4FQJH

Influenza b/florida/4/2006 hemagglutinin fab cr8071 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
228
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGASVRVSCRASGYIFTESGITWVRQAPGQGLEWMGWISGYSGDTKYAQKLQGRVTMTKDTSTTTAYMELRSLRYDDTAVYYCARDVQYSGSYLGAYYFDYWSPGTLVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
publication title Highly conserved protective epitopes on influenza B viruses.
pubmed doi rcsb
source organism Influenza b virus
total genus 42
structure length 222
sequence length 228
ec nomenclature
pdb deposition date 2012-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fqjH01
5I0DA 3FO0L 5AG9A 3ARGC 1NDMA 3U36B 1J0YA 5DEFA 2AGJH 4TVPL 4I0PC 4NRXA 4B41A 4C56D 1KPVB 1VADB 2QADC 43CAB 3SDDB 3T2NH 2QKIB 4U1MA 3U7WL 3E3QC 32C2A 4Y2DC 1QLEL 3ARZA 1KTLA 4QHLB 4YXLL 5H35B 3VG0H 1EUTA 3F8UB 2X4QA 5HYEA 3RWDA 3REVB 4HKBB 3U0PB 4EUPA 1VESA 1MCIA 1SYVA 5EU5A 4O4YL 1G1CA 5F7YC 1MRDL 3B2UC 1F6LL 2CLZB 1TZHA 1LVEA 1OD9A 2Y7QA 2JKXA 2HP4A 5F7DA 2BJML 1T1YB 3A6OA 5JHDD 3SJVA 4DTGH 5DT1L 3EYSH 3ET9F 4UT9L 2BHUA 2ZKHL 4JRXD 4A2MA 5J56B 3S88L 2X4RA 3KYMB 3DRQB 3QBTB 2MMXA 2CKBH 5DD0H 4Z7OF 4AQ1B 4DN3L 4P48A 2X4OB 3N1FC 2PXYA 2ZCKH 4L3AA 1SJXA 3LV3B 2DTSA 3U4BL 1I7RA 2XZCH 2E7BA 4GMTL 1N8ZA 1ZLSH 2HJFA 5EOQH 4PGCB 3CX5K 4JJHA 5FUOL 2R2HB 3C5JA 4HPYL 3ZTNH 3UAJC 4ELMF 3AXLA 1F8TL 1A14H 1NMCB 4XI5D 2DN7A 1H8OA 3HZKA 1EEQA 3QXVA 2KPNA 1WWAX 2WWMC 4PY7B 2IH3B 3OGOE 4U1SA 1MLBB 4UTBH 2XY2A 1TFHA 4X4MA 5E56A 4HWEH 1RVFL 3FQWB 3SDAA 1BFTA 3DO7A 5EC2B 2C1OB 1M4KA 5CUSL 4TTDD 2FX9H 4PTTB 1LP9E 1T6VN 3B9KC 4E41A 2C4XA 4M4PA 1ROWA 3I75B 4ENEC 1AI1H 3MLXL 3MRIA 5B8CA 3H42L 3TZVD 3QIBD 4I4WA 4ZFZA 4J1UA 5IFJB 3LKSA 4FP8H 3FAWA 1ONQB 3NACL 1CDCA 1IM9D 4KU1A 1INQA 2XA3A 1U8KA 4ODBD 4HD9A 4JFDA 1KV3A 4JFFA 5TJWK 3S3PA 2QQNH 4BYHA 1T22A 3VA6A 4AIXA 5IMLA 1JZ3A 1BOGB 2W65B 3SE3C 2YOCA 4B50A 1J1OH 5LWYL 5C07B 5F8RC 3QULB 5GGRY 1YEDB 5D1XD 1W0VB 4HKZB 5GHWL 5T1DH 3MLRL 3ARPA 1JF6A 4ZYKA 1WTGT 2GK2A 1NKRA 1IGCH 3L7FA 4KJWD 2NX5E 1DLFH 1D5BB 2PW1A 4LPUA 5HGAB 3H9HB 1MFEH 3LEYL 1GOGA 4U1HA 4JO3H 1NCAH 1ED3B 4HV8B 4UDUB 5TQ2L 4OD3H 4F7MA 5BOPA 1D7FA 3QWOA 2BVTA 4IEFB 3QDAA 3ZE0E 4GBXB 3VWKD 2DQIH 1ZGLP 3V5HB 1QFWH 1XZ0A 1BBDL 5KW9L 1Q8MA 4N8PA 3A6BL 3REWA 5IB3A 4CMMB 4XPAH 2W0KA 4A6YH 3GMOB 1NFIA 3OR6B 4M93C 4L5FH 3U4AA 4ZUSA 5FV1L 2HWZH 4H0IA 3G5ZB 3RDTD 2LAGB 5KSBB 4JN2A 3GSOB 2EDNA 3TIEB 3WO3B 1VGKB 2XFXB 3ZYIA 4J6RL 5CJBA 4UILL 3S36H 1QBMH 4YX2H 3EDEA 3CSGA 5E08L 4MD0A 3GI9L 1KXVC 5CJOH 4GXVL 5CGYD 5EBMB 5DJZA 4M1DL 3BE1H 1JF5A 5DA0B 3ZKXC 1AHWC 2HG5B 5FYJL 3MRKB 1DBJL 3ZE0F 2FD6H 2XQYG 4K94C 5DVKA 3OAUH 1QSEB 3L5XH 4Y5XA 3VWJB 1UVQA 2NX5D 1IAKA 2V2TB 4FZ8L 5EORL 4NQCA 4DOHB 1HQ4A 5C70A 4QRTB 1Q9OA 1YQ2A 3H9ZA 1F4XL 3NCJL 3W11C 3KPSA 5J1TC 3B6SB 3CMGA 1TTFA 4O2CA 2DQJL 3SE4A 3NMEA 3O3DB 1M7IA 1AH1A 4Z18A 5C6PB 5HI4C 4CADA 4NBYB 1CICC 3T65A 4K9EH 1AQDB 4DZBB 2K7PA 3BESR 4PRDB 5FKPA 1VEOA 1OSZB 2K9UA 3FO9B 4G8IB 1FIEA 2Y23A 2VN4A 2J88H 3K4DA 4N9GA 4OIIH 3ARFD 5MHSE 1FAKT 4RRPA 1BZ7A 1NC4D 5D7IE 3EDJA 3SCMD 3MV01 1QTYT 2F74A 3MLSH 4NJ9H 2VXVL 4EI6B 4NO0B 4LOUC 1OSPH 4WU5B 1AIFA 3LB6C 4XCFH 4XHJC 2GUOB 1I75A 5I18H 1Q72H 2BK8A 1DN0A 3RZCA 5C09B 1A8JH 4PRHE 4OLZH 1HHKA 2GT9B 1EHNA 2J7LA 3G6JB 3C5SA 2OX5A 2NZ9D 3S4SB 3GJFK 2Q3ZA 2ZUYA 5LQBH 1IAIH 1F3JB 2WINA 5I76A 2F5AH 4IDJL 2FIKB 3HRZA 1K85A 4ZNEA 3SY0A 2D03H 4Z78B 1UWGL 5HYSG 5DRZB 4X98A 1YEIH 3AREA 4JEGB 3D69A 1N6VA 3JWDL 1H15A 2FZ3A 3NZHH 1A7RH 2B8OT 1CD1B 4HGWB 4RWHA 5LXGH 5DVLA 2LFGA 1ADQA 1RFDL 3MCG1 1J18A 1AGCB 2XWTA 5D7IF 3P4MA 1G7MB 5GS1B 3TNNA 5FFLA 2XA8H 3EO1A 3IFNH 4F37K 3LKOB 4PJHB 5HI5C 5LBSL 4APQA 4NN6B 2VAAA 3CGTA 4XNUL 2CLRB 3PJSB 2YD4A 3V6OA 2IQAB 3TO2B 1EHXA 4ZXBB 1BX2B 4WO4B 3WHE0 5FYJE 3EFDH 3VXSB 2UUDK 2RGSA 5MHSD 4KAQH 3KPMB 3PWUA 3WKMH 4HIEA 5IR1B 1FYTE 1A6WL 1X5IA 2L7JA 3D39E 4M5YH 4NUGL 3V5DB 5JPMA 4X4YB 3HLAB 4LHUD 3PV7A 2Y06H 3QQ3B 2YSSA 4NPYB 5F1KC 3QQNA 2JCCA 2XICA 4ZFGH 4YJZL 2BY3A 3HPLA 5HHXH 2FNBA 1B0WA 1OY3B 3BFOA 3O3AA 3BW9A 4WHDA 4PRHD 3FOLB 4M7KL 5IKCB 3BXNA 3LN4B 3RX5A 1F00I 2AP2A 3BVNA 5HDOA 1BM3L 1NCCH 4HUMB 1H5BA 1JNJA 5E2WL 2O61A 1J0HA 1IGIH 5DI8B 3NZ8A 4XPGL 4AENA 2C5DC 1F45A 4LSVH 1C5CH 2C3WA 4XP6L 4PV8A 5ITFA 3MBXL 2XG5A 3CDFA 3VCLA 4WHYH 2EDRA 3DUUA 2IPTH 4ODHH 3BPCA 3LEVH 2GHWB 1KYOJ 4RFOL 5BRZE 1OAQL 2GFBB 1IAOB 2DKUA 1S7TB 1T1XA 3BISA 2NY4C 3GMOA 3MRMB 3STBA 5ISZE 4P4RB 2R0KH 4KVNH 1D9KB 3RUGE 4HJGB 3RWJB 2R1YB 5F1OB 5K33A 5JA8B 1PEWA 3CH1A 3VXUA 4WNQA 1B3JA 5TH2B 3QUXC 2WSKA 4HIHB 4S0TD 3PHSA 5TDNA 2R2BB 4RMQA 5TE4L 1NGQL 3M07A 3RVXC 5FYJD 4X6CA 5E4EB 3S5LA 2A0LC 1N5YH 2W60B 1A4JB 3RVWC 1PGRB 1FYTD 3D39D 4LCCA 1UWEH 1YEEL 4KXZH 3NPSB 1RV6X 4NNPH 3D5OF 4FG6D 1FAIL 3E6HB 4JANA 3GMLA 5DRWB 4J3VA 4QF1A 1J8HA 3GMPB 1FNSL 5IGXL 1DVFD 3ZTJG 1JZ5A 5GGQH 1T66D 2YPKB 1UZ6F 3VRIB 4V1DB 1Q0YL 4HMEA 4ZTOL 1HHGB 4FQPA 3MV8A 4RMRA 3RUGF 1JNNH 2DQEL 3QG7H 4RISH 4LSSL 2VLRB 1JPFB 3W9EB 5F7HA 1J5OH 1MQKL 3MCKB 1QFUH 4PGEA 5DHVB 1DBBH 3VGGA 1EO8H 4H25B 5BRZD 25C8H 