4FQJH

Influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
228
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGASVRVSCRASGYIFTESGITWVRQAPGQGLEWMGWISGYSGDTKYAQKLQGRVTMTKDTSTTTAYMELRSLRYDDTAVYYCARDVQYSGSYLGAYYFDYWSPGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Influenza b virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
total genus 42
structure length 222
sequence length 228
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH01
1GZPA 5GS2D 2M2DA 5ECJE 4GBXB 4GQ9L 3M17A 1PQZA 1XEDA 3WE6A 2FEEL 2ADJB 4QLRA 1PSKL 3G5ZB 1Z0MA 2MHAB 5CLTA 2PW1A 4FQLH 4P4KA 5DEFB 1JYXA 5ITFB 1QLRA 2WUCH 4UNTA 4LPUA 1JWMA 4F7MB 1TJHL 3ALXA 3U9UB 4MAYD 5E2JA 1ZAGA 2ARJA 3EYUH 2DKMA 3P11H 1JHTB 4H1LA 3Q6FA 4JE4B 2YN5A 1YEHL 1R5WA 1YPZB 5FYKE 2DBJA 3TN0A 4F9PA 2QQLH 2R2EB 2B5IC 3O8XA 3OKNB 4RX4D 2J1KA 5EUOF 3E6HA 4ZPVB 4P9HL 4JM2D 5EU6A 3U2SB 5K9JH 2QKIB 3FFCB 1YQ2A 4JKLA 1J0JA 2WBJA 3JUYA 2Q8BL 3WFCH 3CX5J 5D8JL 4Y2DD 2NX5D 5D7KE 2Z31C 4ISVA 1Q72L 1U2CA 4MAUL 3FB8B 1UWGL 4LFHD 5D1XD 1EGJL 2ZKHL 5H8DA 3E1F1 4CVUA 4G9FB 4AZ8A 2FL5A 5ALCH 3VFTB 5M95B 1QFPA 4FQ1L 2M1KA 3O8XB 2ATKB 1U93B 4P2OD 4RISH 1HSAA 3NFSH 1OSPH 4YFLF 3T2NL 3BZFA 4WVRA 4P2RD 1BQSA 2A74B 1V7ML 3EOAB 1ZGLA 4IIQA 3ARBC 3VFWA 1ZGLM 2Y06H 3WNOA 1UM5L 2CK0H 1XGUA 2NY4D 1XGTB 3PWLA 3G08A 4OQTH 4WTZG 4PGDA 3L5WA 4PP1D 1ORSA 3FN3A 4Y5XB 3NIGE 4PS4H 5I1GH 5TQ0H 1MCIA 3EDDA 2A0LC 2HT2D 3BQUB 4DUWA 1J12A 4LPTA 4F7CB 5D2LA 3MCKA 4DQOL 1I1YA 5TH2B 2QQLL 3DETC 4NQDD 1NLBH 5DD0L 2BY3A 5ADPL 5TE6L 3OXRA 3MLYL 1ZVSB 1BWMA 2VAJA 4MAYA 1MWAA 5D7KD 5DHVB 4MNQE 1ZLUH 3MLXH 2QR0B 5EU7E 1CD1A 2X6MA 2BMKB 5IB3A 2VLKA 4NRXA 4G6ML 1J8KA 5GS1A 2J6EL 3U79A 2EIZA 3SKMA 4L1DA 1T03H 4NQVA 1HH6B 2W1NA 1DQJA 3FO0H 4LSSL 1BFSA 5CP3A 3SKJH 1XR9B 2RHEA 2VH5H 3IJYB 4PJFF 5D72H 3QXVA 5E5UB 3VFNB 1WITA 2BOCA 4X6BB 4JFPA 3IAGC 1CQKA 4YK4C 1ZLWH 1FSKB 5GGTA 3T09A 5DD3H 4WY7H 2J5LB 3T2NH 5FCUH 4K3JL 5DA4A 1I7ZB 4GAJH 2C5DC 5D1XA 1SMAA 5L7XH 4PG2C 3GIVB 3RPKA 3EZJB 3WIFB 1QRNE 4U1MA 4Z8FH 1SY6A 1NANI 1L7TL 3PE9A 5FUZL 2RB8A 3BVNB 3MZTA 1U8JB 3FQWA 5T1LB 2IPUG 5L9DL 4HQQL 1UWGH 2HVJA 4R97B 4CVXB 4HJJH 1GC1L 1KIRB 1EHLL 1NSNH 4XC1H 5LQBL 3BSZL 4WWKC 3SCMD 4FFVD 4RWHA 3GMOA 4GRWB 3I3BA 4YZFF 4MNHA 4P0DA 3K8KA 4NFBA 1J1OL 2H6PA 4QRUA 4X7FC 1EX0A 4GUPA 3UDWA 5TQ2L 2Z0BA 1PZ5B 4H1LB 2QEJA 4OIIH 4OD1L 2I5YH 4TVPH 1RZKL 3CUPB 5AG8A 3QYCA 3NAAL 4FTVE 4M4RA 4X5WB 4HPYH 4PRIE 5GJSL 1F8TH 1V3KA 3SCMA 3QO1A 5F7LB 2JB5L 5IG7B 3UJIH 1AQDA 1F97A 4GW5A 4MDIA 4LLYA 5GRXG 2XV6B 4N0YH 3SE9H 4OZFG 4CJ0A 4H1LG 1OAXH 3B3IB 3CVHH 5DD6B 1KTLB 4EDXB 5D4QA 2B4CC 4PJHA 4QRPD 2DDQH 4OUUB 4ZOEA 4LIQL 4RX4A 3HAEB 4HHAA 3WO4C 4ZYKB 3S34H 5HPMA 4UQ3B 3C87A 2FHBA 4OZFB 2NY2C 4GXVL 5EUOA 3RGVA 3TBSA 1UH4A 4EVNA 1EBPA 1IGJB 1KGCE 4ZOAA 3BUTA 1JPSH 4F7PA 4P3DB 3WFCL 5JUEH 2DLFL 2BSRB 4HDIA 3TH2T 5DVNA 5ANMA 1AQDB 3D6GA 3O4OC 4GW5B 5I8OL 4K8RL 3QUXD 3CFEB 2LU3A 4HUWA 1CR9H 4W81A 4XP4L 3HUJA 3VRJB 5C3TA 1EDQA 4QT5A 3MO1B 1MJ8L 1UT9A 5J12B 1FNHA 1PG7X 3WE6B 3LEVL 4M1CC 4Y19D 1UZ8A 1PAMA 4GBXA 5E6ZA 1Z3GH 3L9RB 4EJ1C 3HE6C 4OZFA 4KY1H 4R7NB 3SDXB 3UPRB 5IOPB 5I16B 3ARFA 2R1XA 1NBYA 3OKYA 4MD4A 3AB0B 3G04A 3QNXA 4LFHG 3OSKA 2OJZH 4LLQB 1KPUB 1RZ7L 2BVEA 1HHJB 4CVWA 3D2UB 3B9VA 4ZD3L 1S9YB 5I1HH 5A40E 3V2AR 2Y7QA 3P73A 1FZMB 2MJWA 3PL6D 2F19H 2HH0L 3VJ6B 3W39B 1YMMB 1QSFA 2C1OA 4KGJA 1XF4A 4JO1H 5T3ZH 2P49B 5H37H 4YBLB 2WV3A 4NQDA 3W5NA 4Z95L 5EC2A 5DJ8B 5LGKA 1OSPL 4E9LA 4QYOB 2VC2L 2ED8A 5CWSA 5IW6A 1B88A 1KCKA 5EPMB 1H3GA 1EV2E 1XT5A 4PRHA 5FYJH 2NLJB 3ZDZF 5GXBB 2FLBT 3IJYA 3BOVA 5CJ8A 4L3EE 4EUPH 2K7PA 3R8BB 1U36A 3VXOA 4RAVB 1YEEL 3THML 2DLIA 2V2TB 3QA3B 4S1SL 4B53A 2HKFH 4NNXA 3WIHA 1RZJH 3VJ6A 3G6JE 5DMGD 4LASL 1S9WB 4GKSB 2BMKA 1K4DA 3BKJH 1XGQB 4XNZC 3NA4A 4YHIB 3DHJA 2HFFB 3PWPA 1MCRA 5A3ID 1IL1A 3MR9B 3GO1H 1MH5A 1SVZA 3LQAH 5FA3B 3N85L 5J9PA 1NC2A 4GG8A 1LNUB 2A9NH 3TYGH 4P9HH 4L9DA 1ADQL 4RAVA 3EOBB 4MB3A 3KJ6H 3UPCA 4KTYA 4XMPH 3V7AG 5LVEA 3IYLW 4LPXA 5EU3B 4C4KO 1KT2B 3BXNB 3BKCL 4NUJA 2W9DH 3HAEG 4R90H 4XPAH 4HWZA 3L7FA 3BH9A 3I02B 4JFEB 5CEYA 3LZFL 2HAZA 4K7PH 1MH5B 2VDLH 3ZKQD 3V4PH 2W92A 4XMLH 4Z18A 2W0LA 3CFBB 3CX2A 1BIIB 1F3JA 5DD5H 3KXFA 1FORH 2UVFA 4YC2B 2MNUA 1L9NA 1QA9B 4GT7A 4OM0H 3T0BA 2YZ8A 3CCHA 3H3BC 3O9WA 1YEGL 3AAZA 1PVHA 3AREA 3M45A 3NCFB 4XX1G 1D5BA 4Y5XC 3LRSB 2JE8A 3OKKB 1IC5L 3MCKB 4POZC 3GGWA 4IDLA 1A1NB 1MIEL 3WMSA 4UI2A 3S34L 1A6VH 3B3IA 2WBJD 3IDXL 3LRGA 1BVLB 5KW9L 3MXVL 4KK8D 4GLRH 3KYMB 4LHJB 2HA1A 3QNYB 4JPKH 2OS7A 2OTPA 2R0WL 1MJ7L 5CCKL 4KKCC 2M8XA 2MWCA 5J3HD 4I77H 5D5MA 5JZ7D 4YQXH 2RCSH 5FGCE 3UTSE 3N9GH 2YRPA 3DWTA 1SBBA 4J3UA 1U8PA 1FLRH 3IVKA 3IVKB 4O2CA 5LWYH 3PJSA 5DTFA 5TQ2H 3HZVA 3FCTB 3F8UB 1NCNA 1OAUH 1HHGB 2AGJH 2FB4H 3FQXB 4XNYH 5IBUG 3UTTB 2QADB 2IANB 3IXAA 4TUJA 3U0TB 1N4XL 3HUJB 5DK0A 1I1AB 3MGOA 2EEBA 3U0WL 4U1MB 4NO5A 5K9QI 1JHKH 2XPGA 4GOSA 3WO3B 2XZCH 3U6RA 2CLRA 1HI6B 5GSRA 4CJ1A 4OZ4A 1IGJA 1I3UA 1E6JH 3Q1SL 4MXVE 3RVWC 1K5NA 4JO2L 3D0LB 3NCYS 4JO4H 2AV1A 4QKXB 