1UACH

Crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSSFGSTFYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/hydrolase
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of target epitope-directed functional alteration of an antibody. The case of anti-hen lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uacH00
2C5DC 3NFSH 1PKOA 5EC1B 4AJ0A 1B90A 4R2GB 4JKMA 1P69B 2JJVA 1KJVB 3DVIA 3L5WB 4YDVB 2X4NB 3RI5F 3G6AA 4XNUL 5EOTB 1HK6A 1FG2B 1I8KA 3HCVA 1S78D 3VXME 5IB1A 4ODUA 5IJKC 1CXHA 2A83B 3BPNB 1IAIH 4C83B 2RAMA 4KDWA 3CLFL 3QG7L 2FBJL 4LEOB 3EDFA 4NP4L 4MLIA 4AM0B 3PF2A 4ZSOA 1N5AA 1RUKL 1V3MA 5HDLA 1IKFL 2EH8H 2UZYB 5JA9A 1IAMA 3IAQA 4X7FC 3W39B 1WITA 4JO3H 2WUCH 3T4AB 3OB0H 4MCZA 4WWID 1NGZB 5MEND 4H25A 3B9KC 1AXTH 1IC7L 1JNHA 3FQRA 5HYEA 7FABL 4I48A 4LLWB 4OGYH 2AK1H 5C0CE 1PG7W 5K9QG 5KZCD 1VFBA 5D6CB 1Z9SA 2HRPH 3PL6A 4ZDHB 1FL5B 2OJEA 2BVQA 2ESVD 1U36A 2FJGA 4JY6B 1MCRA 5F7DA 1G7IB 2YWYA 3L3KB 2XWBA 4GAGL 3FQTB 3GSXA 3DI3B 5DJAA 3QI9D 5C3TA 4JG0H 2DLGA 5I75C 2ZUXA 4X5WA 4FQCL 4QRTA 1CGWA 2VDNH 1KELH 3L3HB 1F42A 4NO5B 4C59B 1SM3H 3BRGC 3U0WH 3MRFB 1YNTB 1GOFA 3WL9B 3WXVL 5F7NC 1YC8A 1CDBA 4DUWA 5FYKL 4MAUH 4WO4D 2NXZC 2AK4E 5HJ3A 3CMGA 4QWWC 5A40E 2HJKB 5KVGH 5E08L 1MI5B 4UU9A 5ACMA 1UH3A 4HZAA 2R2HA 5JHDB 4OCLC 4HBCH 5C0FB 3O3DA 4YHZH 4LVHB 4HUKB 4S1RL 4Y5YC 5GGRB 1BP3B 4GG6E 5CHNA 1I9IL 6CGTA 3ARWA 2N4IA 3ZSSA 5DJ2B 4PRPD 5GRUH 1EGJL 1Z9LA 1FE8H 3IFPB 3MV7D 1QFWL 3NCMA 1M4KA 5DJ6A 2YD4A 3UBXA 1JBJA 3Q5TA 3ZO0A 3HE6A 3BAEH 1VACA 4FOMA 4PGEA 2Z4QB 2BNRB 5IK3A 3BKMH 3IU3B 4NRYA 2HFFA 4NC2B 3VDCA 1Y6KR 1DBMH 1RZ7H 5F8QC 1FGNH 5ALBH 3PWVB 1ULVA 1WBZA 3VMOA 5HHOA 4QTHA 3PL6C 2WM0A 3HFMH 5BMFH 1LO2H 3V0VB 2C4FT 4P2OB 3GIZL 4FQJH 1Q8MA 4IS6B 3SCMA 4RA3A 1MCWW 2AVGA 2VITA 2CRIA 3CVIH 3QDJE 3RWDB 1BX2B 4QHLA 32C2B 1KF9B 1S7VA 3B3IA 1A4KB 1K5NA 2QR0B 3PIQA 3IJHB 2HKFL 2FJHA 5E5MB 4F58H 5DA0B 1J1XL 1X5AA 3ARGD 1M7DB 5EG6C 2OL3A 4JEGB 4KKLC 3UJJH 1A6WH 3HTLX 1CFTB 3VD9A 3ZYZA 4LEXH 4LASH 1JNNL 1R3IL 4R7NA 3QXVA 4NSKA 2Y23A 4OLUH 3SKNB 4MA1C 2DWEA 5B4MC 2L0DA 4PRIE 5TPWL 12E8H 2C3HA 1P7QB 2H2PD 3ULVE 2NY3D 5DRNA 1BVKA 1BVLA 4PGZA 3NFPA 4PY7A 3QEUB 5KVMC 1OAZH 4NWUH 3U30B 2V9RA 3T0EE 2A73A 3HE6C 4YK4B 2XN9E 5C70A 3GB7B 2VABB 5GIRA 2D4FA 3W11C 2LU7A 3X13A 1GC1L 3MXVL 4FTVE 1ZVSA 4RFNB 2COQA 3IJSB 4NO3A 1LD9B 3ARZA 4YUEH 2V5SA 3H9SB 4NNPL 1C5DA 2X1WL 2BHZA 3OR6B 4KK6C 2M8XA 4F8QA 1HQ4B 1P1ZA 1NGWB 2PW1A 1K4CB 3QBTB 6FABL 1DBBL 1CLOL 2CKBB 3QNXB 1NBYA 4ZYKB 3BXNA 3EYUH 1IEBB 1UJ3A 1SEBA 3PJSA 1F2QA 3MUJA 4M7LH 4Q2ZA 4OCNC 1B4RA 1U3JA 4OSUH 3ARXA 1U95B 1T2JA 3NIDE 3L7EA 5ACLA 4YXKH 3IAGC 4FQIL 4PRAA 1U41A 2IQAA 3O4LA 4PGDA 5C0GB 2OL3H 3F5WB 5FO7B 1HEZA 2WBKA 3UEZA 3L6FA 1KLGB 4QGYA 5DQ9A 5HVGB 2NY0C 4LHUB 1YUHA 3GEWB 2AW2A 5HSFA 4KK5D 3ZTJH 5E2TL 3D5OF 5IFJA 3RRQA 4WTXA 1XZ0A 2DQHH 4BFBD 3TT3L 2A9NL 4APQA 4XBEL 2NPLX 3MLTA 4GRMB 5IHUH 4MXVE 1DDHA 1G7JB 1MCJA 3CSBA 4MA7L 2F19L 1PG7L 1P4LA 3RL1A 3SO3C 2BY0A 3MRRA 3QR2A 4QHMB 5TE6L 1DL7L 2YR3A 2AAVA 3PHQA 2Y5TA 1MLCB 4JE4B 3PG2A 4XNQA 5B38A 3ZL4L 1KTDA 5TGBB 4ALAL 1BLNB 4XNZC 5HVWA 5IMLB 4F2MB 1NGPH 3MNWB 2D9QB 1JPFB 1MPAH 3U36B 4H88H 1KACB 4R8WH 4KJWD 3G5VB 1MFNA 2VB5A 1F5WA 3REWB 1JHLL 4GAYB 1CFSB 3ES6A 2Y6SC 5DLML 1DJSA 2ZCHH 5EBWA 1UJ3C 3I3EA 4LVNB 5DTFA 2GAZA 1CR9H 4QTIL 3BI9X 3TBWB 3T0WA 3VRJB 4QOKB 1R3KB 1RZFL 3INUL 3TBVB 5HYFA 1G0XA 2CKNA 1CLZH 3VFVB 1NFIA 1WC7B 1TQBB 5HHXH 4PJ5E 4DEPC 1HXMB 2FHBA 1IEAA 3VFPB 3HZKA 1EFQA 5EA0L 2MWCA 5IM7B 3TA3B 4H8WL 5JUEH 5L2JB 1GH7A 2WIMA 2FECI 4NN5C 25C8H 2I9TA 5IBLC 5ICZB 4QCIA 4R4NC 4FFWD 1J87A 1ADQA 3IU4L 4JRYE 4JKKA 1D5ZA 3OKLB 2CRZA 5GHWH 1HQRA 1HHJA 4JFHE 5I1LB 3ZT6A 4WRLA 5C7XL 4PJIE 4U1MB 1MHHB 4R26H 4MSWA 1DCLA 3IDGB 1ZV5A 4I3RL 4XCNA 4XMLL 3RBSA 3VA6A 5L2KB 5F9JB 3EO1B 3IDMA 3WYRA 3LKOA 1H3UA 4K23L 1H3PL 1A2YB 2KPNA 1NDGB 3KXFE 3OJMB 1YEDA 4LCWD 3WUWB 4KDVA 5DD3H 5TQ2L 3V5DB 2CMRH 3QNZB 1XF2A 4WI3A 4MD4A 4MX7A 3I75A 3DBXB 1T0MA 1EEQA 1MFBL 4NKOB 3ARVA 2CIIB 2B1AH 3RIAF 3NACH 4QF1B 2C3XA 2PYFA 4WI6A 5DJYA 2IH1B 1A6AA 1IAIL 4W70A 3WFCL 1A4JA 1P7KB 1ZANL 1NGXB 2AJVH 3MBED 2AEWA 4PJ7B 4WFFE 1E4KC 3P9MB 4XBGB 2R23B 4FXKB 5HTSA 3LZFH 1S5IL 2VOTA 1DQLH 4OIIH 1S7WB 2P8MA 3D25A 5CP7B 1G0YR 1YEEH 1NCUA 1AI1H 3QUML 4PB9L 4ODHH 3MRPA 3O11A 4HEPG 5EUOF 4KPHL 4HGKC 5AD0B 1BQHG 5E8PB 1FHGA 4NQXB 2IAMB 3K7UA 3D3VA 4M00A 5FXCH 5LCVL 3VDAA 1NAKL 1PEWA 5IGXL 2EXWC 3ZKMD 1T04B 1G6RA 2ZUQB 3RZCB 5BRZB 1FVEB 4JVUA 5BO1H 5D5MB 3QFJD 2DD8L 3MJGX 1JPSH 3U0TB 5CIPA 2JF1A 5DRXA 2E6JA 2BVPB 4O2EB 1PY9A 3OJDB 3P77B 1I7UB 4HUWA 4PUBL 5I1CH 2Y5EA 1LK2B 2DLHA 3QUXB 2KH2B 3T0DA 1WIOA 2HLFC 1U3HA 2VZOA 3FB5A 3WFZA 3IKCB 5F88B 4GW5B 1YMHB 2CR3A 1QBLL 4FZ8L 4M1GL 5I1IL 4KJYB 3O6FB 4F7TA 1UWGH 1C12B 5E8EB 1S7RA 4FABH 1MREL 3QIUC 4PRHE 2GITB 2AKRB 3V8OA 1EUTA 4FG6C 1X6LA 5F3HB 2EDDA 3FRPG 3KR3H 1T7ZA 1Y18A 4U2ZA 5CBAA 1KCSH 5JOPE 4XAKE 2D0FA 4NZDA 4PJEF 4XVSH 4I18A 3CC5B 3VXMD 3A67L 1WUNT 3BKCH 3RGVD 3VE0B 3ORJA 1A14L 4PJ9C 3B83A 