4F80A 1GC1L 2YRZA 4JG0H 3ZE1E 1Q0XH 3UTSA 4HUKB 5FAAA 5ISZD 1FNEB 1JUFA 4Q0XL 2JF1A 5CSZA 2W9LA 2FSEB 3U82B 3O3BB 3ARYA 2YWZA 4OFVA 5KS9F 1EEYB 5ADPH 5INCA 3QIUC 1FH5H 4MA8L 3OKLA 5DEGB 3RNKA 1KCLA 4Y16D 3ULVL 1NANI 4HS6B 1RZKC 4NHUA 4TNVK 4P59L 3QEQB 2R1WB 2IEPA 4KV5E 4MNGB 5ALBH 5IHUH 1DQDH 3CLEL 1RJCA 3T04D 1MCSA 2ITDB 5F3HB 3BT2L 4WWKC 1YEGH 4QCIA 1WFTA 3MLZL 4UIKH 3UMTA 3RL1A 1J0JA 3GKWL 5F9OH 2EYTB 2DLIA 3EYFB 4ZTPL 4FTVB 2A9ML 1WBZB 5C0GB 1TQCB 5GGUA 5HHNB 5LCVH 1D9KC 3QO1B 3TBVB 4PJFF 4YC2B 2G75A 2AK4A 3ZE1F 2PW2A 5L88L 2ZOLB 3P11H 3OKOB 3LKQA 1A0QL 1JGUL 1T0NB 1YEFH 3RTQD 2NY3D 4GXUN 5FGCB 5I1HH 1NAMB 1SEQH 1MHCA 5JW4N 1FCGA 3FCTA 1HSBA 3PGDA 3UZQA 4LSTH 1CFQB 1WCBA 4WUKH 2HT3C 3F5WA 1MLCB 5CS7A 3SDYH 4KV5F 5JIHA 3S35L 4N0YL 3W5MA 3BJLA 1UKSA 2HVJB 2YUWA 5E6IC 5MERB 3IDIB 5FECA 2I26N 4RX4D 3AS2A 3WIFA 3LCYA 3FZUC 3VGEA 2MCPH 4G6JH 4AQOA 5DFWH 2EIZA 4AY0A 5KOMC 3OJVC 4Z76B 1BPVA 4G7YH 4OT1L 5T1KD 1S7UB 4OBSA 3BEVA 4QOKB 1KLUA 2AXFB 3EJJX 2YEZA 3V0VA 3LPFA 5D1QC 1FGNH 1LD9B 4P2QA 5K9OB 3MRRB 1P6FA 4TPRH 4I18A 4LIQL 1YJDC 1YNTB 3WS3B 4KWUA 5AYQA 3HFMH 4XCYB 2WUCL 5D7JA 3UJJH 4B7LA 4HC1A 4X80L 4KDTC 5AZ2L 5D6DA 4IRJD 1KTKE 2Y25A 3MPCA 3UTZB 1NAKL 1ODAA 4KPHL 1GOHA 1KCUH 1F42A 4U31A 3DMMD 4ODWA 2ADGA 2OBGA 5E1AB 4LP5A 1QNZL 4NN5C 3NA4A 4UI2A 3L3HA 3QUYA 3TIDB 2X4TB 2VC2H 1ZT7B 3PWNB 4P23D 1E4XI 4FFWC 1MCPH 4M7JL 4AM0B 2IH1A 4DKFL 4RSVA 3ULVE 4MNHB 3ES6A 5FDYA 2X4UA 4MD4A 4ZFOB 1P7QA 4LHUG 4AJ0A 4OZHF 3O6FA 2F53E 2OJZH 5EUOB 4N0RA 5AYUH 35C8L 1MEXL 4YHKL 3O2VL 5BVPH 3O2WH 3QIWC 1BQHB 3QI9A 1G7LA 2H32H 4M62L 3BP5A 5CAYB 4YHPB 4UV7H 3OGCA 2MWCA 2EO9A 3IFPB 1KN2H 3P3YA 4P9HC 1NCBH 4MVBD 2H26B 2R0WH 4XVJH 3TNMB 2CIIB 3TH3T 1A4JA 3GMMA 3SKOA 3H3BC 5LVEA 4ZFFB 3I6GB 1S8DA 4RNRA 4R97C 3MJ7A 3OKMB 5EZOL 4W4OC 3CCHA 1KPRA 3MJ9A 2QQLH 5TQ0H 1MFDL 2WW8A 3MV9A 3ULVF 1HZHH 2YPKA 3HC4L 5IV2B 1EFQA 4NQSB 2CK2A 3GI8H 3D87B 2EZ0C 2RFXB 4YHOL 1V3JA 4M61A 5B4MD 1D5ZB 1GVIA 2B5IB 1FVEA 1IGJB 3RA7H 5ILTL 3LQAL 1JNHA 1I8LC 4E0RB 2XG4A 4NQXB 2ICEA 3M17B 3W2DH 4XNXL 4YAQB 3CFBB 2FCBA 3I9GH 4F58H 1SJHA 4Q9RH 3ULVD 5EIIB 3P9MB 3MRJA 1C16A 1FDLH 2JJTC 1FJ1A 3JWOH 1T5WB 2O5ZH 4IS6B 4FQJH 1E6JH 2OLDA 3LRSB 3CFKB 1GOFA 4YHNA 3RJQB 2F53D 3QFJB 3FMGL 1SJEB 3ZHLA 4QNPF 1KLGB 1LO0H 2ZSVA 4H5SB 1AFVH 1HHHB 2EH8H 4LIQE 5DD5L 2QSTA 1MHEA 4Z8FH 3MV7A 2WWKO 1BD2E 1N2RA 2R8SL 4LCYB 3MNVB 2IBGA 4C83B 4G42A 4HCRA 4RGMC 3WIHA 4YBQC 4QXUL 1OGAA 2AJVL 5L2KE 3SKJL 4OM0H 4N0UE 5CINL 3VFNA 1EUUA 1XCTA 3KPLB 4P4KB 2HMID 3BH9B 4AIZA 1J05A 2UWEE 1HYRC 3SPVB 4G6AD 4QTHB 3ARDB 3GNML 3LS4L 4XPBH 3RPIA 5C7XL 1QUNA 1HH6B 4F7TA 4U6VH 1WFUA 3U48A 3WNKA 1W72L 4QRRB 2F5BL 3DPBA 5F1IA 5CIPH 1IZKA 5ICYA 4YDJA 4LSRH 3ULUL 1DQLH 5HHVH 5DUBB 3BPNB 1NJ9B 1L6ZA 2IG2L 3OTTA 4FQQA 3PGCA 4WW2B 5DRXA 3PWJB 1P5VA 5C0RH 3M1BB 3BQUA 3VFRA 4I0CC 1M71B 3LKPB 3SN6N 4X9BA 3AGVA 1CD8A 4GO6B 4HAFA 4P2OA 1G6RA 2XZQL 4HPOL 3SGKC 1U6AL 1UJ3B 4J8RA 4YUEL 4Y4FC 4GAGH 2JE8A 1N5AB 5HYQB 2DI9A 3BRGC 1UXWB 4JHWL 2HRPH 2PO6B 5DD6B 5KBNC 1BD2D 2I5YH 1KCRL 1NPUA 1X5YA 2MKWA 3MMEB 1SYSB 2X70A 1PKOA 4PP2B 5L2KD 1R5VB 4OZFA 4S1RL 4I3RH 1F90L 2FEEI 4NZRL 1HI6B 4QRPE 2OCFD 2MKLC 5I8KL 4WW1B 3UDWA 4O58L 5D2NA 2ICWJ 5TE6L 3C5ZD 5T3XE 3ZYZA 1R3LB 4PJAB 5EA0L 2PKDA 3FQRA 3KPPA 5HYJA 4IOFD 1YYLL 5GSRA 4NN7B 5E2VL 4R2GD 2VDMH 3CK0L 4MA3B 5GRVL 2YUXA 4KRNA 2W9EH 1F3DH 4Q6IC 3KXFA 4HFWB 4JHZA 5IK3A 5GGTA 3AMKA 2FH8A 4CVZA 1YMHA 1XF4B 3VFGH 4OFPA 3K2UH 2WIIA 1FO0H 3TO4B 4HUWB 3ZKMC 1KJ2L 3C8KB 2X1XR 1EBAA 3FB5B 1MNUL 3QPXL 3OAYK 3T08A 1GGUA 1AGEA 2JJSA 3AY4C 4DFHA 4MNHA 3TYGL 3QUMH 1A7NH 3P9WB 1I1YB 4Y8AA 2ERJB 4Y4KD 1TVHB 1G9MC 1LEIB 3SBWA 2DAVA 2DQHL 1HXYA 2NY2D 3AUVA 1CLOH 4OCLC 4HK0B 3MRBB 4N0FA 1T1WA 4RFNC 2DWDA 4I2XA 2H8PB 5FUZH 4WFEE 4DKDC 3BP6A 2Z8SA 4PB0L 5DMJB 3TNMA 3X3FL 5EUKA 4E5XA 4B0MM 5AZEL 4K8RL 1PY9A 4ACPA 1UWXK 1IZJA 4UNUA 1P1ZA 4ZDHA 3ULUE 4YK4B 2BX5A 4QRPD 4LSQL 5CCKL 5C0AE 1ZLVK 1T5XA 3GFUA 1AXSB 5MENB 1PG7W 3WJLC 4U0RB 1JPSL 5T3XD 9CGTA 2VZ1A 2RQ8A 2EDTA 3LZFH 1FGVH 1VACA 4HIIB 5C9JA 2GJ6A 3MC0A 3QUZB 2BRRL 4JN1L 4RAVA 1OT1A 2FB4L 2VUYA 3MOBH 2BZDA 4X4XB 4JPKL 2V9QA 4P2RB 2Q8BH 1E4JA 1OHQA 4P46A 4ZPTB 4YNYB 1G7JA 2G60L 5FOBA 4LSPL 1IQWH 8FABA 2Q8AH 4DUVA 3C2AH 3FOMA 1CDHA 2BCKB 3DXAA 4OD1H 1DCLA 5FYKE 3H9SE 3P9MA 4HWZB 5E7BA 3KG5A 1G9NC 4CMHC 2PTVA 4LGPB 1OGTB 4FZEH 5HVWA 1XR8A 3C60B 3K46A 1CG9B 3MXVH 3WHE1 1CIUA 1QD0A 5GS0L 4NCC1 3O3EB 3P0VH 4YXKL 2NY1D 1MHHB 4TNVF 3ULUF 3WNNA 1U8OB 3MRQA 5DD1L 1TCRB 3FO0H 4PBVC 2HFFA 2BXZA 3QXAB 3HA0A 5L0QB 4TVPH 1AO7E 3MNVA 2QADD 4HF5L 3PV6A 4WFED 4G9FA 1FL5A 5TDPB 3D3VA 5IB2A 1DUZA 2O5YL 4Y2DD 3OR7A 5DS8A 1XIWB 2Q6WA 1QLEH 4OI8A 4HKJA 1WAAF 1AP2B 4YXLH 5GJSH 3ULUD 1ES0B 2VUOA 1NCWL 5C0AD 5M94B 5ACLA 1IQDB 3UP1A 3JUZA 4JHAL 2NW2B 4O4YH 3BP7B 2ICWB 1MRDH 5LGJA 3VXOB 5J89A 3GKZA 3GIVB 5F1NA 4J4PC 4M1CD 2BJMH 4N8VA 4ONGL 4RGNB 2P24B 1FLRL 5SWSA 3U0WL 3T0EA 3M8OL 5DT1H 4UT9H 5KZCB 2OQJB 3TCLB 3JTSB 4YGVA 4NYLB 3PQYA 2ZKHH 2CDGA 1MCWW 1T03L 4QY8B 4XMPL 4BJLA 3ARBB 4G80B 5FYKD 2FLBT 