5LGKA

Crystal structure of the human ige-fc bound to its b cell receptor dercd23
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
307
structure length
307
Chain Sequence
b'VKILQSSCDGGGHFPPTIQLCLVSGYTPGTIQITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig epsilon chain C region
publication title IgE binds asymmetrically to its B cell receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA03
4FQXA 1VGEH 4Y1AD 3WS3B 4DGVH 2QR0B 3CVHB 4FFZL 4XBPA 1Z0NA 4LBEA 5IFHL 2LE9A 2X4RB 5FUZH 5IHUL 4DN4L 1WFNA 5HPOA 4GMSL 4TRPH 3IETB 5E4IA 4Z8FH 1NCUA 2AJYH 2Q6WB 1RUAH 1DFBL 3DO3A 1A7PH 5ETUA 5HHQB 1L7IL 5TE6H 2DDQH 1A3LL 3KAAA 4ONHB 5DJXB 4RA0C 1F45A 1MIEH 4XCCH 2CGRH 2AEPL 1H5BC 1N59A 3MCLL 3P4OA 4XZUB 4P9MH 4PY7B 5ICZB 4MNGA 1QFUH 4FQQA 1GZPB 1CD8A 3KLSA 1UWEL 3QUMA 3NVQA 1FH5H 3D3VA 3IJYA 3UTZA 1S7UA 4DTGH 1EXUB 1C12B 3WFCH 5D9SA 3MBED 1X4XA 3JWOL 1HI6A 1AHWB 1V5JA 1K8IA 1CGXA 1ZHBA 3TH3T 4WUKH 1NCWH 2EIEA 4NNPL 2DQHL 5KJRL 1A1OB 1AD9A 1N7ML 1JHTB 1DQML 2AEQL 5ACZA 4PJGA 3KPPB 3SDYH 4DJMA 4Z7QF 2DQCH 3AS3A 4MA3B 1I1FA 3CFJA 5EOTB 3QFJB 1FFQA 2EECA 2Z31A 4Y5VB 1GGBL 1AXSB 4X4ME 2VLRE 1NGWB 3DTXA 3U46A 3KR3L 3KWWB 5MEQB 1ETZA 4TNVF 4DZ8A 1WZMA 1XR9B 3CFEB 3PJSB 1AJ7L 1CZ8L 5LGHL 5IJKC 1FIGH 4KPHH 5JQ6L 3F8UB 4PJXB 3WHE0 1X5ZA 1I85C 1ZE3C 2GJ6E 1LK3L 2B5IC 5ID1A 1J05A 1DSFL 1MHEA 4X5XB 5D7KD 5FDWB 3QFDB 3VXNB 2NY4B 2A73B 5BQ7B 3OR7B 4O58H 3GFUA 4ZNEE 1Z3GL 3O3DA 5CZKA 3O6LH 4N5ED 2ADJB 2DBLH 2P8MA 3WN5A 2A2QT 5C6TH 2G60L 2J3SA 2DQIH 2DJ4A 2FX7H 1NPUA 4JM4L 4AH2A 1FVDB 3MRLA 3A67L 3DX8A 4OZHA 1ZHLA 4DGIL 4Z76A 4HS8H 5D2NA 3MODL 1Z6JT 1C08B 1MRDH 1QZ1A 4R26L 5EH1A 1VERA 4OD3L 4XI5D 2EIZA 3OGCA 4IMKA 1IM9B 4PRPD 4K3DH 1DQLH 2GJZA 4YX2H 4ZQKB 3T2NL 2ESVA 5D7IB 3UEZA 2ICWJ 1KJ3H 1UCTA 1XH3B 2CLVB 3MUZ1 5D7SH 5E2UH 1H8SA 1LEIB 4FXKA 5IW6A 4OM0L 4OCRL 2W0FA 4KDWA 2NY2B 1K85A 3OB0K 3O2DH 1T3FA 1IAII 1PKOA 4WWKA 5A40E 4PJ7E 2N1KA 1IAOB 3HPLA 4YPGA 2I24N 4LEOB 3QUZB 1HNFA 3UCRA 1RJZB 2VMFA 3ARUA 2LVEA 3IT8D 4OLZL 3W11D 5KZCB 2EYSA 3B5GA 1YYML 3MRNB 4MD5A 2K3TA 3QT2A 3T0EE 1TPXB 4EIGB 4LVOB 2QQLL 3F6IA 3MRKB 3EJZD 3RZWA 2FH6A 2X4SA 4K3JL 3RU8H 2YC1B 3TN0D 3I3BA 4MLIA 4G6MH 4M62H 2Y36L 4XPAL 4Z7UF 1LD9B 3MRJA 1DUZA 3BQUC 1NAML 4KUZL 2GTZB 1BVKA 1HWGB 3QCVL 1R3IH 4S0SD 4Z95H 3HFMH 1ONQB 2Y72A 3T0VA 4J3VA 2KQMA 5HDQH 3TJEH 5AUMB 5E6ID 5LKNA 3U1SH 2AI0L 3ULUE 1J1OH 1KCRL 1NCDH 2BJML 3FMGH 4YFLI 2C1OB 3GM0A 5L2JA 3C8KB 4K2UH 4P2OA 5FV2A 2XICA 4X6DE 2L7JA 3QPXL 5F6HI 3QIBC 1KB5H 3VFSB 5IJVB 2EE3A 4Q0XH 2MJWA 4EBQL 5I18H 2B8OT 2H9GA 5TF0A 5DJ2B 4JHAL 5FYJD 4TVPD 3FTGB 4JRXD 3O9WC 1U93A 4RBPH 3F7RA 1KXQE 1I3GL 3QISA 2EC9T 4DGYH 1VB9A 2P24B 2Q7NA 1T1WA 5GS0L 4WUUB 3MV8A 4HGWA 3OAZH 2YD9A 4ZFFB 4O51A 1B0GB 2P8LB 2YPKA 3HB3D 1X3DA 4FNLH 3D85B 4KJYA 1HHIA 3D69A 3NIDE 2IBZY 1EVTC 1UJ3B 1MI5E 1TZIA 4KZEL 4IIQB 5GZND 2HVJB 5C70A 3QQNA 4G9DA 4HUVB 1MFDL 5E8NA 5DMYA 2NNAB 3LN4B 1W72H 2EIDA 2XY2A 3I75B 5DJ6A 5GGRB 3T0EC 2DQTH 2ITCA 3RNKB 5ANMA 3IF1A 3WHXA 1I4FB 3EIFA 4MNQD 5CJ8A 5TE7L 2EKSB 4NC0B 4XNYH 5DYOA 1EO8H 1J1PL 5IMOB 3T1WA 3MRMA 1CK0L 3PXHA 5T5NG 1NMBH 1QR1A 1EZVY 5IBLC 2BVQB 1U36A 2VNCA 3T0WA 1MCJA 5DUML 4X7EC 4QTIL 1ZLSH 4PRDB 2VRAA 3UPCA 1MWAB 4DEPC 3ULUC 3T8XB 1CICB 2NY2D 4GXUM 3HI6H 3WDIA 2YPVL 2Y1VA 1F02I 3B2VH 4ELME 4LLVA 1AKJA 3QSKB 3WCYA 1LE9B 3LDBC 1MCEA 1HQRA 2XA8H 4X7SL 3SDDC 2O5ZH 5D6DC 3IAQA 1RPQA 1FORH 4PGEB 2IH1B 5CBAA 2CXKA 3GKZA 1YN7A 3PDDA 4O9HH 3QUZD 3S96A 4Z0BL 2F54D 3V4PH 3OKLB 1XF4B 3EDJA 3BRFA 5KG9A 3DROA 1HDMB 3SGEH 5A16A 5IF0B 3SDCB 5F1NB 3O3BA 3KS0H 4HEPG 3QEQA 3MRRB 5FO9A 4LPXA 4LPTA 4HUWB 4M00A 4YGAB 3QHZL 5D7JD 5SX4I 2I25N 3GBLA 2PCPA 4M7JH 4KDTA 1H0DA 1JMXA 3MV11 2FWOB 4PJHF 5DMIL 2VH5H 5L2KD 4TPRL 3BGMB 1M7IA 4WV1B 4LLDA 9CGTA 4JY6A 4F7MA 3ME0A 4XXCA 3STLB 2QADB 2X4UA 2DLGA 2IALB 4OF7A 3QP3A 4GG8B 4L4VB 5IBTL 3N1QC 4CVXB 4FXGB 2NZIA 5JHDE 3TPUB 3JBG7 3PHOA 3G6DH 3HA0A 5IIEB 3ES6A 5I16B 3KLHD 4B7IA 1E4XH 1EJOH 3HAEG 2WBJA 5DMGD 1AGFA 3A6BL 5FUCE 2A6JA 4P59L 4M48L 2D2OA 2R8SH 1GOGA 4YC2C 1HOCB 3TO4C 3L7FB 4GMTL 1EV2E 3QWOB 5GGSA 3D0VA 4RGOH 5IB5B 5TE4L 3KPSE 4MQTB 3BXNB 3BUYA 3RDTA 5K9OB 4WI8A 3MC0A 3FRUA 5HYSB 4OI8A 3EJJX 4LLAA 5DRZA 5E00B 4K8RH 2DQDL 3JTSA 5ITFB 4APQB 4QY8B 1IGCH 4NRYB 1ZLWK 1JTPA 2EYTB 4DVBA 2QL1A 5T33L 4FOMA 3SJVB 4HBCL 3I9GH 5ITBH 2HJFA 2HTKC 4KTEH 2EYRA 5ILTL 3U36B 2BNQA 5CGYC 2X2YA 3Q5YA 1TJIH 4M03A 4PRBA 1KEML 5KVDH 1U3JA 3QQ4B 4P0DA 4JQIL 1CFTA 2R15A 3L3GB 3PHSA 5IFAL 2XZQL 1ODAA 1UJTA 3O2WH 3VCLA 3IU3A 1NEZB 4JPVL 4FABH 2W60A 3L5XL 2A1WH 3BKMH 4HIHA 5E1AA 5T1LD 4JG0L 4Y4KB 3CMOL 1RZ7L 4E5XB 5I0ZA 2VLLA 4NZUH 4YE4L 1IZKA 1OTSC 1U6AH 1GC1H 4JPIA 3EYUH 1BVLA 3QG6A 3O6MH 4NM4H 1UYWH 1A7QH 4R4BB 4YHYB 4HCRH 4LF3B 5GSRB 1IFHH 3ECBB 1QR4A 4CW1B 1MAML 2XQBH 4RX4D 3EOBB 1BZ7B 3SDXA 4N90D 3KPRB 3VRJA 5F9OH 5K9JH 5DUPL 5DT1H 3F7YB 3MXVH 2DTMH 1JBJA 4HULB 3RGVA 1N0LA 4Z77B 2Q3AA 2NLJB 1EFQA 2IBZX 3QIWA 3V4UL 1AGBA 4OZGE 3V5DB 1KYOJ 1K8DA 2VDPH 1MFAL 2CKBA 3NIFF 4RDQF 3VGDA 