2CNZA

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (v13a mutant)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
total genus 23
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cnzA00
2CO1A 4OR1A 2CO3A 3UIZA 3UIYA 2CO2A 2AXWA 2CNZA 2IXQA 2FVNA 5D55A 2CO4A 2CO6A 2CO7A 2CNYA 4PHXA
chains in the Genus database with same CATH superfamily
3L8QA 3G6JA 4UOQA 1D5BA 2WLZA 5JPMB 1NEZG 1KXQA 1RJZB 3D6GA 3O8XC 1JXJA 4I13B 4ACTA 3FQUB 2VN3A 4N2OA 3UAJA 1CGSL 1M71A 5CU5A 1P7HL 2Y36H 4KQ4L 2Y7NA 3BUQA 5JW4M 5E99H 2P28B 3Q2NA 2OCJA 4X9HA 2F9BT 3CFMA 4W4OA 3QFJD 3RWFB 4JPVH 5EC1B 4PVBA 4NC2B 1R3HB 1S4IA 2DKMA 2VE6B 3VRIB 4JFPB 4I0KA 2GJZB 3C87A 1QSEE 4RDQF 4IIZA 2HJKA 2QKIB 2F54A 4LLYA 1JF6A 3GZKA 1RIHH 1CB4A 4XWGH 5FK9B 3D07A 5GS1C 1P7KA 5DJCB 4YSQA 1U6AL 2QKIC 1VACB 2X6MA 3PWVB 2KYIA 4HXAL 4L4JA 2AAVA 3E8VA 1MWAA 4F3FB 3UZEC 1CN4A 2BERA 3CC1A 3NZ8A 2HSIA 2B0SL 1L0QA 1J10A 1ZLWK 2OMTB 4R26H 2EC8A 4J3BA 2DV6A 1J8RA 1L6PA 4YBQC 3DYOA 1P5VB 5CGYD 4V33A 3MOAL 1WSST 1E4WH 2XNAA 4LXFA 5CJOL 5C9JA 1XDTT 1CGVA 1FZJA 3LHPL 5F70A 3PL6A 3BISA 4PJ6A 2JI3A 4WKXA 1BSIA 4ZSOE 2ATKB 3E7JA 4Y2DA 3I50H 1HAWA 3FRUA 2ICEC 5KUKA 4QKXB 3UZQA 3DDFA 5BZWB 1HSBB 5AAWC 1LK3H 1KY6A 1NWPA 1BD2E 4BA0A 1TVHB 2BVOA 1BXUA 3EF7A 1UQSA 3LQZA 2YAOA 3GMOA 2K3HA 4HCIA 2EICA 1VGEL 1I9RH 2VAAA 4JGMA 2EH7H 3QQ9C 3K80A 1OQXA 4LNVA 3S7GA 4AQ1C 4ZMZA 5C0NC 1GZHA 5C0BB 4JRXD 1WCQA 2VSKB 2DY2A 1I3GH 1M42A 4CRPA 5FCSH 2LV4A 4Q2ZB 3MRRB 3E0GA 3QPXH 5IROA 3V4PA 2O5YL 3RY5A 3LQAL 2XZCH 3IT8D 5AAMA 4DVRH 4YE4H 2NY5L 4JHBA 4MAUL 2EP6A 5DQJB 5JXAL 3S8FB 4UOZA 4M8VA 4MX7A 3ULUE 3FOMB 2ZXEB 4LL9A 5IJKA 3B9KA 2PW2A 1XT5A 5FO9A 3WOVA 1Y6MR 3DK0A 3MA7B 3NP3A 1QYGL 4WFHD 3LRSA 1CK0L 3AADB 4GLRH 5GPRA 4LASH 3Q6FA 3QIWB 5C2UB 3C5JB 2DEYX 2FUTA 3B5TA 3RP1A 1IBBA 4I9XA 2ADJA 2IOIA 2Z64C 4PW3A 5I0ZA 2ADIB 3DMMD 4JFYA 5KSBE 1YSOA 3LV3A 3V8OA 3H56A 3GTVA 4OF0A 5C0IA 3V0EA 2Q76B 1IFGA 3P9MA 4YZFF 2NNFA 5E8OB 1QSVA 3LN9A 2PCPA 5A3IC 4G8AC 2CGRL 5L2JA 1H3UA 3PLYA 2J6EA 3B83A 4AC2A 1DBMH 1ZCRA 4FQXC 4Z7UB 3UTQB 2IV8A 3O11A 1A1OA 1KPVB 2AJ3B 1NM9A 1LO0H 4N0YL 1S7VA 1IAOA 1UGKA 4LAJH 1AHWC 2NW3B 1KJ2H 4M93B 3V7AE 5LBSL 4DT2A 3WEXB 1GJWA 1N64L 3EJUA 3I3DA 3NCYS 1P1ZA 2QKSA 3IU3A 3DGCR 2P8MA 2H32H 4FKHA 2DMCA 1ZLUH 1AGCB 2ZX9A 2VR4A 3SDYL 3FN0H 1KYFA 1ETA1 3NJVA 3P30L 3FSVA 5HDLA 2ZOKA 3HC0A 2DBLL 3OHMB 1ETJA 2GK0A 4DK5A 1UJ3B 1QLEL 5JOPE 4G8IB 5C0JB 1MZYA 3AY4A 4XZUA 1BM7A 4GAYA 4KI5C 4XPTL 5IB3B 4NKIL 4R96A 3RVUD 2IAMD 2BWDA 3O2WL 4PRIE 5FA4B 5HYSG 4MGXA 2DI8A 4G7QB 4A6YB 3QBTB 4XMPH 5T3XL 3FQRA 4Z0BH 3BN3B 5D70L 4X98A 4U05A 4OGAC 2GTZB 3JV4B 1FPTL 2OA9A 4JL1A 43C9B 2RAMA 1SM3L 2NT1A 4NQXB 3FB7A 1BFVH 2R39A 4XO8A 1HQ4A 1H6FA 5I74C 4AJYV 3HNSH 5IMOA 3N42F 4KROC 5JXEA 3AS0A 5F1SA 2BIHA 5D1XD 3AY4C 2AEQL 4GRMA 4F7KA 1IT9H 4U6VL 5DJ0B 4L3EA 5D7LE 5AVVB 1ZGLP 4YFDB 2A74A 1N5AB 4FLOA 4JLRA 5MENA 2F53B 2YPLD 4PRPA 4GB9A 4OJYA 2DWTA 3PGDB 4O2FB 3QJVB 3HB3C 2C9XA 4W6WB 4WU5A 5HHQA 3CJJA 4BQCA 2CGYA 4PRBB 1SJMA 5DI8B 1BLNB 3UYOD 1MW3A 4J3OD 1UT2A 1PSKL 2WP3O 3F6LA 4NX0A 4YXLH 1A5FL 4J3WA 4Y16D 4NDMA 1ZWIB 2HX8A 4X5RA 5E23A 3FFCD 5AW6B 5B1CA 2X4QA 2H0FA 8PAZA 3L3OB 2YQ2A 3NQIA 3GC3A 1D5ZA 3DXAA 5CN1A 3KYMA 2PP7A 5ID0B 4OZHA 3VH8G 4Y4KB 5KVFH 1J1XH 1D5MA 4PJHB 1BBJB 1A4AA 2NXYC 2F54E 2W9EL 1H5BA 3PV7A 3MJ9H 4FCHA 4U1MA 3SPCA 4R83A 4EI0A 1DQTA 5IR1A 5J12B 1HQRB 3AWFA 4MD5B 4AMWA 3TF7C 2WTOA 3H1ZA 3QWRD 1AMXA 4GKLA 2VMEA 2WY3B 5D6DA 3U9WA 4UM9D 4JZNA 2YSTA 4WSGA 5FO9B 4XVSL 2X2IA 1A9VA 4AJVA 4LOUC 2YARA 2SEBB 3QRBA 4XP9H 4UF7C 4X4XB 5AVQB 5HYQB 3BPNB 4YUEH 1MWAH 1IV8A 4KTDH 2NY1D 1BFTA 1H3GA 4GEIA 5D1ZB 1ITBB 1JD9A 3MRBA 2FT6A 4LSPH 4L0ZA 2DQTL 2YEZA 5ITBL 3ZTNH 1AGBA 3D69B 2ZPKH 2XTLA 4O2FA 4FMFA 5EIIB 5I8CA 4AW4A 2L3BA 3MRFB 4P2RD 5DFAA 2ZUQC 1KFAH 4F8NA 4KFMA 2PCPB 4JY5H 3HZMA 3TIEB 4ES9A 3PPSA 2DW5A 3EJTA 2DQUL 5K9KA 1DVXA 4C56A 2XA8L 1NAMA 2Y1YA 3BKCH 5DZJA 4LVNC 4EDWL 2EVFA 5LQBH 3RWDA 2ED6A 2Z65C 4APXA 3OKNB 3QUML 3ZE0E 3KPRD 2IQ9L 3MV7B 1YQ2A 2XG5B 2GT9B 5E56A 1FNAA 3KPMA 4PLOB 2JCCF 3PQYE 2IPTL 1I9JH 2OSXA 5EF0A 3TT3H 2VB5A 4LOFA 5KZCD 3QQ3B 2ZOTA 1NC4A 4YIQA 1USZA 3KLQA 5D1QD 1ZD6A 3HAEH 3IDGA 3T4AC 2XY2A 3MRQB 4Z78A 4K7PL 3L1EA 4JCLA 3SDXE 3WEAA 3JZYA 3D2UA 3GUFA 4QRTB 5C0FB 2BINA 3ATEA 5E6YA 3B7SA 2Y5TA 4N8CL 1JFQL 3E6FB 2Y7LA 5ALBL 4NQXA 2FSDA 1HINH 2X4UB 4N5EC 4U6XB 4NCC1 5EF2A 1R75A 5I1AB 1E8ZA 4QPEA 3ZKSD 5KS9B 4GMTH 4TNEA 2ED8A 2JWYA 2BHUA 3MNZB 1D9KC 4LLMB 5LWYH 1VGKA 1DVYA 2A9ML 4A6YA 1E8XA 3TBCA 5GSVA 4TSAH 3UBGA 2IBBA 3F84A 1VFOA 5TDPA 2WSKA 3HN3A 5BRZA 2FR4A 4BUGA 2NW3A 4KK9C 3THML 2CJTA 1EXUB 3REVB 3KDMA 3U48A 1S8DA 5CM1A 2FDBP 4R5TA 3KPRB 1KGJA 2ZSWB 3TA4D 4ABUA 4OI8A 2YMXH 4OV5B 1A8ZA 1UCBL 2XG4B 4F7CB 5SWSD 4PB9H 5AW2B 4GBXB 3IYLW 2BHYA 1OLLA 3DO3A 5IGXH 3K2KA 4GKOA 3FT9A 5E2TH 3TNNB 4GG6B 3ZSSA 4M3HA 4GG8A 3GM0A 4AYFB 3LRMA 3M46A 3MV01 3WEBA 1CE6B 4Y9GA 4JBSA 2MQGA 5JUEH 3UTTE 4KOCA 3MRDA 3W0WD 1IARB 5I1HH 1M6OA 4LOEA 5KSAD 3RDTD 3H9HB 3VSUA 4K23L 