5LGKA

Crystal structure of the human ige-fc bound to its b cell receptor dercd23
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
307
structure length
307
Chain Sequence
VKILQSSCDGGGHFPPTIQLCLVSGYTPGTIQITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title IgE binds asymmetrically to its B cell receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig epsilon chain C region
total genus 41
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA03
2EDQA 1QLEH 4X4XA 4E0RB 1CU4L 2C1PB 1ONQB 3C5ZB 4U1LB 4UV4L 4IOIA 5DEFA 2E8YA 2N4IA 3FZUC 4X6FB 3VA2C 4BZ1H 1MRCH 4UZGA 4Y5YB 5JOPD 5J57B 4P48A 2FIKA 2H6PA 4ODVH 4AQOA 4PRAA 3RZWA 1BM3L 3G5XB 1C08A 3VFMB 4O2FB 5DUBA 5F9WC 2XI9A 4HV8B 1IEAB 1IM3A 2OTWB 2IAMC 1HHGA 1RULL 1JFQH 1VADA 3J7HA 1IILE 2CUIA 3O6ML 5FKAB 3KDMA 1WGOA 3DIFB 3O9WA 2X4OA 4BKLA 3AFLA 5C07E 1B0GB 2QADB 1G9NH 4O5LH 4G7VL 1J5OH 2FX8L 3MGOB 4K7FB 1NBYB 2YBRA 5IMLB 3KPSD 4AIOA 2LU3A 1ZGLM 4Q9RH 3OPZH 1NUDA 3MLUH 4PJ7A 4WW2B 3GMOB 4H0GA 2E7LC 3C5JA 3MRCB 3ARUA 4X7SH 2R69H 4MXWL 2IBGA 3KJ4C 5MI0C 3WDJA 4B41A 3EHBD 2PO6B 4HIIA 4DVRH 1MCWW 2X4TB 3U7YL 1WZ1L 3LEVL 4KU1A 3LEYL 5MENA 1MI5E 1UXWB 5LGHL 2P8LB 4FQ2H 4HGKC 4ZUWB 4QXTB 1NEZA 3G6JA 3HE6D 4N90D 3FQTA 4I9WD 4EN3A 4HIXH 1UWXH 2NY6C 5JPMA 1P4IH 5JXEA 1WZMA 3L3GA 2WBJB 3MLZL 4WO4A 4KVNL 1EXUA 4WHYH 1U8HB 3DSFH 3X13A 4O02L 4JKPL 5DA0B 3SJVE 1FZOB 5IK3A 3EYVA 1I9IL 5E2VH 1T1XA 3L3KB 5I0DA 3H2WA 1KLUA 4WO4C 1LO4L 2EECA 2H1PL 4MD0B 4GXVH 1BQLL 1XT5A 2VXVL 1E4XL 1P1ZB 4L1HA 1H15A 3QDJA 2VTFA 2CMRH 2NY5H 5BV7H 3GJFA 3S5LG 3HC0B 3HR6A 3PXJA 2FWOA 1A3RL 5JLZA 4HQQL 3VH8B 5HYJA 1M6OA 3MNVB 4Q2ZB 3NN8A 3DMMC 4U6HB 3RBSA 3G6JB 2UZYB 1KENL 5IHZA 1GAFL 1D5ZB 2GJZA 4UV7L 3L3OB 2IH3B 1WV7T 4M1GL 1N6UA 1YECL 3KPTA 3VFUB 4U0QB 5B8CB 3ULUE 2EIZA 35C8H 2OSLA 4EUPB 1D5IL 3TT3H 2EE6A 4HIIB 4MQSB 1FZOA 2Y72A 4XB8A 4RQQA 4JLRB 1BJ8A 2V7NB 4LPYA 2PKDA 4QYOB 1U58A 1T3FB 4MX7A 1P69B 4N8CL 2EC8A 3B9AA 3FTGA 3O6FD 2Y6SD 3D0LB 1WWCA 3QUXD 3ABZA 1CFBA 4GH7B 3QIBA 3LEYH 3QAZC 5C0BD 1T2QH 4X6DE 3GJEB 3WLWD 1RUPL 3R4DA 1JGUH 2YN5A 1M05A 2IG2H 3W9DA 5F71A 1UT9A 5KANI 2YD4A 1QEWB 1QLRA 4OCRH 3RAJL 4LFHG 4K7PY 2MQ0A 3UBXI 3QXUA 1OAZL 5DXWA 1G7JA 2I9LA 1MH5B 1P2CA 2OL3B 5IIEB 3Q5TA 2VQUA 3WLBB 2YA2A 2CRMA 4LU5L 3UBXG 12E8L 3EZ8A 3SE3C 2PTTA 4PG9B 4MD0A 3WNLA 4WUUD 4GBXB 3CDFA 1HOCA 4MA7L 2Y07L 5C0AD 1OPGL 2ZPKH 3CXHJ 5CKAA 2WUCL 1H3PL 1QSFD 3UC0L 4Z7UF 4R0LA 3N0PB 5IVNA 1EGJH 2HT4D 4IMLA 4PP2B 1CDBA 4OLWL 2EDKA 2VOTA 4OSUH 3U0WH 2A6KB 4ZMAT 4X6EB 3X11B 2PUQT 3MBXL 1R3HA 1CN4A 3RU8L 2P5WA 4HJGB 2WIIA 4M3KB 5I15H 1G7PA 1T1ZB 1NCBH 3DV6A 4N0RA 4PGCB 4TPRL 2A73B 4W68A 5IG7A 3O2WH 5I2IA 2YWZA 3HG1B 4NBXB 1CE6A 1YNKL 1A3LH 1TPXB 1NBYA 1YNLL 1ZXQA 2YBRB 3ZSTA 4PRNB 2X2YA 4JHAH 4K3HA 3WE6B 4R7DA 1R3LA 1ITCA 2CUMA 3RWIA 1KIQA 1ETZB 5A3IC 5JO5B 4FQCL 2VC2L 2A77H 3WNMA 4WW2F 7CGTA 5EZOH 2PO6A 4M1GH 3E1F1 5JIIA 4OZHE 1TFHA 1HDMB 3BKCH 3ARYA 1HKLH 4OIIL 4Y4FB 1FYHB 3ARQA 3ZHLA 1X5GA 3GIZL 1EA9C 4DAGL 3AMLA 1G7LA 5MEQA 4NQTA 3TNMB 2NW3A 1N0LA 1BBDH 3H42L 2GK0B 3VXQA 1RVFL 1F4YH 2J6EL 2DBLH 1IC5H 1V3MA 5D2LF 5CIPB 1TVHB 3VFSB 1U92A 2OTPA 4TUKL 1XR9B 2R4RH 4JM2D 2NY4B 2QADD 4YFEA 2CXKA 3MXVH 2BRRL 1G6RB 2HKHH 3T0VA 3UYRL 4Y2OA 2VLMD 3GSRA 4WVRA 3SGDH 1FNFA 4F15C 4WFGD 1YN7A 4WGVB 1MCRA 1KV3A 4K3JH 4Y4KA 1MSPA 5DWUH 3L7EB 1J12A 3MO1A 2MWCA 1IQWH 3KNBA 3F6LA 5EZIL 1RQ5A 4GAYB 2ADIA 1CFSB 2A6DA 3QNXA 5T1DL 3W0WB 4LLAA 2VZSA 1GGIH 3RU8H 3QFJB 4N8VB 2PTUA 1EAPA 4YDJB 3B9KD 1WISA 1KYOK 4YGAB 2Z31D 1KT2A 3ALXA 4OLWH 4MQTB 5IW3A 4U0RC 1F3DJ 2VDNL 3M8OL 4YPJA 5DJXA 2O26U 1TZHB 2AXGB 2G5BA 4KUCF 2F58L 3MXWH 1K5NB 4LSRH 5ANMA 4QKXB 2AK4E 1JK8B 3LQZB 5LAXA 3TV3L 4YEFA 2X4UB 3OGOE 1WLHA 4P2OC 3IAGC 1U8LB 1TPXC 3ZE0F 1XF5B 5IBLC 1DVFA 1P4BL 1K3IA 5E8OA 5IT2H 4MJIB 4PJCE 2BVQB 4P3DA 3S96A 2YUWA 4GAFB 1FYTD 4ORGB 2DTMH 4LP4A 1HKFA 1K4CA 5L2JB 4HLZG 4I13B 4JG1L 2JJTC 2GJ6A 4UDTA 3ZMRA 3GMLB 2GYSA 3TO2A 4N0CC 5GPRA 5JOPE 5AD0B 1HHKA 5C0CE 3Q5YA 1A6ZB 5B39A 5I1CL 3FL7A 5TGBA 3MRIB 2AXJA 4P9HH 4FQXD 3DVNB 3C5SB 1D9KC 4I4WA 4RGNB 5ACLA 1RK0A 3WO3B 3GNML 1S5HA 2XICA 2BOCA 1RUML 5HD8D 2EXYD 3SCMB 3OXSB 3SKMA 2LABA 2XNAA 3FMGL 5IJKC 2X4QA 1A6PA 3EW3B 4URTB 4YFDB 3VD7A 3TIEA 4YDVB 1MJ8L 3ECBB 2CUHA 1NLBL 4N8VA 3SDDB 2I9TB 1YEEL 4ZUSA 2G9HA 3UTSA 3N1MC 4XNUH 1CFNA 4BH7A 4MXQC 2NPLX 4Z95L 2IQAA 3P77B 4HGWB 3L3DB 1Q9WA 5FV1L 4GG6E 4S1DC 5IESL 1NGWB 1BBDL 1YC7A 1WBYB 3NVQA 3P4LA 3SDCD 3NCJL 5J8OA 3SBWC 3RJDA 3O45B 1FZKA 1I9EA 3ROOA 1DBAL 3JZ7A 3TGXA 5C0GB 1H0DA 1U8IB 1ORQA 4NQDB 1LO3H 3AC0A 5J0BA 1WZLA 4RA3A 4UTAL 4HCRA 3G5ZA 4XZUB 4K23H 2HMIC 4KVNH 2HN7A 4PJ9A 1CGYA 5TQ0L 2VUOA 3P30L 1CICC 3NPSB 4OZ4B 5EO0A 1R0AL 4U1SB 4JPKH 1P7QD 2F54D 3CVHA 1RUQH 3QHFL 3OKDB 4ODHH 2D7NA 3RGHA 4I18A 5C07A 3VXUE 2AJZB 4MQ7A 1GGCL 1KJ2B 4PB9H 1Q9KA 5FHBH 4HGWA 1O0VA 4KRNA 4I8DA 4H1LH 5JA8B 4IRJD 5FO9B 4FQXC 3L6FA 3VCLA 3DRQB 4IIQB 1Z3GL 2HA1A 4EDXA 3HS0B 2MCPL 2EYSA 3UZVB 2X4NB 1A3RH 2BNRA 1VACB 1V7NH 3GMPA 3ULSA 2E7LA 1ITBB 5K9OB 4DW2L 