5LGKA

Crystal structure of the human ige-fc bound to its b cell receptor dercd23
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
307
structure length
307
Chain Sequence
VKILQSSCDGGGHFPPTIQLCLVSGYTPGTIQITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig epsilon chain C region
publication title IgE binds asymmetrically to its B cell receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA03
4D94A 4AJ0A 4OF0A 5E8PA 5DHXB 4PRNB 4K8RH 1E4KA 4N0UE 3PQYE 5EN2A 4URTB 3GGWB 1INQB 4ZPTB 4Z76A 3D39A 3QFJB 5IF0B 1N8ZA 2CQVA 1N6QH 3NCYS 4X5XA 1A6ZB 1KIUA 5KSAB 4UU9B 2GJJA 4E41A 3THML 1AR2A 3GMOA 3TF7C 4KXZI 5E8NB 3ECBB 3EO0B 3OJDB 5DWUH 1GL4B 3BESR 3NIGF 4X98A 5E70A 1FBIL 4R2GC 5C2BL 5IEHA 3VH8G 1DANU 5C08E 5FCUL 1NFDE 2AEQH 5C0EB 1WIOA 5FOBB 1MCIA 2V5YA 4AIXA 4ZTPL 5BVPH 4R97C 3KAAA 3FT4A 3PGFH 2P8MB 4MS8D 3QO1A 5C0CE 3GK8L 3MGOA 1T1YB 4DKDC 4YUEL 4LPUA 5DJZA 3MXVL 3CLFL 5EU5A 4L3CB 2X4RA 3PV7A 1JGDA 1RJCA 1IBGH 2LAAA 2OBGA 2WBKA 3ZDXF 4O9HL 5MHSE 3T3MF 2YD9A 3QDJB 1VFAB 4MJ4A 1QEWB 4A6YA 1NBQA 2IG2L 4FQ2L 2YA2A 2YEZB 3QIUA 5MENB 3F62A 4PRIA 2RHEA 3RPIB 3UTSA 4LSUH 1A9EA 1QBAA 1S78D 1N7MH 3QHTC 4GG6B 5CD5D 3PE9A 3KPSB 1A64A 1IGJB 5T5NG 1QP1A 1G6RL 1KB5H 1U3HC 1EERB 3KPRD 4ZUUB 3LPFA 1WT5C 3PG2A 4D0BB 5M95B 3H9HA 4MAYD 3SDCD 1UH4A 1AIFA 4OAWA 3RGVA 3TJHC 3VG9B 4OLEA 2C3VB 3S88L 5HHMB 3T2NL 1JZ7A 1E27B 3RNQA 5I76B 4PV9B 3QNXA 4TRPL 5GS0D 4TNVK 3RUGE 5GZND 2HLAB 1JHTB 4KY1H 2F54D 5ESVA 1EA9C 1A7NL 1V7MH 3LHPH 4XXDB 3NABH 5I8KL 3X17A 4J3TA 5FA3B 1YEJL 1CN4A 3SQBA 1YPZB 5DMIH 1UM5L 1YY9C 3OMZA 4YGVA 4S1QH 1KPUA 4LLUB 5E4IA 1GJIA 1IM3B 5HI4C 4KK8C 5JPNA 3H3PL 3MV9A 4ZNEA 5KS9A 1JI2A 1LEGA 4MZ3A 4RGNE 2ATPA 4R9HA 3IXAA 4MWFA 2JCCF 2C7UB 4Z7UB 2E9IA 4TULL 4ELMF 2PO6D 1A6VH 1V3KA 3BKJH 3UAJC 1MCLA 3X13A 5DUMH 2GIYA 4XAWH 4NRYA 1SJXA 3KYMA 4MA3B 1CXHA 3RKPA 1JNNH 2D0GA 4LARL 2E27L 1CBVL 4OLYH 1WAAE 2I5YL 5D1XC 3VD9A 2D9CA 1XH3B 5ANME 3IFPA 5E8DH 1DUZA 1ES0B 4KK6D 1J8KA 2F5AH 3WJJA 5F3BA 4UILL 3B5TA 3LEVH 5CJOH 4JPWH 5B8CB 4NZDA 1ZWIA 2C26A 5MEPA 2I60L 1IT9H 3AMLA 1TVBB 3QEHA 3S37X 5IK3A 3BUYB 4YHKH 2GUOA 4KC3B 3ZTJG 4CVZA 5ENWA 2DLGA 2DQTH 1G7JA 5CCKH 2R1WA 5FO7B 1E4JA 4F57L 4PJEA 3ARYA 3CFJA 5SWQB 1HWHB 1OAXH 3D2UD 1FJ1B 1VADA 1QYGH 1OWWA 4PTTB 