3V2AR

Vegfr-2/vegf-a complex structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
198
structure length
185
Chain Sequence
QHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPLVNRDLSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/signaling protein
molecule keywords Vascular endothelial growth factor receptor 2
total genus 29
structure length 185
sequence length 198
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v2aR01
3MNWB 5EORL 1UB6A 4KKBD 3VI3E 4DKEH 3KVQA 4GMSL 4Z7UE 2YD9A 3HN3A 4CMHC 3GJEA 5EZLA 4JANA 4NKIL 5DFVC 5DUPH 4MNGE 4HSQA 4EXKA 4EOWL 4PJEF 4KVCH 1S5IH 4F58H 1ZWIA 2DM3A 3DI3B 3GKWL 4ZUTA 1OSZB 4KRNA 2YRPA 4QOKB 3DBXB 4TSCL 1N7MH 3QIWB 1KPVA 3O3DA 4QTHB 4B50A 4Y2DB 3FT3B 1NCAH 4NO2A 1IGTA 2NY7H 4GG6B 5KVMC 1FBIH 3N06B 2AV1B 1WJ3A 3M1BB 2CGRL 2EDJA 3C5ZC 4NO0A 1NEUA 4OT1H 4RAHA 2H1PL 3RL1B 3T4AA 1Z3GL 2VYRE 1JWSA 2P49B 1IGFL 3VXNA 3DX6A 1JGEA 1GHFH 4PRDB 5I16A 5E70A 2FL5A 3V6FB 2KZWA 3L3DB 5GXBB 3JSSA 4KI5C 2FX9L 1MVUA 4YXLL 4NN6B 2O61B 1KB5L 1HNFA 2BFVL 4OUOA 2A38A 4FFWD 4PJ9C 3F58L 5IMMB 3KPQB 3ZO0A 4UT6L 5L8LB 3X12A 3MRMB 4Z5RB 4LKCB 1RUKL 1MCIA 4ONOA 3WUWA 4IOFC 3OZ9H 1CLOH 5FM5M 3S9DB 3ZSSA 2DQTH 4ZQKA 1DBKH 1QFWH 4MS8D 3O2WH 2QADC 4Q6IA 4JRXA 4RFOL 3L3JB 4WWKC 1CICC 1EMTL 4FQXA 4QGTA 2R2CA 4JRXE 1ONQB 3VA2C 2YXFA 1LO5A 1MFBL 5EZIL 2EH8H 5T1DH 3LN4B 1UYWH 1QFWI 3TBSB 3EDEA 2XWBA 4XCNB 5DT1L 5AZEH 4WTZG 2AJXL 5IHUH 1JGDA 4S1RH 1JZ8A 2AJ3A 4U0RC 1F3DH 3MGOA 3P30L 3EDDA 3ZT5A 1K5NB 4JQVC 2XICA 4MQXD 3LKPA 1MAML 4LEOB 2FD6L 4ZO6A 4QYOA 1XF4A 2COQA 3BISA 2OR8A 4RA3A 3SPVB 3SE9H 4QWWC 4ZPTB 3GIZL 1DBAH 4JKMA 1MHCB 1P4LA 2DF3A 5B4MD 3RVVD 2DB8A 2QQLH 3QUZA 3VXRB 2BSRA 3CMOH 4PG9A 1DVFC 1J05B 1CIDA 1NPUA 1XR8A 5FYJL 2YD5A 2A9NL 5I1CH 4NN5C 2HFGL 1D6EA 4HUXB 4F37K 5K9OB 4GJTB 1EO5A 5IHLB 3DUSB 5I1EH 5D7KE 3RHWK 1FYTD 1ACYL 1EJOH 1UVQA 2ESVB 1AH1A 1HHKB 2V5TA 3T77B 1CGWA 1T20A 3ULVL 2FL5B 3V6FA 3OF6D 5L0QB 1F58L 2VZ3A 4MB4A 1KV3A 1EEYB 1U8NA 4M8QB 1FNEB 5IJVA 4WCYL 2HVKA 3KR3H 1E27A 4DKFH 3CFIC 4X9HA 4JG1H 3DLQR 1QPXA 1CE1H 1MCWM 2YSSA 3BP7A 32C2A 1FGNH 5E95B 1TTUA 4OD1H 2OZ4A 3P2TA 1FO0H 1GIGH 2XOTA 2HAZA 3ULSA 1QFUH 1YEHH 1LO3H 1F11B 2VUYA 1I75A 3ZT6A 3S4SA 1YNKL 4K7PX 5CILL 4I18A 3FB5B 4P59H 4WFEE 4WU5B 3NIDE 5C6WH 4DKDC 1BLNA 1IILE 4MB3A 5F9OH 5I1IH 1JCKA 4FQXD 1HHKA 1X5YA 3VXSE 2N1KA 1XZ0B 5CGYC 1Y18B 5A3ID 4U0QB 3JWDL 3IDNA 4U7SA 2OJEB 4S1RL 1I1AB 1L7IH 4FQCL 4N9OB 4UT7L 1CD1A 3RI5K 1IFHL 1HDMB 5EO9B 2EE3A 2CDGA 4X7CC 2V2TB 1RUAL 2D3VA 2AGJL 2B1HH 5FHAL 4HDIB 1DBAL 4QT5B 4KROB 3KPRE 2C1OB 3VFGL 4KTYA 3ARRA 2HLFC 1IM9A 4HG4J 5HYJA 1T7VA 3BPCA 5E8NA 2GFBB 2IFGA 1OAZH 4AEHH 1K4DA 5I2IB 4ZFOB 3WFCL 3MXVH 2AJ3B 1YC8A 5ITBL 1N5YH 1FLRL 2BHUA 4LPCA 3HG1A 3NCCB 4OZIB 5GRWA 3QG6B 15C8L 1BQHB 3BP5A 4PJBA 1S7SA 1UXWA 4KK5C 5CSZA 3VFRB 5B4MC 5KAQG 5FO8B 1HSAA 4KJQC 5HHQA 4MMZC 1I9IL 3W5MA 1SVZA 1LO0L 1QTYT 4WEBL 1VFAA 5IB1B 4TUOA 1A6WH 2AJVH 3BGMA 2DN7A 3KPLB 5BS0D 5C0CA 3ARBA 4HJ0D 3OKMB 4KKLC 5I76A 5E2TL 43CAA 2DQJL 2W9LA 3EO9H 1LEIB 3IRPX 2GSGB 5HGAA 3RZCB 1MJUH 1RZGB 1T21B 2OCFD 3HNSL 3PDOA 4UNVA 3GO1H 3KPQA 3MLRH 5EIIB 1NJ9B 1J5OL 5J13B 1QRNB 4PJIE 4Y89A 5IR1B 3QCTH 1AD9A 4R7NA 4Q58C 1T2XA 4JQVA 5MENE 5F7NC 2YK1H 4OD3H 1NCCH 2NY0B 3VXNB 4RFNC 5IM7B 4HUUA 4RDQG 2X10A 1MCRA 2B4CH 4J4PA 3H9SB 1CD1B 1PKQE 5INDA 4EIZC 1DVFB 3UCRA 3DUSA 1A1NA 1NGQL 3OAUL 3FQTB 3RFZC 4PRID 4LAQH 3GMNA 4NQTA 4OZHB 1B4RA 3X14B 3LD8B 3G6DH 3NCFB 1X5FA 4FHBD 4LHUG 4OFPA 1IFHH 3PXHA 3MA9L 2PR4H 2JCCF 2EDHA 4OCRH 4ODSL 4HIXH 2C3XA 1DUZA 4UTAL 4KK8C 4GMSH 3CDGA 4G8EA 1QKZH 5C0AE 2FEEI 4AQOA 2ZJSH 2BVOB 2P5WE 5HPMA 5ICXA 3ILQC 4G9FB 4UZGA 1UWEH 2X40A 5KSBF 5BV7C 3UTSE 1IAKA 5F7EH 1NFIB 1IEHA 1EDQA 2IH1A 4PRIE 1KJ3L 1A5FH 1CCZA 3KNBB 3NCJH 4FFZH 4PD4J 3DV6A 3C6LB 3QDGA 3WN5C 3RIAK 5IROA 3VMNA 5EC2B 5L2KE 3VMOA 1NGYA 5B3NA 1NFDA 4YBHA 3TIDA 1FBIL 3I3EA 3SBWC 2FX7L 4M43L 5HHOA 3VG9B 3QFDB 3PWLA 2AI0L 3U0WL 1DL7H 2XRAL 4LHUB 5F89B 1XIWB 3QIUD 5KSVA 1AD9B 4G6AD 3FAXA 1N8ZA 2IBBA 4HT1H 1X5GA 3GRWA 2D0FA 4LNRA 3O6FA 5FFLA 1Q0YH 3ARDA 2E8YA 2FRGP 1KEMH 1HE7A 3LY6A 5CHNB 1UM5L 4UT6H 2NLJB 3WHE0 1JZ7A 3HPJB 4HGMA 3B9KD 2VXVL 4PRBB 5LWYL 4JN1H 4F8QA 3FB5A 4NIKB 3RL1A 4MXQD 4ZUUA 1EGJA 1WT5A 3K1KC 3ALWA 3WSQH 4KJYB 2BNQD 1A3LH 3MJ7B 3JV5A 2Y9RT 3R4DA 3MRGB 3PDOB 2CH8A 3MMEA 4UV4H 2KUTA 5C0RL 3QIWA 2EDRA 4BQBA 1T04A 3WN5A 5CLWA 2DJUA 2NX5E 2EIZA 5EOCL 2CD0A 5D7KD 3SE4A 2K7QA 2RQ8A 5DUMH 1ZWIB 1MCSA 3ARBB 5CUSH 4FABL 3HC3L 5BW7C 1QQDB 2XXMB 4BSWA 1KIRA 2XTJD 5MEND 4BKLA 1Z0NA 3X17A 2HN7A 4LLMB 5JHDD 1IM9B 5E2WL 2FYYA 5HD8D 2AEPL 1S3KH 3IU4H 1T66C 3IJYA 3LEXB 4P4KD 1QBML 3TJEH 2QTEA 2W60B 4JO3L 5HYSG 2XT1B 3QDMA 4R2GB 4GAFB 3E2HB 3A0OA 3CMOL 4GAYA 3VFWB 4OCMC 3FQNB 4HWEL 2GITB 3X13B 3ROLB 1EPFA 3GSXB 1ZLVK 4ODXA 4M5ZL 2FX9H 4YXLH 4HAGA 3ZKND 4HUUB 3F58H 4TUKL 3QXDA 1I8KB 4JM2B 1U92A 1TTGA 4M6ML 1JTPA 2XPGA 3FRPA 3NPSB 5AAMA 1PAMA 1PJ9A 3RRQA 5DGQA 2X1PA 3RWDB 3SDAA 1ADQL 4M4RA 4Z0BH 3IFLH 1AXSA 5D6CB 3D18A 3V9FA 1D9KA 2Z93B 3CVHB 