2KZWA 1E4JA 3MFFA 1FPTL 5ABDE 1OY3B 2H2SD 3NZHL 3Q6FB 5HHQB 1H5BA 2EE6A 3GJFA 3V5HB 1FE8L 5JPMA 2X7LA 2BHUA 3SKOB 1MCDA 2FHFA 4OLXL 3V0WL 2P5EA 5M94B 2E9IA 4XRCB 1NJ9A 3CD4A 4RWYL 5F89B 3BKML 3WUZA 4UBDD 1RZ7L 4OV5B 3SY0A 3WBDA 3LB6C 4OBRA 4NO0D 2ZJSL 3I6LE 3HFML 1G6RH 5BMFL 1JF6A 1P2CA 1ORSA 2DQJL 5HYJE 5I18H 5JO5A 3MJ9A 5MI0B 2ATPA 4I0CC 3S6CA 3WFHA 4GRLD 5CJQH 2F54E 3KG5A 1K8DA 5C0CD 2OP4L 3C2AH 5E4EC 2B39A 4JPIA 4H1LA 4CVXB 1U3HC 1F90H 1UB5B 5EC1A 4ZAKB 5JW3H 2EO9A 2X4NA 4M6AA 4XCFL 5CKAA 1LO4L 1SYVB 3AUVA 1TPXB 1RV6X 4F3FB 4B7IA 3I02B 3ZDXE 1ACYH 3GHBH 3QXAB 1CTNA 1IZJA 5GGTL 3C60D 2X4UB 5DK2B 1AKJD 3LH2H 3ULUC 4I18C 2NXYD 5K9JL 4JPKH 2FNBA 3AXLA 1QLFB 3TV3L 5SWQB 4AM0A 2B0SL 4UDTA 3ULUH 1IE5A 3UC0H 2ZNXA 1HXYB 2AK4D 2XI9A 4LSVH 1H5BC 4D0CA 1TZGL 4ETYA 2CXGA 2QADD 4E0RB 1DUZA 4HPOL 5C0DB 3VFMA 3W39A 3O0RL 5K9KB 1A02N 3SDXB 3T4AA 3RKPA 2NTFA 3QRFM 1NGZA 2R1XB 4KZEH 4LLWA 1OGTB 1JNLL 3H7BA 3GUTB 1NUNB 3BYYA 5D6CA 4U0RC 1LK3H 4EI5A 3WFEL 1RZKL 3RNQA 1VGEH 2W38A 4RISH 2Z31A 4JY6A 5LQBL 4ZNEA 3BGMA 1G7IA 1F58L 4EXKA 2X9YA 2WBJB 3FQTA 1MWAH 2D2OA 5LAXB 1CXEA 1EO8L 3RVWD 4R2GC 2BNUB 3VXUE 4V1DD 2QKIB 5ADOL 1MRFL 1I7ZB 3QDJD 3ARRA 4OCRH 1URLA 1NL0L 1T1XA 1CE1H 4KQ3H 5J8OA 3AROA 4WI7A 5J6GA 5FECB 1FFRA 3WL9A 4AIOA 4JLRB 4X7EC 3BPNC 4YFDB 3K0WA 5SX4I 5GGSB 1AC0A 4GKZB 3TESA 3EYOB 4B53A 3NAAH 2C9AA 3H3PH 2HJKA 4LLMB 1MI5A 1RZJH 1U92B 4ONOA 5JHDA 1S8DB 2FO4A 5C0BA 5DMKB 1BOGB 2IPTH 3OKYA 3RL2A 5KW9L 2CJUH 4X4ZA 2VLRD 4PRID 3UYRH 1V05A 3VXTB 5DJ2A 5FV2A 3ARBB 3IFPA 3PWPB 2B4CH 5EO9B 1F4WL 2C26A 4POUB 3V9FA 5IESH 5CZVH 4OZIB 3WIIL 3ULVD 1TJGL 3O6LL 5FHBH 1OTSC 5DSCB 4LGRB 2BNRA 1T2XA 5JW4Q 3GZKA 4GXVH 1C5BL 3MNVB 3T0ED 2XN9D 2ZWLT 3KPRE 4L8CA 3UAJC 4EI5C 1TENA 1DLFH 2Q7YB 2DWDB 1ERNA 5HYIA 1GIGH 5I76B 2Z31C 1W0VB 4Y16B 4LVOB 4IS6A 5J9PA 5CMAA 5CAYB 4CKVX 2APBA 2KQMA 3Q48A 3WIHA 3V5KB 2D0HA 4PG9B 3D9AL 1BX2A 2NY5C 4Y8DC 1UXWB 2JCCF 5F44A 4P5TA 4OCXL 1OP5K 1A4KA 2VTFA 2HG5A 4FMKA 1HKFA 2NY5H 3IJHA 3UJTL 3GRWA 2VISA 1ZGLB 1YN7B 4KK9D 3LKPA 1XR8A 1M7DA 4R0LB 4BZ2L 1BFTA 2EDNA 3F7PC 1DQDH 1LHZA 3L9RB 3T2OA 1CFTA 4QNPE 1KXTB 3VWJB 1AGEB 1G0DA 3CJJA 3HHRB 1WLHA 3UTPE 4I3GA 2GQHA 1L6ZA 3FT4A 3M07A 5A3IC 4O9HH 3HC0B 3FQUB 1CBVL 3M17A 5F72S 5JLZA 1P7QA 3S36X 3RWGB 1XH3A 5DUPL 4J4PC 2P49B 3JTTB 4OM0H 1K6QH 3BWUC 3BOVA 3QEUA 3V7AE 3EJYD 1II4E 1YECH 1EERB 4AQOA 3EDDA 5FEBA 5JPNB 3Q3GB 1X7QB 2X4TB 4F9PA 4ZPVB 3GB7A 3QUKB 2VABA 4QRRE 4WEMB 3SPVA 3QHTC 3ZHKA 4JFDE 5KANG 1IL1B 1J11A 3BD4A 5C0IA 5GZND 1IKNA 1BD2B 1S9VA 4LKXB 4WCYH 2R29L 4HIXH 1KN2L 4P2OC 5EULV 1LD9A 3VGHA 1IBGH 3BPCB 1J0JA 2Y07L 4KMTH 3BP7A 5F1OB 2VLJA 5EC2A 4A2LA 5E9DA 1NGWA 1CL7L 1K4CA 1NGQH 3QNXA 5EB9A 3WIHH 5FDYA 4OD1H 1IEBA 4TSAH 1N26A 1CE6B 4DKFL 2B1AL 3HMWH 4MQ7B 3RJQB 1XR9A 4WDIB 2DKUA 3MV9B 3GRWH 3JWOC 3R06A 4QXWA 1JCKA 5C0GA 5FO7A 5DD1H 3JWOH 4DGIH 1Y6NR 4PJ5D 4G8IB 3LZFL 1MHPL 1DQLL 1YYLL 2C3GA 2V5MA 5JNYB 4GRMA 4K8RL 1KIRA 3SJVD 1FBIL 3BKYH 2PXYB 3ZDZF 1E4WL 4KXZI 1WGOA 3OAYH 1LO0H 4NZRH 4QHMA 5D7IF 3U30C 5JMOC 1FNLA 4AG4L 3C08H 1I1AB 2HVKB 3FZUD 1OD7A 4YK4C 4L9LB 5FYKD 1FQ9C 4F9PC 2NY4B 4JRYD 4MNQA 4NRZB 2BSSA 2J8OA 3HPLA 1Q9KB 1SJXA 4JFHD 4KUCF 3OAUL 4XCYB 4N1HB 1IM9D 4X6EB 4YWGL 3DX7A 4CADB 1IKNC 2X4PB 1JPFA 2NZ9D 3JTSB 3U36A 1S7SB 1CVSC 5DVLA 3QUYD 1OVZA 4N8VG 1LNUB 3SDCB 2G75A 1QVOB 3KXFD 4PV8A 2EDWA 1KNOB 1JPTL 1G6VK 1ZOXA 2A9ML 2ITCB 3VMNA 1MJ7H 1OHQA 3CH8A 1HH9A 3QCVL 3J7HA 4YBLB 2APVA 2AJYL 3D2UB 5HHOE 3LEVH 2CKBH 4QOKA 3TBVA 3F62A 1KEGH 2AXGB 2EDRA 1OLZA 1WC7A 4JZJA 5D7KE 1BJMA 5JXED 3TA3A 5IM7A 1A3QA 2YK1L 4XVSL 2NX5B 5TF1H 1W2KT 3GM0A 3BKCL 4OZFG 4X9HA 5ICZA 4F33B 4N9GB 4TNVK 3OKLA 4WFFD 1NLBH 3P11H 2BOCB 3UTZA 4NM4L 3GGWB 4U1MA 4GAFB 4YDIL 4OF0A 3DX6B 3V4VH 2ZCKH 3CXDL 5AUMB 5L2KA 4JFFB 1TZHB 4P9HC 3EO1A 3PXJA 5KSBB 2RB8A 3KNBB 3VDBA 1A8JH 3SKJH 1BWWA 1QRNA 5FUCE 3KYMA 4U1HB 4HBQA 4P9HH 4NOFA 4F80A 1A2YA 1NDGA 5C92A 5I18L 1U58B 4Z7UF 2BZDA 2ADFH 5ETUB 2KBGA 4PBXA 5CJQL 3WUWA 4KY1L 4P9ML 1JHTB 4DVRH 1KSRA 2XACC 2NTSP 4JHWL 3QNZA 2WUBL 4WFHE 4K7PH 4Q58C 2P5WE 4JFXB 3QHZH 2EEDA 4X80L 3UXFA 4NKOA 2GY5A 1GL4B 4YQXH 1FJ1B 4HPYL 5E6ID 1YMMA 1T7WA 1FZKB 1JRHI 1F4HA 4LPTA 3BZ4B 4ONGH 3MA9L 3ARDB 2VDLH 4WEUD 5EOCL 4DCQB 3TA3C 2EKSB 3I6KA 3HUJA 4OF7A 5FK9B 1V3LA 4JY4B 5HYSB 4LLAA 2OXGA 5DS8A 4PJ7A 1UM5L 1OCWH 1BJ1H 4PRHD 1K4DB 3P9MA 3LKRB 4KV5E 4NQDA 2YPKB 4P4KB 3MNZB 1UACL 3O4OB 4M1CD 3WHXB 1S7WA 1MY7A 2BNQE 4NO2B 4XAKD 1S9WB 5CJBA 5JA8B 1AR1C 3ZE0F 3K8KA 2OCFD 3L3GB 1DQMH 3CGTA 4G6AC 4UTBL 4MJIB 1EHXA 4JPWH 3TBYA 2MKWA 2MPAL 1RJYB 2C1PA 1FLTX 5AD0A 4GKOA 1DLHA 2FO1A 1GGYA 2IAMA 4LDEB 1PGRB 5DF0A 5I8CA 1T04A 2EO1A 1LQSR 3RZCA 5BRZA 2OTUB 1FVEA 1EK3A 4OZHE 4PGJA 1T3FA 3U0TA 3GMMB 4NQCB 2IFGA 5DMIH 5L88H 1N6UA 1YQVL 3O8XB 3H42L 2OI9C 3OJDA 1YEKH 4FFYL 1I7UA 1MH5B 1MVUB 5E24E 1LK2A 3I6LD 3AAZB 4UAOB 5KOMC 3VG0H 5CCKH 3QUXA 5HYJD 2VJXA 3QDHA 4P49A 3R1GH 1U6AH 1PZ5B 4U1JB 4YHLH 2F54D 2N7BA 5F88A 2GW5A 1FCGA 1QSFD 1OT2A 4KJYA 3O6FA 4Y4KD 5E8EA 1NMAL 