5LGKA

Crystal structure of the human ige-fc bound to its b cell receptor dercd23
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
307
structure length
307
Chain Sequence
VKILQSSCDGGGHFPPTIQLCLVSGYTPGTIQITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title IgE binds asymmetrically to its B cell receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig epsilon chain C region
total genus 41
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA03
4KMLB 1UWEH 3GIZH 2V6HA 4AMKL 1QO3A 4G6JL 2F58L 4K23H 4KUCD 2LQRA 2XWJB 2NY5C 1IGTA 3N9GH 5ADOL 2OP4L 4Y5XB 3FFCA 1M6OA 3LPFA 1H3TA 3TO2A 2YEZB 3S96B 4M3KB 3FN0H 3DX6A 3HG1E 2AK4B 2IAMA 3NFNA 2WQ8A 5GRVK 2HA1A 5A2JH 5LGKA 5I8KH 1QSZA 2FIRT 4X7TB 1RUAH 3SOBH 2NW2B 1EEYA 4DTGL 4MHHG 2X4PA 4QOKE 2O5ZL 2VH5L 3R0NA 2BNQA 1WZKA 1BREA 1WFUA 5JOFB 1G9EA 1JPTL 4M8QB 2FHBA 1PD6A 2P48B 1HWHB 1BWMA 3FONB 4HDIB 5HYIA 3VFMA 5AUMA 4ETQA 5C09E 3HMWH 4P5TA 2ESVD 4F15C 4H0IA 2X4SB 3D5OF 2E9JA 3SJVB 5DHVH 3I2CH 2RFXB 4U1NA 4HUWB 4U1LA 4UT6L 43CAA 4YHNB 3MC0A 3KPLB 3QXAA 2FEDD 2AJYH 4HT1H 2AJXL 4LBEB 4FQ2L 1OL0A 3HE6D 4WTZG 1HHGA 4ELMB 1VGKB 1PLGH 3HNTH 3P0YH 4YBLB 2X42A 4Z78B 2QQKL 3ZKSD 4U7KA 5I15L 1RUPH 2EKSA 2XACC 4MJ5A 1S5HA 2F19L 1EHLL 1OQOA 4MJ2A 1J18A 1NMBL 4ZD3H 5GGVL 1J0ZA 4LK4A 4P5KA 3MNWB 1CWVA 2D03L 1AXIB 3CVIH 3P9WB 4Z7QF 5DT1H 3STLB 1UC6A 5C0AD 4M5YH 3IDJA 1AGEB 3MX0A 5D7IB 5FYKH 1H3WM 3UTZA 1AGDB 4XVJH 2NXZB 5HDBE 3ZSTA 5GGUA 2CKBB 5C0IB 3WHE1 4M6NL 4Z7UB 1FNGA 4WV1C 3V0VB 4XXCA 1DSFH 2A77L 4KJPD 2NY1B 1CDHA 2GJ6E 3FB7B 3IFLL 5JIKA 3RDTD 1FO0H 5FM8A 4R9HA 1RK1B 3DVIA 2LAAA 1T03L 4NO3A 2NY4B 4R8WH 3KPPB 1A2YA 1N4XH 4Z6AT 4HULB 1V7ML 1AKJB 1QKZH 3B4NA 4WDIA 5ISZB 4OIIH 3TO4C 1U8OA 1C16B 2NY7L 3U36B 4ODTL 1U3JA 2WBJB 1KLUA 3WN5A 2V7HA 1DBJH 2XZQL 2NY4D 1W0VB 2X9XA 1MHHA 3TBTA 4EBQH 3GM8A 3BISA 5D7JB 1G6VK 1PKQE 4R2GC 4UIKL 4XXCC 2DWEA 3ARDA 4M7ZB 1R24A 4YBHA 3QIBD 5AG9A 3EYQD 3MOBH 4TUKH 5IJVB 5AYUH 2BDNH 4K3DH 2EIZA 1M71A 3LRHA 3MLSH 4Q0XH 2FIKA 2BY1A 4OZIE 1FDLL 5IFHH 4HC1H 4HS6B 4R6UA 2ZPKL 3VFMB 4KZEH 3DUHA 3GFUA 4WWKD 5C2BH 4UDUB 3UJTH 3QA3A 3CK0H 4R26L 2V17L 3PWPB 2VKWA 3P30H 4YGAB 3H42H 3BDYL 1GZQA 2LVEA 5T1DH 1YPZE 3DX8B 4XBGB 1TZHB 4JFOA 3C6SA 3BPNB 4PD4J 3KPRE 2HWZL 1L9NA 3MREB 5D7KD 3PDDA 5HDQL 2VAAA 2JCCF 2N4IA 2PO6C 4OZHE 2Y25A 3UBXB 2UUDH 5HI5C 4UQ3B 5KSVB 3AY4A 3PWVA 4CNIA 3NCYS 3BSZL 5BVPL 2EC9T 4XHQA 2HN7B 2VXTH 4KJQD 2K7QA 3HC3H 2X1QA 2X1WL 1U8JA 4ODSH 1NH6A 2IBGA 1BVLB 5E08H 3MA9H 1T0NA 2WZPD 1UCTA 5A2LH 3S37H 3NPSC 3OB0H 4JM4L 2LTQB 3WO4C 1FNGB 4OCRH 3QYCA 3LY6A 3CFIC 3B5HA 5DD1H 5AUMB 4O58H 4ETQB 4WCYL 2ORBL 1QRNB 1WZMA 3P0VL 2MWCA 3PDOA 5IK3A 3RA7L 3UAJD 3BEWB 1FSKC 5SX4H 1FL3A 2X4UB 2IH3B 4ZUTA 3PQYA 3DYMA 3U46A 1DDHA 2YHGA 2DDQL 1U3HA 4U1MB 1HIMH 3PJSA 2VB5A 3SDXB 3SKOA 1RUQH 2Z35A 5C07A 4NRXB 1I3RA 4RWYH 1GC1H 1TNNA 1NCCH 1I9RL 1NL0L 3DUSA 5J6HA 3OHXB 4RISH 1CD0A 1OAQL 2NX5B 4UUJB 5JW4R 3TFKD 1V3MA 5MEQB 1MCDA 2NW3A 4P46C 4P9HH 1EV2E 2HFEB 1R3LA 3VG9B 3WXWH 5GRJH 2VQ1A 5GJSH 3MRMA 1M6OB 1JHKL 1JYVA 4K8RL 1KEML 4ZYKB 1FFPB 1XCQA 4QHMA 3IFPA 5GGRY 4G3YL 1DL7L 4XPAH 5EB9A 5HD8D 3RTQC 4PLKC 3LEYH 5EO1A 3JWOC 2BOBB 1AHWC 4KKLD 1H15A 5MEPA 3U82B 1VERA 3VDBA 1N6VA 2P5EE 2HG5A 4YXHL 4YBQC 5KAQF 1FG2A 3DV4A 1FJ1A 3V5HA 2FECI 4LSUH 4CN4A 3HPJB 3GO1H 3OR6B 3MOAH 2XXCB 3VXNB 4M8QA 4DZBA 1CICC 5BXFB 5SX5K 2IPKA 4NZJA 1WITA 3BJ91 2WK2A 2JE8A 2XQBH 1CDUA 2X4SA 2PXYC 4YPGB 5ESVA 3BAEL 4ZFZB 5JOPE 4JO3H 3ZMRA 3IDGA 3ZT5A 4FQXB 1DLHB 1GZPA 2VLLB 5L2JA 5I66B 1WQVT 2HJFA 1NGYA 5F89A 1UG9A 5EIVA 4I77L 4OLUH 5F88B 3QUXB 4RMUA 4WUUB 4OZFB 1S7TB 1LEIA 1LK2A 4APQB 4PRDA 3AU1B 2MOVA 4KTDL 1H5BC 5TE4H 4I3RL 4F33A 1REIA 1VFBA 3C2AH 3UP1A 1Z9SA 1I9IL 3X11A 2C5DC 2WIIA 4GKOA 5HVGB 5DEGB 1YQVL 4Z7NE 1KACB 2E27L 2PUQT 1WIPA 4X7DC 1I7ZB 1FQ9C 2F54D 3H2WA 2YPLE 1HSBB 1TMCB 4O2FA 3UTTD 1BD2A 2X7LA 5KW9L 3O2VH 3SKJL 5K33A 4LMQI 2WWMD 2K9UA 3QDHA 1ACZA 1JCKA 1OTSC 4K7PX 4U0RB 2AXJA 4NQTA 1FVEB 4XRCA 3CGTA 1A7NH 3OHXA 4TULH 3ZKMD 3J7HA 2YBRB 4RA3A 5LXGH 4YAQA 3MJ9A 1Q94A 5HY9A 1VSCA 3OX8A 1ZHBA 2G9HB 4XP5L 3UTTB 4PLJC 3G5YA 1AGFB 1HQ4B 1LE5B 3RHWF 3UJIH 3G6JA 4UTAH 3T0EA 1EUUA 5HYQA 5GZNC 4XTRC 3TEUA 3KYAA 4JPIA 2V7HB 3NPZB 4OCWH 1AGDA 4QHNA 4HJ0D 2Q1EA 3VRLF 3GMRA 5HHMB 2MKWA 1LDPL 4KFZC 2OR9L 2F5AH 3KR3L 1KTLA 4OD1H 5D5MA 3RVWD 2EE3A 4L9DA 3SDDD 4Y4HC 3VWJC 1OAZH 4HCRL 4JZJC 4OKDA 1FG2B 5FUCE 2YR3A 3B8YA 4GRWB 3U7YL 5IR1A 3O3AA 2XKSA 5FUZL 4LLDB 1WJ3A 4MCYA 1GGTA 2VJXA 3OKLB 4R4NC 2CR6A 4PJEF 1OD9A 1F4YL 1JF1A 2F9BT 4FQQA 5F6HI 2GEEA 4K23L 3VWJD 4G8IA 4HUUA 3CNKA 5I1JH 1IGYB 4NHUB 1A7BA 3FN0L 2IGFH 4TUJB 5GRWA 1H8SA 3VFRA 4A2LA 2AQ2A 2Q76A 2NLJB 2GSGB 4XMPL 5D96C 1CF8L 1YQ2A 2R39A 4G6FB 1VFMA 3IJSB 1M71B 3V5KA 1FBIL 5IW6B 4JM2F 5IMMB 2AERT 2O5ZH 2VH5H 2DQDL 1E6OH 4X83A 3P4OA 1AKJD 4BFIA 3GGWB 3GRWH 4H8WH 3BQUA 3DRQA 1T1ZA 2DRUA 4M5ZH 3PL6C 1NGWB 5ACZA 3W11D 3ES6A 4BSWA 5DD0L 3I2CL 3DETD 5DUBB 3TBYB 1RFDH 1BD2B 3LPWA 1MFBL 5MI0C 4NBYB 5I18L 3F6IA 3A0OA 1BFTA 4UT7L 3S97C 