2CNZA

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (v13a mutant)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
total genus 23
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2cnzA00
2CNZA 3UIZA 2CO3A 2CNYA 2CO1A 2CO6A 4OR1A 5D55A 2FVNA 2CO4A 2CO2A 2CO7A 2IXQA 3UIYA 4PHXA 2AXWA
chains in the Genus database with same CATH superfamily
3V5HB 2YBGA 4UB0L 1Q0XH 3WV0A 2OZNA 3MUY1 3RVTC 1Z6JT 1EDHA 1MY5A 2BVTA 2D73A 3RX7A 1A7QL 2EKJA 4LU5H 3SDAC 4F1SA 1UD6A 5D71L 1ZT7B 4APQC 4NKDA 1U8CB 1UWEL 3FFDB 2AZAA 4Z76A 1P5VA 1QAWA 1N70A 3O2WL 2Q6WB 5EO0A 4PW3A 4DESA 5BS0E 1EAPA 1XO8A 5GS0L 2BZ7A 4M6MH 2BSDA 2EE3A 2Z93A 4HJTA 1ODUA 5IESH 3QPQD 1SYVA 1GCFA 1YPZA 5DCCA 1DL7L 4LOUC 3VFWA 4QMEA 3FFCB 4PY7B 4JO1L 2H9GB 2EDRA 3TEUA 3TEZA 4V2CB 4M1DH 3UBXB 1KCSH 1IEBB 3H9HA 5ACZB 4WUKL 2D9QB 3VDBA 4LPXA 4EXKA 1A3LH 5CKGA 2APBA 4AQZA 3S34H 4PN6A 4JFFA 1MJUH 3QDGD 4X0KA 4Y2LA 4HQQL 4WJKB 5DURB 4NN6C 4V33A 4AGMA 5C0EA 1DBJH 4ESKA 1GGYA 4OZIE 3R7RA 4JJHA 1CF1A 2QSQA 5HJBA 5CKAA 1KIQB 3QXAB 1SUHA 2EXSA 4WI2A 3O6FB 4G70B 4P2AA 4MD4A 1Q9LA 4N2MA 1JPEA 4FJZA 3H7BB 1NFKA 2JJTC 1HSAA 3X11B 4A7TA 3MRBA 1C8PA 4Z7QE 4UOZA 4L37B 3E38A 4GB9A 1OWWA 1UASA 3IMWA 5EF3A 3NFSL 3PY9A 3SE3A 3IJ9A 2I24N 4LMQE 1UT2A 3ATBA 3Q5OA 3WDHA 5IF0A 4HXAH 4P5TD 3B2DC 5F1OB 3OJDB 3TFBA 5AVQB 2AVGA 1P2CA 2VDKH 3NT0A 4HIIA 4Y4FB 1INQB 5D7JB 1RQ5A 2O6DA 3GSUA 5EC2A 4QRRE 4ZSOB 1QVOB 3MNWA 4H8VA 5EZJB 3T6VA 1RZIB 3P4OA 4C4UA 4PD4K 3EDJA 2Y1VA 4XX1G 5FYKL 5LDUA 2DH3A 4WJ5B 2CJTA 3F6JA 1RULH 4R96A 5C07A 2ZYHA 1MSPA 4OLXL 4RMRA 1GY1A 4Q0XH 1OZUA 3N1FC 3B56A 1AOHA 4I2XA 1RZJL 2VLLA 4N2GA 4CC4C 1M6UA 2VN6A 2YD4A 1CFBA 1BYPA 3A5VA 3QPQC 3F7RA 3GJFA 4HETA 3KLSA 1DANU 3OKDA 1L0XA 2QVKA 5C6WH 3ZBMA 4FP8H 4NRXA 3TBTA 3C09B 1CJYA 2DLGA 5F8QC 3QDMB 1XGYL 4NPYB 3SJVB 3FU5A 1IKNA 2WIIA 5J3HD 2JKSA 5EU6A 2R0LH 4P5MA 4PS3A 4U1LA 4Z7IA 4J5VA 4AENB 3SE9L 4D7PA 2C3VA 3DBXB 3I02A 3D51A 4IJ3C 3MA9L 4WNJA 4Z7VE 5T1DH 4UQEA 5DI8B 5B21A 3SYOA 1Q94A 3DO3A 3B5GA 1JMXA 2DZEA 3P54A 1I7UA 3D2UD 2XA8L 4P9HL 1GSMA 1E4XH 4JHWH 5BOJA 1ZPLA 1QFWL 1B2WH 1MW0A 3WJLA 2HVKB 1UENA 4ZNEE 3D3VA 3QIBC 4QLWA 2WUBH 3AGVA 2ZUTA 1IGIL 4M9OA 5HVFB 3J27A 1E3ZA 4XR8C 2COVD 2VQTA 4FL4B 4PR5B 5K1JA 1EK3A 5D2NC 4TOYH 4P5TC 1O9WA 1ZLVK 3UPAA 5IVNA 4P2QD 4A2EA 1WEJL 3R4RA 4J1UA 4Z7WE 1DDHA 1HXKA 1KTCA 5F0MB 2OXHB 3GUFA 4Z3FA 4EI6B 5DJ0A 1T6VN 2VGLM 2AKRA 1YEJL 3VX1A 4MJ5A 1BLIA 5E2UH 3WFEH 5EG6C 5I1EL 1QSFE 2KMWA 1MCJA 1T2JA 1TETH 4GY4A 2Z91A 4LSSH 4HZAA 3S3BB 3TA3B 1BVLA 4K5LA 4RX4D 1WO2A 4YQXH 4CADA 3UIZA 4YHMH 3HCVB 2AERT 5FUOH 1YEFL 1LEGA 5J1AA 2OYLA 1EZLA 4ZBJA 3RGVA 5A6IA 5I1LB 3C5SA 5GISH 1DQQB 3ALXA 1TSRA 2CU9A 1I7ZA 4Z3GA 1PCSA 4M43L 1R5WA 4WLCA 1KYAA 3QIUC 1HE7A 1MCLA 5TPWL 3WLWC 1T03L 3EHBB 5J3HC 3BSZA 4N85A 1QG3A 3FQXB 4F91B 2BLFA 4WHTB 5E8DL 1NOFA 3P2DA 5T1KB 4XBPB 1WFOA 4XX1E 3DV4B 4I0PB 4UTAL 2EXYD 4KI5E 3BWZA 5F1IB 1E5CA 1ACYL 1C1EH 1XR8A 5LBSL 5I71B 2EKSA 3MQIA 2ICEC 5KSAB 2VXVL 4WZ9A 3IXTB 5CO1A 2X9ZA 3TZVB 1S9XB 4G6ML 2D9CA 1J0YA 2MPAH 5BUAA 1EO5A 4AKPA 4PJEB 4S1QL 2E46A 4H20L 1RK1A 3ZO9A 1XF2A 1D5MB 1JV5A 3AQDA 1RZKH 4OD3H 1ZSDA 1REIA 2X2IA 4GG6E 4RZCB 4XPHH 2R51A 1U91A 4KTDH 1JGIA 3ZL4L 3WEOA 5I1DB 3WS3A 4WV1C 5JR1H 5B3JE 5E5RB 1RZGB 4FFYA 3MOQA 4JPKH 3P4MB 3BLPX 5F3HA 2AW2A 2W9DL 2CBOA 3LV3A 5DMKA 1PZ5A 2BPBA 1D6VL 2H47C 1NCBH 3LRSB 4WCYL 1HESA 5DS2A 3VFRA 3W0WB 5K9JL 2Y0SA 3FB8A 2BSED 3OKMA 3GS4A 1KCUL 5DVLA 1S3KH 4NO2A 1JVKA 1TEGA 1ZD6A 2PP7A 2W60B 4BSVA 2J6EA 1QSVA 3IVKA 4PJ6A 4QXTA 1GJWA 4JREC 1BVZA 4PCYA 2D31B 4TNVF 4LCCA 4XBGA 4B95C 2NNAB 4QXUH 3BVXA 3CUPA 4Z3IA 3IMBA 3QO0B 2AK4E 5JW4N 5KYWB 1U8OA 2OTUA 2Y7SA 4KO9A 1Z9MA 2C1PA 3QWOA 4Z6AT 1N2RA 5F0JB 1QFUL 1CBJA 3BCDA 2EYRB 5SWSB 2WO3B 1KEMH 4P3WA 2Y2YA 4U3SA 4NQDB 4D9RD 1ZTXE 4DPRA 5EN3A 5FO9B 1YQVL 1OM9A 5FF6B 2XN9E 5IUCA 2NOYA 3T9WA 3V0FA 3SZ6A 4TNEA 3EH3B 4N0UA 4NN5B 5GS1A 1XSOA 1NBZA 1UQSA 3RAJH 3KGRA 4S0SD 2EXYC 3CVIH 3L5HA 5L9DL 2D0GA 2FQEA 2BSBA 1JPTL 4MB3A 3F01A 2B3RA 4TPRH 2PCYA 1EJ6A 2XZAH 1I8IB 4L3EB 5IK3B 5KANG 2J73A 2ITEA 3D2TA 4FXGC 4LCYA 2UZPA 2LU4A 4A66A 4DF9A 3BVNB 3L13A 4G8FA 4XZUB 3W37A 4YAQA 4GRWE 5F9AC 1ITBB 3HMXL 4PJ8B 4QHNB 5BZWB 4B9CA 4R7XA 4F2FA 5CJBA 3V9EA 2LFEA 4DTGL 3PGFH 4OIBA 3HC4L 4ZTOH 4PJDB 1G0XA 2PWGA 5JQIB 1K6QH 2ZOWA 1TJIH 1D5BA 3RKDC 1IGML 3DGGB 3PXHA 1OF0A 2PP9A 4HX1A 3VXNA 2BSCA 2FVNA 3LB6D 2BHZA 2EDFA 4XC3H 1JF1A 2H3KA 4LLDB 4WFGD 3T2NL 3FFCE 3OKNA 4QKXB 1WZ1L 1EFXA 1GGBH 1N5AA 2GITA 1KN2H 4MHHG 1ID2A 4L5FL 4DO4A 4DVRH 5BVPL 4OV6F 3GSQB 4FHBD 1MAML 4KHXH 3SO3B 2WXFA 1M6OB 4WDIA 4JDEB 3JWDC 3WKYA 4K7FB 4AZUA 3ZKNC 4HAFA 4AEHH 4CMMB 4DVBA 2J8UA 2MOGA 2YWYA 3DDFA 4QEGA 4QHKI 1R24A 5IQLA 3UTPD 3TJPA 3VXMB 2IFFH 5MEQA 3JVGC 1OW0A 1NDTA 3V6OC 5HSFA 3LRGA 2WYZA 4B9YA 5IFHH 4U1IA 3KPPA 4I9WE 1PAZA 4D0BB 1E4XI 4WI0A 3UG3A 5JHDB 1KJ3H 5IMOB 3QNXB 4K3DH 1F3JB 4H0GA 4Z95H 5ICUA 2WBJD 2VUKA 4IK7A 5JHLA 3GSNH 5DMIL 3ZRFC 1OM3L 1ZSHA 1KXQA 1RIUH 3NACL 1ZGLM 5GGUB 1ZDQA 4L0ZA 5CEYB 5ANHA 