3WHE0 2OP4L 1JMXA 2XN9D 2NW3A 2FCBA 4O9HL 1G7QB 3HB3C 1OB1B 4PJHE 3L5JA 4U1GB 4GAFB 1IKNA 2GITA 2GT9B 2HJFA 3BP4B 4AY0A 2DBLH 3MRIB 2J88L 1FFOB 4EN3C 2PO6D 4U1NA 3EZ8A 1OHQA 3QG7H 1FBIH 3QO0B 3CFCH 3IF1B 1PQZB 1AGCB 4PRID 2HLAB 1T80A 1BX2A 2AQ2A 4JKMA 3BKYH 3MMEA 4EDWL 4FQHA 4LSTL 4P23D 1Q0XH 1T66D 2EE6A 4MCYB 4QGYA 2GTZA 4MNQB 2R9HD 2LVCA 4HSQA 3VXTB 1MAMH 2PO6A 4G6JH 5TE6H 2XZAH 4JFOA 2JJUA 3FB7A 1CFSB 5IJVB 1YMMA 3EFDH 2DQTL 4L9LA 3VRLE 1Q8MA 4IRZL 5T33H 5C0GB 4NWUL 5J0BA 1CDBA 4WW2F 3QQNA 2IMMA 2A74A 1FL5A 5IT2H 4PRNB 2GJ6A 1Q0YH 3MZGB 1MIMH 3TT1L 3FOLA 8CGTA 2NY5H 5I16A 5ENWA 4JQIH 4UIMB 3C8HA 3NCJL 3W0WD 1T2JA 4CVZA 2NZIA 4NC0B 5C70A 3BD4A 3AB0C 4UIMA 3HC0B 5GRJH 2JLLA 4IS6A 1J1XH 1DQJB 1T21A 3CVHL 1I8IA 1OGAD 4EOWL 1OW0C 3MV7B 1IGCH 1WWAX 1YMHA 4UV4H 2H1PH 3TN0D 2W60A 2G60L 4G6FD 5GJSH 1JPFA 5EO9A 5DJXB 2IFGA 4CKVX 5D7LE 3STZA 5D8JH 2X4OA 4OB5H 4PTUA 4HUMB 5CEXB 2PO6B 4FFYL 1J11A 1CLZH 5IQ7H 4QRPA 4K3EH 2C26A 4XH2B 4G42B 1X4YA 4JANB 2HFGL 3NFPB 2BVYA 1PKQE 4I2XA 3DSFH 4KC3B 1JWUB 3BP7A 1JK8B 1TDQA 3VXQA 1JNLL 5ISZD 4JFDB 2L4OA 1ROWA 4D9LL 3MUJA 1I3GL 2J7LA 4G7YH 4JFZL 4WFFE 4LOUC 3HFML 3NCCB 2A73A 5A2KH 5AYQA 3S4SA 4O58H 3QDGB 1KBGL 1TTUA 4N0CC 1KIQB 1GJIA 2FBJL 2D7QA 1P2CB 2NQCA 5F96H 3S6CA 4NZRH 4F7TA 3X17A 3V0AC 1X5GA 4LNRB 1PZ5A 5FGBC 4XP5L 1U92B 4KMTH 4UTBL 1XFPA 1EGJA 4V2BA 3JV6A 4NT6A 2P8LB 2CR3A 4UB0H 4WI8A 1ULVA 1J05A 3H3KA 4IOFD 2VLRD 3HAEH 2VXSH 1QBLL 1TLKA 3O2VH 4Z7QF 4TPRL 1NCBL 2YEZA 3QNYA 1QLFA 3Q3GB 3VWJD 2VDPL 2Z92A 1X4XA 3DRQA 5CGTA 3OPZL 2PR4H 3WEXA 3T77A 4ENED 1CN4A 1GIGL 1EFXD 1RUKL 1CLOL 4M8VA 3S7GA 3SDAC 3EYSH 1QSFE 4ZG1A 4QNPE 2PYEE 1AGFA 2AI0L 2FDBP 1JYVA 1YDPA 3O4LA 5F3BA 1JRHI 1QO3A 2E6JA 3Q6GH 3R06B 2BOCB 2OCFD 4X6BA 1BVZA 5F7HA 1JF1B 1QA9A 3GDBA 2EIDA 4JM2F 1EHNA 4YFLI 2G5RA 2EDJA 4M43H 5I8EB 4ODSH 1X5XA 4OLZH 3CNKA 4MQXD 1CICD 4WU7B 4OCXL 1OPGL 3IDJA 1PGRB 4LCIH 5I8KH 3EBAA 4HD9A 3FMGH 4D9QE 4O51B 5E24E 4MDJB 1V7NH 4Y19A 3DIFB 1K3ZA 2Q6WB 1RPQA 4NHUB 1XAUA 1S7TA 2SEBA 2F9BT 3UBXI 3SKUD 1AFVH 3TO4B 1GZQB 3L3KA 1Z5LA 1IAKA 3ARBB 3RVVC 3SJVA 5FUOH 2CK2A 3V0WH 2OJEA 1D5IL 3MOBH 5HHQA 1BOGB 1CGWA 3KYNA 5KVEL 5FDYA 1W0VB 4XNQA 1GGUA 1IC4L 3JWDL 3QP3A 2E7LC 4NKQB 1CZ8H 1FL5B 5EUKA 3QI9B 5BMFH 1KN2H 2KBGA 4OD3L 1IEBB 3GJFB 4ZAKB 3UBXG 4P5KA 4X83A 3VI3F 5IVZA 4I4WA 5LKNA 5DXWA 2AK1H 4HKZA 2DM3A 4LAJH 4HX1A 3BN3B 4L8CB 5T1KA 3O11B 3QQ9D 1BHGA 4ODUA 4Y4KB 4WUUB 5D96B 3MRKA 1KENL 4NN5B 1FAIH 5KG9B 1CQYA 4N5ED 3VFTA 3U36B 1YEHH 2XWJA 5E99H 5JQ6L 1K6QL 3P11L 3V8CA 4KTDL 3QUYC 1CFTB 3KJ4B 3VD4A 3UCRA 1PLGL 2VSDA 2QBWA 5HDQH 3X14B 3RY4A 1ZHBB 4LLWB 4MXQD 1IGTB 3GMPA 4OM1L 3U4EA 3D85A 1PSKH 3D2UA 5GRWA 4IMLA 1CDJA 1ZE3C 2F8VA 3FFCA 4M3KB 4Z7OE 4G9FD 4Q6IC 3EYFA 3MV8A 1Y6NR 4XBPB 4DGVH 1I8KA 2FHFA 1OT2A 5L8JB 4Y4FA 5HVFB 5KVFH 1TQBC 2YD6A 4NZTL 1FNAA 2J8UE 3RA7L 1WCBB 1HSAB 1SJVA 1QFHA 2XI9A 4JQIL 4Z78A 1X7QB 1NFDB 4ODTL 1KCSL 3UDWC 5CHNA 2ICWA 5IMKB 1A9EB 5ID0A 1GC1C 1C5DA 2COQA 5J4MA 1KXTB 1UKTA 4XCNB 2D9QB 3RKDD 3VH8B 4HUWB 2CR6A 4WFFD 3HMXL 5T33L 3QPXH 1PG7H 4WUKH 5HHPB 4YPGB 1S7XB 1OWRM 3D87B 3L6FA 3T77B 2A2QT 5I1LA 4UMGA 4XAWL 4LF3B 4GKNA 4U7KA 2R1YA 1PW3A 5BS0B 3TNNA 2IQ9H 1D5BB 5IM7A 1JJUA 1FL3B 1R5IB 1RVFL 3K3QA 3MA9L 4A6YA 5JQHC 1OTTC 5KVDL 4Y4HD 5JA9A 3UPAA 4J6RH 2NZ9C 2R15A 4RWYH 1AGDA 1UZ6F 1GIGH 3QFDA 4G3YH 2V5SA 4UINL 3OR7A 5GS0L 5E00B 4PP2B 2OXHA 4AENA 25C8L 3RUGB 2YPLA 4J2XA 2ERJB 4NM8H 5T3XL 1X6LA 4JVPA 4PJEF 4XMKH 1TIUA 3VXSE 3ULUC 5AYUH 1NEZB 1ZHKB 5KS9A 2FR4A 3ECBA 1NCBH 1BEYH 1L0QA 3DUSA 1Y18A 4ZQKA 2IALA 5JW3L 4R0LB 2BSTB 3INUH 1INDH 2NY3D 1QHOA 4O2EA 1P7KB 1I1FA 3QUMH 4TSCL 5C0BD 1IQWH 1R5VA 4FZ8L 3TCLA 4QHUA 2B8OT 3RY5A 5DRXA 3GGWB 5AWNL 1JWUA 2YPLD 1OGAE 5C09D 5EZLB 2IEPA 3FQUB 4U1HA 2FX9H 5DEGA 3RWJB 3O9WB 4O58L 3C60A 2JCCE 2CDFA 3CFDA 3C6SA 2R1WA 5KSVB 5EBWA 1NAMA 1Q9OA 4PR5B 1CIDA 4YHIA 5GGUB 4XBGA 2HJLB 5HVHC 5I8CA 1MRDL 4RDQF 5HVHB 1QFUL 1LK2B 1N4XH 4F9LA 3SCMB 1UXWB 3MLWH 3IDMB 5FHAH 1XZ0B 4J3OC 5I0DA 3F12A 3HMWL 1L9MA 4YDJA 2RIKA 4JRYB 1OAZL 4MZ2A 4YBHA 3SGJA 4GO6B 3HC4H 2VDKL 2XN9A 3O11A 3SBWA 4AMKH 3PWNB 3DARA 3KWWB 3MRCB 1N6VA 4CNIB 4GBXD 5BOZG 3FHAA 1AO7B 5IB1B 3ZKMC 4DKAA 2OK0L 4NRZB 1CE6B 3CIQA 1LK2A 3L3DB 3ZZ1A 1OP9A 2P8PB 12E8L 1NGWA 3GKWH 3O6KH 3UYRH 1RSFA 3K2UL 4MD5B 3BRGC 3E3QE 4JFDD 4G6AC 3NCJH 3RWJA 1MCFA 3NCEB 4U1KA 2CO6B 4JFOB 4JM2C 4XPHL 4ZFOA 2X09A 2VLJB 4P4RA 3FAWA 5TPWL 4IOSD 5CFHA 2Y07L 2ZOLB 2VLME 2XG4A 2JCCF 4LARH 1Q9WA 3CZFA 5ICYA 5DC9B 3ZLQC 3G5YA 1V3JA 2DQHL 3DV4A 4HUVB 4QRSB 3G9AB 5CZXD 1FORL 3U48A 4WI9A 4ZUWB 5FCSH 1YY9C 2ERJC 3S96B 5I71C 1E4XL 3TFKC 4LP4A 5HDQL 3SDCD 5D1ZB 5E8OA 3VFVB 2WWKT 1JF1A 1NPUA 1UG9A 1N3NB 5FB8B 4XCEB 3F5WA 3NIDF 4I1NB 2DQUL 3KYNB 3X11B 4WIQA 4WTXA 4PJDF 3W5MA 3KPPA 1CWVA 4FQQA 4DCQA 4HFWB 1KENH 4WWID 4RFEA 1CYGA 4NJAH 1U3ZA 2Y6SD 5D2LB 3OHXA 3TC9A 3JUZA 2DWEA 3QRGH 1T1WB 2EIBA 5FYLH 1FH5H 5CGMA 1TITA 5GZND 2OM5A 3BN9D 2CIKB 3MO1A 1F90L 5JZ7C 3QUXA 1XGTA 3PWLB 2VWEC 2RFXB 3ILQC 4GW1B 3QEUB 4AEEA 3IU3A 4HV8A 3SOBH 