1UACH

Crystal structure of hyhel-10 fv mutant sfsf complexed with turkey white lysozyme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSSFGSTFYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
publication title Structural consequences of target epitope-directed functional alteration of an antibody. The case of anti-hen lysozyme antibody, HyHEL-10
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uacH00
1OP9A 4ZAKD 2ZUXA 1D5MA 3W2DH 3EZJB 3MBXL 1NDGA 5K9QI 5KVDL 1IZJA 4D0CB 1JMXA 5HHNB 3E2HB 3INUH 2OR9L 4F7CA 1BVKA 4MA8H 4ZYKB 2DD8L 2YXFA 1OY3B 3IFOA 4IOFC 4F8TA 1VPOH 1FL5A 1CVSC 2QTEA 5C0RL 1UB5B 1DBBH 1AI1L 1RUML 2O5ZL 3C60A 5EA0L 5JDSB 2BDNH 1KCUH 4AQ1B 3TA3D 4P2CG 1OOAA 1RZKL 5AZ2L 3EOTH 4Z9KB 2OI9B 4K94L 2Q86B 3KPLA 3NFNB 2MFNA 4XNUH 4ODXB 3G6JB 4WHYH 2EDFA 3IETA 1UA6L 1JRHH 1AXTH 4LSQL 1FO0A 4BFGA 2JTDA 1EFXA 2VXSL 4OI7A 2OBGA 2A6IB 1OARH 1IC7L 4OI9A 4UNUA 1WZLA 4RA3A 4XNQA 3X11B 5IB3B 5IBLD 2M8XA 1XGYL 4OD1L 1OTSC 2GCYA 1RK0A 5D1ZC 4JPKL 4ONGL 3SE3A 5C7XL 3LPGA 3CPLB 2R2HA 3IDIA 1L9MA 5SWSA 2Y25A 4LSUL 2AXGA 1T1ZA 4HC1L 1TZHA 4NZUH 1NAMB 1JPGB 3QIUA 2H9GB 3QFJD 4ZUSA 5FM5O 4N8VA 2VAAB 5KJRH 4PLNC 1TCMA 1AGBA 1ZWIA 5ESQA 2FD6H 4FQ2H 1MFAL 4NQXB 3WIHH 2EDQA 1DQQA 3L3DA 1YNKH 5CIPA 3WNKA 3GSXB 4OUUA 2VLME 3MV7D 3BYYA 1S7UA 3TIDB 3ILQC 3OGOE 4OV5A 4G9FD 1KJ2B 1QOKA 2NYYC 1NCDL 4RAUA 3WBDA 2NY4D 4PV8B 2ZCKL 1OGAB 2HRPH 5F7KC 2YPKB 1JNHA 2X4UA 3SCMB 3HC4H 3GSVA 4JHZA 3V8OA 3GSNH 2XN9E 1QO3B 3MRFB 4FQ1L 1U8QB 3LEXB 4QLRA 4JANB 1T03H 5ITBL 3FFCB 2W9LA 4MHHG 1OTUD 1HH9B 3L95A 3C2SA 3BGFB 4PRHB 3FT3B 4ZD3H 3P4LA 1YEHH 3D3VA 1YNTB 3HG1A 2VKXA 4RFNB 2I25N 4QHMA 3B9KA 4LHUG 2IH1B 4OZHF 5MENB 2EDXA 5EFIA 1D6EA 1WFUA 3VXSE 4EDXA 3FQNA 4FFZH 2AABH 4X4XA 4FXLA 4M3JA 2CGRL 3L3HA 3O3AA 5FB8A 4UAOC 2VQ1B 3GFUA 2Z8VC 3Q48A 1AP2A 2VERN 3REVA 1M7IA 4E41B 4RISL 1VACB 4G5ZL 3N85H 1WC7A 1RZFL 1F4YL 3B3IA 2NX5D 4CAGA 2D0FA 1LHZA 1QNZH 1HNGA 3OR7A 1XF4A 4LLWA 3O3EB 2DM7A 3VWKB 4NRXB 1MLCA 3V4PL 1UM4H 1ZOXA 4NCC2 2Q3ZA 3S34H 1PZUB 1QR4A 1UJTA 2RQ8A 1DANU 4R4NC 1NEZB 4ELME 4N5ED 2XY1A 1R5VA 1PBYA 1MLBB 1FVDB 1I7ZB 1T4KB 4Z77B 1I3RB 5FYKL 3DGCR 2PF6A 4FTVE 4YO0A 4P9HC 1FYTB 4XPAH 2ZCLH 3SQOH 4HPYH 5CBEB 2XTJB 1F3RB 2XQBL 3TP4A 1QYGH 3KR3H 5DUBA 3SJVE 3VI3E 2VDRL 1E4WL 4GRMA 2MJWA 3LN5A 3K8MA 4YBHA 4FFVD 4RMVA 3BUYA 3TBWB 3BPNB 1I4FA 4E0RA 3T4YA 5I71B 5F72S 4Z7VE 1MCRA 5FXCH 3QAZC 5GZOC 5DEFB 1KIQB 2QQNL 4KV5F 1JFQL 4HUNB 1T21A 5D1QD 3E8UH 4KJWC 1KXTB 1JZ5A 1IBGH 3MGTB 5A3ID 2R0ZH 2AK4B 1GGCH 5D7IF 2LFGA 1CLCA 4Q97A 3BRDA 3WSQL 4Z8FH 1N6VA 4KZEL 4GKOA 4AH2B 2J8UA 4M6NH 4KDTC 5B4MC 2DQIH 3NABL 4M5YH 2RBLA 5IF0B 2XZQL 3SDYH 2XTLA 2Y06H 5IM7B 1KXVC 3BEVA 4YX2H 1DQLH 3ZDYE 4B53A 4POUB 1J5OL 4JGMA 4CN4A 2IAMB 4R4FL 5IT2L 1I9IH 2XXMB 3MREB 5FYKE 4NQUA 4UIKL 2C7UB 4ZUUB 4PJ9C 4NO2B 3FT2B 4JRXB 1FZMA 2VLJB 2BSTB 5F88A 3UTSB 2QQQA 5B3JE 1L0QA 5AYQA 4LASL 4YDVB 5IG7A 1DUYB 3S96B 5JZ7D 4WO4C 4XTRC 3U4AA 4HMEA 4LPVA 4GS7C 4PJBF 4CNIA 1U3HD 4Z7UE 3T2NL 5DD1H 3PGCB 4KHXL 4LGPB 5E7FA 4LAQH 5IVXB 3GKWL 3U46B 2MKWA 1EH9A 3F7QA 5L9DH 1FLRH 4G3YL 1RULH 3MRRB 4GOSA 3S4SA 3P30L 4L1DA 5E70A 3NCEB 2BERA 2MQ3A 4K3DH 4YDLC 4PYGA 5L88L 1A7NL 3PNWA 1QKZH 1TTGA 4PJ5B 5DFWH 1WCBB 1W8OA 4KFZC 5EU3A 4XCNB 4GW5A 1MHHA 4P5TD 2Y1VA 3SGEI 1AGFB 3I2CL 1W2KT 1TVHA 4PJ7E 4N0FA 5F89A 2AJUL 2UZYB 4ZPTA 2HMID 1MPAH 1UCTA 5D7KE 1KTDA 5ICXB 3VXPB 2CLZA 5C0CA 4Y16C 1H3GA 1EEUA 1Q0XL 1ZHNB 5TGBA 4ZNEE 2WMPA 2DM3A 1IEAB 4KKCD 3QRGH 3GMMB 4DZ8A 5E8NA 1Q9KB 4NQDB 2NY5H 1V05A 4OZ4B 3VFTB 5F1NA 4XNYH 5D7LD 5IVZA 4MXQC 4HCRH 1UFUA 1UGNA 5HGAA 2VLKA 2CUIA 3IGAA 3RVUC 3GJFH 3MV9E 4IJ3B 1BJ8A 4DUXA 2NQCA 5DRWB 1I7TB 5BRZD 4HWEL 5GJTL 5KS9A 1RHFA 2YRLA 4KUCD 1RU9H 4G8FA 1T1YA 3CFEA 2ZOKA 2GQHA 1SJEA 4GRWB 4KK9D 3IU3A 3Q5OA 4QNPF 4YJZL 5CJOL 2ADIA 3CLFL 1QHOA 1ZGLA 1LO4L 3TN0D 4JFQA 3QUXD 5FHAL 1TJGL 4PS4L 4Q74A 4OLYL 1CFVL 3QQ9D 2AXJA 1OAZH 5D7JC 2DIAA 4OLVL 4NWUL 1T5XA 2WQRA 3RPIA 1HXMA 2G60H 4D8PB 1C8PA 3WKML 1WEJH 3QQ3B 3DO7A 1HQRA 3M1BB 4KMQA 5CHNA 3O8XD 4R2GC 4JZOA 5DQJA 3DROB 3KPRA 1QFWM 4NM4H 4OGZA 3E6HA 4R97B 1U92B 4WNQB 5F7NC 5KVFL 5IQ9A 2A77H 1GIGH 4U6TA 1GSMA 3TF7C 3RUGA 4TOYL 4BFBD 5EH1A 3O4LE 4MX7B 1UQSA 5E4EB 3QWRA 1RAMA 4HKBB 3P4OA 3QI9D 4KDTA 2ZSVB 4HHAA 3WV0A 1MAKA 2OTUA 3G6JF 2G5BB 2XWBB 1Q8MA 3S35H 5KTEL 5L2KA 5IKCA 5E2UH 3FB5A 1GZQB 2X9YA 1R5IA 3IRZA 3QDJD 3SOBL 1WTGT 2HFGL 3WJLC 4YDJA 3HMXL 4UUJB 3KLAB 4DCQA 3T09A 1CXLA 1I9EA 3MRNB 5DJ8B 5SWQA 3VGAC 4X7TB 4JY6A 3FB6A 4BSJA 3GNML 1OAXL 3R0MA 1MELA 2BVTA 5E08H 3VXMD 4HH9A 3BWAB 4DKEL 1CIUA 4UTAH 5DJ6A 3HE7B 2XFXA 1P5UA 4PRID 1IAOB 1MIEL 1PYWB 3ES6B 2VNCA 5M95B 3WEXB 2YZ8A 1YJDC 4LVNC 1ZLSL 5I76B 1CR9H 2VISB 4NFCA 3VFGL 3C6LD 1QSFE 3TWCH 3MLPA 1OW0C 4XCCH 5TE4L 4JQVA 3O45A 1ZHBB 1D5BA 3WJJC 4C83B 4D0CA 1I1AB 2FYYA 3MV8A 1E28A 2HKFL 5H2BA 4ZFGH 3TNMB 3OZ9H 4HJGA 1HOCB 4KI1A 2VZSA 1HSAA 3ZDXE 2Z31D 3MJ6A 2WINA 6FABH 2BVPB 3EDFA 1MRDL 2AQ3A 2GJ6A 3AFLA 3LEYH 2VDLL 3QUZC 1GHFL 4PRAB 1G9EA 3BKCL 4CN6A 3HZYB 4TUOA 