2AEQH 4L3EE 4OQTA 4R3SA 1MJ7H 4JG0L 5DJZA 4ZTPH 1WC7B 1MCOH 4IMKC 5T3ZL 5D70L 2NY6B 2VZOA 1IZKA 1AE6H 4P4KC 3O3BA 4LCWA 1EUTA 1URLA 3EYUH 4JE4B 5EC1B 4RWYL 3OF6D 1VENA 4PRPA 5DEGA 1YDPA 1QPPA 2FJHA 3VFOA 3T04D 2CK2A 2OK0L 1VSCA 2XA8L 3SE4C 4UILL 4LLUA 1GJIA 2X10A 4F3FA 1OGAA 3THMH 1DN0B 2OR7A 5LCVL 1Z9SA 4LLDA 3VJ6A 4WCYL 3CLEL 3PGFL 4UTBH 5TGBB 3OX8B 1TTFA 3I85A 4RISH 1G7JB 3EO9L 3FO9B 5L7XH 4OLXL 1WC7A 5SX4I 3OKNA 2K3TA 2OQJB 3QWRD 3ES6B 2QADC 4WTWA 5FYKU 3TZVA 2EH7H 2DD8L 4V1DA 1D5MA 5KN5B 2OXHA 2QQQA 5FOBA 4ALAL 1UVQA 4XP9L 2MHAB 2R2CA 4GRMA 1D5BB 2V5TA 2ICEB 4AL8L 3JV0A 1ND0B 2NMSA 4NNXA 2E3VA 3PGCA 4RNRB 1QG3A 3P30H 4OZIF 1I7TB 3M45A 3BE1H 4MZ2A 4OT1L 4BELD 2Z8WC 4X8XA 5E00A 4U6XB 4G8EA 1H5BC 3VXSE 4YHYC 3HMWL 2NY1B 4D0CA 5D9SB 5DQDL 4JFYA 1IC4H 1U8OA 4M6MH 1DN2A 4OD2A 3BQUC 3VFVB 4CDHA 1C5BL 2EKSA 2PR4H 4KWUA 3K7UA 4FQXB 1GGBL 1JRHH 1T2QL 1RZKL 1S7UA 4X6BB 3MMEB 3NABH 4LBEA 3OAYK 4KXZI 5DI8B 1JZ8A 1ACYL 3GBML 1IL1A 4D9LL 5ALBH 2X4TA 1KEGH 1OB1B 1HHHB 1NQBA 1D6VL 1NFDF 4PBVC 4ODVL 2ZCLH 3EO0A 3NGBC 4HS8L 4UIMA 2A77L 4EN3B 4PY7A 4TSBH 5HGHB 3AY4A 4PJCF 5EIQA 3BZDA 3P0YH 1E6JL 3BMVA 3QQ4A 2AK4B 3OR7A 4FMFA 2YUVA 4PJXF 1J0ZA 5FM8A 1NBZA 5BVPH 4AH2A 3S36L 5CP3A 2GSIB 4M8QA 4RGMC 1IC5L 4OZFA 4YHPB 4LCIH 4PRHB 1I8LC 2XWTB 5I1EH 4LCCC 1AXTH 1VFAB 4E9LA 3FRPG 4O4YH 5K9QI 2EEDA 2WP3T 4JDVB 1CBVH 1F6LL 2VLRD 3AVEA 3SGDI 4NQDD 2ZKHH 2EYTA 3BEWA 4TRPL 4UQ3A 3MFFB 5EO0B 2RR3A 4ZAKA 1MVUB 3F5WB 2WMPA 2ZSVB 4OUUA 2JB5L 1H5BA 3DBXA 5J6HB 2APVA 4UIMB 1IKFL 2OJEA 4ZYKA 3MJ6A 1A6ZA 3DIFA 3V7AG 3RVVC 1JGDA 1NGPH 1IAKA 4U6YA 4U4BA 3M17A 1VEPA 2Y06L 4WFHD 4PJEA 3M8OH 3EDKA 3MA9H 2VDOH 1C5DA 5EOCL 4ZUTB 5C7XL 3H9HB 1RJCA 4M6NH 3T09A 4QOKE 1T5WB 4R7NA 3BXNB 1SEQL 3HMXA 1FLRH 1T4KA 3FT4A 2HT3C 1YEHL 2CLVB 3LDBB 3CK0L 1A1NB 1FYTA 4FQLL 3O3EA 1Z0MA 3MJ9L 1QSVA 1IGCH 2AV7A 3E8UH 5CEZE 3I75B 3IFNL 1QRNE 2AI0L 5F7NC 4PJXB 2HH0H 4CNIB 3OPZL 3VGAC 3MLZH 2F54B 2VZ3A 4JY5H 1OCWH 3BPCB 4KKNA 2E7BA 2D2OA 15C8L 4YHYB 4Z76B 3LRGA 4YDJA 2C3GA 4CVWA 4ORGA 1NC4A 2ZCLL 4AL8H 4G8GE 1C16A 2DIAA 4EUPG 1YEDA 5FK9B 3O3UN 5C09A 4PTUA 4BYHA 4KZEL 5HYJB 5E4EC 4WO4D 1UFUA 3OXRB 2NLJB 4U0RB 2CPCA 1GGYA 3TFKC 4JPVL 5LAXB 1LO3L 2YRPA 4LKXA 1NSNL 3PNWB 3O4LD 1MAJA 3DX8B 2EO9A 1EERB 4FQXA 1LMKA 1YJDH 3N06B 1W8NA 2J8UE 5AUMB 4POZC 5EOQH 4P3DB 2BOCB 2MHAA 1RZKC 4I48A 4XRCB 3C60C 1MWAL 4L8SB 5F6HJ 4RMVA 3BP7A 2ATKA 2ZUXA 4P2QD 2IFFL 3A0OA 1L9MA 3GJFB 3VMOA 5ERWB 4R26H 2DMBA 1P53A 2FH8A 35C8L 3EJZD 3L3GB 4ZTOH 1Y18A 4JDZB 1B0WA 1KCUL 5K9QG 4G3YL 5EU3B 2DQUL 4OLZH 1RIVL 2FX9L 1F8TH 3V4UL 2B0SL 4C55A 3P0YL 5DJ8B 4JM2A 4JN1H 3HZVA 1MCPL 3D18B 5JOEA 1JZ2A 4R3SB 3MNWA 2X40A 4P5TA 2J8HA 3NZHH 5SWQB 1WCQA 1RZ7H 2NY7L 2V5MA 3CFIC 1JNLH 1IAIH 3D85A 5KJRL 1C12B 1TCMA 2A9MH 3ILPA 3I75A 5DT1H 4IRSB 1NCDL 4S1QL 4GXVL 3QDGA 1FFNA 5FYKL 3SKJH 4X6DF 5DEGB 4R2GC 2C4FT 1CDIA 1KCVH 2BVOA 3PL6B 4M7LT 1WZKA 1T21A 1AQKH 1HINH 4OGAC 1NC4B 1OP9A 4N1CA 3DXAA 3RTQB 2BFVH 3AS3A 3ZT6A 3HAEB 5CBAB 4OZHB 5BS0A 2RIKA 2BSED 2G2RB 4HPOH 3NOIA 3X3FH 1I8KA 2QSCL 3VWKD 4HXAL 1YEKL 3B9EA 5IF0B 3WS6A 3D9AH 4EI5B 2GITB 3F58L 4L4TD 4QHKJ 3TV3H 3V6ZB 1CE1H 4EKXA 4Z0BL 5E7BA 4NKQB 3VCLB 3VXMA 3RNKB 2C4XA 4X5LA 4ZOAA 4DQOH 3A67H 4U1NA 5J11B 3I3BA 1MAMH 3MLPA 2FZ3A 5D7LD 1J18A 4P5TD 4PJ9B 4ZAKB 5F6HI 2PTVA 2X4RA 2J7LA 5FOJA 5MP6H 4JRYB 3F7YB 2XPGA 1M7DB 4KKAD 1VFOA 1JJUA 1I1YA 1LE9B 4RIRB 5D7SL 3GBNH 4PGJA 1PG7X 1QEWA 5I76A 2ESVB 2DL2A 3DUUA 2H41A 3SOBH 1X7QB 1MRCL 1FVCB 1FZKB 1EIBA 3LH2L 3ROOB 4HIJA 2DDQL 4G9DA 1U8KA 1CR9H 2I24N 3LKRA 5KSBA 2AK4D 5BOPA 2RB8A 3O6KH 2B2XH 1F8TL 3V4UH 2BOBA 2F8OA 5IB1A 5J6GA 3RWEB 1FIGH 3HFML 4WUKL 1VFBB 3EJJX 3VXRA 4KHXH 2DAVA 4R7NB 2VAAA 1RJLA 1T2JA 3BHBA 4ZO6A 4WNQA 3GSOA 3MV7B 1J8HE 1GOGA 5F9JA 1VHPA 4ZXBB 5I8EB 3MV8A 4AIXA 3MOQA 3BUTA 1TNNA 5I1JH 4D3CH 3ZKXC 3RWHA 2DBLL 2XN9E 3FN0H 5GRXG 1FO0L 2L7JA 2ADGA 1R3KA 2NTSP 5C0AE 3U0TA 2XPGB 4NZDA 3WS6C 3RGVD 2FHFA 2FBJL 3DURA 1AR2A 4CMMB 1J8HA 5KVGL 5D7IA 4XP5L 1G6VK 5IHBA 4ORZC 2O5ZL 2F15A 2BSTA 4KROB 4QOKD 3BPOC 4XCYB 1R3IH 2DYPD 3ULVL 2VZTA 1K8DB 3TBSA 1T7ZA 1MNUL 1YEFH 1Y18B 2AEPL 3WUWG 3TO4B 3DVNA 5D6CB 1PYWB 2XKNA 3U46B 4CN1A 1CXHA 4C59B 2FECL 1R5VA 3TYFB 3QI9D 1S7RA 2X4QB 2ORBL 1T03L 5CD3A 3QUXB 5DVLA 1IQDA 4G5ZL 5EU5A 5FO8B 4X83A 1LQSR 3IU3A 4PJHE 4N1HB 2KKQA 5ACZB 4ZXBC 1RUAL 4KJYA 4YDLB 5I71C 5DJCA 2YPLD 5ERWA 5GS3A 3ZE1F 2Y7QB 2F8VA 3MRFA 1YYLH 4MCYA 2CKNA 2R2HB 3VI3F 1UA6H 5D6DA 3IDYB 3QJFB 2NZ9D 3WBDA 3QIWD 1C8PA 4EUPH 1HWGB 1P4BH 4MDIB 2YXFA 5HGBA 1A0QL 5GGTH 5C0AB 4PJFB 5IMMA 2JCCF 5EZOL 4M43H 3K4DA 3MV11 3I50H 3D5OF 5AAMA 2EDTA 3RWHB 3F58H 2XN9B 2VXSL 3M1BB 4TTDD 1SVCP 3B9KA 3DVGB 2BNQE 2FGZA 3MV7E 4XPFH 5L6YL 4MQ7B 1NGZA 4LPVA 5HD8C 3GNMH 5CCKL 4KMQA 2P44B 3LHPL 3SQOH 4Z78A 4ONOA 2PYFA 2YC1B 2JIXA 3KR3H 2LVEA 1RD6A 2G60L 4DEPB 2NY4C 3R0MA 1AJ7L 2BP3A 1U3YA 5C07D 5JW5B 1VACA 3HE7D 5D7JD 5C09E 3KS0J 5IB3A 1N5AA 4ZFZB 3RKPA 1YPZA 5TPWL 3BW9A 4NQSA 5FUCC 1S9KC 1SEBB 4PUBL 3KYMA 3MLXH 5T5NG 5K59F 1NGWA 2QQLL 