4TRPH 2OBGA 5C0RL 3E6HB 1A14L 5MERB 1MEXH 4N5UA 2ILLA 4JFFB 3HMXH 5AWNH 2MCPH 4ONHA 4P5TB 2BCKB 1U2HA 4J3TA 2P5EA 2YD5A 3QUML 3QIBB 1DBBH 2OX5A 5JW3H 5FDWA 2HT2C 3RA7H 5AUMB 2R23B 4IMLB 4LLDA 3GB7B 3O6KL 5DA0B 1CGYA 2LABA 25C8H 2Z31A 3OQ3B 2ZPKL 5GS0H 3O41B 3QG6A 2NY1C 4PJBA 3QAZC 3MLTA 3VRLF 4ODSL 4WWKB 3WIFA 3RRQA 2AP2A 3OKOA 3U46A 1KPVB 2NX5A 3ARQA 3VXQB 3U2SA 1BJMA 2W07A 3E8UL 4YH6A 3CSBA 5C0BE 4C83A 1R24B 3F58H 4DW2L 4BUHA 3B5GA 1C16B 2VDKH 4KY1L 4NZDA 4PTUB 2VKWA 4KVNH 3U9PH 3PWPE 3UTZB 5GIRA 2VISA 4GRLD 2GAZB 4B5EA 1MI5B 4JY6A 3QXWA 3HI6H 3RWEB 4MJ5B 4XBPA 1P1ZB 5EBMB 4NRYA 1P2CA 2OTWB 5DF0A 2EZ0D 4W4OC 1MSPA 2QV2A 2W38A 4MJ2A 5L2JB 1KJ2H 5I8OH 3OX8A 4FFZH 2NTSP 4JFED 1BECA 4PJDB 1F58L 1QHPA 2VAAB 2W0FB 4L4VA 2L7UA 4MA8L 4KHTL 1ZVSA 5EB9A 5TE7L 4Q2ZB 1HSBA 4GAYA 4GRLC 1JUFA 3SQBA 3UBXB 5DURB 2MKWA 4CDHA 4GMSH 4UIKL 1ZA3A 3NIFF 4Q97A 3LDBB 4W6XB 5D2NC 3VXUA 4ODBD 3RTQA 2H2SD 3MV9E 2ZCLH 3ARUA 3VFGL 3DPBA 1LE5B 4PRDB 2FIKA 1A6WL 4PV9A 4M93C 1QR1B 1INDL 3PIQB 4MD5A 5E6ID 1FN4B 3SKMB 3KS0J 5K59F 5ALBH 2V7HA 1CGSH 1GOHA 3X3FL 1CXLA 5AZEH 1KJVA 5HYIA 2YBRA 1ZXQA 2VR5A 1RIVH 6CGTA 1DBML 2VZ1A 5I75C 5HGHA 3IDGA 4FQ2H 4LVNB 4JZJB 4D2NA 1MWAB 5F8RC 2H2SC 4WFGD 5FYJD 4LDOB 3P4MA 2ITDA 4P2OA 1D6EB 2JK5B 2OSLA 5EOCL 5J06A 4W68A 3QCUH 5EWIH 3NFNB 3CXDH 1FE8H 1IEAB 1IGYA 1ZANL 1ZEAH 4PJAB 3P4NB 4FQXD 2HKFL 1UXWA 2X1PA 2YXMA 3DI3B 1VGEL 4ZFZA 3MOAH 2VE6A 3U30C 1URLA 2E3VA 5D93C 1IT9H 4LMQI 1KJ3H 4M6NL 1A2YB 2GY5A 5F1OB 4NDMA 3QIUC 1TJGH 4XCYA 1NBVL 2IGFL 3CGTA 3FO9A 2Y25A 5BVJA 1OGAA 1RK1B 2WK2A 1J0ZA 2IJ0C 4PJGA 3JV0A 4LVNC 4Z7VE 3I3EA 4FXKB 1KLUA 3PDOB 1NGYA 2PUQT 3LOWA 2P46B 4JCMA 1MCWW 1JV5B 1DLFH 1UVQB 1QD0A 1FVEA 3ZYZA 4JKPH 1G0YR 1JBJA 4DJMA 1BPVA 3AY4C 1FFOA 3RI5K 3OB0H 5AUMA 2JELH 4JR9L 3KPNB 3EFDL 4XPBL 4NM4H 1IGML 5IHZA 1RZ8A 3H9HA 1ONQB 3HRPA 1S7UB 2D4DA 3U4BL 4FXKA 3HFMH 2GCYB 4P57A 5J6HB 4ODWA 1C8PA 4D9QD 4HXBL 3S4SG 1JPST 5D6CA 5CD3B 1A64A 4DQOH 4F33B 4I3GA 5GGQH 1I8LC 4N0RA 4OLXL 1WAAE 1J0YA 1KSRA 4BZ2L 1UWEH 5AZEL 1P4BL 1MY5A 3L6FB 4R4FL 3S88H 4LSVH 5GS0C 1JNNL 3SJVD 1QEWB 1IC4H 1T2QL 1EAJA 3W11C 3GSNA 4IRSD 1X9QA 3CPLA 4Q9BA 2P8MB 5IFJA 4JO4L 1XCQA 2JCCB 1HEZA 4UT6L 4YGAB 3GZKA 4PRPE 5GRJL 5DUMH 3LCYA 2V2XB 3NCMA 1OTSD 4HIIA 4CU6A 4ESKA 5E70A 3MV9D 3PGDB 5ALCL 1PKQA 5JXAL 3ROOB 1Q1JH 4YDKH 2HKHH 3ZYIA 4JFFA 5JO5B 5D7JB 2C3WA 1I9IL 3QEQB 1U8IA 1Q72H 3QDJB 2IQAA 1PBYA 3GMMB 4P2OC 1A4JB 3UTSA 1XGRB 1KJ2L 3K0WA 3CC5A 5T1KD 4OQTA 4L8SA 4U1IA 2W60B 5J1AB 5J56B 3MJGX 1CF8H 5DFTA 5GRZA 3BPOB 1T83C 4NQXA 1J8HE 2D7OA 2JB6B 3U1SH 4F37K 1P53A 4E42A 3GK8H 3IKCA 3OZ9L 3QULA 4KVNL 5F6IB 2BNQB 3PDGA 4YR6B 4OB5L 3IFOB 5I6XC 1I4FA 3BSZH 3U36A 4P2QB 5LQBH 1WFUA 3AREB 3DBXA 1MAML 4JGJA 4PRBA 3RFZC 4NKDA 1YA5A 5CKAA 3MRQB 5JNYB 2P5WE 3F58L 3L3GB 4G7VL 4MSWA 2CLVA 1MI5E 3HC4L 5FA3A 1H3TA 1MWAH 2PXYD 3SCMC 2R4SL 1FSKC 2QQKL 1AD9A 5EC1A 4KKCD 3TJHD 2V5TA 4D0CA 3SKNB 3SKNA 3EUUA 5BZWB 5J3HC 1G9EA 1K8IA 4YAQA 2E7LA 4X9IA 4YUEL 1CD8A 3I2CL 4LGSB 4YHPA 3MRGA 4GAGH 4UILH 1J1PL 3PWPD 5CP3H 3Q48A 5DD3L 5HGDB 1VGKA 2Q1EA 2VXSL 5MEQB 2XN9B 3TT1H 5T1DL 4MSWB 1L4IA 4ZO9A 4Z7UE 2NY4C 1MHHB 1MOEA 4NKDB 7FABH 4XP9H 2PKDA 1P6AB 4OLUH 2KQMA 4O2FA 3KPLB 3NTCL 4OF7A 3CD4A 4M7ZC 1I1RA 1OAYH 1HDMA 3BQUA 4JVUA 3M07A 5MEOB 1P6FA 1AGEA 2A9MH 4RMUA 2AK4E 4YHLH 3HPLA 4G6JL 1RZFL 4FNLH 4Q6IA 5EBWB 1MREL 1YPZE 3MLYH 5TGBB 3ARSA 1QSEB 5SX4H 2XA8H 1OTSC 1Q0XL 4Q9RL 3EOAA 1ZGLB 3DVGA 3NZ8A 4GMTL 4UT7L 5ICXB 2AEWA 3M8OL 3WBDA 2VL5A 4BQBA 3B5TA 1NLDL 1P9MC 3C5SB 2VLLA 5EULV 5CBAB 4I3SH 2X4TB 4X4XA 4WNQB 4R2GD 1DQLL 1P9MA 1T22A 4P5TD 1G9NC 4FABL 4JPIA 4ZXBA 3F12B 3MFGB 1DN0A 3MC0A 3P77B 2YD3A 1NBQA 3JTTA 5B38B 4LRIA 1ZT1A 2Y06L 1FFPB 3EDJA 2EDRA 3O3AA 4OZGE 4OZGF 3Q2CA 4NO5B 5B4MC 1F11A 4HKXB 1X5HA 1RFDL 1F4WL 3ARDA 1CXHA 4S2SB 1DUZB 1M05B 3QPXL 1WIUA 2BVQB 4RFEB 2R1XB 5C92A 4UTAH 1EVUA 1R3JB 2J4WH 3D85D 5ACZA 1KYOJ 5I74B 2EKSB 3FAXA 4RCAA 1L0XA 3OAYK 2EXYC 3Q6FB 1AY1H 1TENA 3QWRA 4QHNA 3WHXB 4QRPE 2FX7H 3RDTB 5DJYB 4ODHL 3RWCB 4KV5F 2XOTA 1NMCB 4Y4HB 1TNNA 4ZD3H 3RVXD 3BRFA 4APQD 2GTWB 3F7PC 2FH6A 3PNWA 3GJEA 1KLUB 3PDOA 1FVEB 3TBVB 1MQKL 3VMOA 3OHXB 4HKBA 3RWFA 1ODAA 1CVRA 3OAZK 1K6QH 4FQJL 2W9DL 1BFTA 4LPCA 1PX3A 1MFDL 4X6CB 1IJ9A 5DLMH 5D7LB 3BISA 3KLAB 1XH3B 5DGRA 1W0YT 3RNQA 4JFHD 1NCAH 3PGFL 3QIWD 5GGSA 1YUHA 3ME0A 5BV7C 1FZKB 3K1DA 3OXSA 4MCZB 5IMMB 2VJXA 1KN4L 3LKNB 1OL0A 3EYVB 5BVPL 4KQ4L 4MZ3A 3BPCA 3L3JA 3Q5OA 4P5TC 2X9WA 3K4ZA 4NYLA 3C6LA 3VFMA 2C3HA 5HHOD 2FYYB 4PJEA 4GXVH 4BZ1L 4WW2C 1GVIA 1U41A 1W72B 3ALPA 4TULL 4S1SH 4U2YA 4LIQH 3ZTJH 2HT4D 3U0PB 3Q1SH 4EUPA 4V1DE 3P9LA 3D69A 5DJCA 4QOKE 3WIHH 3BMVA 1K4CA 2YPLE 2Y5TB 2Z8SA 4PRNA 3SQOL 3H9SB 4JLRA 3LKNA 4PRPA 1IGTA 1TTGA 4LU5H 4XPAL 5FFLA 3UAJC 5MI0B 3C2AL 3BO8B 3GRWL 5HHOB 3QDJE 3FONA 1ZHNB 1AKJD 3V5KB 4P9HC 4Y89A 3C6SB 3QNXB 5DS8A 3VXUB 3RUGE 1RZKH 3LQAC 3IFNH 5I18L 3QA3A 5I1HL 4JKWA 5ETUA 4LLVA 1FYTD 3UYPA 2OJZL 5AZ2H 5FGSA 3SDAD 5D1ZC 2WLZA 1B2WL 4JHAL 5TDOB 4UBDC 4F7CA 3DURB 3MFFA 5F7DA 5IW3A 