3OKKA 5DMKB 3NTCL 4OM1L 3H9SD 3TF7C 3U4BH 5ESAA 5DSCB 4GMTH 3R06A 5C6TL 3KHQA 4PJCB 4OD2A 3RL2B 1F3RB 2DLEA 1DQML 3UAJD 5EG6C 3FB7A 5FUOH 2CDFA 5FCUL 1U8NA 1F8TH 1V8HA 2PXYC 3HAEA 1ITCA 1G6VK 4Z77B 4PRIE 5TDOA 4KKBD 2DF3A 2WWMD 3RWEB 4LKCA 2AXGA 2X9YA 3IFOB 3IF1A 1MI5E 4LHJB 1AO7D 4XCEB 1KXQE 4NZJA 3QO0B 1WZKA 2FRGP 4PP2A 1B0RA 5EZIL 5CUSH 12E8L 3PWPB 2BOCB 1MJJB 4ENED 1LEKA 1H9VA 3O3UN 5H37G 1F11B 1ND0A 3MNWB 5DVOA 2P5WA 3MLXH 3SDAC 4CBPA 3U30B 3H42H 4EEEA 5F7UA 5J13B 1KUMA 3O4LB 4JKWA 1CT8B 3HCVA 3OAZH 4URTB 1C8PA 2HFGL 5B8CC 4MD5A 4PJEE 1KNOB 2VDNH 1PAMA 4MAYB 1UGNA 2OZ4L 1N59A 4NKOB 1VKXB 1FLTX 2GJZA 5SX4I 3MLUL 4OGAC 4BZ1L 3NIDE 2FJHB 5CGTA 1BQLH 5GHWH 1V3MA 3MLRH 1XGQB 2QL1A 4GG6E 1CXLA 1SEBB 1XIWC 2VNCA 1S9WB 1Q9LA 3P0GB 5C0DB 3LDBB 3LEYH 1BF8A 4TQEH 5J6HA 3ARXA 4PRAA 3CIQA 4WI4A 4K8RD 3WNMA 5IOPA 3BSZL 5DQJA 1RIUL 3BGFC 5TQ2H 5KVMC 3QDGB 1P53A 4LLMA 4OCRH 3UBXG 1FVDA 5FM5M 2KQMA 5J9PB 4ONHA 4PRID 3FQNA 4K71B 2CKNA 2I60H 4ELKB 1BBDH 1MI5D 3CDCA 5C07E 1RHHA 2EYRB 5KN5A 3VMPA 1MCRA 1S9YB 4DZ8B 3VGFA 2E8ZA 3IVKB 3OJDB 1VFBB 4MLIA 2VQTA 5B3NA 4FXLA 3V6FA 5LAXA 4AEIL 1DQJB 4M43L 4QHKI 5IQ7L 4IIQB 5TGBB 4J6RH 1ULVA 2DQTL 4UILH 1SBSL 5CZKA 1A5FL 4DAGL 2J1KA 4AL8L 5E08H 1KYOK 3GI9H 3S36X 1P84J 1U36A 2A74B 4I5BB 3V4PL 1SY6L 4XNQA 1S7WB 2XN9E 5D5ME 1YPZE 5AD0A 3L5JA 4XNYL 1L7TL 4ESKA 3WIIL 4Y7MA 5J1AA 1EFXB 5C0NC 1DBJH 4O2FA 3B9EA 3MSPA 5I74B 4F7EA 4OKVB 4P2YA 5D2LB 4PLKC 4X5XA 1KG0B 3BUYB 3JV4A 1E4KA 2E7LA 2R2CA 3PL6A 4Y19E 5EIQA 3BO8A 3QP3A 4FZ8H 5EORH 5C0IB 2VQUA 1JZ6A 3QQ4B 3VDAA 4LCWE 4P57A 3V6ZA 5KAQG 4D0BA 3ZZ1A 5BV7B 3VXPB 3W11D 2DI7A 3G9VA 1WUNT 1MCEA 2A83B 2IC2A 4Y5XC 3KLHC 3NCJH 1KGCE 2D7QA 2OK0H 1YN6A 1Z0MA 2DQJH 4JO4H 3IYLW 4Q97A 1O5DT 1UEMA 3LPGA 3PDOB 3U1SL 5HI4D 1KCVL 3CSPA 4HWBL 3FONA 1CICD 5C07D 3MGTB 4UOJA 5HHQB 3H2WA 4FQLL 5D5MF 4PGZA 3SE4C 1QSEE 3HR5B 1MFAH 1OP3K 2CKBA 3G9AB 4X7FC 2LV4A 1VFAA 3RIFF 4MWFA 4PJBB 4G5ZH 2AKRB 5I17A 1AQKL 4R26L 3EJZC 4DOHE 2YS4A 5B38B 3UYRL 1AD9A 2VXVH 1H8NA 4XNMB 2X6MA 2FGZA 4LOUD 5KSBF 1E0OB 4E9LA 5F96L 1MCCA 3LB6D 5A40E 4XHJD 2XN9D 4WY7L 2BOBA 2X4NB 1OAUL 2JELL 5A2JH 3NCYS 3TCLA 3MLWH 1NGPL 1TXKA 2EYSB 4MNQA 2NY0B 3UPRB 4X6DE 3TPKA 1R3JB 5KG9B 1LE5B 3KYKL 1FG9C 2B0SL 4IDJH 1OAYL 3FFCB 4JFEB 4Y19D 3RZCC 2UZIL 2Z0BA 4I3SH 3ZKNC 3FQXA 4Z7UA 2B39A 1RURL 1ZLUK 3JVGA 4R90L 3O8XB 2GYSA 3RGHA 1LDPH 4LCWD 1UWGH 3HKFA 1SM3H 2W9DL 1Z9SA 2VISB 4EVNA 3DTXB 4XMKL 4IIQC 2ARJA 3CNKA 4K7PL 1KGCD 1S7XB 3ZHKA 4O51A 5CEXA 2SEBB 3AREC 4Y4HA 2HLAA 3DV4B 5SWZA 5C09E 1HN1A 4NGHL 5HI5D 3VGBA 3G6JE 4PJDE 5LBSH 3MROB 3CLFL 2BOCA 4XNUH 4YDLC 4L4VA 3UZVB 2ED9A 3G5YB 3TH2T 1E27A 3HI5H 3QSKB 5KSAB 5C92A 3GRWL 2X1PA 2NW3A 1LO5B 1CGUA 4OB5L 3D0LB 4HFUH 3VH8G 4APQC 1UKTA 1OF2B 3PHOB 4JRYB 1A6WH 4NUGH 1U42A 4RWYL 1I7TB 2MHAB 1KACB 2NLJA 4PJ7E 4WIQA 4PG2A 3RWCA 2DWEB 4LASL 3NOIA 2DMKA 5E8DH 3VXQA 2ED7A 2XKUA 4K2UH 3RBGA 5MEQB 3TBWA 4PJHE 4RFEB 4NKDB 3EYOB 1M05A 5ERWA 3DGGA 1BM3H 2LQRA 5E2WH 5I1JL 1B6DA 1DJSA 2X7LB 4XPGH 1YJDL 2XKNA 2MCG1 1JNLL 4LLYA 4XP6H 4X5WA 3VXSE 3ZDXE 3G6JF 1S5HA 3MBXH 4PJDF 4PJXE 2XI9A 1LE9A 2P4AB 1JF1B 1EAPB 1N0LA 3B5GA 1J87A 1H5BC 4XAWH 4IOIB 4DUXA 1EEUA 1U95B 4G8GB 3GSQB 3WFBL 4B5EA 4G8EA 3JV0A 1OAQH 3SE9H 5EO0B 1E4XL 4JPIB 3OKEA 2NY4D 1IL1B 1R3KB 1T6WA 5C0CE 5CSBA 4XXCA 5C09D 3GK8L 2X9WA 3OXRB 5L2JB 2EDDA 3QUXD 3TN0B 1DEEA 1KSRA 3DECA 3IXAB 3BZEA 4QGYA 4CJ0A 4R3SB 5I1KL 5GRJL 1ZA3A 3L3IA 3RWFB 1RMFL 1NGQH 1IBGH 2E7MA 3RVXD 4CU8A 4U6XA 4X0KB 5F7FA 2A0LD 4M7ZB 3TVMA 3B3IA 4I48B 4PJHF 3RVWD 1QFOA 4AEHL 4ZPVB 4JFYB 3EYVA 4LKXA 4YR6B 1ZGLM 1YEEH 2CDEA 1KFAH 1QEWB 1FAIH 2F58H 3BGMA 2YMXL 3ZDXF 2P8MB 1IEAA 2LTQB 4LU5L 2VR5A 5BXFB 1E6OL 1FNSH 2Z31A 1EFXA 4U1KB 3HZMA 5HHMB 4LCCC 2D0FA 5EO9A 1I9EA 5E8NB 4L4JA 1QHPA 4P49A 1NAML 4GMSL 5D2LA 5D7LA 1M6OA 4F7CA 3AAZA 4IHOA 4NM8H 3HB3C 1NLDH 5E94A 1KF9B 1CTOA 4ZXBD 4WO4D 4M02A 2NR6C 5DHYB 4LSSH 3BPOB 3VXSD 1A21A 4GQPH 4YIQB 4PRPA 4PJ8B 4QO1A 3BD5A 4GJTB 4E42A 3VXPA 3TP4A 1PYWB 2VLME 3INUH 3VJ6A 4AH2B 5IMKB 3O2DH 1GC1H 1Q9WA 2KDGA 1JHLL 2V7NA 2X40A 4K3JL 1GGIH 2EXYC 4D0CA 4KH2A 5C0CD 1J0IA 4KTEL 3SQOH 1XGTB 3BPLB 4JM2A 2F54E 3DHMA 1NEUA 3QIUD 4ZUWB 1U93A 2FLRT 1C5DB 3EOAA 2LABA 5JNYB 4H88L 1DN2A 3DNKA 4OSUL 5D8JL 4V1DE 3ULVH 1NGXB 1OB1B 5K59F 5BZWA 4P59H 5BJTB 2VLRE 4XWGL 2FR4B 4XP1L 5KSUA 1W0WB 4CVXA 2AW2A 5JXEA 4Y1AA 3BT2H 1UCTA 3QG6B 3AB0B 4Y2OA 1T4KB 2J4WL 4S10A 4M5ZH 4PJ5E 4IRSB 1HDMA 3MLZH 5FA3A 5KANI 4CVWA 3BI9X 1RUKH 1V3LA 4Z7VA 2KL6A 4ZTPH 3QXDB 1D6EB 4L3EA 1X5AA 1D9KD 3S37H 2HYMA 3UX9B 1KIRA 1WLHA 2WP3O 4XCCL 1QR1A 2HVKB 1XR9B 5E24E 1LK2B 5L88H 4PGJA 4HUVB 1A0QH 1JGUH 4OQ1A 3BH8B 4XMLL 3X14B 2B1AL 4OZIE 4ZUVA 3K81A 3MFGB 1I9IL 4FQXB 2CRYA 4NKMB 5CJQL 4WU7B 3DTXA 2HJLB 4ZAKB 5HHOA 4POUB 2HT3D 1KULA 3NCEB 3T4YB 4NQVA 2VLMD 2LU4A 2H41A 2J8HA 4F15C 2B1HL 4RMWA 3STZB 1AGFB 3QRGH 5BVJB 3S35H 3FQTB 4N0YH 3DV4A 3I6KB 3QA3A 4HBQA 4YE4L 2P1YA 3FT4A 4R96A 4KJYB 5FYJU 3TCXA 1K4DA 3FZUD 1WBYA 2F54D 5KVEH 3MBEA 5E2TH 1X7QA 1UA6H 1UYWL 4S11A 4HXAH 1PG7L 2I24N 4V1DD 5JPNB 