3HUJF 4BQBA 1BQSA 2IPUK 3OKEB 1SY6H 5BRZD 3QXAB 3MX0A 3U0PB 4KVCL 5L8KB 4M1CC 3GSNH 5E5MA 4K2UL 2J8UA 2FECI 3MRJA 3VMPA 1HYSD 3MLWH 1CGSL 4V1DE 5HGAB 4M1CD 3IDXH 2I9TA 1F4HA 1QFHA 5FF6A 1FG9C 1YZZA 1XFPA 5DJ2B 4TNVK 1CK0H 4U33A 5EU4A 5C0RH 3BH8B 3IXTB 4ETQA 1ZHBB 4MAYC 2ZCKH 2XTLA 1YEIL 2D9QB 5B4MC 1SJVA 5CEXB 4U49A 1QO3B 1WBYA 3X14B 3RWEA 1CDJA 1TETL 1BWMA 1L7TH 5D2LE 1FGNL 4G42A 1NLDH 3WKNA 1JYWA 2BXZA 5DSCA 1ED3A 4X80L 3EFDH 4GOSA 4P5MA 3FRPA 2R2BA 2VDPL 5I8CA 2X4NA 3LKQA 1JNJA 2IH1A 4UT9H 1LK2A 5F1NA 3HNTH 1U3HA 5DTFB 4GBXC 4LHUG 4OLYH 3ARFC 4DW2H 3Q48A 3OAUL 5GSVA 5JDJA 4NQXA 3WFCL 4L4VE 3S7GA 2Y36H 1HINL 5TDNB 2IG2L 4MNHA 1DUZB 5TFSL 5HSFA 4R9HA 2V2XA 1MVFA 2DWEB 5DRZB 4ETQB 1ONQA 4KC3B 4FQIL 2VWEC 4AEFA 3R1GL 25C8H 2CGRH 5JW4M 2F5BH 3SDXF 2BHZA 2EKSB 4QTHB 3GIZH 5E6IB 3KPPB 3TO4D 2R69L 1JUFB 4L3CA 3OG6B 2J8UB 5BXFA 3O81A 2C3VB 4YE4H 4LU5H 2B0SH 1Q9OA 3INUH 3QQNA 2ZG2A 3WFEL 4YFLI 1DQLL 1K4DB 1UKSA 1UJ3C 1OP3H 2ZSWB 1JFQL 2EIDA 3B9KB 2XQYK 3VXSB 2CR6A 3P9MB 4IRSA 2I27N 2ZUTA 4P3WA 5C0FA 3N1PC 4X8JB 2DQCH 2AEQL 3PWVA 3BWAB 5D5MF 1A6TB 4JANB 2AJSL 4XPGL 5GS1C 3HR5B 3VFWA 1I8IA 4F7CA 4GRWE 2E7CA 1ZKAA 4EUPA 2G75A 2XZCL 2FRGP 5DJ8A 4EBQH 5HDOA 3QH3A 4P4RB 3UJTL 5HY9A 3VFRB 1I4FB 2K1MA 4HZAA 1K9TA 1CU4H 4XP4L 3ZKND 5GRVL 5F3BB 3QI9C 3KLHD 4HUKB 4JRYD 4BZ1L 4F9PC 3FFCB 3DVGA 2P5ED 1RUQL 4GAYA 4ODHL 2WUBL 2B4CL 2XZAL 3WCYA 1GXEA 2IAMA 5FA3A 5TDNA 1MRDL 3IU4L 5HVGB 1TENA 2VDPH 4LLUB 2NXYC 1B2WH 3BN3B 3NFNA 4LCCB 4LK4A 1MFBH 1V3KA 1OGAB 1BD2D 3DO7B 1K6QL 3GGWB 4YNYB 4YIQB 5F7WC 3NN8B 5C0ND 3QXVA 2ZUUA 5LGHH 3DRTA 4DGYL 5FUZH 1P84J 2WANA 3W5NA 3BP4B 3X13B 1MFCH 3GI9L 3MYZA 2HFTA 5C0RL 2OMBA 5C6TH 5HI4C 5F9OH 3U30C 3TH3T 5LGJA 2XTJC 2EDNA 4LLMA 5C7XH 3ARFB 3V9FA 2DLTA 2ZJSL 3A6BL 4YHLH 4YDIL 1QKZL 1ODAA 1VPOH 2N7AA 2AV1A 3LZFL 2VQ1B 4G6JH 1RHHB 3DSFL 3O6FC 5EZJA 5JMRA 4OT1H 2M1KA 4XAWH 1VFAA 5EUKA 3SO5A 3QWRA 4HIHA 3DJ9A 1D9KD 3F65A 4L8DB 5I8EA 5DTFA 4MB4A 3SY0A 4IM8A 1ZHKB 5IV2B 4N1EA 3RI5K 2OP4L 4RIRA 1U8NA 1DANU 1WUNT 3I02A 4G6MH 1M1SA 1RZJL 4X0KB 4XXCA 2OI9B 1YYLL 3D3VA 4PTUB 2AK4A 3ZDZF 4R7DB 1PG7W 3DYOA 3VXOA 1C16B 1Q1JH 2YD6A 4CVZA 4RFOH 5I73B 5SV4A 4FFVD 2XZCH 3BVNB 3W81A 1NCTA 4Y4HA 4MD4B 4UB0H 1OY3B 1MH5A 1IZJA 1Y0LA 3PP3K 3M17B 4ODTL 1JPFB 4L1DA 3PP3H 3MACL 3FJTA 4LLVA 3UPAA 2DKMA 2HJLA 2UWEF 1T03H 4M7ZB 1QNZL 2D0GA 4PJCB 1HZHL 2HG5A 1MCEA 1FZJA 1NKOA 5I66B 4JQVC 3MBED 5DRNB 1QYGH 1P6FA 4JQIH 5FCSH 1RSFA 1NMCC 3WFDH 3P4MB 1SBBA 2IQ9L 5T5NF 4KH2A 4NNPL 5IW1B 3HPLB 4Y5VA 1U8NB 3C6SB 4XPBL 3S3JA 2P5WB 4X5WB 4KGLA 3RAJH 2FX7L 2FBJH 5KVGH 4X7DC 4D94A 5MENE 4UUJA 4L29A 3VFTB 5HVWA 4KKAC 2R0LL 3C5ZA 4D3CL 5H94B 5CSBA 4YXKH 3RNQB 1PY9A 2WBJD 3C6LC 5I17B 2EDBA 2VQ1A 4MD4A 4L4VA 2DQJL 4E41A 5FM5O 1OARH 1HOCB 3UO1H 2EIBA 3H7LA 4M6OH 5CINL 4JREC 1N8ZB 3TYGH 3C6LD 3B8SA 3OKNB 5MERA 3HC4H 1CICA 2AEWA 2OS7A 2BVOB 4H5SA 4NN5B 1YMMB 3EFFB 1OGAE 5DJDA 3QEHB 5HTSA 1N7ML 5C1MB 1TZGH 1DZBA 2BK8A 3I02B 5F7LB 3FFCA 2OL3H 3D85D 4GQPH 1ZLVH 4HJGA 4WHCA 1HWHB 5C0EA 1U8QB 4JO1H 2DQHH 3CSPA 1ORSB 2UYLB 3O2WL 4F7MB 5HYSG 3U9PH 2BNUA 4PLJC 3SDCA 3QCTH 1I3GL 3I3DA 3QJFA 3PWLA 1AXSA 5BZWA 4PPTA 1KXQE 5BOZG 4GW5B 3G6DL 1U8LA 4OFKA 4PJGB 3UJIH 3C2SA 1GVIA 1ZT4A 4X7SL 4XNMA 5IQ7L 4DK3A 2MMXA 2XN9A 2VDQH 3ARVA 4QHNB 1MFAL 1CICB 1FQ9C 2E9BA 1A2YA 3S9DB 1MHPH 3BPCA 5DHYB 4CVUA 4XRCA 3PWUB 4KI5E 3IJHA 5E6YA 1L9NA 4LKCB 4NC0B 5TF0A 4KVCH 5T1MB 3C6LA 4GKNA 3REWA 4JQIL 3R06A 3BIKA 4MA3A 2AGJL 2VDLL 4BUHA 4I3GA 3RPKA 2ZCKL 5K9KA 1ZWIA 2HWZL 2Z92B 3B6SA 3IDMA 5F96L 4Z7WA 3HHRB 4K55A 1A3LL 1BD2E 2DM4A 1GZQA 1TQCB 3KXFD 5E8PA 3N85H 1QA9A 4FFWD 4S10A 1G7LB 2HFEB 4IOSD 4AM0A 5JXAH 1T7XA 5GS0C 3CPLB 4RBPH 3W0WE 1HH6A 5HI4D 5CZXC 1QOKA 3SN6N 4YBQC 5D1QA 1FJ1B 4LRIC 1LEKB 2YRLA 2VISB 2VABB 3C8KA 2NR6C 1GGUA 1UB5B 2NW2A 4K7PL 1IC1A 4LDOB 4M5YH 4UV4H 4CN4A 5GGUA 3CXDL 1UM4H 2OJEB 1G7IA 2WBWB 1EFXB 4LLYA 4M48H 4XCYA 1FVEA 1D9KB 3ARTA 5ITFB 4HW6A 1A9BB 3PWLB 1QBMH 5BZWB 3WIHL 4HFWB 4H88H 1F4WL 3VE0A 2JJVA 4NJAH 4PJEB 1A0QH 1GH7A 3NABL 2WZPD 1M71B 5T33L 4RFNB 2FJGA 4Y1AD 4EDXB 4OTXL 4XVSH 5HVFB 1AP2A 3ESUF 3P9WB 1DSFL 43C9A 4UUJB 4O9HL 3VFTA 4XB7A 5EO9B 4KDTA 1OWWA 4ZAKC 1KIQB 4OZFB 4YHPA 2E5EA 3D1MC 4E42B 1BBJB 5BW7C 3CCHA 3OMZA 4XPFL 1CLOL 4R0LB 2IH1B 1QACA 1QFWI 1SMOA 4UOJA 1BFVH 3ZKQD 3WJLC 4XAKD 4XTRC 3CC5A 3QXDB 3ARDA 4YBLB 1I8LA 1MY5A 2AQ3A 5I1DB 5MHSD 1GYAA 2H2SD 5KVDL 1XF3B 2HP4A 4HIEB 1FGVL 1FNSL 1TZGL 3KGRA 4C54A 4NM8L 1QLEL 1RMFH 3ULVF 1OAUL 2CKBL 2WIMA 4X6FA 4PRDB 2H9GA 3HS0A 4S1RL 4Y16A 1CZ8H 4MAYA 2AXFB 3F12A 4BSVB 3WIFB 4PBXA 1YPZF 4HBCL 4A6YA 4CJ1A 5DUBB 4J4PA 1DL7L 3VFGH 4CU6A 3I84A 1R3IL 4R2GB 1RJLB 4MYWB 4QWWC 4U3XA 5D71L 1FORH 3MLRH 4XCCH 1XGQB 4DVRL 2AW2A 5KW9L 4U1HB 3VGGA 2D03L 4H25B 5JW4Q 3ZTJH 1NGZB 1QBAA 5IB5B 4QGTA 4XBPB 3A6OA 4HWBA 1RIHL 1A7PH 3V52H 4GG8B 5GS0D 2X09A 4X6EA 4P46B 2VITA 3BPLB 1KJ2H 2HVJA 5A16A 5JW3L 4J3TA 5D1ZA 4TVSa 4UDUA 3CNKA 2A6IA 5DMJB 1WBXB 1M71A 4CUCA 3HE6A 3IJYA 5KSBE 1XF2A 4NM4L 1HXMA 1IGJB 4JZJC 2VAJA 