4FQJH

Influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
228
structure length
222
Chain Sequence
b'QVQLVQSGAEVKKPGASVRVSCRASGYIFTESGITWVRQAPGQGLEWMGWISGYSGDTKYAQKLQGRVTMTKDTSTTTAYMELRSLRYDDTAVYYCARDVQYSGSYLGAYYFDYWSPGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
molecule tags Viral protein/immune system
source organism Influenza b virus
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
total genus 42
structure length 222
sequence length 228
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH01
3WS6A 1AY1H 4XTRC 3PQYE 3PABA 4NQXB 5E94B 3CK0H 2V2WA 1F6LL 3MLSL 4M7ZC 4L8CA 2P8MB 5C09B 1VGKA 2YC1B 4WY7L 1AC0A 4BUHA 1Z2KA 1PZUB 5HYEA 3BKYL 4J3SA 4GAJH 3CMOH 1RMFH 2X4PA 4PRAA 5KG9A 4GQPH 4QTIH 2AVGA 2CIIA 5HGDA 1UJ3B 4G9FA 2VE6B 2C7UB 3MNVB 4R8WH 1T1XB 4BSVA 2B4CH 2EXWC 1F2XK 5KTEH 3OG6B 1AO7D 2DQTH 1A9BA 1KYOK 5HPOA 1UG9A 2CDEA 3FAXA 2ZG1A 3H9SE 1MCSA 1DQQA 1K5NA 4PLKD 5E5UB 3DV4A 2WINA 2WP3T 3ARGA 5CBAA 5C70A 3HUJB 1BZ7B 4FQPA 1FFOB 3IFLH 1S9WB 1HYSC 4LLDA 5J6GB 3ARUA 4QCIA 4O4YL 4NDMA 5DHVH 1OWRM 2BVQA 1P53A 4IRSD 2D0GA 1PW3A 5A2KH 2WW8A 2DI8A 2XZCH 3RDTA 5JOEA 3GMNA 3Q1SL 4P9HH 4ZOCA 2VDQL 2I5YL 4HK3N 4PBVC 3MV8D 3I85A 1KIPA 1KCKA 2EEAA 3QHFH 5KBNC 2OL3L 5FYLE 3U2SB 1CGYA 1A7QH 4ZXBB 1U9KA 5IFAH 3VXNB 2VXSL 5SWZE 4CW1B 5KJRH 3HHRB 4LRNH 2OM5A 4G7YH 2H32H 4PJGB 4PJ9B 1DVFC 4OFVA 1K5NB 1OGAB 2FB4H 1SJEB 4R96A 3VFMA 4QO1A 1XF2A 4P2QE 3GSQA 3KS0J 2CKBA 5E5MB 1UB6B 4NZJA 3WIFB 3DX8A 4CGTA 2VLJB 2ZJSL 5FECA 3MUZ1 4XBGB 3GUTB 1GRWA 5ID1A 4AL8H 1EVTC 4LQFH 1DUYB 1FZOB 3VFNB 3CSYB 4KK8D 4DVRL 4G8FB 4U1IB 3BYTA 2WBJC 5IFAL 2DF3A 4JJ5B 3E8UL 4L3EE 3IFOA 1O0VA 5KVGL 1X4YA 4G7YL 3BT2L 3G6JA 4JGUA 5FGRA 4IRSB 3CSBA 4X6FA 4L9LC 5GSRB 2N7AA 2DD8H 2P5WE 5B3NA 4XNMA 3G9AB 4I0CC 4P4KA 5L2KB 4OZ4B 1S7RA 2Z92B 4PB9L 3HE7B 1A7OH 3C60A 3OKKA 3TBYA 4WO4A 3VXUE 1KB5B 5AAMA 5HYJB 5L7XH 3ZTNH 5GIRB 4HG4K 4NM8L 2BOCB 2LAAA 4XXDB 3TH2T 4YNYB 1C16B 3K46A 4KMTH 4OZGA 4WDIB 1PZ5A 4G6FB 1XMWA 4ZTPL 4XBGA 5GZND 4MA7H 3T4YA 4Y4HB 3GMLA 4HD9A 2AK4E 3TBSB 3MLRL 1KLUA 4OM0H 2Z35B 1FRGL 2UUDK 4PTUA 1U8JB 3P4OB 1P7KA 2VDML 9CGTA 1U58A 4YDLB 5E00A 1NLBH 1FIGL 4KUCD 4GMTH 3X3FH 4JJ5A 5F1OB 4Y2DB 3AU1B 1S78D 3X3GH 1R5VB 2XG4A 1O7SA 2BZDA 5DC0A 4TSAH 3MNWA 4Q74A 2N56A 5JHDE 4X8JA 1UM5L 5T3XD 1I9RH 5TDOA 2N7BA 4HF5H 2PXYA 4PGZA 4PTTB 4OLVL 4P2OC 1INEH 2HTKC 5IBUB 1EIBA 1FNSL 3T0BA 3D0VB 3GSNB 4HWNA 4XCCL 2IJ0C 1A4JA 5C9JA 3BEVA 3LEXA 5IFJA 1I3GH 4IJ3B 4W6YB 3WIHL 2DICA 4L8SB 1XGYL 1U8LB 3VFPA 5BQ7B 1ZA6B 2ENYA 1N26A 3TP4A 5HVWA 2EDBA 4QRRE 5CJOL 4YHMH 1IT9L 2P8MA 2XPGB 1EGJA 4IOSD 2ZCHL 1MPAL 1A2YA 1FGVL 5C0DB 43C9A 1CL7L 2ZUSA 1PG7H 4Y8AA 2BNQA 4HIXH 3NPSB 1NGWA 2AS5M 1GZQB 4OLWH 5B22A 4HGMA 4HKZB 5D96C 3O3DB 4DAGH 4I48A 1YC8A 2FX7H 1DL7L 4ZUTA 5D8JH 1G7QA 1YPZF 3D2UB 4Y19D 2DLTA 4WW1A 1I3GL 3WIHH 5EO9A 3MLVH 5DJCA 3HR6A 1RVFL 1EJ6A 2DQGL 2XKSA 5TDPA 1TNMA 2X9XA 2RFXB 4NUJB 2D31A 4X4YB 1B0RB 5DJZB 1LHZA 1CFVH 3LB6C 3FT4A 5KS9B 1QBLH 3QIBA 1MCOH 2JCCA 5E8PA 3U9UB 3SQBA 1FYTA 5HHOE 1R3HB 4OFYD 4HG4J 2DTMH 1KV3A 4HSQA 4XBEL 1NCCH 2X1QA 3MGOA 3ZE0F 1MRCL 3RX5A 2N4IA 1JWUA 5SV4A 3OPZH 1T2QL 5MENE 5KOMC 5HHOA 1WFTA 3BWUC 1Z9OA 3MBEA 3OX8B 4IRJC 4OAWA 4ZAKC 2YKLL 1OARL 4CRPA 4ZO7A 1OQXA 1R3IL 2OQJB 4Y5YC 3WFDL 5I8CB 4JFYA 4LPXA 3FT3A 3FO1A 4B53A 2XTJC 3EDFA 3U4BL 3PP4H 4MS8C 5ADPH 1JRHH 3P0YH 4QXUH 3W9DA 5C6WH 4NKOA 3ARTA 3QPQC 2GEEA 5IQ9A 4XBEH 4JG0L 5FYLL 5DEGA 3TYGH 4KMTL 1BJ8A 4XH2B 5BW7C 1T83A 3QT2A 1T22A 4GKNA 2R15A 3OPZL 3QQ4B 2COQA 1LE9A 2HKFH 1SJHB 3DXAA 4F7MB 5DRXB 3RNKB 4HUUB 3HCVB 1IC4L 4N1HB 4JRXB 5T1KB 4KK9C 2X70B 3O41A 5DGQA 4F7CB 1MUJA 1ZHBA 3O2WH 1ZVSA 4N5ED 5ETUB 1T66D 1I8LC 1S5HB 2VUOA 3O3BA 4LEXL 5IK3B 4LSUH 5J0BA 3IDNB 1U8NB 3EZ8A 4OV5A 4LSSH 1X5KA 3LHPH 3ZE1E 2R2EB 4TQEL 1AGFA 4P23B 3VWJD 2DIAA 4A6YL 1NMCB 2XWBB 1YNTA 5KSAC 4OZGB 3S4SA 1LEGA 2ZCLL 2V17L 1PZ5B 1JUFA 4JPVH 2DKSA 4G8GA 3E6HB 5HDBF 4G9FB 1XIWD 4GKNB 1UB5B 4D9QE 3S36H 3KLHD 3HUJA 3O2WL 3QO1A 2K3TA 3TESA 1MCPH 1AD0A 4JPWL 5GGRY 1RZFH 2Z9TA 3H9YA 3L6FA 4LEXH 2R0KL 4M5YL 4JM2D 3UPRB 1IT9H 5HTSA 5T1KA 4UV4L 5FO8B 1C8PA 4OCYL 3RUGF 4W70A 5FKAB 1FPTH 1OAUH 5GISH 1JF5A 5JIHA 5T5NF 4QOKD 3RBGA 2W65A 4YHZH 4L29B 4RA3A 2YD6A 4WFGD 5GRVK 1ZLSL 2C3GA 5BS0A 2HTLD 4PTTA 4XWGL 4LLMA 1UWGL 2MPAL 3MQIA 4OB5H 4ODXB 5LXGH 3B43A 3M8OH 1M7XA 1XZ0B 4X6DA 4XNZB 4NGHL 4XRCB 5GGSY 4LOUC 1BECA 1OGAA 4MWFA 1IAIH 4QHNB 1RVFH 3F7QA 2ADJB 2LVCA 1AXIB 1NJ9A 4LIQH 4NRXA 4UMGA 1UYWL 1GXEA 3VXNA 3MCG1 2YWYA 7FABL 5GISL 5DJ8B 2QSCH 1CIDA 1RZJH 1CFVL 3L7FB 3PE9A 5KSBE 3CLFH 4KHTH 1X44A 5ICZB 3HI1B 3NIFF 3VI4E 1TCMA 2VDOH 2H2SD 1U92A 3U7WH 5CS7A 3U0WL 2JLLA 3ZMRA 2CLVB 3G08B 3GSXA 3GZKA 3HLAB 4NDMB 3GI8L 2X4UB 1A6TA 2K9UA 4OCXH 4JGMA 1ZVYA 5INCB 3C60B 4HW6A 3SPVB 1E6JL 4X5XA 3OKLA 4NP4L 3QR2A 1B90A 3RU8L 4JPKL 3U2SA 1A47A 3BVNA 4Q6IA 1DR9A 5I8EB 4Z7VA 4K23L 2F74A 2D31B 4BH8A 5I15H 4R4FH 4JG1H 4L4VA 5D7JC 5EFIA 3MACL 3EOAA 5ALBL 1T1XA 4CU8A 1KCRH 4YDKL 3UBXI 5GHWH 5HJ3B 5C86A 4MXWL 2AK4A 2GTZB 3K8MA 5I1CH 