2CNZA

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (v13a mutant)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
b'DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
total genus 23
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cnzA00
2CO7A 4PHXA 2CO4A 2CNZA 2IXQA 2CO6A 2CNYA 2FVNA 2AXWA 3UIZA 4OR1A 5D55A 3UIYA 2CO3A 2CO2A 2CO1A
chains in the Genus database with same CATH superfamily
4AKQA 3IJEA 1NBVH 2GVYA 1TJIL 4W9JC 2XN9E 3HRZC 4WSJA 4ADGA 2EXYC 1UD5A 1RZ8B 1S5HB 2P44B 3BPCA 1A7NH 3U6XS 4DKEH 3DK2A 1JDAA 3FQ2A 1I9IH 4C83A 3PV7A 4J4PA 4JN1L 2DKMA 1A7OL 4QGTA 5HHVH 5BQ7A 4YL4A 2BVEA 3NN8A 5I9QB 1AY1H 3UJTL 3OAUL 2RB8A 1J0ZA 3ZL4H 4WIQA 4UINH 5J9PA 3QJZA 2F53E 1XH2A 2QPSA 1A5FH 5D70H 3M1CA 5B1CA 3CZKA 5C0DB 1TFHA 2A6KB 2EYTB 2QT6A 3PDOB 5EPMA 3QNXA 1PY0A 3IRCA 1ZE3C 5GRJH 2PO6A 4P59L 5JW4Q 4GUPA 3C08L 1AKJA 3SZ6A 2A9NL 4IS6A 4HGMA 4A66A 3F83A 2F5BL 2K70A 3PS6A 2ZUUA 3V4PL 4CDHA 3BAIA 3FJTA 1QX1A 4M3KB 3ZDYB 4F7CB 1VKXB 2OMWB 1SVCP 5F6IB 2YGQA 3T6XA 3RY6C 4EQ3A 4KK6C 4QUOA 5IK3B 5LGJA 1P5VB 4XB7A 3CZFA 3VVWA 2EO7A 1OTTC 4LOFA 1RJZA 4N2KA 3WU1A 5FPIA 3L3GA 3V5HB 4JFSA 1MF2L 1RPUA 5HJ3A 4L4TB 1UH3A 3VDBA 1XF2A 4ABUA 5FA3B 4N90D 3ZKXC 4MAZA 3ARQA 3VXNB 1R1CA 4JB9H 4JQIL 5D2NA 2QLVB 3L08A 3WN5C 3ZTNH 2XWTA 1RHHB 4B9GA 4PJ8D 1LM8V 1XGUA 4IRJB 2BSEA 3GMPB 5FGRA 4J7RA 4Y2OB 2HVKA 4XBEL 1RURL 2PPCA 4YC2C 4AEIL 4HT1L 4KI1A 2SEBB 2FT8A 3LQZA 4LNRB 4Z7QF 4DTGH 4APQC 1YEEH 2Z7ZA 4H88H 5KYXA 3CDYA 3QCTL 2V5SA 1INDH 3JWDH 1IEHA 2VABB 5DJXB 5AB2A 4MLSA 3TWCL 2HMID 4KVNL 5I26A 3T0VA 4PGZA 2YGOA 4RAUB 2D2CC 4FTVB 3TH2T 1T04A 3E2HC 4PG2C 4GP5B 4HV8B 4UM9A 3K71A 4J3OF 3AM8A 4OGXL 1BG1A 3BOVA 4C54A 3UC2A 1FNEB 5FO7B 3FT2B 2NX5A 5AOLA 3L4TA 2B7DT 4IBQA 3UACA 1Q9OA 5D5MA 1ZTMA 2GBTA 1QW9A 5I17A 2VDQL 4AYSA 4HOZA 3T6QC 4UAOB 3U4KA 4MD4A 4ZMPA 4Y19B 4E41A 5HHQB 4YIQA 4S1DD 3VXRE 3C60D 3U1QA 4X6EB 2OW7A 5BW7C 3QJHB 3UGEA 2Z8WC 3BDXA 3OTTA 4QHUA 4GKLA 5AW7B 5C07E 5EEWA 2MCG1 5HI5C 1F5WA 4M7JH 4MXQC 3L3OA 3CFQA 4ZMTA 1K8IA 1U95B 1R0AL 3O9WC 4W68A 1LK2A 4HS8L 5EOQL 2X1OA 1LO3H 2UX6A 5D7EA 4WI5A 3VUAA 4L0YA 1PEZA 2ZCKH 3HS0B 3CE1A 1U8LA 4RIRB 3K6SB 1WP6A 2H9GA 1DQVA 1XSIA 3NFPB 3F58L 1X5FA 4LDEB 4M9PA 2AV1B 3AMKA 3MRRB 1TYEB 1KB3A 1S7SB 5K9OA 1GGIL 4XVSH 2XIIA 5BS0B 3V9EA 3WDHA 5JMRA 3OJVC 3PNWA 1XIWA 3GMMB 3KPMB 5E5MA 2HT2C 4RISL 2X4TB 3LZFL 2EDMA 4HIXL 3EGXB 1NCCL 4DGVH 4FQQB 4M1DL 2MKLC 1WTGT 4KXZH 3BD3A 3MLPA 4GUQA 2EYSB 5TE7L 4IOFC 3LY6A 4GXUM 3L48A 4PRHB 3WNKA 2WQXA 1FFRA 3IFPB 5IUSA 5GS3A 1EEYB 1F86A 5FCUL 1JFQH 1OK8A 1P4UA 1EFXA 1UM6L 4X6FA 1O6TA 5JPMB 1N5AB 1XBRA 2K1MA 1DQTA 4R4FH 5BVJB 3HN5A 2CA4A 5IHZA 1BAFH 4GG6A 1SJEB 3AG4B 2F08A 2F54E 2NY1B 4TPRL 5D71H 5DZ9A 4MKTA 3VFMB 4XCNB 4HKBB 2BP0B 3C8HA 1D7BA 4QXGH 4G7YH 2DYSB 5FOBB 5F2FA 5CN2A 2GB2A 1SJMA 3HE7C 1I4FA 5AVRB 1QATA 1R3JB 3KLDA 3G5VA 5AZUA 3G9AB 5ECGA 5K1NA 3SDYH 5K39B 1HH6B 3DX9A 4AVJA 3HZYA 4RGOH 3US0A 3CZGA 5C0GB 1SF3A 4MCYA 1OPGH 2XTJE 4FI6A 3VX1A 3MCKB 4M7LH 2AJXL 4I77L 1R17A 4RNRB 4RWYH 3SE3C 3L5JA 3C8KB 3MV7B 1HHJB 5CJBA 3K5SA 1TQBB 2AXFB 3SPHA 2A77H 2Y07L 4LSPH 3EJZC 3IDNA 2YD6A 3PPSA 4P2OA 4QEGA 1CLZH 4G6ML 2FHBA 4YBLC 1MDAA 4RX4D 4XP6L 3LXCA 4CC4A 2PYEE 4WGKA 4KKCC 3S3SA 3G5ZB 1INQB 1AO7B 4FFYL 1YMHB 1IFHL 4UTBA 3K91A 2X4SB 5IVXF 4DVRH 4KKBD 3HLAA 4P5TC 3KJ4C 1RK0B 4ZW7A 3QAQA 4KJQD 1FFOB 1YEFH 1HTYA 3K1KC 3NJNA 4O2CA 1TZGL 5DHVB 2H0PA 2IBZX 4PRPD 3V6OA 1IGFH 2ICEB 3DBSA 4HFUL 4F58L 4PJGE 4QJ3B 4L5FH 5DYOB 5EO0A 2YEZB 4PRID 1GGBH 1KTBA 3TV3H 3DX6A 2ORBH 4UTCA 2H7WA 5HVFB 4DKAA 1G7MB 1S78D 4RMBA 4P3WA 2DAVA 3I6LE 4IGBB 3EYOB 1J5OL 4QHNA 1L7IH 5FLUA 1JE6A 4HUWA 4PCKA 5CLTA 5T1KB 4F7PB 1K4CB 3UTZB 1PTZA 1C08B 3GBEA 3AVEA 3OLEA 3RA7L 2UZYA 4XCCH 5FYLE 2EYRA 3W39B 1ZA6B 2CCLA 1J88A 5FECA 1OGPA 4OKVA 4J3OC 2BNRE 3LAFA 3IJ8A 5CU9A 1AD0B 2XZCL 3V5DB 3X1NA 3ZE2F 1H5BC 4XNBA 3F7LA 3QUXB 3QEQE 1XT5A 3FCSA 4IM8A 1NGYA 2VDPL 3TLRA 4EN3B 4LDOB 4JHUA 2PF6A 1PQZB 4WGWB 2B2XH 3B1TA 1E3FA 1KPVA 1BD2E 3CWGA 1EWHA 1O7SA 4MQXD 4PB9H 4X7SL 4RDQG 3VSQA 2QDWA 4L2LA 2CUHA 5CKAA 3EXLA 2BCKA 2M83A 5EOTA 3VGEA 4D9RE 5ABZA 5CCGE 2WPGA 2AGJH 1YQ2A 4OBSA 2JI3A 2E3VA 4JM0A 4DP8X 4HYTB 1E28B 3MI6A 4AENB 1C5BL 1Y6KR 3VDAA 4JY5H 3UAJC 1XHHA 9PCYA 3VI3E 1QFHA 1P4IL 4S1RL 3MOBL 3G6JE 5E8DL 3FRPG 4N0RA 4OD3L 3W37A 3RKDC 2QQLH 4PPTA 3TJEH 4AQAB 4HIIA 1LEKB 5MENB 1GR7A 2GW5A 1IKNA 3EO9H 3GSQB 2BP3A 1WZMA 2Q3ZA 4BKTC 2OI9B 3BKCH 1ETB1 4WUUB 5IR1A 3KXFA 2WWMD 3I75B 4QHKJ 1HH9A 5D1QC 3RL1A 3P4NB 1YN7B 2G2RB 3QCUL 4JG5A 2UZXA 4D8PB 1RIVL 1KZYA 5T5FL 3IFNH 4YHML 2WVUA 3WE1A 2C9VA 3OD3A 5FFLA 5ADOH 4XXCC 1NCJA 5DR5L 5KYYB 2Z8VC 1ZPLA 4Z7QE 4HS3A 3ARWA 3BO8B 5HTSA 5GGVL 3ZMEA 4TNEA 3U25A 3DROA 3NJJA 3VFSA 3E1F1 1OD9A 3FSAA 5C0CA 3ULUF 1UGNA 3DXAB 2AI0H 3CVHB 3EFFA 3MREA 4XP1L 3HG5A 1KBBA 4NFBA 3KLKA 4MBOA 4GW4B 2X2HA 2XVKA 5GGUA 5HXMA 2FO4B 4XN7A 5E8NB 3ASNB 3GC3A 1TJXA 5A2IH 1LWRA 3GSVB 4RRPM 3L3KB 1A02N 4OZ4B 5C09A 2DD8H 2YJLA 3RVWC 1MCPL 3GRWL 3WUWG 5IJVB 1R5WB 1ZOXA 3RY4A 