4HK3N 4W4OA 5JOPE 2W0FA 4L4VB 3M8OH 4E42B 3VGGA 4QYOA 4MMZC 4Q2ZA 1FO0B 5DJDA 5KAQF 3WN5C 4PJ5B 2IFFL 1D5MB 5SX5K 4YO0A 4LCUB 3ZT6A 1NFKA 5DSCA 3RBGA 5HYQB 5HGAA 3BGMA 2VZVA 1P1ZA 1H8NA 3EYQC 4KK9D 5GGUA 4QXUH 1MI5A 1CGXA 4XWOC 5K9QG 1FNSH 3MRLA 5DT1L 5SX5H 5MENA 4FA8A 1AH1A 2RBLA 2XICA 1TJIH 1W0WA 4NGHL 5A16B 3AY4A 3MRQA 4K7PY 3MNWB 1YDPB 3KYOA 4MGXA 1LO5B 4DWHA 4P49A 4I0PA 1KACB 2ICEB 3LKRB 5SV4A 5IMLB 2GFBB 2NNAB 1CG9B 4L29B 5IR1A 1C16A 1P7QA 4OF3A 3QH3B 4OF0A 5DRXB 1BM3L 3IXTA 5T3ZD 4PJIF 1YY8A 1BZ9A 2AXGB 4NKOA 5D9SB 1G7JB 1NFIA 3I2CH 1HQ4A 1E28B 2EYTB 4ORZC 2XZZA 2Z31B 4YHML 1C7TA 3HNVH 3MLTB 3FHQA 3F7VB 3P0VH 2DQJH 4JAMA 4ZQKB 4WI4A 5EZJB 4KQ3H 1PLGH 1U8HB 2EDQA 2VABA 3LZFH 2C1PB 2BNRA 4EXPX 4F15B 4HS3A 5CLWA 3ZL4L 1HHGA 2ZUSA 4HW6A 4ZXBB 2XRAH 2NY1B 5ABDE 2GJZB 2GJZA 3BGAA 3NA9H 5GRUH 3QDMB 1U93A 1N5YH 1J8HD 5E1AA 2PO6C 4R4NC 4LSPL 4MNHB 1GAFH 4M03A 3REWB 2MPAL 3DVGB 5GZNC 2OR9H 4P2CG 3WFEL 5I1JH 5DO2C 5H2BA 1E4KA 2ATPA 5FYLE 4XNMB 5I73B 4PGJA 2ZSWB 4KJWD 5T1LA 2NY6B 4JREB 3QHZL 3S36H 1JWSB 3ARGA 5DHXB 1OP5K 1WBXA 4MDIB 3VFRB 5SWZA 4LASH 1Z9OA 3SDYH 5ESAB 1J8HA 3RIFK 2HN7A 3UJTH 1NGYB 5EIVA 4N90D 1CIUA 3LAFA 1Q1JL 2WWMC 2YPVL 4XVJH 3C2SA 1F2QA 2DQFB 3HG1E 4H20L 1MCDA 1JGEB 3FOMA 4PGCB 1EEYA 3ORJA 3FT3A 5IF0A 2CQVA 2NW2A 3NZ8B 1VFAB 1BZQK 1CGTA 4UDUA 5F7EH 3BUYA 5KSAB 4WEMB 1RUAH 1EO5A 4OI9A 3BWUC 2VZTA 1ZLUK 2H2PC 4CAGA 4NQUA 3NFNA 2DM2A 1MCPL 5C0BA 1S9XA 3SGDI 3OF6D 4CDGC 5B39B 3ZYOA 1OF2A 5DHYA 2ORBL 3EDEA 4NC2B 1TFHA 5E8PA 3GUTA 3NABL 5D7JC 1N2RA 2AXHA 4YZFE 1Q9WB 3CZFB 2AEPH 2XZAL 1BP3B 3ZKXC 3V6OE 4Y16C 5I1EL 3QQ4B 4P3CL 1QFOA 3VGAB 5AEAA 3AS1A 1CXIA 5BRZB 3KPRD 1TZHA 4G8FA 1LEIB 4P2YA 2R29L 3NPSC 4G5ZH 4RGNE 5DJXA 5GS1C 1E4KC 4PJFA 4PYHA 4X6CE 4PJ7E 3QFJD 1KF9B 4KFZC 4LHUB 2QSCH 4IRJA 5J11B 2IC2A 5C0AA 2BY1A 3GMRB 2HVKB 3MLUL 4X9GA 3H9SD 3MNZA 2VDPH 5DVLA 2CUIA 3CU7A 1WSST 4OGZA 3DSNA 2EYRB 1QG3A 3HE7A 4CUCA 2C3GA 1NMCC 3L3GA 1OLLA 3EJZD 4JQXA 5HHNA 5HHNB 3OXRB 4KI5D 2V5MA 3QFJA 1WZ1L 4DKFH 3GSNB 1MPAL 3MREB 1NBVH 4F57L 3BESR 1H5BC 4QXUL 1A7PH 5ESQB 2J8OA 5FA4A 4L4VE 1ITBB 5F93C 1P4LA 4F15C 1DUYA 1RK0B 5DQJB 1UWXH 3OJDB 1WFTA 3O45B 4WJ5B 4XZUB 4HJ0C 3MGAA 4YBQC 1RU9L 1A4JA 2IFFH 3UTSB 1I3GH 3CXDL 2GKIA 1F45A 3VXUE 4MXWL 1CFSA 1TMCB 2CUMA 4PUBH 1A7NL 1EFXB 1HHIB 4O02L 2NXYB 3TM6A 1T6WA 2CRYA 1L7IH 1R0AL 5E8NA 4XXDB 1WBYB 2MPAH 2QADC 2WP3O 2JCCA 1CLZL 4OZGB 2IMNA 3IFNL 5I18H 2CLZA 3BQUD 4WCYL 5DK3A 2HLAA 5I1IH 1U8KA 2X5PA 5GRUL 1RUAL 4N8VA 2HFEB 1I7RA 4PRAA 3CAFA 3PV6A 2EIEA 3QIUB 1JPTL 3QDGA 5DI8A 1CGSL 4HQQH 1CDIA 5L2JA 2CKNA 4ONGH 3VXNA 2OYPA 3UC0H 1A6WH 4Z8FL 3M17B 4S1RL 3VWJA 4ACPA 5JOPD 4FQ1H 1QLFB 4J3SA 2JJVA 3FJTA 4H20H 3D39D 1S7QB 1SJHA 4UIKH 3BQUC 1EGJH 2ZKHH 3JSSA 4CU8A 5HGGS 4X98B 1ZHLA 4PLJD 4LSQL 4NWTL 1GRWA 1MFCL 1YQVL 2X4QB 4GS7C 2DKSA 1HZHL 1ZS8A 3H0TB 1JHTA 5EZJA 4FHBD 4U1JB 4F7TB 5IT2L 3LD8C 3ARVA 3B8SA 3EIFA 3TJEH 1N59A 1NCWL 1C08A 3SGEH 2W65B 3ULVD 1DSFL 4YDVA 5MI0C 3FFCD 1BFOB 4ZS7H 1B0RB 4ORGB 4U4BA 3KNBA 3CDCA 1PY4A 1NDGA 2JTDA 4FTVA 1DBKL 3QZWA 4DUVA 4NN6B 4P48A 3LVEA 5C0JA 4RRPA 4Y2DB 3T08A 2DKUA 3ARFC 4WI2A 4IOIA 4GUPB 1YYMH 4KJPD 4JZJA 4V1DB 3QWOA 5L2KA 5DR5L 3N0PB 3MRLB 1MCHA 3C6LC 1X6NA 4YXHH 3RHWF 2X4RB 1VEOA 2NY0B 3S5LG 1Q9KA 4RMWA 1FBIL 3WXWH 4L8SC 1JYWA 3MA7A 3CJJA 4KZEL 4N1EA 4FP8H 5J6GA 3OWEA 1VPOL 1YZZA 4PRPD 1HH9A 1KV3A 2YC1A 2HVJB 3GSXB 4PG2A 2UZXB 5MENE 5I73C 1FRGL 3BZ4A 5FHBL 1NAML 1NDMB 2R2CA 4UOW0 5ACLA 1JCKA 2F5AH 4O9HH 1DZBA 4OCNC 2KH2B 3RZWA 5EOCJ 3O4LE 3AXLB 2PYFA 4BA8A 3HNSL 3S35X 5DT1H 5SWZE 2WQ8A 3MACL 4I5BA 5FO7A 1EH9A 3VH8G 3HC3H 4FQCL 1N26A 1IMHC 4RSVA 1KCRH 5K33A 2CXGA 3U4AA 5MEPB 3UJTL 5HI5D 3SDYL 1LO2L 5D1QD 3D0VA 5IHBA 4HBCH 5D1ZA 2YRZA 3MNZB 3MOQA 5E8OB 3O0RH 3T3PE 4P23B 4D8PB 3QCUL 5EWIL 2VLJD 3L5HA 4XNQB 2BVPA 1OB1A 35C8H 2YUXA 5C6PB 2OR7A 1RIUL 1F4YH 3S37H 1B4JH 1JNHA 3RNKB 5HHMB 1S7RB 2JJTC 4OZIA 2EH7L 4NHUA 5GRYA 4LVHB 5I74C 1NCCH 3C60D 3RVWD 5KSBB 3RWIB 2Z4QB 2UWEA 4DKEH 1SQ2N 3WDIA 5F9DC 1R3IL 5E7FA 4AG4H 1WZMA 5JW5B 2XTJD 4Y5XA 2OR8A 1G7IB 1WJ3A 1XMWA 3FQNA 2B1AH 3DUHA 3R1GL 4YHMH 1MUJA 3TV3H 4XPGL 2OTWA 4XPTL 5MHSD 4E41B 2P5WA 4OUOA 2ARJQ 3V4VL 1YN7B 1TVHB 4HJGB 3HE6A 2E7HA 3GBNH 5LJYH 4FZEH 1TVDA 3NZHL 1WWWX 2ENSA 4JHZA 3LDBC 4KK6D 4WFGE 5CEZD 3O3DA 2WINB 3TBVA 3R4DA 2YK1H 2X4NA 4OKVA 4D0BA 1BGXH 4MWFA 3STBA 1RJYB 4U05A 4UUJB 1CK0H 2H32A 5CEZL 1RZGA 5CIPH 1OWWA 4U31A 1VESA 4TYUA 3AM8A 4Y4HA 3ZE1E 1WGOA 1DE4B 4ELMF 4R2GB 1PYWB 1CL7H 4Y1AA 4X4YB 1MFBL 3OKEB 1BREA 4ZUSA 2YUWA 1QSFD 1U95B 1AGBB 1JGVH 1A6AA 5LGHL 4PRIB 4LGPB 4UT9H 1ZT7B 1RUQL 4ELKB 3IKKA 4J23A 3G04B 3O9WD 1JN6A 2YEZB 3MLVL 4LQFH 5D1QA 3QPQD 2YPKB 2BJMH 2C4FT 4KGLA 3T3PF 3HZYA 3HZYB 4R3SB 3L95A 4XVUD 5CUSH 2BNUB 2A77L 3BD3A 3TJHC 4ZFFA 4F3FA 4HIJA 2P7TA 4DZ8B 1CDHA 4Y5YB 2F74A 3LS4H 1F4YL 5IB4A 2ICES 5ELIA 4MXVF 3VXNB 1NCTA 5MERA 2FHCA 2NZ9D 3ZT7A 2V9QA 5EN2B 5C71A 4LL9A 2ZUQC 4LCUA 1II4E 2A73B 4POYA 5CHNB 5BW7C 4XVUC 3QUMA 1FVDB 4YHLL 5KSBE 5JXAH 1OAQL 5E8NB 1J87A 1TCRA 