2CNZA

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (v13a mutant)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fibril protein
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
total genus 23
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cnzA00
2CO4A 2CNZA 2CO6A 2CO7A 2FVNA 2CO3A 2IXQA 2CO1A 3UIYA 2CO2A 4OR1A 2AXWA 4PHXA 5D55A 3UIZA 2CNYA
chains in the Genus database with same CATH superfamily
3WNIA 1N70A 3AS3A 3QPXL 4EJ1C 1CC3A 3BSGA 4GRLB 3C09C 2BIIA 3H4FA 4RAVA 2QZ5A 3ATEA 3R7QA 3O6KL 5DHXB 1KB5B 4GS7B 2F1AA 3VFNA 1FHGA 5IJBC 5KVFH 1SVBA 1KN4L 5F6HI 2FEEI 3UZQB 1D7DA 2NY2B 3CD4A 1KG0A 3D07A 4S2SA 1HXMB 3N50A 3O11A 1TVHB 3VFPA 1L9SA 1E8YA 4YSCA 1R5IB 1ADQA 4L37A 2GFBA 4NQDA 3BKMH 4FZEL 3T1FB 4X6DB 3HRZA 4B5EA 1GYUA 3NACL 5LCVL 1DQDH 2IDUA 3NA9L 1S7SB 1TPXC 4KK9D 5HBBA 5CJQH 4WTQA 1MPAL 3N1GC 1KB9J 4ELME 1I4FA 4MDJA 1F2QA 1IFHL 4P06A 2HG5B 4XPGH 3L7FB 3QCUH 2N4IA 3OLEA 3HAEG 1NPJA 4AUYA 4UT9L 4BE6A 3DC0A 4JM2B 3N41B 4PG9A 5SWSD 2A5UA 3L5HA 3RX9A 3GI9H 3WFBH 3D6GA 3QR0A 2D9QB 2I26N 3ARWA 4B9KC 3BEWA 2Y7NA 2ZPKH 4JS7A 3K6IA 4GAGH 2YN3A 3D4ZA 1T0OA 4YBHA 5LBVA 1K6QH 3W0WA 1MW1A 4KKLD 1KB5H 3F3HA 5L2KD 2XXCB 3ARFB 5DFVC 1MFDH 4HHWA 2WWMC 2YD7A 1WZLA 4YR6B 3ROLB 2OMWA 2ZSVB 5ICXB 3I02A 1M2VB 5BZZA 4LMQI 1PEWA 2G9KA 4B97A 4M4PA 4UUJA 3FULA 1CE1H 4TUUA 1AD0B 4RA0C 2XICA 3BO8A 5CN3A 1LK2B 3GBDA 5H35B 3AY2A 3FB8B 3NESA 4HUVA 2V3EA 4B6ZA 2A0LC 2ZX8A 4H8VA 2NSMA 2D7QA 4XZUB 1BIHA 3FQ2A 4ALAC 3ETBF 4M5TA 3U7WH 2VLLB 1U42A 2GI7A 3AWGA 4JDTL 4ZS7L 1RZ8A 3VNYA 2EKSA 3H2WA 5KYYA 3KYAA 1WAAE 3IDMA 2AMUA 4YFEA 5C7ZA 4WZ9A 1NKGA 1KDIA 4BSWA 1DQJB 1SDDA 1WQVT 2H6OA 2XXFA 4G11A 2YARA 1VACA 3SQRA 1TYEB 4P2YA 5EUOF 1SN2A 2YEQA 3QT2A 2FZ3B 1F2XK 3PV6B 5TPWL 3MDJA 4FG0A 3DX6B 4FXGB 4IEFA 4MRCA 4ZX6A 3WFHB 3L1FA 4QHMB 1Z3GH 5DWPA 5AL8A 4ORGB 1DDHA 1JK8A 1J1PH 2B1AH 1XIWB 1AHKA 4G70B 1FZMB 4ZUTB 4ZFOA 1DE4B 3N55A 2PO6A 4Y19A 1B4JL 1U8NA 2SODB 3X12A 3WKNA 4PVBA 4IBYA 3W39B 4A7GA 4F9PC 4ELMB 1L3NA 4GW5A 4PB0L 2NUTA 2VT0A 2A74C 3O4OC 5ACZA 4GH7B 4KVCL 2Y7LA 4N8PA 1WFUA 1OB0A 5ACMA 1PLBA 1GHFH 4OW6A 3D18B 5EZOH 3S48A 1P5UB 1F3JA 2TRHA 2BS9A 3RWIA 4UDUB 3VB8A 5D7JD 3TBYA 4IBZA 1RPQA 1NMAL 1YEEH 4QXGL 4M61B 2X4SB 5E6IA 2OQJB 4RAUA 4MZRA 4UQ9A 1X5AA 4HPYH 5JW3H 4CRPA 1RULL 4A37A 1QWNA 1IC4H 4RH4A 1YQVH 1I31A 2GW5A 1NIFA 2W8CA 4TSAH 2WSPA 1IQWH 4NBZB 1PX4A 2FWUA 4DK3A 2ODHA 2P46B 4PG2A 3H9SE 2FD6L 4WFEE 2BSRB 2FO4A 2R0LL 3QCTH 2AVGA 3IFNL 3RVTD 2Q6WB 2EVIA 1YYMH 4AZ8B 5I8EB 4PQXA 1CTNA 4I77L 1J7VR 4OH2A 3MGOB 2ROYA 5D8JH 3QUXA 4HF5H 4HQQL 1U3NA 2Z8VC 2DM4A 2R69A 2XFGB 2VDNH 5IK3A 1HSBA 2PWDA 3AT9A 1G9EA 5LQBH 1WBYA 1P9MC 4NDMA 5AB1A 4EI5A 3ZE0F 2XVLA 4WEBL 4YHYB 3B34A 1NEZB 4HX1B 4LEEA 4EBQH 1JD7A 5IB5B 3GLAA 4FADA 4UM8A 5D5MA 3V9FA 3BWZA 1NGZA 1MELA 5T1DH 1YJDL 1NANH 3MJ9H 2FX8H 4X99B 4ZS6D 5I82A 1PPIA 4KMLB 4YFDB 3VXPB 3WIIL 1JTTA 1AACA 5GRUL 1O0VA 3EGDB 1R9FA 2N1TE 1S9YA 3CHQA 5I1HH 4PWEA 1U91A 2YUZA 3REVA 3M1CA 4HFUH 4AMXA 1MAJA 3LH9A 3BT2L 1FO0H 3RIAK 5D1XA 4RMSA 5TD4A 5DVOA 4LCUB 1SEQH 4PP2A 4QYOA 4YC2C 4H1LH 4DT2A 4N0CD 1DBKH 3DRQA 3NSXA 3FK3A 3VMOA 2A1WH 4JPSA 2ADFH 2IJ0C 2CHDA 3FFDB 3CPLB 5FYJH 1D6VH 3RWDB 2NZ9D 4HJEA 3QEQB 2XQYK 2H47C 5DMKA 4XPTH 1JD9A 3LKNB 4J3VA 9CGTA 3GQFA 3ECBB 4IBWA 4WJG3 1AQHA 2XKNB 4JFFB 1KTLA 4WW1B 2WW8A 3VSQA 3GRWA 4QJ4B 2ZUQB 3Q2NA 3MUY1 1E30A 3UPRA 2DM2A 1V54B 4LLDA 1FNGB 4XBGA 1U9KA 1NBVL 3HN8A 4WUKL 5ERWB 3VXOA 1BMGA 2KBGA 4CC0A 4XMUA 1F45A 2EXYC 4UINH 4YH6A 2X05A 4DP5X 4YMPA 4OKDA 4QRTB 4UTCA 4BKLA 2C1PB 1MW3A 3D85A 5B38B 4GMSH 3H9SD 3VNZA 1J88A 1X44A 3DX8B 4WFED 2B2XH 4XCCH 4FXLA 1XSIA 3VFNB 3QNZB 1YA5A 5KBPA 2VJ0A 1A66A 4D9RE 4PJFF 1B3JA 4MAYA 3MNZB 1MCOH 4X8JB 2FJHA 4H7VA 3DYMA 5I16A 1EEZA 4F8TA 3GB7B 3VFTB 3BIBX 5E03A 3O11B 4IRZL 1J5HA 1KCUL 1KTKE 4M29A 4P46D 1F42A 3I6LE 1THAA 3WFCL 3AITA 3WENA 4Y2OB 2XCMC 4QYAA 2NCMA 1A25A 2D73A 1T3FB 4NP9A 1X9UA 4OIAA 2UZXA 4N9GB 5CNHA 1I4FB 3EH2A 3Q8CA 5SX4H 3O3EA 2JCCA 1JPFB 4A7SA 1HIML 1G9HA 2K8QA 4PYGA 5DI8B 3FN9A 4FLHA 3HRZC 4JKLA 3LEVH 1IIIA 2CGZA 2FL5B 3C5SA 3F7LA 4OV6F 1D5ZB 1H3VA 4KI1A 2Y06L 1GAFL 4ODBD 3U1SL 2QHRH 3BEWB 1S5IH 4S1SH 3AREC 5KG9B 3PHAA 5CKGA 1IKNA 5LNDA 2A9DA 2KLRA 4GQ9H 1BOYA 3QZWA 4F2MA 1WS8A 4IS6A 3VD9A 3ASOB 1MF2L 3FZUC 2Q87A 5KYUA 1QRNB 3P4NA 4FXKA 2O5XH 3I75B 4AX3A 1NBYA 3ECUA 1Y18A 1P2CA 2Y0SA 1ADQH 1BQ5A 1JXKA 1FBIH 2NCEA 1Q0XH 4JFZL 1ETZB 5GJSL 4GBXB 4N8CL 1E5UI 1V10A 2NLJA 2AZAA 3D2UB 3MRRA 3TJHD 3OZ9L 3FPYA 4D0DA 4Z7UB 5EZIH 6PCYA 4B7IA 4W9JC 4KROC 2CO1A 2PPAA 3IDMB 4X7DC 4XNXL 3ZXAC 2EDKA 3T6QC 1H0DB 1EO5A 3SE4A 4FI7A 3WTTA 3IDYB 3VXQB 4S1RL 3ZHDA 4XWGL 1UWEH 4JFXA 4FYQA 2CM5A 4PRHA 3FFCE 1JRHH 5CSGA 3ARPA 5L88H 3EDFA 1FAKT 3ZZLA 4QWWD 3P3YA 3IU3B 4RX4D 5EV7A 5TDOA 4OQ1A 4NNYA 2MTPA 4OZ4A 3EO9H 4Z7OB 1I8KB 3E1F1 4OUOA 3K4AA 1HJCA 3BW9B 4U1GB 2KZWA 2F7IA 2CDEA 2JKXA 3PY9A 1B9KA 1K8IA 3V6FB 3GTVA 5HYEA 3EYQC 5ICUA 3ZRCC 4QLWA 4Z8FL 4ZFOB 2E27L 1TQTA 4LPXA 5ANHA 1XV8A 2M26A 3FB6A 5I2IA 1SUJA 1DVFA 