3P0YL 5C0AA 4WW2F 3CMGA 4JDVA 4OCXL 3OJVC 2PTUA 3KYNA 1BOGA 1U3HB 4DW2L 5IB3A 3QXDB 4KVNL 5IOPB 5D6CB 1IAKB 3UZVB 2XWJA 2F19H 4NSKB 1S7XA 5TE7L 3MV11 4Z77B 1YNTB 4PY7A 5FYKD 2PR4H 4AIZA 5AEAA 5C09D 1FZOB 3INUL 5A40E 1TVBA 1A6ZB 4O9HH 5E8DL 1U3HD 3DGGA 2OXGA 2VR5A 3O11B 2VAJA 1WT5C 1DQQB 2CGRH 3UDWA 1AD0B 3MBEA 4P2QE 2ADFL 4L9LA 4E5XB 3E8UH 4BA8A 4GS7C 2FL5B 1OTUC 4DFHA 5I15H 1JV5B 1ONQB 2IANE 2A73A 1SEQH 2W65B 1FFPA 4E42A 3WXVL 5T3ZE 4ODWA 2VABB 3QH3A 2AV7A 1RSFA 4MMZC 1QKZL 4HGWB 2QKIB 3SPVB 3UEZA 1CFBA 1BQHA 3OKKB 4U6YA 3CVHH 1SJEA 1WWBX 3F6LA 3BKYH 5DA4A 2D9QB 3QWRD 3QUYB 2RQ8A 3T4YA 4QRRD 5E9DD 1BF8A 5J3HC 2DQGH 2AK4D 1EA9C 1PKOA 1F58H 5TDNA 1ZLUK 3GIVB 3MRFB 4O2EB 3SE4A 3ZDXF 2YXMA 1SY6A 2B4CC 2VQ1B 4LLWB 1FG9C 1KGCD 4FFVC 3P77B 4DN4H 2ICEA 1HINH 5DJDB 2EDOA 5EO9B 3OAYH 4NP4H 3EJJX 4GAYA 3DSNA 5F9JA 4BELD 2XI9A 1MLCB 4KGJA 4KZEL 4EQ2A 2VLMD 3FN9A 5E2WL 3LKQA 5I1LB 1QFWL 5E1HB 2DYPD 3QCUH 1JPGA 5ANMB 2A0LD 2CDFA 3HR5A 4BH7A 3UYRL 3QHFH 1NC4B 1BMGA 1KCSL 3AUVA 4KUCF 4X4XA 2XN9B 5EU4A 5HHOE 1DUYA 3FO1A 4FFVD 4MCZA 3TO4A 5T1MA 2EECA 3JWOL 1N2RA 4XBEL 4EBQL 5JPNA 5F9DC 4HAGA 4I2XB 4PP1C 3ROLA 1KFAL 3CZFA 5DJ8B 3HRZA 3GHEH 3GSQA 2DWDB 4KZDL 2O5XL 4PS4L 4DKFL 1IVLA 1WCQA 1CQKA 4MYWB 4UINH 1GGYA 3KYMA 1Z0NA 3QBTB 5IVNA 4I18C 1IFHH 4LGRB 1OAYH 3TP4A 2PCPB 3KLHD 5HGHB 4HIXL 3WN5B 3VG0H 1SM3H 1JHTB 5GGSY 1MCLA 3ELAT 4MAYC 3U7AA 3KJ6H 4J8RB 3B9KC 3T2OA 1CL7I 1AR1C 3TWCH 1OPGL 4J4PA 2X4TA 1MCNA 2Z0BA 5J0BA 3U4BH 1UEMA 1AXTH 4U1SA 5DXWA 3WLBB 4IRJB 4Y4FA 1IT9L 4J3XA 4J12A 3K8MA 4O58L 4M43H 1SYSA 3CU7A 3UBXG 1MLBA 5CJ5A 4K94H 4XMLH 1LO3H 1CZ8L 3BIBX 3VXPB 2APVA 3TBSB 2DQCH 1IMHC 4FXKA 5INDA 4I13B 1IM9D 4CRPA 5I71C 4PUBH 3MO1B 2VXTL 4MNGA 1HYSD 1QBLH 1R0AH 3GKZA 3MRPA 5EOCJ 3QUZD 3RWIB 1YEFH 5FYLD 1S8DB 2BHZA 3V5DA 4RX4A 4XCFL 4EEEA 1YEHL 2X1OA 5JR1H 5CEYA 3WFDL 2AABH 4MAUH 4HK0A 3OJ2C 4Y4FC 2OL3B 4LNRB 5BQ7A 4WHTA 4H88H 1ZGLP 3W9EB 3NAAH 1AO7E 2UWEB 1OT1A 5IBTH 3DJ9A 4TSAH 4JFFD 3V6ZA 5F3BA 4K55A 7CGTA 4ORZC 4PY7B 1J0HA 3RZCB 4I4WB 1U8KA 2HLAA 1QBAA 1L9MA 3HC4L 4D2NA 4GAFB 5TE6H 4LPUA 1MAMH 1UWXH 1JHKH 4KI5D 4I48B 3S34H 2H32A 35C8H 4WTZA 2MPAL 3VWKA 4Q9RH 1TZGH 5I75C 4U1LB 4ZMAT 5C71A 5IB5B 3FQRA 2JLLA 1XZ0B 2VOTA 5IJVA 5DQ9B 1YYMH 3VXSA 5CEZD 5L0QB 1P7QB 2EDYA 4Z9KB 2A0LC 4Y5XC 5FF6A 2GY5A 2EYTA 3AREB 3KPMA 1OSZA 1YEDB 1YEJL 5DFTA 4JO2H 5GGSB 4ERSL 5E9DA 4QRRA 2EZ0D 2OZ4L 1LO2H 3HZKA 4QLRA 3I85A 4OLWL 2Z8SA 4M93B 4P2RA 3TLRA 1NKRA 2DTMH 1RJLB 4Y2DD 5C0GA 2X41A 1G7QB 1UJ3A 4WU5B 1DVFA 2OP4H 1T4KA 1TZHA 2ARWA 4JRYE 4UDTB 2OZ4A 4HIJA 3MRGA 4WHCA 4YHKH 4GRMB 1I8KA 2V5MA 4U2YA 4YDVA 5E8PB 3ROOB 3EDDA 5I1AB 4XNZC 1ZEAH 1YZZA 3EJZC 3OAUL 3OXRB 3SOBL 1ZGLM 4JANB 2WLYA 4JAMB 3MXVL 2PYFA 3SDDC 1OM3L 4CL7A 3ESVF 3MRJB 4A2MA 2VL4A 5FYLH 6FABL 3B9DA 4ZPTB 3TJHC 3OZ9H 3GBNH 2F54E 4N8PA 4H5SA 2AS5M 1CFTB 1CE6B 4WFHD 5J6GB 4J2XA 4DKAA 1BGXL 3C5JA 3SKNA 5DDHB 4I77H 3FKUS 3BP5A 3CFBB 3QI9C 4QEGA 4WV1B 5EU6A 4M1CD 3X13A 1LEGA 5A1AA 4JN1H 4KTDH 1ZHKA 5E2TL 4AM0B 2DLEA 2EIZB 4WU7B 4BZ1H 1W0WB 2B20A 2HFTA 5I30L 2R2HB 3EYSH 4QRPE 4RZCA 1MY5A 1MFDL 3MGTA 4KJWD 5BOZG 5I17A 4Z78A 2O26U 1D9KD 3NZ8A 4TTDD 1Q38A 3D1MC 3F58L 1HXMB 3FZUC 5KVEH 1CFNB 4KKLC 4DAGH 5DT1L 3QG6B 4KQ4L 3VFNA 1QYGL 1FRGL 4L4VA 5TF1L 3WIIH 3HG1B 5D9SA 4W70A 3RGVC 2EKJA 3WS3B 1T1YA 4NQXB 5JW4M 1BP3B 4OZFA 1NDGB 2DQUL 1D9KB 1U91A 2E3VA 4HLZH 4ODVH 3MRMB 1G0DA 2IALA 3SY0B 3VXPA 4GUPB 4GRWE 2OJZL 3VH8B 3K46A 3OKDB 3NN8A 3NOIA 1QSEE 2GSIA 3QB7C 4HGWA 4U4BA 5ID1A 4HKZA 4JFHE 4ODTH 4X6CA 2OL3L 1T4KB 1Q8MA 3R1GL 4GBXA 3NCMA 3VFTB 5I16A 2EIDA 4P9HC 5C0BE 1JPFB 1S7SA 3VXNA 1EPFA 4M48L 2ICCA 4G8GB 3GMQA 4P59L 1MAKA 2DL9A 3O2WH 2BSED 4OD1L 4ONGL 1J5OL 1AHWA 2YD7A 3C9NB 5F7YC 5CGYC 2MSPA 2BC4B 1OAZL 4PB0L 1P84J 5D5ME 3D0LB 1G7MB 3FONA 4HDIA 3MLPA 2JK5B 2FJFA 1HI6B 2DQEH 1OAUH 3LKSB 2CMRL 3I6GA 4OF6A 4RFNB 1IKNA 4JREC 1MJ8L 4Q0XL 1GSMA 1NCNA 1JZ7A 1VADB 4HC1L 5F44A 5IB5A 2ZPKH 1DDHB 1JZ4A 3GSUA 5C2BL 5D72H 1ZT7A 4UTBL 1YPZF 4P3WA 2V17H 4U1KA 3ZL4H 3EJYC 2C7UB 1YN6B 2XN9A 3QDGE 3V6OC 1I3RB 2ZKHH 3MROA 4PJCF 4TSBH 2VERN 2UYLB 5KTEH 3UYPA 3BVNB 1MNUL 5MENA 2AGJH 1JNLH 1XF5A 3K1KC 4X6DB 1MFBH 3WO4B 3O3EA 2YC1B 3K4ZA 5EG6C 1R3JB 4JFFA 2J2ZA 4KMTL 4L8DA 3QCTL 2YRZA 3BE1L 1P6FA 2R15A 3RVUC 2PETA 2AXGA 3BRGC 4R4FH 4MNQD 5DC0A 5JIPA 3OF6A 5BVPH 4LEXL 3I84A 3HZMA 3PL6B 3WEXB 5F7FA 4AEHH 1JNHB 3D0VB 1H3UA 3LIZH 3JXAA 2RCSH 3MUY1 1NMCC 3K2MC 5B38B 4K7FA 4F58H 1KELL 4NDMA 4HUVA 4NC1C 1DR9A 4UV4H 5DUPL 3QNYB 1FAIL 2VNCA 2OSLB 4TRPH 4PJHE 5C0CB 5E8DH 1CGSL 4N0UE 3UTOA 3BO8B 3PL6D 2FGWH 1A7QH 5SWZB 2ARJA 4PJFF 1U8NA 3E8UL 4X4YB 5HHPA 2P5WB 4YC2B 2AEPH 4QYOA 1CDBA 3QCVH 4PRHE 2FR4B 5DJYB 3KDMA 4JM2B 2FEDC 5DDHA 4E41A 1KOAA 4PRHA 3QISA 4N9GA 4PGEA 3IJHB 4ZSOA 2HT4D 4HWUA 3PWPD 1JE6A 2GUOB 1QSED 2APXA 3KVQA 4QHUB 3L3KB 5H37G 4AH2A 4N0UB 4GSDH 3WNLA 4MZ2A 1V7NH 4PRHD 4JM2D 4HF5H 2ZJSH 3TT3H 1UXSB 2V2WB 4IJ3B 5FGBC 4CMHB 4I4WA 3S5LG 3R06B 3P73A 4EUPB 2AK1H 3JV0A 1BF2A 3LCYA 5DJZA 2VLKA 5E8NA 2N56A 4HKBA 