1OPGH 2PTTA 2N7AA 3SDCD 1FO0H 2Y06L 1RFDH 3O11A 4POUB 3ZDZF 1CBVL 3NFSL 5ICXB 1JWUB 3MNVB 3T4AB 3UTPE 5C0AA 4EUPG 1GPOL 3BH8B 5DJCB 4ZOCA 3WSQH 1EX0A 2BHUA 3QJHB 4JFDD 1EBPA 1YY8A 5ESVA 4POYA 4JDZB 1JHLL 1RJLB 2I9TA 5AAWA 3RZCA 1S7SA 3IFPB 4XVSL 2DQJH 3VWKB 2BK8A 2XNAA 4POZD 3WJLC 1EZVX 1DCLA 3TT1L 3MYJA 2QADD 2YKLH 1AHWC 3D39B 2PUQT 5DUBB 1SMAA 2NMSA 3HAEA 1NCCH 3SKMA 4JFFA 4L4VD 2GHWB 4GAYA 1RAMA 4YDIH 5C71A 1ZT7B 1D5XA 1KACB 2VDKL 3QA3A 4EI5B 3DRTB 5SWSB 5I17B 3VFUA 3PWUB 4LSRH 3DGCR 4HPOL 1D6VH 4FTVE 3BMVA 2X4QB 1YEJH 1CGTA 1XGRB 4FHBD 2H2PD 1YEGH 4Y5VC 3AB0B 2FBJH 1H15B 5KAQF 2GYSA 5D70H 1CR9H 3WEXB 4JZJA 1UM6L 4J6RL 1JPGA 4YAQA 3QH3A 4KMLB 2VL5B 2HT4C 1LO2L 3GSNA 3HB3C 1KSRA 4R2GC 4APQD 1P4IH 2VDNL 4FFWC 5C07A 3PF2A 5GZNC 5C0CB 3K2UH 1U92A 2NY4C 3PP3K 3MZGB 3PQYE 3T4YA 4GRLC 1SJEA 4PR5B 1LO3H 3VDCA 3SKOB 4NGHL 4Y19A 3MV01 5GS2H 2V9TA 4LDOB 3N1GC 3PL6A 3G08A 1A6VH 5F7DA 4LSUH 3ZE1E 4L4TB 4ZYKB 4HH9B 4M5YL 2WIIB 5CHNA 5FK9A 1P4BH 2QHLA 4NO2B 4EDWH 1SQ2N 3L7EB 4WW1B 2HWZL 4S2SB 1E6JH 3MV9E 4ETQB 4MWFB 5JO5B 4GAGL 3GHBH 5GSVA 4HWZA 2DQEH 1UKTA 3ILPA 1U8KA 2OJZL 1JZ3A 1N64L 4WTZG 4WI3A 4F2MA 2C7UA 4OF8A 2Q87A 1I3UA 5J7CC 3DRQA 3LEXA 3TF7C 4WFHE 4X98A 1KXTB 4QYOB 3NABH 4H20H 4PTTA 4JPKH 5B8CB 4C59B 5SWZA 2DWDA 5EU6B 1UB6B 3MGTB 1BBJB 3QDMD 4K9EL 4Y4HA 1NQBA 3J7HA 2MQCA 3FB7A 2PYEB 3KPRD 4KTYA 3N50A 1RZKH 5E94A 4NKDB 1J9CT 2NY6D 4OIIH 2CUIA 3WXWL 3NFPA 4U0RB 1IL1B 1CE6A 1WICA 2L0DA 3OSKA 1EO5A 3RIAF 4OGYH 3I6GB 3P4MB 3JWDH 1TPXC 3ZYJA 3R1GL 4LVOC 1JHKH 1FNFA 4G5ZH 1NMCB 2HKHL 1CFSA 3MJ7A 5KSBA 4GW1A 1EUTA 3QWQB 4KK5D 4LHUB 5FKAB 4OLYH 1QEWB 2DQFA 5DD0L 4P5TA 5F7EL 1UT9A 4P9HC 1BM3H 2HFEB 1U91B 3QNXA 1G6RL 1BF2A 4M6NH 3LQAH 4BZ1H 3V79C 1R5VA 3C5ZB 3OKMA 4DKFL 1TZHB 2CK0H 2F8XC 5DO2D 3OXSA 2R4SH 2JIXD 1BVZA 4LQFH 3VXQB 4HF5H 3F5WB 2X4TA 1KCVL 2GIYA 4YO0A 4QRTB 3D39D 1RUKH 3L3HA 2WV3A 4JE4B 5C7XH 3D0LB 1DQJA 1MFCH 4L5FH 3MTRA 5F7WC 2UZIL 4ONGL 5IMMB 4OFVA 4W70A 1A6AA 1H8OA 1NGZB 5IVZA 2MPAH 3O2VH 4EI5D 1FBIL 1A4KB 4IRSC 3DMMC 1ORQA 3LEVH 5TQ0H 2HRPH 3BZFA 1HCFX 4GW5A 4F57H 4O4YH 2AJXH 2CPCA 3E6FA 4NQDB 5HGHB 3VJ6B 4JGMA 1A7NH 2J6EA 3H3PH 4HWEH 5D1XB 4I3RL 3QEHB 5CBEA 2AEIT 3KPOB 3ZKSD 5CEXB 4H25B 5INCB 1U58A 1Z0MA 2CDFB 4I4WA 5FYLD 1RZIA 2F53E 1CLYH 4OF0A 4PJIA 4LEXL 4KHTL 1R3HA 1UJ3C 2IQAB 1YQ2A 3S3PA 2EDEA 5C0CD 3OKEB 3ROLB 2KKQA 3OGOE 3W5MA 3HRZB 4I77L 2JLLA 5J6HB 1T20A 4NQCB 3TBTA 4G9FA 4ODVH 4QRQB 2KBGA 5M95B 1RVFL 4OAWB 4ZXBC 4JEGB 3DHJA 4LCCB 5GHWH 1YA5A 4PRHB 1BFOB 4L4TD 4EXKA 3K4AA 4AL8L 3C60B 1T4KA 5CZXD 5KSAA 4FQJH 2Y5TB 2UZYB 5I1KH 4F8TA 4P2RB 1EEQA 2IANA 4PJDE 3GJFB 3VH8A 4G80A 4JM2B 1JMZA 1UVQA 4J3WA 3AMKA 3UBXB 2MOVA 4H8WH 1NC4A 1CICC 4LLMA 3SCMB 4K7PH 4NHCL 4OLXL 5BV7L 4PPTA 3WD5L 3AGVA 4LSSL 2CDEB 4QHKJ 3DV4A 4L8SA 3WIHA 4KDVA 4NCC2 4ZAKB 5EU6D 3NPSC 3OBAA 1AQKL 2PYED 2XKNA 2X05A 3MRCA 3O4LA 32C2A 5CMAB 4HT1L 1QSVA 4FP8L 5DVNA 3SDCC 2GEEA 2FIKA 4U6VH 3AU1B 1IBGH 4XP6H 4GBXA 2IEPA 4MVBC 5A2LH 1VFOA 3N85L 4LLQA 4LPYA 4PG2C 4K3EH 2BC4A 5CJXA 3CFIC 2AK4B 1FIEA 4U7MA 3VFPB 4WV1C 5EUKB 1XGQB 1HN1A 4J1UB 1W8NA 4UNTA 3QJFB 4LLUB 4W6WB 3GDBA 3OL2A 1FGVH 2A83B 5GZOD 2QADC 3ULUF 3HZVA 1EEZB 3RY6C 4PLJD 1IC5L 2DOCA 2YBRA 4DW2H 3CUPB 4NZTL 3ZTNL 4BZ2H 1NEUA 2AXGB 2IFFH 1QFWM 2ICWA 1CU4H 2R23B 3BGAA 1HHHA 4MQ7B 1UA6L 1TVBA 4XC1H 2F19H 5I1CL 4L3EE 1U8PA 1S7RB 2LVCA 2H2PC 3PGCA 4YHPA 2G2RB 3ARFA 3QNYA 4L3CB 5D8JL 5DVLA 1WFTA 1I1RA 3H42L 2RIKA 4WFGE 4Z6AT 1KT2B 12E8H 1FNEA 2VR5A 1IT9H 4PB9H 3IDMB 2W0LA 3N1FC 3MREB 2WW8A 2R1YB 1Q9WB 5LQBH 4NQDD 5D1XD 4PJEE 2V2TA 4JFZL 1Z9MA 3V7AE 1W72B 3NIDF 1GYAA 3OV6A 4H5SA 5GRUL 2C1PB 4HUUB 3DYPA 5I30L 1UH4A 3RY5A 2XZZA 1K3ZA 5DVOA 3S35X 1KIPB 5JW5B 1T66C 4DKEL 2ICWI 5DS8A 3BEWB 4KWUA 4JRWA 1XIWD 5IEHA 4M1CC 5AG8A 3INUL 4Y16A 1BFVL 1OAUH 3BP6B 1T1ZA 4NQCD 1OAZH 2VDLH 4RIRA 3V5HB 4O2FB 4CNIB 1WK0A 4RAHA 2PXYB 3D3VE 5GJSH 5LJYH 7CGTA 4Q9RL 3KJ6L 1PX4A 4UNVA 4PRHD 4EN3C 3LSOA 3RNQB 1ZSDA 4Y4KC 2XN9E 4R97B 1JZ6A 2OBGA 4E41A 2FO4A 5CINH 4WW2B 2QQQA 3LB6D 5GS3A 4XX1G 5E0QA 3KXFB 5DHVB 4QCIB 4HWBA 3DPBA 3GIVB 3OJVC 1NCAH 5DK0B 5LBSH 1RU9H 4OCLC 2V2XA 4YHYC 2VLRD 1TVDA 4ELMF 3V0VA 4LDEB 4HX1A 2H1PL 3B43A 1Q38A 2ZWLT 1PSKL 3IDJB 4TSCL 3SCMD 4L9DA 1GSMA 1FZOB 2YRZA 1QHOA 3O3UN 4OT1L 3RI5K 2B1HL 2W65A 3VXRE 4MCZB 2DN7A 2ZOKB 4M61B 3O6KL 5SX5K 4D9LH 3TFKD 2NW2A 4MJ2A 1C8PA 3BPLB 1BFTA 5EOCL 1ZA6A 1RD6A 1HXYB 3BIAX 5J6GB 4JDTH 5FGCE 4NOFA 1A1MB 3H9SE 1AO7A 3WFEH 4KK5C 1W0WB 4RWYL 3AAZA 4NDMB 1IAIL 1QSEE 1G0DA 4YBHA 4YBQC 4RGMC 5HGBB 1WZKA 4L9LB 5EIIB 4OF5A 1WVZA 2YUXA 3V7MA 5GGVY 2AK4D 4PBXA 1V7MH 1NJ9A 2VLKA 3U82B 4NP4H 5IOPB 4OGXH 1F6FB 2ZUVA 4ZOAA 3VWKC 1ZGLB 3BSZH 1P9MC 2UYLA 5EC1B 4X9FA 1S7VB 2GY5A 5E08H 1P4LA 5E7FA 1RURH 5HPMA 4X8XA 2GW5A 2FATL 4AQOA 4PJCE 4HQQH 4B50A 1D9KC 4P5KA 2JJVA 4Q6IB 1FNGA 5FUOH 2Y4SA 3TYFB 2GK0A 4NUGL 3RVVC 1T2XA 1DBKH 1ADQA 5BOPA 1FNSH 3C87A 4U6YB 2IAMD 4LCWA 3RPKA 4J4PA 2R4RL 5FOBB 1IGFH 4XVTH 1U8MA 3MGAA 1WBXB 1CDCA 2DLFL 4XC3L 4MNHB 1D5IL 1X4YA 