3B8YA 4ODXA 2D4FA 3MFGB 2XZCH 1ZEAH 2CLRB 5B8CC 4V2CB 4IMLA 1IAIH 3DOSA 2J5LB 2XKSA 1CFSA 4OLEA 3ULUL 5GS0L 4L4TD 3G9AB 4CADB 5ESAB 4XMLL 3A6CH 4QTHA 5J4MA 1BP3B 1CICB 4QOKA 4U0RC 1BEYH 3FQRB 4X6DE 2PR4H 1RUQH 1CGYA 4DQOH 1FNHA 1AO7A 3QNZA 5JMRA 5T5FL 5IK3B 1NAMA 2IANA 3RDTC 2H9GA 3QG7L 1S9VB 3RHWK 1DUZB 2A9NL 3HI1B 4QT5B 2JLLA 1TZGH 3IXAB 5D9SA 5HGHB 3LHPH 1KB5L 5DI8B 5K9KB 5I1GH 1ZVSB 4G9DB 5DUPH 1FGVL 1LGVA 1P4IH 2VL5B 4AM0B 1LEIB 5KSAC 1W8NA 2K3TA 2XWJA 4HUWB 2EXYC 4R4BA 1V7NL 4Y4HA 2NXZB 1H3PL 4OCMC 1GGIL 4HV8B 2CKBB 2GW5A 2IQ9H 4PR5B 2DIJA 5DWUL 4F7MB 5HDQL 4EOWH 2LAAA 4XC1H 4XB8A 2A83A 2CIIB 2G75A 5HI5C 3F5WA 3V52L 5L8KB 3ULUE 2CDGA 5HI3D 1F58H 4XMKL 2NY0B 1JHTA 3FTGA 1X6LA 2ZOLA 1U8QA 3O9WB 1YMME 3LVEA 2APVA 5J9PB 2HFTA 1NGWB 2PYEB 3VE0B 3VFRB 2ARJB 2I07A 2BRRH 1H5BA 4MJ4A 4KDVA 2VABB 1QBAA 1CGSH 4FQLH 4CU7A 1J1PL 1QA9B 4A6YA 5JA8B 3UCRA 2AEQL 4K2UL 3VGHA 1DCLA 3MRJA 3O6FD 5DJZB 2D03L 5JHDB 3H2WA 4JO4L 5ESVB 5J8OA 5DA4A 2V17H 3TBSB 3AROA 1NJ9A 1KPUB 1EUUA 4HQQH 1KPRB 1MFBH 4MNQE 1VACA 3GBLA 2DQDH 4K9EH 2Y07L 3VI4F 3UJJH 2FL5B 2FJFB 3BQUA 2CLVB 4NRXA 1OP3H 1VFBA 5DUML 3Q3GB 3O2DH 4AL8H 2BSED 4GXUN 2L7JA 1CDBA 1NLDH 1QSEA 2MOVA 1Q72L 4UT6L 2JJTC 5DSCA 1CFTB 1RZKC 4PJDE 3S5LG 5GQBA 1S7QA 4S1SH 3QJHB 3K7UA 4K94C 3WLBB 1N4XL 4RMRA 4EN3D 1MNUL 5DD5H 4URTB 4DUWA 2HTKD 1BWMA 4TULH 3C08H 5D5ME 5KVMC 4RAVB 1YZZA 4R7NA 1K4CA 3WJJA 4NO5A 1AGDA 1M1SA 3KYKL 4UU9B 5CD5D 1T20B 5EZJA 5HXMA 1DFBL 4KK6D 4H1LB 3PHQA 3S36X 2P45B 4I3SH 1EJOL 3LEVH 3HAEB 4WU7A 2E27H 1INQB 3BP7B 1WIOA 3RIFF 3REWA 2HT4D 2AP2A 3HZKB 3X13B 1JHKL 2C3HA 4WHCA 3P73B 4KXZI 4RIRB 1OAKH 2EYTB 2Z93B 1NL0L 3PP3K 4HFWB 1BD2D 2D7PA 3WS3B 5HVHB 4Q9QL 5C0BB 3JV6B 4MDIA 1QFOA 5I73B 1QBLH 2QADB 1TCRB 5IF0A 1Y6MR 4I3GA 5LXGL 1NANI 4JFPA 2E9BA 2Q20A 1RVFL 4P99A 5FECA 5LVEA 4IRJB 1N6QL 2IAMA 1UXWA 4PGCA 3RVXC 4KRPD 2NW3A 4EDWH 4L3EB 5I75C 3KDMB 1ADQA 1K5NB 4PJIB 4ZUUA 3G04B 1F3DH 1EEQA 1YY9C 2VLJA 3RWCB 4KKLC 4YXKH 3O6KL 3UTSA 4P2OC 5I30H 1BX2B 5SWZD 3X3GH 4XX1E 1QRNE 4D9LL 3T0XA 1FGNL 3RWJA 3SDCA 3H6JA 3Q6GL 4RWYH 4V1DD 3TIEB 1VEOA 4M9PA 1MJJA 3UBXI 4LVOC 2W9DH 3ABZA 3Q5YA 1XFPA 4XBEH 5I17B 3VXOB 2EH7H 4OZGE 5I8OL 5KSAA 1ZHKB 4DKAA 3SDDA 3AXLB 5EO1A 3UTTE 4OTXL 4XT1C 2A0LC 3UJIH 4QRQA 4D0DB 3H3KA 4YHLH 3MLXH 2P5EE 3MLTB 5L6YH 4POYA 2VDKH 3MGAA 1SY6H 1UXSA 4G6KH 3BW9A 3JWOH 1SM3H 3W2DL 2P46B 2X4PB 4MWFB 3CFDA 4MAUH 3RY5A 1NSNH 2Z91B 3INUL 4KJQD 4OZIE 2YD1A 1JYNA 1LO0H 4MA8L 1H8OA 1A6TA 2BVQA 4FA8A 5TFSH 3SO3B 3GMMA 5HYQA 1VPOL 4NO3B 4AENA 1DBBL 5C0EB 4CVWA 4NQDA 1N7MH 2PCPB 3HB3C 2BDNL 3C5ZC 1KCUL 3GGWA 4HJ0D 1NFIB 5C09E 3EOTL 3H9SA 2CXKA 3LKSB 1KFAH 3D0LA 3ARDA 4PP2A 25C8H 4XNUL 5AYUH 2FO4B 1A6AA 3IB4A 4PJFE 1YEKH 1VKXB 5DRWA 1JRHL 1CXEA 2OS7A 1HI6A 3ALPA 1AXTL 3P0GB 4MJIB 1XR8B 4TYUA 1J0IA 2HLFD 4ZXBA 5CEXB 1OARL 3D18A 4N1HB 4DOHE 2ICCA 2CDFB 1P2CA 1S5HB 1ODAA 4NJ9H 5F9DC 1KIRA 4OCRH 3AM8C 4E42B 4LCWB 3BVNA 2YRZA 4JM2D 4M8VA 1MEXH 2R9HD 3NCYP 5D7SH 4KK5C 3QNYA 1K4DA 4PLJC 1U8KB 2WBJB 3I02B 4HUUB 4NZUL 2WQ8A 5ICYA 3QRFM 5D96C 1Y6NR 3ULVD 4P4KD 3OKNB 1LEGA 5EIQA 5KJRL 4QTIL 3QQ3A 4JG1H 3QZWG 5CUSH 3WIIH 2CMRH 2FD6L 2UYLA 1IC5H 4GMTH 4FQXB 1LDSA 4LGRB 4PJAE 3WIHL 3K81A 2YBRB 5ALCH 1YNKL 4LEOA 5D1ZB 4OF5A 5CJBA 5HGBA 2X1PA 3T3MF 2FBJH 1M6OA 2MQCA 3RKDD 5E7BA 3LQMA 3BIKB 1RUAH 1MCNA 1PAMA 3UBXB 3T08A 2HRPL 4NZRH 2ZWLT 2MQ0A 3QDMD 3F8UB 3VXSA 1P6AB 3HC4L 5GGSB 5E9DB 3GSNL 3RWHB 3MRIB 3HKFA 1SEBA 3D0VB 1T03L 1MCIA 2VOTA 4LKXB 3IVKA 4JFEA 1FN4B 1H3WM 4FNLH 4Q6IB 5KVGH 4JVWA 1TLKA 3DWTA 3HMWH 3MXVH 4QRPE 2UWEE 5TDPA 2W60A 43C9B 1YEHL 3DV6B 3KWWB 4PJHA 3ARBB 3VFWA 4FQQB 4N90D 4NC1E 1JI1A 1AD0A 1ORSB 1YQVH 2BNRD 4KI5D 2BRQA 2J8OA 1IFHH 3TJEH 3EAKA 4K3JH 4FFZL 4HX1B 5DRXA 5F1IB 2AABL 4CJ0A 2GY7B 2NNAB 4ELMA 4KTDH 4U1NB 1KNOB 2BXZA 2ZG1A 3GUTB 1D5ZA 2P8MA 4ETQA 5LKNA 5IB5B 1MREH 1U8LB 3PWPB 2GITB 3BIBX 3BWAA 4FTVA 4TN9A 3JV0A 3N85L 4J3UA 5HHMB 1S7WA 4LHQB 4P2RD 3DARA 5A1AA 2BY1A 5FV1L 1QNZL 2C5DC 5JXED 1UM4L 1LNUA 3SJVA 3AY4A 3S34L 4OFKA 5EOTA 1YEGH 3NIDE 4ZQKA 3FOLB 2EE6A 2Q87A 5AZEH 3QWQB 4TVPH 4RAHA 4UAOB 4Y19A 4P49A 5KG9B 4P3CH 4QYOA 2DL2A 1DDHB 1X5LA 3EYUH 2WWMC 1WLHA 4J7RA 2ZCLL 3GB7B 4XPAL 3SQOL 4HPYL 1MJ8H 4K8RC 1S7VB 3ARWA 3C8KA 1QYGL 1FVCA 3KR3L 3D39B 2YA0A 1BZ7B 4X80H 3CFJA 1X5ZA 1T5WA 1BLNA 1HKLH 3QFJE 5I1CH 4JO1H 4NYLB 1CCZA 2QKIA 4WWKD 4HPOH 3DYOA 4OFYA 3DSNA 2H32B 3BMVA 1C16A 3EYVA 3E8UL 2KDGA 1CFQA 1IBGL 3MBEA 3BZ4B 2R0ZL 2PO6C 4DAGH 1GGCL 3MV7E 1UZ6E 1AC0A 3LB6D 5GS1C 1HNFA 1FZKB 2BNQB 1J87A 3OKYA 4Z8FL 4PUBH 4M9OA 4M6NL 2DQIL 4M5YL 2LU7A 3RIAF 2UVEA 4MHHI 3BPCA 3SDYL 4HIHA 1W0WB 2Y06L 1IAKA 1JGDA 1H0DB 3QCUH 4Z7UA 4YX2L 5BS0D 2YWZA 1DQLL 3EJYD 5HY9A 1A1NA 4PG9A 1I9IL 4CW1B 4UQ3B 1CK0L 3CFCH 1S9KC 1KGCE 1IL1B 2PXYA 3C9NB 5DYOA 4FABH 1XGUA 2CXGA 3GHEH 3AM8A 4GUPA 4YHPB 4LLUB 2GKIA 2OTPA 4XH2A 4P23C 2IEPA 2EDKA 3WFHB 3IXAA 1ZVSA 4TTDD 2PTVA 3EDDA 4HIEB 5DD1L 5HYSB 4IDLA 4LAQL 4NKMB 1PX3A 4HUWA 5L9DL 1FLRL 3ESVF 1RULL 5E5RB 2X9XA 4HV8A 5MP6H 5ENWA 3VFNB 4MMXC 1KTLB 