1CE1L 2H9GB 4JO1L 2D7OA 3VXME 1MWAB 3RWCB 4D9QD 4OI8A 3ZSSA 2GW5A 5GSRA 2BVOB 4X4ME 2YSSB 4Z8FH 3ESVF 3CPLB 5E2VH 3KDMB 5JHDB 2AJYL 1A0QL 2WZPD 3I6LD 2BSTB 5A2FA 1LNUA 1NCAL 5DJCA 1PQZA 4HC1L 3V4UL 4JFFA 5D5MB 4E0RB 4C83A 1YEGL 1HIML 4LLMA 4FFYH 4PJ9B 3GMLA 3DV6B 3SDDD 4P9ML 4G7YL 5DQJA 2M1KA 2DICA 1QFWL 4BSVA 3ARGC 1KJVB 3MUGA 5EU6E 2PYFA 3O8XC 1PY4A 4OD1H 1UQSA 2ZCLL 3QDMD 2V7HA 4JY6B 4K3JL 1YUHB 5IV2B 1KT2B 4YHOL 1EHXA 3O3BA 3P2TA 3PDOA 2Y25A 3JWDC 4PREA 2FSEB 2VDLL 4NBXB 4KROB 3W0WE 2P45B 3HC3H 1Q9LA 3JWNC 1D5BA 5M7QA 3ROOA 2YRPA 4V1DA 3O6KH 4MD4B 3LIZL 4MHHI 3MGTB 2NXZB 5B22A 1HCFX 3S96B 1I8LA 5D1QD 1DLHA 1ZV5A 2A2QT 4P2RD 3ESUF 2W60B 2FCBA 5C0NC 3AMKA 1NLDL 3QIBD 3F7YB 1JPSH 3PIQB 3PGDB 3HC4H 1KELH 4TSAL 2X41A 3Q5OA 5CJXA 1JWMA 5CINL 5E6ZA 5F6HI 1K5NA 3CH1B 1NBVH 4P4KA 5J6GB 3BDYH 5F1IA 3BP7B 5B38G 2FO4B 3V0WH 3VFSA 1NJ9A 3UPCA 2AV1B 4FS0A 2A9MH 4OM0H 4POYA 2R4RL 1OTUD 3DPBA 1EJOL 2VLJA 5DEZA 1GZQA 2EDTA 4BFIA 2VZVA 4WHTA 5HI3D 5IWLA 4D0CA 3TYGH 1WIUA 2G2RA 1MLBA 4ODUB 1HZHL 3S3SA 1YECH 4HIJA 3DX8A 4P23B 3ARVA 1B0RB 1MCHA 2P49B 3KPMA 4OQTH 4HBQA 1MJUH 5IT2H 3GSXB 1UJ3A 3KNBA 3Q6FA 4QXUH 2HT4D 3BPOC 3DVGA 4XTRD 2XPGA 2ZSVA 4OF6A 3UXFA 3T0ED 2O61B 3UC0H 3V8OA 3VXPA 4KJPC 4AIZA 1NUNB 2J6EL 2GCYB 1JF5A 5KTEH 2WUBH 5F1OB 1RZIA 4J1UB 4HKZA 2XWJB 2AVGA 4BJLA 5D1ZC 5KBNC 3E1F1 3QHFL 4HK0B 4CL7A 5LCVH 1QRNA 2VLMD 3SE9L 5J7CC 4K7PX 3AU1B 4OF3A 2AEIT 3DX6B 3MLZL 2QQQA 5GSVB 3JWDL 1Q9WA 3PWPE 5E2TL 1VACA 5BZDB 4KRPB 1TZHA 1XGRA 4YJZL 1IAKA 5LKNA 4BSWB 1LD9B 4KWUA 2WIMA 2Y7QA 5GHWH 1KXTB 4KKBD 1T83A 4OFVA 5I1GL 1URLA 2OTUB 5BXFB 4F37F 1T5XB 3HZKB 1XGPB 5D71L 1J1OL 4Y2DB 3MRFB 3LRSA 5DK2B 2IFFL 1X6NA 2PYEB 4O4YH 1DQLL 1D6EB 3KLDA 3MLYH 4GOSA 3TVMC 1AXTH 5GISH 4L4VA 1T4KA 2OI9C 4HCRL 4OUOA 5DVKA 4ETQB 2AGJH 2DQFA 2YOCA 3CFIC 5JO5B 3G6JF 1YJDC 1VKXA 2CKNA 1MPAH 1DE4B 1QR1B 1MF2H 4HJJH 1Z5LB 1MHCB 3OHXA 3OV6A 1RUPH 3QUXC 5IESH 4L3EB 9CGTA 4Y1AD 4F9LC 5KN5A 1A4JA 2PUQT 4AY0A 5T5FH 3HB3C 3VGAB 1U8IB 4F7CA 1QLRB 2ILLA 1HOCA 3O3AA 5IUSA 1UWGL 5SWZB 1YYLH 1S7TA 3W81A 4PRPE 1SJHB 4XZUB 1YY8B 3RNKA 1OQXA 3A6CL 3MJ9H 5BW7C 3IDIA 2V5RA 5I1JL 3LZFL 4NNPH 2DD8L 2NW3A 4FABH 4HPYH 4PLKC 3L3GB 2AJXL 5BS0D 1H0DB 3EJZD 5L2KE 3GJFA 5ICZA 1HI6B 5T3XH 1AQKL 3PDGA 