1A02N 3DVIA 4X7CC 4PJIA 2P7TB 4ZOCA 3V4UL 3FRPA 4BQ8A 4D3CL 3HG1B 5D1QD 2AV1B 3VGAB 1X5HA 4O02L 4PFEA 3VXME 4PJ5D 4DCQB 1RK0A 4ODSL 2DWEA 2FEEL 4LIQH 4OZIF 4OLUH 5DJ0B 4Z7WB 1K4CB 3VXNB 5BS0B 2ZNXA 2WUCH 1TJGL 3WO4C 3MCLL 4F2MB 2PTTB 3CXDL 4UB0H 4X80H 4CDGC 4GSDH 5AZ2H 1J10A 1CCZA 5IMMA 3QHZH 5HHPA 4I18C 2AI0L 4KPHH 3DV6A 1MIEL 1Z3GL 4HHAA 5J6GA 3TBYB 1PKQB 3MRGA 3O41B 4GW4A 5SX5K 3AFLA 4G9DA 4M4RA 5D7JC 4XTRC 4K3DL 1TQBC 3WE6B 5K9KA 4IOSD 1A22B 3GSUA 5D6DC 1FNAA 1QNZH 2A6KB 4QOKE 3T77B 1MCDA 2G9HB 4FFWD 1IAMA 3DVNB 1X5ZA 1W2KT 2DLFL 4IMLA 2Z35A 2MPAL 4M7JH 5JA9A 3HNVH 5I15L 2VQ1A 4MJIA 2GTZA 2Z8WC 3QDMA 3H7LA 4HKXA 1TJHL 3HC0A 4DVRL 4R7NA 1RUAL 3QUYC 4EN3A 4YO0B 4Z0BL 1WC7B 35C8H 5D93B 1MEXH 4YHKH 4FA8A 3O2VH 2YPVH 3QIWD 4GS7C 5GS2H 2E9JA 3EKCA 3UEZA 3R4DA 2J2ZA 2D7NA 3ZL4L 4M62H 1G0DA 4TSBL 5IB4A 4BSVB 1F3DJ 3O6FC 5MI0C 1WFOA 5J12C 3NCFB 3WS6A 2A6DB 3BMWA 4C55A 2V9RA 4I48A 3GUTA 3G6AB 3NFPA 4EI5A 1PQZB 3IJYA 2R23A 5GIRB 3QI9C 4EUPH 1CDJA 3MRHB 4H0GA 3PWVA 3VXMD 3CU7A 3WUZA 2ZOKB 4U1GB 3KDMB 3C08H 5EZOH 2H6PA 1BGXH 3WCYA 1DQQB 4QKXB 4GRLB 4LSDA 3D85B 3T0DA 3HC4H 2EZ0D 2YKLL 1YMME 1BLNB 1BIIA 5HBBA 4P5TB 4YHOH 2BNQB 5FF6A 4LPYA 5DDHA 1YEKL 3Q3GB 1FORL 2OTWA 3S4SG 4QOKD 1SVZA 2R4RL 5DJCA 5ILTH 3LQAH 4HS3B 5I19H 1R24B 1PSKL 1PYWA 2EDQA 4HX1B 4XNXH 1B88A 5EFIB 5F6HI 5CKGA 2EDEA 4QGTA 2GSGB 1KTRL 3IXTA 1KELL 2BSSA 3NGBB 2EDJA 4POZC 4JVWA 1QA9B 2ICCA 4C56B 1A6PA 2CLVB 3PDDA 5CEZE 2RB8A 2R8SH 3AS3A 5GJTL 1G9NL 5EUOF 5A2IH 5A1AA 4YBQD 1RSFA 5I16A 2AJVH 4PRNB 3SE8L 5IW6A 3KYNB 3SKJH 3KYOA 3S3JA 3V52L 5HYSB 1TVBB 4U1NA 5CINH 5EZLA 1I1AA 3ROOB 3QG6A 1T4KA 1G7HA 4XB7A 3D2UA 1U8IA 5GXBB 4M6OL 4LEOB 4K3HA 1UG9A 1RZJL 3C8DA 3F12B 3KVQA 5IMOB 5CBEA 1HH9A 3QXUA 3GNMH 3LS4H 4JPVH 5BZDA 2IADB 1N0XH 3NVQA 1LQSR 3NCCB 5BCAA 3FFDA 5C7XH 5I6XB 2H3NB 1U92A 1PX3A 4AT6B 1EZVX 1W72H 1T7XA 5I75C 1OTSC 2F5BH 4JZNA 5JHDB 5HI3C 3U9UB 3QJHB 5CILL 4RBPK 1YMMD 3GMRB 1WWWX 3ULUH 1UENA 2APBA 4JRXB 2EC9T 2GTWA 4XBGA 3R1GL 1T89A 4RQQB 2H9GB 1UZ8A 3ZMRA 2KZWA 3GSNH 2GAZB 2MTPA 3IFLH 1KIUA 1MIML 5I1DB 3EFFB 3BDBA 2EKSA 3L5WA 3SGDI 1EBPA 4R4NC 4PTUB 1DL7L 4MXQD 5E6YA 1CGWA 2XZQH 1MVUB 4KJYA 5D1ZC 4MB4A 1U9KA 2IFGA 4YUEH 2X44D 4CN4A 3DSFL 3BQUC 3HNSH 4YQXH 3QJFB 4P2OC 3HMXH 1RZIB 2JB6B 1RD6A 5CEZD 1CXEA 5DJAB 1KCRH 2P7TA 1CE6A 2FJGA 5DF0A 4R8WL 1S7SA 3K1DA 4S1RH 4NZRH 3QNZA 5I8KH 3TZVB 3QIBB 5IVNA 1W0YT 1ZVHA 1E28B 4IMKA 4JZJA 1IM9B 5T1LA 5BS0A 5EA0H 4OUOA 3HZVA 1YYLH 5E2VH 4EDWH 3UDWC 3CK0H 1I8KA 1EJ6A 5D2NC 4OZGE 4S1SL 2NY6B 5D1XB 3LD8C 1G7IB 2AJZA 2FGWL 2R1XA 3QAZC 2BNRA 3VD3A 3EDFA 3ZKMD 3T77A 1CGTA 3L6FB 2EDWA 1KJ2H 3NCYP 4BFIB 3BGAA 1MNUH 1D5MB 3QPXH 2AJXL 1RU9L 3Q6GH 5F7LB 3GIZL 3TYGH 3WD5L 4P4KD 3U46A 4PYHA 3IDJA 3VFUB 1M7DA 3FO2A 4ODTL 3UTQB 5ETUA 4H8WL 3ILPB 4WW2F 2JJSC 1CTNA 3VWKB 3PG2A 1TZIA 2DQHH 3NA9L 3SDCA 2BMKB 3KS0H 1JGDA 1B4JL 5I0ZA 3DIFB 2WUBL 2A6DA 1QLFB 2APTA 1B4RA 4PB0H 4OAWB 3SBWC 3EO9H 4L8DB 5J8OA 3QH3B 5FA4A 5EULV 3C6LA 1EGJA 5AZEH 3OMZA 1LP9B 4K8RH 1UM6L 1C08A 5ITBL 1WVZA 3RY5A 2IANA 1BFVH 4QHMA 4LSQH 1IKFL 3FB6A 3UJIL 5CCKH 2QSCL 2X4SB 2QQQA 4DK6A 2Z4QA 1JPSH 1VPOH 4L8SA 2QSQA 1GGCL 4IDLA 4Z7QE 5HYFA 3ALXA 3FHAA 1I8MA 1P9MA 1OP5K 4BUHA 1ZE3C 1C5BL 43C9B 2BRRH 1Q38A 3CC5A 5C0BA 4PJAF 3B83A 1Y6MR 4JPKH 3MO1B 3PP3K 3D1MC 2PO6D 1R6VA 5J0BA 1XGPB 2G60H 2K1MA 3VW3L 1OCWL 2YN3A 1R24A 2NX5B 3GHBH 3SJVE 3VFPA 5I2IA 3KPOB 4NKQB 1TTGA 4WV1B 5C08B 4NQDA 3G08A 3PGFL 4OV6F 4P46C 2DQDL 5MENE 5ESQB 4U6YB 2OTPA 5GS0H 2EE3A 4YXKH 1T04A 1JVKA 1DEDA 1F13A 2YK1H 1CFNB 1HHIB 1P84K 2XQBL 1I7UB 1OP9A 4Z7QF 4P2RE 1G1YA 1DFBH 4HF5H 5CIPA 5DJDA 3VFMB 3EOBA 4KI5C 4QEGA 4YHIB 2O5YH 3BN9D 4OLWL 3TO4D 5IQ9A 3O6KL 3LMJL 2BVPB 1XF2B 4X4ME 1T7WA 4LAQL 3IETA 4LVHC 1O7VA 5EU4A 4QYOA 1NCWH 4Y5VA 1NC4B 4NO2B 3SCMB 5ECJE 4YPGA 4JHAH 4O9HL 3MREB 3EO0B 2CRZA 1DANU 3TT1L 2FHCA 3W5NA 5IUSA 1DZBA 5IF0B 1MRFH 1B90A 4J4PD 4PR5B 4NZTH 3V0AC 4NHCL 5DJXA 2M26A 2VDOH 4YDVA 3BWUC 5E00B 4TNWK 1UEYA 1T2QL 1FLRH 3S96B 3U0WH 4PG9B 3CZFB 4JFFE 2CO7B 1DUYB 3HS0A 5HVHC 1NLBL 1QQDA 1RIHL 1T03H 4FOMA 3IU4L 1ZTXH 4LGRB 2Y5EA 3SJVD 3TGXA 3GGWB 2J8UB 3T0EC 2BP3A 3BDYL 1IGTA 4OM1H 1NKOA 4ZOEA 3DI3B 5MEND 5C6TH 4XGZA 2R29L 4UIMB 4OFYA 3D48R 4JKPL 1A7QH 4PLJC 4NRZA 1DQMH 4CGTA 2PXYD 5FCUH 5B39G 1L7IL 4PLOB 1RZ7L 2A77L 2A6IB 5F44A 5EBLA 5ACZB 1DLHA 1QRNA 2BRQA 4DVBA 3RVUC 4P2RD 3OHXB 4M6ML 4BH7A 1T1ZB 4KTYA 1BQHG 3RX8A 5GGSA 5JQHC 4ELMA 5EZIH 1HXMB 5AWNL 5F9DC 12E8H 3E8UL 4UUJA 2WZPD 1IGYA 2F19L 4GKSB 2XZAL 2P8PA 4LQFL 3BZFA 1FO0A 4JR9L 4G43B 1Y18B 2IFFL 1U8QA 4QT5A 5E8EB 4PJCE 1ZKAA 4LHUB 3C60D 3QUMA 4LAJH 1KENL 2DQFB 1PZUB 1I3RB 1IMHC 1C12A 2XIDA 1PZ5B 4GW5A 3JBG7 1NBYA 1VA9A 4ONOA 5D70L 4FMKA 1G7QA 2Q86A 2OZ4H 4PBWD 4PRHB 1MVFA 4OGAD 3MLUH 2VR9A 4JFFD 3WN5B 2HKHL 2DICA 3P4OB 3FO1B 2HN7B 2Q76A 2DQCL 4JLRA 2HTKD 1XIWD 3D18B 4YFLI 5DQ9A 4ZOAA 5BV7L 1HILB 3PWPE 1U8MA 1T3FB 2R0ZL 5H2BB 3TEUA 3HUJB 5IHZA 3W9DB 3QCUL 3BSZH 1NUGA 1KPUB 4RA0C 3VWKA 4X8XA 4M8QB 3T3MF 1FPTL 3QNYB 4L4TA 5F21B 3V9FA 5IB5B 4PJCF 5DFTA 1BFOA 