4JY4A 1N8OE 2OMYA 1QNZH 4FG6D 5JPNC 2EABA 1RZKH 2V37A 5E99L 1N64H 2ZPKH 5E1GA 5I16B 3P3RA 4O5LL 3VG9B 3I6KA 3S36L 1XGRB 3DSNA 4P5SA 4MQSB 5F9OL 4Y2DB 2BRQA 5E2UH 1KJ2H 2VUYA 1IIKA 4PP1D 4PLNC 5C70A 1RIUH 3HRPA 5JOPD 4L8DB 5DD6B 1DSYA 3CQQA 5F7DB 5CJ5A 3VXMB 4XNAA 4Z8FH 1Q0EA 5J6SA 3MBEB 1NCUA 1IM3A 1DN0B 2DL9A 2YAMA 2YQ2A 1CGTA 3BE1H 3UGUA 1IV8A 3KPSA 3C09B 1PG7W 2WOBA 1HHHA 2Z4QB 3KPLB 5ID0B 4GBXA 5JW5B 2AXWA 5CZXC 4Z7OF 5JIHA 3IDXL 4AGMA 2KMWA 4KVPA 2KQMA 1L7TH 2NR6A 5DK3A 5F3BA 5ERWA 1DQIA 1IC5H 4P4KA 4HX1B 1X9QA 2GJPA 2OKMA 1YY9C 2Y4SA 4WO4B 4HKJB 4JM2B 3PGCB 1WWBX 3SDDC 1M05A 1SMDA 3QZWB 4K73A 3OGCB 2YXMA 4U1KB 4YWGL 2IWKA 2K8MA 1VFBA 2OXGB 4HULB 3EOAB 2VWEC 4OI8A 1EEZB 2BVYA 1KV3A 2CZNA 1R6VA 3JZYA 4JQVA 3T2NH 1T2XA 1JGVH 2BW5A 2YR3A 5F9JB 5CR8A 3P54A 4HXBH 4XRCB 4U6HB 4DAGL 1BM3H 1NMCC 3FFCD 1E9QA 3T0AA 1KEGH 4PJBA 1MSPA 3EYUH 2DW5A 3F7QA 1EXGA 1OZUA 4MDRA 5KJRL 1Q1PA 4FI8A 2WYZA 2NY6D 2IQAA 5F7EH 3QZMA 2FEDC 1R19A 2F19L 3DHJA 1NOAA 4IBSA 4PVNA 1QSVA 1NIEA 1ADQH 2CHXA 4LP5A 4ODVL 4JDZA 5I30L 2EKSB 4YDLC 3PWPE 4OCYH 3G6DH 1A1NB 3V6FA 1QBLH 4LPUA 5J13C 1GMIA 4FQXB 3L45A 5HI5D 5I0VA 4MXQD 1FH5L 1BQSA 4HISA 5EEVA 4TNGA 4PW9A 4XVTH 2L7UA 3HE6D 1LE9B 3FQUB 5FX3A 3WHXB 4NB7A 3M7OA 1E42A 2BINA 3JXAA 1ROCA 3BRDA 1IAKB 1R3KB 3MRJA 3A22A 5IVXE 4QY8A 1KFAH 1LD9B 2LU3A 1NGPH 4ABVA 5DTFA 5F96L 1LQBC 4XX1E 4Z1PA 3BAEL 1JN6B 1OO2A 5IB1A 2Q8AH 3VFVA 4WEUD 2I9LA 2QELA 1UFGA 3GBLA 2QHLA 1WFOA 3IVKA 1MCJA 2NSQA 4FNLH 5EU7C 3EOBB 2EE2A 4TUJA 1A7PL 2NQ3A 4BUHA 5C0AB 3IJYB 4PJ5E 5GS1C 4EMZA 1BW8A 3QIBB 1U3ZA 1MLBB 3D0LA 1IC7H 2Q1EA 3L95A 4MNQA 1IAII 2C34A 4NO0A 4HK0B 3B9EA 1TO4A 3ZTCC 4PV8A 3V95A 4JFFD 2BC4B 1KCBA 3ZTJG 2VTFA 5HYSA 4RBPH 3CV5A 3G6AA 4Z77A 2NNAA 3DRQB 1F3DJ 3R1GH 1DVFA 2CU9A 2DQDL 2ZJSL 4XCFL 1YMMD 2E9JA 4JKPH 1B9ZA 4JHWH 3ZE2E 1KACB 4X7TA 4HQQL 3QWOA 4QAMB 3EFDH 4YFLI 3SBPA 3IXAA 4QXVA 5FO9A 2JI2A 2R9HC 3MJGX 4Z78A 1MCOL 3NMEA 2VH5L 1CLOL 2GHWB 4NC1C 2TRHA 3CLFH 5GZND 5TDNA 1RV6X 1BM7A 3EJZD 2PWFA 4OM1L 2VR3A 2TSBA 4AGNA 2DTSA 1MWAB 2ESVA 3TCTA 1TMCB 1ZDQA 1O7VA 4X5RA 1GGUA 1KB9K 2F8VA 3LRHA 2ZXBA 3BPLB 5KSAD 5JIQA 4NPYB 3QULA 4D3CH 2K45A 4IRSC 2YO3A 3F7YA 5DVMA 4O51A 3TOPA 4IKIA 1BVLA 2Q76A 4JR9H 3WS6A 4V2BA 1KY6A 2UY7B 4MHHI 4ZFZA 5EO9A 2ZXDA 3HC0B 3QG6A 5AVTB 4A7UA 4L4JA 3IDUA 4QRRD 4F7TA 1IBBA 5HI4C 5L8KB 3LKNA 2P8MB 4E9XA 4K9EH 3UEQA 4WNQB 3W1ZA 1LO0H 3WS3B 4I3SH 5DJ6A 1G4MA 4E9TA 3U9WA 4H8WH 5TFSH 3QISA 1FZMB 1IBGL 5ELIA 4BHUI 1L6XA 3V5KB 5HGDB 5B1JA 1F0LA 1EJ8A 4ES9A 4Z7WE 5SWQA 3ULUE 3ZIMA 3QEUB 2CR3A 5D7SH 1CCZA 1DE4B 2BK8A 5C0EB 1DTUA 3PWNB 1GS7A 4DK6A 1OEZW 3TS8A 5CN3A 2HJKB 1B4JH 5JMOC 4PW4A 4WWKD 4LOEA 3KPRE 2GSGA 3L3JB 4AZ8A 1DP0A 3AG3B 3OKDA 4N86A 3VXUD 4Y1AB 1EO8L 3GI9L 4GIAA 2AABH 3ASWA 4LQFL 4FG4A 2ADJB 4QGYA 4H2CA 3QUML 4WEBH 4U6VL 1MCKA 5DZJA 3D2TA 4A6YL 4JG0L 4UDUA 1CD0A 5C0DA 1FRGL 1RU9L 2CKBH 1KIQA 2A6KA 1KC5H 4PV9B 4UV4H 5IW6B 2JFCA 5F7AA 5EZIH 4X0KB 2VDOH 4OFQA 1AMXA 4LCCC 1JPTH 1ZD6A 4HWBH 4JRXD 1F4YH 1WAAA 2F68X 1EHKB 2OJZL 5GHWL 3BCFA 1WYJA 4A63A 4YLQT 5I8CB 2ROXA 1J0YA 1VADB 3QUYB 3UPRB 1T66C 4XHJD 1WZLA 4HK3N 2P24B 4KGLA 1N3NB 3EYVA 4ZXBD 4GKZB 5L8JB 1XR9B 4KNSA 1BIIA 1J11A 2JKNA 3Q6FA 1PLGL 3V5HA 4GO6B 4WFHE 2XWDA 2VITB 1H9VA 5EOCH 2B14A 1KGWA 4JRWA 1JGLL 1EXUA 1DL7L 1WH0A 3A4FA 3D4GA 4ZOBA 4F15B 4Z7OE 1Z9PA 1W8NA 2IOOA 4WDIB 3VXNA 25C8H 1WISA 2FQDA 1HL5A 3D3VE 4Y9CA 1UA6L 4LHQB 1BFTA 3CDGA 3QQ4B 2ID5A 4GP8B 4J3BA 2DWSA 5DRNA 5E9DB 2BHFA 5DHYA 4W9KC 2XA8L 1J1PL 3UAAA 2AK4E 3C6LC 4LNRA 5H37H 4KC3B 1P69B 4LMQI 1QSFB 2DB8A 1BF2A 4WSGA 1XV8A 3SJVE 4DKFL 4OFVA 5AYTA 5C6PB 3ZTJH 4YHNA 3FB8B 2VABA 5DJXA 5FYJU 4CSTA 1DQQB 5DO8A 4L48A 2YRLA 5JXEA 4RAUA 4FTVA 3APNA 3S37L 3ARBC 4HV8A 3ES6A 4RMVA 4TUOB 5AD0B 1FL6B 1Z2KA 1FVCA 1MRCH 3TA3D 3BAJA 4P2QD 5DURB 1FNEA 2VLJE 2Y7SA 3V0EA 1JDDA 3PF2A 3W2DH 4UQ2B 3MMEA 1ETZB 5F0MB 5DLLA 3UTSB 5BZDB 5LGKA 1A7BA 4OCWL 3OB0H 3HUJB 4FYQA 2NPLX 2WCPA 4M62L 1SJXA 3U82B 1INEH 2ZIDA 4ICWA 4Y19A 5JOFA 1BQRA 4KXCA 5MERA 4X6EA 4O4YL 2BJMH 4OLXL 3QJHA 1GHFH 3IBEA 5CWSA 1P4LA 3C5ZC 5KSBF 3WTWA 2K3TA 4BFKA 1J8RA 2X40A 1U95A 3VFTA 2GC4C 1PKQA 3IE4A 4M6OL 4DGUA 3FKUS 4ZW6A 3O8XD 4OIBA 3VGBA 3K1DA 1DDHA 3Q0HA 4FHKA 2CBPA 4HBCH 2V3FA 3HS0A 4JPKH 1JBJA 4RIRA 1AZRA 4HAFA 4UQIM 4G8GB 2VC2L 3RWJB 2NNXA 3NFPA 1FUNA 2JCWA 2AV1A 4JKKA 5IROA 3UJIL 1B6DA 1GZHA 3CX5J 2FNWA 4FCAA 2OR8A 3FT9A 5DGRA 1A6AB 3P30L 5F21B 1G7LB 5BS0A 5I2IB 3ZKNC 1YDPB 1BVKA 3GMMA 4A67A 4NI3A 3KYNA 1G0XA 3NCFB 4P5MB 5CZXD 3EGXA 4NQXA 5KEZA 2WLHA 5AW1B 1NINA 2JSFA 1N0XH 1PSKH 2HN7B 1E5AA 5FEBA 2HH0L 2EYSA 5I74C 1FO0B 3CVIH 1T89A 2WINB 4X8JB 3IFPA 3NTCH 2CDGB 1EEYA 4GSRA 3MRCB 1YY9D 1LGVA 2FZ3B 3ECBA 1Q94A 2WO3B 2XNAB 3VXSA 4GRWF 4ACPA 5JPMA 3QQDB 3ULAB 2R4SH 1PFOA 3SDXA 3MV8D 1RVFH 5BVJA 3S5ZA 2BVTA 1SJEA 5DRWB 1BPLB 2PXYD 2ICWB 4NZDA 1A14L 3VFMA 3WAJA 4HKBA 1YEWA 1U8NA 1QI3A 2BVOB 2DI9A 4NENB 4ONFH 4Z0XA 3BZ4B 3JQOB 5I1KL 1FBIL 5LGYA 4P5KB 5AENA 5FOBA 2G3NA 1TJHL 2FR4B 4WTZG 4U0QB 4XN4A 3FT0A 