1IAOA 2GYSA 2LAAA 3VGDA 2ED7A 2F54A 4Y4FA 3MLZL 2A6DA 2EE2A 2EKJA 1GAFL 3EYVA 4P0DA 1FH5H 3BQUA 2VXVH 3REWA 2J6EL 3F12B 3T1FB 4PGDB 3MRGA 4LVHB 4H1LH 4NQUA 5TFSL 4MD4A 2NY5L 3FO0L 4HK3J 3PWJA 3QIBA 4U6TA 1T5XB 43C9A 1HIML 4XVTH 2Z92A 1QHOA 2H8PA 1SY6H 1ZT1A 3JVGC 4WI9A 1T3FA 1A7NL 4IRJD 5E6YA 5FA4A 4LFHD 1KACB 4OZFH 1I7TA 1R6VA 3DX8B 2X4NA 1KG0B 3QXVA 3UTZA 1UVQB 3VXOB 4HK0B 3QUKB 3RTQC 1I3UA 3GM0A 4C56B 4MQ7A 5C0JB 5HHOB 3FQUB 3HI6L 2A9NH 3IJYB 3BZ4B 3ULUL 5IROC 3VG0H 3IFOB 5MP6L 4OB5H 5ESAA 2P8MA 4Z7UB 3LPGA 4IOIB 1S3KL 2CLVA 2IADA 4NJ9L 4XAKD 3RIFK 5KS9F 2VDOH 4UQ2B 4YHPB 3SDYL 1ND0B 4EUPH 3HAEG 5I8CA 1QBMH 4G42B 4IDJL 2EZ0D 1IGTB 1V8HA 5CEZE 1D6VH 2J5LC 4NQVB 4OCLC 4NQXB 1R0AL 1WUNT 2VZOA 1SVCP 3ARDC 3IGAA 3WCYA 4AIXA 5EOTB 5FECB 5JXAH 1PEWA 4LLWB 4Q6YA 3ULVC 1G7PB 1BFSA 2YD7A 1IE5A 1CF8L 4X83A 1UCTA 5D1XB 1QFHA 3EOTH 3BGAA 5IHZA 5IEKA 5EFIB 1TJGL 4RFEB 1JPFA 3SBWA 1JV5B 1T22B 1YNKH 4LCCB 2E9JA 3OR6B 1ZS8A 3HI1B 1WZLA 3WE6B 3I9GL 1JWUA 5K9KA 5J12B 3MRDB 4PRNB 3RDTB 1HI6A 4WEMB 3U36A 4ODHL 2V7HB 1R3KA 4ZUVA 4LLDA 4YK4C 5C0ND 3MLZH 4FQXB 3GO1L 1UH2A 3WV0A 5FCUH 3G6JF 3IDYB 4M1DL 3QJHA 4ZO9A 1CZ8L 1OAUH 1HQ4B 3WMSA 1U8IA 4KI1A 1JFQL 3D1MC 1ZLUH 1YMHB 1F2XK 2X70B 1U8IB 4F9LA 2HVJA 1A64A 4PJAF 1P9MC 2R23A 2NCMA 1U58B 4YR6B 2ICWJ 2AJYL 1HYSD 2CKBL 5KAQF 1QLEL 4MJ5A 2VQTA 3JUZA 3IDYC 5FGSA 2L0DA 3KPNA 3MCKA 3CVIH 3MSPA 1IEBB 1LQSR 5CGTA 5JPNB 3TWCH 1XMWA 2OR9H 1B6DA 4MQSB 3RVXD 3MA7A 4JPIA 5GGRB 1XF2A 3NCBB 4HXAL 3RWFA 2PYEE 3SO5A 3KPLA 4L1DA 2Z91A 4IRJC 3U82B 1AGCA 1RJCA 1G6RB 4KV5F 4XHJC 4Y2DA 3BPNC 5B8CC 3LQAL 3OB0K 4YX2L 5L88H 5AG8A 2WINB 2AK4E 3O9WD 3GIVA 3UTQA 3Q2CA 3FB7A 1YYML 3JWNC 4JY4B 3LEVH 3U46A 4HKZB 4XPTH 4X4XA 3TYGH 3WIFB 2F8VA 4UNUA 1BQHA 1FNSH 3LSOA 1G7HA 1QHPA 3L3OA 3QG6A 4QKXB 2JF1A 3MRHA 4L9LC 1WAAA 3AREB 5F7EL 3RWCB 5JW4Q 4WTWA 3BZEB 3C8DA 2AABH 1CT8B 1MHHA 3HCVA 4GW4B 1DANU 3OGCB 1JZ3A 4P2QA 1BJ1J 4M7JL 4WWKD 1Y0LA 4N1CA 2UVEA 3BDXA 3ES6A 2CLVB 2IADB 3GUTB 5DRXA 1I7ZA 5DC0A 2V6HA 2FCBA 3LRHA 3GSWA 1ULVA 4LQFH 3E2HC 2FNBA 4LF3A 5L2KA 1IKFH 3GSUA 3KDMB 1K8DB 1IC5L 5IKCB 1BBDL 3PGDA 1MH5A 4ORZC 1J1OH 2BC4A 2VLKE 4ETYA 3HFMH 2P5WD 5FUOH 1TVBA 3UYPA 5IW6B 4CVXB 3G5VA 3LMJL 1A6TB 3IJSB 3VD5A 3ARPA 1JMXA 1N26A 1BLNB 4B7LA 2BMKA 3CZJA 1Q0YL 4KK9C 5HYJD 4HS8L 3QO1A 5ILTL 3WLBA 3BD5A 1B0RA 4XPAH 1KJ2A 3W39B 3PWJB 2DQGL 5KOMC 4HKXA 2W1NA 4NZRH 3MCG1 4NO2B 1BP3B 2OI9C 2ESVD 3FTGA 4FNLL 3LKOA 5DJ2B 2C3WA 3U4BH 1MI5B 3QDHA 1SMOA 2PYFB 2MQ3A 2VWEC 5D71L 4CDGC 5I0ZA 3V7MA 4PP2B 2IAMC 4MLIA 3S4SB 2EE9A 4Z7VB 2MPAH 3T0BA 2PF6A 3C9NA 2YPKB 1BJ8A 4MAYC 4CVZA 2EDEA 3RTQA 5BVJA 2Q76B 4PP1C 4QXWA 3MBEA 3GJEB 5EZLB 4J8RA 4ZOAA 4WNQB 2VDML 4TNWK 4P2CG 5HYFA 4HPOL 1QZ1A 1YEEH 2FB4L 5EUOF 5D7IF 2NZ9C 2X4TB 1JF6A 4HIJA 4LVEA 5AWNH 4EI5D 1FVDB 3F7YB 4GG8B 4M8QA 4LU5L 3WKMH 1RZKC 1SJHA 1ZHNA 3O2DA 3P77A 3KPRB 4PJCB 4ETQB 3NPZB 4QY8A 3TA3B 3K2UL 3V5HB 5D93C 5DK2B 3OKLA 4KKNA 1ND0A 5A40E 4HX1A 2Y36L 2BNUB 1IAIH 3D85A 4M8VA 3U48A 3BXNA 2R2BA 4PJDA 3FQXA 4ELMF 4XCFL 5BW7A 4R8WH 2W65B 3BI9X 4IOSD 4M7JH 3WL9A 3PP3K 1FJ1B 1JNJA 5CBEB 4WJ5A 4K7FB 1HZHL 3EFFB 1D5BA 4DCQA 4ODWA 4WW2A 4XC1L 2ITDA 3NFNB 2Y25A 4HHAA 3IDMA 3MLXL 3MRNB 3U6RB 3H9SD 3WFEL 1GGCH 5HHVL 4YZFE 4DWHA 2P5EE 5MEQA 3RP1A 3ARYA 3VXMA 2R9HD 3MR9A 4KK6D 3JUYA 4MNHA 3BAEL 2D2OA 4KI5F 1A2YB 2ADJB 5JQ6H 2J4WL 1C7SA 1QYGL 5ICXB 1UENA 2FBJH 3B43A 3ZDZE 5TF1H 3D39A 2JB5L 2AEQL 4ZUUB 4MJIE 1IC7H 1QRNE 4JN2A 2VABB 4YUEH 4U3HA 4UILH 1KUMA 1LDSA 4O4YH 4OJFH 4XP6H 4UQ3B 5BO1H 1EO7A 4DK6A 3SGKA 3PE9A 3O2VL 4YHLH 1RQ5A 2ESVA 5TDOA 2E9IA 4JJ5A 3RWDA 1TLKA 3GMNB 2VLJA 3MLWL 1QR4A 4KWUA 3IU4L 1WEJH 1U8QB 3AMKA 4PRHD 4X99B 3GSOB 2LU7A 4KRLB 1SQ2N 3TNNB 4JM2A 1WTGT 3HZVA 2E27H 4OZHE 4L8DA 1TVDA 1ES0B 2I5YH 2D0GA 1AO7E 5T3ZE 3B9AA 5ESVB 5LXGH 1MRDL 3L7EA 3OB0H 1A7PL 3HI6H 3MO1B 4RDQF 4RNRA 3U4EB 3ZYOA 2ADGA 3INUH 4DFIA 2ERJB 3DO3A 1WBYA 1V3MA 1UH4A 4FMKA 4OV5B 1OW0C 1OWWA 4LK4A 1CG9B 3RA7H 4BZ1L 1OP5K 5F7HA 2P5WB 5DD0L 3MLTB 3T0XA 2GSGA 2R2EB 5HGAB 5GS0D 2PO6C 3R06A 3ZHKA 3JWOH 1RI8A 5CSBA 2B0SL 3VGBA 3CX5K 1JGVL 5KN5A 4P5TA 3O9WB 1VFMA 4DN4L 2Z8RA 3OHXB 4RGNB 4HQQL 1HYRC 2LABA 2CIKB 4OZ4B 1L9MA 1RZJL 4NM4L 1OSPL 5C07E 1S9YA 3CCHB 3V5KA 2FATL 3WKNA 3UMTA 4XBEH 5I1LB 2W9DH 5HYSB 5I8EA 1T80A 4HCRH 2GEEA 4E42A 4X98B 1WZ1L 3CFJA 1ZA3A 4X4ZA 2EDTA 3TZVC 3IAPA 2GFBA 4KROC 4L1HA 4N0UB 2JELL 3FQTA 2RHEA 1M4KA 4H5SA 2N4IA 4MVBD 1LWRA 4JFFA 2EXWC 4Y4HC 4M62H 4JCMA 3MUGA 3MNZA 4PGZA 3QPQD 3I6KA 1F6LL 2V5YA 3GZKA 4PTUB 4Z18A 3ARZA 3QDMD 5CSGA 5T1KA 3ZKSD 3L1OL 3ILQD 4R97B 3ARGD 5J89A 2DQFA 1BOYA 2MCPH 5E24E 1FFQA 1JNNL 1SBBA 2PW2B 2VDKH 5F7KC 3HNVH 5SX5K 2PNDA 5GHWH 1GZPA 1H3PL 4Z78A 2ATPA 4F7PA 5IJKC 4LEXL 5EZOL 2XN9D 3TBTB 4ZNEA 5DZOA 5IBUG 2WUCH 2QSTA 1N59B 3BP4A 3KG5A 1AI1H 4CW1A 3L5IA 1ZVSA 2R1XB 4DTGH 1J0YA 5E6IC 3IDGB 1J1PL 1TQCB 5TF0A 4LARL 1CFBA 1AFVH 4I5BA 4B5EA 1CVRA 2XFXB 5I9QB 4MJ2A 2R29L 1KB9J 1R3JA 3P40A 4LBEB 4XBGA 1LE5A 4YWGL 1N6QL 5C9KA 1S7WB 4LOUD 4Q9QL 1HSAB 4KPHH 5DHXB 3S96B 