4YO0B 5DJZA 3RKPA 3DOHA 2O93L 2IWFA 3IAQA 4FE9A 5EN2B 4CVXA 1JGVL 5EU5A 2ITCA 5I6NA 2PO6C 2OMTA 2BIQA 3HRPA 3U82B 2D3LA 3SPVB 1H15B 2FYVA 5C0IB 1NDGA 3MLRH 2WOBA 2Q86A 1JZ5A 4ANWA 4WNQB 1YNTA 4B9IA 4JREB 3OAZH 4DHLA 2DQDH 2R39A 3WY3A 3BT0A 1YMMD 1P4LB 1D5BB 3MV7D 1NCAL 1BHGA 1CGSH 2DJUA 3CPUA 4ZW7A 5CEYB 4IW4C 5ADOH 1OM3L 4A2HA 4CW1B 3OAYH 4RAUB 5C07E 1JF1B 4G8GE 4LLAA 4TPRL 2HVKB 3BYYA 3QNXB 4N2EA 2UUDH 5HDBF 2VDMB 1DHKA 1YYCA 3SODB 2IXQA 3KYNA 3GYRA 3EFFA 4HCGA 3DVFA 3JUZA 1KJMA 4X4ZA 43CAA 3ISRA 1L7IH 4LDLB 5CFHA 5TH2B 3DX7B 2VITA 4YDVA 3MOAL 1RZGA 1AG6A 2CLZB 3ABLB 1C7TA 3EO0A 2YO3A 3RL2B 5F1KC 5F7DB 4WGKA 2BVOB 1HDMB 4OZGB 2W38A 3DMMA 1Q9KB 4HKBA 4GW1B 4Y5XB 2F8XC 3BP6B 2WP3T 1XQ4A 4AV4A 4NCC1 1UTDA 1YCSA 3D33A 5DUBB 5E8OA 2ATPA 1J5CA 2VLJE 3VO0A 4M6NH 4N2IA 4U3HA 5F6HJ 4YSAA 4TTGA 3K80A 3PL6C 3QUXC 1R75A 2JF1A 5JIHA 1PX8A 5KVGL 1EBPA 3F6IA 2CU9A 3FH7A 1QSZA 1XD0A 4PRBB 4JCLA 1JZ4A 1HNFA 5GJTL 3RVWD 1A7QL 2DQGL 2V5TA 2ZF9A 1Y6NR 1LD9B 2NY4D 4JG1L 4XMKH 1A6VL 5EB9A 3RUGF 1VESA 3VJ6A 1U91B 4OIFA 1VSCA 3LB6D 4JHWH 5T3XE 2P5WE 1ZTMA 4V1DE 5AB2A 1FCCA 2X4PA 5AZEL 1TNMA 3LV3B 4Q0XH 1OF2B 2WLIA 4U1HB 4TTDD 3CLFL 3N85L 5E9DE 2OK0H 1ZHBB 5AFAA 2R8SH 1IT9H 1EFXA 1MCSA 6CGTA 3BLBA 2DDQH 2R69H 3C12A 1QVOA 1UA3A 2PW2B 5LNGA 3GJFA 2DOCA 1OTUC 2UWEA 3KPPA 4PJDE 2WO4A 3RL1B 3RU8L 3OJMB 5D1XC 4A6YL 5DMKB 5DUPH 2B9BA 1K4DA 3KLAB 3ETTA 2XN9E 2ALAA 5HDQH 4UQ3B 1QKZL 2GEEA 3QZLA 1WZ1H 4ZNEA 1CG9B 2IDCA 3C6SA 3CSYA 3DOSA 4ZOCA 2VDRL 2XG5A 1A1OA 2X10A 4G8GD 3HMWH 3MRFA 3CFBA 1HHKA 4XBGB 3WXWH 2EINB 4XMLL 3U2SA 2FNBA 1VFAA 4HISA 3V4VA 5ESAB 3GBEA 4NNXB 1TFPA 4R3SA 3II2A 3N40F 4HDIA 3MO1A 4F57H 1BLNB 5D93C 3MXWH 2CXGA 3DHPA 5F0JB 3TBCA 5GS1B 5DMYA 1PAZA 4FNLH 2W65A 1AH1A 3GSNB 3X1FA 2PF6A 1KXHA 1W8EA 1PIGA 2FEDC 2V5RA 3FT2A 4J23A 1UACL 3MRQA 2WYIA 3HZKB 3UO1L 5DUML 3G5YB 4EI6A 2X7LB 3ESVF 3NYKA 4PJBF 4ZUWB 3GXPA 3CJJA 2AV1A 1E4JA 5F9OH 4FQIH 4PUBH 2X1QA 3B9AA 1OAJA 5MERB 1G6RB 3ZRFC 4MYWB 4MAYC 2AQ3A 1TTRA 1MJUH 4KKAC 5HGBA 1IM3D 3SBRA 4DQOH 2VDQH 3VG0H 3GRWH 3SDAB 5JOPD 1VCBC 1WIOA 5MEOA 2JQMA 3O3EB 1UKTA 3O41A 4AL8H 3MJ8A 4X0NA 1MY7A 4N8VB 4N5EC 5C0FA 5TQ2H 4PJGE 3DSNB 1MZZA 1G9ML 4LQ1A 4Z5RB 4LP4A 3WO4C 7PAZA 4UM9A 3H3KA 4XNYL 2P5WD 3HB3B 3Q9QA 4PWHA 3Q5YA 5FA3A 3HJ0A 4V1DB 1W6WA 3OC5A 1A0QH 4F7PB 1IAMA 4X9BA 4UOZA 1OHQA 5JLZB 5E9DD 5E2TH 2XN2A 4PWGA 1N67A 3PGFH 1TEGA 4HXBH 4X2UA 5FO8B 1ONQA 1EPFA 3QJVB 3KGRA 4GUCA 3KR3H 4JR9H 2PNDA 1BZDA 1QSED 4AQ8A 5A1AA 2AV7B 2KC0A 3DVGB 3IDJB 3EJTA 2XTLA 4LEXL 3HPJA 5E94B 3RNQB 3S3JA 1U92A 1YNLL 1DQKA 2XN9B 4FXKC 5GISH 3K2IA 4AUUA 1DSYA 1BP3B 2EYRA 3FQUA 1BD2A 5FHBL 3VFSA 3O3BB 1DVQA 3F00A 1YEKH 2FECI 1ZE3C 4XB8A 5B3JE 2BMKA 2GSIA 2VDKB 2G60L 4UTAA 1AKPA 3L3JB 3AY4C 2PPDA 2MRYA 3D34A 4OGAC 1VFBB 4X4YB 2C3HA 2WVVA 3JWOC 1NMBH 4X42A 1I8MB 3B2VL 4Z7WB 2JNZA 1EMTL 1LMIA 1FNEB 2GBVA 1EAQA 4G7QB 3QG6A 4X5LA 1Y7VA 2WKOA 3PXJA 3G9VA 4M1CC 3SE4C 4JLRB 5D1QA 4GIOA 1YSOA 3GS7A 2PPCA 5GGRA 3KWXA 5BJTB 3UABA 2MPAL 4ZFGL 5FDWA 1ZE3H 4HU8A 1ID2A 4GMTL 4AITA 4JJHA 2Y7QA 4XCYA 3BPNB 2VMCA 1E4KC 2FHCA 3NIFB 1GMEA 5F7KC 1S2EA 5JZ7C 2WD0A 3ALWA 4QHUA 1OTTD 5E08H 4NZUL 5F7YC 1CFQB 4J3OD 4Z7IA 2BHYA 5E4AA 1F4YH 2JFCA 3JWOH 3QWRA 4C4KO 4FNPA 1LE5A 3PWPA 2AK1H 1JFHA 5J6HB 2PETA 1ORQB 4PRAA 2E0PA 3MQIA 3MV8A 2LVCA 1UB5A 3F7VA 3PXHA 3QO1A 4YPGA 3RY4A 4TM9A 1VGEH 3Q3GA 3GEWB 4X6CF 4PJCE 2F0CA 1DJSA 1CL7H 1E90A 1J9RA 4YHNA 5AUMA 5J9PA 2EDXA 2QADD 5C3TA 5A3IC 2O6CA 5JOFA 3CFEA 5GZNA 4DKFL 4OR1A 2B77A 5GSRB 2JQZA 3TCTA 3W56A 4APXA 1JCKA 1G7JA 2X0VA 1E3FA 1AR1B 1R5WA 5M7QA 1WHPA 3K74B 1JJUA 4G8FA 4KRPB 4KUCD 4YDJA 1KEML 1UADC 3MJWA 1DUZA 1T5WB 4C57C 5C2BL 4YLQT 3RVVD 2CGRL 5LN8A 1LP9A 3IJEA 3G5XB 4K07A 5GHWL 4LSDA 4LCVA 1CR9L 2W9LA 4PS4H 5DQ9A 2XWRA 3OAZK 4BUQA 2AJXH 3RGHA 1ES0A 3VI3F 5IUSA 2I7OA 5ID1B 2ESVB 1QR4A 3QPQD 2VL5B 5J13B 2GHZA 5JORA 1X5MA 3X1NA 3BLPX 2JCWA 4HUXB 1KLUB 1Q8MA 3OAYK 3NDZE 1X4XA 2VM4A 5FGSA 3VH8G 3NFSH 5IHUL 4MD0B 3CC1A 1WK0A 1X5GA 3G9AB 1MLBB 2VRAA 2UUDK 4HK3J 4DTGH 3IF1A 4QOKD 3BH8A 3DMMC 4KO6A 3WEXB 3FSVA 3ZHNA 2HZHA 4Z95H 1G5AA 4Y5YA 3AC0A 5CIPA 1N64L 5KSAD 4X0KB 4BWUA 2VWEE 4PJ6A 5ANME 1NIAA 3LNIA 2UZIL 3KPSB 4WHCA 1DBAH 4FG4A 3I3BA 1I1AB 4KPHH 1JZGA 5EBLA 3AMKA 2W59A 4L8SA 3MLSL 4H20L 3Q6FB 4ODHL 1XH3B 2WLHA 2Y24A 4U31A 5EORH 4ZW8A 2Y3NA 4YEFA 3O3UN 3GC3A 2VLKB 4QCIB 1ZK9A 3HW7A 2YQGA 4Y2LA 4HH9A 4G83A 3DIFA 4DN3L 4L8CA 4DP1X 3OAUH 4U6HB 4XI5D 5LJYH 1FYHB 3INOA 2V2WB 4A7TA 3ZDYB 2FX7L 3QORC 4PJCB 3WS6A 1K4DB 5T5NG 4L5FE 1IM9A 2B0SH 2YUVA 4BQ9A 1NM9A 4OF6A 4Q56A 4F7EA 4W4OA 4IRSD 4WI3A 4K2UH 2CHNA 5IWLA 1OW0A 2HUHA 1FZOA 1HTYA 4EOWH 5DFWH 2F5BL 4NN7B 5J1TC 1FZJA 5C0EA 3GBNL 1F90H 2FEEL 5F7EL 5L6YL 3RGVC 1SF5A 1AXSB 5AL0A 4R3SB 3TIDA 4I13B 1Z0NA 5B7EA 4I2XE 2HJKA 4MJIA 4OGXL 3TZVD 4OFIA 3IGLA 1RZ7H 1TJGH 3OXRB 4NWUH 1U2CA 2F08A 5C0JA 1GGBH 1CICD 1S7WB 3FU7B 2JV6A 3DETC 3S37H 5DS2A 5DZAA 3Q1SL 2XTJB 1PY0A 1DDTA 3VYNA 4HSCX 1HWWA 1DSFH 3GJFH 1I82A 1LTXA 3VMNA 3PWNA 4D7PA 4OD2B 4N8UA 