1NUDA 2UV3A 3IKCA 3QPQD 1UQSA 2IPUK 4OF7A 5E9DA 4K7FA 5DC4B 2HLFC 4QRSA 1ZHNB 1U8LB 3RDTA 1YNKH 4GAJH 2E7HA 5D72L 2R0LL 3FQUB 1P4IL 5FO8B 1XAUA 2AJ3B 1CS6A 1X9QA 2OR7A 3TYFA 2OR9H 3VRJA 1LGVA 5CD3A 5IQ7H 3K8KA 2DQTH 3GMQA 1SBSH 1A5FH 4BQCA 4O2EA 4DAGH 4AL8H 2HT2C 1BVKA 3V4PH 4HIXL 1SY6H 2D9QB 3BD4A 1I4FA 4DFIA 2EIBA 1DVFB 4H1LG 5GGRA 4WTWA 1L7TH 1CXFA 1UWXH 3DURA 1MAKA 3CFJA 2OP4H 3BWAA 3WIIH 5C0ND 3GMNB 3WUWG 5EBWA 5JZ7D 5EN2B 4WFFE 4ZOBA 1J8KA 3LKRA 4WV1A 3FB8A 3CJJA 4YLQT 2NTFB 4XPHH 4PRBA 2Q7YB 4WENB 1FVCB 1FSKB 5I8OL 1PVHA 1QFHA 5F9AC 2BSRA 5GSVB 3KLAB 4FXKB 3KLHD 1E4KC 3DUSA 4MQ7B 2E7LC 4HXBL 3PL6C 2M8XA 4DUWA 4WJ5B 5ALCL 1CVSC 3MFFB 4MSWB 5ISZB 1T2XA 4Y89A 1FFNA 4XXDA 1LDSA 2V7HB 4PP1C 3U1SH 2E5EA 1KCVH 2HFEA 3GJEA 1I1RA 2BDNL 1CFBA 3BIKA 3HE7A 4HK3J 3CFDB 4HWBH 3KR3H 4MA7L 4JREC 3VDCA 5DR5L 2P8LA 5IESL 3OXSA 4Y16B 4BQ9A 3RWGB 3C09C 3ARFA 3ZSTA 2ITCB 5EPMA 2ZCHH 3IDYC 1AGBA 3Q6FA 1CGYA 3TJHC 3EJZD 4LSUH 5I66B 4G6FD 1AQKH 3DVGA 1NANH 2V6HA 3GB7B 4NZDA 2JJUA 5F96H 2VDRL 1MWAB 3DHJA 4WY7H 1OAUH 2JELH 2HJKA 4JDZB 5I9QB 3MJGX 4QRQA 5D4QA 2V2WB 2XQYK 2Y72A 1NGPH 3B9DA 1FFOB 1CQYA 2QQKH 5DC9B 4UAOC 5EU6B 4WFFD 1ZVSA 2BNUB 1OOAA 3GGWA 5IM7A 1D5XA 3H0TB 3KYKH 5DZLA 3RTQB 3RZCD 2B0SH 3ZKND 1OAYH 2UZIH 5DMIL 5E95B 3HZYB 5E8PB 5HDQL 4R90H 2FH6A 2QHLA 2BSTA 3O9WC 1JHTA 1ZHLA 2W9DH 4CN6A 2E9IA 4NQEA 1GHFL 3U0TA 4QXTA 4K7PH 3QDJA 3RVTD 3JVGC 3ARED 1X5LA 1QSVA 4D9RE 4X9IA 1UC6A 1UACL 5DRNA 5JO5A 5CMAA 4JO2L 3MJ8B 4GKNA 3CLFH 5KJRL 3P0YL 3N9GL 5HXMA 2FBJL 3U7YL 1B2WH 3O45B 4Y4HC 3FFCE 4JFEE 1F6AB 5D7IA 2JK5A 3CMOH 3VXUE 3GRWH 4APQD 1RPQA 3PABB 4OB5H 2B4CL 2A6JB 1AD0B 4GUPA 1RZGA 3TT3L 1N3NB 1A6ZB 3VFWB 3G5XB 4PJBF 4PRHA 4LASH 2YXMA 5HGBA 4JZOA 5CJ8A 5FHBL 4D8PB 4ZQKA 4KK5C 3BD3A 2BFVL 2I9TA 2CRMA 4JDVB 4I77H 4PG2C 3VI4E 2BC4A 4U4BA 2X4PA 4MA1C 3OPZL 2PYEA 5DHVH 3BZDA 4HEME 2AEIT 1JNLH 1XGYL 3WFEL 4WVRA 3BEWA 3E2HB 3MV8E 2FL5B 2DIJA 1HWHB 4WDIA 4PJ9B 4NNXA 1QFWI 5C1MB 4LVNC 1K2DB 1K3ZA 2HRLA 1I8IA 1JK8B 4D9RD 1BVLA 4UDTB 1DANT 3GK8H 5A2LH 4ODUA 4XRCB 2XWJB 2FWOB 5IJVB 3V0WL 2GITB 1DE4A 1KT2B 3UTSE 5I1KH 1JGLL 4KUZL 5GRJH 3SO5A 5F72S 5I1AA 4EDXB 3FFCD 2ZSWB 4JFED 1FYTA 3D39A 4XXCC 2G5BA 4GW1A 3VXUD 3O8XD 1T20A 1AE6H 2O5XL 4AEHH 1H0DA 2VABB 4J23A 4G8GE 3OB0K 3TVMC 5EU3B 5IB1A 2D9CA 4PS4H 1HHJA 4LU5H 1KBGL 3VE0A 1H3WM 5EDXA 4RCAA 1TJIL 1NAMH 3RWHB 4NFCA 1CQKA 1Q1JH 3HB3D 4DEPC 5FEBA 3X12A 1RJYB 5E6ZA 2OSLB 3RKPA 2AEWA 2NR6D 2OR8A 1NBQA 1K3IA 3QNXB 2J5LC 3D0VB 1RK1A 1XF3A 1CXKA 1L9NA 3O0RH 4MQTB 2AK4E 1FFPA 3BUTA 4FQHB 4JY4B 5BRZA 5CZXC 1C7TA 4JQXA 4UOW1 3MV8D 5FDWA 2VE6A 4NFBA 3T1FB 3ARQA 4K9EC 1X5FA 2V5TA 5IBLD 3LY6A 2OTUA 1JHLH 1JGEA 2EXYD 4K3JH 3RUGA 4HUUB 3MRFA 4X6FB 5HHME 3SKNB 5F9WC 2WBJA 4KTEH 4PGDA 2AVGA 4AMKL 2BXYA 2FBOJ 2XZZA 2ATKA 1T7YA 4H88H 4OZFH 3UTSD 4OSUH 2DYPA 2VLLA 4M03A 5AAWA 4XWGH 2Z92A 3ISWA 4XVUC 3GB7A 4PB9H 5KS9A 4JFPA 3LVEA 4JFOA 1ZWIB 3DBXB 4UBDC 2JIXB 5JOFA 3MLTB 4TYUA 2J4WH 4G8GD 2VIRA 1QBLL 3C9NB 3QHFL 1RQ5A 4P2QE 5IVZB 4HS8L 3CDYA 3MYJA 3ZE2F 5JXEC 1QO3A 2AS5M 5IBTL 5EWIL 3W39B 3FT2A 1FZKA 5GGTH 3TV3H 3QFDB 3S37X 3GSXA 2NNAA 4GH7B 2OJEA 4N90E 5F7WC 4NWTL 1CD0A 4FNLL 2Z91A 3X3GH 3WIHL 2CIKA 5E1HB 2B1AH 1YDPB 4AK1A 2ZCLL 4MDJB 4YHLL 1I9IH 2AK4D 2EC8A 2UZYB 1IC5L 4MJ5B 5CJQH 1R5IA 2EECA 3IJHA 5TPWL 4PJFA 3NFNB 4WHTA 1X5XA 4PREB 1QHOA 1JP5A 3L3JB 4NSKA 4R0LB 2B1HH 4HZAA 5DJ8A 2J6EL 4RX4A 2P43B 3BKJL 3DX9B 4YE4H 4XP9H 4FQ2H 4RRPG 2AV7A 5HHMD 3RY6A 3O6LL 4KZDL 1XCQB 5IW1B 2XPGB 4RZCA 4LARL 2VYRE 4X83A 4OTXH 4LPXA 5DYOA 5T1KA 4QXWA 3NN8B 1ZLUH 2WWKT 1UYWH 4LP4A 1Q9KA 4PV9A 1PG7H 1GIGH 1IC1A 1ZOXA 5L2KB 2IGFH 1U8HB 2AK1L 3U79A 3V4UH 5D7SL 5E7FA 3I02A 2VB5A 5F6IC 1UB5A 3D25B 2CSPA 3MBEC 1K8IA 5ABDE 2UWEB 2ADIA 4FFZL 3C5ZB 4O02H 1A9BA 1XF1A 3UBXB 3GBML 4YEEA 1MJ7H 1CDBA 1ZT4A 2GKIA 4ODSH 4LVEA 2VLJB 4IRJA 4P2QD 1FV1A 1TJGH 3MCLH 3CXDH 5T1MB 2QV2A 1ZHBA 5J06A 2GY7B 1KN4L 4GRWE 3DMMA 2DKSA 3L3KB 2HA1A 4QHUB 4KGJA 1JV5A 1CGSH 1Z3GH 3S8WA 3LEXA 2C7UB 4N90D 5D7JD 5FKAA 4S1QL 3ELAT 1FN4A 4Q6YA 4XTRD 3N0PB 3MV9E 1U41A 1U2HA 1KIQB 1FNGB 4N8CL 3VXRA 4P23A 3WL9B 5AUMA 2DJSA 2XKSA 5EC1B 3WFCL 5INDB 5FXCH 1QPXA 2DLFH 3WMSA 2MPAH 3S6CA 2IBZY 4OQTL 4Y4KB 4DKEL 4MCYA 3EDDA 1ZT1A 1TJHH 2WNGA 1KCSL 3QUYD 4F8QA 1JK8A 4DVRH 2DJ4A 1F4HA 2NY2B 4LBEB 5D6CA 4Z0BH 1U58A 3ROLB 4XRCA 1I9JH 1YECH 3MTRA 2DIBA 3ZKQD 4DGYL 1MFNA 5BQ7B 5DA4A 1PKQE 3ZL4H 3VFVB 3O6FD 3QCTL 4TSAL 2VSCA 4DW2L 4TSBH 4EN3C 4EDXA 1I7ZB 1U3HB 4OZ4A 4NNYB 4OZHA 1TETH 1YY8A 4LLVB 3UYOD 3QI9D 3MV7E 4QRPB 5IEHB 4KRPC 4FQXD 4ZAKD 4U1JA 1UH2A 1OGAE 3OB8A 4HLZG 2ADJB 3CSYA 4P2CG 5KTEH 2IAMB 5B38G 5F88A 4EI5C 5F9JB 1SJVA 1JPST 3R0NA 2LE9A 1D6VL 3T09A 1MRCL 2DTMH 3JUYA 3UTTE 4XX1E 5ID1A 3FTGA 4HH9B 1CI5A 2WAHA 1O0VA 4S2SA 1NBVL 3OKNB 4FFVC 3TLRA 2YKLH 1ORQB 5D9SB 3JTTA 2XTJC 4Z7WF 3VXTB 2G5RA 4RAHA 4Y8DC 4JFQB 2P45B 1YEKH 1UB6A 3MV9D 2ZG2A 3O6MH 5FIEA 5JIKA 1FORH 1N6QL 1ZMYA 5F3BA 2EO1A 1S7RB 1FZMA 3HMWL 1TIUA 2R4RH 4OUUB 5JW5B 2ATPB 1PSKH 2VLKB 4MX7B 3VDBA 5E8OB 2VSDA 1QLRA 5JHLH 1MJUL 1HQRB 