ESKA 3QUML 1LDSA 1BD2D 5DVOA 5D7LB 4WJ5B 1G1YA 3G6AB 3PHSA 3U0PA 4UT6L 4KUCF 1I1YB 2JK5A 3LKRB 3TT1L 4PGJA 1EFQA 1W2KT 4P4KA 2KKQA 3VRLE 5BJTB 4PJDB 1FAKT 4ONHA 4PS4H 2R0KH 5GS3A 3TBTA 3VI4F 5TDOB 3PG2A 2H8PB 4MQTB 1OTTD 2ZUUA 1BF2A 1UXWA 5E1AB 4K7PX 3BVNA 3HUJA 3QPQD 1OAXH 2C3HA 2ADIA 3V4PH 1A47A 2YZ8A 2HJKA 2ILLA 1AIFA 3BKMH 1LK2B 2BSED 1RI8A 1VEOA 3TN0B 1S9KC 2C1OA 3U7AA 3P9LA 1OT1A 5C08D 1AFVL 1A7RH 2ZCHH 4XCYB 3D85B 1YEFH 3P4NB 4KDWA 3EYVA 2DJUA 4OCSL 4O9HH 2V17H 4YHNA 1YZZA 1ZWIB 4ENED 4PLNC 4XXCC 4OLUH 1IM3A 1IM9B 5DQDL 5TF1L 1DQLH 3LEXA 1FBIH 1ZT1B 2NY6D 5GZOC 4NPYA 3SGDI 4J7RA 4CVXA 5HY9B 1EHAA 4OFIA 1KPRB 1J87A 1TZHA 3HMWH 3EYQC 1RVFH 4NNYB 5FYLH 3S4SG 1X4YA 2I9TA 3BZEB 1S7VB 4G3YL 3ZZ1A 2DQFA 1NAKL 4LEOB 4LL9A 4PLJC 2J8UB 3KPPA 4Y4HA 1MAKA 4NN5B 4NQSA 1OGTA 2D31A 1I3RB 5FHAH 3WKNA 5KN5B 1QHPA 4F7PA 2OI9C 4ODHH 3HZMA 4XP9L 4WU7A 3GK8H 3ZSTA 5TQ2H 4YDVB 4PJ5B 1G7HA 1M6OA 2EIEA 4YJZL 2F15A 1X7QB 1FL6B 4NRYA 2IADB 3B2VH 1J1XH 3GKWL 4POYA 5ENWB 1P4BL 3V7AE 2X4NA 2UYLA 4QRRA 2E7MA 1F97A 2P7TB 3T8XA 2J6EL 1K8DA 4E5XA 1IQWH 4TULH 4JRXB 4Y2DD 2BFVH 1U8OA 4DN4L 2ATKA 5BXFA 3RVXD 3RNKB 4ODSH 4G5ZH 5ESQA 1DUYA 4TUKH 3E6FA 4FG6C 4X4MA 3QDME 3AUVA 5DO2C 1OOAA 1YMHA 2AJSH 1MCIA 3NFSL 4P4KC 4YK4B 2NY2C 4EQ3A 4NO0A 3FQWA 4HUVB 1ED3A 4XI5C 5HI5C 2BVPB 3CFEB 1QLRB 4Z7WB 5A16B 3CLFL 3ZE2E 2DQUH 1F58H 1KC5L 1CG9B 1S7SB 3MJ7B 3IFLH 4PLKC 1UZ8B 5DA4A 2G5BB 1DLHA 4N9GB 4HG4J 1JZ5A 2EDRA 2A77H 1T7WA 3KPRD 5D6CA 3DXAA 1LWRA 4UINL 1QPPA 3FO9A 3QIUA 5E7BA 5E8NA 1R3HB 1A7NH 5I1GH 1JIBA 4R96A 2NY1D 4U6VH 4EUPA 4NO5A 1OWWA 4X9GA 4P46C 3CFDB 1D9KC 1XGTB 4JFEB 4B7IA 3GMQB 3T0EE 4FQCL 1VHPA 2A6KA 3WE6A 4E0RA 4RAUB 4WO4A 5IHZA 2HMID 1S7WA 4POUB 5EPMA 1CD1B 3ZMRA 3CMGA 3SE3A 4BSWB 4PPTA 1WJ3A 3VXSA 4MS8D 2HVKB 5FO9A 4KTEH 1G0DA 4ZO6A 4HS3A 4PRIB 5EBGA 2AJVL 4ERSL 2DI9A 2Q87A 4NQED 4MYWB 5D7KE 1UKTA 3QA3B 2Y6SC 4GMTL 3RY6A 2GK0B 4FFYH 4WTWA 4ZFOL 1MNUH 1CR9L 2C9AA 2FX7L 3DUUA 3GB7B 5L2KA 4TTDC 3BKCH 3MLWH 1CE1H 1NBVL 2FH8A 1G9ML 3SE4A 5K59E 4X4ME 5IFAH 2BMKA 1IKNA 4OLUL 4LARH 3L3IA 5BV7H 3VDAA 2ORBL 4I2XE 1KJVB 2WIIA 4FQLL 5FV2A 3MRBB 4F7TB 2HH0L 2CUIA 3FO2B 1GVIA 2B0SH 4F15B 1H15A 1WFNA 3CX5J 5DVKA 2EDDA 1PG7H 5EC1A 2V2XA 1A7OH 1A4JB 3BDYH 4YEEA 2A83B 5ANME 3MRLA 3QO1B 2WUBL 1BQLH 4QRRE 4JM4L 3S8WA 5IB3B 5IG7B 1UT9A 1WBZB 4HXBL 4CDHA 1AGDB 1CICC 3G6DH 1AHWC 4H26A 3MJ9L 4G9DA 1I1RA 1VENA 1WWAX 4YHMH 5FA4B 1BQUA 4P5MA 2F8XC 1JGLH 3JUYA 3FTGA 4LLWA 4ONOA 1LD9A 4PGBA 1YY8A 3IYLW 2VZOA 2HLFD 