2FX9L 3LPFA 3PQYB 4M3JA 1EEZA 4PJCE 5F6HI 5F7UA 2YSSB 5FYKH 1MEXL 2DJSA 5L2KD 1NCDH 5E7BA 5ICXA 3NTCH 2EDFA 2I25N 3WS6C 1MHCB 1IILE 4J3VA 2D31A 4M1CD 1JE6A 4P2RE 2P5WD 4GKNB 3VWKC 1R3KB 1Y0LB 4GRLA 1NAMH 5DZLA 3LB6D 3JBG7 1MLBA 1U8JA 3FQWB 3KXFB 5D5ME 1JRHH 1J1PH 2CKBB 3HTLX 5FEBA 1AE6H 3JV4A 3VXPA 5HYQA 4NQCD 1U8MB 4X8XA 4YHNA 2J6EA 1CLYL 1D5XA 3ZDXF 4Q74A 3BIAX 2IAMC 3WKML 4JFEA 2ITDB 3WO4B 3QEHB 4J6RL 4PJGE 3ARED 2AK4A 1FL6A 1FL6B 2JIXB 4Y1AD 3A6OA 2XIDA 3V6ZA 4ETQB 3QDJD 4M48L 3WXVL 1G7PB 1RURL 5ADOH 3KPQA 5E6YA 1GSMA 3VXPB 2VRAA 5J9PB 1RI8A 5DUBA 3CK0H 3GBMH 3BAEL 4QRQA 5CGYC 2DQGH 1UM6H 4PD4K 4U6HB 4MMXC 1LEGB 3DVNB 1A3RL 1NAMB 3PG2A 1HQRA 3QEQD 3CFDB 4YLQT 5IW1A 5FGBA 3BP5B 4M1DH 2R4RH 3TBWA 1AO7A 1U58A 4K55A 5GS3A 1RIHL 3RU8H 4ZDHA 2ZCHL 4WHYH 2J8UB 3SDCA 3T04D 1G7HB 1M7DA 4RGOH 3WN5A 4FQIL 3TZVD 4YUEH 1GHFH 3OL2A 2WSKA 3UC0L 1D5XB 3X12B 1LDSA 2X41A 2QQKH 1A1OA 5CMAB 2GITB 4WU5B 4LGRB 5I8EA 3T3MF 4MHHI 1JPTH 1TETH 1W8OA 4XVTH 3G5XA 43C9B 3QUZB 4K9EL 1AI1L 1Z2KA 3FTGB 3D0LA 1NFDE 3BMWA 4I0PC 5FO7B 2DQDL 3TZVC 4C4KT 4QRRA 3MODH 4O00A 1WIPA 1U91B 5TFSL 2XN9E 1JZ2A 1MVUA 1L0YA 4LPWA 1CF8L 5CZVH 3RIAK 1YNTB 2F54A 2D7TH 3FRUA 3IETB 4X7CC 5CILL 4WFHE 3X3FH 4R7DA 1PYWA 4RFOL 2VUYA 2D7MA 4Q58C 4OIAA 4HGWB 3PXHA 4ZO7A 4HF5H 4XTRD 3MLPA 2EE3A 3BT2L 3O6ML 2WUCL 1DQML 5JPMB 4HULB 2YD9A 2FSEB 1DL7H 2L7JA 2IG2H 3HZVB 3AU1B 3BDYH 3PL6B 4FZ8H 1H5BA 3WDHA 1QO3B 2DQCL 2J12B 4Y4FB 3MJ6A 2Q7YB 5TE7H 4TVPD 1E6OH 4L4TE 2FL5B 1BIHA 1JIBA 1FCGA 1WAAF 3MGTB 1G6VK 4W70A 3B6SB 2X4PA 4AQ1B 1AGBA 3RTQC 3VXRA 5HPOA 2IPUK 3X14A 3VA6A 4XP1H 2X4PB 4M43L 4GRWF 5MEOA 5HVGB 1G6RH 1PZUB 4Z0BL 3QNZA 4QTHB 5EU6B 2IH3A 1ZMYA 4UAOC 5F1NB 4Z9KB 1V3LA 3WFBH 3ZT5A 3JTSA 4AH2A 2X4QA 5FYJE 4J4PC 3DMMB 1T83A 3LIZH 3QDAA 4UDTB 1W0WB 3ZYJA 2HWZL 4BFIB 3F5WB 4PP1C 1S9VB 1B2WH 3G5VA 1JYNA 2X4SB 1Z9SA 4MJIE 5AZ2L 1BAFL 1YN7A 4PGBA 5TQ0L 3MJ7A 3KR3H 2GJ6D 1CLOH 2R9HC 5K9OA 3C09B 5HGAB 3WJJA 1K8IB 1J0IA 1JGLH 1JWMB 3ZE0E 4WO4C 1R3LB 4LDLB 2FH8A 1M7XA 1YEKL 4R4ND 4PJ5A 3S37X 1CFNB 3UO1L 3QIUA 1V7MH 5F3HB 3BJLA 4X7SH 3WS3B 2B0SH 2BFVH 4YC2C 5CSBA 1J18A 1SJEA 4HWZB 1EUTA 4BYHA 3I50H 3WV0A 5IQ9A 3LEXB 4WDIA 2GSGB 2XQYG 2WW8A 5C0FB 4KKLC 3MV01 4Q6YA 3L5IA 5F7KC 1NC2B 4GG8B 5HI3D 3OF6A 2GK0A 4R8WH 3SE8L 4XPFL 2YS4A 1YN6A 5CBEA 1T66C 2BX5A 3OJDA 4WU7A 3D1MC 5J11C 2PCPA 2FJFA 5CBEB 3O81A 3HA0A 1C7SA 4IIQB 43CAB 2Q8BH 3B4NA 1CD9B 1H0DB 2N56A 4AM0B 1IZJA 3DUUA 5TF1H 3ULUD 4X9BA 1T0MA 4U2ZA 3CX5K 4X4MA 4WDIB 4U0QB 2JK5A 2ATKA 3WCYA 3HI6L 2ZSVB 5AD0B 5AD0A 4BH8A 2AJSL 1NDGB 5IQ7L 1UJTA 2IAND 4BSWB 5E4IA 3MV9A 3FB6B 4JG1L 3TBYA 3U4BH 1JGDA 1CFNA 1WBZA 5F1IB 4P46A 2NXZD 1UADC 4XBGB 5I8CB 1H8OA 1T0PB 3E8UH 5ID1A 4A2LA 3TNMA 5FYJU 3D3VA 4PJ8D 3WJLC 3G08B 4Z7OF 2DTMH 3VG0L 3VRIA 5JPNA 3DO3A 2ZPKH 1TZHB 1Q9KB 3BPNB 3EW3B 1HYRC 4NQEA 4HAGA 1BQUA 1J05B 2AJZB 4QOKD 2HTLD 2P8LA 4JPVH 2APTA 4XWGH 3UBXA 1V7NL 1R5WB 1EMTL 2NTFB 2ADGA 2NY5L 4FFZL 4L4TD 1AQKL 1LHZA 4OIBA 3V52L 5H35B 5DDHA 1N5AA 2B20A 4L8BA 4PFEA 3V95A 2AEQL 1FNSL 1H3UA 3DGCR 4OLZL 1KJ3L 3BEWB 3VWKB 1UGNA 3QCTH 2DMBA 5HI4C 1A4KA 1L6ZA 5EOTB 3VWJC 2HMIC 3VI3E 1YECH 2ADJA 1IM9D 1ZEAL 5IB2B 5GRVL 1LK3L 5HDBF 2HT4C 3PJSB 1JF5A 2YWZA 3QEGL 4MLIA 1MVUB 3DRTA 3SGKC 4JFHE 3QDGD 2BDNL 4F33A 3EO0B 3LHPH 3VW3H 4UQ3A 5HHMD 3PV7A 4ERSH 4Q9QH 4HZAA 4S2SA 4EDXA 3QUZA 3L3HA 4NDMB 2GCYA 3I9GL 5E2UL 4PJHB 2R8SL 4PTTB 3VRIB 1S7UA 4ZS6C 1OSZA 3DXAE 5KANI 3MV8E 2DF3A 3VXRD 5HHXH 3VXRB 1T1WA 3QAZB 1BWWA 2H32B 1GPOH 5I17A 1TXKA 4RBPK 5CZXC 2DLTA 1MHEA 3JV5A 3O3DB 5DJAA 3S98A 1ZLWK 1DR9A 3GSNH 4NN7C 1QP1A 5LAXB 15C8L 2AABH 4I13B 4YNYB 1IC7L 5JHDE 3HE7B 4OLUL 3KLHD 4P5TA 4MJ4A 5A1AA 4OCMC 5JOEA 3DETD 3G5XB 1Y6KR 5TDPA 5FK9B 5T1DH 3STZB 2G9HB 3L3IA 1LO0H 1F00I 1QVOB 3TF7C 1U0QA 3O4LD 2PTUA 3MCLH 5F70A 3GMNB 4QNPF 2J8HA 2Z4QA 2X40A 5GJTL 4NM8L 4XGZB 5T3XH 1BVKB 2DD8H 3WIIH 2KL6A 3ISWA 3KG5A 3TP4A 4TSAL 1Z9MA 1SEQL 4OFVA 4IMKA 2AJXH 3PWVB 1AI1H 3SO3C 3QIBC 5C9KA 2QSVA 2GFBA 2NNAA 5DJ0B 2PN5A 4QY8A 4HT1H 5JDSA 3MNWA 1B4RA 1RVFH 1X5FA 5F88A 2H1PL 1QNZL 3VFUA 5HDBE 5DJ6B 2OL3A 4MJIB 9CGTA 5SV3A 1DFBL 1GGIL 3ZSSA 4ZAKA 3GM0A 2AJXL 3ARXA 3U7WL 4BK5A 1FHGA 3S96A 3I6GA 1DVFB 4TQEL 4L9LB 4X5LA 2BNRE 4KRMB 4NQCE 4MJ5A 1CK0L 5CEZH 1CBVL 3B9KA 3I02A 2AJYL 4NFDA 1KCSH 3C5JA 4XPHH 1IAIL 2I9LB 1A3LL 1FYHB 4URTB 4Z7WA 3RWHA 4P2QE 1I1YB 1F3DH 5TH2A 3PWUB 5IESL 5IVXA 5KVFL 1A5FH 1UA6H 3QNZB 4QTHA 3ROLA 3S8WA 4BQCA 2ZCKL 4U6VL 4KK5D 2QQNL 3L5WB 2Z35B 1T7XA 4G8IA 3VFWB 1O0VA 2P8PA 4OZHF 4K7FB 4M5YH 1Y0LA 2VDLL 1KXVC 3T65B 5BRZD 1FH5L 3BW9B 5KN5B 5JO5A 3HN3A 1UH3A 3OGOE 3ET9F 1AO7D 2DAVA 1G7PA 2CIIA 5F6HJ 3BKCH 4HKJA 4XC3H 4ZFFB 4HIXL 3ZE0F 3MLWL 1RZJC 4PGCA 2MQCA 4G3YL 3L3OB 3PWJA 1DDHA 4JRYA 4NO2B 3TT3H 1J5OL 3EYOB 3DX6B 5HYJA 1CGUA 4HPOL 3E3QC 5EA0H 2FEDC 5KVDH 2ZOKB 2C1PA 1KULA 4R0LA 5DMJB 3RGHA 5C08B 3WD5L 2K3TA 1IAIM 4R9HA 3BX7C 4M7ZB 4IM8A 3K46A 3ARGB 3L5XL 1OSZB 1HKFA 2GQHA 2IBGA 1QRNB 4XRCA 4I9WD 4ZSOE 5FM5M 1FIEA 4MNGE 4PY7B 1OAYL 3QH3A 2CDFB 4LCWD 1WEJL 3DX6A 