4FQJH

Influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
228
structure length
222
Chain Sequence
b'QVQLVQSGAEVKKPGASVRVSCRASGYIFTESGITWVRQAPGQGLEWMGWISGYSGDTKYAQKLQGRVTMTKDTSTTTAYMELRSLRYDDTAVYYCARDVQYSGSYLGAYYFDYWSPGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/immune system
total genus 42
structure length 222
sequence length 228
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH01
2N4IA 4MQXD 2CJUH 5I15L 5IJVA 3PWJA 5DMKA 4F33A 2W9EL 3FRUB 3JBG7 3EJYD 5I1HH 2QSCH 3JV0A 4NCC2 2AJZA 4KVNH 2ITDA 4NRZA 3QQ4B 3HE6D 1P9MC 3UBXI 3C09B 1GXEA 1IARB 1JGDA 4TTDC 4FABH 5MEOA 3ARBA 4QRTA 1T5XA 3HZMB 4PJ7B 1KNOA 3PXHA 3N1MC 3AREB 4RSVA 2QR0A 1F4YH 1MCKA 4PGBA 4JN1L 3P4NA 4RFEB 1QO3A 5A3IC 2Q76B 3A0OA 2UYLA 4JFFE 5IROC 2IF7A 1QFUL 1NBYA 5IQ7L 1U3HA 3LMJH 2B20A 4QF1A 4H88H 3A6CL 4LEXH 4M61A 3RZCB 3SKUD 5J1SC 5E2UH 3HC0A 1FZOB 3NCFB 4IRSB 5EC2B 4WY7H 3MLZL 3D39A 2DF3A 1FAIL 2J8OA 2ICWB 4AG4H 2DN7A 3MOQA 1MCFA 3CXDH 3FO1A 3SE9L 2FYYB 3RNKA 1IEAA 3ZYJA 1JHTA 1G7PA 1NL0L 4TVPE 2HJLA 4G7VH 5I71C 3GKWL 3PL6B 1YJDC 3MGOA 4M43H 1MJUL 4OKVA 3GUTA 1KENL 2EH8H 4YK4B 3ARTA 1XZ0B 1LE9A 5IK3A 1I1CA 3O3AA 1IL1B 2Y6SD 1RUML 5IVXF 4UQ2B 5J57B 4JM2F 1E4KA 1ES0B 1Y18B 1DBML 1MPAH 2DQUH 1BM3H 4U7SA 3FRUA 1FH5H 3ET9F 4NKOB 3LV3B 4HWZB 4KK9D 2FB4H 5TE6L 1HSBB 3QQ4A 5F6IB 3IT8D 1QKZL 1D6VL 1OLLA 2FEDD 5ENWB 5F8RC 1PW3A 2H41A 3HZMA 4PJ7A 3NZ8A 3AREA 3QO0B 2HT4C 5F44A 1B0RB 1DQTA 3HE7C 4RMTA 5DSCB 1QBML 2FBJL 2OTWB 1A9EB 4RFEA 5AWNL 4ERSH 3GSWB 1N3NB 1CK0H 4X6EB 5GJSH 3R0MA 2Q76A 3AB0C 4S11A 4Q9RH 1JNNH 3LVEA 5C3TA 3C8KB 2QQNH 4HJ0C 2FSEB 2DJUA 3ZT7A 2QSTA 5EPMB 3RZCA 1TVDA 2DQIH 1WQVT 3MRQB 2M1KA 4PBWD 4CRPA 1A7PH 5E99L 1CGSH 3RWGB 3RKDD 1FZOA 3LDBB 2D0GA 5EOCH 3FQUB 4IRSA 5EC2A 1OAUL 3ZDZF 5HHOB 5DDHB 4TNWF 3OMZA 3NAAL 1DP0A 3H9SB 5I8KL 1SQ2N 4Y88A 1CG9B 2FYYA 3U7YL 4KJPD 5BS0E 4NM8L 1EAPB 4U33A 3V6FB 1OQXA 3QUXB 2IWGA 3C08L 4FNLH 4DZ8B 1D9KD 2XFXB 1GPOH 2NQCA 4IRJD 3I85A 4XMPH 4F3FB 3NTCL 3ISWA 4NOBA 1ZV5A 3VWKD 4MAUL 1OLZA 1GZQB 1MQKL 4JCMA 4UT6H 3RNQA 1T3FB 1XZ0A 4CUCA 1UWXK 1KCRH 4L8CB 3SE4C 4WV1B 4FQCL 5DLML 1ES0A 1WIUA 2A83B 1Y18A 2XPGB 4M93B 4NZUL 4G6KL 3LV3A 4HWZA 4J3XA 25C8H 1HSBA 2XZZA 3RY5A 5GRXG 3T3MF 5ENWA 1W8NA 3UJJL 4M6ML 3S35H 4XBGB 4OIIL 1YUHB 4OD3L 1LO0H 4YHKL 4NT6B 4QO1A 3MZGB 3QO0A 1QRKA 1B0RA 1RZKC 5DSCA 4U3CA 2CPCA 2P8PA 3GSWA 4LEOB 1N3NA 4X6EA 4GKOA 2R0LH 1Q0XL 2AK4E 4PY7B 3C8KA 4L8SB 3FZUD 2OYPA 2FSEA 5DURD 5EPMA 1NFDB 1M7IB 4JRXB 3MRQA 4U1KB 3IDMB 1QFWH 3RWGA 4LK4A 2WWKO 2CLVA 3SDXB 3UXFA 3FOMB 3FQUA 2DMBA 2R2CA 5F89B 4YUEL 1REIA 1KPRB 4J1UA 5HHOA 5JUEH 5LXGH 1YQVH 5DDHA 5GGQL 2ZOLB 1BGXL 1ZOXA 4XAWL 4KROD 1JZ4A 1F4XH 3H9SA 4WHYH 1YMMA 4NNYB 1YNKL 4U7KA 1MVFA 1CG9A 1I9IL 2R29L 4HBCH 5FECB 3QWOB 4UT9L 1NDGB 5D5MB 1EAPA 3O2VL 3V6FA 3QUXA 3HG1E 4DZ8A 2XFXA 5I2IB 4F3FA 5I1KL 1X44A 3SCMB 1JF1B 1GZQA 1M71B 1T3FA 4P2OB 4L8CA 1UA6H 3BFOA 1PD6A 5DJ8B 1QPPA 3DGGA 4XPHH 3UTSB 2O5ZH 1UQSB 3TO2B 4MA3B 3E8UH 2EYRB 1XF2A 2GIYA 1T2XA 4D94A 3P40A 4WU5B 3I9GH 4YBQC 2DLTA 4AT6B 3G6JF 1YUHA 2X09A 1JPSH 3V4UH 2X70B 1TFHA 3SBWA 1LO4L 3B43A 3QEQD 1K8IB 2IMMA 4LEOA 3IDYC 2QHRL 2FX7L 4PY7A 3RQ3A 1MRDL 4XC1H 2BDNH 2FX9L 1BLNB 3VFPB 4AIXA 1M7IA 4QTHB 5KVGL 4JRXA 4U1KA 3IDMA 1OM3L 1ZT4A 5GISH 3B5TA 4XPGH 2NY0B 3SDXA 3FOMA 2JTDA 1U8QB 3RL2B 1FNHA 3T65A 5GGTA 4P48A 3FN0L 3O0RL 4HXAH 5F89A 2DTSA 1MEXL 2BVQB 1CQYA 4HUUB 2AKRA 4OQTH 1KPRA 3KDMA 3PGCB 3O81A 4IEFB 2H32H 2YR3A 1NJ9B 3EFDH 4LLDB 3IFPB 3UDWA 1TZHB 2OJZH 4N0CD 2D4FA 5FYKD 4CL7A 3GI9H 4NNYA 2P1YA 5HHMB 2I5YH 4O5LH 4Q9CA 1EO8H 4RGND 4ALAL 1KCKA 5FECA 3DYPA 3QWOA 1MELA 1NDGA 1QHPA 2EE2A 4JVUA 4N0FB 4GMSL 4WHYG 5D5MA 3ZL4H 5C6PB 4ZFGL 2UWEE 5IG7B 5I2IA 3JWDL 5T3XE 4L8DB 3UC0H 3FJTA 1JWMB 3SCMA 4JHZA 2ZUTA 1NCCL 1JF1A 1M71A 3LB6C 4OFDA 5IHUL 1ADQL 1B0GB 5IV2B 2CXGA 3P4MB 4MAYD 3W81A 4D9RE 3GBNL 4JQIH 1SJXA 5DJ8A 3HNSL 1FL5B 3UTSA 1UQSA 3TO2A 2DQCH 4MA3A 3S36X 1T03L 3GDBA 4MQXC 4K3JL 3FMGL 4JZOB 1ZMYA 3BH8B 4WU5A 4AT6A 5ISZB 1EGJH 3FO2B 1UZ6E 4U6TA 2X70A 1YEGH 4HKZA 5A2FA 3LKPB 5LGJA 4DOHE 3I84A 1K8IA 3FT3A 2CKBH 3I6LE 1ZEAH 4PJAE 5F9OL 1BFOA 1P7KB 3H42H 4DN3H 3ALXA 1T1YB 2YPLB 1IM3B 1QNZL 1BLNA 3KPRE 4QCIB 3B8SA 5KSAD 4ZTPL 3VFPA 4V2CB 2FL5B 3IFLH 4QTHA 1J0JA 1UKQA 4NKQB 1F97A 3OAYK 3CCHB 2Z92B 3KS0J 4L9LB 4UDTB 5DFTA 4GG6B 3IJSB 2IAMB 2CDGB 4LLQA 3GMLA 1HINL 4UTBL 4HUUA 2Y72A 3CX5K 5GRJH 4KQ3H 2DBJA 3PGCA 3OXSB 4LLDA 1NJ9A 1C16B 3IFPA 2C3HA 1S3KH 1TZHA 3DUSB 2DIAA 1S9XB 2FBOJ 2JF1A 4E5XB 2BVEA 4FP8L 1CL7L 4EZMA 3EHBC 4N0FA 4PG2C 1IQWH 3KJ6H 5HHNB 3HRZB 1CLOH 5I6XC 5IG7A 1OAQH 2IH1B 5FV2A 4L8DA 1KCSH 1JWMA 4UV7L 2J88L 4XB8A 4LARH 1B0GA 5IV2A 3P4MA 4MA8L 2M2DA 1KEMH 1WLHA 4W68A 4HUVA 5E9DD 2HFFB 2BRRL 2GQHA 3TWCL 1FL5A 2EDFA 4NO0D 3C60C 4C56B 4GAJH 4O4YL 3BN9C 5I8OH 2ZCLL 3SEPA 4IIQA 1CDGA 4I3RH 4JZOA 3BH8A 5BW7A 3FO2A 5B8CB 2NW2B 2W9DH 2HKHL 5H35A 4K9EH 1PY4A 1QACA 1UH4A 3WSQL 5FYKU 3LKPA 1QRNB 4U1SB 1CICD 1K6QH 1EFQA 2GJJA 3RWIA 1P7KA 4DN4H 4R4BB 3TT3L 1T1YA 2YPLA 1IM3A 3QISA 