2HTKD 1HILA 3VFTB 3BIKA 2IQAB 1LNUA 2H2SC 2XWJA 1T03L 5H37H 1SBBA 2QEJA 3QT2A 4ZMAT 5I16A 1PKQB 2QJDA 3IAPA 5CP3H 1FE8H 3VFVA 5IM7A 1KBGH 2XNAA 2LU4A 2AXJA 2X4NB 3F5WB 4QWWD 4XMPH 4JPKL 3PJSA 4QY8B 1U3YA 4BKLB 2DQDL 2EDOA 2NTFB 4K9EH 4L9LA 4BH7A 4EI5D 4EQ2A 4XPAH 1NCWL 1OP3K 4J1UB 3IJSA 1CXLA 3LV3A 4OF8A 3MJGX 3VFRB 4OCYL 5HI4D 1RAMA 1S7QA 4KHXH 1M7IB 1S5HB 2ZNWA 4EXKA 1T0NB 5BS0D 1UCBH 2MKLC 1B6DA 1BECA 5DD1L 4U1NB 5HDOA 1WLHA 4UV4H 4TVSa 5D72L 2HJKB 1UWEH 5D5MF 2AAVA 1S9YB 1ZVYA 5DMYA 3C60D 3VRJA 3O11A 5KSBB 5EUKA 3F7YA 4EI6B 3TV3L 3EDJA 2HFTA 5HGAB 1DP0A 3O4LB 2X4SA 4X7TA 3MODL 3BUYB 1N6UA 3BD3A 1GH7A 3D85D 4L8BA 4QRPB 5FDWA 5GRUH 3OKNB 2FIRT 1VPOL 2UY7A 4I3RL 2IPTH 4MXVE 4ZO8A 5CJBA 1MHEB 3Q1SH 1ZAGA 2BZDA 3O9WD 4MNQA 2ICEB 3U79A 5DDHB 2NYYC 3HAEG 1T5WA 3GMMB 3DMMC 4HUUA 1L6XA 4TTDD 5BRZE 4P2RE 5F88B 5IW1A 5I8OL 3G6JF 4NNPH 4JDTH 4V2BA 3M17A 1R5IB 4YK4C 1EBAA 4C55A 1G9NC 4F57L 3WIFA 2P44B 3PABA 5EU6B 2EZ0D 1QSFA 3R4DA 4LSRL 2X1OA 3GJEA 3QDGE 2BVEA 4UTBL 3V6OC 1KULA 1P1ZA 3EOAB 3IDXH 4ONGL 2DLGA 4PJGF 2APXA 2EDWA 4GMSH 3UAJC 1XH3A 4PG9A 3HRZA 1VPOH 1HHJB 1XGPB 3DV6B 1XCQA 1CE6A 4M6OL 4OCXH 5D7JC 3VMPA 3SDDC 3H9HA 1FH5H 4FZ8H 4E9LA 2G75B 2FJFA 3U2SA 4DGYH 3O2DA 1G7JB 1ZLSH 3SO3C 1BBJB 2R1XA 1D6VL 3H42H 3QWOA 4PTUB 5HYJA 1U8MA 4F9PC 1J11A 4HIEA 5AG8A 5F3HA 4YHKH 2Q20A 1MHHB 1FYTA 2AK4B 4OGAC 3W0WD 3UYRL 4HUWA 1K6QL 1C12B 4LU5H 5I1CH 4JFQB 5H2BA 4BH8A 4HH9B 3U4EB 4RRPG 5DFWH 4NZDA 3T2PA 2MHAA 1UZ6E 2ZUSA 2VDOL 2EYRB 4TUJB 1I9IH 4K7PY 1FO0L 1LE5A 2J3SA 1IC1A 3C8DA 4PP2B 3RY6C 3U0WH 3S88L 4DZ8A 3MO1A 5I17A 1A6WL 4KKAC 4ELKA 5BZDB 1FIEA 5DJYB 4ZS6D 5ID1B 3V0WL 1BGXL 3V5KB 3J7HA 5MHSD 2NW2B 5DHXB 2FJHB 1KTDA 1JNHB 3BN9D 2V6HA 3MCKA 1HKLH 1IARB 1TXKA 4HKJB 4NJAH 3NCFB 2B4CL 3SBWC 4IEFB 1T1XA 3H9HB 3QG7H 2KZ1B 4HPYH 4Z7QF 1SVCP 1MCPL 2P24B 5C0JB 3BGFB 4OLYL 3HC0B 4J12A 1GZQB 1FZMB 3FFCA 1FGNL 3F62A 4UDUA 5EWIL 4M7KL 1R5VB 1J86A 3AC0A 2HFFB 5IROA 2VDLH 4MNGA 2DQGL 4HCRH 4G8GA 2C3XA 4Q2ZB 1ZKAA 2ARJA 3PUCA 1MFEL 1F13A 4LF3A 4NN6B 2GSIB 1JZ4A 3X17A 1HINL 3SDAC 2AGJL 3ZT7A 2ICEA 1E6JL 4R90L 5DZLA 4PJXB 3PQYB 3B9KA 1YY9C 5LXGH 1ZHKA 2DTMH 3NCCB 4EXPX 4L4VD 5EZIH 3IFNH 3JUZA 4RDQF 4WHYG 2XG5A 2Q76A 5T3XE 2NY4B 2XXCB 3O0RL 2EYSA 1U8QB 4PJ8A 5CSZB 4BZYA 1U3ZA 1FIGL 1WIPA 4ENEC 1DANT 4ZUUB 5K9JH 4R0LC 4OT1L 4NHUB 1MHCB 5L8KB 4MAYA 1NGXA 1PYWA 2GKIA 2KBGA 1XZ0A 3A67H 4YHYC 1YUHB 5GISL 1IAIH 1BHGA 4Y4KC 3GMLB 2GCYB 3E8UL 4KRPD 5GS0D 4HS6B 4ZO7A 4M8QB 3FONA 4PJBE 4YXLH 4F15C 5MP6L 