2L7EA 2N7SA 2X6BA 4GAGL 4GSXA 3N06B 3O6MH 2EDOA 4JY5L 2FH8A 3NH7L 1IQDB 3WEXB 2J2ZB 3S35X 4KV5E 4A7GA 1O0VA 2DYRB 2Z31A 2A6KA 1NCJA 5FGBC 5MHSD 2PNDA 4OM0H 1Y1DA 2XG4B 3CGTA 1BFVH 1LEIB 2VZ3A 3A4FA 3HE7A 4FQHB 1CFSB 3QUML 4LFHG 1J5OH 4U33A 2C1OA 3CC5B 4WUUA 2SODB 1MQKL 2WTRB 4OTXL 2YEVB 3FQNA 1YJDL 3NK4A 1Z1WA 4K23L 2BXZA 4N0YL 2VDMB 5HHMB 1JZ2A 3WI9A 5C6TL 3ECQA 4PGDB 2V8MA 1FC2D 3BQUB 2A6DB 3D4GA 2WN2A 4IHBA 3MV8A 1M71B 3OG6B 2F6AA 3MOAH 2J1YA 3L95B 4FEIA 3L7EA 1MHHA 3GBML 3CFDA 2XC8A 4LKXA 3B4NA 1HH9B 4PB9H 4D94A 2R15A 4EI5D 3FN0L 1D7BA 3OLIA 4ADGA 3QDME 3KPRE 2Y6TE 3LD8C 1K85A 3SJVE 4F2EA 3D50A 1ADQL 2RQ8A 2O5ZL 4YOKA 1DBKL 2VDRB 4X2UA 1Z66A 3GMRA 4X7SH 4PJCF 4ZS6D 2J4WL 4I5BA 5FDYA 4DO6A 3FT4B 3QUKA 3CN2A 4MJHA 4KZDH 6FABL 1NCCH 1LO5A 1NFDF 4EUPA 5DUBA 3CDGA 1AIZA 1ONQB 1PNDA 5IFJA 1A4AA 1LD9A 1RIVL 1NGWA 1AR1B 1GIGH 1HHJA 2EABA 3DOSA 3LRLA 1L0PA 3HG1D 3E6FB 2ISDA 4LQFL 2EUXA 1KULA 5DF0A 1U8MB 1S9VB 3CV5A 3NZUA 3NIGF 1BAGA 4DP6X 1NGZA 3ARFB 4QGTA 3QEQD 2P42B 3ETSA 1AZZC 2F1BA 1TYJA 1IFHH 2OMTA 4NKIH 5I1IH 1AQKL 5J6SA 3SQOL 3GTTA 1F6AB 1CI3M 3ETBF 3BDXA 1MLBB 2CMRL 4GW4A 5D7IB 4AQ8C 2P1YA 3TNMB 3U30C 3QJTB 5C08D 1SN0A 4FQ1H 4EKJA 2NXZC 2WZ0A 1AP2B 5C6PB 4FQLL 4R5XA 5SWZD 3BAJA 3U4EB 4XWGH 3B2VL 5JORA 3GT6A 3STLB 5E95B 4N8VA 3RIAF 5GS2H 1O9VA 4GRLA 4AEIL 3CJJA 2RACA 2X6UA 4X8CA 7PCYA 3GRWL 3O41B 5E6IC 3BH9A 3O2VH 1IIIA 3QBTB 3HRZB 1I8AA 5AUMB 2FIKA 3QUXB 3PWNA 1CL7I 1AH1A 4AIEA 2A9ML 5DEFB 3AXLA 5HYFA 2BOBB 3EYOA 2C3WA 2BVYA 2X12A 2Z7YA 5F70A 2N7BA 1VFBB 4PVNA 4U1NB 4P57B 2HVJB 4HJ1A 1SNRA 3WIHA 1JCKA 1AXSB 4P3DB 3G08B 4L4VA 1HEZA 3I6GB 4U1SB 4WI6A 4X9HA 2BVOA 5FO2A 1DJHA 5G5DB 4TUJA 1OCWL 3O3BB 4CSSA 1MCOL 3V0DA 2W59A 1HL9A 4XP5H 1JF6A 5B38B 5DD1L 1KLGB 4LBAA 4NEHB 3OMAB 3WGVB 5A3ID 1JNHA 4PMEA 3RZWA 2CALA 4KXCA 1PF3A 1Z9SB 3ULUF 4J3BA 4PWJA 3QDJD 3AS1A 4E41B 1HTYA 2W38A 5F7DB 3K6SB 4CN1A 1MRFH 1F41A 5FECB 1XZ0A 3QCVL 1KFAL 5DJ6A 5FHAL 4PJEE 1H6TA 1NAMH 2J12B 2DYPA 4JRYD 5TE6H 1A6TA 1U8PB 5DC9B 5E99L 2VSMB 3O9WB 1MHPL 4HGWB 3WTXA 1F3DH 2PCFA 4HCFA 5KYYA 1TZOA 1JYXA 3LH8A 3HC3H 3I50L 4OBRA 3GUTA 1W72B 4N8CH 3SE8L 2JB5L 3DSFH 3QHFH 3S8WA 4PRHB 3HZMB 1E9OA 1VZGA 2YA2A 4R97C 4GMTH 2X2HA 4DNLA 3A4AA 1WAAF 2R69H 3GSNA 4MMZA 2BIPA 4ZFFA 1TTBA 1X6LA 5ABDE 1BJMA 1SN2A 2CHZA 1CFQA 1KEGH 3EJZD 3DNKA 2BIIA 5I30H 3Q6GL 1FBIL 4QHPA 1RZ8B 1LYQA 4FNLH 4KXDA 4G43B 5AEAA 4ODVL 3KEHA 2EUZA 1PYWA 1PJWA 4DH2A 4UDTB 4IK6A 3TM6A 1GMEA 3ULUC 2WY3B 1PLCA 4M5ZL 3UO1L 3ESNA 2X9WA 3EFFB 1GA2A 3LQAH 1JI1A 4WO4A 1IB5A 4OZHB 3T3PF 2HJKA 3IDJB 4J8RA 4HCRH 1MH5A 4A67A 4HG4J 1GOGA 3VFPB 2F53D 3P4NA 1FZJA 5ESAA 3E3QC 3VI4A 1I82A 3MRDB 3C87A 1TLMA 1S7RB 2I5YH 2ID5A 3CFMA 3LZFL 1WISA 3RDTD 2DQEH 3MRNA 3BZDA 2KZBA 3OZLA 1E9PB 2IALA 2AITA 3Q2VA 4NQDE 3KPSA 3CFUA 4MAYA 3IDMB 5DUJA 3MGTB 3FRPB 4QRPA 1JAEA 1KYUA 4ZTPL 4GNKB 4QCIB 4J2QA 3X3GH 4AC2A 2J1KA 5DQDH 4TS6A 1P84K 4ORGA 5L4FA 1IILE 3SGJA 4EUPH 2WSKA 5CU5A 3HFML 5DRXA 3T04D 4CDGC 4KO5A 4UMSA 4P99A 3VWKD 3H54A 2JXMA 3G04B 3AMLA 1ZJAA 4L3EE 2FYYB 3JZ7A 3IDIB 1DUYA 2XV6B 4JFPB 1AZVA 1NCOA 5AVVB 3TN0A 1GMIA 2SEBA 1ZLWK 3L7FA 4JVPA 1WH0A 2DI9A 5HYQB 1C12A 5SWQB 1GTNA 2JFCA 4PJ5B 5AB1A 3UGXA 2AJSH 1J12A 4HS8L 4ES8A 4PJ9A 1M1XA 3V6BR 2A77L 3L1EA 4WFFD 5BRPA 4G5ZH 2ZWZA 1E4JA 3D8MA 1A14L 4J3OG 2FO8A 2CO6B 4PJDE 5AYUH 3QPXH 1B4RA 5AQ0A 1J8HA 4JJ5B 2X4PB 5BVJB 4EUPG 2JB6B 1NMAL 5GZNA 2VDOH 2P43B 1ZV5A 2X2YA 4LARL 3PAVA 3WFZA 5E24E 2QFPA 5AZ2L 3GLAA 3MLUL 4A2FA 2YN3A 1M7IA 1RUML 2CLVA 1WBXB 4DGYL 2MH4A 5SX5H 1NCNA 3VFUA 2GC7C 5GZOD 4E68A 3GINA 3QNZA 5CS7A 4TSCH 2N0MA 2YAPA 3RRQA 3KWTA 3TBSB 2VM4A 3ZXAC 4OM1L 4OF3A 3WKQA 4NZJA 1A4BA 4Y4KD 3ME0B 3QFDB 1FNGB 1Z9NA 1L7TL 3D85D 4M1GL 4N3UA 1GJIA 1GGCL 2ZUXA 2EIKB 5ALBH 4Y4HA 1GOFA 3IKCA 3ZQWA 4LLMA 3I9GL 3TO4A 5C0GB 1CTNA 3VACA 2C34A 2A83A 2D7MA 5I1JL 3EJSA 4PV8A 1T0NA 4JY4A 1T7ZA 2CO3A 4IOFD 3ROLB 3SKOB 2CLZA 4HGKC 5J1SC 3T0BA 2FR4A 4JRXB 4QXGL 3PYCA 1I31A 3RJDA 1HHKB 3SCMB 5D9SB 5FOBA 2F7IA 2HG0A 5CR8A 1DFXA 4FG4A 1Q0YL 2K6WA 4XNMA 1P1VA 3GKWL 4XH2A 5FB8B 4I1PA 7FABL 4OGAC 3B2MA 3F85A 1HHIA 3MRFA 2FWOA 1D2PA 2IQAB 1X6NA 5HY9B 1VB9A 2IXQB 3SDDB 3VWKC 3FTWA 5J11C 4WNQB 4YDKL 2A7BA 2IWKA 3THMH 5B38G 2O5YL 4HC1L 4P2RD 3DGDA 3V4PA 3BSHA 3L5WA 3KBPA 5L2KB 5L6YH 6PAZA 2Q9OA 1W9XA 3FTGB 4Y1TA 1T5KA 3SQBA 1XGPA 2ADIB 2VABB 3O8XB 4UQIM 1DLFH 3FQ1A 4WFEE 4IBQA 4Q52A 4NUJA 3BESR 3BT2H 1G7LA 5HHME 1T1XB 1VZHA 2O6PA 4Y19B 1F1DA 2UXFA 3TCTA 2FIRT 4L05A 5JTWA 1GAFL 3HUJA 3MLWL 1F8TH 3MROA 5IJVA 4YHYC 5L88L 4HG4K 1RPUA 4UQ2B 2WKGA 3IFOA 3U9PL 4JFZL 3GBNL 3A6OA 5ELIA 1FL5B 3G6DL 1S7QB 3ECVA 5GZOC 4RGNE 2R69A 4KPHH 3C6LD 4AW7A 3ZTNL 3PL6B 1OTUD 3NGBB 2YBRB 4ZAKB 3VI3F 2NY1D 1AG6A 3FO1B 1FNSL 5F71A 5F44A 3CDZB 3BP7B 3US9A 3Q6FA 3JWDL 1LJMA 1MFVA 1JDDA 1HSBB 4HWBL 1RU9H 1QOKA 3BAYA 4JZJA 4LVHB 1IO4C 3OVUB 3OXRA 1DE4B 3AY4C 4CU6A 5HPMB 2LVEA 2Y7QB 1CYWA 1CDHA 4YN3A 3G5ZB 4NQSB 2YUXA 1DR9A 5LDSA 1P0SE 2R27A 1UXSA 2CDGB 2WZ6A 3QSKB 5ALCL 1PDKA 4E9TA 1HYSC 1BVNP 