3ZMNA 1IIKA 3DV6A 1NCWH 4GAJL 2DH3A 2N0KA 4JRYA 2VXUL 4XOEA 1BAGA 4MCZA 3WJMA 4B3EA 4OT1L 3LRMA 1F1DA 3EJPA 1U8HA 3GSWB 4QXTB 4P5KB 1DVZA 1A7PH 5GGVH 3MBED 4OFYA 3HC4L 3ZL4L 3ZZ1A 5AAPA 1V7MH 3MV9B 1DBML 3S8FB 3JT2A 1PKQB 4JDEA 3TO2B 3V4VH 5ANMB 2V3FA 5E1AA 1RUML 4F8OA 4WFHE 3QNYB 5BVJB 4DK6A 1JG9A 3QFDB 4J3TA 5IQ7L 4KJYA 1A7NL 2NNXA 5HY9A 3T6ZA 3B4NA 5C0BE 1BIIA 3ATFA 3LQAC 3SCMA 3BUQA 1KPRB 5HJBA 4XCEA 1CB4A 4M48H 4BYHA 2EDFA 3HE7B 1HS6A 1XCTB 1Z7JA 3O4LA 4W6YB 1EEYA 1U3HA 2DD8L 3M88A 3MLZL 1ONQB 4TUOA 3FCSB 1AHWB 4TNVK 4CNIA 3ULSA 3P9LB 1MNNA 1NAMA 2X2JA 2ZKXA 4OLZH 4M6MH 3KBPA 4ZO7A 1KULA 2DBLL 4PJIF 1ED3A 3PDOB 1NGQH 3CIQA 2APWA 3NCYS 1XH2A 2WSDA 3KLSA 4ESKA 2VLRA 12E8L 3RTQD 1RUKH 2NY3C 1S7TB 3LQAH 5DJ6A 3ULUF 3K1DA 4G7RB 4H88H 3AGWA 5JIMA 5E95B 1QBML 2B15A 4K73A 4PLJD 5CEZE 1FORH 2BS8A 1F6AB 1C1EL 2F58H 4DSYA 1WVZA 4ZTOL 4H8HA 3BWAB 3RKDC 3SKMB 1YAZA 2D31B 4JE4B 4X8CA 4I2XB 4KDVA 1VENA 4GRWH 1AZUA 4LSPH 2FAUA 5IHZA 1RVFL 1CZ8H 4JY5L 3QG6B 3RZCD 1SVZA 3IBOA 2NY1B 1AY1L 5EOQL 2FJGA 3FKUS 1L0QA 4OM0L 3N40P 4YXHL 1ZLSL 4XB7A 2Z4TA 3AT8A 4YHIB 3DXAE 3T0EA 4CN6A 3FU9A 4KH2A 1RP9A 4LBAA 1EUUA 3MRCA 3CE1A 5EWIL 3TA3A 4HYTB 3UYRL 4JJ5A 1FI8C 5EO0B 4C47A 3HI5L 2BP8A 1IGFH 4XWOC 5TGBB 2Q3ZA 1L9PA 4KI5D 2ORBH 5CWSA 5C09E 1O5PA 5DRWB 1IQDB 3CN4A 3UTSD 4ELKA 3QXAA 2Z35B 3WFEL 2NX5D 2XHNA 4XMPL 4GKZA 5I5RA 5IMKA 4RMQA 4UTAH 1E5CA 2H45A 5CD3A 2JIXB 3HZYA 2JXMB 1WEJH 3P9MA 4YL9A 4HD9A 1TOXA 3MV8B 1S8DB 1UB5B 3Q2CA 4H26B 4YK4C 2KPWA 4X4XB 1ILUA 5GGUA 4P2OA 1KWKA 2IG2H 2FSEA 5E6SB 4HULB 5C0BD 1KPVB 3AWFA 5EA0L 2E6QA 4JGMA 1KGIA 4JRFA 4W9KC 3GBML 1J5IA 3FMGL 1KNOA 4GEIA 5CCKH 2F8IA 2X53A 3VI4F 5EOCH 4TNWF 3UTPD 2H0JA 3NQKA 1I7UB 2PPEA 1VLXA 2E5EA 3U36B 4LLVB 3O8XC 1NUDA 1RHHA 1SJHA 4HUUB 1A65A 2ISDA 4U7MA 1S7VB 5DCCA 2ZOUA 3D87B 1E28A 4F58L 3EZJB 4KKCC 4MXWH 1G9NH 3IJEB 3SZKC 4EDWL 1HHGB 2I07A 4YWGH 4TVPE 2NYZA 1FGNH 4FFZA 3ULVH 4IGBD 1BQHA 5JW4M 4HWBA 3ZPDA 5CEZD 3BAIA 3WOVA 1JNNL 3LIUA 5FW8A 3B8SA 1IJ9A 3NFNB 4DO5A 5D71L 4BZ2A 4M4RA 1H3XA 4HWEH 1UVQA 3FO0H 3EHBD 2J2ZA 4MWFB 2YPKB 1DUYA 2LLLA 4K9EL 4M8QA 1FCGA 4TRPH 4XNZB 1G7HB 2VR6A 5AW3B 5I8CA 1QMUA 2A4EA 2H8PB 5AVTB 3NIGB 3NIDE 2CH8A 2B3IA 4HS8L 5K39A 2NY0B 3DUUB 4PY7A 4MNQD 1T0PB 1U8CA 1WCBA 4YSRA 2EDHA 4IOSD 1CXIA 5L4MA 1QEWA 4U1NB 3S98A 3WIHA 3DXAD 4RGOH 3T6XA 1SHSA 2WBJD 5CIPB 5FV2A 1QFHA 4MB3A 3NK4A 3S35X 1U8LB 5IVNA 2A6KA 4RCAA 4H8QA 4HMCA 3SHSA 5IQ9B 4OBRA 5C09B 4XP1H 2JB5L 4Y5YC 4JO3L 2FVNA 4Y2DC 5I66B 1W15A 4N3TA 2CK0L 3LZPA 1NOAA 1QSFD 5T1LD 1JDCA 3C6LD 5JQIB 2ENJA 3FT1A 3ISYA 4HH9B 3PHOA 2TAAA 4MA7H 5DK2B 2RR3A 4C54A 2GYSA 4ODTL 4FGMA 1CLZL 4NWTH 3PUCA 1P7QD 4UDTB 3JV0A 3MMEB 3Q6GH 3FU8A 1OCWH 1RZPA 3L5XH 4YXKL 2K9FB 5I18H 1F4WH 2GIXA 2X4QB 1BAWA 3LRSA 4Z3FA 4H5SB 5EUOE 1EK3A 4O9HH 4ACTA 4PRNA 1UCBH 2O61B 2PN5A 2CUIA 3KBFA 1Z9PA 5CIPH 3MLWL 1XGYL 3WS6C 2A9MH 2DQUL 2K3TA 2QSVA 3QXVA 2K4AA 4PJFA 4X8GA 2Y2WA 1IFRA 4R4ND 3U0PB 3LNHA 4XO8A 1OB1B 1W80A 4JPKH 4CMMA 3T2LA 1RZFH 4W4OC 1M9WA 3WNOA 4PS3A 1ZJAA 3FTZA 1OW0C 4MJIB 2YSTA 3HPLB 4KHXL 1K3IA 3U7YH 4HIEA 3DVNA 4TVPD 5I1CL 1M6OB 2BIPA 2YA0A 4WTZA 2BNRB 3NJHA 1XR9B 3JV6B 3ARBC 3B2UD 3NCCB 1N9PA 1WWAX 4G9FA 1HCZA 4PJ7E 4YBQD 4L4TE 4WWPA 2H1PH 4U6XA 5DZLA 3QEGL 4HS3B 4LVNC 5MEND 4X7TB 4EF3A 4RWYH 3VD3A 5J6GA 1GGUA 3QRFM 1VIWA 4JFUA 4XP4L 4L2LA 2VW7A 4NZ8A 2NNAA 4JFHE 5BS0E 3GXUB 2BRRH 4FXTA 4AGPA 4F15C 4LXFA 5GRJL 2XZAH 4X6EB 3MRMA 4NP4L 2ZYSA 3SGEI 2ADGB 3ARXA 3FQNB 1TDQA 2J72A 3GZQA 3OKKA 4OCRL 1KBBA 1YMHA 2GBTA 4FNSA 4J4PD 4PJ8D 5KVFE 1GGCL 4GQRA 3FSWA 4LSUH 5BXFB 4JNXA 1JPTL 4HIHA 5KSUA 3H7BA 2XY2A 4TLKA 5ETUB 3TO4A 4OBSA 4JFEB 1GIGL 1VZIA 2XQBH 3V0VB 3MTXA 1BPVA 4OSUH 3ARDD 3UBFA 1RD6A 3P73A 3SOBH 3ZKNC 1J5OL 1X6NA 3GJFK 3SGDH 5I17B 1UXWB 4O4YH 4NHUA 2CJTA 4PJHE 4C56A 4UV7H 2AVFA 4FOMA 2PTUA 5JIIA 3HBZA 3T2PA 3CGTA 1NLBH 2F53A 1JDDA 3UTTA 1U3HB 2XZQH 3ZSSA 4X7FC 1AGBB 1MCIA 2AERT 2F15A 4M5ZH 5F7BA 5IVZB 3TBVA 1HEZB 2FWLB 4EI0A 3SCMC 1MEXH 3HN3A 1V05A 2R7EA 4LASH 2H0PA 5DD0L 4JAMA 5IBTH 3V0IA 1N6QH 1NFAA 1G7MA 1T1XA 1ACYL 5D2NC 4DUWA 4U1SA 5IMMA 2NXYB 5EUOB 2VAJA 1LDSA 1X5XA 2V7NA 2ZP0T 5HHNB 4PRIE 1RJZA 1FZKB 3DURA 3MCYA 3VSUA 4KUZH 1PSKH 2EUVA 4EUPG 3P2DA 4U3SB 3TV3L 2ZKHL 3C60D 4NC2B 4FQHB 3JV5A 3OHXA 3ZY7A 1I7RA 1KTJA 2VDPL 1HE8A 2GIMA 4BCXA 3DJSA 2AC0A 3G6JE 3MRKB 2GEQA 5EZPA 4FNTA 4BWTA 4XNMB 4ZMQA 5C8JA 3MRGB 1TJHH 2HVJA 2H6UA 4AQ1A 4F7CB 2ZOKA 3MOBH 5EEWA 1I9RH 2BW4A 4WUUA 5J5EA 4NRXB 1S7UA 2YPLB 4LHUA 4L4TB 5D7LD 4ANKA 2AJZA 3WHE1 1DTUA 2W81C 3HNVH 2W9DH 1GW0A 4NNPH 2RQ8A 3TA3B 2DIJA 5PCYA 1JXJA 3Q43A 4JFHD 5BS0D 3RPIA 1NAMH 2BP8B 3ABGA 4PM1A 3LYRA 5BCAA 1KCKA 3RFRA 3X14B 4DKAA 1F8TH 4QHNA 1P1ZB 2IANA 1AGFB 3GO1L 2EDRA 1KYOK 1BXAA 3GI8H 4P4KB 1XF3A 1PLGH 3VYPA 3QJHB 1FE8H 1IARB 4NZFA 3DRTB 5CD5D 3AXHA 3LN4A 4E5XA 5B8CA 1ZTXL 3IDXL 2D0HA 3H9HA 5TQ0H 4FFVD 4JRLA 1WAEA 4L3CA 1G6VK 4NYLB 3A4DA 3DV4B 4JMNA 3WEOA 3SBWA 3WBDA 1ID5I 3MA7A 3MV01 4MJ4A 1P69B 4NI6A 4X7SL 4ODWA 4GP8B 3L45A 4I0PB 1K4CA 