4PJ9B 1DBJH 1MCQA 3QIBD 4K3DL 3VRIB 2DLHA 1T1XA 3TO4C 2BVYA 5C0JA 1QKZL 5EOQH 3BSZH 3TO2B 5I16A 4ZNEA 4OUOA 1NAKH 4Z0BH 2MPAH 5I1JH 4WO4B 3LS4H 4DGIH 3NGBC 3HPLB 4J3TA 4GS7B 4Y2DB 3TVMD 1JV5A 1EO8H 3PL6D 2BNUB 2X4OB 4HS6B 4XX1G 2ARJA 2OTWA 1CD0A 4FMFA 43CAB 2SEBB 5DFVC 1AGEA 4J2XA 2JB5H 4AIXA 2VABA 5HD8D 1MPAL 4L8BB 3MV9A 3QWOA 3NN8A 3U9PH 5BW7C 4UNVA 1EEZB 3QIWA 4OFPA 3W0WB 3QRGL 5JHDA 3GMOB 2WLYA 3MROA 1FQ9C 4PG2C 1AC6A 2NY5L 2AS5M 4X6CB 3DETD 1FG2B 1ZK9A 4HCRL 1YYMH 2Q6WA 4JAMB 1SQ2N 1MCCA 4YDKH 5DQ9A 3T0EA 4NQEB 4UDTA 4KC3B 1S7SB 3QUKB 2D7OA 3S36H 1F4HA 1FFOA 5K59E 3QUYC 1XGTA 3PDOB 1RU9L 5EOCH 5CBAA 3FT4A 4JDZB 3STBA 3QJHA 1T0PB 3CVHH 4I4WB 1W72B 3BD4A 4EBQH 5HHQB 4GG6E 3WO4C 3PGDB 3G5ZB 4W70A 1YN7A 4G80A 4XZUB 5ELIA 1HILA 3L3KB 4Q58C 3QO1B 2IALB 4RAVA 3MODL 5DHVH 1FNGB 2GK0B 5F3BA 3ULUC 5GS0C 2FIKA 3MACH 3GM0A 1OAZL 5D70H 1IEBA 1NCWH 3SGDI 5K9OA 1T22A 4JRYE 1ZA3B 4PJGB 5FOBA 2G60L 1E4JA 3CK0H 1INQA 4BELD 3D85B 3X13A 3DECA 3HZKA 5C0AB 1IGJB 5H35B 1JZ2A 4JEGB 2XWTB 4JPVH 1F00I 3G5XA 4NM4L 4HFWA 1KLGB 2APFA 3MZGB 4MVBC 2A77L 5EC1A 4LEXH 1GIGL 3P9LB 5D7JB 3DJ9A 3MRPA 1KPVB 3VXTB 4QO1A 2HJKB 2PTUA 2F54A 5HGGS 5J1AA 3VWJC 5GS1A 5BXFA 3H7BA 1OF2A 2NZIA 3E6FB 5AAMA 4HD9A 2NY3B 4PJIA 1H3TA 4XVJH 5EIIB 3U36A 3S35L 4YBLC 1T7WA 5E2UL 1J18A 3RWCA 2X6MA 1BX2A 1M71A 1FCCA 5F9JA 4WV1B 1JN6A 5JW4Q 1G7JA 5I6XC 4Y5XC 2MWCA 3TCLA 4O5LH 4G8GD 1H15A 4HS3A 2OJEA 1A1OB 1QSFA 3IU4H 3KYAA 3KPSE 5J13C 4P23A 4K7FB 3ECBA 1OSPH 5E08L 2BJML 5D7LE 4HMCA 1IGYB 2QHRH 4JVPA 4UTAL 5CGMA 1X5YA 5C0NC 2DQUH 3VFOB 3J7HA 4JREB 4F7TB 2I24N 3FONB 3AMLA 5A2JH 1U8IA 1WBXA 4Y1AD 4D0DA 32C2A 3TO4A 1BZ9B 5GGSY 1CR9L 5BRZE 1FO0H 4XAKD 3TWCL 1MJ7H 1KOAA 3BAEH 3HMXA 3VGAB 5A2IH 2DWDA 4BZ1H 3VD9A 3GBNH 4XCCL 1IKNC 3EJZD 3GMPB 4MZ2A 4IRSB 4XI5C 3RAJH 4QHKI 3TBTB 4MWFA 3ZL4H 5J6HB 2DQEH 1XF1A 2X7LB 2ADJA 3K2UH 1X5AA 2CDEB 4WUUE 4ZFGL 3OZ9L 1XH3A 5EU6E 2ZG3A 3QZWA 5F6HI 5JIPA 2A6DB 3ZE1E 3RVVC 5BW7A 1J0JA 5CMAA 6FABL 4LOUC 5C0EA 3DVNB 2WUCH 3KPTA 1A4JA 2NY4B 5DJDB 1UVQB 4PJ8D 4R7DB 4HBQA 1F4XH 5B22A 1ONQB 4BFIA 2JELH 1AFVH 5C3TA 1FSKB 1FZOB 1MWAA 1NCAH 1UJ3C 1VEPA 1NGZB 3H7LA 4X6DA 3GRWA 3KS0J 5SV3A 4NNXB 2XZCL 1ZEAL 5CIPH 3U9UB 3K8KA 1IAIL 3VW3H 4WFFD 4XNMA 4NO0A 1PKQE 3V5HA 4RBPK 5I1HH 3DXAA 3A6CL 5CP7B 3R1GH 1MI5D 2PNDA 2XKNA 1A22B 4BQ8A 2CDFA 5ISZB 3RY4A 5FGBC 3QXDB 2X09A 4WI9A 5T3ZD 1J8HD 3IYLW 3UPCA 2IH3B 1BEYL 4HKXA 4WFHD 4LCWA 3V4VH 2PR4L 2NY2D 5F1KC 4QRRB 3IDJB 3BYTA 5B8CB 1RUQL 3UYRH 5JXAH 1WTLA 3O6LH 3RL1B 3VG0H 3ARGB 5KAQG 5E8EA 1IM9A 5GSVA 2NX5B 1J05A 4LPXA 1TZGL 2CKNA 3LHPL 3QDJE 1PJ9A 5I1GL 4DJMA 3F12A 4JDVA 2BOCA 4U0RB 4UI2A 5DUPL 4EI5C 1P4IL 3MRQA 5TDOB 3JV5A 5KN5A 4L4VB 2V5TA 4M4RA 2NLJA 4LBEB 4NQCD 4TNVF 1XGRA 3FN3A 2IQ9L 4Z7WB 1WJ3A 2IGFH 3CC5A 3G9VA 4YNYB 1CQYA 4Q9RH 2C4FT 2IFFH 2V7HA 4CMMA 2ARWA 4EOWL 4XC1L 3RDTB 3CFKA 2ENYA 3SPVB 3PQYB 5KSBB 1ZE3C 2YPVH 1F58L 3S37X 5E9DA 4X7EC 4IIQC 5F7MC 1YEIH 4NFDA 2HAZA 4Q6IA 3VWJA 2BRRL 4MNQA 5T1KB 4LLYB 4PRDA 2X4TA 3BH8B 2DQHH 1CGSL 4FQLL 3DV6A 1OAYH 2R1XB 3SE4C 4K55A 4ZSOB 1MHEB 1NGYA 1GGYA 1H8SA 4X4ME 5D1XA 1FLTX 5FKAA 1ZLVK 2F9BT 4Z0XB 3KPNA 5DMKA 5CJ8A 3OF6A 3QEQA 2V17L 2V2WB 4HQQL 3GUTA 1MFBL 1RZIA 3QXUA 5KSVB 2UUDK 3PWPA 2HFEA 2FWOB 5EO9A 2DQDL 4K9EL 2F5BH 3V6BR 2ZUQB 4S2SA 2UZXB 3UJJL 2C3XA 3A6OA 5D5MA 1V7MH 4RMSA 3QDGD 1QG3A 4JFDD 3O2DL 4AL8L 5J3HC 1T1WA 1I8KA 1NLDL 3U0PA 4CBPA 3V7MA 1JBJA 5IJVB 4L4TE 5C2UB 4L9DA 5KG9A 3MRDB 4S1SL 3GK8H 1C1EH 4B41A 5DD5L 4TNWF 1F6AB 4HZAA 4N68A 5J6GB 4TULL 3C08L 4FFYH 1S7VA 3PF2A 1LO5B 3FHAA 4WEBH 4L8SC 1FDLH 1N0LA 1OB1B 2OQJB 3PG2A 3SKMA 3U0TA 3HUJE 4I3SL 4ZUVB 4NYLA 3L5IA 1UKTA 4ODUB 1BGXH 1NBZA 3LEVL 3I3BA 4GBXB 1OP5K 4IEFB 5CJQH 4CVXA 2E27L 1TTUA 5E1HB 3NA9H 4G6FB 3B8SA 3RIFK 2EC9T 3L5XL 4NC1C 5HHPA 1UJ3A 3L5WB 2BNQA 2XN9B 2H26A 1QBLL 3O41B 4X6CF 2RFXB 4U6VH 3OKKB 1W0WA 3DMMC 3CX5J 4J4PA 1BQHG 1H0DA 4L4JA 4NRZA 2HTLC 3WN5B 4RX4A 3MA9H 4OZFB 4EDWL 2DQTH 3WXVH 2CH8A 5FGBA 4Y5VC 2CRMA 4L8CA 1ZT4B 5LJYH 3UTQA 2PW2B 1HSBA 4OZGA 4KROD 4YXKL 4NCDA 4QHNB 2WBKA 5I30L 1C5CH 3X3GL 5HHOD 3UTTA 3K80A 2BSSA 5E2VH 1N2RB 3MNVB 4RWYL 1JGVH 1P7KB 4KMLB 3FQXA 3VXQB 2LVCA 1SYSB 5CJXC 2MHAB 4RNRA 1HHHB 2W9DL 3U7WH 3WUWB 5FGSA 2VC2H 4XBEL 5JIHA 4EI5A 3TNNB 3BGMA 3PWUA 2EH7L 3W11C 4HK3J 4QEGA 1AD9B 5IHUH 2WUBH 4P2OB 3R4DA 1F02I 4HKJB 1RSFA 1UZ8B 2ATPA 2HG5A 4PJGF 3UJIL 2XT1B 4WIQA 1M05B 3QUMH 4JZNB 4YHLL 3MLXL 2R2BB 2VDKL 4U6HB 1NC2A 4LVOB 1SY6L 4LPTA 4G6KL 4IIQA 3JWOL 1MY7A 1SM3L 1LE9B 3F65A 3X3FH 4YK4C 3KVQA 2X1QA 4MAUL 4ZFZB 1NSNL 3O8XB 3HZVB 3GSQB 1LO0L 3VXUB 4I5BB 1EEZA 2DN7A 3I6LE 4M6OH 1BFTA 1RPQA 1J1XH 4Z7VB 1XCQB 3DUHA 1N7ML 1OWWA 3RGVD 2ARJQ 3RFZC 1D9KA 1F2XK 3VFVB 4O02H 1R24B 4RZCB 1G7QB 4JAMA 4KK8C 2VMFA 1OTUC 1MFDH 1KFAL 3KPOB 25C8L 2W65A 2XPGB 4HWBH 5JOPE 3QI9B 5AYUL 3RBSA 4L8DB 3DURA 3GJEA 1YEKL 5TDNA 3BO8A 5CWSB 3FKUS 3DV4A 3D69B 1E4KC 1DQDH 5J1TC 1BD2E 3VCLA 2XKUA 3K3QA 5GRZA 1TJHH 4PRPD 4X7DC 4ISVA 3SEPA 5JLZB 4R0LC 2EECA 1FFQA 4NJ9L 5GRYA 2VZ1A 2VZ3A 4U1LB 