3HAEG 2G5RA 2HT4C 4JO4L 4JRXE 3ZYOA 1UYWH 4Y2DA 5GJSL 3P0VL 2XY1A 2AKRA 4JJ5A 1DFBH 4J3VA 4U6YA 4BQ6A 5D7SH 3HMXL 3QEQE 1JFQH 1QACA 3H3PL 4IOFD 1D9KA 3H9ZA 1C1EH 3CC5A 4LSRL 2FX8L 3PGCA 3E6HB 1RZJL 3F65A 1UM6H 3VE0A 5CJ8A 2BP3A 1J18A 3RAJL 1FYTB 1MAKA 2CJUL 4PJXB 3ZE2F 3HZVB 3FFCB 2H9GB 4JGJA 2B4CL 1JTOA 4YZFF 4E41E 3VRLE 3SKOA 5CZVL 4XRCA 4F7EA 2IAMC 2CK2A 5FHBL 4LU5L 5F89A 1WVZA 2ZUQC 4M61B 4BFEA 4OV5A 3RZCC 1A7QL 1XF1A 4L5FH 1ZLUH 3QCTL 3TIDB 1DLFL 4FXGA 2XIDA 1UEMA 3WNKA 5CD3B 3RVUD 3VW3H 5DUMH 3HLAB 2F53B 4U1IB 3TZVB 4M5ZH 4NUJA 4OB5H 2W60B 3WFDH 3QUXC 3O2VL 1V3JA 4YGAB 1EZVX 1HHHA 1KT2B 1J8HB 3L7FB 4J3WA 2EC9T 5I17B 4ZAKA 4RMWA 3TO2B 4XVUC 2J3SA 4DUVA 3BYTA 3O6FC 3UO1H 4YBQC 3BDYH 2BSRB 3NN8A 3U9UA 1WZLA 1NDMB 1VB9A 2A6KB 4ZFOL 5ICYA 3TFKD 4TN9A 1SYVA 4Y2DC 4F3FA 3I02A 3A6BH 4FQ2H 3VXUD 3KDMB 2BCKA 3QXAA 5EZIL 3GI9L 3SGKA 5DGQA 1U8MA 3KPQB 4OZ4B 4QEGA 2YN5A 5DK2A 3OBAA 3DX8B 1FDLL 3MCLH 5GGQH 2ZSWA 5B39B 1QLFA 1WFNA 1J0YA 4D9QE 1HXYA 4H0GA 1QSVA 2VUOA 4KAQL 3ZKXB 4GXUN 4JFQA 4E0RA 1EIBA 4PBWD 4C58B 1EHNA 4HAFA 5C0DA 1Q0YH 5K9KA 4RFEB 1JYVA 1FFOA 3RPIA 3DROB 5T1DH 5LJYH 1B88A 2R1XA 1H8OA 1OGTA 1JHKL 3GUTA 1I9EA 3OB0K 2GTZA 5DK0A 1CGYA 2YUVA 4WCYL 4JHAH 4HLZH 4UIMB 5D1QD 5MI0C 1WICA 4OFPA 1RJZB 3LKQA 4G9FB 2E27H 3G5XA 1U42A 2DI8A 2XWTA 5IOPB 4FZEH 2P24B 4LARL 1G9MC 5T3XH 4EBQH 4UT9L 2YD7A 4ZAKC 4U6XB 4EN3B 1J86A 2BNUA 1JL8A 5AAWA 4LQFH 5E8OB 5GGTA 4OLWL 3SO5A 3B9KD 2W9DL 2I07A 3WXWL 4OD2B 1TPXC 3K1DA 2PYEB 5FECA 3PQYE 4KZDL 3T3ME 4CW1B 3SGKC 1PDKA 4L8SB 2ZP0T 5GGSA 3OB8A 4DGIL 3G08A 5FO9A 2NNAB 5IFAL 4LLMA 4H5SB 2CUIA 5HI3C 1MF2L 5E2VL 1BOGA 4P3DA 3UTPD 1DBJH 4KHXH 4PS4L 1T83A 1RY7B 3NTCL 1LO0L 3QDGE 4AMKH 3ARBA 1BQHA 4UILH 4PB0H 1MIMH 3P30L 1T6VN 3ULUE 4TUKH 2GSGA 3OTTA 2ATKB 5DSCA 2KZ1B 4RRPA 4PJCE 1CDJA 3FMGL 4UOJA 3LRGA 4EDXB 2AEQL 3STLB 4ZUTA 2P8LB 1KCVL 4XNMB 4JAMA 2JE8A 2VZTA 4DGYH 2Q7YA 4O2FA 4QRRD 2DLIA 1IRAY 5I76A 1W0VA 1T6WA 4JHBA 4JFDD 2JB5H 1WBYA 4JFEB 4PG9A 5ELIA 5FCUL 1KGCE 1M6OA 3ZE1E 2PTUA 4JG1H 4HWEH 4PJAE 3GIVA 3IXTA 4IRJD 4GQ9L 2ZUWA 1C7SA 3SGJC 3VI3E 2G5BB 1K8IB 4LQ1A 4DUXA 5DRWB 3FRPA 3L9RA 1CFBA 1NAML 2H6PB 4J2XA 2VWEC 3PL6D 4LGSB 2FEDD 3GSVB 3NA4A 1X5IA 3VWJA 1N59A 1AGEA 2ZUYA 3U9PL 4M1DH 4WV1B 2P1YA 1F6FB 3MGAA 1QFPA 3GMNA 5CSGA 3HC0A 5F1IA 4OLVH 1RZ8B 3CFCL 5F6HI 3SGEI 5I15L 1U8KB 3MODL 1T83C 1EMTL 4YNYB 3JTTA 4PD4K 2J6EH 3ARBC 4R6UA 3SDAB 3CVHB 1V7MH 2HT3C 2VLLB 5JPNA 5BS0A 1X7QA 3GSRA 3QO0B 4KKLD 3F7RA 4EQ3A 4F7MB 3I6GB 1FAIH 2R2CA 3QUKA 3SKJL 1QLRA 2O5YL 2DQEL 2F8VA 3RTQD 4LSSH 5CEZH 1IL1A 1JUFB 2AXJA 2EC8A 3GNML 4RBPK 3QEHB 1BD2A 5EWIL 1YJDL 5B4MD 2YPLB 1AR2A 5IW6B 1PYWB 5E2JA 5H8DA 4CUCA 5DMYA 4I0PD 3TT1H 4LVOC 4P5MB 1HHGB 1TCRB 5EFIB 4ELMB 4LMQI 2W07A 2XKNB 5C1MB 2DTML 1XGPA 4E5XB 3WD5H 4Z7WB 2DYPD 5A2IH 5IVXB 1OSPH 4LCUB 3RDTD 3PDDA 2NMSA 1J1OH 4MQ7A 3RHWK 1GAFL 3G6DL 3NBNA 4Q6IB 4R0LC 1RUPH 3MV9A 2GUOB 3CFKB 3QHFH 3W11D 4ZNEE 4Q97A 2NW2B 1C5CL 5I2IA 1TFHA 5HHOD 4LSQH 4K3JH 3VWJC 1D5IH 1WAAF 3MRKA 1WCBA 1EPFA 3FHQA 1SJHB 4WJ5A 1GYAA 4ZQKA 3B5GA 4IRSA 5ITBH 3T0XA 4KK6D 1BJ8A 5IF0A 3F7VB 2EE2A 5T1LD 1ITBB 1AD9A 3S5LG 1F3JA 4NIKB 1NC2B 4K07A 2PXYA 4GKNB 1RMFL 5I30L 1BPVA 4JPWL 2VC2H 5DURD 1RURL 4XWOC 3WSQL 1I1AA 1QEWB 1X4YA 3BEVA 4L9LA 1E6JH 3EOAA 4GMTH 3Q1SH 1MI5E 4I77L 5JHDE 1CLCA 3JSSA 1KN4H 4XCYA 1GXEA 3CSPA 4MCYB 2D03L 4WUKL 4CADA 1I4FB 2IBGA 4Y19B 5J1AB 1JZ3A 4NJAH 1A9BA 3VFTB 3JTSA 4PJGF 2B1HH 5L88L 5KVEH 3GMQB 2QBWA 2EH7H 4GS7B 5CD5D 5FHAH 3MLYL 1G84A 2H3NB 1LNUA 1JPGB 4POZC 1QVOA 1KNOA 4YHLL 2OX5A 4M03A 4X6DE 4OZGF 3LDBC 1IGYB 4YPGB 3X3GH 3MLPA 3K3QA 2VDQH 4WFHD 2JCCB 4HIIA 2P5WD 5CEYA 2J8UF 5CINH 3QNYB 2OR9H 3BDXA 3F58L 5D2NE 4KHTH 4WEBL 3NIGE 1NSNH 1G7QA 1J5OL 1QNZH 1OAYL 4G8EA 2ICWB 1C1EL 1FO0B 5SWSB 2K1MA 1UM6L 1BMGA 1DEEB 1YEGH 2HTKD 3BSZH 3BP6B 2PXYC 4N9GA 4Q6YA 5MP6L 4IRZH 2BOCA 1HDMA 4WTZA 1GOGA 5T1KD 1I1AC 1L7TH 1LILA 2ED8A 2IMNA 3BP4A 4L9LC 3QCUL 5HHME 1GGTA 1VFAB 2NY4C 3DX6A 2BNQD 5I19H 5AUMA 5FYJL 4JFFA 3MRCA 1TZHA 2VZVA 5HHVL 1N4XL 3FAWA 1JN6A 1RZGB 1OB1A 3KNBA 4ZD3L 4HXAL 2FATL 1EAJA 5CKGA 5DHYA 1KEMH 2W1NA 4JKPH 3MUY1 4PFEA 1CGVA 3CK0L 4NZTL 3CX5J 4PGBB 3O6ML 5IBLD 1UZ6F 4Y1AA 4OB5L 3NIFF 3TPKA 4PJBB 5DJ0B 4NFCA 1T2QH 5F1SA 3FO2A 4C55A 2M1KA 3QG6A 1YEFH 4YBLC 2VAJA 3P0YL 1IC4L 2JIXB 5GSRB 2X4QA 4G80B 4OIBA 1EFXA 1IILE 4MB3A 3H9SE 2J1KA 5E8DH 3HI5L 4NCC1 3ARDA 2ZKHL 2A6JB 4DCQA 1AD0A 3FN0H 5FK9A 3G5ZA 4MJ2A 4JY4A 1UVQB 5HYSA 4LHJB 3O9WA 1NC4B 4JRXD 2R8SL 1IGIL 3KPSA 2YPKA 1DUYA 1NKOA 1T03L 3MNZA 4Y5XB 3BH9A 4TSCH 4PLJD 4WVRA 3WHXA 4X98B 3QEQD 4NO2A 1S9WA 3IFNH 3B9DA 4G3YL 4JCLA 3TF7C 4YDJB 1BHGA 2WWKO 3GI8H 3L3GA 3DV6A 3J8F7 1CN4A 1YNKH 3T4YB 5IV2B 3B9VA 1SEQH 3LEYL 4HIHB 5D7IB 3MREA 5C0ND 4E41D 2OTUA 2JK5B 2WBWB 1DBKL 3EHBC 3QPQD 2AEPL 2BC4B 1PFCA 2PCPA 4QGTA 5H2BB 1I1FB 3V4PH 4PYHA 4FP8H 3D85B 3VGFA 3QISA 3X14A 3NABH 3DX9B 2ID5A 2IPUK 4F37K 5DEGB 1ZHNB 4DTGL 4I13B 2XXCB 2B8OT 4HUUB 1PD6A 1I3GH 5IT2H 3QULA 5H35B 1N3NA 1FZOB 1PZ5A 4LQFL 2XNAA 2D7TH 