2FGWH 4QRRB 3UJTH 3QVAA 2VN7A 4PMEA 1NGXB 1UKSA 1Y6MR 3DI3B 3P3UA 5IBUG 1SJMA 3LPGA 2B8OT 4Z3GA 5DR5H 1FP5A 3SO3B 2XWXA 2QT6A 3DX0A 5F44A 1AAJA 2R27A 4LLUA 1TJXA 4YAQA 5LXVA 1INDL 1KEGL 4X6FA 3SJVD 4HIPA 4OGYL 5FM5O 3VGAB 3ZE0B 3GKWH 1KTCA 1DQLL 4XAWL 3QWOA 2LTQC 4PRIB 5D7KE 4Y5VA 2JELL 4YDIL 4WLCA 4JZNB 2C9QA 2DQTL 1NKOA 3OX8A 4MB4A 1QA9B 5L7XH 4M4RB 1RUQL 4UI2A 2HT3C 5A16A 1MHPH 4L9LA 3QI9A 4ZPTA 1S7XB 3MRBB 3S96A 3QQ4A 4PGEB 3EBIA 4X80H 1Q0EA 1G43A 3RVXC 3OKNA 5LDSA 1F1GA 2DQIH 2K8MA 4ILDA 5C6TH 1NGPL 5ISZB 5TK2A 3BZEB 3LPOA 2IGTA 1QYGH 2ICWA 1KT2B 3HG1A 1QEWB 4M9OA 3K6SA 2QR0B 4ONHA 4AYEC 1I8UA 5T3ZL 3OPUA 3FTXA 1M56B 4OJEH 5EC1A 5F71A 4KK6D 3GUTB 4GG6E 4IDJL 3ZE2F 4PJXF 4QRQB 5DDHA 3GPEA 4AEIL 1XB8A 2DLEA 1SYVB 2EE9A 2VMJA 1IEBA 3QYNA 2VXTL 3RVUC 3SDDC 2R4SH 4NENB 5SX5H 1F1AA 3DX9B 4JKNA 4LSRH 2ZP9A 3ARFD 3MNDA 1CFSB 4FFZH 3V5DA 2F1BA 5KOMC 1KXTB 4FKHA 4HWBH 1QNZH 4XNQB 3AWEA 4XCFL 1GOGA 1UOKA 3AS0A 2ZNXA 4PJ5A 5DRXA 1A9BB 1IKFL 2J4WL 4BZ2H 1QABA 1CYXA 2EDOA 1NJ9B 4J1UB 3D48R 4BFBD 4JANA 4UILL 5B1JC 2G9HB 2DJMA 2H2SC 1I85A 2ZD0A 3O2VH 4HG4J 4NUJA 3UJJL 4M3JA 3U4KA 2WZAA 4HU2A 3WIHH 4WENB 2ZIDA 4G9DB 4A66A 4F7MA 2VCOA 3CMGA 4PJFB 3QJFB 1ZS8A 3VXSA 4R4FH 1WZAA 4M43H 5JPMB 4PGZA 3M1BB 3TT1L 1OPGL 1IX2A 3WN5B 4F27A 2K7PA 1RSFA 4U6VL 3C5ZA 4O2CA 5FYJE 3HS0B 1JOIA 4DIXA 1DCLA 3J7HA 5FHAH 3X1EA 3ZUNC 3L3GA 1MG3C 5HYJA 1PCXA 3VD5A 4DF9A 4KQ3L 5LLIC 1JL8A 2YAFA 5HGHA 3HVDA 3ZMRA 1BAFL 1I1RA 1IGYA 2EIEA 2ADIB 1W8OA 2WXIA 2WUCL 3VRJA 5KVDL 2G5BA 2NNAB 2WZ6A 1VPOH 1CU4L 1MWAA 2HT2C 3A6CL 1JTOA 3IB4A 3O4OB 3WKMH 4MAZA 1F58L 2IFFH 4HUWA 5F96L 3MRMB 5FO7A 1UENA 4Y7OC 2AGJH 4OF8A 2CCLA 2D2CC 4XRCB 4YZFF 2Y6TE 3U25A 4BA0A 3D3VE 4ONGL 4RIRB 3QUMB 2M2DA 4N26A 1WITA 3OKKB 2P24A 4FQXA 3D50A 5IEKB 4AUJA 3WEBA 1MCQA 1JGIA 1TU2B 1WCQA 1AIZA 1I7ZA 4I9XA 3T6VA 5KVEH 3WFDL 2GJZA 3BIKB 2Y1ZA 1F00I 1AD9A 5DD5H 4TQEL 2Y7SA 4KVNH 3W9DA 4KRMB 4HPHA 4OUUB 5I1GH 1UJ3A 1L5GA 5F9JB 2MQ3A 5A7BA 3P73B 1UM6L 5C0AA 1UG9A 2MPVA 4G5ZH 3K8LA 3TO4C 2C5DC 5TE4H 3VXMA 3FRPA 3OMNB 3R06A 3UTTB 2WBKA 2FECL 3W9EB 4PH8A 1WFJA 3SIKA 3AVEA 4NQCB 1E4WH 4QAMB 1UZ8A 3VYOA 4JAMB 4P57A 4Z0BH 3VFUA 3NPZB 2J6WA 1VERA 1E8WA 4K71C 3GSQB 3T4AA 4FQ1H 4U1SB 2EDLA 4DVRH 1P7HL 2WJ7A 2R56H 3S35L 3ZDXF 1P4UA 1AI1L 4K23L 5I26A 2FR4A 1FHNA 4HXAL 1RJZB 2A9AA 2VZVA 4DW2H 6FABL 4DPCX 2BM3A 4HT1L 4EN3C 4B7LA 1I7RB 2X9WA 1EHNA 3LMJL 1HHHB 2AP2A 1Z32X 2Z8SA 4N2AA 4NQDE 1MRCH 5AOKA 5FYJD 5LUMA 2YPVA 3ES6A 3VE0B 3GZOA 3D25B 4DGVL 1IC7H 4HJUA 4RGNB 2F7RA 2PPFA 2CO7B 5DHYA 4G42A 1A14L 2NY5C 3OHXC 4Y2NA 4NPYA 2Z31B 2X4OA 4UQBA 2W60B 2BLFA 3QUHA 4BELD 3ELAT 5JTWA 1KJ2A 3DVIA 4L8DB 3UDWA 3W57A 4BM7A 4NO0D 4LOUD 4QXUH 2LR4A 3BH9B 2HTKC 1R24A 3FO2B 3LKQB 4UOQA 2I5YH 2HJFA 2OYMA 2X1XR 2CIKB 4JFQB 4X6CA 2WCPA 2I9LA 4XP6L 3W0WE 2E86A 3G6DH 4PRDA 3AQDA 3D3VD 2ZSWB 3V6ZA 5HYSB 4M9PA 4D8PA 3E7JA 2AKRA 1QRKA 3K2MC 4Z7VA 7CGTA 3CQPA 4E42A 4KTGA 2HTLC 1L9RA 2EYTA 3PP3H 2HB0A 1UM5H 4NC1C 1ULVA 2WNWA 1AO7D 3CSTA 5ILTH 1I9JL 4FMFA 3QEQD 5IW1A 1OT4A 1YUKB 4P2RD 2X2IA 4HJJL 4H0GA 5HDBB 5C97A 1ZXKA 3PIQA 5D2LE 2OSXA 2A83B 1T22B 5IB4B 3EXJA 4Y1AB 1FVCB 2X4UB 3KL0A 5IM7A 1GJUA 3ESPA 3KL3A 2CBOA 3BEVA 3RILA 4I0CC 3INUL 3V5HA 5LWYL 3E2HB 3NMEA 1RIVL 3W5NA 5FKAB 5KYNA 5E4IA 4AVKA 3VI3A 2NPLX 3CSBA 2LOEA 3IRZA 4PD4J 4PJBE 4Z3TA 1CFNA 2J8HA 2XWEA 1P4BL 2ZWZA 3NCJL 4LLUB 3GM0A 4PP1D 4XX1E 4BFIB 3U0WH 1CLOL 1J86A 2DB8A 1AQMA 5AWNL 3NOIA 1CGXA 2QPEB 3GMPA 3TWYA 3HBPA 5C08B 2EDMA 2NMSA 1P5VA 5LCVA 1D5IH 1A6WH 4M3HA 5DO8A 3BVNB 3L7EB 4D0CA 2XKUA 2Y5TA 4X5QA 1F4AA 2GI0A 3QISA 4E68A 5DRZB 4N68A 2VC2B 4NQDD 3MXVL 5C6PB 1CGUA 4HHAB 4ODUA 2WNXA 3HI1A 5F3BB 4UT9A 3S96B 1LO4H 3F7YA 4Y19E 4WCYL 1JHLH 4V11A 3RUGB 1HQRB 5C3LD 1ZK5A 2BOBB 1GW6A 2YS4A 2FO8A 4M5YL 2DQJH 3B2XA 1ZLDA 2VRKA 5D4IA 3AQZA 4L9LC 3WG7B 1OOAA 3QI9C 3AREB 1I8LA 3M6DA 1CE6A 3M17A 2RMNA 2G3ZA 3N9GL 4RFNC 1NDMA 3GHBH 5T5NF 2WIIA 2XT1B 5MI0B 3T0XA 3QIUA 2MCG1 3L1EA 4ODXB 4EZMA 4JQIL 5DLLA 5BQ7B 2IPUK 4NZJA 4P23A 4GW4B 5IF0B 1NCGA 3W0WD 5GZOA 5INDB 2KMWA 1T5XB 1C16A 1BZ7B 1WV7T 4NO3B 5CUSL 3EOAA 1PU0A 4JQVA 1T4WA 3QEUB 1QPPA 2O5YH 3Q8FA 5I1EL 1YEDB 1IGTA 3BP7A 3L4XA 3TEUA 4MMZA 3MRJB 3O6ML 4A2FA 3ZO0A 1TIUA 4ODVL 4ELDA 1WUZA 1U4EA 1BXUA 3L9YA 3MRHB 1B0GB 1J0IA 2EXTA 4KROB 4NUJB 4UB0L 3FONA 2OJZL 5HHOA 3MR9B 4A55A 4E41E 3SE9H 4YHOL 5SX5K 3BKYH 3F12B 5IVXA 4XPFL 2HT4D 3HI6H 4UNUA 2W1NA 3TWCL 4Y4FA 1OK0A 2DWEA 4ZPVA 4G7YH 1PZAA 4UBDD 1VEPA 4PJBB 5IT2H 4BQBA 2XUWA 2H9GB 1RZKL 2EEBA 4LKCB 1TT6A 4CADB 4H0IA 1S7QA 5AKVA 1WC7B 3OKDA 2PWFA 2P45B 4N1HB 2V8MA 1F3RB 4KXZI 4ZXBB 5T33L 1R3JA 4HLZH 3RIFF 5CP3A 5BZXA 1OANA 1Z6JT 3C5ZC 1UM4L 4M7LT 4TL5A 4XN5A 3TH2T 4D9QE 1IGYB 4JZJA 4KNSA 2X6VA 1BX2A 3DIDA 1HH9A 4U6YB 4BH7B 1JPGB 1ET8A 1RMFH 3S5LA 5BZDA 2PO6D 3L9RB 4Y19D 3OR7A 4RMUA 1UH2A 4QY8A 5HI5D 3BD3A 4Q9QL 3DBSA 5B39B 5D1XE 5G5DA 4C4KT 4IKJA 4GNKB 5KEZA 4WDIB 5G55A 3L81A 4LSQH 4R7VA 1HOEA 1I7ZB 2DQ6A 5LGYA 5IMOA 1SN0A 1ZIBA 5D96B 3TVMC 5DWUH 3RDTB 4XGZB 1J0JA 2XWJA 