3HE7D 3P11H 1G7IB 4OCMC 5TPWL 2VABB 1ZMYA 2BSSB 4AG4H 2D7MA 1IKFH 1ND0A 4M7ZB 3EUUA 3IYLW 3PABB 1CIUA 1ACYL 3EYOA 1N26A 5DHYA 2ITDA 3EFFB 2APXA 2DIJA 5EOQL 1CGWA 1N6UA 2MKWA 4LLWB 1JL8A 3A6CH 1N4XH 4JRYE 3BZ4A 4KK8C 4DKAA 1CLCA 1SEQH 1HIML 3C08L 3DIFA 5CZXC 2CLZB 2PXYD 3B9DA 2V2WB 1UACL 2MWCA 1KN2L 4N9GA 1ZT1B 3QCUH 1UKSA 1EUUA 1NLBL 3ULVH 1EJ6A 4FQCL 1FZMB 3RWFA 1CL7I 4M4RA 5F70A 3BIBX 3EO9L 2IPTL 1YNKL 2X4OA 1JN6B 4F9LA 5JW4M 2FJFB 4R8WH 4Y5XB 5CSGA 1JGVL 5ICYA 4LLYB 2ARJQ 2DLEA 5ENWB 3IU4L 5T1KA 4LPUA 5FKPB 2QSTA 4GFTB 2DI7A 5I1GH 2ORBH 5B8CC 1KJMB 3NA9L 2JKXA 2FB4H 5DD5L 4Y5YB 1FO0B 3H9ZA 2HFGL 35C8L 2AJSL 1GJIA 2KZ1B 1RZFH 4MAUH 1YEKL 4MAYB 4RMRA 1BMGA 5BMFH 3PWJB 4U3CA 3LKPB 2FHFA 4NKQB 3GMLB 4GQ9H 2FJGA 1A4JA 3U2SA 2EDXA 2LFGA 2X40A 1BPVA 3D9AL 3F62A 4I0PA 5GIRA 2IADA 4PRPA 1KYOK 1BJ8A 5D7LE 3QG7H 1JNNH 1GIGL 2VXTH 5D7IF 2MFNA 3FB8B 2AGJL 2JJTC 3E8UH 1U42A 5ANME 4KVNL 4U1GB 1HK6A 2BRRH 2E5EA 1R3JA 1RK1A 5JW3H 3C5ZC 3KPQB 3K81A 4CVZA 4R96A 2NY3D 4PLJC 4YK4C 2BSTB 1MPAL 3VFTA 1II4E 2R0WL 3U4BL 2R1WA 2HJKA 5E6ZA 3QCTH 1TCMA 4RISH 5GRVK 3CLFL 1WTGT 4JDVB 2G5BA 3VFNA 3HE6D 1RIUL 2NX5B 5F1SA 4YHNA 3FQTB 5I76B 3O3AB 4BA8A 4PGCB 3NCJH 3CLEH 4FFVD 2V9QA 1Q94B 4K8RD 3RHWK 4NC2B 3ISWA 4P3DA 1JPTL 1KJ2L 4PS4L 3SHSA 2CH8A 4XP1H 4N1EA 5E8DL 2Z8SA 3S3JA 5H35B 5D1XC 5I8KH 3GSWA 3IDYB 1AFVL 1PZ5B 4R4NC 1GGIL 4OLVH 4U1NA 3EJYD 1F8TH 1S7TA 3UJIL 5ACMA 3GHEH 4UNUA 1X9QA 5JIIA 4G8EA 4PJFE 4OFYD 1B0WA 2ZUSA 4X8JA 4I3SL 1FVEB 3MMEB 5E6IA 4MX7B 1LHZA 2ICES 1NCBL 2APBA 3FT2A 3PWPD 4O02L 1H3WM 3NGBB 3VMOA 2OQJB 1FL6B 5AYUL 2J8UB 3P77B 3VXTB 5E9DB 3MRGB 3ZE1F 5T1DL 4G3YH 1AI1L 2E9JA 1KELL 2IQ9L 4NNPH 3JWOC 1T1XA 2F15A 3AREA 3TPKA 4LCCC 3VD3A 4J12A 1WT5A 3QAZC 5E56A 2AEQH 3ZT5A 3OJDA 2PR4L 2Z4QB 3TNMB 5K93A 3HZMA 1M7XA 5JW4R 2WMPA 4NZDA 5GRJL 2GT9B 3IDNB 2YS4A 3C60C 1IGJA 2B7DT 3CCHA 4Q2ZA 1OT1A 1GGBH 5DD6B 2A9NL 1HH9A 4YXHL 1EAPB 4JRXA 2ED7A 2EO1A 4JKPL 1KCUL 5HYJB 2E8ZA 5SX4H 1AJ7H 4JM2C 5IR1A 2D31A 4KAQL 3PP4H 5JQ6H 1XAUA 4IOSD 4XMKL 2O5XH 1MJUH 3TESA 4D0BA 2XPGA 4X99B 3OR6B 1TDQA 2HFFB 3KPSD 5C92A 2FHBA 1AR2A 2ICEA 3I02B 4U2YA 4U1MA 2EO9A 1YPZE 3OKNA 4OGAD 3NIGF 1Z3GH 3TFKC 3JVGA 4ZAKC 3GKWL 4C56A 1CFQB 1AXIB 4Q6YA 1AGCA 1H3GA 2AW2A 3O6FC 2G60H 4H26A 4X6CB 4N68A 2VERN 5AYQA 1ACZA 5E2TL 3MV7B 5JDSB 1N8ZA 1FAIH 4MAYD 3D2UB 4TULH 5K9QG 4MNQA 4NUJB 1I8MB 2CIKA 1QBLL 3I6LE 5I66A 2BNQE 1KJVA 3MODH 3QULB 1CD9B 3RAJH 4J3XA 5HY9B 2Z9TA 2YA2A 2D4FA 5MEPB 4BSVB 2YOCA 1A6UL 2VLJE 2ZSWB 2BVPA 2OP4H 4OM0H 4ZTOH 5J13B 4HKJB 3V6BR 4B53A 5DJDA 5FO7A 1HHGA 5D6CA 2AV1A 4JY4B 4WCYH 3ULSA 3TBVA 4HWNA 3HLAA 1QLFB 3C8HA 3ARVA 3UO1L 3C6LB 4IEFB 1T0NB 3U83A 3ARYA 5IGXH 3L5WB 1L6ZA 3VXOA 1ZVYA 1S7QB 1DN0B 2NX5D 1T21A 4LMQI 2FSEB 3QDGD 1A21A 5ID0B 4TTDC 4G6AD 5EBWA 3IAGC 4HGMA 2ZSVA 2QQLH 1QVOA 4HSQA 5E4EC 3S34H 1IGTA 1XR8B 5HDOA 1YMMB 2DAVA 5EFIB 2YZ8A 3AROA 4EDXB 4UUJB 3VFMA 1OAXL 4RFNC 2D9CA 1E0OB 1U3ZA 1YN6B 2FEEL 1CFVH 4HK0A 4XCFL 1OCWH 4L8BB 5CEYA 3V6OE 5LGJB 3BDYL 5L2KA 2P46B 2VZOA 4M7LL 1F6AA 5LVEA 3CDGB 2W0KA 1CDGA 2GITA 3TNNB 3JTTB 4NKIL 3TA3B 3ZKMD 1IC4H 5GS2D 3W9DA 4U1SB 3OAYH 1BJMA 3LRSA 1HILA 1A3RH 2IBBA 3NZHH 1QLRA 1MCPL 1G6RB 3UTPD 3L1OL 1BAFH 2AI0H 3FQWB 2X1QA 5C0BB 5C0JA 1KCRH 3ZZ1A 3JV4B 1PKQB 3V0AC 2BJMH 3V4VH 5ERWA 2VWEC 5CP7B 1SYSA 2V7HB 2BCKA 5E9DD 2HT2D 2D7OA 2FGWL 4DOHB 4LSQL 2OSLA 1U8OA 3TCLB 3M17B 4FQ2H 1GCFA 1WISA 5HHPB 3ZE2F 5KW9H 3G04A 4XVUD 1MJ8H 4EI6A 4YXLL 3VI3F 4R0LB 1QSFA 2BVUA 5C08E 1RZ8A 2ZKHL 4DVRL 4R97C 4D9QE 2BSRB 1AH1A 3JWNC 2IH3A 4XMLH 4XCYB 3KS0J 2P1YA 1I3GH 1TIUA 1ZHKA 4IRJD 3MA9L 4NQEE 1MCQA 5GS0H 4CUCA 5A3ID 4FTVD 1QPPA 5C0ND 2ADIB 4I2XA 5EULV 5IB2A 1MHCB 3U9UB 1XF2B 2ATKB 1MIMH 3SGJC 1NFDB 1J1XH 2VQ1A 4IHOB 4NN7B 4RAVB 1XGYL 1YDPA 5BW7C 4LL9A 1U8JA 5GS1C 4N0CC 2ARJA 4PREB 2HRLA 1CT8B 2ZPKH 3HCVA 4NPYB 1GAFL 5IK3B 2XWBB 4CMMB 3BPLC 3KG5A 1GZQA 1BZ9B 1GGCL 3O41A 5AZEL 4N8CH 2OMBA 5LWYH 3MV7D 4IDJH 1PQZB 3UTTE 3PQYD 4KRPC 4R7DB 3REWA 5TE7H 3T08A 5HD8C 3TV3H 5BJTB 4RFEA 5CLTA 5T1LA 3H9HB 5EZOL 2HG5B 3JZ7A 5D2LE 2HT3C 3E2HC 3V6OC 4PJ9D 3QWRD 4H0HB 7FABL 3ZL4L 2HLAA 1C5DB 5IMKA 3X11B 2JB5H 3GO1H 4L9LC 2VAJA 1TVHB 4JKWA 3WHE1 2R39A 3PIQB 1X5GA 1CDYA 1TJHL 2GK2A 3JV6B 2BY0A 4IDLA 4AEFA 5EZLA 3MV9D 1DEEB 2C3HA 4UINH 1SVCP 5TDOB 4KJWD 4N0RA 3VGHA 5ISZE 1CXHA 5MENB 3Q48A 1S9VB 8FABB 2DI8A 4UB0L 2CKNA 3CFCL 5K9QI 3QI9D 3HAEH 3OJMB 3C6LD 4WFFE 1WTLA 5FO8A 1RUQL 2GSIA 4UTBH 3UAJD 4MJIE 3G6JB 5JDJA 4Q6IC 3IDUA 4ODSH 5H2BA 3O8XA 5C9KA 1GHFL 2VZUA 4GRMB 2OL3A 5GRZA 3O45B 5CCKH 5LG1A 3W0WB 4PG9B 5I1DB 1HEZA 1BGXH 2G9HA 4M9OA 4R7NA 2IPKA 3WLBA 3BI9X 5HI3C 1DUYA 1RIVH 3GMQB 4HKBA 4HKXA 3DX6B 5DFWH 4UDUA 4I1NB 2NW3A 1IZJA 1F90H 3EOTH 3HNSH 2EDLA 4OIBA 4M1DH 3TA3D 1G7JA 4NO3A 5I74B 4HMEA 1MSPA 5DF0A 3B9AA 1RZGA 3FT3A 1KNOA 3FO0L 4KMTH 3KYNB 3TZVB 1QBML 3MLVL 3LEYL 2UWEB 2JJSA 4PRAB 5T5FL 3SN6N 3EGSB 4IRZL 4LCUB 1A1NA 1I1AA 2I07A 3S88L 4MS8C 4Q9BA 4M5ZL 5IM7A 3IJHA 1NAKH 3V5KB 2VTFA 3A6BH 2O93L 2EDDA 4ZSOA 2BZDA 2M26A 