1MFAL 3QULA 3V0AC 1U91A 5DRNA 5C0EA 3QHTC 5GRJL 1U8NB 4LSPL 5EU3A 4HV8A 5BZWA 3QUXC 4M5ZH 5IUSA 3SKOB 4XVTH 1Q9WA 2CGRL 3HNTL 4H5SB 3ZDXF 43CAA 3F7VB 2AJYL 5J6HA 4JGMA 3EO9L 1TVBA 3KS0J 3GJFK 2AKRA 1W8OA 4M62H 1CDJA 2JB6A 5I17B 5I0DA 1BVZA 1FVCA 3GM0A 4P5TA 1S5IH 4L5FH 2J5LC 4LLMB 5ESAB 3KPQB 3VFTA 4HIHA 2B1HL 4R26H 1J0HA 1YY8B 4X8JA 5DRWB 3UYRH 3O45B 4P5MB 5I1CL 1EGJL 5JHDB 5BQ7A 1RUQL 1W0WA 3QEQA 1GCFA 4HH8A 4LLVB 5C0DB 3UP1A 4GXVL 2YXFA 2WP3O 2WMPA 1RSFA 1YNKL 3RZWA 3SCMA 4RGOH 3MROA 3NIDE 1YECL 2QQKL 1K4CB 3VG9B 3RU8L 1NMBH 2Z35B 1MCOL 5D1XC 3LVEA 1T3FB 3JWOL 2G2RB 2AJSL 1MIML 3SDCB 4HFWA 4OQ1A 5SX4I 1FNEB 1H5BB 1B4RA 3QUZB 3NFNA 3RP1A 3EZJB 4HCRL 4G9FB 3VXUA 5DJZB 4CJ1A 3PDGA 3UC0H 1Q9OB 2VMFA 3E2HC 4GQ9L 5D7JB 2R56L 1KGCD 3WFEH 5D6DC 4IHOA 1CU4H 4LQFL 3ARFD 2WINB 3OQ3B 4P4KD 1HDMB 4LASL 2BNQE 3AVEA 2HG5B 4PG2C 2ESVE 5FB8A 2A74B 3DGCR 3OKNA 3BP6A 5FOBA 3QH3A 3MV9B 1L7TL 3VH8G 2BFVL 4LHUG 1KIQA 2D4FA 1LO2L 5DHYA 5I74B 2BSSB 2R39A 4FTVE 1VFBA 3MRMB 1A22B 5EOQH 3MTRA 1FFOB 2CUMA 3SKJH 3TH2T 1YJDL 1KGCE 1S78D 3FB7A 3WUZA 4DQOL 1Q9LA 1C8PA 5EA0L 1QBLH 2B20A 1RZFL 2XA8H 1B6UA 2VDRL 4U1IA 3ZE1F 2JIXD 4O02H 1QQDA 5E8PB 2H1PH 1GGCL 3EGSA 3QZWB 4EDWH 4BJLA 2KZWA 1A7QH 3UMTA 4HBQA 1M7IA 1VFAA 2Y23A 3HNVH 4YHKL 2AJUL 1QRNE 1R24B 4LCWA 3LV3B 3QQ9C 1ND0A 1QFWH 1DLHB 4X6EB 3VA2C 5F70A 1N7ML 4FOMA 4XP6H 1DR9A 1JPSH 4YHPB 3VGFA 4YIQA 1BX2B 1WUNT 3ARWA 2ZUTA 4R0LA 4AMKL 4PRDB 3MRDB 1OLLA 1QVOB 3OAUL 4X80H 4WW1B 1RK1B 2XWTB 5ACZB 3QHFL 3QWRD 1K8IB 1MY7A 5HGHB 3L3JB 5FO8B 1F4AA 1H5BA 4QHMB 1GGBL 2ZUQC 4DGIH 2DQCH 2W9EH 1QSEA 2GJ6D 3OR6B 3Q6GH 5JTWA 1OVZA 1BWMA 1D6EB 4ALAH 4UI2A 4NQXB 1UG9A 4MNHB 2ATKB 3BFOA 5FECB 1I7UA 1Z3GL 1QEWA 35C8H 3NGBB 3QNXA 3REVA 2K7PA 3MRHB 4Z7QE 5BCAA 3N9GL 1OWRM 4TNVK 1KPVA 4I77H 3PGDA 3VFUA 5K9OB 2V2XB 4X0KA 5CGYD 5FV1L 3HG1A 1AD0B 5D70H 4EN3A 1ORQB 1KBGL 4LGPB 4LP5A 3L3GA 5DRWA 2XWTA 3NCBB 2Y5TB 2ORBH 3MOAL 4G6AC 1KEML 1A6VL 4G6JH 1KXQE 2BMKB 1TVBB 1ETZB 2Q3AA 2F8VA 4NC2B 4O51B 3WSQL 4LKXB 2R0WL 1WBYA 3UZEA 4XH2B 2FHBA 1WBXA 2J4WL 2BY3A 1WC7B 2HLAB 4L4VE 4QXUL 4XWGH 2ICWA 2JTDA 5HGBB 2Z93B 3DURA 4M62L 3GGWB 1T20B 1U2HA 3HRPA 2IFGA 2ATPA 1Y6NR 3MRJA 3CC5A 4XXDA 3ARFB 1T22A 5AZEL 2Z8WC 1NMCB 1YEKH 3CPLB 1VSCA 1YEIH 4NJ9L 3TBSA 2ZPKL 3QI9B 3UCRA 3QCTH 3O8XC 4QHNA 5F8RC 5D1XB 1MFCH 1CD1A 4EDXB 2B39A 3DX6B 4DQOH 1HYSC 1DBKL 1MHCA 1T2QL 4ZDHA 3WDIA 3N1GC 1BFVH 2XZZA 2YD8A 4X7DC 5MP6H 1TJGH 2LTQC 3HUJB 3QXTA 2PXYC 5JIHA 3BN3B 5T3ZH 3CVHB 4G6AD 3CLEL 2ZG2A 