4Y4KB 1U8JA 4WEUD 2XT1B 3SDDD 2O5YH 1A3LH 3MGOB 1MCEA 5BW7A 3H9HB 2VISB 1L9MA 3EDJA 4UIKH 4BQ8A 5B38G 4WV1B 5EU5B 4KDWA 4NQEB 3L3OA 4BQ9A 5IBTL 3RU8H 3B9KB 4I5BB 3VFSB 4U1LA 2VAAB 5IMMA 2J8UF 4HS6A 2YA2A 2ZCKL 3MRKB 3NFPA 4PV9A 3HMWH 4Y2DA 2IBGA 3MACH 2PKDA 2UV3A 3MYJB 4LMQE 5I18L 4NZDA 1VERA 1FAIH 5KOVC 4U1JA 3OAUL 1BFOA 3KPRA 2YD1A 1XGRB 4RNRB 2YPVL 1SEBB 1F4AA 3VDAA 3RZCA 1DSFL 2XZQH 2BC4B 5I71C 4PP1D 1JHKH 4OIBA 4WO4C 5CSZA 3TT3L 4Y4KA 4F2MB 3L3JB 3DI3B 1I8KA 1FH5L 4JPWH 4JAMB 3VG0H 1VFAA 4BKLA 4F33A 1W72L 3UJIH 2XNAB 2CMRL 3OAUH 3BO8B 3NCYP 1RAMA 4F15B 2V2XB 1A1OB 2EO1A 3OAZH 4ERSH 3O3DA 3NFSL 4K71B 5E56A 5CHNA 1MCRA 2GTWA 4L1HA 3BAEL 4FQCL 4XWGH 4Y89A 1FVCA 3L7EB 1FFRA 1CFNB 1QPXA 1I7ZA 3JZ7A 2HKHH 1JN6B 4UV7H 1HKLL 2P4AB 4X8JB 3GMPB 3WFHB 1BJ1H 1T4KA 1OLZA 4MVBD 3WLBB 3B8SA 5D2NB 1KUMA 3TO4B 4JO4L 4P99A 1MF2H 2PW2A 2FX8H 2Z31C 5TE4L 1D9KB 3N9GL 1BQHA 4PS4L 1WBYB 1N2RB 4KY1H 1XF1A 2HFEB 3LN9A 3EFDL 1OAYL 1FG9C 3ARBA 2OR7A 3GFUA 1CGVA 5LVEA 5K9KA 4Y4HA 5C6TH 1P7QD 4U6VH 3C2AH 1HE7A 2IMMA 1FVDB 2M26A 1NL0H 3UTTE 3DBXA 4CVZA 5BS0B 4FG6C 3WBDA 1ZSDA 4LGSB 4XCFH 5CFHA 3ARQA 4ODXA 5FYJD 3RIFK 3SBWC 4R2GD 4E41E 4LLWA 2FO4B 1TJIH 3AU1A 4FFZH 2EDTA 2V9RA 1TZIB 3N9GH 4FXGA 5C0RL 2NR6C 2J8OA 3IXTB 1FDLL 4NRXB 4UIMA 3QUKA 2J8UB 4LVNC 2VDNL 3IDJB 4EUPA 4OJFL 4S2SB 1OGAD 3VWJC 4JZOB 5LAXA 4PJGE 3QEUA 2ESVB 2W59A 3MO1B 2WLZA 1TQCB 5I2IA 4DUXA 3OJDB 2FD6L 3KJ4B 2WWMC 1ZOXA 4CMMB 4FTVB 2WBJB 3F65A 3RGVB 3RWFB 2L7JA 1CGXA 2HLAB 4RBPK 5D1QB 3L3KB 4NKMB 5C08D 2G60H 3MLXH 4LASL 1BZ7A 5C0RH 2P7TB 1Q0YL 4AJ0A 5CLTA 2H1PL 1A7BA 1NMBL 2BNRE 4Y1AB 4C4KT 1TZIA 3FQWB 3IXTA 3O2DL 1S7UA 2HN7B 5DURD 5I8KL 4RA0C 1QFHA 4LAQL 5M95B 4BFIB 4ZSOA 3IS0X 2CK0L 5J7CC 2HJFA 2R2HB 4MAUL 2J88L 4PJAB 3MO1A 1E4JA 1NKRA 3S88L 1AGFB 3MRJA 5DD5L 3H9HA 4PG9B 4FRWA 4D0DA 4KK5C 3ULUD 2EH8H 1SJEA 5L8KB 4AENA 4U33A 3EYOA 4P2QD 4YIQB 1CFQB 1G7LA 3OF6D 2YD5A 1Q9LA 2AXFB 4E5XA 1EO8L 2VAAA 2Y6SD 4GFTB 3HMXA 1B88A 3R4DA 3UPRA 2DQIH 1AO7A 3MPCA 5JHLH 3DHMA 1Z0MA 1DVFA 4U6XB 3UZVB 3B6SB 1G7HB 4XNXH 3LB6D 4YWGL 2VAJA 1ZK9A 4HGWA 2BSED 1OAKH 1A22B 4L29A 2R0LL 4UV7L 2XZZA 2FNBA 4G42B 1NFKA 5CD5D 2DKMA 1KCSH 3CVHB 4XT1C 3PWJB 1YEEH 4EUPG 3MUGB 2P5WD 4P23A 1KT2A 2AEQH 2PR4H 3B5HA 4LARL 3PP4L 3RGHA 1LD9A 2CRMA 4ZDHB 4LK4A 4U1KB 3GM8A 1I7UA 4HCRA 5E9DE 3HI1A 4RRPG 1OB1B 4R7NA 4JG0H 5FYLH 1J1PH 1LVEA 4WUKH 5ERWB 4BYHA 4GBXA 3QO1B 4XCNA 1FSKB 1LK2B 5GGQH 4YBQD 4OIIL 3VGAB 3HLAA 5K9JL 4HMDA 3TVMC 1T5XA 1OSPL 5C0JB 1LEKA 5L2KE 5IB1A 1P4LB 3BPOC 4YBLB 2VN4A 3UYRH 3GGWB 2V7NB 1IQWH 3S37H 5I73C 2UWEE 3GSWA 5A16B 3MRBA 4AYFA 3QA3B 4YFDB 2YSSB 1T04A 1BFTA 3FZUD 1A6PA 4JDVB 1BQHB 4NQDD 4YFLI 5JLZA 2BOBB 5GGQL 3NOIA 5E4IA 1OB1A 4R7NB 2ITDA 1JGDB 2O61B 2IPTL 3QI9B 1J7VR 3BE1H 3O9WB 5HHXH 5F1SA 1MCBA 4UQ2B 2UZIH 1DUYA 5HJ3A 1RZFL 3MLXL 3LS5L 5IV2B 2CJUL 1LO4L 2QTEA 1MFAL 3DV6A 1J10A 3FQUA 4Z7OE 1E28B 4RMUA 5E0QA 3QUYC 1U91A 5MEQB 5C0DA 1WWWX 4RX4D 1DQDH 1S9KC 5I1EH 4KHXH 4TVPL 4PUBL 1BBJA 5CD3B 4RSVA 3D5OF 4LCIL 1QHPA 4PY8I 4HQQL 4HFWB 5JPNA 3QA3A 4U4BA 3LRSA 4X98B 5AAWA 4LKCA 4X5XB 4WHTA 1KB5A 5HYJA 4UTBH 1QKZL 3HZYA 4PJ8A 5MEOB 4Z76A 2VXUH 2Y9RT 3SDAB 3WXVL 3SE8L 4X6DB 2F8OA 4JKMA 4P4RB 3WNLA 3GMRA 5DD5H 1A3RH 5DEZA 2J6EH 1CDGA 3IJYA 4DFIA 1A4KB 1UYWH 4P2RA 3NIGF 5F8QC 3DSFH 4RFOL 2LE9A 1I1YB 3S6CA 1FV1B 4KK6C 5C07A 4P46D 3E0GA 3WHE0 4XPHL 2VLME 1NBQA 1HXYA 2P1YA 5FUCC 1A6UH 3WFBH 4X5LA 5IKCA 3ARFB 3UO1H 4JFEA 2VXVH 4O9HL 3U7WL 5K9OB 1K6QL 3QI9C 4BFGA 5KVEL 1EEZA 4OZIE 2XWJB 4X80L 3JVGC 3CXHK 4PLJD 3TV3L 3AAZA 2FWOB 2O5ZH 5E8EA 3MXWL 3MOBL 3U7YH 3MXVL 3TH3T 3MGTB 2R0LH 1KCVL 5LQBL 1KCSL 2IALB 4OSUL 3BZFB 1RK1B 3JXAA 1IKNC 5DVOA 1JWMA 3ZE1F 1QSFD 3W9DB 4X4ME 2NW2B 1N5AA 3TIDB 1F02I 4UQ3A 4BH8B 3ZLQC 3MREB 4UUJA 4AMKH 3MRQA 1QACA 3MCLL 4OZGF 3LIZH 5D7LE 1YEFL 3ZKMD 1VENA 4TPRH 4PG2A 5ACZB 3DLQR 4LPWA 3SGEI 3MXWH 2R2BB 4GRWB 1HHIA 2ICWA 5EUOB 4PLNC 4JQVA 1EVUA 5K9QG 3VMOA 2DM7A 2BNUB 4LLWB 5JMOC 4FNLL 4L4VD 3FJTA 1UKQA 3MRPA 2BHUA 3RAJL 4P5MB 5SWQA 1MFEL 3O4LE 15C8H 4YXKH 5K9QI 5E2WH 1NGYB 4APQD 5DD0H 1FAIL 2I26N 3ZKXB 4FXGB 1T5WA 4Z95L 3MLUH 2B5IC 4CJ0A 3W11C 4OZIB 5DJZA 2IPUG 1D5ZB 2FHCA 1L7IL 2ESVD 4TSBL 4NSKA 4K8RH 3BE1L 1P2CB 5EU7C 2R23B 3NMEA 4MNQA 4NKIL 3DX9A 1YYLL 5DUPL 5ITFA 5J4MA 3UTQB 4JAMA 5B38B 2XA3A 4KGJA 3WS3A 4NC1E 4GW4B 1BZQK 1DQDL 3VFWB 1E27B 2FECI 1IC5L 3TPUA 3BD3A 4GKOA 3TNNB 1EAJA 4RZCA 3QYCA 5ISZA 3QXVA 1OF2A 5B39G 1A1OA 4FXKB 3T77B 4Y4FA 1Y0LB 3W0WB 2QADD 5JTWA 1U8PA 2G75A 3FT3B 5T1KD 4MA8H 2JB6B 4NWTH 1FZKA 5B8CC 3DURA 3I2CH 4NKIH 1ZS8B 2PUQT 4N0UA 1NFDE 1MAKA 1I8LA 4AIZB 2Y7QB 3NCYS 4WWID 3GJFA 3U46B 3SJVD 5DHYA 4R7DA 5HBBA 2JE8A 3MUHL 1BX2B 4PRPE 2YS4A 3RWJB 2H9GB 3QXUA 4PLJC 5CEYA 3GSUB 4YXHL 5HHPA 3MJ6A 5JUEH 4FP8H 3V7AG 5CZXD 4P2QB 1TVHB 1KEGH 3MLSH 5CP7A 2CO7B 2V2WB 2IBBA 2I24N 5DF0A 4FFVD 4DZBA 4ZD3H 3LMJL 5T1DH 3DVNA 5IW1A 2CGRH 5EPMB 4NO0D 2J8HA 1YMMD 4GAJL 5HHNB 2V5TA 2GJ6A 5FAAA 5J11B 4CAGA 1ZANL 5JQ6L 4HJ0D 2FJHB 1S7WB 1CDYA 1LO2L 1TITA 4LU5L 2MJWA 2ZZUT 3GJEB 