2F53A 4XPBL 1D5ZB 3L5XH 3ZTNH 2CLVB 1ZK9A 4QGTA 4NBZB 4MD5B 3PDDA 1ZOXA 1FGVH 5JW3H 1S7UB 4YHPA 1FYTD 1ND0A 3FZUD 3DV4B 4PJ5A 5C70A 2G75B 2WSKA 1YNLH 3NCFB 5F6HJ 2XY2A 2ZJSL 5H2BA 1AR1C 1BMGA 3ABZA 3QDGA 4WI3A 3UTZA 4R0LB 5I30L 5IKCA 2NNAA 1BOGA 1XR8B 2VZ1A 4K71C 3VXUB 4XVTL 5DTFA 1HINL 5GS1B 2HVKB 3L7EA 1U3ZA 1FSKC 3GSNL 4KQ4L 3EYUH 3CFCH 4NKOA 5I1DA 1TJGH 4TPRH 1K3IA 5DD0L 3ZKSD 1NCWL 3U9PL 2GTZB 3H7LA 1S8DA 4U1JA 1WZMA 1IKNA 4X6DE 4U0RB 5F9JB 3ZKXB 3GUTA 4JKMA 1NKRA 4PP2A 4RISL 4NQDE 3Q2CA 5A2JH 3OKLB 3H7BA 3W39A 2C3HA 1BX2A 4LIQE 4XCEA 4I0PA 4BUHA 4ODSL 2XTJC 2A6DB 3WO4B 4K8RD 4Z78A 1YJDL 4HXAH 1K4DB 1WBZA 1X5XA 2AK4A 2D03H 2X9YA 4X4XB 4MB3A 5B3NA 1F5WA 5DHYA 3KLHC 2CDEA 2CDFB 1UEMA 2ORBL 4NHUA 5DQ9A 4I2XB 4G8EA 3HUJF 3QZWA 3OAZH 2HFEB 1I8MB 1KJ3H 4JQVC 4MMXC 4Z0XA 3TGXA 1ZLSL 1D9KC 5ID0A 3S35H 1ZT4B 2VITA 2OQJA 1ZE3C 4Y4KC 2AJUL 4WWKD 1A02N 3QULB 4XNYH 4UIKL 4Y5YA 4M61A 1CDIA 1JJUA 2YPLA 3RZCB 4BKLA 1J5OL 5H94A 5ISZA 5SX4H 2HA1A 4Z5RB 3FB7B 1GGBH 4RGMB 5F96L 1YN6B 2PO6C 2FR4B 2X40A 1C5BH 3SE8H 3VRJA 4GS7B 4DK6A 1ORQA 3KHQA 4ZOBA 4PBXA 4XPAL 4YHML 3MSPA 1F90H 3HG1D 4F2MB 2FWOB 1CGUA 4U1NA 4J8RB 1TMCB 2W9DL 3VFTA 4FP8L 4F58H 5EDXA 3IFLH 5DD1L 4ZD3H 3WIHA 4RMRA 4J4PC 3IAPA 3UROR 4L5FH 4WW2B 1BZ9B 5DS8B 3RWGA 1N26A 4CNIA 1X5KA 1LVEA 5C8JB 4WV1B 1WWCA 3WL9A 4HUVA 3AM8A 3UTSE 5INCA 2AJVH 4RMVA 3ZE1F 5CP3H 3U7AA 4P5TB 2VJXA 4JN1L 4JFDD 4OGXL 1WZ1H 4JDZB 4WFEE 4XH2A 2E9WA 4NQED 5A43C 1CXIA 1YDPB 4YZFE 3O4OB 3P9LB 3R1GL 4DEPC 1TENA 5CBEB 3PP3H 3NZHL 3MGAA 4ELKB 5DSCB 1Q9KA 4PJXB 5C6PB 4OGYL 1DVFB 1FLRL 1FZOB 3WNLA 1Y6KR 1MEXH 3LKPA 5CZXD 4YNYB 5B4MC 1S5HA 4MQSB 4GT7A 3M17B 3NIFF 1LP9B 3OX8A 3VXRA 1LEIB 1KN2L 3ZHDA 5DFWH 4BQCA 3N85L 3UP1A 2BSED 1C5DB 5I8OH 4HK3N 1HHIA 3MV9E 3FONA 5HHOD 5F9DC 5TPWL 2W0FB 3I9GH 1FFOB 3TN0A 3LRHA 4M4PA 2BNRE 1EEZA 4F8TA 3PUCA 3GSNA 2BERA 2VSDA 4TOYH 1H15B 5DLML 3WIIH 2HJLA 2P5WB 3VFMA 3ULVC 3HNTH 4R3SB 4I5BB 4JKKA 3IDYB 4QNPF 2APFA 5J1AA 1IEAA 1LQSR 5E5RB 2VQ1B 5D6CB 1RV6X 1FORL 1OD9A 2R4SL 1S9WB 1TVHB 4MNHA 3VMNA 3P30L 5HGAA 5A2KH 4LLWB 5F71A 4DGIL 2C9AA 5ELIA 1T2QL 4WU7B 4NKDA 3MLTB 1U3JA 5KJRH 5FYKL 2R2BB 4WFHE 3H9YA 5IJKA 3IVKA 4X9IA 1OPGL 1FGNH 1IEBA 1VFUA 3P4LA 1G7PB 1ZSDA 2EIBA 5IB5B 4FQIL 3CDGA 4LFHG 2X4TA 