3ILEA 5K39A 1HH6A 2ITEA 3MJ7B 5FYJL 2QQNH 3K2UL 4FA7B 4CN4A 2Y1ZA 5D1XB 2IAAC 2W07A 4JDVA 4KTEL 3NJKA 5EZOL 3MCKA 3VG0L 3BAYA 2IH9A 4ZYKA 3ETTA 4RNRA 5AWNL 3C8KA 3MV7A 1HHJA 5TK2A 2IQ9L 3HJ0A 4JFED 1OP9A 3IKCB 4KKQA 4U1GB 4X9FA 5CKGA 1TFPA 3M8OL 4Y4FC 3VYOA 1QPPA 1KELH 2ZXQA 3ZN6A 3ZYZA 3PJNA 2JQMA 3AY2A 2Y9RT 1QKZH 3DRTB 5JUEL 3G5ZA 4HH9B 4DEWA 3KBHE 1R46A 5BOPA 2P5EB 2X4SA 3O6KL 1K5WA 3US9A 4YEFA 4XNQB 1MIMH 4Y4KD 5F9WB 3WFHB 5L7XL 2QMJA 4LU5L 2J56A 5DHVA 1KTDB 5KYUA 4HJ0C 4R0LA 3S35L 5I75C 4X4ZA 4LOUC 4XP5H 3JTTB 5IJBC 4KNUA 4UB0H 3QUZA 3UL4A 4KROC 5DYOA 2YEZA 4KQ0A 3K2IA 4G6AD 3QI9C 4YHIB 4KK8D 2VXSH 2HLAA 1G7MA 3HBQA 3DIVA 1TCMA 3EYOA 4B7IA 2Q6WB 2WN3A 2Y22A 4IOSA 3SEPA 2AJYL 1UXWA 5T1KA 4ZSOA 4FEIA 1C08A 2FJHB 3P4OB 3EBGA 4Q7DA 4WI2A 3RGHA 3H0TB 3GZOA 3RFZB 4KTYA 4G59C 3QRLA 2OYKA 4TQEL 4ZX6A 1UATA 3EJRA 1ZA6A 3GSNA 1L3WA 3RTLA 3W39A 5HHME 2QSCH 1RCYA 1Q38A 3CSPA 2WGNB 5L4MA 3V5DA 2VJ8A 1F3JB 4PREB 4LVOB 5F6HI 4D7BA 4EKXA 2I9TA 4Z7NE 3QUXA 2XKNA 3FB7B 3RDTD 1H0DA 2EEAA 2F5BH 4G7VH 4EN3A 2CUAA 1B90A 1I1AB 5FCSH 1UG9A 3RU8L 1T0MA 5BZWB 2Z35B 1HHGB 2KH2B 2ZWYA 3WFCL 3S88H 3KWUA 1HOEA 1OF2B 3E7JA 1ZHNA 5F44A 4R96A 3W38A 1NGZB 2H3KA 3FU6A 1T22B 1Z5LA 5E7FA 2ICWI 3UBXI 5EEYA 4E36A 5CU5A 4YSQA 3Q44A 4L5FE 4BZYA 2WWKT 4Z7UB 4W9IC 5E6YA 1E28A 1UHVA 5IT2L 3MOAH 3NABH 5F1OB 5F3FA 1MVFA 4LSTH 4R26L 1F4XH 5HHOD 2P80A 2H32H 3ZR5A 1EO7A 4W6XB 2FGWH 4FQPA 1I8KB 4Q4EA 2GIYA 1YAZA 3TASA 1EV2E 3RVUC 1ZGLB 5MENA 3GSQA 1AQ8A 1FIGH 2YAPA 1OGAA 1F4AA 4WUUA 2AKRB 3DK0A 5KSUB 4TTDD 3TH4T 5D7IF 2CWRA 1WFUA 3P4NA 1YN7A 1ZEAL 2G2RA 1UWFA 3NSCA 4YSUA 2GG1A 4GJTB 4Z3EA 3NACH 1YG9A 1CMOA 5FLVA 3K74B 1ZHKA 4ODXB 4U05A 3NH7H 3RX9A 1NANI 3QCVL 4XC3H 5K59E 4Y4HB 5KYYA 4NKIH 4MJJA 3FAXA 4KV5E 3WBDA 1HYRC 1UADC 4LPTA 4LEOB 4AC2A 1VESA 4PWKA 4I0PB 1MHPL 3DXAA 2VSCA 2WMPA 4PY8I 2AMGA 4NP4L 4JKMA 1FNSH 3KBFA 3WXVH 1EGJL 3CVHA 5JZ7C 4K3DL 2QLYA 2DI7A 3Q6GH 4P2AA 5L6YL 4GW4A 2CBOA 2FO4A 5E8NA 1U4EA 3SDCB 1IB5A 4YDVA 4XGZA 3V55A 2DKSA 2BIPA 2NYZA 3OKMA 4EIBA 4OZ4A 5I18H 2H2PD 3IPFA 2C9SA 5CILH 5IMMB 3VGAB 5IQLA 3GM0A 2XTJB 4JN2B 5IJVA 1OCZB 2VXVL 1JV5A 3AB0B 3WIHH 1SDAB 2YK1H 2G30A 1G7PB 5KSBE 1OAKL 4DP0X 3BN3B 1TTUA 4OZGB 2YIHA 2Q0ZX 1C1EL 1HNFA 3Q5YA 2DWXA 5EIVA 4ZO7A 3QYMA 1HWGB 3SO3B 4XNXH 3HR5A 4F33A 5I16A 4YDJA 2AJSH 3ALWA 3NQIA 4EIZC 1GC1L 2A6JB 2MCPL 1XGRA 4KKPA 4Y2DA 3K6IA 2DLTA 1SY6H 1T66D 4MLIA 3VRLF 2PYEB 3K2MC 4HHAA 3ZT6A 4YSCA 4NO2B 5EF2A 1VF5C 5DD6A 2O72A 3VXMA 5C08B 4XPGH 5C7ZA 1GYAA 2DH2A 4WW1A 5IQNA 3H54A 1DN0A 1T83A 1E6OL 1YEDB 3DUUB 4GI8A 4KBPA 3MLSL 5E08L 3KPLA 3ZYIA 5JW5A 2WLJA 1J5IA 3KPPB 4N90E 4BINA 1DZBA 1P7QA 2VDRL 2W60A 3CHSA 5C7XL 2QGEA 4ZFOA 3ZJAA 4MNGE 4OF8A 1MRDH 1EZSA 4HKJA 3IEAA 1NH6A 4HP5A 5J56B 4KHTL 5KBMA 4E9LA 2Y3NA 5F9DC 1QFWL 4GRWE 1AG0A 4MVBC 1XZ0B 4IMLA 4N8VG 3QH3B 3CAFA 3QIWC 3SGDH 4KRMB 4R7NA 3NPSC 4B9FA 3B4NA 1MFVA 5D7LE 4DN4L 3BSZH 5E23A 5EBGA 1JVKA 1RJLB 5JHDE 5L0QC 3MSPA 3QJRB 2A7BA 2Z31D 3LPPA 5F9JA 4JO5A 3ARBD 5A2JH 3B2PA 1CLYH 2D7MA 2W8CA 1UWXK 4QR7A 3VMOA 3L1GA 5HVGB 1M4KA 1UM5H 4EPSA 4HC1L 5SX4I 2JK5A 1N59A 4PJEE 3W9EB 3MRQB 5CEYB 3GBMH 3VI4A 4NQSB 2I85A 1HHKA 3K6FA 3C5ZD 3IJ9A 3T0EB 1MJ7L 4P3DA 4FQXA 4GAJH 3DECA 4U2YA 2Q9OA 2V4LA 2EINB 2IH8A 5GIRB 3PXJA 1LO4H 5E6IC 1LE9A 3FQUA 3CSBA 5HI3C 3ZLQC 2J5WA 2H6PB 3MUGB 3KLHC 2I69A 4JO3L 2XWBB 3J07A 1R3KA 4PJXB 4HFUH 1QUNB 1CDGA 2YGVA 2GJ6A 5SV3A 3VI3B 5I8KH 2B1HL 4P46B 5KVGH 1CQYA 3G6JB 4G8IB 4HU2A 2VE6A 1SQ2N 2OR9L 1OHZA 4HHGA 1MFNA 4EI0A 3S36X 2JKXA 3MO1B 4H8UA 1E2VA 4UM8B 1IX2A 1PDKB 5GGRY 4CNIB 5IFJB 1AGFA 5IMKA 5FYJE 1HEJC 5DC2A 3BGFB 2YKKA 3QDGB 4X6DE 3LYRA 3GSWB 3HMXA 3Q1SH 1MFBL 1PG7H 3EGDB 3ATEA 2LU5A 4GH7B 5C0AA 5GZOA 1T7WA 3GLDA 5EDXA 1XZWA 1ZWIA 4TVUA 5F89A 1RUKL 4BFNA 1J1XH 2BFVH 5E2VH 4HK0A 4L8CA 2BC4A 1MJUL 3VWJD 3KE0A 2OV0A 3DGCR 5EB9A 5ICZB 3TT1H 4AVHA 3AGVA 3CZSA 2R7EB 4D9LH 2VM9A 1KYOK 2EUZA 3AG1B 4K15A 4WWPA 4DVBA 3HOGA 5DVLA 2EVIA 3Q8AA 3R18A 4OFIA 1JHKH 5E6SB 4HZAA 3VGDA 4GRLB 4XNMA 3OKLA 5D2LA 5FFOA 2MNJB 3MRLA 1XR8B 1T4KB 4L9DA 4MMZC 2CJTA 2VMEA 3V0DA 5TH2B 1V27A 2C3WA 4YDIL 5D72L 1BMGA 1ZT1B 1U3HA 3FU7B 3GHBH 4X4KA 5E6RB 2D9CA 3ARRA 4KDVA 4OQTA 5LG6A 4ZMVA 5D4IA 3UTTE 3GSXB 3GHEH 4WFFD 4ENZA 1VSCA 4NQEE 4OLWL 4FLHA 4OGAC 3MA9H 2HFGL 1MI5D 4A2LA 5J12B 4YK4B 3L16A 1QG3A 3KCPA 4AQ1A 2EQDA 4HPYL 4Y5VA 3MJ9H 5SWZE 3Q2CA 3B2UD 4PEEA 4B41A 1HXKA 3L7EB 4PJCA 1I9JH 4NZRL 4NPYA 1MFEL 2CUMA 3O3UN 4NM4L 4UQEA 2FH8A 4EEEA 3CHPA 4P57B 5DGQA 3HVDA 5T5FH 3QXAB 5EF3A 2DQIL 4Q9RH 3ASOB 3MQIA 4FXGC 1XTMA 1COBA 2A9MH 4ONGL 4WU7B 4PLKC 4LCYB 5EG6C 4EQ2A 4PRPE 4L9LC 4LBEB 2P8LB 1E2WA 3HC0A 2FJGA 1CURA 5D7IE 4ODSH 3HG2A 2ITCB 4N2EA 2Z92B 1V7NL 2WY3B 2YUWA 3B5TA 5JW4R 5BOZG 4XCYA 2SODB 3S34H 1QSEB 2OL3L 2YXFA 1NWPA 3MR9B 3V0WL 3NT0A 4HJTA 1UWGH 2XBZA 5HDBB 4PJFB 3MGAA 1XTLA 1GC1C 3CTTA 1W0WB 4Q9QL 1A22B 2VR5A 1DE4A 3POCA 5DS8B 5C0EA 1BFVL 4FNSA 3ZE1F 5LXGL 4O02L 3U30B 4LLAA 1AZCA 2CLRB 3L3JA 4RVBA 1NMAH 3JVFC 3CQPA 4LQ1A 4IRZH 1CR9H 4Y1AA 