1S7QB 2F53A 3HAEH 1ZGLA 3LN5A 5JIPA 3RU8L 1FP5A 2NY1B 3KPQA 3ARGB 2GCYB 2ZG1A 5ESVA 4J3XA 3W0WA 3S5LG 1KELH 4I0PB 1NGZB 4TUOA 4NDMA 2QADB 2FO4B 1P2CB 4XBPA 5MEOA 4HJJL 4O5LL 5GISL 1YUHA 4JRWA 2CRIA 2PCPA 5GJTH 4GKZA 4Y2DB 2BNQE 4O00A 1KIPA 3KNBB 4NUJA 3WLBB 3MV7D 3V52H 2FO1A 2VAJA 3GBNH 5HGHB 5C0AB 3P73A 4Z6AT 4X7TA 4U1IB 5I1LA 2H32B 4M6OH 1XH3B 3F7YB 4Z0XA 1OGAD 1XGRB 1PD6A 4BZ2L 1CR9H 3IDMB 1I1AC 4MHHG 3VD4A 1U8PA 2HKFL 3QR2A 1OTSD 3UTTD 2VDPL 2NXYC 2DBJA 3HI1B 5HI3D 4YPJA 5ADOH 4WFGE 2C3VA 5EOTA 2QEJA 2VXTL 2MJWA 5CILH 2YBRA 4X99A 4C56E 2VRAA 2QJDA 4YXHL 4KZEL 5JR1H 3R1GH 1MFBL 4NJAL 2V2XB 5CEYA 5L9DL 4EIZC 1K8DA 1ZVYA 3PWLB 4MJ5A 2PUQT 4HJ0C 2EDHA 3VH8B 4DQOL 4F33A 2Y5TB 3KXFE 2GK0A 8CGTA 3H9SB 2FDBP 3FT3A 4Y5YA 1NMBL 5KANG 1MIMH 5KVGL 5CBAA 1HIML 4M9OA 4R4ND 4BH8A 2VDQL 1RUPL 1IC4L 1A1MA 1DL7H 2FJFB 5GRZA 2ENYA 4FXGB 2MQCA 3L3OB 5D1ZD 3BP4A 4ISVA 3BQUD 3V7MA 4GRLD 1N6UA 4R4FL 3LQZB 1BD2A 1F02I 2W59A 4P2OD 4LPWA 1AO7B 5IEKB 5H94B 3GSWA 1A6AA 3K3QA 4L9LA 4LF3B 4P5TD 3PNWB 4N0UA 3WFHB 2BNQD 4GG8A 1C1EL 4XAKD 1V7NL 1S9VA 3LSOA 5CFHA 3B9KB 4XCNA 5IBUB 4R8WH 4I2XE 5DJ2B 1KEML 2KBGA 3IDNB 1RJLB 2VXUL 3UBXA 3ZLQC 2BVOB 4F57L 2FATL 3WXVL 2MFNA 3HE6A 5D96C 1IEBA 2OL3B 4GLRI 3OX8A 2NPLX 4JGMA 5A3IC 4WFGD 2DDQH 3QEHB 5HJ3B 4IMKC 4JZJC 5FK9A 1JHKL 4S1SH 3FAXA 2VZOA 1ETZB 1ZS8B 4ODXA 4MS8C 1XEDA 3STLA 3L7EB 3KXFD 1XGUB 1RU9H 3JV6A 3GIZH 1TPXC 4KKCD 3WD5H 5MEPA 4ZUTB 4YEFA 3G5VA 4JQIL 4P5KA 4QXGL 3ULSA 3DXAE 5I30L 2H2PD 4ODTH 4H8WH 4KKAC 4PRIB 5SX5H 3MA7A 3TM6A 5C0EA 4EBQH 3NA9H 2AJSH 3MLYL 4ZD3L 3TBTA 1B4JH 1MI5B 4M93B 2WUBH 2A1WL 4KI5E 2LVCA 2WBWB 5B22A 3SDCC 2ZWLT 5TE7H 3QWQB 1UM6H 3QEGL 5ITBH 1VDGA 4JHBA 3DX7A 3Q2CA 1LEGB 4JY6B 4QHNA 2D31B 3QUKA 4UU9B 5IFHH 1IKFH 3UJIH 5L8LB 2QSCH 5EU7C 3VFTA 1W8NA 1NGWB 4MDIA 2G2RB 2GSIB 3C6LC 3O11A 1GGCH 4YHZL 3BN3B 2BVQA 4PJEB 2ZUVA 1NBZB 4U3CA 3ZKXB 1CDUA 1AHWB 2YZ8A 5EZJA 3MNZB 4L8SC 1SHMA 4LNRA 4MB5A 5IIEB 5HGDB 3T2PA 1FC2D 3D9AL 1P9MC 4CU6A 3JWOC 1R5WB 4GG6B 3VW3H 5I71C 4G7VL 1JN6B 1OCWH 3V8CA 1IILE 4OBRA 5SWSE 1DSFL 4GT7A 5FO7A 2A73A 4P46D 3L95A 2O93L 3MRNB 3PGFH 3SEPA 1OAKL 5DURB 1FL3B 3PQYE 3LKNB 2DQDH 2Y1VA 5F7EH 1LNUA 3DXAD 2GCYA 1WBXA 1KJVA 5I8EB 2XRAL 3IT8D 1P4LA 3OQ3B 1LK3H 3QEUB 3VFOB 2XQBH 2XTLA 3X11A 1W72A 3WKNA 1CICB 4KI5D 5HD8D 2NY6D 3G04A 2DB8A 4DKAA 4LFHD 2YA2A 2DBLL 1A4KA 4BQBA 4JFXB 3PHQB 1BZ9A 2D7TL 4OLWH 1A1NB 3O6KH 3LMJH 5DFVC 4JJ5A 5ENWA 5C08E 4LAQH 3GSNA 4HH8A 2N56A 1NUNB 4D94A 1U0QA 4LCUB 2JJWA 5C0FA 2EE6A 4NO5A 1LP9F 2R2EB 3MGOA 5LG1A 3M45A 1QPPA 1KC5L 3TT1H 5I1CL 3ARTA 5FM5O 4L8CA 1WAAA 2XN9B 5D5MB 4Y5VC 3PIQB 1YPZB 3QDHA 4NHCH 5DVMA 4YWGL 4BSWA 4ZMAT 1IKNA 1OD7A 4JFZL 4NIKB 2EXWD 1T2QH 3RAJL 1A9EA 4LLDA 1JCKA 1WIUA 2APWA 4HDIA 4P99A 5EO1B 2YD3A 3MRCB 5JDSB 4R7DA 3HMXA 1Z9LA 2F8XC 1NLBH 5HPMB 1FZJB 3KGRA 3VGDA 1WISA 3IU4H 4Y19B 2IPKA 5SWSD 1A6TB 4R9HA 4TTGA 2IALB 5DD0L 1VGEL 3KWWA 4HUXA 4LCWB 3PQYD 3BZ4B 3UC0L 1XF5B 4PLJD 4NM4L 4W6XB 1BBJB 2FX7H 4KRLB 4RBPH 4GAYA 5SWQA 5CP7A 1L7IH 1RZ7H 2A77H 3U4EB 1U91A 3RGVA 3U6RB 4HG4J 3RVUD 1EVUA 1AY1L 4XX1G 4KQ4L 5KVFL 3LIZH 1MELA 5DJYB 4ZS7H 3KPNA 5DK0B 5CWSA 2OM5A 3CFEA 4L29A 4FQ1H 4JM4L 4NT6B 6CGTA 4P5MA 4YFLF 4HIJA 4XH2A 5AWNH 2JTDA 3E8UH 3V5KA 2F19H 4UZGA 5C08D 4X6BA 2J8UE 1KJ2A 4JR9H 3TA3A 4CN1A 2IFFH 4HZLB 2NXZC 2FIRT 2UYLB 3RWIA 1ZSDB 1DP0A 5DHXB 3S97C 5L7XL 3MJ6A 2P5WD 3QEHA 3U36A 5FYLD 5D70H 4Q2ZB 3DSNA 2DOCA 1KPVA 1VADA 43CAA 3SDDA 1AXIB 1BAFL 2VDLH 3OKDB 2QKIA 3CVIL 4X6DB 1Y0LB 2HKHH 1J1OL 4QHLA 5C0JB 1JIBA 1QP1A 5H35A 1XGUA 2DQCH 4PGBB 3SKMB 5BV7H 3REVA 4HKBA 2R0ZH 1B0GB 3U0PA 1IGCL 5DMGC 1ZA6B 3IDGB 4MAUL 2CLZA 1MFEL 3LN9A 4N0CD 4Q7DA 4PRIA 4YHYC 1IGFL 4UQ2B 1TZGL 1T1YA 2J8UF 1FPTH 2NY4B 3V4VH 4MB3A 2Y6SC 4WI5A 4BFBD 4BM7A 4KMTH 3KYMA 1QFWL 3DRQA 1CE1L 3QUXB 1EEZB 1K5NB 2HLFD 4PJDB 3B2VL 1VSCA 3FJTA 4HLZH 4A6YL 2X4OA 3G6DL 5D72H 3LV3A 2R0LH 2KH2B 2ZPKL 4XP4L 3MGAA 3D6GA 4HQQL 2EE9A 4D9LL 3HUJE 3T3PE 2DM3A 1ORSB 4PGCA 1MWAL 2R2HA 3RDTC 2X5PA 2BVEA 3QT2A 4KK6D 1MCNA 2HT2D 4JKKA 4PJ7B 3IDXL 1IVLA 4PY7A 3O81A 2IH3A 1QBML 3MNZA 4HIXH 1MLBA 3FQWA 3NIGE 4LLQB 4ORZC 3U9PH 5EC2A 4UQ3B 5CGYC 2C1OA 1X6NA 3BRFA 2AJYL 5FGBA 3BE1L 4PTTA 3CDGB 1CZ8L 4YZFE 3IGAB 2FD6L 3I75A 5JQ6H 1WT5C 3MRLB 4G6KL 2EH7L 1Q94B 5IFJA 1S9XB 3L5XL 2E9WA 5I8OH 1ONQA 4KGLA 4PJXB 5F89B 1OP5H 2CXKA 3GSRB 5AAMA 3PL6D 4GXUM 3VFOA 4HXBH 5JW4M 1FG2B 2W0FB 1BOGA 3PP3H 5CHNB 2W65A 3HUJF 3T3PF 1I1CA 5ALCH 1CICA 5C07A 3ARUA 5C0CB 3QULA 1YEDA 1W0VA 4HKZA 4JY5L 2BDNH 4OFIA 3QIUB 3IRZA 1MCQA 4MA7H 3WNLA 1D5BA 5DR5H 5HGAA 3MV11 5IESH 3H9HA 4LRIA 1CL7H 4QWWC 4U49A 4ZSOB 1ED3A 3LHPL 4LVOC 3RNQB 4HV8A 1OQOA 2L4OA 3HE7C 3TJHD 3UJTL 4UDUA 4Z5RB 1NCTA 4X6EB 4WWKB 4YZFF 4CUCA 2APVA 4L4VE 4OV5B 2VTFA 3L5IA 4RMUA 4GBXA 5KSVB 3V5HA 5DVNA 4NWUH 1NEZG 2I9LB 2VDRH 1JTPA 3FRUB 4CMMA 4NC0B 3OR6A 2YPLB 1G7PB 1GZQB 1QYGL 4M6NL 5I18L 5JLZB 1Q72L 3G5ZA 2L0DA 4M3KB 1EHAA 5GZNC 2IALA 4LFHG 5KSBA 3GSOA 3TIEA 5K9QI 1VGKA 5J7CC 5DMIH 2XFXA 1Z9OA 4JB9L 5HDQH 1FIGL 4G6ML 5IROA 3KPRB 5DZNA 3O9WD 3F6IA 