1FORL 1RHFA 5F3BB 2BFVH 2VDML 1RUAH 3ARDC 4MMXC 1HSBB 2EDYA 4TTDC 1I3VA 5E56A 4PRBB 3LRHA 3UPRB 3TO4B 1KIUA 5AZEH 1GGIH 2CD0A 3JV4B 1B4JL 4QOKE 5LVEA 3E6HA 2DLFL 3O4OC 2OTWA 4R96B 5JOEA 5BZDB 4M4RA 2BXYA 4EOWH 1KXVC 1PG7X 2BHYA 1FYTA 4IHOA 2HWZL 1U3ZA 5DHVB 1BF8A 4JO2H 3FFCA 3E3QC 2H9GA 5FGRA 4AMKL 2OXHA 5I0ZA 1AC6A 1MIML 2M2DA 3X3FH 4D9LL 1F6AB 2WINA 4HIEA 4M9OA 4BJLA 4TVSa 4JPVL 4D9QD 2W0PA 1RVFL 3V6FB 3QIUD 3VFUB 3WO4B 4M61A 3QQNA 1NUGA 5DWUH 1HNFA 4Y7MA 2GT9A 4J3TA 5CD3A 1NCWL 4TNWF 4PJ9D 4XP1L 4N8VA 3OJVC 3O8XC 4AEEA 4ISVB 3HLAA 4ONHB 3U1SH 4U1IA 3TZVA 5L2KE 4UAOC 5LWYH 2FEEI 4Z7UB 2VL5A 3L7FA 3CUPB 5HGDB 1KCUL 3MGTB 4UI2A 1JV5B 4ODBD 2P44B 3TO2A 5BQ7B 4G6ML 4POYA 1LEIB 1FL6B 5KVFH 3UTTB 4L9DA 5C0RL 1BGXL 3RWIA 2VE6B 5DVOA 4MDJB 3CNKA 1MAML 1NDMA 3OKKB 2A6KA 2RHEA 1Q72L 3LB6D 5ALCL 5JDJA 4HH8A 4JM2B 2GJZB 4QRUB 4F15B 3KDMA 4Z7NF 5FOBA 1QG3A 2A0LC 4HC1H 4OZ4A 4M1DL 5JIIA 2ZPKH 2XFXA 3PQYD 4HEME 4ODVL 3QEGH 2WQRA 1KENH 2R9HD 5KJRH 1Z6JT 4N0YH 2I60L 5E4IA 2MCPL 2QQKH 2J6EL 1DQJA 4ORGB 4DAGL 2MQ0A 2MHAB 3FQWB 1NCAL 1UWEL 5J56B 5ILTH 4LLVB 2J88L 5C6WH 5FUOL 1MFDL 1NMBH 4PJFF 2XKSA 1CFNA 5L9DH 1ZK9A 2X1XR 3QDGD 5EUOA 5DJCB 3GJFK 4QXUL 4KRNA 4YX2H 1TLKA 4KJQC 1HSAB 1JYNA 2ZUSA 2GJ6A 4HZLB 3LN5B 1MUJB 3QDMB 4UIMA 5D6DA 3TT1L 1RJZA 4G9FA 4UIKH 4YHPB 5IOPA 3TZVC 3G6JF 2P24A 1A1MB 5DGRA 3AB0C 1MVFA 1JGLL 4G6FB 3IDXH 5BRZE 4ENEC 4U6XA 4EN3A 2OK0L 4DKAA 5D5ME 1QSEA 4B0MM 5E8OA 1I9JL 4M5YL 4TUOA 4ZFZA 2V7HB 1X44A 2YSSA 1G7MB 3QWOB 4I3SH 4TPRL 3KLAA 1UM4H 4OD2A 3VFSB 2WIIA 1YZZA 2PYEA 1MRCL 3EJZC 4PJ8B 3PGFL 4ZTOL 4QO1A 3HE7A 2X70B 2D7OA 4YHOH 4AEHH 1M7IB 2V17L 4JY5L 1EVUA 2HAZA 1ZLSL 2BOBB 1XGYH 4H5SA 1F2XK 3B5TA 4PREB 4LCCB 2V9TA 1EJOH 2LAGB 5D9SA 3ZKXC 2YC1B 3SKUD 4NT6B 4JREB 5I1HH 1DP0A 1DN0B 1JRHL 1PSKH 3JV6B 2NY6B 2W9EH 4JQIL 4S10A 2IBBA 5DFTA 4NQSB 3TWCH 3REVB 5ID1B 5I8EB 1IGML 4GMTL 3MLXH 3Q1SL 1TNMA 1LO3L 2W65B 4Z77B 2ATKA 2DBLH 2NR6D 5CEXB 2P43B 4QRQB 2C4XA 1SQ2N 3NA9H 4UQ3B 5TDOB 5EO1B 2P8LA 1HYSC 2ZOLB 1KB5B 2EDBA 4XNMA 5D6DC 2FD6H 3IAPA 5AWNH 2PUQT 1R0AH 4WHYH 1DVFB 4UMGA 3IDIB 3WJJA 4JFEA 1Q9OB 4O58L 1VDGA 4Y4HA 3K4ZA 3ZYJA 4EN3C 5CBEB 1B0RB 4XVJH 4K3EH 2FJFB 3GM8A 5DJDB 2Q86A 2VDQL 1OTSD 2AJ3A 5F21B 5A16B 4W4NA 1K8IA 15C8H 5CINL 1N6QH 5DRWA 3OKOB 4JM4H 5T3XE 2FX7L 4YH6A 4ODSL 4KHTL 4OLZH 2X5PA 5T5FH 1AFVH 4HS6B 4L8SC 4FQXB 4S11A 1T21A 3U4EB 3L5XL 3RVTC 4XPAH 3WFBH 3UTSA 5KSAA 2CSPA 1I1YB 5BVJA 4JR9L 1XT5A 3VFGH 3C6SB 2PR4L 1RZ8A 3AREA 4WU5A 1GGBL 1PLGH 4M6OL 1NUDA 1ONQB 1U8KA 3PNWA 3BZDA 4MAYB 1MIEH 5E94B 5T3ZL 2ILLA 2R4RL 4JDTH 3CSYB 4YNYA 3LD8B 3GSNL 4OFYA 3EO0B 5C07D 3O6KL 3SDAA 4K7FB 3CVHA 1T20B 1NANI 5D8JH 5I19L 2CO6B 3L3JB 4U31A 4WFGE 4C56A 1BZ7A 1G7PA 3FQNB 3IDJB 1QPPA 2NY1B 3MCKA 4OGAC 3EYSL 1QLEH 4CN4A 1I7RA 2A6IA 3D1MC 4YDKH 3QEHA 3QAZB 2YPLA 1PYWA 8FABB 5L0QC 1TCRA 3SDXE 5EFIA 3OPZL 2XKNA 2OZ4A 5KN5A 4J4PD 5JORB 4HMCA 3GBMH 1AXIB 4Y4HC 1VPOL 4E5XA 4L3EB 4Z7WA 3S35L 5E7FA 5IVXA 1NAMA 5BV7B 4JDVB 3MZTA 4LCUA 3CDGB 4NFDA 2IGFL 1G9NC 4OGXL 1HN1A 4YR6B 3FFDB 1CZ8L 3RU8L 2GUOA 5AZ2L 1J0ZA 2LFGA 2Z9TA 1G9NH 1I7TB 1YA5A 4U2YA 1VFOA 1CQKA 1FP5A 1OAUH 2DF3A 4P2OD 4KQ4H 4WV1C 2R1YA 5JTWA 3DO7B 2XG4A 2VIRB 3W5MA 4UNTA 1X6NA 1KIPB 1U8JB 5C0AB 4ODWA 3H0TB 4GKNA 2CRYA 1RU9H 2ICES 2EDOA 2VWEE 1RIHH 5BZWB 3SDAC 1N64H 1SEQL 1VCAA 1N6VA 4GBXD 4MS8C 3HNTH 1QEWA 4GW4B 4XCCH 2VXSL 1FNEB 1CU4H 4IDLA 5KAQF 4QY8A 3CVHH 1EVTC 4HK0B 3MUZ1 3OAZH 1A5FH 5HHMD 4P46B 1J10A 4XP9L 4Y19A 1AO7B 3EO9H 3JUZA 3VFTA 3KWWB 1M05B 3PWPE 4HWBL 4NJ9L 4FP8L 4WNQB 1A9EB 1VEOA 4OZIE 2H3NA 3TN0B 5GS1A 1JPGA 2VSDA 4WUUB 2R4SH 4U1LB 4U6VL 1I3GL 3WLBA 2OZ4H 3RP1A 1U8NB 1IGYA 4G8GB 4W81A 4YPGA 5T1MB 3DXAB 1SBSH 3OZ9L 4HWZB 1WCQA 4MNHA 3RX7A 4KKBD 2JCCA 4Q6IC 5CJOL 1V3KA 1JZ4A 1JTTA 1RUAL 4XX1E 1S7XB 3QNYA 4ZUWB 3MGOB 1D6EB 3IETB 1XGUA 4LLYB 4GG6F 2R56L 1MEXL 4L1HA 4CVUA 3H9SD 2ICWA 3ROOB 1FO0A 4AENB 5F9OH 3MRMB 5TDNB 1MSPA 2FLBT 3QWRD 4WGWB 5DJXB 1FVDB 5HYQB 1AGBA 1FZMA 4M8QB 1FFPB 5D1XD 4MHHI 5D7JB 1BF2A 4GLRH 4WWKA 4N0RA 1VFAA 2R0WL 4LHQB 1KULA 2DQDH 4HIJB 2HJFB 3RVXD 4LHUD 1CIDA 1BBJA 4WHYG 5J3HC 4GUPB 4RAUA 4JFOB 1OAQH 4MNGB 4DGVH 2EDQA 4GS7C 2ADJB 2YN3A 3LCYA 3MRDA 5FV1L 1CGSL 3BD5A 5GS1C 3G9VA 3MO1A 5DJ0A 43C9A 3U4AA 3DURB 1P4IH 1ZVYA 2XOTA 4RQQB 4JZOB 3GK8L 2YPVH 4M7LT 5IMOB 4X99B 3P4NB 1BD2E 4F7CA 5GSRA 4G80A 3LIZH 3UYPA 1XIWD 1FCCA 3OHXB 1U3YA 3L3DB 1FC1A 4OCYH 3VWKA 4BQBA 1MCOH 3DTXB 2A6JA 4HCRH 4ZOBA 5DXWA 4NQVB 3ULVF 5DD0H 2ZPKL 5I0DA 3CLEL 4LRIA 2HVJA 1IQDB 4M6NH 3HC4H 4WHDA 4HUMB 1FO0H 1U91B 3MV9E 4K94C 1ZAGA 4P0DA 5HGBA 4DOHB 1C08A 4YDJA 4QOKD 4YHNB 4Z0XB 4K94H 2JJTA 4WTWA 3BIKB 4G9DB 2R2BB 2GCYB 5FOJA 2ARJA 3IGAA 4HIHA 5D1ZA 1NMBL 2EDKA 2AGJH 4XVTL 3TJHC 1WK0A 5D7IA 3TA3D 5KSUB 1JGDB 4Y5VB 2DQCL 4Q0XH 3FT3B 2H45A 2JK5A 3AMLA 1X4ZA 3O3BB 4QRPB 2OM5A 4UIKL 2ZUTA 2XTJB 1XGTA 5H2BA 1OP9A 3D85A 4P59H 4WGVB 1AP2B 4JO1H 4XWGH 3MV8B 4RGOH 4MXWH 3IDXL 3QPXL 4PJGB 3NIDF 2GK0A 2A77H 4XPHH 5DRZB 1FZOA 3BEWB 2V2TB 3GDBA 1YPZB 4F57H 4P2QA 