1HWGB 3VDCA 1QZ1A 1LP9F 5C07E 4TVPE 2VC2H 4PJXF 5JTWA 2A6IA 3VGHA 4MA1B 1EMTH 4E41A 1GGTA 1NKRA 4KJYB 4LEOB 5CS7A 1G0XA 1P84J 3BPLB 4XCFH 2HLFD 4WW1A 3K2UH 4Y4KC 3UYRL 3N06B 5F89B 3MNVA 1VCAA 3I9GH 1HXYA 5E2UH 2IPKA 2XACC 4HWBH 3WNLA 3QUXB 1VENA 4CW1B 4KZEH 4UV7H 5B38A 2CPCA 1G84A 5ANMB 1FFNA 5TDNB 3KPRE 2OK0H 3IFPB 3IJHB 1T1YA 5HYJB 2R0KL 1I75A 2CDGB 4NUJB 1YNTA 1JZ8A 3RVTC 3HB3D 2YA0A 1BBDL 2A6IB 3SEPA 2ZOLA 4ALAH 2B39A 1ETZA 1T04A 4NO0B 1S7RA 3C5SA 4XAWH 1LK3H 3QFJE 1BJ8A 1MJ7H 5BVJB 1CDYA 2VWEE 3QI9D 2EH8L 4GRWH 2XTJC 5DEZA 1RZIA 4JFYB 3TBWB 1P7QD 4QHLB 1AXIB 2EDBA 1M05A 1K2DB 3QCTL 2Y9RT 3HI1A 3WIIL 1A7QL 5DD6A 1RUKH 1I8MA 4P23A 2A6KB 1F11B 4Y16A 4GKSA 4OF6A 3GSUA 5E8EA 3NMEA 4MD0B 1G7LB 1Q9LA 3QT2A 1I7ZA 1FFPA 3LS5L 4TTDD 1JVKA 2ICWB 2VR9A 5IMKA 4FTVD 3NH7H 2R0ZH 4TUOA 4UB0L 5BZDA 5I9QC 5CJOL 4XXDA 5DC0A 4FXGB 4IIQC 2NR6C 5MP6H 2VIRA 2AABL 5FV1L 5DJ8A 2IPTL 1YJDL 2NMSA 2EDWA 3LN9A 4S1RH 4KAQH 2R0ZL 4PLJC 5JORA 1KBGH 2B2XH 5E2VL 5E4EB 5HHOA 2N4IA 2FLRT 4HAFA 3D25A 4HXAH 3LN4A 4WFEE 5IUSA 2Z35A 1K4DB 2AJSH 3DX7A 5IROA 1HILA 3TZVB 3CSYA 4EEEA 2Y4SA 4OAWA 1X4ZA 5C7XH 4JFYA 3TFKD 3HZKB 3S97C 4GG6E 1AXTL 3D69B 4OFIA 3SY0A 3S37L 3FQUA 5IOPA 5IVNA 4RFNC 4LVOB 5T1MA 2BNQA 1S7VA 2JIXD 3MMEB 1LWRA 1Q38A 1NAKH 4CMHC 2HMID 3HE7D 1EEZB 5BXFB 3WJJC 1HN1A 5EPMA 3ZTNH 2EKJA 2V7NA 1JF6A 5MEQA 3FB5B 3O2DH 5IEHB 5F3HA 4XGZA 3JWNC 5BMFL 2ICWI 2DS4A 4KK9C 2ZUXA 3FQTB 5A3IC 4S1QH 2GIYA 1T1ZB 1FC1A 1G7MA 2JELL 5I2IB 2CDEA 3C5ZB 1QFWI 4Z76B 3QDJA 5CAYB 3MJ7B 1H3VA 4PLKC 3ARFD 1I7UA 3G5VB 4NQTA 4HWBL 1AFVL 1W8NA 3ULUE 3MJ8B 2R1WB 3MRNB 1O7SA 5JDJA 1NBYB 5IKCB 1I7TA 4X98A 5C0CA 3L95B 4JO1L 4WGVB 5T3ZL 1MCJA 4JRXA 2E9IA 1IAOB 2IH3B 5D96C 5KSAD 5CJQH 1MIML 1SJEB 4LF3A 2R4RL 1G6RB 4YE4H 2F53D 3H3PH 3TCLB 1WBXB 3NBNA 3CXHK 5DJ2B 1MCSA 1UM6L 2OMNA 5DFWH 2JJSA 3BE1L 1MF2H 3QUKB 1VFMA 5J6GB 2D0FA 4L3EB 4GW4A 2NY7L 4Y8DC 3FO2B 1R6VA 4MHHG 1HNGA 4JJ5A 3DROA 3OR7B 3OR6A 1LMKA 1RZKC 5IB4B 3QRGL 5JXEC 3D39E 4Y0GA 2VLLB 4PJGF 5CBAA 3OR6B 4EZMA 1NQBA 4A6YB 5INCA 5CJXA 1FNGA 3TT3L 1IVLA 1DTUA 4HIXH 1FGNH 2R1YB 3W2DL 2H26B 2AXJA 1UACL 2EECA 4L4VD 3TEUA 5AG9A 4OLYH 3QIBD 3VFRA 2VO5A 5ALBL 1U95A 1NC4B 4NBZB 1YY8B 2OZ4A 3CU1A 5GQBA 2F54D 3EHBC 4NZJA 1IAOA 5C0EA 1NH6A 1GL4B 4NJ9H 5H2BB 4J4PA 3V0VB 3WNPA 1P5UA 3VMNA 1D5IH 2APWA 5C8JB 3RPIB 3KPSB 2A1WL 3DGGA 2F58H 3RNKA 3JV6B 4NT6B 4NKMA 4OT1H 1D9KD 1CDUA 4NQEB 2NY0D 4XVJL 1BQLH 2YPVH 3CLEH 4DN3H 1F6AA 1F58H 3T4YA 4NQVB 2FBOJ 1BIIA 4ZFZB 1Y6MR 4JFZH 2AKRA 3FMGL 5CMAA 4LCIL 5I8KL 4JO3L 4G6KL 5DVKA 3LQMA 4P46B 4WCYH 2FO4A 1G7IA 5FYKU 3ZSTA 1BZ9B 2AXGA 1BAFH 4NKOB 5D9SA 3RL2B 4ZUTA 2HFGH 2XYCA 5IBTH 3WFEH 5I1JL 4KK5C 1RUPL 4N8CL 3TESA 2HWZH 3GSRB 5IHLB 5IIEB 4K9EH 4DKDC 4G43A 2VZ3A 5E5RB 5HYJE 3OKLA 5T5NF 2XRAL 3I3DA 4ZO8A 3FTGA 5DHYB 2Q6WA 3EFFB 2YRLA 3BZ4B 1PEZA 2EDOA 2WWMD 4KMQA 4GQPH 3BZEA 4IRJB 2CRZA 3P0VL 3WKMH 3GSQB 3U7AA 3IJSA 3KPMB 2I07B 4GAJL 4NRZA 3BDBA 5E2WL 3BI9X 3ARYA 5GSVB 5E94A 1T1ZA 1KIPB 1VFAA 4AQOA 5BRZA 4BM7A 3MCLL 4PJ7B 3H7BA 3T0EE 3RWDB 2X4SA 1IRAY 4CNIA 5GGTL 4JZJC 4U3HA 2OL3B 4MJIA 2VITA 2JIXA 2VXQL 5CJBA 4PB9H 3RVXC 3BP6A 1T3FB 4PJ9D 3QIUD 5KS9F 3NZHH 1QYGL 3C6LB 4UTBH 3JTSB 4AH2B 3BDYL 3SKOB 5T3XE 2UUDK 5SWZD 5JIKA 1TVBB 1WEJH 2QSCL 3B5HA 3ALWA 1G7LA 1R3HB 2Q76A 1IGFL 3WLWC 3IDYB 4H26A 1KB5A 5INDA 2Z8VC 5D5MF 3MRIA 3OV6A 1IM9B 4MX7A 1G0DA 1XCTA 4TSCH 5C0AE 1FG9C 4PRPB 3WSQL 3LH2H 2YHGA 4K7PL 3RL1A 3GIZL 2V2WA 3ARZA 4MD4B 1WICA 2AEPL 3SN6N 2CSPA 4G8FB 4ZPVA 3WUZA 2BSED 3RIFF 5EA0L 2W9EL 1MFAH 3GM8A 2WLYA 1QSVA 1W72L 1C5BH 5EIIB 4ZTPH 4L4TB 2Z9TA 4K7PX 4I3RH 1FAKT 4PJ8B 1YPZA 1UZ8B 5F1NA 2AXFB 4U6YA 3TYGL 1KPVA 4JGMA 2F5BH 1A9BA 5DFVC 4M7LL 1UCBH 4DVRL 2APFA 3GO1L 3KYAA 1BFOA 1X5KA 2BNQE 3HG1A 4HBQA 3JV4B 3EYVA 4IRSA 1EIBA 2FATL 2IF7A 2CGRH 2C3VB 4C56D 3I75B 2BP3A 3GEWB 2VLRE 3RZCD 2HTLC 4YIQA 6FABH 4KKLD 2E8ZA 4RDQG 5BJTA 2CMRL 4I9WE 2CLZB 3RWEA 1N64L 3P9MA 4U6YB 3V8OA 1GOGA 2XWTA 1OAQH 4QRRB 4WENB 3T1WA 2XZQH 3D3VD 4PJ8A 3DX9A 5IM7B 5IEKA 3V52H 3TVMA 2R69L 4S11A 3DVFA 3GI9H 2BVTA 3DX9B 2YKLL 1X5JA 1TPXC 4WEUD 1EHXA 4JFQB 4E0RA 1UM4H 4HIHB 2ADIB 1JPFB 5EO9B 4JVWA 3C08H 1YMHB 4KWUA 1U8QB 4F58H 4Q7DA 4OM0L 3CDGA 4KXZH 1C5CL 3CVIL 3EAKA 4XCNA 2NXYD 1I1AC 2QADD 3BWAB 3U7WH 4EI6A 2QHRH 2V9TA 5T3ZE 4OM1H 1T0NA 3TO2A 5EU5B 5FDWB 3EYOA 2A83A 5D2NB 2Q3AA 1FIGL 1YYML 1A6TA 2O61A 4FQJH 1J7VR 2ZSVA 5C86A 3FZUD 2VL5B 3T2OA 1KIUA 2CRIA 4KKBC 2CIIB 4JY4A 5ITBL 1H3PH 3TO4D 4AYFA 1YEFL 5C09A 1ED3B 2B1HL 3P4OA 1WK0A 2GJ6B 3MXVH 2UYLA 4OCLC 3JVGA 4ZS7L 2AJ3B 5F9JA 3N1MC 4Y8AA 5GJTH 3HPLB 4U6HA 5D7SL 2A0LD 2E9WA 4PJDE 4EI5B 3MBXL 5TF1L 2VE6B 1BGXL 2ESVE 1CICB 1S5IL 2XNAA 4N9GA 3L7FB 3IETA 1LE5A 3VDBA 4O4YL 4O2FB 1KN2L 1KT2A 3BXNA 3RTQB 1YEGH 4MA3A 3O0RL 2BY0A 3GBNL 3LEYH 3GI9L 5EBLA 3KVQA 2OP4H 2WZPD 1ACYH 2P42B 3SDXE 1KCRL 5I19L 3Q5YA 4ODUB 4Y4KA 4XPGH 3A0OA 4OCRL 2R56H 4BH8B 2CUHA 1T1XA 3GI8H 1I3RB 2G5BB 3RUGF 3TVMC 1OP5H 4J1UA 1TZIB 1U8MA 4D3CH 4N5EC 1FLTX 1RFDH 3DNKA 4AM0A 3BP4A 2HJFB 1MLCB 4WW2B 5DHVA 