4JY5L 5BRZA 2P48B 4H0HB 3MR9B 2CDFB 3BUYB 1L6ZA 3HE7C 4P23C 1RHHA 4AMKH 1T03L 4PJGE 3LKNA 2VZUA 1IT9H 2CRIA 3B5GA 5J57B 4D3CH 2X4OA 3U0PA 1T83C 1ZHKB 1NDMA 3MLVL 1FRGL 4KQ4L 1X5HA 4I48B 3QQ4B 4PIRF 3CK0H 3IDJB 1QO3B 1UZ8A 3EUUA 4PB9L 2F54D 4Y4FD 3GIZH 4LSPL 1A9BB 2XA3A 4YBLC 3LD8C 3V4UL 1EEZA 4EBQH 4P5KB 2P45B 4ZPVB 5DZNA 3DROB 4D0BA 3A6BL 3MOAL 1UKSA 2B5IB 4ZAKC 1A02N 1KJ2B 4NDMA 3ME0A 1RAMA 4LPYA 5CFHA 5DC9B 2X44D 4QRPE 1CR9L 4XT1C 2D9QB 1ZVSB 5JW4N 2M8XA 3BVNB 2OR9L 5EOQL 2OTWB 2DLHA 4ESKA 3QULA 5IVZB 3TFKD 3VDCA 4P5MA 4U1GC 4EDXB 3ECBB 5D96B 1MWAL 3QUXA 5I1GH 5ACMA 3LKPB 4K07A 1A21A 5BCAA 3AAZA 2R4SL 3DTXB 5H2BB 2AJSH 3P0VL 4ERSH 5C6PB 5GHWL 1PGRB 4ALAH 2HTKC 1OTTC 3P4NB 1S7VA 3RUGB 3MRLB 2G75B 4DZBA 1AO7A 1I1FA 3LRSB 4OBSA 5I73C 3HRPA 3MUGB 4OLUL 5F96L 1KCRL 4LARH 5BQ7A 4BELD 1EFXB 3ARGC 2QQNH 3V7AG 3QUMB 5DJ8A 1GGTA 1XCTB 3H9HA 1Q9KB 5MI0C 4NUGH 3WLBB 1U93B 2P7TA 3T3PF 5K9QI 4OI7A 1BFOA 2W59A 2BRQA 3MFGB 4JY4A 1SM3H 3QWOA 3EYQD 4LSSH 3CFKA 3BD4A 3STZB 4M48L 2VLMD 3WKML 5D2NC 1KT2A 3G9VA 4AM0B 3OGOE 1FC1A 1S7UA 2L4OA 4GSDH 4LQFL 3DIFA 4LLUA 4F33A 5CP7A 5LGKA 1TXKA 2GAZA 4KTEH 4MJ6B 4AT6B 1I7RA 4I13B 4R4FL 5C08E 1XF2B 3GUTA 1Q9LA 4JDZA 4PB9H 3R06B 1N2RB 1DQDH 4FZ8L 2G60L 3P0YH 3N9GH 1P69B 2ZNXA 1CT8A 3RX5A 3DECA 4GFTB 1LK2B 1DUYB 4L3AA 1DSFH 5DUPL 5ELIA 1TJHL 4L8CB 2Y07L 5HJ3B 3L5HA 3DRTB 3NCMA 1EZVX 2O93L 3WNKA 3P73A 3RUGE 5I73B 3WXVL 3GBLA 2A83B 5ERWB 1NEZB 1OAYL 1CGVA 4XC3H 4E41E 2JJTC 2C1PB 4C58B 1I4FB 3TH3T 5DMYA 4OKVA 5BQ7B 2J8UE 1DQTA 2HP4A 4GRLA 5I8OH 1KC5H 2FSEB 4MLSA 1KELL 1OGAB 4FRWA 3ULUE 3TN0C 3UAJD 2WBWB 3EO1B 5JDJA 3GHEH 2VLLB 3T2NH 3MA7B 4JPIB 1EZVY 5D6DA 1UCBH 3EO1A 3KHOA 4GLRH 5FB8A 4NNPL 32C2B 3M17B 1HH9A 4OFYA 4M6OL 2OL3L 3OV6A 5E1HB 2YHGA 1YC7A 2XTLA 2R0LL 4OFYD 5EU6D 2ZWLT 3PQYA 4ZO7A 2GIYA 3WO4B 2LFGA 3P3YA 5BVPH 5L2KD 1OAQL 2DYPB 2EO9A 1KCSH 1BWMA 1EUTA 1F90L 4XWOD 2H9GB 1IAIL 5EBWA 4DEPB 3WDIA 3I50L 2R2HA 5JHDE 4B7IA 5L2JA 5I1AA 1T2QH 1KLGA 3O4LE 2DQUL 4JKPH 5JZ7C 4FFWC 2ICWA 3D3VB 1XGPB 3NTCH 4CJ0A 4X5LA 5IF0B 2DBJA 4D9RE 1C16A 4NSKB 4RFOH 3WHE1 1KPVB 1OCWH 1RK0A 4H1LA 4U05A 3QUZB 4GSDL 3RA7L 4X4YA 1F6FB 4H8WH 1MCNA 3EOAA 4RWYL 4GMTH 4PD4K 3EOBA 3RHWF 1A6PA 1PG7W 1CL7L 3MRIA 3WNMA 4PJHB 3B8SA 4X5WB 5D2LF 5I0DA 2W07A 3C2AH 5K9QG 1DQJB 1WCBA 5ETUA 4L9LA 3QZWA 1I85A 3QUKA 1NUNB 2O5XH 3B5TA 4FFYL 2Y5EA 5EO1A 5C86A 1G9NH 4U1NA 4PLKC 1RZ7H 4RZCA 3RWJB 1FVDA 3S4SG 4CBPA 1XCTA 43C9B 2B1AH 1YDPA 2N56A 4YHLL 5FO7A 1KTKE 4Y5XB 2R8SH 3D0VA 1CDCA 4A6YA 2BSED 4HH9A 1HH6B 5EBLB 1F3JB 1FL5A 3QJFB 2XWJB 1BX2A 4H0GA 4YBLB 5DHYB 5C0FA 3DGGA 2E7CA 4JQIL 2IBZY 5INCA 1ZVYA 5D70H 4G7YH 4POZC 2E27L 1FAIL 5L8KB 4WI8A 1GXEA 4LP4A 4XP1H 4OM1L 1O5DT 3UZQA 1FL6A 3ZTNL 2X1QA 3HMWH 2H2PD 1K4CA 5FUZH 1DL7L 2XRAH 1CFNA 1EFXD 1KG0A 3KPMB 3TP4A 5CKGA 3EYSL 4H20L 4LLYB 2ZUXA 2SEBB 4PGBB 4ONHB 5FHBH 3DETD 1AHWA 4BZ1H 1ZLVH 3ULVF 3RVWC 4MB5A 4M1CC 3V0WL 4PGBA 1CWVA 1AR1C 3I02A 4LSRH 5HYQA 4NKOA 5DJCB 1JTOA 2J3SA 1HOCA 3BW9B 2ZG1A 4YDJA 3U1SH 2M2DA 1RUPL 3FN9A 5I8KH 1JI1A 3HS0B 4NRZA 4FQHA 2HFTA 4NM4H 4N8VA 4Q9QH 4CN6A 1QO3A 1UZ8B 1VEMA 1G9NC 3BKJH 4DQOH 1KPUB 5I1IL 3U9UB 4P2RA 2RJMA 3C08L 2JCCA 4N0YL 4MGXA 2K1MA 3LH2H 1WWAX 5DJ0A 5CJBA 3VE0B 3VRLE 2YD6A 4XPFL 3EGSA 4OCWH 3O45A 5JR1L 5LGHH 3K1DA 4JFEE 2XA8H 4PTTA 3OR7A 1HXYB 1H15B 1U6AL 3C5JA 5TQ0H 1T1YA 1T1ZA 3MROB 2ZSVA 2BVQA 1QLRB 3W2DL 5EBGA 1FNGA 3E8UL 1UWGL 4HV8B 1U8HA 3MRIB 2ICWB 1L0YA 3GNMH 3HPJA 5BMFL 4M5ZH 4V2CB 4H26A 1B0RB 2IPTH 3VFSB 3O41B 3I2CL 5FOJA 4HZLB 1YPZA 3D69A 4JQIH 1J9CT 1NCAL 2D7OA 4RMWA 1KCVH 3QEQA 5KG9A 1OTSD 2BDNH 3VU2A 3V8OA 2KH2B 4U6YB 1U3JA 1J0HA 4JJHA 1KLUB 4MJIB 5HYIA 5FUZL 3QFDA 1HXMA 4OAWA 4S10A 3MV01 4U1LB 3IFLL 4XNXH 2V9RA 5GS3A 1XF1A 4FXKA 3QG7H 5E08H 5F1KC 5HHNB 4QHKJ 5B39B 4G8GE 1GZQA 4ZS7H 3GSNA 12E8L 1J1XL 3TO4C 1FPTH 1YMME 1FORH 5K9JL 2B8OT 2VRAA 5DMKB 4L4VB 1J5OH 1I1YB 4X98A 1KJ2L 3CXDH 4NPYA 1RJZA 3QCTL 1AJ7L 5DK3A 2EYSB 3MLYL 5IMKA 5D1ZC 2XG4A 1T7YA 5IVNA 4W6YB 5GSVB 3SGDH 2R1YA 1RFDL 2XZQL 3O81A 5HPMB 2NNAB 2B4CL 1SM3L 3BKJL 4DQOL 3NFNA 4UUJA 5E9DB 2P24B 2IFFH 4PJ7F 4CN1A 4QHLA 3MX0A 1XF3B 4R90H 2Q7YB 3QRGL 3QULB 3ESUF 5I6XC 2LU3A 5EOTA 3FB8B 1MAMH 1NLBL 1N7ML 3F6LA 4CGTA 2ATKB 2X42A 3U4AA 4MA3A 4OCRL 4JPKH 4QRQB 4X7SL 4HAFA 4V1DA 3NABH 4X6FA 1CR9H 5SWZB 4MXVE 1VACA 4NKMA 3Q5YA 4XPGH 3DO7B 1AKJD 2AQ2A 2ICCA 5E8EA 4QXUH 4G8IA 2AV7A 2HJFB 4XP4L 4KUCD 4F37F 4Z7NE 3WFBH 1OP9A 4PJDE 1MREL 3NPSC 1KTDB 1IAMA 4R0LB 2NY3C 4LLUB 2W0KA 3QQNA 1FYTE 4G8GB 1JHLL 1FVCB 3WNNA 4F33B 3OL2A 1A5FL 5ID0B 5DD5H 2AKRA 4L4VD 4MNGB 5AZ2L 2X6MA 5JPMB 3NGBC 1VEPA 1H8NA 4G5ZH 4N8CH 1ZHKA 3Q6GL 4NQDD 5I74B 4ZFOL 1LVEA 1FO0B 1ZA6A 1UJ3B 5J9PA 5FUCE 3S37L 1JNLL 1PY9A 1S8DA 1D9KD 4K3JH 3D6GA 4OLZL 3MV7B 5FGCE 2OZ4L 1IGJB 3SDAD 1T1WB 4GG6E 3QIUA 2HJLA 4R4BB 3NGBB 2B7DT 2YKLL 3T09A 4WTXA 3WD5H 5EA0L 5DJXB 3UX9B 2VMFA 1A3QA 3QDJA 4NZDA 5SX5H 3SY0B 4NNXB 2AV7B 1PX4A 4LVOC 5E4EC 2BFVH 2WBKA 2FD6H 4XCYB 4ZOBA 4DVBA 1B2WH 1YPZF 2IGFL 1IKNC 1UJTA 4JZNB 5SWSB 1JF1B 4H25B 