1UCBL 4N0YH 4YL9A 4XNYL 4L1TA 3QDME 2ZXCA 5FHAH 2ADJA 3V0VB 1URIA 5ESVA 2FDBP 1M7IB 5HGAB 3SGKA 4ZNEE 5GJSH 2GBUA 3ARGB 4QWWD 1KCWA 1T1YA 1RHFA 2X4NB 4LEEA 4L8SB 4X0KA 5FM4A 4CN6A 4YFEA 1J18A 2XVBA 2J8OA 3B37A 1JWSB 1JNNH 1I3GL 4N9GB 5GGQH 1NC4B 2CO7A 4NO5B 1OAZL 2AJVH 3BQUD 4ODTL 3WELA 3SCMD 4AVIA 5I8CA 5ISZD 3T2QA 1VADA 2QQKL 3VRLE 4HF5H 1PAZA 1SHMA 3ZKMC 3WENA 2E27H 2P24A 4NC0B 4N4YB 4WWID 1N3NA 4GKZA 2IAMA 4JZNA 1WWCA 2Q2EB 2CJUH 2N59A 4NBZB 3LRMA 2VITA 3OKOA 2ITDB 2HPOA 3OF6A 2IGFL 4H25B 1KXQE 5A6LA 4OGYH 3K6DA 3TO4C 3TN0C 2X12A 4MDIB 1UD8A 4ZMAT 1BVOA 1I3RA 4PRAB 2O30A 5T3XL 3CN4A 2P9RA 1KEML 1SYSB 3GMQA 2K6WA 4GLRH 4NHUB 5E4AA 2LTQB 3SPVB 1CBJA 1V7ML 2HKFL 2ZKHL 4M6AA 5K9JL 1ONQB 4I87A 2OSWA 2GYSA 4IOIB 4J5VA 3TXAA 4DAGH 1KENH 2OZ4A 3RVVC 4CL7A 1DQQA 3I9PA 4XAWH 4LCIH 1GJUA 1TQUA 1KCRH 5E2TL 3C6SB 4R8WH 1AACA 2IC2A 4EDXB 1Y7VA 1KG0B 3SPIA 5HYJE 4BYHA 3QPXH 4JFVA 2F19H 5KBDA 3WKNA 1JHLL 4TUOA 4H1LA 5AD0A 1FL6A 2GTZA 4HWNA 1TTGA 5FKPB 1GSKA 1QRND 1OKEA 3HNSL 3IN0A 1WS7A 5BZDA 1ETZA 4L4VD 3UTSA 1YYCA 2YPVH 5F7BA 3L13A 1FH5H 3N42B 4KJWC 2H1LM 3RWDB 3IMSA 4MJ6B 5TPWH 1ROWA 4WI6A 5KW9L 2RFXA 1A6TB 4E5XG 5CBAA 4PP2B 4M8QA 4HSAC 1Q0YL 1IGML 1DBMH 1JHTB 1V10A 1S7TB 1F8TL 4EBQL 2AQPA 4AYBA 1HJCA 3O41B 6FABL 2HTKC 5DJZA 1GJIA 1BZQK 4KNTA 1DSFH 5E24E 1HZKA 3Q3GA 3QHTC 1Q9LA 3BYTA 1BFOA 3IFLH 4MD5B 1MXDA 3CZJA 4TQ8A 3BAEH 4G8GA 3RWJA 3K7UA 2QDVA 2CO6B 1CXKA 2LLGA 5DRZB 5AOKA 2HSIA 1A6AA 2BX5A 2QJDA 1FE8H 1H3VA 1D2PA 1F18A 2P5WD 4WK2B 1IKOP 1YDPA 1QPKA 4A7VA 1WUNT 2XN1A 2ZAHA 2ZUSA 4G3YH 4TSBL 1X5MA 2IDCA 4K8RD 4LK4A 1JF1A 3CDCA 4N24A 4YUEL 1GPOH 2D4DA 1VZGA 3VXPB 1H8NA 1IVTA 2J44A 2HN7A 5INCB 2Y1VA 2EXTA 4NN6B 3F6IA 1LL1A 3D12B 2ZWKA 2WINA 2CDGA 1KLGA 3AQYA 4Y2LA 4YHKH 1AIFA 3U79A 3H42L 4KOBA 2XNAA 1N8ZB 1KTJA 4Z7VE 5EU3A 5DJCA 2IFFL 1SYVA 1D5BB 1C5DB 5IHHA 5E4EC 4Z7WB 3SE8L 3MUUA 3QIWD 3M88A 4JK0D 3V7AG 4X6BB 2IALA 5KJ4A 2YAQA 4ADIA 1FPTL 4NQDB 2FATL 5E8PA 2LLLA 4AQ8C 5EEXA 3MRFB 2VO5A 4EF3A 2BVOA 4IKJA 4ZFQA 2DQEH 4NENA 1KYUA 3KPRB 5CBEA 1SXBA 2NXZC 3BZ4A 3ZTDC 3HFFA 4P5KA 3GJFH 2FX8L 2N56A 3LD8C 4M8UA 1FHNA 1FCGA 4W9CC 4AE1A 5I6LA 3QFJD 5L2KE 2FR4A 4JRYB 4MMXB 2VLME 1L0PA 1P7BA 3OMIB 5DWUL 2F53A 1MH5A 3S37X 4B9YA 2YOAA 4PYHA 1L5GB 4F2ME 4Z0BH 2E9GA 3N1FC 3N41F 4KJPC 4DKTA 4L29B 2R8SL 4L4TD 2XYCA 1SF5A 4N2BA 2X6BA 1E4XH 4X4MA 4UUJB 3HW7A 4GXUN 4PN6A 3J8F7 3N0AA 3NJMA 5D93C 5E6ID 3RZWA 4BM7A 4AK2A 3IXTB 5HI3D 3AUWB 3DRTA 3V4VB 2JCCB 2UZIH 4IRJD 3KLHD 3CHRA 3FTXA 1ZS2A 2OTWB 4BD4A 5CNHA 2IH1B 4XBGB 5B3SB 1H3XA 3TFKC 4XNQA 3B2MA 3AADB 3OB8A 1F6AA 5HHNA 2ZOLA 1WBZB 5CGYC 3RZCD 3F8UB 4ZO9A 1IQDB 4NNXA 4Y5XA 3BI9X 3L2NA 2WWNA 5IEKB 3IF1A 3BWAA 1FFPB 3VQLA 2DBLL 4PS8A 4JMNA 2QV4A 4XMKL 3N43B 2HG5B 2P43B 3MTXA 5EZLB 4PJ9C 3E3QC 4LGRB 5IEHA 3FQTB 4OCRL 4RGMB 5EBWB 4MS6A 2Q6WA 1CL7L 3CPLB 3NIFF 1L0XA 1ZANH 4L3FA 4ZAKC 2H4EA 3KPNA 5E0FA 5E8OA 4AKOA 5B39B 2FJFB 5DZLA 5TK4A 1WEJL 1LDPL 4D0DB 3ZE1E 3VWKC 4CJ0A 1OW0A 4NN7B 3BZEB 3RFZA 3QDJB 4AWJC 4QKTA 3HFML 4IIQB 1RU9H 3VM5A 4CBPA 5KBKA 5ID1B 2WWOA 3A3YB 1ZIAA 5IHLB 5ITBL 1N68A 1CGVA 1ET8A 4KH2A 4JFDB 3ILQD 3L5HA 2FL5B 4OH2A 2JVUA 3VYPA 3WEBA 2LHAA 2CRIA 1EPFA 3FB7A 3DMMB 5FF6A 2NLJB 4GQ9H 1JRHI 3AU1B 4LVNB 3H7LA 2OJZH 3VXRA 5ECJE 3STLB 1HYSD 2XV0A 3I3EA 2MHAB 1HHGA 2WZAA 2Z35A 5C07A 3VFOB 3WO4B 3N55A 1D9KC 4ZUSA 3UC0H 4DZ8B 2GPZA 1NGZA 4Y5YC 1T22A 4DWHA 1RUQH 3L9RA 3ABLB 3MBWB 3OKKA 1RJYA 5IWLC 1QRKA 1BVNT 4GNKB 2XPZA 4PHXA 2OJEB 5JORB 4XX5A 3LNDA 4TL4A 3HB3D 3EG9B 3QA3A 1OP3H 3P11L 3F12B 1I8KA 2ZXGA 3U2JA 1LE5A 4Y1TA 4HJGB 3QZBA 4WZ9A 4PGCB 4N2OA 4BKSC 1J0JA 1MJ8L 3Q2WA 2AKRA 1KT2B 1PIFA 4KK5D 2QR0B 4UI2A 1B4TA 2ZSVB 2ZCHL 3E3QE 1F13A 4G11A 4ODXA 3LJ3A 3S35X 2OS7A 3UZEA 5EIIB 4CC1A 5I8OH 2GT9B 5D7JB 3AXLB 1AD9B 2EXWC 2DQFA 2OZNA 4Y16C 5D5MF 5DHEA 2P26A 1DLFL 1KYDA 1P9MC 4J2QA 1AXSA 5IBLC 1JVOA 3G3LA 3Q8EA 4OCNC 1R47A 3DX2A 4M03A 4GT7A 4U1SB 1KCSL 2A83B 3RAJH 1HXMB 1RK7A 2F5AH 3DSFL 3OKYA 3RTQC 3HZMB 1C5CL 2YLKA 3ZZLA 5GISH 1BVZA 4GKNB 4H20L 5BCAA 4JM4H 2VDKL 1UOVA 2G5BB 2JIXA 2QSVA 1IM9B 5KBNC 3SDCA 1CFVH 4QRQA 1T3FB 3VXUE 4MAYC 1N6UA 4LEBA 4ZFFB 5G2NA 2Y23A 4HIHB 4XPFL 3S96B 4MWFB 1OSZA 4GMSH 1I1RA 3ARFC 1CT8B 4UMGA 1P4BH 1BMZA 1RD6A 4NKDB 1GOGA 3S3JA 2Y6SC 5JIIA 1JPST 5DA4A 2A74C 1O6SB 2BIQA 1A1MB 2DLFH 2DH3A 1E3XA 4BUQA 3WLWD 3GRGA 3ZHNA 2VLRB 3ZDZE 4WCYH 2QGDA 2ZCLL 2H45A 3JWOH 4NCDA 1A3QA 2XDHA 2PYEA 3OSVA 4NO2A 4IGBD 3GRBA 4N1EA 2V5YA 1RUAH 2DQJH 3DURB 5C08A 4R4BB 2HP4A 3EHBB 2VZUA 5IQOA 4XXDB 5IJCC 1ZMYA 2F1EA 1YEDA 3DUUA 3NJLA 3IYLW 1S7UB 4PJDB 4AUYA 5CD3B 4QRTA 2NTSP 5IB5B 5AB1A 3CN0A 3BUQA 1T1XA 3VFUB 4GG6F 4PJGA 4LFHG 1QI4A 3KPPA 2WZPA 4YXHH 1ACZA 5KVDH 4UTBL 4MJHA 4HS6B 4K2UL 3OVUB 3TZVB 3GIZL 1NA8A 2ZTBA 3OXSB 1PF3A 5FKAB 4QOKD 2KDGA 4J4PC 1B0GA 1JTTA 1KGIA 2DLHA 1QOKA 2V5TA 2HTLC 2LU7A 3NRPA 4OFYA 5AKRA 4H8QA 4Z3HA 3QH3A 4JPSA 4BSVB 5I1KH 4HWZB 4JE0A 1TJHH 3ZOAA 4ANXA 4NHCH 1KV7A 3ARPA 4K8RH 3H56A 2B9BA 2RAMA 3QFGA 2PO6C 3JTSB 3TEWA 4YQXL 2ZZUT 3P0GB 