2K7QA 1S7SA 3E8UL 1XSIA 5E2VL 3W9DA 3ZT7A 3NA4A 2XIDA 3QARA 4KJYA 4KVNH 4PV1C 2RGSA 3T77A 1F3DJ 2KPWA 1NWOA 2IWEA 4NPKA 2HMID 3OZ9H 5FDWA 3QJXA 3K71A 5I9QC 3CXHK 4J4PA 3PHAA 1INDH 3FRPG 2UV3A 2FECL 2ZNWA 1AD0A 4NKDB 5KSUA 1O5DT 4Z76B 1P5VB 1CTOA 1RZPA 2BIQA 5EO0B 3U0PB 1EGJH 4HU8A 3TJEL 5HDQL 1L9SA 2Z93B 1AXTL 5DR5L 2VDLH 1SYVB 2FE0A 2R7EA 2YAEA 1YPZB 4U6VH 1LO4L 4NJ9H 2VERA 1ZT4A 3FQTA 3VFWB 1D5ZA 2B4CC 2H1PL 2YKLH 2YIHA 5JQ6L 4ERSH 1Z3RA 2FJFA 1OP5H 4HAKA 4HPYL 3KL3A 4XVUD 3ZZLA 3H9HB 4X6FA 3U9WA 1BBDH 5IWLC 1TYEB 1JHKL 1G9HA 5MEND 5AVWB 4LLUA 4H88H 3ZHFA 1FVEA 3K4DA 4JFFB 1JPSH 4X0KB 5I1KH 5JPNC 2YAMA 1BWWA 3D0VA 5ESVA 2JIXA 4YZWA 1KYFA 1HQRA 3KJ6H 2NY1C 1CT8A 5C0EB 4R5VA 3DXAD 5HHQA 4HS3A 1P4LA 4NQED 1UH2A 4WENB 3CBKB 5I18H 3BGAA 4FRWA 5BMFH 3MXVL 3FB6A 4X6EA 4XNUL 4UOJA 3ARED 3LNEA 4KNQA 2GSMB 4E41E 2VJXA 4XPTH 3L3OC 4MD4B 5C0BA 1Q9LB 2F5BL 2OMNA 4OUUA 1HSAB 2VXQH 3MRBB 4CC0A 3D9AL 4M48L 5DK3A 2FATH 1U4EA 4IEFA 4C57C 1QFHA 2YGNA 3WFBH 3D0LA 1H6EA 3GSXA 5IF0B 5E4EC 3RWIA 4HIIB 1P2CB 4PRHE 2P52A 4WY7L 5CD5D 3D48R 3GSUB 4WIQA 3CFKA 5EC2B 5AL0A 3HHMA 5E0FA 3MNWB 3MJ9A 1BZ8A 3X1GA 3IAQA 5F7FA 1YEKL 4GQ9H 1J0IA 3QRGL 4JM2C 4N0FB 3WFCL 4JQIL 1S78D 1V3MA 3ZIYA 2DIEA 3FAXA 4R96B 2EDKA 5C07B 2O72A 1HFUA 5I5IA 1BQHA 2OXGA 4KX7A 5H8DA 1AHWC 1ORSA 3Q1SL 2PXYA 3TVMA 2DLFL 4NP4H 3HR5A 2VR7A 3EKCA 3N41F 2VN5A 4KOBA 3BP5A 4I2XB 2VLLB 5CZXD 2NNRA 4PJ7E 3CN0A 2TRHA 1U8JA 1NIEA 3GGWA 3T8MA 2KLTA 4BYHA 4KKPA 5C92A 3GJFB 1DVSA 2ZD0A 5D55A 1EO7A 3OKDB 2ZUVA 3JYBA 2LW3A 4NRXB 3TBTB 1U3JA 3WU1A 4OR1A 4FFZH 4BFGA 5EZOL 1IAKA 3MUGA 4EAEA 2WIIB 3FF8A 3K81A 3CSFA 5EU6B 5EFIA 3EYUL 4P5MB 4U1LB 2PTUA 3CQPA 3FUJA 1TLKA 3DARA 4BZ1L 2C3VB 3I02B 1OHZA 3KPMA 4OY9A 3VD3A 4L18A 2Q20A 1I1AC 3S7GA 3JQOB 4PJXA 1Q94B 4N5UA 1G7HA 4RFOL 4PJFA 1XBDA 3P30H 1I7UB 2HKFL 4XMLH 3WMQA 2QPSA 2CRZA 4XNZB 5TF0A 2AJYH 3AREC 3SKJH 5C8JA 5DJZA 3ZHKA 2Y1YA 4YDLC 3D3VB 4UIKH 2YLKA 1YZZA 1CN4A 2V9TA 4UT9L 2OI9B 3ZJAA 4PJ5E 2P45B 2EQDA 4CSTA 2Z1PA 5DS8A 5C1MB 1LQBC 3PDGA 3MZGB 4HK0A 1KWGA 2V5YA 3MCLL 2FK9A 2XXFA 2AQTA 4Z0BL 5CD5C 4ADJA 4J1UB 1M2VB 1DDHB 2CBMA 2Y3NA 5TK4A 2YPVL 3M8OL 4DPAX 3LDBC 5DJ0B 1P69B 2D7PA 2EDHA 2AKRB 4AGNA 4H25A 5KZCB 1NC4D 4MJ5B 2C4FT 1WK0A 1OSEA 3FQ2A 1XF3A 1MRCL 1XL4A 2Z91B 4X8GA 1BVLB 4TULH 3MLSL 3UJJH 1FSKB 3MXWH 3QZMA 2DEYX 4CADB 3N1GC 3OMNB 1I1CA 3KLAA 3BPOC 3VM5A 2EC9T 4JQVA 1LEGB 3ZU8A 5J1AB 4JFXA 3RGVB 1OO2A 3GMLA 4YHKH 4E9VA 3T4AC 3BDYH 1I7ZB 1VJSA 3WXVL 1A7RH 2PW1A 4K3EH 5I6XC 3AG3B 5EU5A 5DFTA 1SBSH 5GRVL 4AGPA 1IAIH 1R5WB 2MHAA 1VEPA 3AG2B 2YD6A 1NEPA 2F58H 2GBAA 1E50A 5CN2A 3INUH 3CIQA 2TAAA 2D2CC 1UHVA 2DQCH 3CAFA 5IEHA 4IKJA 1N10A 1V5JA 2XTJB 2N56A 4OSUH 3JYCA 1N5YL 1J0KA 1XR8B 3B83A 4P3CL 2EKSB 1N19A 3L3KA 2BSRA 1YEWA 3N9GL 4Q6IA 3NJIA 3QI9D 1CE1H 4N8UA 3B2PA 2DQDL 3HMWH 2CH8A 1O6TA 3ISRA 5GGTH 1PZAA 5ES4B 3IPBA 2M83A 3GFUA 1RK1B 4FERA 1E30A 3BKCL 4U1HA 2QFRA 1XF2B 2CCWA 4YXHL 1JV5B 3KLHC 1I3UA 1ZSDB 1HKLH 1TG8A 2QGEA 4EZKA 5L2KE 1UYWH 2IPTH 3DK2A 1YEGL 5HDBF 2ITCB 3GK8L 1U91B 1WZKA 2K4AA 3WS3B 5SX5K 4OW6A 4X4XA 2DWYA 2VXQA 2BRRL 2O61A 4FQJL 3ZT5A 5JO5A 1VKXA 2FT8A 3V5DA 5JPMA 1J87A 2P3YA 5F3HB 5KYUA 5JXEC 5DMKB 3LV3B 1PZ5B 1B0GA 4NFBA 5E4IA 3TBWA 1A8JH 4FG6C 1D6EA 1VGEL 4ZX3A 3U1SL 4KFMA 3VFRB 3LZLA 4R4NC 3NA9L 4ZFGL 4BUGA 3FB8B 3OKMB 5BOPA 4JEGB 4X80L 2Y7LA 4NO2B 3DVFA 2VQ4A 1R46A 4BSVB 3BE1H 2NR6D 3UTSA 3IVKB 3Q48A 2XQYA 4NRZA 3CK0H 4QXTB 4LPVA 1HNGA 3IU3A 4XPAL 1RMFL 4LCCB 2CRMA 3DTXA 3CUPB 4XT1C 5IBLC 1UADC 4LVNC 1UATA 1NIDA 1OVZA 2COQA 1F4YL 1H8NA 1U8OB 2OTUB 2C1PB 1NLBL 2X6AA 2Y06L 3QWOB 4CVWA 3VO0A 1FORL 1N2RB 4G8GA 5DLLA 4WEEA 1JZ8A 3D30A 5ADPH 5HXMA 2UWEF 1VLXA 2W81C 1T3FA 2MCPH 1FUNA 4U3SB 4IGBA 1EXHA 1XDTT 2MTAA 3UABA 4ZX4A 4F57H 1HAWA 3TNNA 4GAJL 2ADFL 2AEOA 2FSDA 3ARGC 1NCWL 2GJ6A 1JGEA 5I73C 1OAUH 1KGJA 4U4IA 3MV11 4UV4H 1GHFH 1PX3A 4MAZA 3HPJA 4N0UB 2BC4A 3II1A 1H0DA 5C7XL 5GS1B 4FNTA 5KSBF 4NQVA 1IV8A 1NBZB 1UQSB 2WYIA 3L5JA 1DBAH 4UZUA 3UFIA 1OCZB 3UZVA 3VXUD 1XGRA 2DQIL 3QI9C 1GL4B 1NCDH 2R56L 5B39G 2CG9X 4LCYB 5JA9A 3R0MA 4G8FB 4PREA 1B6UA 3IAPA 4YAQB 1DJYA 1OGAA 4L29A 4ELME 3U0WH 3C60D 1LE5A 4PRPB 1JF5A 3PP4H 1LTXA 4RH4A 5HHVH 2RIKA 2XG5A 3QHZL 3JTBA 1DLHA 2D7OA 3QJHA 3VXTA 5KBNC 2Q10A 1NICA 1D5BB 1HCVA 4HBCL 3VXNB 1W0YT 4HX1B 1AY1L 1SRDA 1YPZE 4HALA 4UCFA 4MYWB 5D6CA 1JF1B 4HJ0D 5TH2A 4AYMC 2XVLA 3LEVL 4N5EC 2CM6A 1RFDH 1TVHA 4O51A 5FIEA 1YEHH 1EFXB 4X7TA 2GITB 1N5AB 3MGAA 1ZXQA 2AEIT 1P4IH 3UJTL 1AOZA 4N2CA 5DJCA 4Q9QL 4WDIB 1HKFA 1TVBA 2QVMA 2WAHA 4KMLB 1QZNA 4PLOB 4Y2DC 1TZAA 3LY6A 3U46B 3BDBA 3OKYA 4F7PA 4JFFE 2X4TA 4ABWA 4DVBB 3HG5A 2KYIA 2IV8A 5FEBA 4WEBL 1XTMA 1K3IA 1OF2A 1QNZL 2WPGA 4ZJ9A 1R24B 2VDRL 5I6PA 5BO0D 1BZ9A 2ZKXA 5MEQB 3ML9A 1AS8A 3CBRA 4FQCH 4K94H 1CXEA 1YYCA 3KPPB 3MLTA 4U1IB 4PS8A 2IG2H 1NM4A 1OAXH 3OBAA 4WI0B 4FNSA 3NEEA 1T0MA 5CCJA 3KNBA 7CGTA 1QTPA 3QXDA 4UNIA 4MJ6A 1J0JA 5T5FH 3ILPA 3GLEA 4BSWB 4KKCD 5AAWC 5EO9A 2AC0A 2ZUWA 3HI5L 4N26A 2G0KA 2IV9A 3N6YA 