1O6TA 4Z7NE 4LSRH 3CPUA 4JFQB 5HP5A 2DL9A 5J6HA 3S34H 4ZMNA 1OP3K 5JMRA 1ZANH 1COBA 4ENEC 1KIRA 3BUTA 5KVFL 1UTDA 4F37F 1ZS2A 2C9UA 2ED7A 3KPPA 4RZCA 1WLHA 3NRFA 1QKZH 4FI8A 5I75C 2A9CA 5DJAA 1FL3A 3GSNB 1BOGA 1MFUA 1P4IH 2ZWLT 2EUVA 3BT2L 3DBXA 1EANA 1RKRA 3ZMRA 5HJDA 3F7PC 1XD1A 2AZUA 3VRLE 5BS0D 4GQRA 1HIMH 1IKFL 4H0LC 4JHUA 4HPYH 4LHUA 4Y2OB 2R29H 4Y7MA 5B39B 4B50A 4BFIA 3BMWA 3Q1SH 2HJKB 1N7ML 2QKIA 4LLYB 4UBDD 4TULL 2Y4SA 3SPIA 4YK4B 4BZYA 4FXGB 1KGYE 4WNQB 2R0ZL 1E5CA 4KDTA 1SPDA 1AQKL 2O72A 1UWYA 4PJ7A 1XO8A 2X9ZA 5FM5O 2FWOA 2AEQH 3ATDA 4P23C 2P44B 4AQEB 5IOPA 5HD8D 3FULA 1O75A 1GZQA 3I85A 3MKGA 4QTFA 4UT9H 4XWOC 4YSDA 5DMGC 3TIDB 1NIFA 1M71B 5FHAL 4G6MH 3FSWA 1UACL 2I85A 4NNXB 3NPSB 3KLAB 4NQUA 4RBPK 1ID2A 3FPXA 3QEQA 2ICWI 3L9YA 4L0PB 2XI9A 5GRYA 1I3RA 4DHLA 2X44D 4AXWB 4BFFA 1C1EH 4ZTOL 1WWBX 3NJFA 4YSUA 1NCCL 1DEDA 3BD4A 3MCYA 3N0AA 5GS0D 3PYCA 2IQAA 2UVEA 3BEWB 3EUUA 3MCKA 4KVCH 1WC7A 4MQXC 4AUUA 4GAGL 1QRNB 2IH1B 2GFBB 3V6BR 1IAIM 3QG7H 4ZNCD 5L0QC 4NN5B 3SDAB 3WLBB 2VZTA 1YHPA 3UGUA 3FN0L 3CVHB 1W72A 3S5LG 1GL4B 1NGZA 5EO9A 5C0BA 2CRIA 3LZOA 1UXMA 4HAFA 4MB5A 4ZW3A 3WG7B 1NBVH 3ZPDA 2YRBA 3FH7A 3QXAB 3FT2B 3FYIB 1KJ2L 5EDXA 4FQ1L 3U7YL 3JWOH 2DMKA 3Q1EA 4JO1L 4UT7L 3LQZB 4EBQL 4H88H 1JZHA 3SPVB 1HHJB 3FTWA 3OSKA 3RUGF 4LPVA 3ZN6A 4HBQA 1B0RA 1BA9A 2FO8A 4NYLB 3WTUA 2L4OA 4P3DB 2IF7A 4WWKC 2BP5M 4EO5A 1E0OB 3E80A 2EXWC 3L3IB 3LS4L 1GOGA 4AEHH 3ZR6A 4GAAA 5C6WH 3WKMH 5JOFA 3BAEH 4OCNC 2JKIS 1OM9A 3FNKA 3MRLA 2PYFB 1CYGA 2EIEA 3FONB 5D7LD 5TF1L 1SMDA 3G6DL 4E9XA 1EHLH 2GSMB 1KCBA 1NMCB 2DKSA 1EAPA 4HEME 1DQML 1ZT4A 5JXED 3LHPH 3EOBB 2R27A 1KB5A 3VFUA 5D6CA 4IBVA 4H1LH 2P4AB 4G42A 4YHMH 3GGWB 4FP8H 1OY3B 1CF8L 5GQBA 4Q9QH 2P5WA 3KWUA 4M62H 3OWRA 4A68A 5CJQH 3LH2H 4MXQC 1KJMB 2XKNA 2BIQA 1B0WA 3U1PA 4AXWA 2XWEA 4ZZKA 4NZFA 1TCRB 5F0PB 2EDTA 1M1SA 3OKOA 5EU6D 3G5XA 3GBNL 1M57B 5TE7H 4TQEH 5D5MB 2AV7B 3QEQD 5I1JH 1MHCB 3H3PH 1BIIA 5BV7C 1EJFA 3HB3D 3V0VB 1ECYA 4E0RA 4J5VA 2EEBA 1FAKT 4P8QA 3OJDA 1S2EA 3SDAD 3MUY1 3US0A 2GW5A 3QJUB 2MNJB 1NOAA 4KKQA 1ZLUK 3GBEA 3TJPA 3VX0A 3ARBC 1T4WA 5I8KL 1EFQA 4C56E 1CIDA 3PCYA 1FN4B 1DVTA 4FG4A 4KJQD 3AG3B 1F1DA 1KV3A 3SZ6A 1WO2A 3TEYA 1KN2H 1S78C 2XFXB 1KJVB 3QXDA 1JTPA 5DJYB 4ESKA 1Z5YD 2DQMA 4CN1A 1KCVH 3A21A 5BUAA 1QBLL 1XV8A 4Z76A 4PRPE 4N2IA 5DS2A 1Y1DA 4GKSB 1GHFL 2ZX7A 2WKOA 3AG1B 1A7RH 1NCGA 1U3YA 4AVIA 4OCXH 3NFSH 4RMRA 4UILL 4GMSH 2I9LA 5CILH 2B1AL 2AJZA 4OLXL 1OB1A 2SODB 4X4ZA 5CBAA 2EC9U 1KLUA 2HT4C 3O11B 3HUJF 3OHXA 4W93A 5MP6H 2R8SH 4FTDA 2EKJA 4M7ZB 4PU2A 4WEUD 3QDHA 3IN2A 3F7VA 2GITA 4MNQE 3WTVA 2ADGB 4LIQE 4TNVK 1TNNA 2ZIDA 3BSHA 3QA3A 3IFPB 4QAMB 4R26L 4OCSH 2J1YA 5GJTL 1SOXA 4F58L 1Q90A 4RIRA 5EORL 4ODWA 1FORH 1AXTH 1N26A 1YY9D 4MXQD 4WNQA 3RJQB 3TV3H 5E8OA 4AKQA 1YEKL 1YN7B 3DJRA 2VXQL 3SD5A 2J5LC 1IQDB 3LRLA 1BVKB 1M6UA 4YXHH 4AM0Q 5ANMA 3SDCB 3X14B 1FG2A 1K4CA 4AIZA 4ZZFA 1JN6B 3F01A 4MNHA 5I1JL 1JFHA 2MMXA 3VU2A 5KVDE 3BLPX 2P45B 4TNGA 5TE7L 3VI3B 3RVWD 2WMPA 2XOTA 4PP2B 5EBMB 4POZD 5LB1A 1IC5L 4UZUA 4BH8A 2V7NB 4MMZB 1HOCA 4CDGC 2BP0A 3X1NA 4KJPD 2DZEA 4F80A 1GZPB 4NHCL 1JVOA 3ULVD 4YHIB 4RBPH 4JJHA 3D48R 2B20A 4X8JB 5K9QI 5INDB 1FO0H 3OJ2C 4ZW6A 5C6PB 3AROA 2K7PA 4R3SB 2GEEA 3WJMA 1P1VA 1FRGH 3ULUD 3MLVL 1A7OH 3FYEB 2I07B 4HOMA 1T1WB 2J2ZA 4YHZH 3VFPB 3UAJC 4EIUA 2ZJSL 2K70A 4TSCH 2YGOA 4G3YH 4PM1A 1OALA 5CKGA 3K91A 2HRGA 3NCYP 1JNNL 2F61A 5BJTB 5AAMC 4X4MA 1KCVL 3RX8A 4ENED 2VDMB 3ZHFA 3QJFB 1J1OL 4XXWC 4Z95L 1LWRA 2WBKA 2OK0L 1KNOA 3NIDB 2E7HA 4OIFA 1INEL 2A6DA 1PLGH 1HILA 1YYMH 2CD0A 3F64A 3FO0H 3H42H 1PAMA 2BXYA 1TFPA 1MFAH 3QP3A 1MNUH 4G9FE 4OFYD 4H44C 3L08A 2OQJA 3HW7A 3TO4B 2MWCA 3VYOA 3KLAA 4FHJA 5FS5A 4L1DA 4M8RA 3ARXA 2IDSA 3GZOA 4F33A 1J18A 1SUJA 1MCOH 1QSEB 1BWWA 4BYHA 4U1MB 4A6YH 1RZKH 3MR9B 1KTLB 1PZBA 4G7YL 1D7DA 2VXQA 4F5CA 5BVJB 1XF1A 3T0EA 1KIQB 3QAQA 5FEBA 4M1CC 5E1HB 3QPQD 1B9ZA 3L3GB 1AR2A 2HRHA 5FCUH 3RDTB 1RUAL 1TQTA 5JHDA 4OJEH 4PJDB 3FFCB 3VXQA 4P2AA 1PDKA 3UTTD 3QUYD 4ZMWA 1F1AA 3NCEB 5EU7E 2MIZA 2NXZB 3A6CH 1DQMH 1TIUA 5DR5H 3MV11 2X9YA 1ORSA 2K45A 1FE8H 1EPFA 3D2UB 5ESQA 1AP2B 4ERSL 2WB7A 1CDIA 1KGUA 4GUOA 4OD1H 3NJKA 3GK8L 2WGXA 1K4DB 2FLRT 2X2HA 3I6KB 4A7QA 2KDYA 3BN9C 3FMGH 3IJSA 2Y1ZA 3BLBA 5E4OA 5ADPH 2NZIA 3GRWA 3IMBA 5I71B 1XIWA 5E24E 3V0IA 3B2PA 3BQUB 3US9A 1JGUH 2R0ZH 3BUBA 2B5IC 2X4PA 1PZ5A 3GSRB 3QIBA 4ORGB 1S7QB 1WITA 2JLLA 2B3IA 3MLYH 4OFKA 3U7YH 4C83A 1GJUA 2E4FA 4CA4A 2NY0B 1NFIA 2AK4A 4LHQB 2H4EA 4JVPA 2QQKH 3SHSA 4AYBA 1E4KC 4WK2B 2GSGA 4HK0A 2X0WA 2LR4A 4KAQL 4C4KO 2WSDA 1SJHB 4XBGB 5J9PA 1AHMA 5GRUL 4UOW0 4RX4A 3QG7L 3QEGL 3BPLC 2YZ8A 4S10A 4R7NB 5SWZA 2E7CA 5JW4N 3EOTH 4OQTL 2OMZB 1M7IB 1MLCA 3UTSA 5IREA 4XPHH 5TH2A 1ZV5A 1WHPA 2KZBA 4XX1G 4Z6AT 1W6LA 1O5DT 2W59A 5IV2B 5FUCE 2DTML 1MJ7H 2AXWA 2CLRB 2WLLA 5ERWA 3UDWA 3UTPE 2AJYL 4ADJA 1EXUA 3GQFA 4FKEA 4JFHE 1BQUA 2H32B 4S2SB 5SX4I 2H0EA 3KLDA 2OSLA 2JLPA 2OYLA 5ANME 3ZDYF 4DO6A 4OZIF 3BP5A 3B43A 2E86A 1IGFH 4FQXD 5AZ2H 3WNPA 