3N0PB 3KYKL 4UTAL 1B4RA 3SDAA 4U3HA 5DQDH 4PJ8B 3TVMA 4V2CB 1NFKA 4GMTH 1XCQA 3TCXA 4FQPA 4OZFG 3DO7A 1OGTB 3NTCL 3Q3GB 5J89A 1GRWA 1EVUA 1FZKA 3DX9B 3QIUA 3ARBA 4G8GA 4QHKI 3VXUE 3SKNB 4F9PC 2JB6B 4I18A 1X5AA 1YEDA 5DEGA 5I19H 1WEJL 2DQDH 3QUXB 4Y5XC 4XBPB 2D03H 3Q6GH 4LBEB 4P2YA 4KXZH 1HHJA 2B2XH 4EVNA 4D0CA 5EU5A 1IQWL 1MFBL 3NH7H 1WC7A 1A7RL 5E03A 1LDPL 5I1AA 2P5EB 1QSZA 4LAQH 2E9BA 4Y5YC 1A9BA 5ETUB 1YC7A 4PJHA 2W91A 3DVNA 4M3KB 1RZJH 4KHXL 1FDLH 2BY1A 1T5XA 5HJ3A 1EO7A 2F53D 4MAYC 4BFBD 3U0WH 1VKXA 1Q9LA 3WUZA 3VXSD 1N59B 3SKJL 3GK8H 3MLXL 3S36L 4UQ3A 4MNGB 1XF5A 4JR9L 3QUMB 3T3ME 1F4HA 3BWAA 4NNXB 4OD1L 3WO4B 1RZ7H 3IJYB 3UTZB 1BFSA 2AQ2A 4P99A 1NGXA 3I2CL 5IROA 2J8HA 4U1GC 1VA9A 5D9SB 3AUVA 4LVNB 4D3CL 1HI6B 1J8HA 4LFHD 8CGTA 1K8IB 1ZHBB 3RTQA 4FFYH 2W92A 1NUGA 3CVIH 1AD9B 5ACZB 4FN0A 4PJGB 3QUYD 1JPSL 2R56L 5DUPH 5E2VL 5FCUH 4U1LB 1GOHA 1I1FB 3CFJB 4PJCF 5HHVH 2Z31B 1NMAL 3CDCA 3L3KA 3DTXB 4HXAH 5FGBC 3O3EB 1ETZB 2ZNWA 4X6CE 4DZ8B 3IJSA 3QNZA 4NCDA 1MFAH 4CDHA 2IWGA 4YLQT 4QRRA 1K5NA 4ZS6C 3WFBH 1OSZA 1JZ4A 3TBSA 1FGNH 5ID1B 1J05B 4Z78A 1MHEB 3CFKA 4KJPC 4OLWL 3TYGL 5D93C 1CBVH 3IDYC 1MCNA 4TUOA 3ZKMC 1KPVA 5DEFA 4A6YA 2J6EH 3O3DB 3IFNH 3DSFL 4UT7L 2P8MB 4OUOA 1JHLH 1CFNB 1LE5A 2JIXA 4AH2B 2FD6L 4P4KA 4N0YL 1XT5A 3MRLB 3NGBC 3TT1H 3P30L 3IKCB 3R0MA 2G5RA 2WBWB 1FE8H 3H7BA 3DX8B 4OZHB 5I1HL 3TZVD 4Z76B 4ONFH 3U4EA 2C5DC 4XVUC 1EK3A 2EIZB 4XPBL 2VDKH 1S9YB 1LNUB 2GUOA 2GJZB 3BAEH 5CP3A 2Y9RT 2ESVB 1KTDA 2Y23A 1DDHA 6FABL 4HJ0D 4X5LA 3EOAA 2R2HA 3V9FA 4FXKB 5IW6B 4N1HB 5JNYB 1JGUL 3RVUD 4PJ5E 4N1CA 1YMME 4AJ0A 1OM3L 2FX9L 3FAXA 1T3FB 2ZZUT 5C0NC 1IRAY 2PO6A 3MJ6A 2EDWA 4WWKB 3QDJA 4FQXD 4UOW0 2DQUH 1DLFL 4WFGD 4YPGB 4WNQA 3MUHL 3QXDA 5CJQL 3H8NA 5FHBL 4U6XA 3VFWA 1MCOL 4U1JA 1IEAA 1F3DJ 3JWDC 5BVJA 3RJQB 1G9NL 2J5LC 5GGQH 1YQVH 4MD5B 1SY6L 1X5YA 2VLMD 4YFDB 2BNRE 4DK6A 5J1TC 3WFDH 1S5HB 4NN5B 3ARGA 5B38G 3UDWC 5C1MB 3WIHH 2X4SB 1IEBA 1YUHA 1QYGL 4GXVH 3WDJA 1NDGA 3MRJB 1DUZB 2JTDA 1T83C 5MERB 1BVKB 1H9VA 1MUJA 3P2TA 2P49B 5JUEH 3D3VD 1U8HA 2OJZH 3NCBB 4JM2F 5J13C 4LHJB 5MP6H 2BVTA 1N3NA 4UI2A 3KLAA 3RWEA 1OWWA 2J4WL 4KJWC 4YDVB 5IWLC 3BP4A 5L2JB 2YK1L 3U7WL 3BKJH 2OYPA 4P2OB 5CEZL 2F9BT 4JO3H 1LWRA 4L1DA 1BOGA 5F96L 3CU7A 2W9DH 2GTWA 2BMKB 4LRNL 3WXWH 4DFIA 5INDB 4K9EC 2Z31D 1U93B 4ELKB 1MFEL 3T65A 3MLSH 4PGDA 2ZCKH 2X42A 5EC2A 1XEDA 3MV8B 3VXRD 4GG6A 4P4RB 2LU4A 4O51B 1RV6X 1DBAL 1VSCA 3BN9D 4KJYB 1HHIB 4OCXH 1OP3H 5F7UA 5IESH 4KI5E 5GRWA 1VEPA 2BSED 4YUEH 1TZIB 3FB5A 3MLRL 1P84J 1AO7E 2EC8A 3DUUB 5E8NB 3KYAA 2F58H 4FZ8L 3EW3B 1RULL 5IVNA 2ZG1A 5DJ6B 1JFQL 2ITCB 3WHXB 3IF1B 4HJJL 2D0HA 1JIBA 4UT9L 4IS6A 2DD8L 2BDNH 5CLWA 4IM8A 2XXMB 4ZUVA 5DYOB 1KPUA 3ULVD 3DBXA 1CXFA 1UCBL 3MRMB 3DSNA 1JGEA 1I85A 4R0LC 1ZLVH 1QR1B 5JORA 4GJTB 4N0UE 1KLUA 4F7CA 5J06A 3T09A 4LASL 2Y6SC 5ABDE 1Q0XL 3FQXA 3VD5A 2BY2A 5HDBF 3WNKA 3W0WE 2GFBB 3RFZC 1YEFL 1PY4A 2E9IA 5IP4A 4WWKD 5I1IL 3AS0A 5TDNB 3LKOA 4HWBH 4BJLA 3LS4L 4NN7C 1YN7B 1KUMA 3DURB 4G42A 5L6YH 2N56A 1T7YA 3KPMA 1EH9A 5KG9B 3DROB 1NANI 3LKQB 5E5MA 3SBWC 3O3BB 4I0KA 3VXMB 3QEQB 5FO9B 5AZ2H 5JXAH 3HC3L 1CI5A 4KQ3H 4MDIA 2EXWD 2PCPB 3IXAA 4JFEA 3QHFL 2YD6A 5HHOE 5BRZE 4X80H 3MNZA 5FGSA 1M7IB 2ZOLA 1BECA 4JVPA 1JGLL 4LLDB 3CD4A 3NAAH 4YHOL 3ZT6A 4KI5C 3MJ9L 1CLZL 2XFXB 1BEYH 4JY6B 3QDHA 4F7MB 1ZAGA 2XTLA 4HIEA 5IG7A 1YMHA 3UZQA 2ZG2A 5KVFL 2X4UB 5LXGL 1PGRB 5FFLA 2H26B 3OX8A 5F89A 1BBDH 3SE4C 1BD2E 3PHOB 4M6OL 4NZRL 4S0TD 4X4MA 2VLRA 5IMLB 5GGUA 4U7SA 1DBML 2PYFA 2XZCL 3ES6B 3MPCA 1CTNA 4TSAL 1L7TL 4QHUB 1OAYH 4RBPK 3VFOB 2WBJB 4LGSB 4WDIA 1AGFB 1NBQA 2A6JB 3RWIA 1CF8L 4HS6A 5GGSB 3BQUA 3OXRA 3OAZK 3T04D 2GJ6A 3DLQR 5EUOB 3ZKQD 3SY0A 2XTJB 1UB5A 4J3OC 3BUYB 3RDTB 5E2WH 3SGKC 1FPTL 4HT1H 4DK3A 4K3GA 1HHKA 1X6LA 4U33A 4ZNEA 5DRZB 3HC4L 4XBGA 3JTSB 5I8OL 5DD3H 1DL7H 1J18A 3GRWL 3RVXD 1ADQH 4BKLA 4DVBB 4BQ8A 1R3LA 3CH8A 1FYHB 3TBYB 1J12A 4OLUH 5FEBA 4JO4L 3STZB 1KN4L 4PRBB 3QIBA 1XGPB 3MOBH 5FHAH 1CFTB 5I74C 2B4CH 1NDMA 4P2QE 4ACPA 1ITCA 4KROB 1A6TA 3UTOA 3VCLB 3IU3B 1ZLUH 2AJVL 4MQXC 3O9WA 4FQLH 2W60B 3ZTNH 1T2QH 1IGMH 1R24A 3X3FH 4HG4K 2QSCH 4HIHB 5E1AB 3PDOA 1FL5A 2VO5A 4YDLB 2HN7A 3KPLA 5I1CH 1UEYA 1KTKE 4U05A 4PJ8C 5D4QA 3NZ8B 4PJ7A 2HA1A 5D8JH 3K80A 4F7EA 1FVCA 4QHLB 1P2CA 4JPIB 1FYTE 3ESVF 3OZ9L 3RVUC 3QG6B 4CBPA 2WQ8A 5EPMA 2OJEA 2IAMA 2EDYA 4YHMH 1CDBA 3K4DA 4ZUTA 3CVHL 4OF6A 2Q8AL 2VDOL 4J23A 2CRMA 3SE3A 3MBXL 3QUXC 4L29B 3SDXB 3T0EA 3VRJB 1OTTD 5CKAA 4AIOA 1AKJD 2A0LC 4WI7A 2GI7A 5E8PA 5GRUH 4M9PA 1TCRA 3DVGA 2F74A 3B3IA 4MB3A 3QIWB 1J0YA 4OCSL 5DRXB 1AGBB 1S5IH 5I6XB 2CKBB 1IGIL 2R9HD 4MXWL 2W9LA 4XNMA 4WGWB 3IFLL 3CDFA 4LP5A 2X1XR 3OAUL 3QEQD 1BFVH 5GQBA 3O11B 5EBLA 3OKOA 1YEHH 5DJAB 1KIQA 2CRIA 1I7RA 3QZWG 5C0AB 3P0YH 3L5HA 5D2LF 3TWCL 3REVA 5IHBA 3KJ6H 4PP1C 3F58L 2VUOA 3RA7L 4G6KL 1B4JL 2E7HA 4NHUA 3VGFA 4BH7A 3WO4C 1YY8B 5ESVB 4NWUL 2AK1L 3SDDA 1ZS8A 1QQDA 4RRPG 1S7SB 3RZCB 5D6DA 3LAFA 4X6DA 1M6OA 4Z7OF 1WV7T 3GMNA 3EYSH 3GI9L 1J7VR 3HAEB 3U48A 