4JO1L 4NFBA 5C07D 1YA5A 1RUKH 1R3IH 1KN4L 1QLEH 4GUPB 5KJRH 1ED3B 3KLSA 4ZFFA 1U92B 1UEYA 4HUKB 1UM6H 4PJDB 1SJVA 3P11L 4JPVL 3VFPB 4X6CB 2EDYA 3OKEA 3ZDYF 3V4PH 4N9GB 3PGCA 5M95B 5EDXA 4LSQL 1I9JL 3IDJA 3GSOA 1UYWL 2P4AB 3MRFA 1RUAH 4H0IA 5DJ0B 2OJEA 3MROA 3VFWA 3EYOB 4UT9L 3TH2T 3L7FB 4NWUH 2EECA 2XIDA 1HXYA 4Z7WB 3EJZC 4MCYA 1BGXL 2XZAH 3CFBA 2WWMD 4XP5L 4G80B 4KMLB 2HFFB 4HMEA 4O00A 4OZIF 1T5XA 4XVUD 1CXLA 1IC4H 1LP9B 1MFCH 4KVCL 3M45A 1UWXK 3CGTA 3LN5A 4X7TA 4GS7B 4TNVF 2ZUTA 4HK3N 3NAAH 1GIGL 4MCZB 4RGMB 2APBA 3S35X 4L4TD 2SEBA 3H42H 4EI5B 1LO0H 3S7GA 1T04B 3C6LC 4L5FL 3WN5B 1RK0B 3NIDF 1H0DB 2YPVL 2DQIH 3VWKC 4ZOEA 3KPNB 3MJ9L 1I1AA 4RCAA 3SGEH 3TJHD 3AREC 3CU7A 1J1OL 3FT4B 5HHMD 3HMWL 2ATKA 4CDHA 5TGBA 5GS1B 4OV5A 4KTDL 2Y23A 2P44B 2YKLH 1LO2H 1XEDA 4NO3B 1NAKL 2UWEF 4YXKH 3GMPA 4JAMA 1GSMA 4KJQD 4ORGA 2GJJA 4YDIL 3QFJB 2EC9U 3U7YL 1XR9B 2P5ED 2IWGA 3PP3H 1GOHA 3QJFA 1RJYB 5DFVD 5D9SA 2DLGA 4FXGB 3LKRB 2X4PB 2DQGH 3NIGF 2GT9A 4G8GD 3RY6C 4LSRL 2GK0A 1U8QA 1IQDB 4XZUA 4HGWB 4GAGL 5HBBA 3WE6A 3CVHH 2PO6D 1A6VL 1A7NH 3NFPA 4BH7A 5IBLC 4NKIH 4P59L 1A3RH 2JJSA 1OQXA 5I9QC 2VDRL 1JPGA 3VWJA 1J0ZA 3TFKC 4OLVL 3HAEB 2XACC 3LPWA 3MA9H 2BJMH 3EFDL 5EN2B 3JWDC 3MRKB 3D3VD 4Z7WA 1FCCA 4NFDA 3AU1B 5H8DA 4YHKH 4HPYH 5ICZB 4OV6F 1SJEB 3H3KA 1Q1JH 4YDJB 1C5CH 3K0WA 2VLRA 2WANA 3LHPH 1QP1A 4FQJH 3IDMB 2YEZA 8FABB 3K2UH 1XGPA 1FYTA 3QUXC 5HXMA 3UBXG 3QP3A 5SWZA 4MVBC 3HTLX 1TETL 4MMXC 5JHLL 1GHFL 4I5BB 3C09B 5IEHB 1EXUB 1U3HC 4ZOCA 1WFOA 1X7QB 4OZGF 5DLMH 4MD0B 3FOLA 4AEFA 3CSPA 1DQLL 3FN3A 2FR4A 4I1NB 5JXAL 4J3XA 1KXQE 4WWKA 3QEQE 2APFA 4IMLA 4E41B 5DSCB 1FLRH 5F7WC 2GTWB 2A74A 3RNQB 5AD0B 2CXGA 1TCRA 1I7ZB 1YEGH 3MO1A 4RNRB 4XI5C 1U95A 4JREB 3GRWL 4G9DA 3SDCC 5EU6B 4APQA 5J1SC 4R96A 1A6WL 2AJVL 3I84A 3VXPA 4OIIH 2D9CA 5CD5D 3AUVA 3KXFA 1AGEB 5JW4M 1IGJA 3VE0A 1KCKA 1HH9B 3MQIA 3KYNA 4KKAC 4X0KA 2JB5H 1K6QH 4G3YH 4JGJA 5LG1A 4HKBA 1IC7L 5E2VL 3GSQB 1SHMA 3GEWB 3VFTB 3ZZ1A 4XMKL 4OD2B 1KJ2H 1XCQA 5C70A 5JR1H 2Q6WA 1CDIA 4N8VB 3QEQD 4Y1AE 5C09D 3VXUA 1NFIA 1U3YA 4H88H 5F1NB 5D7LA 1U0QA 4Z7VA 2B20A 2ARJB 2MFNA 3BPLB 3KYAA 1R24A 5F7YC 1S9WB 4ODVL 3D3VE 3RTQD 3MRPB 5C0CE 1Y6NR 3SE9L 1NCCL 4O51B 5C0CD 4LVNB 1A1MB 4ORGB 4WEUD 5T3ZL 3BVNA 3QQ3B 1FZOB 4ISVB 4XH2A 4M93B 5GPRA 4WU7B 4RMTA 1Y6MR 4BFBD 1X4ZA 4U6VL 5IOPA 3WJJC 1CXKA 5E6IA 4FFZL 3HMXL 4H8WC 2YEZB 2XKSA 3G6DL 5TE4H 2WNGA 5E2WH 2FLRT 5FYKD 2WW8A 5T5NG 4U1KB 2HH0L 3TIEB 3P4OA 1K8DA 1F97A 1E6JH 2HLAB 1CD8A 5LKNA 1J8HD 5BOPA 3KPRA 2FYYB 5DLML 3LDBC 5E0QA 1IAIM 5DEZA 4BZYA 3SJVD 2B5IC 2KPNA 4YDLC 5AYUH 3UTZB 4WI2A 3DJ9A 2Z31B 3QAZC 5IHBA 3LRSA 5GSVA 1UB5B 3SO3C 1U8LB 2AXFB 2QR0A 4JQXA 2HRLA 1OTTD 3UC0H 3QUMA 1I9IH 1QEWA 3UDWA 4NN7B 2YPLB 4HUVB 1IKFL 3F5WA 1C5BH 2VISA 2QJDA 5C0CB 2NW3A 4UV4L 1MIML 4JHWH 5DGRA 4XRCB 1G9MH 4QHMB 3O6FC 1RVFH 4AIZB 4J6RL 4AG4H 4I9WD 4XMKH 3OXSB 3VW3L 1ZGLB 5IK3B 3N0PB 2JIXD 1C16B 5C0GB 4BQ8A 2XPGB 5FEBA 2PKDA 2PW1B 5KTEL 1U2CA 3QI9D 2AEPH 4IOIA 3PWLB 3CH1B 4NYLB 1KN4H 1I1CA 5ICYA 5FF6B 1CFSB 4M9PA 4OF3A 4WO4B 3ULUD 3I6KB 5KJRL 3BZ4A 1JHTB 2H32H 5E7BA 3ROLA 3QYCA 3D85B 6FABL 1MCCA 2CR3A 2F5BL 5K9OA 3OKKB 4LPUA 4Z7UF 3EAKA 3S3JA 1NGXA 2Y5TA 5JIIA 1EJ6A 1VGKA 1AGBB 2OQJB 4IIQB 2UZIL 1PEZA 5CBAB 4BK4A 3MLPA 4X6DE 3K80A 2VXQH 2HA1A 1FSKB 3BEVB 2QR0B 1BF2A 1PX3A 4OTXL 2QKIA 4WV1C 2UY7A 5BOZG 4BQCA 4QLRA 4QTIL 1QD0A 3BPOC 4HUMB 3F62A 5SV3A 1FVCA 2P43B 5ANME 1LMKA 1T6WA 5IB3B 2DAVA 3UROR 3JWOC 5IHZB 4UB0H 1NC2A 4JHAH 1DDHB 3U9PH 1NAML 5FGRA 4P5TD 3RVUC 2WUBH 1DLFH 1GAFH 5AUMA 3WEXB 1N59A 3BP4B 2YZ1A 1MQKH 4U1JB 3EOAB 1P1ZB 1E0OB 2I26N 2J8UA 2EZ0C 2YUVA 4X6FB 3QUXB 3VFVB 2ENYA 3HE6C 1TZGL 4LASH 4WHYH 5I1JL 1RK1A 1RMFL 1KJMB 4Y2OA 4X80L 3T08A 1X4XA 2MMXA 1MIMH 3KPOA 1K2DA 1LD9B 3U7AA 4FQLH 1Q9OB 2A6IB 1P4BH 5EU5B 3NN8A 5HVWA 3QPXH 3WIHL 1M71B 3F7QA 1T20B 1IEBA 4IRSD 4OCXL 1CTOA 3G5VB 3DARA 5KSVB 2RR3A 3FQNA 2FBJL 1YMMB 2EH7L 4P3DB 4LCUA 3O6MH 4NKDA 4PG2A 5KS9E 3ULUH 2G5BB 2AEQH 4LP5A 3KDMA 5EO0B 3KYKL 3V0AC 3QNZA 1AP2B 1FH5L 1XT5A 4UT9H 4HIIB 2NY3B 3HZKB 4L4VA 3VI4F 5DR5H 1CK0L 1XH3A 3N1MC 4M7ZC 2NZIA 3OJDA 1M6OA 3O11A 1W2KT 4Y19E 2L7JA 3CNKA 3PV6B 3KNBA 4OGXL 5HYEA 3B3IA 4Q74A 3OXRA 1YY9D 3C60A 2QQKH 4P5TB 4L3CA 3L3OB 1E4JA 3KHQA 4P46D 3HI1A 5D1XD 1AKJA 1JGDB 4PLKD 3NCJL 4RIRA 3MRCB 3LQAH 3LVEA 4CAGA 1YN6B 1Q0XL 5C3LD 5ISZA 2JJVA 4YHKL 4D9QD 1QFOA 1LK2A 2BNQB 4JPWH 5EWIH 2VDQH 3LEVL 5CCKH 3H8NA 2UZYB 5C9JA 1EO8L 4K9EH 4NOBA 3ZSTA 2X9XA 2A6JB 1U8MA 2HG5A 4PJ7A 2HTLD 1N3NA 2EDDA 3FRPG 5KS9A 2IBGA 3O6FB 2BVUA 3TO2A 1G7IB 3L5JA 1DFBH 2VLME 3TF7C 5ENWA 4LLVA 2GITA 1WAAE 4HQQH 3O9WC 3I6LD 2BNRD 3PDGA 1TZGH 3LN9A 4LASL 1MCJA 1AY1L 4BZ2L 1TFHA 1J8HE 2IMNA 4PTTB 4ZYKB 5GRVK 4I77L 3QIBD 2R9HC 4KK6C 5T1MB 3DMMC 4RGOL 2DKUA 3F65A 5JLZB 2O5ZL 4XVJH 4LPWA 3OF6A 4LCYB 3TVMD 2E9BA 3N85L 4LCCC 2FX8H 2RCSH 5GISL 3JXAA 1ZSDB 3LAFA 3O3DB 3CLFH 4ONFL 2ADJA 3MJ8B 2VZVA 5CZXD 2HT3D 3DSNA 2D7MA 4GQ9H 3TT1H 1P7QD 3HC3H 4PS4L 3WNLA 1X5JA 2J6EH 4H88L 1AO7D 2FGZA 5T3ZD 4PGDA 3E6FA 