4ONFH 1VESA 2IAMA 3B3BA 2XICA 1J86A 4LIQE 3WDJA 1A6AA 4X8XA 3H42H 4AC4A 3POHA 2Z31B 2A6KB 1NWPA 5EU4A 1OAKL 3F00A 3K72A 2DMCA 4GSRA 4LLYA 3UACA 4PFEA 1VFMA 1ERNA 3HE7B 4ODWA 3FUKA 2C1OB 1FGVH 3IDGA 4L23A 1EBAA 1QQDA 1OAZL 2AQRA 3D06A 3FQNB 5C07E 1D9KC 1R47A 3SDCC 1WIUA 3ARDA 3WNLA 2PYFA 4RRPA 4JPIA 1OP5K 4YS4A 4NB7A 2ZJSL 4FTVA 3HKFA 3HG3A 4XAKE 5DZNA 4I2XE 1MRDH 4ZT1A 2R59A 3MV8B 5GGQL 4WQOA 3L7EB 1MHHB 2GI7A 4PCKA 3CFDB 4LKXB 1KB5A 4CUCA 2F2HA 3A24A 1L5GA 5F9WB 2JVUA 3UJIH 4HJ0C 2VMCA 2L7QA 1N0XL 1IAII 1LDSA 1QFOA 2APTA 2BS71 4KK6D 4MLSA 4RISL 4FXLA 3T08A 3MLVH 1AACA 3TTSA 4JN1H 1FFPA 5EU6E 5EO1A 4O4YL 4NAQA 3GMRB 1QSFD 3QJZA 1H3GA 5FW8A 1JGUH 2QADB 4L9DA 2QPFA 2VO8A 3I3BA 4I5BB 4BK8A 1B9ZA 3FTVA 2YRZA 4NUGH 5AYTA 4BKSC 3QUKB 4WJG3 3RZCA 2VSKB 2NY5H 2X0UA 5D6DA 2WNXA 1LO5B 2E86A 4BIKA 1RJYA 3CDGB 5DUBB 1PKQA 3SYQA 5IFJB 4AG4L 1LD9B 5HI5D 1NGWB 3VW3L 1HHJB 2OKMA 3DOSB 1RSFA 4CU7A 5IIEA 3ZDXF 3MV7D 2OZ4H 3LS4H 7TAAA 3RA7L 4L9LC 1S7TA 4FCAA 4N68A 1DFBL 1U8QA 1NGZB 4HBQA 5CBEA 2AVFA 3TASA 3MBXL 4DN3H 5KTEH 2OMTB 3NIFB 1NLDL 1URLA 1BXUA 2J7LA 4WTQA 4GW4B 5CLYA 2WBWB 3T0EC 1S7WA 2AGJH 1CG9A 2W80C 4LBEA 3AGWA 3NAAH 3MTXA 5GSRA 5GJTL 1NEUA 1MCNA 1WHPA 1DQVA 3HR6A 1E5UI 4S1RL 3RILA 2JCCF 1KGUA 2B77A 5ABAA 4HAGA 3CFNA 3R7QA 3ML8A 5ETUA 3WN5C 2HRGA 5L8KB 1GW0A 3O2DL 1AG0A 1TTAA 2ZXCA 2GYSA 3U1QA 4PGZA 2JE8A 5IQ7L 4GRLB 2K3TA 2Z35A 5KBMA 2ILLA 3UO8B 3OXSA 5DD3H 5IUSA 3TC9A 2VL4A 3BH9B 1JZDC 3FULA 3BWUF 1T7WA 3CCHA 3VWJC 2FIKB 1QUNA 2W95A 3PWNB 4XAWL 9CGTA 4MZ3A 4N6RA 1CTMA 2DN7A 3AXLB 4OCXL 2VZSA 4EBQH 1ECZA 3EYOB 5J06A 1ZS2A 3NK3A 4YDJA 4D9LL 3U4BL 3WTUA 3L45A 4M7LL 5C2BL 4KBPA 1HAUA 4KK6C 4L4VB 4S10A 1HEZB 1BVKA 2BVOB 4NCC1 1GRWA 4TUJB 1UD4A 4HH8A 3ROOA 3ENEA 4GXUN 1TU2A 5KVFH 5DD6A 2D03H 5A43C 2IQ9L 1AGDA 2J25A 3RTQA 4P2OD 4FQ2H 4KRNA 3L5XL 5F93C 1XCWA 3PNRB 4P8QA 3OV6A 1UEYA 4TVSa 1INEH 3BUBA 2W94A 4H1LG 4Z8FL 4TMPA 3WNIA 1JNHB 1G7IA 4F7CA 3EZJB 3Q9QA 2NT0A 5E5LA 4QO1A 5BW7A 3DYPA 2F61A 1XZ0B 1EZVX 3BWUC 4OQ1A 5DJ6B 1BF2A 4HOXA 2DYPB 4ZMYA 1A6TB 1JP5A 1EH9A 5D93C 2IDCA 2WXJA 3QCUH 4Y5VC 3EFDH 2F54E 2G60L 3KR3L 1X7QA 2PCFB 5KYYB 3GUTB 1IU1A 5KN5A 1E9OB 2AFNA 1J8KA 1CF8H 2QQLH 3GSNB 3DVIA 4MMZB 4R2GD 4ZFFB 3RWEA 1OLLA 1YYLL 1CFQB 4G9FD 4PJBA 5F6IC 1L7IH 5GGVY 1KC5L 1QYGL 3JBG7 4U3CA 3KGSA 2FBOJ 4EO5A 4NPJA 2EH7H 1JRHL 3GZQA 1PYWB 5AOKA 3WY3A 1LDPH 1KGYE 5D1ZA 1F18A 2HVBA 4P5KA 3EF7A 3VFGL 1CBVL 1IGCH 2BHFA 1J9QA 3SDXA 4PLJD 4WO4B 5F96L 2ETWA 1NJ9A 1PY9A 3TT1L 1SLUA 3UZEA 2HJKB 4HEMA 4J8RB 1HQ4A 1MH5B 1S7VA 2JKXA 1GC1L 1BHGA 3BSGA 4PJGE 3EDEA 3P4NB 1FZJB 2NY7L 5ESAB 3FFCD 3B8SA 3VI4B 3I9AA 2ERJB 2JKJA 3L3JA 3MRNB 3VFNA 5KVDL 2IALB 1PFCA 3CDYA 3KPSB 5IHWA 2Q7NA 4MAYB 5IW3A 4QRPB 4ZQKA 3RUGF 2OW6A 4WTZG 1U3HA 2AS5M 3AM8C 2JF1A 2YGVA 3CD4A 2EEAA 4P2OC 5IBUG 5DURD 5JXAL 4ORGB 4N0UE 3PHOA 1SF5A 2CLRA 4Z7OB 3DO4A 5DRXB 1BPLB 3ELAT 3MLZL 5HYEA 2RAMA 2BNRA 2NY3C 4BM7A 1DSFH 5JMOC 4I9WD 1KJVA 2JXMB 2HT3C 4L8BA 1PZCA 4NZUL 3O6FD 1XCXA 1DUYB 1KPRA 3VYPA 3TN0B 2SEBB 3L7FB 3K2IA 1U33A 1C12B 4N2LA 1WA0X 2YWZA 5CINL 4K9EC 4PJ9B 4A2HA 5C3LD 1M1XB 4IRSC 3ZPDA 4G6KL 2B1AL 4LASL 3WO3B 3VXQA 5FKAA 4F58H 4UT6L 3HVDA 3GZKA 5CLWA 1BFTA 1J8HB 4ZXBA 4UQ3A 1A1MA 1NM9A 4Y4FD 2MRYA 5D7JD 3A0OA 3VXSA 2LFGA 3WSQH 3MNMA 1NOLA 1M7IB 4WWOA 2PO6D 3CZGA 2CLVB 3MJ8A 2XU9A 1UURA 5ADOH 3VFUB 1DVXA 5AKSA 4XCYA 3E0GA 4A6YL 3DI3B 3QNZB 5A7BA 1I8LA 3W11D 1O6VA 2BK8A 5A2CA 4N2OA 1X5JA 2J8UE 1N8ZA 3D39E 4PLJC 4XNQA 4Y4HB 3GXUB 2IVFC 3IKCB 2YD5A 4LLMB 1HDMA 3TO4B 3ABGA 2A83B 1HI6A 3QUZC 4J7RA 2HFGL 2AJVH 4PV8B 2CKBL 1T0NB 4JY4B 3QDMD 1ILUA 3V9CA 1R5VA 3RBSA 1LK2A 2CLZB 2V7HA 2HT2D 3L4TA 3N2JA 2F08A 2QTEA 2AQPA 2W0KA 4RA0C 3WNJA 2FR4B 4HYTB 5BNXD 2FHBA 3Q3GA 3DIDA 4YPGA 4PJAE 3O6KH 5GGVH 5FOBB 1LP9A 1KXQE 3EYQD 5FCSH 5JUEH 1IRAY 3S98A 5KS9A 4KRMB 4XNMB 1BFSA 2HRPL 4XH2B 4HOZA 5DWUL 2FNBA 1F42A 4NO5A 2FGWL 4OLYL 4GG8A 2WUCL 1DYZA 1HHIB 4GLRH 3MRFB 1ZVHA 4GFXA 3IFNH 1MDTA 2FWOB 3N85H 1UG9A 1ZE3H 4ZTEA 1T1ZA 4K7PX 3Q8BA 5CGMA 3NTCL 3V4PB 4NQXA 3L5WB 5IQ9A 2DIAA 1A2YA 1M3IA 2AZUA 4JO3L 1UFGA 5DFVC 4XCCL 1T2XA 4WUUE 3UCQA 1C16A 3SOBL 3SQBB 4M7JH 1XGPB 3JUZA 5AENA 3ZMRA 2V6HA 4NUJB 1B4JH 1L6ZA 1G7LB 2VW7A 4CAGA 2QSTA 2CJ3A 3OB0K 1ZANL 3F58L 5D7JC 5F6HI 3MBEA 2QGCA 1RZKC 3HUJB 3MROB 4YEFA 3IJSA 5IJVB 3DV6A 4X7CC 3HOGA 3GEWB 2ZAGA 5ACMA 4WF7A 2PO6C 5F7WC 1B0WA 2HKHH 4YXKH 4KJQC 5D5MA 4XCFH 1UUSA 1CU4H 1GKEA 4S1SL 2ZKWA 1TTFA 3LHAA 3W11C 4OF6A 3TBYA 4LEOA 1PD1A 3TA3D 3Q6FB 3FTSA 4UT7H 4B9IA 4JZJB 5C0AA 3SPHA 1BAFH 5DUMH 3OXRB 2NDFA 1T7YA 1NDMA 4IIQA 4BFFA 5F72S 3IN0A 5T3XH 4Y89A 2AQNA 4QRSA 1QFWI 4UTBA 3L4YA 1TDQA 3KWWA 1RKRA 2LU7A 1UXSB 4MXWH 1PDKB 5BV7H 3EHBD 3UYRL 4U6YA 1S7SB 2AAAA 4QJ5B 4XZ4A 5F0LB 3W9DB 1XZWA 3EYQC 1CE6A 3HS9A 1FPTH 3KDMA 4JMNA 4KJYB 3N0PB 5T1KD 1A4CA 5AW0B 3T77B 1ZDSA 3P3UA 2CGYA 4I0PD 4LFHD 1KNOA 4K7PL 1HC1A 4OLEA 5EOCH 5FDWB 4X6BA 4LIQL 3NJFA 4LSQL 4V2BA 3K71B 1MNNA 1FHNA 3UP6A 4OJAA 3VU2A 3GWJA 3TZVD 5JOPE 4Z3JA 2EDJA 2NW3A 1DQTA 