3SKMB 3MLYH 4JFFB 4NQSA 4GAYB 1YNTA 3ESUF 4ZDHA 1D5XB 3IGAB 3QA3B 2R69H 1U9KA 2YHGA 1BJ1H 3NMEA 4XP5H 3NCFB 5F88B 4TVPL 3VFUB 4TSCH 4QXWA 5E99H 2WBJD 4TOYL 1KCSH 2RFXA 4OT1H 3F7VB 3KYMA 5KS9E 4EQ3A 3NCYP 1X4ZA 2EICA 5EOCH 3GMPB 4HUKB 4I9WE 3RDTD 1MI5A 1KIRB 1JPGB 4YAQB 5DXWA 2CLRA 2EZ0C 3GSNB 4RGNB 3IFOA 1NBZA 4C56E 1JUFA 2OTWA 1YEEL 5C07B 3MRBA 5DFVC 1CDIA 5KVGL 3GSXA 4GKNA 5KN5A 4Z9KB 1F11A 2BNQD 4HUXA 4Y19B 2Q86B 3UTSE 3M8OL 4JKLA 3C09C 3PL6B 1BQLL 3TO4A 1G7PA 3Q1SH 2EDOA 1UWXH 3RWGB 5EO1A 4WJ5B 4HDIA 1IAKA 2C3GA 1HXMA 3SGEI 3IB4A 3MLPA 2ADGA 5CHNB 5FK9B 2VLJD 4NRZA 4U3XA 3V6ZA 5F9AC 2YRPA 2YMXH 3D1MC 1DANT 1MRFL 2APTA 1JYXA 4IMLA 3HE6A 3HG1E 2RAMA 3EFDL 2FR4A 1XGUB 1TXKA 4Z7QE 2NY5C 2YRLA 4UILL 5D5MB 5GSVB 3OKKA 1WBZA 3X3GL 4ELMA 2VSCA 4HWZB 3EYQD 4QRPE 4BQBA 3M1BA 3ILPB 5GS0D 1D5ZA 1U8KB 3CIQA 4NKOA 3WFHA 3H3KA 2X4NA 3N9GH 4F2MB 2ARWA 2C7UB 4NSKA 5HYIA 3DRQB 1WZLA 3LEXB 4NZJA 3HZKA 4RMUA 4PGJA 4X98B 3ZDYF 5L0QC 5I8CA 5JPNA 1FV1B 5SWZB 1UQSB 2DWDB 4XAWL 4ZFZA 2H32B 1CQKA 3FB7B 5E94B 5HSFA 5TDPA 2ZJSH 3X14B 4J3UA 4DUXA 1H3UA 3P9MA 4MLSA 4OM1H 3WL9A 2R2EA 3RGVD 2VAAB 1ACYH 4CADA 4NN5C 2J8UF 2J88H 4PRIE 3QIWD 4W81A 1R0AH 1JTTA 3QZWA 5EOQH 5KSBB 1CFSB 4EUPB 4UQ2A 5F8RC 4GW1B 3TJHC 1SMOA 1RIHH 3T3MF 1TNMA 4R90L 4JFHE 3WS3A 4JJHA 3ZHKA 4RRPA 3LKSA 3QNXB 3IS0X 5JHDA 4DCQA 4ZO9A 1B0RB 1ROWA 1C1EL 4HCRA 1Y0LA 1AGDA 2YA0A 3BE1L 3OXSB 3FN0H 1QP1A 2EIBA 3WJJA 4GS7B 1UXSA 3EO9H 4ODTH 2HKFL 3IETA 1CCZA 4ZFGL 1HQ4B 1JF1A 1YNKH 4YHLL 3DGGA 3DHMA 1YJDL 3NFNA 4Y2OA 3RWHA 4YO0B 2R0LL 3P40A 2AXFA 3W2DL 4EZMA 3L3HB 3KPSA 5DLML 1IAIM 3ABZA 2CRYA 2P8PA 4JFFD 4RWHA 4P2OC 4OQ1A 4ONHA 5DJXA 5C0IB 3DETD 4KU1A 5IVZB 3BD3A 5DD5H 4KY1L 1N5YH 4WO4C 4XZUA 1AD0B 4PY7A 2AJSH 1ORQB 3FCTA 3CZFB 3AM8C 4X6CF 2HMID 2NY0B 2EXYD 3BZFB 4V2BA 1DQDL 1EPFA 4GW5B 4XB8A 3VXME 3GNMH 3JV0A 3E6FB 5MHSD 1EXUA 2NY1B 2X5PA 5IBUG 2CDGB 1SJVA 3WJLA 1ED3A 1PLGH 3PGDA 1U58B 3C2AL 3D9AH 4I4WB 4Z7UE 5CGMA 1RZIB 4LP4A 3F7PC 1QA9A 4RGND 4PJIB 2ZUQB 4JHWH 1GIGH 5C07D 1DP0A 2V17H 2O26U 1JRHL 2K7QA 5HYFA 1FZJB 5F3HA 5CZVL 3UX9B 2LTQB 1L0QA 4LRIA 1T20B 4XBEL 1QRNE 3TBTB 3BX7C 4G9FB 3NA4A 2D9QB 2XWJA 4MA3A 5EOTA 4JJ5A 5GGTL 1MPAH 2RCSH 3PL6D 3T3PE 2R0WH 3U4BH 5MEQA 3ARWA 3VXPA 3CLFH 3PJSA 2VE6A 1T4KB 5DJ8A 5TH2A 4TUJB 4F58L 4XWOC 1KB9J 2XT1B 2OZ4L 3S37L 3RIFK 5FOJA 5FDWA 3G5VA 4EXPX 1MWAL 3VH8B 4KJQC 4G80B 1QLEH 2VQTA 1PG7L 1S8DB 5JMRA 4NFDA 4GQPH 4X4ZA 4PS4H 4GRLA 3DX7A 1OW0A 1NC4B 4LLMB 5D1ZD 1EFXD 3UTQA 3ORJA 5DD1L 3MACL 4MJID 3HI5L 3B2UC 3OTTA 5BS0E 1AFVH 4OZGA 1GGIH 3DV4B 1R5IB 4L8SB 5SWZD 5DR5L 2VDML 4KUCD 4Y4HD 4N0FA 5CILL 4UBDD 4GT7A 4S1QL 3MNWA 3UZVB 2XG5A 3FO1B 1LK2A 3O4LB 32C2B 3GSUA 1NCBH 4NQVA 5TQ2H 4C4KO 1WAAF 3S3SA 2CLVA 1TTGA 4Q58C 4HLZH 5T1DH 2FIKB 4YZFE 2P43B 2IQ9H 5J11B 1YNLH 4GBXB 5DRWB 5HI5C 4Y4FA 3CAFA 2BC4B 1UM5H 4UT6L 4XGZA 5EIVA 1NGPH 4OQTL 4OKDA 2J12B 4P5TD 4KKBD 3ZE0F 2A9NH 5D71L 4XXCC 4JKPH 2EDNA 1QKZH 2VDRH 3LD8C 4IRJA 2W1NA 2MCG1 1WLHA 4HZLB 2ATPA 1X5FA 1S78D 1RJYB 4FTVA 5A2IH 2YBRB 4KAQH 4XMKH 4PTUA 4YHKH 3MRHB 2ICWB 5JW4Q 4F80A 1PAMA 3U7YL 3VXUD 1NFDF 4J7RA 1TVBB 2WBJC 1UGNA 4XAKE 4G8GE 3T0AA 3VFGL 1U8PB 4YHPB 4NNYA 1PFCA 3MRQA 4MZ2A 3F6LA 4Z18A 1FNEB 5EWIL 4YDKL 2XTJC 4ZTPL 1ZEAL 2D0GA 4OSUH 1I9JL 2NY0D 5J3HD 3NACH 2QSVA 4F7TA 2QLVB 3PQYA 5ALBL 1F4WL 5DQ9B 2V2TB 4UV7L 2YD4A 3DV6A 4WFEE 5DURB 2IPUG 3QWRA 4KI5F 4H5SB 3SOBH 2OL3H 3GBNH 2VZTA 1INDL 2C1OA 3C8KA 4F3FB 1RY7B 2FBOJ 4YDJB 5DS8B 3VFSA 3MFGB 5IEHB 4Q9CA 3MV9A 4W68A 1G7QA 3LKNA 4XPTH 4IRSA 4Y16B 3MCKA 3I50L 4KROC 3DMMA 1T1ZB 3GGWA 4G9FD 1A0QH 4MQSB 4LFHG 3FTGA 2R0KL 4DAGH 1OARL 1CE1L 1IJ9A 15C8L 4HFWA 4FA8A 4D8PA 1GL4B 5JA9A 3QI9A 5BXFB 1ZSDB 4YDLC 1W0VB 4E41B 1G9MH 3OF6D 3G6JF 5KSAD 3SE8H 2DYPA 4EKXA 4ZOBA 2DQGL 1ZANH 4HFUH 2IAND 1UJ3A 1Y18A 3MGOA 2EDTA 4ZO7A 1KFAL 3W39A 4AT6B 2V2XB 3ILQD 4KC3B 1HH6A 1FRGH 4WVRA 3ZTJH 4HX1B 4XCFH 4O5LL 1NC4D 3UYRL 3BISA 3RNKA 4ZXBA 1F4XL 1X44A 1YC8A 2W65B 3L3DB 2L7UA 2NW2B 2EKSA 1ZA6B 1FNLA 4RA3A 5HI4D 2EEDA 3LS5H 4QF1A 5I6XC 2UWEF 3O4LD 3L3JB 3PGFH 3AAZB 2YD7A 3EBAA 2DM7A 1EEYA 4GAJL 4CU7A 4JREB 2FECL 3EDDA 1BIHA 4GBXD 1QFWI 4Q9QL 5D5ME 5DA0B 3PUCA 5C3LD 2CMRH 1IEHA 4DVRH 3FFCE 4AY0A 1NJ9B 2VLKB 5F72S 4RMSA 1RHHA 2I60H 5M7QA 3RZCC 2BHYA 1QFOA 2Q7YA 5I9QB 3MA9H 5GISL 2UYLB 3BYYA 3OKLA 5C9JB 4TSBL 1P4LB 5HPMB 5IF0A 2ZG3A 2X1OA 3FZUC 1A6WL 3I6KB 1DZBA 4XNUL 2VYRE 5JR1H 4P5KB 4KZDL 4M43H 3SE9H 1FNGB 2HMIC 2GK0B 4PG2A 5DEZA 2FWOA 1QFHA 1M71A 3ARFD 2Q76B 3OMZA 3UJJL 1LP9B 2F53A 4LCWB 5F1OB 1EAJA 2FJHA 5AZEH 1N6QL 1KLGB 4JQVC 3HC0A 4MD4A 5FYLL 1U8MB 1INEL 3CH1A 4RGNC 5EZOH 3WKML 3ZDZE 2LV4A 1SBBA 2NCMA 2WANA 4FXGA 7FABH 5DTFB 5DURD 2X41A 1ND0B 4B41A 1CWVA 4G7VH 2Y7QA 5IT2L 4U49A 4WU7B 3MBEB 1OY3B 2R0ZL 3BKYH 3T0BA 1KPRB 3EYOB 3LHPH 3AXLA 1WZ1H 4A6YH 2NY7L 4WI6A 3TLRA 3EHBC 5LAXB 5L8LB 4H0GA 4NT6A 1DQTA 1K3IA 3P3YA 3S7GA 3BZ4B 3VU2A 4LIQL 4Y16D 4PJGF 4JO2L 3O0RL 4PJDA 4OBSA 3DIFB 1XF3B 3VG9B 1T6VN 5HYSA 4DGVL 1JI2A 4QXGH 1XF1A 3BO8A 4N9GB 3Q2CA 