4HK3N 5FA3B 4KQ4H 3TZVC 4ZUTB 4U1KB 1MEXL 5D7SL 2DWEA 3HR5B 3VXMB 2C1PA 3EDKA 2ZUTA 4PJXE 5D2NA 1JP5A 4MNGE 5SWZE 4YHIB 4L9LA 4QF1A 5LAXA 3THMH 3QG6B 4M8QB 4ONOA 4N5EC 5DJ2B 4JG1L 5EU4B 3LKNA 4LCYB 5CUSL 3WIIL 2CMRL 3G5YB 1IC5L 2EDOA 4GMTL 4ODSL 1OGTB 5GRUH 1JNJA 1EDQA 2R2EA 3P0VH 4NQSA 4WI3A 3Q1SH 5HVFB 5ALCL 3ZKMC 5IVOA 3V7AE 4QRPA 1VFAB 5GSRB 3UJTH 4ZAKA 4MLIA 4Z7NE 2FBJL 1RUAL 1PZ5A 1TXKA 3VFUA 1NFDA 4NZRL 3GSOB 5DS8B 1NGXB 4PTUB 5GGRA 4PV9B 2CIKB 3WFZA 3B2UD 3LKQB 4QGYA 15C8H 2VZTA 5I66A 2P42B 5HPOA 1CGWA 4FNLL 4M93B 5KVGL 4O51B 3Q6FB 1OTTD 4YIQA 3MXVL 3WIHA 3ZSTA 4R8WH 4K7PY 4AEIH 3LKPB 3TA3A 2HLAA 3U2SB 2XG5A 3DX6B 5E6YA 5A3IC 3WNMA 4Y5VA 3ZYIA 3OXSA 4GT7A 1YQVL 3CH1B 1R3JB 2P47B 3GHBH 1F3JB 5T1DL 1IFHL 3HNTH 5DR5H 2W38A 1XIWC 4K3JL 5IROC 3TJEL 4JRWA 2E6PA 2C26A 4Y4FC 5I8CB 5CINH 1FAIH 4NJAH 3HC3H 3RNKA 1MREL 1R3IH 3CFBB 3N1GC 5F7WC 1PY9A 1T2QH 5DEGA 1T89C 3X12A 3KPPB 8FABB 2V9TA 1OGAD 3HC0B 2HJLB 4HKZB 3SCMD 1EHAA 1BZ9A 3CUPA 2EIBA 1JZ7A 1YEGL 2J88H 3FRPG 2NY5C 3QYCA 5JR1H 4WW2A 3GMLB 5CZKA 3QFJA 4XBGB 2IPKB 4I9WD 4TVPL 1U3HC 3FFCD 1MCWW 1ZLWH 4F3FB 1MF2L 4P3CL 5DD3H 5JOFB 2XZAH 1ZANL 4HDIB 4UDUA 4PRHD 4Z7WF 3EYUL 1DANT 1E27A 3DHJA 4XHQA 3RWIB 1MJ8L 5MEND 1DBKH 4LQFH 5KSBF 2I9TA 5IJKA 3MV7A 3KPQB 4AEHH 5ADPH 2A6DA 1WT5C 2VDOH 1XCTB 1NAMH 4G9FA 4X80L 4RFEA 3QR2A 2BP3A 2GAZB 1ZHLB 4N0RA 1HKLL 5I1CL 1ONQA 4JO1L 2HVKB 1FL6B 3T0AA 2ICES 4E41D 2XG4A 4HPOL 1NGZA 1LILA 2HMIC 2F58H 1NPUA 1NMBH 3VWKD 2NXYC 1KJ2H 2N7BA 4OAWA 4DAGL 1UKSA 3UROR 1QFPA 2L4OA 3U4EB 3MLYH 4PUBL 5CZXC 4Y5YA 3T1FA 2DQCH 4MAYC 1E4KA 5BV7B 2R69H 3RIAK 4Y4KC 1J86A 4JCLA 3QCUL 4QHKJ 5JW5B 4TVPE 2IH3A 4NN5C 4GW1A 2CUMA 4HUMB 1FYTD 4OGAD 4AYFA 1NCCH 1S9XA 3SY0B 3IFNH 3KYOA 2XTJD 3MJ8B 3U1SH 5F6HJ 1KENH 3MR9A 4FABL 2AGJH 5DMIH 3GHEL 4A6YH 4JFYB 2PO6B 4LDOB 3DBXB 3S37H 5JW4N 5C2BL 2ERJB 1KTRL 4XPBH 2H8PB 4YEFA 2NX5A 5ETUA 5DRNB 1HHJA 2DQJH 1OWRM 4HGWB 5C08B 2IBBA 3M45A 1ZXQA 5B39G 2CRYA 4NRYB 3NMEA 1NH6A 3R8BB 2YK1H 4GQPH 2EDJA 5EBMA 5EZLB 3DX8B 3TBVB 1I3UA 3CSBA 1CD9B 3QUXC 4Z95H 5CP3H 5MP6L 3KLHD 3MQIA 1DBJL 2AK4D 4JO2H 2V2TB 1G6RA 5IIEB 3QQ9C 3LIZH 4O2EA 5DK0B 3TBYA 2WK2A 4P2RE 5EOQL 3BSZL 3BJ91 1NAKL 4Z0BL 2P5WE 2MPAL 5I1JL 3ARTA 3LS4L 4DGIL 3EKCA 3RVWC 1RJYB 3UMTA 4GKSB 3MOAH 1EO8L 1A5FH 5F97E 3ARZA 5DJXA 3OQ3B 1RI8A 2JB5L 3B6SA 3VMPA 5IFJB 3FHQA 4JRXD 1B4JH 5DO2D 3RY6A 5IHZB 5TQ0H 1NDMA 2R1XA 4IDJH 2JCCA 3U9PL 3SDXB 1AIFA 5EO0A 5D1QA 4TUKH 4NQTA 4Z0XA 3NAAH 1WSST 3LDBC 4HBCH 4ZFFA 3FZUC 3OAUL 3CXDH 2B5IC 1T6WA 2GSIA 5KSVA 2EZ0C 1YYML 2D4DA 2OMNA 4HXAH 1RJZB 4YDKL 1OT1A 2EYRA 5F9WC 3PV7A 2DLEA 5DJYA 3WHE1 4PJ5D 3S36L 3R06A 4MCZB 3UYPA 2Z4QB 1BQHA 3EGSB 2BVOB 2IBGA 3QNXB 5JQHC 2D7NA 5FYJH 1J7VR 4L3CB 2VDMH 3IRPX 4UQ2B 5EOCL 1WWWX 4JRYA 4XVTH 4XRCB 2A74A 1CGVA 4XPFH 3B5GA 3MRBA 3U83A 3MV01 1TVBB 4BZYA 4IOIB 3CVHL 4EBQL 2FZ3A 1U3HA 1LWRA 1FFNB 5BS0E 3G08B 1JNLH 1DSFH 2KQNA 5ERWB 1RZJL 1UT9A 5EUOA 5FIEA 3GJFA 4HUXA 3QUYB 3X17A 3MACL 4N0CC 2R1WB 3R0NA 4LARH 3MJ7B 5D70L 1NCWL 3PWVA 4WHDA 1QBMH 4ZUVA 4X9GA 1DN0A 2Z35A 3CK0L 4E5XB 1CDHA 3JVGC 3VI3F 4MD0A 4X7FC 5AEAA 4P5TA 1K8DA 4OQTA 1X7QB 2AEWA 4JPVL 3EHBD 1XF5A 3NIGE 4Z7VF 3ISWA 1G7HA 3E3QE 3N50A 4N0UE 4AIZA 4LEXL 1MVUB 4YAQB 5TE7H 2EC8A 3STLB 1YMMB 5HYJE 3MRLA 4Z7OE 4NBXB 2G5RA 5A16A 1A9BB 4LCIH 4G8IB 1Q9OA 3QO0A 3BKJH 1S9WA 4WJ5B 2ZUVA 4DZBA 4XVJL 4OJFH 5D7LA 2WZPD 1MAMH 4B7LA 3PXJA 4XB7A 1KIUA 2ED8A 3CDGB 1CT8A 3ZDYF 3FO9B 3DX7B 1KB5B 1A8JH 3PWNB 4O5LL 1ZTXH 3WL9A 3OKLA 3QHZH 5BRZA 4K71B 5LBSH 1JYVA 3IU4L 2D31B 1WBZB 4W81A 2OYPA 5IB1A 1KCVH 1OSPL 1UWXH 5B3JF 3KNBB 3L3OB 2X4QA 1I1CA 1HKFA 2GTZA 4YBLB 1G0DA 2QHRL 4YFDB 1EJ6A 1AD9A 1FORH 3LD8C 5FO9A 3O3DA 1Q9WA 3TN0A 2DQUL 3QUXA 1CG9B 4Z7UF 1LE5A 5I6XB 4G42B 4Y5XB 4ENEC 3ARSA 4JM2B 1GZPA 1M05A 1YEDA 2LTQB 1FO0L 2PN5A 1BFOB 2O26U 1L7TL 1MJ7L 4GRWH 1MQKH 1RZGB 3BAEL 3PUCA 5J13B 5E94B 4BM7A 2PYFB 3GBNL 1KJMB 4K9EC 5IEHB 5FA4B 3V5KB 5IBTH 3SGJA 3MRGB 8CGTA 3RAJL 5TQ2H 4JDTL 3ZL4L 2AEPH 2DQEL 2ZSWB 3MRMB 3O8XA 1VDGA 3K2UL 4LQ1A 3VGEA 1U8MB 4O2FA 1WQVT 3HPJB 1Y18B 2ORBH 4ZPVA 1YPZB 2AJXL 3EFDH 4PJ7F 3O11B 5HI3C 2WUCL 2WW8A 3QPQC 5E6ZA 3QP3A 3JTSA 2BFVH 3MRHB 4PJCB 1KTKE 4QY8A 1F4XL 4IOSD 1JUFB 4JJ5B 3OKMB 2JELL 1FZJA 3TFKC 1AFVL 1TFHA 3GSUB 5F3HB 3EYFA 1EBPA 1NCAL 3DRTA 3QI9A 4M7LH 3A6BH 3OR6A 1B0WA 3WFEH 3VW3L 1BVLB 4TUJB 5DFTA 3QJFB 5CILH 3W39B 1XF3B 3ZE2F 4MJ6A 5I1HL 2N1KA 1J88A 2GTWB 3O6FC 4G6JH 3BXNB 1AKJB 2BVEA 3R1GL 1FHGA 5HGDA 3QDJA 5B38B 5MI0B 4XGZB 3H9HB 4LKCB 3MNWA 4GAYB 1I1AD 5KOVC 1K8IA 3ARVA 1QRNB 5JXAL 5L2JA 4MJ5B 4DKDC 1DQMH 3O6LL 2APXA 3VXMA 3LMJH 5I1DB 5J57B 3PE9A 4PRIA 5SWSE 1A4KA 5BVJB 3IFPA 1JRHI 2DJSA 3AUVA 3QG6A 1RZ7H 5DJ2A 4KMTH 1LD9B 3QXWA 2NY6B 4CU8A 3L6FB 2AXFB 4WW1B 4LMQE 3C6LA 3MLUH 5I74C 4NUJA 1YY8A 4M7ZB 3ROOB 1TNNA 1BFSA 4TNVK 1HZHH 3FRPA 2X1XR 1MFCH 3F6LA 2IGFL 4Q9RL 2IFFL 5CGYD 5CD5C 4XP1H 4QWWC 5EBWB 3U6RA 1HXYA 5DS8A 5ACMA 2YPVL 1KCRH 4PTUA 5AUMB 4YEEA 5IFHL 5JOEA 4NHUB 2Z31A 1CDYA 1CICD 3OJVC 3U30C 1I8MB 1YEIL 4K07A 