4HLZH 3T1FA 4G42A 3BGFC 2Q7NA 5KANG 3NGBB 4PJBA 1KPRB 2DRUA 1PAMA 1Z3GH 3EOAB 4GKSB 3VG9B 1MLCA 2MSPA 3MCLH 5D7SL 1HEZB 3DV4B 3QNZA 1H3PL 2BNRA 3RWDA 3VXTA 3VGFA 3GSOB 2BSRB 3VXMD 3L3GB 5I17B 2QSVA 3LCYA 4L3ED 2AXFA 1E0OB 1INQB 3QIWA 3QQ9D 1I9EA 1D6EB 4ZUVA 3S8WA 5E95B 4KI5C 3QWRA 1WT5A 4Q58C 1UADC 1MFEH 15C8L 2QKIB 1OM3H 4PB0L 2G5RA 5DS8B 4Y5YB 3QEQD 3N1FC 1Y18A 4ISVA 3O2DH 5I8KH 3QJHB 2KL6A 1EXUA 5IJVB 4NBZB 3VXRA 4P3WA 1KPRA 4Y19E 4TSCH 3F7RA 4R4ND 1HHHB 2VLKA 3O3AA 1WT5C 5JPMB 1VADB 1NEUA 2NW3A 4X0KB 1PBYA 2Z35A 1Q8MA 2X10A 4R96B 3VFMB 3P40A 3P4OA 4PG9A 2HWZL 5TQ0L 4I18A 4HFUL 1E6OH 3HKFA 4MB3A 1CN4A 1U3YA 3RJDA 2I60H 4CVXA 1JYNA 2H26B 5SWSE 1FZOA 3VFNA 3QG7H 1SY6A 1AJ7L 4Y4KD 2NY1D 3SKJH 3GIVB 5TGBA 1OTTD 3QXWA 4TTDC 5GSVB 3BH9A 4JFPA 4NNYA 2BX5A 5F96H 3FOMB 3QRGL 4POZC 4JQXA 1SM3H 3SDAA 1ITBB 1DJSA 1UZ8A 3STZB 3LKSB 4JQVC 3LKNB 5FA4A 5TDNB 4R0LA 1U8QB 3ULVC 3ARYA 3DVIA 1B0WA 5T3ZH 1X5FA 4BSJA 1G0YR 4RMTA 4JHAL 4PG2C 5ITBH 1F4HA 3F8UB 3I3BA 5E1HB 3NCFB 5DI8B 5T33L 1RUAL 3TA3B 5B38A 4P49A 3PQYA 2VRAA 2E8ZA 4PGEA 3IJYB 3IJSA 2LQRA 1FP5A 2CKBB 4OCRL 4QRTB 4WNQA 2ORBL 4ODVH 4IMKC 1KN2L 1LP9F 1WAAF 1KEGL 5IV2A 5CJBA 1NLBL 3X3FL 4KKLD 3HE7D 1IFHH 3PGFH 5HPMA 1QO3A 1TFHA 4J7RA 3BW9A 5F8RC 5FHAH 4UAOB 3OHXB 4OV6F 3R0MA 2X89D 1AC6A 2IALA 2V6HA 4K3HA 5E2UH 4C56B 3KYKH 2PYED 3SO3B 5K9OA 4HT1L 5D7JB 3EDDA 4XNQB 3V0VB 3AAZB 5D2NC 1NCNA 3CZFB 5DK0B 1MY5A 1C5DB 4ZUSA 3MRNB 2CLRA 2HFFA 2ORBH 4QNPF 3CSPA 4DOHE 4MJIA 5BV7H 5GIRA 5DQJB 1U42A 5D70H 5CJQL 5HDQL 4YGVB 2YD7A 5GRYA 1I1YA 2EDJA 1CU4H 2FBOJ 4S1RL 4OLXL 4QRPE 5FM5O 4Q9QH 4HT1H 1T0PB 4J1UA 2DLFH 3QHZL 4RGOL 4XPBH 4TQEH 5D1XA 2P46B 4I3RH 1IKFH 4MNHA 3S5LA 3DV6B 3L95A 2FZ3A 2H2PD 4KRPC 5IWLC 1OM3L 4DAGL 2EZ0D 3BJLA 1S7WA 1K8DA 3HE6C 3P9MA 5KSBB 1CDCA 1V3KA 2FWOA 5E8EB 2XFXB 3OGOE 4WJ5A 5EZJB 1AQDB 4I48B 1AE6H 1NFIB 4KKCD 2PO6A 5HI5D 3LH2L 5GGVL 4FS0A 3VH8A 5AD0A 5I1HH 4BZ1H 1CFTA 35C8H 5CZVL 3O0RH 5L0QC 4YR6B 2WIIA 4OLXH 4HXAH 4WHTB 4Q9QL 3FB7B 1VPOL 2NQCA 2R1WB 1Z9SA 2GFBA 1FVEA 3QHZH 2DLFL 3BESR 3DJ9A 3LPFA 5TDPB 3VGAC 5T3ZE 1YDPA 2DS4A 2I9LA 5DSCA 5I17A 3WV0A 1FZJB 4M02A 3S98A 2X4QB 3VFTB 3L5XH 2P44B 5D6CB 4Y0GA 4ONGL 1KCUH 5BJTA 3DTXB 2JKXA 2IANA 5CINL 4Z7QF 3G5YA 1VFMA 5J1AB 4NM4H 3OXRA 4QHMB 2FZ3B 3OB8A 2AW2A 1IAKA 3BIKB 3WLWC 4YZFE 4HH9A 5F96L 1LEIB 1FGVH 2LU7A 4WGWB 1BVLB 1YEJH 1YQVL 3MLWL 2NX5A 4NFBA 4FQQA 1OF2B 3VWKD 4TRPH 4LPTA 3BPNB 1EH9A 4KV5F 1G7QB 2IQ9H 4R8WL 3GB7A 3MUGA 4GXUN 3HRZB 3TYGL 3RNQB 4JHBA 3KPPA 5BOPA 4DW2H 3QCTL 1JZ4A 1H3WM 4JRXE 5IJKA 4XH2A 4R26H 4NNXA 4C54A 5J11C 5TFSH 3MJGX 2I07B 3RVUC 2I9TA 3HPLB 4MNQD 4NNPH 4OLZH 4GBXB 5GGTL 4KTEL 4NC1C 1PY9A 4NZUL 5GRZA 1YEJL 1BM3H 4G6AD 3U4EB 4CU7A 1J88A 4QRUB 4NBXB 3IFLL 2ZKHL 3ULUE 3NVQA 3QXAB 2ZUQC 3DNKA 1Y6KR 1KFAH 5E2VL 5EU7E 2XG5A 1L9NA 3H7BA 3V2AR 3EIFA 4ODHH 3ZKMC 4J3OC 2HAZA 4GBXD 4ZFFA 1BVLA 5BMFH 3LKSA 5CEZE 5JW3L 1G7PB 4MWFB 2B5IB 4QHNA 3OGCA 1Z9LA 1WZ1L 1L0QA 3EYFA 2I5YH 4A6YH 3HPJA 3UTSB 2BSTA 4PP1C 1XF4B 5E99L 5DJ2A 3RTQC 4GUPB 5F70A 3MRJB 3TA3A 2VXSH 1ES0B 3QG6B 3PQYB 4KRNA 2MWCA 4AIZA 3UROR 2D3VA 4HUXA 5IM7B 4HS3B 3IU3B 4MD0B 1AXTL 5A3ID 1REIA 1CLZH 5HDQH 2J4WH 4OI8A 1RK0B 1BFVH 3BEWA 1W8NA 3STLB 1P1ZB 4OZFA 5I1LA 3GHBH 3U4AA 2IFFL 1ORSB 4LIQE 4J3XA 4NSKB 4JFXA 4ZFGL 2KQNA 1OAUL 2EO9A 4JFDA 4DKEL 2CR3A 1I7RB 4P46C 2HKFL 2DQHL 5D5MF 1CFBA 5IOPA 3SPVA 4G6MH 1OTUC 4HWEL 4BH7A 3RL2B 4M03A 1RUKH 4OD2B 1K3ZA 2BDNL 5L6YH 3TT3H 2AV1B 1OSZA 1XT5A 1PEWA 4OBRA 1NBZB 4Z78A 4AT6B 1FL3B 4LSRL 3IDNA 3KPNA 3VWKB 5C6PB 3FCTA 3ZDZF 1VPOH 3KXFA 4JQIL 2XI9A 3CFJA 3QDMA 2EE3A 3O8XD 1FFOA 5DJ8A 1S9WA 1X7QB 4HWEH 2QSTA 3UTPD 4OCLC 4LVOC 3ZKSD 1FV1A 4UOW1 3D9AL 4OM0L 1HH9B 2IFGA 2OJZH 4YO0B 3QDGB 5ILTH 2CDGA 1EFXB 4M7LH 5KZCB 1BIIA 4NCC1 5T1LA 1ITCA 4YC2C 4DWHA 5K93A 1I3VA 4ZUVB 5JDJA 4NN5B 3QWRD 4EKXA 5ANME 5KVFH 4MYWB 1MELA 1MH5B 1QQDA 3MYZA 2Z92A 4NQDE 4M48L 1EHLL 1QVOA 2BFVL 3KG5A 4MB5A 3CFIC 4DQOH 2GYSA 4XPAL 5IJVA 3Q3GB 4OKDA 5D2LA 3SBWA 4HMCA 1FZJA 3BJ91 3GBNL 3IAPA 2VLKD 3IFNL 1IGTA 5FV2A 4X6EB 4M62L 1ORQA 3ARZA 1B0GA 1IAIL 3MSPA 4UDTB 5KS9F 3S5LG 5DJAB 4LVNB 1BM3L 1VFBA 2VABB 3BKYH 1RZ8B 4RQQB 3CMOL 2BNRB 3UBXG 3DVFA 1YMHB 1JYWA 5FOBA 4WHCA 3BQUA 4IRSA 3HE6A 3H2WA 5BXFB 1SY6L 4NIKB 3AXLA 2CQVA 3GRWL 5TGBB 5EZLA 4LCWE 4FQJL 5CEZL 5J12B 2D9QB 4PV9B 3TF7C 3LEYL 3VD7A 4ZXBA 1WZ1H 3QDJD 1G7IA 3EYUL 2BNRD 4D8PA 4OT1H 4DKFH 4HLJA 3MA7A 1JGEB 3GSRB 5D8JL 2EXYD 3B4NA 1FLTX 2AXJA 4YK4C 4UILH 5I76B 2KDGA 3ME0A 1L6XA 1J8HD 3T4YB 2YXMA 3GHEH 3VCLA 5GGVY 1L0YA 1KB9J 3QZWG 1UVQB 3PNWB 4MZ2A 3BIBX 2VLKB 2ZSWA 5MEPA 3HC0A 1NMBH 1IL1A 4X0KA 5IW3A 1FO0L 4Y4KC 4LLVA 3LKRB 2KZWA 1N59B 1AGBA 3HA0A 1OP5H 1MCQA 2NX5E 4P59H 3SKOB 5ENWB 3M1BA 2VR5A 3RQ3A 1QLRA 3KAAA 3L5HA 1I1RA 3V8OA 4PJCF 3VFWA 3TPUB 3W81A 4ZUTB 3SKJL 2IG2L 3BDYL 3BXNB 4TUOA 4XMKH 4HUNB 1RZJC 3GBLA 1HKLH 3CC5A 5GRJL 2MQ3A 1J0KA 1I7TA 4HWZA 2NY4C 2GFBB 2NY7H 3MJ8A 3L3DB 5BO1L 3KPTA 3B3IB 1ZS8A 2F5AH 2YD2A 5F1IA 5D7IE 3GBMH 1TVDA 5D2NA 5TE4H 3CH8A 1ZA6A 1NCBL 5IHZB 4PJGA 