1A6UH 1CF8L 3V7AE 5JIKA 1OAYL 3S4SG 2VZUA 5CD5C 2ITDA 4DCQA 4GBXD 1WJ3A 4O02H 4PG9A 3VI4F 4HS6B 2P5EE 4JM2B 3VWJD 1FVDA 4QNPE 2RAMA 4AT6A 3C60B 1ZGLP 4BUGA 2ARJA 2ED7A 4JZJA 1HCFX 2XKSA 3NIDF 4P9HL 5HGGS 4V1DD 3FO1A 5DI8A 1DFBL 4P2RE 3MRLB 3D39B 4MJ6B 4JPWL 5SWZA 1OPGH 3VH8A 1E4WH 4P9HC 1C5CL 1G6RL 2LAAA 2KZ1B 5FHBL 1YMHA 1F13A 2Y7QA 3GSUB 1MFNA 3CJJA 3TO4A 5JW4N 1Q38A 2XXMB 3TH4T 1HYSC 1M4KA 5H2BA 1AGFB 3VFRA 3NAAH 1J0JA 4GG6B 5I1GL 3VXRE 4OM0L 5GGRB 2PETA 1F45A 1UENA 4LIQH 3OHXB 5D2LB 4P5TB 4PJ9D 3ZTNH 1RUPH 5JNYB 1EUUA 3LDBC 4KRMB 2VZ1A 5D2NC 3MJ9A 3L95A 5TDOB 2X1PA 1M6OB 4DOHB 3KPQB 4Z7WF 5FO9A 1IM9A 2FJHB 4P23A 4J1UB 4JRWA 3DUSB 5JQ6L 3CLFH 4QXTA 4X9FA 4G43A 5D5MA 1P5UA 4X7FC 5EBGA 2V2XB 1U3JA 3O8XD 1U8PB 2VQTA 1U3HC 4PGEB 3SE4A 5DJZB 1A22B 1S7VA 3GO1H 1I7UA 1H3XA 4OLVH 4XPTL 5GZOD 2AK1H 1K8IB 3MRQA 4P57A 1FFPB 5EWIH 1LWRA 4F37K 3CUPA 3QRGL 3BT2L 2XZQL 2WWMC 3WXWH 3STZA 5EN2B 1H0DB 1VFUA 2F8XC 1BVLA 1MCKA 4JFDD 3ARGA 2W9DH 2XV6B 4BH8B 1Z6JT 1LNUA 2G60H 3B5GA 5BS0E 4HH9A 5C0NC 1OW0C 4P46C 2NY2B 2GAZB 4OUUB 1HSAB 3DXAE 5SX5H 3DVFA 1NSNH 1E4XH 5GRJL 2CR3A 1F58H 3TBWB 1A6VL 3QPQC 3CMGA 2LTQC 5BV7L 3MPCA 3EO0B 3WNKA 1G7PB 1T1ZA 5IGXH 2NCMA 1A6WH 3A6CL 4KRPD 1EFXD 2WINB 1G7QA 2X4OB 4BKLB 2GITA 3H0TA 2OK0H 1I9JH 4HS3B 2JB6A 2CXGA 4ZNEE 4ZTOL 3QNYB 5HHMD 1NBQA 1XF4B 4MJID 3ZYIA 1RY7B 1T4KB 3FT4B 5DA4A 3FO2B 3QFJE 1MCJA 4Y1AB 5JORB 4Y4HD 1U3HD 2VDKH 5CJ8A 4PJDA 2I25N 4Y7MA 5M94B 3D3VD 3LQMA 1KTLA 2HLAA 3BP5B 1JWUB 1RZGA 5IM7A 5E95B 2W0FB 1I8KB 4CVXA 1MF2L 4O2CA 4GMSL 3K2MC 3I3EA 1EBPA 3MRGA 2VXTL 1N5YH 2IH3A 1W2KT 3BKMH 3PABA 4G80B 1R3LB 3ULUH 4RMRA 3QQ3B 4M1DL 5ETUA 4D0DA 4AEHH 3L3HB 4DVBA 5H37H 4YHKH 1A4KA 1CL7H 2NXZB 4FHBD 5EU3A 3TCLA 4WI5A 2VUYA 4LLMB 2J2ZA 3I6KA 5C0IB 3PV6A 1UJTA 3EJYC 1OB1A 1QFUL 1PY4A 5E2UH 1N6QL 2GSGB 4JVUA 3EZJB 1TJIL 2W92A 4YO0B 5DS8A 1N2RA 4C4KT 1GOHA 2ZJSH 2W1NA 2B1HL 3S35H 5ICXB 2R56H 1IQDB 1GAFH 1D5XA 1ZA3B 2J6EA 1B4RA 4O4YL 4V1DB 1KPRA 1HCVA 5CEYB 2A0LC 3BSZL 5EU6A 2ZKHL 4P2QA 5FHAH 1JPTH 4YWGL 2BVYA 3VGDA 1J7VR 1G0DA 4MLSA 4D8PB 3SDXB 2VLLB 4YHOH 1YYML 5GRJH 4NUJB 5JHDB 4U05A 1F4WH 4HKJA 3RVUC 1TZHA 2AXGA 3L3HA 4WEUD 3CFCL 1WIPA 4OZHF 1IGYA 3BMWA 3AREC 1OAXH 1UG9A 3NTCH 1T20A 4JN2B 4X7TA 1BECA 4WI8A 2XZAH 3QH3B 4UU9B 4G9FE 3HRPA 5ELIA 1X5YA 1Z2KA 1FIGL 4Y5XA 3V6OC 1RUKH 5L2KA 3BP5A 5CHNA 3G08B 4U7KA 4WWKB 5A2LH 4EOWL 1NAKH 5F9WB 5L88H 3V2AR 1BOGB 4BQ6A 4LEXL 1FNHA 2HTKC 4JVWA 4LLQA 3HPLA 3GMQA 3GM8A 2BHUA 2GK0A 3VXQB 1J11A 1O7VA 4DKAA 1AQDA 3LV3B 4JJ5B 5TE6L 1E0OB 1BD2A 4ZUTA 4G8FB 2XWJB 4CAGA 2G75B 2ITDB 4DCQB 1KBGL 5MEPA 3N9GL 3CSYB 4Z7WE 2ZG1A 5F7DB 3EYVB 1CLYL 1S7RB 5DO2D 1U8MA 3HZKB 4R2GD 3IGAB 5I17A 4WU5A 4L8CA 2GSGA 3O8XB 3FT2B 1IGYB 1CT8A 5FYKE 2H9GB 3GMNB 2X4PA 1X6LA 3MA7B 1LO2L 1H15B 1FAIH 4MAUL 1P9MC 4XVJH 3KJ6L 1NC2B 4DGVH 3TN0C 4EQ2A 1WTLA 4LVHB 4XNQA 4PJHB 3QWOA 4C83A 3BGMB 4Z5RA 3O6FA 4HUWA 4ZYKB 3OAYH 1E6OL 4UB0L 1TVBB 3B43A 2VXUL 1XR8A 2X7LB 4OD3L 4S2SB 4W4OC 3MRDB 3U48A 4MAYD 5IW1A 1K8DA 3TBSB 5GXBB 5CEXA 4HSQA 3TIDB 1P7KB 3DVIA 1WK0A 1CDHA 2NY7H 3VXTB 1RFDH 1QSZA 1IAIL 2F53A 1P4LB 4H1LA 4PRHD 1UWGH 1FFOA 1MQ8A 3IB4A 3KPMA 4PJBA 3IRZA 3D39D 4KQ3H 4OFDA 1F4XL 3RNKA 3KPQA 2HRLA 4PJCA 4GXUN 2ICWA 2VE6B 1QSFA 3GZKA 4C56E 3V0AC 1ZHKA 4JM4L 3HAEG 1C7TA 3X11A 4RGNC 4LOUD 1PQZA 5L2JA 4NO3B 2VZVA 5D1XB 5T1KB 5EU6D 3CSYA 3BGMA 1AC0A 4YBQD 1ZS8B 3DETD 1FYTE 5FGSA 3T4YB 4DUVA 5SWZE 3NCMA 3VXUB 1IGFL 2DIBA 4FZEH 1LEIB 4OFIA 4Z7WB 4QRUA 4S2SA 3D25B 2WLZA 3LKRB 4U3CA 4M6ML 5FECA 5KSBB 5DJ6B 1AGBA 2D31B 1OD9A 4I5BA 2PCPB 4L5FL 5FEBA 5HY9B 4F7EB 4JFED 5IWLC 1GCFA 1SY6L 5IMMB 4CADA 3HCVA 1IFHH 1FJ1A 5FYJH 3RVTC 4EI6B 4W81A 2GEEA 2ARWA 2VDRL 3N1QC 1KCSL 3PNWA 2HH0L 2Q7YB 3QUMB 1XF1A 5CMAA 1IT9H 5L0QC 2OR9H 2ADJB 2NR6D 5K9JH 4IHOB 5GGUB 1YQ2A 2ADIB 1KCLA 2X1OA 1E28B 1ZT7B 2ICWJ 2MCPH 4KK6D 3FO0L 2XTJB 4M6OL 3S6CA 3IJHB 3OKKA 2ADFL 4XWGL 5I1IL 4QXGH 4R6UA 3GFUA 3CLEH 4ONHA 4ZOBA 3N50A 2AQ1A 3MV9E 5MEPB 1UM6L 5HYJD 1BIIB 4XH2B 5EU6E 3HZVB 2FH6A 5GGRA 3ZDXE 4UU9A 5K33A 2DTML 5HHVH 4O9HH 4HK0A 4K94L 3T1WA 1CE1L 1ZT4B 3JV4A 3EAKA 1AIFA 2GJ6D 3QEQE 4YXHH 5GSRB 1OGAD 3HC3L 2A6DB 4KUCD 2IQ9H 3PJSA 4ISVA 4UT9L 3TN0D 1A9EB 1MIEH 4RZCA 1MAKA 2IFGA 3VXUA 3HG1D 2DQFB 3HI6H 3T0BA 2RBLA 3T0ED 2MQ3A 2B1AH 4LSSH 1WIUA 3MOBH 5I8KL 4PJDF 3MCKA 5A43C 3QDHA 4GRWH 1U8HA 1D5ZA 4JHZA 1V3LA 3RVWC 2X89D 4FQIH 3PV6B 4OZIB 4OFYA 5I9QB 4J3WA 5CSGA 5I1HH 1AKJB 4HDIB 1OSZA 1ZT1B 1MLCA 3O3EB 3PG2A 4OCXL 3RGVC 3EYFB 1CLCA 3GHEL 1IGIL 2Z35A 3TVMD 1YNTA 5F44A 3IFLL 4KUZL 5GGVL 4PJ8C 4YX2L 4BFIB 4P4KD 4CN6A 5D2NB 3WXWL 4YEEA 1XCQB 4M9PA 5E94A 3DYMA 2UUDK 5TJWK 3EYUL 1SBSL 2VITB 1UGNA 1R5IB 1IFHL 2L0DA 4XPTH 3S5LB 5IB2B 2GUOB 2NXZD 5DD0L 3L3JB 3Q6FA 5E4IA 3C6SA 1NFKA 3CFJA 4X6CE 1NBZB 2VN4A 1A3QA 3T8XA 4XP5H 3OWEA 4CGTA 4O51A 3JWDH 4YDIH 4NN7C 4GSDH 4ZUVB 1T2XA 2A2QT 5HYQB 4HS6A 1JPST 4EXPX 4TNVF 3TVMA 3VXOB 4EI5D 1GGBH 3QNYA 1IEBA 2VKWA 4KV5E 3SE9L 5HYJE 4XMPL 3MJ7A 1I7ZA 4U1NB 3CH1A 1HHJB 1LNUB 3MLTB 1VEOA 3JV6B 