4FQJH

Influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
228
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGASVRVSCRASGYIFTESGITWVRQAPGQGLEWMGWISGYSGDTKYAQKLQGRVTMTKDTSTTTAYMELRSLRYDDTAVYYCARDVQYSGSYLGAYYFDYWSPGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/immune system
total genus 42
structure length 222
sequence length 228
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH01
2HKHL 3D2UB 3MRQB 3AREC 4QXUL 5JIHA 4PRHB 4TULH 3B2UC 4YH6A 1JTTA 2VDPH 1UH3A 5DEFA 1Q9WA 2ID5A 3V5DA 3R8QA 2YD8A 4S1DD 1MLCA 1KIRB 3RTQC 2O5ZL 5HD8C 4PJ8A 1XGYH 3NA9H 1HH6A 2XIDA 3L3JA 3FO2A 5GGTH 1LEIB 1I7TB 3WS6A 5HHMD 1U8KA 2WANA 3I02A 3CK0H 1EGJH 5D7LA 1DEEB 3B9EA 5DJZB 4NM4H 3ULUL 2EDWA 4R7DA 4WEBL 4WU7A 4HKZB 1T6VN 4YZFF 3P73A 4X99B 1DANU 2RBLA 1F3JB 1QA9B 5EOTA 5FKPA 1RFDH 2X40A 1RUQH 2Y9RT 4IRJB 5DR5H 1PD6A 2NY1D 4OFIA 3EHBD 4X7EC 5EIQA 3QDHA 3TZVD 3ZYIA 1A7RH 2K7QA 1ERNA 1HILA 4JRYE 2AJ3A 4PJGB 3JTTA 3JZ7A 3MGTA 2BCKA 4LLUB 3GMOB 4M7LH 4HDIB 4ZO8A 4AEFA 1BFOA 1CICA 1K8DB 1CD9B 1NUDA 4GXUN 1N7ML 2V6HA 3CCHA 3IGAA 4ZO7A 4XXDA 5E6IC 1Z2KA 3QPXH 1A3LL 4YHLH 5LKNA 5FAAA 1FSKC 5C08D 1C16A 1R5VB 5IFJA 3P9MA 4P23D 1QRNB 4ZUSA 5HI3D 3L3HB 1MFBL 1SJEB 2CUIA 2DWEA 4M48H 1U93A 1K4DB 4DZBB 3HZKA 3GSNA 1OAUL 3BKMH 3T4AA 3O45B 4ZFOL 1KEML 1PKOA 1LO3H 3KVQA 3KDMA 4MQSB 4ZPVB 1D6VH 3TYGL 2D03H 1V7MH 5CJOL 4DKAA 3QFDA 5EN2A 4JPIA 5CSBA 5HDBE 2UV3A 2XA8H 1JNNL 2E27H 1RPQA 4PGEB 1IGTB 2VZOA 1VPOL 3EO1A 5FO8A 2F5AH 2P47B 3IFLL 5EOCL 3B5GA 4NOBA 3VMPA 5C0DB 4MCYB 4YAQA 2XT1B 3SDAD 4JFPB 1MCLA 4KQ4L 5FA3A 2NY4B 3MLSH 4MZ3A 4FNLH 4U1LB 3SDXB 2F53E 1U8LA 1S7WB 1I3RB 5HPMB 3KPNB 5D93B 3Q0HA 1FFRA 4ZYKB 2V2TB 3WFHA 3IKCB 4DEPB 4CNIB 2IAMC 4Y5YA 1YDPB 3MLYH 3QG6A 1N4XL 3ZTNH 4LHUG 4LLYA 1ES0B 2XPGA 3QEUB 5TF1H 4AM0A 1NMBH 1AGFA 4MJ6B 5C86A 2CDEB 2EDDA 3MXWL 4QHKI 1S9WA 3VXOB 3UTSD 4AT6A 1MWAA 5SWZD 1NANH 4KWUA 4POZD 4E0RB 3VI4E 5KZCB 4Q9RL 15C8H 5IB3B 1U2CA 5C7XL 4KI1A 3RWEA 1A4JB 5GSRB 1FG9C 3IFOB 4K3HA 1KJ2B 2EH8L 4O02L 4L3CA 4CN4A 3X12B 1A8JH 2VDNH 4RQQA 5I1HH 4CVXA 3VRLE 3TBYA 1E4KA 5I6XB 2HFGL 1IGMH 3TYFB 5BO1H 1CU4H 5F7FA 1U6AH 2PW1B 2P5EA 2PYEB 3W11D 5ESAB 3UBXI 4R97C 3O6KL 3MV8A 4WWID 5C09A 1T5WB 1EV2E 4QGYA 4DVBA 4J1UA 5HDBF 4WEUD 5TH2A 4NQSA 4ONOA 1SEQL 5CLWA 1LE5A 1I1FA 4N8VG 4ZQKA 3U7YH 4YXLL 4AENA 5C0BB 1N64H 4YFLF 1IC7H 3I2CL 1OPGL 3SJVD 3OKKB 1BQHG 1G9EA 1AH1A 4CBPA 5A3ID 5AZEL 3AU1B 4KQ3H 3ZT6A 1MCEA 2FJHB 3ARZA 3CX5K 3MNWB 1FLRL 2NY6C 1WBYA 3C2SA 4XH2A 1BZ7A 3SE4A 2L0DA 4P57A 3D3VD 5K9JL 3MBED 2JJTC 1NGZB 1R5VA 5I8KH 5F7DB 2RJMA 2HFFB 1CE1L 4HFUL 1NCNA 5J1AA 5J6GA 4N9OB 5E2WL 1M7XA 3VI4F 1NMCB 1QBMH 3T4YA 4AIZA 4CU7A 1JGVH 4P99A 1T4KA 4X0KB 4IRSA 5JOPE 1AHWC 4PR5B 1CGUA 3RZWA 3GO1L 2IQAB 3UJJL 2PW2B 1J8KA 3E3QC 1U92A 3VRLF 4KXZH 4NDMA 4Z9KB 1MH5A 4K7PX 1CLZL 1IEAA 1RQ5A 4ODHL 4NQVB 1A7QL 3MRDA 5DJ8A 1WT5C 4JQXA 4DAGH 3NGBB 4XAKD 2ICWA 2V7HA 4Y5XC 5EWIL 3NACH 3SKOA 4WO4D 3FOLB 4IDJL 3QFJD 2NY7H 3U79A 1HHIB 2DQCL 1WF5A 3RAJH 1XF2A 4LVHC 3ULVD 2VYRE 1CVRA 1MPAL 1YPZB 2A6KB 3O6FC 4JLRB 3VFVB 1S7WA 2A9ML 4NQUA 4DTGH 4AEHH 2Y1VA 2APBA 1M7IA 1NGYB 2FB4L 2BVUA 2CK0H 3QWRD 3NFNB 3WD5L 1G9NC 2OR8A 3Q6GL 5E1AB 2VLLB 4K23H 2V7NB 4ZXBC 2OZ4H 5C0AA 5I19H 2VDKH 3DBXA 3MUGB 3DPBA 1AE6L 4NZUH 1FVDB 4TSAL 4E41D 3UBXG 3MCKA 1F8TL 3EOTH 3G6AA 3MJ9H 1RUAL 1R3KA 2VLKA 4JKPH 4QHLB 1BM3H 1NBQA 1CK0L 2VAJA 2EYSB 3V6ZB 3SGDI 4N5ED 1IMHC 4IMKA 2FHBA 2JCCA 3WNMA 2P8LA 4L9LA 4L4TB 2YKLH 4G8EB 4A6YH 1DLHB 1B4JH 1OSPH 1EIBA 2DB8A 3VXNB 5I1EH 4WWKA 3VGDA 3V52H 2GUOB 1B88A 3TIEB 5CEZL 5EO0A 2MMXA 3JV6A 3MLTB 3RWFA 4U1SA 5I1CH 1VSCA 5C0ND 2XOTA 2FYYA 3KPPB 5E99H 4GXVL 3L3GB 3IJYA 5CD5D 2ATPB 4NFCA 3S37H 3GSOA 1HQRA 2JLLA 4LK4A 4RRPG 5HDLA 5HYQB 1U91B 3RNQA 5L2KA 3WEXB 2F74B 4X83A 1U42A 4TUKH 3UJTL 4P2QB 4V1DB 3QXDA 5EU6B 3VFPA 1P69B 1YA5A 5DYOA 2X89A 3U48A 4Z8FL 2QSCH 1OQXA 4EQ2A 1DVFD 1DBJL 4GS7C 4XRCB 3A0OA 5B4MD 5E5MB 1FCCA 4M7KH 4RFEA 2VXSH 4NKDB 1CD1A 4XPAH 4QHNA 3TFKD 1Y6MR 5INDA 1WCBB 4HC1L 3O9WA 3MRGA 2R1WA 3KPLA 4OB5H 5CHNA 5DHVA 1PW3A 2D7QA 3QEGL 1BQUA 4P9ML 4ZTPH 4GQPH 1RJZB 4JM2A 3MJ6A 1E6OL 5E8NA 4OAWB 5DQ9A 2JB6A 4F37F 2BSSA 3MYJA 2HTLD 3MZTA 2E7LC 4OZHB 1BGXH 4F9LA 4ZODA 4MVBC 1VKXB 1F4WL 3P4MB 2OBGA 3K80A 4HJGA 4EUPH 5C0EA 3L5XH 3EFFA 5MERA 3P9WB 1RZIB 5I1GL 1HHGA 3I3BA 4XP4H 5EH1A 4DUXA 2PXYA 2VWEC 1ZEAL 1KCVL 1XCQA 2ENSA 1SEBA 4P5MA 4RAVA 2EH7L 1TQBB 2C3VB 3U4EB 1ZGLM 5IEKB 3SDDC 1DQQB 1VFMA 3LD8B 1DBBH 1K4CA 1ZHKA 4PY7B 2C4XA 3S5LA 2BDNL 1DE4A 4LNVA 2BK8A 5MENE 4IHOB 1VADB 4CVWA 5E8PB 4Y7MA 1NBYA 3A6CH 2XZQH 4U6TA 2BXYA 5J06A 3IS1X 4K2UH 1QLRB 5DXWA 1DBML 3IRZA 5TDOA 3GSXB 2X4UA 4M1GH 2XA3A 1I8KB 3FQWA 2ZJSH 3RX7A 1N0LA 1KJVB 4N68A 3FQNB 1D5MB 2Y5TB 1CGXA 1KB9K 1T6WA 3OKMA 2RHEA 4GAFB 4RFOL 3OGCA 5KVEH 1GIGL 2JB5L 3INUL 3FQRA 4K3EH 4O2CA 1UQSA 4U31A 2V5RA 5HGBB 1YY9D 4OUUB 4XVSL 4LLDA 4NJ9L 1F00I 5GZOD 1KCRH 5IB5A 1XR8A 3I6GA 1NAML 2MPAH 2H26A 2NNAB 2CDGB 3QCUH 2IADB 4N8CL 3HR6A 1A2YA 3BO8B 3W82A 1J18A 1EVUA 1MCHA 4H25A 4ZFFA 