1DDHB 4PY8I 5EBMA 1A7OH 1GHFH 2DMBA 2A2QT 2ZUSA 3PF2A 4JAMB 5E6IB 2FHBA 4K7PX 3RIAF 2A38A 2HG5A 3QWRA 2PETA 3MRKA 3R8BB 3MRPB 4D0DB 1V7ML 2YZ1A 5HDLA 1UACH 2A9NH 3GM0A 2F54B 1QSEA 3SGEI 2OZ4A 4PJGB 1E4WL 1HOCB 1CFTB 3IFNL 4JO2H 5EU6E 3VWJA 5KJRH 1QSFB 2UZXB 2V2TA 3N9GH 1U3JA 3U7YH 4Y4HD 1KJMB 1EVTC 3K80A 4OGZA 5D1QB 4HMDA 1M1SA 1GZPB 3DUHA 2X09A 4POYA 4TN9A 4X7EC 2NY5L 4QRTA 2B4CH 3EFDL 4L4VD 3B6SA 4PJ5B 3TT3H 3X13B 4M5YL 1L0XA 3Q1SL 3O3DA 1S78D 2ESVB 3OF6A 3NH7L 2WK2A 5HHXL 4JQVA 1AQDA 3GM8A 3S3SA 4DZBA 4EXPX 4PRDA 2WP3T 2BFVH 3RKDC 2C1PB 1OSZA 2PN5A 3FO9A 4G8IA 3F58L 1T7ZA 4NN5B 4YFEA 3F7VB 1ZA6A 4OZIB 2Q3AA 3EIFA 3MUGB 1IGIL 3PP4L 1XGYH 5D7LE 3WFEH 4EI6A 4NO0A 5MP6H 5A16B 2WBKA 3WEXB 2FYYB 3QZWB 4WU5A 2X1OA 1Z2KA 3B5HA 4KJPC 1AKJB 2GUOA 2P5EB 5DC0A 3LEVL 4C54A 1P69B 3WLWC 5C09A 5JORB 2GT9A 4M7LH 3G6JA 3QIWB 1K5NA 3BHBB 1SY6A 3S4SA 4ETQB 1F3JA 1A1OB 3L3DB 3L3GB 4CNIB 3V0WH 2VL5B 2FIKA 5EU6D 1R3HB 1ACYH 5C8JB 4N1CA 1JGLH 4JVUA 4KUZH 3VI3E 1AGDB 1KTDB 4Z78A 5I1IL 5DRZA 5HVFB 4ERSL 3N1GC 5HGGS 1FL6B 1J1PH 4MYWB 2O5XH 3CD4A 4R97B 3VXMB 1PLGH 1CD1A 4HGWA 1RZ8B 3VGHA 1UH3A 3AROA 2EDOA 5DLML 3ECBB 4L8BB 1AGCA 1UWEL 3VG9C 5IWLA 1G7MA 1Z5LB 5GS1A 1H3UA 5JUEL 4LLQA 4LLUB 5CP3H 1KJ3H 1NC2B 3LKOA 4F7PB 1KBGH 1N64L 4PJHA 2ED8A 2EDFA 2QR0B 1TJIH 2CLRA 2D2OA 3PJSA 5HVGB 2IQAA 3TO2A 1ZHKB 3BJ91 1U8JB 4RAUB 4ZXBA 1BX2A 4WO4A 5DD3L 5FM4A 5GRVK 4HWBA 3MLVH 3VXSA 4MQSB 5ANMB 1KB5B 5D71H 2VITB 1MUJB 3KPMA 1MCBA 5IR1A 1IM3B 3V5DA 4TUJB 5D7LD 4X4YA 2GY5A 3HLAA 5CZXD 3QG7L 4RISL 2IQ9H 3QQ3A 4NPYA 4QRUB 1S7VB 3A67L 4GAFB 4J3UA 1OPGL 3VI3F 4FRWA 1HCVA 4HWNA 1OARL 4R4BB 4G8FB 3P40A 3B8YA 4KROC 1MH5B 5HHOE 3FOLA 1NDGB 4P3DB 5IKCA 3CFCL 4JQXC 3LN4A 1Q0XL 3AU1B 3ZSSA 5DI8A 4AMKH 3WJJC 1NL0H 4RGMB 1JWUB 2XWBB 4F9LA 3RY4A 4WEBH 5ADPL 5HY9B 1FH5L 2X10A 1A2YB 4XP5H 2WBJC 4XVUD 1CLYL 2ZZUT 5KSVA 1EO7A 2GFBA 1IAOA 5B39B 3SDXB 1KEGL 4PJIE 1S7TA 3MXWL 4NO3B 4PJ9D 5DJ6B 3MRMA 4P4RA 1I3UA 3QHFH 1D9KA 4WI2A 4HJGA 3RWJA 2R1YA 3EYUH 1RJZB 5IBTH 5EWIH 5TH2A 1IE5A 4HIHA 1YMMB 3DX6B 1ZLWH 1QVOB 1HKLL 2R2BA 3JWDC 4NWTH 4FNLH 3CVHB 3U2SB 2W60A 3P11L 1EXUB 3ZKSD 4P0DA 3P30L 2ZCLH 4YHLH 1OT2A 2IWGA 4X4ZA 2NY3C 3E6HA 3GRWA 5DRWA 3CPLB 3OL2A 3OKYA 3E6FB 2V5MA 1OAZH 3GMPA 3EGSB 4EZMA 1EMTL 1A6UL 1T83A 4Y4FB 2J6EH 5HHOD 4G3YL 2WM0A 1JE6A 2ZJSL 4MJIE 3QDME 3O6LH 4KZDH 3VRIA 1BWMA 3SO3C 4V1DA 3VMNA 1EGJH 1HHGA 1KJMA 1DBML 2Z93B 5DTFB 1EK3A 4OF5A 5GZOC 3VFSB 2Y9RT 1JPGB 2MCPL 5T3XL 4G6JL 2VLRA 1JPFA 3W9EA 3LPWA 2MNUA 3IS1X 3MCKA 2ARWA 5CJXC 5D7SH 5DHVA 2C3XA 1P4BL 4JPWL 4H25A 2PF6A 1H3VA 4FFZH 2D3VA 3GBMH 3MA9L 2VXQH 1FNEA 3VD5A 4XC3H 2VERN 2FSEA 2AABL 3O3BA 1FFQA 4M1GL 4H26B 4Q6IB 2DQGL 5E2JA 3A0OA 1KN4H 1EEYA 4OIBA 5DEGA 4M3JA 4LNVA 2XTJE 3OBAA 1V05A 1CIDA 4MJ6B 5ICXB 5K93A 1X4XA 4IRJC 1D5IL 4HS6A 1KCUL 1UXSB 1EIBA 3QEQA 2R1WA 1EHLL 4MNGA 3LH2H 3DMMC 1CWVA 4U05A 2QLVB 2ITDA 2V17H 5F3HA 1MQ8A 4I3GA 4OCYL 5C3TA 3WFCH 2L7UA 4IJ3C 2JIXD 4DKEH 1MCPL 2HAZA 1NGYB 2EYTA 4P23C 3EYFA 4RIRB 2DQUL 4FTVA 1KCSH 1WBZA 2VLJE 5C0GA 3MR9B 3BHBA 4H1LB 5HHNA 3ZT7A 3QO1A 3TBVA 4NRYB 3SOBL 4PIRF 1P7KB 4MJID 2OJZL 3L3GA 3QDMD 4LLWB 4RFNB 5FB8B 2E7CA 3WUWB 2YD1A 4OGYL 2ZOLA 4DGYH 2CMRH 3RIFK 3CUPB 3O2WL 3OKOA 1T0NA 2V5RA 4EN3D 3QCTH 4TSAH 1NH6A 3MRDB 1NAMA 1RUML 3QCVL 1U2CA 5M7QA 2PTUA 1FZOB 1CFQA 3GJFB 1NCBL 2FEDC 4EIGB 2R0WL 4XVJL 4MVBC 1MLCA 5IG7B 1T21B 2ZUWA 3IU3B 5A43C 4KJQC 4LLUA 2HVJA 4EI5D 5MERA 3IDIA 5ICZB 1D6VH 2F8VA 2UWEF 1NCNA 4AG4H 1T0MB 4Y88A 4OZGB 4X9FA 4FFVD 3TBSB 5FYKL 2RCSH 2XTJD 4Z76A 5CD5C 4KK9C 1S7UA 1A6VL 1UADC 4QOKA 4WUUB 3ESUF 2AXFA 3B5TA 1OLZA 3DROB 1A7BA 1GC1C 1YEJL 1LD9A 5F1SA 5K9OA 1N6QH 4U1LB 4LLAA 4XPFH 3HMWH 3MRRA 4KK8C 3OB0H 3MOAL 4CMHB 3OJMB 1YNTA 2PYFB 3WS3A 5ID0B 1MJUH 4XCYA 2I07B 3RU8H 4NBZB 3LRHA 1CFSB 4MCZB 2VLJD 4MLSA 4ALAL 4DGIL 3ULVC 3DRTB 4YHML 2R15A 4BFEA 3UTZA 3T8XB 2AXJA 1GGTA 5FO9B 1YN7B 1CXIA 1LO0L 4YBLC 3AS1A 5E1AA 4QHKJ 1AFVL 4HJJH 4O5LH 3C6SB 4Z8FL 4AZ8A 1JJUA 1NDMB 3TIDA 1LO3H 2X4TA 1ZT7A 3PWNA 5DEFB 3WSQH 1RUQL 1LO4H 2OL3L 4NRXB 4AM0A 3K8MA 4NOFA 1GXEA 3Q5TA 2VLKE 4U1MB 5C2BL 3WDIA 32C2B 4ZFOA 1CK0L 1KTLB 5E5UB 2DL2A 5EUOA 1G0YR 4XBEL 1I1AD 2X4QB 5KAQF 5E5MB 3D2UD 3RWDB 4NZUL 2NXYD 1BQHA 2VO5A 2HKFH 4EUPB 1KXTB 1SYVB 2VDPH 5EU5B 5A2FA 1QVOA 1FC1A 2VXTH 4YHPA 1TZHB 2Y7QB 3IFPA 1Z0NA 3I85A 4YXHH 1FCCA 2H26A 1ACZA 2CIIA 3E3QE 1TDQA 1U3HD 1IEHA 4NJAH 4GOSA 2X89D 4ZFFA 4HJ0D 3SJVB 1J9CT 3I6GA 2ORBL 2YWYA 1NMBH 3OKMA 2X4RB 2BNRE 1DTUA 5KVGH 1HIMH 3ZTJH 1V3KA 2PXYB 2CXGA 2IAMD 1I7RB 4OLEA 5GRUH 3IAQA 5IV2A 4Y5YC 1N8ZB 4NQSA 2BVYA 4R4FH 2HJFB 2YN5A 4HW6A 2RFXA 4GAGL 3C5JB 5FV2A 4DN4L 3AXLB 2EIEA 1D5ZA 4N5EC 3HZKB 1CXHA 1IGJA 1WITA 1C1EH 2HRPL 1V7NH 2I5YL 4E0RA 4NQXA 4U1SB 3M17A 4YAQA 3CFBA 4ODVL 3KLSA 3SDAB 3DO7B 1TCMA 5EIIA 5EU7E 2VXUH 1LHZA 2VLKD 4L9LC 4F57H 1T5WA 2FATH 4IS6A 5J4MA 2VXSL 2XXMB 3WXVH 3LRSA 3CFKA 5JDJA 4XNZC 1W8OA 3QFJA 1L6XA 1SJEA 2IANE 4WI6A 1QOKA 1KLGA 3MRIB 5DWUL 4K94L 2HT4C 5B8CB 4H5SA 2CUMA 3HTLX 3MUHL 4I4WB 3ARGD 1HHHA 4ZFZB 4J1UB 5A3ID 3LKSB 