3MLVH 5A2JH 1WRFA 1L5GB 4YHKL 4N25A 5L9DH 2G75B 1KXQA 1N12A 1BV8A 2BH0A 3F6LA 1QFWI 4XPBH 5I6XC 2VDOH 5JHLL 1CF8H 5CJOL 5C0AB 4PJIA 5HHXL 1RXLA 4MA3A 1CDYA 5EZJA 4NQVB 5E6ID 3SGJA 1ZGLB 2ZCKL 4DZ8A 5MEPA 2GBAA 4NKQB 4AGNA 2X4TB 1IE4A 3P0YH 4MCYB 5AKSA 4ATTA 4PRPA 3MRPA 4X4ME 1GCYA 1HH6A 4LRNL 3P3TA 1MWAH 4XPAH 1W72B 3W1ZA 1LEIB 3A24A 4JGUA 4QRSA 4HSAC 4ETQA 4FI8A 1OAXL 3T4AB 4DZBB 1L6ZA 4BDVA 1GZQA 5I73B 2JB6B 3IXTA 3D0AA 3OJDB 3C6EA 4E41B 3A23A 1AQDB 3GINA 2P80A 2LU3A 5TF1H 4PS7A 5I71C 1UH3A 2VIRA 3QULB 4OB5H 4Q2ZB 3QUXD 4YE4L 1UD6A 1S9VB 1LDPH 1T04A 2C9VA 1MFEL 1T83C 3CHOA 4JB9L 4U1JA 1M7IB 3PWVB 4H8WC 3C2SA 4N86A 3LS4H 5EO9B 1JV2B 4QNPE 2SEBA 5L2KA 5AENA 3P4LA 4EI5D 4WO4B 3T0WA 5BUPA 1XCQA 2WK2A 1RURL 5FGCB 1CFTA 1DR9A 3UZVA 2OXGA 2ICEB 3NJFA 2GUOB 3PHQA 5JXAH 2F5AH 1E7UA 1WE5A 4GO6B 4AK1A 4QTHB 3WIFA 3L95A 3HJEA 3M46A 4LLWA 2JKSA 4EXKA 1MQKL 3H3BC 5I0DA 4JHAH 5EO1B 5CBAA 5EF2A 4M6OH 2EICA 1J0HA 3ESMA 2Q10A 1D2OA 4YL4A 4N0FB 2Z91A 4H8WH 4OZHF 1OSPH 2FLMA 4I1RA 4IBSA 3P0VH 4KX9A 1OTUD 3UDWC 4AH2A 5D1XD 1F4HA 4TULL 1UWGL 4MAUL 1P7KA 3WL9A 1TZGH 4PREA 5AW2B 1USZA 1KIRA 3IJSB 4XP9H 5I1LA 2ZCLL 2ED7A 3ZUCA 4N5UA 1IAIL 5FUOH 1ZV5A 5GGVY 1UCTA 2YPVH 3BISA 4IMLB 1I3VA 4ZMZA 4XBEL 5DURD 2YBGA 1T0NA 2YKKA 1UD3A 4XBPB 3PABB 3RBSA 2XYBA 3VGHA 1F86A 1PQZB 2W80C 3ILQD 1KJ2H 5D93B 5F97E 1MFCH 4IHBA 2MSPA 2Z0BA 1JFQL 1QEXA 3DO4A 4K15A 3SDYH 3VXTA 2P26A 4YDLB 2EZ0C 1BBDL 2FEDD 2EE2A 4MD4B 5LBSL 2KUTA 1CFNB 4X7CC 1G5GA 1RZIB 2WXFA 1OAZH 2YHGA 3IJHA 1IL1A 4K3DH 4NXSA 5HJGA 5JHDA 3D85D 1FV1B 3MU3A 5CBEA 2B9AA 5K59E 3KBEA 3PP3K 3IJYA 4PRHE 4IRZA 4HZLA 5D4QA 3EDJA 3DKHA 2M1KA 2IALA 2OR9H 3HNSH 3QJUB 4MAYD 1OSZA 2Y5TB 4MA1B 4JO4H 3SQOH 1UWXH 1L7TH 1PDKA 4Z6AT 3V7AE 4OZIF 3HHMA 1GGIL 5AG9A 1MFUA 4G6JH 2D7MA 4ODUB 3ALXA 4P5TA 1B0RB 4YSSA 1SNRA 4N5ED 2VSDA 4E9RA 3QPXH 3HZMB 5I0WA 3VWKB 2IDFA 1ECYA 4AEEA 1SM3L 3EFOB 3O6KH 3OGCA 4YVNA 1JXGA 2IH3B 2Y7MA 2OM5A 4G80B 1WUNT 1AZZC 4CDHA 1NINA 3LN5A 2NQCA 4K4KA 3A0OA 2DI9A 3D69B 1I8LC 2XY1A 3QQ9D 3NACH 4UNTA 5LCVH 4GKNB 2ZAGA 1TQBC 2YGOA 2FX9L 3QJZA 3QIUC 1DQTA 1MPAH 2Q2EB 1I3RB 4R90L 2FHFA 1DFXA 3KYOB 3RE0A 3B6SA 1WF5A 1J1OL 4GQZA 5GZOC 1IGTB 1ZT4B 3GSOA 2NYKA 2JSFA 4QKXB 1WIPA 2X70B 2CO6A 2X4NB 3E80A 4UT9H 3ZIMA 2WM0A 4KZDL 3BXNA 1JN6A 4LFHD 1CXKA 5EDXA 3RY6A 5D7EA 4AQEA 4WKZA 4POYA 4HIJA 3UADA 4OGAD 3HAEB 1SEBB 1AGEB 3GS4A 1J87A 3O2WH 3UXFA 3L4ZA 4LCCA 4Y4FB 4NQSB 4ZPVB 5LKNA 1G4RA 1GYCA 1XGQA 3GJEB 3CZGA 3TEZA 4O51A 3NRFA 4XPHL 4YSEA 3UYPA 1IBGL 3A3YB 4PRHD 3U30C 1MNUH 3UBXA 3SDXA 5IMLA 1AIFA 3DI2B 1DLFL 5EIIG 2AJVL 2JKWA 3I9IA 4WGVB 5JZ7D 2KDGA 1K5WA 3CCHB 1IAOB 1MCRA 4WEEA 4JDTH 5BZWA 4ZS7H 4DGIH 1A6TB 2VOTA 5CCJA 5EN3A 4LPYA 2L04A 3NVQA 4JDVA 4RRPM 3R0MA 5IB2B 4KXCA 3QZOA 2XIDA 3QUZA 3D30A 1DVFD 4BH8A 3L3DB 4P3DB 5B22A 1NCJA 2AQRA 3L1OH 1WFIA 2GSGA 4JZJC 5F2FA 3WSQL 1WICA 3V0DA 3QGVA 3MLTB 5T5FL 4JY4B 1O7VA 4NRZA 5TPWH 2WQAA 4EVNB 4PV9A 3DYOA 2XFXB 4FTVA 1SOQA 2MMXA 4WI5A 4YSOA 5F21B 5IMOB 4W9FC 4XX5A 1CIUA 4RVBA 4HIXH 3CVHB 2QTVA 4YXLH 1TKWA 2FSDA 2N1KA 4F9LA 2UWEE 2B4CL 3VA6A 1QPKA 2N0MA 3C08L 3FOMA 3TLRA 4ZUSA 1JZ3A 1CXHA 1S5HB 4XMWA 1N7ML 3WXVL 1AZBA 2JK5B 4UZGA 2DMCA 3TYFB 1B4JH 3WLBA 1ZOXA 4AEHL 4ZG1A 4KZEH 5CP3H 1T7YA 4ZNEE 2GIYA 1HZKA 2CBMA 3NTCL 5L8JB 2CKBB 1D5XB 4N6RB 4RSYA 4PB0H 3Q9PA 1V3LA 4KRPD 4EQ2A 2A99A 5KSVB 1KENL 1I53A 4LU5L 3H2QA 2Y2YA 4UTBA 3SGJC 2LV4A 3WGVB 5DHVA 3L8QA 5BV7B 4OJDH 2H2PC 3AB0C 5AW8B 5DRNA 4MSWB 2DBJA 2GVYA 5EEXA 2H6PA 1G6RL 1MRFH 3QDJB 5DJ8A 4KK9C 2MCMA 2ENQA 5EZLA 2C1OA 2C4FU 4NB7A 4KV5E 3OJVC 4JFPA 5HJ3B 5FDYA 3W5MA 3FT3A 4PWIA 4AYGA 1T04B 3MA9L 4NSKA 2EDQA 3T3MF 5TDNA 2A3TA 4U1JB 1FIGL 1FH2A 1G0YR 4KTDL 3BWSA 1HI6A 1CI5A 4XMTA 1J48A 1RULH 2BP0A 1AZNA 1U3ZA 3FQTA 1GS6X 3MOQA 4LLMA 4I5BB 5T3XL 1KACB 4LCIH 3MODL 3V10A 5BUAA 2ZKMX 2QQQA 2FD6H 3OM3B 3BWUC 2X1OA 3IFNH 2YOCA 1XT5A 3GMLB 2WB7A 3QZMA 1CD8A 2BC4A 1X7QA 2IQ9L 4BQCA 3QIBA 4I77H 1YY8B 1C08B 1I1AD 4QRAA 3IETA 4HQQH 1QQDB 3VG9B 1GC1L 1RJYB 4J3OG 1GXEA 5INCB 3KCPA 4HEPA 4GRWE 4WGWB 4JPIB 4A6YA 4XCNA 4E9VA 2WKLA 3QG7L 3ARGB 3TPKA 5EU7C 1JUFA 4ZBJA 1EZUA 3QORB 5CEXB 2IH1B 4IOFD 1EFXD 3VI4B 3D39A 5I1LB 4F2FA 4AM0A 1NPNA 1JNHB 3FS9A 1IGCH 1ZA3A 1NANI 5EPMB 2XU9A 3QJSB 1UZ6F 4A2EA 5CLXA 3JVGA 5GSVB 5E0QA 5SWZE 1R3KB 1DFBL 1NC4B 5GRUH 4KJPD 2NY6C 1CGYA 4PPTA 3IVKB 3VFRA 4JFYB 4Y7MA 3UG5A 1D9KB 1DJWA 1UXLA 3QJRB 3RGVB 3VFOB 5DZPA 3VWJA 5C9JA 3VX1A 2OMYA 4OCXL 3BT2H 2YKLL 3H4HA 4OF3A 3KPTA 3NCBB 3WS3A 3MCLL 3GMOA 3ROOB 4Z7QE 4WEMB 1KJVB 1A02N 1UEYA 3AMLA 3U6XA 3ASNB 5H2BA 4DO6A 3U9PL 2C9AA 5HPMB 2FK9A 1JHTA 2VMDA 3F83A 3OWRA 1U36A 1EJOL 5F0LB 1I1YA 2ZOLA 4BFRA 2B08A 2ETWA 2VJ8A 2XTJD 1A2YA 2BRQA 4H25A 2GITB 3BAKA 2YD9A 3EUUA 3W82A 3EDDA 4YLBA 4O02B 1CD1A 1YMMA 4GAYB 1RH8A 4ZO8A 3TTSA 4PJXA 2PCFB 1NBVH 4H13C 4WUKH 2EECA 3STLA 5F1IB 1FJ1B 1JNJA 3BPCB 3UEZA 1BZ9A 4JEGB 3JQOB 2OL3B 5E4EB 4P5TC 2H3NB 3NFPB 5IHBA 5I15L 3IJ7A 2WINB 3VXUE 3FQXB 3PGDA 3V7MA 4NHCL 4UM9D 3T2NL 4LCWB 1USQA 4IRZH 1KCUH 