3OSKA 2KUTA 3KYKH 3NGBC 1GIGH 4QCIA 2GUOB 3CMGA 2FL5A 3EYOB 5T3ZE 1CDJA 3CCHA 1IE5A 1HKLH 4L9LA 4UDTA 3DYOA 3EBAA 4GG6A 3U30B 3IJSA 2IAMA 2CDGA 4PRNB 4QRQB 4WI3A 1I1FB 4HIJB 3L5XL 3ZTNL 4YFEA 3RKDC 3QRGL 4QHKI 3V52L 1C16A 1JGUH 5L0QC 1MAMH 4YNYA 4CN4A 3DUSA 4UOW0 2PF6A 1WV7T 4E5XA 2ICES 1NMCB 5F7UA 2KH2B 5FYJD 4XP9L 1C5DA 5HHNA 3HRZA 2UV3A 2IH1A 1P7QA 3TV3H 3SE8H 4KJPC 2AJXH 5L8JB 5T1DL 2VN4A 3NZHH 1N7ML 2HFFA 5ALCH 1WZKA 4LFHD 5F71A 1II4E 1LQSR 3GMPB 4C56A 2DQHH 5DJ2A 3RTQC 1TPXC 1F00I 3FQTB 5BS0D 5IFHL 5CD5C 3L9RA 3VE0B 1IGMH 1KGCD 1OTUC 5KJRL 4ODHL 4HCRA 4XHQA 4BELD 3OF6A 1TJHH 2YD7A 5TJWK 5B8CA 2NW2A 5D7IE 2F8VA 1LILA 2BVUA 1NC4D 1QRNA 4Z7UE 1U8IB 3QUYD 1GL4B 1UKTA 2KDGA 4F37K 1K3IA 1ZK9A 4RFOL 4YEFA 3CLFL 4BQ8A 4GBXD 2Q7YB 3MJ7B 1D5IH 2F5BH 1QBBA 3OX8B 3EYOA 1JHLH 1KIUA 2VLJE 1CBVL 1HXMB 3S35X 4UINL 4X5XB 3X3GH 1OTTD 4PRNA 4QRQA 3GSVB 3RPIB 1I1FA 1HH6B 1R3IL 4HIJA 5DC4B 2AVGA 1A7QL 2QADB 2NLJB 1AHWB 2HLFD 5CLWA 4J3SA 5E2WL 5L2KB 4M03A 3IFOA 4RQQB 5J11B 4X6CB 4TSBL 3H9YA 4WDIB 3VXUB 2P24B 3X14B 4MLIA 1AFVH 5EUOF 3AVEA 2LABA 2XN9A 2ZCHL 1JZ6A 3HZKA 5F1OB 3CMOL 1G7IB 4P5TB 4LDOB 1YYML 4JO3L 4RGOH 1JPTL 4J3WA 4JKWA 3HFMH 4DUVA 4R0LA 1K8DB 4XWOD 4Y16D 3BE1L 3O6FD 4ZDHB 3VI3F 4WW2B 4OZGF 3GMPA 3RU8L 2AGJL 3FQTA 3CFEB 3ZMRA 4QRRD 3LKQB 4O58H 3HG1D 4XPTL 5ILTH 2O93L 4XVTH 4Y4HD 2YA2A 2EXYD 4KC3B 3WIHH 1QLRB 3FAXA 2WZPD 5ERWB 2IFGA 3T1FB 1U8IA 4JFOB 2VDLL 4KRPD 7CGTA 4O02L 2O5YL 3ARVA 2Q7YA 3MJ7A 4PJCF 5T1LD 1M6OB 3VG9C 2D7MA 1BVZA 5CP3A 3DPBA 1FVCB 4E41E 1HXMA 3DMMD 5B4MD 4X5XA 3P11L 2AI0H 2ZG2A 2FGZA 1UEMA 3TLRA 3GSVA 3MGAA 1HH6A 3TZVA 5C08E 5I1CL 2UY6A 4LSVL 1RIUH 1F3RB 4H5SB 4K8RL 2NLJA 4DVRH 1NH6A 1E6JL 3BJLA 4NBZB 3HNTL 5L2KA 4RQQA 2D3VA 1MCQA 3EYFB 4X6CA 3OGCB 4WDIA 1JGLH 4L4TE 4Q6IB 4UV4L 2P24A 3MRKB 3X14A 1C1EL 4XNUL 2I07B 5EULV 3K8LA 3T8XB 2W0LA 5E2VH 1G7IA 4Z7VB 4IS6B 3HAEB 4XNMB 1UM4L 5I1EH 4YHZL 5IEHB 4M7JL 2OZ4A 5EA0L 1N5YL 4P0DA 4G8GE 1K8DA 2WWKT 1SMAA 4MXVF 4WW2A 3VXSB 5JQHC 3SDCC 3RA7H 1NAKH 3N1QC 1VEPA 2CR6A 4PBXA 1H5BC 5IBUB 3HKFA 1KT2B 3CFEA 5TE7L 3LKQA 3FO0L 5GHWH 4LSUL 5T3XD 4PG9B 1QLRA 5ERWA 5LWYH 5GS1B 4HJJL 4D9RD 4ELME 2NY6B 3T1FA 1CTNA 4LSDA 1JYVA 5CJBA 2D7QA 4JFOA 5HDQH 3FHAA 4PJDF 1P4BL 3ARGD 5FUCC 3HS0B 1WAAA 3D2UB 3T0BA 3IDXL 3ZHLA 1M6OA 2W0PA 4YBLC 2BY2A 1T1WB 3ALWA 1HOCA 3ROLB 3MROB 3VWJD 4H25A 5GGTL 1BREA 5JQ6L 5KSAC 3PWUB 3I6LD 4IMLB 3HB3D 3UPCA 4H5SA 4YBHA 1QUNA 5GRVK 2I9LB 1W0VA 3VCLB 1IGCH 4PB0L 1DANU 3QG6B 1EIBA 3EYFA 4KTDL 5K9QI 3OGCA 1ERNA 2O5XH 4Q6IA 3MA9L 3MRKA 4BZ1L 4I2XB 2J2ZA 2I07A 3B9AA 2ED7A 3T8XA 3K4AA 4YHNB 1QPXA 4I48B 4XPFH 4Z7VA 5E03A 2DB8A 3CLEL 4IS6A 3I75B 4XNMA 1MFEL 4X6DB 1MH5B 3MOAH 4PRHE 1ZSDB 1HYSD 4I0PB 3O9WC 1P5VA 5A1AA 1WK0A 5FYLD 1KXVC 3VXSA 1FNSH 1CFBA 1UT9A 5K59F 1KT2A 3RI5K 1G9NC 2PETA 4XP4H 2EO1A 4GSDH 2VAAB 2I24N 2XZAL 1DUZB 3EYQC 4PG9A 1ULVA 2E9WA 4O2EA 4P9HH 4X4YA 2C1OA 2DRUA 4MD5B 4PJ8D 4HGWB 2FDBP 5GS1A 1U3ZA 4JR9L 1AGDB 4OCLC 2A1WL 1Q9OB 1SBSL 2MHAB 4XCCH 4MWFB 5ICYB 4OZHE 3D2UA 1HHGB 4I0KA 5SWZE 4LOUC 4IHOB 1CICC 3W0WE 3Q2CA 4X7EC 1JVKA 2I60H 1XGYH 2VXQL 2VXUH 1T1WA 3ROLA 3MROA 5JHLH 3LQMA 2DD8L 2YXMA 3G04B 4MS8D 3QCVH 4NO2B 5JXED 3PWUA 1CXKA 4IMLA 4ODVH 3WIIL 3MMEB 4YXLL 3DSFH 2GSIB 2I9LA 4LSTH 1RMFH 2F74B 3VCLA 4X5WB 4KXZI 4F9PA 3QG6A 4NP4L 3ULVL 4P23B 1AXSB 3WUWB 5DO2D 5IBTH 4DQOH 3EW3B 4I2XA 5DUML 4PD4K 1F3DH 3GSQB 2J8UF 4GG8B 1CFSB 3IU3A 3AS3A 4I48A 3ZKMC 1RVFL 3LKRB 4J6RL 2NY2D 4M6AA 3ZSTA 3DHMA 4X6DA 1MH5A 4M6NL 1F6LL 1ZSDA 4I0PA 2VDPL 4DCQB 1CWVA 2JJUA 3UTQB 3OL2A 4JQVA 1OSZB 4WFHE 3SDAD 1AD9B 4XC3L 4LCIL 4S0SD 3RBGA 4FQ2L 2EDBA 2VAAA 2RCSH 2CO6B 1IAIL 3QCUH 4HQQH 4ENED 5DVMA 4KMTL 2BK8A 4HGWA 2FWOB 3HA0A 5E6IC 5KOMC 4JB9H 1AGDA 1NGPH 3DROB 3IVKB 1Q9OA 1N59B 2MHAA 2VZVA 4Y4KB 1OY3B 4RWYH 4MWFA 2ZSVB 3RY4A 1DBBL 5ICYA 1N6VA 1HHGA 2OI9B 2ARJB 1LHZA 2ICEB 1EJOH 2BNUA 1C08A 1JFQH 4XMLH 3SKNB 5DD1H 1CD1B 3T0EB 4QXTB 2AK1H 3PJSB 3WXWL 2XQBL 5JW4M 1SEQL 4GBXC 4NO5A 4PJEF 4ZAKC 3G04A 3V0AC 2Y4SA 4RMUA 4NO2A 1U8OB 3ARDC 2CIIB 1JCKA 3C87A 5D70H 1TNMA 3MMEA 1BZ7B 4F9LA 2GSIA 1EHLL 3JV6B 2GYSA 1T2QL 2VH5H 4I5BB 2DQEL 2FD6H 2F74A 2V7HB 3GRWH 4HT1H 4X4ME 5FYLH 1E4WL 4MVBD 1GGCH 5J6GB 1L7TL 4IDJL 2HLFC 4P23A 1AXSA 3WUWA 5DD5L 3OXRB 3V4PL 1X7QB 3GSQA 3UBXG 2VQTA 4GG8A 3VGHA 5FB8B 1CFSA 2A77H 4KTYA 3LKRA 3RVTC 4UOJA 5CEZH 4YDLC 1BAFL 3VD3A 1MCRA 2HRLA 1G6RB 3IJYB 5DVLA 1FSKB 5JORB 2MCPL 4DCQA 3VFSB 3UTQA 5CJOL 4YXKL 4CVXB 3LCYA 1OSZA 3S3JA 1AD9A 3MR9B 4WVRA 3MLYH 4XP1L 1J5OL 2DLFL 2JJWA 1P4LB 4Y16C 3LIZL 4FQIH 5ADOH 5DGQA 4U2ZA 3VFNB 4RDQF 5HYIA 3ULUE 1JYXA 4JFEE 2FWOA 2EXYC 3DROA 3LS4L 2GJ6E 4WHDA 2VLME 3IVKA 1N59A 2YPVL 4Y4KA 5GGVH 4Y2DB 2ZSVA 5L6YL 2P5WB 2YN3A 1JGVH 5DHVB 2ARJA 1JZ2A 1BQLL 5F88B 4JM4L 3SKNA 3D39E 4LVOC 1CD1A 4Q74A 3VRLF 3T0EA 4F7TA 4QXTA 2XWBB 3PJSA 4APQB 5KTEH 4JDVB 2AEWA 3QYCA 1N4XH 2Y7QB 4XNZC 2XTLA 1RIHH 1KV3A 1OGAD 2DLGA 1U8OA 2P42B 2VXTH 2CIIA 3MBXH 2D03L 2HT3D 3IU4H 1I8KA 3DMMC 1XIWB 4YQXL 1OAXH 5CIPA 3ESUF 3C6LB 1BZ7A 1JHKL 