4W4OC 4EXKA 1UC6A 1HILB 2DM4A 3LKRA 3I3EA 3GMMB 5T3XH 4N0UE 3CZJA 4J8RB 4OFPA 4YBLC 4N0YL 5EBLA 3MR9B 1IMHC 3DMMB 5E00B 3GSUA 1IGCL 2WP3O 2YPLA 4KJYA 2O26U 3LSOB 2ERJC 2APVA 1K3IA 4NQCE 5IESL 2NY6B 1S78C 4PJEA 3EJYC 5BJTB 4Y4HC 2ZNXA 4W81A 1EDQA 3QUZB 3D25A 4LSUL 3TBWA 4S1QL 3OKMB 1KJ3H 3HNSH 4NJ9H 5CD5C 1ZLUH 1KN4H 3TVMA 2ZNWA 3NIGE 5GSRA 1KB5H 4YDVA 5HYSG 4OJFH 4FQCH 3I6LD 4YHKH 1CK0H 1WAAA 4LLUB 3D3VA 4MA3A 5K9JH 3FFCD 4S0SD 2QLVB 5CWSB 4MD5B 5E7BA 5IESH 5IGXL 3WIIL 1YY8A 4KQ4L 3UTOA 3S36L 4K3JH 5C0BE 2UVFA 4XC3H 1E4KA 3KGRA 2QV2A 4KAQL 3N1PC 1HKFA 1QSEE 1I1AD 3I6GB 2BMKB 2BNQD 4NRYA 4QWWD 1G7HA 3WCYA 3O4LA 1OTSD 4HKXB 3UJJL 4G43B 4DK6A 3C5ZB 4XCEB 1A6WL 2VL5A 1QVOB 3RIAK 1U8PB 3GJFH 1OT1A 5D7IB 1EMTH 4HUWB 2DMBA 3TBVA 2Q3AA 3JTTB 2P24A 3QUMB 5CMAA 2V2TA 4S1SH 4MCYA 1U6AH 3P30L 4G8GB 4MQXC 2P42B 1GL4B 5JZ7C 4NT6A 3QIWC 3W2DL 1J0IA 3ESVF 1Y6NR 4LHUG 1DQLH 3Q6FA 1XH3A 3GKWH 3A6BH 2PXYC 2VJXA 3REWB 4M1GH 4CMMA 3L5IA 3MNZA 3U7AA 5CBAB 1J87A 2A6IB 4WU7B 1GJIA 3S35H 3T1WA 1JGLL 1SYSA 5HYIA 3MA9H 3OXSA 4S1SL 1ORSA 3C6SA 4YGAB 5JHLL 3SGKC 1MJ8H 2VLMD 3GDBA 3DGGB 2XIDA 4PJEF 2R2EA 5GGTA 3F7YA 3DGCR 1D5BB 1IAOA 4XVJH 5EO0B 2VR4A 3KJ4C 3VFGL 5HYJD 4LCCC 5E8DH 4EXPX 4O2FA 4EQ2A 2NY7L 3HI5H 1Z9MA 5HGDB 3PWVB 4IMLA 1DN0A 4KPHH 5HGGS 1J8HA 3NTCL 1CLOH 1T0MA 1IEAB 1A7PH 1LP9E 2GITB 5C08E 3FCTB 1AQKL 4JKPL 2J88H 4PR5B 3THMH 2X89A 5T1MA 4LCCA 4NFCA 4KROC 5I1LB 2X70A 3O41B 1IM3A 2OSLB 3KLAA 3HPLA 1YN7B 1BBJB 5CD3A 5I8OL 4NZUH 3SE4A 4KK8C 4OSUH 1S7XB 3MV7D 3WEXB 2CH8A 4YHLH 5IEKA 4ZTOH 5E70A 1LEKB 2YMXH 4L4TA 3PQYD 3LPWA 5FYJH 1I7TB 2RR3A 2VZVA 1UCTA 3T2OA 2CPCA 4KTDL 2DMKA 4ZFFB 4XVSH 4JJHA 3IRPX 5EORL 1KJVB 5CGYD 3CXHJ 4O2EB 3EJJX 1UB5A 3MJ9A 3SEPA 5DR5L 2R56L 1KXVC 2H8PA 2CLZA 2VDLH 1K4DA 4LHUA 5JLZB 4L8SA 4YJZL 5BQ7A 2WIMA 4PR5A 4GXVL 1JPTL 5MERB 2XXMB 3ZKND 1F4WH 1EEYA 3IU4L 4MLIA 5GQBA 1VFBB 2VABA 3QIBD 3LSOA 1KJ2H 4E0RA 4G5ZH 3D0LA 1GGTA 4YHPA 4Z0XA 5I30H 4FQIL 3WEXA 1BBDL 1FCCA 2Y36H 3CDFA 4ODWB 4LLDB 3REVB 1E4KC 1J18A 3LOWA 2CUHA 2WNGA 3QDGA 3Q5YA 4NHCH 1QBML 2Y06H 1Q1JH 4OQTA 3BZEB 2VR9A 2QHRL 3G04B 2O5XL 1XR9A 3MA7B 5TF1H 4FZEL 4GXVH 1PFCA 1F8TH 1VESA 1IJ9A 2A6DA 3OKNB 4PJIF 2VH5L 3IVKB 4OIAA 1YYLH 4NN7C 4XNMB 3VH8B 5JO5A 2DM3A 5CSZB 5E6ZA 3QO0A 3RY5A 5I30L 3CFEB 4YR6A 1QRKA 2GSGA 3HC0B 3N1GC 1ZXQA 3HG1A 1FGNH 4NQCD 3OTTA 5F7EH 1QBAA 3A6BL 3OAYK 1AKJA 4JFOB 3DXAD 4ONFL 2Y06L 5EUOA 1A02N 1T7YA 5EU4B 4IRJD 4WWKC 4ZAKD 1PLGL 1HHKB 1XCQA 4G9FD 4FMFA 3ARDC 3NFPB 5DWUH 1N59A 3KYOA 5AG8A 4Q2ZA 2L0DA 2OJZL 2A38A 4JN1H 4M7LL 5DUBB 3MJ9L 8FABB 3H9SB 5HYSA 3IDIA 2D7TL 3TJEH 1JNHB 5F7EL 7FABH 2GIYA 3QCVH 5I16A 1F90L 2HFFB 4NOFA 2Z93B 2DQJH 1DFBH 3P11H 4WFED 5MHSD 4XC1H 1CR9L 4K9EC 4NO3A 5AUMB 4P2RD 4K8RD 5T1LD 4QRQA 4XMPH 4UOW0 1BOGA 2FGWH 1FNEB 2F15A 2NY0B 5IMKB 1AQKH 4JKPH 3U9PH 3MRCA 4DN3H 4M62H 4K55A 2HFGH 2FD6H 1T66C 3GO1L 3ZL4L 3BH8A 1IGYB 2D7TH 2XQBH 3BEVB 2Z8VC 4M6OL 3LS4H 2HYMA 4PJIB 1U3HD 1X5AA 3RI5F 1ZLVH 2WK2A 3T2PA 2W91A 1A2YB 3UTPE 2F53A 3BP6A 4Y2DD 5D2LF 1TNNA 1EHXA 4NO0A 3FO0L 1JHTA 3VXOA 4PJIE 3UAJC 4R4FL 3VH8G 4P5MA 5FDWA 2NY5C 3VFVB 3HR5A 2VYRE 1U3HB 5FYKU 3OZ9H 2D0HA 3RWGA 2O5ZL 3N50A 1MJ7L 2WZPD 1B6UA 4S11A 1N2RA 4HGKC 3P4NB 1RK1A 4QXWA 1FFNB 3WFCL 3FFCB 1JK8B 4JM2B 1AHWB 4U1NA 3QISA 5H37H 2D7OA 5SWSD 1P2CA 4NRZA 4RRPA 1P1ZA 4OZFB 1VSCA 4ZS7L 1ZSDB 1FFQA 1OP9A 1RJZB 4MHHG 4ZNEE 5BZDA 1RURH 4QOKB 3IDMA 1T6WA 5CZKA 1U41A 3WDIA 3WNPA 2HT2D 2R2BA 3NA9H 4K3EL 4XHQA 2DQIL 4HJGB 2YPVH 4M1CC 3ARFD 4PRBB 3X13A 1WJ3A 4MHHI 3MV01 1HSAB 3MRIB 1HZHH 4QHUA 3CXDH 2HT3D 3NFNA 2UWEA 4PD4J 3F6IA 5SWQB 2EEBA 1J12A 3BFOA 2C1PA 1OD7A 5DMJB 1FH5H 2PYFB 2J6EA 4LLQB 2DQUH 1T6VN 5DMIH 2AABH 1BQLL 2VN7A 4Z78B 1E6OL 1ROWA 1AGDA 1X3DA 4F9LC 4Z0BH 1DLFL 2CMRH 3E6HA 3TT1L 2GW5A 4XP5L 1OW0A 3O6FC 5FM5M 1YY8B 1HNGA 3FT4B 1YNLH 4DTGH 1OTUD 3OKYA 1I3RB 4FP8L 1MLBA 5C0CB 3T09A 2C9AA 4Z77B 1NUGA 4WFFD 2XNAA 3EO1A 4JM2F 4OGAD 4K7PH 4LGPB 4OIIH 5EBLB 5DMGC 4OLYH 1NAKH 4AL8L 2P43B 2P47B 3WKNA 3D3VE 4TYUA 2NLJA 4U6TA 2UWEB 3FQRA 4PGBA 4JZJC 3CVHA 2HP4A 3WXWH 2W9DL 5H35A 1CXEA 1XGQA 3MOAL 3T77A 5HVFB 2BERA 4S1QH 1LO2H 4LU5H 5EZOH 3CVHH 5JW5B 2DL2A 1PYWA 5FUZL 1FFPA 4X4MA 4GQ9L 1TZGH 1CR9H 4O2FB 2Q8BL 5F44A 1OPGH 1HDMB 3UTZA 1D3CA 1S9VB 2H3NB 3EO0B 1EZVY 4Z7UF 4KRPB 3WE6B 5IF0B 1GVIA 4K3DH 4LVEA 4PJ7E 2VLRB 4L5FH 4WI4A 4ZFOL 4FG6D 3VFSA 4K3JL 2P5WA 5JXED 4FFZL 2CDFA 3V0WL 2H2PC 3V9FA 4WU7A 4RMSA 1MFAH 4G8GD 2XZAL 3VXUA 4YXHH 5F3HA 5GGUA 4YXLL 3RWHA 1TZGL 4KDTC 4OKVB 1JL8A 5ACLA 5F1NB 4JZNB 1A6WH 4GS7C 1DANT 3V5HA 3HUJF 5DVLA 5CGTA 1CFSB 3Q2CA 4AT6A 2FH6A 4ALAH 5DJDA 3DO7B 3R1GL 3V6OE 1YPZE 5JZ7D 4LHUB 3BX7C 2FDBP 3QPXL 2BOBA 1UA6H 4JRYB 1IGFL 4JR9H 1JGEA 3GSRA 4Q6IB 1CI5A 2O61A 1JPSL 5CMAB 1A9EA 2EKSB 1I9RL 5GRWA 3WE6A 5IW6B 3HNVH 4LCWB 3EYSL 1FN4B 4O5LL 1J8HE 2W60A 3EJZD 1CGSL 2NXZD 5E6IC 1MHPL 4XNUH 5IQ7H 1T03H 4Q97A 1IEAA 3UCRA 5DVKA 1DQLL 3KPMA 3TZVD 2BK8A 1N0XL 4K71C 2F58H 2VDPL 3ARVA 2MFNA 4YK4B 3RGVA 3UX9B 1WFUA 4U1GC 4KZEL 3ZDYF 3ZE0E 1IAIM 1YN7A 3M1BB 