1P7QB 4U49A 4J3WA 1D5ZA 2DKUA 3AB0C 4U4BA 4H0GA 2ZUYA 2Q6WA 3GRWH 4RMQA 1I1YB 1XIWB 3BPOC 3BXNB 1CFQB 2P43B 4OT1L 2AXFB 3O2VL 4OLUH 5JNYA 5SWSD 2AEWA 3H9YA 4NQDE 3QUZA 2F54D 3UYPA 5C3LD 3U7WH 5C08A 3MRJB 4JY5L 4BFIB 1H3PL 4P23A 3GNMH 4P2OC 5I76B 5FGBA 4FQ2H 5J6HA 5KANI 5C2UB 4J8RB 4PTUA 4UTBL 3MOQA 4R90H 1D5BB 3EYFB 2EXWC 4UQ3A 2SEBA 3QQ9D 4R3SA 2VLJD 4C4KT 3IDGB 2DLTA 3MLVL 1MHPH 3PV7A 2E5EA 4CU8A 3BN9D 4OCYH 5MEPB 3CX5J 2M2DA 1UENA 4M6MH 1REIA 4PRID 4MZ2A 2DKSA 4F58H 5E8OB 4AG4L 3BIBX 5TGBA 2ZNXA 3MRIA 3BJ91 5CMAB 4YBLC 5D7IE 4HW6A 4HUVB 5EU4B 3KYOB 1W72H 3TLRA 1UJ3B 3TV3H 4F80A 3DETD 4HWBL 4KI5C 3HC3H 1OSZA 5E8EA 4YXHL 1EUTA 4WFGE 3V5HA 3WSQH 2NW3B 1UZ6E 1U8JA 3DROB 1LK2B 3HRZA 3CVIH 4L4VE 4N9GB 1SJXA 3EFDL 3HNTH 3O8XC 2G60L 3SQBA 1VHPA 5TE6L 4WHYH 1IQDA 5ANME 3LRGA 5SWZA 4OZ4B 1S5IL 3IDNB 3HE6B 4PJDA 4OQTH 2ZG2A 5KG9A 3N9GL 3WE6B 2R0ZL 5KN5B 1JPGA 2AABL 2EDKA 4Y2DC 2D7PA 1RZ7H 1FZOB 4JHAH 5C3TA 3G5XA 3KXFB 1JNJA 4N90E 3R8BB 3KAAA 3LRSA 1HH9B 2FX9H 2G5BB 1ZT1A 4TVPH 4Z7VB 4YO0B 1FZJB 1NC4B 5MHSD 3MO1B 3ZKSD 3CSGA 4DZ8A 3SE9L 1P9MC 4LCYA 1FN4A 4XCCH 1NSNH 4G80B 4XWGH 1HHKB 4N8PA 5GGVL 4MAYA 3BDYL 1NGWB 5E2JA 2WBJC 3GHEH 4KK6C 5CWSA 5D7IF 1NGXA 1ZT7A 3SDCB 1KG0B 5D2LB 3NTCH 4F3FA 1EGJA 3SJVA 3PWPB 2X4RA 1MY5A 3DUHA 1G7PB 4FQPA 5GS2H 2DYPB 2VLMD 2X4OB 3IDXL 5KSAA 4FG6D 2QEJA 1CDJA 4ZS7L 5T3ZH 1DQML 5GRJL 2RFXA 1UWGL 3NCJL 2C1OA 5F9AC 5GGQL 1TJIL 2A73A 5CILL 1KIQA 1WFTA 4RBPH 1HEZA 3K46A 4JPKH 3N85L 4Z6AT 3D3VA 3DRQA 3MBEA 1KULA 5DQJB 1TVBA 1G0DA 3DGGB 4KC3B 4OF6A 4Z7UB 3UTTE 1A3RL 2PR4H 5T1DH 5IGXH 5DJYA 4OGYH 3PP4H 1AGBB 4WENB 3OXRA 3LKSA 2HLFC 3SEPA 4CVUA 3LN4B 43CAA 5KS9E 4I2XA 3DECA 4MMXC 5LAXA 1TTFA 1GXEA 4XP1H 1RZKC 3GSUA 3O0RH 1QSFB 3OKDB 3V7AE 1FBIL 4EDXA 1QOKA 4HV8B 3T0BA 3SO5A 4HPYH 1PVHA 1U95A 1UXSB 2C3WA 1R5IA 2EXYD 3RL2A 1OL0A 1I9IH 2GJZA 5DLML 4MAUL 5CKGA 5J1TC 1I8MA 4WO4A 4R2GC 3QFJA 2ADIA 4GRLD 1UYWL 5GGSY 1J1XH 3BEWA 3QDJA 4YHOH 1LGVA 1OAYL 3FTGA 4Y4KC 1GOFA 2EDXA 4U05A 1A5FH 3LQAL 3PIQA 1P6AB 2WAHA 3EO0A 4JM4H 1A6UH 1TVHA 1ZHBA 1L0YA 4X6EB 4IMLB 2KBGA 2YEZA 4HWEH 1ZHLA 2HP4A 2R1XA 2K1MA 3D87B 1WTLA 2YPKA 3VGHA 4GLRH 5TPWL 3MFFB 1AKJB 4E41A 2LE9A 1EFXD 2I27N 1G7JA 2COQA 2QR0A 3VWKD 3CUPA 4CMHC 1DSFL 2DQTH 1U36A 3VG9B 3HS0A 4KKLD 5DRZB 4NQCE 2H2PC 3FO1A 3LQAC 2C3HA 2PO6C 4L29B 3UP1A 3S4SG 4YDKL 2YD7A 3CD4A 4FP8H 5KS9F 1GGIH 4M5ZL 4LKXA 1LNUA 1JPSH 4OD1L 3E6FB 5DJ0B 3NZHH 7FABL 3DV4A 3ARGD 1FPTH 5HVHB 4BZ2L 5F8QC 4LF3A 1RMFH 4I0CC 1A1MB 1YEDA 3BE1L 3TCLB 1DFBH 3TNMB 5GZNC 4ZUUB 3KS0J 4OLWL 1W0YT 3WUZA 2ARJA 2YS4A 3F58H 4WVRA 1KV3A 2Y7QA 4OD2A 4LRIA 1DL7L 4WW1B 3C9NA 4WJ5B 2OTWB 2Q20A 5F1NA 1BWMA 3HMWL 1P1ZB 2B4CH 5HYSG 1MJJB 2AK4D 4MJIA 2E9JA 3QUXB 4MXQD 4ENED 1BLNA 1FZMA 1E4XI 3CDGA 4TTGA 4E42A 3VFGL 1LDPH 3VFMA 3OAYH 5EO1A 4QOKB 3KLAA 4QRPD 4HIEB 4RGNE 4I0PD 1DVFA 3UO1H 2CXKA 2VZUA 1G7MB 4PRNB 2WBKA 5IV2A 3WN5B 3EYOA 3VXTB 4JG0H 2HJFA 3N50A 3RX5A 1ZWIA 1AC6A 3QJHA 4PG9B 3TNNB 1V3JA 3G6JE 3U9PL 3RDTB 4QXGH 4QRRD 1N5AB 1GAFL 5GS3A 3HE7C 1LK3H 5AWNL 3WJLC 2DLFH 1S9XB 4HQQL 4GAYB 3WS3B 3PL6D 4X8JB 4KK8D 2CKBH 4Y5VC 4YHMH 1JFQH 5E6YA 3LPWA 4PJHB 5FYKD 3RGVB 4UU9B 3RFZC 1P5VA 2NX5E 2WWMD 3T65B 2E9BA 3QEQD 3MCLH 2QSQA 3DIFA 2OYPA 4IIQA 1FORL 4HS6A 1Z9MA 3CXDL 3GKZA 3HPLB 1FNEA 4JY4A 1OCWL 4XNQA 3L6FA 4KROD 5ICXA 1E6JL 1HDMA 3CDFA 2ZUSA 4WFEE 3LKPA 1A6PA 4WW2A 4Y8DC 1QTYT 4UAOB 1I85C 5JW4Q 2C26A 1BFVL 1MCWW 1P53A 4NKIH 1YJDC 2GYSA 2CJUH 1XGTA 2OSLA 4HXAL 4NIKB 2X4SB 2H8PA 1R6VA 5DMKA 1XZ0A 4EUPB 5IB2B 3U0TB 4K8RC 4H0IA 1Q9OB 2XNAB 2QLVB 2BJMH 5GISH 4F33B 3QNXA 4C83B 4MA1C 4YBQC 4YNYA 3QIWA 4LASH 1LEGB 1S8DA 2D31B 1J0JA 3BSZL 4OCRL 4UV4L 3WIIH 3B5HA 5C9KA 1CBVH 3PQYB 5I73B 1Z9OA 4GG6A 5HGAA 4LP5A 4XPBL 3NCEB 4GQ9L 3G6JF 3CU7A 1DLFL 1S5HB 2PUQT 2ADGB 3LKQB 4HPOH 4NQXB 1D5XB 2HJKA 3BPLB 4PJ8C 3L5IA 4FFVD 3DRTB 4NJAL 5ICZB 1J10A 2GSGB 3WS6C 4MA3B 2LTQB 2DMBA 3GBLA 4QRUB 4YWGL 2XWTB 1TZGH 4Q6IA 3U36A 5E7FA 1KLUB 4B7IA 1H0DA 3MREB 3QCVL 5BV7C 2A6IA 1SY6L 1TVDA 2Z92A 3QUKA 3DYMA 1WZ1H 5GXBB 5F3HA 2GK0A 3ARYA 3BH8A 3KYNB 1IAKA 1V8HA 1VFBB 3C5SB 4A6YA 1HXYB 4R7NB 2OJEB 5E9DB 1OTUC 1T0NA 3RUGA 2ZCKL 3BPCB 3T04D 5DD3H 1I3UA 1NGQL 3IU4L 5FV2A 5IFAL 1BIIB 5J12B 4WCYL 3OG6B 1WBZB 2ED8A 3TBVA 3QO0B 4JHWL 3PXJA 1QFUL 4M62L 3EW3B 1MHHB 1CDIA 5FXCH 4ZOAA 4PY8I 5SWSA 5BRZB 4MQXD 4CDGC 4APQB 4QHKJ 4K7FB 3QUYD 2WK2A 3HNVH 1CICC 3O6ML 4IRZH 2FSEA 4ELMA 1A9EA 5C0GB 2M8XA 3FB8B 3DXAE 3MV7D 2IMNA 3JUYA 1AXSA 3I6LD 5ACLA 4LNRA 5HDOA 3WFZA 4NBYB 3WFCL 4N8VA 1YNTA 2R4RL 3STLB 4TUOA 1NFDB 4ZTOL 4KU1A 1QFWH 5GS0C 3VG0H 2XN9B 2VLJA 4UIKL 3FFCD 3O3DB 3PXHA 1FFPA 2FRGP 5JORA 5BQ7A 3B3IA 4G9FD 4PRIA 4Y89A 4XX1G 3OHXA 2XRAH 4NN6C 4PLOB 4XWOD 4ZUWB 3RL1B 2UZYB 1KGCD 3KPOA 4G6FB 1KTLA 5C8JB 2Z31D 5J9PB 1OAXH 2R2BA 3DX8A 4PJ5D 4K71B 2HWZL 4K94H 3FB6A 4PRPA 5I66B 1URLA 2JJWA 2YHGA 1U8QB 2YD4A 3CFIC 1YEFL 2DI8A 4TSCH 3WHXA 1JGLL 2I07A 2DQGH 1I4FB 1JF1B 5EUKB 5KSUA 3RNKA 4AQOA 1I3GH 2R29H 1RU9L 3NBNA 1Z5LA 4RWYH 1W72B 3WNKA 2X41A 2DI7A 