1ZHKB 3JV6A 1ZLVK 3GIVB 2V7HA 4JFQB 4AL8L 3H8NA 5J6GA 2D7TH 3OXRA 1X7QA 3I50L 1EDQA 4KY1H 5FB8A 5BVPH 5C08D 2Q8AH 1MJJB 3IFNL 3ZDYF 1CIUA 1G6RA 5ICZB 4DKEL 4G9DB 4D0BB 3FN9A 3REWB 4RZCB 2VL4A 5JORA 2ZZUT 3VFSA 3CFJB 2I27N 4EXPX 4CVXA 5C0IB 1YMHB 3QDJB 4HIHB 4YLQT 4MCYB 1OWRM 3BAEH 3MR9A 1IFHL 4GXVL 2FEEI 4L4TD 2X9XA 1INEL 4L3ED 1P4LA 1DQDL 4RNRB 4OB5H 3L95B 4JPKL 4FZEL 4N1EA 3WNNA 3VFNA 3VMPA 4JPVL 4U1HB 2Z31B 4UIKL 3L1OH 1IT9L 1H8OA 3E0GA 3A6CH 4LIQH 4S1SH 5B3JF 2Q86B 4Y2DA 1EA9C 3QIWB 4WIQA 4LGPB 2P5WA 4FOMA 3KLAB 5DHVA 2Z91B 4P2YA 5F88A 5D6DC 2CRYA 3EOAB 4XI5C 2EIDA 2XWBA 4APQA 1TVBB 4JDVA 1WWCA 1FDLL 1DZBA 3ESVF 2CQVA 3BISA 3D0LB 4PJ9C 1XIWA 3QXTA 5J3HD 1P5UA 1VGEL 2A6DB 1ZHKA 1DBJH 5JMOC 4YHYC 3QEUA 3GIVA 1K2DB 4JFQA 5LGKA 1NCWH 2VZUA 3MLTA 5SWQB 5GGSB 2H2SD 2OTUB 1KIRB 5E95B 4L4JA 1SM3L 5FGCE 1XF4B 3CVIH 2XA8L 4N9GB 1ZHBB 1BFTA 2HFEB 4J4PC 2XWTB 1A8JH 1RUMH 1X5HA 4RBPH 1HHIB 3L5IA 4RDQG 1MJJA 1GJIA 3H2WA 5K93A 5EU6B 5ICZA 4JQXA 2YXFA 2DICA 4X7FC 1T4KB 2DJSA 4D0BA 3REWA 4RZCA 1RFDL 3CFJA 3HNVL 5C0IA 1YMHA 3QDJA 4HIHA 3HUJE 4P3WA 1R3JA 3TVMB 3D1MC 4EN3C 4WCYH 4LQ1A 1HYSC 4JREC 5E5RB 3DSNA 2DLEA 4DAGH 2AJUL 4RNRA 3U9PL 12E8L 3L95A 3MJ6A 2Y5EA 4KKCC 5FCUL 5DUPH 4LSSL 4PRHD 4U1HA 2Z31A 3RIAF 3EZJB 4K7FB 3PWLB 2Q86A 4PJFB 5F93C 3QIWA 3WXVL 4JGMA 4RA0C 4LKXA 3WFEL 5HD8D 3KLAA 5BV7B 3F7YB 2Z91A 4CVZB 4NUGH 3WFDL 1WBZB 4MZ3A 2BY1A 3EOAA 5B21A 5LAXB 1TVBA 3LPGA 5KSBF 5EOCJ 5IJKC 3O4OC 3EJJX 4YEEA 3BZDA 3D0LA 1GOFA 3SDDB 3FB5B 1LWRA 2A6DA 2V6HA 3HCVB 4NM8H 3BOVA 1ZLWK 1K2DA 7FABL 1OAKH 5SWQA 4OGYH 3QEGH 4Y19D 1ORQB 2OTUA 1KIRA 5GGSA 1LE5B 1YC8A 4KMQA 1H3GA 1XF4A 2WK2A 4HZLB 3QRFM 4PP1D 4N9GA 4LCWE 3REVB 1BIHA 2HFEA 5J13B 2XWTA 1JMZA 1T89A 1HHIA 2WINA 2V9TA 4QHMB 3CSGA 2I26N 4PB9L 3AS2A 2DQGL 3P3YA 4NZUH 4NZTL 4JFHE 5EZIH 3ZKXB 5EU6A 3MPCA 4PLNC 1T4KA 2YUVA 4FQXB 2V2WA 1KCVL 1FNEB 1WFUA 1OPGL 1O5DT 1A6VL 3UJJH 1FYTE 2XZCL 2ZKHL 5IM7B 4NQUA 1MIEH 3TVMA 3O2DH 4IJ3C 4JHAL 1MFBL 4P2CG 1FL3B 3SDAC 4K94H 2HWZH 4R2GB 1S7RB 5KS9F 2X5PA 4X8XA 1MCIA 1Q72L 1NFDE 3DJ9A 3DXAE 4K7FA 4U1GC 3PWLA 3T4YB 3VXTB 1MCBA 4PJFA 4JG0H 5E56A 1P6AB 3F7YA 1ZA6B 4YWGH 1SYSB 4CVZA 1BFSA 3IAPA 5J1AB 5L88L 4HS8H 4AYFA 1WBZA 3ARUA 5LAXA 2ERJC 4QEGA 1OSPL 1YEDB 1AR2A 2ORBH 1BGXH 4UTAL 3MLXH 3WJJC 4G7YL 3MREB 5F7FA 3SDDA 4EEEA 1T66D 3FB5A 5SV3A 4NZJA 1MQ8A 5D5ME 3TT1H 3O2VH 1AE6H 1UYWL 4OLWL 1P1ZB 4HXBL 1KN2H 3BQUD 1MFCH 3UO1L 4MCZB 1ORQA 3DV6B 1UJ3C 1LE5A 3W82A 4ODXB 1I3GL 4HZLA 3REVA 4KZEH 1UG9A 2PXYA 4QHMA 5TE4H 3JTSB 1MSPA 1B2WL 2R0WL 1IC7H 1KN4L 4B41A 1JF5A 1A3QA 1T7WA 3P30H 4I18A 3PGDB 1MLBB 4FQXA 1FNEA 2WBKA 2DYPB 3ME0A 1I1YB 2MQ3A 2EO9A 5IM7A 3D9AL 2IQ9L 4M4PA 4IMKA 1LO4H 2IANB 1FL3A 1WFOA 2VLKE 3STZB 5IMLB 4BSJA 3GSUB 4HPOH 4XVSH 1MRDH 5IVXB 1S7RA 4JM2B 4QRUB 5BZWB 4ZMAT 2FNBA 4BQ6A 3ARBD 3Q1SL 3X3FH 5SWSB 4NRXB 3SDYH 4GRWH 3T4YA 3V79C 3K4DA 1KUMA 4KGLA 4L4VB 2WBWB 3KG5A 5L8KB 1ZA6A 1U2CA 1SYSA 1JNJA 5J1AA 3FN0H 1EH9A 4Z7WA 3DVGB 4PJXF 5DMGD 1G1YA 1GC1L 1OTSD 4OZIF 2YK1H 3EIFA 2EYTB 4EDWH 1YEDA 4E0RB 1RZ8B 5HHME 2GJ6D 3MREA 2X1QA 4KDWA 3KR3L 4LQFL 1NCNA 2BVTA 2Z8WC 3FTGA 1B90A 1MCSA 1W0YT 1P1ZA 5CGMA 4WEMB 5K9KB 2HT3C 3D39D 4MCZA 3DV6A 4ODXA 1XGRB 1YY9C 1FG9C 1AO7A 2DI7A 3B9KB 3WKNA 4OCNC 4RMQA 3BT2H 1QOKA 3MV9B 3JTSA 3ARQA 2YZ1A 3Q6GL 4NIKB 2VWEE 2VXVL 1WF5A 2EIBA 3PGDA 1MLBA 3LZFL 3BPOB 4D9LH 4K3EH 4NKMB 2FJFA 2DYPA 5ISZE 4RMSA 1I1YA 3D0VB 2H26B 5GXBB 1KYOJ 3C8HA 4ODTL 3HC3H 4LPUA 2IANA 4ZSOE 2W91A 3BSZH 4FXLA 3STZA 1HZHL 5IMLA 2HTLC 4PRIB 3GSUA 1DFBL 5IVXA 5HI3D 1Z0MA 4JM2A 3WHXB 4QRUA 5BZWA 2EEBA 3OTTA 1WVZA 5SWSA 4NRXA 3CPLB 4R7NB 4L4VA 4YO0B 3R1GH 4HK3N 3UROR 1QQDB 3UYPA 4OM1H 1TETL 1Y0LB 4D9QE 1LDPL 2H8PB 3DVGA 3P0YL 1HINH 3V6OA 4FQHB 5C0AB 2EYTA 3DNKA 3TA3B 4OLZH 4E0RA 3VFGL 4URTB 3PHSA 1RZ8A 2MTPA 2VC2H 4LRIC 5E5UB 3BESR 2D9CA 5CEYB 3Q5YA 4F15B 4UT7H 1FN4B 1KCUH 1RUQH 2AQ3A 1WEJL 3STBA 2R0KH 5K9KA 1FGNL 5AUMA 3EDFA 5J3HC 3P0GB 2AEQH 1DEDA 1J10A 4UV7H 4Z7OE 3MTRA 3O4LE 3MV11 4Z76B 5C0BB 5AZEH 1YEJL 3N1GC 3B9KA 1I7TA 2C4FU 4NWTL 3B2UC 2LAGB 2W0FB 2UVEA 2VZ3A 4YC2C 2H2SC 2AXGB 3MV9A 3TWCH 3CXHK 3ZT5A 2CGRH 4PTTB 1G6RL 3RIFK 3M17B 3P4OB 3VXOB 2HH0H 2KL6A 2M26A 3PL6D 2ZNWA 5CILL 5AYUH 4NKMA 3V5HB 4XBEL 4GXUN 4BK4A 3D0VA 4U0RC 5EWIL 1U3YA 4WGVB 3VGDA 2R39A 4Z77A 3X17A 5C86A 3U0TA 1YN6B 4M6OH 5I1JL 1I8LC 1Q8MA 4NKIL 4BSWB 4PRIA 3NVQA 3TT3H 4MJ2A 1UADC 4Y8AA 4OGZA 1ORSB 3CPLA 4KJQD 5K33A 3T1WA 4YO0A 3SHSA 1P2CA 1ZVSA 1ZT7B 4RCAA 1Y0LA 5DFVD 1CF8H 1NSNL 2H8PA 3H3PH 3ZKSD 5C0AA 2QQKL 1CE1H 3PWPB 5HD8C 1INQB 2A74B 3TA3A 2DI9A 5I1IH 4L3CB 3O3DB 5EU7C 1NBVH 4PGEB 5CEYA 5TFSL 1FN4A 3DRQB 4AEFA 4UILL 5DZNA 3S96B 3JSSA 3C5ZC 4PRBA 1S78D 5HHOD 5JHDB 1LO3L 4HDIB 1AGCB 4K8RD 4Z76A 4BH7B 5GRVL 5C0BA 2YD1A 5C0JA 3MRIA 1N7MH 2W0FA 2AXGA 5ELIA 5IGXH 5J56B 3OKLB 4PRPE 4PTTA 3OKNA 1RUAL 1NUFA 3M17A 2C4XA 3P4OA 3QG7L 1UCBL 3IJHA 4ZPVB 4ODHH 3VFMB 5FHAH 3LKSB 5HDBE 3V5HA 5D1XD 1JV5B 1CU4L 3CFBB 4MX7B 3QPQD 1YZZA 3TJHD 3BP4B 3HMWL 1LO2L 4XB7A 2VLLA 4Z6AT 