5JIKA 1S7XA 2XTLA 4L8DB 4XTRD 4YHML 5IEKB 3PDOA 1MWAB 1QYGL 4XHJC 2W65B 4FQHB 4P4KB 5L2KA 5IMMB 5C07E 4HAGA 4IBLT 4WO4B 3ALWA 5E4EB 4M7KH 1A1MB 1CXLA 1ZT1B 1NC2A 4XNYH 4XVJL 5JW4M 3VFGH 5FO9A 4AQ1B 1QFWH 3SDAC 4X6BA 2FIKB 3MGAA 4M93B 2QSQA 5ITBL 1HXMB 1N7ML 2A73B 1UH4A 3MLVL 5EUOE 5GS2H 2DQDL 4G6FD 5BZDB 1F3JA 1QYGH 4YHNA 1A21A 1GCFA 4XX1E 3SCMB 5KAQF 1M05A 3MLWH 1RJYA 5DZOA 3ULUH 3JWOC 5C0FB 4QXGH 3X13B 1EEZB 2EDNA 5HVGB 2HWZH 4MD4A 1RJLB 3SDYL 1A6AA 4PJ9D 1QFWL 4JGJA 5LGJA 3JV6B 5I1KH 3AGVA 5C3TA 3R8BB 1I9JH 25C8H 4W4OA 2K7QA 1WFNA 1AI1H 4AY0A 3K4DA 4P2OB 1QFUL 3E2HC 3WUZA 3NGBC 3NZ8A 1JNHA 1T4KB 1KGCE 2HTLC 1U2CA 3VWKC 4KVNL 2BCKB 2VLJE 3MV7A 1UCBL 1BFSA 5H2BB 2VIRB 2QQNL 1JMXA 4MNGE 4N9OB 3U4BH 4XAWL 4ZUUA 4ODHL 4TSBH 1R3LA 1P7KB 4IDJL 2Y07L 5EC2B 4M4PA 1UB6A 5JW3H 1I1FA 3PGCA 3RTQA 4GG6A 4BKLB 3V0WH 3IJSB 4RGOH 4NRYB 5F88B 3RVXD 3TGXA 2WQRA 3I3DA 1PKQB 2E7BA 5EC1B 2J2ZA 2IF7A 4U1IA 3GK8H 3VG9C 4YHOH 3QJFA 4HPYH 4NUGL 2PW1B 3O11A 3SGDH 4GSDH 4G8EB 1AE6L 3AS0A 1RIVL 1BFOB 3TBVB 3F58L 1UA6L 2E7LC 35C8L 3T0ED 1FSKC 3GMRB 1B0RA 2DMCA 3IDJA 1LK3H 3MRQB 4RAUA 2JCCB 4J3TA 4X6CE 5LAXB 2J7LA 1NCDL 1QRNE 3EJYD 2M1KA 1CGSH 5D4QA 3M45A 3U4EA 4HS8H 1NCUA 4HLZG 4HHAA 4PBXA 2OZ4L 5LBSL 2E7LA 2NY1C 2ZOLB 2FJGA 4M7LT 1MAJA 2ZPKH 4FFYH 4PJEB 4XAKE 1QNZH 4NJAH 1YEHH 3BMWA 3DI2B 1ACYL 2CKBL 5IB5B 3F58H 1BEYH 4PJ5D 4EN3A 4X9FA 1LK3L 3TBTA 1VEPA 3KYOB 5DYOA 2E9JA 3FB8A 4JN1L 3NACL 2IQAB 3VW3L 2NY0D 4ODBD 2X4PB 4PRAB 5KG9B 3N85H 2FL5B 4GRMA 3NN8B 1A9EB 4MXQD 1MFBL 4ZXBC 4RAVB 2JK5B 2W07A 1WBXB 1QA9A 1LE9B 4XCCH 3WMSA 5LXGL 3AMLA 3TO4A 3LY6A 3P11L 1I1CA 3M8OL 1CDBA 5F7DB 5SWZB 4ODSL 4ORGB 5I1HL 2ZG2A 3TCLB 3P9LA 2OL3A 3O0RL 1BJ1J 5AG9A 5BVPL 1DZBA 3DPBA 3ESUF 4Y88A 5DHVA 3HI6H 4OZHE 3EO1B 1JYXA 4AENB 4EDWL 2IAND 4P0DA 4F7PA 3GMOB 3NCJH 5DQDH 1LO3H 4XNZC 2Z31B 3OWEA 1NGQH 2QBWA 4HKJB 2D0FA 1NC4B 4L3CB 4UDUB 5E9DB 4FZ8L 5GGRB 1DTUA 2R4SH 5EOCH 4NZRH 2UZXB 3GSWB 5A16A 2BVOB 3M17B 3MCKB 1G7MA 3U0WH 4X9HA 4HDIB 1TZHB 3JTTA 3O4OC 5LCVL 3I50H 4KKCC 5F3BB 5E99H 3HI6L 5HDLA 3S96A 3QXTA 4P23D 1N4XL 1YEKH 3VWJB 4K94L 2CO6B 1URLA 3LQAH 1LO3L 4ZNEA 1DE4A 4QRRB 4PJFE 4OLEA 4JFHE 2P8PB 1K4DB 1DQML 3QUXB 5A2JH 1WWAX 5FV1L 2F8VA 4YH6A 3KNBA 2C3XA 3OJDA 1B4JH 1Y6MR 5ERWA 5F7WC 2E27H 2NZ9C 3INUL 3LEYH 2IH3B 1RJLA 5MI0C 1A5FL 3U6RA 5GGRA 2FEDC 3RL1B 2B7DT 5EBMB 1CDHA 2OL3H 1FZMA 4LGRB 1A7QL 1T21A 2NNAB 4KTEH 3CDCA 3V5HB 4MJID 4K94H 5DQ9B 5CKGA 4JKWA 1AGCB 4OTXL 2MKWA 5J13B 1PY4A 3GMQB 1MCDA 2GHWB 1H3TA 1DUZB 4PJ7F 3OF6A 3MX0A 3QBTB 2BCKA 3MV7B 3WIHA 4OD3L 4HGWB 4OZ4A 1MIEH 2D7QA 4Y5XC 2B4CL 4WTZG 1P84J 1EAPB 3INUH 1HK6A 3C9NB 4WHYG 1T0MB 1MIMH 1ONQA 1BWMA 4H26B 1DCLA 3HAEH 5DEGB 1PG7W 3HZKA 4GS7B 4XP1H 4RQQA 4J3UA 2ITCA 3VRIB 2VZOA 3ZYJA 4D3CL 3EYOB 2XOTA 2DBLH 1FC2D 1Z5LB 4IRZH 4YDJA 5E2TH 3AREA 5EU4A 3PV6B 4D2NA 1OGTB 3PWPB 5JOPE 3RNKA 1BF8A 5I1DB 5F71A 4XHJD 4P5TC 2FH8A 3QUYB 5D7LA 4FFWD 1HH9A 4JM4H 3UTQA 4YEFA 1JJUA 4MA1B 1G6VK 1QSEB 2BVQB 1YNKL 3MRDA 3CIQA 5EUOF 1CLYH 1U2HA 3O9WC 4OKVA 3WN5B 4BH7B 3C60D 2I25N 4M8VA 3LRSB 3EFFA 2NYYC 4X98A 5E6ID 5F9WC 5T3XL 3DX7A 2BDNH 5L6YL 1MREH 3EO9H 4B7LA 4LF3A 4OGZA 2BY1A 3GBNH 4KTYA 3BISA 3IFNH 2IH1A 5CEXB 5C0BD 2LU3A 1HEZA 1AGBB 1HQRB 1ZHKB 2RCSL 3CDGA 3T0XA 2BRRL 1AGEA 1ZGLP 3F62A 1BGXL 1OGTA 3PWPA 3V4VL 2NXYB 5ID1B 2EIZB 2EDEA 4UZGA 1WIOA 1WGOA 4PJIA 4ONHB 3SJVB 4FZ8H 1GPOL 2R4SL 4KVCH 4MXVE 2GSIA 2EYSA 4OB5L 4FQJH 3D9AH 5DRWB 5CEZH 3GI9L 2OMNA 3UBXA 2HMID 3IDXL 3WDHA 4LNRB 1WZMA 4HIIB 4XCFL 1IM9B 1IGMH 4ETQA 4PRIE 1JI2A 3O3UN 5JMRA 1UGNA 5L7XL 3UYOD 5I19L 3BZFA 4GH7B 5GJTL 3DO7A 3BP5B 5CJOH 1EA9C 3VCLB 4P3CL 2JJWA 2OI9C 1R0AL 1BD2B 2PYEA 4PRHD 4F7PB 2EYRA 2YPLB 32C2A 1JZ5A 1HYSD 3S34H 3MLRH 1N0LA 1FN4A 4IDLA 1MLCB 3FKUS 3QI9D 3IDXH 4X5WB 2MNUA 2BVOA 4Y4FB 2DLGA 5IHUH 5GS2D 2D9CA 4HKBB 2CRZA 2R1YA 3PHOB 5B8CB 5C0EA 2EC8A 5DD3L 4EDXA 5BS0D 5FOBB 5ID0A 2XFXA 1Q0YH 1DEDA 4JFEE 3LRHA 3QUZD 5GRJH 1LGVA 4I4WB 3BXNA 4O4YH 2EDWA 4TUOB 2Z93A 4QOKE 2Y7QA 1GGCL 3WUWG 3X14A 5MENA 3OB0H 4EIGB 5MEOA 2VDKH 4K3GA 1OHQA 2GJ6E 4JVUA 4OT1L 1KTDA 2X4SB 4Y2OA 4F33B 2ZOLA 3RDTC 1NAMH 2IH3A 4Z7WE 1A1NB 1SVZA 4R26L 3OKOB 5DD3H 4PGDB 1U8MA 2W38A 2AQ3A 3BUTA 4U1MA 3WNKA 3QUML 1KIUA 1RUMH 2WBJD 5MEPB 5DRZB 4YEEA 3IB4A 5C0CA 1PG7L 4JHWH 1AGCA 5JDSB 3QNXB 3V52L 5GGSA 1CT8A 1FO0H 3P4MB 2ZKHH 4MAYA 2W0LA 1H3XA 5EZJA 4QTHA 4PJHB 5A43C 5FDWB 3MV7E 4P59L 4XNQA 1TETH 1RZIB 5JHDB 3MRPB 3HFMH 1OP3K 2XKNB 2HT4C 5LGHL 2A0LD 3A0OA 3O2DA 1RUAH 1FZKB 1CK0L 1Q72L 3DURB 5ESQA 3NA4A 1M7DA 1Z0NA 3QUMH 4KRPD 1YA5A 1ZT4A 2AAVA 1JK8A 1MRDH 4JHWL 3VG0L 3BPCB 4LBEB 1KYOJ 4F37K 2VDRL 1C12A 3WFZA 3MMEB 2YMXL 2FYYA 1RUQL 1QSZA 2YPLD 3X11B 4ZPTA 1HN1A 1QSFE 2OL3B 1GGBL 2OZ4A 1S3KL 1PSKL 4G6JH 5ITFB 2BVEA 2ICWB 1NKOA 1G7MB 3BAEH 4NN6C 3ZHKA 1MHHA 3KPOA 4QHUB 3FT2B 4Y1AD 3DX7B 4UIMB 5GPRA 1N3NB 4HX1B 3O6LL 4DCQB 1DN0B 5D93C 4HUMB 2V9TA 5DA0B 1CDIA 3O11B 3TBWB 2NY2B 2CRYA 1CU4L 5F9WB 1ADQA 2LAGB 5DK0A 1JZ8A 1II4E 4S1RH 4WW2A 4N0UB 2Y36L 4Z5RB 3W5NA 2CLRB 3OBAA 5IFHL 4XCYA 