4Y5YC 1W0WB 4AENB 3IT8D 4HZLA 4Y2DC 5D7JB 3K4ZA 3FL7A 3EYVB 5DUBB 5TE7H 4D9LH 1H3PH 3VXQA 2J12B 4PJGA 3UTTD 5T3ZH 2F74A 1D5XA 5BVPL 1RD6A 4LEXH 4OGYL 4QRUA 4I2XB 1JJUA 5D7SL 3V0VA 1U8OA 2Q87A 1CXIA 1U8HB 3TNMA 5JW5B 1ITBB 4JFOA 5DYOA 1FZJA 5CHNA 3U79A 2AABL 1OVZA 4MA8L 2IPKB 2OM5A 4Y5VA 2FEDC 1MH5B 1DVFA 5EULV 4JKPL 1MCDA 5B21A 2CIIB 1XR8B 1DVFD 1YMMD 5J06A 4LF3B 4RRPA 4PJ8C 1EAPA 1EEZB 1MCOL 3SCMC 1YY9C 5F9JA 5EU3A 1I7RB 4X7FC 2NY0D 4AH2B 2FJGB 2UYLB 3ARQA 4IDJH 4P2QB 5TQ2L 3JV0A 5D1QB 4LQ1A 2ZG3A 1SBSH 4LIQL 1AGDA 3BT2L 5DJZB 3QHFH 4KRPB 1OPGH 4BSWB 4LKXB 1CDHA 5ECJE 5KVFH 2DLFH 3CFEA 5DVOA 1P7KB 1HZHH 1OF2B 3QH3A 3VXQB 3QRFM 3UJTH 2MKWA 5IUSA 2VQUA 1RURL 2EYTA 4HW6A 1B4JL 1BFVL 3QIBB 1BEYH 2AERT 4I4WA 5I1HL 1EEQA 1F11A 2V9TA 3BQUB 1KN2L 3O3BA 2MPAL 3O9WA 1PY4A 4HCRA 5HGBA 1NLDH 1FE8H 5H35B 2Q1EA 1OGTA 4UMGA 4I2XE 3HUJB 1GC1L 2UVFA 4Y5YA 1VGEH 3B9KB 4ZFOA 2HFEA 1FV1B 1INEH 4KY1H 3UTSD 1BD2E 4HS8H 4PY7A 4B41A 5INDB 2YRZA 5L2KB 2VDNL 5I66B 3HI5L 2G5RA 3EYSH 3V5DB 1ZANH 2IQAA 5E99H 4J23A 3MTRA 4XAWL 1UQSB 2FHCA 4LVOB 4M9OA 5E56A 4ELME 2HT4C 3BO8B 3BGFB 5GGVY 2BCKB 2CRYA 9CGTA 3P9MB 5IR1A 2JCCE 5D96C 5DRZA 1MRDH 1ZHNB 2VZSA 4HBQA 4PJCA 3RZCC 4R8WL 5DJ6B 1RIHH 2HLFD 4Z7VE 3H9YA 4U1NB 4ZUTB 1ZT4A 2VOTA 2WIIA 1UADC 1CBVH 3U46B 1XGQB 5GS0L 2C3HA 3ET9F 1I8MB 3V6BR 2VXQL 5DA4A 4PJXA 1S9YB 1HHGA 1J87A 1MFBH 4P2QD 4R4NC 3ARXA 1GGCL 4KI5E 4OZ4A 2I25N 5GZND 1N4XH 5DQJB 2EIEA 5DT1H 2RFXB 3SGDI 1F4WH 2IANA 3RGVA 1WIUA 5KANG 4XBPA 2O5YL 1SBSL 3HAEH 4LIQH 5D8JL 1ZAGA 3KAAA 1IAKB 2FBOJ 5I15L 5HVHB 4U1IB 4Y4FC 3RKDC 2MCG1 5JNYA 2P8LB 5IF0A 5E8OA 2P1YA 4DN3H 3SDAC 5E8DH 3IS0X 3BESR 4YUEL 5IG7B 2DM2A 2Z4QA 4X7DC 4RGNC 5ALCL 4UINH 5IB2B 1CZ8H 1OAUL 4JRXD 3F7PC 4OQTA 3AY4A 2R23B 3SDDD 1EEYA 3BRGC 2D31B 2QHRL 4OCSH 3GBMH 1ZLWK 1DBJL 1KB9K 1KN2H 4B53A 3C8KB 3QNZB 3X12B 1XF5A 4ENED 4XC1H 2EDNA 3KPSA 1S7XA 2CKBH 1OARH 2WLZA 4WW1B 3SEPA 5FK9A 3RGVC 4C56A 4EN3C 2EDOA 2P24A 1IGYA 4PPTA 5A2IH 5ENWB 3VMPA 3VGFA 2X70A 1IGYB 3ARSA 3V6ZB 1HKLL 1R5WB 4JFXA 5BXFA 5LXGL 1INEL 1IM3A 3O6ML 2DIJA 1JWSB 4AIZA 3KR3L 3UYRH 5F1SA 3VGAC 1T22A 2PYED 2X1OA 1LEKA 3EJJX 3L6FA 4L3EA 2V5MA 2YA0A 4O4YL 4XP6L 1FGNL 1F4HA 1NCUA 2W0FA 4N0UA 3H0TB 2YUWA 1J1XH 3GHBL 3T1WA 1FQ9C 3WIFA 2X4UB 2YPLA 5GS2H 4QXGL 2IH1B 4U6XB 1IARB 1KPRA 4L8CA 4YDLB 1F3DJ 2BXZA 2R29H 5GSRB 1AE6L 4L29A 1CBVL 3BH9B 2A77L 3QEHA 5FOBB 3D39E 2XZQH 4Z0XB 2WV3A 4BFGA 2R0WL 1AGFA 2AVGA 4L8BB 1FL3A 5CD5C 4G8FB 3UTTE 1CGUA 1KPUA 5J1AB 1J86A 1BVKB 5MENA 3O41A 4J3OC 3CXHJ 4Z77B 1UGNA 4LCIH 1FRGH 3DVGA 3C09C 5SX4H 5HY9A 1OD7A 2AK4D 5SWSD 5IMMA 1C7TA 4OZFG 2OK0H 1DE4B 2ICEB 1G7MB 3CK0L 3NABL 3HRZA 2DIAA 2B0SH 3TBYB 3GSUB 2O5XL 3KWWB 4FFYH 1A6AB 1WFTA 5CZVH 4KVNL 4HEME 3T2PA 3FO1B 2P7TB 4PGCA 1NBQA 1MF2H 2Z0BA 1KYOK 3BSZH 1YY8A 1QG3A 2NXZD 4IEFB 3TO4B 4BKLB 2A0LD 4Y19A 4NZUL 4P9HL 2B1AL 1D5ZA 1WWWX 1NMCB 5C07B 4ZSOA 4EUPG 2Y7QB 2ORBL 2W9DL 1XF4B 5H94B 4PJFE 5ALBL 3QI9A 4K7PH 5C1MB 3MRHB 3RUGA 2EIZB 1DN0B 4IMKA 4NQDB 3MGOB 2R56L 3SDXA 4QCIA 4U6XA 4RFEA 3MMEB 4X7EC 1U91B 3IFPA 2ENSA 5HHXL 1LE5B 3FHQA 1IGML 4JHZA 1JNLH 5DXWA 3REWB 1HHIB 1HINL 3D39B 4BUHA 5DQDH 2JJTA 4NKOB 1PLGL 2YA1A 3FMGL 5DJCA 4I4WB 3MJGX 1EHLL 4TOYL 1WVZA 3HZYA 2PTUA 2V2XA 1MJUL 3O2VH 2Z93A 3IKCB 2XTJE 3ARDD 1W72A 4XHJD 3W9DB 2MCPL 1CDUA 1YQVH 1G6VK 1KCRH 5JTWA 3E6HA 3V6ZA 1P2CB 1UFUA 4PBVC 1ZSDA 1DP0A 2NY2D 3I75B 2D7PA 1F4YH 4Y7MA 4ZPVA 5I18H 1BIHA 3F7VA 3O8XC 5I1DA 3QDMB 4PYGA 4XCFH 4JGMA 4PJ5B 1Q38A 1KIQB 2YBRB 2FR4B 4YPJA 5D1QA 5B22A 1XF5B 5TJWK 4JB9L 3QUYB 3LCYA 4ODXB 3UJIL 3L5XL 4I48A 1N64L 2VDLL 1Q94A 4P48A 3BKCL 1S78D 2QBWA 2CK0L 4P4KB 3IU3B 2YA2A 4OGZA 4KTEL 4AMKL 3RDTD 4PJFB 2AJZA 1I3GH 1A9EA 3A6CL 1GC1C 2D03L 2P8LA 5I1AB 3N85H 2BSRB 1WZKA 3QO0B 1K5NA 3L3IA 5LAXA 1J0KA 1IGCH 2QQQA 5EOQH 1GJIA 4FTVE 1LEGB 3FB7B 3QQ3A 4TULL 1GCFA 1MWAH 3TT3H 1C5DB 4I18B 2NR6C 1R3JB 3ARBC 4WUKH 4PS4H 1UH3A 3ARGA 3GSRB 3W0WD 3PQYE 1AD0B 3E6FB 2BX5A 4ALAL 1UWGH 5C0BE 2OTUA 2EIBA 4JFPA 5ALBH 3MGTA 3G6JE 3LQZB 1VEOA 2DTML 3RVVC 1E4XH 3FRUA 1J0IA 4U7MA 5L0QC 4LNRB 4TRPH 2ZSWB 1OTUD 1NH6A 1OM3H 2VQ1A 2YPVH 4GBXC 2NXZC 3IAQA 3QUML 4JDTH 3GHEL 1QSVA 3U4EA 1X5LA 2CGRH 1ZLSL 3OKNA 4OI9A 1FNEA 5IJVB 1NMBH 4KI5D 1F45A 4XNMA 1FNFA 5T1MA 2YOCA 1TZIB 2NY1C 1XIWC 3FO9A 4ZTPH 5IMOA 3TBWA 3T2QA 5F3BA 4WO4C 1U8JB 3PXJA 1OY3B 3WXWL 2H6PB 5DRWA 4HWUA 5IT2L 4RGMC 1S9XA 3S6CA 1AI1L 4APQC 3BPNB 5B8CB 2GJ6D 2ZCHL 4WUUB 3Q48A 1OP3K 1NKRA 2DICA 3CXDL 3DBXA 43CAB 3ZKMD 2DQUH 2GJZB 4GT7A 4AK1A 2BNQA 4FZ8H 4NCC1 3O3AB 4LRIC 3QHTC 1AGFB 4TUOB 1I3VA 3MUY1 3SJVB 1PG7X 3V6OE 3QIWD 8FABA 5GS0H 1X6NA 1HILB 2OJZL 4JFQB 5IEKB 5C0RH 4WFFD 1MLBA 4OBRA 1X4YA 1RIUH 4JKKA 4KUZH 1NGWB 3L95B 1OSZA 1U91A 4HKZA 1I3GL 3CFCH 3CFEB 1G7QB 4ZFGL 1BOGA 2EYRB 4EN3B 2GSIA 4FQQA 4XNQB 1H5BB 4R97C 1DUYA 3DUHA 3JZ7A 2NQCA 1JUFA 4WGWB 5KSAC 1TENA 1KC5L 5MHSE 3T4YB 4ACPA 3FKUS 3T2OA 3T04D 4YJZL 4NHCL 3RL2A 4K7PY 5JIKA 4GRLC 5F6IC 1J8HB 4D0CA 4JO3H 2APTA 1T0NA 3HZKA 3LOWA 1RUQL 2EDQA 3V5DA 3MREB 4X8JB 5I1DB 