3LHPH 5D2NB 3M17B 3BP4B 3BAEH 5SX4I 5FUOH 2DQJH 5MEQB 1RK1B 3HHRB 3WKML 1HHHB 1MI5B 5E94B 3C08H 4WTWA 1UM6L 5GIRB 3TVMD 3OKLB 1C12B 4D9QE 4XNYL 1LP9B 5T1LB 3HI5H 2GT9A 1A7PH 3O11B 1TLKA 4KTDH 4N0YL 5F1IA 2CIKB 4HX1B 3F7RA 4JB9L 1E4KC 4OZGB 3S88H 3LZFL 3MUJA 1NEZG 5A16A 4PJEF 1EJOH 3ROOB 4GSDL 4M5YL 5D5ME 3G6DL 3OAZH 4LCWD 5DZOA 2HH0L 2E8ZA 2VITA 4JAMB 2XTLA 3EGSA 5MEOB 3BWAA 1F4YH 5D1XD 4FQXB 2BFVL 3CDYA 4BKLB 1JHLL 2CH8A 1U8IA 4X80L 3BP6B 4P2YA 4PGBB 5B8CB 1M71A 3KPSE 3PWUA 3FN3A 1KT2A 3HFMH 5DQDH 3QBTB 4U1GB 5E8DL 2WINA 1EEUA 4ZOCA 5DTFB 4PLNC 5HYJB 3DX9A 4UTAL 4OLYL 1N26A 4YDJB 4ODUA 1KTKE 4J4PD 5ENWA 4EI6B 2AJXH 5DWUL 4JO3H 5D8JH 3F7VA 1GOGA 5LQBH 2Q87A 4PD4J 5TDNA 5GGUB 1D9KA 3ZHDA 1IAIL 4X6DE 5EZIH 5J56B 1HQ4A 5DI8A 4P3DA 3S9DB 1Z0MA 3PG2A 3QI9D 4WY7L 3RWCB 2BSRA 2EIZB 3O3BB 2YPVH 5TDPA 2VKXA 1RZGA 3CMOH 5HGHA 4YHNB 5BJTB 2W07A 6FABH 1A9BB 2FH8A 4RRPA 1I7ZB 1NCBH 1MFCH 4LKCB 4PGZA 4Y1AD 4IRSC 4L9DA 4EBQH 4V2CB 1FL3B 4HJ0C 1I9JH 1QSVA 3VXSB 2OMBA 3STZA 4L8CB 4OSUL 3D9AH 4D9LH 4PP1C 4GRLA 5D5MF 4X9BA 4Z78A 3MOBH 4YDVA 3S35L 1SBBA 2C1PA 1KPRB 1MUJB 3ROLA 4LAJH 3P9LA 3VWJA 1K3IA 4PJBA 3UTZB 3X11B 2NY4C 4LLQA 4HWZB 1CIUA 4R4FL 4Y19E 9CGTA 5D7SL 2BSTB 2FGWL 1KJ2L 2FD6H 4DEPC 3THML 5HHOD 5ADOH 3W0WD 4OZIE 4PJ7E 3RZCB 4JHBA 1EFXA 1MRDL 4ONHA 2GJ6D 3V6OE 3VWKA 1T1XA 2YWYA 5DK2B 3SKUD 1N8ZA 4X6DF 4LQ1A 4PRDB 2FLBT 1MHCA 1MFEL 4U1NA 5BS0B 1Q94B 4PRAB 3IDIA 5I1AA 2EIEA 3QDAA 4JZNA 3T1FB 3DWTA 3RBGA 3TWCH 5FYLD 1ZGLB 4I3GA 4I9WE 4NYLA 4LFHG 3FRUA 1ZSDB 4NQEB 4EN3A 4IMKC 3ARGA 4B41A 2CIKA 1CLYL 2KL6A 4LSQH 2W0KA 1MRFH 2NYYD 4LVOC 4ZUTA 1TIUA 1OTTD 4L8BA 4OIBA 4EDWH 1GGBL 3GSQA 4P3CH 1UZ8A 1FZKA 3V95A 4JO2L 3IJSA 4LHJB 1OP3H 1HOCA 3OJDB 5DDHB 5EU3A 3KPRB 5AYUL 1LD9B 4OF8A 4NBZB 5FKAB 5JXAH 5DSCB 1MHEB 3B9VA 4U6HA 3GMNA 4G8GD 1X44A 4MNQD 4MSWA 5C0JA 2DD8H 2AK4A 2X4PB 2GITA 4Y4HD 1I9RL 2NW2A 4HKJB 5IBLC 4H1LH 1J12A 1FAIH 4KKCD 1EZVY 1FNHA 3A6BH 4FTVE 4Z7WA 2CLZA 4I0PA 1IGIH 4OZIF 4PJ7F 1TQCB 5C6PB 1QSEB 2ZOKA 2VUOA 1J05A 2OS7A 2FIKB 3HUJA 3OAZK 1MCRA 3ARBB 4JRYB 4YR6A 1A3LH 4F37K 4NRYA 4J3XA 3FOMB 2HAZA 1MNUL 4QRRA 1OWRM 3IDMB 3X14B 4D0CB 1MFBH 3LQZB 4MQ7B 4R26H 1U8OB 3ES6B 2YD5A 3PL6A 4GRMA 2ESVE 3ELAT 3PWLB 4HIXH 3CLFL 1OAUH 3O9WC 3BRGC 2XACC 4KJYB 4MJ4A 3TYGH 5FB8B 3QEQA 4L8CA 2BC4B 4FQQA 3VXRD 3K4AA 5IHZB 4JM2C 1S78D 1FL6B 5D1QD 4ZNEA 2UWEE 1T2QH 3G04B 2AEIT 4Y16B 1EJ6A 3TO4B 2AV7B 2HT4D 4RGOH 2VRAA 3IFLH 5EOCH 5I1LA 3HLAB 4F9LC 4HK3N 3OX8B 4LDEB 2RAMA 2ITCA 2NXZD 2BERA 1MRCH 5CGTA 2NXYC 3ILPB 4KQ4H 5I8EA 1LHZA 2HVKA 3PE9A 5DJDA 1DUZA 1T7VA 5JUEH 3PGCA 1IM3B 1JTPA 3IETB 1KLGB 2PXYC 3LEYL 3FT3B 4YUEH 5DFVC 3VGAC 4U0RB 2BNRE 3BGMA 2P42B 4YDIL 4I4WB 5HJ3A 1OHQA 2F53B 1A14L 1T22B 4LGSB 3MGAA 3RTQD 3O4OB 4LCCA 1TZIA 2UY7A 5C7XH 4NUGL 2F19L 2EH8H 4O02H 3WNLA 4DN4L 1PZ5A 3QO1A 3P3YA 1IM9B 4NO5B 5EBWA 2IBBA 1ORQA 1CGYA 5EPMA 2HFGH 3K4DA 1Z3GH 5KOMC 1WAAE 1UB6B 4QRSB 5HHMB 1RUKL 4G6AC 3QG7L 4B5EA 2QKIA 5JHLH 2C3GA 3NIFE 3O6KH 4IS6B 4KK9D 4YGVA 5IJVB 4ZUVB 4G9DB 4I48A 4PB0L 1FLTX 5T5FL 1OLZA 5F9JA 2UWEF 4XAWL 4FZEL 2A0LC 4XCEA 5MI0C 2WIIA 4J3UA 2FATL 4MDIA 3L7FB 3KYMB 2QQKL 4JQVA 5IHUH 4NT6B 2VIRA 4XTRD 3RWJB 1LO2L 3H7LA 2NY1B 2YA0A 3B83A 5B39G 3TZVB 1OPGH 4XVTL 4QCIA 3OTTA 3REVA 4OFPA 3ULUD 5GS1A 1FE8L 3GMMA 1PZUB 5AZEH 1T1WA 1JHTB 2BY0A 3VXPA 5T1MA 1IAOB 5F9WC 1H3WM 3QUZC 4HLZH 1CTNA 3MV7A 4H20L 4DVRL 4P23C 5K9JH 1OP3K 5F93C 1G84A 2BVYA 2P24A 2YK1H 4HT1H 3QNZB 2VLRE 3BKCH 1CE1H 3GMPA 4NSKA 3DX7B 3BQUD 5FGBC 4ZPTA 2DI9A 4S1RL 2E6JA 3BD3A 5E2WH 3FFCA 5FUZL 1HWHB 2XXMB 4M6NH 2VZTA 4XB8A 3IDJB 4K3JL 4OBSA 2EE9A 5I15H 3D25A 5CFHA 4MB5A 5KSBE 4ZOBA 3UJJH 3RA7L 1MJ8L 5FF6A 5GRZA 1K2DB 1AXTH 4KGLA 1WAAF 5T5NG 3MXVL 1A4KA 1UVQA 2Z31A 3UC0H 2LFGA 3NIFF 1DUYB 2WP3O 5KOVC 1N6QL 4X98A 4OD3L 3WLBB 3GFUA 1F6AA 5FYJL 3AVEA 4L8SB 2CKBA 1I3VA 2VL5B 1M05A 3KWWA 1JK8B 1MCKA 4P4RA 3SY0A 4NN7C 1KPVB 3PWNA 4EVNB 5E08L 1HKLH 4BSVB 4X7TB 2I9LB 2A6DB 1TFHA 1MPAH 5IR1A 3CH1A 3SDAB 3MODL 5HHVL 2A9MH 1MELA 3NFPA 1P2CB 2OK0H 3QWQB 3WD5H 1NCCH 1TQBC 1J87A 3Q6GH 3LCYA 4YPGA 5CJ8A 1NJ9B 3P0VL 2VDPL 1IGJA 4L1DA 5GGSB 4TSAH 4NCC2 5IMMA 1CFNB 4K9EH 4POZC 4QRQA 3UTSB 1F8TH 1G6RA 1XGYL 5GGTL 1VENA 2YBRA 3Q6FB 2GSIB 3FT2B 2APWA 1U3JA 3GSVB 5CD3B 1CK0H 1ADQH 4XMLH 1KB5B 4GKSB 3QAZC 5INCB 3BZEB 5A43C 4PV9A 3R06A 4P4KD 3RHWF 5IFHL 2J3SA 1YC7A 4RX4D 3MLWL 5FHBH 3T0EE 2LVCA 4PJGE 5GGVY 5A1AA 3ZT7A 1RUQL 2ADJB 4P46B 5DR5L 4PREA 3T2OA 5D1XA 4G8IA 4MAYC 1A7RL 4FQLH 5ALCH 5FECA 4UINL 3CFKB 3S4SA 2OMNA 3U6RB 1P4LB 1CYGA 1T0MA 5FHAL 5JPMB 5BVPH 1QUNA 4CADB 2C4FU 2W60B 4M7LL 2IALA 4WHTA 3RIAF 1DQDL 5KSAC 4FS0A 4LFHD 4LL9A 4Y4FA 1H8NA 5F7YC 4I0KA 3BP5A 4J4PA 3MRRA 3UPRA 2PTTB 5GRXG 3QPXL 4YHLL 4N0CC 2W92A 3EOBB 1DCLA 5IM7A 3UJTH 2Z9TA 1XH3B 2EYRA 3MBEC 3KJ4C 3QNYB 1G9MC 2NTFB 3QI9A 2XTJE 1ZAGA 4NN5C 4Q9QH 4RGMB 5LGJB 2BVOA 4F57H 1KN4H 4F7EB 5LCVL 1QVOB 2VISB 4LLVA 3MC0A 1LO3L 3T2NH 4JRWA 1D6VL 4ZDHA 4Y1AA 4GMSH 5IVNA 1QPPA 4AIOA 3VCLA 1CFVL 3M1BA 2E27L 2R2HA 5DC9B 4NC2B 3SDXE 