5KBNC 1CDCA 1EUUA 3RWFB 4P23A 3M1BB 4N1CA 4HT1H 4YHMH 2F74A 5SV4A 3S37L 1HH6B 2YUWA 3KPOA 5F71A 3MFGB 3U6RA 4MXVF 4O5LL 4ZMAT 2Z93B 1WIPA 1FLRL 1MY5A 4LRIC 3UPRA 1I75A 3TO4A 1WEJL 2E3VA 4Y5XC 4M8VA 1E28B 1WISA 4R96A 5BZDA 3UTOA 4OQTL 1F8TL 2GTWB 2XZAL 4FQQB 1QFWM 5IMMB 1CIUA 1AGDB 3W0WD 4KTDH 4TVPH 5ERWA 4X5XB 2WLZA 1PSKL 5F7FA 2JJTC 2W9EL 4IDJH 4ZS7H 5IUSA 2NX5E 1RUQL 3MRIB 5D1ZC 5DQDL 3V6FA 4ODXB 3VFUA 4RAVA 2I5YH 2WQ8A 5K93A 2AJSL 1FNHA 4X4YA 1NFDF 1ETZB 3RY4A 1HILA 4LL9A 3IDUA 2F5BL 4O4YL 4L8DB 1JWUB 4DJMA 4HS3B 2UWEE 4G7YL 4OD3H 3QQ3B 1R0AL 5FM4A 1F13A 2JELL 2EIDA 4ISVA 4PG2C 4ONHA 3OG6B 4X8XA 4Z7UA 5KSBE 2BXZA 5BJTB 5IB3B 1I9RL 5FYJD 1R5IB 5FKPB 4CGTA 3B8SA 1JV5A 3KVQA 5JR1L 3MRLB 1LEIA 3VXOA 3UTTA 1W72B 1K3ZA 5IG7B 5F9DC 2E7MA 4P23C 3MXWH 2VE6A 2IANA 5E8NA 4MDJA 3D39B 3HZMB 3OKKA 3RZCD 5BRZD 2MJWA 4MJ5B 1S9YB 4ZXBB 3VFRA 5T5FL 4X6CF 4OI9A 3PV6A 2Y1VA 9CGTA 4B50A 3GO1H 3KPNA 4KRPC 3GMRA 3TO4C 1CK0H 4PJIF 3NH7H 4HF5H 3TLRA 5I75B 4GRWE 1CXLA 4J6RL 4UOW0 2N56A 1I8KB 3CMOH 4RDQF 3QSKB 2FB4H 4FN0A 3LQAC 1RUMH 4ODUB 4ORGA 3O6FD 3FQWA 2MHAA 5DHVH 1KPUB 3LQAH 5CGYD 1ND0A 5IBTH 3WDHA 3BIAX 3R0MA 3P9WB 2EDLA 3WO4C 2BK8A 3MQIA 2ICCA 3B6SA 5DJCA 4PGCB 1OQOA 3LN4B 3MRNB 1RFDL 5HHPB 3X11A 3TVMB 4YDKL 1CDUA 1JPST 5IQ7H 3E3QE 4P5KA 1OLLA 1OAKH 2QL1A 4HZLA 3QDMA 4MJIE 5EUKA 1ES0A 4OT1H 4OUOA 1G1CA 5GS2H 5I1GH 4RGMB 1A1MA 3GBML 3MR9A 2DMBA 4OAWB 4HKXB 4XMPH 1JNHB 3K2UL 4I48B 3QXTA 5I1EL 1INDH 4RGNB 1IFHH 1JWSA 2OJEB 4NQCE 3A6CH 2BVQB 5E2WL 3VFSA 3BFOA 3BN9D 4JM2C 4F15C 2FJGB 4PJ8A 1MQ8A 1L9NA 4RNRB 2X70A 3MRQB 2HMID 3GSXB 1M7IA 5T3XD 5DJAB 4X5WB 1EJ6A 1TQCB 4PREA 4LCCA 3ZKNC 5E99H 5FFLA 1Q1JL 1EDQA 3QQ9D 2YC1A 4XHJD 4CU6A 5C9JA 2IFFH 4OF5A 3QUZA 3JV6A 1A7OL 3JWDC 1MCNA 4OI7A 3REVA 5ID1A 2P46B 4HUNB 2EIEA 2W65A 1DN2A 4Z77A 3JWDH 4I2XB 4UU9B 1OPGH 2ICEB 3UYOD 1FYTE 3IFOB 2MSPA 3O3DB 4QRQA 4U1SB 4UQ3A 4PJXE 3FT2A 5EO1A 1IAOB 4WFGD 3EO9L 3R0NA 1KB5A 2GJJA 2EYTA 3HC3L 4KROB 5TDPB 4L4TB 1UWXK 3U4BL 5DJ6B 3UBXB 1DVFA 2AQ2A 2WANA 2IMMA 4UV7H 1BQLH 2R4SL 1Q9OA 2ZCLH 3DIFA 5IK3B 4NRYB 2HFFB 4I8DA 4LKCB 1B0RA 2FJFA 2XA3A 5DMGC 4QTHB 5E2UH 3TPUB 2VERN 4DZBB 5A16A 1BREA 1S7QA 3MLWH 3OKOA 1JF1B 2PNDA 1OP5H 2F53E 4PJ8C 1IAII 3MLZH 3SCMB 5F1NB 3HS0B 1J8HE 2A6DA 5INDA 2AJXH 1S7VB 3H3KA 3U4EA 2W9LA 3B3IB 3SQOL 1K5NB 1I1YA 2QSQA 3OMZA 2FJHB 2WBJD 3P0GB 5T33L 4LCCC 3RJDA 5E94A 4YXHH 4MAYA 1TZIA 3CSYA 1HWHB 4L3AA 4JREC 4CMMA 2FZ3B 3JV5A 3QUZC 2NY6C 2XRAL 3C6LD 4K7FA 4R7NB 4DN3H 1VESA 1MCWM 5EU5A 3FB7A 2DWEB 3P4LA 2OBGA 3FQNA 3IDJA 1MJ8L 1NLDL 2X9WA 4W6XB 2YUXA 1RHHB 3SDDB 3LN9A 5DRNB 1BVKB 1BVLB 4KTEL 3QRGH 1OWRM 3NFPB 2VZSA 8FABA 1MFCH 1KB5H 2G60H 1DVFC 3RPKA 3ARBD 4L3EA 1NPUA 3PWPD 1FH5H 2DM4A 4XNZB 1WWAX 3X13B 4BSWA 2VH5H 3CDGA 2HN7B 2YOCA 4HXBL 4XP4L 4YR6A 3WNPA 2E6QA 4NO3B 4LPUA 1OGAB 5FUZL 2XZQH 1MCOL 4HCRL 1C5DB 4HKBA 1LDSA 4FQXC 1MQKH 1R6VA 1SY6H 1XAUA 1XF5B 5FA4A 5IKCA 1MCPL 1A3LH 3NOIA 4PJDF 2FEEL 4Y16D 3BXNB 3QWQB 3QZWG 1SEBB 1UEYA 4XNYH 5C09A 4PP1D 3RI5K 4MAYC 5D72L 1KIPA 2PYEE 3L7EB 2ZNWA 3H0TA 3LD8C 4WY7L 3P40A 4PRAB 5MEOA 1Q9WB 2WZPD 2IQAB 5BZWA 4MQSB 2OQJA 3LMJH 4V2BA 1W0YT 1WZ1H 2QQLL 3L6FB 3MLUH 4KKNA 5DQ9B 3X12B 1YUHB 2ENSA 1IMHC 3DI2B 4HK0A 2NY1C 3VXNA 1OSZB 3VXPA 1JK8A 4APQB 1JZ2A 3MLTB 1IGFH 1RAMA 5TE4L 1ZT1A 3QAZC 1P4LB 3RL1B 2E7HA 4XAWH 3MRRB 4WNQA 1A9EA 1QBAA 2EYSA 2NW3B 4NPYB 1MELA 2CGRH 4K71B 1KTDB 4GMSH 4U1LA 1MNUH 2VDPL 3C5ZA 3M45A 3C2SA 1U8NA 5BV7C 3BIBX 4G8GA 1B2WH 3HG1A 1Q94A 3VGAB 1KJ2B 4HT1L 3VXRE 4Z18A 5BV7H 1XCTA 3DSFH 3GJEA 5JQ6L 4NN6C 3MGOA 3ARUA 2OMBA 3I50L 4LBEA 3IETA 5FCSH 4LLYA 4DKEH 3MSPA 3KHOA 1IGCH 3T1WA 4U1KA 1R24B 3ROOA 3RWEB 5LGHH 5DTFB 4EZMA 2FGWL 3MRMA 2R69L 5TDNA 4POZD 2O93L 4UINL 5KTEL 1ZKAA 2HT2C 4LCIL 1X5FA 4R4FL 4BFGA 1I3UA 4OM1L 2DJUA 1FVDA 1HINH 5HYQA 4HK3N 1ZTXH 4M8QA 1AQKH 4IDJL 3HZKB 3P9LA 4P48A 1BZ9B 1E4XH 2B2XH 4JFPA 5AYUL 5HDBE 4G42B 4Z0BH 3GSOA 1FRGL 5DO2C 3RA7L 4J1UB 4HWBA 5GRJH 2E8YA 4XH2B 2DQIH 4HIJA 3QIBA 1FSKB 5IBUB 2V7NA 4GUPA 1U8HB 4YE4H 1HQRB 4OD3L 2JLLA 5ISZA 1X5KA 4DQOH 2DM2A 3TN0C 4K9EL 4XCNB 5IB2B 4OFVA 1ZS8A 4NZUH 3H9YA 1BFVH 1F6LL 3B2VH 3IDMB 4KKCC 4JZOA 3C8HA 3LKOB 3IFLL 5A2FA 2NY4D 1NH6A 4MLSA 4X99A 4QNPF 3P4NA 3PUCA 1JF5A 4XPBH 5GGUB 2YPLE 3ILPA 5DI8B 2HFGH 4M4PA 1MCBA 1ZEAH 1IGJB 2F5AH 1YEDB 3EBAA 3OHXA 1CXFA 1J7VR 3RGVB 4ELME 1QQDA 2CLVB 4LAQL 5IJVA 1CFVL 4URTB 5BCAA 3L1OH 3T1FA 2UV3A 4Z7WE 2QHLA 1ZHKB 1JWMA 3CCHA 1CICA 5IVXE 5E6ZA 4MX7B 1CK0L 4P2RA 3I75B 2CDEA 3SDCD 4HF5L 1T0MB 2AERT 3S34H 5FGCB 3BKJH 5BXFA 5J0BA 4OCWL 1E27B 1WAAA 2V2WB 1YDPA 1A7RH 2PYFB 4TRPL 1A6AB 1P5VA 3D2UD 4OJFH 5HI4C 4YHNA 4Z0XA 4NO0B 2YMXL 3BIKA 1A4JB 4R90L 1K85A 2YD9A 2DL9A 4XPGH 5D71L 3CSGA 4ZNCD 2A38A 4M7KH 4Y4FD 2DQUH 3K46A 5KSUA 1JGDA 4XGZA 4S2SB 2EECA 1D5BA 1SVZA 2VXQH 2NX5D 1Q38A 3FT3A 1TETL 4YO0B 2P8MB 3D25B 1TVHA 3O3BA 4MHHG 2CUHA 3OF6A 4DW2L 1MFEH 3VXSB 3S3PA 4LRNL 4YEFA 4U3XA 1AP2A 3DMMB 4PJGA 1LMKA 3GMPA 5DRZA 3RY5A 3BEWA 4Y19E 4LIQH 1YPZA 2A1WL 1MRDH 4MA8H 4H20H 