2VB5A 1JGLL 3DIFB 2OQJA 4IIQA 2E7HA 4PP1D 2ADIA 5HI5D 1F42A 2AXGB 1S7UB 3AXLB 3WS3A 3BO8A 3O4OB 2R15A 5ADPL 5CJQH 3ISWA 1QLFA 5DMGD 4GRWB 5ITFB 4N5UA 3GSNL 4PG2C 3VRJA 5I66A 3PL6C 3OMZA 4DVRL 3Q6GH 1F4AA 1PZ5B 3Q0HA 2HFEB 5E6ZA 1IBGH 4DJMA 2J8UB 3RTQB 5DD6B 3LIZH 2KQMA 4JY5H 4JG1L 3WEXA 1QQDA 5FHBL 1XGUA 5ACZB 4F8TA 5DS8B 1U36A 2F53B 1T03H 4HC1L 1NC4A 3TZVA 4X8XA 2WBJD 3LS5H 3PP4L 5FM8A 4J2XA 2F8XC 5GJSH 4XB7A 2R0LH 1UEMA 3FHAA 4D3CL 3VXSA 1NC2B 2CKBB 2WBJA 4LCCA 4OLUH 3CSYA 3HE6A 4Q0XL 1CLOL 4PY8J 5H2BA 2BSTB 3QQ4A 1MSPA 3DVIA 5J12C 1AD0A 1PYWB 2VAAA 1F6AA 4XCCH 4N8VG 4FQXC 3BEWB 4KQ3H 1ZT7B 4I0CC 5T1LD 3VD7A 3G5XB 3FJTA 4W70A 2X4OB 3U0PB 3NFPB 3X3FH 5KVEL 4P5TC 4OLYH 4ZYKA 4UINL 1UB6B 2OR7A 1RIVH 3QCUH 4OZFB 4EOWH 5FGBC 1WISA 5AG9A 4L9DA 4XPFH 1ZTXL 4TVPL 5CBAA 1IAII 4MA1B 3HMXH 4WV1A 2GK0B 4PJ9B 3FQRA 3UTOA 3VFOB 4H8WL 2Y5TB 3VG0L 4AH2A 5I6XB 3GGWA 5JA8B 1YEJL 3ZE1E 2HTKD 4MDIA 5GRJH 3N1QC 1T83A 3QFJA 2ICES 4HS3B 3OPZH 4NHCH 1FAIH 1GPOL 3IDGA 4JRWA 5D4QA 5C0BA 1DQDL 4MZ3A 2BVEA 4LPXA 1NBVH 4GW4A 5EG6C 3REVB 3FT4A 4X4ME 1X44A 5IBTH 1W0WA 1GZPB 1DSFL 3OBAA 1PD6A 1XZ0A 1CLZL 3CC5A 5FDWB 4H20H 3ZYJA 3MXVL 2EYRA 5B3JF 1YN6A 1MCBA 1IC4L 1MFCL 2ORBH 1D5XB 4AL8H 4RISL 2A9MH 4K7PL 3EYQC 3GI9L 1CF8H 4Y5XC 2ARWA 2Z92B 1JRHH 3BWUC 3C60B 2HRPH 4YQXH 3PIQA 4XBPB 1KIUA 2ITCB 4TSCH 4TQEH 1W8NA 5IJKA 4O51A 4OM0H 2HVKB 2BP3A 2ADFH 2C4FU 3M8OL 4ZNCD 1RJLA 1U8NB 5GS2D 1OP3H 2NX5A 5IV2B 4LMQE 1PG7L 5K59F 2H1PH 3H6JA 5HHMB 3QNXB 4PGJA 5EOCJ 5FA3B 2EICA 4N0YH 3LS4L 4G43A 4YDKH 2G5BA 4PR5A 1DANT 1YQVL 4WW1A 3PUCA 4X5XA 5IKCA 4NUJB 3PWPD 4YAQB 1QUNA 2P5EB 3TO2B 1BWWA 1I8KA 5D7JC 3CUPB 3I50H 4APQB 1T2QL 4HFUH 1U9KA 5TPWH 4Z8FH 2MOVA 2QQLL 4OIBA 1JZ4A 4J3VA 4J3TA 4GUPA 4JY6A 1UZ6F 2VE6B 5KSUA 4GAYB 5DFWH 4ELKA 2Y07H 4UAOB 4KH2A 4BQ6A 1XGRA 5ISZB 4RRPG 5D1ZD 2ADGB 4OF8A 3OAZK 1EJOL 3QDJB 3SY0A 4YX2H 1X7QA 3FZUC 2BDNL 5E00B 4XC3L 1BZ7B 4HPYL 2VNCA 1MAKA 1U2HA 4MAYB 4V2BA 5I8OL 3QB7C 1A1MA 5TQ0L 3KJ4C 5ID1B 3TA3D 5TDPA 4YHIA 5IBTL 2Q6WB 4XMPL 1OAZL 4D9QE 3BH9A 2DQEH 2RIKA 1CLZH 1O0VA 3U9PL 4F3FA 3B2UC 5E08L 1P7QB 1ORSB 4JFYB 5HGHA 1DLFL 3JBG7 1FPTL 3QSKB 5I8CB 3QCVH 4KZDL 3BPCB 5E8NB 5DRZB 5BMFH 5D93B 4LCYA 5EH1A 4YFLI 1AGEA 5JLZA 3CFDA 5I1EL 3H9SA 4Z5RA 1KCVL 4YXHH 3NACH 1E4KC 3BPOB 1MEXL 3N50A 4PJ7E 4P46B 3ZKNC 5FV1L 3KYOB 3BH8B 1OAXH 1A4JB 1MWAB 2E6PA 3RBGA 2BVPB 1CLCA 4GG6A 4PY8I 4ZODA 4YDKL 3E3QC 4LLDB 3WD5L 1CQYA 1HEZA 4YO0A 2EH7H 2CRMA 1WF5A 3HKFA 4PRDA 4RWYH 1YPZB 2RGSA 3D69B 4UV7H 4F7MB 3T4AB 4PRIA 4MXVF 1T4KB 3OR6A 4H26B 3O3BB 3TIDB 4LIQE 4Q9CA 5L7XH 4KMTH 3W0WE 3RZCA 1QSEB 4KXZI 3OWEA 5E5RB 3PWPA 2HKHL 4K8RL 2Z4QB 4RMVA 4PJDF 4NP4H 1DQMH 4Y4KD 3U7WH 1KB5A 3TT3L 4UDTA 4ZFZB 4PBXA 5IVXE 3ELAT 3C08H 2ARJQ 3QDJD 3X3GL 4X6CE 1TPXC 4PB0H 4EZMA 3CDYA 4P2OA 3PGFH 3RWEA 4ODSH 2AXHA 2DM7A 3BPLC 1BAFL 1Q0XH 3MOBH 2DTMH 4Z7WF 5I74C 3OJDB 4P4KC 3HG1D 5EU3B 3T0AA 2R69L 5LJYH 3RVWD 3ZE2E 5GGVH 4BH7B 5CCKL 3RNKB 3B9VA 4OFIA 3IJHB 5EO0A 4JHBA 1A7OL 5DEGB 3HRZB 1FIEA 2EXWD 2RAMA 3OX8A 5B38B 3BKML 3SOBH 1MLCA 1KJ3H 3O8XB 3TBWB 2LAGB 3FFDB 1WWCA 3FQRB 3NAAL 4L4TE 3VFOA 3WFBL 3L3HA 1JNHB 5GGSY 1CICD 3H2WA 4KZDH 3ARUA 2A6KB 4WHTA 1F4XH 1PW3A 5IQ7L 5LBSH 1ZT1B 1JYNA 4NBZB 3AY4C 4LPVA 2E3VA 1P53A 4LLYA 3DUUA 4NO3A 4XPHL 1RK1B 3I75A 4RGOH 2ZSWA 2EDKA 1NL0L 3QUYD 4MQXC 1RUML 4PV9B 4QOKA 5BJTA 3DPBA 3SHSA 1N5AA 4QRTA 3K4AA 2NY4D 4GBXB 4Y5YB 5E8PA 5HI3D 4UDTB 5JOFA 4ZS7L 4WFHE 1BX2B 4BFEA 3BYYA 2VLLA 1RVFL 5GJSL 1JHKL 1FZKB 3KYNB 4X0KB 3T3PE 2PR4L 1JF5A 1QSED 3MV9A 4KJWC 1BQHG 4Q0XH 5C0DA 3IDXH 3D0VB 2JIXA 1BF8A 3RU8L 3RIFF 1QFPA 2A0LC 4MA7H 1U6AH 4EKXA 1A3LL 4XCCL 3QO0A 4GLRI 4UIKH 1MCQA 1TCRB 1NUDA 4OQTH 4YNYB 3X13A 5D7SH 3VD3A 4A6YH 4HD9A 2NW2A 3RAJH 4J3UA 1BVLB 3SQBA 1JWMB 1M7XA 5IIEA 3O3EA 4L4TB 4P46A 4GAJH 2DBLH 1S7XB 3EYUL 3WLWD 4E5XA 4AQ1B 1U3ZA 1WC7B 2C3GA 3FOLB 2FO1A 4OFDA 1NGYB 3ARVA 4MWFB 1I9JH 5HSFA 3Q1SL 3NBNA 5J6GB 5IEHA 3GMMA 2NXZB 3TO4D 2V2TA 4P3CL 4HIXL 3T0EC 4G6JH 2FX7H 4M43H 3MYZA 3UYOD 4DVRH 5C9JB 2KQNA 3DRQA 5T33L 2IQ9H 1QPPA 5IK3A 2VLJD 3QEHB 4POZD 5FYLE 3TCLB 2IPKA 4Y5VB 4TSAL 1MPAL 4HWEH 4L29B 5C92A 5T3XL 5MEOA 3ALXA 4WU7A 3KS0J 4HJGA 2YD4A 4ZD3H 3HE7B 4J1UA 5F7DB 4W4NA 1FVEB 1PKQB 3ULUF 1ZEAL 1QVOB 1Q9KA 2AQ1A 4AENA 4G5ZL 1JPGB 4N8CL 4LRNL 2MNUA 3S3SA 1C1EL 3UTPE 3MV8B 1MAJA 1RUMH 4Y0GA 2R1YB 4NRYA 5HDBE 3VGAB 2DD8L 4WTZA 4I0PD 4ZQKB 4IRJB 5SWQB 1T5WB 5T5FL 4X9BA 4Z76A 3IXTA 2AKRB 4MNGA 4OSUH 1FE8L 3BP7B 4YO0B 1AP2A 1I4FA 3DTXA 2H45A 4KTDH 4IBLT 1K6QL 4PUBH 3S35L 4YEFA 1LO2L 5KVDH 2P47B 1G9EA 3DHJA 5JORA 5D1QD 3QRGH 3ZDXF 4YXKL 4M02A 3NZHH 1MNUL 1MIEH 3DSFL 2E5EA 5CS7A 2R1WB 4M1DH 4UT7H 4LLWA 1QBLL 3T65A 1CS6A 1INQB 5F97E 2JE8A 1B2WL 2J1KA 4OAWB 4UIKL 4U49A 1GPOH 2ZUQB 5EIIA 4NO0B 2ZG2A 4KKAD 2GTZA 1QACA 5JHLH 5IWLA 3W9EA 3EKCA 4YHOH 3CVIL 4K3GA 5D2LE 4TN9A 2JKXA 4YHPA 1JWUB 1N3NB 5K9KB 3T3MF 3P11H 4FP8L 5FYKL 5EBWB 3AMLA 1H8SA 2VDRH 4X6BB 4XRCA 3MOQA 5TDPB 4Q9BA 1P7HL 2FECL 4YWGH 1JBJA 4Z0XA 4FABH 4MAUH 2Y6SD 1CGTA 5IFJB 1G84A 