1UA6L 1KCKA 2J8HA 5DVNA 3I75B 3DURA 1INEH 2Q7NA 3JV6A 4JFPA 3IU4H 5HYSA 5I76A 2HKFL 4GMTH 1QSFD 5DMGC 2R2EB 2PKDA 3C5SB 1ZT4B 3CVHL 1F11B 3O8XC 4Y2DA 1DFBH 4C56B 2NMSA 2BVYA 3O11A 4Q9QL 2D7TL 3DVGA 5KSBE 1NFDB 3L6FB 4LSUL 3IRZA 1P2CB 1T1ZB 5JA8B 1FP5A 1UM5L 2VZVA 2YS4A 1E6JL 4PJFB 4P9MH 2ATKA 3TA3B 3WHXA 1X5YA 1YYLH 1F6AA 4OLYH 5L9DH 5IVXA 2XQBL 4B7LA 2O5XH 1VACB 3HKFA 3V5HB 2BVPA 5HDOA 4PS4H 5C8JB 3K81A 4Z7UA 1Q9LB 1CLZL 3QIWC 5DTFB 1CG9B 3W81A 1CD1A 4Y0GA 3RY5A 3IVKA 2XZAH 3JBG7 3BGFC 3PHOA 4U49A 3BYYA 3KJ6L 4XCYA 2BOCA 1IAIH 3S4SG 2CRIA 1BVKA 3VW3L 4WFED 2N7AA 3V2AR 3TWCL 5DQDL 3UPCA 2BSSA 3IDMB 3RU8L 3OSKA 4LIQH 3GSXB 3QDJE 1RIHH 5D8JL 2JB6B 4NM8H 4OQTL 1BX2A 1RJYA 3HNSH 25C8H 3FT2B 3CU1A 3RX5A 1U8QB 3BX7C 4XMLL 3EFFA 1CFTA 4GBXD 5CBAB 1PAMA 1I7TA 2A9MH 1WBXA 1ZGLB 3QXAB 4GRLD 4FQLH 1PG7X 2WIIB 4C55A 3Q5TA 5GS0D 3LKOB 3SJVD 5JR1L 1NBYA 1LEGB 3JWDH 1DBML 4K3HA 1BAFH 3WDJA 3HS0B 4MS8D 3HZVB 1TPXC 5J12B 1EEZA 1QLFB 3RDTB 3I50L 3BGAA 1MRDH 4TNWF 5MEOA 3U4AA 3EYUL 4HXAH 4JPWH 4JRYA 2F53E 4K94L 5C92A 1VESA 2Y5TB 3VGAC 5JW5B 1MCWM 5GGTA 1A22B 5DJ6B 3RUGE 4ZOCA 3QXWA 1D7FA 1ZS8A 5I71B 1ND0A 2BMKB 1AGFA 2BNQB 5TQ0L 4LQFH 4NQCA 2EIEA 5EBMB 3JTSB 4D0CB 1VFOA 2B7DT 1AGBB 1KPVA 2CDEA 4B53A 4KK8C 1HHIB 3WS6C 1RU9H 4DK6A 3O41B 1RZIA 3CC5A 4NWUL 5JQ6H 5AD0A 3A6OA 4Y4FB 4Y19A 3MACH 3SN6N 1OAXL 2GSIB 3V7AE 1P5UA 3HC0B 1IC1A 3DX6B 1NEZG 3CXDH 4NIKB 4DUXA 2AJ3B 1U92B 5JHDD 1E4XI 3KS0H 4YWGH 3KLHC 1T1XA 2UV3A 4P2RD 4KHXH 4RGNB 5TE6L 1F2QA 3VWJA 12E8H 2YMXH 5DSCA 5CILL 3SDAA 1MF2H 1TZGL 1XF5B 2A6IB 5DWUL 1ZLUH 3S36H 1PW3A 4CVZA 2VWEE 3RVWC 5DJCB 4OTXH 3ULSA 1WBZA 4LFHD 1Y6NR 3K3QA 4A6YL 4D0BA 4Z76B 1ONQA 1MRFH 1IILE 3KPLA 2W1NA 4M7JL 4HH9B 4EDWH 3AS2A 4M93C 4YJZL 2QSCH 4M5ZL 4U1KB 1EO8H 5HGAB 4PJBF 2QTEA 3C5ZA 3FO9B 3L3JB 4OV6F 1DEEA 1Y0LA 4NOBA 2DQHL 1U95B 4XC3H 2BNQD 2KL6A 4KPHH 2DL2A 3KPSE 5ICXB 4TYUA 2VDNL 4MQXC 3REVB 1CICD 1B3JA 1ZHBB 5BW7A 4Z7OE 2PTVA 1JK8A 4ACPA 3QJFA 4XWGH 5CEXA 5LWYL 2ATPB 4RMTA 3G6DH 2VISA 4L4VD 4U6HA 1KPUB 3VFWB 2FR4A 3MOQA 2BOBA 3N1FC 3IKKA 4GW4B 5I8OL 2QSQA 1CG9A 3KJ4C 4NN7C 3U9UA 1OTSD 1Q9KB 1LO4H 3RWJB 4ZFGL 4XPGL 4S0SD 2EH8L 4POZD 4RAVA 1RURH 2DICA 1E27B 4JO4L 5J8OA 4JRWA 3O45A 4X8JA 3ULVC 2J1KA 1I1FB 1UWXK 2BMKA 1PY4A 1J05B 4EJ1C 1FRGH 4N0FB 3FQXA 3K8LA 1HH6B 4OUUA 4D0DB 5IHUL 3T4AA 4F57L 4JFXB 2IQAA 4P5TB 4M3JA 3BOVA 5AD0B 3L1OH 2OJZH 2V2TA 2Q8BH 3ALXA 4LSDA 4F9LC 4UB0H 3U2SA 3ILPA 5I30H 5KJRL 3CLFL 1QVOB 4Y4HD 5FM4A 2QADD 4LLMA 5GJTH 4H5SB 4L9LB 4WFFE 3ZHDA 5CAYB 5EZJB 4JFZH 2ADIB 2JJTA 4RBPH 2OL3H 3T77A 1YNLH 3WIIL 3RX8A 3BZ4A 5INCB 2VQTA 2NZ9C 4YZFE 3LHPH 3UJJL 1UXSA 2V2WA 4P59H 4XCNA 1MUJA 5FGSA 1TQBC 4K9EL 1MREL 2HN7A 3QUZC 5C9JA 5CCKH 3P9LB 5HJ3A 1BLNB 5E8NB 3MGAA 1EHAA 4F2MB 2E7MA 1W0WA 4DN4L 4O4YL 3AMLA 5C0BA 3EHBC 5EPMA 3RNQA 4PJGA 4OM0H 3ZTNH 1OGAA 5IESH 4MDJB 4JKPH 2Y9RT 1XGPA 3OXRA 2AXFB 1CXHA 5AAWA 4PV9B 4R96A 4OLXH 5AZ2H 1C5BH 1CGTA 3B9KB 2PYFB 2HH0H 2WV3A 2D7QA 4LSVL 4P2QA 1YNKH 4RA0C 4MD4A 5F6IB 2D0FA 2NY0D 4JFDA 5CSZA 1MHPL 2VDRH 1CK0L 4R97B 3L7FB 2PYEA 2M26A 1OAUL 1KEGL 1CGWA 4DKFH 1QZ1A 4G8GE 2BNUA 3GI8L 3WFEL 4FFYL 2VITB 4QRQB 1ZGLA 1P4IL 3D85D 3I3DA 5I1CL 2EZ0C 2ZUQB 1OCWH 2E7LC 4XTRD 4ZODA 4G8FA 1WC7A 2VDPL 3O6LL 3U48A 3VI3F 2XTJE 2NCMA 4GG8B 2ZKHL 3LIZL 3O4OC 3CDFA 1D5IH 1FL3B 2X4UA 1ZLVK 2AGJL 3PUCA 3MLUH 1NCBH 5C0JA 1MIML 2XZCL 3IAQA 3QUMH 2VDMH 1CGSH 4GH7B 5DHVA 3TA3D 1LP9A 1N59A 1YC8A 2FB4H 4FQ1H 2YD6A 3MV7E 4LPTA 1UENA 5D2LB 3RZCC 1ETZB 4DGIL 5MERA 1DBAL 1S9VA 1JYWA 1VA9A 5HDLA 4Q2ZA 5F8RC 3DV4B 5CINH 5KVFL 2R8SH 1JZ5A 3T1WA 5KBNC 3S98A 2CLVB 2ERJB 1OWRM 1SYVA 1AFVL 1T7ZA 3ZYIA 5SX4I 1LO0L 5FGCB 2ITDB 4DZ8B 1FGNL 3BZ4B 3HI5L 3D48R 3PIQB 4OSUL 5INCA 3O6FC 3P4MB 5DI8B 5HGGS 1ULVA 1EGJH 4YHYC 2NY0B 1UB6A 4QF1A 3S9DB 3L3DA 3C8DA 2ZJSL 3TT3L 3MCLL 1G7JB 4Y2OA 5IBTL 4RFOL 3PWJA 3VFOA 2WQRA 4GG6E 1SHMA 5A2FA 4PB9L 1JGUH 4QTIL 2FH6A 2YSSB 3V0WL 4BSJA 3TT1L 4H20L 1BQHG 2R1WB 4OF0A 1RHHA 1FFQA 1NCWL 4U1GB 3ULVF 4Z7VF 3NZHL 4XCCH 4Q97A 5KOMC 1I4FA 5DK0A 3FT4A 1J1OL 5E2JA 5FCSH 2NY5L 5LGHL 4ZFFA 3TVMB 2Z9TA 5TH2B 1RZ7L 4Z76A 3UZEA 4P57B 3TIEB 4QGTA 3ARYA 1KC5H 3HE7B 3HAEG 4PY8J 5ICYB 4PJHF 3AROA 1CLOH 3BFOA 5ENWA 3C6LC 5ANME 4XNZB 1CXFA 5EZOL 1CDYA 4FQPA 4AYFA 3L3JA 4G8IB 3DGGB 3MRHA 4A6YA 4OV5A 4FN0A 4X6CE 3DBXB 3V6OA 3JZ7A 4PJ5E 1ITCA 1GGIL 2QQLL 4P49A 2XKNB 4NT6B 3DO7B 5HTSA 1YMME 3OV6A 2NY6D 1JZ6A 2VSDA 3IYLW 2FECL 2X4QA 4IMLA 3O8XB 4ZUSA 4CVWA 1ZEAL 3OAUH 5ALBH 2LV4A 4PJ9A 3FRPG 1ZVHA 5JUEH 1A6PA 3CAFA 4P3DA 1T0NB 3VGHA 2VXSL 3RWEB 3NN8B 2OQJA 1W2KT 5E8PA 3ROOA 2PYED 3ARED 2FWOB 2DYPB 1KT2A 1PQZB 1ZK9A 1DEEB 3O8XD 4MGXA 2NW2A 4KRNA 2YD5A 3RQ3A 4L4JA 1FZKA 4ZOEA 1I1FA 1B2WH 4C83A 3HMXL 5SWQA 4RAUB 5DJXB 1FJ1B 2MJWA 3AB0B 4DKEH 1Z2KA 1UGNA 1Q72H 2IPUG 4UAOB 4YHOL 2ZUTA 4GRLA 1OP5H 2XWTB 2IPKB 3QSKB 5J56B 4HS8L 2FH8A 4X9HA 5JW4N 2OTUB 3EO9H 3LD8C 4RMWA 3BWAA 3JWDL 1MVUA 1G7MA 3BZFA 1PLGL 2P1YA 5CZVL 3QUMA 4Z7VE 5KSUB 4JN1L 5E2TH 2QQKH 3I50H 3ARGD 1VPOH 3BH9A 1BIHA 2CDFB 