1UWXK 4R2GC 1KELH 5D7IA 1J0KA 1ZKAA 2NXZC 3GTTA 3KPLB 1CBVH 3L5JA 3WFCH 4R97B 15C8L 2J44A 1TO4A 4EZKA 2GY7B 2CO2A 2QGCA 1RUAL 3J07A 4IKKA 5SX4I 2QQNL 3G6AB 1HIMH 1KCWA 3FBQA 3CVBA 4FFTA 2NY3D 1IC5H 2G2NA 5E0FA 3ASWA 5SWZB 1COBA 1N8OE 2FQEA 4AWJC 2Y06H 3UP1A 1GAFH 1WLHA 1WGVA 3U1SH 1B6DA 3AQXA 3HBQA 4IK7A 1FVDA 1LP9E 3LS5L 1BD2D 2XV3A 3RKDD 2ZAIA 2AJ3A 2OTUA 4GY4A 5A6LA 4YSQA 2Z93B 5GS0L 5HVFB 4OJAA 3FBKA 2HFFA 5B1KA 1OGAE 2OMZB 1Q0YL 2ARJB 1NDTA 1MF2H 1QI4A 2W0FB 3SE3A 1XGQB 2N7AA 1TVBA 4JFTA 3AT0A 4P9HL 4ZS6C 1KZQA 1N5AA 1XGRA 3S4SA 1QO3A 3QDGB 1QPXA 3QHTC 5FF6B 3WTUA 2JKLA 3K71A 2EH7L 1JV5A 1R6VA 2DEWX 5FYKU 5J12C 5IMLB 3EYVA 4LCCC 4XWOD 1SOSA 4JFZH 3NN8B 3SDCA 4KOCA 1HWHB 1HVXA 1SXSA 1SMDA 1UZGA 5D1QD 5GJSH 1OCZB 3JZ7A 4N8CH 1VGKB 1T1YA 5ALCL 5SV3A 1FFNA 1B9ZA 3OZ9H 5KS9A 3KHOA 3E8VA 1OCOB 4N0CC 3KE0A 1SFHA 4XNXH 5I74C 1I8IA 1WISA 4C55A 3LIZA 5AAMC 2DYRB 2NZ9C 1D6EB 3IS1X 4OCYL 4S1RH 2TSBA 4XWGH 1MCCA 1JDAA 3BFQG 1S9XA 3QWRD 1JRHI 3PWPD 4R96A 3U4EB 3ZTDC 2XN0A 2DPKA 3I50L 3ULVD 3H0TA 3DNKA 2BZ7A 1MUJB 4TQPA 3QUZC 3BAWA 1LE9B 3MV8D 5EFIB 1E8XA 1KIUA 2AQQA 1AKJB 3VXUB 2BNUB 3KPQB 2VRQA 3IE9A 5DYOB 1IEAA 5G4OA 2QEJA 1PLAA 1K5NB 5EH1A 5AB0A 3JTTA 1ODAA 1KGJA 3TCLB 4Z8FH 2E27H 3S3PA 1Z9SB 3O8XB 4R7DA 5GZND 4NQQA 2CHXA 2DH2A 2DL2A 1BOGA 4N0UA 4BK5A 4Z77B 1G7LB 4F9LC 2A9NL 3MHZA 5KJRL 1J9QA 1I7TB 2FT8A 4RMTA 4GO8A 3I74A 2YFOA 2XN1A 1JGVH 1TQSA 2YC1A 1TJIL 3HUJA 4HKXB 1Q72L 5HI3C 3TPUA 1FL5A 2HA1A 2KYIA 2DQFA 4N0YL 3H3PH 3RAJH 1DN2A 1VKXA 2PYEA 1FN4B 2X89A 4FJ6A 2QMKA 2A73B 2RCSH 2M8XA 2XV2A 4NAQA 4FJYA 4JG9A 5EOTB 1EAPB 3CQQA 4G7VL 1NCAH 2RFXA 1KSRA 4JFPB 1OGAB 4UQCA 3AU0A 3FT3B 1NC2B 4YNYB 4JFDA 1OM3H 1MJJB 4ELMF 3ZL1A 1FC1A 4YLCA 1YHPA 4TPRH 2BP0B 2DYSB 2NUPA 5EUKB 2P8MB 2JKTM 5I1AA 1H3WM 1X5ZA 4LO9A 43C9B 1Q38A 4KMQA 3IMWA 3HCVA 3I6GB 4JRYE 2NY0D 3MBWB 2R0WL 1HXYA 1Y0LA 2O5NA 3WLWC 2CLVB 2LFEA 2G30A 3MOAH 3LEXA 5K5YA 4FA8A 5T1MA 5GXBB 1YPZE 4PVMA 4UTBH 5F8QC 3UAEA 5DHVH 3RJDA 1CIDA 5GIRA 3WHXA 1ZV9A 3VA2C 3EGSB 1T7WA 4IIQA 2FYYB 4ZYKA 3BAXA 2GPZA 4WJ5B 1KMGA 1JUFB 3QIBC 1MG2C 4G6ML 4PBXA 4ZQTA 2G4GA 2YBRA 4MRBA 4YDNA 3O4LE 5D2NE 2WLLA 1XL4A 1CK0H 2ZKWA 4OM1L 5DJ2A 3TJHC 3U0TA 7FABL 5D1ZB 1GTFA 1TQWA 2J7LA 1AE6H 2VDRB 5ABDE 1P1VA 2VL4A 1QLEB 2UZYA 3DDGA 5GJTH 2XBTA 2J8UA 1A7QH 2DQGH 1BEYL 1L9QA 5FFGA 1QFUL 1WAAF 1A6VH 2BX5A 2VO5A 4R9HA 4R8WL 3KPNB 4PWFA 3VXNA 1C8PA 3VWJB 5F7LB 4ANUA 3CZFB 1IAIM 2PXYA 2VLRE 4QWWC 2WXGA 2ZUYA 3D09A 5AZEH 1MJ8H 1VB9A 4W9CC 4WI7A 32C2A 1DEEB 3CLFH 2XI9A 3ARBB 3BQUA 3JVFC 4N85A 1LVEA 2MOGA 4MJID 1SY6A 5GGQH 3RU8H 4A6YH 3T65A 2YXVA 4NQEB 4L2YA 3B1TA 1Q9OB 1AQKL 1VHPA 2F9BT 3IPFA 4EIUA 1H6UA 2G4EA 2OJEA 1IC1A 2QVIA 3HE6B 1GL4B 4I48A 5ICZA 1TEYA 3E9UA 3ZYIA 3ZE2B 2K9UA 4PJXB 2AQSA 4XMLH 1O5DT 4JL1A 4JRYD 2GJPA 3QA3A 4WWID 4DEUA 3FOLA 4PCYA 2K78A 2CQVA 3CFKA 1C5CL 3NJMA 3ESOA 4G8IB 5FLVA 2B59B 1XCWA 1NL0L 4LP5A 2JJTC 2NT0A 4OFYD 4IM8A 2KQNA 3FQ4A 4N2DA 1TZ8A 1GGYA 4LLQB 3H55A 5F3FA 1UACH 1ML0A 1UA7A 1R19A 3KVPA 3UO1H 5DUMH 4AOFA 4JFED 4PJ9B 4DGWC 3C5XA 3H85A 1TYRA 5DMIL 3VQ2C 4XVJL 3MC0A 1PKOA 5I9QB 3ZL2A 3SCMD 4CC4A 2EDYA 3TBSB 4XC3L 3GFUA 1XVSA 4ZMPA 1ZHKA 4BKTC 1DQMH 3O4LD 4JE0A 3BDYL 1U3HD 3BCDA 2BNQA 3QARA 2DWDA 4FQ2L 1U30A 3OB0H 4DCQA 5C7XL 4M7ZC 4NIYE 1BZEA 3APNA 4K94L 4P5RA 5EIVA 3WJLA 1F6LL 1SDAB 3TEXA 3EO1A 1THCA 3PDDA 5BPPA 2FATL 4Y4KB 3KXFA 4QMEA 3I9PA 1AP2B 2KLTA 2GK0A 2VLRD 5FECA 5IUCA 2D03L 2MKLC 2XG4B 4F1ZA 5BRPA 3LQZA 2XDHA 1NH6A 2G2RB 1E6JL 1X5KA 3D0VB 1FVEB 3DPBB 3S4SB 2OJ1A 1CT8A 1QO3B 4GT0A 4PTTA 3T0AA 5AG8A 1N8ZA 2J5WA 2HFEB 1T0MA 1EVTC 2NY4C 4R4BA 1UUNA 3DJTA 2P1YA 3EYVB 4MNHA 3S5ZA 2QHLA 5ES4B 4MX7A 3SDCB 5KZCD 3LB6C 4ZAKA 4M7JL 1LO5A 5FB8A 1TUPA 3UOAB 1HL9A 4K5NA 5DT1L 1ZWIB 4M5SA 3BN9C 2B1HL 1T1YB 3H9YA 5FHBH 3T0ED 3TA3D 4CSZA 4TTDC 3NUKA 4OLVL 3FTGA 2QSQA 1A3RL 2H32B 4JZOB 2G60H 3FUFA 3H9ZA 4P99A 2GJ6E 5IB1A 5HHVL 1HJBC 2FWSA 1C5DA 1Y07A 1T6WA 5DJAA 4ZSOE 5HXMA 2WXPA 1HAUA 3V0WL 4UCFA 1OAQL 2KDYA 5IW3A 2VMEA 4J2QA 3B2VH 1UOWA 4ZI8A 5E9NA 5BRZA 4LF3A 3X17A 5F7NC 3Q1EA 4ADIA 4K8RL 1UQSB 3CX5K 3OVUB 4LNRA 4NUMA 4P2OD 4WTXA 2OMUB 4W70A 3RPKA 2MPAH 4ZFGH 2Q7YB 3ARTA 4TMPA 4GMTH 4PU2A 4I0PD 3IGAB 4BSJA 4OF5A 4QRPB 1J8HA 1HQ4B 5IW6A 3APDA 4OKVA 3ZDXB 4GSRA 3JV4B 2XQYG 3TF7C 5J6SA 5L0QB 3ZTCC 1WWWX 3MRLA 4AW7A 4WU5B 3D08A 4GPVA 3EF4A 1JTPA 2XWDA 4MDIB 2V33A 3FQ1A 3LIZH 4BK5C 3I9AA 2DQFB 3FU3A 1FLRL 3BHBB 4LDEB 1EHAA 5CLWA 4MS8D 1A1NB 1KGWA 1Q1JH 2HT3D 2NTSP 4PTUB 1CL7I 3T2QA 3VRIB 4ABWA 2IOOA 4G9FE 4MMYB 3QQDA 4JDZA 1SPDA 4AT6A 1ZLWH 3Q06A 4G5AA 4K3EL 4NPJA 3ZYOA 4DKFH 3HVNA 3BGMB 3VU2A 3CVIL 4J3XA 5FO2A 5KBNC 1TQVA 3FYEB 3FUEA 3WEMA 1AG0A 4QT5B 2Y36H 2F6AA 4MD5B 5JPNA 1O9ZA 4I8DA 5JW4R 5DEFA 1N0XL 3PP4L 5C2BH 3RVUD 1PZ3A 3BH4A 3LKSA 5DVPA 2ZUSA 3SDDB 1ZHNB 5ESVA 4U1LB 1CR9H 5J0BA 4KRNA 1ZMYA 3SKOA 4BQ6A 3M07A 2YRPA 2H4EA 5DJ0A 3QFJA 3OHMB 4NGHL 3T77A 3CBRA 1G0DA 4U3XA 1I1FA 2GJ6B 3I9GH 3C9NA 4FYSA 2CM6A 4ZSOB 1DVXA 5IR1B 1N0LA 4GG8A 1MCFA 2BDNH 4LK4A 4XB3A 