4JCMA 3TFKC 1AD0B 1KTDA 3QFJD 5KSUB 1SDYA 3HTLX 1F4HA 4PJIF 2P49B 4XN4A 5FUCC 1JZFA 1LHZA 2C3GA 2C9QA 3HNVL 4UTAA 1QATA 2HH0H 1WSST 4LL4A 3TOPA 5DVMA 4PI2A 5LBSA 1KGIA 2VT0A 2CCLA 4P04A 2X0WA 2OYKA 3BP6B 2ZKMX 3KBFA 5BRQA 1U2CA 4GMSH 4LESA 4KXAA 2R7EB 2OMBA 4FL4C 1YNLH 4KQ4L 1ZT4B 3FQTB 3NZSA 4L3CA 1D5ZB 1DQLH 3T65A 3VG9C 1O9ZA 2Z8RA 2WP3O 2FJFB 5EZPA 5D1XE 4N2EA 1A1NA 2ZOLA 3H6JA 5D1QA 1QTYT 4X6FB 4Z7UF 1VRSA 2VXTL 3W0WD 3BRFA 4L4VE 3SGKC 4LLUB 5DD0H 3S5YA 4A7VA 1V7ML 1FVEB 1OP3H 2Z7WA 2V9QA 3HHRB 3N5AA 4DEPB 1QBMH 4XC1L 5ESVB 3STBA 2JIXB 4Q2ZA 1HQRB 1CT8B 4PGEA 2K78A 3K6FA 4GW5A 1A64A 2TSAA 5HHQB 1R0AL 3ZDZF 4HS3B 1P4LB 2R4SH 4OFPA 5F1KC 4YLBA 4P46A 1BXXA 2Y1AA 1XR9A 2ICWA 3FB6B 1UA6H 4X6EB 2JTYA 3F05A 3HPLA 4HJJH 2DAVA 4H2AA 4YXLH 5IOPA 2OYPA 3KG5A 2F68X 3P0VH 5C0BB 4I4WA 5TDOA 4OUUB 1PLGL 3HZVA 3FL7A 4OF0A 4Y5XC 4QOKA 5SWSD 2CR6A 1TR7A 1A25A 4IEFB 1E3FA 4NQDD 2UZYA 4PWIA 1EDYA 4AM0Q 2DQHL 4HEPA 1TJHL 2JQZA 2WKLA 3EHBC 2VOTA 4XGZA 3D0LB 2E9WA 3GSXB 4NI6A 1A6VL 2IOMA 4OCRH 3RWIB 4Y9EA 2F7PA 3NCXA 1E0OB 2E7LC 3FNKA 1I8UA 4DZBA 4IU2A 3QZOA 1QW9A 3CFKB 3H2PA 4I0PC 4L48A 2DV6A 4L1BA 1HXMA 3SDYL 2I9TA 4AOFA 1ZEAL 4MXQD 1XGQA 2G3ZA 2UUDH 2EZ0D 4DETA 1U6AH 4L3ED 2YQGA 1LVEA 1KBGH 3BI9X 1YAIA 2EDBA 2ZP0T 3L8QA 3RYMA 1CZ8H 4P48A 1CICA 2E6PA 1A8ZA 1EVUA 1F4WH 4OCYL 1BQHB 2ZWLT 2VDNH 4PJ8D 1KXVA 1MFDH 4TQ8A 1Q38A 3PWPA 1ORSB 2PXYB 3TVMB 3BHBA 3HR5B 4E5XA 2QKIA 4AKQA 3WFDH 1JTTA 2DEWX 2DJUA 1H5BA 3BP5B 5KAQG 1F56A 4PWEA 2R8SH 1Q0XL 2NY0C 1U8JB 3GGWB 3I2CH 3ZUNC 2BNQE 4BA8A 1Y6NR 2CK0L 2DD8H 1F97A 2JKLA 1SQMA 2WXOA 2ZX9A 3OPZH 4LAQH 5E1QA 1G7JA 3AS3A 5F9DC 2PTTA 3T0AA 1JNJA 5K9KA 5ACLA 1QSEE 3AXIA 1R4XA 1IAKB 3BGFB 3MUGB 3VI4E 4Z9KB 1HWHB 3DI2B 3US1A 5EFIB 4OZGF 3T6ZA 3BAEH 2GEQA 2Z4TA 4GXFA 2FGZA 4M6ML 5B4MD 3KPSE 1ZTMA 4FEMA 4FA6A 5IESL 5IMMA 3GZPA 3KPMB 4FFVC 4QRPE 4RMTA 4IBWA 3KWUA 4KGJA 4CMHC 1UWFA 4PJXB 3BSZL 3LRKA 3OAYK 4XP9L 1FLRH 1G7HB 4PJFB 2JCWA 3VXMD 4P49A 4IRJA 1A4JA 4GLRI 4RFEA 1VIWA 1C5BH 2DMHA 2NMSA 3MRCA 4G7QB 1KCSL 1E2ZA 1G87A 4NQUA 4TNGA 4Y1AA 4AIOA 5C8JB 4Y9FA 5DJZB 3EDFA 5A2BA 5JHDD 2OAAA 1A3LL 2FUQA 1UM4H 1AFVH 3S34L 2VXSH 3V8OA 2W91A 1IUZA 1MJUL 5HPOA 2X4RA 2DICA 3QO1A 3L4UA 4ZUSA 4AI7A 4M7LT 4IBZA 3RVVD 1J11A 3NSFA 4ADIA 1JFQH 3MODH 4HK0B 3HB3B 4JDZA 5GPRA 1J8HE 1WFNA 3IPEA 4Z3HA 3Q8FA 3BYYA 2TRYA 1NMCB 1RUAL 2WQUA 1XXDC 4MXVF 4OU3A 4XE0A 2XZQH 4CA4A 4BE6A 4LPWA 4NZTH 3MAWA 5CSZA 1EMTH 4H25B 1XF3B 4HUVA 4GKOA 5KUMA 5KVMC 4HXAL 2JI1A 4OLZH 5FA3A 4HOWA 2VDKL 2QHRH 1SXSA 2GJJA 4O5LH 1J1OH 3DVNA 3KLAB 2H32H 5HHMD 2H0FA 1BG9A 4FF9A 4BRVA 5LUMA 3BQUD 4G7VH 1BW8A 4JFXB 3LN5A 3PIQA 3F7YA 3GMLB 4LNVA 4X4ZA 4M1CD 1S9KC 4RFNC 1E4WH 1IAIM 1VPOH 1F5WA 2PW1B 1PSKL 1RULL 5EU5B 3SDAA 4C4KO 4XVTH 5KSVA 2A9CA 3GIZH 3BPNB 2MHAB 1HT6A 1AQMA 3ATEA 3PJLA 4OZFA 4Q0XL 4YFDB 2ZUSA 4B7IA 2MSPA 4C83A 5BS0A 3ZE2B 5I6OA 4M7ZB 5F9OH 3J2PA 1JBJA 4YSAA 3M7FB 4P0DA 1YYMH 3DMMC 5IEHB 2R83A 2H26A 2BO0A 3B9DA 2XETA 3EOTH 3QAZB 1V7NH 5DA4A 2MCMA 4HISA 5J56B 2YD7A 2X4SA 2BSRB 4Q6IB 1MFBH 2D4DA 1ET7A 1G84A 2K6ZA 1Z2KA 4OLVH 1NIFA 2XWDA 4J3OD 1NFIA 1AR1D 2OMYA 1YNTF 4OF7A 3RX5A 3O3UN 2R0LL 5E1AA 3CHRA 4W6WB 5J4MA 2WO2B 4G59C 4WHCA 3RY6C 2ORBH 5G55A 1UA3A 3ARFD 5TDNA 2ICES 5M95B 3NBNA 2QJDA 3MKGA 4GKSA 4M5YH 1RK7A 4PY8J 2YXWA 3I84A 1X44A 5E1HB 3C2SA 3CZEA 3D87B 5FYLE 1UVQA 4X4XB 2O61B 4LEXH 3NESA 5JO5B 4RMVA 4YK4B 2VH5H 4WK0B 1VKXB 1E4XL 4JHWL 3V5DB 5JPMB 5KYUB 2QGDA 3QHTC 3HUJE 1B0GB 1EAOA 3FPYA 3TBWB 5JW4Q 2L7JA 1D6EB 2WUBL 2JJTA 2W07A 3Q2LA 3RL2A 3SKNA 5LQBH 2IANE 1JS4A 1S8DA 4NCDA 2O26U 2APXA 2EDTA 1ND0A 3UTSB 4KJWD 4HIPA 4JGUA 4TOYL 5BO1H 4NRZB 4R3SA 1QBAA 2XACC 1ZLSH 3IU3B 4J3OF 3VGDA 3ISWA 3VQ2C 4ANKA 3N44B 4ODXB 4MA3A 5DHVH 3DTXB 3QUXD 3U2IA 3GM0A 5C0CE 1QD0A 4QTHA 2CWRA 2GVYA 1BQHG 2NY6C 3GHPA 2PETA 1F90H 3P11H 5DVPA 5MP6L 4G8GB 3LQAC 4UF7C 3M1CA 5E2UL 3WFEL 1T3FB 4MD5A 4IGBB 1YECH 5D7IF 1TETL 5CAYB 4JPVH 2B16A 3TT3H 3TNNB 5IP4A 1ZLUH 4JFDB 2GJ6B 4YQXL 1WWCA 1QNIA 2VMJA 3DJ9A 3BUYA 4A7UA 5J89A 3D69A 4YHML 3HPJB 4M61A 2BC4B 4LPYA 1H0DB 3D4CA 5FUOL 4CC4A 4H13C 4NQVB 5EIVA 4N20A 3UZVB 3BVWA 2R0KH 4GQPH 2X3AA 3RLSA 4GXUM 5GISL 4KUCF 5LGJA 3B5TA 4MQSB 2X6VA 1YCSA 1XGRB 4ODTL 2PR4L 1XIWD 2QVTA 3BEVA 4K8RD 4R83A 4E41D 2NZIA 3L4CA 2XI9A 4J3OC 2AJXL 4PREB 2XFXA 2BP0A 1IEAA 1OGAB 4L29B 2O6CA 3HG0A 1LE5B 2OCFD 3O9WD 1IC7H 5FWRA 3ARFC 1JYNA 4Z7VA 2XG5B 1A0QH 3CZFA 2ZXGA 3CDFA 4I85A 1C1EL 4HCIA 1DLHB 3VXTB 4EIGB 3MJ7A 4UAOC 1KBVA 4FYQA 4PRHD 4RMSA 3U83A 3HHSA 3RJOA 4F1ZA 3ARWA 4HJGA 4LOVA 2MPAL 5D6CB 5TH2B 4N0CC 2E9IA 3B3IA 4ATTA 1TVHB 4O51B 4JQXC 4U0RB 4X7TB 1AJ7H 5C0ND 1PG7H 3QIBA 1ML0A 1MWAH 4JHVA 5E4AA 3UAJD 4NO3A 1QHPA 3GSVA 5DJCB 3M46A 1TVBB 3NSCA 4XPHL 1L0YA 4JNXA 4KTDL 4DW2H 4F7PB 4YC2B 2CHWA 2X4TB 3ZN6A 5IQOA 2LR4A 1KXHA 5F7NC 1OCRB 3M7OA 4K71B 4Q8BA 3AROA 4BA0A 2VLMD 1OF2B 1T1YA 5D2NA 5LJYH 3KWVA 1BZ9B 4P5TA 4UM9A 4JPKL 5HDOA 1PZ3A 1IZKA 2YXMA 4LHUA 3QUYA 5CR1A 3UMNA 3MLTB 2VAAA 2X4QA 1NCBL 2R29A 3PV6A 3VD9A 1P7QB 