2DOCA 4FQJL 4JHWL 3HNSL 5IMOA 5IB1B 3C87A 3IF1A 3SQBA 4KKAD 3MLTA 5LCVL 4M9PA 5T1KD 5T1MB 3VXUE 2FSEB 5CJXC 1JI2A 4X9GA 5T5FL 5HVHB 2XPGB 1XF4A 3JVGC 1RZFL 1IAII 1N3NA 5D7IF 3UXFA 1VFBB 5L8LB 3N1PC 5FHAL 3ARFC 1EGJA 2V7NB 1HOCB 1RUML 4PGDB 4LHUG 3VFPA 3VFNB 1S7VB 4M6NH 4GLRH 5IBLC 5MERB 1UYWL 2VL5B 2X6MA 2JIXD 3RIFK 2HRPH 2WWKO 5JHDE 4JY6B 1NANH 3CSPA 3TBYA 1XGTA 3MFFB 2IFGA 4L8SB 4XBPB 5F7DA 4OFPA 1GHFH 2QKIA 1JZ2A 4OIIL 4GXVH 1FLRH 3UTPE 3DBXA 2VDQH 2BHYA 5EUOE 5I1AA 3R1GH 4HMCA 2JIXB 4X5XB 1MCOH 4MA7H 4S1SL 4XVTL 2BVQB 1KF9B 4FG6D 4X6BB 3WE6A 1OF2A 1QFWM 3FT3A 4Y16A 3L7FA 1C16A 1U6AH 2WAHA 1T7WA 1BZ7B 3HZVA 3G6JB 4PJ5B 3WNMA 5CEZL 1BWWA 1HCFX 2R1WA 4ZPTA 1QD0A 4G8GA 4IMKC 4OF3A 5C3TA 1RJZA 4JFDD 3ILQD 3GM0A 3QFJE 2GI7A 3GIZL 3MLSL 2H9GA 1KJ2A 5E5MB 3OKMB 1G9MC 1UT9A 2OL3A 4YHIA 4JQXC 1X5XA 4AY0A 4AEEA 3JTTB 4RAUA 5DJXA 4NO3B 3WLWD 4RDQG 2AJVH 4BQBA 1TFHA 3REWB 2IANA 2QADC 3MV9B 3GMOA 1JNLL 2JB6A 1KPVB 1C12B 1I7ZA 4LLDA 1JBJA 1ZHKB 4AM0A 2D0HA 3ZKND 4JR9H 1HHKB 1ED3A 3BPLC 5ESQA 1T3FA 3QQ9D 2NXYC 3VXSD 4IMKA 3LKRB 4XWGL 4N90E 3HAEB 3ZO0A 3W82A 1VFUA 1CLYL 2EKSB 3NFSH 2LABA 3CX5J 5IHLB 4Z5RA 4YC2C 1QTYT 1A6ZA 5FEBA 4ZTPL 5D7JA 2HFGL 3FTGA 4LARL 3RWDB 1JPTH 3OAYK 4HH8A 3IXTB 3HMWL 3PNWA 2CLRA 3LKPB 5C0EA 4FFZH 4N1HB 4YBQD 5FAAA 3P4MA 1ZT4A 1KELH 2VLKE 2XG4A 4MXVE 2GIYA 1S3KL 2V2XB 1U8IA 1CD8A 4JFED 4OI9A 4QRPD 2VDNH 3NCFB 2IAND 3N1GC 3QZWB 4HT1L 3GHBH 3G9AB 5T5NG 5IMKA 5BZWA 5GGUB 1P2CA 1OGTA 1S7WB 1XEDA 3PV6B 3VFPB 3ARFD 3CIQA 3QO1A 3ARQA 5ICZA 3WUWB 3EFDL 1L4IA 1ZE3C 3FB7A 2CK0L 3HR5B 4M6MH 1T7VA 2X4PB 4NQCE 4L4VE 3QPXL 4IRJD 5LAXB 3OGCA 4RMRA 1A1MB 3O0RH 3CVHA 2R0KL 1ZTXH 3MNZA 1GJIA 2H3NA 5DTFA 1A8JH 1RZIB 3CC5B 4U33A 1W8OA 4JFZL 5HHOA 2NTFA 3EAKA 4UQ3A 1NMAH 5C0ND 4Y4KD 1EK3A 2J6EH 4OZ4A 3I9GH 1GC1L 1OW0A 5I73B 3BRDA 1BQLL 1ZKAA 3WFHA 4FQHA 2VLRB 1WT5A 4E41B 5F9JB 3BYTA 5JTWA 2P44B 3P4NA 5F9WC 2AJSL 3UMTA 1DSFL 4WWKB 2BSRB 3E6FA 4I0PD 2AK1L 1BM3L 4JQIH 1JHTA 3BHBA 5GSRA 4P9HL 1PZ5B 3ZTJH 1N3NB 1ERNA 3EO1B 1J0IA 2OR7A 4LLQA 1YEIL 1N4XL 1LP9E 1N2RB 5JPNB 4HX1A 5EORL 4MNQB 3ZTNL 3SDAC 4K8RH 1E27A 3DXAA 4L3CA 5FGBA 2YWYA 3GSQB 1P7QA 1A6TB 3TZVC 3DHJA 4FQIH 3RWFA 3O6ML 1B9ZA 3GMOB 4J3TA 1FAKT 4LHQB 3UJJH 1DUZA 1D5ZA 3SBWA 4XPBL 3KYMB 4GQ9L 3S4SB 3DNKA 3IDIB 4GJTB 3L7EA 2WUCL 1UM5H 4MNGB 3D18B 4DCQB 1TQBB 1TETH 4P9ML 1A02N 3SDCB 1XF2B 4MA3A 2DYPA 3MOAL 4Z0BH 3L5WB 4KK8D 3ILPB 3B8SA 4PJ7A 5F9AC 5CEYB 3K2UL 5ICXA 2DLFL 4GKNB 2G75A 4DK3A 5IESL 2NY1D 4JKPL 3IXTA 5I1CH 3QNYA 2YPKB 3ZSSA 2V5YA 5FIEA 4J7RA 2KZ1B 5A2KH 1BVZA 1A6AB 1VACA 2F53A 1C5BL 4JVWA 1B88A 2HRLA 3VFWA 4MQ7B 3PGCA 1XIWA 3GRWA 5JHLH 3QUMB 3EHBD 3DTXB 4BKLA 1WTLA 1TPXB 4MNGE 4OLUL 3W39B 1Q9KA 2Q8AL 3HHRB 1QPPA 3UC0L 4YPJA 4EI5D 3GKWH 1YMHB 1J05A 3X3GL 1AD0A 3MBEB 4BH7B 5SWQB 3KYOA 1LK2B 3HPJA 1UKTA 4GMSH 4Y19E 5EN2B 4JHAL 5DSCB 1ZLVH 3D9AL 4FXLA 5IEHB 4PGBB 2ZUQC 4LCWA 4ZFOB 2K3TA 2GFBB 4GRLB 3X12A 1CL7L 1ES0B 1HKFA 2VIRA 1BEYH 4Y16D 3GSWB 4TTGA 1WF5A 2BHUA 2YPLB 3RIFF 5A3ID 1FN4B 4KXZH 5C07D 2W0FB 4JZNA 5E08L 1NFDE 2D7MA 1BQHB 1HE7A 4NBXB 5HI3C 1I7RA 4ZO6A 3T3MF 1AIFB 2VR9A 3IFOA 3ZTJG 1FFOA 2Z31B 2IQ9H 3LKOA 2IAMD 4KGLA 1E4KC 1F4XL 4JFQA 3FO0H 3CFJB 5CJQH 3RA7H 4QNPE 3NMEA 4IDJL 1CT8B 43C9B 5A3IC 2JIXA 2WP3O 3TC9A 1XF3A 1TQCB 3QZWA 1NCWH 3LN9A 1YECL 4UQ2A 3HPLA 4OJFH 4D9QE 2V5SA 2W38A 3WS3A 1HNGA 1BBDH 1UACH 3EYFA 5I19L 5L6YH 3TN0D 1P4LB 1GC1C 2OR9H 4S1RH 1P4BL 1IGIH 1EGJL 5HHME 1G6RL 3QZWG 2AK4E 1LEKB 1NC2A 1OP5K 5CLWA 3QDJB 2AXHA 1I1AC 2OJEA 3WMSA 1FNEB 1RI8A 5EU3B 3IXAA 1LP9F 4IIQA 4P2OC 2Z91B 5B4MC 3TYFA 4N1EA 3CXDL 1AGBA 4XNYL 1S9YB 1I8KB 5CP3A 4LAQH 4U0QB 3PP4H 2Z92B 2B4CH 2R23A 1KSRA 4PBWD 2JJWA 1ZA3A 4OGAD 5CILH 1TZIA 4KI5E 4X9BA 2VLRA 5JOPD 5FK9B 4XPAL 4RBPK 4DZ8A 4WU7A 2BNQE 1FVCB 1A6AA 2VXQH 1MVFA 1A3QA 4W68A 5DHYB 5E2VL 3D3VD 2ZCHH 1NLBL 5H8DA 4XPFH 3BN9C 4NFDA 3ORJA 3NPSB 1UVQA 2C3HA 5CJ8A 2VITA 4U3XA 5DFWH 2GCYA 2Q6WA 3WJJA 3G6JE 5BZDA 3GO1L 2NNAA 1YY8A 4GG8A 1FORH 4JKMA 4PG2A 1T1YB 1E6OL 4NQXA 5CKAA 2J4WL 2IEPA 3QUKB 2D4DA 1EO8L 1K5NA 1YN6A 4H8WL 2P43B 4EI6A 1T6WA 5JHDB 1DUZB 4PJIE 1D5MB 1CI5A 4GAGL 1HNFA 3KJ4B 5AWNH 5ITBH 2VZTA 4S0TD 2AV1A 2RBLA 4KH2A 3QIBB 4WTWA 2Y4SA 1ETZA 3EDFA 5C09B 4NKDA 5TFSH 4PJ7B 3ES6B 3ZYJA 4RRPA 1G0YR 3GNMH 4P5TC 3HE7A 5D7SH 1RZJH 3MRCA 5E70A 2P8MA 4G5ZH 3ARDC 4PIRF 5DJAB 2KDGA 4P46B 3Q48A 2Q86A 3C2AL 2NX5D 5MP6L 1GGBL 1F00I 5DJ2A 4QHKI 4FP8H 1ZMYA 4K94C 3DWTA 1N5YL 3VRIA 1AQDB 5KSAB 1EMTH 7FABL 1H3XA 4LOUC 5F7EH 2PR4L 2A6KB 1LVEA 1UXWA 1O7VA 1F3RB 1BOGB 4D9LH 2A1WL 5IVXB 4UAOC 5TJWK 4C54A 3QDMD 3VCLA 3INUH 2EDKA 4LSTH 5EOTB 2EYRA 4X99A 4LLUB 5L2KB 5B3NA 5GQBA 3MUGB 2CGRL 3RBGA 5EDXA 2QR0B 1CICB 3A67L 2D4FA 3IVKB 3LS4L 3VFVB 1SEQL 3F7PC 5HVWA 5BVJB 1JGEB 2ARJQ 4ELMF 2IQAB 3DI2B 4WI7A 3FB6A 1MI5B 4NM4H 1JF1B 4FQQB 4Y8DC 4I3SL 3HLAA 5I8CB 4WO4D 1MCSA 3WKMH 4S1SH 3VXME 3QDGB 2EDQA 3F5WA 1MCKA 3VWKD 4BH8B 5JMOC 4F8TA 1IBGL 5ISZE 5JDSB 4HG4J 1MREH 3EOAB 5IROC 4R97C 5F6HJ 3RRQA 3F62A 3C60A 1DQLL 4ZQKA 3BP4A 