3VE0B 1L7TH 3K7UA 1AY1L 3O6LL 3OSKA 4MMZC 3RVUD 4M1DL 3WO3B 2YA1A 2PETA 2A74A 2AEPL 3LN5B 3X3GL 1B2WH 4MX7A 4DK6A 4V1DA 3ES6B 5IESL 3UTQA 2H45A 1HDMA 5IQ9A 3FQRA 5I1LA 3U30C 4P59L 3ULUE 2QR0B 3S34H 1JZ6A 5I19L 5JIKA 1TZIB 2OQJB 5CZKA 5DS8A 1J88A 3BWAB 3CFCH 4G80B 3FQWB 3KDMB 1UA6H 1DN0A 1M71B 1T04A 1VADB 4KKNA 4NQCA 1DDHA 5F97E 2UZIH 1AQDA 4AIXA 1J8KA 5KVEH 2ARJB 1HH9B 1MLCA 4DEPB 1PX4A 9CGTA 1RZGA 1KCSH 4KZDL 4G8GB 2CPCA 4M1DH 2R15A 4RBPK 5HHOA 5DMIL 4U4BA 1NDGA 5BO1H 3EO0A 5T5NG 3QDJD 3DIFA 3TM6A 3TYFB 4W6XB 1MQ8A 5EZJA 2XFXA 1JPFB 1C7TA 2AW2A 3AREB 4QHKJ 4RWYL 3CH8A 4YAQA 5TPWL 1KENL 5DEZA 4JDZA 5F8QC 3HMXH 4XBPA 5F6IC 3QEHB 1EO8L 4X6CA 1TJIH 3D3VD 1I1AB 1UWGL 1FVDA 4WCYH 2IADA 4X8XA 1AE6H 4M1GH 5EOCJ 5E8EB 2H1PL 1A6TB 2IANA 4MSWB 2RFXA 3L9RB 1OTSD 5ICZB 1A1OB 4AIZB 4XBGB 5HHPB 4M00A 5JZ7D 1OB1A 5K9QG 5F9OL 1JHLL 2DLFH 1F5WA 1U8KA 4WUKH 5F7YC 5D2NE 1AH1A 2H6PA 5D2LE 1AP2A 3BH9B 4KKBC 1I1AA 1H5BC 4GUPA 3TESA 1WQVT 5LGHH 2VLJA 1BBJA 1NEUA 5DD5H 4EBQH 4YDJB 5HY9A 2HKHH 4XGZB 4NPYB 1MHPL 4WTZG 4F7EB 3QULB 1A6AA 5IEKB 2DQIL 4CNIB 1U8HB 5T33H 1FL5B 2VLJE 3X14A 1KJ3H 1HHJA 3RTQB 1F8TL 4JDZB 4EN3C 3V52H 2XQBL 1SEBA 1CTOA 3ABZA 4JO1L 3GKWH 4JHAL 1FG2B 4PJHE 4UOW0 1ZGLA 2P8LA 4YBLB 2DWEA 2VISA 3QFJB 4ZFZA 4N68A 4FABL 4KTYA 4RAVB 3V4PL 2E7LA 1SM3H 4JFYB 5JDSA 2ITDA 3PWPE 4DGVH 1I8LC 3BAEL 2E27H 3OGOE 1G7QA 3IDXL 4ONGH 5DD6A 4OD3L 1LQSR 4PJHA 1EVTC 3BPNC 5I1LB 4JM2A 1V7NH 2NNAA 2XRAL 4GBXB 4PJDA 1G0XA 2V2WB 4X5WA 1SEQL 2V7HB 1SHMA 4CADA 5HHQB 4L8BB 5I19H 1CDGA 1MPAH 2NXZC 1G7MA 3ORJA 4OKVA 4U33A 3RI5F 4BZ1L 4K3JL 3V4UH 3HZKB 4ODBD 3QNZB 4ZOBA 1F6AA 1IQDB 2AJZB 4YHIA 5T1KB 5IBLC 3VDCA 1LK3L 2YA0A 4DK3A 1XGQB 4NT6B 5JW4Q 1SJEA 2CLZA 1MCCA 2FX7H 4UILL 3ZKQD 1I4FA 2ENYA 3KPNB 3V0VA 5LWYH 4I0PC 4HEPG 1S5HA 1T22B 3AMLA 2Z8SA 5TFSL 5IEHB 4MQXD 2APFA 4U1NA 1JWUA 3BUTA 2PW1A 2AK1H 2ADFL 3MBEA 4JCMA 1NMCC 4TRPH 5DVNA 1P9MC 1KNOB 1MI5D 4YDJA 4NM8L 3HFML 1E28B 4KZDH 3K46A 5CMAA 1CXIA 3NTCH 4NO0D 3FZUD 4MA3A 4L3CA 3D0VB 3RWFA 3PHOA 1ETZA 2VE6A 4WTXA 4NZRL 5EBWB 1REIA 1KCKA 4L4JA 2EH7L 4JJ5B 2NX5D 3N85L 3DRQA 4DZ8B 4UAOC 1FYTD 3MOBH 2EE3A 2OL3L 4CMHC 1D5ZA 5IBLD 1I3GH 4LAJH 4LLDA 5C0RL 3OZ9L 2IQAA 4YPJA 3RUGA 2IANB 4MSWA 3R0NA 3THML 2OX5A 4P57A 3HKFA 2VDLL 5CLTA 3IFPA 3LDBC 3WIHA 3L3OB 1MHHA 3FTGB 5E8DL 3NN8B 5LGHL 5SWZD 4P3WA 5E2WL 4FFVC 2QSTA 1WZKA 4XNXH 4OI7A 4X0KB 5CS7A 4H26B 4P5TC 3S5LG 4LDOB 4JM2D 1I8KA 2W0FB 1MAJA 3FJTA 4Y1AB 5C0BB 2Y4SA 1A9EA 5D9SA 2CLRA 2E6QA 2WSKA 5L8LB 1K5NA 