3C5ZB 1INEH 2FWOB 2P7TA 1GYAA 2HT3D 4X6FA 5GGRY 1BJ1H 2F5AL 3JWNC 4PJGF 3EJJX 5ECJE 2DBJA 4U1MB 3BIAX 1X5ZA 4PJXE 4P5KA 1IC5H 2G75B 4KGJA 4WO4C 3ESUF 3MLSL 3MR9B 2ICES 3MCG1 5LWYL 4U1KA 4PBXA 1EZVX 4ZSOE 3HAEG 4XVJL 3O6FD 3ZE2F 3CSYB 3TN0B 1T1ZB 4HKXA 5GRUH 1XEDA 2OQJB 4XC3L 5A40E 4PIRF 2QADD 3C5JB 5TF1L 4JRXD 5HHOA 3W0WA 1XCTA 4BSWB 1A6WL 4CW1A 1B6DA 5I1GH 5EU7C 2GJ6A 1JN6A 3PV6A 5D7KE 2X09A 2VDOL 3NFSH 3HC0A 1U58A 5KVDH 1K3ZA 1N5YH 1JNHB 3F12A 15C8L 2PYEE 5H8DA 5I17B 1CZ8H 1F3RB 3DO7A 3UEZA 1UXWA 3C2AH 3SGDH 3TBTB 3VXME 5BO1L 5DVKA 1R24B 1U6AL 5I8CB 4JKKA 4X7SH 5MENB 2BNUA 4KUCD 4PJ9B 4NCC1 4F8TA 2KQNA 1FV1A 4UDUA 3SDXF 4MX7B 5F9OL 4YEFA 4MDJB 5F7UA 4M6OL 1JGDA 3WDIA 4RFOH 2PTUA 4JFXB 1GIGH 2JB5H 4RNRB 4LLWA 4PJXF 4R4ND 1JWSB 1N64L 2WUCH 4G8GA 1FH5L 4MNQA 1A22B 4LRIC 4K7PL 1FRGH 3SDCC 1EDQA 4Y4HA 5FOBB 5BZWB 3EYVA 3U2SA 3BJLA 5FM4A 1CT8A 4KQ3L 5BXFA 4L8DB 1HSBA 2FECL 5CEZD 4X7CC 2H32H 3Q3GB 5F72S 4O51B 3ARDD 4OT1H 5GRYA 2DQIL 3IFPB 4GKNA 4UNTA 1AP2B 2APXA 3TBSA 1IILE 2V5YA 5SX5H 2Q8AL 1DVFC 2KZWA 2HLAB 1DN0B 4WTXA 4H1LB 3FFDA 4JY5H 3DMMA 2E6PA 5C07E 2KUTA 1QBML 5D72H 1KPUA 1RAMA 1T7XA 1JGVL 3CPLA 3E3QE 3QWOB 3B5TA 3FO9A 5I16A 3T77B 5EZJB 4XMKL 3N1PC 2R23B 4KAQH 3QQ3A 4J12A 4NQDB 4BSJA 3X13A 5DRXA 4UTBH 4HZLB 2XI9A 3LQMA 4FRWA 4GBXD 1VFAA 1SJHB 3BT2H 4NFDA 5EB9A 2W65A 3OV6A 4DAGL 4YDLC 4HK0B 3NACL 3VXRA 2IPKB 5CSZA 5BCAA 1VDGA 1YMMD 1RHFA 5EUOE 5HVGB 1J1PL 3PWJA 2NY7L 3DV6B 2AERT 1KJ3H 2X9YA 4AH2B 1OT1A 5E1HB 3L95A 4XPTH 4Z76A 5J3HD 4RA3A 1MIMH 4IIQC 4NZRL 4AEHL 1S7QA 4XNMA 2AEQH 3DURA 4O00A 1MVUB 5ISZD 4PY8J 2VMFA 2DWDA 4K23L 2FX8L 2OZ4L 4WW2C 1LWRA 3RPIA 3GSRB 1EERB 5DRWA 4NZUL 2X9XA 3PDGA 5DS8B 3SDDD 2IAND 5D7IB 4RWHA 2IQ9H 4C56D 5HY9A 3ZT5A 3O3AB 1A1NB 3EOTL 3BGFB 3FAXA 2IGFL 3HMXA 3EFDH 4N5UA 3MJ9L 2J5LC 1SHMA 5JPNB 3RWDA 3VGBA 1B0WA 4JKPL 3IXAB 1BQLL 5JDJA 2JIXD 4LP4A 5I17A 3RKDC 3RTQA 3VG9C 3QIWC 4Q2ZB 3B9KD 2W0FB 1CL7I 3N9GH 4L4VB 2H9GA 2AABH 4U33A 3U1SH 2YKLL 5EBMA 1OSPL 4JZJA 5I1EL 1JYNA 1W8NA 1R24A 3MA9H 1PFCA 4U1IB 5ANMB 3VXQB 2AXJA 1YYMH 2FH6A 4HBCH 2XICA 1S7UB 1XF4A 1NCDH 4L5FH 4LPUA 2AGJH 3LV3A 4ODXA 5DO2D 4X6CA 3SGEI 2XWJA 5DD5L 4D8PA 2HJLB 2UYLA 3FMGH 3G5VA 4L1HA 4Q6IC 5EUOF 4TVSa 4TUJB 4HD9A 4P2QE 4LHUB 4V1DE 5EU6E 5IVXA 4KRMB 4S10A 5GGVH 4RMVA 2XWBA 3BDYH 4YHIA 4MA8L 3VMNA 4LDLB 3MZGB 3AY4A 3BEVB 2VE6A 3O81A 3C60D 1AD0B 1WIOA 2P5WE 5I71B 3ISWA 2DIJA 4LQFL 4NO2A 3T3PE 4LVEA 3F6LA 4UT6L 3BZ4A 1UWGH 3NCJH 1Y18B 4JKMA 2QSCL 4UDTA 5GGQH 3V9FA 1TJIH 2HVJA 3QP3A 1NEZA 1KCKA 4BZYA 4PPTA 5JHDE 1SYVB 3MJ7B 2F9BT 2VXUL 3R0MA 3BZFB 3VA2C 4M7KL 4P2OD 4NGHL 3EYSL 5H94A 5T1KD 2F54B 3VXUE 3WN5C 4OV5B 1RIUH 4I18A 4NO0A 3LKRB 3BQUA 4D0DA 1TZHB 2BNQE 4XPAL 4OBRA 5HYFA 3NCFB 4JJHA 4BELD 4G8FA 2IPUG 4OB5L 5FGRA 4LEOB 5F7MC 1CIDA 1P5UA 1WC7B 5IMLB 1WSST 1FO0H 4C4KO 3UTTB 3QQ9C 3CZFB 5IESH 3IAGC 1XF1A 4ZTPL 5H37G 3K0WA 1INDH 3S36H 3BN9C 2X5PA 5KS9B 4PV8A 3L3OB 2WWKO 1BQHB 5BOZG 2ENYA 1BGXL 5DLMH 4MAUH 2M1KA 3NZ8A 1JP5A 5CINH 2VWEE 1Q0YL 4X7DC 3CFDB 4P2RD 3L5XL 1EO5A 1UYWH 5GSVB 3RY4A 1KTDB 3MJ8A 1QQDB 4CMMB 3UXFA 4ZFOA 1OAYH 3GIVA 3ZSSA 5FYJE 4KKBD 4ZAKB 4Z18A 3ZKQD 1KC5H 5F88B 5D70H 4PJAB 3ARVA 4IDLA 1Y0LA 3UZVB 1DBBL 4KDVA 1CGVA 1IARB 3T3PF 3O8XD 5C71A 1OOAA 4PJIE 1CG9A 2VJXA 1CLOL 3DI3B 2NY3B 5F1KC 3NN8A 5IBTH 3IDYB 2CPCA 5ACMA 3S36X 3FZUC 3HPJB 1KXQE 4XPFL 4R96A 5E2UH 4K2UL 1KNOA 4KTEL 3MROB 2X05A 5C0FB 4OTXL 3L5WB 1H8SA 1JI1A 4FQCH 4JFDD 5J13C 3LH2L 5ID1B 3VD3A 4YDKH 4U3CA 1KIPA 5DJXA 2EDLA 4P4KA 5EA0H 4LSPL 5EIVA 1KIUA 2ZNWA 1YEIH 4JDVA 3V4VL 5FYJU 4K3EL 4DKEL 5AYQA 2IG2L 4KK5C 5F3BA 5I75C 1VERA 1KELL 4LARH 4BZ2H 1KCRL 3D5OF 3JWDC 2MPAL 2Z8WC 3GM8A 3QCUL 3BE1H 1IEHA 1IKFH 3MRMB 5I1DB 2WBJD 3UTPE 4KK6D 5ADPH 3SKMA 1AGDB 4NPYB 3LY6A 3GRWL 2NZIA 4P5TB 1JPTL 1DL7H 4WUUD 1JF5A 3W9EA 3UBXB 2A77H 3TESA 1JCKA 1MCFA 3D39D 3TH4T 5J12C 2WZPD 3HMWH 5C0CE 1K5NB 2UUDH 3IVKA 1KJMA 4LSSH 5TQ2H 2QQNL 2AQ3A 3HZYA 5ETUB 2VQ1B 1YY8B 3GNML 4PJIF 4APQC 1NAKL 1R0AH 4HS3B 4KJWD 2OX5A 1D9KC 1ZLUH 4NZTH 3UROR 1AQKL 5DVMA 3SQOL 4R90L 3OR7B 2EDBA 4KVNH 4YE4H 3QSKB 1RY7B 3I85A 2YPLE 3MFGB 4LPTA 4JJ5B 4NP4H 3QIUD 3HA0A 4RZCB 3VFNB 4RGNB 3LEXB 4ONFL 4HGWB 4BFGA 4WDIB 1GZQB 3FQXB 2LABA 3OKEB 2FNBA 3KR3L 4M6ML 2EXYC 4AEIL 2ICWI 1CFTA 1WT5A 2AV1B 1FL5A 2XKNA 3FL7A 3CXHJ 1PKQA 2MHAA 3G6JB 3E8UH 1W72L 4Z0XA 1AO7D 1UM4H 3BHBB 4BZ1L 1JZ7A 3TV3L 4GRLC 4UIMA 4EI5B 3P77A 5JOEA 3LIZL 4X9HA 4JE4B 1FORH 4H88H 2ZSWA 3WSQL 1BF8A 1YUHA 4U6XB 1OCWH 2P44B 3N1MC 2O5XL 3VWJC 3CVIL 1FCGA 1BVKB 4FXKA 2NX5B 3HNTL 4HFWA 1ACZA 3IXTA 1J9CT 2AXGB 4BH7A 1CDHA 3RWHB 1CQYA 3ARXA 1ONQA 3O4LD 4RCAA 4YHPA 5ESVB 3VWKC 1OGAD 3ZKXB 3U46A 2D0GA 2H2PD 4KKLC 4JHAL 3JUZA 1F97A 4WFHD 1MCNA 4J3SA 3UZEA 2Z93B 4POYA 4U1JA 4OCRH 1SVZA 4PGCA 1U8MB 4TVPL 2DQDL 5DURD 1EUUA 2GTZA 4GQ9H 4R4BB 4LIQL 1IL1A 1EO8H 1DLFH 3C6LA 4XPGH 4EN3C 3ARGC 3KNBB 4XCCL 1BBDL 2ERJB 3H9SD 4LPXA 5L6YH 1TPXB 4NQCA 2ZSVA 2JTDA 3U0PA 3H0TA 3VFSA 4X4XB 3GHEL 5ALBH 1N6UA 3NTCL 5BZDA 3K8KA 4D3CH 4E5XB 1LE9A 2X9WA 