4L5FL 4OLEA 4IBLT 2W9DL 5CEZH 2ZUSA 5IHZB 2HFFB 3ARVA 3BT2H 2Y6SC 3QDGD 3B9EA 2OI9C 4XCNB 2X2YA 1JPSH 4MWFA 3OX8B 5C9JB 3DVFA 3O4LA 4P5KB 1IAIM 1ZVSA 2YUWA 3PHQB 4GBXC 4X8XA 2NY2D 1N0LA 1QO3B 1TJHL 5C6TH 1NC2B 4JPVL 3WD5H 4UT9H 3UROR 1A9BB 4OZIB 4OLVL 2VWEC 5D7LB 3QEUB 3MV8E 4UMGA 2AJZA 1CE6A 5DD6B 1TDQA 4JB9H 1CK0H 4M03A 3PL6A 3WEXA 4G6KL 1KIQB 4U7MA 1YMHA 4P5TD 2PW2B 1MCQA 4P5MA 1RQ5A 4R0LB 4L8SA 4KK5D 3VXRD 2Q87A 4CKVX 4AL8H 3O45B 3O3AB 2DQDH 4X8JB 3T0WA 3VDAA 2LTQC 5GIRA 5IEHA 5F7HA 5DEZA 1N26A 1QR4A 3GRWL 2W91A 4MB4A 4QHLB 5F71A 1XGQB 1I85A 4NUJB 4ZTOH 4WO4B 3CFCH 4DQOL 5EIIA 5GISL 5IM7A 3DROB 1MJJA 4YDLB 1ZOXA 1W8NA 1J1XL 5IFJA 4WY7H 1J8HA 3CMOL 3WYRA 1RFDL 3ECBA 3PABB 4G8GD 3L5JA 1YN7B 1MIMH 2ERJC 3VWJB 2VSCA 4L29A 3DX9B 2E7LA 3NTCL 2CUIA 4W4OC 4UT7H 4JRXE 2NXYB 5DMKA 4ALAL 3GSNL 4JHZA 1QRND 3THML 1UZ8A 1A9EB 2B0SH 4OD2A 4PP2A 4CVZB 3VFSB 1KENL 4Y1AE 2ZUXA 4DGVL 3HAEH 5EBGA 2DLGA 3ZDZF 4EN3A 1X4XA 2HFGH 4LARH 5B3JF 3PQYD 5C0AE 3LN4B 4LL9A 2EC8A 4PGDA 4TVPE 5TE7H 3W0WD 3O3EB 4LPVA 1FYTB 3L3IB 3WHE0 1QBLL 3CSBA 4WUUD 1F97A 1SJEB 4OSUH 3TVMC 1NMAL 4APQD 1J7VR 1D5BA 2C3VB 2OMNA 5DYOA 4PJDB 4DEPB 4X7CC 2XIDA 2XKUA 4RGMC 3RDTA 5I16B 2Z35B 1OB1A 5KS9B 3W0WB 4P3CH 4Y4HA 4G80B 2OK0L 4NKMB 1P7QD 2ADFH 1YY9D 2M8XA 2FWOA 3V0WH 3VJ6B 3TT1H 4LHUD 1UB5B 5ESAA 5IGXL 4M4PA 4PJ8C 3HC4H 1F3JB 4F7MB 3PHQA 5D1ZC 1IGMH 5D6CA 4U1JB 5C7XL 2YA2A 4XP1H 4L3EE 1IC5L 3UTPD 1L0XA 2H32H 2J8OA 2HVJA 5T1LA 1RZ8A 2YN5A 4NZRH 3U30B 4Y19B 2C7UA 2QR0A 3PXJA 4I48A 3QNZA 1NSNH 4PD4K 4R4ND 2CRZA 1PG7W 2F54A 4PGCA 1QNZH 4IRZL 1PFCA 4ERSH 3AS3A 4R7NA 3L9RA 1KNOA 4MD5A 1M7IB 1BM3H 2E9IA 4HUXA 2MNUA 4N0FA 4QWWD 5KVMC 2GJ6A 3H9SD 3KPSA 3O9WA 5ADPH 3ARBC 3OKNB 1KN2H 3EDEA 1U8PA 2W0KA 5HGDB 2PCPA 2FIKB 3TBWB 2P8PA 4M7KL 3DYPA 5JDSA 5JXAH 1IZKA 3ULSB 3WDHA 1NAMB 4UDUA 2JELL 1RV6X 4NC1E 2CIIA 3IETB 5F96H 4JKWA 5ALBL 3LRSA 3D2UA 4D8PA 2FX9H 1IM9A 1I7TB 5D7LD 1MFCH 3CH1A 4Z0XA 1WISA 2QJDA 3JWOH 3CCHA 4MZ3A 1ZS8B 1RUKH 3VMNA 4U6XA 1F45A 4Q9CA 3BKMH 1ZSDB 1ZHNA 3UC0H 4U31A 2C3XA 4M7LL 1KFAH 5GGRB 1KCUL 3LD8B 2Z8RA 3QPQC 1NBYB 1J11A 1K9TA 1GGCH 4B41A 3KPSD 3ULUF 2ZSWB 1CR9L 3DXAB 1YUHB 1OAYL 4JHAH 5J57B 5CUSL 4PY8I 4MA1C 1N0XL 3IFNL 4YK4B 3TCLB 5FYKU 1RJLA 3KXFB 5DGQA 4RGOL 2X44D 3VFGH 5JHLL 4J6RL 3MUGA 4APQC 2ZNXA 5I1IH 1G7LB 3FQNB 1A3RH 3IDYC 5C8JA 3WLWC 3D85B 5E1AA 2XY1A 5HHVH 3L3KA 5E7FA 5TDOA 3C5JB 3SKNB 3IDNB 4DVRH 3B9KA 5DQJB 2YD9A 3OKEB 4WENB 5GZND 3PHOB 3FO0L 1S7RA 1CZ8H 1MJJB 5D6DA 1EFXD 4MJID 4HIHB 4JO1L 5B22A 2H32B 3CFEB 4BK4A 3FO2B 3DX7B 3UTSA 1SMAA 3REWA 5MEND 1GYAA 3NACH 2DTSA 5TDPA 1SVCP 3I6KA 1KJVB 5L6YL 3FT2A 5C3LD 1KLGB 1U8HA 1K4CB 1FCCA 1RUMH 2XPGA 1I1RA 4APQA 4PR5B 4CGTA 1WTGT 2ZWLT 4WI9A 5LVEA 3BPOB 5DRXA 3RPKA 2UZIH 2I26N 1OWWA 4B7IA 3VXUA 4P4RA 4QTHA 4XMKH 1XH3A 1YEKL 4LLVA 5E6ID 4U2ZA 5HYJB 4JPKH 4G9FB 3MRLB 4JQVA 4OGYL 1G7IA 2B4CL 4MB5A 4TVPH 2W92A 2BERA 3G5VB 3LKPA 4HMEA 5C0EB 3RL1B 2X4NA 3GJEB 3VI3E 1E4XH 3CH8A 1FL5B 4XB8A 4DVBB 1DVFD 4G7YL 4XNQB 1FYHB 4NC0B 4PRAA 4MAYB 5FO7A 3QHZL 1U41A 5I17B 4F7TB 2P7TA 5F3HA 4M6OL 4D9QD 1F13A 4NNXA 1B0GB 3FQWA 4JDZB 5F1IA 1BBJA 4ZAKD 2P42B 5CZXC 4XPFL 3WNNA 3F7YA 4PB0H 3EOBA 4JO2L 2HT2D 4ZO8A 4XCEB 2L7JA 2MHAB 4HFUL 3O4LB 1T5WB 4U7SA 5MI0B 2QQQA 3FQXB 2LVCA 1N5AA 1JWUB 4YFDB 3NGBB 4H1LB 1KJMB 2J4WH 3D0LA 4S1DD 2KUTA 4UIMA 5HI4D 4H1LH 3O9WD 2EE9A 3BP7A 4NCC2 2OTUA 4NHCL 3EFFB 2XXMB 1HHHA 4X98A 4HJGA 3MNVB 3CX2A 4BYHA 4QCIB 5KTEL 3MV8D 1OHQA 4XAWH 1X5JA 4FHBD 5E2VH 1EAJA 1HQRB 4ZFOL 4UU9B 5DD5H 3FFCE 1WK0A 3UTQB 3IF1B 3GNML 1GGUA 2CKBA 2P5EA 5C0IA 5LQBH 4KAQL 1KYOK 2CKBL 1T7XA 2BCKA 4ZTPH 4OBSA 4WEMB 5D1QD 3WIHH 3Q6FA 3B5TA 4ODHH 3O3BA 5FB8B 1R3JA 1U3ZA 1WEJH 2DI8A 3BXNA 4JFFB 3ULVE 5FOJA 4O02L 3MRKB 3VGEA 1T22A 2HT4C 2E8YA 1DVFB 2GJZA 1C5CL 1R3IH 1R5WA 3FN3A 3U2SB 1S3KH 4Y1AA 4QHKJ 4D9LL 1ZT7B 3FMGL 3RFZC 4W6XB 4NKMA 3PDGA 4LAJH 5HGAA 3EJYD 3O6FD 1GCFA 3C8KA 4PJIB 1ZXQA 3ALWA 4JG1L 4OKVB 1NGQH 1QR1B 3ZE1F 1U3HC 3TIDB 3A67H 2HLFD 5B8CB 3S88L 4HWBL 5F7LB 2NR6C 4ZS7L 4N8CH 3DVNA 1K8IB 3RL2A 1MI5E 3L3IA 4C4KT 1AP2B 1D5MA 4OFIA 2XNAA 1MIEL 4P3DB 1MH5A 4RMSA 1DANT 1LD9B 4N5EC 4ZD3L 5KSAC 4I3SH 1G7HB 5KAQG 4JQVC 4ZAKB 1S7SB 1OQXA 1KUMA 1PSKH 3I9GL 5BRZD 3QIBA 5I2IB 1UQSB 4HWBA 3QO0A 4PGZA 4ZNCD 5EZLA 4NKOB 3ULUL 4F9PA 3DIFB 5I1EL 4LCIH 3O81A 1V7NL 2VLJA 1MFEH 2ICES 4I0PB 1PEWA 4HS3A 4JQIL 2F8OA 2R4SH 2BVTA 2BK8A 4WI3A 5I8EA 3SO3B 3T2QA 3ARGA 5C0CE 4KTYA 4P4KD 3RNKB 1MCJA 5SWZA 1XF1A 4JGJA 2NY3D 5D71L 1DP0A 4ZFFB 2IFFH 5K9JL 4P23D 3I6LD 4Y4KC 3FCTA 2Z8WC 4O2CA 2XN9D 4KMQA 5I9QB 2HKHL 3OPZH 3TO4D 4P4RB 4QTHB 4CN6A 4KROD 4PG9A 2VN7A 1T2JA 2WUCH 3C2SA 1G84A 2F5BL 4X5WA 3SE3C 1T6VN 3T3PE 1FFOB 2HYMA 2I5YH 1DQLH 3S36X 4NJ9H 2NYYD 5D1QB 1DUYB 1NBZA 4MCZB 5KSBB 4KDVA 5T5NF 1B0WA 1JK8B 4NQEE 3U7WH 4PJDE 1AXSA 1XGRB 1MQ8A 2AXGB 3IJSA 3GSNA 1AJ7L 1G0XA 3VXMA 2OI9B 2VXVH 2O5YL 3QA3B 5IROA 4OB5H 3SCMD 3D39A 2XKNA 3EUUA 3QQ9C 3EYQC 5BS0E 3HPLB 3PXHA 3HLAB 3PGFL 5HDBF 2GK0A 2XTLA 4HWZA 4HAFA 3U79A 3EDKA 4NO2B 