4P23D 4LGSB 3S0PA 3K2MC 4YHYB 5EBWA 4ACPA 4I0PB 4M4PA 1JJUA 1V7NH 3E8UH 1DBJL 4EZKA 1EFXA 3RX9A 3BWAA 4XNZC 4NFBA 2LU3A 5EOTA 3RUGB 3KLLA 4BIKA 5EZIH 2R2EB 3CFDB 3ZDZF 3IJHB 4RRPA 5EU5A 1LEKA 5IBUB 3APDA 4NGHH 4Q6IC 1Y1UA 3IJEA 3TO2A 4M43H 1WZKA 1NSNH 2DQCH 5BCAA 5DJ6A 3S35L 4HFWB 2G60H 4OV6F 2PETA 2RQEA 1KXVC 5IEHB 4YSSA 3B7YA 3EADA 1S7TB 3P9WB 4OJFL 1W72L 3WJLC 2OMWA 3MXWL 1T03L 4YSRA 3DURB 4GSXA 5EO1B 3RB7A 3MLUL 4MA7H 3TCLB 1QFUH 2CUAA 4F8OA 2AABL 4GSQA 3B2MA 2RIKA 1GYVA 2HX9A 5I18L 3DUHA 1TTFA 3X3FL 1CZ8L 2UUDH 1JGVH 1WZAA 3DXAD 5CLXA 4G7VL 4P2YA 1XGTA 3REWB 5F88B 4X6CA 1PLAA 2E7BA 3FFCA 3BUYB 4LL4A 2WWKO 4QOKB 5K69A 1DBAL 1AJ7L 3L4XA 3DBXB 1AOZA 1XZWA 4LAQL 5HD8C 1HZHH 2ROXA 4N2DA 3NGBC 2JCWA 3H85A 4FFWC 3K4AA 4P3CH 1CF1A 3TVMA 1JGDA 1FL3B 3BUDA 4JM0A 2G30A 3SKJH 4AV4A 4CU8A 4IBZA 2DI7A 1OF2B 4Y4KD 3B9KD 5LG1A 2QTEA 1I8AA 4P3CL 3H55A 1OAQL 3QEQE 1HYSC 4TL4A 4N2NA 2QGEA 1E4XH 3B56A 4E41D 2XZAL 5D8JH 3CMGA 4HGWB 4UTAA 3EW3B 2OJEA 3WL9B 2V9UA 3T0EB 4ONFH 3GIZH 4ZS7L 2C34A 1J1PH 3G6JB 4HMEA 1ACZA 5F7BA 1JGVL 1J5DA 3O4LA 4RGMC 3R7RA 3W9DA 2BMKB 3DX3A 4HK0B 3E2HB 1G7HA 2HG0A 4MJ6A 1IJ9A 2CA4A 5I8EA 1AO7D 4HMDA 3QI9C 3QZWG 3HE6C 2H2SD 2Y5QA 5GZOD 3MXWH 4JKPH 2ADFH 3FT0A 1KCUH 4JFDD 4Q0XH 1U2CA 3NCXA 1DL7H 35C8L 3P0VL 1JGEB 4HUUB 4PLJD 4KTDL 4G8FB 4N90E 1M53A 3VFGH 4FHKA 3QI9D 5DVPA 1EVTC 3VUAA 4PMFA 2ZUTA 4TOYH 4DK6A 3L3HA 3VRLF 1O5PA 3MZTA 3S5YA 1ILUA 4ONHA 2C3GA 1I1AD 3WU1A 3H7BB 1A4BA 2WYHA 4X7DC 4MKTA 2X4PB 3ESVF 2JCCA 3WKYA 2J8UE 4Z7UA 3P4MA 2G3XA 1K8DA 5F7KC 1AIZA 3CK0H 5DC4B 5GGVH 5MERB 5ECJE 4EUPH 4MLIA 4ZTPH 4I3SH 1FBIL 2GSGB 5B1AB 3E6HA 2OBGA 2W07B 3CFQA 3LCYA 1Z66A 3MJ9L 4FD0A 4L8SC 5D71L 5HJBA 3VI3E 4HV8B 3B2VL 3TA3D 2Q2EB 2WOYA 3DRTA 1MJ7L 3F5WB 4FQ2L 3DV6A 4LVHB 1TLMA 2AKRB 3IBEA 2OP4L 4UQBA 4H8UA 2YUZA 1AS8A 1FNSL 1X7SA 1NAMH 4OB5H 4X9GA 1YPZE 5D4IA 4PPTA 5D7IE 2ZOKB 3BKJH 2HWZH 1T83C 2JI2A 3EHBB 3HC0B 5KG9A 4PJEA 5CZXD 4XNMB 3RE0A 1T89A 4O51A 3RB5A 3QQNA 4HS3B 2DWSA 2P49B 3K8MA 1XR8B 2CK0L 2BW4A 2MQ3A 3H3BC 1HSBA 3ZZ1A 1G9MH 3LRHA 1OP5K 4APQB 4ZMPA 3KGUA 3W3BA 3ZTNL 1FYTE 4CC4A 3KYKH 1OGAE 3OL2A 4F8QA 1LEIB 5B39G 2WUBL 4TRPH 9PCYA 1BXVA 3BWAB 3D09A 3D50A 3S35H 5IQOA 5KBDA 4O02H 4NS0A 1NKRA 1VEPA 4XBGA 3CSGA 3ZMNA 1JZ5A 4LVOC 1AGEA 1O7VA 3N50A 4L8DB 3GJEB 3TN0D 4BKLA 3Q2LA 1V7NL 3O4LE 4KNTA 3CX5J 3IDYC 4PGJA 3MODL 2EDJA 4CVXB 5HYIA 5K93A 3PPEA 4LSQL 4XP4L 2NZ1A 4M6ML 5DR5L 4OIBA 3S96A 1RZPA 1BIIB 4Y2DB 4K3JL 1IE5A 1NC4D 2J6WA 3FT2A 3F85A 5B7EA 2J12B 3RZWA 2X1QA 3UDWC 4UTCA 4CKQA 2UY7B 3U25A 3SKNA 4LCUA 4H7VA 4X5XA 2XBDA 4MCYB 4OQTH 4F15C 3V4VA 1P5UC 3ZT6A 4MJ4A 1ZPLA 3FUJA 1JN6A 3GWJA 1QR4A 2X4NB 3ILDA 1MHCA 3RIFF 3SODB 1JG9A 1NUGA 2P8LA 2WYTA 4DKDC 1YMHA 1SN0A 3D3VA 3KXFD 4ZT1A 3PWUA 1HS6A 2EACA 2XU9A 3IXTA 4TL5A 5A2IH 4AGPA 2FJHA 1DLHB 4WI9A 2R1WB 1BX2B 2BCKB 4OGQC 1NCBH 3RWFA 5JW3L 3ZTJH 1N8OE 2EXSA 2XV0A 3F7QA 1ZS8B 1MFAL 3PGFH 3RILA 2ZXDA 4QUOA 5EFIA 1NCOA 4K0OA 1IGIL 1H3PH 5E9NA 2CDGA 2JXMB 3NGBB 2I32A 3HJEA 3F05A 1SVCP 4NKQB 5F7FA 3ARBD 4FQPA 5KS9A 2A38A 3G6JF 2F18A 3DX6B 1L7IL 3BYTA 1S7RB 4L4TE 1UATA 3W5MA 2VXUH 4WCYL 4XE5B 3F6IA 3OAUL 5GGTA 3VXSE 3VXTA 5GRXG 4BQ6A 4WWID 2E46A 4P49A 4B9PA 5E1AB 5K1NA 4P2OC 5IHZA 4LSTL 4NO3B 5D1QC 3JTTA 3LSOA 5E8NB 1HL8A 5F0JB 4AWJC 3GSNL 4M8UA 2CA3A 4NRXA 1THCA 1U2HA 2E47A 4NUQA 4N28A 3FT4A 4Y4FB 5LN8A 5I8OL 2OMXA 4TUUA 3DX9A 4QRPE 3LTVA 5KN5B 1UH3A 5BQ7B 1MH5A 3ARWA 5CLWA 1PIFA 1QO3A 4P2RA 4HUWA 4KRPB 4YDKH 4JPWL 3EO0B 1EDHA 3T1FA 4G7YH 4IM8A 4X6CF 4JDEB 1CTMA 5ADOH 5HXMA 4AYEC 4HS6B 3BH8B 4AMKH 4HC1L 1L9OA 1Y18A 4N20A 1TTGA 4KK5C 3MLTA 4PS7A 1RK7A 4U33A 1FNLA 1IMHC 2FE0A 3MYJA 4LKCA 1RAMA 3DVNB 2DIEA 4XCCH 5EIIG 1MI5E 3QHZL 2EXYC 5C3LD 2J2ZB 3X2QB 1IBFA 4U1HA 3NCJH 4WAFA 3IETA 3TURA 2WBWB 3IDYB 1F4YL 1N0XH 3L7FA 4HOXA 4XP4H 4LNRA 1OSYA 1S9XA 1RURL 3LKRA 4NRZB 2CGRH 3BPCA 5D5MF 5H4YA 3GXIA 4W6XB 1Z9OA 4PS8A 4WHCA 5GZNC 1A3RH 1A6WH 1T1XB 1A7OL 2QSTA 4AYMC 1WQVT 4R4ND 3N1MC 3DO4A 4Z7NF 2JCCB 1U3HD 2E75C 5T1MB 1ZLVH 5JIHA 2OZ4A 5KSVB 4X6DF 3SJVA 5ETUB 5I76B 3WDIA 3QQ4B 1JXGA 4XOCA 3KWVA 4WV1A 2PP8A 5FLUA 1JYWA 1T20A 1IFHH 3P9MB 4O58H 3PNWB 5DD1H 5FUCC 4EAEA 1OCRB 4FTVD 2YXVA 1HOEA 5C3IA 3AB0C 4I4WA 1U3NA 5EOCH 4PJGB 2UZXA 1PG7L 3WFHA 1YNTB 5D7EA 5ACZA 2KC0A 5IEKB 1VKXA 4Y1AE 5HHOD 4HQQL 3LOWA 2ZNWA 3V4VB 3SO5A 2FJHB 2J5LB 2HJFB 4P46A 1JPFB 2F15A 2JJTA 3MX0A 4BKSC 2EUZA 5DD1L 2BHZA 3AT8A 3CFCH 1A6TA 5DSCB 1LD9B 3TBWA 2V33A 1DZBA 2CHZA 3ZYOA 5F7UA 4JY6B 1MRFH 3K3QA 2F8IA 5IUCA 1KN4L 3MLTB 4HPHA 2DLGA 2RA1A 1URLA 3PFQA 5MEQA 1SJEA 1OM3L 4PJ8A 1R3JA 4CUCA 2TSBA 1IKNC 4LCUB 3MLPA 3CLFL 2HB0A 3SGJA 2B1AH 4UIMB 5GSRB 2A6KA 3NT0A 4OF6A 4PJFE 2IXQB 1UB5B 2BP3A 2R2CA 3QUZA 2D7PA 2HT2C 2XKNB 3LVEA 3AY2A 4QHLA 3MYZA 1AGEB 3CZEA 3ZDXE 4L4VE 1K85A 4ADIA 4AEHL 3RJDA 4FLHA 1JNLH 4QXWA 5JNYB 5E5RB 1EHNA 1CLYH 3N9GH 4HIEB 5ID1A 4FXGC 3WUZA 3ISYA 5AOLA 2CUMA 2G9HB 5I1GL 4XMVA 3KPLB 3MRIA 4H1LG 3C12A 3IPFA 3UP6A 4FKKA 1F58H 1G87A 4AG4H 3NAAH 2R56H 4UDUB 1IQWL 