5D72L 5AZ2L 1P53A 3JUZA 4JFHD 4FFVC 4FQQB 4RGMB 2G5BA 2NY5L 4OQTA 2ZUYA 1A5FH 1ORSA 3SGKA 1VGKB 1S7WB 2J4WL 1L4IA 4W4OA 4AMKH 2NTFB 4FFYL 3RVXD 3HMXH 1UB6A 3BX7C 4PLJD 1ZT7A 2FHCA 3BGFB 2VIRB 4F7MB 4NC1E 2PW2B 1U36A 3QQ9D 1A7QH 2A38A 3PWPA 5IW1B 2RBLA 4L3CA 1VB9A 3UJTH 3O3DA 2CKNA 3BPLB 4OI8A 1EO5A 2FZ3B 4TUKH 4EI6B 3U4BH 4PGEA 1XCTB 4JRXD 4P2QE 3VXUE 1JYNA 3DRQA 4KKLC 2NY3C 4KUCD 1Z3GL 3S96A 3QFJB 1ZHNB 3CMOH 3WDIA 4HDIA 4JO3H 1AGCA 1GZPB 4FFWC 4BH7A 1I1AB 2XOTA 3KPSB 4CADB 2F9BT 1EGJA 2R2EA 4ODWB 2F8OA 3OKLA 2OSLB 2NZ9D 2NZIA 4FG6D 3RHWF 4TOYL 5A2LH 4ZPVA 2BNQB 5ETUB 2X44D 2O26U 2R69H 4HZAA 3LKSA 1DL7H 3SCMD 1JV5A 3CFBA 4MX7A 1L0QA 3RWFB 4NUJB 3VU2A 4XCYB 4P2OD 3SKOB 4OD2B 5E1HB 3BP4A 3TYGH 1BWWA 3BIKB 3Q5TA 3UTSD 1IQDA 2V17H 4H26A 4OCXL 3GIZL 1X5IA 3NIDE 3VGGA 2ZCKL 2DTMH 1ZTXH 5EBWB 4YXHH 2C26A 4TVPH 5FM5O 4FQQA 3KJ4B 4DJMA 5EN2B 4RX4D 2QHLA 3TBTB 1VGKA 1S7WA 3MFGB 1YEKL 4BUHA 4PS4H 2NTFA 5BV7L 4KXZH 1A7OH 5I8CB 3MQIA 5JR1L 3S34L 3S36L 2VIRA 2JLLA 4JG1H 5CINH 1T0PB 1AP2B 4OFIA 5D93C 2FIRT 1SVCP 5I1CH 5IR1B 1CQKA 5IW1A 3A6OA 3N9GL 1CDYA 2EC9T 5TDPB 1G0YR 2VDRL 2FZ3A 5DMGC 4IOFD 1OTSC 3BWUC 4KI5E 4EI6A 1F11B 35C8L 4G6MH 1XCTA 3AMKA 3T0AA 1VFMA 1JBJA 3ULUC 1CYGA 1NPUA 2CJUL 2NY0D 2BSSA 1IZKA 3IF1B 5B3NA 3QFJA 1ETZB 4JO1H 4XP5H 5I1HL 2Q3ZA 2QSCL 4KVNL 4KHTH 5DYOB 1A64A 1GZPA 4FA8A 1I1AA 2JB6B 5H8DA 3MRHB 1MFDL 2WUCH 2HLAB 5HHMD 5FKAB 4ODWA 2OSLA 2Y36H 1FPTH 4CMHB 3ULVD 5DHYB 4LSPH 4Z9KB 1F4HA 4XTRD 2BNQA 2BCKB 5ETUA 4G6FB 4F2MB 3FO0H 4AH2B 2RGSA 1W72H 1UH2A 4M7LL 3RWFA 3LMJL 4NUJA 4XCYA 2IPKA 3SKOA 4H88L 4OD2A 4CDHA 2VJXA 4LEXL 4BZ2L 2UUDH 5C07B 3WFBH 3BIKA 5E2UL 5EBWA 4HFUH 2P5EE 4WY7L 3TGXA 4ONHB 4S0TD 5EN2A 3K1KC 1C5CH 1KOAA 4PYHA 4LLUB 3TBTA 5ISZD 3F5WB 5H2BB 2WBJD 3MODH 4AG4L 2B39A 2JKXA 1LO5A 1BBDH 5HI3C 3BHBB 3CXDL 5FHBH 4LLVB 4BA8A 1AP2A 3LSOB 3SKMB 3SQBA 3KPOB 5GS2H 4HKJB 5IR1A 4G7VL 3D3VB 4OLUH 2YPLD 5TDPA 2IPUG 4OLYH 3ULSB 4M43L 4R6UA 1OP9A 2BVPB 4PYGA 1HNFA 1F11A 1EHXA 4KKBD 3BPNB 2VSDA 1LK3H 4I2XE 4JFDE 1J87A 1WZLA 2IAMD 3IF1A 3NH7L 1MPAL 2DQUL 1BM3L 1ETZA 3T09A 4LCUB 1FH5L 4D9QD 3QWRA 2Z4QB 4POUB 5IW3A 2LE9A 2DKSA 1WBXB 5DYOA 3HR6A 4K3GA 2JB6A 3X13B 4J2XA 4B5EA 4O9HH 2DM4A 4DUWA 2HLAA 5FKAA 1W0WB 4OUUB 1JTTA 2ED8A 3SGJA 1KTDB 5DHYA 2L0DA 4ERSL 2BCKA 2OTPA 4F2MA 1CK0L 3PF2A 5GJSL 4AH2A 3QNYB 4Q9RL 4R7DB 1JNNL 4P49A 4PJBF 2QQNL 2YOCA 3O4LD 4C83B 1QSFE 4AY0A 5EUOB 3PL6C 4LVNC 3TCLB 3F12A 3LD8B 2DQIL 5C07A 1IC5H 1ITBB 3GMMB 3O3UN 1A7PL 4YK4C 4C56D 2UZXB 5EOCL 2WWMC 2X4OB 4M7LT 4ONHA 3H7BB 4LLUA 1YECH 3F5WA 5H2BA 4OZGB 4HG4J 3CZFA 2Q20A 4MNQB 1DUYA 2VXQH 2GCYB 1AKJB 4LPCA 1OL0A 3BHBA 3NOIA 1CXHA 3JVGA 4LLVA 3LSOA 5TQ0H 3CVHB 3SKMA 3KPOA 3W39B 4HKJA 1AC0A 4FNLL 3D3VA 3WIIH 1EAJA 3ULSA 3WE6B 2WLZA 4XMPL 1J05B 2APTA 2BVPA 4N0UA 4GAYA 1H3VA 4X9FA 5IIEB 4UT6L 2NY1C 3PV7A 1KCRL 1DLFH 4G9FB 1XR8B 3O45B 4ZNEA 2K7QA 4PJCB 5D7KE 4HK3J 3TFKD 3GJFK 5DJ6B 3HPJA 3V0VB 5DUMH 1NUDA 1TQBC 3TBVB 2GTZA 3IGAB 4KVCH 4J12A 4LCUA 2IC2A 5H37H 4DWHA 2HTKD 4XRCB 25C8L 2Z4QA 1S9WA 3X13A 3S35L 1F3DJ 4FQJH 3NN8B 3WIHA 4GUPA 1LO0L 1W0WA 3U2SB 4YX2H 1KTDA 3CDGB 2P8MB 1PG7H 1QSEE 4S1DD 5GGUB 1KEGL 1GGBH 3QNYA 3E6FB 4UNUA 3ARFC 2QTEA 1X5KA 5EZJB 4C83A 5EUOA 4DKAA 1MCWM 3QHZH 3L3JB 3MACL 1R5IB 1VFUA 5D1XC 4Y1AE 3GMMA 5D7JB 1QFWL 3QPQC 2DMCA 3C2SA 5F72S 4WV1C 1FLRH 4M7KH 2ZNXA 3BUTA 5E1AB 5LXGL 1YQVL 5C0ND 3QIBC 3CC5B 1QLEH 4MNQA 3TO4B 2GCYA 1AKJA 2XQBH 1F4XL 5IFJB 5GS0H 1BVLB 4FQPA 1C7TA 4HBCL 3BZEB 4MB3A 3CVHA 1T6VN 1KLGA 1FVDB 2NXYC 1J86A 1RZGB 3RKPA 3NACL 1GOHA 3UTTE 5D1QC 3WE6A 4ESKA 4XPAH 5JW3H 1J05A 1F42A 2DQEH 4NC2B 3DI3B 3R0NA 5IIEA 2ED9A 4OF3A 5F21B 1UA6L 4G9FA 1XR8A 3FT4B 4IDJH 3O45A 1WCBB 4L8SC 4MSWB 3T0WA 4F7EB 4PJCA 5DJ6A 3V0VA 3W5MA 4XPHL 3TBVA 3IGAA 1FP5A 2O5ZL 1CGWA 1I9RL 2XYCA 4JRYB 2X2YA 4FHBD 4NN5C 3E8UL 2QADD 5IB4B 3GO1H 3VRJB 5INCB 5H37G 3WNKA 1RURL 3NN8A 1KLFA 3SO3C 5L2KD 3O8XB 1JPSL 1KPVA 2J6EH 3V4UL 3U2SA 3VXUD 4N5EC 1UWXH 3CDGA 2P8MA 2PO6C 2B5IC 3AM8A 2CK2A 4M5ZH 1JTOA 5GGUA 4HCRH 2GT9B 3C2AL 4IOIB 4GKZB 4P5TD 3E6FA 5HYFA 4XC1L 2BDNL 5EZJA 4QXUL 3I6GB 2BY0A 4ZFFB 4QWWC 3L3JA 2X4NB 1R5IA 5GISL 5BRZE 4XPGL 4P4KB 3HI1B 4P2OC 4AZ8A 2BXZA 4LLWB 3S5LG 4R4ND 1I8IB 4OQTL 4X99B 2E6QA 1R3HB 3NPSB 5E1AA 3CC5A 3TO4A 3EFDL 5IFJA 4HKXB 4PJIE 3GI9L 4U2YA 1BVLA 2I5YL 1OARH 4O5LL 1EO8L 3BZEA 3UBXB 3RJDA 1FVDA 3ZL4L 1XF3B 2ATKB 1TLKA 2EYSB 1MCCA 3QUZA 1N8ZA 4U31A 3QI9C 5CJXC 2LQRA 1YEFH 1F8TL 1CGYA 3UC0L 2UVFA 1VFAB 2V2TB 2FATH 3B4NA 1PDKA 3UZEA 3I2CL 2DM2A 1UGNA 5C0CB 3FT4A 4F7EA 1WCBA 4JQIL 4MSWA 2VUOA 5GGSY 5FGBA 3GJEB 5D2NB 1XGUB 4JRYA 5LKNA 2DQCL 1HHKB 1TENA 4V1DB 1S7TB 3KPLB 2NY0C 2X1PA 2YRPA 5IB4A 4F8QA 3J8F7 2KZ1B 3MNVB 3VRJA 5INCA 3NCMA 3KYMB 3BKCH 3BKJH 4JANB 3WYRA 1EGJL 5K9OA 5CSBA 1IAMA 3QDJE 1NGWB 5T3ZH 1S7SB 3O8XA 3HHRB 3MJGX 4G6AC 1IFHH 4P9MH 5MEQA 4Q9BA 1LK2B 1INEH 1PZUB 1ZEAL 1PAMA 2GT9A 3H42L 5JDJA 2WUBH 4IOIA 2VR4A 4GKZA 5D7IF 4DN3L 5IESH 4R4FH 2AJSH 3GK8H 3I6GA 4YZFE 4ZFFA 2J8UB 3A6BH 3S8WA 3IFLL 2X4NA 4NM4H 