3GDBA 4I89A 2VLLB 1F11B 2BNRA 4UYQA 3BXNA 4FQ2L 4BZ2A 1FAIL 2I5YH 4FFVC 2Y06H 4P2QE 5AWNH 3W0WB 4DJMA 3UO8B 1M71B 1U6AL 1LLAA 3SKJH 4PTTB 2IAND 2BVPA 1TJMA 5MEPB 5CEYA 4OZFA 1KGJA 1K85A 4OV6F 4QO1B 1BD2A 2YPKB 4OVUA 5JUEH 1CTNA 5HHXH 3STZB 3UCRA 3FF7A 3FULA 3FW6A 4MKMA 5C3IA 3EJUA 5L7XH 5D2NC 5IBUG 1OSPL 2H6PA 1VDGA 4X7DC 2WQWA 2XACC 1UH4A 4BQ9A 4XCEB 4U7MA 3MOQA 4R83A 1QUNA 2G3MA 3TVMA 4NAJA 3VI3A 3I3BA 3QQ9C 3G6JA 4G8IA 1R4XA 2XZAL 5JQ6H 3FO1B 1UYWL 1OZTG 4R7DB 1EK3A 5IHUH 1BWWA 1S9YB 4DZBA 4AV5A 1EAPB 3DGDA 3IGKA 3B7SA 1JOIA 3TPUB 4CNIA 1DQMH 4WI3A 1G6RH 3N44B 2OMBA 5T3ZD 3VCLA 2LFGA 1NL0H 2IDSA 3QDGA 3PWUB 1IJNA 4JGJA 4R90H 2VN5A 3D8MA 4RA0C 2B1AL 3EGDA 1D6VL 1VENA 3AM8C 3NP4A 1AQKL 3P73A 1Q1JL 1WC7B 4KI5F 4TULL 2ODHA 1V54B 3K8MA 4XO5A 3BLBA 4N87A 3V4PA 4BZ1L 2O26U 4WUKL 1DFBH 4JZJA 2KPNA 3NFNB 3MV8E 4R4NC 4MCMA 4N8CH 4OLUL 4V2CB 4ZUTA 2MNWA 5EU6B 2YA0A 1ZA3B 2GKIA 1MFDL 3EDJA 2DKUA 4Y7MA 3L3OC 4X7FC 2NXZD 5JQIB 4KKAD 3IU4L 4XO4A 2M1KA 2Q3AA 4A2EA 2MCMA 3RU8H 3JWNC 4GRLA 3PHOB 3BRGC 1EHXA 1EJOL 5AAMA 3VVVA 5CJOL 4GAAA 4PB0L 1CFQA 4ZTPH 1T4KA 4HJ1A 4M9OA 3FUMA 1ZT7B 5TQ0H 1TETH 5CLZA 5JDJA 5KVGE 2BRRH 3MV01 1RMFH 3VO0A 3FOMB 2H26B 4XE0A 4PVLA 3D69B 4JFXA 1XIWC 1ACYH 3GSXA 4JFEE 4DH2A 4MA7H 2P49B 5DUPL 1JZGA 3PU7A 4BELD 4BV1A 2EVJA 1OSEA 2ZF9A 5DUML 4JM2D 4QT5B 2NXYC 3ZKSD 5I1DB 1XH3A 3MJWA 4WU5A 1HESA 1UWEL 1SOXA 1W72H 4S2SA 3M07A 2ADIB 2OTUB 5IIEA 4QPEA 4LCYA 2EIZA 3NK3A 3CHXA 3QO1B 3X3GL 4LBEA 2YD4A 1N5YH 1NICA 4FG2A 5HPOA 2GI7A 2R4RH 3D05A 4KO7A 1HSBB 3D0VB 1P5UB 5EU4B 1JPEA 2NY4C 4TVPL 4PJ9D 5TDOB 4PJ8B 5LWYH 3NIDB 5GGVY 3V0FA 3O2WL 3O0LA 1HZLA 3MR9A 4XMLH 1ORQB 1IGJB 2F7QA 2NX5E 3TWYA 5AVXB 3VFWB 1AHWB 5BVPH 3U7AA 5D5ME 2GCYB 1BLNB 1OM3H 1AXTH 3G08A 4KX9A 5A3ID 2FECI 1IGIL 3VMPA 2X89A 1M57B 3CBKB 2X38A 2XSKA 2FNBA 5DHMC 4MASA 3WFDL 4R3SB 1NJ9B 2EAEA 5TDPB 1OARL 5KG9A 3C5JB 3MVSA 3OPZL 3CLWA 3JWNE 4P2OC 3FF8A 3H2PA 3VD4A 2A9DA 1DUYB 1KN2L 3CK0H 3EH3B 4HZLB 2CSPA 5GRZA 3V0VA 4CC4C 1BBJB 4KUCD 2H47C 5DHXB 1X4YA 5DT1L 4PJEB 2KZKA 2X42A 35C8L 1VGKB 3NJXA 1XSJA 3DUHA 4M7LT 1CF1A 5DQ9B 4ZG1A 3R06B 3NDZE 2BS8A 1G7JB 3ARGA 3UFIA 5JXAL 1YNTB 2DQCL 3P02A 3C60B 3ENEA 2A4ZA 4HAGA 1I7TB 2Y25A 2Y7LA 2OX5B 5D96C 1UUSA 3V6OC 1ZK5A 3CIQA 1JWSA 5CSZA 2WJ5A 2YUZA 1NC4A 4FN0A 4NO5A 4X80H 1BEYH 1IEAA 1FI8C 2R1WA 2EIEA 4JFZL 2HRPL 3MLSH 3T2OA 1T21A 5F3HA 3ZDXB 2PUQT 2IWGA 4BGLA 1I75A 5IVXA 1MLCB 5K1JA 1HKFA 1P1ZA 1JNHB 1NCWH 3IAQA 5EZJB 2CCWA 7PAZA 2C9XA 1DVQA 4N22A 4NNYB 2V9QA 2F58L 4H25A 3LN5A 2X05A 3HCVB 3GK8L 3MU3A 4GG6E 4XWGL 2QV2A 2YGPA 4MDIA 3N40P 3FTWA 1QFWH 3DETC 4LDCA 4XVUC 4X6DB 2R0ZL 4PRAA 2XT1B 1MHCB 2BSTB 2E4FA 3GTNA 3MRNB 3Q9QA 5E2JA 1CVRA 5DD0H 4UTAL 2ZKWA 1ZXQA 2V6HA 4C4KT 4PJBF 3W3BA 2AJ3B 4PJ5A 4DFHA 1ONQA 3WD5H 3H9ZA 4KO5A 4KI5C 4WV1B 2LT9A 1AR1D 5CD5D 2YD1A 4IOIA 1S7XA 1Z5YD 2AK1H 5CO1A 4ALAL 4XO8A 5DUBB 2CGZA 2BP5M 5CSGA 3HZKB 5E8EB 2IG2H 3QZPA 5LNEA 2X3CA 3RURA 5CZVL 4NQQA 1GZPB 1TIUA 3C6SA 3D9AH 3HG1D 5KOVC 2XXFA 5F8RC 3RTQD 1KG0A 3RGVD 2VQ1B 4G9DB 3QHZH 1A7RL 3O6FD 2AXGB 1ML0A 3FC8A 2L7EA 2Y7MA 4Z7AA 5M95B 4YDKL 5FKPA 2WO2B 1TDQA 1KB9J 2FBOJ 4WFED 5IGXL 1N7ML 1B9KA 3FRPB 1FL5B 3AXIA 4IW4C 3RWDA 3OAYK 4EI6B 4MJ6A 1RFDL 3B7UX 3BN9C 4ZS6D 1A6TA 4F24A 1OAXH 4PP2A 4N2MA 3VRJB 5ABDE 5BRZB 2RBLA 1JHTA 2X9YA 1IKNC 2YD3A 3APCA 4G5ZH 3IS0X 3CN2A 5DEZA 2B1HH 5TF0A 4AG4H 2DMCA 1JWUB 4J12A 3FQ4A 1UUNA 4YVUA 5EULV 3QZNA 5I1EL 2OPCA 4QYOB 3RPIB 2AXJA 3H3PL 4JDTH 3MLVL 4BDVB 4HCRH 5G5DB 3PAZA 4HOXA 4PCYA 2ZP8A 1J0IA 4FYSA 5ENWB 4WLCA 3MNWB 1DQKA 1NM9A 3KPTA 2Y5EA 1E90A 1R3LA 1A2YB 4MB1A 4CVXB 4Q2ZB 5CP7A 1I7RB 1OP4A 2B9AA 2AQ3A 4XBPB 3TIDB 3VFPB 1XH0A 1W8OA 4PRIB 4ZT1A 4NKMB 5A43C 5B38B 3NESA 2WBJD 4FNPA 3BT2H 1ULVA 4PY7B 3IN2A 1N8ZA 4KI5E 1BX2A 1D5BA 1C5DA 3WUWB 4Z7WA 1VEOA 4IDJH 4WJ5B 1G43A 2GK0B 4L1SA 3TNMA 2JLLA 1GCYA 4OCSH 4UAHA 1NFAA 1VEPA 2D7QA 3MRFA 5T3ZH 2V7NA 4FLOA 2E86A 5IVOA 1FV1A 3KPRA 1SJVA 3AREB 2QVTA 1AKJD 3NFSH 1H6UA 1ZVSA 2L8AA 2DQMA 3O3DA 4JRYA 4A7GA 4JPVH 4NP9A 2PWHA 5I71B 1NCTA 3PWVB 2HT3C 4K5OA 1GGYA 4UT6H 4ANWA 4H0HB 5K5YA 2YD9A 4MB3A 1ICTA 1T0NB 4BK5A 3ECVA 4AEEA 2M8XA 2DQGH 2DWYA 4N2IA 1D7FA 2YFOA 2KDYA 2IGLA 2XPGB 3EJYC 4JG1H 4JVPA 5A7EA 2P5PA 3LOWA 1NLBL 3LS5L 4GBXC 4UIKH 2ISDA 3WEXB 1MFEH 2E5EA 3CXFA 3UTPD 5GGSB 1D5MA 1JZEA 2YMOA 4JFOB 4NGHH 3GO1H 3V4VA 2JCCA 5CCJA 1AH1A 4M48L 2DQIH 1BQ5A 2NR6C 3V6BR 4P4KC 1DN2A 1GZQB 5DJ0B 1JXDA 2BSSB 1IAIH 1I9RH 3B6SA 1GCFA 2QGBA 1WBZA 4XO3A 1V7NH 3WGVB 3VW3L 5C0CE 2W0FB 4GY4A 3RE0A 5IEKA 2J73A 1BWMA 5AW8B 1SVBA 4QF1B 4JQVC 1OAUH 3HI6H 4X9YA 3PP4H 3KZ8A 2GSIA 2DLIA 3T4AA 1DQDH 2UX7A 15C8L 1OT1A 1NMBL 3QJQB 4NI6A 4POYA 5EBWA 3O45B 1JVLA 3FL7A 3JV5A 3CPLA 4FYTA 3A4EA 3PV6B 5DJ8B 1UB6A 4WHTA 5B39A 2CKBB 2YD8A 5J6GA 4AQOA 2WXOA 4LVEA 1OP5K 4R4ND 1BQKA 4D0DA 3CVCA 3LHPH 1QWHA 3BZEA 3QXDB 2VDNL 3CD4A 2MOGA 1T5XB 1NGXB 1T1WB 2VDOB 4R6UA 2NTFA 1XBDA 5T1MB 5KTEH 4IIQA 1NFDB 4NOBA 1CN4A 3ARYA 1AVAA 2JB5L 3ZDYF 4PRDA 5GS2D 5B8CB 1OAQH 3GXNA 2P3YA 3AT9A 