1UXWA 1XF5A 2B39A 1IVLA 3UPAA 1RU9L 4R2GB 5EH1A 5FCSH 2QHRH 4OI9A 2AJXH 4B50A 1NL0L 3VD4A 2VLJD 1H8OA 5DFVD 2AJUH 1JGLH 5IB4B 2X2YA 2IPTH 2AJSL 1ED3A 2AQ2A 3DRQA 2A1WL 4G9FE 3P0VL 4KAQH 5ILTL 4EEEA 1BMGA 1XGYH 2CKBH 4DEPC 5FYLD 5DD1L 3AFLA 3IAGC 1UZ8B 3STZA 3MUY1 1A14H 4M3KB 3C5ZA 4JE4B 2EDFA 1EAPA 2C4FT 3QAZB 1HCVA 3BP5A 1MCWW 3LKPA 1EV2E 1JNNH 4QHKI 5I1JL 3R06B 3S4SB 1F11B 3L1OL 3ETBF 1HHJB 4M1DH 1R3JB 3RGVC 3L5XL 1G1CA 3Q5TA 4RGNB 2LVEA 2VDOL 4XCYB 5EIVA 1NLDL 2FIKA 3GUTA 3CX5J 1D5IH 1WQVT 3RZWA 4MS8D 2LTQB 1NAML 1OWWA 5EIQA 1FLRL 1YEIL 1QZ1A 4GKSA 2DOCA 5E24E 3FRUA 2AGJH 4YHNB 1R5WA 1A6VL 3ZTJG 1XIWA 5I8OH 4PJFF 3BOVA 3FAWA 3H7BB 4JFDE 5F6IC 4JY5L 3NCMA 4JKKA 4M1GL 1NGQL 1DFBL 2MHAA 4YHZL 4JO3L 2NY3B 1T21B 2VZ3A 1S7RB 4K23H 1SEQL 3DARA 4N1CA 3GRWH 5C0IB 5I75B 3HPJB 3UMTA 3UTSA 4XAKD 4LPUA 5C3LD 3ARDB 2NY5H 3VDBA 2ITDB 1YECL 1W0WA 1YN6A 5TFSL 1N8ZB 1OARH 3UJTH 1CD0A 1D9KD 4O2EA 4LCWA 4N0FB 3AM8C 4HUXB 5IM7A 3IU3A 5GJSH 3OKOA 3VXRB 2QL1A 1BWWA 3TC9A 1JWSA 1S5IH 5DT1L 3F7PC 1E28A 3T8XB 3DHJA 1CGUA 1CT8B 3P4MA 4N5EC 1BBDH 2WUBL 2D4FA 3I6KA 3WNMA 1RZ7L 4PJHA 1CFQA 1G7LB 3VXRD 5FGBC 3IS1X 5CIPB 2Q76A 3C2SA 3LQZB 4N9GB 5HXMA 1NPUA 3FL7A 1CCZA 2V7NA 3EYQC 1D6EA 4FXLA 4YHIA 1FJ1B 2IANE 4EOWL 3HZMA 2PXYB 3ZYIA 1YPZA 4KXZH 1IC4H 1FG2A 4YE4H 4IOIA 5TH2A 1D6VL 3E3QE 3OKLB 1Y18B 1AXTH 1FVEB 5D5MA 5H94B 4N0FA 4LKXB 1U8OA 2NPLX 3BKJL 2YK1L 2OBGA 3TIEA 3BSZH 3C6LB 5C1MB 2ZSWB 3BDXA 2IANB 3G5YB 1UWXH 4QLRA 43C9B 4Z7NE 2PTVA 4C4KO 3EYQD 4D0CB 4C56D 3ALXA 2XA8H 4DUVA 4QHKJ 4D3CH 1OSPH 4G6AC 4TNWF 5DUMH 3QH3A 5B8CA 1RZGA 1WZKA 3IU4H 4JLRA 1D6VH 1IGCH 1LEIA 2GK2A 3NPZB 5TE7L 3PWNA 2Q7YB 4X5WA 4P48A 5JORB 4M7JH 1E4XH 1A14L 3IDYB 5EO9B 4IOIB 1NUNB 4NQVA 3ZSSA 4XGZA 2PXYD 1RUPH 3MJ8B 1AQDA 4OGYL 1A7RL 1OP3H 2HVJA 4H5SB 4PRIA 4UU9A 3RTQD 2UVEA 1T3FA 4HZLB 4I4WA 1ZEAL 3QIWD 2YOCA 2GUOA 3EOYG 4PGCB 3ZT6A 3MRFB 1B0GB 1JNJA 5IUSA 3B2VH 4MVBC 1JF6A 3PP3K 5TF0A 4DN3L 2YA0A 4NGHH 1LO4H 1MFCL 3H9SD 2FECL 1M4KA 3RTQB 1NBVH 1EHNA 1WISA 3EYVB 5C0CE 4XC3L 1M6OA 2E8YA 1YMHA 3LKOA 3P3YA 4QRTA 4MAYB 3RBSA 1WTGT 1TTFA 4PJ8C 4RDQG 4XPTL 5HI3D 4PTUB 4GW1A 2E9IA 4HBCL 1EHLH 1DBAL 3PHQB 3H0TA 3S3PA 5IIEB 1IGIL 3MGTA 4XPAH 5T1LB 4U7SA 5ID0B 3F7VB 3RVTC 3WL9B 4HWBA 2HKHL 5DRWA 4RGNE 4LSTH 3JTSB 4LLUA 1S7QB 1UM6L 4EN3C 1ZANH 4MX7B 4ELMB 3UZEA 3ULSA 3QDMD 3WSQH 2DQJL 1IGIH 3MLZL 2ADFH 5D1ZB 1H8SA 1V7MH 4UB0H 2FGWL 3OX8A 3DWTA 3D3VD 3TM6A 1MEXH 3D25B 3BWAA 1INDL 1A3LL 5F6HI 5ADOL 12E8H 1N3NA 4HX1A 1CG9A 3QUMA 1W2KT 3O81A 3EYSH 2Q87A 5C8JA 3FO1B 5HHVL 3D3VB 5GXBB 1W0YT 3JWDH 5CLWA 1N0XH 1CZ8H 5KVMC 1RULL 1OAXL 2AABL 2J8UA 4J3WA 4RCAA 5D1QC 2C4XA 1EX0A 3JV0A 3L6FB 2YN5A 5JW4N 2P5ED 1LE5B 1T1WA 2VDKL 3AB0B 2KH2B 4TPRL 2EXWD 2J5LB 4P2QA 1P84K 3I84A 1UQSB 1IBGH 3QUZC 1I4FA 2MQ0A 1DSFH 5DGRA 4XCEA 2P5EB 3DYOA 5EG6C 1DQJA 4YDJB 4PP2B 1K85A 4JFDB 1AH1A 1KTKE 1NAKL 2H1PH 1BVKB 4R3SA 1BF2A 1VGKB 1KNOB 5F7NC 3LV3B 4NFDA 1KC5L 3KPQB 4M7JL 3QXAA 3VGEA 2AEQL 2PR4L 2AV7B 5IVXF 2WBKA 3CFKA 3CUPA 1AJ7H 5FK9A 1RUPL 4BELD 1LEGB 2ERJB 2W9EH 4BFBD 3HFML 4PPTA 5EZOL 4MAUH 3CVHL 4HWBL 1UEYA 4LRIC 7CGTA 4JFQA 3NBNA 2BSTB 1XF4A 3DECA 3V79C 1FFPB 3SE9L 1JZ6A 4UDTA 1KTLA 2R56H 5KSVB 3E2HB 4NOBA 2CKNA 5F9JA 1PKQE 2DQUL 5DMIL 1IQDB 3NCCB 5HI4C 4CKVX 1HH6A 5IHZA 3O9WA 4LDEB 2QADB 4WI9A 2AKRB 3KYNB 1CIUA 1X5GA 4Y2DC 3DVNB 3LDBC 2AEPH 1KELL 5EU6A 3EZJB 3AC0A 5JXAH 1CWVA 4KJYB 1U8IB 5HGBB 4MA8L 4NWTL 4OZFG 5FGCE 4C56E 5EO1B 3CPLB 4U6YA 1FNAA 1P5VA 4BQBA 1KIRA 5BV7B 4PD4K 5TE6H 4B5EA 3RL2A 4UOJA 2MCG1 4FQXA 4NQTA 5I1IL 5FUOH 4HZLA 4Z7OF 5C0GA 4XB8A 2B8OT 2X1PA 4LKCB 4I0PB 1R24A 4JCMA 4V1DD 1ADQH 5ESVA 1B3JA 1LDSA 2VH5H 1QR4A 3TCXA 4I8DA 2JIXD 2FCBA 2HA1A 1ZHNB 3LS5H 2W0FB 1QOKA 1IGTB 1KELH 5F7UA 4KH2A 3G5ZA 5FYJU 1BOYA 4NQEA 5E94A 3QEGH 4DGIL 1G84A 3B9KA 32C2B 4E41B 5C92A 1MQKH 2VC2L 4NWUL 4LCIH 1H3UA 2IBZY 4HQQH 1FJ1A 4L4TB 1JHLH 3MRRB 5B39B 4HKBA 2YPLE 4UT6L 1J0ZA 5FB8B 4DZBB 4OD2A 5LWYH 1U8QA 3B9KC 1IKFL 3ARGD 4H25B 4U1GB 1YMME 1ZWIB 3JWOL 3KWWB 4I0PC 3BP7B 1XR8B 4ORZC 1GC1H 1KTRL 1ZHNA 1DDHA 1MQKL 5DJDB 5HI5C 1ZLVK 4GAGH 2BNQE 2PETA 2V9QA 4WDIA 3ULVD 1CDJA 2F54A 3PGDB 4FQLH 5HD8D 4H0HB 4R2GC 5FCUH 1IBGL 3C6LA 1UWEL 4X6EA 4KRLB 4RAHA 1FLRH 4N0CC 1Q0XH 2YD4A 5FKPB 3S88H 4PGDA 5F9DC 5F88A 3VI3F 2NY6D 5ICZA 1IEBA 2XQBL 5IQ7L 3JWOH 4M6OH 2JIXA 4YUEH 2X05A 3FRUB 2GSIB 1KULA 5D7JA 4ZFOB 2HVKA 3G6AA 1BPVA 3HNTH 4LVOB 1IC7H 4DN4H 5LGJB 1EGJL 4HIIA 1EO8H 1V7NL 1AI1L 1BVZA 3RWEB 1CLOL 3ZE2E 3BRDA 4KJPC 4MNGB 4P9HC 1VDGA 2X4OB 3HC4H 4OF8A 4JB9L 5DS8A 3HS0A 1YECH 3NZ8B 3NCJL 2YA1A 5D5ME 5DQDL 2OP4H 3BPNC 4H1LB 5DI8A 1T80A 5E5MA 3IDGB 3VXSE 3BP4B 2J6EL 4HHAB 2YRLA 1M7IB 5GS0C 3IRZA 2B2XL 2B0SH 5HGAB 1YEEL 2CIKA 1NCCL 4P3DA 1AY1L 3MMEA 4A2MA 4GRLB 4LARH 2VLKE 1D5XA 3I50L 1EERB 3HRPA 4E41D 2VL5B 2GK0A 2YKLH 3VFUB 2V5YA 4NO0B 1BLNA 4WJ5B 2XTJB 1J1XH 1S7SB 1KJ2B 2WLYA 3VFVA 4G8IA 5DJ0A 1NGXB 1PQZB 1P9MA 4X99B 1IAII 2VB5A 3RY6A 1MJUL 1OGAE 5A2LH 1RPQA 3SDYH 3VFRB 2B0SL 4YE4L 1ND0B 3L3IB 3QSKB 2AXGA 2RBLA 4AEEA 2VZ1A 1U36A 