5C9JA 1FNLA 3MRKB 2W0KA 5GGUA 3DUUB 1JPFB 3AU1B 1DVFB 4OZIB 3TJHC 1DLHA 2DQHL 3EUUA 2GSGB 2ITDA 2ICWA 2RCSL 1OAYL 1UYWH 3TYFA 4JJHA 5DMJB 3MGOA 3CH1A 1G7PB 1R3JA 1LP9B 5C9KA 1F3JA 1AJ7H 3QEHA 3P40A 1J8KA 3K0WA 4XAWH 5LGJA 4LK4A 1N5YH 1EZVX 5C09B 4L4TA 4MCYB 3GO1H 3I6GA 3JWOC 2VSDA 3F7YB 2A73B 2AK1H 3PIQB 5F1SA 3CFBA 1JYWA 1SJHA 4KRPC 4NT6A 3HE6C 1T66D 4PJFB 5D2LA 5E1AA 2F5BL 4CKVX 3QULA 1J0YA 1FNFA 3KPPA 1BHGA 2VKWA 3W81A 1C7SA 1V7ML 4ODTH 2P48B 4LVHC 1YC7A 1OLLA 4XVUD 2HJLA 2XICA 1NMCC 3OX8B 1U8PA 4WFFE 3O9WD 2G9HA 2KL6A 4KDWA 3G6AB 3HUJA 2PYED 5EN2A 1L0XA 1XGPB 4DK6A 1N3NB 4RCAA 4MQXD 1LK2A 3GK8L 1C1EL 4P46C 4JB9H 4TNWK 3H3BC 4FFYL 5D93C 1B90A 3GMRA 3NFSH 5B39A 5E6ID 5D6CA 3N1PC 4FXGB 2PTTB 1A9EB 4WEBL 3ROLA 4EIGB 1FDLL 3JUYA 4HS8L 2CK0H 4HIJA 3AB0B 1BGXL 4PGEB 5CJQL 5C0GB 2GUOA 3ZMRA 3P77B 2VITB 4L5FH 3TVMB 3PL6B 3UDWA 2VXVH 1PLGH 1MCEA 2CKBH 4KJQC 4LLQB 4GKZB 1JWUB 4WHTB 1QR1B 3CX5K 4L8SB 3FQTA 4U33A 1INEH 1F11B 5J56B 1RHHA 2EH8H 4U6VL 2QEJA 2JIXB 1B6DA 5CEZD 1VGEH 3OAZK 2J8UE 3Q0HA 4O2CA 3O6FA 3EBAA 2UWEB 1Z5LA 3MA9L 5FO7A 2DQTL 3A0OA 3IF1B 3WXVL 5FUCE 4I18B 5E4IA 4JM4H 4N9OB 2I9LB 3DBXA 5LG1A 1B0GB 1B0RA 1TZIB 1C5CL 1RUKH 5E2VL 5IMKB 3SE9H 1EX0A 1T7YA 4LLDB 1JGVL 5INCA 2HLFC 5D6DC 3DMMB 1M7DB 2ICEB 1IQDB 5EZLA 1QLFB 3GSWA 3U7WL 3HFMH 2HT2D 2VC2L 5C07E 3B2VH 5ID0A 2BY2A 1JK8A 4Y88A 3FN0H 4M1GH 4QXTB 5C0BD 4U2YA 2K7QA 4EN3A 2WUBL 5IHUL 1LDPH 3FFDB 2QADD 2DQFA 4OD3H 3QDGE 1I8LC 3MMEB 4IRJD 3GMNA 2R29H 3QUML 2C4XA 2GEEA 2CRIA 1R3KA 4I0KA 4R90H 5CLTA 5CEZH 1KACB 3CXHJ 2WIMA 4H0GA 3DLQR 4MZ3A 3PHOB 4Q7DA 4DVBB 3L9RB 2X42A 1RY7B 4M7KH 4R9HA 3ULUF 4NNYB 2BOBA 3X3FL 4RFOH 1RQ5A 4QRSA 3D25B 3ZYJA 3RZCC 1AXIB 4KV5E 4OCLC 4I2XE 4RDQF 4X8XA 1VCAA 4M6OL 4PGBA 1J1XL 2GK2A 2FECL 1U8NA 1BD2A 4DN3L 3LQZA 3I9GH 4KTEH 4YR6B 2YD2A 3HAEH 4O02L 2NY1B 1A7RH 2Y6SD 2B1AL 3DVGB 1Y0LA 1MFDL 3ELAT 4YK4B 4HWBL 3V5DB 5GZND 4HMDA 4UBDD 1CTOA 4JFHD 4BSWB 2VLKE 2JB6A 4MD4A 2Z4QA 4UT7H 1HHKB 1ZS8A 4JFFB 1DQDL 5EPMB 1P84J 2BHYA 4QHLA 4ODWA 5GGTH 5SWZA 4ONFH 1P5VA 1TJHL 3KPMB 4B50A 5KS9E 2OK0H 3DX9B 1UG9A 4UZGA 4V1DA 4JZJC 4G8GB 3GZKA 4J3VA 1ITBB 4R3SB 1TJIH 2LABA 4NKDB 4KQ4L 1OT2A 3N1FC 5MEQB 4RRPA 1HCFX 1OAUH 4PJDF 4NKIH 3IDYC 1BIIA 1FNSH 3MJ7A 5JXEC 5MHSE 1YQ2A 5BJTB 1DEEB 4GAGH 1ORQB 1JF1B 1YNLH 3OAYK 4ZFOL 3VFPB 1WIUA 5D72H 1DQTA 3THML 5HSFA 2J6EA 4APQC 2WWKO 2EDLA 2PKDA 4E5XA 4Y1AB 4FRWA 2V5RA 5GRUL 3ARRA 3P0VL 3QXVA 3Q1SL 2O93L 2YN5A 2Y7QA 3VFSA 3TEUA 3TZVB 1YPZF 4LCCA 1ACYH 3UJTL 2ITCA 2YEZA 4WEUD 3KPRE 1YC8A 2VAJA 1B6UA 4IOFD 4YAQA 4L29A 4MJID 2Y5TA 5DVOA 4PJCF 4JFOA 4X6FB 1G0YR 2J4WH 1U91B 3IKKA 3HS0B 3RUGE 1H8NA 4GAFB 4C56B 3CCHB 3AREB 2WIIA 3IKCA 3C5SA 4JY4B 3V6ZA 2X4SA 15C8L 2WP3O 1OQOA 3L1OH 4HIXH 2FLBT 1I1FB 1HH6B 4R8WL 4AEIL 5MEOB 4HW6A 3RA7H 4BUGA 4LNRB 2WBJD 5L2KE 3P9MB 3FB8B 4NSKA 1R5WA 4YPGB 3RWFB 3GHBL 2BC4A 3HNTL 3PWNA 3JUZA 5DR5L 4X6EB 2ZKHH 5DJAA 2OP4H 2YA2A 4FQHB 4ODVH 4XC3H 5FAAA 4FQXD 1ZAGA 1S7XA 1OTSD 5CINL 1S8DB 1FAIL 1Y6KR 5I0ZA 4NJAL 1Q1JL 5D1ZD 4F33A 3HC3L 4BKLB 1MCKA 1R3IL 2BCKB 1MWAH 1T2QL 3DGGA 3KXFB 3RU8H 3RX5A 1VENA 3SE8H 5C70A 1PSKH 5A2KH 3KLDA 2NY2B 3QA3A 4JM2A 4G43B 1GOHA 3SDAC 2J88L 1XIWB 2F15A 5JR1L 5DDHA 5FKPB 3BRFA 3BWUC 3IJHB 5BQ7A 4GG6B 4Y4FB 1I8LA 3B5HA 4TTDC 4P4KA 4XXCC 3KYMA 2E7BA 4GW4B 4F2MA 2W59A 5DD3L 1KSRA 2XZAL 2X40A 4GRLB 4NPYA 4GKNB 2ZSWA 3BI9X 3DTXA 3E3QC 5EC2A 3ARBD 2NYYD 2X70A 2EDYA 1FJ1A 4P5KA 1DBKL 1ED3B 3ARFC 4LQFL 3HPJA 1Y18A 4LIQH 4M1CD 4NQCB 4AEHL 3TV3H 5ADPL 4I0PC 4FQPA 2VDOL 1NAML 1NC4B 2C3WA 2X9WA 2B4CH 3IJSA 4X5XB 5MERA 4OZIF 3QDMA 4OZHB 4M61A 1ROWA 4Y2OA 2AJ3A 2DLIA 5HHMD 1MJUH 2F58L 5E00A 5I1EH 1NMBL 2G2RA 4BYHA 1LP9F 1BVLA 3GIZH 5H94B 1KJ2L 2AV1B 3G6JE 1U58B 1PKOA 4IMKA 3B4NA 1U8HA 4XVSH 4J1UA 2YN3A 2DQCL 2ID5A 3I50H 4N8PA 3PABB 2IPUK 5EDXA 2ATKB 2R69L 2BNRA 1GPOH 4PJFF 4LCUB 4XP9H 5EORH 3DETC 3GEWB 3IJYB 1CVRA 2P44B 5DZNA 4QOKE 2HWZH 2ZG2A 1NCCL 5ACZB 3IFNL 3LY6A 5LGKA 4I77H 1KENL 4NN6C 4XXDA 4GLRH 2AGJL 1T3FB 5DMIL 5C0FA 3D39D 4A6YL 3S37L 5EU7E 1ETZB 5C8JB 4XPBL 4Y8DC 1IAII 4P2RA 3FRUA 5L0QB 2FJHB 4S1DD 3BIAX 5E8PA 1P1ZA 2DQJL 3KPSB 2IANE 1ZT1A 2P5WA 5FYLD 3FQUA 1Z0NA 4MAYB 5JXEA 2NY7H 1ZVHA 1T0NA 1W0VB 2AXFA 2P8LA 3QHFH 2YK1L 1MCFA 1K85A 2E7LA 1AR2A 3OBAA 4JKPL 1KYOJ 3C8HA 4U4BA 1EEYB 4D9QD 4OM0H 1U0QA 4Z95L 2CJUH 4AMKH 4O9HH 1YEJH 4JO2L 3LKOA 4WY7H 4YGVA 1QLRB 3LIZL 3FOMB 2YA1A 1S7TA 4PJAF 4X4YA 4TPRH 1I7RA 4Z6AT 3DUSB 1R3HB 4NHUA 3NIFE 5GZOD 4HZLB 1I8MA 3MOAL 4XHJC 3KAAA 5D7IB 4XBPB 3VXRD 3AU1A 4NKOA 1AR1C 4YE4H 4I9WE 2VE6B 1OSZB 3EDEA 1RV6X 4WUUB 1HHGA 4I48B 4WWKA 5EU6B 5TQ0L 1HE7A 1JWSA 1B4RA 4IDJL 2ICWI 5GGRY 4KWUA 4MA3B 5JNYA 3RNQB 5MENE 4TUKL 3IDGB 1NBYB 2XY2A 2UWEF 3NAAL 4HBCL 5FYLH 4LLMB 1U8JA 3PWJA 4S1RH 3CXDL 4NC0B 4ERSH 1P4LB 3JTTB 3L3GA 5HPMA 4HXAL 4PJ9D 1PKQB 3SE3C 4X9BA 2VDNH 1FL3B 4E41E 5BS0A 1QFWH 1Z9MA 4P59H 4DVRL 4ONHB 2Y36L 3QIUC 4WO4D 4XTRD 5FGRA 5FYJL 2UY6A 2CR3A 5FO8B 3CH8A 4Y2DD 1XF2B 2Z92A 1QSEE 4C58B 1XGPA 3LDBB 1U93B 3O0RH 4XVTL 1ES0A 2EC9U 1JZ4A 