4XPAL 1UD3A 1TTCA 5ADOL 3TP4A 4A66A 5HYFA 4YAQB 3OZLA 1S7RA 1T4KA 4WI6A 1BJ1H 4FDWA 1T2XA 2NY7H 3L7EA 2CO7A 1XSOA 1VADB 1QFOA 1M7UA 2Y23A 5CINH 1ZSDB 1R33A 1RZ7L 1NGZB 5EO9B 2BVQB 2PYEB 3DWTA 3GIZL 4JMXA 2AF2A 4IJ3B 4V2BA 1MY5A 5L4JA 4Q9QL 1ONQA 5HVGB 4HXBL 1XF3A 3VMOA 3TA3B 2DQIL 1WAEA 2OXHA 5E8DH 3VCLA 2ENYA 4LOVA 4OZIB 3QEUA 2BSTB 1ILSA 2KKQA 5HHME 3VG9B 2GYSA 4X7CC 5D72L 3MZGB 4GW1B 2AZAA 3IDGB 1LGVA 1QPKA 2COVD 3VRJA 4WKZA 4NN6B 3ARDA 4NNYA 4PJ7F 5CJBA 4OD2A 2MSPA 4RSYA 2XY1A 5JDJA 1YAIA 5A7EA 4KV5E 2X12A 5IFHH 5DUJA 4H88L 4QYOB 3K1DA 4AJ0A 2EEDA 3EYOA 5E6UB 5C07B 4JRYE 1S7UA 3MLUH 1EZUA 1G7LB 3W39B 4KKBD 3BEWA 3MCKB 3PIQA 2P24B 4BFEA 1KENL 4BM7A 2MH4A 4G8FA 4Y5XB 3TEUA 5AG9A 1TLKA 1PD1A 3GSUA 4NZUL 3IU4H 3U7AA 3U83A 5DJZA 3O3EB 4FTVA 3QDMA 2M83A 2QELA 2FLMA 4I7ZC 3ZKMC 3UTTB 3O9WC 3BDYH 4NUPA 4P5TD 1YC7A 3FH5A 1TETL 2YEQA 1FA4A 4JEGB 5EZIL 1ODUA 1HH6A 2E76C 3ARFC 5ICXA 5I6MA 1CICA 3UYRL 4RH4A 5DHVB 5GRVL 3SD2A 4XMKL 2A0LD 3K6FA 1I75A 2QPUA 5FGRA 5SWZD 1AC0A 2FVNA 1ACCA 3FW6A 4UIKH 1N59A 1LQSR 4OLYH 1A0QH 5AYQA 1XH2A 4HEPG 3OB0H 5IM7B 2Y6SD 3BQUC 2AKRA 3BVTA 4OLWH 4XCYA 2FJGB 1UD8A 3O3AB 1O9VA 3CC5B 5F88A 3ZUCA 4D0BB 1BZ7A 2HJFA 4JKKA 1W16A 2GAZB 1BQSA 1M3JA 1OGPA 1S9XB 3D2UD 2QZ5A 2QPSA 3OX8A 4FXLA 1G5AA 2DJSA 1UOLA 2VDQH 3MUJA 3NEOA 4HCRH 1R19A 2LFGA 3QO0B 1BQHB 1XR8A 2QDWA 4I18C 4K71C 3G6JE 3O2VL 4MCZA 3DLQR 4FXKA 3MAWA 4XMUA 1RHHB 1UWGH 1J9QA 4FQLL 2XKSA 4A2FA 2HN7A 1CLVA 2UXTA 1J9CT 4WFEE 1A7PH 2H26B 2JH2A 3B8YA 3NJMA 5DK2A 1LO3H 1R0AH 1SYVA 3ECBB 4NUGL 5D2LA 5JPNC 3D25A 3BJ91 4JGJA 3SB3A 3A6BH 4DQOL 1WS8A 3S3JA 3T2NL 4HV8A 2RTTA 1YUKB 3HZ3A 4KKAC 3AXLB 4OD3H 4P59H 3ZO0A 5C09E 1GS6X 2Y6TE 5I6XB 1MCDA 2UZIH 2XRAH 3HAEA 1JZ3A 5GS1A 4CBPA 3V6OE 4YHOL 3BVVA 2P43B 4FQ2H 1YEJH 1G7HB 4JO2L 4IK6A 1CVRA 2XSKA 5I16A 4JREB 3BW9B 1FN4A 4I0PD 3FHQA 1OGTB 2APXA 1AQMA 2ADJB 1DBKL 1H8OA 2PTUA 3A4FA 1F3JA 3CU7A 4AITA 1KBGH 1AIFB 1BZOA 4NUJA 4NO0A 3H9YA 5E2WL 5GS0H 5JW4R 3QDJA 4YSEA 1CLCA 5CFHA 5BW7A 43C9A 3SGDH 3ULUH 3O45A 2I5YL 3PV6B 3T0DA 3GRGA 2E8ZA 4N24A 2ZICA 2VSCA 3NJXA 2IBGA 3L4UA 4XZUB 4X7EC 4FA8A 3CPLA 2Q6WB 5KYYA 2O6CA 4HBCH 4EOWL 1INDL 2NQCA 1IBZA 3DSFL 4MMZA 3HE7A 2BZ7A 1SY6A 4YLQT 1Z2KA 3DHUA 3MFFA 1VKXB 4UQ2A 5J57B 1G9EA 2EINB 4W81A 1SVBA 1YMMB 4WZ9A 5D9SA 5EU4A 1BX2A 1WD9A 2A9BA 2CK0H 2X9XA 5T3XE 3X14A 1RZKC 4D0DB 3AT0A 4WUUD 3MCLL 1TU2A 4Z7WF 4PRBA 2VDPB 4K4KA 3M7FB 2YAQA 4FFTA 4N0FA 4JR9H 4TV3A 4PRNB 2VYRE 4EIZC 4ZPTB 5C0BE 4J8QA 4NDMB 1ZA6B 5KW9L 1TJMA 3IJYA 4KKLD 3VI4F 5IVOA 1KDJA 3KL3A 1W0VA 4KMLB 2VDNB 1VLXA 2A6JB 2FWSA 2XVGA 2ATPA 2Z8SA 4P06A 4KJWD 4RMWA 5DJ6B 5J4MA 2RQ8A 2XDHA 3HFML 1UKQA 1X5MA 2E6JA 2A1WH 3TT3L 3H2PA 3OKEB 4HKZA 4R6UA 1G7IA 5E9DA 2WIIB 1I8LC 3S8GB 4IBUA 3DX4A 4M5SA 4LAQH 1XAUA 1TZGH 1FZOB 2NLJB 4MMXC 1FYTB 3QUMH 3WE1A 2ZP9A 2YBRA 2BOCA 5IQNA 1OLZA 3R18A 4TQPA 1HWGB 3SEPA 4Z7QB 2YUXA 3O3AA 1A6VL 5JQIB 5FIEA 5JPNA 3GSXB 4MA7L 4UTBH 1CFQB 4DVBA 1E65A 1T5KA 35C8H 4MZRA 4G11A 1Q94A 3HMWL 1EQWA 5KJ4A 2BSCA 3C60C 3VFNB 4PGBB 5DCCA 5IBTH 4Z7AA 3ULVH 3TV3L 5CZRA 3KXFB 2H6OA 5INCB 3QULB 1BBJA 2Y22A 1AQ8A 2W8CA 1P9MA 2H8PA 3OGOE 3HE6D 3MRMB 2XX1A 5JDSA 3KAAA 4D9LL 1SZNA 4HIJB 4C54A 1M7XA 2QSCL 1M7IA 1MLCB 1BV8A 1UEYA 3JV6B 4OCWL 5PAZA 1B0GB 2V2WB 2YD2A 4IGBC 1NFDF 4WWKA 3TNMB 3BRGC 4FMVA 3OAYH 3SQBA 2WXFA 3UC0L 2VLRE 4WY7L 3EG9A 4L37B 4CW1A 4BK4A 1UENA 1ZT4B 5D7JA 4XO3A 5FUOH 2PP9A 1IGFL 2EKSB 4IBQA 4LEOA 4V2CB 4Y4KA 4PRPD 1N5YL 2OR7A 3Q9QA 3R4RA 4LLAA 2DQ6A 2NYZA 4Z7VE 3LX9A 3B9EA 4XMKH 3S98A 1CJYA 2AJSH 3ARFA 1T7ZA 3CZJA 3EO1A 3FC8A 4XRCA 1DQKA 3ARQA 4ONOA 2V3FA 3D25B 1AGDB 3BVNB 4P2OB 1RK1A 4A2MA 2E7DA 1OAYH 4OCYH 5EIVA 4PWGA 1SJHA 1E3XA 1CFSB 3IJSB 4G7VH 4Z3HA 1OP4A 3O6FB 3X3FH 1R3IH 1VFBA 3T71A 3G7TA 4K8RH 2WXNA 2YK1L 1BEXA 2Z7ZA 1P7KB 3B7RL 4HH9A 4B6ZA 2X1WL 3VGDA 5IP4A 3FFCE 4LSVH 2PWDA 3CSPA 2IC2A 4YDKL 3K74B 2GJPA 1AD0A 2BY3A 5B1KA 4APQD 2HH0H 3MGOB 4RQQA 5BV7L 3LH2L 3IVKB 4ECNA 2X6CA 5IMOB 2QV2A 7CGTA 4LPWA 4MLSA 1E9PA 3L5JA 3MBWA 3SO3C 4N0CC 1NICA 3RBGA 4BQ8A 2VGLM 2VJ8A 5E6SB 2HT2D 2OJZH 3APNA 3CPLB 3LPGA 6FABL 2IANB 1KTLA 2CBQA 2WN2A 2BVPA 3QJQB 5FO8A 4RMTA 1D5BB 3TJHD 2L0DA 4Y7OC 3FHAA 2RHEA 5SV4A 4P2QE 5K39A 4E42A 3TN0B 1KTCA 1BP3B 3P4NA 4HULB 4N5ED 4TNWF 1JMXA 3L3KB 4X5PA 1TTBA 2PCXA 1RU9H 3UTZA 1ZHBB 5AUMA 3V5HA 4X6DB 1WEJH 1YEIH 1WFJA 1A3LH 1C08B 1UURA 3Q3GA 1QW8A 3P2BA 1L3WA 3AG2B 3SGKA 3QDJE 4A2LA 4KRMB 4OLUH 4CSZA 1S9KC 2GJ6A 2VSMB 4W9GC 5FYLH 3ZO9A 3U46B 3IFLH 1WV7T 1V10A 5D7IF 4MASA 4MYPA 4O2CB 4LZKA 3UERA 1X5XA 1YJDH 2EDKA 3ALXA 3I74A 1XGTB 1ID5I 1N70A 5DQ9A 1HL9A 4EZJA 1ZJAA 2BVQA 2PYEA 1CDUA 3V6OA 2XACC 1E8YA 4NWUL 2CLZB 2AK4D 2BSBA 5LBSH 4NJAH 4OCYL 2UVFA 4Q9CA 5IFJA 3NOIA 4IJTA 1INEH 3AU0A 3LNGA 2Y69B 3KPPB 4QLRA 1RU9L 4UCFA 5ADPL 4NCC2 3P4OA 5CJXA 2XWXA 5CLYA 2AK4E 4D7BA 2W1NA 4U3CA 2CHDA 4B7LA 1HESA 2CRZA 4NM8H 2GUYA 4S1SH 4G3YL 3VXUA 2C9SA 2PR4L 3WSQL 1TPXB 4C58B 1FE8L 3RWEA 2IAND 5FB8B 3NJIA 2ZNXA 2X88A 1FO0L 4OAWA 1XWVA 2VO8A 1MIEL 