3HNTH 2FO4A 1CGYA 1C08A 4XPBL 2IQ9L 4IMKC 4TQEL 1I7UB 4DEPC 1N4XL 1RJZB 1D6VL 5FB8B 4LDOB 4Z0BL 5JHDB 1T5WA 5KOVC 1NMCC 2EKSB 5F8QC 3C5ZB 4HJJH 4F9PA 2AK1L 3AS1A 1L7TH 3KLHD 1T7XA 5D1ZA 3K8KA 3F12A 3T1FA 5BS0E 4YFLF 4FTVA 2XNAA 1Z0MA 3WIHA 4HS3A 3OJMB 4U0RB 1F2QA 2E7LA 4L5FH 4MDIB 5DJ6A 1LNUB 3OKYA 4CW1B 3LKSB 1JYWA 4K23L 5HDQL 4JO1H 3ZE0E 3EDKA 1B6UA 4HFUL 5EU4A 4FXGA 2E6QA 4GKNA 1CL7I 3OXSA 3DI2B 1MVUB 2PW2A 5J11B 4JO4H 1ADQH 2DWEA 5EU7E 1XFPA 3EJZD 3EOYG 1D5MA 4NT6B 4OLWL 5FA4B 5DUBA 2R39A 1ADQA 2E6JA 4K8RD 2XQYK 3CDFA 4HWZA 5I17A 3QEUA 1FZOA 4ISVA 2XY1A 2YC1A 4NHUB 4NRXA 2WBJB 2HH0H 1G1YA 2X7LA 5A1AA 5F7LB 5CEZH 1IGIH 2APVA 3WDHA 3CFBB 4HH8A 2J6EA 4QGYA 4Y1AB 3VRLF 2VLKD 5CP3H 3UTTA 2GCYB 3C8HA 1R0AH 1AHWC 3ZTJG 2YN3A 1W72L 2K9UA 3C5JB 1HKFA 1K4DB 3ARED 1DDHA 2VN7A 1P4IL 4EDWL 5A2JH 4HUWB 2Y7QA 3O45B 2YR3A 1VKXB 4LHQB 5FO7B 4MCYB 5TDNA 5TH2B 1TQBC 1FNLA 3RX8A 2NY3D 1ERNA 5ITFA 2WIIB 3WO4C 1Q1JL 2NY6D 1VESA 3T0EE 3Q6FB 2AK4A 4K2UL 1AXTL 4TVPE 4FQJL 4IHOB 3G9AB 3QNYB 1A7OH 2P5WA 1YNLH 4RX4A 1Q9WB 4C54A 2AI0H 3OKEB 3BP6B 4JHWL 1D9KC 5LQBL 2AK1H 4EDXA 2Y36H 3V79C 4JO2H 4NKQB 1JGUH 3I02B 4JM4H 2DWEB 1IQWH 3T0WA 1T4KA 4WU5A 3I85A 5A2KH 1BVKA 3W81A 3BN9C 1MF2L 3LRGA 1UACL 4JFOB 1X5ZA 5DYOB 3TVMC 2IG2L 4X99A 3TNNA 5E94A 3EOTL 4LNVA 1RZ8B 3O6LH 4LHUA 5F89A 5FUOL 1YJDC 3QQ9C 1CYGA 3RY4A 3GSQA 4ZUSB 5EIQA 5CZXC 1MLBB 3VXUB 1U42A 4KMQA 5BS0A 4Y8AA 5A16A 3H7BB 3SDXF 4JFFB 1EHXA 4X6DF 5KVGL 1M6OB 3GK8H 3MBED 2AAVA 2ZUVA 3O3AA 1KENH 1G9ML 5DO2C 5E2VH 3FO2B 2VH5L 1ZLWH 4G9DB 5F7UA 4WUUD 4Y5XA 4NNPH 3U4BL 4OFKA 3VRJB 3EO0A 2Q86A 3S88H 3VW3H 4GKSA 3T0EB 1QLFB 3STLB 3TVMB 1Q72L 4K71C 3KLAA 3VXMB 1AQKH 1ZANL 6CGTA 4O2CA 5GIRB 3SKJL 5JDSB 4XAWH 1KLUA 3G5YA 5KSAD 3SE3A 3TJEL 4JHAL 2QQKL 1TETH 1WBXB 3MYJB 2PCPB 3EDFA 1IZKA 3QHZH 1X5IA 4PJHA 4LSVL 4GRLD 3IDUA 2VSCA 1YEEL 2FB4H 3GMPB 5IB5B 5E8EB 1VFBB 3DVFA 3QDJE 4HXAH 4TYUA 4O2EB 3TN0A 4F7MA 5J8OA 2HMIC 1DJSA 2I07B 4FN0A 5FYJU 4PJ8B 4UOW1 3MNVA 4K9EL 1YEFH 2GSIB 1ZGLP 1CFTA 3V0VB 3S98A 3ARFA 1HQRA 4YFDB 1TITA 2GJ6B 5FGBA 4U7KA 4JFHD 4JRYA 5GGTA 4PJEB 2ICWI 4MQTB 3HZVB 4UB0L 3MACH 4UNTA 5ANMB 5HVHC 1CD0A 5ISZD 2BRRL 1RULL 2X1XR 5EIVA 5LGJB 1Z9SA 4BSVB 3KYKH 4FNLH 5ALCH 1ZA6B 2WBJC 4GG6F 3O6LL 2AJZB 1R3HB 3BIAX 1ZT4B 4M3JA 3KYMA 3BAEH 3L9RA 2A73B 8CGTA 1BZ9B 3AS2A 1OARL 1S5HA 2IALA 1UKQA 1OB1A 1GVIA 4GXUM 4M7LL 5DJ2A 3OKOB 1IC1A 4HIIA 3BJ91 4RFNB 2OXGA 3OHXA 1A7QH 2F54E 3GB7B 5KVDL 3WIHH 1YPZE 2FGWL 5HJ3A 4DZBB 3GSVB 3GI8H 2FHBA 2UV3A 2XQBL 3CDCA 4FG6D 3TCLA 5ILTH 5MP6H 3DO7A 1CDBA 3MBXL 4Y16B 4YHNA 4LU5H 4MYWB 4GW5B 3EDJA 1RV6X 4MA3B 1NFDF 3ZDYE 3PHOB 3MBEC 2DJ4A 3CJJA 3W9DA 1AR2A 5D71H 5EZOH 5JZ7D 1VFBA 4OFVA 4MJ6A 5HD8C 2HT2D 1J88A 4YHOL 5D5MA 1T66D 2W65A 4ZTOL 5IVXB 6FABH 3QUXD 3JV4A 4I3SH 3IS1X 2RBLA 5DRNA 1YNTB 2ERJC 4C59B 1HDMA 5EO9A 2VLKB 1ZGLM 2K3TA 4KAQL 4Z95L 2IAMA 3MUZ1 3WFHA 3OGCA 4D0BB 1N6UA 4RAUA 1AY1H 4BZ2H 1V7MH 4M03A 2EKSA 4O2CB 3IVKB 3BP5B 4HF5H 4I3GA 4OZIE 3MFFA 3IVKA 4BH8A 4AIOA 2GCYA 4ZSOB 3MRKA 3PV6A 2Z31A 2C3VA 1VGKB 3UTQB 1JGVH 3KPTA 5T5FH 2I9TA 3QHFL 4GKZB 4DGYH 1WCBB 3BEVA 3HC0B 1WBZB 4KJPD 3P4LA 4ELMA 3QUYA 4F2MA 4HLZH 3AS0A 3MCLH 4P57A 1G9MC 5IFAH 3LKNB 3P4NA 4DGIL 7FABL 1VENA 4NT6A 4D94A 4NBYB 4HGWA 5I1HH 2PW1A 1RZ8A 4ZAKD 1V7NL 4JZNA 1NDGA 4G6AC 4P5MB 1T89C 3GJFB 3OG6B 5ESQA 2WP3O 3FTGB 4Y16A 4PRHB 1JHTA 4JG0H 1PZUB 3FOMB 3GNML 4P2RD 2B39A 3A6BH 1BFTA 4WO4A 4DAGL 1NLDL 3MLSH 1MHPH 2ESVE 3AC0A 3BHBB 5ADPH 1B0GB 5HHVH 2KDGA 2CLZA 3VFUB 1KIPA 3NIGE 1INQA 1QNZH 1WFNA 1G7JB 1I8IB 3QIUB 1HQ4A 3RWGB 5BZDA 1TVBB 1SEQL 3B4NA 3UO1L 5I71B 5IBUB 3HI5H 4EUPA 1NCTA 2ADIB 1T1WA 1MY5A 2VL5B 3QZWG 3RNKA 2F19H 2WK2A 4XGZA 3DGGB 5E5UB 4EI6B 5DMIL 4IRJA 1H15A 2WQ8A 2W0FB 3ZT7A 4HH9B 1WIOA 3VWJC 3SDCB 1DLHA 2Z8SA 3DVNB 1JYXA 1RIHL 2JJUA 4I8DA 4ZUWA 4JKWA 2JCCB 1S9KC 1NAMH 3TA3C 1P4IH 1MRFH 2HFFA 2QKIB 1NDMB 1L7TL 1P5UA 4KRMB 4XWGH 4X4XB 4NC1E 3BQUC 4F7TA 4KPHL 3UJTL 5KVEH 5FDYA 3J7HA 4XBGB 3EZJB 3JTSA 3BUYA 4FQ2L 2X7LB 3L5XH 1NFKA 1MFNA 4OUUA 3S96A 1RMFH 3TN0B 2C4FT 3MLVH 3G5ZA 3BRDA 2GTZB 3K8MA 1BBDH 1J05A 4Z77A 4KQ4H 4Q6IB 2Z31D 4XNZB 3VXRA 3HFML 5LQBH 4NO0D 1KNOB 5LCVH 1GGBL 4X7SH 4HIEA 4P2QE 3RPIA 3WUWB 3BZDA 1A6UH 2B2XL 3PDDA 2HWZH 1KEGH 1I8LC 3MRQA 5B8CA 3UZVB 4BSJA 1HNGA 2BNRE 2VDNH 2ARJA 1U58A 4WUKL 4YR6A 3STZA 2AXGA 4U1SB 1U8KA 4UTBL 2VWEE 3D9AH 2XWTA 4YE4H 1EK3A 2ZKHL 3MREA 4X8JA 5FIEA 1YQ2A 4MXWL 2LTQC 3TBSA 1LO4H 1BM3H 3QWRA 5C7XH 3S34L 5DHVH 2V2WB 1F3JA 4OQ1A 1IMHC 4HUVA 1A14H 2HRPL 4YQXL 4OGXH 3VFMA 3D48R 1RZFL 3NIFE 1XH3B 5A43C 2APXA 1UWXH 4ENEC 1N6QH 1IL1B 3P0VH 3LKQA 1IM3B 2NXYD 2UUDK 3BZFB 3NZ8B 2DOCA 4HBCL 1OTUC 5E94B 5E9DD 1RU9H 2GT9B 3RJDA 5FXCH 3AAZB 3QEQB 2X9WA 5KG9B 4XMLL 5FK9B 5EA0H 5BJTB 1JTTA 1BD2B 5KN5B 5TE7L 2XZCH 3HZMA 1INDL 4HWBL 1NCDL 3WHXB 4D9LL 1C8PA 1SMAA 5MEPB 5CIPH 1G7JA 3VXSD 4MD0A 4NQEA 3GMMB 2A6IA 1ZOXA 5TGBB 5GS1A 4MNQA 4K3HA 4IMLB 4JVUA 3DETC 3MGAA 3VDBA 3ARFB 3FOMA 5EPMA 5GJTL 4HHAB 1UXSA 2V7NB 4G42A 3VWJD 1KF9B 2F9BT 1MLCB 2NY5C 5BZWA 