3IXTA 4XPFL 2FEEL 3WO3B 3IS0X 5JPNB 5FOJA 5DHYA 5E0QA 1PG7X 3MUGA 4AT6B 3HR6A 1JWMB 5IGXH 2P1YA 4F80A 5FDWA 4X7CC 4XXCA 2R56H 5F9WB 3TLRA 1DSFL 3WYRA 1PG7W 2JK5B 2QR0A 5FF6B 4LL9A 1QTYT 2FHBA 1P4BH 1U95A 2R23B 3LSOB 4QGTA 3W0WD 4LARL 5INDB 3QIBA 2OJZL 5IEKA 1I1YB 3V9FA 3WIFB 2P7TB 1QBML 3MLWH 2ESVB 3GI9H 1HYSC 1FFPB 2DOCA 4NQED 3TVMA 1G1CA 5LGHH 2DBLH 2O61B 3CVHA 3PL6A 4Y16D 1I85C 3WHE0 2YD9A 3TPUB 4HUVB 4LLQA 3B9KC 1T04B 4A2LA 4BFEA 1K9TA 4H8WH 5DHVA 4YHKH 1VADA 1MHCB 3PGFH 2AK4E 5TE7L 3UPRA 4U1JA 3EOBA 5FYJE 4P2QB 3T0DA 3PJSB 3BP5A 1BJ1H 4ZUWA 5MEPB 1URLA 4PJ8C 4LCIL 1B88A 3AAZA 2Q7YA 3S6CA 3N9GH 2W92A 3L5HA 3BKJL 4LP4A 2IC2A 3H42H 2N7AA 3P4NA 3RVUD 4OJFL 2EDHA 3ULSA 4MNHA 1MAML 2H6PB 5AG9A 1TZIA 5AD0A 2VLJE 3MLRH 3UTSE 4M6AA 3MNZA 4H5SB 4LHUD 5HHVH 1ZTXL 3OGCB 1UM5H 1NGQH 3QHZL 2X1OA 4OF6A 1M7DA 2OSLB 5LBSL 3HN3A 4R26H 2ICEA 4YXLH 5TH2A 5E56A 1T2JA 3D85D 4RQQB 3ZKNC 1KCVL 1BOGB 5IVXE 3LPFA 1G9MH 3OHXA 4RMQA 3WHXA 4JQIH 4HT1H 1RJLB 2ADFH 2NW2B 4ZODA 1FORL 4PTTB 5D7JD 3FO1B 1F2QA 4JN2B 3N1QC 1K2DB 2O5XH 3L3IB 4PJ5E 1WAAF 4IHOA 4POZC 3IAGC 4ORGB 4OLWH 1MQKL 4WFED 2B8OT 5I15H 3O3BB 1U8OA 2VUYA 2NY3D 2YMXH 4I13B 1W72H 4MXWH 5IBTL 4DKFH 3OKDA 5TQ2L 3M8OH 3CZFB 2AEPL 2OL3B 3I75A 2OR8A 3LD8B 4R6UA 3BT2H 3DRQA 2AJZB 2ORBL 5TJWK 5GIRA 3H9ZA 4F9PA 3EFDL 2QSCH 5CEYA 3P2TA 3OXRA 2K1MA 3T4AA 1V8HA 1KG0B 4YHYC 4DEPC 3OKEB 1YN6A 2BFVL 5IMOB 4NQDE 4KUZL 4MA1C 5FUCC 4D0BB 5FK9B 4ODHH 1IM3B 1R3LB 2Z8RA 3H9SE 3A6BL 3WFEL 5KSUA 2VLLB 1HHKA 3NFPA 5GRVL 1NCBH 5CILL 1ND0B 4L3AA 4AG4H 4O00A 5EG6C 1IILE 1KIPB 1CU4H 4F57H 5DJ0B 4H25A 4NOFA 3KPMA 4XCEA 3C5JA 1SEQH 4UOJA 5GPRA 4GRWE 4NZDA 2X4NA 1DQJB 4IRSD 5EIVA 4G8GA 5JMOC 2VH5H 9CGTA 3BP4A 5CSZA 5F7YC 3JV4B 3NPSC 4YHOH 1HDMB 4GG8A 1AHWC 5HJ3A 1ZA6A 3D2UB 3MLVH 4EJ1C 1DQML 1Q0YH 3RWDB 2X41A 2ZCHH 3LMJL 3ZTJG 5T5NF 5BJTA 1JF1A 4GG6F 3MRCB 2ZZUT 5C0IB 4YPJA 1RZ7L 1EVTC 4KMTL 3ARUA 4OKVB 5CAYB 2IMNA 4Y1AA 3UTPD 2EKJA 3VD7A 5CCKH 4QCIA 3T3PF 3MLUL 3WE6B 4MMZC 5IMLA 2IADB 4GSDH 4U1GC 3EOAB 4MXVE 1HZHL 5GS2D 3LRSA 1MFCL 2A1WH 1A6ZB 3BHBB 1I85A 5IR1B 1IEHA 2B1HH 4XP1L 3NTCH 3QUZD 1Q94B 1UENA 4XCYB 4IS6B 1KCRL 5ISZD 2YSSA 1BBJA 5IW6A 1I1FA 3IDMA 3IDNB 2F74B 3VG9C 3FO2B 4QRRD 4PJ8A 4JFEE 2VYRE 1E0OB 1PQZB 4UOW1 5I2IB 4Z76B 1KCLA 3ARGD 5DJCB 1YMHA 5T1LB 4P4RA 4DN4H 3V6FB 4PJHE 2EIZB 4YPGA 4Z78B 5SX5H 1PX4A 5AG8A 2ZNXA 1AJ7L 4Z5RB 2F53B 4XAWL 3ZE0F 3U30B 1N5YL 3V79C 3EDJA 1KF9B 3GO1L 3OJDB 4L4VD 2AK1L 4MSWA 1MI5A 1ZVYA 4KPHH 4KU1A 2BMKB 1J8HA 4JFZH 2R4SH 4KROC 4ODTL 3RDTD 5SX4H 4PJEB 5GS2H 1GXEA 3PQYD 1DBMH 1TITA 3L7FB 2WLZA 1QQDA 4X83A 4WUKL 3IJHA 1G7IA 4F7EB 5IW1B 3K46A 1C5DA 4EI6A 1C08B 4DW2H 1SYVB 2H1PH 3WXWH 1LK3H 4HG4J 5T1KD 4XMPH 2EXYD 4P57A 2W1NA 1IMHC 3HE6B 4Y19E 5HHXH 5F6IC 1A47A 2DYPB 4JPIB 4JB9L 3QCVH 2YC1B 4BQBA 3NCYS 1ED3A 5K9QG 3CMOH 1UKQA 5ANMB 5C6TH 4NQCA 3NFSL 4PJXB 5HI5D 2GT9B 4MNGB 1WFTA 4J23A 2PW1B 1RIVH 2FJGA 1HWGB 3RVTC 2X4RB 1L6ZA 2NTFA 1CE6A 2CK0L 2AV7B 1TENA 5EBLB 4UILH 3T04D 3VGDA 3MYJA 3EYQC 3P4MB 4NDMA 1NMAH 4L5FL 3ZE1F 3FAWA 2VXVL 1PLGL 1NEZG 5D93B 2CKBL 2LAGB 5IOPB 1T7XA 1T83A 4OCNC 1G6RH 1UWEH 5IV2A 4C54A 2EYSB 2V9QA 4KZDH 3OPZH 1INEL 1Z0MA 2EH8L 4EVNB 7CGTA 4ELKA 4ZOBA 1VGEL 5DD6A 4HIIA 3RGVC 1YDPB 1WGOA 1WWAX 2GFBB 3UX9B 2R0LH 3BGAA 5CD3A 4QHUA 4I0CC 5C07A 1FNEB 3NCBB 1FC1A 1T3FA 4JM4L 3T77A 5ID1B 3DIFA 5I8EA 1AHWA 2FJHA 4KJPC 1AH1A 1RUKL 1K3ZA 3MYZA 1RURH 3QDGA 3SE9L 4JFDA 2YPLB 4CUCA 4BH7A 2OR7A 1CFNA 4QRUB 4GBXD 3LZFH 3STZA 2VLMD 3OKOA 4N9GA 3NCJH 4OGYH 3LQAH 4JQVC 4G6FD 3WCYA 3C09B 5IMMA 3HFML 5DTFB 3E0GA 5BZDA 1GAFH 3E2HC 4HK0A 3HZMA 3FN0L 4M1GL 2E9WA 2XN9D 1LDPL 2P24A 4I2XA 1LEKB 3RL2A 4OD3L 3RRQA 3CXHK 4TSCH 4AEEA 4HZLA 5DGRA 1Q38A 2R29L 4R90L 4YC2B 4JKWA 5CEZL 4U1MB 1QPXA 2IQAB 1D5XB 2PYEE 1T0MA 1G9NH 2VE6A 2VR4A 2LE9A 4M7KL 3IAQA 4ZO8A 3DPBA 4RFOL 1LO2H 2RIKA 1RZ8B 1WFOA 4TRPH 3VA6A 2XNAA 3I6KB 3RNQA 2AEIT 1N5AA 3T0BA 3V0VA 1JPST 4K8RL 1A7OH 4LDEB 1PG7H 4CJ1A 4LPUA 4LLMA 4OBRA 5JHDE 2XRAH 4DGYH 3I9GL 4KTEL 3RVXD 5I1LB 3QUMA 2MCG1 2FNBA 1A7RL 4MB3A 1N59A 2J7LA 1FL3A 1HQ4A 3LV3B 4PJBA 5EU7C 1AQDB 4OQTH 3I84A 4P2OD 1P84K 4U3HA 3T0EE 3RZCB 1KJ3H 1N8ZA 3QH3B 1KN4L 2W0FB 4UT7L 1X44A 4FZ8H 1MH5B 1F8TH 1A1MB 4P5MA 5F7DB 4NCC1 1YEEH 4KJYA 5GGTL 1U93A 4ONFL 4RGNE 4XP6H 5HHOA 4WU5B 4W4NA 2OK0L 1AXSB 5JPNA 5I1AA 5CEZE 1ZGLM 2HN7A 4X5WB 3C6SA 5ECJE 1JWMA 4HWZB 4Y4HC 2DTMH 5FUZH 5C7XH 1U6AH 1TJIL 3EO0A 1I7UB 2ICWJ 3FO0H 3NACH 2JK5A 5C0DA 2XXCB 3VXUD 4HWBA 2BSRB 2DKSA 4OQ1A 1QFHA 3CLEH 1OAUL 2R8SH 4NKIL 2A0LD 1ZLUH 2VSCA 2YUZA 1FNSL 3SCMC 2P7TA 4GAGL 4WEMB 1FIGH 1CXIA 1YNLL 3NZ8A 4OFVA 1ZSDB 4H26A 1BF8A 4P3DB 3LS5H 2APBA 3VJ6B 5D72L 2DJ4A 1WBYB 1MCHA 1I3GH 1CDIA 1H5BC 5C3LD 3BGFC 5IUSA 4YHNB 1CN4A 3MCKA 4BSVB 3RWEB 3TPUA 4RFNC 3HUJF 4MD5B 1ACYL 5TF1H 1DJSA 1Z9OA 2I26N 3IDYB 1MHCA 4X0KB 3WFCL 1IGTB 3OB0K 5C0BE 4PRBA 4U49A 3PJSA 2J4WL 3G5VA 3C5ZD 2QQLH 1RK1B 5FYKD 3VRJB 2F54E 2RB8A 5K9JH 4APQB 4ZFOA 1RD6A 3L1OL 4HIXL 2V2XB 5HDOA 1CFBA 1MRFH 3RGVA 4L3EE 4PJIE 3RA7L 1A0QH 