4YBHA 3WIFA 1S7XB 1CFTB 3EIFA 3KPLA 1U8IA 2IPKB 2VABA 1GC1L 2P5EA 2VE6A 5L2KE 1BQHB 1OAQH 1QFPA 3CFDB 2NX5D 4D0BA 5E2UL 1CIUA 2VXSH 2FDBP 3NACH 4U6VH 2H32H 1BFTA 2C26A 4PJGE 1I1CA 2FSEA 5KBNC 2YA0A 1IGCL 1T0NA 4WGWB 1SHMA 2YK1H 1Q9LB 5CLTA 1ADQA 1T3FA 2HJKA 1OSZB 4L3EA 4MZ3A 3JV5A 1N5YL 2AABH 1SM3L 4R26L 4KTYA 1DQDH 1FH5H 4Z7OE 3GUTB 2ZWLT 2ATPA 2VO5A 3FO0H 1FLRL 4TTGA 5GS0L 4JY6B 1ETZA 3ECBA 3MV8E 4F33B 5JR1H 3MLVH 4OZGF 3DBXB 1FAKT 1F4YL 4ZSOE 3HMXL 4OIIH 1GIGH 3TBYA 4XNUL 1CLZL 3FZUD 3O2DL 1UEYA 1PX4A 4HWZA 2J8OA 1J0HA 1P2CB 1FPTL 4PGCA 1NGPL 1YC8A 3T08A 4HHAA 5F93C 2BVEA 5CP7B 2R1XB 5EU4B 2NY0D 2Y06H 3RWJA 2BZDA 1IGML 2EXWC 2CK0H 3JVGA 3C8HA 4JHAL 4XGZB 1W72B 5I9QC 2CDGA 4JGUA 5TDPB 5T1LA 2DYPB 2BNUB 3LV3A 2P5WE 1NFDA 1PZ5B 4FQJH 5JZ7D 4NBZB 3QIUA 1A7PL 1IKNC 1EMTL 2BJML 5F89B 1EZVY 3MACH 4RFOL 2X4SA 5DMIL 1KJVB 1T6VN 2O5XL 3H9ZA 4P2RA 4GG6A 3JV4B 3V6OE 2PW1A 3FRUA 3OX8A 3QEHA 4LCYB 1RZ7L 4TSCH 1MF2H 5HHOB 4P2OD 1HSBA 4JM2F 2GY7B 3NACL 4ZFOL 4PJAF 4CMMA 2CDFB 3T0DA 1T22B 3OKYA 1OQXA 2BNRB 4QTIL 3ET9F 4OLYL 3KPOB 1I1AA 2JIXB 2YK1L 5IEKA 4PGDA 5JIHA 2FL5A 3RWGB 3TNNA 2W65A 3RZCA 5D7SH 2IPUG 5TQ2L 4HPOL 3QCVL 3QPXL 4X6DA 4K3EL 5AAWA 4R96A 4F8TA 5D1QC 4WWKA 5CINH 4N90E 4CBPA 4HC1A 4I48B 3U2SA 4LSPL 2RJMA 5FO8A 3FB7A 1MCNA 2H1PH 3CFKB 3TZVC 1KFAH 2VLKD 2Y25A 1A2YB 1GPOL 4QRTB 5AYUH 2LFGA 5EUOF 4NCDA 3V0WL 4G8IA 2J8UF 4P23D 5C08D 4FMKA 4O2CB 5HDLA 3IU4H 4HK3N 4MAUH 5EULV 1IT9L 1SJXA 1SMAA 1IEHA 3IAQA 4WW2C 4OM0H 4KDVA 2AJUH 1I3UA 2M2DA 4JRYA 4OIBA 2YKLH 3WFBH 2R1YA 4I9WE 4G7YL 1INEL 4M7LH 3BEVA 5IR1A 4PJGA 3WE6A 3SO3C 3H9HA 4YC2C 4ELMF 4Y2DB 3NTCL 1QRNB 4PRNA 5DGRA 4ZUVA 4HIXL 3BISA 2ARJQ 3QEUA 3RWDB 2FYYB 5GS1A 4TUOA 1LK3L 2RFXA 1I1FB 3BPOB 4UV7H 5F9AC 4OLUL 1NCDH 4S1QH 2JB6B 4I77L 1X5AA 4RMSA 2AV7B 2JKXA 4PRHA 2E27L 4M5ZH 4MVBC 4P5MB 3SDYL 1KCVL 1AGBB 5T3ZD 4PB0H 4LRIA 3MV7A 4PJHA 3GK8H 3QUZB 3K3QA 4PD4K 1M7DA 1F3JB 3U0WL 5DJDB 4IJ3C 4HEPG 5DJYA 3ZKXB 5I1AB 4HKBB 4AMKH 5DZNA 4LVNC 4WEBL 2BSSA 4PJEF 3N1GC 3SDAA 1KXTB 1KPVB 3WHE0 2AGJH 2VDLH 3DURB 3MOBL 4OI9A 1FPTH 3O2DA 2JK5B 2WINA 5DJAB 4HT1L 1JNHB 2XN9D 2FHCA 3QUML 3BUYB 1UYWH 1NL0H 1S8DA 2YZ8A 4C58B 2LV4A 4TULH 2AAVA 3OB0H 5E5RB 1ACZA 4JFPB 4HUUA 3CDGB 5BV7C 3S97C 2UY7A 4YHKL 3PF2A 2F9BT 4D9QD 4GRLB 4HAGA 5I1IH 5ESAB 3QIBB 3ISWA 3O41A 3VD5A 4UQ3B 1EFXA 3GJFK 3CC5B 5EPMB 4P3CL 4E5XB 3OJDA 4OSUL 1GL4B 4XBGA 4ODBD 5BV7B 3DX6B 1DR9A 3H3PL 1CD8A 1SYSB 3KS0H 5E1AA 1RK1B 3LS5H 3B9VA 5IB3B 1E4JA 5HPOA 3EOYG 5JOFB 1B2WL 5C0GA 4MDJA 2FX8H 2I60H 3WFHB 3H7BB 1IAMA 2QTEA 1RFDL 3RPIB 3PDGA 1F3RB 3MJ9H 2NZ9C 1BEYH 4GXUM 2A6JA 4LCWE 3W5MA 3QEGH 4WI9A 1JGUL 4WHTA 5F9OL 1ZHNB 5IJKA 3PL6C 3PWUA 6CGTA 1XIWC 5HHNB 3MV9A 2Z93A 5GGTA 1WVZA 3T77B 1H3PH 4ODXA 5JW4R 4JO3H 1OP5H 4XCNB 3MRLA 3RZCC 3IVKA 5BRZA 3MNVA 1IGFH 4Q2ZA 4MCYB 1JE6A 4XXCC 4WFFD 1ZVSB 4Y8DC 1NBVL 3WFDL 2A74B 3MQIA 2HJFB 4M4PA 4NUJA 5JHDA 4HBCH 3UZEA 3QUMH 1CWVA 3C60A 3QHTC 4JFDB 1QFUH 4HMEA 2YR3A 5ESVB 1WBZA 5ACZA 1L7IH 4Y4FA 2V17H 5GRYA 5SWQA 5TPWH 5D2LA 1D5XB 3QA3B 1YDPB 4ZTPL 3TZVB 1Z0NA 3FFCD 4ZFOA 3HMXH 3LCYA 5LWYL 3ROLB 2JELH 1KXVC 1A5FL 2FGWH 5BMFL 3ULUC 3IRPX 5CP7A 4GKOA 3VRIB 3H3PH 4FFZL 3BKYL 2HVKB 4JKKA 3VXSA 5BJTB 5LXGL 5FAAA 4JG1H 4D8PA 4PB0L 1S78C 2EEAA 3FT3A 3GSUA 2W0PA 3V5KB 1BZ9B 3U30B 2BSTB 3RPIA 1X4YA 4OBSA 3ZLQC 2Y36L 3ZDYE 4P0DA 5E6ID 5E6IA 3BH8A 2GI7A 1RIUL 3QIWA 4PJ7F 4U1GC 5KSVB 4XVJL 1NMAH 1YQVH 4FXKA 2CKBB 5EBMA 1P4IL 3TYFA 3MREA 1QHPA 3VFOB 1U93A 1H3UA 3FB5B 5E9DD 3L9RA 4HS8H 2ADGB 4W6WB 3ZE2F 4Y4KD 1T1WB 3EOBB 4LSRL 5EOQL 3W0WA 3AXLB 1D6VH 4WTZG 3QT2A 5D7KE 4G9FD 3O6MH 4Y4KC 4U1SA 1TZIA 3G5YB 3MBEB 4JR9H 1T80A 1CD9B 5DC4B 4F9PA 1EX0A 2EZ0D 1MFDH 2ZG3A 4M62L 3MFFA 4PRIB 5DFVC 1C1EL 5JTWA 4XMPH 3MROB 3LN9A 3DV6B 5IG7B 5C0JB 5ITBH 3MRRB 1CT8B 3DRQA 5DWUL 4GAJL 3L1OH 1X7QA 4JO1L 4Y4HB 2XIDA 1HHJA 3JXAA 2J88H 4XXDA 4XPHH 2Y23A 2GSIA 3CU1A 1RUKL 1MY7A 5F7MC 5J3HD 5CJXC 3ARGD 5ABDE 3AB0C 1A7OH 1JPSL 1BAFH 1JPGA 3G9VA 5GSVB 5GGQL 4NOBA 4LQFL 3OJ2C 1H3TA 5C9KA 2BMKA 3QUZD 4KMLB 1GIGL 3W0WD 2QHRL 5HBBA 3FKUS 4PJ5E 5J9PB 4QOKA 1KCRH 3S88H 3L3IB 3WHXB 4TQEL 1HSBB 5KSVA 1XGPA 1JWSA 2P5WD 4Z95H 4F37F 4J12A 1CG9A 4LPUA 5HYSA 1IM9D 2BVQA 1MLCB 5GISL 4AJ0A 4IRSD 3S4SA 3WNOA 4X4ZA 3W39A 3MLXL 4GG6F 3PHQA 1VESA 4KY1H 1G84A 2OR9L 1EGJA 1XIWD 3LMJL 3TO2B 1MCOL 3E6HB 3PL6D 1I4FA 1Z9LA 1OLLA 3WSQL 3WIHA 1ND0A 3RWFB 2Y4SA 4AIZA 5DK3A 3T77A 3S98A 2R8SL 3GMMA 4I4WB 3GDBA 3HI5H 4Q58C 1FNGA 1QQDA 4U6HA 3PWNA 1T89C 1ZT7A 4RZCB 3WDHA 3VI4E 4NZUL 3MRFB 3C09C 3SDXA 2BNRE 2DTSA 3RWGA 5F7UA 3KLSA 2OP4H 3UTSE 5HYIA 3KYKH 2KZWA 3C9NB 5C09B 5HYSB 3PHSA 2CIKB 3MYJB 5EBLB 4APQA 5DJ0A 3IJSB 4K8RL 4H88L 1CYGA 3MUZ1 2GCYB 2VDOL 3MTRA 4ZS7H 3UPRA 3QQ9D 4JN2A 4X7TB 2JE8A 3EFDL 4TULL 3T4AA 4OF7A 2H32B 3ZE2E 4HC1L 5HI5C 4JFHD 5EU5B 3QYCA 5KVMC 5ICXA 2XRAH 4PBWD 4PJ8B 3QG7H 4GMTH 1WEJH 4LL9A 3CX2A 4LF3A 1PX3A 3BESR 1KCKA 3RY5A 5JW3H 2YD5A 2NY3C 1UM6H 3MRPB 3BIAX 3GMMB 3BIKB 4IRZH 4MA3B 2W65B 1HXMB 1IGJA 3FONB 1UH2A 3WFHA 3FQRB 