2NXYB 1IFHL 7CGTA 5CIPB 2MOVA 3M1BA 4LDOB 4OZGA 2Q8AH 5GS3A 3RKDC 1CICC 2J8UA 5SX5K 2QADB 1A7BA 2VXUL 5E03A 5E6YA 2VO5A 1OM3L 3FB5B 2UZIL 3UMTA 2JCCE 3S8WA 1E28A 4GG6B 2XA8L 4M43L 5MENA 1S7RB 8CGTA 4FQQA 3BW9B 4K3DL 5EORL 1AGDA 4I9WE 4BM7A 3O2DA 4N5UA 3QFDA 3ULVL 5GJTH 5SWSE 3JWNC 1D5XB 2DS4A 4ODTH 1MHEA 4RDQG 4EI6A 4MD5A 4ACPA 3ARDD 2ESVA 4Y5VC 2WAHA 2Q6WB 5JDSB 4UB0H 3MPCA 2CK0H 1H5BB 2FR4B 4P4KD 3GJFB 3Q6GL 3QI9A 3DUUB 4V1DB 2XTJC 5JPMB 2X7LB 2DOCA 5F7KC 1T5WA 3UCRA 4PYGA 4S0TD 2Q1EA 3CIQA 2P5EB 4CN6A 4UV7L 2R39A 1NJ9B 2QSVA 2XXMB 4K2UH 5GQBA 2G9HA 1FNSH 3SE9H 4MJID 3PWJB 4O2CB 2CLRB 4X7SH 4EUPB 4NHUA 4FNLL 3SY0B 5FKPA 5ADPL 1H8NA 1QBBA 4WO4A 1NCDH 3QO1A 4YEEA 5E2UL 3U7WH 1BZQK 1W72A 5IG7A 1DZBA 3O3EB 2UUDK 5JO5B 5TFSH 4EEEA 1G9EA 3HZMA 3KS0H 3AVEA 4S1QL 1T1WB 4PJBE 4XPFL 1TNNA 4BQ8A 1S9YA 2AV1A 5CSZB 1QFOA 4JPIB 3DSNA 4LF3B 4H1LB 4OQTA 2VLRB 4NQCD 3O8XD 3IS1X 1L4IA 4PRPA 2YHGA 3MV7A 1KB9J 3EFFA 3WJLC 2NLJA 3HR6A 4YXHL 4BSVB 3EZ8A 1I85C 3ILQC 4L3CB 5EOQH 1GGCL 1A7PH 1AGFA 3GHEH 4M48L 4RMSA 3LRSA 1KPUA 2NY7H 4L29A 4XNXH 3VXQA 3MLSL 2ORBH 3CFDA 4HSQA 1XCQA 3O2DH 3AXLB 3WHE1 4UT7L 4TVPE 3LS4H 4UDTB 1BJ1J 5GS0C 4PGCA 4WW2B 3LN4A 3MRNA 5HHPA 4LFHD 3TVMA 1H3TA 4D0CB 3QRGL 4YHKH 3QI9C 2BJML 1F4AA 4PY8J 1QFUH 1DUZB 1MFCL 5GS0H 1BBDH 1FYTD 3VFMB 1F97A 5TE7L 3ZDZE 1U8LA 3ARGA 2BVEA 2NTFB 1A6UH 4XB8A 3VFOB 4OAWA 4Z8FH 4A6YB 1CT8A 4HKXA 3S4SG 4BQ9A 2LU4A 3LQZB 1OTUC 3PHOB 3H7BB 3VA2C 4IOSD 2VLKB 2IQ9L 4N90D 4QRSA 4HGWB 4EI5B 4Q9QL 1P4BH 3RNQB 1A3RL 4KV5F 1A7NL 1W72H 2BVOA 1TVBA 2Z31B 4ZXBC 2RCSH 4KJQD 3BGMB 2R0KH 4GSDH 4RNRA 3MRQA 5DFWH 3WS6A 2F53D 1IQWL 2XPGA 4BUGA 4NGHH 3TJEL 4AEIH 3KLDA 1QYGH 5B8CA 1J8HD 4Z95L 1T1XB 2J4WH 5GGVH 2V5TA 4ENED 5J6GB 3LV3A 3RIAK 2QHRH 5EU4B 4OLYH 3G9AB 3N9GL 5I1JL 3MBXL 5DJZB 3ARQA 4ONFH 5JW4N 5EN2A 4OZHF 3VRIB 2Y06L 3I9GL 4NUGL 5I1AB 4XXDB 3EJZD 2BRRH 3MACL 4XMKL 4I2XA 1EX0A 2ICEA 2FO4B 5C0BB 1IGFL 3IFOA 4U1SA 3RL2B 3CDFA 3TVMC 3S36H 4I5BA 4JN1H 1IAOA 2Q20A 1KCRH 4XAWL 1NFDB 5KANI 5DD5L 3MLRL 3S96B 5KS9E 4RGMC 5TDPA 4L4TA 5IB4B 2CGRL 2EDXA 2XZCL 4LSDA 4IMLA 3ULSB 4N8CH 4G5ZL 4LKCA 5H37G 2E9BA 1B2WL 4F7PB 4P3CH 3TPUA 4RGNC 4L8CB 4BELD 4DZBA 3DSFL 3OX8B 4I0KA 1JF1A 2D9CA 4U3CA 5J9PB 4ZOEA 2VZ3A 2F15A 5CMAB 1A6VH 3EFDL 5BW7A 4DKEL 1LDPL 4Z7UE 5F1NA 2H2PC 3SJVB 2NY3C 3HS0A 3C8KB 5E00A 5KVDH 2W0KA 3S98A 1U8OB 4P5TB 3WS6C 1DSFH 1KJ3L 2HG5B 3UTTE 4OQ1A 4X6CB 3VRLF 5I73B 3EDEA 1ZWIB 3D87B 2Q8BH 3K2MC 2F58L 2JJWA 2W91A 1TQCC 2VISB 3EW3B 1C7TA 3KYNB 3MOAL 4Z76A 3LKPB 4NHCL 1XR8B 4G8FA 1IM9B 5FGBA 2FZ3A 4HG4K 1OD9A 1WFUA 1XMWA 1MFAH 2MTPA 4KKAD 4TSBH 5HDQH 1IT9H 2DAVA 4X6BA 4Z0BL 3T2NH 2DDQL 3FT4B 3QUYB 4WI8A 1RIVL 3DETC 5LXGH 1T4KA 1KC5H 3M17B 4Q9RL 3KXFB 5I1KH 5JLZB 5EZOH 1RHHA 3RVTD 4M02A 3SDDA 3FOLA 3U7AA 1XH3B 4PJFA 3ESVF 4HK3J 4M6MH 3M8OH 4KROC 4HKZA 1F4YH 4GJTB 3TYFB 5D2LB 4HJJL 2YD5A 3WNNA 4NZUL 2D3VA 1PY4A 4RBPH 3UJIH 3B2VL 1F3RB 4RZCB 3G6JA 3SPVB 3UZEA 2IADA 2WK2A 3PDGA 5C0IB 3QDME 2HFGL 1S9VB 2HN7A 4KK5C 1OGAA 2EIBA 3ZZ1A 3SCMC 3NCYP 5F9WB 3L1OL 3BP7B 1BAFL 2VLJB 1Y0LB 4X9GA 5EC2B 5E9DB 3DRTB 1XF5A 4MVBD 3VXRD 5K9OA 3B8YA 2RQ8A 35C8H 1YY8B 3LS5H 3S34L 3V8CA 4DN4H 1P9MA 1YEHL 5A2JH 3U2SA 2EXYD 1XR9B 1YEJH 1MJUL 1ZT7A 1YEIL 5FGBC 3R06B 2NY2D 1OF2A 3UDWA 1Q9WA 2GK2A 4TULL 4HS8H 1FC2D 5K33A 1QHOA 3X12A 4LCWA 3PP4L 2RFXA 2E9WA 1G7HB 4RWHA 5CJ5A 1OSZA 5KSVA 4BZ1L 2QSCH 1TJIL 2P4AB 3SDDC 1KIRB 5CP3A 3OAZK 3I2CL 5JXAH 1NEZG 4NKIL 5HGGS 5F7LB 5E6IB 2HH0H 4NPYA 2NW3A 5T5NF 4MNQB 4OFYD 2BSSB 3HPLB 1GSMA 1BVZA 3DX7B 3IT8D 4M7ZB 4PV9B 1YNLH 4YFLI 2D7NA 1KJ2A 5IFHH 2NQCA 4KGLA 3U7YH 2H32A 2VXTH 2YXFA 2G75B 1T5XB 1B6UA 4PV8B 2I26N 5DFVD 4H26B 1R24A 1N5YL 3RWEA 1HH9B 1GOHA 3QJHA 1P9MC 2OJZH 2J7LA 4P3WA 3N1FC 1DQQB 4PJCF 1T22A 1PX3A 1UA6L 4JZJB 4LDLB 3UDWC 1H3XA 4JCMA 3V7AG 3QFJA 1BZ9A 5LKNA 3MRGB 4ODTL 3ME0A 4G42A 1ZSDA 1A0QL 2FGZA 1MCKA 5F7EH 1BEYL 4FQ1L 2YS4A 4J1UA 2OMNA 3D18B 1X5GA 4XH2A 3IS0X 1H3GA 3HNSH 5I6XB 4JQXA 4APQC 4U6HA 5HYJB 1AHWA 5E5UB 2FWOB 3TYGH 1U8HA 1S5HB 1DE4B 2VLME 3ZLQC 3DWTA 4E9LA 3UTZB 3NZ8B 4PJAF 5EBGA 1QSFB 1NC2D 2XKUA 3WNMA 1S9XA 4K2UL 5IB2A 4Y2OA 2VNCA 4K71C 1F4XL 1FNSL 1SYSA 4R97B 1GJIA 1GPOH 2AJUL 1NCBL 5C2BL 2R0ZL 2DKMA 1QRNB 3KYMB 4X0KA 1H3VA 3GSQB 2O5ZL 2AABH 5GGUA 2PF6A 4CVWA 3VGAC 1OARL 5DI8A 4OTXL 3VXMA 1IGJA 2VDKH 5BVPH 3RGVA 2CLVA 3KPMA 1KJ2H 2OI9B 3RWJA 5J3HD 1GHFL 2HKHH 2ZUVA 2X1PA 4L3EE 3NFSL 1ZHKA 4OFIA 3MJ8A 4XP5H 3STBA 3DYOA 3FO1B 1AY1H 1KG0A 2ADIB 1FGVH 4HHAA 4ZS6C 3UPCA 5JW4R 1IGTA 2Y7QA 1MCEA 1E27A 4PJDB 1CD9B 2V2WA 2X1QA 4D94A 1YMMB 3ZKMC 1EV2E 4TQEH 1QBMH 4NO0A 3I6KB 3HUJB 1RZIA 3EDKA 3AGVA 5IHLB 2ORBL 2IBZY 4JFZH 3U0PA 3F6LA 2DRUA 5DS8B 2DQGH 5DC9B 5F7UA 5IW3A 3DVGB 1UXSA 3VH8A 3PABB 4I9WD 4NQDB 5C0CA 4JQXC 4S2SA 5C0AE 1FSKC 1AHWC 1DQTA 5L8KB 5SWSD 4YO0A 5DZLA 4J23A 2EH8L 3GMOB 4X8JB 1BBDL 1KYOJ 3VXSA 3W2DH 1ADQH 3LKNA 2VAAA 3TBYB 2C1PB 4JO3L 1ITCA 1YYMH 2WUCL 4L4VB 5MEQB 1DLHB 4WW1A 3S35X 3DMMA 1P84J 1AXTL 3SBWA 5I8CB 4OGYL 2AK1L 3HNVH 3C60A 4NNXA 