5C3TA 5IW6A 1XB3A 2IGLA 2XTJD 3NCBB 1UD6A 5F7EL 5G4NA 1YEHL 3CXFA 3ZE0F 2MHAA 1XF5B 2VM9A 2WUBH 4TRPL 3K81A 3HB3B 3TWCL 3T1WA 3RFRA 1T22A 4NJ9H 1PX4A 3B2XA 5GSRA 2E4TA 4JDTL 5HGHA 1JGIA 1U0QA 1EXHA 2W60A 2WNXA 5F8QC 3PHAA 3LNHA 4HGMA 4P2OA 2FHCA 4KX7A 1U6AH 2BNQD 4PSPA 3TEXA 5BOZG 5BZDB 5M94B 3IMRA 5JXAH 1PG7H 2IADB 2WXOA 4ELKA 2MNUA 3IJHA 1CFTB 3ESOA 3B7UX 4BSJA 3U6XA 5BQDA 5D7KE 2AXFA 3JWDC 3I6GA 4YN3A 2WK2A 3QUMA 1GOFA 1S3KL 4YQXL 3JTSA 3GTNA 1NAML 3WIHA 4M29A 5ICZB 1QR1B 5LN4A 4ZK8A 3A67L 4I9WE 4GY4A 3NQKA 1V05A 3N9GL 4EQ2A 1TMQA 5A1AA 1WZLA 4YPGB 2RMNA 2X4UA 4BELD 1BM3H 4LDEB 4PMEA 5IY5B 4ZTPL 3KD4A 2NNRA 1BVNT 1IGMH 1OE2A 3G5ZA 3HNVH 3I50L 4HAKA 5DVOA 4X0KA 2I7SA 1YYCA 1OW0A 2FD6L 2IMNA 2PO6B 4HWNA 5DZLA 1L0PA 4S1QL 4W9IC 3AREC 1DVFD 1WBXA 2X89D 4NB7A 4CMMB 1U8JB 4ODTL 1A7NH 1QABA 5KSBF 5F1NA 4LLQB 4XCCL 5FB8A 2YLKA 4NOFA 4POUB 1RFDH 5CZXC 5MHSD 2YHGA 3HJ0A 5KSAB 2YGPA 4J28A 5I8KH 1L9NA 4KGJA 4YS4A 3FHEA 4NENB 4KX8A 1V8HA 3NEXA 2ZWKA 4WU5B 5HHQB 4YQXH 3MSPA 1RUPL 2ZCZA 4IKKA 4AMKL 4R7LA 3GHEL 2YJLA 2QVFB 3DKHA 4HUVA 3NPZB 2VDKH 2FTAA 1XH3B 5DURB 4ODSH 1SQ2N 4KJPC 2R29A 3L4ZA 4I77L 1T1ZA 4UINH 3MTRA 1EHXA 2WNKA 3APFA 1SEBA 5FO8B 4UTBL 3WENA 4WI7A 1BQ5A 4LVNB 4YXHL 4L8DA 3HBPA 2Z93A 2A6IB 1IFHL 4O58L 1QBML 5IHWA 3MJGX 5F9JB 4MXWL 2W0FB 4N2HA 4UUJA 3STLA 1G43A 2VKWA 1R34A 4JFQA 2LTQB 4YBHA 1E4XL 3FU6A 2NY0C 2WZ5A 4MMYA 3VWJC 3NSCA 3WO3B 1TSRA 2AV1A 2YKLH 3APCA 4P5TC 3VSQA 2OZ4H 2YN5A 2COQA 1SXCA 3DI2B 4N1HB 5HDQH 1JHKH 2JJWA 2KI6A 4NUJB 2PR4H 3MN8A 3PWPE 1OP3H 5IG7A 2I60H 3AS3A 2NYKA 2VXUL 4I87A 5GHWL 1U8NA 2XTJC 5CN3A 4NN7B 4JO2H 12E8L 2A4CA 3LS4H 4PGCB 2OCCB 1N3NB 2HFFA 2YD4A 1OL0A 3FN9A 4JR9L 3ZGIA 4U31A 4NNPH 4G70B 5K39B 4E42B 3T77B 4XNYH 4YLCA 3BESR 4TNVF 1KACB 3LNFA 3ZKNC 2VLKA 4GPVA 2XXGA 1FWXA 1GGCL 1RQ5A 2AANA 2B4CC 4EUPG 5K9OB 1QRNE 4MA3B 4PP1C 1HT6A 4JM2D 1T03H 4KI5D 1BLIA 4X7FC 5D2LB 3IK2A 1LTXA 3B2UD 1N67A 2XV2A 4GXVH 2AXHA 5JR1L 2ZG2A 3JTBA 3S36H 1YPZF 1ACYL 4KK6D 3DVIA 3P11L 4DN3L 1LXMA 4WK0B 3FQNB 4JAMA 5ESAB 2VRQA 1EK3A 1KLFB 3FU9A 3M1CA 5D93B 4XN8A 2WUCH 2CKBB 4IDLA 4N2EA 3B9AA 4X6EA 1DVFB 4B7IA 2W0LA 4XNZB 4FEMA 1JNHB 5H35A 2Z8VC 2EE3A 5HDBF 4NKDA 4RMVA 1PVHA 1PEWA 5IHZB 5JA8B 2ENQA 3U36A 4YHML 4M9OA 5GS0L 3EFFA 1NLDL 3L16A 4ODWB 3M1BB 3EFOA 1IJNA 4MD0A 3PU7A 1FO0B 2GI0A 4EEEA 5J6GB 3NK3A 3BAJA 4F20A 1BVLB 2XN9A 2QMJA 3T2PA 4V11A 2CCWA 4R97B 3W2DL 5KZCB 3HG1E 2Z34A 3BVXA 1DE4A 5DJXA 2W80C 2C4FU 4LSUH 5JHLA 1D5IL 3UCRA 3VYPA 1MXGA 1TETH 3MA9L 4HIXL 3S2AA 1U3ZA 1LMKA 2PNDA 3BPLB 4EBQH 3KPMB 4JFUA 1NA8A 3KYKL 4JM4H 1E67A 1KJ2B 4ZW5A 5E70A 2CO4A 2WNGA 1UJTA 3D4YA 2YEZB 2ZUQB 4P4KC 3CHPA 4MAYD 4WNJA 4FQLH 1AKJD 1S9VB 3GI8L 1QLFB 3NIGE 4IOSD 3ZQ9A 3D0LA 5HVHB 1OAKH 1PIGA 5LAXB 3SQOH 1A3QA 3ELAT 2MOGA 3CVDA 3F00A 3LMJH 4FLRA 3DUUA 4H0GA 4P05A 3W82A 1E9OA 4W9KC 1CDJA 4F33B 2JFCA 4JZJB 2WQSA 1WBXB 2H5UA 1QHQA 1QTYT 1UJ3C 3NSXA 3RIAK 4JHWH 4XMWA 4M6AA 4QD2E 4ZTOH 5D7KD 2FAUA 3WFZA 1D5IH 4ZFQA 1VERA 4GT0A 3SGJC 1QNZH 1HILB 2BW5A 2UZPA 1RZ8B 3EG9B 4L37A 4CW1B 1C9SA 1RZFH 5EO0A 3RNQB 5B8CB 4U3XA 4J2XA 1WWAX 4OLYL 4I3SL 1UACH 4PBXA 5T1LD 4DGVH 3ETBF 4EIBA 3DV4A 3IWUA 5E4IA 4R5XA 2CH8A 3QFGA 2M8XA 4X99B 4HIJA 3CZLA 2NSMA 4FNUA 2GJ6E 5DMKA 2IFFL 4JB9L 1FH5L 3MLSL 1X6LA 1UT1A 3FSOA 3GTTA 1YNLH 2FECL 4UAOB 4KO5A 4KK8D 3F58H 1N0LB 3FJTA 3P0YL 1AYOA 5F71A 5KVEH 2YMXL 3DX6A 4Z7OF 2LVCA 3RAJH 4F92B 5JPMC 1T66C 2C26A 3VXRA 2A6JA 3HBQA 5JHDB 3RNKA 3BOVA 1KZQA 1U8KA 1RZKL 4L3ED 3BQUA 1BQLH 3FQ2A 3WTWA 1KIQA 3NAAL 1G7MB 3DHJA 4KXCA 1C7TA 3HG1B 3IXAB 4WW2F 4KUCD 3IXTB 2K9FB 4W1TA 4YAQA 1OTUD 3ARGD 4YHNA 3D39D 5LGHH 5I23A 1DQLL 3U2IA 3ZJAA 1H3WM 1RULL 1DVQA 4PWJA 1ZJBA 5IQLA 3O0RH 2X28A 4GRWF 4FFZH 1SXBA 1T21B 1U95B 2GY7B 4X7SL 1P84J 4IDJL 4GRLB 4RWYL 4EMZA 5IB1B 1DJZA 2I27N 1S9YB 4JY4A 4GRWH 5BOPA 3G04B 5KWYC 2IQAB 3T77A 4ABQA 3X12B 1FSKB 3L9EA 3CFBA 5B1JC 1CE6A 3SDDD 4B9YA 3N40P 3NSYA 5JO5B 4MA3A 3R8QA 3V5HB 3OB8A 4PJAA 2MRYA 1K5NB 5GRZA 1OP5H 3EDKA 2WGNB 4ORGA 3BHBA 2E27L 4LESA 1KN4H 1YUHB 5KSUB 1E4HA 2BK8A 2W9DL 2Q2LA 2N7BA 2UYLB 2ITCB 3DJ9A 2GTZA 3JV4A 3BDXA 4GQQA 1TG8A 3OQRA 4JRXA 4L3EB 3CH8A 4AQEA 1KGXA 2GK0B 5EEVA 5DVKA 2GFBA 2JKNA 3O81A 5CIPH 2X7LA 3T3MF 4BUQA 3UBHA 4WHDA 3OR6B 2H2PD 4MMXB 2H9GB 2VDRB 3ABLB 4R96B 4XO9A 5D1XE 5C07E 3RHWF 5LXVA 1Q9WA 4P4KA 3O6MH 5J8OA 3Q3GB 3EFOB 4GSDL 4PJDF 3EJZC 1E5BA 1OAJA 4ZFZB 3WN5A 5AD0B 2EEFA 5JLZB 3SOBH 3L5WA 2F68X 1IAOB 2D0GA 5LWYL 4XBPA 7TAAA 3N85L 2WLLB 3ABMB 5ERWB 1WH0A 2AEPL 2C3WA 3ARGA 1NSNL 1BZ8A 1GGBL 3DURA 5CGTA 4BH7A 3QJFA 1S5IL 2V8LA 3NZHH 1ZSDA 4M7KH 2Z31D 1LK3L 2IANA 4FF9A 4JAMB 5ESAA 2QEJA 5KYUA 3QDGD 3ZL1A 2MFNA 3M6DA 1JWUA 3T2LA 5IEHA 4KV5F 2GTQA 3F83A 4U6YB 3EZ8A 1CU4L 2HCZX 2K0RA 3FK3A 4IHBA 4CADA 3OHXB 3NPSC 1PLCA 4UTAL 2VR5A 1FJ1A 4ZUUB 4ZOEA 3V10A 1I9JL 4HPOL 3ZE1F 4WTXA 1WAAE 3X13B 3A67H 2QADD 3ZYZA 4OCMC 3PGCB 4NYLA 2HLEB 5T1DL 5BVPL 5IFAL 2BC4B 4MZIA 1PF3A 1E3ZA 3L81A 3IPEA 5DYOB 5DJ0A 3BKCL 3VWKD 3V6ZB 3CFCL 3KNBA 4JG9A 3ECWA 