4ZNCD 4HMEA 3PAUA 2JB6B 4LIQH 3GSUB 1I3GH 3AU1A 3FO2A 4F9PA 3AITA 2ODIA 2XWRA 4MAUL 4TVPE 3UP6A 4N1HB 2MHAA 5FO8B 2FRGP 3QK0A 3VFOA 3KPSE 1E9PB 4PQXA 3WIIL 4DZ8A 3CIAA 3JT0A 3DO7B 4N28A 4JPWL 2CXKA 2ZUQB 5CHNA 4H13C 4HLZG 2HKHL 4AE0A 1E4KA 4ZS7H 3BDYL 4QTIL 2HLFD 4ALAC 4PGJA 1MI5E 3NJIA 2KUTA 5JORA 2B3RA 4LAQH 3CUPA 4G6KL 1N67A 1H8OA 3EG9A 3AAZB 2ITFA 2ZX9A 3QUKB 2WQVA 4P9HH 4U1IA 5AYUH 2EEXA 3U1SL 2VN7A 2GBAA 4PGCA 2B0SH 3HTLX 4FADA 1DQLL 3GUTA 4K71C 2QR0A 3MCLL 3VH8A 2DJSA 5DD5H 3WN5B 3TURA 2VQTA 1AGBB 2NY4D 1DVFC 1YJDL 1MG3C 4PJBE 3T77A 4DGYL 2WHVA 1PLCA 2GT9A 4Z7VB 3AXLA 1X3DA 5CJQL 2C1OA 4EZKA 1QI5A 3VD3A 5D1XD 4OJEH 5LKNA 1WPCA 4HUUA 4APQB 4XPTL 3BC9A 4K7PL 4HDIB 1CXHA 4U1SA 4AIZB 2A83A 4CJ1A 1B0RB 3DTXB 4L23A 2WBKA 5MEOB 3DLQR 3DJZA 4JO2H 3PGFL 2EADA 3E2HB 5FUOL 3QEGH 2G5BA 1KLUA 2R29H 2H0EA 3HAEA 1F4HA 3FFCB 3LKQB 1ZLVK 2RQEA 5EA0L 1T2QH 3WEMA 1QWUA 2E7MA 2YFNA 4ZFFA 3X11A 5DJDA 1NAMH 1FVEB 2P5ED 4HIHA 1PW3A 2VNCA 1BCIA 1NUDA 2DWDB 4NKDA 1SJHB 3ESOA 2VXQH 3DA0A 4K5PA 3REVA 3U0WH 1KPRB 5E94B 2ZKXA 4PLJD 4YPGB 5JR1H 3ARDA 3WS6C 3MX0B 4Y7OC 1A6WL 5IG7B 2F7OA 2FUQA 2JKRM 4LRIA 1KIUB 1NDMB 4KHXH 3GZKA 3RVXD 5EV7A 2AF2A 2Q10A 2Y7QB 4B5EA 2J6EA 3EIFA 4R4BA 4XC1L 1CB4A 5LCVH 5C6TH 4X4XB 1IBHA 3WNLA 4G6FB 4MNQE 5B1JC 2NY3C 4K5NA 2ZUWA 4PWJA 1S7UA 4PJDA 5E51A 1TJGL 2YKLL 3ZL1A 1YNKH 4JCLA 5IB5A 3AQDA 3HMWL 3MLRH 1R3IL 2WQSA 3VFUA 1XSOA 1YEKL 1HS6A 4Y9EA 3VU2A 1LK3L 3SE9L 1D5RA 4BFIA 4OD1L 5IB4A 2OP4H 5FB8B 5I6PA 3TZVA 1ANUA 1PBYA 5C0BD 4P2RB 1A3RH 2XG4B 3SQOH 2FATH 5I9QC 2WP3O 3EW3B 5DEJA 3ZE0E 4KNQA 4W9FC 1FIEA 1U8CB 5DFVC 1P6AB 3NSDA 3MDJA 1MCBA 3TCLB 3ZSSA 4BSVA 4YHLL 1KIRB 3DUSA 3K0WA 5KOMC 4HWZA 4IK6A 1QMUA 1EEUA 4OLYL 1K5NA 1AJ7L 4JFFB 1E40A 4UU9B 4AGQA 2BH0A 4QXUL 4XNUL 4HUKB 3ROOB 3UADA 4X8GA 3QRGL 4JANA 4L05A 1O7DE 2VLLA 4KAQL 1NBYB 5HD8C 4LSQL 1N4XL 3EH2A 1YMMB 1SXSA 5F6IC 1QRNE 2WNXA 3TU6A 1GGCL 1D5ZA 2KLRA 4PTTA 1A3LL 3QORA 3MNMA 4DERA 2EDYA 1TG8A 2GIXA 1U9KA 4RDBA 3GSNL 5CP3H 3BN9D 5AB9A 4PMFA 4X83A 2CIIA 4QO1A 3CFBB 2WLIA 3BVXA 3MYZA 1WE5A 4ISVA 5CEZD 2ZOKB 4TOYH 2K4AA 1J8KA 3STZA 2CG9X 3DARA 3U0TA 3NCXA 4MX7B 1FYTE 3D0AA 4WWNA 4X5QA 4NRYA 4X5XB 4NUGL 2WLNA 1BBDH 3UZVB 4NN5C 3RX8A 4YBLB 4DPRA 4Y4HD 4HAKA 1B3IA 5IFAL 3RWIB 3OKNB 1I8LA 1MZZA 1R5IA 3ARSA 5KSAB 1WK0A 1WFIA 4MQ7B 1A7QL 3IWUA 4IU3B 3KJ4B 1E50A 2F7PA 4LXFA 1S9YA 4YHPA 5DUJA 5JNYB 1TLMA 3KJ6H 2WXMA 2J3SA 2X6AA 4H8HA 4RAVB 1S7VB 2EP6A 3TPUA 4LCUB 2VN3A 2OMTB 2BSRB 5BZZA 1NZRA 1IUZA 1U58B 2WAHA 4ERSL 1RK1B 3U4EB 5JXEC 1LEIB 5HGBB 1VCBC 1QFWM 3QWRD 4QRRB 4OJFH 1WEJH 3H7BA 5DEFB 1E7UA 3TBWB 2EVHA 3U9UA 3V0HA 2ZX7A 4RMTA 4DNLA 3NP3A 2YSSB 4AIXA 1ZXKA 2I7SA 3FCTB 3HKFA 5B4MD 2YAOA 4G7RB 4R9HA 4UAOC 1T5KA 1WIUA 3BVDB 3EJJX 5FC9A 2DY2A 1QFUL 5AUMB 1ZA3A 4XMPH 5KS9B 4JPQA 5T1JA 3OZKA 3VSVA 1EZUA 4WWKB 1GAFH 3D50A 1KXVA 2Q7YB 3VXUB 3HS0C 1H5BB 2V2WA 3AS0A 1EDQA 1QQDB 5ANHA 3T0WA 2G9HA 4N0UB 3CVHL 3GB7B 3ZHDA 5IROC 1GZHC 4OB5L 3BP6B 3NZHH 3E1ZA 5KSBA 3ZTEA 4L4TE 3FOMA 4M1CC 4XVJL 1KCVL 1KLFB 1YJDC 2DBJA 3KS0J 3K6NA 4UBDC 5AVZB 2W80C 3IK2A 3LSOB 4Q0XL 3RKPA 3TBTA 5I1JH 1X5LA 3P11H 2HX8A 4JRXB 5IQ7L 3ZDZB 1SLUA 4K94H 2KI6A 3HN3A 3CHOA 5CF3A 1H6EA 3MACL 1DO6A 5GS2H 4YS4A 1WS8A 4FHJA 1S5IL 1T89C 1MJJB 2GUOB 2VB5A 4QT5A 1E5CA 4IHOB 3S4SG 3BP5A 4ZXBB 3BKJL 4MBRA 5JPMC 2ADIA 2OTUA 3QR2A 3QO1A 3TX4A 3H1ZA 2L04A 3JUYA 2OTPA 2NY1C 3MV9B 3EH4B 2R0KH 3X12B 5C0IA 4HEME 3GXFA 2DM4A 2Y7NA 1HSBA 3D0VA 1F3RB 4LLUA 5D1QB 3S5YA 5BV7C 4HEPA 2KPWA 1FO0H 2P48B 3H9SB 4G9FD 1ZHBB 1ZVYA 4MNGA 4NC2B 5TDOA 5D1ZA 1UTDA 1ORQA 1IGJA 1QTPA 4KX7A 1HE7A 3VFWA 4M4RA 2CKNA 3HBPA 2PMZA 4HIPA 4S0SD 5E6ZA 4WAFA 2ZAIA 2FX9L 2XVGA 4Y19E 4Q4IA 4LEXL 1VFUA 4ZFOL 3T0ED 1XAKA 3S5LA 4EZLA 2DQTH 2YD2A 5D7LA 1AZVA 1B4RA 5C8JB 1CU4L 5JHDA 2MQ0A 3J7HA 32C2A 1TQBC 2C9PA 3C5JA 4ZBJA 3V0IA 1XMEB 4F3FB 3F3HA 3CN1A 2PW2B 2X4QB 4Y1SA 1PD0A 1XXFC 2EE9A 2VERN 3TA3B 3FTYA 4HZLA 4P2QB 5FM5M 4JFYB 1KJ2A 1BBJA 2YJQA 1GOHA 2X4PB 4PJEA 2NY7H 2ZKYA 4N5ED 2QKIA 3FQNA 1YEIL 3QR0A 1AR2A 1G7JA 5J6HB 5I66A 1WDAA 1YNTA 4YBQC 3C60A 3PY9A 5GS0D 2ADGB 2NY5H 5BS0E 3VJ6B 3P9LB 1BYNA 2EE6A 2V5MA 5JPNB 3CFUA 4R0LC 4TSAL 4TUKH 1TNMA 1QEWA 3QUZC 3PJSA 4U3CA 2QEJA 3O8XB 3THMH 3MLYH 5IBTL 1PX8A 3QO0B 2V8MA 2XJLA 4PRHE 4RSYA 4MB4A 5E1HB 4PGEB 1R75A 1MLCA 4FQCL 3UG4A 4JM2F 4PJIB 4YE4L 4G82A 5DMGC 5EZJA 2ENQA 5ACZB 2DICA 4UT9H 1IAIM 3MLWH 4RGNC 4GXFA 2AJUL 4LLQB 2DEXX 3FN9A 4NNYA 3FT4A 1ERNA 4CMHC 3BEWB 4ELKA 1ITCA 1YN6A 1KYOJ 2Y36L 3WL9B 3GHPA 1FL3A 1U8QA 3QG7L 4X6DA 2R0LH 3G5XA 5D6CB 1MW0A 3RPBA 1KN4H 2BSTA 2W9DH 3MRNA 3BH8B 4LHUD 1ZLWK 3O4OC 3MRDB 3WFEL 1EMTH 3CVDA 4CGUB 2LW3A 4LSSL 3ULVL 4UOZA 1JXKA 2IMMA 3ALPA 3MXWH 4WV1A 3BD5A 2HJFB 3QUXC 1OIOA 5DSCA 3U6RA 5DZVA 3INUH 3SDDB 1ADQA 4EN3C 2NCEA 3HZKA 2NDGA 1U92B 2G2NA 3O0RL 3HHRB 4P23A 3HMXL 5TE6H 3IMBA 3WJMB 4JHAH 3IJ7A 4BSWB 3MV7E 2IDUA 3QNZA 3HLKA 1PZ5A 1R5VB 3CLEH 1K3ZA 2PW1B 3KPOB 5EBLB 3F2LA 4PBWD 1NMCB 2HCZX 2GHZA 4FXKA 1KTLB 4KKNA 3FO0H 5I1CH 1WSST 3WJLA 5A1AA 