1OT2A 3V4UH 4FQHB 3MX0A 3FRPA 4GW1A 2FZ3B 3QEHA 3U4BH 4YHYB 2ZCKH 5IFAH 1NGQH 3N1GC 3D69B 4JVWA 3GUTB 1I7UA 4NRZA 1J5OH 1OB1A 4JHWH 3ARDA 5ETUA 2EDHA 1EX0A 3K7UA 1GPOH 4WFFE 1ZLVH 5DUBA 1H5BA 5FOJA 5T1DL 2D0HA 1Q9KA 5IGXL 1T21A 4OGYL 1AXIB 1RHHA 2VO5A 3PP4L 4GUPA 4X5XB 4JFEE 1NFKA 1FVCA 4QRPB 5JW3H 2PTVA 4JFFE 3SKNA 1VESA 3O6MH 1WISA 4RDQG 5IIEA 3ZO0A 3MV9E 3V4PH 3G08B 4LCUB 4XP1L 4NNYA 3ARFD 3MMEB 2H32B 1PX4A 4H8WH 3VD7A 4M93B 3ALPA 4L3ED 4X5WB 5LXGH 3BDBA 2A6JB 1H3TA 5E00A 1RIVH 1MFNA 5BVJA 4GBXA 1T04A 4OM0L 2MCPL 3DUUA 3T09A 2ZUXA 2BP3A 3PL6C 5ICYB 2FJFA 3DXAB 4MNHA 2NLJB 1N6VA 1YMMA 3FQTB 1NBZB 1XGRA 5F89B 1J1XL 1WITA 1KCUH 3ECBB 4YHOL 2J7LA 2YA2A 1BIHA 2HRLA 1FHGA 4WV1A 1TETH 2DLIA 1JV5B 5HHNB 3BPNB 4HC1A 1LO4L 1A6UL 1RVFH 1UKQA 3WDJA 1F4XH 5ISZA 4OIIL 2ZOLB 1WTGT 4KROB 4X9IA 4KRPD 1OGTB 1HZHH 4U1HA 2IANA 5FA4B 1JGLH 4ELKA 2Y36L 4C56A 2EKSA 3GB7B 5DEGB 1EAJA 5ERWB 2FL5A 1S7VB 4K8RD 5F70A 1JGEB 4TQEH 4HMDA 2E3VA 3HG1D 3I9GL 3FB5B 1GC1L 1T80A 3QH3A 2JIXA 4G43B 1BX2A 4FP8L 1WGOA 3ARQA 1RJYB 1X6NA 3B9KA 3BUTA 4LMQE 2VABA 1GGIL 1F90L 4JN2A 1ZVSB 5D7JB 4GG8A 5IK3B 2PNDA 4M8QA 3UX9B 1QRKA 4WHCA 1QKZH 3OXSA 4WI9A 8FABB 5FK9B 2BX5A 4XNYH 3DHMA 4LCCC 4HEME 1RMFL 1MQKH 4FFVC 3GJEB 1TJHH 4DKFH 4N0UA 1A0QL 1MFDL 4QRTB 3GMLB 3F58L 1OD9A 2YSSB 2HN7A 3B9DA 3ARWA 2RB8A 4QXTB 4GO6B 1JUFA 1U8PB 4GW5B 3FCTB 25C8H 4PTTA 4GSDH 4QOKE 3MRLB 2AJUL 1IEBB 1OTUD 2B4CL 3LN5B 5DJ2A 4YIQB 3T2QA 5E4IA 1NH6A 5IW1A 2LAAA 3MNVA 1VGEL 3MA7A 5FM8A 5CZKA 5HVWA 4PBWD 3C60A 4XCNB 2HFEB 4JQVC 1JHLH 1BJ8A 4G7YL 4NOFA 1WWWX 5ITBH 1IT9H 2ZUVA 1EAPB 3OKYA 4QHMA 4YX2H 5D96C 3IYLW 5E8DH 3ULSA 2NY2B 4JG0L 1CICD 3CAFA 2OI9B 1VA9A 1EA9C 2KQMA 2VAAB 1NAMA 5KAQF 4XCYB 5T1KA 5I2IA 3QDGD 4OLZH 1LEKA 1F5WA 3KPSB 3QUYB 3S96B 4WUKH 4PJHE 2EEAA 2EC9T 1IAIH 3N1FC 4QXGL 3ZYOA 1CFSA 4WIQA 5I9QC 3ARBC 1PG7W 1U8NB 1FYTE 5EC1A 3LAFA 1QEWA 4M00A 1PQZB 2A74A 4WY7H 5CBAA 1QO3B 2VN7A 5IG7A 4JCMA 2BHYA 2J8HA 4MLSA 1ZMYA 4YHML 1JFQL 1FDLH 4ETQB 2L7UA 2F5BH 4TNWF 4XBEL 1YNLH 2X1WL 3PHQB 5EFIA 3FONB 1A6ZB 5HPOA 1WBXA 5KSVA 4GJTB 5EULV 3QULA 2OJZL 2WMPA 4M7ZB 3QDMB 4G9FB 4XWOC 4OSUH 1FO0B 4HG4K 2Z31C 3MRFA 1T5XB 2PCPA 2G9HB 5J11C 3PDOA 1J8HD 3S35H 4PJEA 3R1GH 4NNXA 4NKIL 4PJ5B 1S9YA 2DMKA 1QLFA 2FEDD 1L7TL 1EXUB 2CJUL 2Y07H 1FYHB 4BK4A 5FO7B 1N3NA 3PQYE 2X7LA 5BMFL 2O61B 3BMVA 1F3DJ 2A9NL 1DQJA 3WL9B 1VFOA 5GGRB 2APVA 2K9UA 1LILA 4RIRA 4YQXL 2BJML 1EVTC 2G2RB 4NZDA 4LASL 4BQBA 4U0RC 1MRDH 2GHWB 5DZLA 3WIIL 1GGYA 1R3JB 4HWBA 3IT8D 4Z5RA 1BD2B 3HZVB 1QNZL 4Y19B 3D2UD 4YEEA 5JIPA 3KJ6H 4PJHF 4PRHD 4HCRL 2CIIA 3RI5F 5M95B 4JFDA 4XBPA 4HWNA 4QWWD 1C08A 1NUGA 3HAEA 4ORGB 5TJWK 3AGVA 4J3VA 2D7TL 2EE6A 4X4YA 4OZIB 4PJ7B 5D7LE 4MD0B 1VFUA 3CLEH 3LSOB 1BFSA 2OLDA 2OTUA 1HHJB 3BIKB 3RIAK 4KPHH 3V0VB 4HKBB 3OKNB 3K74B 1TZGL 4MNGA 1ZA3B 3L3DB 3UTQA 4NKMB 1QG3A 3BYTA 3PABA 4RFNB 1OY3B 1I1RA 1Q72L 1WZ1L 2HTKD 2AJVL 1CLYH 2DICA 4TOYH 2CQVA 3IB4A 3IS0X 4OZFA 1FG2B 3ZDXE 1SBSL 5DD3L 1GGBH 3OKOB 4AJ0A 4ZNCD 2V2XA 4JO2H 3ZTJH 5D1XC 4LCWB 4WUUA 4NKQB 4IRJD 3MLZL 3D39A 3PHOA 4MCZA 5FO9A 5ITFA 5D6CA 3VGFA 5CZVL 1N59B 2Q7NA 4OGAC 5L9DL 4AMKL 1OAKH 2DQHH 4F2MB 5D5MA 1II4E 3SGJC 1EHLH 4XZUA 3HNVL 2JJSA 1ZA6B 3B6SA 4XNZC 3V6BR 4Y4FC 1UGNA 4FABH 3N06B 4J4PC 4ISVA 2DBLH 3EO9H 5D9SA 4K55A 5KW9H 4HIIB 3RVXD 1MAMH 5E2VH 4JPWH 2GI7A 1QRND 2E6QA 3QI9C 2BRRH 5JW4M 2DAVA 3FB7A 1GRWA 1QFWL 1BZ9A 4B0MM 3QIUA 1WWAX 2H6PB 4FTVB 4ZFZA 4R0LB 1EBAA 2KKQA 1MNUH 1QR4A 3EDDA 3HI6H 5TQ0H 3CDCA 4IRSD 2AJZA 2E7HA 1N2RA 4X6DA 4HJ0D 3GKWH 4OF3A 5HYSB 1XGUA 2XRAL 5FUCE 1AQDA 2J8UA 3QR2A 4OI9A 4D9RD 1TCMA 1OAXL 1XF5A 3EDFA 4WU5B 4K94L 3ZDXF 2ESVB 3BWUC 5D2NE 4G42A 2W91A 4TSCL 1YN7A 1G9NH 2IWGA 2NY4D 2FIRT 1ZT4B 5FCSH 2R29L 3SCMB 1FFOB 3K3QA 1MI5E 3QIBB 3L9RA 3WJJA 1RJLA 3Q1SH 4RWYL 3RVWD 1RZJC 3S8WA 2ZZUT 3DUSA 3LHPL 4F7MA 2UWEB 3BAEL 1KB5L 5FM5O 1NFDF 4KUZL 2DQJL 3V6FA 5C0AD 5C0RL 3RWGB 1DJSA 2NY5C 3O4LA 2VDML 3LEYH 1OGAA 3WKNA 3C08L 3FT4A 1PEZA 2DM3A 3P4NB 2BMKA 4QF1A 3MGOA 2O93L 1QPXA 1AD9B 2R2EA 3L1OH 3HI5L 2OL3B 5KZCD 3V5KA 3D18A 5F96H 1G7LB 3L3IA 4HH9A 2IH3A 4YC2C 2P5EE 3P30L 4KTDL 2ZUTA 3S98A 3BUYB 1NC2B 4WNQA 2XKSA 4HUXA 2BNRB 5C09E 3MV8E 3DTXB 1A21A 3V6OA 4MJ5B 2VZ1A 3HCVB 3OKNA 5DD6A 1AIFA 3H9SA 3VE0A 1EJOL 4LIQE 1D5IL 2F19H 4JFQA 1XGPB 1EEQA 4W6YB 2NYYC 3NIGE 1HK6A 4Z77B 5T33L 5HYJE 3QA3B 4M61B 5JQHC 4MA7H 1RUKH 5I74C 3TA3B 3AXLB 4K7PY 3K4ZA 4P46C 2P8MA 3DVNA 4RAUA 1BP3B 1RULL 2Q3AA 5DGRA 1UB5A 5DQDL 3RY5A 3MUZ1 5C0BD 4CVZA 2FATH 4Y4HC 5IHLB 2Q76A 5SV3A 1I1AA 2QQKH 1ZHNA 4KKCC 2CDFA 4JO3L 4JKLA 4NO3A 1SVCP 2GAZB 3DNKA 5K9KA 2ZUQC 3T8XB 3STBA 1A6VL 5EZIL 1LP9F 4TRPL 4LVNB 4AIXA 2CXGA 1Q0XL 1RK0B 2LAGB 1IBGH 1T3FA 3ARFA 5B38B 2WBWB 3ZL4L 1KYOJ 4DVRH 3DMMC 2C7UB 5IROC 2BXZA 1RZ8A 5F7NC 5DD0H 1I7RB 1LO5A 1MFCL 5D71H 2C9AA 1S7TB 3JBG7 3OJVC 32C2A 2XG4A 3C8DA 2BVPB 4S1RH 1I9JL 5E5RB 3RVTC 3D9AL 3ULVL 4D9LL 1FNGA 1MCDA 4K3JH 3H9HB 5CEXA 2WLYA 2VLRB 3RWIB 5L8KB 5DHYA 1G7HB 3BH9A 1C5DB 3MOBL 3BW9B 3NIGF 4R9HA 3RA7H 1NUNB 1WEJL 