4IRJA 4K7FA 2KUTA 2VLJD 3GSNA 4O00A 7FABH 2DKUA 5K9OA 1S78D 1N2RB 1XZ0A 5DD0H 4HGMA 2OCFD 9CGTA 1DQJA 4GFTB 5L88L 1FNEA 1EO8L 3P4NB 4GQ9H 5DJAA 1FZMB 4NZTL 1OW0A 4P46A 4BZ2L 2YS4A 4MA1C 2DD8H 3BI9X 1QD0A 4YDKH 3TBYB 1K4DA 4U2YA 3RX7A 4KK6C 2P8LA 5IUSA 1FRGH 3EYQD 4I3RH 2CLZB 1EEQA 4UAOB 5IMLA 1CD0A 4RGOH 3FQWA 1E4KC 5BZDB 3VFNA 1DJSA 2GUOA 3G04A 3ILQD 4RDQF 2VKXA 1SYSA 4R97C 1EEZA 2HT3D 4I0KA 2Y5TA 1QSEE 3QXWA 4LQ1A 4Y16B 3D25A 3RZCD 4MJ5B 2RQ8A 4TSAL 4MA8H 4UNVA 4GRWB 4DAGH 1T7YA 4NFBA 2GY5A 4JO4H 2RHEA 3SGJC 3MJ7B 4UT6H 3Q5OA 5D7LE 1AHWB 2Q86B 3UC0H 3ZTNL 3VXTA 3ARRA 2LAGB 5CGYD 1J87A 4XZUA 2Q20A 3QXDA 3MRKB 3HUJB 4J7RA 2DMKA 3ARGB 4J23A 3B83A 3V6BR 5E2JA 3C8KB 2WIIB 3QWOB 2FO4B 4C83B 4H26A 2BMKB 3PIQA 2VDQL 5FF6B 5GS2D 4JZOA 1EEUA 4K71C 5ENWB 1A7NL 4ALAH 5IF0A 1BIHA 1CXFA 5JUEH 1G7MA 1ULVA 4TN9A 2R0KL 3EO1A 2NYYC 5HYQA 3MXVL 2VYRE 1MJJA 2UY6A 3VA6A 2NX5E 4PLJD 3VXMB 4U7SA 1VFMA 3NZ8B 2BVTA 5DRNA 1MWAB 1TIUA 3DYPA 1IM9B 5IVZB 3VWJB 4Z0BH 3U9UA 3CFKA 4IDLA 2COQA 5GIRA 5E5UB 4QRTA 3BJ91 4D0CB 4LHJB 3RUGA 1A9BA 3QI9A 2YRZA 3JWDC 3K8LA 3UYOD 2AEPH 2R4RL 1CF8H 5ISZA 4JJHA 4UQ2A 5DVMA 1KTDB 4NPYA 3GSWA 1N5AB 1F58L 2IANE 3OR6B 1J10A 2A74A 1AKJD 2EXWD 2WP3O 4PYHA 5A2FA 3IXAB 3TM6A 3O9WC 1CXIA 3HZKA 1XAUA 3EDJA 4EJ1C 4PJIE 2G5BB 1HH9A 4XI5D 4PGDB 4JFFA 1PKQA 3WMSA 5E08L 5E1HB 2YA1A 4MNGA 8FABA 3MUY1 4L4VD 1KB9J 2H32A 5KAQF 1B4JL 1DVFC 1CXLA 1KNOA 3IDNB 3B9DA 1BQUA 4R96B 3G5VB 1X9QA 2E9IA 1IAOA 1S9YA 3UJJL 5E7FA 5BVPL 2BY1A 1QYGL 1RZIA 2PYEE 1FSKB 1YECH 2DWEA 1GGCH 1LEIA 5LKNA 3BQUD 5BO1H 1V5JA 1ZA3A 3RP1A 1DBBH 1IGTB 3X12B 2EEBA 1IARB 2C9AA 2CDGB 1JWSB 4A6YL 1AXSB 4P9ML 4F7CB 2OR8A 4UTAH 1DBML 5GJSH 3VG0L 1PVHA 5A2IH 4BFGA 3KPPA 5BXFB 1MFDL 4QF1A 1T1XB 1BWWA 5D7KD 3W39B 1EGJL 5IB4B 3HE7A 4AZ8A 1YY8A 2FR4B 4DGIL 1WIOA 2IGFH 4U31A 2F53B 4WI3A 1UJ3A 3ARED 1YA5A 4W6YB 3FFDB 1JVKA 4ZSOB 5EPMA 1DBJH 1YMMA 2UVEA 2XFXA 3EFFA 4XBEH 1MRDH 2C4FU 2XXCB 1KULA 3P73B 4NJAL 1GOFA 5LQBH 5FA4B 3CXDH 1UEMA 1C5DB 3LQAL 5M7QA 4FZ8H 5CZVH 1PJ9A 1PQZB 3EJYD 2A0LD 3GRWH 4IEFB 4OCRL 1E4WL 1S7QA 4UT7L 3G04B 4H26B 5H94A 3ZKMC 1XMWA 2YPKB 4NHUB 1MEXL 1MI5B 3ZDZE 4WEBH 4KRPB 1Z9MA 5GGVH 3REVB 5D8JH 5DYOA 1KELL 1MHHA 3H3BC 4MWFA 2DQDH 5KJRH 3EO9H 4QCIB 1QO3A 5FYJU 3OJMB 4ELMB 4PS4L 3GMNA 1NCAH 4AEIL 5IMOA 5BMFH 3HCVB 1U2HA 1W0VB 1NEZG 2VLRB 3VXSD 1T7WA 3ZT7A 3SJVA 1CFTA 3KPLB 4L8DA 5DD5H 4OZGA 3LMJH 4XBPA 2V2WB 4ZUUB 3CIQA 5EUOB 3P11L 3GSNB 2BSSB 4O5LL 2XG4A 1OD7A 1DEEB 3HAEA 5CBAA 4KPHH 5D9SA 4HWBL 2A73A 5CUSH 1HZHH 4CMHB 2X1QA 1JNNH 3BOVA 1L6ZA 1JV5A 2R9HD 2EDLA 1MCQA 2FIKB 2X4PB 1CFVL 1K2DB 1YJDC 2YEZB 4F58L 4JZNA 4XC1H 4ZODA 3WL9A 3AROA 3ILPB 3STZB 1RZKH 5E94B 5BQ7B 3O4OC 1KB5A 4F8QA 5HXMA 4LGSB 4XP1H 4GJTB 5KG9B 1MHCB 4N0CD 1MREL 1KB5L 3FQNB 1TMCB 1BEYL 1SYVB 1ZAGA 2V5RA 3RX5A 4JM4H 2EDXA 4PY7B 4OZHA 3D3VB 1U8PA 3QEGL 4O51B 4ODUB 3PJSB 5C0BB 2AABL 4OB5L 3C08H 3SDCC 3ZDXF 3B5TA 3NFSL 4P2QB 3WXVL 3LEXA 1FNGB 3LQZA 1KN4H 1MCLA 3V6ZA 4L9LA 1BFOB 4RA0C 1AR1C 1BX2B 3CFBA 3SGKA 3RVXD 5EA0L 4FXLA 3GBNL 3MMEA 4M8QB 4FXKB 3T0WA 4HEME 4MLIA 2FJGB 3QFDA 5E0QA 2DQJH 4WW1A 5C3TA 1TJHL 4JFFB 3NBNA 1I8IB 4EIGB 2LTQB 2DQDL 1ZV5A 4YO0A 5DS8B 2XT1B 3KLHC 5LG1A 5TE4L 2D7TL 5DMGC 5EO1B 5HHOD 4GAGL 5AWNH 5HGHA 1RIHH 3RKDC 3G5VA 2E6JA 2ZNXA 4DQOL 4OF3A 2VN7A 3OJVC 1BZ7A 1NCWL 1KEMH 2JIXD 1I85C 1REIA 5TDOA 1RU9H 3NFPA 2XYCA 1J0KA 1S9WA 1TLKA 4X6CF 3VD9A 2EH8H 5E8EA 3U1SL 3GBLA 1EAPB 1U6AL 5ID1B 5SWZD 1FRGL 4I3RL 4N0UB 4DZ8A 2Q87A 3QZWA 1KT2B 1X5HA 1X5XA 3NA4A 3WJLA 3I6LD 1UC6A 3ZHKA 3ZZ1A 2X4SB 2D4FA 4TUJB 5FYKH 3JBG7 4FFZH 2DRUA 4RAVA 3NGBB 2P1YA 1U36A 4P4KA 2ZSWA 3JSSA 4G8GD 2Z31C 4GUPB 2ENYA 1D5BA 3UXFA 3VGEA 4KQ4H 3B3IB 4R90H 2KBGA 4R4BA 4CKVX 1XGTA 4Y2DD 4WO4B 5IHZB 3DI3B 5ICZA 3BQUB 1Y6KR 3RVWD 4WV1A 4KTDL 1QP1A 2AJYL 5C08A 1KCUH 2NY1C 4G6FB 4NM4H 1FSKC 3X3GH 3T0EC 2F5AH 4KMTL 4N0UE 4BQCA 3ULVH 1JZ4A 3U0TB 3OKOB 4PLKD 5DVOA 2HLFC 4PJXA 1HQRA 3DGCR 3UBXB 5F1NB 3BYTA 4C56B 1XCTB 4JZNB 3CFDA 3WL9B 2L4OA 3GB7A 3O9WB 3MRKA 4FQ1H 5F3HA 1NGYB 4UIKH 1NCWH 1A6VH 1U3ZA 4HH8A 4ZAKD 4YHIA 3V6FA 1MFBL 2Z31B 2HT4C 4WDIA 1EV2E 2PO6C 4FRWA 5DJYB 3KJ4B 4WI4A 4GKSA 5EORL 1XR8B 4MVBD 1W0WA 1ZANH 4PJ5B 1G7MB 1U91A 2DQGH 4HS3A 3TBTB 3C08L 4GS7C 5EWIL 1OVZA 3CFJB 3P0VL 1T0MA 3D87B 3PQYD 5EFIA 4CRPA 1XGRB 4HX1A 1BLNA 1PSKH 2OJZL 4MAYB 5FO7B 2MPAH 43CAA 4Z77A 3PWPB 4G3YH 1NCUA 5CZKA 3ULVD 3U83A 1AD9B 3IFLH 3H8NA 1BFVL 3OKEA 4MHHI 3F5WA 3G5XA 1T1YB 1I3VA 2WV3A 3U4BL 1WAAA 4JR9L 5ICYB 2DI7A 4Z7VE 5IFHH 1DEDA 4NQVB 5J56B 4YXKL 1J05B 5CCKH 1MPAL 1P84K 2P42B 4NRYA 3EGSA 3KDMB 5IW6B 1MCHA 4B7IA 5I76B 3AUVA 1X44A 3U7WH 4OKVA 1Y0LB 4KHTH 4QRRD 3OKOA 3QHZH 3JTSA 1NAMH 2YPVH 2VRAA 2F53D 3WUWA 3MCLL 1N6QH 4BQ9A 4M93C 4QXWA 2DMCA 2LU4A 4LPXA 3S96B 4OCLC 3PL6A 5CEZD 5DURD 5FDYA 3SDDD 3MZGB 5F7KC 4KFZC 2X9XA 4CW1B 2VSDA 4BH8A 5JR1L 1JHLL 2V5SA 3UTQA 1OQOA 4WFED 1G6RH 5HHXH 2P43B 1RJYA 2EC9T 4KJWD 3FN0L 4Z8FH 4FQ2L 5C0DB 2VDNH 2MQCA 5ESQB 1L4IA 4Z76A 2EO1A 3ULUL 4NBYB 3HPJB 1S9WB 4W4NA 5IEKB 3RY6A 