5IFJB 3T77A 4NQEE 4PG9B 4V1DE 4N0FA 4XPHL 1P1ZB 3EOAA 4Y2DA 2XFXB 3GJFH 4LEXL 4OLZH 1RFDH 4JG1L 4XMLL 4Q9RL 3I50L 3WIFB 3EYFB 4YDLC 3Q5YA 3OR6A 5KJRL 4L5FL 5D1XD 2BHZA 4OCYH 4RWYH 4LP4A 2KH2B 2W60A 5EUOE 3QRFM 4MD0A 5FIEA 5CHNA 3HPLA 1D5XA 4YGVB 5ADOH 4ODTL 5B8CA 4NBYB 1VCAA 1HXYB 3ES6A 3DX8B 5JXED 3QI9C 5DK0B 3UBXA 4F8QA 4O5LL 4HQQH 3EOYG 4WFHE 2PN5A 4MX7B 4MXQC 1S9WA 3RGHA 4P9HL 2HRPH 4QRPA 4LNRA 4Y5YA 3FT2A 2HT3D 2FYYB 5HGAA 4HAGA 5MEPB 4L4TD 1CT8A 4WW2A 3QYCA 3DECA 3SO3B 1I7RB 1RURL 2AJXL 1ZGLP 2H2PD 2OBGA 5IHZB 1LP9B 4KKLC 1JGVL 1NEZG 3DHMA 4K55A 1JGEA 3HMWL 4BFGA 1RVFL 4MDIB 3VXSB 4IS6B 1IGYB 3CZJA 5GIRA 2H32H 4UB0L 3VXMB 1MHPH 4BSWA 4I2XA 3TGXA 2FD6H 4O2EA 1U3HA 5GGSY 1E4WL 1UFUA 2C3GA 3VW3H 1P5UA 1F8TH 4XCEB 2X4UA 4JM4H 1F6FB 2HP4A 3PL6A 4F37K 3NGBC 4RMQA 3CPLA 1KIQB 3TBSB 1WSST 5FF6B 4TSAH 4JY6B 2WLYA 1UWEL 2EKJA 3H9SD 3BZFB 4KY1H 2YBRA 5E6YA 2RCSH 5D71L 1F6LL 2YKLL 1P53A 3BSZL 1HQRA 1OL0A 3QG6A 1BOGB 5I1HL 3QIBD 1T6VN 1QLRA 2A73A 4Z7WA 3WFHA 3UPCA 2DIJA 3RQ3A 3PGDB 1MUJA 3KNBA 4MS8C 4KK5C 3EYFA 4X7SH 1NCAL 1HE7A 3EBAA 2F74B 4O02L 4HS8H 1E6OL 1T66D 5T1LD 3OKLA 5TDNB 1KTKE 2GT9B 1CVRA 1FNHA 1T3FA 4X9FA 5GJSL 5IB3A 3OF6A 3KHQA 4LLVA 4FQQB 5KSAD 1SYVB 4U3CA 4XCCL 3OKOA 3DO7A 3EOTH 1NCBH 1NDMA 3SCMB 4R7DB 3QO1A 4YC2B 1KN4H 3M8OL 1KJMB 4PJ5A 3TV3H 1QO3B 1KOAA 1JMXA 4O4YH 4LAQH 5F89A 2YEZA 5KSUA 1RU9H 1K3IA 3RZCA 4IBLT 3MLRL 2OMNA 1FVCB 4KKAD 1EVUA 3SY0B 4S10A 4F33B 4J3SA 3ROOB 3VXUD 4QHKI 2A73B 4PJAE 3P0VL 3L3JA 4HZLB 2IMNA 1LDPL 2VXVL 1UJ3B 3MV9D 1IBGL 3SKOA 3ARGA 1KPRA 1FZJA 1TZHB 4PJ9C 4ODWA 4D0BA 5I8KL 4P2OB 2VDPL 3NAAH 4NKOB 1I1FB 5IB5A 3BD4A 4EI5C 4LSQH 4PV8B 3IDNA 1I9IL 1N8ZB 3DVNB 2ERJC 3Q1SL 3QEQE 3SJVB 3V6FB 3VXOA 4C56A 3CUPB 3BO8B 1Y6KR 5EIQA 5EU3B 4ZAKC 5DLML 4NNXA 2D7QA 3ZDXE 1NL0L 1IGYA 4I13B 1JGDB 4J8RA 4L8CB 1J9CT 5DZNA 3GRWA 4GW1B 4TSBL 5FUZH 3F6LA 4OUUB 2FLRT 3EGSB 3QZWA 4GBXC 3W82A 3CFDA 4JFEA 3RGVD 2OK0H 5HYJD 2OMBA 2BERA 1TQBC 4EUPB 4U1IB 5DHYB 1ZLUH 3CU7A 4J23A 4D94A 4DJMA 4DUWA 1TQCB 3RDTC 4E41B 3ZDYE 3V9FA 1EHXA 2VN4A 4JVPA 2AJZA 2P48B 4UT7L 1Z5LB 2IALB 3O41A 1UXWB 3MJ8A 3FMGH 5DEGA 5GSRA 4FXGB 2FYYA 5I1JL 2WLZA 4BM7A 3MGOB 1H8NA 5TQ2L 2W0KA 3CJJA 3DARA 4I0PB 2X05A 3DX8A 3TH3T 2P45B 4M4PA 2APWA 4A6YB 4IHOB 4R2GB 3KPOA 1MCQA 2BRRL 5B22A 3GJFB 3KYKL 1GGUA 5E2UL 4Q2ZA 4CVZB 5KVEL 1IEBA 5CSGA 5MERB 3ARQA 1MFDH 4MNGB 5CJQH 1OP3H 1RZKH 2W1NA 4O2FA 1GGTA 1JNNL 1SVZA 3AROA 4DUVA 2DQUL 4HWEL 5I1GL 4LHJB 1MJ8L 1UM5H 4MQXC 5HHMD 4M7KH 1TNMA 4J3WA 1I8KB 