1OCWL 1KNOA 2DQHL 2HT3C 1UACH 3KJ4B 4N0CC 1NCWH 3QWOB 1ES0A 2IG2H 1ROWA 5EBMB 2V17L 4Z7QF 5INCB 1H3TA 3FFCD 3RJQB 3MRJB 4XNMB 3EGSB 2BOCB 1IT9L 1WBZA 4PJ5A 5KSBB 1BQSA 2W0PA 3OR7B 1P5VA 1N0XH 1UA6L 2F58H 2XV6B 3QXTA 4PR5B 4NWUL 1SJEA 3VGEA 4A6YB 1EUUA 1YECL 3TVMA 4U1HA 2V5RA 4KVNH 4YNYA 5F70A 3MRBB 3U30B 3HPLA 4GKSB 5GZOC 3D0LA 5BRZB 2FEDD 4YC2C 3R0MA 4R3SB 2FLBT 3H7BA 4NHUA 4LCWA 4U6HA 2R0ZH 5EZJA 3MLWH 2NY4B 4GBXD 1HHIA 2XFXA 1U95B 3SCMD 1KELH 3DRTA 5CKAA 1MFDH 4G6KL 2GY5A 1G0DA 3V4VH 4N0FB 1N5AB 4QRTB 1X5AA 1ZHBA 3TCXA 3INUL 3RWHA 3RWGA 5JW5A 3ZYIA 4Y19D 4QRUB 1GGIH 5FO9A 1PSKH 3C5SA 3D2UD 4NQCB 5BV7L 4JR9L 2H3NB 3QO1B 4ZNEE 4TUJB 3FO1A 1FL5B 3C6SB 1F4YL 5DD0H 5I18L 3HE6D 3IF1B 4KMTL 5T3XE 3B2VL 3TBYA 1NAMA 3WFDL 4CVXA 3QIWC 1TNMA 4GAGH 3STBA 3OZ9L 2D7QA 5E2JA 2EO1A 4RZCB 4LCWB 3RWJA 3TPUA 3U1SL 2C3VB 3EHBD 4OGAC 3UJIH 1H3XA 4WW2F 4KQ3L 3BKCH 3CU1A 4PJFF 1VKXA 3FO2A 1L0XA 5KZCB 4PJBF 1BFVH 2DMCA 2XKNA 4FQPA 1ZKAA 3IETB 3OKDA 2VITB 4WDIB 4CUCA 4M48H 4EXPX 2P46B 3SDCA 4DW2L 1A47A 1M7IA 1X6LA 3BOVA 3DMMD 1HSBB 1UA6H 2JELH 4TTDC 1QRKA 5E00A 4X5WA 2IJ0C 1NC4B 3TZVB 1IGMH 3EOBB 4N0CD 1LHZA 3W9EB 5E8DL 1E4WL 3CXHK 4WENB 2JK5A 1DN0A 3RDTC 2E8ZA 3L1OH 1OP5H 4PV9A 2J88H 2JB6B 4P99A 3S5LG 4P3WA 1XR9A 5CZVL 3ESVF 1AIFB 2ZUYA 1KCLA 1MCLA 2BNQE 2QHRH 3CAFA 4S1SL 1T0PB 4NQCE 1FYHB 1JVKA 2F74B 2GK2A 4KK9D 4QRSA 5D5ME 4LMQI 2H32A 2PYEA 3G6JB 1F4XL 4L8DB 2BOBA 4M61A 3PQYD 4LLAA 4Y2DD 4PTUA 1WT5C 4QF1A 3RBSA 4JFFE 2F8OA 1QNZL 2VKWA 4ZTOH 4EEEA 1K3IA 5GZNC 2ED9A 3PJSA 1MCPH 3BZFA 3VI4E 3BE1H 4NNXA 3PGDB 3TYFB 5D7LB 1NGPH 4ZTPL 3M8OH 1DTUA 2JJSC 3QEGH 5CMAB 3TC9A 2HN7B 4PJ8D 3T0VA 2D7TH 2PTTA 2YMXH 1ZLUK 2V2WA 12E8H 4G3YL 3L9RB 4MXQC 5CWSB 3VXTA 1QSFB 1O7SA 4KDTA 1OOAA 5C2BH 2O5YH 4I0KA 4PFEA 3S5LA 5MERA 4R0LC 3MODH 1P9MA 1G7HB 4HEPG 1P84K 3L95A 4ONGL 4ODVH 4OLXH 4WI6A 4S1DD 4KZEH 4LSPH 2X4UA 4RWHA 4Z8FL 4U2ZA 4APQD 4WIQA 3QDME 4HWZB 5KS9B 2X89A 2R4RL 2R0KH 1E28B 5C0AD 2X89D 4JRYE 4KFZC 5D5MB 3BFOA 3OQ3B 1J10A 4X6BA 4UDUB 1WAAF 2OK0L 4MA1C 4OZHA 2P8PA 3R1GH 4JFXB 5JPNA 4MJ4A 3LKSA 5EORH 4DKEL 1IRAY 1YEKH 3TA3A 1IGFH 1OT1A 4FZEL 5HPOA 5GRZA 1AKJB 3R8BB 5C09B 4QXUL 5E1AB 2OTPA 4IIQC 1ZHLB 3FFCE 4FTVB 5JOEA 1MFEL 4CRPA 5CJXA 4GW1B 2H2SD 1RZKL 3OJ2C 5TDNB 5TH2A 4R7NB 1I1YA 2XN9E 4JZJC 1CD9B 1RZIA 5FYKE 4F15C 3HAEA 2HKFL 3L3GB 2I24N 2GUOA 3RWIB 1IJ9A 4OKDA 4L8SB 1TVHB 3MLUL 2YUXA 2HMID 1T0MB 2HT4D 3VG9C 4ODBD 1W0VA 3C9NB 1NGZB 1T0MA 1RUPH 5H35A 5DMKA 3G04A 4N5EC 4RMQA 4JN2B 5FAAA 1FDLH 4K3JL 1MEXH 2CDFA 4LCUB 1I3RB 1X3DA 4MJIA 2BK8A 1P6AB 1S7WA 2R0WH 1V3JA 2AXJA 1ZLSH 1VERA 3D39D 1NMBL 4PJAB 5D2NE 1M71A 2CMRL 4U3CA 4R0LA 1FORL 3C6SA 3VFNA 2CUIA 2LQRA 4YHZH 1HXMB 3UBXA 4JRYB 2NY6C 4Q6IC 4XNZC 3W11D 3HUJE 3FFDA 2CDEB 1A4KA 4HJ0C 3BHBA 4QXTA 5EUOB 4OUUB 4A2MA 1FNGB 4TVPD 5CINL 2P8MB 1XAUA 4D2NA 1PVHA 4PJCF 1VDGA 4PJ9A 1J18A 3O2DH 2HYMA 4BA8A 1DQML 4Y1AD 5C09E 2ZCLL 3BSZL 3OAZH 4TVPH 3OAUH 4RGND 5DI8B 4PLOB 4TNWF 2VISB 4AT6A 2LVCA 3D9AL 2Z8WC 3V4PL 4ELMB 4DGVH 2NNAA 3X3GH 2EH8L 5T1DL 4J3WA 1QRNA 3OAYK 4L4TA 1QEWB 2D03H 3L3KA 1CGSH 5JDSA 3R1GL 1HWHB 4KHTH 3J8F7 4K3DH 1NBZB 1A14L 5SWQA 4MNQD 4MDJA 4CNIB 2YD1A 3B2UD 3G08A 3VXSB 4ODUA 3HB3C 2JIXB 1HINH 4LBEA 3ROOA 1NGWA 4ZS6D 3GSNB 1DQJA 1PKQA 2L7UA 1Z3GH 3VD4A 1EHLH 3CSBA 4ZDHA 4JFDD 4IRZL 1WICA 3HR6A 1A2YA 4O5LL 4X6CA 3TIEA 4CMHB 1DEEA 3QFJD 3S37X 2XY2A 5DURB 5ACZA 3MLYH 3DRQB 4F57L 4R4ND 4L3EE 3TEUA 3N1FC 1J12A 4QF1B 2YD8A 4JFED 4GRWE 1NL0H 3HR5A 4XCYA 4DVBB 2HVJB 5T1KD 1A6AA 1WBYB 3C87A 4NQEB 4NJAH 3K7UA 2BVTA 1Z2KA 4PRAA 3ZE1F 3MRPA 5E4EB 4Z7VF 3DWTA 4XXDB 2ICEA 3AXLA 3WS3B 1MI5D 4MX7B 1MI5E 2HJLB 4LOUC 4R4BA 2Q8AH 2F53E 2X4RA 1DBML 3LEXA 4QTHA 4WI5A 5J3HD 4P5KA 1S5HB 2AGJH 3I3BA 1HI6B 5FHAH 4YGVA 1N0XL 4QRRA 1YEHL 1BPVA 4Z76B 5JHDA 3IFNL 4BSVA 1G7QA 2W91A 4P2YA 4TULH 1M7IB 3VJ6B 5ID1A 4RGNE 4OQTL 1QR1B 1ZXQA 3ETBF 5DEFB 1CGXA 1FFPA 1BZ7A 4Q7DA 5D1XA 5F9OL 3BKYH 4RISH 2D0HA 2CLRB 3AB0C 5IFHL 4G6MH 2XWTB 1PKOA 2A74B 3JWDH 4FQHB 5SV4A 1A7RL 3LB6D 2NPLX 3U2SA 3ARWA 5JOPD 4M1GH 3CIQA 2C26A 1T6VN 4LGPB 4WFGD 5C8JB 4G7YL 4RAVB 4LGRB 2XN9A 3ULVH 4ODWB 3PG2A 1EERB 2KKQA 2J88L 4IS6B 1AHWB 4Y88A 5T5NF 5MHSD 2FJFB 3BUTA 3MV8D 1R5WA 5BXFB 4M7LT 2DYPA 3RY5A 1A6TA 1S9XB 1K4CB 3G5YB 5IW6A 5E9DE 4V1DE 1R3LB 2A9ML 5ICZA 4TUKH 1CXFA 2WM0A 4ZS6C 2DL2A 3B2VH 3JVGA 1TZIA 4G9FE 1SYSB 2Q86B 2XZZA 2PO6A 4JVWA 2WP3T 3LQMA 3DMMB 5FKAB 3UTSB 4NWTL 4MZ2A 1U41A 1PQZA 1KFAL 3QXUA 4OM0L 3S37H 2DKSA 3DVNA 5D1ZB 1TNNA 3A67H 2MQCA 1WLHA 1JN6A 4KC3B 3PP4H 3VFVA 1JUFB 1H5BA 5HHME 1P1ZA 4CVZB 3X11A 5HVGB 5F3HA 2IANB 4O58L 3RGVB 1KTRL 5I30L 5MEOB 4EJ1C 1FGVL 3K3QA 2P42B 2CQVA 1QKZL 3VD9A 5ETUB 3IXAB 1Q72H 1CVSC 3PWPB 1RY7B 3NA9H 4PREA 1T1XB 4YHYB 2DI9A 3X3FL 1UWEL 1KBGL 4OLYL 3CMGA 3AS3A 5F9WC 3PL6D 2XXCB 1D5BB 1LILA 3WYRA 3QXDB 2XTJB 4IS6A 4PB0L 3PL6A 1ZTXH 1VFUA 2BNUA 2R2EA 5FGCB 3HG1E 2GAZB 5FYKH 3KWWA 1DR9A 4E5XB 1AGBA 4WV1B 2VLRE 2C5DC 2VR9A 3QXWA 5IWLC 1MCOH 1QLRA 4K71B 2H9GA 4QEGA 5CD3B 3GMLA 5HGDB 4FZEH 4Y4HA 3RVTD