2FX8H 4LCCC 3SE3C 4ODVL 4PJEE 2RBLA 5HI3C 1BFVL 1N2RB 1J1PL 2B4CC 1TIUA 4W70A 2KUTA 2F5BH 1P84K 3CSPA 4YXLL 1CD1A 3ILQD 2FYYA 4Y5XA 3V4VH 3HZMB 4QTHA 5FUOL 1NDMA 4LKXA 4Q2ZA 1GC1H 4JRYB 4CN4A 1AFVH 5IW1A 3B5HA 4Y16D 4M6MH 1UXSB 2ADIB 4NRZA 4OLZH 4XTRC 4UDTB 3HLAB 4N8CH 4JFFE 4L9LA 2HKFH 2Q86A 1HXYB 2QKIA 5FCSH 1U8JA 4YFLI 4XP4H 4U33A 3FN0H 5EU4A 1MI5E 2WINA 5CGYD 1T03L 1KV3A 1GPOH 4JM2C 5SV3A 3SKOB 4G6AC 4NO5B 4OSUH 5TGBA 1ITCA 2DJ4A 5ALBH 5D2LA 4ZOCA 2Z91B 5DRXA 3QUYD 3OG4B 3TT3L 1JF1A 1HNGA 2AXGB 1H5BC 2Q8BH 1FVEB 5DR5L 3B2VH 2AKRA 2J8OA 1FE8H 2WW8A 3JUZA 2XQBH 3VA6A 1DQMH 5HYJE 2Z31D 3ULVL 4V1DE 3WDHA 1PLGL 3LCYA 3WS6A 4MLIA 4I77L 4LVNB 3X3FH 4BFBD 4EQ2A 3C60C 3KPRA 5LXGL 3PQYB 2JTDA 3CX2A 5EZIL 5CEZD 4MAYA 3RI5F 3SDCA 1HEZA 1S5IL 2LU7A 4NNYA 4DKFL 3KPOB 4BM7A 4W6YB 1EBAA 5F70A 1ZGLB 1N5YH 1DLFH 1LDPL 2W9EL 1J0IA 4NGHL 3JWOC 3MBEA 4KI5E 2BFVL 2UWEA 1PD6A 2BVPA 3L1OH 1MJ7H 2M26A 3QNYB 4K23H 4TSCL 3T4AA 3U0PA 5A1AA 3IAQA 2F54A 5C08B 5DMKB 1NFDB 4XVJH 4LQ1A 4YK4C 2A6IA 5BMFH 4U1MB 6FABH 3O6MH 2YZ1A 4LU5L 5C0CB 4NNXA 1QHOA 4Z7VE 4GH7B 5FM8A 3PWNB 4FQXB 4XNZB 4PY8J 5JR1H 1JHLL 3PHOB 1EMTL 1TZGH 4PJDE 5E5MA 4J7RA 1JF6A 2HH0L 2Q76A 1A6TA 5AWNH 2GSGB 2VH5L 3H6JA 1JZ3A 5C0IB 3LKRA 5FHAH 1X5GA 1QG3A 1DBKL 1T2XA 4GXUN 3NH7H 1Y18A 4UIMA 5HYQB 5DRZB 5FGRA 5I8EA 2DLIA 4PRAB 1QOKA 3AY4C 5DRWB 4NKMB 4RRPG 1NQBA 3HI6L 1WFUA 3U1SH 2CLZB 1U8HA 2QQLL 5HHPB 3VRIA 1DDHB 2WWMC 4PGCB 1JNLH 1QRNE 1NCNA 1FDLL 1T66D 4Q0XH 2AV7B 1T0NB 3ZT7A 5J9PB 1I9IL 4ZUWA 4QLRA 3BO8A 2B1AL 4LCWE 4J3UA 4OKDA 4KPHL 4RFOL 1I8IB 1X3DA 1JUFB 4PJ7F 4POZC 2H1PH 4NN6C 4F80A 1AY1L 4MNGA 2AW2A 1JGEB 5HVHC 1QSEB 4Q6IC 4ZFFB 5EZOL 2YUXA 4Z95H 1OM3L 3GRWL 4ZXBC 3WHXB 1EO5A 4FNLH 1QACA 1H3PL 2NY3D 2DKUA 5T1KB 3DRQA 4JHBA 3D2UA 4HS8L 2EDNA 4LSPH 5CS7A 5IMMB 3U7YH 1MHHA 4AEHH 2JIXD 2EYTB 1UH2A 4M7LL 2C1PB 5TDOA 3K2UH 4AL8H 5FV1L 4Y19D 3F7RA 4L4VE 1FIGH 2HTLD 1HDMA 3JWOL 4ZODA 2O93L 4LVOB 3MRHB 3RWIA 4ORZC 4RDQF 1OSPL 3TIEB 4OZIF 1U8KA 1ZHBB 2EO9A 4RGNB 5FHBL 4ZFOB 1MVUA 2DL2A 1GHFL 4JO3L 1GH7A 1F6FB 2X1QA 1GRWA 1ZHNA 3K1KC 4W4NA 1P6AB 3MR9B 2CR3A 3D69A 3B9EA 3LMJH 1FHGA 1AGEA 2F8VA 1Q9OA 3SDDA 1D5IH 3WUZA 5JZ7C 3NBNA 4EBQH 4QXTB 5DD3L 4BQ9A 4K3GA 3ARPA 1W72B 3RHWK 5AEAA 1HSAA 3HE7D 1UWEH 