5L6YL 3UZEA 1IGML 4I0PD 4LCYA 3HE6C 1INQB 4R2GC 4C83A 4HG4K 1B6UA 5JW3L 1JHKH 4JFDB 5F93C 2CR6A 4JFFB 4N1HB 1T22B 1HCFX 4MS8D 1GAFL 5IMLB 5C0BE 3U7WH 4RDQF 3KPLA 4IM8A 4P4KA 4KFZC 3BH9A 1S5IL 1CVRA 3K2UL 3SPVA 2UY7A 2Z8RA 3DI2B 4QTHA 3ARDA 1QG3A 2BNRD 4ZYKB 3BGFB 4QXGH 1HH6A 3B2UD 3CSBA 3L7FB 3QUML 2PW1B 3ORJA 1QR4A 4H1LA 4KKAD 4ZUUB 4NQDE 4QRRA 3FRPG 4D9QE 4U1HB 3RP1A 3MLYH 1CGVA 5DUBA 4F7MB 3VD7A 5FM8A 3QWOB 1NJ9A 1L4IA 4J3OC 3P4LA 2A1WH 4WHYG 1N26A 5I1EL 3S88H 4N1EA 1WIOA 3EHBC 4BFGA 4W68A 1XZ0B 2CPCA 1EZVY 3B9AA 4WW2A 1BIHA 3PWJA 3REWB 5IB3B 3M1BA 4DN3H 1NFIB 1M71A 3LKPA 5IVXE 3C6LD 2BHZA 4NP4L 1WICA 1UJ3A 4NKIL 2IAND 4HPYH 4JN2B 4P3WA 4YHZH 1N5AA 1JMXA 5HYQA 3LZFL 1UXWA 1JRHI 4WI8A 2PO6A 3CX2A 3LQAC 5DD6A 3RRQA 1X6LA 4NC1C 5J11C 4MD0B 3MMEA 1SYSA 1RVFH 3MOBL 3SGJA 1JI2A 1R5VA 3D9AH 5DJZB 1HI6A 5C0BD 3OG6B 2AJUL 4G7VH 3B9KD 4KQ3L 4WW1A 4TSCL 3MX0A 1DSFH 5HTSA 1BF2A 3C2AL 1R3LA 4PJAA 3ZYJA 3RX7A 2C9AA 4OD1L 1OAKH 4Y5XB 3NACH 1UVQB 1IAKB 3KAAA 1MHPL 4MA3A 4NQDD 4FZEL 2XRAH 3MXVL 5D7KE 4D9QD 5IVXF 4HFWA 1HQ4B 1IRAY 4W4NA 1Q9OB 2DIAA 4GQ9L 1XF4A 3KPSB 4UV4L 5LWYH 4O2CB 4Z7OE 3TO4A 3IAPA 4HUWA 3HNTL 4HULB 3C8KA 3TC9A 2DBLH 3FB5A 4ETYA 1RHFA 1M7IB 3ZDZE 1QRNE 2D7TH 5DFVD 3UPAA 4CADB 4KDWA 5GGSY 1I1YA 3T65B 1TVHA 5GJSL 4ELME 4G6FB 5FKPB 3ULUC 5ACMA 1BEYL 1LEIA 4J4PA 5E5MA 1KC5H 5I1CH 4FFYL 4N9GB 4HK0A 3MRBA 1BZ7B 4TRPL 5CZVL 4YWGH 2H8PA 2F74B 5KW9H 4JFZH 3A6BH 3RAJH 1MPAL 4M1CC 4KC3B 2QHRL 4L1DA 1AIFB 2VMFA 4WEMB 4PJEF 1JZ8A 1DN0B 1IKNC 1WCQA 3RZCB 1HHKB 1AXSA 5MENA 5JW4Q 4HAGA 4FN0A 5DUML 3C5SB 3OZ9L 1VGEH 3NIDF 3PXJA 1X5KA 2OI9C 2K3TA 3RI5F 4HIIA 2WINB 3UC0H 4GG6F 5I76B 3ZDZF 1NFDE 3HRZB 4NM4H 4OCSL 3QUZA 3SY0B 2GQHA 5D7KD 4GXVH 4X4XA 4X98B 3AREB 4P2RA 3D69B 1H3PL 4OFYD 4M1DH 1H15B 4ZPTA 4YNYA 5F70A 5J3HC 4OLXL 2FZ3B 1AY1H 4KQ4H 1JFQL 5KVFH 4KKBC 5FYJH 3FHQA 2BCKA 4L4TE 4YDLB 1QFWM 2XWTB 4JM4H 3P4MB 2VR4A 3TNNB 3RGVC 3EO1B 1QRND 2IPUG 4HWZA 3WNPA 5E9DE 4APQB 1OGTA 3C60A 1CG9A 2VAAB 5DURD 3O3EA 2NXZD 1MHHA 1NCUA 1U8OA 1TCRA 4K23L 5FHAL 1F4XH 3DX8B 2Q1EA 5L7XH 3CXHK 3QXAA 3PWUB 4HIEB 3DARA 3N1QC 3TA3C 5JPMB 2YD2A 1N4XL 5TDPA 1JL8A 1NFDF 2YSSB 1BAFH 2VDNL 3KJ6L 2JCCB 2E3VA 1XIWA 3CVIH 1UJTA 3HPLB 1AP2A 1YPZF 1Z9MA 3O3AB 1ES0A 4W6YB 4U6TA 3BW9B 1BQLL 3SDDC 5EB9A 1IQDA 5DMGD 3NIFE 3BXNB 2NW2A 3BVNB 3BP7A 4TVPE 2ICWA 2IMNA 4MAUH 1H5BB 3VXOA 2XNAB 4QTIL 2O61B 4ZUUA 2CUIA 3NZ8B 4AENB 4TQEL 3GIVA 1IGFH 3NABL 1TZGH 4PV8B 3N85L 5ITFB 4K8RC 2P24A 3VCLB 3HN3A 2VZ3A 3DUUB 2CUHA 4OCRL 2Y6SD 3BPCB 1RZKL 2OQJA 3JTSA 3DGCR 4NYLA 2I60L 4M7LT 1CE1H 4QY8A 3OV6A 1BP3B 1VFOA 3ARBA 4L4TD 3B2VH 1T1XB 4G80A 5DMKA 2AQ3A 3G6DH 3VA2C 5DSCA 2ZPKH 3CH1B 3K74B 2NYYC 4V2BA 4WNQB 4XP4H 5E9DD 4PJCA 3VXUB 4XPTL 4HQQH 3RL2A 4D9LH 2CQVA 4XT1C 2E6JA 1FRGL 5TDNB 4HT1L 1MWAH 4OGXL 3JWDH 4Z77A 4X6CB 3RWEA 4JCMA 3S5LB 3NIFF 5J1SC 3IDXH 1X4YA 3IFOA 1YEHL 4WGWB 1RFDH 4LCCB 4XCEA 3QO0A 1J86A 1NMCC 4JANB 3GMLB 4RDQG 2AJYH 4QF1B 4FABL 1J8HB 3T2OA 5GS0C 3PWPA 1CZ8H 1MJJA 1F11A 3MNWA 2WLYA 4G6KH 2EH7H 2VOTA 4LCIL 3O4LA 5FGBC 1JPTL 4X6DF 3BOVA 4TVPD 1IAIM 1CT8A 2HTLC 3MV8B 2NZIA 3V6OC 1KNOA 4MAYA 3IRPX 4MMZC 1F2QA 4I9WE 4K07A 4NKOA 1VKXA 4PGEB 3NCBB 2MOVA 5K9JL 2OK0L 4NQEE 2FJHA 4JO4L 4JY5H 1XGQA 4M7KH 1OQXA 1A64A 3QDJE 1SEBA 5E2UL 1XFPA 5I73B 3UTSB 1S9WA 3FN3A 2YUZA 1JUFB 5C0DA 4QWWD 5CSZB 1NSNL 5BO1L 3HE7D 5HSFA 3LHPH 5INCB 5IBUG 2EKJA 3UJTH 3BIAX 1MFAL 3OKLB 3RNKB 3QDGA 5C6WH 5J9PA 4G5ZL 4NHUB 4LRIC 4RFOH 5J57B 2GJJA 3QISA 4ELKA 1ZANL 3CAFA 2J8OA 3UTOA 5C86A 4D2NA 2EYRA 4QCIB 4LHQB 1S9YA 2R39A 3RL1B 1QYGH 4M6NH 4GBXC 1XMWA 1YQVL 4DZ8A 2W1NA 4PJ7F 3IVKA 3OJDA 3MLWL 3O4OB 1VFBA 5GZND 3V95A 3ARWA 4F3FB 5F6HJ 1P6AB 5GGUB 5TE4H 3K7UA 4ZSOE 5LGHL 1DQJA 2G75B 4JG1L 2AK4B 4IIQA 5TGBA 2PW2B 4JB9H 1FIGH 4G6MH 4I3SL 5TF0A 3LKQB 2PYEE 3L1OL 1LDPL 2A74A 3NAAL 3BIBX 4I5BA 4CKVX 1S7WA 4F15B 1MHCB 1SM3L 3FCTB 1HSBB 3PGDB 4I9WD 1OVZA 4B53A 4PJXF 1CBVL 5IROC 3AMLA 4P9HL 1WCBB 1AR2A 4MQXC 5IGXH 2BVUA 3F5WB 2KUTA 3AS0A 1TNMA 4NQED 2YPLE 1V7MH 1F5WA 1WFNA 3IDUA 1L0YA 4OKVA 3QDJD 1E4WH 1KG0A 1NUFA 3BUYA 1CN4A 5FECB 1Q0YH 4ZTOH 4IRZL 5C0IA 3QQ4A 3WIFB 1CLZL 2DQEH 4ZO6A 1AC0A 3GSVB 2EIZB 3HI5L 2IMMA 2NY5H 1MQKH 3KPRE 4LMQE 2A83A 4XVSL 3VWJC 1MOEA 3DX8A 3BEVB 4RMTA 4HFUL 1KLUB 1LILA 2YEZB 3V0VB 3WO4B 3Q1SH 4P2QB 3PDOA 2FHFA 3KHOA 5BOZG 2IF7A 2H2SC 4I18B 3NH7H 3MGTA 3TPUB 4Q0XH 5HHQA 4WI9A 1KB5L 5E8DL 4MHHI 3RKDD 4K2UL 3HR5A 5D7JB 4PJGE 4MA8H 1TQBB 3WDJA 3F58H 1QSFE 4J3WA 5I73C 4PJBA 2AKRA 3QYCA 2XNAA 15C8L 4JQVC 3PP4H 5B38A 4ODWB 3CLEH 2ADGB 4XNMA 4FQIL 4WWKD 1LO2L 4WI3A 2QTEA 2PYED 4KJPD 3MUZ1 3L3HB 3QUYB 2X4NA 4XAWL 4YDKL 3WLWD 1J88A 3GKWH 2IH1B 4GS7B 2EYSA 3SE9L 2A9MH 2ESVE 4KVCL 3PDGA 3ES6B 3UPRA 2X4UB 1UZ6E 2YPLD 4MD4B 1P7QB 1R3JA 4IBLT 5KG9A 1LE5A 3O6FB 5MI0B 5J12B 2M2DA 4I8DA 3FFCA 4JFEA 4WEUD 3O4OC 1BFSA 3O8XA 4UT6L 5I1IH 3QI9B 1G7LB 3GDBA 5GQBA 4ERSH 5DGRA 3BP5B 2DL9A 4PJGF 1IBGL 2VISA 3OGCB 1GRWA 2ICES 3KPRD 5CKAA 3GEWB 3Q48A 4U3HA 2PNDA 3K4AA 1S7XA 2P48B 3GMMB 5DLMH 3FL7A 3SKOB 1FBIL 2SEBA 5T3ZL <