2ATAA 5IHUH 1Q1PA 4ZYKB 4AIZA 3KPRB 3QAZC 2GTWA 4C56E 2P7TA 2R1XA 2Q1EA 1U8PB 3BZ4B 3QBTB 1EZVX 2VR3A 3RFZC 3KHQA 2F53E 2C4FT 1NOLA 3X3FL 4IIQC 4ABUA 3PWJB 4QEGA 3E38A 2BJML 4DEWA 4ETYA 2R2EA 4GSQA 3SQBA 3VH8B 4Z3EA 3B7SA 4PN6A 2UYLB 3MREA 2UZIH 1MH5A 4FC3E 1XF5B 5AVWB 3VFWB 5CSZA 4KGJA 1RK0A 2P5EB 2VDLB 4FHJA 4HC1A 4W93A 3MLSH 4H20H 4ODHH 4IU3A 1AJ7L 1NCBL 5FA4B 1MZYA 3TJPA 4MNGA 1S3KL 4P2QA 1ZHLB 2WC7A 3P77B 5TF0A 4E9WA 3E6FB 3DECA 32C2B 2EYSB 3L2NA 3WCYA 4OZIA 2KS0A 3UTSA 4XNDA 2IAMB 1E5YA 4DN3H 3EYFB 1FG2A 1PNCA 1BFOA 1ZA6A 2NX5A 5J3HD 3QUGA 4I85A 5CZXD 5AALA 1FL6B 3QDHA 4XOAA 1Q9LA 3MVSA 3L3IB 2DLGA 1XHHA 1OTTC 2HT2D 3BQUC 3JZYA 3LD8C 4L48A 4WUUE 5HDOA 1RSYA 4Q6IC 3KPMA 1CQKA 3B9KA 2ARJQ 1OD7A 1JXDA 3DX4A 3O6FB 4UWQB 5KVFL 3FRUB 2F5BH 4ES8A 3ML8A 3L6FB 3GBNH 4X83A 4HKJB 2ZJSL 5F7EH 2IANE 4HW6A 5L6YH 3D4GA 5KTEL 4HIIB 1L9TA 3AJ7A 3IRCA 3KYMA 4W9GC 4NC1E 1UATA 1QACA 4EIBA 2D4FA 4NN5C 1M7DB 3CXDL 3C87A 3T08A 1O7SA 4DKTA 2MQ0A 2YWZA 3NGBC 3Q1SH 3SPCA 4CMHB 1SY6H 5FOBB 1IC0A 4UIMA 3B8YA 4I18B 3GI9L 1R3HA 3EYUH 2EIZA 2X38A 3LXCA 3OMIB 1A64A 2CIIB 1EANA 3MNVA 3BYTA 3REWA 3RVVC 4C56D 5MP6L 4GAJH 4K7FA 3PAVA 5DFAA 5ENWB 1R3IL 4GAGL 4IRJA 3WY4A 4OT1H 5DU7A 4OZFA 3UTTD 4GI8A 2ERJC 1FGVL 2VERA 2F54A 4QJ5B 3RWCB 4CC4C 4LKXA 4NQCD 3HC4H 3ZL4H 4OQTL 1DBMH 5D9SB 4QXWA 5E5MB 1Z0MA 1JXFA 5IJCC 4OCSL 2WUBH 1DVUA 2IOIA 2RGSA 2UY6A 4KKQA 5JW4Q 2Q2LA 5F9AC 1W0WA 5EF0A 1YDPB 1EQWA 3PQYA 3V6OA 1X9QA 2QBWA 2X3BA 2Z6FA 4YHML 5IQ7H 1W16A 3K46A 1A7NH 1XL6A 4EN3B 2GK0B 2V5MA 2J57A 2O1AA 2F7PA 4RNRA 3FU6A 5IREA 4IHOA 5J1AB 3F05A 2J12B 4J28A 2EEDA 1JHKH 2FHBA 3NPSB 1MI5A 2D4DA 4GLRH 2RAMA 4GXVL 4MMXB 4NKMA 2FH8A 2PW1B 1UB6A 2DD8H 1WBZA 3L9EA 2J5LC 2YD8A 3GEFA 1N8ZB 4K0OA 3TN0B 1KTBA 3PFQA 3OB0K 5BW7A 4TVUA 1E9QA 1N2RA 4CVZB 4WUUD 5CHNB 2OZ4L 3VDCA 2DBLH 2VYRE 2OMVB 4G71B 5IG7A 2Z31D 1G7QA 1WWCA 2VR5A 2IF7A 3HG1E 4IDLA 2XYCA 4XOBA 1YEFL 3U46B 3U2IA 3KM1A 1Q9WA 4NKDB 3BVWA 5B3NA 5A2CA 1QBMH 2IAND 1C1EH 4M8RA 2AQPA 4JRXB 4YIQA 4ALAL 4XI5C 4U1IB 2B1AL 4ZTOH 5DQJA 3MLXL 3TBWB 4DWHA 3C2AL 3UAFA 1HWGB 4L4VA 1EV2E 4PJDF 4FULA 2WWNA 4M8UA 1RVFH 4PJ5E 2I69A 1VADA 4OM0H 5MEQA 1SOKA 5DO2C 1ZLSH 4YXHH 3QR2A 3POHA 1C7SA 3LXBA 4AYSA 4WJKB 3UYRH 5EWIH 1BCIA 3HI5H 3WUWG 5IFAH 2NT1A 3KMDA 3MX0A 4MYPA 4P3WA 1OXYA 4XVTL 1BG1A 2V5YA 1ZEAL 3VD0A 3HC0B 4AENB 1CICC 2AI0L 3WFEH 2B3RA 2X6CA 1O75A 4XMPH 3ZBMA 3OXSB 3BP5B 1G7PB 1Z3RA 4ZNCD 2C7UA 1U93A 1FA4A 1KBGL 3QH3A 2ZYIA 3MJ6A 1U8IB 1XR8A 1IC4L 2EJ1A 2ADJA 3WU1A 1YQVL 4Y9BA 4UNVA 1ZVYA 3BX7C 5HYJE 1BA9A 4GQPH 4PJAA 4H1LG 3FMGH 5ACLA 3VFVA 2NW2A 1S9WA 3AABA 4JY6B 5KBLA 1U58B 3QUML 2PR4L 1X5YA 4YUEH 3JWNH 3Q2LA 5FKPB 4JFSA 3QI9D 3C8HA 4J3OF 2A6IA 4UOJA 2APXA 3F85A 5E5LA 2UVEA 4PJGF 3CDYA 4OZHB 4YN3A 2VDNL 3HG1D 3KJ4C 4BEIA 4F58H 4HS6B 2EVHA 1FNSL 4EDWH 3RWEB 1SQMA 2HLEB 5HHPB 5JPNC 4APQA 2Q76B 4EBQL 2O4EA 4FQPA 4UU9B 3VDAA 5KAQG 3C8KA 2BZDA 1KBWA 3AG1B 3EYOA 1XX9C 3P4OA 1JNNH 2X6AA 5D6CB 1ZLWK 4AYBA 5KW9H 1XF2B 5K9KA 5D71H 1MY5A 4TUKL 4U4IA 1N0LB 1UHVA 4JO1L 4K9EH 3S34H 4UQ2A 4WV1C 1YYLL 4L1TA 5I6PA 1BM3H 1MSPA 5HHQA 4ZX3A 2P7TB 5I1HL 5DF0A 3MBXH 4PJ5D 1YEJL 3GDBA 5H94B 3QZNA 4W68A 1YC8A 3RTQC 1UH4A 4CBPA 1HL8A 1GJWA 5IJKA 1EIBA 2R2EB 1KIPB 5CLTA 4PLJC 4TSCL 5B3JF 4PIBA 4TLTA 1H3GA 4UQIM 3C5JA 3P1VA 1MH5B 3VFMB 1K2DA 2YLHA 3R0NA 4BSVB 1INQA 1D6VL 4URKA 2JB5H 4JO3H 4IU3B 4XPTL 1YZZA 2Q3AA 2CK0H 3GMRB 4O5LL 4JN1L 3VXSD 3MGTA 3PRZA 4RRPA 5CCGE 4QO1B 4FQQA 1K9TA 3QIWA 1U8MB 4OZIB 2AK4A 5DJYA 1T7ZA 5ITFB 4L3EA 3ZQWA 4ODTH 3O2DL 1T4KB 1QFPA 1CLZH 5E2VL 2XVKA 2X3CA 3QDMB 4UINL 2UXFA 4KI5C 2VH5L 4XODA 3IJ8A 4KRLB 4MZ2A 4NRYB 4YXKH 4F33A 1FFTB 4WHTB 2Z4QB 3WNPA 2C9PA 4DH2A 2OYLA 2ZXQA 4JPWH 1MHEA 3QCVL 4IMKC 1GPOL 4XXCA 2IQAB 5EBWB 2B2XL 1OAUL 2WLJA 3OQRA 1KTDB 2C3XA 1XGYH 3MLWH 2DQUH 2IPKB 4KWUA 5IIEB 3CFDA 4AVJA 4R7XA 2QVFB 1C8QA 4YDMA 2E74C 3IKKA 3B7RL 5LGHH 2V2TA 2IMNA 4HC1H 3BIAX 2YRLA 3PUUA 3NSJA 4I87A 3TVMB 4KHXH 1JGDB 4AXWB 4FQXD 5FOJA 4LOVA 5I1CH 4PJCF 1A6ZB 4OCMC 3L13A 2FT7A 4Z7VE 3X3GH 1FYTE 4GRLA 1QTYT 4TXVB 2X4RB 3QEGH 3DJZA 5D7SH 3ULAB 3LZNA 4XP4H 3NJVA 3GPSA 4KXBA 1NA8A 5C0AD 1R3HB 5E6ZA 3UZQA 1BVOA 1AGCB 5AVVB 3REWB 3VXMD 5FUZL 4K7FB 5I8KH 5E6RB 4S1SL 1HXMA 2F7OA 4NP4H 2WHVA 3WE1A 1TVHA 2BWQA 1R5IA 1AS8A 2VR7A 2J3SA 3T1FA 2F54B 2VM3A 2AXFB 4J3WA 5BO0D 4OCRH 1S7SA 3CH1B 1OWWA 1GGCH 2E76C 1SBSL 4I3GA 4Y16B 2HH0L 2DTMH 1JPTH 2UY6B 2HG5A 2K7QA 3L7FA 1M3JA 1YRKA 4JCMA 1GIGH 5E8PB 4N20A 4Q89A 1J12A 4JM2A 3V4PB 2NOYA 1TTUA 1TTAA 1J5OH 3SGDI 5AVUB 3K91A 5C0CE 3TIEB 1MI5B 3V6OC 5HI4C 3TF4A 4XX1G 4NKMB 3VM7A 4L4JA 3KD4A 3P69A 3ROLA 4YHPA 4YR6A 4WO4D 2ZSVA 4A7UA 1M2VA 3KS0J 3KLHC 1URLA 1EXGA 5DD0H 1XEUA 1KCSH 5AW6B 5IROA 2JWYA 1AD0A 1ACYH 3CC5B 4OZFH 1LK2A 5H35A 3FB8A 3MRIB 5AB9A 2KZBA 1JRHL 1FL3B 1EDHA 3TCXA 5BW7C 2APFA 4FRWA 4RZKA 1OO2A 3FUKA 3IFPB 3VCLB 4DGUA 2EDWA 2AANA 4JPVL 3TV3H 2YQBA 2WLNA 2ZKHH 3NSFA 2VLLA 4RMBA 3LZQA 2VDPH 3W2DL 4HK3N 2G5UA 2WLZA 3IMUA 3ATDA 3FC8A 3KLDA 3EOYG 4Z3IA 2HKAA 4ZUUB 4EUPB 