4BZYA 3MRCB 4ZPVB 3WJJA 1PEZA 4CMHC 2LFGA 5EIIA 4U1SB 4ZO8A 4OGAC 4ODTL 5CP3A 2GKIA 1XEDA 1HHKA 3F5WB 1MWAH 4HEPG 3W9EA 1NC4A 4L3CA 5E03A 5E9DA 3PGFL 1YNLL 3SE3A 3B5GA 2G2RA 3S3SA 1KLGA 1TMCB 3O4LD 3LQMA 1UEMA 5ESAB 5I0DA 8FABA 2APBA 4YPGB 3OAZK 3RPKA 5K33A 3ZE2F 5F3BA 1LMKA 4ZFGH 1WEJL 1W0VA 4FA8A 3N06B 2Y5TA 2C7UA 3MNVA 1LP9B 1KBGH 2GTWB 3SGJC 5D96B 1I85A 2HT3C 5CJ8A 4DGVL 1TDQA 3K1KC 4QRPB 3PL6B 5KW9H 4Z95H 3UC0L 4OFDA 4O51B 1UJTA 1ZT4B 2WINB 4H0GA 1T0NA 1CICC 3VXQA 2R29L 3D0VA 2FIRT 4XP9L 1OL0A 1T7ZA 1YEGH 4QRRD 4XVTL 5EU6E 1QKZH 2XKUA 4NKMA 3QQ4A 4C58B 3B2VL 3NIFE 1I85C 5EZIL 3LMJH 5CCKL 4F9PC 1M71B 2Z4QA 1G1YA 4MJIE 1HIML 2ED9A 5ESAA 2ATPA 4UT9L 5JQ6H 4F7CA 5GZOD 1ERNA 4ZSOE 4HKZA 2OZ4H 1WFOA 4ZOBA 3DOSA 4PJ7A 4QY8B 4QWWC 3O4LB 4I9WD 3N0PB 4WUUE 3RDTD 1KJVA 1UH2A 3IDYC 3CCHB 3SOBL 3EHBC 1KNOA 4DKAA 1P4BH 1X6LA 3FHQA 3TBTB 4BSVB 1J8KA 4JFZL 1FCGA 2D03L 4XP4L 4H1LH 5DJCB 5DYOB 5TJWK 5I71B 5FGCB 2R0ZH 4WUUA 3VD3A 1HDMA 4RISL 3PGDA 1NFIA 1EEYB 4D9RE 3TA3D 3T0EB 4KGLA 3QIBB 5E8PB 2YZ1A 4DQOL 2X4RB 1QFWM 2W0PA 2QHLA 4R7DB 4KVCL 6FABL 3G9VA 1X5IA 5GZOC 5DMYA 4AM0B 5JUEL 3JUZA 5GS3A 3FO0H 3KPLB 5L9DH 1WCBB 5B4MD 4EI5D 4AEHH 1IGML 5IVXE 4QF1B 4H8WC 5CSGA 4TNVK 3T0WA 5I19H 3X3GL 1SYSB 1E6JH 2BY3A 5D7JD 1F4XL 4LHJB 1XGQB 5D9SA 2VXQH 3EFFB 1G7JA 1CFSA 5IVXA 4RIRA 4JRWA 3QO0B 2A6JA 2UYLA 5ANMA 3CPLA 4U6YB 2XWTB 5FK9B 2DB8A 4PRNB 4M7KL 4HIEA 1XGUA 4N8VB 1LILA 3TFKC 1MAMH 2WV3A 4NQCB 1MSPA 1U8OB 2F5BL 4NQSA 3SCMC 4PJAA 3WIFA 3ZDXF 3I75A 1BD2E 3ARDD 4I3SH 4LRIA 1MHCA 3Q0HA 3P4NA 1GIGL 3ABZA 1Q94A 3AUVA 3TYFB 1I8MA 4QTIL 5DK3A 5GGUB 4X4XB 1A7NL 3RVVD 4K94C 1KPVB 2CLVA 2E27L 2PCPB 3AREC 2P5EA 3RWIB 2NX5D 2W92A 4C56A 4JHAH 3TBYB 1N6VA 1UXSA 4P5TB 4HIEB 2AV7A 3QFJD 3QPQD 3CFKB 4CU6A 3DUSB 4QHLA 4H0IA 5J3HC 2W9EL 5MI0B 4Z8FH 2EYRB 4JCLA 3DX8B 3MRNA 4OCSH 4ZYKA 2GI7A 3PXHA 2A9ML 5IG7B 5JHDD 2D7PA 4OFIA 4O2CB 1MHCB 3CMGA 2J1KA 4JFQB 4JZJB 1DQQB 2QQNH 4JY4B 5F6IB 3P73A 3RP1A 5CCKH 4IS6B 3QUXD 1BIHA 1TPXC 3ARED 4XPGL 2DYPD 2WWKO 3RWCA 4EBQH 4HK3J 1T2QH 2IWGA 3WXWL 5D1XB 3TO4D 3BKMH 2AXHA 1JP5A 2X4OA 4NHUB 2YPKB 1MRDL 3MJ7B 5CP3H 5KSAD 4LP5A 3S36X 1R5IA 4MQXD 4HCRH 1CE1H 4K3DL 1AP2B 2APTA 1CL7I 4LQFL 4WCYL 2FBJH 2ATKB 3QEHA 2DQCH 1CVSC 2E7CA 4NC0B 2PF6A 1TJGL 4NRZB 1UM5H 4JY4A 4CVWA 4EZMA 1F00I 1JPST 2NYYD 5JOPD 2J12B 3LN4A 2V7HA 3BKML 3HG1B 3C60C 3EOTH 4QNPE 2LV4A 2BNUA 2R1XA 2NY2D 2DLEA 4HS8L 4LQ1A 1X5HA 1X7QA 2ADGA 3DUHA 4ELKA 3G5ZB 5IKCB 3ARGB 2MTPA 4UQ2A 3JV6A 3UZQA 1A7OL 4PRID 2ENSA 1HWHB 4G8FA 5DMGD 3QRFM 4FQHA 3WHXB 3CCHA 2XKNA 3V0AC 1WBZB 1WVZA 2WWMD 3RRQA 1EFXA 4ZFOA 3BZEA 3K80A 4O02L 1A8JH 1JHTB 1QSED 3VXOB 3ULUC 5I66A 4XPFH 3ARBD 1NQBA 3LHPL 2FO1A 3H9SA 2DBJA 2HTKD 3DUUB 3VW3H 1CFNA 4U3CA 4KKBC 2OR9L 4HC1A 4HUKB 4P46B 4B41A 2EDLA 1OP5K 3VMPA 2F5BH 3GNML 1AD9A 3HRZA 3GMMA 4JPIB 2ICEA 3BI9X 3MFFB 2VUYA 2WUCL 4I3SL 1X5YA 1MCPL 1T7WA 2ADIA 1AR1D 2FEEI 4G6KH 3EYVA 4HJJL 4O00A 4JRYD 1AKJB 5CGMA 1HQ4B 3BHBA 1OAZL 2APFA 3TNNA 5F9OL 2AEWA 5IWLA 5GS0D 3MBEB 3TO4C 4OF7A 2G5BA 3SKUD 4GG6F 3W0WA 2BY0A 3VXUD 4AIXA 3ARSA 4RIRB 1VACB 4DCQA 2DTSA 3Q1SH 4P9HL 1N6UA 1TETL 5DFWH 1J5OH 4CNIA 3C5ZD 4S10A 2E9BA 5HYSB 3D48R 1XGRA 3MNWB 2JJUA 1K8DB 3P9MB 4DW2L 3OGCB 4AK1A 3ES6B 4RAVA 5KJRL 5KN5A 1FNLA 2PYFA 3ZO0A 1QR1B 3ZHLA 5IF0A 3RX7A 2YWZA 4OCSL 2EH8L 4X7SH 1IE5A 3WJLC 5HHPB 3QG6A 1FORH 4XX1G 1M71A 1NBYA 2X40A 1NGPL 2X9WA 1MOEA 2VLRD 5LG1A 3GSNA 1Q9WB 3BN3B 3HCVA 4JO3H 4OLWL 4WENB 5C0AE 2FX7L 4JFFB 5D1QA 3O6FA 5D6CA 4C55A 1FYTB 5HGHA 4EBQL 3RWHB 3BWAB 2IC2A 1PKQA 5J1AA 3PV7A 3RVVC 3QJFB 5EU6B 1NEZA 2NXYC 3VDCA 1TZHA 4Y4FD 3VFUA 2JB6A 3PWUB 5E1AA 1OCWL 4JRYA 1FORL 1LP9A 2JK5A 4HJGA 4PRBA 4JDZB 1HSAA 2QEJA 3T0EA 2J4WL 5I15L 3DMMD 5FYJL 5INDA 1R24B 2Z0BA 3AVEA 4OD3H 4LCWD 2FBJL 3QZWB 1ZGLM 4O58L 4V1DE 2R8SH 3KPPB 5HVHC 3V4PL 3VRJA 4UINL 2B1HL 4PBWD 5FA3A 5K9KB 3U9UA 5FKAA 4TOYL 3ZKQD 4XP1L 3R0NA 1DBKL 5D2NE 1DBBL 2WWKT 4X7CC 8CGTA 4Y5VA 2QR0B 1CD1B 3F5WA 5E2TL 1I1FB 3PGCB 2PTTB 4HXBL 2DWDA 4GW4A 1RIUH 3B9EA 1WWCA 3DETC 5BMFL 5EOCJ 4G6JL 5CZXC 4D94A 4K2UL 3GMNB 1JUFB 3MRIA 4TUJA 5D2LE 4WI2A 2VKWA 3BKCH 4NT6B 2OR9H 1U8NA 2E5EA 3LKPB 5TF1L 1WICA 4MJ2A 4X8XA 3KNBB 2E3VA 3FTGB 3TJHC 4QRPA 3MLYH 3T4AB 2VQUA 3VD5A 3REWA 1BQHG 2RQ8A 4HAFA 2ZUYA 4K7PX 3G6DH 3N1MC 3X12A 3CFBB 2VLJA 3ULVE 1BEYL 3SKNB 5KS9A 4CN6A 1V05A 2NMSA 1F3RB 1EPFA 1NFDB 5CIPH 5JR1H 5KVFL 4WWKB 3KPLA 2H2SC 4JFPB 1EBAA 4NKDB 1I8IB 2XXCB 3LVEA 2QQKL 4UT9H 4U6HB 1DUZA 1EO7A 4LAJH 5JXEC 4HK0A 1IAOB 1MWAA 4RGND 3K74B 3T0AA 4YAQA 3D87B 1FE8L 2HJKA 2J5LC 3RIAF 3K7UA 2A1WH 1EZVX 4UI2A 5GRVL 4OV5B 3RWEA 3SE8H 1IAMA 3MRMB 3OMZA 3DX6B 3G6DL 4LF3B 3VXMB 4MNGA 3ULUF 4UV4H 4YFEA 4JDVA 4JO1H 5EOTB 3GJFK 4KJWC 4M9PA 3BPLB 4XPTH 3L5JA 3SGKA 4LPYA 3F12B 4PS4H 1HHJA 3CFJB 5KSUB 1QBLL 2LABA 5I1JH 1PX3A 2EKSA 3LDBB 3MV9E 4XC1L 5B3JF 3GMLB 1RFDH 3BZDA 3C08H 1SJHA 3DXAB 4F7MA 2WUBH 5DHVB 1RZ7H 3P73B 1FZMB 1VACA 3GO1H 3HAEA 3L7EA 2R0WH 1YYML 4NO5B 3MXVH 4JFFE 1INQA 4NNPL 1G9NH 1ZVSB 4PREA 3UTSD 5ETUA 4UIKL 1CICB 2H32A 