2FO1A 1HINH 3PABA 4FG6D 3IU4H 1F3DJ 1K2DA 3PHQB 2VB5A 3WKNA 4DVRH 2UWEB 3V6ZB 4Q9QL 3LS4L 3DHMA 3OB0K 1O7VA 5IMOA 1NFDF 2X9YA 3OKLB 4L4JA 3QJFB 2LTQC 1S7TB 5T3XD 1MNUL 3ZO0A 2DQFA 3RTQD 3OAUL 4Z7UB 1T1YB 3S9DB 2XA8L 2PXYB 2FD6H 3TYFB 2R0WH 5CCKH 3G6JF 5IBLD 3TZVA 4ZUTB 4C58B 3PHQA 1MREH 4BZYA 4EN3B 1RZJL 3S3SA 3WSQH 4PJEE 5GGSB 2VDNH 3TPUB 4M61A 3VFSB 5I1DB 3UP1A 3ZDXE 4JN2A 2A9ML 4OFYA 5D6DC 5F7WC 3T0EB 5JIPA 3PGDA 4U1HB 2VL4A 2EC9U 4L3CB 2JJSC 3ARTA 1PFCA 4R26L 1FZJA 2VLMD 4OZIE 4FTVB 4HH9B 5DK2B 1N6QL 2M26A 4NP4L 4PB9L 3VFOB 4H8WL 4MQXC 3BPOC 3QXAA 5JW4M 1IKNC 1ZTXH 1BQHA 4G80B 2EDYA 4U3CA 2H32H 1TZGH 3HG1D 3ARDB 5CIPA 5B22A 2XPGB 2I27N 5DD5L 4JHBA 2EXYD 1KG0B 2GEEA 1YEFH 4WO4B 4F7PB 4TNWF 5HYJD 3MUZ1 2BXZA 2VXUL 3A6CL 2EE2A 2R23A 3UTTA 1MWAL 2WBJC 1AHWC 1QBAA 2JB5H 3CZJA 3KLAA 1C1EL 1JGUH 3ZDYF 5ICZB 2R2EA 4F3FB 1NGPL 1A0QL 2LQRA 4HH9A 4GSDL 1OY3B 2P48B 4M7LT 1DUZA 3G6AA 1WFNA 5IHZB 4WWKD 3ARRA 3DLQR 3I75A 3U1SL 4JCLA 4HLZH 4DEPB 5JPMA 4YXKL 4HZLA 3LKQA 3ZKNC 4P4KB 5DEFA 4Y1AE 4CBPA 1E4JA 3PHOA 3W0WA 2BHYA 3ETBF 5EZIH 3FQTA 1EZVX 3D5OF 3LV3B 5FM5O 4HCRA 3SDDA 3PP4L 2ZNXA 1CDCA 5C0NC 3BH9B 1BD2B 2NXZC 2H2PD 5FO9A 1X7QA 2KUTA 4ZOBA 2UWEF 3NFSL 4JQXC 4X4XB 4YGVB 3FRPA 5DMIH 1Z0NA 1ZLVH 1O5DT 3UAJD 1UJ3B 5I66B 3G6JB 4YDIH 4FQQB 3AS2A 4DCQB 4LVOC 3STLB 4EI5D 2P5WB 3PL6C 1U3HA 4WY7L 4YBQD 5TGBA 1DVFC 3MBED 3TA3D 4MAUH 2ZUUA 4HCRL 5J12C 5BO1L 5ID1B 1P4LB 1DVFA 1SM3L 3LQZA 3H42L 3IDYC 4KMLB 4XI5C 5JW4N 1IGIL 1VPOH 4NIKB 3O4OB 2W91A 5I2IA 2CH8A 2J6EH 4JREC 1N0LA 3LB6C 3JXAA 3MRPA 4I3RL 3U7YH 1A1MA 4X0KA 3BAEH 1KC5L 1T5XB 4YHYB 5I1AB 2B4CH 2YUZA 2NY2B 1RURH 5ADOL 2QHLA 5HI4D 2QJDA 4HG4K 1FC2D 1JGUL 1RZFH 3DUUB 5D1ZD 3R0NA 4YHNB 1CLCA 5I1KH 3VXUD 2XY1A 2FEEI 2I24N 3ZTJG 3QDHA 4JR9H 4IRJC 4PJ7F 4XP1L 4X6CF 1OM3H 5FKPA 1DUYB 2VOTA 4PR5A 2XKSA 5FKAB 5B38G 5D71H 1I9JL 1RD6A 1QYGH 4PJIE 5JUEL 1TZGL 3G9VA 3H3PL 2H8PB 2MQ3A 2CK0L 4PJFE 5F7NC 1MFCH 1YQVH 1WWCA 1OQOA 4OF8A 3U30B 4LSSH 3HR5B 4OZHA 2J5LC 3SJVE 4XP5H 2X05A 1DL7L 1ZWIB 3FT4B 3FQRB 5HGHB 5HGDA 5KOMC 3H7BB 1KJ2B 5D7IB 3GBLA 3CMOH 2FBJH 2IPKB 2GI7A 5C0AD 4LCCB 2EIZB 5FYKD 5JA8B 5JHDB 1ZT4B 3T0XA 3UJJL 4D8PA 2AJUH 5CILH 1V8HA 4XCCH 1K3IA 2D7TL 3GMLA 1G7QA 3BHBB 1PX4A 3L1OL 4J1UB 5GPRA 5JMRA 3QXTA 2I5YL 4G8EB 2ZUYA 4OIIL 1AR1C 2PETA 1ZLVK 3DSFL 1SYSB 4PJ9A 2DB8A 4HHAB 2R2BA 1MCPH 1EXUB 5A2JH 1T5WB 4K3EL 1QQDB 4LSPH 3RGVD 4H5SA 5EBLB 1BFVL 4JDTL 1RZ8B 3H9HB 1R5VB 4XVTL 4PJDA 3IDIA 1QRNA 2OQJA 2LU4A 1N59B 3HUJE 5LBSL 4X7TA 2XTJE 1LP9A 3TGXA 1BQLL 3EJJX 4NBYB 3LN5B 1RZGB 1A7PL 3MJ9A 2EEAA 1DN0B 4FMKA 4UT6H 3KHQA 5KW9H 4OLEA 3QDGE 3QXAB 5C0CE 5HJ3A 4BFIA 1WISA 2X4UA 3L3OA 2Y6SC 3RGVB 3TBSB 1MCLA 1QBBA 3WHE1 1RMFH 3NH7L 4Y5YC 3ZHKA 1S5HA 2X89A 1N6QH 5D1QB 4ZTOH 1CGVA 5DRZA 3AS0A 2KQNA 4R4FH 2YD2A 4R26H 2AW2A 1M6OA 5BJTB 4J3XA 4HUXA 4P46D 3C5ZC 4I0PD 5D71L 4DK3A 2CIKA 4XRCB 4G8GA 3GNMH 3OKDA 1QSZA 3JWDC 3VD5A 3C60C 3MLXL 3GB7A 4Y16D 1XGYL 4ETYA 1G6RA 4GRMA 4LCYB 5BQ7B 4JFFD 5L6YH 2VDNL 4PTTA 1GZPB 4Q9CA 4NC1C 3B2UD 1KLGB 1CXEA 3L3HB 2Z93B 1BQHB 4G80A 1IFHH 4NQED 2ZNWA 2VZOA 4PJGB 1C1EH 1ORQA 1A6PA 1NFDA 3OGCA 4HFUL 1HHIA 1RK1A 3RWHB 1WVZA 2D03L 5DD0H 3MJ8A 3MRNA 4FG6C 1J0HA 4ODWB 4R96A 5D7IF 5T1KB 1JFQH 5C0IB 3RZCB 4L4TA 2MKLC 2ORBH 4HKZB 4HKJB 5LGJB 1BJ1J 2Y36L 1CU4H 2Q3ZA 4PLKD 3P30L 4K3DH 4M8QB 1S7SA 1F02I 4N9OB 4U1GC 2VDRL 5DWUH 4BFEA 3U9UA 1LE9A 2V5RA 3T65A 3UTPE 1D9KB 3PIQA 5KJRH 1HKLH 1SM3H 4QRTA 1IM9A 4NP4H 3TIDB 1KB5B 3MREA 5INDB 5J13C 3V5HB 2AK4D 3IXTB 1A7OH 1UCTA 4DOHE 1T6VN 1MVFA 4MNQD 1P84K 5GGRB 1VERA 2IGFH 3MRJA 3N1PC 5JDSB 4G9DA 1U42A 3E0GA 1V3MA 4I0PB 1V5JA 4YR6A 4OD2B 3HC3L 5GGRA 1UZ6E 2EDXA 4KK8C 2MCPL 1OF2B 2YUVA 4OCRH 1HQRB 3EDFA 2HVKA 2WWKO 1BVKA 1VGKB 5ILTL 1JMZA 3VXMA 1D9KA 4Z95H 1RK0A 5DQJA 2IBZY 2CDEB 1SBSL 2K9UA 2ZUWA 3C5ZA 4PV9B 5EO0A 3GMMA 3AS3A 4YAQB 3BEVA 3T0WA 4ZNEA 1BZ7A 1T21B 2AGJL 1WLHA 2FB4L 3P9LB 4JRWA 4TNVF 3MQIA 3P4OB 1AD9B 4TNVK 3FT2A 2F8XC 4NQDE 5DJ6A 4FABH 1YC7A 1JGEA 3ULVL 4EQ3A 4KXZI 2O93L 3KS0H 4KDTA 4KV5E 1RZ7H 3MX0A 4L3ED 1I9RL 4L5FL 2XXCB 5C8JA 2EDHA 3MXWL 1P5VA 4M1GL 5ENWB 4WUUE 3BZDA 2W9EH 4Z5RB 2DQUH 3BKMH 5EU5A 1T0MB 4KPHL 3W39A 3OX8B 4PGZA 2XWBB 1PEWA 4NKIL 3T8XA 4KRPB 4F80A 1MFBH 3D18B 4U7MA 2V7HB 3OTTA 4BQ8A 1FZOA 1MLBB 3D39A 3C8KA 3IDXH 3X3GH 2WBKA 2Y5TA 1YN6B 3WL9A 1DQDL 1JL8A 3HNTL 4OTXH 5CSZB 5MP6L 3PHSA 3FT3B 2EO1A 2GK0B 4KDVA 2AJ3A 4DTGL 5I30L 3MRHA 4LKCB 3O6LH 3MV11 4H8WH 1M7IA 2DLFH 5IEKB 2BNQD 7FABL 4PV8B 1G9MH 1U92A 2JKXA 4L1HA 4GG6B 5HJ3B 4OSUH 1NL0L 2P45B 3GSRA 4J3WA 3JVGC 1HNFA 3QSKB 2PTTB 5C0ND 3U46B 1IC1A 4LSQH 4KDWA 4JPWH 1U8HA 3RZCC 3TV3L 4PREA 4YXLH 2X1WL 5E2WH 3SPVB 1ZVYA 4HS6B 1HHHA 1NC4A 3AREC 4MA1C 1KCVL 4QHNB 4PP2A 4AK1A 4J7RA 1OVZA 3QWRD 5LBSH 1AP2A 4NQEE 3OJVC 1RHHB 4M1GH 4I2XB 4ZYKA 1S5HB 2AQ3A 1I9RH 4L5FH 4LCWA 4P9ML 3DGGB 1QPXA 3QUZC 1K5NB 3ZHLA 1U6AH 5HGBB 3GMQA 3HMWH 3U83A 4LCWB 3HI5H 4ZAKC 4QHUB 2VABB 4ZOCA 3GJEB 4QXTB 1OGTA 3C2AH 5EH1A 1EO8L 2NY2D 4CW1A 4GLRI 3L1OH 2HRLA 1VKXB 4MXWH 1ZLSH 2APBA 