4LSSL 4M48L 4P5KA 1FIGH 3VGDA 1PBYA 4HUXA 1OARH 2BC4B 2EE9A 5IBTH 1CF8L 4GKSB 1HH6B 4QO1A 5FYKU 1XF5A 5C0BA 3F7PC 5BZDA 5I30L 5HVFB 4LPTA 1E27B 4YDVA 4KZEH 2HKHL 3MCKB 3KLHD 4XP9H 1KTDB 4OCWH 1LE5B 1DUZB 1I85A 3U46B 4GXUM 2X10A 3T2OA 5BQ7B 4QT5A 4JKLA 5DVMA 4CU7A 3ROLA 3O45A 5JHDA 2MHAB 1E6JH 3G04A 5FUCC 1N5YH 2HH0H 4G6FB 4A6YL 5TQ0H 4QCIB 4OZFH 3WO4C 4K9EL 5CD3B 5IKCA 1PEZA 2XZQH 4GS7B 3FRUA 3GMRA 1IGCH 2HKFH 3UO1L 1CICA 1MJUL 4FMFA 2VERN 1WT5A 1JPST 3ARDA 1A2YB 4ODSL 5J11B 2VE6B 4KK8D 1JWUB 1JE6A 3CDFA 3O3BA 1CE6B 2YWZA 5IBUB 1CDCA 3P0YL 2NY3C 3GMLA 3S35L 1RJYA 1C1EL 1U8NA 3KXFD 5DWUL 3TIEA 2QADC 3EFDH 5MHSE 2C1OB 4WO4D 4WHDA 4YHML 1T2JA 4KTEL 1XCQB 4YC2C 3K1KC 4PJGE 3WNPA 3DXAE 5EBMA 4D3CL 3HRZB 5F7HA 1HZHL 3NABH 2JCCF 3HZKA 3BPCB 2F19H 3KPOB 3ZYIA 4M8VA 1IFHL 1P69B 2NX5E 4TOYL 3W0WE 3JVGA 3ECBB 3K4AA 5IMLA 1IQDA 3WXVL 5SWSE 3GSRA 3MNVA 4ZUTB 3TBYA 4P46B 5I15H 3DVGB 3K0WA 2XI9A 3HPJB 5F88A 1I9RH 4YE4L 1TVDA 3QJHA 2EO1A 4PJCB 4ZPVA 3AB0B 2MCG1 1EJOH 4MNQB 5CILH 3NZHH 2CIIA 5EN2B 5K9KA 4PJGB 3FN3A 3NCMA 1RIVH 1A6PA 4RAVA 3MUZ1 4Y16D 5FDWB 4JFFE 2VISB 2WBJD 4XCFH 2VN7A 2HTKC 4PTTB 3O4LA 1H3GA 4LVOC 1CGSH 4NO2A 4YDKH 3O3DB 2XTJC 3F12B 1E4XH 5EB9A 3RAJH 2Q86A 1ACYL 1LEGB 5I76B 3DYMA 1L7IH 1HSBA 3Q5OA 3H3PL 2HFGH 2YXMA 5IJVA 4G8FB 2AV1B 2GY7B 2GSGA 4P2RA 2OTUB 4PUBL 5H35A 4EDXA 1A6AB 1BBDL 2HFFA 4J8RB 1JTPA 3V4VH 1N0XL 3GHEL 5HTSA 3BP5A 4BH7B 2X70B 3VXTA 1XR9B 3UTPE 3VWJA 2VLKE 4GLRH 3V0WH 4NZJA 3GGWA 3PIQB 4HC1A 1FDLL 3O81A 3VWJD 2VXUH 4NZRH 2LAGB 1FZJB 3FRPG 5I0ZA 1TVHB 3RAJL 1DSFH 4Y16C 2BOCB 3WYRA 2VR5A 1ORSB 2AV7A 4MZ2A 4PRPA 5CJXC 3RWDA 5H2BB 1OAXL 5I18L 4W6YB 5EZLB 1GGYA 1SBSH 1FVDB 3L3GB 5AAWA 4PP2A 3HZYB 4QYOA 3MR9A 4FNLH 3I3DA 1ZGLM 5DJCA 1G7JA 2C7UB 3EDDA 3MV8D 5DQ9A 4MA7H 5FA4A 1JGLL 5DHVB 3O8XB 4PJ7B 3QQ4A 4K3EL 4LCCB 1JZ8A 4HHAA 4C83A 3KVQA 4U1MB 5HHNB 4AK1A 4JHBA 1MPAL 2R2BA 4O9HL 2AERT 4N1CA 4OCRH 1P6AB 2GUOA 1T04B 2CK0H 1HEZA 1LO4H 2VDKL 3L3IB 5E99L 4U1JA 5KSBF 1HH9A 1MLCB 4M6ML 4I5BB 2EC8A 1MCLA 2BVOB 3HZVA 3W11D 5D5MB 1U42A 2XTJB 3PABB 1T2QH 3B2VL 4Q58C 1IEAA 4WW1A 3D2UA 4WW2C 3LKPA 3D3VE 1CDYA 2FRGP 3BIBX 1KN2H 2X4TA 4N0YL 4CN1A 3MGOA 5GJTH 4YBLC 4LSRH 3CLEH 4RA3A 3KLAA 5A2FA 3UTQB 2IGFL 5DEGB 5CD5C 3T09A 3CVHA 4XPGL 1YEGH 3CXDH 5HYSA 3WLWC 1INEL 3A6BL 4AH2B 1R24A 4YXKH 2W38A 4FFYL 1GZPA 1JZ7A 1JNLH 2VXQH 3BRDA 4UB0H 4GG8B 1YN7B 1MJUH 4RQQA 1NBYB 2B4CH 5B38A 1CDUA 2WUBH 1PD6A 1GSMA 4JFXA 4UUJA 5KS9E 4PUBH 2D7OA 1TLKA 1CLZL 1IE5A 3D69A 4OQTL 1OP5H 