5A2LH 2ZKHH 1MIEL 2DYPB 5T3XD 1UWXH 2DI7A 3BH8B 3QDMA 4L4TD 3TV3L 1ZLUK 1DQQB 1FNGB 5IFAL 4QRRE 4TQEH 3QEQD 5BJTB 3MRJB 5LAXB 1SBSH 1PG7L 4OT1H 3BWAB 1BBJA 2F53E 3VG0L 4XMKH 4H25A 1F00I 1KNOB 3P73B 4PJ5E 3LQAH 2VZSA 3IETB 5D1QA 4P2RA 3JTTB 3CC5A 4PJBA 4WNQA 4N0CD 2EYRA 5TE6L 5EUKB 4GMTL 3QDGE 1YN7A 1ADQH 3QIBA 2FEEL 4XBGA 1I3GH 1FNHA 3KPLB 3VXMB 1PW3A 1ED3B 4QRUA 5D6DA 3SDXF 3GMRA 3QIWB 2BMKA 4XC3H 2DIJA 3EOAA 1IQWL 5EBWB 5IVNA 1CTOA 2K9UA 3BYYA 3NPSB 2ESVD 4OZHE 3SO3B 5J89A 15C8H 2NLJA 3OKKB 1S9XB 1ZTXH 2FO1A 3NCBB 3MMEA 5C9JA 2LQRA 3BJLA 3TCXA 2HVJB 2DDQL 1QA9A 1MRDL 2XG4A 3P4MA 5FO8A 3QQ3B 2BVUA 3LQMA 3T2QA 1AP2A 3G04B 3SKMB 1EZVY 1WK0A 3FQNA 4OZFA 5IBLC 5DC4B 2GJ6D 5TDPB 2V7NB 3E3QC 5FUCC 2QSQA 5F9OH 4U49A 1CD8A 2AK4E 4UINH 4MNQD 1CDUA 3T0EA 1CL7H 3RTQD 5DK0A 4P2YA 1MFEH 3DARA 4DAGL 4J3VA 2GTWB 3D9AH 4PJFB 4HUUB 4ODHH 4L4JA 3IT8D 3SKNB 4HH9B 5J13B 4L9DA 3QISA 2V2TB 2YK1H 1RIUH 4HIXH 5ILTL 2ITDA 1OWRM 1D5MA 4FZ8H 5BVPL 2YPLE 2KPNA 3T4YB 2YRLA 4NOFA 4MXQC 2V9QA 1SY6H 5KSBE 3QCUL 3RY5A 3X11B 5DT1L 3FQXA 4IMKC 5L7XL 2ITCB 3QUMA 3B83A 3T0AA 3OR7A 2B0SH 5ICYA 4X80L 1T20B 4M5YH 3GM0A 1I8KB 1F8TH 5HYIA 4MQTB 5MP6H 3WKMH 4JFHE 5IIEA 2E8ZA 3HRZA 2V5TA 5FDWB 4LSUL 1S7RB 5EWIH 4JREB 2ZCHH 3MRNA 5JXED 3LAFA 1KCUH 2UUDH 1RVFL 4WEBL 2H3NB 1IRAY 5D7IE 5FYLE 3K46A 3L9RB 2OR9L 3LRGA 3TO4C 5FB8A 1R5VA 2YMXH 2GITA 3EUUA 4JVUA 4A2LA 2OCFD 4IIQB 2C3WA 4P2OD 5HHVL 3HHRB 3UMTA 4P5MA 4Y1AA 2D3VA 2XN9E 3WE6A 2DLFL 1T6WA 4AEIH 4ZOEA 3IF1A 1WEJH 1CXFA 3FHAA 1I4FB 1Q1JL 2LTQB 4UDUA 2F19H 5I18H 1BIIB 3BPNB 3HKFA 3OTTA 1IGYB 3PHQB 5CJQL 4YLQT 1MCQA 4QRTA 3OAZK 1T1WB 4JDTH 3EYFA 2KDGA 1V7ML 2P24A 3RIAK 5IEKA 3PP4H 3WSQL 2VKWA 4U1IA 5BS0A 4P3DA 2CRZA 3P4OA 4XX1G 1RZJH 4WGWB 3CFBB 2OSLA 3QZWG 1T7YA 1X5HA 1ODAA 5FK9B 5HJ3A 1FYTA 2CDGB 1S7XB 2C1OB 3GO1H 2GK0B 3VXRE 4JFYA 3VXNA 3IFNL 4NO3A 3T65A 4MJ6A 5K9KA 1GYAA 2DIBA 4J3XA 1EO7A 1BGXH 1RJLA 3RY6A 5JQHC 2YD7A 5B3JE 3BKJL 3MZGB 4XAKE 4H1LH 4X7SL 3GMQA 4EUPB 5DC9B 2LFGA 3FOMB 4LAQL 2VABB 4FXGA 3QUYC 3TFKD 1PKQE 5LQBL 1NSNL 2AAVA 2FATH 4LHQB 2A6JA 3T2OA 1EGJL 1A3LH 5GGUB 5JIIA 2WBJC 1YEHH 3WN5C 2HLFD 5E8DL 2C5DC 2DTML 1QPPA 2Z31C 4D9LL 5I1CH 3G08B 4NO0D 1JN6A 4KMQA 5FKAB 1KCVH 1WF5A 4RIRB 4JFZH 4YIQA 4H0HB 2EEBA 4ZUSB 1LE9B 