3LEVH 4KXZI 5F6IC 1S78C 3P4OB 4BH8A 3SGKA 1F6LL 4O2FB 3UPCA 1BJMA 4ORZC 3MXVH 2HT4C 1LQSR 1PSKL 5D1QB 3E1F1 3PWVA 4MGXA 1N6QH 5KSBB 2NXZC 5CEYA 1U8HB 4GT7A 5FYJH 1C7SA 1A1OA 4JZOA 2FD6L 3ARRA 4HK3J 1T7WA 2HG5A 1A64A 2PXYD 5K9OB 1MAJA 4BFEA 3MODH 5ABDE 5DK0A 2EO1A 4PJFE 4HUKB 3JWOL 1EO7A 3EYUH 2ITDA 2VLKE 5CCKH 3HG1A 1Q9LB 1HI6B 3MRCA 4NHUB 3P0VH 1X5JA 2JCCE 2J6EH 2CRZA 3KYAA 1K8IB 1B0GB 3W9DA 5E95B 3TWCL 2ICEB 2Y23A 3AREB 5FEBA 2XYCA 4FFWC 2G5RA 1NPUA 3MTRA 5CP7B 4DFHA 3KPRE 2EDEA 4JFOA 1T1YB 2R9HD 2XV6B 2EKJA 3ZHKA 5FGCE 5F7KC 4JZJC 4LSQL 4DCQB 3IAPA 4L4TD 1HYRC 1MRFL 3D0VB 4N0FB 3GGWB 5HVFB 2BOBA 4UV7H 4EQ3A 1V5JA 4HUUA 3QQ4A 5ACZB 4EDWL 3M07A 4P3CL 4X4MA 2YN5A 5IFHH 4G6AD 3MLWH 3DX6B 3QYCA 3VFTB 3RU8H 3BRDA 5JXAL 1B90A 4KK9C 2X4NB 4UUJA 1ORSA 4XGZA 5EBLA 2A0LD 1R3LA 2DD8L 2R0KL 2VR9A 3WO4C 3ZKMD 3WUWA 4V2BA 1QSEE 5L2KE 4PJCA 3LKNA 1FAIL 1A6AA 4OGXH 4UINH 1W0VB 3T0EB 3HI1A 5HTSA 4XTRC 1ND0B 3A6BL 3AY4C 4P9HH 3EOAA 5FHAH 4HHAB 3WFDL 1U9KA 1IGIL 3QXVA 1PYWB 4WI2A 3TJEH 1SY6A 1DQDH 3ULUC 3EUUA 2MKLC 2GAZA 3B2VL 3CIQA 2N1KA 3VDCA 5IOPA 2DQFA 4PJFF 4V1DD 5EU6D 4HS8H 1IFHH 3QUZD 3QDGA 1DBAH 5AUMA 1AR1C 4IEFB 5J57B 2AS5M 1KFAH 1NDMB 5E6IB 1CQKA 3WNOA 4GW4B 4R26L 1FSKB 2H1PH 2JCCF 4I18C 3MLXL 1P7KA 3QUMA 1INQA 1QFOA 2E9IA 3BQUC 4MD5A 3MJGX 4I13B 2Z91B 1OAQH 4HIXL 3CFBA 3JV4B 5DMGC 1IE5A 5LCVH 5DJAA 4O4YL 4PGDA 1R3HA 4X6BA 3K8MA 3MNZB 1M6OB 1E28A 1CFVH 2XTJB 1R5WA 2Z4QA 3D6GA 1W2KT 3RWIA 3W39B 1G7HA 1YMHA 1T2QL 2YUZA 3UPAA 4HIJB 5T3XE 4RGOL 5DVOA 4PP2B 2Z35B 4S2SB 4A2MA 3VFWA 1MRCL 2WP3T 5EU5A 3VFRA 2CR6A 1J8HA 4XB7A 3TPUA 3WIFA 2AJYH 5HHPA 5LWYH 5IW6B 5JUEL 5DRNA 5ID0B 4XVJH 3NCYS 4YUEL 1NFIA 1DDHA 5KBNC 3PJSA 4XC3H 4PJXB 4XP5H 3MOAH 2Z8SA 4F7PB 5CP3H 1OM3H 4MMZC 2IAMB 5CBEB 3GSWB 1CFBA 4GMTL 1A6WH 3L3KA 3QJFB 5DMIL 4ZSOB 5DC4B 1JWUB 2BVQB 5JLZB 2H2SD 4FXGB 3VFOB 2AKRB 1HI6A 3UCRA 2VDOH 3VRIB 1I8IB 3D2UA 3MRQA 4PRHA 2VXVH 3ZE0E 4JFYB 5HHME 3P0YH 4LCIL 4YLQT 5A2LH 3AAZB 1S3KL 5HGDB 1BBJB 1KIRA 4QXWA 4O58H 4JG1L 1MSPA 2DTMH 3TO2B 1LEIA 1I7TA 3J7HA 3HZMB 5IVOA 2ICWJ 2Q3ZA 1MLBB 1Z3GL 2B2XH 4JM2F 1T20B 3BVNB 4O9HH 4P4KC 1DEEA 2KH2B 4M7LT 5DJZA 5JHLL 5CIPH 1RIHL 4HKZA 1MCIA 1BWWA 4X99A 1F3JA 1QA9A 4R97B 2LU7A 5F9OH 5TF0A 3VXMB 5IMOB 4MAYD 2Q1EA 3C8KB 4M6OH 3KYKL 5IHUL 4IRJA 2RIKA 5I1KH 1BVLB 3K2UL 1UEMA 3LDBB 3CFJB 4CJ1A 1FH5H 4K7PH 1P7QD 4PJGA 5KSAD 4LLUA 5C1MB 3GMOA 4GKZB 4PGJA 5C08E 3VRJB 4OCXH 4WI3A 1XIWD 3SPVB 4XC1L 4HDIA 4N0CD 4X9GA 1K8DA 2EDOA 1NKOA 1X5AA 3RIFK 1RZKH 2DQIH 2NY6B 4M8VA 2YK1L 4HT1L 3BKCL 1QRNA 3H6JA 3L3HA 2Q8AH 5HXMA 2JK5B 1SJEA 4QYOB 2EECA 1NMAH 4XHJC 2FO4B 2WLZA 3ZE0F 4U3XA 1CCZA 1K4DA 2V9QA 3FQUB 4DZBA 3F5WB 4M6NL 3LKOB 3BDXA 2LV4A 2XXCB 3RJQB 5I15L 1L7IH 1BVZA 3O45A 2ZKHL 4JDZB 4XMKH 5SWQB 3FKUS 3DVGB 4ZPVA 3G5YB 4P2CG 1AXTL 4UT9L 1AHWB 3OL2A 5C07B 1ZVYA 5HHQB 2HT3C 2FEEI 3UC0L 1QLEH 4MD4B 1H3VA 2X4QB 4YFEA 4PGEA 1IGTA 5AD0B 4BYHA 4Y88A 3K1KC 2YD3A 1J1PH 1P84J 4D0BB 5C0DA 1TNNA 3QDJD 4MCYA 4Y5XB 2AQ2A 1HKLL 4JFPA 4BQ8A 4NZRH 4LBEB 4U1LA 3SDXA 1I3RA 5HPMA 3MRKB 4K3GA 3KPNA 5CGYD 5IB1B 4LVHB 4XP6L 3UJIL 4ZYKA 2V2TA 1WCQA 2OK0L 3IKCA 5EUOB 3UTSE 4CNIA 3O6FB 2QADC 1O5DT 1YDPA 4W70A 1NCCL 5GHWH 5SWZE 5LVEA 2FX8H 4PJDE 1ES0A 2ARWA 3QEUA 4MJ6A 1A7NH 2CDEA 4HUWB 4LLAA 1CF8H 1CDUA 3VXOA 3NABH 4ZXBB 2R0LH 4K9EL 3F7QA 3UTOA 5JMRA 3MSPA 2IGFH 4M3JA 1X3DA 3HE6D 1NL0L 4E0RA 1CVSC 4OM1H 1HCFX 1LO0L 5KVMC 5E6ZA 2AXHA 5IB3A 1ADQL 1BQLH 4XMLL 1A4JA 5GSRA 1CDBA 3IFOA 1KJ2A 2GTWB 1U3HB 3X12A 1RURH 3KXFD 4MHHG 5FHBL 1IGYB 3TYFA 1UCTA 1ACYH 1XFPA 2PW1A 4W6WB 2PYEA 5ESAA 3C6LC 2E8YA 3IU3B 1T5WA 4K9EC 3IJHB 3OR6B 4JKWA 4JANB 1CDYA 4FQLL 3CU1A 5ALCL 3SJVE 4JY6B 1JWMB 2W0PA 5DD5H 5IEHB 4R4NC 5BVPL 3SDCD 2BZDA 1VB9A 5C0BA 2GFBB 1FVEB 4NRXB 3PWPD 4MA8H 4P5TC 3OKKA 2YOCA 5HGGS 2YC1B 1UACL 2DYPD 2VR4A 3D3VE 3I75B 4MJID 1AGEB 4ODSH 3VRJA 3AU1A 5ESQB 1HKFA 2FJHA 3OPZL 3MNWA 3VI3E 1TCRB 3ARDC 35C8H 5E03A 4LQFH 4PJDF 4PRBB 1OWWA 1JPFB 1H5BC 4UT6H 4OKVB 1DZBA 3PP3H 1HXMB 1FNSL 4Q9QL 1NGZA 1K85A 5F7DA 4XVUD 2HFFA 2VXUH 4F57L 4G6KL 1KN4L 1B0RB 4MWFB 3KLHC 3DSFH 5SV4A 4NGHH 5IVZB 3EYSH 3T2NL 2P5WB 4LEXH 5JW5B 2VN4A 2FJGB 4GMSL 3WIHH 1CS6A 2HT2C 3QXAB 4X0KA 1QSFD 4PR5A 1HSAB 2IQAA 5JHDB 1GGCH 5CLTA 4XAKE 3NVQA 1INEL 1H15B 2PW2A 2A38A 5I1JL 2B1AH 4GBXC 3VXUB 1G7QB 4NQVA 3O3EB 1YNKH 1GZPB 2IH1B 3ULVE 1I1CA 4IOIB 2BNQB 3SO3C 1IC5L 2FCBA 5C0IB 1PG7H 5B39B 4F7CB 2W0LA 1FJ1B 3GJFH 3FOLA 2CUMA 5FFLA 1O0VA 3OMZA 1HHIA 5J3HC 2J4WH 2YD1A 4JGUA 1ZLSH 4S11A 4DW2H 5GRUL 4WV1C 3TH2T 1YPZA 2A6KA 1YJDH 5EU7E 4Y8AA 1Q0YH 2B0SL 3CSPA 4JLRA 3VFVA 5L7XL 2B39A 4WHYG 1G1YA 4E41E 1NGYA 2FR4B 1MY7A 2BOCB 3NFNA 3NFSL 5E1AA 1JRHI 2VLLA 1UWEL 2V7NA 3AMLA 3MRHB 3NPSB 4HGMA 5KVDL 1G7IB 3QHFH 3MUGA 4OFKA 1EEZB 1N5YL 3F6IA 5D1ZB 1FVDA 1EHNA 4GRWB 1AKJD 1GHFH 3SDDB 1CLOH 3CNKA 4LSDA 1OP9A 1E4WH 4QT5B 1CZ8L 4GLRI 3RKDD 5CZXD 1AC0A 1FC2D 3C2AL 3QIWD 1PG7X 4QHLA 5E70A 3ZKXC 3PNWB 4XPFH 1CL7H 3B9KC 1NGPL 2EYSA 4KTEH 3V6ZA 4OTXH 4PJIB 4X7SL 3RQ3A 3WO3B 4AYFA 1IC4H 