2GTZA 1DQDH 4M3KB 1T0MB 1JDAA 1FNFA 1UA7A 3B37A 1E7VA 3BVVA 1XB6A 3KNBB 1F1AA 2WB7A 3QXDB 4LO9A 4MJ6B 3QUHA 4XMUA 5GGSY 3TWCH 3ILPB 5DO2C 1M05A 4U2YA 2H32A 1RP9A 4YHZH 5EO9B 4GQZA 4K3JH 3EJJX 1MIEH 3CTTA 3QWRA 5FM8A 2IAMB 2JELH 4MBOA 3NP3A 1OPOA 4QXUL 1CL7L 1QFPA 4HIHA 1A6AB 1UD2A 3CFQA 2B20A 2W9LA 4U2ZA 1JMZA 3DPDA 3M17A 1ZAGA 3KPNA 3ESVF 5EU4B 2PABA 3A23A 1KEML 1TOXA 2X89D 4O58H 1TMCB 1XIWC 4AXWA 2N1TE 3K72B 3NCMA 4LLYB 3D08A 3BEWA 3LXCA 3QIUA 2XIIA 4XN5A 4ODWB 2DQGH 3IDGB 4PJ5D 1QQDB 4OF5A 4BSJA 4X7EC 1E27A 1MI5E 4OZHF 3ARDB 1AKPA 5ERWA 2QQNH 2OMWA 3O0RH 2PYFB 4L2LA 3RAJL 4JPIB 5ICZA 5IV2A 3AWGA 4FTVB 3CVIL 4TVPE 1CLCA 4MYPA 2EO9A 4TPRL 3TYGH 1SM3H 3PABA 1G4MA 3ILEA 2XZAL 2ICEA 4NNYA 1I8KA 2NXYB 2P5EB 3FO2A 4YPJA 1KB5B 4MJ4A 4OI9A 4P23C 1L5GB 4EN3B 3MZTA 1KZYA 4Z7NE 5L0QC 2PCXA 2XY1A 1P4BL 4HULB 2NLJA 3UAJC 4KROB 1IC4H 1FFPB 2VKWA 3PGFL 2FJUB 5EO1B 4FTDA 4GG6A 2CGRH 3CH1B 1K6QL 1TJIL 1BQLH 3SYPA 1WGOA 1K9TA 1TCMA 3RZCB 2QVFB 5JLZA 3O45A 4WV1A 3MRKA 5E56A 4QWWD 4G8AC 4PJXE 2WQXA 2DH2A 4XC3L 2Z4QA 1GYCA 1DANT 1RJYB 1PKQB 2NY2B 3QXUA 4PJFE 3U25A 3VQ1C 1A6ZA 1X7SA 1VSCA 1ADWA 1GGBL 5IIEB 4QGYA 1KN2L 3LHPH 2IC2A 4DVRL 5GHWH 3QXWA 3RDJA 3OTTA 4KHXL 4ENEC 1A1OA 1S7TB 4FDWA 2DBLH 5TQ0L 1U8QB 5E9DA 5CBEB 4AEHL 3BISA 2OR8A 3CWGA 1TQBC 4JRXD 2EP6A 2DKSA 3KHQA 3ZTJH 2ZOUA 4HWZA 3C12A 3SCMD 1BQSA 4DUXA 4QHUA 2IFFL 1X5HA 5DMGD 4F3FA 2V0AA 1S7WB 4BH8B 1CG9B 3BO8A 4LBEB 1UWXK 1R1CA 2FL5A 1RPQA 2AK4A 5KVGH 4NZRL 5GSRB 4MB5A 4KKQA 4X99B 1KJ3L 4R6UA 4K3DL 3LS5H 4M4PA 3OMIB 4Z95L 4QRQA 5FYJU 4G6AD 1AZCA 5AW9B 4N0RA 1GXEA 3GSNL 1J7VR 3SDDD 5ETUB 1PCXA 3QIWD 1RIUL 4Q9RH 3C5JA 1H15A 3Q8AA 4G5AA 2ZUQC 3PWJB 3ZTJG 4NC1C 2XN9A 5L2KD 2Z35B 4NC1E 3OXSB 3H55A 4JHUA 4N2KA 4GP5B 4C56A 1RZ7H 2J57A 2OW7A 3O6ML 3O8XD 1DSWA 1MNUH 3ZL2A 3CCHB 4LEEA 1QUNB 3K5RA 3KM1A 3TS8A 2VRAA 4N3TA 5CLTA 4N6RB 1CGSH 1TPXC 2YGPA 3KH4A 4JHAH 4RCAA 5E8EA 4OM0L 1UZ8B 3BH4A 4MSWA 4NXKA 1SLWA 4Y19D 1CO1A 1BFVL 4PJHF 4DP9X 3DIVA 1J5DA 4YDJB 1IBBA 4FXGA 4F93B 3NJVA 2PPFA 4RWHA 1J5OL 3QQDA 1BZOA 1BIHA 2WZPD 1FL6A 3NMEA 1BVKB 5DRZA 1VERA 2B2XH 3ZKMC 3RY5A 1MQ8A 3ROOB 1TU2B 4MZ2A 3ZE2E 5K9QI 2YC1A 3RTQB 3BRGC 2WBKA 2C8NA 3PL6D 4L8DA 1G5AA 1MCQA 4ZAKD 4R0LC 2IH1A 3MOAL 3NPSB 4K5MA 2WWMD 1OOAA 4M6NH 5H35A 1G7IB 2DIJA 4F7CB 4PB9L 1XH2A 4KMTH 1DN0A 2VM9A 1HHHA 2CSPA 4I77L 4Y9GA 4E0RA 2LQRA 1AYOA 1MCDA 2LOEA 4HLZG 4CW1A 1PKOA 4I87A 1ETZA 4X7SL 4XN2A 1OCOB 3PP3K 4ZW8A 4WKXA 1PNCA 2VM3A 3O11A 3UAAA 3OF6A 1X7QB 4LCIH 4HWBA 1MCBA 2ZSVA 2FX9H 8CGTA 1OWRM 3K2MC 3KS0J 4J3UA 2APSA 4HIQA 2ED6A 2AV7A 3T2OA 4KZDL 1NCCL 1TZGH 3NABH 4YE4H 5KN5B 3GJEA 1BBJA 3MVSA 3JVGA 1NCAL 4FE9A 3V6OA 1GIGL 1I1YA 2X9YA 3RWEB 1R3IH 5B1JA 3B2XA 5EA0H 3DX7B 4PJBB 4IOSD 2VC2B 4HP5A 2E75C 4CJ0A 4YHIA 1QKZH 4MCNA 3EH5B 2GT9A 2I27N 3SDDC 3KLLA 1IFHL 4URTB 5IT2L 1EEYA 3BC9A 3HNTH 4NKIL 4PHXA 3QIWC 5D4JA 5H37H 1YEEH 1G1OA 3TH3T 1KJ2H 5D1ZB 1TQVA 4P5KB 1X5ZA 2QDWA 2Y5TA 5HYJA 5DEGA 3UTSE 4KX9A 2RMNA 3SDXB 4B97A 3VXRE 1NJ9B 2JKWA 1HQ4B 3R0NA 1S7VB 1LNUA 1CUOA 2QQQA 1E40A 3QORC 5FGBA 1JZEA 3IFPA 4XWGL 1N64H 1CQKA 3VFTA 4RRPG 4G8GE 3VM7A 4ALAH 5EU3A 3FYEB 3L3JB 4WI3A 3VFNB 3FYIB 1SHMA 4D9QE 2NZ9D 2APWA 4ZOBA 3DUUA 1EV2E 3NJHA 3O2VL 1I4FB 4ZQKB 5J9PA 4JG1H 1KBBA 2GJ6E 3GMMA 3V4VH 2EXWD 3WFHA 4KNUA 3PHOB 5E9AA 2CLRB 4JFHE 3QGVA 4KQ3H 3GLZA 1CLYH 2MFNA 2RQEA 2BNRB 4W9GC 3U0TA 4G6FD 1KJVB 3FSWA 4HUKB 5K39A 4L8BB 3HS8A 5D96B 3KPRA 4NGHL 3BIKA 1KPRB 2J8HA 4IU3B 1F45A 3QYMA 3TEYA 2MMXA 3ZUCA 1SXCA 4P07A 1N9PA 5G4NA 4XP5L 2E27L 2BP5M 4R8WH 3VRLF 5FKAB 3VXQB 4F80A 4W9JC 2XRAH 3MI6A 4BFRA 32C2B 2AEQH 4ZXBB 3DX3A 4TSBH 4UQ3B 1A1MB 2G5BA 2JV6A 1MRFL 2EE9A 3VXSB 5J12C 4OIFA 5AG9A 1TNNA 1NAML 3MJ8B 5TE6L 1A21A 5LNGA 2EC8A 2R1XA 2I32A 3V0EA 1XGZA 3LSOB 5IQMA 2VRQA 2J1WA 5EN2A 2ZYRA 4XCYB 4I3RH 3K0WA 4EQ3A 3HC3L 5C07D 4N8CL 3QHFL 3DSFL 5I23A 4KKRA 4OVUA 3FXIC 4IS6A 4OVVA 2XYCA 2Q1EA 4YBHA 2P4AB 1G9NH 5INDA 4WGKA 4AQ8A 3DJTA 4GMTL 4CBPA 2Y2WA 3QJFA 2R69L 1N8ZB 4B60A 4XAKD 3OWRA 4OGXH 3R1GH 8FABB 4XNQB 4QF1A 1KEGL 1YMME 2LVCA 4JQIA 3WTYA 4PJCA 1HDMB 1T21A 4FNLL 2HX9A 4J8QA 2A2QT 1HI6B 1MEXH 4N28A 2GFBA 1R5VB 1LK2B 2V7HB 4YBQD 3N1QC 4HJIA 4D3CH 1NFDA 1U8NB 4IJTA 1PQZA 2HX7A 3Q3GB 4YPGB 4H26A 5EU6D 3HG2A 3V2AR 1LP9B 3LQAL 4MA7H 3D6GA 2Q86A 3H2QA 3MUZ1 5KS9B 1N6QH 5E6IA 4WHYH 3IE9A 4HCRL 5DC2A 4HXBL 5I0ZA 4L2YA 4NO5B 3NJXA 4GG8B 4PTUA 3TPKA 2YEZA 2ZWYA 3UPCA 1SJMA 1PVHA 3QJSB 4MMXC 1T1ZB 1IVTA 2J6WA 2NPLX 4ZUWA 4I8DA 2DQEL 3BYTA 2X70A 4LPTA 4ZW7A 1AO7A 3M45A 4BZ1A 4M8RA 3D3VD 4NQXB 4AV5A 4KH9A 4KKBD 5IQ9B 1A2YB 2JQAA 3S3CB 1MW2A 4XO4A 1UXLA 1C16B 1JOIA 1SFDA 3DJZA 5DQDL 3X3GL 4DP7X 1GS6X 3K2UH 2H3XC 4Z3EA 5GRUH 2LGNA 2YXVA 5D72H 4FTVE 1VFOA 4MNQA 2FWUA 3U9UA 1W0VA 3ILDA 3LRMA 3CSBA 4I18C 4YWGH 2FTAA 3MBEB 1KTBA 5JIQA 2BY2A 5CJXC 4IMKC 3DV6B 4WWNA 3VSUA 2DBJA 3K74B 3Q06A 2WCSA 1JJUA 2AJSL 2EDMA 2F9BT 3SY6A 4AL8H 4FQQA 4F8NA 5D5MB 2GSIA 5ESQA 1UD5A 4G5ZL 1WFTA 1KBKA 5KZCD 1TTRA 4ZI8A 1X7TA 5AYUL 3QPXL 5JNYA 2P28B 3G7TA 