4WO4C 4U4BA 1CFSB 1IAII 4YHKL 1QZ1A 4EI5D 1A14H 1HSBB 1G9NC 1E6OH 5L2JB 1JBJA 1CFTA 3DVNB 2DQTL 3IJHA 5GRUH 5E4EB 1G1YA 5KSAC 2XOTA 3RKDC 4FQQA 3MV7D 3MNWA 3PABB 1NUGA 4MA7H 1QLFA 3HAEB 4HAGA 4ZPVB 1UYWH 4IOIB 4X99B 4NQXB 2J5LB 5L2KB 2W0PA 2ED7A 2QADB 4ODXB 5BV7B 1IAMA 3M8OH 4PRBB 1NMCB 4IRJD 1U42A 3ARXA 3NIDE 3NFNB 1WFNA 4Q74A 1J05A 2EH7H 4OIBA 4WHDA 1KIQB 3KJ4C 3SY0A 1I7ZA 5C86A 2VL5B 1NCTA 1G1CA 1C16A 4MYWB 1JPTH 4PJHF 4S1DD 4FFYL 4WWKA 5EZLB 2I07B 2ZG2A 2X4SB 3BEVB 4KJWC 1JI1A 4PS4L 3VFUA 4OD3H 1GVIA 4PGDB 1FG2B 2OL3H 1NCBH 2B1HL 5HY9A 2AQ1A 4OZGA 4U6VH 1KCSL 4NRXB 4JANB 4G6FB 2XZCH 2A1WH 1FL6A 5HYSA 3BIAX 1V8HA 4EIZC 3HG1A 1CDGA 1T66C 4JZOB 4X6DB 3O9WB 1QBLH 4HIEA 3TBVA 1C5CL 2DQHH 3UTQB 4JO4H 3TNMB 2JJSC 3PWVA 4QHMA 1HQRA 2WM0A 5E6ID 2X4NB 3VG9C 4GXVH 4QRSA 3BSZL 1KB5A 1XGQA 1RUML 3UBXA 1LO5A 3MUY1 2XQYK 1BQLL 2NY5C 3VFWA 2F8OA 4G6MH 2FHFA 3G5XA 5TQ2L 5E8PB 2PR4H 3KPRE 3ZHLA 4MCYA 1E28A 1G9NL 5EN2B 2F74B 4NQEA 4Z76B 2Y5TA 4GJTB 1N8ZB 3IS0X 2FJGA 4X5XB 1E4XI 3NFPA 1CFQA 2DQIL 4E41B 2XTJE 3GMOB 1HILA 3GJEA 4M1GL 4F37K 1TJIH 3TYGL 3TJEH 2UWEE 4XWOD 1WIPA 4P5KA 3U9UA 3D0VA 4JPIA 3EJJX 5IEHB 2VO5A 4OCSH 1XR9A 4JHWH 4YBQD 5DJ6B 1MJJA 5IT2L 1A3RH 4N0YH 3SDYL 1J0KA 5J11B 3GMNA 3PNWB 3CXDL 4JR9H 3QO1B 2JB5H 2CLRB 2X70A 4LCYA 2I9TA 1UH3A 5I2IB 4GXUM 3HE7C 5BQ7A 3LS4H 2A74B 1R3JA 2NY0B 5DJZB 2WUBL 5JHLH 5HHOA 2BSSA 4F7TA 1LWRA 5EU5B 2X4RB 1MAJA 3D5OF 1JGDB 3T0WA 3UPRA 5B8CC 3R4DA 1T5WA 4GRMA 1U8PA 1WZLA 5FUZL 3QIUB 1OAYL 4HS6A 4PRIB 4JQXA 4JGJA 3UTSB 1A9EB 3Q1SL 4FXKB 4GQPH 2F9BT 3VJ6B 1ZXQA 3H9HB 2ATKA 4X7DC 3RVTC 5KAQG 4YE4L 1AIFB 4OAWB 3RGVB 1IMHC 1HYSD 1B9ZA 4MNGE 3VCLA 1WTGT 2UYLA 2XZZA 5CIPH 4ZTOL 2NY5L 1X4ZA 1R3LA 3RNQB 1HKLH 1EK3A 1JYVA 5FYKE 2MTPA 2YD6A 2R9HD 4JJHA 1I1AA 4QYOA 1OAKL 4YHLH 5D70H 3H0TB 5ESVB 3TZVD 2GYSA 3V6ZA 3BP4A 5KW9H 1IGFH 1YEDA 5DVLA 2CO6B 2L0DA 4FQCH 5T1DH 4YDIL 2Y36H 4YGVB 1KPUB 1WGOA 3JBG7 4D9QE 1HHJA 1FNFA 4WJ5A 1VERA 5JPNB 3MV9B 4XRCB 5T5FL 5KS9B 1MCPH 1LEGB 3MBXL 3S7GA 4Y16A 3Q5YA 2ATPB 3I6LE 4TTDC 3ZHKA 1T7XA 3IXAB 4MWFB 3S37H 4ZYKA 1MHPL 1D6VL 3DRTA 3EYQD 5FYJU 3KYKL 3TA3D 3ARSA 5DZNA 3X13B 5IBTH 4DKAA 4NRYB 3HPJB 3KYMB 3O41A 4U3CA 4PJIA 3K1DA 2QSCH 1BJ8A 4OFPA 2NXZC 3IFPB 1DUZB 3S3JA 4DKEL 3ARRA 5KANG 5JW3L 