4JQXC 3O4OB 4WWID 5MP6L 1IGTA 1KC5H 2N7BA 2UYLA 3KWWA 3EYSH 3F62A 4PV8B 1MAML 4EDWL 3UTZA 5JZ7C 1QSED 3IETB 3UX9B 3OJDB 3TA3C 5IB4A 4ZNCD 3UAJC 3L5HA 4YPGB 4H5SB 5IBTH 1TETH 4TOYH 5CEZL 5F7HA 1QR1B 3MLSH 3E6FA 4ONGH 5AUMA 3RFZC 5F89A 1HHIB 4RCAA 1JGVL 1XIWA 3MV9B 3Q3GA 1OSPL 4NT6A 1CLYH 3UTTE 3E2HB 2D0HA 2FEDD 1ZVHA 2ZOLB 3T3PE 4MMXC 4MNQA 2FO4A 2VL4A 1ZGLB 2OM5A 4Z7VB 1HQ4B 1UWXK 2DQEL 4AEIH 3KLAA 4YXLH 3N9GH 1ED3B 3QJHA 2MKWA 4IS6B 4AYFA 5EU7E 4WNQB 2DWDA 4QRPD 4KRPC 5IOPB 5KVEH 4U6TA 3FOMB 5EA0H 1CI5A 2C1OA 4YHNB 3BD5A 1JI1A 4KTEL 1BIIA 4XH2A 1A8JH 1MOEA 1QRKA 4PLNC 4LIQE 4ZS7L 2RCSL 3RHWF 1OTUC 5DVKA 3Q6GL 1NCNA 1FZJB 1MNUH 1YEFL 4F7TB 3P0VH 5LGKA 3V4VL 5C0CD 1Q0XH 3F7VB 3TT3L 2NY6D 2B4CH 3RY6C 4PJAA 2R1XA 2R1WA 2DDQH 2MOVA 1JGDB 1OTTC 3P9MA 5CJOL 1MHPL 4PG2C 1EJOL 5EDXA 1GC1C 2X4RB 5CKGA 4XPAH 1KPVA 4XP1L 4U1IA 5ETUB 3WJJA 5CSZB 1TZIB 3F7QA 3FQNA 1PW3A 4JY4A 1DEEA 3GSXB 5EIIB 3DUUB 5KSAA 4O58H 4PP1C 1OT1A 3BUYA 4OQ1A 3PDDA 4U1LA 1BQLH 5JO5A 1T0MB 2GT9A 3EGSB 5IW6A 4P57B 2CK0L 3GM0A 1MCWM 1W0VA 3PQYB 5TF1H 3KJ6H 2RFXB 3R0NA 4LVOB 3QG7L 1ZEAH 4GMTL 12E8H 4HH9B 3D0LA 3BZ4A 1VGKA 2GW5A 2WNGA 1G7HB 4K7PH 3UTSB 4TVPL 5EG6C 1QKZH 1FVEB 4NWUH 4MHHG 1A7QH 4K94H 1EAJA 2OX5A 1RU9L 2VXQH 4I0PC 1CL7L 3LIZL 2QSQA 4U1MA 5ANME 2BVPB 2OTUB 3Q6FB 3DOSA 4PJFA 5HI3D 4JDTL 2GIYA 2AKRB 3K4ZA 3P0GB 1FH5L 5KTEH 3DHJA 2QSTA 3QEQB 2ZUQB 4LLWA 1G1CA 3MLYH 5KS9B 2KPNA 1TJGL 5JHLL 5E8NA 4Q9QH 3X14A 1ZLUH 2P7TB 1ZLUK 4IDJL 4XNMB 4MSWB 4PJ8D 4M3JA 4JFEA 4OB5H 3E2HC 3QZWG 1RZJC 2GK2A 3FN3A 4J1UA 3E8UL 4Y4HC 2O5ZH 3D0VB 3VGBA 3CDYA 1GSMA 3UAJD 2XWJA 4AMKL 1J0IA 4G6FD 4S0SD 4NT6B 2OLDA 4I2XA 4Q9BA 2CRIA 1MFEL 3NIDE 2HMID 1A9EA 4MJIE 1H8NA 1OGTB 2CLRA 3BWAA 5DFWH 3V8CA 5TH2B 5E08H 1BZ9A 4QNPF 1YEIH 4RDQG 3BRFA 5D6CA 5KOVC 4O58L 4ZG1A 2A9ML 4NO5A 4XPAL 3KLAB 4JFDA 3MOAH 4XPBH 5C6WH 4KKBD 5E9DE 4R0LC 5I1KL 1FORL 4XCCL 3QDAA 4X7EC 4LSQL 4LSVH 4NYLA 5TE7H 1NFIB 2J12B 5HDQL 2VERN 4DKFH 1LK3H 3FCTA 1BAFL 3WD5H 4LPCA 4L8SC 4XP9H 3LSOA 4RFNC 1VB9A 1ZHNA 5D1ZB 2BVPA 4JEGB 4KUZH 1J05A 4U6VL 2IALA 4AG4L 1AJ7H 4H0IA 4M93B 1QQDB 1NJ9A 1LO5A 5DRZA 3TH2T 1YMHB 1HIMH 1WICA 2OXGA 3S8WA 1AY1L 4MNQD 3SDAD 2UVFA 3JUYA 4XPGH 4M00A 2EIZB 4Y16C 3CDGA 5T1LB 5C0AA 3GKWH 2CRZA 3DO3A 5L0QB 3IAPA 4OCWH 2PR4L 2AJVH 1QRND 4I5BB 3QDMD 4HBQA 3FO1B 3QO0A 4GLRI 4KGJA 4Y88A 2B1HH 1CXEA 5BQ7A 1YY9D 1MLBB 3RVTD 4TSBL 1LE9A 3V7MA 3V5DB 1KTLB 3WFEH 1CGSH 3VG9B 3MLTA 4LMQE 1R24A 2W0LA 1LEGB 4XCEB 4QCIA 5L8JB 1YEEH 5CIPA 3QUMA 3TJHC 2BFVL 1OGTA 1AD9A 2CLRB 5FV2A 3GMOA 5JPNB 3BWUC 1G9NL 2PW2B 3H7BA 4N8VG 3HG1A 5I1AA 2KDGA 3TWCL 2VJXA 1XGUB 2H26A 5IJVA 4Q6IB 4DN3L 3FAWA 3IT8D 4WV1C 5FYLH 5DQ9B 4L9LC 4U1MB 3PHOB 5GJTL 2PCPA 3DETC 1FO0B 3LB6C 3MV8B 4PS4H 2GT9B 3DHMA 1TCRA 2B20A 4IMKA 2P8MB 3KYNB 4H25A 1AGEA 2AJXH 2M8XA 4GW1B 4I3SL 2EDEA 3GHBH 3RUGF 5FGCE 1D5IH 1GRWA 3IYLW 2Y1VA 3QUZA 2WUBH 4YHIB 3DNKA 4MD5B 2D7OA 2W9EL 3WD5L 5C0CB 1R24B 1R0AH 4HKBA 3OKMA 2FEEI 4K3GA 3AXLA 2F19H 2P24B 5IWLA 1YMMD 5FKAA 4KRLB 4FZ8L 1FC1A 1KTRL 5EZLB 3SDDA 3E3QC 1JGLL 1I1YB 3DV4B 1CLZH 4DOHE 5B38B 1M05B 3TBTA 3W9DB 1O7SA 5D7JC 4XP4H 4X5WA 3IKCB 3EUUA 4N0FB 5IEHB 1MFAH 2A1WL 4ODSL 1LD9B 1CQYA 4PJ7B 3SHSA 3C09B 3QEUB 4M7JH 1MPAH 2X9YA 5JXEC 3WLBA 3WYRA 1RK0B 1S5IL 3DGGA 3ARFA 4ZS6C 5J6GB 1XF4A 5HI5D 2OZ4A 1JI2A 4Y4FD 1DL7H 5FGBC 1ES0A 4JREB 4Y5VC 3HZYA 5BJTA 5CILH 4LSTL 2ATKB 3D2UA 1IGMH 3C6LB 1M7IA 2HJLB 4GKNB 5IVXF 3REWB 4Z5RB 3QIBD 5AD0A 5D2NA 3P3YA 1XGUA 4NRXB 5D93C 3L5IA 4DK6A 3B3IA 5EOTA 4PRIA 5HHNA 4FTVB 4QRPB 3RTQA 1SY6A 3AS0A 5DO2C 3EDFA 2YHGA 3X12A 1GHFL 3P4OB 1S7SA 4QXUH 4XHJD 2B7DT 3IS1X 5HI3C 4H8WC 3GJFH 4UQ2B 1LO5B 1NMBL 4X4ME 5DHVB 4M62H 5GS0H 2X4UA 2HJFA 2C1PA 3G6JE 2J3SA 3T4AB 1XZ0B 4UBDD 1Q9OB 2D9CA 4M7ZC 1OARL 3V5HB 5H35B 3O3AB 3CGTA 4OF0A 4S1SL 3QPXH 2PYFB 3K2UL 4AENA 2B1AL 1ZSDB 4J3XA 3E6HA 1JHKH 4YUEL 3QDJB 3QIUC 2J1KA 4HUVA 1IAOB 3NCBB 5E00B 1N64L 3H6JA 4NNPH 3BKCL 3WN5C 2I5YL 4PJFF 5B39B 2HVKA 4ELME 1QR4A 2D3VA 2ZP0T 3PWJB 2ESVD 4OCSH 4Y5YC 1F2XK 5HHQB 3CVIL 1F97A 3JWOL 4K94C 1FE8H 4KJPC 3QHZL 5ID1A 3F8UB 1J0YA 4OV5A 3MCKB 3U4EA 5EB9A 3SDCB 5I16B 5ESVA 3E6FB 2O5XH 3C9NA 3CAFA 1M7IB 3BDBA 4N9GB 3MRNB 3IDXL 1AQKL 5CS7A 4KQ4L 5KZCD 3CZJA 1JGEB 5FIEA 1VGEH 3EOAA 1AIFB 3ARSA 2XKUA 3L7EA 4F7PB 4KJYB 3QQ3A 2R2EB 5EU6B 3VD3A 1A4KB 3QULA 4NKOB 5INCB 1RZJH 4XCNA 2V2WA 2W07A 4MXVF 4F7MA 5I1LB 4NQED 4PJ7E 5DFVD 2DN7A 3AREA 3GMPB 4QRRE 4WY7H 2B5IB 1G7QB 3CFCH 3ZDYF 3GHEH 1YN6B 1L0XA 2FB4L 4QEGA 3MRRA 3CSBA 4NOFA 3LKQB 4YHOL 4KJQD 1YYMH 3A6BH 1O5DT 4IIQC 4R4ND 4YHLL 5F6IC 3KPRD 3LZFH 4LEOA 4I0CC 3I2CH 1FL5A 1LD9A 1IMHC 1MCSA 4NIKB 4GAGH 1B0RB 2NX5A 5AWNL 1IC4L 5I71B 1PLGH 1KFAL 4M7JL 2QHLA 1GPOH 3KYOB 4S1SH 3DMMD 1CK0L 1OSPH 1F00I 4LIQL 5C9JA 1MELA 3NPSC 3HI6L 5DT1L 1I75A 2APTA 4YHML 2IF7A 3D3VE 1NGYA 1IL1B 3D2UB 3FB8B 5IT2L 4JY4B 1YEGH 2XTJD 1JZ7A 3HFMH 4WUKH 3SE8L 4P46D 3QXTA 3UTTD 2C7UB 2YD3A 4GKSB 4D9QE 2GFBA 4MB5A 5GHWL 3O45A 4XPHL 4Y19D 4LHUA 3WN5B 2UV3A 4P59H 3X3FL 1UJ3B 4IOIB 4KROC 