3VXSD 1NBZA 5CP7B 4P4KA 5E8DH 1U8KB 4LLWA 1I8IA 4X99A 1R3HA 5GRJL 4KQ3L 1YEEH 5CP3H 4AQ1B 2J3SA 4WW2F 1FZJB 4HH9B 1BVKB 2XA3A 1S3KL 4UI2A 2VWEC 3F8UB 4HKXA 4CN6A 1FL6B 4JPIB 4YDJB 3BYYA 2WBJC 3UBXA 3ECBB 5D96C 1LEIB 1XF3A 4NC0B 2ATKA 3KJ6L 4ZOCA 2EYSA 1CLOL 3ZKNC 3D2UD 3QQ3B 1OAQL 5I71B 2NYYD 5CBEB 4U4BA 4DK6A 2V2TA 1KCSL 4K3DH 2AEPH 4LARL 1KEML 3WS3B 1SM3H 5C0CA 1LMKA 3OG6B 2DQJH 3ZE2E 4FTVB 4S1QH 2DKMA 3UAJD 4KU1A 5J12C 1ZXQA 3GJEA 1KJMB 2QQQA 2X1OA 4GAJL 4KKBC 1HHKA 2PUQT 3BKML 4V1DA 4MNHB 1S7TA 3KPLA 3U48A 5I8OL 4PJEB 3MNVA 4I3RL 4K23H 3QNXB 1P9MA 3KYMA 5C09B 1V7MH 2OZ4H 4JANA 1J8HB 3UJIH 2W9DL 4OLXL 3S6CA 1S7SA 2KPNA 4K9EL 1KF9B 4P3CH 4J3OC 1LK2A 4JFDD 3HE7B 3RWCB 4P4RB 1K6QL 3KLHC 3SE3C 3L3GB 5GRUH 3ARRA 3RUGA 3AB0B 2GY7B 5IROA 3KYKL 2FHBA 2J8UA 3TH2T 1HHHB 3GGWB 1YNTB 4Q0XL 4UBDC 3HTLX 3LPWA 4AK1A 4ZUUB 1HKLL 3F7RA 5J7CC 4I4WB 4PJFE 1U8KA 5AG8A 4GH7B 4KDTC 3B5GA 4OSUH 2EIEA 1H3UA 1WC7B 1KCLA 5D4QA 4HS6B 4K07A 2Q8BH 5KVEL 2YD6A 1FZJA 4HH9A 1BVKA 2JB5H 5C0RH 1JGUL 3QO1B 1MAML 1FL6A 4JPIA 3GRWA 4YDJA 4MMXC 4X4XA 2CUHA 4WO4C 3VXRB 4KGJA 1C5BH 2ZUWA 2JIXB 1S9KC 3ECBA 5TH2B 1WT5C 3OAYH 2OMBA 3Q3GB 3HI5H 2VABB 2ESVE 4KK8D 5CBEA 1MCPH 3TV3L 2OR8A 1ZS8B 3SE8L 3WS6C 2AJXL 4M48H 3WS3A 3HPLB 3NZHL 4I77H 4K71C 4FTVA 5ALCL 3P73B 4R8WH 3JWOC 4JKMA 4JY4B 3B6SB 1KJMA 3EO1B 2DQHL 5HHPB 2LU3A 2DDQH 4MNHA 4PB9H 4XWGH 4ELKB 1CIDA 1IGML 4PJEA 3S97C 3TFKC 4X80H 1IAIM 1GOGA 5C09A 5HYSG 1S7XA 2JK5A 4N1HB 2EDNA 1TJHL 4P59H 1J8HA 4RFNC 2NY4C 4PUBH 1CDBA 2P47B 2JCCE 1XGTB 1SMOA 3O2WH 4P23D 1OP3K 5FUOH 3HE7A 3RWCA 2MOVA 4P4RA 2GI7A 4MXQC 5CHNB 3L3GA 1S7QB 32C2B 2KQMA 1V7NH 3RVWD 1Z9MA 5HGAA 1D5IL 2F5BL 3QZWG 2G2RA 1I9JH 1V3JA 4PJHB 1HHHA 3GGWA 4O2FB 1YNTA 3WKMH 4WWKB 3B83A 4ZUUA 1Q72H 1WUNT 2LU7A 4I4WA 1BF8A 5EDXA 3X3GL 1A4JB 5CJQH 3FRPG 1WC7A 3TCXA 4HS6A 1PG7X 4NNPH 4YAQB 4MNGE 1XH3B 4R9HA 5IB5B 4UU9B 4M8VA 1FZMA 4JY5H 5DA0B 4POZD 4WUUA 5C0FA 3INUL 3VDCA 2R4RH 3VXRA 1JUFB 2AQ2A 4Y5VC 2JIXA 4Y1AD 4G7YH 5EBMB 5TH2A 1AQDB 3CK0H 4HJGA 4WI4A 1AFVL 1M7XA 1T0NB 3Q3GA 2VABA 2X4RB 4TULH 3MRDA 4RGOL 4ONFH 3T0ED 2AJ3B 3HPLA 3SE4A 3WV0A 3P73A 4JY4A 3B6SA 3EO1A 4F37F 4UQ3A 5HHPA 2DIJA 3RVUD 4LCCC 4IDLA 1KN4H 4ELKA 1RJYA 3MC0A 3UTTD 1TQCB 5ILTL 2JJSC 4OI9A 3RAJH 3OGOE 4XVTL 1U8HB 3WIHL 4YE4H 4NC1C 2QADC 1XGTA 1AHWC 4WJ5B 4OFKA 3H9HB 4P2RA 5I1AB 5HI4D 4YIQB 5CHNA 4DEPC 1S7QA 5J11C 32C2A 3WO3B 3BZFB 4LCYB 4OQ1A 2FLRT 3IDYB 2XRAH 1NMAL 3GB7B 1BQHG 3UP1A 1G7QA 1P84J 5IVXE 3UMTA 1ACZA 4PJHA 4O2FA 4KK5C 4P5TC 1IKNC 2DMKA 5E4EC 1A4JA 4YPJA 1XGPA 4Q58C 1RIUL 4QHKJ 2AP2A 4YAQA 3U9UB 1XH3A 4DVRL 3NABH 1GC1H 5IB5A 4OLEA 2VISB 4Z78B 1UXSB 4R4NC 2P7TB 4WFEE 3KLDA 4G3YL 3CVHL 4G8EB 1JUFA 1ZGLM 1JGLL 2FHFA 4YHIB 1AQDA 4Y2DD 1BIIB 1UVQB 2P5WD 4B0MM 1T0NA 5EB9A 5E2VL 4KTEL 2X4RA 4EXKA 2E27H 4NJ9H 4M00A 5I1EL 2HMIC 2J5LC 5DXWA 2AJ3A 2P8LB 3MBEC 5DJZA 5JOPD 3ZDZE 3RA7L 1NAKL 5EH1A 2HVKB 5CGYD 3V2AR 5KSBB 1EERB 3C6LD 2IH3B 4BQCA 3VGAB 4JEGB 5GHWL 3MCKB 2XXMB 3HR5A 3LZFH 1NGYB 3DX7B 5LWYL 4WJ5A 4D2NA 3DVNB 3WLWD 2CLRB 4XCFH 5I1AA 4OGAC 1LP9E 1TDQA 2YEZB 4YIQA 4L29B 5HDQL 3MV7B 3PQYB 2BNRE 1DLHA 4KI5C 5DK0B 4LCYA 3GB7A 4XVJL 4PRIE 3OJMB 4S1RH 1ONQB 4DUXA 2VB5A 3QHFH 4OCWL 4A2MA 3QDJD 2Z8SA 3MO1B 4MB5A 3MNZB 5C0GB 4OF7A 4Q2ZB 1BMGA 3U9UA 2CDFB 3E2HB 1HQ4B 3VXMB 1Q1JH 1YPZE 1UXSA 1NKRA 3VFWB 2P7TA 2Z31D 1IGCL 1WZ1L 2YWYA 4YDKL 4G8EA 3U0PB 1T1ZB 2O5XL 4YHIA 3OKYA 3LPFA 3MLVH 1BIIA 1BJ1J 3QIWD 5CIPH 5A2IH 1UVQA 4LU5H 1T21B 1RI8A 1LGVA 5I6XB 4TYUA 5KS9B 4XPFL 4MMZC 1CS6A 5FIEA 5E00B 2P8LA 2YD8A 1A0QL 1BD2B 2J7LA 4NWTH 1D3CA 1FNSL 4HS3B 2GTWB 3U1SL 3C60B 1HHJB 4DVBB 2HVKA 5KSBA 2LVCA 1CLYH 3O2DA 4XP4L 5FCSH 3UAJC 1X5AA 2IH3A 4GSDL 3RVVD 4DTGL 3K81A 5E5MB 3SJVB 1R5WB 3IYLW 3MCKA 3VDAA 1NGYA 4BFEA 5F3BB 4L1DA 4MXWH 5L7XH 5DT1H 3DX7A 3DVNA 2QSVA 2CLRA 2YEZA 5DUBB 4L29A 3MV7A 3PQYA 4XCCL 1A1OB 5DK0A 3FT2B 3KPMB 3Q0HA 4BK5A 5FDYA 2PYEB 5EU6D 1BZ9A 3ULUF 1S5HB 4NKIH 1ONQA 4HGKC 3QJFB 2R9HC 3NGBB 4CW1A 2I60L 1XGYL 2VXUL 5BOPA 4YFLI 5JHLL 2QKIB 3MO1A 3TVMD 5DRZB 3MNZA 2Z8VC 1BECA 2AXJA 3QCVL 2F58H 5C0GA 2JELH 4Q2ZA 5EU3B 3G6JE 1T0MB 1NSNH 4ODVL 3MOBH 3PXJA 3GHBH 2CDFA 2NY7H 1HQ4A 2FR4B 3OKKB 2BFVH 4HWNA 3VXMA 3S98A 4LSTL 3ZTJH 4QOKB 3VFWA 5L0QB 1RMFL 2F54B 3U0PA 1T1ZA 4HUKB 4LPWA 1RZIB 1FCGA 2VO5A 5IBTL 4DQOL 3QXWA 1BBJB 1DQMH 5FO9B 3RI5F 4PG2A 1T21A 4LBEB 2GJZB 2EDKA 3MRJB 4AEIH 4NQEE 3AXLB 5KAQG 3B2VH 3DO3A 4XNQB 5JHDE 5IW6B 5E00A 1GGYA 3ULUH 3ETBF 1BD2A 1UC6A 1V05A 5FO7B 2CO7B 2XXCB 2XZQH 4PJXB 4HS3A 5F7NC 2GTWA 5TDNB 3C60A 3SDDD 1U8LB 5ANMB 3RTQB 4JZJC 1TPXB 4DVBA 4PTUB 5J6HB 1IGJB 2ZJSH 1OF2B 3GSNH 1MHHB 2E7LA 1QTYT 4NFBA 2J12B 3OB0K 4CNIB 1JZ3A 2RCSL 3SJVA 3TC9A 3QCUL 4TQEL 3EFFB 3OR6B 2AABH 4Y0GA 1CLZH 1TCMA 4JB9L 4FQ1H 1NGPL 5I74C 1N0XH 3V7MA 3GM0A 4DKFL 4EI5C 3F65A 1A1OA 1OGTA 4RWYL 4JDTH 4NN7B 1PSKL 4NBYB 3FT2A 3KPMA 2LAAA 2PYEA 4H8WC 1S5HA 1JFQL 4XMLL 3QJFA 4FQXD 5DD1L 2AK1L 1LD9B 5EU5A 3RY6C 4LLMB 1NUGA 2QKIA 4P3DB 1QFPA 1R24B 5DRZA 5L9DH 3N0PB 3ZE0F 3ARWA 1IJ9A 5EU3A 