4OGZA 4L4TA 4X7FC 5BV7H 3EBAA 1C5CH 4G8EA 3LH2H 2H3NB 2R69H 1DLHA 3VXNA 5GQBA 5F7EL 4S1QH 2GUOA 4IBLT 3TIEA 4LSPH 3MLTA 1F58H 3NCCB 3V4VH 3SGEH 5DO2C 4QY8B 5JOFB 3KPMB 3ULVF 2DF3A 4DKEH 1W0WB 2WUCL 3QXUA 2IG2H 5JDSB 5EO9B 1KELH 3KPPA 1FRGL 3L3GA 2R1YB 1XF3B 2ATPA 4JFHE 5KJRL 2ED9A 4FFYH 1YN6B 5EC2B 5CUSH 4AL8H 4NRXA 1NLBH 4BM7A 5HYQA 1U91A 4M1DL 1JPTH 1V7NH 2V2WB 4KVCL 2X4TB 4E9LA 3C60C 3WEXA 3BKYH 2X70B 2F74A 1J11A 3AB0B 4TNWK 2CLVB 4P2QA 2QQNH 4V1DA 5EU6A 1MCPL 3PF2A 3CFEB 1E27B 3PGFH 5D72L 1DTUA 2VSCA 4XRCA 5E5MA 5GS0H 1NAKH 3VH8B 5C0CB 1XR9B 3GSNH 4KAQL 3V8OA 4P2OB 1QR1B 3VJ6B 1AQKH 4QHUB 3E6HB 3SQOH 2ZUWA 4WTZA 5IMKB 4NKDA 3RDTD 4QTHB 3BT2L 4F7TB 1WCBA 3NIDE 4I3SH 4DOHE 1DR9A 3MRBB 5EZLB 3L7EB 4ONFH 3GDBA 1WWBX 4TSBL 1JZ3A 1KJ3L 1HNGA 3RGVD 3KR3H 1RJZA 1NBVH 2DL2A 4AEIH 4OAWA 2YPLB 4XPTL 1MIML 2WWKT 1WK0A 3ARTA 2GW5A 2IFGA 1X5KA 3K81A 2UVEA 2F8XC 4Z95L 1HE7A 1ULVA 4OZHA 3VDBA 5IKCB 4JEGB 2FX7L 1VKXA 2AEQL 4BZ1H 5FDWB 4RMTA 3P4MA 4YBLB 4XNUH 3LIZH 4U6YB 4PRPD 2Q7YB 4KKBC 4P2RB 5GJSL 1RZIA 2QSTA 2DM4A 3C09B 4ZO9A 3T0VA 2IQ9L 2O5XH 4RMWA 4URTB 4XPHH 1UH4A 2C3VA 3U4EA 5BW7A 3AMKA 5IEKA 3JXAA 1DQQA 1MWAH 2XFXB 4NBXB 1FFNB 4PY7A 3GMRB 2A83B 3O8XB 3FZUD 4IHOA 4GG6E 4KMTL 1VADA 1X6LA 5E8PA 3O2DL 3U1SL 4NWUL 3HB3D 1JYVA 2PYFB 4MLIA 5DJCB 1F11B 2P46B 1QLRA 5I8OL 3MA9L 5D7JC 4Y2DB 4WEMB 3GSXA 2CLRB 1YYML 1I8KA 5H35B 4HBCL 1KJVA 3FQNA 1NCDL 3NIDF 4L5FL 2AGJL 1D5MA 1Z6JT 4YGAB 2DQDH 2Y5TA 5IJKA 3FMGL 3H3BC 4LIQH 3JTSB 4KK5D 5IQ9B 2HMID 1B9ZA 1BBDH 3M8OH 1L0XA 5HGBA 3F7PC 4OUUA 3KPQB 5GGTA 1D6EB 5IP4A 4ODWB 2NNAA 2CDGA 2IADA 4WW2F 1FAKT 4MS8D 4LLMB 3BO8A 2GCYB 1KN2H 4RMSA 5E9DD 5SWSE 2WBJB 1P7QA 5CIPB 2F54E 43C9B 1I1YA 1C5BH 1XIWA 3BXNA 1CFQA 3Q5TA 1UZ6F 1X5XA 1HIMH 2AXFA 4UOW0 4ELME 4HF5H 5BRZD 1ZLWH 5EIIB 2JJSC 4UT7H 4APQD 1CTOA 2YUVA 1L9NA 3MRJA 4BFIA 3GMQB 3AUVA 1RIUL 2VNCA 4KJWC 4PLKD 3GZKA 1D9KD 4GG6F 2OP4L 1BOGB 5I76A 2VLJE 1A6TB 3EJYC 3NMEA 4J8RA 1FO0L 1D5BA 3F7YB 3EYFA 3QIUC 5IESL 4PRIE 1G0YR 1EEYB 1INDL 1NKRA 4NUJB 2XN9D 3S36L 4JFEB 4XP9L 3IDGA 2YZ8A 1NCAH 4HSQA 4JFFB 3NA4A 4XMPH 4OM0H 1J1OH 1FGNH 3SBWC 3PUCA 2MCPH 2ATKB 3MV9B 5MEPA 1K9TA 4RMUA 3VFUB 4PJAE 3DI2B 1NQBA 5CINL 5E8OA 3NAAH 4XBGB 1AGCB 5CMAA 4EIGB 4HUVA 5EU4A 3KYOA 1UJ3A 4R2GB 1AO7B 1KC5L 5DUPL 5D70L 1IAMA 4Y4KB 4WRLA 3TBWB 3VWJD 4OKDA 1LO4H 2NW3A 2NR6D 3DROA 1LK2A 1VGKB 3CC5B 3IKKA 1K6QH 3R0NA 3WMSA 3D0LB 4OIIH 5IF0B 1M7DB 3WJJC 4N9GA 3FO0L 5IBTL 3AS0A 1SYSB 4HIHB 3HR5B 4ELMF 4LU5H 3O3UN 3U9UB 2H45A 2Y36H 5E2UL 3H7BB 4OZ4A 3ZDZE 3IDNA 3HE6A 5C9JB 3PGDB 1IRAY 1T2XA 4FQCL 3WE6A 5KN5A 3BP7B 3I9GH 4JREC 4P0DA 4S0TD 2AVGA 4Z7OE 1GC1H 1MI5D 4CMHB 5MHSE 3RPKA 1FZOA 5EA0L 1F90H 3KXFA 2PO6B 4UQ2B 1YEIL 4JO1L 1HH9A 1IKNA 2G5BA 4G6MH 3A67H 4KHTH 5M94B 2J88H 3MRNB 4Z7VA 4YO0A 1FZJA 4EN3D 3V6OC 1S9VB 1NC4A 2PETA 2R2CA 4LARL 4ZOEA 3MO1A 5DJ6B 1ETZB 3CVHB 1IKFL 1A0QH 4RFNC 1MFDH 5ADPL 4G80A 4PJAF 2C5DC 1HHKA 2VLME 1NGWA 1ZS8B 1QP1A 1MJUL 2Q86B 3SDCA 3U82B 5GJTH 4O2EB 2A77L 1KG0A 5D2LA 5H2BB 4TVPD 4FQXD 2AJUH 3PWPA 4OLEA 2DQUL 1G7PA 4LSSL 2DYPA 2X4OA 3D85B 5TQ2L 1S7XB 5CIPA 5JZ7C 3DLQR 1W8OA 4ZMAT 2P8PB 3I6KB 3WXWL 1VGEH 4YPJA 1I1AC 3IF1B 5L2JB 1JIBA 4G7YH 3H2WA 2DLEA 1R0AL 1KB9J 5DQJA 3DGGA 4FHBD 2EYTB 4Z7UA 4NZTL 3REWB 5GS2D 4YE4L 1AGBA 1OF2B 4KVNL 3ZDZF 3GM0A 5T3ZD 3LN4A 4NP4L 5F1SA 1S7SB 3ARFC 4Z7OF 3MRPB 4DFIA 1QSFA 5DHVH 2VDLL 3OKDA 5DUML 4HV8A 5DVNA 1CGTA 1F45A 1ED3B 4L3EB 1UXSA 3HE7B 5C6WH 3QZWB 4RBPK 2DDQL 5JO5B 1XGQB 3E8UL 1UM4L 4XBEH 3GI9L 1ZE3C 3VXSD 1DANT 1FYTB 4KY1L 4Y5VB 5JR1H 1B4RA 5T3XH 4H88L 2OJZH 3TT3L 1DEDA 1NDGB 3SGKC 4NCDA 3QHZH 4TN9A 3C6SB 4F8QA 5IB4B 5B22A 2OL3L 4IMLA 4X6EA 4FQJH 3OJMB 1JPST 4KRPC 3SCMC 3GJFB 3RBSA 2VC2L 4NKOB 1X4ZA 4H26B 1KXTB 4NM8H 1L7TH 3O41B 3DHJA 4KHXL 4G3YH 5E2TH 3MFFA 1AKJA 1Q1JH 3UZQA 5BMFH 3H3PH 2A9NH 2R8SL 4H5SB 1VACB 3RZCD 1WZMA 1X7QB 5JW4N 4YQXH 3G5ZB 4PYGA 4JFZH 1IZKA 3I3DA 5DRZA 4L29A 1AI1L 2Z0BA 3ME0A 1T66C 1QNZH 4MA1B 4NHCH 2OZ4A 5BS0D 2I9TB 4HCRH 5E4EC 1EO8L 3MBXH 4EXPX 4XPGL 5DEFB 3E6FA 5DJ0A 1Q9WB 2D7TH 3V5DB 5L6YL 4NQED 1MLCB 3MJ9A 1UM5H 4BQ6A 1L9MA 1WICA 3W2DL 4PJ8B 3TT1H 4B53A 1HH6B 3L3JB 1A1MA 3FO2B 5ALBL 3TCLA 3TNMA 4D3CL 1U8KB 3I02B 4ZUUA 2W9DH 4JPVH 1PLGH 1Q72H 2AJVH 2AK4E 5D7LB 3ZDYE 2YR3A 5BV7B 3V4UL 1DBKH 4Q6YA 4R7DB 4WU7B 4WW1A 3K1DA 2OTWA 4WJ5A 3TP4A 3U4BL 3P73B 3RKPA 1SBSH 5JIKA 5EOTB 4GH7B 1E4XL 1P1ZA 4QRPE 5FKPB 1MJJA 1J5OL 4Z7WE 2WNGA 3HC4H 3MLZH 3QUXA 5KVFL 1TJGH 1GPOL 5L88L 5CZVH 1BECA 5L9DH 4AMKH 1T7ZA 3ORJA 4QOKA 1MF2H 3SOBL 5JXED 1HILB 1P4BH 1PBYA 4HIEA 2AJ3B 4OCSH 3JTTB 5JW3L 3MGTB 2BCKB 3W81A 1G7MA 4PRNA 2A1WH 2EDYA 3V4PL 3WN5A 4QRRE 3VXTA 4H8WL 4LVNC 1BFOB 1CICB 5F8RC 5LXGL 3ARBD 4PG9A 2OM5A 4JRYD 3CCHB 3IGAB 3RRQA 4XXDB 3TNNA 4D94A 2I60H 3ZLQC 1RIVL 1C16B 3RDTA 5IFJB 3P9MB 5FYKE 4WI8A 1N5AA 4ZUSB 4C58B 1S9XA 1OP5H 5IW3A 3QRGH 3QEQE 4GAYA 2DWEB 3WS3A 2PKDA 4X8JA 1U93B 3HZKB 1KENL 1KCUL 3RGVA 4PJHA 3GSNB 3OAYK 4ZNEE 3T4AB 3QCTL 4UU9A 4GAJH 5I0DA 2NY0B 1TETL 3KDMB 3T65A 4W81A 4KZDH 