1DQJA 1KJ3L 5KUKA 4BFOA 1FYTB 2FIRT 3ET9F 5A2BA 2F2HA 4DOHB 3T3PE 4IBVA 1FPTL 4OAWA 2FZ3A 4P2CG 3PV6A 5CILL 3DX6A 3WFHA 4CSSA 4Z7NE 1MCHA 2UV3A 2EZ0D 3KBHE 3L3HA 4EQ3A 4ORGA 4KQ4H 1A4JB 1IV8A 3SB3A 4ONOA 1WP6A 2HKFL 3ILPB 1XIWA 5HHOE 2VW6A 3JWDC 1FZMA 5IVXE 3UX9B 4ZUTA 1LEKB 1DE4A 3B2UC 1SYSB 2DEYX 2IAAC 2XWCA 4L1HA 1YO4A 1ZLVH 5I76B 5DHDA 1MW0A 3KH3A 1E6OL 1BXXA 1ZTXH 4JFOB 3IDXH 3W39A 1CDGA 4HZ1A 4P4RB 2E9GA 3RIFK 3T3MB 4ELMA 3G08B 1INEL 4B50A 4GKSB 5HHMB 2PTTB 2F18A 3VXRE 3OKLB 3CIAA 3GLDA 2AEPL 2ADJB 3QS3A 1OQXA 4B9ZA 1SUHA 1AGDB 3K0YA 3BPLB 1H8SA 2C34A 3LKPB 4N2LA 3JTBA 4X7SH 4KO7A 3D18A 4LBEA 1P5UA 4M1DL 4F5CE 3VTMA 1T1ZB 2Y2TA 1S9WB 2C3VB 4UDUA 4KNUA 4PJ8C 4J4PC 3FH8A 3MJGX 5AD0B 3L5IA 4M61A 1BVKB 3FQRB 5MHSE 2CR3A 2VTFA 2Z92B 2X4SA 3OPZH 2OQJA 4Q58C 3VWKD 3BGFB 4JQIA 1INDH 2FQGA 3E1ZA 5IBUB 5CGYC 1PX3A 1XB6A 2IWGA 5E00B 4XAWH 1NKRA 1OP9A 2JELH 4YDIH 4TOYH 4X5RA 5BOPA 3QIUD 1OAKL 2BSRA 4P23D 5GZOD 2YLKA 4K3JL 2Q6WA 1RUQH 3S7GA 1KXQE 1W72L 4FEIA 3F7KA 5I8EA 4AZ8A 4PJEF 3MGOA 2DMBA 4XMKL 1T1WA 5HHQB 2WO2B 5AYTA 1NGPH 2AEQL 4JHWL 2ITEA 3V5KB 4OLYL 3SE6A 2HMIC 1DLHB 4PRPE 3UAJA 3FL7A 4HV8B 1NEZA 4HX1A 5T3ZH 6TAAA 5IB5A 4IDJH 3C60C 2GTZB 2ZXDA 4Z7NB 4AEIH 2R8SL 3FO9B 2VXTH 1TNNA 2BXYA 5HHOD 4IU2B 4UQAA 4X99A 1WHOA 2WWKT 3NH7H 5IJKC 3VXPA 3D51A 1OIOA 4PLKC 3EGDA 1MCWM 4XTRD 4Y4FD 3MGTB 4HUMB 4AKQA 4XCFH 4FQQB 4J6IA 2I60L 1FH5L 4HHGA 1KY6A 4W9LC 2J4WH 5L2KE 3IGFA 1MLCB 2H3XC 4BJLA 1AVAA 3BE1L 5DSCB 4LCUA 2DY2A 1TQCB 4UILH 3UC0L 1HEHC 4FCHA 1ZS2A 3GIVB 4F57L 3DO3A 3QIWC 4LAQL 5AEAA 2FLRT 2E6PA 2W94A 1V7NL 2CMRL 3CPLA 3FFDA 2F7QA 4TNFA 5EU6B 3RWDA 5CU9A 3QEQA 4JHVA 5CZKA 1B6UA 1TZIB 3TV8A 3GXTA 2F19L 3LKNA 3ZHLA 4CDGC 5CD5C 2VJXA 2B5IC 5AYUH 1YN6B 3K81A 3RWFB 2XKNA 4JFFA 4KNTA 3GS0A 4WW1A 5EU7E 5MHSD 5LG6A 3NBNA 3RURA 5I75C 4XXCC 4HVBA 1OE3A 3IXAB 1OPGH 3TT1H 5J11C 3QRGL 1CDBA 4U6VH 2BWIA 4FQIL 1LHZA 4PUBL 3H2PA 1FNGA 4YS4A 5ERWA 1WA2X 3FAWA 4N87A 1PZ2A 3SKNB 5DS8B 2AXJA 4M7LL 1U3JA 5JHLA 1KYOJ 3O0RL 2AJUL 3RNKB 4QRTA 1DO5A 2C1PA 2OP4L 4ZZFA 5B38A 4G1EB 4U6TA 1J8KA 3ZU8A 3DX8A 4LSTL 4CU8A 3SYOA 3CK0L 3QNZA 2ZUUA 1CO1A 2WUCH 3PPSA 3QZWG 5KVDH 1L6XA 3MNZA 4X8JA 4GRLC 5F9DC 5I8OL 2X6BA 3A6CH 3F62A 4J8RB 1F58H 3GB7A 4FG2A 5F96H 3VFTA 1M4KA 4CA4A 2RH0A 2P48B 4GS7C 2H2PD 4LVOB 3GZKA 5AOLA 1E4XL 4FKEA 4ONGH 2XPGB 4PRPD 2L7EA 4Y2OA 3WMQA 2EXSA 3X1BA 2NY2C 4LFHG 1T3FA 1KPUB 4N9GA 1NSNL 2E8ZA 4HEMA 5A2AA 3WFDH 4HXBL 3LEYL 4NO5B 1JPFA 3E8UH 4TQEH 5DI8A 3UPAA 1H6TA 2P5PA 2BZCA 2JTDA 4MZ3A 2FL5A 3P3SA 4DAGL 5SWSB 3QYCA 3LDBB 1D5ZA 1UM6H 2P80D 2ZWKA 4L0PB 3N1FC 3STZB 5IJVB 5T1KA 3H8NA 1SXNA 3NIDF 3FW6A 2EC8A 5KG9A 4Q9RL 5E1QA 4RFOH 1SJEB 2WTRB 4JM2C 5C86A 4KK6C 4YHPB 1Q94A 35C8L 1O6SB 3QYMA 1QRNA 3I75A 3TT3L 1SDYA 4WW2F 4KX7A 5EOCJ 2EEXA 3CDZB 4NAMA 3ARFC 3V7AG 1YEWA 5I1IH 1J05B 2G5RA 4FDWA 3S35H 1B2WL 1AI1H 4K23H 3HR5B 4OLXL 3RIAF 5SV4A 4E0RA 1ETZA 1JWUB 1U0QA 1NBZB 4GBXA 3BSZA 3GK8L 5F89B 4I88A 6FABH 3D2UA 4P3CH 3S36H 3TNMB 5E1HB 2CUAA 3LMJH 4Z7UA 3FUIA 4DGVH 1H0DA 1Z9NA 5LGJB 3MKKA 2QKIB 5GS3A 2AF2A 4P0DA 1JVOA 1NBCA 2NY6D 5DS1A 1JS4A 3VXQA 3LSOB 1A14H 5E23A 1JYXA 5E08L 1BG9A 3ZR5A 1QX1A 1F4YL 2NQDA 3ME0B 4F7TB 4NM4L 4OAWB 3V4LA 3ZZQA 3IU3A 1Z9MA 2X09A 3RWGA 3KDMB 3UROR 3L3HB 1PG7X 2YD6A 5LBSA 1JERA 2OMXB 1I8KA 3EDKA 4XVSL 4NFCA 3WE6B 3BW9A 4XP6H 3V6FA 4ABQA 1CL7L 3LPPA 4P8QA 4KITB 4FXGC 3CX2A 4MBOA 3UTZB 1PZSA 3CFQA 2DKUA 5CGMA 4PGBB 2W5PA 4PJ7F 4R5XA 4K3HA 4YO0A 4AI7A 1XIWC 3MAWA 1CLCA 4KH9A 2E46A 5JHDD 4W9ZA 5EN2A 4MCNA 4ZZKA 1GA2A 2E4FA 1MVYA 4GP5B 4C83B 1EUTA 2VXSL 1I9JH 3SDXE 4HJJH 3MYJB 4ZFZB 3SPVA 1H15A 4OI7A 5C0IA 4LBEB 5AVSB 4CN4A 3H53A 4DP8X 4WNQA 3SPGA 4GQQA 3SPIA 2KERA 2VISB 1P4LA 3INUH 3OR6B 5LWYH 1D5BA 1RIVH 5D7JB 2O6FA 2OXHB 4P5TD 4HPOL 1U3YA 5CEYA 1RK1B 1ZLVK 3CVHL 3UTQB 5TE6H 4CW1A 2AS5M 1P4BH 1JF1A 1CLOH 1T2QH 2OA9A 1N59B 2HVKA 1FFOB 1JE6A 4X6BA 3QNXA 5AWNH 4R2GD 4WHYH 1AOZA 1ZT1B 2NXZD 4LGRB 2ZF8A 3QAQA 4MA8L 1HINH 4FTVE 4ZMWA 2V7HB 4R0LB 4PJHF 2E7LC 3NQIA 2CKBL 5CSBA 2ID5A 5TH2A 3UIZA 3DX7A 3ULUL 2HRHA 1ODUA 4BFGA 3SO5A 2CLZA 3MXVH 3BAEH 4WNJA 3UZEA 3FB7B 5DD1L 5ID0B 4PS8A 1IBFA 1OGSA 3RL2A 5F7DA 3WJJA 4WCYH 1T1WB 4F2EA 5BV7L 2BVOA 1HDMA 2XACC 4OZGA 4NC0B 2GBUA 5E2WH 1Q9KA 4IK6A 4GW1A 5G4NA 4Y5XA 2IGFL 3BP6A 4RGMB 4M5YH 2YAPA 5EORL 2WOYA 5DUBA 1XSOA 3B5HA 5K9JL 4U1KB 2MNUA 2JTYA 2VR8A 1CWVA 1U33A 3WFZA 5L4FA 3N9GH 4HK0B 2OPCA 1J0ZA 2WCSA 1QSVA 4KGLA 4JQIH 3CSPA 3OAUL 4PRBA 3UAJC 4YHYC 2X12A 1XH1A 1NMCB 3G6JF 1LD9A 3AM8A 2OR7A 5DXWA 3FTVA 3FCUB 3OQ3B 4C58B 4PGCA 1AOHA 5I1EH 2GJRA 2L7JA 2NSXA 4FLSA 1TLMA 1V3MA 3KLQA 3AG4B 4LOUC 2XVBA 4N24A 3LV3A 4ODVH 1OF2A 5KYXB 1CCZA 4U1HA 3CSGA 1JWSB 3L3OA 3TH3T 3BUIA 3S88L 1ZHBA 4WWKB 3L3KB 2PW2A 2VLMD 3CZJA 3EGXB 4UB0H 1EHLL 2YK1H 3WTWA 2OX5B 2OJZH 2Z7WA 5D6DC 1U8KA 3RL1A 2PP8A 5I24A 4YHOH 3KLAA 4U0RB 2YAOA 3THML 3TWCH 4B9PA 4UQ3A 3QO0B 2QV4A 1CG9A 2H0EA 2IBZX 1A6UL 2NR6A 1FG9C 3F84A 3QUZD 4HUKB 1OT2A 5FV1L 2OI9B 3IYLW 3ECQA 3RQ3A 1RZKH 2WN3A 4XHQA 1F3DH