1JF5A 1WUNT 3RGVB 4GKNA 2GITB 3N06B 2P5WD 4NQEA 1JFQH 4GO6B 3DURB 3T0VA 1JPST 4CU8A 4TQEL 3B2VH 4J1UB 4LSPL 4G6KH 1H3GA 3CVHB 2BC4A 1DJSA 5AAMA 1OGAE 3OKEA 5D8JH 1GIGH 4XCYB 5D1XD 2G2RB 4L8CB 4MWFB 4R0LC 2XG5A 3RX7A 5C0AB 3OXSA 1Q9WB 2J8UB 2OS7A 1WWCA 3MNVA 3CFEA 3VXRE 5J1AA 1TQCC 3LKQB 3Q5OA 3LVEA 5CSZB 2OM5A 3U1SH 5I1LA 3NA9H 4FQHB 3O3UN 4ZYKA 2P46B 5IOPA 5GISH 4ZSOB 2F8VA 2YPLD 3V7MA 1HEZA 1TCRA 4QRTA 4TN9A 4YDLC 4POUB 4QXTB 1IKFH 3ZHKA 5BV7L 4L3AA 4UV4L 3F65A 1WBXB 3SQOL 3HUJA 1DBMH 1NBQA 4TRPL 1BAFL 1ES0A 3ZE2E 1I9EA 3CUPB 5CHNB 3T2PA 4FQCH 1XH3B 2DLHA 4CJ1A 2ZZUT 2A6JB 4HIEB 3VH8G 1A7QL 4KTEH 2BOCB 4O51A 4PRIA 1MWAH 2Y36H 4MS8C 3TVMA 2JJUA 4QT5B 2YPVL 1U0QA 3GSOB 4HKJB 1EIBA 5C07E 1RZGB 3IFOB 5FYJD 5LGJB 2BVEA 4OQTA 5H37H 2E6QA 4XNMB 3P0GB 4OJFL 5EIIB 3UTZB 1EVUA 3GBMH 3TH4T 2AV7B 2AW2A 4MNHA 1BBJB 3FCTB 4S1RL 3BH8A 3GMPA 4H26A 3HE6A 5D2LA 3MR9A 2HT3C 3WLBA 1CU4H 4R96B 4EDXB 1NCAL 3L6FA 4CMMB 1PX3A 3MSPA 1F4WH 2BVOB 2EH7H 2IG2L 4HV8B 4XNYH 3CFKB 4JFDB 3AREA 2YUZA 1NJ9B 2VLME 3HNVL 3BGMA 4GW1B 1ORSA 2ITDA 1MFNA 3MXWL 1J0YA 5E6YA 2OMBA 5D7LA 3WDIA 2VDLH 3QIUD 5D2NA 4Y5XA 5K9OB 1PY9A 3PV7A 4LEOA 3IGAA 4ZPVA 1G6RB 2KKQA 4QF1B 3SCMC 1KB9J 4G8EB 2ESVE 1JGLL 1NMCB 2VXQL 4XVSH 3RJDA 3VXTB 3RGVA 2DM3A 4K7PH 2JB5L 1GPOL 4YR6B 2A2QT 5ETUA 1F90H 4H0GA 5JZ7D 4KKBC 1T20B 3D2UD 3HUJF 4KKNA 3QIUC 4EZMA 5IB2B 3IKCB 5D70L 4HEME 4M1CC 1N6UA 5C0JB 4LLYB 5DEFA 5DJCA 3F7QA 3H9ZA 1BQSA 5EU5B 2GAZA 3FOLA 3GMLB 4KRPB 3QUXD 4M7JH 1U8QA 3P73B 2VDOL 4G6JH 3TNMB 5T3XH 1T89A 1KN2L 5BZDB 2DIBA 2GQHA 1L7TH 3LDBB 3P2TA 5IQ9A 3MMEA 1CCZA 4GAGH 1JWSB 3DX8A 1N0XH 3SDCD 4J3WA 4K3EH 5CD3A 4KPHL 1A9EA 3CXHJ 4N0YL 1LO5B 1W72A 4PP2B 2GTZA 3ARFA 3FO9A 1IAIL 2F54B 5GGQL 3HAEA 1ADQA 4GFTB 4GXUN 5DC9B 3STZB 1CLCA 4R7NB 5D2NE 1J88A 3Q3GB 5TGBA 3D39B 4K3JH 5IKCA 1PGRB 4Z8FL 1KCUH 3H3PH 1RUPL 4PRPD 5CMAB 5CZXD 3QQ3B 4E0RB 1AI1L 1I9IH 2D9CA 3KPTA 4FP8L 1GGCL 3MZTA 1GAFH 5DJ6A 5IIEB 4U6HB 2A6DB 4ORGB 4LCUA 4JO1H 4PJ9B 1EAPB 1CN4A 2X4OB 3HG1D 3AM8A 4LDOB 2D03H 5KN5B 1XGTB 1WBYA 2A1WH 1VGEH 8FABB 2DJ4A 4KJWC 2YD2A 4OFYA 4Y88A 4LSTL 3WNPA 3C5ZB 2EDXA 1OARL 5ESAB 4NQCD 5HHXL 3SGKA 3BQUC 3HNTL 4U6XB 2J7LA 3RUGA 1KTRL 3MLWL 1MRDL 4OFDA 4ZNEA 2AJ3A 4XMKL 4DFIA 2YEZA 4Y16B 4HXAL 5J11B 4MQ7A 1NGZA 2LU4A 2EXYC 3C08L 3CLFH 3DMMA 1KYOJ 4HLZG 1XGQA 4RRPG 4NRYB 4ZO9A 2BRQA 1I9JL 3LKRA 4LEOB 5K9KA 1Z3GL 5JLZB 1EJ6A 1CTNA 4Z7VB 4WFFD 5HI3D 4JZOB 5CJOL 1V3LA 3BGFB 4YGVA 4PTTA 1N8ZA 1AY1L 4P99A 5IMOB 4HS3B 1LNUB 1YY8B 4H1LG 4AQ1B 3BUTA 2OTWA 4D0BB 3LSOA 1PZ5A 3BT2L 2VUOA 3R8QA 4KRLB 1HH6A 4OUUB 2YD8A 3DSFH 3OG4B 4EI5C 4HH9A 4S2SB 1S5IL 2JK5A 2NTSP 4HUWA 1TVHA 4M02A 3TPUA 3DMMC 2IPTH 1IAKA 4WO4C 1MCHA 3UJTL 5F97E 2GT9B 1D6EA 1I1AD 3JWNC 1SJHB 2HH0L 3MFFA 2ILLA 1W72B 4LSVH 3V5KB 5IW6A 4QOKA 2BJMH 2BSTB 2DI9A 5T1DL 1LQSR 4MA3B 4GUPA 4L3EA 5A16A 4IEFB 1YDPB 2E5EA 4OZIA 3EKCA 4RMQA 3BWAB 4KQ3H 5C9KA 5T3XD 2BDNL 5EOCL 2GYSA 4G8EA 4XAKD 1UXWB 1QSFB 1H0DA 5IFHL 5CGTA 4BZ2H 1CYGA 1NGYB 5BS0D 1PKQA 4U1JA 1IGTB 2DIAA 3MA7B 3VMPA 4ORGA 1BQUA 4NHCH 1QLRA 4HG4K 4ONOA 4WEBH 3V4VH 4U6YB 5GS1C 3H0TA 2JTDA 1KBGL 2GAZB 4ELKB 1II4E 4AEIL 1YMMD 4QOKD 1A2YB 3WO3B 1JJUA 5E4EC 1FC1A 2IADB 4OD3H 4TTDC 5C0CA 3ET9F 3BEWA 5F1KC 3DUUA 5JORA 4LSQH 1DBBH 1TCMA 2UY7A 1KB9K 2CLZB 5I8OH 4DGIH 5E24E 4ODHL 5CFHA 4OCXH 1WEJL 5DHVB 4HIIB 4RGNC 5D1ZB 1KXQE 2QSVA 3D18A 4DCQA 4MXQD 1AD9B 4KWUA 1KPRB 1MSPA 3FRUB 3ZE1E 2FHCA 1WZ1L 4PJCB 2X9YA 2C4FT 1EHNA 3TNNB 5EZIH 1DQTA 1RULH 2Z93B 1PDKA 1QSEB 1R3HA 1OSPH 4UOW1 1B4JL 2FL5A 4I9WD 1VGKA 3LV3B 4JM4H 4L8DB 3CFKA 3EZ8A 3P9LA 5HJ3B 5D7KE 4LF3A 1WIOA 3EGSA 3G5VA 5SX5H 2BFVH 1MFEL 5DD1L 4K2UL 4BFBD 1N7MH 1CFVL 3Q6GL 4FZ8L 5C0BB 1JGUL 1UFUA 4MAYA 5FO7B 1FZJB 4NQSA 4UB0L 3OG6B 4YHPA 4QXGL 5B8CC 3WXWL 1I8MA 2VLRD 3CXHK 1A1OA 4LVHC 2MMXA 3PWJB 1INQA 3NZHH 4IRSB 4HKBB 2AEQH 3NABH 5D5MB 2G5BB 4FS0A 5D71H 2A74A 1MCFA 5T33L 1DLFH 1JTPA 3QIWD 5JW3H 4JN2A 4CW1B 4PRBB 2V9QA 3UO1H 1TJGH 5DJ2B 3V6FA 1NL0H 2XWBB 3I02A 3RVTC 1OP3H 5BMFL 4IJ3C 4HV8A 5E6IC 5E1AB 1G9NL 4YBLC 3MODL 5C0FA 1OAQH 1QBBA 4UILH 1HSAB 1HHKA 1UWGH 3V52H 3DPBA 1B4RA 3BIAX 4RFEB 5SV3A 2VLLA 2O5YH 3QFDA 1Q1JH 2XNAB 5FKPB 1I7RB 1XR8B 1A6UH 1EO7A 2QSTA 2CIKA 3MTRA 3RBSA 1WC7B 3T8XB 5K9JH 1UCBL 3I6KB 2DM2A 4PJXE 1BFOA 5DVMA 1P7KA 1A47A 2FX7H 4UI2A 3T77B 3QCUL 5I9QC 2Q6WB 1JRHH 4UV7H 2DQIL 2ICWI 4PGBA 4R3SA 4MNQE 3VXUB 4OZFG 2DI7A 4TQEH 3BMVA 3GGWA 3P11H 2CIIB 2H26A 3IETA 4PJFE 4GRWH 5TE4L 1P4LA 2EO1A 1JUFB 1GIGL 4BH8A 1KJ2L 4PGJA 3PHSA 3GHEL 3S3PA 2HJKB 3GI8H 3UTSE 5HGBA 1CR9H 4JO3L 1OP9A 1CFQA 4OZGE 1B2WL 3BZDA 5ALCL 3L5XL 4WTXA 4PRID 1XGPB 1FNLA 1MCWW 4NKDB 4X4ZA 4C56A 4Z18A 1JNHA 3D0VA 4GAJH 4WW2B 5IFAH 3SKJH 5I1IL 1IKFL 5BV7H 5L2KD 1YUHA 5GRXG 5DURD 3QUZB 4AT6A 3V4PL 5CZVH 2CXGA 4P2OA 2DQJL 3T65B 1MWAA 5HPOA 3S8WA 3GI9L 4ZAKA 5FHBH 4HEPG 2NY3C 2B2XH 3QDJA 1YQVH 3G6AA 3UJIL 2A6KA 2X4OA 5JXEA 3BP7B 1BJMA 4OZHF 5DURB 4UTAL 5I6XC 2GK0B 5IT2H 5BV7C 1TVBB 4LQ1A 5EC1A 4IRSA 3ZE0F 1QUNA 2NXYD 1AFVH 2HMIC 3JUYA 4WUKL 1SJXA 