3TBYB 4R7LA 3VNYA 4LEOB 1UWEH 1N12A 3L3HA 3JTSA 2WQRA 4YLQT 5EDSA 4W4OC 3ETBJ 5C0AB 4DKFH 2YPVA 3T2PA 1PJ9A 1PKQE 2FBJH 5ECJE 4IIQB 3TA4D 4HIJA 4QRBA 3RGVD 3N1PC 4ZPTA 4B50A 5J6HA 5DD5H 1DL7H 4JDTH 4QRSB 3PAUA 4FI6A 4TSCL 1SJXA 3KWWB 4G9DA 3MRGA 4WFHD 1FHGA 4XMPH 3FQRA 4KKLD 3QS3A 2Z34A 2R39A 4HA1A 3CXFA 4FAAB 4U6YB 4EIBA 4ZD3H 1CE6B 1QLRA 1KIRA 3KDMB 3IJHA 3FH7A 5ALBL 5ICXA 1WP6A 2Y9RT 2XTJD 1QEXA 3V6FA 1PX8A 2Y7NA 1KNOB 2TSBA 4HQQH 3ULAB 4QTIH 4X6BB 4AYBA 4DEUA 3VYNA 1HILA 4QRFA 3GPEA 3T3MF 1H3PH 5AW3B 4XB3A 2NW3B 3I6KA 1KTDB 2V5TA 4MB4A 1LXMA 5I8OH 1WAAA 4U1GB 4YSTA 3V0HA 2J88H 3CSGA 2Q7AA 1BQRA 4DN4H 1D5RA 2ITFA 2DQTH 3NFPA 1AVAA 4FMVA 5EUOF 1QLEH 3NDYE 1T4KA 3O4OB 4L3CB 4WU7A 1EUUA 5D2LE 1UM6L 3T65B 3BZFA 1VEMA 1HNYA 3DIFA 4MKMA 5ITBH 1ZWIA 3H3BC 1A1NB 1A3RH 2ZOLB 5D1QB 5L6YL 5AVSB 4GW1A 3QR1A 1CLZH 2K45A 3PWVA 4NLHA 4YJZL 1R3HB 2CGZA 3C8HA 4XVSH 3WAJA 1L9TA 3QYCA 1DLFL 5K5YA 3PUUA 4BXVA 4M5SA 3RIFF 4J28A 3BT2L 1OAJA 1MJ7L 4Q2ZB 4PGEB 4BELD 4HHWA 3SEPA 3Q13A 4GW5B 5FFLA 4P46B 5AW4B 4PIRF 1XR9B 2ICWB 2X41A 3L4VA 1T2QH 1BMGA 4OLUH 1VCAA 5JW4R 5IOPB 1U58A 2NY4C 4GEIA 4I4WB 5TDOB 1ETB1 3QQ4A 4JGJA 5HHOE 4HDIA 1B0RA 1UZGA 3HZVB 1T4WA 4RBPH 3MRQA 1PZUB 4KPHL 4QOKB 2Z7UA 3W57A 1I9EA 2UZYB 1LEKA 1FFTB 4K94C 3UG5A 4Z23A 1MPAH 4XGZB 3AUWB 4CN6A 2XPGA 4LNRA 1RU9L 1P7KA 2E7BA 4DZBB 1KV3A 4IU2B 4F7MA 1WFUA 2XTLA 2YD0A 4XI5D 2DQUL 4YZFF 3EG9A 1N6VA 3L08A 2EICA 1HXMB 2I9TB 1F00I 3K3QA 3P1VA 1XGQB 2M1KA 2D3LA 2ZXQA 1PPIA 1KENH 4FLRA 4Y88A 4KRPC 3NJJA 1P1ZA 3QA3A 1CICB 1P7HL 4KK9D 4KH2A 1GYWA 4QPEA 5ENWA 4PUBH 4PRPD 1DVFC 2CIIA 2I9LA 2W88A 3PWPB 1J1PH 3D05A 3BHBB 1T22A 2XN2A 4E5XB 3V55A 4HPHA 2QKIB 1KIUB 1H5BB 4J3WA 3OZ9L 3SDXE 3SPJA 2DB8A 1IGIH 2Q8AH 2VLJA 4UOQA 3EJPA 4DP5X 4HEME 1INDL 4M93C 2YQBA 4IKNA 3H4HA 4L1LA 1G7JB 4HKXA 4H0HB 2PTTB 2VJ0A 4AVIA 2K1MA 2QTVA 5GGRA 3FB7A 1N67A 5I0YA 5K9KB 3DX9A 3K4ZA 3EFOA 1EFXD 2L7UA 2FAUA 1EGJL 4MRCA 4GP8B 4BFIA 2W8CA 1JI2A 3OHMB 5IMMB 3B34A 5J8OA 3L4WA 1PS3A 4NJ9L 1MJJA 2IGTA 4W9HC 4GT7A 3N0AA 4AEEA 4HH9A 3L48A 2N01B 4IRJB 3EJYC 4GKNA 1L3WA 4RFEB 4P9MH 4DKDC 3MRCB 2JKNA 4ERSL 4B9KC 2BNRE 4Y1AB 5K1VA 4GSUA 4JANA 1BBDL 2JLLA 1FC1A 4WSKA 3VFMA 2FWLB 2C7UB 3FCTA 4H88L 4QNPF 3U4AA 2NY5C 1JPSL 2X4RB 5GZOA 5I1KL 4ONOA 1E42A 3QO1B 3MCG1 4ZUSB 3KJ6L 3CBJB 3JWNG 4BQ9A 1DN2A 2D0HA 3F3HA 3QQ9C 1YO4A 2AMGA 2H3NA 4JPWL 4N2FA 3VGHA 1PFOA 4AIXA 5I18L 5BMFL 1KCLA 1FNEA 1BD2E 4JDZB 3H1ZA 5E08L 4MX7A 1YEIH 3FUNA 4XI5C 4ZOCA 4DKTA 1CURA 1OSYA 2GB2A 3VSQA 2VXQL 2Z31D 3HI1A 3GI8H 3N04A 4EIZC 4MMYA 1TTGA 3FU8A 5CSZB 4XP1H 1D7CA 4IQHA 2QQKH 1Q9WA 4AYDC 1G94A 3HE7D 3WFBL 3TX4A 4X6CF 4DWHA 4HUVB 3HJ0A 1P9MC 3S0PA 1JN6A 2A1WL 2D7QA 3DVNB 4P59L 5EB9A 4O00A 3FU6A 4PB0H 1ZMYA 3KM2A 3IT8D 1H9DA 2RCSL 2WXPA 3RKPA 4AK2A 3D12B 3LN5B 3MV8D 3PIQB 3F7YB 4H5SA 4IBTA 4GQ9L 4JL2A 3TLRA 4BGLA 5KUKA 3D25A 1Q1JH 3B7TA 4L1TA 1UJTA 4HFUL 3DURA 3NSYA 3SDAB 5KSVB 1OLZA 3VE0A 2EAEA 2IWGA 4HW6A 4OZFB 4C83B 3REWA 2ED9A 5BS0B 1LMKA 3WKNA 3TESA 4NP4L 5DMYA 3KLKA 3BQVA 4ENZA 1LP9E 1AS7A 3EF4A 2FHCA 1FYHB 2H26B 2QADD 1CXIA 4C55A 5KS9E 5DHXB 5EH1A 2VIRA 3FU7A 5FHBH 1UOWA 2X4SB 2DLEA 1PD6A 4FA8A 1UACH 4FFZL 1OW0C 3HE6D 3UPRA 4UIMB 5KVFE 1BP3B 1NFIB 2OMYB 2UXGA 3HBZA 4IOIA 3I74A 1QPXA 1EIBA 4HKBA 3C5ZC 2GY7B 4YHNA 1A65A 1CDUA 3M1BA 5E1AB 3ZZ1A 4U6XA 1W6WA 3T09A 5HYIA 5IWLA 1UT9A 3TEXA 5TDNB 2GJRA 1QFUH 5I74C 2X4OA 1V55B 1MUJA 4GKSB 4JRWA 4NN6B 1HH6A 1UVQB 2R23A 3P30L 4XMLL 2GUYA 1T7XA 3SKJL 3T2QA 1OB1A 1U36A 3L3OA 3ARRA 3NQKA 4MS6A 3KW8A 4XOBA 5JOPD 2XKSA 2OTWA 1SMAA 5HD8D 4Z7QB 2W07B 3QQ3A 4HV8A 4HJUA 3RL2B 1OGSA 1FWXA 3A67H 1GYVA 3SKNB 4A04A 4LAJH 5D5ME 1SJEA 1S8DB 2A38A 3OKOA 1CXHA 4GRLD 1IGYA 1BSIA 1ND0B 1R6VA 1FIGL 4P4KC 3EZ8A 1MF2H 3HMXH 4R3SB 1IX2A 3GSOA 1IC1A 4W81A 5DJAA 2JJSC 2WLNA 1DJSA 3OKLA 4JKKA 3UX9B 5I1AA 4MA3B 1TITA 4IDJH 4P5SA 5C0AE 1J5HA 3O2DA 4QTHB 2EUWA 2F5AL 5IBTH 1JHLH 1ZGLA 3ESOA 4JM2A 4WI5A 3TH2T 3V7AG 4E5XG 1WYJA 1C7TA 3EO1A 3NIFF 2G75A 3O4LA 1NIAA 4MD5B 1ZLVH 1MOEA 1YHPA 4L4VD 1WGVA 1EEUA 2EDDA 4TULL 1O7DC 3EYSH 4NQCE 1AHWA 4PS4H 2VDQH 3RHWK 5IB5A 1CYXA 3BUYB 1JSYA 4O02H 4W9CC 1AZNA 3D69B 3B7UX 4M61B 3CC1A 2WAQA 1KYOJ 4YHKL 3RVWD 5F88A 5LGJB 1T5WA 4YX2H 5A2FA 1GGIH 5DSCA 1A7RL 4K3EL 1IBGH 1SBSL 1WHOA 1IAIL 3BEVB 3HE6C 4N87A 1ASPA 5AOZA 3B2UD 3DLQR 1LM8V 2F58L 2EO1A 2XFXB 2WWKT 2BP0B 1IEAB 2C9UA 2EDLA 3E80A 3KL5A 4L1SA 4QRAA 4X9IA 3INUL 2DYPD 2DQCL 1FF5A 3M1OA 1MHCA 3DX8A 4Z7VB 5AOMA 4N25A 4IJ3B 3CZFB 4OSUL 4B9ZA 4MGXA 3MJ7B 1I1AA 2WWNA 2LLLA 3TONA 3WY1A 1XFPA 1U4FA 4XN9A 1JTOA 3HHSB 1CE1L 5T3ZH 5H4ZA 3HMWL 4HJGB 3CLEL 4HWUA 6TAAA 4ZFOL 4UZSA 4ZFZA 3GS0A 3B3IB 5CJQL 4GAGH 2P5WD 3WUWA 3AREA 3QQXA 4DK5A 2Q0ZX 5I66A 3NH7H 3QIBB 5GJSL 4LSVL 2ED8A 4NO3B 1HKLL 5D1QE 3GSVB 4B7LA 3SBQA 1UYWL 3JUYA 2IPTL 1IM3A 1ES0A 2WLHA 4F15B 4Y9BA 1G6RH 2IJ0C 5F8RC 1JVLA 5IR1A 1JXFA 2GTQA 3GF8A 2Q3AA 1BQUA 1T1YB 5D2NB 4P5TB 4UM9B 2R1YA 4WO4D 3GXMA 2CE6A 4LHUB 2EDQA 3QUYB 4JR9H 4TYUA 43CAA 4Z7WB 2VAAB 3WEMA 4K23H 2X4QB 