1KJ2H 2VLMD 5JMRA 1X5FA 1JGDA 3UTTA 4FQIL 4PRNB 1A02N 3HG1D 2HLAA 1BQHG 2JE8A 4K2UL 4HIJB 4L9LB 5BW7A 3CC5B 3H6JA 4R90H 4LNVA 1G84A 3W0WA 5AWNH 2DJSA 3DWTA 4M1GL 1KPUB 1A5FL 5I1EH 5B38G 4LCYB 1KACB 2FB4L 5DK0A 2VH5L 1T03H 1WBXB 3JTTB 1OSZA 2CO7B 2EDFA 4PBWD 4J4PC 2W60B 5H37G 5JQ6L 3CVHH 4PGEB 4L3EB 2QSCH 3T2NL 1O7VA 2OCFD 4G7YH 1PKQE 3BYTA 3I75B 3VFPA 2EYTB 1Z2KA 3FT3B 3T0ED 5HVWA 3RFZC 2DL9A 1FYHB 3L3DB 1HWHB 2KQMA 2VLLB 2FGZA 4Y19B 1DQDL 4P23C 3MREA 4MJ6A 2X40A 3N1FC 1UGNA 5MEND 3FB8B 4LLAA 4NKQB 3TZVD 3WO4B 4BFEA 3Q6GL 5HI3D 3T1FA 1S7RA 4NM4H 2CRYA 4GO6B 4JQVC 2MOVA 4R97B 3D25B 4KK8C 5CEXA 1WV7T 1K8DB 4PB9L 4LRNH 5C0DA 5GHWH 3G5ZA 3TA3D 2P7TA 1UACH 2HN7A 1YEDB 5SV3A 1F4HA 3MX0A 4Y8AA 3WDHA 3V95A 1AQKH 4HJ0C 2AXGA 3MRKB 1RK1A 2WUCH 4NRYB 1XGRB 4OAWA 4LMQE 5IR1A 5C0GA 5FGBC 1IKFL 2CJUH 1I9JL 4Q9CA 1OAQL 3RUGB 5FO8A 5FM4A 2IH3B 4F9PA 1GAFL 1HQRB 1JWMA 3W2DL 3UTZA 3GB7A 5KG9A 4RMUA 5J12C 1X6NA 1Q0XL 2AP2A 4WIQA 3BZFA 3PHOB 4H20L 4JO4L 4DWHA 3WJJC 4Y8DC 6CGTA 4HV8B 5BZWB 5GS1A 4L8DA 3DUUB 3D85A 5JOFA 5C0EB 1XF2B 3QDJA 3GI8L 3QA3A 4LCCC 4PGCA 2AABH 4X9IA 4OZ4B 1ZT4A 1I8LA 5DJXA 1EEZA 1HNFA 5TE6H 5CCKL 3MACH 3RVWD 1SY6H 4XCYA 3LKOB 1A7RL 2ZCHL 5F6HJ 1AR1C 2J8UF 3CFKB 3MXWH 2XA3A 1HINH 3G5YA 1NCUA 4JPIA 4C4KO 5ANMB 4ELMA 4UMGA 4P2QB 4OSUH 3B9DA 4RFOL 5KZCB 5D6CB 1FFOA 1NPUA 3NA4A 5BJTA 1A4KA 1U8QA 2YPLA 4X9HA 4TVPL 1MAMH 4B5EA 3HZVB 5EOTA 2X9WA 3G6AA 1LEIB 4LIQL 5BVPL 3TWCL 4LVNB 1PEWA 2SEBA 2GUOB 4M6OH 4OCXL 1ITBB 1I1YA 5F96H 1ZT7A 1AXTL 5FYJE 4AEFA 3D2UB 4KI5D 3QUXB 1L9MA 1IT9H 4WY7H 1EO5A 4D2NA 5D7IE 1YMMA 5MEQB 4U1SA 1NGPL 1CL7I 2HTLD 2WW8A 3QEGH 2GK2A 2Q3ZA 3A6CH 2ITDB 1Q1JH 5D72H 5DHVA 2B8OT 3X11A 3E8UH 1RZKC 3K8KA 1QFWI 4JDVB 3OJVC 2YZ1A 3ZDZE 4UBDD 3WJJA 2C7UA 3O2DL 2EZ0C 3O9WC 1YMHB 5HD8D 4DVRL 2W65A 3DSFL 1YEJL 4U6XA 1A3RH 3WFBL 3NIFE 2GTWB 1K9TA 4LHUB 4PB0H 5ESQB 2A6DA 4JFDA 4MD5A 3RL2B 1KXTB 2ADGB 5IVXE 2A9ML 1UXSA 1CBVH 5C0AE 4KQ3H 4OTXL 8FABA 1AXSA 4PJAA 1IGCL 3PP4H 5CFHA 3MUY1 3QXUA 1Q94B 5DJCB 5HYIA 1QR4A 4GH7B 4Z7OF 3EJJX 1QKZH 1JF5A 1SMOA 2XICA 5KVDH 4XAKE 5FHAL 5K93A 2A1WH 4JQVA 4KXZH 1JV5B 1MFEH 2CKBH 2DQFB 5DUMH 3BWUC 4ZTPH 5C0ND 5J8OA 4NM4L 1QG3A 2XZCH 2ZSVA 4Z95H 2AVGA 1X5AA 1J1XL 5H35B 1WZMA 4TYUA 4PRHE 2OTUA 1K6QH 3S97C 4NC0B 2P49B 1D5BB 4OTXH 3IFNL 3K1DA 4ODHL 1WCBA 5IF0A 1MCRA 3L5WB 5ADOL 5DVLA 2WBKA 4QWWC 5MENB 2XN9B 4XPAL 3MMEA 3NACL 4HDIA 4JN1H 2PW1B 1JPFA 1MRDL 3AREA 1NAKH 5IEHA 2LU3A 3WJLA 3B9KD 3ARUA 1MRFL 3LKNB 1MRCH 1GC1L 4Z7UE 2XPGA 