2Z8VC 5HPMA 1AO7E 3KHQA 3VGGA 2FIRT 2HRPL 1T3FB 3CU1A 1JZ6A 3Q0HA 4PIRF 3TJHD 1JMZA 4YFLF 4ETQB 3RGVC 5J13B 5K59F 1NMCB 2FSEB 3KJ6H 3EYQC 1L0YA 2E9JA 3SDYH 4WUUE 3MLVH 2AK4A 5DD6B 3QZWA 5DEFA 1A47A 1O7VA 3Q2CA 4G8GE 4WI4A 5IVZB 5MEPB 4JG0L 3DXAE 2FL5B 2W0FB 2VDNL 1K9TA 1KELL 2EYRB 4UV4H 4GG6A 1SM3L 1SMAA 2C1OA 3U0WL 4UBDC 2YRPA 4O51A 1FIGH 2JIXD 3BW9A 4Y2DB 3ZDYE 4X9IA 5CILH 4JJ5B 3ZTJG 1PKQB 4U6YB 4MAUL 1N7MH 3EUUA 4LSUH 3W9DA 5D1QB 1D5XA 5IIEA 2BRRL 4G7VH 1D9KB 4GG8B 1AGCA 4I1NB 5KVGL 1HIMH 3PGCB 3QUMB 4S1DC 1IC1A 3QH3A 4HBCL 4YHZL 2Q6WA 5JDSA 1NC4D 3L3OB 5IR1B 2UVEA 1VADA 4HH9B 4NFBA 4FQPA 3RIFF 3WO3B 2FR4A 4K3GA 3ZTNH 5GRUL 3DUUA 4V1DA 4X6DF 2DBJA 3PV7A 1WSST 1PAMA 1AE6H 4GAJH 4F7EB 1CFQA 3BAEL 1GGUA 3DMMC 3BN3B 3PWJA 1HCFX 3NGBB 4O2CA 4S1SH 2CLRA 1DBML 2X41A 3CXHK 4EUPA 3C60C 1FGNL 3HI6H 5ALBL 3O45A 4NKQB 4P3CL 1CCZA 3NIGF 2NXYC 4MNGE 3SEPA 1O7SA 3O3EA 5JOFB 1LO2L 4FXGB 5D7LB 5FDWB 4FQJL 1RULH 2APWA 5EBMA 1T1WA 3N85H 5CIPH 3ZKQD 3LPWA 3CVIL 4NUJB 5CSZA 2PO6D 4LIQE 5ESQA 2BY1A 4LF3A 1HHHB 2QADC 1B6DA 2VLRA 2MQ3A 2ZOKB 4UT6H 3QQ4A 2YA2A 1P6FA 5HHNB 4ZTPH 4N8PA 4F58L 3NN8B 2DM3A 3U9UB 4BSVA 4E42A 4PPTA 5ICYB 1TCMA 3UJJL 4L3CA 1A6WL 3ALPA 4XC1H 3WLWD 3T0EA 2BCKB 3LKSA 4LEXL 4LASL 2OTPA 3WKMH 4FFVD 1TJHH 1J1PH 1U8MB 4HD9A 4OLUL 2VR4A 3BQUB 3KLSA 2ZSWB 4JFDB 3V7MA 2X44D 1QR1B 3IF1B 2C3VB 12E8L 5I1KL 3DVFA 4WW2A 4DOHE 2Y4SA 5JW5B 3RVWC 2L7UA 3CFEB 3M8OL 4JFQB 4UTAH 1OAZL 4NWUL 43CAB 4BFIB 2VXVH 5B38G 5L8JB 4AIZB 4FFZH 3GJFH 4JANB 1HNGA 1CQYA 1FFOB 3RPIB 2QQNH 3VFOA 4A6YA 3OQ3B 3LQZA 1OAXH 2YKLH 3PHOA 2IC2A 2GTZB 5DK0B 4O02H 2VLKA 1RJLB 4QRPE 4EUPH 2XTJE 4HGWA 1NGYB 2FDBP 4YUEL 1FYHB 3LKQB 1MCSA 3G5XB 2XWTB 1CTOA 3H6JA 3MV8E 1OWWA 5GS2D 5CZKA 3MJ9H 1OT1A 4JVPA 3EYUL 1YPZE 4H1LH 4M7LL 4KVNH 5IEKA 2NZIA 4GKSB 4OSUL 4EQ2A 1G1YA 2I07B 1Z0NA 5EU4A 4YXKL 1R5VA 1DBAH 3UTTD 3RTQB 1K2DB 2OL3L 5DJZA 1F3DH 3VRIA 4J3OC 3G08B 5FO9B 5I1AA 4I0PB 2BVUA 4JM2D 4XXDA 3WS3A 4L1DA 3VD7A 1HCVA 2AI0H 2DQHL 2CO7B 1EBPA 5IBUG 4HMDA 4WW2C 5IHUL 3DGCR 4P3DB 3DRQB 5C0EA 3MROB 3NFNB 1CLYH 4PTUB 3SE8H 1JGUH 2DN7A 1NFDA 3EZJB 1BQHB 3WE6A 3S96A 3P3YA 1ZLVK 5IB4A 3ZKND 4NM8H 2GSGB 3ULSA 1UC6A 4LSPH 4CRPA 5CUSH 1NGPL 5DUBB 1IC5H 4F7PA 1DEDA 2YD3A 4ZUTB 4A6YH 5L7XH 4JAMB 4NRXA 1MPAL 4M7JH 1G7LB 3S37X 4H88L 4H0IA 3OX8A 4R8WL 4O2FB 5FYKU 1BFOB 3MOBH 4NQEB 5GZOD 4FTVD 3SJVA 1WBYB 3C8KA 3VCLA 2ZCHL 4CN1A 1M6OB 1U8OA 3EJYC 4XNUH 1CR9L 3GIVB 3IXTB 4LMQE 4X6CA 3ETBF 1ZWIA 2YRLA 5DDHA 3WDJA 4JRYA 3KYNA 3NCFB 3D39E 3BGAA 1CLZL 3ECBA 4PJIA 1Q9LB 1IM9A 5HHXL 3WN5B 1QFHA 3CZFB 4NWTH 3A6OA 5JMRA 3CLFH 2VN7A 3QG7H 3PHSA 5JUEL 2FBJH 1HHKA 1NEUA 4NP4H 1N59B 2H1PH 1UH4A 4PJ8D 25C8L 3GMNB 3QUYA 1WZKA 3HNSL 1EGJA 1RUKH 4LSTH 5F1IB 4HAGA 1IKFH 2MMXA 3KXFA 2AJZA 5GHWL 4XI5C 4LCYB 2I24N 4R26L 3TYFA 5D2LA 5BS0B 1IC7H 3GSRB 4ELKA 2RGSA 7FABH 5C0JB 4ZPTA 4ZSOE 2NY6D 4QXTA 4RZCA 1QLRB 4OBSA 4PLKC 5JXEA 4MZ2A 4Z7OF 3QXUA 4JRWA 5T5NG 5BVPL 3H3BC 5DD3L 2CMRL 3BH8A 4GAGH 3AY4A 1Y0LA 4N5EC 1XGPB 3DRTA 4P5TC 1LVEA 3O3AB 5DVMA 4FQCH 1YY8A 1FGVL 5I73C 1DVFD 3FZUC 3LDBB 4RGNE 3FAXA 3W5NA 1OW0A 1EH9A 3NACL 3WXVH 1CG9B 4KI5C 1U93B 5FYKH 3KYOA 4U6TA 5I2IB 3UROR 2H41A 2A74B 3MMEA 2OR8A 2NZ9C 2AJVL 3MRKB 1WCBB 5E08H 3K80A 4DVBB 4WJ5B 3QUYC 4ZQKB 4IRSB 1GZPB 1G7HA 1A1OA 4S1RH 5IF0B 4FQXD 1WF5A 2I9LB 4OIIL 1AD9B 1JI1A 1D5MA 1F3JB 2XYCA 1QFWH 1YEEL 2CUMA 1AI1L 4ODHL 3W2DL 1KFAH 5D5MF 1T89A 5DT1H 2CLZB 1F00I 2E7BA 3S97C 4RMTA 5E6IA 3BEVB 3EOAB 3ESUF 1S9KC 4JQVA 2VLMD 4I2XE 4GO6B 4U0QB 4PV9A 5BO1L 2IF7A 5LGJB 3GIZH 1JPSL 1JGEB 1A9BB 4PRHA 4L4TE 3FTGB 5F9WC 5I1CL 3Q5YA 3TEUA 3AY4C 3QEQB 2OSLB 4PRDB 1T5XA 2IWGA 4RA0C 2XQYK 4H26A 5F1KC 2DTSA 2HKFH 4ZUVB 5EH1A 3MYJB 1J1XH 1OW0C 1UWGL 4L3ED 1B0GB 4HIIB 4NN7B 5CEYB 1HHIB 4FABL 4D0BA 2EICA 2X89D 1DQQA 1T1ZA 4E41B 1CXKA 3SKMB 1JNNH 1R3IH 2AXHA 5E5RB 2EE9A 1VA9A 3KR3L 3KYKH 4W4OA 1XGQB 4DK3A 1OTTC 1G7QB 1KCSL 3H9HB 4C57C 3MRGA 4G8EB 1N2RA 5TPWH 1UT9A 4HJ0C 3THMH 1QKZH 3D18A 5HYJA 2DQFB 2GFBB 1P6AB 2FWOA 2I25N 4NYLB 5J7CC 1S5HA 1DE4A 3T04D 2F54A 3JUYA 1N0XH 3NZ8A 1HDMB 2HT2D 3ARFD 1QSFA 3BP4B 1GC1C 5C0AD 4Y4KA 5E6IC 4CL7A 5D93B 1AE6L 5DK3A 5E1AB 2ED9A 5CSBA 4JQVC 4NDMB 3MRCB 4C54A 1GC1H 1JN6B 3MXVH 1OB1B 3C5SA 4D0DA 3BZEA 4M7ZC 3VD3A 4BH8A 5DHYB 3GSQA 1G6RL 1RK0A 2AXFB 5DO2D 5L6YH 2F8OA 4NNPH 3C8DA 1MAJA 3S7GA 4P46D 4Y1AB 6FABH 1DBBH 1CLOH 1AO7D 3C2AL 5IMKA 3QXDA 3TNMB 4OFDA 3FO2B 1F90L 3QG6B 4UT6L 3O41B 3FO1A 4KK8C 3CFBA 5JW3L 2ADIA 3TN0D 4ZTPL 3W9EA 2X4QB 3LPFA 4WUUD 1Q0XH 1HI6A 1EFXB 4NNYB 5IEHA 1NCNA 4PJDA 5F7WC 1P53A 1OGAE 4FQIH 4JZJC 2ZG2A 3RX8A 3DXAD 2LVCA 4XC1L 1ACYL 1XF4B 3GHBL 2HTLD 3OG4B 4W4OC 1AD0B 4NBZB 4KDTA 3BMWA 3G5ZB 5E2TH 1P7HL 3LH2L 3O9WB 4XBPB 3TT3H 4JPKL 2A9NH 4XBEH 3KPSB 3DVGA 3CPLA 3PABA 1DUYB 3SDXF 5I6XC 4Y0GA 2LTQC 3ULUL 3BH9B 3UC0L 4MA7H 2F19H 1PG7H 2VDRH 5JOPD 1J12A 4LSVL 1QTYT 4Q9BA 1KTLB 3LEXB 1FFNB 1BIIA 3GMOA 3DV6B 4ZUUB 3O4LE 4X8JA 2VXVL 2N7AA 1YQ2A 3HZYB 4L4JA 4Y4KC 3ZL4H 4LLQB 3SE3A 1EXUB 1A6ZA 5HVHB 2UVFA 