3ASNB 2HVKB 4FQXA 1U4EA 5ACMA 4MZ3A 3CU1A 4CU6A 2NZ9C 3FB8A 2R0KH 4UQDA 2X1XR 2VLRD 2IOMA 4QHUB 4B9GA 2PF6A 3ZBMA 3HS0C 5AB2A 2ICES 2XV3A 2YQ3A 3NP4A 5GGUB 4GS7B 4DAGL 4B41A 3QUMB 4JKLA 1E3FA 4E9RA 3BJLA 3GUTA 2H1LM 2HUEA 1F18A 3RKDD 1JERA 5D1ZD 2EXTA 4K9EH 5DFVD 1DUZA 5FF6B 3FRPB 2ZAGA 3GSUB 3UPRA 2GITB 4PLJC 3CNKA 1QP1A 3T3PF 4FYRA 2GHZA 1WFNA 1QO3B 4P2RB 4PJ9D 5E94A 2WVUA 5C71A 2HT4D 4IOFC 3EJSA 3DSNB 2OYPA 2CM5A 5KYWA 4D9RE 1FYTA 1IIKA 4C83B 1RP9A 1RURH 2F6AA 1A0QL 1ES0B 1W15A 3L4CA 3NIDE 4OUUA 3SDCA 3ZYIA 1CD1B 3Q5OA 3NDYE 3CZUB 5C08E 1I8LA 3M07A 1KF9B 1K5NA 3K5RA 1NBYA 4CC4C 3DJTA 5IROC 3PWLA 5FOBB 4QT5A 1ROWA 1QUPA 1FGVL 2XIDA 2ZXQA 4KTEL 3MMEB 3JYBA 3A4DA 3A23A 4Z3JA 3HMXA 4NC1C 4D8OA 5FGCE 1EZVX 1MXDA 1C12B 3HHMA 3C60D 4RFNB 1I1FA 4LQFL 4JNXA 4GRLA 1OWRM 4NZUH 1NGWB 3ESNA 5AZEL 4APXB 3RWDB 2K6WA 3L17A 3O6KH 3FKUS 1YJDL 2VXTH 2WXHA 1BFSA 1DUYA 1USQA 4LLUA 4OQTA 4C4UA 3K6SA 4H40A 4IS6B 2JVUA 3EAKA 4S1RH 4YSOA 1GC1L 2AQPA 2VC2B 4XOBA 2CBMA 3KHQA 3PWJB 3TO4D 4EPSA 5ICZA 3QZBA 2R2HA 1E2ZA 4J3XA 1L7TH 4DP9X 2FEDC 2LVEA 3BSZH 2AQRA 1B6DA 5DJ8A 5D2LE 1MIMH 4JFPA 4JJ5A 1AD9B 3VGHA 4FFVC 2AERT 2EIBA 4JM2A 1UZ8A 5ESQB 2QQQA 4U6HB 5CCHE 3NACH 4JPQA 4OD1L 4P5RA 2HT3D 2Y06L 1XH0A 2N01B 3L3HB 4Z18A 4HKBB 4ZUTB 4RCAA 4ES8A 1XB8A 3WDJA 1FPTH 2JNZA 5ID1B 3VG9C 4ZMVA 1WT5A 3NSJA 4PVLA 4XXCC 3FQWB 3WNLA 1JGLH 3OPUA 3S36X 1BAGA 4JFSA 4OKVB 5B38G 5GXBB 5J12C 3O2WH 3Q1SL 1ZTMA 1FDLH 1QOKA 1VSCA 4HPYL 3FO2B 4IHOB 4K94H 4UDUA 4NERA 4TXVB 2ZSWA 4F2EA 1G7JB 2XN0A 4JN1H 4PYGA 1OT4A 4DAGH 4X5LA 5FFLA 3D33A 1GC1C 4GS7C 1RK0A 5IVZB 3RL2B 3MBEC 5I24A 4IEFB 4Q52A 2TRHA 3KGSA 1JUFA 4OFIA 5AZEH 4G6AC 3QRFM 2V0AA 3GHEH 2UWEF 4EI5A 4H25B 5EF1A 2Q87A 3S96B 2IDTA 4ZXBB 2HWZL 4QHKI 3SGKC 3HLKA 4DN4L 4KO6A 5A6MA 1FFOA 4FC3E 3QO1B 5KAQG 1C16B 1PL3A 1D6VL 5PCYA 1G6RH 1ZANL 2ARJQ 3EGSA 5DT1L 5IB4A 4FXKB 5IB5B 3QRLA 4ZS6C 1XF4B 1AY1H 3QNFA 2HLAA 1B4TA 4LEXH 2GJZA 4FNTA 1KIRB 3INOA 1I1AA 5EU6E 4PWEA 2FD6H 2FH6A 2H47C 4TVSa 3LIZA 2DB8A 4K7FB 1KCSH 4CILA 1T0NA 1K4DA 1WA2X 3I6KA 2A73B 4X9YA 3UBXA 1JRHL 1QHOA 1LYQA 3STLB 4PV9A 1PCXA 4OUOA 3R0MA 3EBGA 1E4XI 3SKOA 1Q9KB 1QPXA 5DD3H 5SV3A 1RI8A 3T4AB 1IAMA 3G9AB 5HJ3A 3V5DA 2RALA 5DZAA 4X98B 3DRQA 3MUHL 3PWLB 4XNQA 5FOBA 1CK0H 5BZZA 3TWYA 3VXRE 3WTSA 4Q97A 1UUSA 2NW2B 3SE8H 2KZ1B 1A9BA 4JFDE 3MRMA 3O8XA 2DIJA 4NO5A 4A7GF 4NBYB 2XHNA 2IDUA 3T8XB 3B7TA 3QDMB 1TQWA 2H3NA 2KZWA 1B2YA 3JWNH 1JK9B 3WTTA 1MCPH 3AWEA 3N1PC 2EE6A 5I17B 4ONGL 4C4BA 1WCBB 3CFJB 3RPBA 1PMYA 2ZCLL 5I1LB 3HZVA 4BFIB 4XN9A 5IQ9A 2WLYA 3IAGC 6PAZA 4PJ9A 5T5NF 4ZMAT 4NRYA 5GS2D 5MP6L 3GI9L 3O4OB 1A2YB 4ETQA 4RRPM 3F7KA 3Q2CA 2VN7A 4UB0L 2UY6B 4R2GC 1G5GA 3D7PA 1C5CL 3MLWL 1G1OA 5F1KC 2JSFA 2DM7A 4WHYG 3VO0A 2JTDA 5IHHA 4MSWB 3ARDC 1J5OH 3WMSA 5F93C 4ZO6A 5KBMA 3TFKC 1KIUA 4IDJH 1J5IA 3DSNA 4ABWA 3IDIB 4PWIA 3VXNB 4R97C 4TOYL 4L2LA 4PJHA 1AKJB 2XA8H 4NQVA 5I1EL 1F4AA 1RVFL 3BUYA 4XHJD 3UJJL 3QJHA 1I3RB 2PYFA 1XFPA 4L3EE 5D7LA 2J20A 4HW6A 3EJRA 2BJMH 4M5YL 4RAVB 1DYZA 3QIBC 4RQQB 2NXYB 2ORBH 3WFBH 3MKKA 4PV8A 3G08A 32C2B 3PP3K 2Z0BA 4Q89A 4U6HA 1UZ8B 3GS7A 5KN5A 3JUYA 1QFWI 1IZJA 2VL5A 3PWPA 1BLNA 5I75B 4H25A 3WFEH 2AW2A 3QZLA 2Z0UA 1KJMA 4ODXB 4I1RA 5T3ZD 1CI5A 4Z7WB 2F7PA 5HDRA 5EOQL 3NJNA 5IVZA 4NQEA 5T5FL 1NCCH 2GSIB 3RL2A 4L18A 1JCKA 3WTYA 2WZ0A 6TAAA 1NLBH 1N5AA 4OZGA 4RDQG 3K6SB 4IBYA 1BIHA 1H8NA 5IT2H 1NANI 1WVZA 2GBVA 2P42B 4CL7A 2HKAA 2ADYA 4F9LA 3TGXA 4TQ8A 4NI3A 4NQDB 1RV6X 5K33A 5HGBA 2NY2B 1OPGH 2VN6A 3TBVA 4XPGH 1Z1WA 2JTYA 1VFMA 4DEPB 5EBLB 4TM9A 3QDME 1OE1A 1A6PA 3GDCA 5DLLA 1S46A 1SOKA 3NRPA 1U3JA 3IDNA 3W37A 3LIUA 1ET7A 3L2MA 1MHHB 3NIFE 4XC3L 4A37A 1SMAA 2IWFA 3PL6D 3TBSB 3RWHA 2UZIL 1CO1A 3II1A 1WK0A 1RZQA 1DN2A 2VWEE 1JV5B 2NQDA 1A7BA 5DRZA 1JRHI 1GTNA 3QUXD 5KANI 5JIQA 2CO1A 4QRBA 4GBXD 5JPNB 4WRLA 5HGAA 1OF2A 2FGWH 3QIWC 1IC4H 5D7SH 1P4UA 1BD2D 5I6OA 1QEXA 2RCSH 1D6EB 3L5WB 3GRWL 1W72H 2XWZA 3Q44A 4W9FC 4EVNB 5MERA 5AW4B 2WBJD 5C0BD 1KULA 4X7TB 4JFEE 5EC2B 3NFNA 2OX5B 5DFWH 1IGJB 4ICXA 3Q43A 5AVTB 4K8RL 3D1MC 1XR9A 5DRXA 3MNWA 1W2KT 4N2MA 3TVMD 5IEKA 3SDXF 3NJGA 2I69A 4Z7NB 5EULV 2WAHA 2F5AH 1XCTA 4V1DB 2ZXBA 2BIIA 2ZP8A 2P5EE 3GK8H 1ZLVK 1TSHA 2F53A 5F7NC 4F7MB 1GW6A 2HUHA 2CE6A 1FGNL 1HNGA 2OSYA 4KKRA 1G7MA 2OFQA 1WE5A 5AZ2L 1SN2A 4QO1A 3KYOB 3QPKA 3KWXA 4HZLB 4LCCA 2ITDB 4XWOD 2XQBL 5KYNA 2VT0A 1R9FA 1MJUH 3HR5B 4P9ML 3T09A 4E9WA 4WU7B 4OM0H 1X5AA 3GXMA 2YAMA 3MV7D 4J7RA 3PWVA 4X4XA 2AQ1A 2VR7A 3BIBX 4KI1A 2YPVH 4N0UA 1J8KA 5CN2A 1W80A 3O9WB 4P46D 3HI5H 3F7YA 2I9TB 1S3RA 1U42A 4F27A 1YG9A 2AK1L 2FQEA 4P4KB 3DVNA 4XN4A 2R7EA 4X6EB 2XWBB 3QT2A 1QW9A 1CDCA 1JWUB 4S1DD 3QZMA 5AW9B 2VUKA 3BT2H 3CH1A 1MCFA 1OARH 4QRFA 1RLWA 3CHXA 5KS9E 4KKBC 3EBHA 2BWQA 1DQJA 4ZSOA 1KGWA 3KJ4B 3ESMA 4L4VA 2A9MH 1UM4L 3OKMB 4ZUVB 4MA1B 4HUUA 5ECGA 3JVFC 3ORJA 2P24A 2X4OB 2BNUB 4KKPA 5IFHL 1YYML 2B7DT 1LO5B 3MACH 4MYWB 4UT6A 4P5MB 3OGCA 5D1ZI 3EYUL 3IF1B 2CGZA 3Q8AA 3RVUC 1YEFH 3O3EA 3TESA 4IGBA 3CXHK 4OR1A 4PJIE 4DWHA 