3BQUC 3HLAB 3VWKC 4X98B 3BP6B 3MFFB 4LSSH 4J8RB 3NVQA 1BQSA 3W9EB 1JHLH 1E4XH 2ZKHL 1CLZH 2OP4L 3ZT6A 4ODVL 3EFFA 4RQQA 2ZJSH 5ICZA 5J12C 1KT2B 3BFOA 2X1WL 4PRPA 1VGKA 4OGAC 2AJVH 1MWAL 5BZWB 3GRWL 4KK5D 3RU8L 2EIDA 4ZOEA 4PLJD 4PTTA 3SE8L 1U3YA 2QSVA 1XAUA 1PSKL 4JHAH 3FB7B 2NR6C 5HHNA 3F7PC 4ZYKA 2E3VA 2FLRT 2XQYK 1FH5H 2J3SA 4BZ2H 5T1MB 3BPNC 4JFXB 5I71C 3BESR 4K23H 3D6GA 1X5KA 4GH7B 4X8JB 4GMSH 4U6XB 4MQ7B 1UB5A 3VXNB 5I18H 5JDSA 2M26A 4YDIH 3S3PA 3VH8B 3BKYH 4PIRF 3N06B 5EU5B 2YD6A 2Q86A 3KLHC 5JO5B 3NFNA 2IBZX 2D7TH 4D9RD 5HDLA 4LIQL 3G6JA 4U1IB 2FBOJ 3TV3L 1WWBX 2E5EA 3SDAB 2HJFB 2UY7A 4G7YH 3HNSH 4S0SD 3V2AR 2B4CL 2A6IA 2IAMC 3PXHA 4FG6C 5IB3A 1D7FA 1X5GA 3X11A 1VB9A 1MJUL 5I1EL 1F3DJ 5IESH 2C3VB 2VIRB 2DRUA 3GIZL 3DI2B 5HYJB 3CPLA 3T2QA 4I0PB 2MKLC 5F7HA 4KKBC 3QB7C 4XVSL 3SDCC 1JPGA 3I50L 1SMOA 3DXAE 4QRTB 3WKNA 5JPMB 1GPOL 1I75A 2VAAA 4XP9L 4X9IA 5F7FA 5EORL 4CVUA 1X4YA 1SVCP 5ACLA 2HWZL 1FE8H 4LMQI 4NQXA 4PJEF 4WDIB 4MDJB 4LCWE 1EHNA 4JR9H 5IBUB 3GSXA 1A6PA 3SDDC 3TIDA 3W9DB 4YBQC 1DR9A 1KJ2A 4LIQE 1QVOB 4MGXA 5SV4A 3GSRB 5I1KH 3OTTA 4PV8A 1OGAA 1KYOK 2YPKA 2NY7L 4UTBH 3SCMA 3FN9A 2O5YH 4Z7QE 3QHFL 1QO3A 3MRFA 3LEXA 2WWMD 4JANA 4FXKB 3SKNB 2HFFB 4EXKA 3BEWB 2KPNA 1CD8A 2IADA 3FFCA 4OM0L 4PJXF 2X10A 3EYOB 2CJUL 1HH9A 3EOAA 4AMKL 3PDGA 4O9HL 1YEJL 1GYAA 3O4LD 4WY7L 4PRHA 3FT3A 2VLRB 2WV3A 2A9MH 1YNTA 2FEDD 1J10A 2UV3A 4TPRL 1Q94A 5EUKB 2IH1A 5MENA 4ESKA 1EO7A 3FQWB 4J3WA 4PY7B 4J6RL 5E6IB 4G6AC 3RTQB 3ZYOA 5E9DE 4HGMA 4Z7NF 2AJUH 3FO2A 2NPLX 4BUHA 2VQ1A 1TVDA 1D5MB 4YE4L 3ARDC 4Z76A 1BZQK 1G7MB 2R15A 4IJ3C 3OSKA 4E41A 2PO6D 5LWYH 4F7CB 3EHBC 5CP3A 1UACH 4JKKA 1BECA 2AW2A 4Z78A 5C08D 3O3EA 3U79A 1FL5B 3VWKA 4Z5RA 3M17B 2BVUA 4ZXBC 5D71H 3CFIC 3C60B 2E9IA 2HT3D 5FYLL 1NEZA 1KEMH 2VDQH 4ERSL 2YRPA 5D4QA 3QEQE 4EUPB 1MLBA 3KPLB 1FVDA 1I7ZA 1T4KA 4Z77A 1I3RA 2VDNL 3K8LA 3PWPE 1JI2A 1OVZA 3LN9A 1QFWL 3U82B 1FYTA 3IETB 4P59L 1GGTA 4OLZH 5CBEA 4WVRA 5HBBA 1EFXB 2M1KA 4NN7B 1UCBH 5BV7H 3O0RL 1BPVA 4Z18A 1SHMA 4XNQB 3TBWA 4WTWA 1SMAA 2YOCA 5FUOH 4NP4H 2GCYB 3AS3A 1RK0B 2FGZA 5DEFA 4ZS6C 5IGXL 1KIQA 2YC1A 4WFGE 2R56L 2R2HB 4R97C 3IDIB 5SWSB 1A3RH 2IMMA 3GBMH 2AXGB 1T1ZB 1TZHB 1P4BL 1EGJH 3MGTA 1F5WA 3QIUB 2AK4A 2X2YA 4ZUSB 4DK3A 4N8VB 2MCPH 3ZHDA 4AH2A 1MFEL 3B9DA 3MLWL 1AGBB 1ZWIB 5ESQB 3QFDB 1S5IH 5DFVD 5FYLE 2VTFA 3GI9L 5IM7A 1DQQB 3SKUD 5CIPB 5LGHL 4OUUB 2DBLL 2E7MA 1VHPA 3VA2C 2D9CA 4M6MH 1KN2H 3MREA 3BOVA 5KVFH 2HKHH 4OV5B 4FP8H 4RAUB 2C7UA 4H8WL 4NO2A 3FT2A 1S3KH 4YHKL 4JRXA 3PGFL 2BSTA 5JW4M 1JNHB 2X4UB 3CIQA 3GSVB 2BNQE 5FM8A 4HSQA 4YDVA 1DUYA 3S96A 1MUJB 5F7EH 4CVZB 1B3JA 4Q0XH 3N9GL 1UM6H 2NZ9C 3L95B 5KTEH 3H42L 3PGCA 5IVXA 3IS1X 4H1LG 3HE7C 3U46A 3D3VB 3MRRA 2EICA 3QUYD 3HG1B 3B9KB 3HAEG 5EFIB 3AY4C 4CMHC 1BJMA 1D6EB 2AAVA 4PJ5A 2DL9A 3RI5F 4EDXB 4X6BB 3FQNB 5HHVL 1WCBA 1UM5L 1NGQL 3L3HB 1F97A 3O3AB 4IM8A 5FB8B 4R26L 4YXLL 4XCNA 1AP2B 3ILPB 1M7IB 4WENB 1AGFA 1MOEA 4FFWC 1WC7B 3B3IB 1F4AA 3WDIA 1G9ML 2EXWC 1OLZA 4JQIL 4NBYB 3ULUD 5GS0D 4HT1L 2ADFL 2EKSB 1XF4B 1NCUA 4LLWB 4XPGH 4F37F 1MLCB 5ICXA 3VXPA 1YMMD 3T0VA 2NMSA 2O5XL 3BPLC 1ZHNA 1IEAA 1QP1A 1R5VB 4OLWL 2DDQH 5I15L 1P7QD 1D5XA 1Q9KA 2YMXL 2MSPA 4OZ4A 4YO0B 3VFTA 1W72L 4MXWL 4DKFL 3M8OL 2AI0H 3DYPA 3MBEC 1BBDH 4MA7H 2KUTA 4OT1H 5DUBB 5T3XD 3BT2L 1NBVH 2H45A 4GRMB 2QSCL 3LN5B 1I7TA 4LLVB 2CPCA 3BUYB 1GHFH 1I4FB 4E0RB 3L3JB 4WI2A 1CICC 1K3IA 1L0YA 4F8QA 2J6EH 4ODHL 4X6CE 4OBSA 2D0GA 1T21B 2PXYC 2PUQT 3WFBH 1FBIH 1NCBL 4JO3H 4OSUH 4PRNB 4AG4L 3BMWA 3OJMB 2J8UB 5KOMC 1SEQL 3BEVB 5C1MB 2FECI 3T8XB 4G7VH 2B2XH 4D8PA 4M43H 2VH5L 5HVWA 2NXZC 4PLOB 3M1BA 1T66C 1I7UA 3ZZ1A 4FQ2L 1TNMA 3MCLH 5C0ND 3LCYA 4YZFE 5FCSH 2C1OB 5F8QC 3DROA 3MLVL 5F88B 1Q0YL 3RBGA 2FCBA 2ZCHL 1U92A 4WNQA 5IG7B 4XVUC 5JQ6H 3TT1H 5T3XH 1IARB 2NY0C 3O9WC 1BVZA 4CNIB 1PFCA 4MX7A 5D2NE 3OB8A 5CCKL 2VZUA 4PJGE 4X4ZA 4HKBA 4XI5D 2CO7B 2ZSVA 1UADC 1JJUA 3NPSB 3S4SB 4NZJA 5C0AE 2FX9H 2G5BA 3H8NA 2XWBA 4GSDL 1NCTA 5FYKU 2A1WL 2VN7A 3PNWB 2ED7A 3MLZH 4NOBA 4X0KA 4ZD3L 3QIWC 1Z3GH 1GZQA 4PGDB 4LOUD 1AKJD 2B1HL 3NTCL 3MXWH 5EU3B 2E6QA 1NFDE 3BN3B 1MHHB 5F9OH 4UUJA 3KLAA 3NIGF 2YZ1A 3MRNA 1TVHB 5DJ8A 3ULVH 4N0FB 1CL7H 4X7TA 2F5AH 3T0EC 4F58H 3ZKSD 2ILLA 1QRND 1KTDB 4LNVA 2VL4A 4U1GB 4Z7OF 5C0CB 1HEZB 3HE7A 4DN4L 5IP4A 4XWOC 1IAOA 1FC2D 5DF0A 4RGNC 1YA5A 1PYWA 1J12A 1LO3H 3ES6A 5DGQA 4DZ8B 2NY6D 1EBAA 5E8NB 5EOCJ 3WEXA 3W82A 5DMYA 4AK1A 5I76A 1BAFH 2VISA 5F1NB 5IVZB 5JHLH 3VG9B 5HGAB 2VLKB 3UBXG 3IGAB 1ZHBA 4KPHL 4C83A 4JFZL 2R4SL 2N4IA 1I1AA 2K7PA 3VD3A 2P5ED 1DBML 5KS9B 4HG4K 3TNMA 4NC2B 1HOCA 4G8FB 3CFEB 2ZOKB 4LVEA 1SJEB 3IU3B 2BVPA 4MQ7A 4DW2L 2H1PL 3WXWL 1LK3L 2PETA 4UIMB 3ARYA 1DVFD 1I3VA 4PRAA 4XMPL 2Q8BH 1ZGLB 1X3DA 2J2ZA 4JFQB 1MCBA 4UOW0 5HHXL 2UVFA 3HZYA 1A7PH 1IGIH 3QCVL 3TYGH 3CMOL 2CLRA 4FOMA 4U1IA 3PWLB 4W4OA 5IFAH 3TGXA 1RIVL 1T5XB 5GJSH 5C09D 1I8IB 2EE9A 3RPIB 3HI5H 4G9FE 1HXMB 3BJLA 5ESAA 4CADA 3DO7B 1HQRB 3LRGA 2Y72A 5CHNB 4UILL 1CLOH 4JZOB 5DQJB 1NMAL 3QAZB 1CICA 5F6IB 1VERA 