5T3ZH 1RUQH 4QY8A 3QEUA 3P0GB 3RWFB 5FUZL 1LEGB 1I9EA 2YPLE 1F2QA 5HGGS 4ODUA 3HMWH 5CP3H 3GI8H 1CXIA 4ERSH 4NWTL 2X4OB 4Z8FL 2AJYL 1RUAL 5J1SC 1A7PL 5T1KB 2DM4A 1G9EA 4AIXA 4HS3A 2KPNA 2DDQL 2Q20A 2H2SD 1MIEL 3V0WH 4XCCL 4K23L 4UAOB 3ZHDA 5EDXA 4UBDC 4P9ML 1UC6A 2J7LA 4PB0H 3HI1B 1QFUL 3HMXA 4HUNB 2WINA 3CSYA 4EN3A 4RCAA 3D18A 1FH5L 4Y4KA 4DTGL 3L3OB 2FJGB 4OZHF 1DBBL 5T5FH 3U2SB 5EO0A 1MLCA 1AO7D 3K1KC 3WFCL 2FO1A 1JK8A 4I0PB 5GIRB 4PRPB 3PWNA 4RMTA 1RMFH 4XP9H 2C26A 4WUKL 1NCWL 3KYKH 4E42A 4F37F 4JVUA 3ECBA 1WWBX 1U8IB 3EOBA 4URTB 1R3JB 3SDYL 1OGAE 1JV5B 2EE6A 2DQCL 2WP3T 4R96B 2VLKD 4KRNA 3PWVA 4F8QA 3VFTB 4L3EA 5DA4A 2NZ9D 5K9KB 1O5DT 2OXHA 4PBWD 4UV4H 4HHAB 3BVNA 3EDFA 1DANU 2VIRB 2OI9B 1LMKA 3VFNB 1JZ7A 4YFLF 4KPHL 2AVGA 4RMWA 3V6FA 1LDPH 2NQCA 5KS9F 2B0SH 3K2MC 1GXEA 4BFIA 1ZA3A 4HGKC 4PJEA 3BWUC 3T4AA 1I7ZA 3VFVA 4O58L 4JGUA 2NY0C 3TN0B 3T2QA 3GMOB 2DBLL 5C8JA 5E5RB 4LCWD 2YUWA 4YQXH 2NY1C 3GSWB 4J4PD 2V5SA 5IVXB 2FX7L 3GJEB 3MLXH 4U1NB 3M45A 4PUBL 3BEVB 1PX3A 3DWTA 4G8EB 4OD1H 2A77L 4HS8L 1Q9KA 2ZUQC 2K9UA 4FQIH 2WSKA 5DSCB 5E6IB 2VOTA 4S1RL 1JVKA 4CL7A 3I2CH 1WGOA 3QEGH 3FT2B 4WGVB 4K3DL 1DQLL 3DXAE 4JFEE 2LTQC 3DRTA 2JCCB 4LOUC 3SKUD 1KJ3L 1D9KA 1I3VA 2X4QA 2XN9A 5E2UL 1N2RA 25C8H 2H8PA 1T1XB 1SEBB 1H15A 3OJDB 3DARA 4W4OC 2WUBH 1JPSH 3HZMB 3O2DL 2DMKA 4KGLA 4XMPL 1BIIB 4F37K 3HN3A 1IGJB 5EBMA 3CCHB 4Q2ZB 1NANH 1HH9B 5F3BA 3MLUH 4JRXB 5JZ7D 1I3RB 5IR1B 3ILQC 3S9DB 3VXRA 2YWZA 4JZNA 4D0BB 2XPGB 1F2XK 2O5YH 4NYLA 2BVOA 2ICEB 3TYGH 4OLWH 5EU4A 5T1KD 3RU8L 4UDTA 3H9SA 4U1MB 4FG6D 4G6ML 3OKNB 4L8SC 4D0DA 3LZFL 1J0KA 4UT7H 4ZYKA 2BFVH 3I3DA 1LO0L 1QSEA 5CSZA 1KTRL 1EMTH 1AGCB 5HI4C 4NO2A 1MCLA 3MX0A 1HYRC 1R3IL 1C5CL 4Z95L 2FD6H 4ZFOA 3IDXL 3HFML 4KTDH 4ETQA 1UG9A 1B6DA 2DS4A 3P30H 1OB1A 4V1DE 4XPGH 1MOEA 2EH7H 4MNQB 4YHZH 3TJEL 5HDQL 2CIKB 5I1HH 3U4AA 2FCBA 5I66B 1YY9C 1KJVB 1NGQH 5I1LA 3U1SL 3MFFB 1A2YA 3FB6B 2HAZA 4WTWA 5AD0A 1NCDL 4P2QD 1CGSL 2E27H 3CMGA 4I0PD 1RSFA 5CEZE 5CJXC 1TTUA 4K2UL 2LQRA 3RKDD 2E7LC 4BQCA 4DKDC 3P0VH 2XV6B 5CD3A 1UB6A 4WEBH 1KB5L 3MRDA 1BBJA 4GLRH 4TUKH 5DJDB 1JGUH 4TVSa 1HHGB 5FO7B 3C5JA 4Q0XL 5D6CB 2AV1B 4PJCA 1U8LA 4QNPE 5I18L 4XTRD 3TBVB 2SEBA 2P5WE 3LV3A 5C0DA 1IL1A 3HLAB 1DLFH 5IQ9B 4QOKE 1HKLH 3BKCH 4MHHI 2FHCA 3PDGA 3I6GA 4DGYL 4IJ3B 3VXOB 2AXJA 3UPRA 2F54B 3QBTB 1T21B 1SY6H 4FNLL 1RUPH 4LHUA 2ZSVB 1AGEA 1QEWA 4Z7NF 1YZZA 3UROR 1G9NC 1LO4H 1IGTB 2HFEA 2JJTA 2F5BH 4GKSA 5J9PA 5D7JB 4AEEA 5HVFB 4DN3H 1XGTA 3ETBF 1X6NA 2VJXA 4HK0B 3C5ZA 1BQSA 1TZHA 4AK1A 1W72L 1YEIH 3EO1A 3F7QA 5CEYB 5L2KB 1F6AB 2DQTL 4OV5B 5JOPE 4NJAH 4EOWH 2ZUUA 4ORZC 4LCIL 5ESAA 4LDLB 1JTOA 1HILB 1QLRB 4JRYA 4XNYL 1EO8L 1FL3B 2NXYB 1HZHL 3S5LG 1G0XA 5IMMA 4Y1AE 4ORGB 3LPFA 2E6PA 1NMBL 2OM5A 4XHJD 1SYSB 4OCYL 2J4WH 4JO1L 1H3PL 2BCKB 3T3PF 4Y16C 2OSLB 4KQ4H 1U8OB 3FT4B 1ZLSL 2CO6B 1BX2A 4IOFD 3G04B 5CEZH 1JYNA 3ARED 4FMKA 4EI6B 3G5YB 1QSFB 3B9KA 5HGHA 3HI6L 2MNUA 3ROOA 2HP4A 3QEHA 1RZ8B 3GUTB 4CMHB 2Z8RA 3B2VL 5EUOF 2I5YL 5H94B 4TNWK 2IH3B 4LRNH 4RZCB 5EZIH 1T22B 4HJGB 2IGFH 4M1GL 1MFEH 2AAVA 4JPWH 1ZHKB 3MLWH 4O9HL 2WUCL 1AXTL 2IQAA 2OR9H 4I2XB 2AKRA 1KB9K 5IB2B 2OR7A 3MXWL 5DWUH 5E5UB 1GOFA 2Z91A 1I7TA 3DUSB 2MHAA 4JB9H 3L6FA 5C0EA 1VENA 1YDPB 3CU1A 1U8JB 3RL2A 3HCVB 4M7JL 1NCTA 1MCBA 3P4NB 2VH5L 4ZS7H 2ENSA 1UENA 2D7NA 4C56D 1GZQB 1OL0A 3C60A 1VEMA 5IKCA 1JFQH 5D7LA 1MNUH 4WIQA 5I2IA 4MJ5A 5EA0L 4YZFF 4UT9H 3BP5B 4X9GA 3REWB 4ODBD 5T5NF 1OTUC 2P7TA 4FQ1H 5T1LB 3GJFA 2OCFD 3UTSD 4JM2A 4JREC 3AY4C 1DVFD 4NCC1 5IMKB 1K9TA 3G6DL 2OTUA 3GBMH 2W07A 1E4XL 1EJOL 1UH2A 4KKLC 3F65A 1S7WB 1NUDA 3ULUH 2R8SL 4JG1L 1TETH 4PYGA 4ZAKA 5EZLB 2LAAA 4QTHA 3ZMRA 5HXMA 3O6FA 5D7KE 4KKCD 5CMAA 3SDXF 1YEFH 3IDIB 4K7FA 3MR9B 3ARZA 1I9RH 1AP2B 1RI8A 3CFDA 4K8RL 2NYYD 1SYVA 5C09E 4PY8I 2GSIB 4GW4A 4KRMB 3AU1A 5HHMB 1IGCL 4BH8A 1P5VA 3K4ZA 1GH7A 3PG2A 5H2BB 3O8XB 2Y07H 3I9GL 5ITBL 4KTEL 2WP3O 2GCYA 4PJFA 5EUKA 4C55A 5TGBB 5BO1H 3OAYK 1A9EA 4OZIB 5KVDL 4U1KB 4GRWB 1CVRA 2A83A 4PJAE 2G9HB 4R7NB 2IPKB 4H1LG 3WLBB 1HYSD 4MSWA 3O2WL 1DUYB 1EEZA 5JOFA 4HKXB 4UDUB 3S5LA 4JFDB 4Z7WE 5A1AA 4YHOH 2NW3B 3ZSTA 4FABL 1U8QA 4U6HB 1G7JB 2A1WL 2AXGA 3RWCB 4UOW1 2ZCLL 5IFJA 5KVFH 1RZGB 3FT3B 1KNOB 3MBEC 2VDQH 4PV9B 2NXYD 4AEHL 1U3YA 4NZUL 4KMQA 5T1MA 3CX5J 5JXED 2G2RA 1A1NB 1JNHA 1I1AB 2I07B 1GC1L 3EZJB 5DGRA 3EYUL 3IJHB 3O6ML 2EDFA 4NM4L 4YH6A 1IGYA 1UYWL 1A7QL 4HV8B 5E6YA 4ZSOB 3IDMA 4U1IA 3VG9C 3MYZA 3L3IA 3TVMB 4MB5A 2P4AB 1XZ0A 4P57A 1XCQB 1CVSC 3QXTA 1QSFD 1V7NH 3AS1A 3DO7B 4JQXA 1P7KA 5F9OL 3ARBB 5DT1L 5E8EA 1R6VA 1FPTH 3IAPA 3HKFA 3MXVL 3VD9A 4OD2B 5IB3A 1YPZA 5DEGB 1NAMA 1YEDB 4MA7L 1MAJA 4F9LC 2R1XA 1WCBA 3CK0L 5JA8B 3FO2A 1KIPA 2ENYA 1HHJB 4RMQA 3K1DA 3CZJA 3QQ3A 4EVNB 4D0CB 1OPGL 3BEWA 5EU5B 1FO0L 5C2BH 5I1AB 3V5HA 1KIUA 1ZVSA 3EOYG 4N5EC 4JO4H 4NFCA 4A2LA 5C2UB 4GO6B 4JFXA 1T5XB 1I8LC 4JY5H 3WSQL 1VKXB 4J8RA 1Q9LB 5ADPH 1RUML 3U6RA 1OOAA 2VLJA 3VDAA 4UQ3B 1XF5B 2DQJL 3KPTA 5F8QC 2H41A 1BJ1J 4XI5C 3KXFA 3B6SB 4QCIA 4I0PC 