1TJIH 1JIBA 5D70L 1T0MA 1CDCA 4WUKH 2FR4A 3OKEB 5DMIL 4QOKA 3GRWL 4HT1L 4R2GD 2F54A 4JJ5B 1GGCL 4OIBA 1TJGL 1PYWA 5FO9A 1BBJA 2DWEB 3S88H 4LBEA 2GJZA 3MRJA 1CXEA 3D48R 3QEQE 2A77L 2FGWH 5LGHH 1TIUA 1UXWB 5CEZL 5DMKB 4XNQA 5IW6A 4YHMH 3K74B 4BQ9A 1J0KA 2OI9C 3KPSE 4TNVK 5MEOB 3F7VB 5FO7A 4TPRH 5DS8B 1PBYA 2EH7H 1CTOA 3MLYL 2D7OA 5F1NA 5TDNA 1S8DB 1U8LA 4TUJB 5ANMA 3RTQA 5J6HA 1A1NB 2GAZB 1UM6H 1IGJA 2IALB 1OF2A 3K46A 1DVFC 4PTUA 1WFTA 4Y8DC 4CNIA 5LCVH 4PGBB 4WEBH 3EDJA 1QO3B 4FQIL 5ADOL 3EFFA 3OR6A 3CDCA 1JZ8A 2UYLB 3HUJF 3RVUC 3P4LA 4I3GA 3ZO0A 1U3HB 5GGVL 3ILQD 4RGNE 1IKFH 1IVLA 1JGVL 4QY8B 3QHTC 2YD3A 3KYOB 3VG9B 2DYPD 4N0YH 1LD9A 4LLMA 4GRMB 4P3DA 1R24A 1N4XL 4M5YH 1PEZA 2VXTL 5CMAB 3S34H 2WLYA 2IAND 3IU4L 3FO1B 1OAXL 3UYOD 1S5IH 3CFKA 3OKEA 5DRWB 1EPFA 4JM2D 3MGOB 4JJ5A 1IMHC 1Q9KB 2OXHA 5SWSD 2D7TL 1N6UA 3AY4C 4L4VD 4KY1L 2ZUVA 3SY0B 2F19L 2WV3A 5BVPL 3QPXL 1M1SA 1UXWA 4W6XB 2Q8AL 3FL7A 3QA3B 3QDHA 1NGZA 4GO6B 4HSQA 3TPUB 3BUYB 4GMTH 1A6TB 3FFCB 3F7VA 4D0CB 1MFDH 2B7DT 4WFED 5DS8A 4Z7WF 1JZ7A 2WQ8A 3BAEL 3NZ8B 3ABZA 3SDCB 1S8DA 4TUJA 2WIMA 4F7CB 5F9WB 1A1NA 2GAZA 1H5BB 4LLYB 2IALA 1J88A 3OJDB 5ACLA 1I7ZB 2FO4B 1RULH 2ZSWA 4OCYH 4OB5L 3L5WB 5A40E 4PR5B 4M7LH 3S4SG 3C6LC 1ZE3C 3LEXB 4PJ5B 3WCYA 2MKWA 3L1OL 3B9KD 4BZ2H 4LIQL 4S1SL 5C07E 3MV9D 4GRLC 1RK1B 2W92A 1DEEB 4QY8A 4MJIB 1G0XA 5F7DA 2NXZB 3KYOA 4YBLB 2MQ0A 4GRMA 3KXFB 4F57H 3F7QA 4Q7DA 5E9DE 1RZJC 5CMAA 3TP4A 5KSAB 5J1TC 2DWDB 1MRFH 2BNRD 4BZYA 3EYVB 3FQWB 3VJ6A 2VR9A 2D0FA 3P9MB 1DBJL 3DX9B 4PRID 3Q5OA 5DRWA 1Z9SA 1NCWL 1QP1A 3LRGA 5GSVB 1Q9KA 4B7LA 4GLRI 3CVIL 3RNQB 4JFFB 3O3BB 4KRMB 5FK9B 3ARYA 3SY0A 2NY5C 4LVEA 4LSQH 3QA3A 3NH7H 2ICCA 3H3BC 4I3SL 4BQBA 4J7RA 3TA3D 3TPUA 1Q9LB 2OBGA 3EUUA 3BUYA 3O9WB 1A6TA 3FFCA 3DECA 4R26H 1ZLVH 4D0CA 3SDCA 4F8TA 4WCYL 4F7CA 4LLYA 1H5BA 3RGVC 3OJDA 4PLOB 1A2YB 1RPQA 4DAGL 1I7ZA 2FO4A 2P8PB 3W9EA 2ADGA 3GMQB 5E08H 3L5WA 1D5BA 5DUPL 4OCRH 4XHJD 4PR5A 2KBGA 2B0SL 3RVVC 3LEXA 4PJ5A 1B3JA 5EUOE 5C0BD 3VG0H 3NA9H 2XY2A 3BIAX 1A7RH 4NQDE 3IDJA 4LASH 1RK1A 3VFVB 4KJWD 1DEEA 2K7PA 5FYJE 4U05A 2CLVB 3HMXA 2V5TA 4MJIA 4NUGL 1J1XH 1YYLH 4ZPTB 3VI3E 4J1UB 4OGXH 4OZGE 2A0LD 2FJGB 5F7EH 1U8MB 5C2UB 4AQOA 3KXFA 3WFCH 1YMMB 1F90H 5KSAA 2X4PB 2DWDA 5F96H 2X1WL 3EYVA 3FQWA 3P9MA 3DX9A 1KGCE 1N0LA 3DOSA 5CEXB 1OAKL 2AAVA 4OGYL 3QEGL 3ZSSA 5GSVA 2OJEB 4JFFA 3G9VA 3O3BA 4G9FE 2BVOB 5FK9A 1L0XA 1LDSA 1JPFB 3DGGB 4NCC1 2ID5A 5EZIL 2EDDA 1C8PA 5JDSB 2HFGH 3WL9B 4KZDL 2WIIB 4EUPH 4MA7H 4DGYH 5BV7C 1XF2B 4CAGA 1Q9LA 1TTGA 1XF5B 2GITB 2R1XB 3MLUH 3O9WA 3ZYZA 2FO1A 3U7WH 3RWJA 1W72B 1RUKH 1MIEL 3WN5C 5HXMA 4QTIH 4EKXA 3O2DL 1G0DA 1ND0B 3MNWB 3WD5H 4LNRB 1A2YA 4OV5B 4NQED 4NO0A 3GMQA 2X1XR 1KEGH 3DWTA 4M62H 2GK0A 5HSFA 5JHDD 5ESAB 4K94L 2HWZL 3NIGE 2H2PD 2VDKH 5E6IB 3CX2A 5HVGB 5TQ2H 4XVUC 4U1LB 3MACH 3VFVA 4JG0L 3HRPA 1CZ8H 1ZT4B 4YWGL 3T65B 2D4DA 4GQPH 4HS8L 3AROA 5C1MB 4ZPTA 4OD1H 5IBLC 2AKRB 4MXVE 3KDMB 4UB0L 2FJGA 4PGZA 1U8MA 3ZKXC 2V9QA 5E4IA 2ORBL 4GBXB 1J9CT 4ZAKB 2R2HA 2GY5A 3MLXL 3LEVH 2X4PA 3ARDB 5A2JH 3K80A 2E8ZA 1VENA 1PLGH 3TT1L 2CLZB 4QRRE 3NACH 1AE6L 3FN3A 5CEXA 1S7UA 4Q97A 1KN2L 1X3DA 1MFCL 2BHUA 2IG2H 2WQRA 1ZWIB 1QVOB 3UZQA 6CGTA 3RDTB 4PJDE 2OJEA 2AK4B 5CCKH 1Z5LB 2BVOA 5ITBH 4KZEL 4L1HA 5TE4L 1JPFA 1VKXA 3BEWB 2OR9H 5J8OA 1IC7L 1ODAA 5AD0B 5HI5D 1G1CA 3QDME 1I9RH 5JDSA 4YDLB 3P30L 3WL9A 2WIIA 4RMRA 4CGTA 5L2JB 1TVHB 2R1XA 2GITA 1XF5A 1ZLWH 1RURH 1W72A 5DVNA 3AUVA 4ZXBD 4EUPG 4OZ4A 5D9SA 2NR6D 2IBZX 1ND0A 3MNWA 2E5EA 3L3HB 4HKZB 3Q48A 4LNRA 4MA1C 1BJ8A 5LGJB 4OV5A 3FT3B 1KB5A 3QFJD 5LG1A 5KW9H 3V5DB 1BFOB 3EOYG 2HT2D 3C2AH 5ESAA 5BS0A 4OCSH 4HPOL 4ONOA 4XVSL 3HG1B 3KPSD 4J23A 5E6IA 4QXUH 5IMMB 4U6XB 3X3FL 1L9MA 4U1LA 3SDYL 1RV6X 2YHGA 1Y6KR 2W07A 4LLQB 3GMLB 2BNQD 2VLRE 3ILQC 4LAQH 2DOCA 3QCTH 2KKQA 4X7CC 2W59A 2Q7NA 4PIRF 2YK1L 3LRSB 3JUYA 4EDWL 5K59E 4H0HB 4GBXA 4RAUB 4ZAKA 3BRGC 4L3AA 3QJHA 3ARDA 3BVNB 3GBLA 3MJ8B 4G43B 4PJBB 2CLZA 1SJVA 5IFAH 5T5NF 3MCLH 1V3LA 1ZWIA 1QVOA 1F8TH 4HHAB 3RDTA 4CN1A 4CVWA 1MJ8H 2AK4A 3CFCH 1Z5LA 2VQ1B 3MXWH 1FNLA 3I2CH 4HUVB 2FECI 4JO4L 3BT2L 3BEWA 5D2NE 5AD0A 4V1DE 2HKFH 1URLA 4NGHH 2N7BA 5L2JA 2RAMA 1TVHA 4D9LL 4K3EL 4IIQB 1T7VA 3JWOH 3EJYC 2R0ZH 2EDOA 3KPQA 2XKSA 5H35B 3HE6C 1PY9A 3L3HA 3HC3L 2HJKB 4Y16A 1J11A 3S5LB 3BSZL 3RWIB 3V5DA 3QDGE 5D6CB 4QHUB 5E8EB 5D71H 3WO4C 1A3RH 3QWRD 3SQOH 2X9WA 3HG1A 5IMMA 4Y4FD 2J8UE 4U6XA 5GGVY 2DLIA 5ESVB 2EZ0D 3EDDA 3BJ91 2YD4A 4NHCH 1IGFH 3QULA 4RIRB 2X4TB 3R1GL 4JFYB 4OM1L 5ABDE 5ALBH 4NFCA 2IMNA 3PDGA 2RHEA 1A6WH 3LRSA 4DGVL 4OLZL 2VDMH 5B22A 3PDDA 3EGSA 4RAUA 5T1LA 4YNYB 2VC2L 5FYLE 3L6FA 3CU7A 4WEUD 5C07D 3BVNA 4UT7L 3MJ8A 4G43A 2ARJQ 1H3TA 3DMMA 4PJBA 4PJ9B 2BY3A 1KCUL 1C5DB 1RUQL 3TNNA 2R0KL 4QXGH 5D7SH 3KPNB 3NIFF 3MSPA 5GZOD 1P7QB 3TN0D 2IBGA 2H6PB 4HHAA 1NEZG 2AEQL 3R8BB 4JKPL 4WI2A 1VSCA 1OCWH 2VQ1A 5AZEL 5JLZB 4YPGB 1FLTX 1MOEA 1E27B 4W4NA 3DURB 1RJCA 3KPRB 1FO0A 3B8YA 2CGRL 2OM5A 5DJ2B 3DBXB 2HH0L 1RZ7H 2PKDA 4YDIH 3BKMH 2CUIA 4G8IA 