1OTSD 3QFDB 5EN2B 4NC1E 4JPIB 3HPLA 1RVFL 3ZDYF 1F4XL 1IQWH 4Y16D 3MYZA 4NN6B 3TO4D 4JDTH 3HRPA 2EDQA 2MSPA 3EO1B 2R0WH 5FO8B 8CGTA 4TTDD 1HZHL 4YAQB 4Z7WF 2FEDC 3QRFM 5FA3B 3LS5H 5FYKU 2Z8RA 2CO7B 1U8LB 4TQEL 1EH9A 2OR7A 4LPVA 2X4SA 3WFHB 1VACA 4EUPA 1KB5H 5IB2A 3U0TA 4Y5YB 4KUZH 1Q9OA 2XNAA 3VA6A 3QG6B 1TTGA 4F33A 2R4SL 5C0RH 5DMYA 1VEOA 3FHAA 2BY2A 4M4RA 1MFAH 2VDMH 4C83A 4F15C 2F53D 4LLYB 2XPGB 4AM0B 1AGFB 1LEGA 2D31A 1M4KA 1QKZL 2NZ9C 1S9WB 3PQYA 4QWWC 4AT6B 4YHKL 1MWAB 3VDAA 1S5HA 3AS3A 1MQKL 3LKQA 2ADGA 4NQXA 1Z9LA 1R3IH 1D5XA 4FZ8L 1TJHL 4DKFL 4HZAA 3P30H 3DRTA 5ICZA 2V5MA 3RWEB 2GSGA 1OAZL 4MA3A 3O2WL 4L3CB 4QRUA 2XWTA 1IM9D 2VXTL 1KLUA 25C8L 4RQQB 3MREA 4GKOA 4CVXB 2HTKC 1D5IH 3LRHA 3TBYB 1F2XK 2NCMA 3NCMA 5CS7A 5I0ZA 4H1LG 2P5EB 3KYNA 5T33H 1VFBA 1JTOA 3C5SA 3BD5A 1HXYA 5C09B 3MV8B 4R7NA 2OJEA 5E9DA 3BPCA 4DVBB 4J1UB 1WJ3A 1JGUH 3BI9X 5TH2B 4IRJC 1BIIA 1X5GA 5LGHH 3AFLA 4NQSB 2EZ0C 1MEXH 4OGAD 1WBZA 2X1OA 2VQUA 1RULH 1LE5B 3QO0A 5ITBL 1IT9L 1I1FB 4FMKA 4ZQKB 4YX2L 3T0EC 1MHHA 3NH7L 1FC1A 1G9MH 5E56A 4RSVA 5BRZA 4AENB 5L8JB 3MV7E 3U0WH 1YECH 4Y4FD 3I6LE 2J2ZA 4APQA 4K7FA 3B8YA 4M7JL 4OLZL 4WUKL 3KPTA 4M6AA 5BOPA 5C0GA 3FB8A 1A6VH 3P11L 1DN2A 4TRPH 3GRWA 3RVXC 1RUPL 1WBYB 4XH2B 3FFCE 2Y4SA 4XI5C 1BZ7B 5K59E 1Q0XH 4P57B 5GRVL 3STLA 1CGSH 1GOHA 4DQOL 1NFDA 3QDME 3ZL4H 4G9FE 3T1WA 1FDLL 2F5BL 2XN9A 1YNLL 2B7DT 5J1AB 3O3DA 5J6GB 4JR9H 1KGCE 3T4YB 3WFEH 1TXKA 5DMJB 4AIZB 3VMOA 1T4KB 5E24E 4IRSB 2OXHA 2VTFA 4NWTL 4PJ5E 3ZMRA 2XTJC 3ULVH 4WI7A 1U92B 3RL1A 4ZUWA 4NDMB 1MH5B 1IEAB 5C8JA 5J9PA 1CXEA 1WEJH 2OXGA 5JOPD 3MRDB 5DJ8B 3R1GL 1HINH 5I66A 2ICWB 2V7HB 1U8QA 3SKOB 2Y07L 3OQ3B 1PSKH 1BD2E 4OCMC 2RQ8A 1XF2B 1I4FA 1JF1A 5D93C 5EUKA 3BX7C 3RVWC 3JV5A 1OP5K 4ERSL 3OWEA 1W72A 4LSVH 3EDEA 2AK1H 5D2NA 1M7IB 3M17A 3EKCA 3BP4A 2UZIH 4ETYA 3JWOH 3WNPA 5MEQA 3KJ6L 1RK1A 2X6MA 4FXLA 1MCOH 1MCSA 5C0AB 1HHHA 5K9QI 1MI5A 3DBXB 1TENA 5E94A 5GIRA 2EE3A 3OKLA 5K59F 5C70A 1C12A 3CLEL 4KDTA 1P4IH 5TE4H 3MCKB 4KPHL 4PJFB 1HYSC 1LP9A 5T1LA 3G6AB 1MJ7L 2E7BA 3DO3A 4IM8A 1R3KB 2VLKB 3UDWA 3O11A 3P4LA 4LCWE 4Z7NE 4OQTA 4HX1A 5I6XC 4OZGA 4TOYL 2JCCB 1SM3H 2P8LB 4L9LB 3ROOA 3D48R 3WYRA 1MCCA 4WWKB 4LHQB 4JAMA 5I30L 1UJTA 5MEOA 4LVOB 1BQSA 5EO0B 4P46D 3JV6B 2CUHA 4FQXA 5FGCB 2BY3A 3RWFB 4BKLA 2VDQH 4U1SB 4CJ0A 1OAKL 2R0KH 4W68A 2DQHL 2YUWA 3BP6A 4PGBA 3T08A 1ZANH 5B8CA 2FYYB 1EHLL 5C6TH 3LDBC 4HLZG 4LOUD 1JNLH 3IJYB 4IOFC 5HYJA 5DTFA 4FABL 3GSOB 4YDJA 1HQRB 3GI8H 2DBLL 3WFDH 1FNLA 3EO9L 4EI6A 5FIEA 5KW9L 3RNQB 2DM7A 5L2KB 1MAML 3B2VH 5E2VL 4JPWL 5GGUA 4UNUA 5J1SC 1EMTH 2BRRL 3V7AG 5ILTL 2PF6A 3QXDB 3FN9A 1RJCA 3RWCA 3VFPB 3DMMD 4Y1AE 2EIZA 3ILQD 3O3BA 5DYOB 3HI6L 1RZFL 2YA1A 5TQ0L 3Q2CA 4YHNA 1T2JA 5BJTA 7CGTA 1NMCC 1A9BA 3MLXH 1I7ZA 2ADFH 4LKCA 5J89A 3GKWL 4RFEB 1KBGH 3RVTD 3V0WL 3WFBL 1FL3A 2RCSL 4Z7NF 2MQCA 1CD1B 1H3GA 4QHNB 3VXSA 2E7CA 2IPTL 2Y06H 3C5ZD 4O4YH 5INDB 2BRQA 3O9WB 1I9EA 3MRGB 2R1WB 3KPLB 2VKWA 3X3GH 5CHNB 1LDSA 5DHVB 1YEHH 3KS0H 3NGBC 1G9NL 5TFSL 3BKJH 3H42L 2VB5A 4JM2B 1KPRA 1MUJA 2VR5A 5E8NB 5DQ9B 5C92A 5HHOE 3W0WE 5K9QG 4QTIL 3Q1SL 2B5IB 2ICCA 2JB6B 3UTZA 4KMQA 3MYJB 2BSSB 2OR9L 4U6VL 3TN0D 1MAKA 2GJ6E 3X11A 1T89A 3QXTA 4HWZA 3V7MA 2BSTA 2NXYB 4HJGB 5C0EB 3LOWA 3RZCA 3EFFB 5MERB 4OJFH 1HHGB 4U2YA 5D6DA 2PXYB 1XCQB 1SEBB 4P5MB 4RAVB 3IAQA 3LMJL 1JBJA 5DK2A 4GMTH 3VGAB 5FYLE 5TE7H 5DMIH 3L1OL 4PRDA 1UC6A 5F21B 1J0KA 2VH5H 5F96L 3H8NA 1K4CB 5BS0A 1Q94A 4PRAA 1ZHKB 2WIMA 3S5LB 1DE4B 4FFWD 2ZPKL 1ZGLP 3FRPG 3T1FA 4ODVL 4LCIH 4PJFA 1XAUA 1ZGLA 4WGVB 1S3KH 1NBYB 1ZSDA 2QL1A 3NCYP 4NQEA 2R9HC 4JG1H 1U3HC 5MP6H 2DIAA 2FO1A 1LMKA 5MEND 4PJ9D 5TDOB 4FQ1H 2X4UB 1QZ1A 4MA7L 3FQWB 4G8GE 2IMMA 4MNQE 3SDYH 2DTSA 1RIHH 3OJDA 5DDHA 4WI4A 2DMCA 3KPRA 4UOW1 3OKMB 1LD9A 4JCLA 3ZKMC 3OGCB 5FKAA 3FQRB 1MHEA 4O2CB 5DSCA 1UQSB 5I1IL 4KRLB 3KYKH 2X4PA 2DM2A 2VZ3A 3AC0A 4LLDB 4HKJA 5MI0B 5IB5B 1XR8B 3I6GB 3K2UH 3RVUD 2H26B 4NC0B 1A2YB 2W9EH 3CSBA 5JXEA 4OCWL 3DSNA 4H25B 4ZFFB 1D5ZB 2Q6WB 3VD9A 3P0GB 4XC1H 1QSEA 1IBGL 1WWCA 3X3FL 4JFHD 1AR1D 2FIKA 2O26U 3QPQC 4FQIL 1YEEH 3KGRA 5JNYB 3ARBA 5DD0L 4JRYA 5F9WB 2XZAL 3QUZB 3FOMA 5D71L 2JE8A 3FN0L 4NO0D 5C08B 4P23B 3IDMA 4WGWB 3X14A 4D0CA 3LQZA 4MQ7A 1U8OA 3ES6A 4K07A 5DMGD 3T0WA 3VXRE 4NQDD 3PWLA 4JVUA 5J6HB 2EDRA 2DLGA 2B8OT 4HAFA 4KJYA 5E5UB 2ZKHH 4PTUB 3OF6D 4MB3A 4UQ3B 2SEBB 3LEVL 4JN1H 5FB8A 4UT9H 5IBUB 3S37X 4BUGA 4R3SB 2BC4A 3MACH 4ODTH 1CR9L 2BHZA 5IHZA 1FL6A 1OLLA 3G04A 2APTA 4Y16A 3TO4A 2AV7A 1TITA 5C2BL 3HLAA 3GBNL 2AI0L 3OX8A 3W5NA 5TGBB 3MRIB 4UILL 3ILPA 2IFFL 1IZJA 1CWVA 3WXVH 3DARA 4NN7B 1IM3A 4XP6H 3EYUL 3IETA 1MREL 4XX1E 3UJIH 1KLGA 1OSZB 5CCKL 5E8EB 3FT3A 3GIZL 3V5HB 4JQIH 3ZYJA 5BW7C 1U8JB 4OFDA 2FHFA 4I4WA 3NPSC 3LD8C 3HRZB 2J6EL 5D1ZC 2F15A 2F53A 2H2SC 2YRZA 1EK3A 1ZV5A 4RISH 3IFNH 1AR2A 2YD6A 4KJPD 4WFGD 1GVIA 3H3KA 1T22A 1IQDB 1NL0H 5SWZB 1LO0H 4PJDB 4L4VD 5KG9B 5CJQH 5EORH 1X5HA 1JPGB 2DJ4A 4UV7L 3PHSA 4X6CE 3JWDH 2W9LA 4U2ZA 4M43H 1IM9A 4Z0BH 4NO5A 3G5XB 3QAZB 5CJXA 2NPLX