1TLKA 1LK3L 2EEDA 2FJHB 5J12C 3IJHA 1ZA6B 3P9MB 3RDTC 4ZNEE 1XF4B 3WFDH 3V6ZB 5F3BB 2VLKD 2X70B 1J0KA 4NUJA 2UZIL 4LPYA 1YEGL 1UYWH 2EH7L 3Q0HA 3RY4A 5LXGL 1T5XB 4NJAL 3MCLH 4RFOH 5ENWB 1JZ8A 4HHAA 2AV1B 1J8HB 4ONFL 3HNVH 5F89B 3MUZ1 2YPLA 5JO5A 5JLZA 5K9QG 1TVDA 2FEEL 1NAMA 1GXEA 4NQVB 2VE6A 3FQTB 1V3KA 1D6EB 3QIUA 1FLRL 3TBVB 3LZFL 4QXWA 4DKDC 1IC4H 5ILTH 3T0AA 4U3CA 2R0LL 4M1DL 1LDPH 4M1GL 2E8ZA 5J6GA 4JLRA 1AXSB 1UKQA 4X6CF 3MRFA 3VD7A 1RD6A 4N5ED 2XRAH 2JJSA 3PWVB 4CAGA 1XF3B 3SGDI 5B39B 2UWEF 5MEQA 2KQMA 5D70H 1RIUL 3HE6C 5DRWB 1CLOL 4FTVB 4AIOA 1T2QH 1S9XA 2EXWD 1FSKB 4L3ED 4ZO7A 1T21A 4KK6C 5D1XB 3L95B 5F21B 2DKMA 1TTFA 3E3QE 4L4TB 4KK5C 1LD9A 3BDXA 2ZOLA 4ZUWA 1M05A 1DVFC 4FRWA 5EU4B 4YDVB 1MJ7H 1WAAE 4Z7WA 5FOBA 5EBMA 3CLEL 5C86A 2GTWA 5DC4B 2EDBA 3QO0B 4EXPX 5J1SC 2MQ3A 3K1DA 4FFWC 4N0YH 3F12A 5IK3B 3OWEA 3TCXA 5DMYA 1Q9OA 4L4TD 4I0PA 4P23C 5GGQH 2CDGA 1NCTA 3Q1SH 5CJXA 4KAQH 4XT1C 5BQ7B 2GKIA 1GVIA 4PP1D 4CADB 2EYSA 2CLZA 1A0QH 1ORSB 4UU9A 3FOMB 4Z8FH 1G7PA 1AE6H 2DIJA 3WFCL 4F15B 1CTOA 1K3IA 5GS0C 2VQUA 5IW1A 4POZC 1YNTA 5T3XL 1ITBB 1CD9B 4OI8A 4FQXA 3D6GA 3G5XB 4OUOA 1GOGA 1HWGB 4DKEL 3LH2H 3T0XA 4JRXB 2BX5A 5FB8A 4K3EL 1MPAH 3LRGA 3O9WB 3T3PF 5JXEC 1WWWX 1T89C 2X10A 3BZEB 3EGSB 3T2NL 3O6FA 4J3SA 3PWUA 4I0PC 4P23A 4RMVA 3UAJC 1NFIA 3HE7C 4LHUA 1HN1A 4TVPD 3C6LB 3MLWH 3T0BA 3SO3C 1JNNH 2LE9A 3O4LD 4Q74A 3QPXH 5MEOB 3WUWA 4JFFE 4L4VB 3EJZD 1ZTXL 3BP4B 1E0OB 4FQXC 4TNVK 4CMMA 1JWSA 1MCIA 2Q76B 4ODUA 2EDRA 5ELIA 3M8OL 1P1ZB 4IHOB 4OGXH 3R8BB 3FTGB 3RWDA 4O2FB 4Y19D 2XWBA 3KPNB 3OB0K 1CGYA 5IMMA 3ULUH 1O7SA 1BQLH 2ED8A 4GRMA 3T65A 2P49B 3MV8B 1U8OB 1WLHA 2V9TA 4LSRH 1ZLSH 5F93C 1DQDL 2DQUH 4WO4A 5FO9A 3BQUB 3DRQB 4X7EC 4FMKA 3BW9B 4TOYH 2NXZC 2QHRH 3O2DH 4RQQA 2EIBA 3G5YB 3MGOB 5GZOC 2AJZB 5D2NC 3VWKB 1HINL 3WXVH 4TVSa 5E94B 4HJGB 2NY1C 5J11C 1GHFL 2A74B 4NP4L 2UUDK 2WBJC 2G5RA 4X99B 5DQ9A 3VXSB 2IFFL 3AB0C 1Z3GH 4AG4H 4X80H 1MCOL 4MA7L 4XVTH 1OGAB 2L4OA 3ARTA 2UVEA 4XP4L 3MV9A 4NNYB 3IS0X 3O6MH 4EN3B 2C4XA 4HSQA 3T0EC 5D7JC 5H94B 2A6IA 2F5BH 4MXWH 4M48H 4PV9A 4XPBH 2DQGL 3ARSA 1NGPH 5FV2A 2X89D 1A4KB 4NJ9L 2ZG1A 2CRYA 3KPPA 1P6AB 1P9MA 2QL1A 3L3GB 3HZYA 4JJ5B 5EU6B 5C09A 5L8JB 4Z77A 4WDIB 5ISZA 4QT5A 3DSFL 1N6QL 1FH5H 2EDHA 4EQ3A 1WVZA 3L3HB 3QJHB 3VMOA 1MJ8H 4WI2A 2P8LB 3FAWA 3T8XA 3VGDA 2FO1A 1EBAA 3E6FB 1HHJA 1INDL 3CFDB 3W11C 5J9PA 3MBED 4FXGA 4WUUA 3STZA 4MX7B 5E2WH 4QRQA 3PWLA 1ADQH 1QFUL 4JHBA 4HIXH 5D72L 1IM9B 3QHFL 4WEBL 1KCSH 4G9FA 4ZXBC 2GY7B 5HY9B 4TSBL 2X09A 3OF6D 4M61B 3V4VL 3B9VA 4LCWD 4XBEH 4JZJB 1XCTA 1KG0A 5EA0L 2H8PA 4XP9L 5FM5M 4XX1E 5T1LB 3C6LA 3K0WA 4YHYB 1QHOA 4OM1H 4L8SC 5GZOD 5ACLA 4QHNB 1MFAL 3QXVA 2ZG2A 4GG6B 1BPVA 1A9BA 4BQCA 1DBBL 4PJ5D 3PWPA 1A1NB 4XPTL 4ZXBD 5I1DB 4LLAA 4R4FL 2PO6B 3QWOB 1FGVL 4J23A 1A7PL 1YPZB 3SEPA 1I85C 3VG0L 2AKRB 1BOYA 4P2QB 4XX1G 4Y5VA 2DBLL 2ZCKH 5JMRA 4ZXBA 5JNYA 2IANB 3O3DB 3SQOH 3U46B 3GHBL 3PP3K 2PYEB 3U4BL 3VXUD 3W9EA 1FAIH 3OB8A 2AQ1A 4PREA 5FO9B 3EFDH 5LKNA 3EOAA 4V2CB 4M43L 4JZNB 4Y5YB 2YPVH 4LSQL 2NXZD 4YHNA 1L6XA 5GS2H 3FQUA 4NUGL 4PRHB 4JGUA 2ED7A 4BQ9A 3ZDYE 3ARWA 1BJ1J 3SCMB 1MAML 2MCPH 1BVLA 2ENYA 3FL7A 4OCYL 1YECH 3JV5A 2YWZA 1RHFA 4X7SH 3O6FB 1EZVX 2VLJD 4XCFH 3KYOB 2PXYD 3SKMA 3MJ9H 1RZGA 1UZ8B 3EOYG 3BN9D 3M07A 4MJ6A 4MJ5B 3W5MA 3UO1L 5EBLB 1TJGL 3TM6A 2HTKD 4UQ2B 5CIPA 4YFEA 3U4EB 4AEFA 1PVHA 1IQDA 5H2BB 2W9LA 4U6TA 4UILL 1MY7A 1H15B 5T1LD 1M7DA 4ETYA 5MEPB 3C60D 1DN0B 1LO2L 3DV6B 4JY4A 1I8IB 3MXWH 3QP3A 5ICYA 2CUMA 1KIUA 2VZ3A 2Z31A 2R2EA 2PTTB 4C59B 5GGVY 4TNWK 3KLDA 5FOBB 1QEWB 2HTKC 3S34L 3U0PB 4CBPA 4QY8A 3NABL 3DUSB 1AHWB 3HZMB 1CT8A 2FCBA 3IU4L 5DI8A 5JA9A 4YXLH 3F12B 2QV2A 1LGVA 4H25A 5H35B 1QA9B 4K71B 4UUJA 2HAZA 2B1AL 2FJGB 4PJEA 2G2RA 3RVXC 4L8CA 2EDEA 3VXMD 4OLZL 4QRPB 3RUGB 2HMID 3S35H 4MA8H 2I9LA 2N7BA 4F7MA 1TETL 4X7TA 1PX4A 3BKJL 5DD3L 3KHQA 3S5LB 1UWGL 3V52L 1IL1A 2HTLC 3GZKA 1NGZB 3ISWA 5DJDA 2G60H 2OCFD 4I5BB 3QRGL 4XP6L 5EZLB 5GRVL 3D25B 3G5ZA 3MQIA 3UTTE 4KVCH 1MHHB 4PRDB 5KVDH 1A6UL 4P2OD 4GOSA 3ZKQD 4MNQA 1UEYA 4HMDA 1UCBH 5ALCH 2QLVB 3QFJA 1EVTC 3UCRA 3GEWB 4YGVB 3MRLA 4UBDC 5I73C 3DMMD 1CBVL 3OKOA 3LS5H 4S11A 3RZCD 3QQ4B 5DMJB 1JRHL 3G9VA 5BXFA 2EYSB 2A83B 3LB6C 5IB3B 2PN5A 1EEUA 2R0WL 5F9WB 3WIFB 4MJIA 2N1KA 3O41A 1MCBA 2Q8AH 3QFJD 2R2HA 3QDMA 3H3PL 3QUXC 1C08B 5F3HB 1OM3H 2W60A 3R06A 4EUPA 3H9SB 1AI1H 1QBML 3GJFH 3OKKA 1U92A 5GS0H 3X3GH 1JWMA 5T1KA 3JV4A 1H5BB 3U6RB 2P8MB 5F70A 4CVXA 3Q3GA 5TGBB 1YEEL 4MDIA 1P69B 2CIKB 5I1KL 5DRXB 4PLKD 3EOBB 3TJEL 1WCBB 4JQXA 3D9AH 3MR9B 1EMTL 4KK9C 2ESVB 5KVEL 1A5FL 2I9TA 4Q6YA 4XH2B 1CL7H 1JRHI 4N0CD 3HR6A 4IMLB 4ZUSB 1JWUA 5KANG 3STLA 2P24B 1BGXH 1JV5A 4LP4A 3HZKB 4WUKH 5IFAL 4JY5H 5FYJU 4QGYA 4Z7UF 3RWEA 1WBZB 3IXAB 4LU5L 1EBPA 3SJVE 2Y5TA 1U8MB 5JW5A 1T2XA 5K9OA 1FL6B 3QULA 4NJAH 5GS2D 1PQZA 2ATKB 4HKZB 4F7EB 3GI9H 4OT1H 3ARUA 4HIJB 3EYSL 5FHBL 3WJLC 1MFDH 2KPNA 4IOIB 2NY2C 1M4KA 5JW4Q 1G7HA 2BNRD 5FYLE 1SEBA 2QBWA 3QT2A 5IT2L 2H41A 4DAGL 4MQXD 3MPCA 2D31B 