2Y6SC 4PJEE 3D3VD 3L9RB 3QXVA 2BX5A 1EBPA 5AYUL 5C09E 1NC2D 1ITCA 4XMKH 4BJLA 4OLXH 4KK9C 3TA3C 4EN3B 3MXVH 2FEDC 4ONGH 2HJKA 2X89A 1EEYA 4M6OL 3S5LA 3W9DA 1A7NH 2YRZA 5D6CA 4QHUA 5E8EA 1ED3B 1MCHA 4TRPH 3QIUD 4ODBD 1GGIH 2VNCA 1XEDA 4PRDB 5ESVA 2GK2A 1HCFX 5FA4B 1L6ZA 4RMVA 2V5RA 4Q0XH 2C1PA 4CU6A 4RIRA 1GGTA 2X4TA 3VFRB 3NIDF 4JFYA 5T5NG 3UCRA 1DBKH 4QYOA 4U0QB 1CF8L 1L7IH 3H3PL 1I3UA 4TVSa 4JAMB 1CE1L 4KJWC 5KVEH 3TYFB 5I1IL 1MCWW 2HG5A 4E9LA 1NKOA 2V2XA 4PBVC 3U0WH 3FKUS 5EZOH 5DEZA 1NBVL 3FB7B 3IFOB 4O51A 4NQDD 4PJ9A 3RIFF 1JRHI 3KPNA 1IM9D 2XN9B 1PKQE 3HZKB 2H6PA 2R2BA 2XACC 4PJAA 1DSFH 4KI5F 5BCAA 4MNQD 1Z2KA 5JLZA 4QKXB 4YPGA 1D9KC 1E27A 3TH3T 4IRJC 4J4PA 1JE6A 3CAFA 3DURA 4R0LB 5IGXL 3KPRA 1NEUA 2YMXH 3VWKC 5M94B 3EYUH 3DBXA 2J6EA 4ZTOH 3CX5J 3OAUH 2BJMH 5KANI 5FHAL 4X98A 1K5NB 1C7SA 4OKDA 4G9FD 4EN3A 5C9JB 4RAVB 3DHJA 4XNXH 1LEGA 4IJ3B 1QFWM 1ZLSL 3MRFB 2VR5A 1M7DA 5EU4B 1ED3A 3G5ZA 2EEDA 4X7SH 1G9MC 5E70A 4PRDA 3EDEA 1A5FL 5FA4A 2X4SB 4AMKL 2R56H 4U1GB 1D5ZB 3ZDYE 3VFRA 3HMXL 4GKSB 2H2PC 3FZUC 4ETQA 4J3UA 5HHXH 3MUHL 5T5FH 4OLVH 4JHWL 3TZVB 3MUGB 4JAMA 5D2LE 3TYFA 1IEHA 2ERJB 3KAAA 1T6WA 3T04D 4YFLF 3UJTL 1DQLH 5IJKA 4ZS7H 4TUKL 3PUCA 3INUH 3U4BL 3FB7A 5DJXB 5D7IB 5I73B 1NDMA 5D7JD 5CFHA 2YUXA 3TJEH 4HIXH 4KROC 1R6VA 3GFUA 3V8OA 4Z7UB 5HYSB 5B3JE 1UJ3B 5FEBA 3TO4D 4RGMC 3LH2H 2EDEA 2QSQA 2VLJB 4A6YA 3TBYB 5C8JB 4OF6A 4KAQH 4HULB 43C9B 2R69L 2EE9A 3BGFC 1WJ3A 3QZWB 1DL7L 1QZ1A 1VPOH 3L5JA 4MD0A 4CJ0A 1K5NA 5HI5C 4OFYA 2EXWD 1OVZA 5C9JA 4RAVA 3TYGL 1H8NA 4JPWH 2D7NA 1OGAE 4QGTA 1AIFB 3NFSH 4ZXBC 3MRFA 2AJYH 2V17L 4JRYD 3SDAA 1G7MB 4KJYB 3QDMD 2DTML 1ZTXL 5EU4A 4YXHL 4ETYA 5FYJU 4TVPL 1NMAH 4X9BA 1AGBB 4XXDB 5ADPH 2BSRA 4W70A 1H15B 4NDMB 2X4SA 3BDXA 3KYNB 4PS4L 2QQLL 1D5ZA 3O8XD 1HOCB 4GKSA 1A7OL 4H25B 1RZFH 3S37X 4JG1L 5CINL 4R97C 3BD3A 4WFFD 3MUGA 1M4KA 5HVHC 4RISH 1CN4A 3G6DH 4K9EC 3K2UH 4FN0A 2ADIB 4U6HB 1W0VB 1KBGH 3HAEG 4G6ML 1SVZA 5MEPB 3WJJA 4G3YH 5DJXA 3E6HB 3CVHH 2COQA 5D7IA 5MP6H 1SY6H 3MRNB 4L3EE 4N0CC 5BZDB 4JO1L 1BFVH 4XP5L 4Z7UA 4KTEH 2VLRD 4RGNC 5HYSA 4KHTL 2XIDA 1QYGH 1UJ3A 4HEPG 4MJ4A 5LBSH 1MI5B 1MHEA 4Z7QE 4ZUVA 2WUCL 5I0ZA 4ZO7A 4BFBD 3VFOB 2Y36L 3VA6A 2CDEB 1FPTL 2VLJA 4E41B 4B7IA 3OG4B 3TBYA 4MAYC 4LSPL 5C8JA 5KSBE 1JI1A 1JL8A 43C9A 1BQHB 5CD3B 3LAFA 3QZWA 1W72L 3GNMH 1UM5H 2ZPKL 1X5JA 3I3EA 4O2EB 5CSGA 4X4YB 1BF2A 5D7LE 2VERN 2C1OB 1L0YA 4OF8A 4NN6C 5J89A 5C0CD 4BSVA 3WFBL 3OZ9H 1CFVH 1AIFA 3PQYE 4JKKA 3FRPA 3VXPA 1G7MA 4KJYA 1WBYB 4V1DD 4HFUL 1AJ7H 3QAZB 4X6BB 3ALPA 1AGBA 4XVJH 4XXDA 1C5CL 4HBQA 4TTDD 1MCOH 1H15A 3BYTA 3MODL 4NDMA 1RUPH 4OCWH 3KYNA 5T1KB 2FX8H 2PNDA 1BBDL 3N50A 4XAKD 1A6UH 3DX8B 5FHBL 4Y4FC 4P57B 2XTJE 4Y5XC 1EUUA 1RD6A 4G8GB 4Z5RB 3QDGD 4KHXL 4OLUL 1NAMH 43CAB 4OLYL 3I02B 2ADIA 4U6HA 1MJ7H 4U7MA 1WZ1H 1QD0A 5MEPA 1K4DB 3E6HA 4YDKH 3MRNA 3K0WA 1LK3L 5BZDA 5JIKA 1RU9H 5KS9E 3O6KH 4EBQH 1HILA 3IU3B 1A4KB 4W81A 5HYJE 1A21A 5DJ0B 1NBQA 1MI5A 1L9NA 4O9HL 3TN0C 1A0QH 3NCCB 4YC2B 5KVDH 3VFOA 4XXCC 2CDEA 3U1SH 4E41A 5CJ5A 1FV1B 4ODSL 3OBAA 5E2TH 2W1NA 1BQHA 3SJVE 4DTGH 5CD3A 5C9KA 1K9TA 5C08A 5I1GH 5CEZD 2A9MH 4U0RB 2B1AH 2B4CH 4FTVD 5JIIA 1IC5L 5FDWB 4GRWE 1GAFH 2L7UA 1WBYA 4WGWB 4L4TA 1U2HA 5I75C 4X6BA 5FKPB 5DD0H 5C09D 2BNUB 1C08B 3OQ3B 1YECL 1KJ2H 1J8HD 4Y19E 5D8JH 3AMLA 4Z95H 5HPMB 1UEYA 5T1KA 2N56A 3VRIB 3QIUC 4NO5B 4MB4A 4K7PY 4JKLA 3DX8A 4P57A 4XP6H 3HE7D 5TQ0L 4G8GA 1E4XI 4Z5RA 2R8SH 4IM8A 3IDIB 43CAA 4WENB 1YY8A 1D5MB 3I02A 4PJIF 3H3KA 2C3XA 4HPYH 4LRIA 1K4DA 5HVWA 2AW2A 3RUGF 3TBSB 1DLFL 2IPTH 2FEEL 4PV9B 2MFNA 4KVCL 3T2QA 2Z35B 3C5ZB 3L7EB 1A4KA 1GYAA 5I9QC 2QL1A 1F02I 1RIVH 4OZHB 5DJ0A 2G9HB 5SWZB 4FQJL 5DRNB 2Q3AA 2DQTH 4HH8A 3W0WB 5D1ZD 4PJXE 4MDJB 3GBMH 2JIXD 4OZIE 3J7HA 4YX2L 1FV1A 1PG7L 4AEHH 3ZYOA 1GGBL 2YSSB 3T4AB 5EOQL 3CDFA 4WW1B 4TQEH 4X7TB 3RBSA 4YH6A 1WIOA 1EEZB 1FNGB 5CZVH 2Y25A 5B38G 3QHZL 2CH8A 3LQAC 5FDWA 4WI7A 4P5MB 4DKFH 2R1WB 1I8LA 1KIPB 1PSKH 5KZCB 5FKPA 1FLRL 4M7KL 2D0HA 3QUYC 4NPYA 1OWWA 1QLEL 3DVFA 4KRLB 5HPMA 4F7TB 2OR7A 1NLDH 4ZO8A 4ZODA 3VRIA 3JZ7A 5EBLB 5GS0L 1FFNB 4PRHA 4GLRH 5EFIB 4FZ8L 3BRDA 2NX5E 3FFDB 2AJVH 4OM0H 2VRAA 1I8KB 1IAOB 3IDIA 5CIPB 3FO9B 1DANT 4UMGA 3FQRB 1D5MA 1OTTC 4XPAL 3EO9H 5DMIH 5JW3L 1HYRC 4WWKD 1VFOA 3G08B 1T7ZA 1FFQA 3TBSA 2EIZB 1TJGH 1KELH 3IAGC 4PV9A 2NY3B 2Z35A 3C5ZA 3L7EA 1YJDH 3K4ZA 2BVYA 5D7JC 2LTQC 1IGYB 1CXIA 1ZKAA 3GO1L 2DL2A 4OZHA 2G9HA 1OP5K 5SWZA 3WBDA 5DRNA 3W0WA 1FC2D 4NQCB 4MDJA 3ZHKA 2J6EL 1U8PA 1T5WB 4M5ZL 1IC4H 4GS7B 4HCRL 4Y2OA 4XWOC 3GJFH 3O6FC 2YSSA 3T4AA 1TCRB 2BERA 4WW1A 3KYAA 4X7TA 1EEZA 2PYFB 1A6PA 1FNGA 3CU1A 1ZA3B 1ZLUK 1EHNA 2QV2A 4Y4HC 4JCLA 1L6XA 1PVHA 3MGTB 4LHUD 4PD4J 4H1LH 2RB8A 4P5MA 2R1WA 2Y1VA 3UEZA 1OAYH 1KIPA 2EXWC 1XT5A 3UX9B 5DC9B 5C7XH 2XY1A 3T2PA 4KRPC 4YBQD 5IWLC 3G5VB 5F6HI 3CGTA 3EYSH 3T3PE 5EBLA 1FVEA 3CDYA 1FFNA 5EFIA 1OARL 3FFDA 5GRWA 4Z7NF 4P9HC 5D93B 1IAOA 2ATPB 5B4MC 3FO9A 1CFNA 5A16B 3FQRA 1YEFL 1EXUB 3QEUB 2FATL 4QNPE 2DKUA 3MLTB 3G08A 5F3HB 3NBNA 2EIZA 