4FNLH 4JFXB 5IFAL 1FFPA 3VGFA 3MREB 4LAQL 4Z7QF 4N5ED 3U7YH 1R3JA 1YEHH 4Y1AE 1T1WA 3OL2A 1RJZB 3SKNB 4P3CH 4U1KA 4V2CB 5SX4H 3SCMA 2QQKH 3ZT5A 2EIEA 3S5LA 1VCAA 4QO1A 2AJSH 3LN4B 3NH7L 3QP3A 1F6AA 4NZRL 2J6EH 2R0WL 1BGXH 5DMKA 2V6HA 3SCMC 3QJHB 1DLFH 2UWEA 3QUYB 4IS6A 5GRUH 3T65B 3C5ZD 4K3DH 3EDEA 4MS8D 5I19H 4WJ5A 2D7QA 1BPVA 1QLRB 5TH2A 4P2YA 4JKPH 1AI1L 1T5XA 4RQQB 2ZUQC 3ARBA 5ILTL 4MQXC 3A6CH 2F54E 3SKMB 4DWHA 3ZO0A 1I1FA 2L7UA 5TDPA 4E41E 3V5HA 1N4XL 2J4WH 3LRSB 4NJ9L 5FGCB 1D5MB 2NQCA 1NFIA 3CXHK 4ONFH 1RPQA 2V7HB 3IETA 3BD4A 1RZIB 4JKWA 3SQBA 4KZDL 4QGYA 3GK8L 4HK0B 4KV5F 1RV6X 2YSSA 3DRTB 4LHQB 4MJ6A 5SWZB 3IVKB 1NEZB 5HJ3A 1LP9F 3I6LE 3RUGB 2GQHA 4OD1H 3TPKA 3BH9B 4I0PA 3HKFA 2FD6H 3WHXA 2Z8SA 4PRBB 5D7IF 5F7DA 1EHNA 1A6TA 4JANA 4K23L 2DYPA 3IF1A 2OJZH 1PSKL 4APQB 4P59L 1I85A 4J6RH 1RMFL 4OJFL 3VXNB 4JPKL 5DK0A 4HCRH 5IVZA 3VWJA 4CW1A 1JZ3A 4NKIL 4JHWL 5IVXB 1I3RB 4F57H 4ZDHB 3CH8A 3KR3L 1WTGT 1YJDL 3AAZA 1KB5H 3WIIL 5E56A 4JFQA 6FABL 3V79C 3E3QE 4PLKC 1MJUL 1X4ZA 4JM2C 5T33H 4G80A 2YMXH 2IPTH 1MCDA 3QDJD 1DSFH 4YAQA 3R8QA 5GGQH 2FBOJ 3C60D 1TVHA 4FFYL 2BY0A 4HUNB 4HXAH 3AS2A 1NANH 4PJDE 5FYLE 1RIUH 5TQ2H 4NQCA 4P2RB 3GSNL 4MWFB 4YX2H 2PXYD 5F1SA 1FL5B 4KJWC 3U36B 5FCUH 3T3ME 2EYTB 3BEWB 1YN7B 3V95A 3VG9C 2JTDA 4R4FH 4HPYH 3D0VA 3BKYH 1A47A 4JQVA 4KZDH 5E1AB 4OLXH 1DLHB 5EUKB 3GRWA 1C1EH 3G9AB 1U92B 1FFQA 5IVOA 3K46A 3I6KB 1JTOA 5HGDB 5F6IB 1TITA 4POUB 1FBIH 5ISZD 1J1PL 3GI8L 3MROA 5GGVY 5C0BA 4IRZL 1ZLSH 3G6JF 5IOPA 2PNDA 3BSZH 2A83B 4L4TA 3DXAB 3HE7C 5D5MB 3GSQA 5DMKB 4NQEB 4QHMB 3BZEB 3S34L 3MUJA 4WHYG 1P6AB 1AH1A 4JAMA 2DLIA 4QRSA 4NQCB 3L3IA 4K3DL 4NQSB 3O0RL 5BS0D 5I19L 5D1ZC 1CDCA 2EDOA 3DSNA 5DEFB 4PTTB 4NQDA 5FYLD 3VD4A 3CCHB 1XGRA 4HX1B 4Y19A 1AI1H 3NAAL 1Q72L 1UWEL 1OF2A 1YPZE 4RSVA 4TRPH 1KJ3H 1DBJL 4FQQB 1UKQA 3TO4C 1BJMA 4JDTH 3FONA 5FKPB 2IGFL 1X5ZA 1NDMB 5H2BB 2XY1A 4WTXA 4Y2DA 2QQNL 1DQDL 4HF5L 4FOMA 2HAZA 4LSDA 5FYLL 4J2XA 4N68A 2JCCE 2E9WA 4XXDB 3CZFB 4WU5B 2AP2A 4OZFH 5ANMB 1Q0YL 1T66D 3FOLB 3QUYD 3KWWB 4NNYA 4NZJA 5CP3H 3ZHDA 1HQRB 2PF6A 4N0UA 4DZ8B 2BNQA 3MODH 3QO0B 1UVQB 2NY2D 5AZEH 1CR9L 4A2MA 1NCCL 2XFXB 4LPTA 5DC9B 1UB6A 5GS2H 2I07B 4Q97A 2VLKB 4DZBA 5EBLA 1GC1H 2AVGA 1QLFA 4NO0A 3QO1A 5FYJL 4NO2B 3K81A 1N7MH 2VDRH 4ISVB 2PYEB 3CU7A 4OZGE 4PJHF 4N9GA 1WFNA 3MSPA 1P9MA 4ZUSB 5T3XH 1DTUA 3O8XA 1F11A 3GMRB 5I74B 4FQ1L 4WUUE 1ZHLA 4TQEH 2R9HC 1J1PH 3GI8H 3KLDA 1MHEB 3A67L 1JMZA 5D72H 3KG5A 3D18A 3OBAA 2BX5A 1ADQL 1GZQB 5DK2A 1NL0L 3ETBF 2CDFA 4FP8H 4NNYB 4RGOL 1BFOA 1S7WA 1UZ6E 1KYOJ 5DJ0B 4PJGF 5FECB 3RWCB 3UTPE 4WY7L 1ZT1A 2EDHA 4HWBH 4APQD 4O2EB 4WHDA 4M5YL 1FFNB 4LRNL 4OAWB 3UJJH 2MPAL 2VDMH 4NO0B 4XNXL 5I6XC 5MEQB 2YPLA 1SYVA 1KN2L 2SEBB 1CTNA 2H2PD 3IS0X 4KQ3L 4XVUC 5BRZE 3CLFL 4I2XB 3BDYL 1VGEL 4ZO9A 1WWAX 5E2TH 2CH8A 4FA8A 1WSST 4XGZA 5D7IE 3VXMD 1HNGA 1AGCB 4OF8A 4PRDA 2JK5A 3HE6C 1CCZA 1KIPA 1D6EB 1BX2A 3DUHA 3RTQC 1W0YT 1PFCA 4JVPA 2APFA 2FHBA 5C2BH 1CG9B 1S3KH 5DUPL 3AU1B 1MCPH 5ALCL 2DQIH 4L4TB 3V0VB 2VLJA 4IRSC 4HWEL 1A7BA 1BOYA 3BAEL 2XRAL 3EHBC 4MJ5A 2ZPKL 4CVXB 4DKFL 2XACC 2VL5A 5F3HB 2BERA 2VNCA 1JHKL 1KLFA 2DIJA 1BQHA 5HHOE 1INEH 1UZ8A 2BCKA 1KEML 1Q9KB 2VLRA 4AEHL 1R3JB 4QRUB 1UM4L 3CMOL 3Q2CA 3GKWL 3KPNA 1A6WL 4F80A 5JPNA 1EZVX 4JO4L 4K9EL 3G5YA 3MBEA 3F7PC 4U1IB 1B90A 4X99A 3MUGB 5ID0A 1CD1B 2X6MA 3MLRL 2EICA 3ZE1E 1K85A 3WNPA 4L4VB 4JFDE 4WV1B 4ACPA 3IDUA 3MRDA 1FZMA 2E27H 4N8PA 4KKCD 3PWPA 4AQ1B 4WUUA 3U7AA 4ELKB 3H9YA 1P5VA 1RUAH 2XTJE 4LGRB 4D9RD 1LK2B 1FLTX 4MXQD 4J6RL 4L8CB 1EH9A 3VXME 43C9B 5KSUA 3ORJA 3SGEI 4JB9H 3OKLA 3OXSA 3ZE0E 3MODL 4OFPA 4UILH 4NM8H 2VDML 4Z7QE 1NAKL 1IRAY 1VDGA 3DX7A 1CFQB 2BSRB 4PREA 2Q8AL 3TBWA 5GGSB 4MNHB 4OLZL 3HAEH 1OT2A 2DWDB 1T21B 1UCBL 3RGVA 3BKML 1D9KA 1T04B 5D1XA 3QEQD 5T1KA 3PGFH 4MS8C 3P77A 4UTBL 4TUKH 4EZMA 3VRLF 5CJ5A 3PHOA 4PP1D 2ZCHL 5HHVL 4OZIA 2Q76A 4OF6A 3VGAB 5KW9H 2AXHA 4M6NL 1PAMA 3FT2A 7FABL 4F7TA 3QDGE 5KVFL 2Q1EA 1U91B 4QRQA 2FEDC 1MCCA 2B8OT 2CQVA 2BC4B 1MHHB 3K8KA 3VXRD 4UOW0 5E8PB 1T89A 4Q9RL 5E8OB 3C2AH 1Q0XL 1WWWX 1JTTA 2BNQD 4LSSL 1RZ8B 3FHQA 3UP1A 4BH7B 2RCSH 4OJFH 1DQLH 1WCBB 4KROD 4XCFL 4HLZH 1NGXA 1D3CA 3O2DH 2GJ6B 2ZNWA 4UDTB 15C8H 2KL6A 2JJWA 4HUWB 3TPUA 3MNWB 4MNQB 2AQ2A 2X44D 1CDGA 5IQ9A 1UA6L 3DLQR 3LS4L 1WQVT 1KPUB 1KIUA 5DRWB 5IK3B 2Z93B 3L1OL 1U8OB 1EO7A 4HFWA 4HXBL 2OQJA 1S9VB 4X6DB 5BVJA 4HKZA 4HKJB 4CMHC 1DFBH 5F3BA 3PWJA 1I1AC 4X9HA 3MNZB 4KJPD 4RMQA 3PXHA 3VXNA 5JIPA 3ARBD 4Z6AT 2XOTA 3E0GA 2DM2A 4XNZC 4JFFD 1SM3H 2VISA 4BQ8A 1ZEAL 4RMWA 5H35A 4G5ZH 3IU3B 3OG4B 4G6AC 2GCYA 3O11B 1GHFH 3NCYS 4L3AA 5DD1H 1EHAA 3MLUL 3RWFA 2DBJA 5HJ3B 4NRZB 2R0ZL 4UDUB 3DXAD 3GSWB 3L6FB 1HEZA 1N3NB 2VLLA 3GMQB 1J5OL 5ADOL 1JYXA 1XR9A 2FO1A 1YEGL 1JV5B 3WEXB 3ULVC 3CSGA 1MJUH 4PGBA 4ZPVA 4LOUC 5LVEA 1OAZH 4DGYH 3S34H 3ILQC 2X89A 1EEYA 3B9KC 1ZTXH 3ARPA 4KI1A 4L8BB 5D6DC 3MV01 2HT2C 2HKFL 2V17L 2VIRA 1KLGA 4LARH 2JJUA 2ESVA 1R3KB 1MJ8H 1DVFD 2F74B 5MEOB 4PJIF 4RX4A 4PJEE 5AEAA 4ELMA 4WFEE 4YGVA