2A1WL 1MRCL 3W0WE 3S5ZA 1KCRH 3S6CA 4XPGL 2P47B 1IGYB 5AYTA 1FFTB 4Y5YB 2V9RA 4QMEA 4A55A 4O4YH 1VEOA 1DJWA 2F19H 1JPST 2IWGA 1LO2H 2MEJB 1BBDL 4AK2A 4WI0A 4Y1AB 3TBYB 2BIMA 4JFFE 4PRPB 3F04A 2XKUA 1QSEA 3PUUA 2QVKA 5AG8A 4DSYA 4Y88A 3W39A 7PCYA 5LQBL 3WBDA 5BMFL 2FATL 5AKSA 2FJGA 2FHFA 3L4VA 2FWUA 1ZEAH 5CWSA 5E2VH 5TDPB 2H41A 4JE4B 1EGJA 3FUDA 1LK2A 2YGQA 1FL5A 1CL7H 1YCSA 2DLIA 4UOW1 1U8QA 2CO6A 3QC5X 3LQAH 3K2IA 2V5RA 5ILTL 3UX9B 4NQDA 5HGBB 1YEKH 5JYMA 1LO4L 1UB6A 4L4TA 4PJ7E 5TGBA 3B6SB 4GQ9L 4AGMA 3LSOB 2YD7A 5D5ME 3P3YA 5TK2A 1GW0A 3MV8B 4PTUA 4N9GA 1U9KA 4NNPL 1KTBA 4F9PA 4EZLA 3E6FA 4EXPX 3I75A 4IRSA 4CKVX 5ITFA 2XXFA 1VZIA 2XJKA 3X1EA 4NHUB 3ZUNC 1UG9A 2V2TA 5C0JA 3UAJD 1PKQA 1TQCB 4X42A 4ODXA 1K5WA 3M86A 4OZFA 3W11D 2G9HA 2RGSA 5CCJA 1KZYA 5MEOA 2VLLB 2R15A 4JDVA 3U36B 1R24B 5AOMA 2G2PA 4JE0A 4NQTA 4W9CC 3MNVA 4LVOB 1CIUA 1S78D 1FH2A 4LP5A 2QMKA 3BXNA 2C3HA 1JPSH 3FO1A 4N22A 1EEZA 4WHTA 5DUPL 2QQLH 2DQJL 3EBAA 5CJ5A 4FHBD 1AS7A 3T3ME 5EOTB 2VH5L 2YQGA 3KPRE 3NFNB 1DVFC 5I5MA 3FAWA 3TEWA 2XRAL 3EUDA 4LCWB 4NO2B 4GEJA 5G4MA 3U6RA 3ZK0A 5KVMC 4GQPH 3IFOA 1V3LA 5I8CB 5I6XC 2VDNH 1IC5H 5I18H 1JZ2A 3OSVA 1G7PB 4DFHA 1WC7B 2DLFH 1J0YA 1RCYA 3K0YA 1X5IA 2VXVH 3KPSD 3H3PL 1DJIA 4NCDA 5TDNB 2ZUVA 3NBNA 3VTAA 3WIIH 1JL8A 3GS0A 3VDAA 2G0LA 4X6BB 4KNUA 5FO2A 5KOMC 4K94L 3RWGA 2W9LA 4Y8DC 1VCBC 1I7TB 2E6PA 3V4PH 5I66B 2OMUB 1YECL 2HKFH 1I8KB 5IJBC 1PAZA 3FQRB 2IANE 3QNZA 3O0LA 1YEHH 3KVQA 3UJTH 5GRJL 4GUPA 3MRJA 1CD8A 2WKGA 2EEAA 4JJ5B 1HXMB 3BGMA 4OF3A 5CIPB 4ZO7A 1KUMA 3RIKA 3TVMC 2QGCA 2IDQA 1I9IH 3OKMA 4ZUVA 4KKZA 5JXEC 2C4FT 1WFOA 3P3UA 1CXKA 3H9SA 2QADB 4I2XA 3G6DH 3L45A 3U1QA 3QYMA 5FYJL 1PKQB 1WA0X 5DD0L 4S1SL 1PYWA 4KWUA 1X3DA 3TVMB 1BFVL 1IGML 3GMNA 4XNXH 1IAKB 4YBLB 3M1OA 4P0DA 2WQUA 3FCBA 5TH2B 5J6GA 1G9NL 2RR3A 2ZCHL 1JD7A 3DMMB 4UQ3B 4I89A 5FFGA 3V0FA 4P5KB 3BZEA 3G5WA 4YGVB 5HI3C 5DJXB 4LB8A 5HGHB 1G0DA 3P4OB 1QLEB 3PNWA 2DD8H 4WI4A 2IV9A 1T2JA 1MCIA 1E9QA 1TTAA 4N6RB 4WU7A 1T2QH 2IPKA 4LFHD 4JMNA 1KYUA 3Q6GH 3KG5A 5J1AB 1YZZA 2CO7B 4WGVB 1S7TA 3PNRB 1BREA 4BQBA 4KQ3L 2BOBA 1MREL 1T1ZB 4A38A 4Z7OB 4O2EB 4LGPB 5FYLL 2N56A 3T6WA 1TR7A 4PY7B 2APTA 4QY8B 3NIFB 2JB5H 5EIIA 1GJIA 1UZGA 2ENSA 4NZRH 4YDNA 3UG4A 4X5QA 3BWSA 1JGLL 5HHVH 5DMIH 2B5IB 1KB9K 4H4NA 4MDJB 3S2CA 1Q72H 4FZ8L 5C7ZA 4K3JH 1Z0NA 2UY6A 3LKOB 4JQIA 5CAYB 4JUSA 2ITFA 2ZE0A 5DJ2A 3KYNB 1MKFA 1A1NA 4HJJL 4ZFOB 3ZQWA 5JHMA 2OKMA 4LRNL 3O8XD 1J05A 4UNVA 2FRGP 5F7HA 1PZAA 5DEGA 4L1HA 4FZ8H 1W72B 4Y5VA 1NPJA 2QPFA 1AQKH 3BSZL 5T3XH 3V55A 1BQRA 1ZVHA 3GMPB 4HHAA 1YQVH 3SO3B 4ZMOA 5KTEL 4WEMB 3JWOL 4JO1H 4YPGA 4TPRH 5F3HB 4HLJA 3QA3B 3M1BA 2GJ6D 3LEXA 5IF0B 4W4OC 5C0RL 5I73C 2WQRA 2A77L 2J7LA 4RGMB 1D9KA 3MRHB 1MF2L 3IFNH 5D7IA 4JKWA 5GS1B 5KBNC 2VXTL 3NVQA 4Y1TA 1XQ4A 1YEDA 3VXOA 2FBJH 1G6RB 3EGXB 5I1AA 5EUOA 4M61A 2FEJA 2FQDA 2NQ3A 4PG2A 3GIVB 4XOEA 1AANA 2XZCL 3ME0B 3N0PB 1PG7X 3SE6A 4DVRL 3QPQC 1P7QD 1YEGL 2R0WH 4Q6IB 3TTSA 5FX3A 4G1EB 4L9LC 4L1BA 3QG6A 4YSCA 1LP9E 4G8GB 2W5PA 1FC2D 2XA3A 3AQZA 4IU3B 2EH8L 1E7UA 4ODHH 1PQZA 4FABL 2JELH 3NIFF 4FJ6A 4PN6A 1VGEH 1UKTA 4OGZA 1CUOA 4BJLA 5JIDA 2CJSA 4X83A 5IQ7L 2P8PB 3RDTC 1F3DJ 1R5WB 4Q2ZA 2C7FA 4G6ML 5F7MC 2WQXA 2NY0D 2ZOWA 2Q76A 3FFDA 3GXDA 4M3JA 1X7TA 1S6NA 1INQB 1OANA 1EJ8A 3ALWA 3CC5A 5I5JA 1WWCA 4JRYA 3CDYA 4F7EB 3RI5F 3ZTDC 5GGQH 1FRGL 5C0AE 4KQ0A 1S5HA 5CBEB 1D2PA 5JIIA 1BVOA 3BP7A 4JN2B 4WWPA 4ZOAA 4XH2A 3LRSB 2BPBA 2NY1C 3L1GA 3WGVB 4BWWA 3FO9A 3Q8FA 4WFHE 2VDKB 3R19A 4GINA 1F3DH 4Y2DD 4OV5A 4Y16B 5ICXB 1U8PA 3SIKA 4ADGA 4J3OF 4Q0XL 1UZ6E 1OP9A 1AGDA 3BVNA 1SHSA 5DEFB 1G9ML 3SE3C 4APQC 4ZRGA 4PY8I 1J0IA 4K73A 3GO1L 4KHTL 2IVFC 4TF4A 5I1KH 1N12A 4FTVB 4OU3A 5JIKA 2IWEA 4M61B 1R3IL 4BKLB 2BNQB 2VDNL 3BGFC 4Y89A 1DSWA 4B0MM 3BKJL 2VAAB 1Z5LA 3CN1A 3QWNA 4POZC 5C0CD 4J3UA 3DVGA 2VLRB 1KTRL 3MJWA 3NTCL 4TLSA 5HVHC 1OOAA 2CPCA 5H37H 1HC1A 1WA1X 4OGXL 3RKDC 3B5GA 2GC4C 3VM7A 2DQJH 1Y7VA 2V5YA 5CP7B 1CR9L 2AMUA 3T0WA 5E99L 1I7TA 5D71H 2X1OA 4AEFA 5KBKA 5C0CE 1FBIH 1FIEA 1ADQA 1HZLA 1F2QA 3TT1H 4GW4B 2P8PA 3TN0C 4XODA 1Q38A 1BOGB 1I3VA 5DZ9A 1ZS8A 4QWWC 1F4YH 1MAKA 1N0XL 2XC8A 4DGIL 3SDDC 5DRWA 3BZFB 1E4WL 5CJOH 2R4RH 4M48H 5J1TC 2D03H 3KW8A 2KH2B 1G4MA 3GKZA 2CLZA 4YSTA 3AGWA 4IMKA 4YDJB 5AB9A 43CAB 4Y8AA 1YC8A 3DI3B 2DJUA 3MHZA 3R0NA 4OFVA 4R4FL 4CC0A 4BFGA 4E2OA 4M6OH 4XI5D 1DJXA 2Z1PA 3PGDA 1T6WA 1DUZB 4AL8L 1N2RB 2EUXA 1C12A 1W91A 3DBSA 3MV9E 4R84A 4UV7L 1CL7L 4E41B 3WXWH 3ZXAC 1YNTF 2TSAA 2WIMA 2X4TA 4Y19D 2UZYB 4XWGL 2P8LB 5DVNA 1MWAL 1QSED 1WAAF 3TJEH 4OF5A 2VZ3A 3B3IA 3B9KB 2CU9A 5T3ZH 3WUWG 1L6ZA 3LDBC 2EDBA 5GIRA 3CQFA 3L9BA 2ZAIA 3P0YH 5LCVH 3RPKA 3C6SA 1MDTA 3PWJA 4OM1H 2XZAH 4IOFD 3IJYB 5EO0B 3RNQA 2C9VA 3S4SG 4BDVA 4HWZA 1QUNA 2NYYC 4Q4EA 5KYYB 3HS9A 1KYDA 2Q7YA 1T22B 4F1SA 1B0IA 4WJG3 1E27B 1ZLEA 3MFGB 1FHNA 1RPKA 1VPOH 3FS9A 4KTGA 3RL1B 3VXSD 4PLNC 4L5FE 1DLFL 1MRDH 4HFUH 4P3WA 4Y0GA 4WF7A 3HC4L 5D7IB 3BAIA 4L4TD 5C0RH 3QDJB 1HQRA 3A5VA 2P80A 2KS0A 4FMKA 4MD5A 