3BEVB 3EOTL 2Y9RT 4JFEB 2D31B 1JNLH 4PJHF 2F19H 3CD4A 2VMFA 2GJ6B 1U8NB 3QPXH 3IDUA 5DJAA 1BHGA 1IGYA 3GSNB 2E7MA 3R4DA 4XX1E 3BKJL 3BKCL 3LN9A 4NQCA 3C5JA 5T3ZL 4PJ7E 5C0DB 1I7UB 3EDKA 1R3JB 4P9ML 1T5WA 3MUJA 5DWUH 1QBLL 1CVSC 3MLRL 3CSBA 1CFQB 2IADA 4LSRH 4PJGF 2WUBL 1TCRA 3D18A 5IESL 1U91A 15C8H 4R4FL 4D3CH 2AJSL 2PYFA 3LB6D 4OZFG 3ZT6A 3GK8L 4NBXB 1ZA3A 3A6BL 1RZKH 4NM4L 3MGTA 4X4MA 3V7AE 1YEIH 1G7HB 5T33H 5E8DL 4GT7A 1I3VA 4LKXB 4JFXB 3NPZB 1VFBA 4H1LG 1U9KA 1YEEL 5D2NC 4PGJA 2VDQH 4IOSD 3LY6A 3ARGC 5KSVB 1CR9L 3G5VA 5D7LD 3KXFE 2ZUQC 2IFFH 2CRIA 4R90H 2C7UB 4ODUA 4JY6B 3MV7D 3PQYD 3LKNB 3VWJC 4TSAL 3QUMH 2ATPA 5A16A 4YR6B 1EXUA 4HF5H 4KQ4H 4K3DL 3FB8B 2AEPL 4NRYB 3HB3C 5HPOA 5F3HA 1TTFA 4NQTA 4X6FB 3BEVA 3CNKA 1J0YA 3TBWB 2DQJL 4S1QL 4JFEA 1VCAA 2D31A 3PWNB 2XTJD 1U8JB 2HRPL 2WINB 2GJ6A 1U8NA 5LJYH 4WI5A 2EDJA 3T0XA 2B8OT 4I3SH 3GSNA 3K2MC 1UWEL 4K23L 3VXMD 1V7ML 2OZ4L 3S4SB 2GFBA 2V2WB 1KJVB 3T77A 3UJIL 1YNLH 2OX5A 5C0DA 1F4WL 1I7UA 2JJTC 4GOSA 4P3CL 5CWSA 3EHBD 4HAGA 5SX5K 3BP6A 1CFQA 2K3TA 5GRUL 1KB9K 5AAWA 4U1JB 4M02A 1OT2A 4X9IA 1X4YA 5HYJD 2B0SH 2D2OA 1BD2D 3DIFB 4LVNB 5BVJB 2EDQA 1G7HA 1NCUA 3PV6B 4J3TA 3C60D 5FGCB 4PJ8C 4JFXA 4OSUL 3BN9D 4UAOB 3V5KB 3BO8B 3B9VA 3SJVD 3CFIC 4PY8I 2Q8BL 3KHOA 5HHOE 3O41B 2JB5L 5C0RL 1HKFA 5KSVA 3BGMB 4LGSB 3AAZB 3QP3A 3H9SE 1YMME 1C5BL 2C7UA 4JY6A 2DM3A 5FV1L 2AV1B 1VA9A 2VZOA 3HUJB 3LKNA 4U6YB 2PYED 1PX3A 2AXFB 4MS8C 3HI5L 5J9PB 4YR6A 1MCPL 5JXEC 5A2KH 3FB8A 1BJMA 1ZT1B 2CK0H 4NRYA 4M48L 4BUGA 2NY1B 2NNAB 4X6FA 3TBWA 4I77L 4R8WL 2X40A 3PWNA 4XPBH 1U8JA 4M7ZC 2PXYB 1TQBB 5EIIB 2MQCA 2DDQL 3TNMB 1Y6NR 4XWGL 3BP5B 4X80L 5DO2C 4KWUA 4I18B 4KZDH 3S4SA 3I6KB 4P59L 4QOKD 1KJVA 2F54D 4BKLB 4PUBL 2NY2C 2OS7A 3O2WL 1XCQB 2ICWA 4GXUM 5FUOL 1A22B 4LL9A 5D1ZC 1KXQE 5F97E 1YQ2A 5DZLA 4U1JA 1V7NL 1ZVHA 3WDJA 1Z9OA 3ARFB 3P0VH 1GRWA 1I9JL 3WKML 3PL6A 3DIFA 1LP9F 1DQJB 3MV8B 5BVJA 2DM7A 1JI2A 4ENEC 1PFCA 5D1XB 4NWUH 3ZE1E 1XMWA 4JRXE 2QJDA 3PV6A 5GQBA 4WWID 2XWJB 3RTQD 5CJQL 3SDXE 1OW0C 4LCWB 5IUSA 5CD5D 1B6DA 1IL1A 3V5KA 3C5SB 1DN2A 3BO8A 1OTUD 4UQ2A 3TPKA 4NNPL 4Z7WB 1J18A 4JFZH 3O41A 3QIBB 1Q94B 4JY5L 4NKOA 4UB0H 3BGMA 1T1XB 1O7VA 3AAZA 2P45B 4P46D 2DBLH 1G84A 2R4RL 1XFPA 2DL9A 2AV1A 3CK0L 1FYTB 3HUJA 1KB9J 4KKNA 2NXYB 5BJTB 4U6YA 2ZG3A 1NMBH 1WFNA 2AXFA 1YPZF 3FTGB 5J9PA 4TULL 5D1QB 2VDNH 2OTWA 2ZUXA 1A9EA 4ONFL 1JMXA 1ZT1A 2NNAA 1AO7B 4U49A 2HFTA 5JW4Q 5GRYA 1CFTB 4MVBC 2NX5D 4WWKC 5EIIA 3MFFB 4M3JA 3UTSE 3TNMA 3DXAB 1P69B 2B1HH 4NN5B 1B9ZA 4WTWA 3BP5A 4JRWA 4C55A 4GW1B 3RAJL 5ESQB 3CFDB 3I6KA 4YE4L 1D5XB 2FJFB 4I0CC 4BKLA 4LRNH 3SO3B 3VI4E 3W2DH 1XCQA 4OAWB 2YUZA 2PO6B 2B5IB 5C6TH 3BMWA 1NGXB 2XRAL 1CGTA 3ARFA 5EORH 3BD4A 3PP3K 1DQJA 4Z18A 3MV8A 4DKDC 2QLVB 3WEXB 2APBA 5D1XA 1NUNB 2XWJA 4LCWA 1PX4A 1OP3H 3C5SA 1KFAH 1JK8B 2E9BA 4WV1A 1HDMB 2A83A 2XPGA 1JRHH 2OP4H 1AY1H 4HW6A 3NABL 3QIBA 1K85A 1Q94A 3PHQB 1Q9WB 4LVHC 1T1XA 1TQCC 4U3XA 3P9WB 3SOBH 1U3HD 2OL3H 1ZAGA 1T83C 4FMFA 4XBGA 3BDYH 1BEYH 1FYTA 5IVOA 5BJTA 4NT6A 4PJBE 3ULVE 1R0AH 4MQ7B 3QI9B 3K8MA 4HEME 5D1QA 2E27L 4NJ9L 5AUMB 3O6MH 4S10A 2VLKB 4EUPB 4L8SA 1BZQK 3QB7C 1CFTA 1I7TB 3OJ2C 3VW3L 4JO4H 5IVZB 3MFFA 1NFDA 3DXAA 3MRLB 1JWUB 2AEIT 4GW1A 5ESQA 3CFDA 4LPVA 4WI9A 1D5XA 3A67L 4JGJA 3H0TB 4M1GH 4DW2H 4R3SB 2ZOLA 4OAWA 4NQVB 4Z77B 4N90D 4XCFL 5AEAA 2PO6A 4GW4B 5JNYB 3U0TB 1NGXA 1T7YA 3IKCB 1BPVA 4S1RL 2YPLE 3QHFL 1F5WA 1MWAB 3FFCD 4HMCA 3WEXA 1OT1A 3MRBB 3SDCD 1GVIA 4LDLB 3N85L 4P2OA 3ARED 4GG6E 3LN5B 1P2CB 1ZVSB 1MFAH 2PTUA 1W8OA 1JK8A 2BOCB 1HDMA 1G9MH 4K7PH 3PNWB 1X5ZA 1BJ1H 3PHQA 2Y5TB 1Q1JL 4EQ3A 1Q9WA 4DGVH 2EYRA 4PJ5D 3VGAC 3NCJL 3V6ZB 4RX4A 5LQBH 2WBJB 3RZCD 3MLVL 5D96B 2DAVA 2HN7B 4K94C 4LU5L 4TSCH 4KV5F 4CMMB 4IRSD 4MJID 3QI9A 4MQ7A 5CJXA 4N8CH 4HGMA 4PRBB 2NXZD 2P48B 4ZSOB 4DGIH 2MPAH 3RRQA 2VLKA 4JKPH 4X7DC 4EUPA 4P5KB 3KXFD 5KANG 6FABL 4Q9QH 4KK6D 1CT8B 5C0JB 3MRIB 5J12B 1EFXB 4U1NB 1KJ3H 5IVZA 5BQ7B 2LFGA 4C56E 3MRLA 1CLYL 1JWUA 3OKNB 3RX8A 1EJ6A 1FORH 1U8QA 2XTJC 5EO1B 3RL2A 3IJHB 1AH1A 3QEHB 1EEUA 2BVQA 4MXWL 3H0TA 5L7XL 5DT1L 4R3SA 3E2HC 3OWEA 4JFFD 5J4MA 3WJLA 4M9PA 4NQVA 4LDEB 4GW4A 5JNYA 4S2SB 1CDIA 1QRNE 3RL1B 4P99A 1KSRA 3IKCA 1GHFH 2VLLB 5E94B 2DLHA 5CUSH 3U46B 1SBBA 2G5BB 1MWAA 4TN9A 3O9WD 2CD0A 2Y07H 1UENA 4HUWB 3MRBA 3O4LB 3LN5A 2F58L 2OQJB 1UB6B 2A6KB 2JELL 2F5AH 2BOCA 4ZUTB 2VKWA 1PKOA 3MOBL 1A3LH 3GHBL 3PNWA 3EYQD 2NY7L 3W5NA 5DI8B 2Y5TA 2BFVL 2E7LC 1NEZB 2Y06H 4TVPD 3V6ZA 2C5DC 4WO4B 4OT1H 5ISZA 2WBJA 2E7HA 3TEUA 1DQML 2HN7A 5GZND 1JWSB 5IP4A 1T7XA 4AEIL 1IGIH 4CMMA 3B2VL 4LOUD 2XN9E 4ZSOA 2B2XH 3ULUL 4P5KA 3SGEI 4K71B 5FYKH 1IZJA 3H9SD 1CT8A 1Z9LA 2FLBT 1YMMD 1EFXA 2XZQL 4U1NA 1INDH 4WFGE 5BQ7A 3QFDB 2R2EB 3PP4H 2ZJSL 3GSNL 4PP1C 1OQOA 2Z92A 3MLSH 3FCTB 3QUXD 5EO1A 1QFOA 3QEHA 2ILLA 2AABL 1CLZL 3NCYP 4RFNB 2NY4B 3AGVA 3PABB 4GAFB 4YHOH 3OXSA 4FQ1L 2EDYA 1N0XL 5F7WC 4CDGC 5C70A 4M3KB 4S2SA 1S9XA 2CMRH 5HYQB 3RL1A 4N8VG 3BI9X 4JDTL 3JWDC 3SE3A 2IBBA 4HD9A 4G6JH 3DVIA 2WM0A 1ZLSH 1IQDB 5E94A