4OZ4B 3BWAB 4ODWA 3FONA 1F3JA 1NCCL 5KVEH 5D5MF 2CJUH 1NGXB 4H88H 3QFJE 4TVPE 4YDIL 5EOCJ 3SQOL 5DZNA 5BW7A 5A2JH 1J8HB 5GS1A 2BXYA 3SPVB 5LGKA 1D6VL 4ENED 3BIKA 2VXQL 2DRUA 2XZAH 5KTEH 4XVJL 1I7UA 1QNZH 3EAKA 2DM3A 4PJXE 2WIMA 2FBJL 4X6BB 3MBXH 2W9EH 5D70L 4NBYB 5J6GA 4PD4J 4KUCF 3QDMB 1CR9L 1A1MA 3PV6A 1G1YA 3W11C 2NY6B 3L3KB 1F00I 1L4IA 1P6FA 2QV2A 3V6OA 1P4IL 3IJSB 5HHMD 5HGBA 1WIOA 5E7BA 1IGIH 3EJZC 3K2UL 5EIIA 3NCMA 2MTPA 3O8XD 4MXWH 4QRRB 2FEDD 3AMLA 3IFLH 3TN0C 1OD9A 1K5NB 1OSZB 3OAUH 1LO3L 1CIDA 1K4CB 4H1LA 5SWQA 2Q8BH 5IOPA 3CFKB 3MO1A 2X1WL 2QQKH 4XCNA 1A6VL 2PETA 3TWCH 1KPVB 5DEFB 4LSUL 3F58H 4A6YB 4HBQA 5DMKA 2ADFH 4UZGA 1P4BL 5D7IE 4YJZL 3D25A 4EDWL 3GSVA 2Z35A 1LE5B 5E6IC 2JIXB 4P4KB 3VDBA 2UY7A 2UUDH 1ZWIA 3FQRA 5C08A 5IHZA 5GRXG 3GI9H 5FB8B 2DQEL 3TYFA 4IOFC 4XCEB 1S3KL 1I1AD 2D3VA 2GUOB 4OZFB 1SVZA 4NQEA 1KTDB 1DDHB 3OPZH 4BYHA 4TOYH 1V3MA 3ARDD 3NABL 3EOAB 2R2HB 1J10A 4H20L 4AENA 4P3CH 3SDAD 3TVMD 3U0PA 4MNHA 1VGKB 2X89A 3QDAA 3TT3H 5DJZB 1ZT4A 3X13A 3QIUD 1RZKL 3T2OA 4XAKD 1WF5A 3ARBD 4G8GD 2BSSA 4LSVH 5DK3A 1MCCA 4OIIL 2XA3A 2PO6B 3MRIA 5JHLH 1EERB 1OAKH 4OGYL 4WNQB 4I5BA 3JWDL 4U6XB 2RR3A 1JHKL 3EFFA 3VFWB 4PJIF 5FECA 4G5ZL 3H0TA 4LSPH 5BVJB 4X4XB 3B9EA 3HR5A 3UTTA 3JVGC 5CD5D 5IUSA 3ARGB 2CLZA 2PW1A 1NKOA 5D2LA 3M8OH 3HNVL 4WFED 1TJGH 2M1KA 1IEBB 2RQ8A 3CFBA 4M6NL 1B2WH 3LQAL 4BZ1L 1FZMA 5EORH 4NOBA 3V8CA 5ALCH 2JK5A 2CK0L 1NDGB 2WWMD 2R2CA 5E95B 1CTOA 2X9XA 4PRNA 2FX8H 2R4SL 2UVFA 4LQFL 1UZ6F 4HF5L 1JF5A 3T1FB 5D1QD 3LVEA 4Y5XA 4KVCH 3VWJD 5CUSL 4O2CA 2D7TL 1RUKL 5ENWA 5C7XL 5ISZA 1CGYA 1MFCL 4L5FL 1U8HB 1FCCA 3D48R 1KEGH 4HC1L 5FA3B 4WHDA 2MPAL 3O2VL 1ITBB 4NM8L 3RWEB 2VC2H 1IM3A 1J8HD 5D1ZA 2NY2C 1EFXA 1W0YT 4WENB 3BP4B 4MJIA 4N5UA 3UC0H 3LEVL 4QHMA 3HUJB 1CQYA 4WUUE 3RTQD 5TQ0L 3BHBA 3VH8G 2HRPL 4F57L 4O4YL 3PWJA 2AJXL 2NYYC 2YD8A 5CIPA 1A7NL 3H3PL 1T7XA 2N4IA 1BOGB 3N1PC 5IQ7H 1S9XA 4IJ3C 1P7HL 5I1JL 3QUZC 2FRGP 3EDKA 2GTWB 3NIGE 3KDMA 4M6ML 5EU3A 1CLYL 1DR9A 3EDEA 4PGDB 3GMRB 5EC2B 5FV1L 4GG6B 5D7JC 4JVWA 2E3VA 2IG2H 4QRRD 3KNBA 4BFGA 4YWGL 1N0XH 1D5BB 1LILA 4P9HH 3KPQA 5GGRY 4CKVX 4ODVL 3UJTH 1YYLL 2BSTA 5GHWL 3FB5B 4KXZI 2A9MH 1F58L 3A6OA 2X7LA 1F3DH 1C1EH 5LCVL 4JDVA 4XNXH 4B7LA 4UIKH 3FQTA 4ZFGH 4FQJL 2DIAA 4P4KD 5BZWA 5I1KL 4NN6B 5FGBA 1JNLL 3BDXA 4JHZA 4N90E 3W2DH 3KLHC 3VXUA 1E28A 1PY9A 3ALWA 5T3ZD 5DMGC 1YJDC 1D7FA 3SGDH 1IC7H 1O7VA 4H8WL 1JGEB 2YD1A 3MOAH 3VW3H 1MLBA 5H35A 4K7PL 1KLUB 3HNTH 3H3BC 2AABH 4K94H 2EDBA 2XY1A 3FQXB 3T77A 4DQOH 2AJ3B 1FVEA 4MGXA 4GRWE 1AE6H 2PO6D 1NFIA 3QDJD 3EYVB 1T7VA 1QFWH 1FLRH 1FL6A 2VITA 3R06A 3VFRA 1FFPA 3TGXA 4NQXA 4U6VL 4WY7L 4G42B 2VXVL 1G84A 1C5BH 5B38B 4XP6L 4P48A 3KPMB 1A14H 1MJ7H 5CZVH 2Z4QA 3TNMA 4IIQC 5E5MB 4K3EL 1VCAA 3U79A 1XIWB 3IDNA 3ARGD 2NR6D 2VUYA 4MDIB 2X1PA 4TN9A 4L4VE 2Z8WC 3FRPG 5DZLA 3RVWD 3S35H 3WDHA 1FGVL 3WO3B 5DK2A 2CUHA 2AQ3A 5GJTH 4CJ1A 3H2WA 1EBAA 3MNZB 3RWJB 2ZOLB 1NSNH 1T0MA 3ZE2E 4YR6B 4DW2L 4OJFH 4JN1H 3VI3E 2UZXB 4BZ2L 3OF6A 4HIEB 3QQ9D 4JFYB 2HFFA 3LY6A 3KJ4B 4MCYA 4NJ9L 3WUWG 4QRSA 2D7QA 4XC1L 2HYMA 1MWAH 1CD1B 2F19L 3OX8B 1D3CA 5F89B 4QNPF 4FZEH 4EEEA 5DQJA 4PJBB 2APWA 2VLRB 5GGUB 3P73A 2PYFB 1NL0H 1XCTA 12E8L 5E2JA 5DD1H 1Q0YL 3MACH 4P46A 5I1EL 3UDWA 1K6QL 4X6CA 3B8YA 1IT9L 4PB9L 4WDIB 2YPLD 4OB5H 1MCSA 3FOMA 1B9ZA 5JDSA 5DVMA 1CGUA 3SJVE 4HS6B 4AMKH 5J1AA 1KGCD 4NUJA 5DR5H 5LQBL 3OXRB 2GJ6B 3SY0B 1T83A 3R4DA 1UB5B 5F9JA 5L9DL 4L8DA 1OP3K 3S4SA 3O8XC 4XWGH 5HY9A 4QHNB 5MEPA 4XBGB 5ESQA 4MA1B 3U9PH 2ZSWA 4YHIA 5E8OA 1AY1H 1R3LB 1JJUA 3VE0A 5IWLA 1OAUL 4ZD3L 1OAZL 2VDLL 1E6OH 4OQTH 5GJSL 3HTLX 1QLFA 4J3SA 4QWWD 1NDMB 2QHRH 3L5WA 4JZOA 4POZC 3CJJA 3QXAA 1ZLVK 1DN0A 3HPJA 3O4OB 1KB5B 5ID0A 5BZDA 1IKNC 1R24B 3VG0H 3U7YH 2FZ3A 3PDOB 4PJ5A 1FL5B 1Z5LA 3MOQA 1XR8A 1DLHA 3KPRE 4U1HA 1YMMA 5EFIA 1RU9L 4G6JL 4EDXA 4UUJA 5KSVA 1S7XA 2A74B 2GKIA 3QO1A 3TVMC 3WXVH 4PJ7B 3RX8A 4HEME 3RI5F 1FVCB 1QD0A 1P2CB 2KL6A 1T89C 5BCAA 4PBVC 4YXKH 5EPMB 2OJEB 4LVEA 4M7KH 1LP9F 5EWIH 3WE6B 2AV7A 2IAMB 4ZTPH 5GPRA 3TNNA 2AJUL 4ZUTB 3FKUS 2Y5EA 4D9LL 5K33A 4U1SA 1PYWB 3BGFB 1G6VK 2BNRA 1MQKH 5ALBH 1F4WH 4MA8H 3PHQA 3UMTA 4JDTL 3T0EB 1G6RA 2KDGA 3HE7B 4WU5B 5CFHA 5DJ0B 1G0YR 1KG0A 4APQC 3WFEL 1VFMA 3BRDA 1PKQA 4WHTA 5E8PB 1TCRB 5CP7A 1B88A 2F74B 4LPVA 4ODXB 1INDH 5CD5C 3B3IB 5ACLA 2VISA 5HHPA 1H8NA 3FRPA 2AP2A 3LMJH 5H8DA 1NLDH 5EU7E 3L9RA 2Q1EA 3FHQA 2WWMC 3I50H 2ZCHL 2EH8H 3D39E 3HMXH 5EBLB 4OFPA 4S1SH 4OGXL 3LRHA 3QUML 3B4NA 1KIQB 2R0KH 1I7RB 4HZAA 4XCYA 4DEPB 43CAA 3REVB 5DJYA 3DXAD 4JFED 1O7SA 4XT1C 4QXUH 3BSZL 4NO0A 3WUWA 4G8FB 5SWSE 4BH7B 3LDBB 1EGJL 1MHCA 1RURL 3SDDB 1ZS8B 1QQDB 3KPNA 3BPCB 1PG7X 2XKUA 2JJWA 2PNDA 4TTGA 5JQHC 1NFDA 5IROC 4X6DB 5TJWK 3RVTD 1M6OB 2WLYA 2R29H 4HQQL 4PREA 1CT8A 4NPYA 1SHMA 5C6WH 4NQSB 4E0RA 5IK3A 4XH2A 5FUOL 1YNTB 3Q6FA 5I73B 4CMMA 5FYLE 3CPLA 1BZ9A 3KGRA 1Q9OA 2Z0BA 1IGFL 4XVTL 1KLFA 1EHLH 3CXDH 4P5MA 4QO1A 5C0CE 3KYMB 2Z8VC 2NY6C 4ZMAT 1A3QA 4MXQD 4XB7A 2FYYB 2VKXA 3BQUD 3P11L 2GJ6D 