1B2WL 2PTTA 1ED3B 5AYQA 1AO7E 1FL5A 2J5LC 3EF4A 3GPEA 4G7SB 4LKXB 4EI6A 3PXLA 5F7MC 5KVFL 2AVFA 4HXAH 3RB5A 2QBWA 5J13B 4FNUA 3ULVF 4WTWA 1S7QA 2A6DB 2D0GA 2EICA 2J57A 1JWUA 3ESMA 1HC1A 4CN1A 4BE5A 1G6VK 3RPIA 1GS6X 1PLBA 1QSED 4J8RA 3NQKA 4RX4A 2NY2D 2Y5TB 1XVSA 2J71A 3ML8A 1Z9MA 2CK2A 2Y24A 4OQTL 3RQ3A 2GK2A 1TKWA 4PUBH 1D5IH 3MNWA 4U3SB 4XOAA 2OSXA 3WTTA 4YHOL 3S48A 5CEZH 3J27A 3T1WA 1Q72H 4PHZA 3UJJL 4PRPA 4E42B 2A2QT 4CVXA 4FQIH 4Q2ZA 5D7IA 5C0JB 3ECQA 1X6NA 2PR4H 4FP8H 4W9EC 3VFPA 2VIRB 3GFUA 2COVD 3NEXA 2CLZA 3OL2A 1RIHL 1GYVA 5B38A 2VDPB 5EF1A 3IGFA 4OF3A 1U8KB 4QOKE 4HK3J 4O2FA 4PY7A 5SX4H 3RDJA 1AI1L 3NSFA 1YEGH 4TN9A 3X3FH 3VACA 5DFVD 5GS1B 3N50A 1W6LA 4OIIH 1YPZE 5FK9A 3N06B 3CFKA 2LAAA 2QTVA 4M7ZC 4WJ5A 1TR7A 3TBBA 4HWEH 3EJCA 3MXVL 2C3HA 4JE4B 1U8MA 2QHRL 2YA1A 4M1GH 2AANA 5L4JA 2W9EL 3KLSA 3VGGA 1SZNA 2O5ZL 1FNGA 1I3VA 1QBBA 2ICCA 3IB4A 4NDMA 1HZHL 3DVIA 4LHUG 2Y2YA 4J6IA 4Y2DC 3Q2LA 2R0WL 5GJTH 4X98B 1XF1A 3RWHA 1BZDA 2RCSL 1JZ3A 1NGWB 4PJCF 5HDQH 3RDTB 1T0NA 4ZNEA 3CDFA 2W1NA 4XH2A 3N1MC 1J0HA 4I3RL 4YE0A 5PCYA 3AJ7A 1E0OB 1NCBL 1RUPL 1T83C 5F7KC 3RJQB 2UXFA 1SXCA 2XPGA 3PYCA 4HIEB 4N0CC 4QRPD 3C09C 1F1GA 3VYNA 3N9GH 4B3VA 3SKNB 4NZTH 4H8PA 1LWJA 5AEAA 3WEXA 2VYRE 1XF5B 1NSNH 2QFPA 2Y69B 5GGSA 3K4DA 4AGLA 5BUPA 1JGEA 1JF6A 5JO5B 1DZ0A 3ROLB 2W94A 4M43H 3OHXB 2BSSA 5A2LH 43CAA 1WA1X 5HHOB 5ACMA 1IGTB 3M86A 4KMTL 4XP4H 4ZRGA 1ITBB 1PY4A 4KUZH 4Z95L 1FA4A 1KB5H 4K3JH 2X70A 3ECWA 4IRSB 4DSYA 3MTRA 4F8PA 2W0FA 2YRZA 3F7VA 5DMKB 5DD3L 1KXQA 4GW1B 1MREL 5LVEA 1OTUC 1TVHB 3QNYA 2J88L 1CD1B 5T3ZE 3TBYA 4B9CA 5JIKA 2P7TB 4HA1A 3U7WL 2ZSWB 2R59A 4KXBA 3A67H 3O45A 3I9IA 5TGBB 3WFBL 4FXLA 1H19A 4J6RH 4OFDA 5IKCB 3LN9A 3UROR 4ANUA 2CKBA 1Y18A 3OPZH 2ZUTA 4ZMXA 3RNKB 5HBBA 4X5WB 1JDCA 1KN2H 3S8WA 4JNXA 3RBSA 1T5XA 4DUXA 2BZCA 1F41A 1JZFA 3U36A 4FQXC 3D4CA 4K7FB 3VTMA 4MQTB 2WLKA 5DT1H 4HWBA 3RUGB 4DN3L 1XWVA 3SKMB 3FQ1A 4I5BA 3UYRH 1P7HL 2X2JA 4GMTH 4U49A 3I50L 2DQCH 2OZ4L 4QMEA 5B8CA 3NBNA 4DF9A 2KC0A 1XCTB 3U83A 4NYLB 4OCXL 1YLBB 5I76B 2D03H 2JB6A 4WI9A 1DQJB 4YFDB 4ZD3H 3GSUA 1DCLA 3LRKA 3VXME 2E6QA 4BIKA 4GAYB 5IROD 1MRFH 4UILH 5FO8A 2HRPH 3GMOB 3DO7A 2X6UA 3FU5A 2VAAB 4GSDH 1PPIA 1A9EB 3ULVC 4LCCB 2IO5A 4W9LC 4ZUVB 3GGWA 1BZ7B 3MNVA 4QDGA 2XLLA 3B9KD 2K9FB 4J23A 3G5WA 3ZPDA 5GZOC 4CKVX 1WO2A 4UNUA 5H37A 5B1AB 1JNLH 3NCMA 5GS0H 5J0BA 5DI8A 3NIGF 5C2BH 1TYJA 1REIA 5ANMB 3QDHA 3RWEB 1FZOB 4N9OB 3B5GA 3C6EA 5GGTL 5I1GL 3QPQC 3LMJL 2P1YA 1JPFB 1P84K 3HNVH 2V5RA 4MA1B 4Z3JA 4Z7VA 4DK5A 3C6LB 2R69L 1TENA 3HUJF 4NRZB 3IAPA 1BF8A 4KVCL 1DJGA 5J7CC 1TTAA 3TT3L 5CUSL 1ORSB 1LYQA 1MNUH 4HPOL 5CLXA 1J8SA 5TF1H 3DO3A 1U3HC 2ARJB 5MEOA 3FHQA 3JV6B 4LLMA 4U1LA 2Z31B 5IF0B 2PR9A 2YOCA 3ARBB 4JDEA 3LKQA 3FFCA 4UQBA 1JTPA 3E9TA 2UZPA 4DPBX 2VW6A 3ZZ1A 1YYMH 4AQ1C 2AQ1A 5B7MA 3T3MF 4WNJA 4G80B 2Y1YA 4FQJH 3X13A 4LL4A 4ENEC 3FUKA 4Y5VC 1G9EA 2VERA 4F2MA 3D2UA 4GUOA 4KH9A 5I6KA 4PS4H 4RBPK 2QVFB 2J1KA 3JUZA 3LH2L 3QBTB 3CQFA 3C5ZB 2KLSA 5A16B 3ULVE 3FUDA 3MX0A 1TZOA 4G8FB 1TQSA 4G2AA 2DTMH 5CMAB 3QUZD 2KQNA 3EOTH 1J1OL 3KL3A 1MAJA 3HE6A 3IGAB 3B7TA 2NSXA 1BJ1H 2H0JA 1KIUA 4EDWH 1NDMA 1IAOB 5C0AE 2Y7QA 4WENB 2VRAA 1H3PL 2E8ZA 3DWTA 1KCUL 4PG9A 4EIGB 4Z23A 2X88A 3MRMA 4RGND 5HYEA 4NUMA 4MD0A 2EDXA 3LEYL 4M5ZH 3GIVB 1QBMH 3QDJD 4BA0A 3QR1A 5CZRA 5FB8A 5DK2A 1JTOA 2YPLB 3MJ8A 1WZ1L 4H26B 2PCFA 1A0QH 4OTXL 3WCYA 4NBYB 3GJFB 1AGCB 1K8DA 4JFDD 4F7EB 2I07B 3DX0A 5JA8B 2V2XA 3A6OA 2N4IA 4XR8C 2DDQL 3FN0L 3BH4A 4GLRI 4GXVH 3CZNA 2QVIA 1GKEA 1SEQL 2C1PB 4W4OA 1JD7A 3EGSB 1KIRA 3BP4B 4BQ6A 3SGKC 1KNOA 3TH3T 3DBXA 3VWJB 1AQDB 3ILDA 1CICD 2VRQA 1S3RA 3ROOA 1A66A 1GIGL 1CGSL 3ZKQD 2G3ZA 4ZX3A 1EO5A 3MKGA 4UV7H 1F1DA 3UH8A 4UOJA 4H5SA 1XGPB 2GTWA 4MMYB 3O6LL 2ZT9C 3E8VA 3L4UA 3HNTL 1PYWA 1K2DA 3L17A 3OBAA 5I15H 1NQBA 1PMYA 3LS5H 4GFTB 4LMQE 3S9DB 5ILTL 3CC5B 5BMFL 2IAMC 2CJ3A 2O5XH 2VDML 5D4QA 2CRZA 2OL3A 1Y6NR 2E59A 3ILPA 1F4WL 2ZOKA 4PJ7B 1LQSR 5CEXB 4DGIL 3RWGB 3D51A 1CDBA 4MDJB 1OGAD 2X1WL 2BPBA 1UZ8A 1OP5H 4DKDC 4I13B 5GZNA 4F15C 4H44C 4DOHE 5IQ9A 3P3UA 3O3AB 4X5XA 2CGRL 2R2EA 1QLEH 3BHBB 4OLZH 1E5ZA 3CFJB 1F42A 3UZVA 4W1TA 1JSYA 4GFXA 4HCGA 1IQWH 2W0KA 1JYVA 3VW3H 3LNGA 1NPNA 3CH8A 3NCYS 3A6BL 4U0RB 5D8JH 3WXWH 5J11C 2YC1B 3RWIA 3HBZA 5D7JD 5EZPA 5KSAA 3FB5B 3NJFA 3SDAA 2BERA 2ZYSA 3TJPA 5IHWA 5GPRA 1UEYA 4LCWD 3O2DH 1S7VA 4A38A 1G9HA 3IE9A 4LCUA 5I75B 1A6ZB 2OMTA 4UDTB 1RK1A 3FTZA 5IOPA 1EAOA 5HGBA 4KROB 1T6WA 2NOYA 2NY0C 1IM9D 3MGOB 3T71A 3W82A 4RSVA 4QRRA 3KGRA 1RP8A 4AMXA 5JW3L 3QI9B 4Y1AE 2UWEB 5IV2B 4L0PB 2CK0H 2VDNH 1OPOA 2EH7L 2YSSA 2R83A 2YZ1A 2EO1A 4KX8A 4N2DA 4E5XB 5JHLH 3LEXB 2HRHA 4KMQA 2ZX5A 4S1SL 3RWFA 4MA8L 1NAKH 3V52L 2WLLB 3KDPB 4WW2A 2W0PA 5T5NF 5KS9A 4Z6AT 3QFDB 2A9AA 4IKNA 1HIMH 4WWKA 4L3CB 1HCVA 3TEYA 3TIEB 4P9MH 2Q7YA 3VXUA 5D9SB 3RILA 2H1PL 5JA9A 3ALXA 4LPCA 1QQDA 4JO4H 1EANA 2FD6L 3L5XH 1RSFA 4Q74A 5LDSA 2ICWJ 2H32A 3BEVB 4K0OA 1MQKH 2Z6FA 3ET9F 3KNBB 2ZNXA 3BP6A 4YHZL 2R1XA 4IQHA 4NJAH 1TSHA 4EI5D 