3QUYA 4PB9H 4U1HB 5F3BB 1LDSA 1NCDH 1RULH 3DURA 7FABL 3UDWC 3S4SG 5F7WC 1ZWIB 2BHYA 4QRQA 3QEHB 5IK3B 1JGLH 3B2UD 4N68A 4CVZB 1AD9B 2GUOB 2Z31A 3VFRA 2D31A 5ENWB 3ULVE 1KFAL 1G7JB 4U6HA 3BW9A 2YWZA 2R1WB 3UO1H 5DJYA 2ZZUT 3F58H 2E5EA 4PJEB 2OM5A 3KGRA 3CFJB 4HT1L 4MQXC 1J8HA 1DQTA 1R3HA 1VADB 3TNNA 4P99A 3CFCL 5D7JD 3I50H 1CT8A 3QEUA 1MWAL 1NCCL 5INDA 3AAZA 1A5FL 5GSRB 2Q87A 1U91B 2PXYD 3DYMA 1PJ9A 4HWEH 4WUUD 3GSUA 5E8EB 1A1MA 4NWTL 5D93B 1LNUB 2DQCL 5DJCB 1PQZB 1AGFA 5CUSL 4JFFB 4NQSA 7CGTA 3S9DB 4IM8A 2W0LA 4P2OC 4C83B 5E94A 4O58H 3GBML 4LLMB 5IW6A 4JPKH 3D85D 2VDMH 4OQTA 4LHJB 3GMLB 4KGJA 1J18A 1IARB 3DXAD 1MI5B 5DQJB 3GHEL 2J8UA 1J88A 3V95A 4BSVB 2Z92A 3RAJL 3F6LA 3MUGB 4QOKD 5IR1B 4NM8L 1SYVA 3RX7A 1MAMH 1UQSB 4ALAL 2V7HB 3WXVL 4LSVH 3OZ9H 5L8JB 1IZJA 2VLRD 3BPCA 3O3BB 4G8GE 3PDOB 4PREB 5TFSL 4ENED 4NN5B 1MFBH 3MFGB 2MSPA 4KRPC 1Q9LB 1UWXK 2C4FT 1CDBA 1D5BB 5HYJB 3ROOB 4IJ3B 4NZRH 4V1DB 4F8QA 1MLCA 4M48L 2ZOKA 2D7MA 4ZFZB 1DN0B 1T1ZA 3DIFA 1OW0A 3R8QA 4LLQA 1DLHB 2DBJA 3NACH 4YHNA 3ARWA 4EXPX 5I1EH 1SMAA 2VLME 4Y2DC 3SE8L 4G6JH 1ZA3A 4RQQA 1OF2A 1JWMB 5IFHL 1M4KA 1NAMH 2IWGA 4X6CF 3DUUA 4Q9QL 4P4KB 1JFQL 1F90L 2D7NA 4UV4H 3PV6A 5E2WH 1G9EA 1JGUH 5F1IB 1HN1A 3PXJA 5DDHA 3VFSB 1NJ9B 4XPFH 2V5MA 3U4BH 1UB5A 4F58L 2FEDD 4PGBA 4R4FH 2VLJB 1GZQB 4BFIB 1MCBA 4WHTB 1NFIA 2PTUA 1CLZH 4FZEH 3UJIL 4D0CB 2G2RB 1MLBB 4KK9D 1A47A 2JIXA 3MLVH 4HIJB 2CH8A 3DX8B 4GAGL 4KJQD 4Y19A 4K7PH 1EAPA 1DEEA 5E03A 3W11D 2R39A 3E8UH 3KPMB 4KUCD 3G6DL 1P4LA 4GKSB 4PJDB 3KNBB 3NOIA 3Q6FB 4LEOA 4WI8A 2O5XL 4HWUA 3DVGB 4RGOH 2XPGB 2ZSVB 2HT2C 4TVPH 1UVQB 1K9TA 5F7EH 3VXPB 1JYWA 4AIZB 4P46D 2D7PA 4Y1AE 4P0DA 1S7QA 3LEXA 1A6WH 3MJ9A 4XPTL 1RZIB 4HKZB 3PHSA 3IFOA 1YEFL 4R97B 2ARJA 5JOPE 1LGVA 1GC1C 5CBAA 4HJ0C 4OZFG 3PJSB 1FN4B 3D1MC 3V4PL 4LOUC 3HE7A 3K2MC 2XKSA 1QRNB 2X9WA 4A6YH 4OBSA 2ED9A 4LDOB 1TITA 3HCVA 4R0LC 4L4TA 2X4OA 3HPLA 1XGYL 4WFGD 1Q9WB 5JMOC 1VACB 5BS0E 1LK3H 3EDDA 3QEQA 3U4AA 1TZHB 4FA8A 1XGRB 5GS1C 2AI0L 3MPCA 1IAKB 5I66A 3O4LD 3IS1X 3DYPA 2Y7QB 1W2KT 1AHWA 3C2SA 2V9TA 2FX7L 2L7JA 3ZYIA 3IAGC 4J2XA 4EN3D 5FA4A 4R90L 5T1LD 3R0NA 5JQ6H 4TUJA 3CD4A 5DHVH 3LRSB 1FAKT 4X4YA 3WIIL 4HGMA 4U0RC 3ZKXC 2JCCA 3TH2T 4X7TB 1CQKA 5L6YL 4L4VB 4ELMA 1BQUA 2IPTH 