3JV4A 3PV6B 1YLBB 1JWMA 1OGTA 3IMSA 2OJZH 3NCFB 1W6LA 1WA2X 3U7AA 3ZIMA 5ANMA 5IB3A 4ZO6A 1E6OH 3HAEG 1M05B 1LO3L 2H32B 2UX6A 4QOKE 3FBKA 3BE1L 3Q01A 4FNQA 5CUSL 2IADA 1TKWB 3KPSD 4IBSA 5DU7A 4MAYD 1GSKA 4QRPD 5TE7H 1A7NL 5IROC 3TF7C 3VFVA 4HIHB 5CM1A 4NFDA 1OGPA 3AACA 3MOBH 2D7TH 4YSDA 1M2OA 3N50A 2J4WH 3M17B 4OZFG 1H3TA 2FH6A 3KPNB 2XDHA 4IMLA 3T4AA 1N0LA 5ADPL 4XMKH 1NH6A 4NC0B 3BH8B 5AKVA 6FABH 4AXWB 4FLOA 3RE0A 1BYNA 2MCPL 1KJMA 3Q9PA 3BEWB 3FW6A 3FU3A 4F57L 2CA3A 3QIUB 2EIBA 4HZLA 5E2WL 3TN0D 2MEJB 4PGCA 4LQFH 4UV4L 3MC0A 1GHFL 4PJ9D 1E27B 4E9QA 1JZ6A 4F8TA 4MA8H 4JRFA 5ERWB 2OMWB 3PWPE 5DEZA 5ICZB 5IV2B 1DBAL 4M3JA 2XHNA 4UILH 5LCVH 3L2LA 5EV7A 4JFEA 1J8HD 3PABB 3Q7JA 3IBEA 2ICEB 1MDAA 4NNYB 1VF5C 5GZND 1I8KB 4LDOB 1Q9OA 3FO2B 1UB6A 3VGAC 3WUZA 1UUNA 1EWHA 3U0WL 5FC9A 1ZHBA 2NLJB 2YUZA 3PP4L 3AU1A 3U6RA 5HHVL 1AC0A 4UT6A 1XL6A 5MEPA 1UOLA 5DVNA 2OCCB 3W81A 5I5JA 1M42A 2Q2EB 3B7RL 3VH8G 7PAZA 2HTLD 4Z7OF 4GG6B 1XF4A 2OM5A 4WSGA 5JLZB 1SUJA 3O45B 4WK4B 4WV1B 5EIIA 3MRKB 1DCEA 4HUWA 2Z4QB 2MIZA 1AQDA 5HI3D 3QZPA 1A6ZB 1RFDL 4Y4HD 4X8JA 1YEHL 4BFEA 1TENA 4L5FE 5JXEA 3FCGA 3D07A 4A6YA 1P4IL 3D0AA 1YRKA 1UZ6F 3P9WB 4Y1AE 4L0PB 3WKMH 2A9MH 4UQBA 1TZHA 3B6SA 1A1OB 3PQYA 1TTUA 3DJSA 3EXLA 5E9DB 1PEWA 5E6RB 1RIHH 4M6OH 5DHDA 5I26A 4HWZB 2J5LC 2W0PA 3MLYH 3NPZB 4QHUB 1OD9A 4DGIL 3S8FB 4F3FB 1M57B 4JREB 1UCBH 3FHQA 2D0FA 2BP3A 1GH7A 3BO8B 4K94L 4HK3N 1E4HA 4F27A 4KZEH 2FL5B 2NRDA 2AK4B 2CKBA 2IG2L 1SXNA 1OAXL 5I5MA 4ZMVA 1IC5H 3GXFA 4WW2B 2RHEA 1HZKA 5BV7C 4LE8A 1A7PH 4QRQB 4POZC 3KBHE 2XN0A 3CN4A 5T5FL 4X5QA 3RB7A 4FXKC 2FEJA 3C5JB 4RDQG 1H15B 3AB0C 3F04A 4ONFL 1UD8A 2XN9B 5F89A 1MW1A 3ARGA 4AQOA 5JDJA 1F1GA 5IHZA 5PAZA 4C56B 4PLKC 2YA0A 4S1DD 3H42L 4M6AA 3SHSA 5FYLD 3GSWA 3MA7A 5I1HH 1NBCA 4FLSA 4MJJA 4MSWB 4Q4EA 2JB5H 5E00A 5DO8A 1QW8A 1R9FA 3QI9A 1QI4A 4FXGB 4PRDA 3FTXA 3W5NA 4GRWB 2VR6A 3QQDB 1FGVL 4ACPA 4ELMA 5LVEA 1JZIA 1FL6B 3DYOA 1IBYA 1SQ2N 4G6JL 5DRZB 2FHFA 1KF9B 4K07A 3IGLA 1UWGH 2YC1B 3DJRA 5L4IA 1MFNA 3L1OH 2OCJA 1AD9A 1S46A 4L8DB 4XPBH 4GBXD 1MRDL 1F0LA 4HSQA 4PH8A 2B5IB 3NQIA 4HS6A 2IH1B 2UWEA 4M5ZH 5K93A 3BKYH 3LMJH 5H35B 5KAQF 2W92A 1DN0B 2IGFH 1HHHB 3FQYA 2YR3A 2ZAHA 3QP3A 2CXGA 2WQWA 2I25N 4E0RB 4R84A 3MLVL 2OL3H 3FUMA 4AVHA 5I19H 5KSBA 4DQOL 1FVCA 2F8VA 2VUYA 4JN1L 4CW1B 2EINB 1ETZB 4KY2A 1JGUL 3LEYH 2RR3A 2EE2A 4LHUG 4KX8A 2J55A 3TBCA 2XY2A 2ZSVB 4XNXH 4Y2DA 1OK0A 2JTDA 2NY5L 2AV7B 2HXAA 1A6WH 3LIZH 1U8IA 2J1ZA 1LO0H 3GJEB 5CILH 1BBJB 1OCCB 4I13B 2EEBA 5HGHA 1I1YB 1FRGH 1X4ZA 2AV1A 1SLXA 2VXUH 2HN7A 3PXJA 2OZ4L 2A0LD 4Y5YA 3LS4L 5DVKA 4O2CA 2KL6A 2WVSA 1J10A 4YHIB 4FFWC 4N24A 1NA8A 3OGOE 2ZUYA 4LVOC 3TGXA 4J4PD 2GT9B 4XP4L 2ZZUT 4QJ4B 5KTEL 4AM0A 5B7EA 1F86A 3DSNA 1EEYB 3OC5A 5J11B 3MLXH 4JE4B 1BWMA 1FN4A 5AAWA 2NX5A 3NP4A 1JWSA 3G6JF 1IZJA 2Y5TB 5HYJB 1V54B 2AGJL 4MJIA 1SJVA 2WXLA 1QEWA 4ANXA 5H2BA 1NGPH 5DEGB 1JPST 1OPGL 4S1DC 1P6WA 1T20A 1JG9A 4XXCC 1LLAA 1LO2H 4Y9CA 4YHLH 1MVFA 3VUAA 1LNUB 3OJVC 4F2MA 3GNMH 3IFPB 4W6XB 4Q89A 2FB4H 2YGQA 5DA0B 3VFTB 2VWEC 5LHDA 1QR1A 5IQNA 4LARH 1E43A 5EU3B 3FMGH 4L4JA 2WCGA 1WQVT 5DD3L 4WSJA 3DUUB 1D9KA 1S5HA 1VADA 3SDCA 5J9PB 1TQCC 3TURA 3GMMB 3EIFA 5JIHA 1N18A 3WFHB 2LLNA 1SHXA 2JIXD 4GBXC 2ATAA 3OLEA 5BQDA 2GABA 4EBQL 4W6YB 1A3QA 1FAIH 1J18A 4G8EB 4DKEL 5E03A 3U0TB 4GUQA 3NCYS 5K39B 2LAAA 5HTSA 2Y36L 3KPRB 3SD2A 4ZO7A 3BIKB 3LD8B 5C0BD 4JUTA 5KVFL 3RX9A 1MG3C 2OK0L 2YJLA 1FI8C 1UGKA 4NO0A 4FQ2L 2KPNA 1NINA 4YHOH 2G5RA 3AS2A 2NNCA 1INEL 3UTQA 3LNDA 1HEJC 4P2CG 4QXGH 4U49A 1CLOH 3BMVA 5DHMC 3EJRA 4N90D 1YDPA 1FH5H 2G5BB 4K9EH 3DUHA 1ZTXH 3BZEA 2UY7A 1CDGA 1JK8A 2OTPA 4RAVA 2ARWA 4KXZH 4O2EA 1HOEA 4Z78A 3VD0A 2HLFD 3UBFA 2ZQKA 2R1XB 4L9LA 3ES6A 1DVYA 1Q0EA 5EN2B 3F2LA 3EFDL 3TV3H 2ZYIA 4X6DF 3UL4A 1KB9K 1RLWA 4HZ1A 1SY6H 3WIIH 3GSRA 4YDKH 5C0FA 3FN9A 4IS6B 3RVXD 4HC1H 5CMAB 2VSCA 2Q8BH 5INDB 1TYRA 3TVMD 3T0EA 1CF8L 2QQLL 4M56A 5A16A 5FW6A 4TVPD 2H0EA 3U30B 3EGSA 3IJ8A 2D7NA 3LNHA 5D2NE 1SN5A 2P9RA 3DKHA 2NXZB 4QF1B 2IIJA 1L7IL 5KOVC 2BMKA 4PJCB 1T21B 2ZF9A 1BOGA 1QMUA 2EH7L 4XOAA 5F3BA 3TF4A 3WN5A 4E42A 2GFBB 2XWBA 4YSRA 2GCYB 4NJAH 1NFDB 1PQZB 3CE1A 1IGCL 3OHXC 5MERA 4H26B 3FSAA 4U1KA 2Q86B 4UTBL 5E6IB 2WNGA 5JQHC 3VWJA 4Z18A 4YFLI 1Q8MA 4PTUB 5J0BA 1BQ5A 4LXFA 2EYSA 2YEZB 4N1CA 3NYKA 2IDUA 1AAJA 2XWTA 2A73A 4OV5A 4DUVA 4ZUWB 3FT1A 1N68A 2DL9A 2X70B 2J8OA 1AO7B 3LNIA 4H0LC 3L81A 5DK0A 1SMOA 3V0VA 3K6OA 1AQ8A 5BOZG 4W9LC 1B4TA 3AITA 4QDGA 2X6MA 4XBEH 2FUTA 1II4E 4WVRA 5DEJA 2JCCA 4Y2NA 4J3XA 2HLAA 3FC8A 1SPDA 3QPKA 3B9KD 2J3SA 3UBXG 4MNQB 3L16A 2X4NA 3CFBA 3U9UB 2AJ3A 3X1FA 3HB3D 1CD8A 1W0VB 2NZ1A 3E8UH 1QWUA 2V17H 2WLLA 3U6XS 1A6UH 1W16A 4BZ2H 2F8IA 3GDCA 4FOMA 3MFGB 4MQXD 5LXGH 3MV7A 5FS5A 4APXA 3SPVA 3L9BA 5A2KH 2XWJB 1N3NA 4FQQB 2GSIB 3FCBA 5ESQB 3UC0H 2F54A 4F58L 4Y5VA 4JLRA 3GO1H 1CR9H 3RVXC 2OMZA 3L3HB 4R7NA 1ORQA 5TK2A 1ZLWH 4R97B 1OANA 4GKZA 5DRNA 3WSQL 1XGUA 5AVXB 1OARH 3BN3B 3IMRA 3LN4A 4HIJB 1DO6A 5ADOL 4ZPTB 4AE1A 4K4KA 5J6HB