3IKKA 4P9HH 2GCYA 5EN2A 3SOBH 3O6KH 4GFTB 5F3BA 5I71B 4ZPVB 5F9JB 1F4YH 1WTGT 1DEDA 2QADD 3QWQB 3VFSB 3DVGA 4LCWD 3LKSA 1IL1A 3RVXC 3GSRB 1JHTA 4ZUTA 2HJFB 3GSXB 5GGUA 1CICD 1L6ZA 5C0AD 3QNZA 2DYPB 3MLSH 4FRWA 3FOMA 3OG4B 4G7VL 4LEXH 2A38A 4OLZL 2A6JB 3NA9H 4FN0A 4WWID 3B9KB 1F2QA 1WCQA 3K4DA 3LMJH 1RUPL 4JE4B 3ULUH 1DBAL 2QQNH 3LN5A 2IPTL 3RNQA 2WK2A 5ETUA 4ETQB 4X9BA 4XT1C 3O9WA 2R0KL 5EWIH 1R3LA 1TTGA 3F7YB 4EI6A 5GRYA 3VXMD 1L7IL 5HXMA 4ZSOB 3U7WL 1H8SA 4AENB 1QACA 4XPBL 4LSUL 3DMMD 3BP7A 4FFZL 1YPZF 2PYFB 4S2SA 4O2CB 3P77B 1DQQB 4I9WD 4H88H 4GRMA 4TUKL 4KK9D 5E08L 4UTBH 5I9QB 5GGTA 1RJYB 4FQ2L 4ZUVA 1BIIA 5GGSA 5HDBE 5KVFL 5FM8A 4ELME 1N6QL 4AIOA 3VFNB 5DJYA 2Z93A 3IJSB 3GUTA 5J1TC 5FCUH 3TNNA 1MWAH 4OLXH 3CLFH 3GMRB 1IC5H 2R2EA 1A0QH 1S7XB 1EBPA 1HOCA 3DI2B 3FO1B 1E27A 4DOHE 1W0YT 1GAFH 1F4XH 3PJSB 3MRFA 3OXSA 1CFTB 3FHAA 3CXHJ 4RGNB 5AUMB 4C59B 5HYFA 5CBAA 4EZMA 2A9MH 1CBVL 3QCUH 4XPFL 4OUOA 2GI7A 4WI4A 1DBMH 1DVFD 4K8RL 4U6XB 4HJ0D 4Z7VB 2R1XB 2OJEB 1G9MH 1VGKB 2BY1A 3WL9B 1VACB 3PHQA 3TJEL 5GRVK 2D03L 1R3JB 4O2FB 5KVFH 4S2SB 3CFCL 4AEHH 4NHCL 35C8L 2PO6D 5FCSH 1RUML 2VL5B 1RZ7H 4G8EB 1ZLWH 4P2YA 4OIIH 1Q72H 3PGFL 2PTTB 4JPVL 2H32B 4XHJC 3T3ME 3BP4B 4K7FA 5LJYH 1NCAH 3NCYP 4M5YH 3UJJL 3B9KC 4XAWL 4EJ1C 1N4XH 1FV1B 4ODUB 4I18B 3VD4A 4BK4A 4NRXB 3L95B 3QPQC 1T21A 1ACZA 5HYEA 3G08A 5C71A 1HNGA 3KWWA 5IMKA 2VITB 1OGAA 4UTAL 4PJIE 5ACZA 3VRIA 5HHXH 1J5OL 4P5TD 2VABB 5GGVY 5M95B 4PJEE 1DL7H 3TJHD 1P84J 2VAJA 4GRLD 3O6KL 5JXEC 5IROC 3Q3GA 4W68A 1DZBA 4Z6AT 5L2KB 4FXGA 1NC4B 5ACMA 3MLRH 5T1LA 3GSVA 5J57B 4OUUA 1NCCH 1J0JA 2AJUH 2DM2A 5DI8B 4Y5XC 2P5EB 3WFEL 1UQSB 2PR4H 2IEPA 3HFMH 3SBWA 1BOYA 1UCBL 3IXAB 4G6KL 5B3NA 4L1DA 4OF5A 1M05B 3HR6A 4S1RL 5IB2B 4JY4A 3BX7C 3K80A 3CSYA 2O61A 5K33A 1XIWA 3ZKMC 4D0BB 3GMQA 4LK4A 2IWGA 4P2RD 1LO2H 3ARGB 4HLZH 3O6ML 3DVNA 2OTWB 1NC2A 3N9GH 3MRGA 1OW0A 2YUWA 4PLOB 2CXGA 2XKNA 1PDKA 1IGFL 1EO7A 2MNUA 4R7NB 4H88L 1A9BA 1UM6H 4IIQA 4GBXD 4ODWB 1DEEB 3AS2A 4X6FA 5DUML 5FYJU 1F45A 3HE6D 3O3EA 4KKLD 1R6VA 3F65A 2QQLL 5KSVB 4PJFE 4KI5C 3WNLA 4O4YL 2KL6A 1LNUB 1N5YL 5DD0L 4EUPH 1GPOL 1S7RB 2RIKA 3TFKD 1Q9OA 4FQQA 5EH1A 3MLUH 5DA0B 4ZUSB 1P4LB 1BFOA 4QEGA 2E9IA 5BS0E 1FN4A 2Z91B 3BZ4B 4RNRB 4MDJB 4Y19D 4P99A 2EDHA 1FNEA 5IW3A 5ISZE 3LQZB 1QFUL 2XN9D 2GTZA 3IS1X 4XVSH 5DUBA 3LN9A 3OAUH 1F4WL 4R7DA 4AEEA 4U3HA 4N5UA 2WWKO 3BQUA 5KBNC 4U1LB 1XT5A 4F57H 5CIPA 1WVZA 2PTVA 3W39A 1ADQH 3UJIL 4MJIE 1B4JL 2A83A 2DBLL 4J3UA 2D0HA 2G9HB 3D39D 4I4WB