3DVGB 2BJMH 4Z7VB 5CSBA 5I8EA 5KN5B 1XR8A 5DFTA 3C5JA 3LZFL 2PW2B 1CQKA 1X5ZA 1NC4D 5E9DD 4Y5YA 4MJ6A 5IB2B 1H5BA 2MOVA 3DO3A 4GG8A 1GGCH 3SCMD 4HUVB 3L3DA 2A6KA 4M8QB 2ZOKB 1A7PL 4ZNCD 3QDHA 2JELH 4F2MA 5J13C 3B83A 1UJ3C 5CBEA 4QGYA 1M1SA 1P4IH 4N8VA 4X6CF 1MEXL 2F9BT 3VRIA 2P5EE 1MI5D 3GI8H 2AJ3B 3RPIA 4MB4A 4V2BA 5I73B 5GRUH 3EGSA 2E6PA 5D6DA 5BZWA 1SBSL 3LQAC 4YHLL 5DUBA 4M7ZB 1RUML 2IADA 3I02A 3MYJA 3LZFH 3RAJH 4DZ8A 3JWDL 5FOJA 4E9LA 3GIZH 2IGFH 3G04A 3RZCC 4GLRI 4KRMB 1J1OH 3AB0C 1TVBA 3V52H 3QIBC 4L8DA 4ETQB 4OF6A 2Q7YA 3PWNB 2AEIT 4JN2B 2XZCL 3MRBB 4PJDF 5HDOA 5D6DC 4U1HB 2WIIB 3EYUH 2VLRE 4DKFL 3MLUL 4ZMAT 3JWDC 2V17H 4JPVL 4PJCE 2HMIC 3HE6D 4JPIA 4UILL 2XTJD 3MFGB 4H5SA 4FQXC 1L7IH 1JFQH 4H20L 2VO5A 5JIPA 4NZTL 1ZHKA 2YXFA 4LKXA 5FYJE 1J1OL 5DJXA 3PXJA 2V2XA 4KI5F 1N5YL 5MERA 4P5KB 3I02B 2R1YB 4DZ8B 3RKDC 2ZUQB 5EU5A 1F6FB 4KDVA 3FQWA 2ATPB 5SV3A 4WU5B 1CDUA 3QWQB 1U3HC 4XNXL 2G5BB 4EN3B 1MFDH 3BT2H 1QSEA 1CVRA 1OAKL 2EIEA 1NGZB 1S8DB 5I9QC 5IMLB 1D9KC 3RNQA 1T83C 2GY5A 3V5DA 4LP4A 5AWNH 1DBJH 4P9ML 1E4XL 1DEEA 3FFCA 3PHSA 1B2WL 1MQ8A 2KUTA 1WBXA 1L7TH 2XY1A 5DJYB 4L4VE 3WSQL 2DDQL 5L2KD 3L3JA 3FOLB 3MLZH 3NIDF 5J9PB 1GZPA 5CUSH 1U8HA 5KSAA 4S1DD 1KXQE 1U93A 4N0YH 4OF3A 3PJSA 5SWSA 1CGWA 1MFDL 3LN4B 1S9YB 4F58H 4TTGA 1AGEB 1KLGB 5ABDE 4QT5B 5BOZG 2R0WL 1NBVL 4WTZA 4JO4H 1NUDA 5DRNB 1IQWL 5EC1A 3QCVL 1FNFA 5DD1H 4K7FA 4GUPA 1C08A 1D5BA 2XZAH 4Q6YA 3IDIB 3EFDH 4MSWA 1FYHB 1Z3GL 1LNUA 3T65A 4UQ3B 3D69B 4LCUA 2BHYA 3PWVA 3I6LE 3L1OH 2VQ1B 2HLAA 1FNSH 3RVTD 3L3KA 5L88H 1FL6B 1FAKT 2VXTL 3QUXA 4NO3B 5AUMA 1CE6A 4OUUA 4Y5VB 5I2IB 1DN2A 2A9NH 3WNNA 1HHIB 1Q9KB 3HMXL 3IDMB 2RJMA 2NY3C 5IOPB 5LWYL 3B8YA 1QSFA 4ZO6A 4BM7A 3NABH 2ZCHH 4M6ML 3SDXB 4PP2A 3RVWC 2VLLA 3UDWC 5I1EL 3RL1A 5AYQA 2EECA 4G43A 3HI5L 4R4NC 3DROA 4PRPB 3O8XC 2IAMA 3U30B 2DWDB 2XV6B 1QRND 4LLMB 3NTCH 3W39B 5E6IB 3M17A 3MCKA 3B9AA 3FTGA 1XIWC 1LQSR 3IKCB 1T20B 3HR5B 1HYRC 4GW5B 5K59F 3GMPA 5GS0L 1ZLWK 1TQBC 4LBEA 1CLCA 2AJ3A 3RPIB 5HYQB 2NR6D 1QSVA 2AJVL 3NABL 5J6GA 3X11A 1OTTC 4TTDD 2B20A 4QRSB 1OQOA 1IZJA 3TN0C 3VE0A 3MROA 5EBWA 1BP3B 3QG7L 3PABB 4NQXA 1MUJB 4P2RE 4R97B 4CVUA 5ISZE 3S35L 4QF1A 2NZ9D 4JN2A 1RQ5A 5JXAL 4HKJA 4UDUA 1MHHB 1EFXD 2MQCA 3KPOB 4LEOA 5TPWH 1ZWIA 3KWWA 2ZUWA 1Q72H 2EICA 2P49B 4Q7DA 3D39D 5E7FA 5GZNC 5E08L 1I3UA 2GJZB 3K4ZA 5EO1A 2UYLB 1IKNA 2VDLL 4K7PY 5DQ9A 1T7XA 3C8KB 5T3ZL 1J86A 5IW6A 2CK2A 2IBZX 2X41A 4NBYB 2HFTA 2HG5B 3SKMA 4KMLB 2F74B 1MF2L 4M6AA 5J12C 3KPMB 2Q3ZA 4S2SA 1WUNT 2GT9B 4FQIH 3SGDI 5IBLD 4MCZA 4U05A 4HWBH 1KN4L 1JZ7A 4RGMC 1F97A 3S3JA 3K8KA 4Z7WB 1UACH 4L8BB 1KN2H 1KB5L 3KVQA 1UCBH 4YHYB 3CNKA 3WYRA 2E6QA 4RMRA 4MGXA 3VXUB 4CVXB 4ZS6D 1VB9A 4GRWH 3T0VA 1NCWL 2BVPA 2VZTA 2XTJE 4JZNA 4DJMA 2KPNA 1TJIL 5C09A 1WAAE 2YC1A 3TWCH 1RIUL 1AFVH 1U8IA 3FN0L 1T1ZB 2H6PA 3RA7L 4FABH 1RD6A 1UACL 2YD9A 2DYPA 5EB9A 3GK8L 3QCUH 3CGTA 4U0RC 5DK2B 4QKXB 1JWSB 1QG3A 5DVNA 1MCCA 3CLEH 4I0PA 4L4TD 5B21A 4Z18A 1LD9B 1KGCD 1EMTL 4ZDHA 3W0WD 1AXSB 3WUWB 3I6KB 1ZA3B 4G9DB 2A9NL 5CIPA 1G6RB 4YQXH 3QNXA 5C2BH 4LMQI 4DGYH 4G8IB 4OCYH 1JYVA 1WITA 4CADB 1T5XB 4KK6D 2CDFB 1ZMYA 1U95A 3MV8B 4HBCH 5HVHB 1ED3B 2AJYH 1OVZA 2O5XH 5TQ2H 5K59E 4OF5A 1HOCB 1ZLSH 2H6PB 4PREB 3FB5A 1I9IL 4JM2C 1LWRA 2H32B 3DVGA 1R5IB 1YQ2A 4L3EA 1W0WB 1YN6B 3UO1L 3H7LA 2Y23A 4JB9H 4YLQT 2IMNA 5D1QD 3X14B 3FO2B 1YMMB 3UYPA 2ILLA 1AXSA 4N90E 1ZGLB 4ODUA 4HIHA 1UM6H 1C16A 5C0AB 4JO1L 4FMKA 5CGYC 2XN9B 1L0XA 1G0DA 1RZKL 4PY8J 4X6CA 2HRLA 4WFFE 3CLFL 4KHTL 1K2DB 4M6NL 3BZ4A 3OR6B 1NSNL 4RBPH 3G5XA 4Q9BA 1PDKA 3DROB 1V7ML 4PRPA 4UB0L 5C0AD 4UTBL 3WDJA 4AMKL 4KC3B 1UWEH 3KPSE 2IADB 4UT7L 3TLRA 3BGMA 3IYLW 1YQVH 1AKJD 5IP4A 4PJCB 4ZFZB 2R9HC 3ALPA 1BAFH 5ADOH 4IHOB 3IFOB 1KPUA 2MHAB 4TRPL 4JEGB 4EI5B 3ILPB 3KDMA 4QGTA 1RZKH 3U36A 5C08A 1IM9A 4LCYA 4OZHA 4KQ3H 2EE2A 1CQYA 4PLKC 4QRPD 3MV11 3HE7A 4EUPH 1K9TA 5ACZA 4UTAH 5IB2A 4AEHL 4ZPVA 2OI9B 4KI5E 4NQEE 4ODTH 1R3LB 1NCTA 5E8OA 5D7SH 4H1LG 3DRTB 1N4XH 1P4IL 3VRLE 5IB4A 4KV5E 4G7VL 4TULL 3TV3H 3SDCA 4M3JA 4LSVL 3G5XB 4JLRB 1DQMH 4PRDB 5DRNA 4J2XA 1ZLUK 1BREA 3SCMA 1RJYB 3F7VA 3WL9A 1J11A 3MV9D 3C09B 4IHOA 3S37L 2UUDH 2F53B 3BP6B 1JN6A 1KC5H 1QFUH 4XWOD 1MCFA 5DMKA 5FM8A 1FBIL 3FT2A 1DLFH 4R6UA 3BSZL 5IQ9B 2Q86B 4AZ8A 3C8DA 2J8UE 1WC7A 4KVNH 1GIGH 4XP5H 4K7FB 3ULSB 5EA0L 1Q1JL 3RWGB 1D9KA 4DTGL 1KEMH 3QNZB 3RWDB 1S9XA 3NAAL 4HUUA 3TZVB 1ZT7A 1GAFH 4P4RA 3LRGA 1UXWB 1XF5B 4JFHD 4OLYL 4IOFD 3JV5A 4YQXL 1GZPB 2CUIA 1GYAA 5DRZA 4ZPTB 2IAMB 4WVRA 3DMMA 3IKKA 5SX5K 1QPPA 2XRAH 4JQXC 2Z8RA 4BSWB 4BK4A 4ISVB 2AJYL 5TQ2L 4JO2H 1ZVHA 3C5SA 4JRXD 1OPGL 3JTSA 2BXZA 1G9ML 4XP4H 1H0DA 2KKQA 4WHYH 2OJEB 5JNYA 5D1XD 2VXUL 2R1WA 2CGRL 1F6AB 5T5NG 1KTLB 5DXWA 5T5FL 2HVJB 4GRWF 3GEWB 5C2UB 2UY7A 3EHBD 4PJGF 4M4RA 3TJEL 3ECBB 1MI5B 2BXYA 3L5WA 3DSFL 4RFOH 2B1AH 4MA3B 4C83A 1L7TL 4L9LB 3BPCA 4NCC2 3U46A 3ROOA 4X4YA 4X4XA 5EWIH 2AKRA 5DHXB 4KI1A 5CEZD 4JO2L 4XPHH 4L8CB 1KSRA 5IW1B 3MUJA 2OTWB 2ESVE 3KPQA 4Z77A 2P48B 1F58L 1TVHA 1CE1L 1NAMB 2HFGL 3TN0B