2Y23A 4WI4A 4PY8I 5H8DA 3FQRA 3E6HB 2DIBA 5BMFH 3VXRB 2FIRT 1AQKH 1G6RL 1UWEL 4KZDL 3RUGB 4MLSA 2X44D 3OPZL 5C92A 2LU3A 5IK3A 1UQSB 1NBQA 1RVFH 1S9VA 4DGVH 1DUZA 3HI1A 1N6QH 4QT5A 3P4OB 2AQ2A 3GMQB 4HHAB 5HGHA 3LOWA 5DI8A 5K9KA 2OTUB 2R0LL 4G9DA 3UTZB 2Y6SC 1Z9LA 2VL5A 4AM0A 4N8CH 5IKCB 1LEIA 4OCWH 5GZNC 3FB5B 4QRRE 3W9DA 1R5IB 2CKBA 4PR5A 3QISA 4ODBD 4F7MA 2A38A 4PBVC 1RURL 4YDJB 3KHOA 2NX5E 5KANG 2CIIA 4DCQB 5SWQB 3LZFL 3NCJL 3FB6B 4OGYL 3LQAL 3O9WA 1F90H 1HIMH 1L9NA 5J9PA 1NGWA 2PYEA 3O2WH 3KYNB 3LAFA 3VE0A 3VFRA 2N56A 35C8H 3EYOA 5DJ6B 1GAFL 2XFXB 2YS4A 2IJ0C 1QA9A 4Z7WE 5L7XH 1NQBA 4YDLB 3I3DA 5DC0A 2JIXD 3ZT5A 4K3EH 4M00A 4TSCL 5E6IA 5DJZA 5KSBE 2W07A 3C8DA 5ESVA 4PP1D 4RMTA 3O45B 4KY1H 1D5BB 3TBSA 2DS4A 2FX8H 1TDQA 1G9NL 1KPUA 3HI6H 1KPRA 1G7MA 4XNYL 3N0PB 3MTRA 2FYYB 3MV8B 3V4UH 1E28B 1TTFA 1WF5A 1LO2L 5H2BB 4TRPL 1HHIB 4HJGB 1HSAB 2ZUUA 2FL5A 1WCQA 5HYSG 2FJFA 4ZSOE 2CLVA 2JCCE 2WINB 4Y16B 3M17A 5DMGC 3Q3GA 4ZO7A 1A7OL 2GJ6B 3DMMD 1PG7L 3FCTB 1JZ6A 2HTLD 4DGYL 2XRAL 3O3UN 4EUPA 1CFTA 4TUOB 4FQIH 3P0YH 4JHWH 1JGLH 3WLBA 4IMLB 2WAHA 4OQTL 4UT9H 1QFUH 1CFSB 2WBJC 4GJTB 1KJ3L 1ERNA 1TETH 5DT1H 4FZ8L 1F8TL 4UU9A 1UC6A 1T20A 2B4CC 4QTHB 1YEEL 1AGCB 4H1LA 4XP6L 4QOKB 2FR4B 1C12B 1JPSH 4FQXC 2QLVB 5BOZG 4LHUB 1O0VA 3HAEA 2FB4H 1WEJL 2DTML 5FUZL 4HLJA 1U6AL 3W11D 3BP7A 3FO0L 3NACL 5GGVY 2D3VA 4NIKB 1AO7B 3P73A 3QNZB 3CLEL 4RIRA 2EYTA 3K4ZA 2Z93A 2IANB 2R8SL 3ZKXC 4NHCH 5EUOE 3WS3A 5CKGA 1A6WH 5C0BA 3JV6A 4DUVA 1FIGL 5D9SB 4QTIH 5B3NA 3LS5L 3WLWC 1TCRA 5GGTA 4NWTH 3QFDA 3VGFA 4Q6IC 2NY1D 3VDAA 2EE2A 2FDBP 1I3GL 2XWJB 4IRJA 4R4BB 4OIIH 4F9LA 4Y4HB 2FEEI 2DI7A 4R2GB 4L3EA 3KDMA 3ARBC 1K5NA 3M07A 4Y7MA 1HK6A 5TF1L 3G04A 2FH8A 5E2TH 4JFFD 4M1CC 2Q76B 2A83B 2G75B 3F5WB 2CDGB 4M4PA 1IRAY 5D1XC 4PB9H 5IWLA 3HNVH 1JHTB 3CDYA 3FTGB 2ZOLB 1MUJA 2QQLL 3PP3H 5K9JL 1KGCD 4LPCA 4CVZA 2AKRB 4KK8D 3TIEA 3UAJC 3B83A 1KEGH 2I07B 1H5BB 5M94B 2FO1A 1OP3K 1MRFL 2X89D 2RHEA 4A6YB 5I17A 1A0QL 4U3XA 2J8UF 3VXOA 2UZIH 1P9MA 2WANA 1CS6A 2AERT 3MRJB 4LSSL 1ZHKA 2LV4A 4LSPH 3AXLA 4X6BA 1JHLL 1E4XL 2VQTA 5F9AC 1CLZL 1NJ9B 3ILPA 2ZJSL 3RZWA 3A67H 3MLTA 3H0TB 1B2WH 5HYIA 2YWYA 1Q9LB 1CDJA 3MX0A 4M7LT 2AJVL 3TZVD 4HXBH 2EKSA 3BQUB 2X4PA 4JHAL 4XCFH 1VFBB 4XNXH 2Z91A 3CU7A 1QSEB 4S1DC 5FGCE 1FH5L 3BDBA 4BZ2L 4C56D 3AS2A 3ARED 4K23L 5DSCB 3ZDZE 4LVNB 4GMSL 4NO3A 1S7QB 5J12B 2PCPA 3LEYL 5I18L 2CUHA 3ZKMD 4YDIL 1OD9A 5TE6H 3BKYL 2IF7A 2DLTA 1NFIA 3ZHKA 4R7NB 3DYMA 1K4CB 3LKSA 3BD5A 4NO5B 4S0TD 2XA3A 4HH8A 2D7TL 1AGDB 2FO4A 5EZJB 1VKXA 3VXUE 4C4KT 1XR9B 5DHXB 4KVCH 4LLVA 3PHQB 1RUPH 3O6MH 4G7YL 3L3JA 3HNSL 4MJIA 4WCYH 5HYFA 1XR8A 4J4PC 3ZT7A 1HINH 4WU7B 3SGKC 5CEXA 3QUZB 3KLSA 3REWB 2C9AA 3KXFD 3BZEB 5JW4R 3GM8A 1S5HA 3RQ3A 2APWA 5J1SC 2L0DA 4E42A 5IESL 1S9YB 3U7AA 5C86A 4PRNA 4MDIB 1U8KA 4DQOL 2WBJA 1IAMA 1XIWD 3I02A 4HUUA 4JFPB 2R39A 4Y4FD 1OM3H 5FECB 3OKNA 3T8XA 1UXWB 2Q8AH 4GRLD 2HH0H 4PGCB 1CK0H 2NW3B 1PEZA 1IGCH 2ZUWA 3VFMB 1FE8L 4FQXA 2C1OA 2QV2A 4ACPA 2YBRA 5D1ZA 4Y8AA 4H8WC 4JR9L 5ADOH 5KS9F 1HYRC 3ZHLA 4JRYD 5E5UB 2B7DT 1NC4D 1JE6A 4XPTH 3RWJB 3VXME 1MY5A 3SDCB 3BIKA 4Y2DC 5I1KL 4PRIE 3UBXA 2BK8A 4UTBL 2O5YL 1MJJB 5BVPH 5GGSA 3RWHA 3MRIA 3D0VA 3LH2H 4LKXA 5DC9B 5HYEA 3S88H 1FN4A 3WD5H 5KSAB 1JIBA 5T3ZH 4K3GA 3SDDB 5EO1B 5DURB 3KWWA 43C9A 2A9ML 4PGDA 3ARBA 3ZLQC 4QRQB 4IRZH 4FQQA 2YXMA 1ORSA 2H2SC 1D9KC 1XZ0B 4HX1A 1UXSB 5F1IA 3BW9B 2NNAA 2EO1A 4U1NA 2ZPKH 1G9MC 1KNOA 3MA7B 1IQWH 4F15C 2DI8A 3CFDB 3GDBA 5IB5A 1U8LA 2NXYD 2GITA 3VDCA 3RUGF 1NLBH 4EEEA 5LWYL 1HEZA 4CN1A 1UACL 2GY5A 1CQKA 1A6TB 2BVQB 3KPSD 5CZXD 4NBZB 2E6JA 5HYQB 1UH4A 4MAYD 3SBWC 4D9RE 4AENB 4OD2B 2CK2A 5D71L 4Y4KD 5J11C 1CZ8H 5E95B 4OM1H 3FOLA 2VZOA 3ZE2E 2VDQL 1KEML 3GGWB 3H9SB 5DC4B 3D0LB 4EZMA 3ARDB 4PP2B 1DDHA 2QL1A 1A6AB 5D2LE 4OLUH 1C7TA 3GB7A 4OLZL 1HI6B 1OCWH 1EXUB 3IT8D 5D2NC 3D39A 4ZXBB 4L9LC 1BZ7A 1L6XA 1EV2E 4NKQB 4LF3B 3D18B 1UCBL 5BV7L 4MS8C 1U3ZA 4UIMA 4U7SA 1P2CB 1YYLH 4M3KB 1IE5A 2DM2A 5FUOL 4NP4L 2V7NB 1KIRB 1SVZA 3OJ2C 4WUUD 3BVNB 5GISH 5EU6D 3MODH 2H32A 4ZAKC 2P43B 1K4DB 3QNYB 4OCSH 1A3RL 3GBML 2OZ4H 3PWLA 5JDJA 3ZKQD 1OAKL 2NCMA 1EGJL 2IPUG 3BZ4A 5ICYB 3V8CA 3RVWD 1LEGB 5LCVH 1I8IA 2MCPL 4LSDA 1FZKA 3UZQA 5CLWA 1YECH 3R8QA 4W68A 1S5IL 2KKQA 2UYLB 2NY3C 4NGHH 2RAMA 1DTUA 2Z0BA 2BZDA 4LEOB 3SGKA 5KBNC 4XP4H 4CW1A 4M6ML 5HGBB 3TA3C 3VXRA 1KN2L 2HKHL 4UQ3A 4FP8L 1EHLH 1M6OB 4WV1C 1IL1A 3C9NA 2HVJB 1S3KL 1GOGA 4YHPA 1PVHA 3VXSB 4LLUA 4U2ZA 3V0AC 1E6OH 3FZUD 1SEBB 7FABH 1F6FB 3WFHA 3CSGA 3GMQA 5F7EL 2EZ0D 1CXKA 3IVKB 4JFEB 4Q0XL 1UM6L 4JGUA 3UTZA 2P8PB 4HIEA 4PGZA 5HYSA 3B9VA 4NKMA 5TDPB 5IBLC 2F8XC 2W60B 2CR6A 4PJHB 4IBLT 5I75B 4JREC 3VFNA 3VFWB 4C59B 1KTLA 4PJ9A 4LSRH 1G7LB 3VRIA 1AD0B 3C2AH 3ALWA 4OFDA 5IHLB 5KW9H 3TO2A 3TESA 4WW2C 3RI5K 5DRXB 4ELMB 5C08E 2ESVD 4WO4A 2IPTH 5J06A 3HPLA 4ZTOH 4Y2DA 3SN6N 4PY8J 1D5ZB 2JJWA 2L7UA 2P8MB 4ETQB 4IRSC 4PYHA 2BJMH 3KYNA 5L6YL 4AEFA 2BNUA 2X4OA 4HS6A 4FTVB 1DLFH 3IDUA 1S7WB 43CAA 2SEBA 3OV6A 4XPGL 4N0CD 4YHMH 4ALAH 4L8BA