4D3CH 3KEHA 4LKCB 1QNZL 4J8RA 4EF3A 4JFED 4PVMA 1CD9B 3MXVL 1IGIH 5HGDA 1IEBB 2EDLA 4MBOA 4PS3A 4AQZA 4BK5C 1QA9B 2CDEB 3T8XA 3ARVA 5C1MB 4ZDHA 4I88A 2WZ6A 5ISZA 3ULVF 4HS6A 1UM4H 5DEGB 1R5IA 3RZCD 3WLBA 1OAKL 4ZAKB 4Y5VB 4HIPA 1DO6A 3U79A 5HHPA 2J8UB 4TVPH 2X5PA 1KBBA 1YYLH 3D85B 4GI9A 1AIFA 2MCG1 4CN4A 3D51A 3BFWA 2OMVA 3NJHA 4QCIB 2ZPKL 3EO0A 2BP0B 1LE9A 3QQXA 2QDVA 3C2AH 4JO3H 4LCWE 3RTQB 3DSFH 1J0ZA 2UXVA 3QIBD 5EU6B 5EWIL 5E8EA 3T65B 1KGCE 2QGDA 5E0QA 5FUZH 2X40A 2YPLE 3EYVA 3B2UC 4PCYA 4M7LL 2R1XA 4Z23A 4QXTA 1P5UB 2NUTA 3VD5A 3GT6A 4Z7UF 3WY1A 3JWNG 3VFPA 3R1GH 5EEXA 2BM3A 1IKNA 5IIEB 1U92A 4L29A 4YO0B 1VENA 4S0SD 3WO4B 1R24A 1W0VB 4HFWA 4P07A 3QE5A 4AM0A 1BBDH 5IVXB 4GKNA 5FYJU 3S37X 3K2UL 1T7YA 2MKLC 1ASOA 1BEYL 3RPIA 4WHTB 2J56A 4B0MB 1OCOB 4QOKE 1KG0A 2D2CC 3MODH 1TOXA 4P2RE 3Q6FB 2AEIT 3QIWA 5ITFB 4CADB 3FB7B 3FRPG 4NQDD 1MCHA 5EO1A 3H4FA 3LB6C 1A4JB 4MJIA 4WFFE 1R3KB 1UM6L 5EDSA 1RUAH 4PJ5E 5FWQA 3CX5K 4GKSA 3VD3A 1HXKA 2BRRL 4OD3L 4R9HA 3BCDA 5FUZL 1MEXL 4NQCB 3R06B 4WW2C 3OM3B 2H9GA 4ZDHB 4LKXA 1TJXA 4QJ5B 5EPMB 1PSKH 1EH9A 2DQEH 4I3RH 3FTXA 1LP9B 2WZPD 1HEJC 1ZIBA 3TYFA 4G5ZL 4IHOA 4KAQH 4PSRA 1EGJH 4AQAB 3U4AA 4QHKJ 6CGTA 3CLEH 1AYRA 1KC5L 3LEVL 3GUTB 1YUHA 1WBYA 5EBWB 2W0PA 1XCQA 2ESVA 1UYWH 4BH7B 3MRJB 3D9AL 1KMGA 2XQYA 3DMMC 2WXGA 1HHGA 2PTTB 4FN0A 4YHLH 5FYLD 5JORA 1HXMA 1WG3A 4PJFA 4DP5X 4ANUA 5IK3B 2OPCA 3VXMB 4G6FD 2Q7AA 4U6VH 5I1CL 2XVBA 4TTDC 3KPNA 3AB0B 3T2OA 3VFVB 3ZZLA 1A1MB 4U1JB 1AVAA 3RWGB 3UTQA 3ARPA 5B4MC 3VW3L 4GG8B 1VGKB 3C6SB 3ZQXA 4ERSH 5EZLB 1MRDL 4HFUL 3SQRA 3V6FB 4ZFFA 2JKTM 4GAYB 3C09C 3FUHA 1AE6L 2EO7A 4K3DH 4FXKC 2C8NA 1TVBA 3X13A 3ARFB 1BQHG 3DPDA 3IDMA 1QLRB 2H6PA 2R2HB 3OAZK 2G5RA 4X2UA 3VD0A 5I5IA 2WQVA 1F1GA 2ID5A 2ODIA 2KPWA 4ZTEA 3VXRD 4KMQA 4AYGA 3TLRA 4H5SB 1M05B 4PRDB 3V4VL 3WN6A 5EOQH 4E36A 5E08L 2B16A 4X6CB 4PUBH 1WIOA 3P9LB 4BE5A 1FZMA 4PJBA 3Q8BA 1K2DB 1VA9A 3S36L 4XB8A 2WMPB 3QQDB 4HJGA 4WUUB 3SDYH 2GHWB 4XAWH 3SJVE 4KNQA 1ZHLB 2ZX6A 4L9DA 4NQCD 1RUPH 3U0PB 4FOMA 1YDPB 1KXQE 3MBXL 4ALAC 4KH9A 4OVVA 1IQDA 5SX5K 4YBQD 4OCSL 3QEUB 1R17A 4OZIA 1JPGA 4U1LA 2X4RB 5EU3A 3DOSB 3MO1B 3B9VA 5C0GB 4E41E 5DK0B 1NPUA 5DGQA 2PPEA 2G0KA 5D8JL 1IEBA 4WEBH 5F8RC 1ORQB 5AW1B 5BVJA 1X6NA 3L3JA 1XF2A 1TVHA 3N6YA 2NY4B 1J8HA 1CICB 2AXGA 3IE9A 1OD7A 3MLWH 3GSOA 3II3A 4ZXBA 3QJXA 5I74B 1KBPA 4LCIH 2GABA 1HCYA 2WBXA 3M17B 4WI2A 3S48A 1F42A 3QNYB 1A25A 4LSSH 5GS0C 3QNZB 3U4KA 2F58H 1REIA 3SOTA 3K72B 4H8PA 1AI1H 4AEIH 1BZQK 2J1KA 5DHVA 1E9OB 3G9VA 1NKOA 1UFGA 4CVWA 1ZA3A 3DYMA 2G2RA 3IDIA 5T3ZL 5H37G 4DKTA 5D2NB 1MCPL 1P5UA 1I4FA 3I6LD 3ZLQC 4GO8A 2KBGA 2O1AA 4Z7WA 4GW1A 1LWHA 2NY6D 3L3DA 3VGFA 3R8BB 4MAZA 5CZVL 4I48A 2ZWYA 3Q8CA 1J8SA 2P52A 2SEBA 5ITBH 3G08B 2CLVB 4Y19E 1HTYA 1MFCL 3L5XH 1A6AA 4KNSA 1UXSA 4KK6C 4P2QA 4F58H 2XQYG 4PJFB 1RVFH 3VNZA 4CNIA 3HI6L 5E6IA 4PD4J 4XP5L 1SNRA 4XP9L 2CBPA 1QPPA 3FL7A 1AD9A 3QFJE 4GRWB 4PWFA 3ASWA 3QZPA 5KG9B 3U9UB 2NCMA 1BZ7B 4D0BA 2YN3A 1MI5D 4XP1H 5KYXA 1H15A 3L3JB 3P77A 4JG1L 1E5YA 2VKXA 5EPMA 3RDTA 3BVWA 3QORD 2Y24A 3QDAA 5IB2B 1U92B 1BQHA 4L29B 4XT1C 4YO0A 4JFHD 3L3OA 1QX1A 1NM4A 2BRQA 4MCMA 3JXAA 4XPFL 4NUMA 1F6AA 1IBYA 1D6VH 3FOLB 4HSCX 4FQ1H 4JRXE 1BAFL 4IJ3C 4NAQA 4XPHL 3QIWD 1MFCH 3SPVA 3TIEA 1YEGH 2R0WL 2XUWA 5EUOF 1UA6L 4K07A 3LS5L 1A5FH 4G6JL 5FYJE 3GO1H 4KHTH 3PABA 2YRLA 3AXLA 3EDEA 4XAKD 4GT7A 2JE8A 3CZKA 4Q4IA 2P9RA 2I7OA 1SLVA 1UM5H 4BXSV 4NO5B 5EZLA 3O9WD 4GSRA 3H6AA 2ZAHA 2XICA 4NPJA 3AABA 5T1KD 4F7MA 5FR3A 5L7XH 2FT7A 5DK2B 3UTSD 1U8PB 4LCYB 1C1EL 5LVEA 5DD3L 1KCWA 5KTEH 1TQBC 2ICCA 4QNPE 3MOBL 5T3XD 2K8MA 3ABKB 4ZFGL 2EYRB 1JPEA 1MLBA 5BQ7A 2YUWA 5E00B 1J48A 2LHAA 2EEXA 1A3RL 4HALA 3M8OL 3CDFA 5DF0A 2HPTA 4ATWA 4HLEA 5K9JL 3LN5B 3TYGL 3QORB 3PAUA 2VAJA 4PCTA 3AG4B 4HJJH 4OFQA 4JRYB 3WKQA 5D5MA 1OGAA 3B1TA 4ETYA 5ISZD 3QHTC 3NJLA 2CLRA 2AMGA 4Z1PA 5IQ7H 3TBWB 4L3FA 1RHFA 2WTRA 3DYPA 3ZMEA 4KHXH 3WNMA 3SN6N 3GMMA 3KYOA 5BO1H 1U58B 5DT1H 1ACXA 5F9JA 3HAEG 3GXNA 3VH8A 7PAZA 1SFHA 5IB5A 1K6QH 3KE0A 1AACA 2EH8H 4N0UE 5JW4Q 3CH1B 3T4YB 3AFLA 4HUWB 4LHUD 4MMZC 4LOUD 1OCWL 4G1MA 1A9BB 2L8AA 3AM8A 4N68A 4HUVB 3L54A 5D1QE 2YFOA 4KQ3H 4MKMA 1E6OL 1RZJL 5F9OH 3HRZB 2AJVL 1DVSA 1L6XA 3SJVD 4PV8B 3HPJA 3ZT7A 2ZKWA 4EN2A 1NGXB 3SDCC 2X9WA 5DEJA 4LNRB 1JK9A 1RJZA 4RISH 3RG1C 3BI9X 1KLFA 4MNHB 5D6CB 5TJWK 2YK1H 4N9OB 5JHDD 4JPWH 1FLTX 3QWOB 1X5JA 1RSFA 2YMTA 1ZHKB 1SLXA 1VCAA 3MA7A 1XMEB 3IDJB 1J86A 3ML9A 4NKDB 4KRLB 5CSBA 2EIMB 3ZL4H 4F7TA 2AVGA 1SBSL 2OMWB 2V17H 3KLKA 3QUKB 4ZMQA 3MRIB 3KVPA 4R5VA 3GXTA 4XNQB 3KS0H 4ABVA 2Y7SA 1T5WA 5L2KB 1GY1A 5E6ZA 4WV1B 2EDDA 1CG9A 4GSUA 2X4TB 4NSKB 1MHEB 4OTXL 1O7DE 3AU1B 4FFYA 2KLTA 4YMPA 1EX0A 3MRCB 1AMYA 1AAJA 1NIAA 3OAUH 5JUEL 3PS6A 4XX1E 3QULA 2BLFA 3UZQB 4WCYH 4UT9L 3T1FB 5DS8B 2EVGA 3NIGB 3CFIC 4X8CA 2OJZL 5CZKA 6FABH 4OFDA 2NTFB 1SJXA 3IDNB 1Q72L 2DM2A 4I48B 1BOYA 2P5PA 5DMJB 5DMIL 2FZ3B 2Q86A 5F72S 5AW8B 1UCBH 5ISZB 4GG6F 1LD9A 1BYOA 1HYRC 3EDJA 5IOPB 4JQVC 3QSKB 4RGOH