4Q9RH 2X7LA 4XC1L 1QFWL 1A6UL 1CFQB 2L0DA 4ZUUA 3GSVB 3RDTA 4KKAC 1FGVL 2FZ3A 3BEWA 3VWKA 2YD1A 3I6LD 3FQRA 3SGDH 1YEEH 1LDPL 2A6DB 3QUZD 1UEMA 4M5ZH 1AR2A 4UTAL 1D6EA 4X80H 3MACH 1N64H 1FDLL 1CFVL 1CCZA 4TRPL 3ULSA 1R3JA 3AU1A 1INQA 4W6YB 1G9MC 4XP9L 2F5AL 1OD7A 1F90H 2HG5B 2DI8A 5FM4A 2FJGA 2D2OA 1HKLL 1KTDA 3QXDA 1UB6B 3PUCA 4JDZA 5FV2A 4Z7VB 2GUOA 2D0HA 4Z76A 4MX7B 3PGFH 2VDRH 3WXWL 1AJ7H 3IDIB 3G5YB 1GGYA 5I15H 4G6MH 4I3SL 3FRPG 5DLML 2FRGP 4KKBD 5DR5H 4DGYL 4X7DC 4GG6F 4X6FA 4MCYA 4LHQB 5ITBH 3SBWC 3C9NA 4GMTH 4OCYL 4JRXB 4UT7H 5JW4R 3IAQA 4FN0A 4P4KD 5C07D 1OLZA 2NXYC 1KB9J 1FQ9C 5ADPH 3V5KA 2OL3H 3AM8C 5E95B 1L6XA 1NLBL 2NYYD 2O5ZH 5HBBA 2HFFA 2BZDA 3P9WB 1MUJB 3DX7B 1EJ6A 4Z7WF 1RUPH 3CVIH 5EUKB 3FQNB 3KHOA 3OXSB 4MCZA 5EO0B 1EEUA 4PS4L 1ZHBA 3QEQE 2DQIL 4ODHH 4LRIC 1DLFL 4QRSA 1GGCL 1MRFH 4MVBD 4OQ1A 2VISB 2XTLA 4JO3H 4LKXB 3SJVB 1HK6A 3IFOA 4LQ1A 1MHPH 2GTZB 4DN4L 1CBVH 4NFCA 3CFIC 5ETUB 2VERN 3L7EB 4X9FA 2WQRA 2C1OB 1AO7E 3PQYD 2F54E 3UTQA 1G9NL 1HILB 3IF1A 2WIIA 5EN2A 5IMMA 3MOAL 4N0YL 1I3VA 3LKQB 4KRPD 1HHJA 3H9SA 1ZANH 4NO0D 4YHOH 3RUGA 3C60B 4WI5A 4V1DA 3TO4C 2ZUVA 5T5FL 5DMKA 4JG1H 1BFVH 4RAUB 3EO1A 1MI5D 4KKNA 2F74B 3KPTA 3OB8A 4TSAH 4ODVH 5IBTL 1TQCC 3GHBH 3QIWB 5B8CB 5GGQL 3PGCA 4KZDH 1FL3A 4PLNC 1CICC 3RP1A 1B0RA 5KSBF 2I60H 3IDMA 3NA9L 3OJ2C 4GSDH 1LO0L 4WV1C 4DVBA 1EHLH 4OLVH 4JZOA 5C6TH 2Q86B 1J0KA 2C9AA 5K59E 4HXAL 5DQ9B 5E08L 5E1HB 1T7YA 4OV6F 3H7LA 4NM4L 2Q86A 4JZOB 5LG1A 3DO7A 2NY7H 1G7JA 5IHUH 2VDQL 1ZS8B 3H0TA 4C56E 3OG4B 5KSVA 4MJ6B 2BC4A 1CI5A 5D7JA 4H5SB 5KANG 4U33A 3EJYD 3MOBL 4XVSL 5L2KB 5HI3C 1WAAA 2BRRL 2EZ0C 1X3DA 4JY4B 5DTFB 3RJQB 3ZHDA 2Y72A 2F15A 3SDAA 3SDAB 3TNNB 2ADFH 3CDFA 4HKBB 2VR4A 2DYPD 3QDMA 3KDMA 3VXSB 4HEPG 3HZMB 4KHTH 3S3PA 3SHSA 3VWJB 1BF8A 3QPQC 4YPGA 1UACH 4EI6B 2X7LB 3DO7B 4HWBA 3VWKD 3ECBB 4F9PC 2ZUQB 1I7RB 1KELH 3MRDB 4PRAB 3WEXB 4KTEH 2BERA 4RMVA 5D7IA 5FXCH 3VE0A 5H35A 3VW3L 2OQJB 5I1KL 1FO0H 3NIGF 4S0SD 1VGEH 4JFFE 4XT1C 2WANA 2DYPB 1M7DB 3O3BA 2FD6L 3SDCB 4CL7A 1FV1B 3OAUH 3GMOB 5ACZB 3ZTNL 3KYOB 2VLRA 4MXQC 3LKSA 4HX1B 1SYSA 1MCKA 3BDXA 3QXUA 4JHAH 5CSZA 1MNUH 4PY7A 4Y19E 2ID5A 3BD5A 3UTTE 4BH7B 3DVNA 5MENB 3K8LA 4UV7L 3MROB 4NQCB 3W9EB 3KPNA 4ZUSB 1DBMH 4LRNH 3N1FC 1UM5H 2PR4L 1IEAA 2LVEA 5F7EL 1T7ZA 4ZUWA 5BO1H 2VDMH 5E5MB 2YA1A 3KPLA 5HD8C 3RIAF 3RX5A 4ZSOA 4JPVL 1DANU 3T0EC 4MWFB 1U8LB 2B2XL 2DQCH 3ARWA 4D3CL 1Z5LB 4LVEA 5DK2A 4OZHB 1IQDB 4UQ2A 2MSPA 1UKQA 1XZ0A 1MFEH 4XP6H 4ZFOB 4PJ9C 3GSWA 1Q9LB 3V7AE 3HPJA 1AXSB 1JNNH 4CMHB 2I07A 3KPMA 2KDGA 2JJTA 3NVQA 3S88L 1MCQA 3O6FA 1QVOA 2DQEL 2G75B 3O2DL 4LLWA 5F9WC 4E5XA 2G9HA 3EJZC 4JLRB 2VLJE 2AVGA 2IH1B 4OLXH 3TWCH 4MNQA 4HPOH 3ARFB 4OD2A 2V2XA 1A7QH 3SE3C 4S1DD 4KZDL 4CVZB 3F7QA 5E8PB 1J10A 4XC3L 5MEND 2PYED 3MRKB 1W72A 3V5HA 3HLAB 1SVCP 3UZQA 3C5JB 3O2DA 5J1SC 1FPTL 4O51A 1B6UA 2ITCA 3ZKSD 4PJ7A 4KQ3L 4U3XA 1VB9A 5HDOA 1XF4B 1UQSA 3BJ91 1GGBH 3BEVB 4RMQA 5GGVL 2HT3D 5IWLC 3PABB 2R0KH 1YYLH 1LD9B 1MQ8A 3BYTA 3QRFM 1KEML 3GSOA 3HNVL 2A6KA 4XHQA 1YJDH 4M8QA 4D0DA 1MFNA 2EXWC 2YPLB 3V0WL 5LGJA 1S9YA 3ROOA 1BBJA 5E8DL 1D6VL 2N7BA 4HIIB 2C4XA 1HHKB 3DYOA 4Z7UF 1QSED 3NOIA 4EQ2A 4X6CA 3DMMD 2Y07H 2DM7A 1AY1L 1UJ3A 4NOBA 3FFCE 4C83B 2VQUA 4LNRA 1SMOA 4PD4J 3V4UH 2R69H 1QEWA 4HWNA 1OPGH 4YIQB 2LAGB 1HIMH 1RULL 3V6BR 4Z7NE 5ANME 1KIQA 1A3RH 2E7BA 4WO4A 5GISL 3OAZH 3TIEB 4NWUH 4TUKL 4XBEL 5DRNB 1EJOL 1INEL 5CD5C 5KSAC 1WC7B 1R3LA 3F65A 1HYSC 3GBML 3DUSB 1REIA 2IQAB 1U8KB 3LIZL 5E9DD 2G2RB 4M62H 2C7UB 2Q7YA 4HIHA 4JM4H 5F44A 3QCVH 4GG6A 3ZE2F 2BCKA 4UDTA 2AAVA 2MFNA 5L2KE 3MRHB 4LKCA 3NACH 1R24A 4JFXA 1DQLH 5C0EB 4FOMA 3TO2B 5JXED 1KCUH 5F97E 4BFGA 5ITFA 4ISVB 1A7RL 1T20B 5EBGA 1CL7I 1YNKL 2N1KA 2X2YA 5EOTA 1UYWH 1UC6A 2OZ4H 4LIQE 3T8XB 4LLDB 2ZJSH 5TF0A 3B9DA 1H15A 4FNLL 5KTEH 1CG9A 3LRSA 5F7MC 1A9EA 1OT1A 1LO5A 4H25B 2PTTA 3F6IA 3OKNA 2D0GA 3BN9C 4JPIB 5GS0D 5I71B 1UA6L 1ZHLB 3PWJB 4NO2A 4EIZC 1MCEA 4X80L 1SJHB 4DGIL 1XR9A 4PB0L 1EFQA 1YNLH 4MQTB 1DBJL 2FNBA 4L3CA 4QCIA 1V05A 1A6ZB 5F6IC 4JJ5B 5DMKB 4YHPB 1B3JA 4UNUA 2VXQH 5E94B 4P5MB 1FNEA 1QSEA 1YMMD 2FGZA 1YEJL 3ZDYE 5JHDA 2FJFB 1WV7T 2I60L 5I1DA 1X5AA 4YEFA 1A4KB 2N7AA 4XMKL 1NCAL 3NGBC 3R0MA 4MQSB 5I1CH 1UENA 1QKZL 3WFDL 1UB5B 1NUNB 1JGDB 2OJEB 4WO4D 3HS0A 3W0WE 1TVBA 3MV9B 2ADGB 1IAKB 5FM8A 1H3XA 3PWUA 2NY1D 4L3AA 5IVXB 5D7IE 4YQXL 1FIGH 1T7WA 5IJKC 5IW1B 4G8EA 2H3NB 2QTEA 4KI5E 4XCYB 1VADA 4ZUVB 5DYOA 1QLEL 3I6KB 1F4XL 2DIJA 3OZ9H 1HH6A 2VTFA 2APXA 1KIPA 3TNMB 3K2MC 3MRRB 4AT6A 1VA9A 4GRWE 5IBLC 1NANH 3MA7B 2DWDA 1MJUH 2V17L 1UQSB 2APVA 1HIML 2H9GA 4JPWL 5TPWH 2DN7A 5A2IH 3TBYB 2YKLH 1IQDA 1OP3H 3HLAA 2H3NA 4H0GA 3K74B 3SKOA 2IWGA 3KPSA 4DN3L 5C0JB 2X44D 4EN3D 3KYKH 1LP9E 1YNLL 2XFXA 4OZ4B 2EYRA 4G9FA 3GKWL 3SY0B 2BXYA 1BD2E 4IRZH 1AGFB 1YEIH 5IFHH 4BKLB 4TVSa 5I6XB 5IB5A 5EZOL 3HE6D 1F4WH 1KB5H 2BK8A 3V6OC 1EA9C 5FKAA 4NJ9L 3RVTD 1R3IH 4RGNB 5HTSA 1LE9B 2VMFA 1KTDB 5E03A 4OCSH 1YC8A 4H8WC 4I0CC 4R90L 3IDUA 1XIWA 2V5YA 4HC1A 4R7NA 3UPRA 3JZ7A 3EO0A 5E6IC