1ZTXH 3BESR 3BD5A 1OSPH 1MI5B 4AG4L 1IKFL 4RMVA 4QRUB 3BZEA 1TVHA 1WCQA 2CLRB 1LEKA 1L0XA 4L4TE 3BT2H 3IFOB 1NBZB 3GIZL 4PJAF 4AIZA 1JUFB 1GGTA 2OTWB 3SE4A 4BZYA 4F33A 3NN8A 4LIQE 3MRBB 2BOBA 2GQHA 4P23A 4WHCA 4Y8DC 1L9MA 4GKNB 4Z7WF 5KN5B 4V1DD 1ZLUK 1N4XL 1R3KB 1TMCB 1JWMA 2EDRA 3RUGB 4LVHB 1F11B 3TIEB 5MENA 1SEQL 4HUXB 3TO2A 4HLJA 3G6AA 1T03H 2NY3B 5DO2C 5CWSA 3TO4B 3QIBD 3QCUL 4Y0GA 3ULVL 5EO1B 3P9WB 1I9IH 4HDIB 1A5FL 1IAKB 1UH3A 4PFEA 5CEZD 5GISH 1HXMB 4AM0A 5EU7C 2ADGB 3L95A 4XPHH 4NRZB 4N0UA 3V6ZB 3O9WD 2NY5L 3UP1A 3HE6B 3RL1B 4X4YA 5EU6E 3O45A 5K59E 4G6FD 2J8OA 2PYEE 4EI5C 3OKKB 1WBZB 3W0WA 2P5WD 5C0RL 3M1BB 4PG9A 1D5ZB 4XNZB 2ORBL 4NKOB 1TZGL 5I1GL 4X6FA 2X4NB 4JFOA 2FB4L 3FQUB 4NSKB 2JJUA 5F7KC 3AB0C 3HZKB 3S97C 5I8CB 2PO6C 4MAUL 1RZFL 3LKRA 5IVXF 5JPNB 1G7HA 3X12B 5BMFL 1ORSA 2WM0A 3KYNA 4ZFZB 3ZKND 1P5UA 4GQ9L 3WKMH 3T0ED 3QXUA 5JMOC 5TDPB 3THMH 3P9MB 2BNUB 3WL9B 2R2EB 5HHOA 3PWPB 4HIJA 5BRZA 4L4JA 4CADB 2JCCF 3WLWD 3DECA 3QG7L 1JNNL 3ARGC 2VXTL 3GSOA 5ADOH 4M8QB 3QZWB 4UQ2B 3L5IA 2BRRL 4XP4H 5IBLD 3Q3GA 5JW3L 2KUTA 2UV3A 4JO2H 5GGVH 5HHXH 2X6MA 4JFQA 3LKSB 4TQEH 4ETYA 3ULUD 3G9AB 1BD2A 5JHDB 3OHXB 4DCQB 3QQ9C 3QUXA 3QCTL 3EYFA 3OKYA 4RISL 2R2BA 3CC5A 3K0WA 2OK0H 1Y0LB 4ODHL 1AGDB 4Y2DA 1UXSB 3SDDD 1M4KA 5MEOA 4WI9A 3RHWF 1JF1B 4NWTH 3BD4A 3DGGB 3MQIA 3NFNB 2P5EA 3E3QC 4X0KB 2B1AH 5F7LB 5F7NC 3RWHB 4F7PA 1WITA 4NQDE 3NCJL 3CLEL 1UM4L 2AXFB 1QHPA 4PJXF 4Z7VB 3KPSB 4AEIL 5HVWA 2P8PB 5A2FA 4FXLA 5CS7A 4K23H 4XP1L 3OG4B 3VGBA 1J87A 4G7YH 5I8KL 2HLFD 4QXTB 1UZ8A 3FCTB 4OLVL 3BW9A 5DFTA 1AIFB 3LIZH 4LK4A 1F8TL 2HH0H 4PD4K 3GHEL 4X6EA 2BX5A 4U0RC 4NNXA 5FM5M 4MJ6A 4NQCE 5F7YC 1WBYA 1DBBH 43C9A 1MI5D 1ZGLP 1A7OL 2VXUL 3ELAT 1EGJA 1OHQA 1ED3B 1KC5L 3PGDB 1NMCC 1U3HA 4PRHE 1QA9B 3PWLA 4P2QA 1TQBB 1UWXK 4G3YL 5CJOH 1M1SA 1FFRA 2FGZA 5J4MA 4RSVA 5F3HB 4QWWC 1B90A 5IVOA 1RK0A 4P2RE 2PTVA 3CSBA 5EZJA 1E4WH 5GZOC 4U1LA 2XWJB 4JJ5B 2XRAH 3DNKA 4PJBE 3TO4D 2AS5M 4NN6C 3O3EA 2H45A 3VXPB 5IB1A 1FYTA 4FFZH 2E6QA 5IFHH 2VE6B 5TH2B 5DJ8B 4RNRB 4ALAL 3PP4L 5IHUH 4DN4H 2O5XL 1MJUL 4GMSH 3QDGB 4R2GB 4HPYL 5DMJB 3G5VB 1DFBH 2NTFA 3RPIA 1L7IH 1UFUA 4FRWA 1LO5A 2HTKD 5HDLA 4GRLB 5J12B 3DX7B 5C09D 1TNNA 5CGYD 1A3LH 3UTQB 3VA6A 1CFNA 2AEPH 3MCLH 4Q7DA 4OZGB 2WAHA 1OAQL 2HTLD 1FAIL 4PUBH 3IKCA 4TULL 4OKVB 1UWEH 4N0FB 3D87B 2FDBP 2A77H 2AK4E 4X9IA 5EO9A 3MNWB 1LK2B 4S1RH 3GSUB 3WNOA 2B20A 3V52L 4NQVB 1S9YA 1LNUA 3RAJL 3MLZL 1XIWC 3JWOH 3PE9A 2YUZA 1OTSD 4GXUN 2OP4L 4ZTOL 3E0GA 5JNYA 4RAUA 2DQHH 5KJRH 4LCYA 4Y4FB 3WIFB 1N7MH 1DQMH 4TYUA 4XGZB 4XMPH 4WCYL 2A38A 4JANA 1MVUA 5JHDD 3VGEA 3GJFH 3RVTC 3LB6C 3KJ4C 5IGXL 3VRLF 4IRJB 3KR3H 5F71A 2ATPB 3C9NA 3U30B 4FTVB 3P9LB 3ALXA 1CZ8H 5LGHH 3GMMA 4PTUB 5KS9A 3ARRA 4TNVK 1S5HA 5HDBE 4YIQA 2V5RA 3S34L 1LK3H 1DSFH 2DLTA 3SCMC 2EDKA 4PIRF 3QUKA 4NNYB 1CFVL 3MRQB 3LZFH 2E7MA 4MXQC 1OCWL 4ZPTB 1LO0H 3QR2A 2YEZB 3MLTA 4ZUSB 5MERA 5IBUB 1C5CH 3IDXH 2YN3A 1IC4L 4HLZG 4JM4H 5EG6C 2VWEE 4F7TB 3PQYB 1A3RL 3NZHL 4MA1C 1Y6NR 1DE4B 3A67H 4DGIH 1BAFL 3UTSA 3DV6B 4PJ9B 1DVFA 4R26H 3V4VL 2AJZB 4OD3H 1CGSH 2F5AL 3FFDA 4YDVA 2X4PA 4IBLT 4GH7B 4FQ2L 5DI8B 3HZYB 3T2NH 4NQTA 1FQ9C 1MHPL 5KW9L 1MJ8L 2D4DA 3HG1A 3DI2B 4OCRH 3MV9B 4MYWB 4WO4A 5E24E 1G7QB 1R5WA 3LKNB 1X5HA 3KXFE 4IRSB 3MCKB 3DMMB 3GGWB 1HNGA 1H3VA 3AM8A 4IOIA 2BMKA 4XMLL 3QFJD 5INDA 3O4OC 4QRPA 3FQNB 2I26N 4HFWB 5FYKL 4D8PB 4ELKA 4G8IA 1UXWA 1VFAA 2V6HA 3QI9B 2YWYA 1X5LA 4P4RA 4OLZH 2HT4D 4I48A 1JWSB 1MIML 1NGYB 1VADA 1YYMH 1J1XL 2DYPB 2FIRT 4K07A 1CXKA 4R2GD 5IEKA 3MJGX 4FFWD 1Y18B 3MGOB 2IAMC 2ZPKL 5F7HA 4YPJA 2NY4D 3WFZA 4LKXA 3W39B 3W9EA 4K3JH 3DUUA 3UPAA 1HH6B 2QSQA 4OZIF 3BGFC 3BMWA 4GRLD 4GRWF 2FNBA 4UIMA 5JPMB 2PTUA 5F21B 3SE3C 2XACC 2Y36H 4XPAH 3ZKNC 1KTLB 4N8CL 4PRIA 1FG2B 3HE7C 4WEUD 4ZXBB 1NAMH 5LWYL 4KUZH 4IDJL 2Z93A 3QCVH 4LCIH 3RUGE 3TV3L 3LN5A 1P69B 2CKBL 1ZVHA 3WLWC 1HZHH 1J11A 1GVIA 4QF1B 2JB5L 3GO1L 1FAKT 1IM9D 5JXEA 1CG9A 4OCYH 4JO1H 1H3PH 5FXCH 1EEYB 4N8VG 4BUGA 1MAKA 5HYQB 2PXYC 5F1IA 4UINL 4Y4FD 1HCVA 3QPXH 3MSPA 2GFBA 2DMCA 3IKKA 1V05A 1KJ2A 2I5YH 5D72L 1RHHB 2V5TA 4EBQH 5TDNA 1OF2A 5DHVH 3STBA 4JHAH 2Q7YB 3NPSB 3KYOA 4M1GH 4WW2C 4LPWA 2WUCH 3DURA 4S10A 4UTBL 1AXTH 3D6GA 2X70B 3PNWA 3GSRB 4S1DD 5KZCD 3ZTJG 3BOVA 4ODSL 3MXWH 5I73C 5I8EB 3LKQA 1D5MB 3VXMA 5T3XL 1T6WA 3W5NA 1M7DB 4KK9D 4L8CA 2HLFC 2OMNA 2GSGB 5CCKL 1S9KC 2A6KA 4U4BA 1FJ1A 4AQ1B 2QJDA 5AG9A 3PWPE 1M71B 4KZEH 1KXVC 1BGXL 3OJ2C 4UU9B 5J8OA 4Z7UA 1CDHA 1BP3B 4ZUUA 1RIVL 2F53B 1MFDH 3H7LA 5ELIA 2FJHB 1OP5H 1N5AA 3CGTA 2QQNL 3VXSB 3HNSL 1F90L 1NBYA 3EOTL 3HC0B 3GSNL 2XFXA 3LN9A 4M1DL 4MD4B 5EA0H 2X9WA 1FG9C 3CH1B 4PV8A 4LKCA 3G5ZA 4K71B 1NC2A 4KMTL 5F7MC 3EO0A 3W81A 1IQDA 1QRNA 3A0OA 1U8NA 4FQHA 2H26A 4HKZA 1FFNB 1J1PH 5HGAB 1QUNA 4H1LH 5IMLA 1MHHA 3NCYS 2Y7QB 1CK0H 5EN2B 3TIDB 1NAKL 4QHUA 1I1YB 3VFOA 4LVHC 1EHXA 2VZVA 3AXLB 4PLKD 4JG1H 1ES0A 1T5WA 2NY3C 5DQDL 1OP9A 5DUMH 1BHGA 4QTIH 4LARL 4BSWB 1A6ZA 4NT6B 4Z7OE 5EUOA 2BVEA 4Z7VE 4BK5A 2M8XA 4IRSD 4MDJA