4L4VA 3NCEB 5MEQA 2B7DT 2ZSVB 4R97C 4JB9H 5HI4D 2H26A 3NCJH 3VXUA 3MREB 5D7JD 4KZEL 3WEXA 3VJ6B 3RWHB 1MJJA 1LK3L 2GI7A 3PQYB 1HOCA 4ETQA 2PCPB 1VGEL 4HMEA 4RISL 1JHLH 2CDGB 2FSEA 2AQ3A 4YC2B 3X14B 5DLMH 5DD6A 4QTIH 1FNFA 1MWAL 4UDUB 3QULB 5MEPA 5IVZA 1N3NB 2XNAB 2FL5A 2W0FA 3STZA 1L7IH 4H8WC 1FZJA 2EYRA 4OCRL 5EBLA 5MHSE 1QPXA 4U1NB 4KQ3L 1CE1L 5MERA 2EEBA 3OSKA 1IZKA 5J57B 3N1QC 4QHNA 5EA0H 1SJVA 3I84A 4H8WH 3FB6B 3TH2T 2SEBB 5C86A 4KDTC 1M1SA 2Y36H 1PKQA 5DC4B 5F7YC 4ZO6A 5D1QA 3NAAL 3RVUC 4KVCH 4GG8A 4CNIA 4A2MA 2DLTA 3QUMA 3N1GC 4OZIF 3IU4H 2OTWB 2IPTL 3T3PE 4IHOB 3L3OA 5C7XH 5IR1A 3GSUB 4HH9A 3UYRL 3FONA 4B7LA 4JHZA 4I3RH 4XMLH 3H7LA 2WINB 4HIEB 3DPBA 5IESL 5GGRY 4LOUC 2Q76A 3TFKC 2N1KA 4I4WA 5SWZB 4MXQC 4K23H 1H3PH 4GXVL 2CDFA 5INCB 2BY2A 4ZODA 5JOFA 2GT9B 5AG8A 5D7LA 3ZT5A 5J13C 3OXRA 4PP2A 5FDWA 1CD1A 1GIGL 1NMCC 4N8VB 5I1DB 3PWUA 1PX4A 3OF6D 4QRPD 3AB0B 1I8MB 2VL5B 1MFBH 2A2QT 2XTJD 2LV4A 4N0UB 2ZOKA 5IROA 3MV8D 2NY5L 5HHNA 1U8QA 3IVKA 5JW4M 2JB6B 5EU3B 3RWIB 2KUTA 5HDOA 4NWTL 3WFCH 1DQDL 1ZANH 4RX4A 5FOBB 3F7YA 1T0NB 5D1QC 4LHUG 4HQQH 2H1PL 3EOYG 1LO5B 1D9KC 3BQUA 4OZFB 4EVNB 1S5IH 5FGCE 2XFXB 4QRRA 4O9HL 4LSTL 4Y5YA 4JFDA 1QR1A 1KPVB 3IF1A 2C3VA 5GRYA 4NQUA 1VKXB 1LWRA 4PB9H 3QUMH 5JW5A 3MC0A 2ICWJ 4OM0L 1K6QL 3CFEA 4KPHH 1DQJB 1SHMA 4IRJA 43CAA 4NKDA 5E95B 5IB5B 4BFIA 5I8OH 1YECL 1FVCA 5LCVH 3MTRA 1NAKH 5EIVA 4AIZA 4WU7B 5IGXH 3EYVB 3ILQD 4JANA 4N9OB 3NGBC 3GKZA 1CFNB 5EUOB 2DD8H 3AU1B 2GJ6B 3VI4F 1RJLA 4HIXL 2YUZA 4PJHF 3VXSE 4W6WB 4PUBH 3K1KC 1IBGL 1NGYA 5EZLB 3RX5A 3UX9B 5GS0D 4KMTL 5FIEA 5AEAA 4JVWA 3D3VE 2O61A 3KPRD 1NGQL 1UB6B 3KPPB 4DFIA 4ZFOB 3WIHL 1QBLH 4FZ8H 4M1GH 4OD1L 3DVNB 5C07B 5I1IH 4TSAL 5IROC 1G9MH 3TBTB 1QSEB 4H0HB 3IXAB 3HMWL 4ZFZB 4TUOB 5CFHA 4GKSA 5IWLA 2YSSB 3DUSB 1MREH 2X1OA 3KLAB 1OTUD 2P7TB 3GRWL 4TOYH 2WIIB 2XQBH 1EA9C 3RTQA 1UKTA 1K2DA 3NPZB 1JIBA 3HE7B 5DD1L 3A67H 3JWOL 3D39D 5H94B 1H15B 3BQUC 1A14H 4I0PA 4ZXBD 1CVRA 1FPTH 5J4MA 3KLHC 2CXKA 3NZHH 1AIFA 2VYRE 3BKYL 4PJEB 5GRVK 2FHCA 3DRQA 2DYPA 3MROA 3NFNA 1J05B 4PTUA 5D9SB 4OLXH 1KFAL 3V0WH 4NZRL 4IRJC 1RK1B 5HD8C 5DT1L 3RDTA 4RWYH 3C08L 1UKSA 4N1EA 3V52H 2Y25A 2X4RB 3KAAA 1XGRB 2WWMC 1UZ8B 3QT2A 4X6DB 4HDIB 2ZJSH 3HI1A 4AK1A 1PVHA 2FEDC 1INEH 3SHSA 2NXZD 5DUBA 2DQJH 2EIZA 1UWXH 1UADC 3T0AA 4QWWD 4V1DE 2GSIA 1LP9F 3WUWG 1G7LA 2D31B 4DWHA 1J0HA 2OP4H 1H3WM 4WFEE 1BFOA 2P5EE 5D2NB 5J06A 5L0QB 4NQEA 5T1LA 3TVMD 4CMHB 5C08B 3CXHJ 1A6TB 4Y4HB 5IP4A 1ORQB 4X4XA 1MJ7L 5I71B 4K7PY 3ARTA 4GBXB 3LEVL 2X09A 2CKBL 4XCFH 2ADGA 4D8PB 5HBBA 1LO4H 3HAEB 2Q86B 5IWLC 2AJ3B 1KEGL 5TF0A 1D7FA 2DIBA 1MCIA 2DQTH 2OR7A 5GGTH 1Q9LA 3WN5A 3SGDH 3CZFA 3RTQC 5HHMB 3KYKL 5E70A 5CGMA 4RGND 2VLRE 1AH1A 5K9JH 1T21B 5JZ7C 3TV3H 2P45B 5TF1L 4I0PC 2B0SH 4UNUA 3BUYB 2UWEF 3UTSB 3THML 1QKZL 5KSAB 5B21A 4LAJH 5BVJB 2YD6A 3T8XB 3AREB 1TZGH 4WU5B 2MCG1 3PNWB 5KSBF 1MCLA 5JIPA 4HPOH 1NLBL 3P11L 3N50A 4EIZC 2NYYC 3O0RH 1N0XL 1R5WB 4YDLB 1FAKT 4LCYA 3RDTC 5EIIA 4G43B 1ZVHA 3V4VL 2ZCKL 1FFQA 2P5WA 4C56B 2X10A 1BZ7B 5C0JA 1G7PB 1JNLH 1RZKC 1ZLWH 3MCKB 4NBYB 2ZG3A 4P9HL 3WFEH 1I7RB 1RZKH 2A6IB 3QIWB 5L6YL 2ADFL 3P4OA 3DETD 5LQBH 2APFA 1LE5B 2IALA 1F58H 4GRWF 4UQ2B 4TNWK 4DVRL 1GRWA 5KN5B 1EO8H 4K7PL 1FN4A 4F9LA 1ZE3C 4OKVA 4KROD 3QHZL 3O3AA 5ADOH 1MRFH 4L4TD 5EPMA 5D1XB 2LAAA 5T1KA 1NL0H 1NAMB 2VLKE 3HE6D 4YQXL 1Q0XL 2WW8A 2BNQA 4FMFA 1E0OB 4J12A 1CG9A 3WN5C 1U93A 4ONGL 2R0LH 2VDLL 3IRZA 3IRPX 2A74A 2DM7A 3OGOE 2BY3A 3GBLA 2R1YB 4DVBA 1OCWL 5CD5C 1MOEA 3SCMD 1KTRL 1PJ9A 5FUCC 5TH2A 5D7KD 5FF6B 1GZPA 4DZ8A 2I9LA 4OZHA 5KW9H 2VDRL 2X9XA 1UG9A 4ODWB 2E6PA 1MLBA 1DQML 1F4WH 3LHPH 3WIIH 1TJGH 2CLZA 3O6LH 2IPKB 4BUHA 2YRZA 2M26A 4MB4A 1TVDA 1XIWB 4JB9L 4OKDA 1C5BH 3NCJL 4QY8B 4HLZG 5C0BE 3HB3C 2NY0D 5LGJA 1NFDE 1JGEA 4OF3A 4JRXA 1T7VA 5I16A 5DMIL 3DHMA 2ARJQ 1YEKL 2MNUA 3FTGA 3D9AH 2HTKC 3SDDD 3VG0L 3QEQA 2OSLA 4OCXH 4PRDA 4F9LC 2BNRE 5CCKL 5GS1B 3R1GL 1U6AL 1JNJA 3WLBB 3UJTH 5JHLH 4ZUVA 3MYJA 4ZOCA 1L7IL 4XZUA 4BZ2H 4MNHB 4OLEA 1MCHA 1B0GA 1HHIA 4KRMB 1UYWL 1EEZB 4E41A 3SKMA 3SJVE 4R7DA 5HGAB 1DFBL 1XGUB 2Y36L 3ROLB 1LGVA 4PJXF 1JYWA 1LE9B 5D7SL 1E4KA 1XGQA 3AFLA 3H2WA 2FH6A 3H9HA 4ZUSB 1JFQL 1OGAD 4KVCL 1CBVH 4IRSC 4X6CE 2PTTB 5FYKE 4Z6AT 4PRNA 5DUPH 4KJPC 2F8XC 2Y6SD 3LPGA 4KI5E 2DQFA 2GFBA 4NYLA 4HW6A 1AGBB 1FZMB 3ET9F 3RVVC 4WI9A 1WBXB 5HGHA 2IJ0C 3EIFA 4WWKB 5E1AA 2VQTA 3DARA 5FA3B 2FIKB 3VG9C 3RNKA 4NDMA 5EU7C 3O4LD 3EOBA 1S7UA 4KI1A 1L6XA 2R29H 4L5FL 1KN2H 3HPJA 1BBJB 4RAUB 1FL3B 2AXFA 4HX1A 2Y07H 5D2LE 3VW3L 4APQD 4D3CH 4TUJB 5DUML 4R4ND 1UJTA 3MRDB 4PLJC 1CL7H 4M5ZL 4B41A 3MO1B 3WFDL 43C9B 3TNMA 2XWJB 4DK6A 3W0WB 4DKFH 3O41A 4MD0A 4Z7VF 5ICXA 3EOTH 3OKEB 3UO1L 3U82B 4UUJA 4F7CB 3BDYL 5ECJE 3NVQA 3QIUA 4NNYA 4NN7C 1JJUA 5DJ8B 1UCBH 5C0NC 3BO8A 3VWKB 3A6BL 4FQ2L 2VLJE 2VMFA 4FXLA 4AT6B 1XF4A 5E9DE 3QPQC 2LQRA 3NCBB 4HQQL 4K8RC 5KOVC 5MHSD 3PWNA 4RIRA 1MHPH 4XBPA 4PJ9A 1YYLH 3MCLL 5GGQL 2HVJB 4K8RH 1FBIH 1TXKA 1E4WH 5HGBB 1C08B 1KTLA 1FFNA 3LEXA 4ZS6D 4AG4H