4UZUA 3V2AR 1ET5A 3LSOA 1NCDL 3BCDA 4AM0B 2FLBT 5ALCH 1F90H 3BH9A 1ZGLP 1IIIA 2WTRA 4P4RB 2GAZB 1A25A 1YAIA 3TCXA 3BQUB 3UTPE 5ISZB 3GTVA 1ZTXL 1P7QD 1T20B 3DPBB 3MRBB 1RUML 3OQ3B 3OB0K 2R51A 5BRPA 2LR4A 1N6QH 1YVLA 5E9DE 1M6UA 1MJJA 2GUOA 3M17B 1FVDB 3FBQA 2EZ0C 4IHOA 4TLSA 4ZXBA 1ZLVH 3K0YA 1JG9A 3NA9L 3R7RA 1BVNP 1E4WH 1QSFE 1ZS8B 3LB6D 4NNPL 5JOEA 4EUPA 3DNKA 4C56D 2Z7YA 3OZ9L 1E5YA 3QS2A 3FPYA 2UYLA 1DJWA 1OXYA 2GC7C 4KGJA 2EDOA 1I85A 4KY2A 3NZ8B 4QXWA 4CW1A 5IFHL 2Z91B 3PFUA 4TLUA 4WTZA 3IRPX 4RETB 3UO1L 4C57C 4PY8J 3C87A 3W0WD 2BIIA 3DHUA 3I02B 3Q01A 1FORH 1JRHH 2J7LA 4UIMB 3FZUC 2L7JA 2WUBL 3HUJE 4HD5A 5FUOH 3AQZA 1H15A 4FF9A 2W92A 4CVWA 1Y0LB 3WIHA 3FMGH 1AGDB 3QJFB 4V1DB 4OZGF 2J55A 1G7QB 1G9ML 2XBDA 1AYOA 4CVZB 4XTRD 2O6PA 3MODL 4Y88A 4DP7X 5BV7H 3LIZH 3MROA 1FG2B 1M6OA 2QKSA 5DA0B 2PW2A 1DVYA 3F6LA 3NRQA 4HUNB 4WRLA 3WSQL 3TA3A 2WXKA 4P2QA 4MS8D 4F8LA 1QRNB 3AABA 4RZKA 4JFYA 1PL3A 4FABL 4G8GE 4H8VA 4L4VB 1BOGB 5H8DA 5FYLL 5BO1L 2WCSA 3FCGA 2GJ6D 4R2GC 3BKMH 4UYPA 3EH1A 5FM8A 5J6HA 1PZUB 2CNYA 5F9WC 1IGCL 2GFBB 3RHWK 3WFZA 4BZ2L 4B9IA 1IC4L 1OCOB 4Y5XC 1U8HB 5EWIH 2Q3XA 1CE1H 1CE6B 4FLSA 4DK3A 5JLZB 2Y7OA 1WJ3A 3UOAB 1DANT 3O8XA 1TZIA 4AQEB 1QO3B 5I6NA 3LXBA 5FUZL 4OT1H 12E8H 2V9UA 5DF0A 2XUWA 3UG5A 4QNPE 1ND0B 4PGEA 1SDDB 4LVHB 3U9PL 2VISB 2JKWA 3EOYG 4PJIA 5ESQB 1LK3H 4OD1H 3EYSH 3FU9A 5ACZA 1JZ5A 1FFNB 3HPLB 3FFOA 5CZKA 2ADFL 3PRZA 2HFFB 4X7CC 4LLQA 1BZ9A 2P5WB 1XH1A 1A4BA 3KVDD 3C5SB 4CA4A 4CSPA 3BEWA 5EU6D 4L8BA 2WVVB 5I5JA 3FU0A 4BUGA 1OW0C 3BSZA 1UJ3B 2PWGA 3BMWA 1JI2A 4HKZB 3RFZC 1M3IA 2CDFB 4KRLB 3BH8A 3MRDA 3QPQD 3C8DA 4U7KA 4HLEA 5FGSA 4N2NA 2HJFA 1BF5A 1OSYA 3GMNB 1U8IB 2XQBL 5AB0A 2KZWA 1DVUA 5D1XE 3SD2A 2QADC 3HBGA 4U1HB 1PJ9A 3MV8A 4PW3A 5KVEH 3QIWB 2O61A 3O4LB 3OR7B 2JKIS 4YSTA 3NPSB 4LSUL 2VAJA 3WJMA 4X4ME 3VSUA 2GI0A 4BSWA 5J1TC 2A1WH 2GITB 4P05A 2PXYA 1U3HD 4XP9H 3RBGA 5ICYA 3MLZL 1S7RB 4M56A 5L0QB 5EBLA 3KVPA 3O6ML 3W11D 3RVTC 3VFNB 4N2CA 1G94A 2FSEB 4ORGB 4F1ZA 3QFJB 4YZFF 4M7KL 1R34A 1CK0H 1MPAL 4PJXF 2P5EE 4ENED 1GXEA 5D1ZI 3HVNA 3VI3F 2FBJL 3KM2A 4QXTB 1HNGA 3G6JF 1EHLL 2WLMA 5I0DA 2WUCL 1HHIA 1CZ8H 1UOLA 3P0YL 4G1MA 4IKLA 4IEFB 4RFNB 5BXFB 3N5AA 4MTMA 1KGXA 4OM0H 4JFEA 4Q89A 2ATKB 1FC2D 1G6RB 2PN5A 5E6IB 5EUKA 1BA9A 2VDLL 4MJ4A 1ZJAA 4KZEH 3B8YA 5JYLA 3DX7B 4PS7A 4DQOL 1AG6A 2E56A 3UXFA 2XZQH 3EO1B 4XPAH 3FT3B 4U2ZA 3UZEC 3MNDA 2DQUH 1FZJB 4Y4KA 3H9HB 4FFZH 2O5YL 3RZCB 2UUDH 1TITA 1DJIA 4MJ2A 4OW6A 3IDMB 1C12B 1E8WA 3MGTB 3L9EA 2VIRA 3HC3H 2NZ9D 1OAYL 3JV4B 4JZOB 1KJ3H 4JCWA 3Q48A 2Q8BH 2FJUB 4NLHA 1A4JB 1F56A 3PDDA 5LBSH 5C0BE 1PKOA 3SDCC 3UEZA 2WW8A 3U2SB 3FQXB 4FZ8H 2OSLB 3V0AC 4NLAA 1QLRB 4Q97A 2CXGA 1ET7A 2HPTA 2VXUH 2E7CA 1YYLH 2CO4A 3VGAC 1S6NA 3RL2B 5AOMA 2XTJC 4O58H 2BNQB 2L4OA 3P9MB 2NNCA 3AB0C 5DO2D 3CFCL 2NSMA 4FFWD 2RA1A 4QTHB 1IBYA 2X1QA 1KGCD 3V0GA 1BZEA 4KTDH 4POUB 2XZZA 3SO3C 4G42A 5CLYA 2EH8H 2BNUA 2J2ZA 4ZUUB 1EX0A 4Z7UE 1AIZA 1SOSA 1UXMA 1L3NA 4X98A 2XXMB 3GKWH 3IMWA 2A6IB 5LGHH 3R4RA 1JAEA 3V10A 3MJ9A 4LE8A 2P4AB 1NGWA 4RMSA 3BGMA 4NWTH 4U1NB 3RDTA 4MMZB 5FDWB 1HEZB 4AL8H 1FLRH 5IQ7H 2IAMD 3FUEA 3HG0A 1Q9WB 1W72B 5EDSA 2QZQA 4HIEA 1CC3A 5CEZE 5DQDH 4LRNL 4AXWB 2FE0A 3VD1A 3WIAA 3EO0B 3SKNA 4LF3B 5HHPB 1JGUH 1XF5A 1MN4A 2H2SC 2Z4TA 1KWKA 1EXHA 5KSVB 5EEZA 3I2CH 4M3JA 2X6VA 1HKLH 4JY6B 4KPHL 1GMEA 1U4FA 5FWRA 4KQ4H 5AZEL 5E6UB 4IBWA 2R2HA 3GBNL 5FYKU 4K23L 4ODBD 4U31A 3ROLA 3OHXA 2NYYD 3KYKL 1O6VA 4K3EH 1KBVA 1QBAA 1G9MC 3LH8A 1FGNH 1FFQA 1IGTA 4F57H 3HB3B 4AEHH 5F88A 4OLVH 5DJYA 4NQCB 5E00A 5HDBF 5KZCD 4YX2H 3Q8FA 4GT0A 4GW1A 1NFKA 4FXGB 2DJMA 1B2YA 1TVHA 2B4CH 2HRGA 1DJXA 1UENA 4HG4K 5I5IA 4L9LB 1CD1A 3U4BH 3L81A 4UOQA 1K6QL 4NXKA 2ZSWA 3B3IB 4IRZA 4F8OA 4YXLL 1H6FA 3O2VL 4K4KA 1F58H 1NEZA 4KO9A 4XMUA 3BLKA 4QD2E 5TGBA 1BAWA 1CU4H 4OKDA 4EVNB 4FJZA 1I1YA 1K72A 2E0PA 5IKCA 3BKYH 3GI8H 3KPQA 3KW8A 4MJID 4GO8A 4PBVC 3DV4B 1ZTXE 3NCJH 4HUVB 5BRZD 5M94B 3FRUB 1C8PA 1HNYA 5EH1A 4O2EA 2XHNA 4OZGE 1D6EB 4LPYA 3RIKA 5J5EA 4YSEA 3JZ7A 4IJ3B 3RUGA 3SKMA 2BWQA 1E27B 4LARL 1NUGA 4X50A 5IBUB 1TQCC 3HN8A 4P07A 1EBAA 4CSZA 3GLEA 3O11B 4PR5B 2X4UB 3G04B 4NYLA 5I76A 3QXWA 2PP9A 1IRAY 1DQJA 2DM3A 1ZLWH 1A6VH 3OM3B 2ZG1A 3H3BC 4Y2NA 3PUUA 3TVMC 4M5YH 5C08E 4AYFB 1TZHB 2V33A 1TPXC 4ZPVB 5IESL 4XPHL 1YQVH 3QIUD 3IMUA 3GMOA 3VB8A 4CMMB 2JF1A 4ZUWB 5I1AB 5AQ0A 2H6UA 5T33L 4NJ9L 5C9JA 4FQCH 1NFIA 1WV7T 1WFMA 2VR6A 1DEDA 1RULL 1QA9B 1OANA 3RIAK 3RNQB 3S3CB 3SYCA 2AV7B 1OWRM 2YBGA 1BOYA 1Z66A 2AJUH 2ARWA 5D4HA 4DCQB 1CF8L 1UM4L 2IADA 1M2OA 4YPJA 4I18A 1V3JA 3IS1X 5A2BA 5DMIL 2R23B 4ZTOH 3PL6D 3KM1A 1VGEL 3ML9A 3TBVB 4ZO6A 1I8MA 4PM1A 1N6VA 4KQ3H 4NWUL 2G60L 4JZJC 2JNZA 2FX7H 3FTGA 3KYMA 2XN9D 2PTVA 3TN0B 2BS71 3LRSA 4N6RB 4OF0A 3RWEA 1J10A 4Z76B 1FZOA 5FYKL 3ARED 5HPMA 1P7KB 5JIPA 1EUUA 2W5PA 1JPFA 4QOKB 3JVGA 3HMXH 4FMFA 2R2BB 5LQBH 2X10A 4GRLC 3TYFA 2YPVA 4NKOB 5AAMC 1BECA 3KR3L 1YPZB 3N42F 4XT1C 3S7GA 4ONHB 1BPVA 1IBZA 2JXMA 7PCYA 4FQ1H 4HOWA 5EN2B 1ORSA 5B1KA 1B2WH