2F74A 4JFEE 4NWTL 5BV7B 1QYGH 4MCYB 1IC4L 3MV8A 1UACL 2H6PA 3DMMB 4U1HA 3IDNA 5F1SA 4X5XA 1KLUB 2QQNL 3G08A 1KCLA 4JKLA 5EU5A 3IU3B 3BUYB 4XVUC 3WS6A 3LB6D 4WHTB 3RVXD 3TBTB 5JQ6L 3BPNC 5JXED 2K7PA 1ZWIA 4J3VA 3CPLB 3GUTB 4MLIA 2BY3A 4W6YB 3TIEA 3OAZK 2AEWA 4FTVE 5E94A 1VADA 2DQEL 4JKKA 4JFYA 2CMRH 5HXMA 1RIUH 2ICWA 4WHDA 3SDXF 2RJMA 1P7KB 1ZHNB 1VHPA 4CU7A 3TYGH 4AMKH 4PR5A 1KTLB 3LQZA 4UTBH 5DRZA 2R0ZL 5MENB 2YKLL 5H94A 1QSEA 5ILTL 1SBSH 3P4OB 1IQWL 1EXUB 5D4QA 4G6AC 1MNUH 5D1QA 1DN0A 2J88L 1AP2A 1OSZB 1YEDA 2XRAL 3VFUB 4XNMA 4CU6A 3EIFA 4FXKB 5INDB 2H45A 3UYOD 3VXMB 1ED3B 4MSWA 5ESQB 3QJHA 4KMTH 1RK0A 5GS1B 1HXYA 1QP1A 2YUXA 4DTGH 5DFVC 1AGEA 4G43A 3HE6B 5IQ7L 3GB7A 4I1NB 5SWSB 1UWEL 3UBXA 4TUOA 1A6VH 5FO8B 1T04B 4YFLF 4MDIB 4LLMB 4TNVF 1AR1D 2WINA 4ZTOL 3ZL4L 1MOEA 1D9KA 1BVKB 5F8QC 3TV3H 5FYJL 1RK1A 1T0MB 3VCLB 1W0YT 1X6LA 4HJJL 5SWSD 4UT6H 3S96A 5ESVB 4ZFZA 3PGDB 4FQ2H 1MI5D 4XWOD 4LASH 3QCTH 2AVGA 4ZUUB 1VKXB 3OXSB 5F7UA 2OYPA 3PV6A 2J8UA 1A0QL 4Q6IB 4MXVF 4F2MA 1T21B 4DGVH 5FA4A 3WFCH 4H8WC 5D1ZD 1FPTH 3VRJB 4LVHB 3OJMB 2AKRA 3DRTA 4IRSC 5GRUL 1UZ6F 2D3VA 4HK0B 2BY0A 3CZJA 4AEHL 1LO4L 5E8EA 2UZYB 5CZKA 1FVDA 3NIFE 3ARRA 4XWOC 4Y4KA 4JO4H 3M8OH 1OSPL 3ARGB 5GPRA 5DUPH 8CGTA 1URLA 1T80A 2KH2B 1C08A 2BZDA 4BFGA 3V4UL 4I0KA 1KTDA 4GSDL 3NIDE 1PEZA 3MRIA 5L2JB 2FGWL 4LSRL 1CVRA 2R1YA 1DTUA 3Q6GH 4TOYL 2A77H 5FA3A 3O2DL 4NQEB 3IFLH 4LVEA 1XZ0A 3SO5A 5E99H 1CXIA 1UA6H 4URTB 3JV6B 4JFPB 5DMKB 4R8WL 3V6OE 1V7MH 1NBZB 2AEQL 1NMBH 4LMQE 5T3ZD 1LDSA 5GGVH 5KSBA 1XMWA 2VYRE 4PLOB 5C7XH 4YHMH 4WGVB 1MUJB 4GMTL 2ICEB 3QUYC 1Z9OA 4M5YL 3X11B 2BVQA 5J13C 2VKXA 4XVJL 1G9NH 1U91B 4H0HB 2B1HH 1KB5A 4HF5L 3TA3A 2DB8A 4GKZA 1DQDH 4K9EH 3W5NA 3B9KD 4ODWB 2X5PA 1KIRB 3E1F1 3EYVA 2GITA 2X7LB 3ZLQC 4FA8A 1FO0L 1XR9B 2J5LB 4NQUA 4P46D 1Z5LA 4K3DL 4PJAA 1JYNA 4OM0L 5EC1B 1M7IA 2CXKA 4RSVA 3QUYA 4YPGA 2VLJB 2NY7H 2E9WA 2WSKA 5BO1H 3E6HA 5C6TL 2RIKA 1XGUA 4EUPG 5IFJB 5FGRA 1H8OA 1DFBL 3G04B 4UV7L 5C0DA 3PQYB 2F53B 3H42L 3SDCC 2XT1B 1D9KC 4JB9L 1HZHH 1NFKA 4XPHH 5C1MB 5BS0A 5JDJA 1JWMB 2HWZH 1B90A 4KHTH 4NQED 1QRNE 4TUKL 4JG0H 4OM1L 4KJYB 2R69L 5ID0A 4OKVA 1TXKA 2B8OT 4XPTH 3TBVA 3BP5B 3WFEH 4FFYH 2YN3A 5HHNB 1QFHA 2MQCA 2V9RA 1BFSA 5CUSH 3HI1B 4C56D 2WM0A 5EN2A 1EFXB 4R26H 1NJ9A 2EEBA 3HC3L 3S4SA 3BD3A 1FZMA 3KHOA 5DUMH 2C26A 3ETBF 3TN0C 4IRJC 1BZ9B 1MHEB 4NZTH 3B9AA 2XA8H 3CSGA 4LIQL 2EC9U 4QNPF 4CDHA 4LVOC 4P57A 4Y4HB 3QQ3A 4E0RA 5FO8A 3MBEC 4Q2ZB 1VCAA 5DUBA 5A2IH 1RIVL 3B3IA 5HHOD 1NBVH 4R0LA 2YRPA 1X5HA 5L88L 4HK3J 2R2BA 4XHJD 1SYVB 4NUGH 4JJHA 1IAMA 2GK2A 3CFDA 4P2OB 2BVOA 4F80A 4BSVA 4OV5B 4KV5E 4NZDA 4YXKH 1S5HB 1OAKL 3BGMB 2DBLH 4NT6A 3DO7A 5HHOB 3LKSA 4M61A 3BJLA 5GRZA 2FATH 3B6SA 3QG7L 3R4DA 4JCMA 3RKDD 1G7JA 4RWYL 3MA9L 1K2DB 4OF7A 1R5VA 3QI9A 1ZWIB 4NSKA 4O5LH 5ACZB 2R1XA 4CADA 4XC1H 3KPRD 1S9WB 4JCLA 3MACL 2NX5E 4YDIH 4YUEH 5D2LF 3DX9A 1NKOA 4WRLA 5EWIH 1Y6KR 5IP4A 4Y5YC 5C0CD 1F2XK 3BVNA 5IB2A 3N85L 4CUCA 4Z7VA 1EEQA 4KUZH 3LZFH 1I1AA 4M9OA 5IBUB 2P45B 4XP1L 3L3GA 3V8OA 4Z95H 1MF2L 3VE0B 2R0LH 4M1DH 4M1GH 1SY6H 4U1NB 3QHZH 2OLDA 1HDMA 5JNYB 2NY5H 1F8TH 3CD4A 3GSVB 5DF0A 4Q58C 4V1DA 1RU9L 2IPUK 3U0TA 1KN4H 4DVBA 1KB5H 1Z0MA 5L7XL 5L0QC 3QEQA 4MA8L 4X6EB 3ZE0E 1U2CA 1T2QL 5ACMA 5F1IB 3AREC 1R3HB 1J8HE 1GL4B 1WAAF 4EDWL 4XHJC 5ADPL 2ED9A 4QKXB 3QRGH 3LAFA 5E5UB 4JANA 4C57C 5C0RH 1FVEA 4XRCB 4BFIB 3RWHB 3D3VE 3IJYB 4F3FA 3HS0A 5HYJE 4HBQA 1KB5B 3KPNA 4BZYA 4AT6B 4YQXH 4YXLL 3O9WC 4LHJB 4MMXC 4JRYD 4NQSB 2ZUUA 4DEPC 4QXUH 2C1OB 5D7IA 3RKDC 5IJKA 4PBXA 1NFDF 3OBAA 5DD5L 1M05B 5D6DC 2Y72A 2Z91A 4OLZH 1MFCL 1CGXA 4I3GA 3V0VA 3PE9A 1FC2D 5LWYH 2CKBH 3BKJH 4Q7DA 2Z92A 1GZQB 3CUPA 5CHNA 4M7LH 3QPQD 4PRBA 1IKNC 4JY6A 3S7GA 1I75A 1Q0XL 4HIEA 4S10A 5DJAA 4D9RE 3VXTA 2YSSA 4MB3A 5TDNB 2EDNA 4L4TE 5KVDL 2YA1A 4N0UA 4XPGH 3RPIB 2EH8H 3U36A 4JRXD 1AQKL 5HGDA 5DHYA 3H0TB 2FO4B 1KJVA 2DKUA 3MLXL 1Q72L 1U8NB 4YHOH 3U30C 3OKLA 4X4ME 2B5IB 4Y5VC 4XNXH 1FZOA 4RGOH 3T2NH 3G5XA 3KNBB 3LS5L 1IEAB 2X1XR 2IADA 4MNHB 1CE1H 2FHFA 4HS8H 1BIIA 5BRZB 2E6PA 3W2DH 4JRXA 5ID0B 5JO5B 5FV1L 3VD3A 1C5DA 3VRJA 1QSVA 4M7LT 2DM7A 4P4KC 4PGEB 2W0PA 2VRAA 5C2UB 2X89A 3RUGF 2ENSA 5JHDA 5K93A 1A4JA 3LSOB 3K8KA 1FIGH 3EO0B 2NR6D 3L5IA 1FL5A 4G6FD 2VUYA 4GRWF 1FNSH 5D2NB 3VWKC 3ULUE 3VD9A 1JVKA 1ZHLB 5E8OB 3V95A 1E28A 4OAWA 2IAMB 5FYKL 1I8IA 1F02I 1A64A 1U36A 5ITFA 5BRZE 5IHUH 4F57H 3WSQH 4X5LA 3U0WH 3T4YB 2IBZY 5D1XA 1G7LA 3FQNA 1T3FB 4HFWB 1UJTA 3MCG1 4HKXA 4NCDA 4TULL 2Q8BL 2I60H 4O2EA 1U93B 3KPOA 1T03H 4N0CC 4XP5H 3TYFB 1F11A 3TZVA 3WE6B 5GJTL 3BW9A 4KKCD 4AJ0A 3E6HB 5MHSE 3TYGL 1UJ3C 2R23B 1UH3A 5TH2A 1K2DA 1CIUA 5I8EB 1Q9OB 1R3LB 1ZA3B 2R29H 3FFDB 5EOTA 2VC2H 3WN5C 43CAB 4ODXA 1IL1B 2XZQH 3VH8A 5ANMA 5LBSL 4OFKA 3WFBL 4NBZB 3X17A 1FVCA 1KIRA 2VZUA 2FYYB 5CCKL 1X5LA 2FD6H 4PJCA 5ID1B 1WGOA 1RJCA 4OI7A 5EUOB 3OAZH 1KJ2B 1CF8H 5MHSD 3BKCL 5IJKC 3MOBL 3U7WL 3FQUB 4ZSOE 3QFJB 2YD4A 3QXUA 3VFTA 3HRZB 5EH1A 4HLJA 4OB5L 4E41E 5I1HH 1INDH 2PYEE 4HXBL 4FABL 2XICA