4MB5A 2ARJQ 1T4KB 5IHUL 3MACL 5JDJA 1S9YA 1RZFH 1UEYA 2DQFB 2ESVA 4KI1A 2CKBA 2WK2A 1VKXB 3FMGH 3UZVB 4OLWH 5IOPA 3OHXB 1F42A 3NMEA 4GKOA 3ZZ1A 2EIEA 4R96A 4QTIH 1NBYA 1F4XH 2APWA 1EHNA 5DJ8A 5KN5B 1A4JB 3I75A 3GSRA 4YFDB 1I3UA 3RIFF 3ZKMC 4OV5B 4F7CB 4JPVH 1HOCB 3O3AB 1FGNL 2EE2A 1KBGH 1DL7H 1S7TB 3FT2A 1P5UA 1FH5L 5TJWK 2FX8L 1P4IH 2GJ6A 5F6IB 3IDIB 5ID1A 2YD3A 5HVWA 2NW3B 4MNQA 2DM3A 3RZCC 3RTQA 5ICZB 3V4VL 2F53B 4FG6C 2IAMD 5A2IH 5BOZG 4RGMC 2R23A 3CVHH 4YHPB 1GC1L 5JW5A 1ND0B 2VDKL 4OCYH 4GS7C 4PJ5B 3JVGC 4N1HB 5D1XB 1H9VA 3W2DH 3MLRH 1G84A 1ZLVH 1MH5A 4OLZL 5GRZA 5H2BB 4OCWH 3QDGB 4KFZC 4YWGL 4TSBH 1KSRA 1BOGB 3KVQA 3RX5A 2IQAA 3A67H 4MXWL 2MCPH 3ZE2F 5DTFB 5C0AA 1U3YA 1KC5H 5D2NA 4L8BB 3WLWC 3L7EB 5JORA 3QPXH 3FQUA 5DFVD 5ALBL 1O7SA 2AJZA 4WTZA 3FAXA 5GRXG 3F7QA 4WV1C 5I1DB 1QNZL 5HXMA 2YR3A 1CQYA 4KDTA 4KTEL 3B2VL 5ADOH 1FRGL 4U1JB 4F33A 1IC7H 1INEL 4P5TC 1KJ2A 3TCLA 1DQML 1CZ8H 3FO0H 1RU9L 1FAIH 4H8WH 4J3OC 3GUTB 4PP2B 1YYMH 5MEQA 3H7BB 5HI5C 1KLUA 3W39B 5JXEA 1BX2B 4I0PB 1YQ2A 5CP3A 3TPUA 5ITBL 4OCXL 1NMBH 4UTBH 5ETUB 1NFKA 4Z78B 5E9DD 5IVXA 4APQD 5JLZA 1WBZB 2AK4B 5JW4R 4LBEA 5H37H 5DHYB 3KXFD 4YDKH 4TNWF 2UZIH 4F15B 4P2OA 2CUMA 2CDEB 3DO3A 1DLFL 3BT2H 5FGBA 5DQ9B 4G8EB 4JFDE 3QZWB 3DETD 1SVCP 1VFMA 4Z0XB 2BRRL 4Z7WE 2ICCA 2NYYC 3HZYA 3BZFA 1X5AA 2CRYA 5ID0B 4P48A 1Y0LA 3T0DA 4TUKL 3ARBA 1EEQA 2VITB 2CMRL 2OQJB 5BO1H 3J7HA 3E3QE 5FUCE 5EFIA 5ACZA 4Y5YB 5BMFL 4M61B 4UQ3A 2YPLB 3O6ML 3ULUC 1ETZA 4UZGA 4BKLB 4NT6A 4YBLB 4PJCA 4M6OH 1B0WA 2OJZL 4Y4HD 2OMNA 3T09A 2NY4D 5HD8D 4ODTL 5LGKA 4LCIL 2V6HA 1IGCH 4NWUH 2Q1EA 3VRJB 5HHQA 2J3SA 4R7DA 4GRWF 4NKIL 5F44A 1MFDL 1ORQB 1H8OA 2AP2A 3MV8E 4BZ2L 2HKHL 3FB5A 3IDYC 4HDIA 4R4NC 3U30B 5I16A 1IQDA 1AD0A 3NH7L 3GKZA 3NCEB 1OP3K 3H42L 5CSZA 2OX5A 3OKEA 4EQ3A 4U1NB 2NY6D 5F1KC 3B9VA 4NZUL 3VFTB 1CGVA 5K59E 1SHMA 3QCVH 4GO6B 3EAKA 3RWGB 4CNIB 5D7IB 4Z7NE 1YMME 1YNKH 4NO0A 3WL9B 4HUVB 1P5VA 5INCB 5HYSG 5D96B 4ZDHB 1TXKA 2JJUA 4EZMA 4UTAH 4ODBD 3WHE0 2VMFA 4EI5A 4ZUVA 4XH2B 2MOVA 2VKXA 2IPUG 3O6LH 2DM2A 5D7JC 5TQ0H 2OR8A 1MIML 4UNVA 1TTUA 2AQ2A 5AAWA 3MV7A 1Q9KB 4J6RH 4HG4J 5F72S 1GOFA 4I3SL 1GGYA 4JJ5B 4AEHL 3SBWA 2YD5A 4IBLT 2HFFA 1S5HB 3BAEL 4KKCD 4J3SA 3RUGF 4OCRH 3DMMD 4IRJA 5DD6A 1HHHA 5F7NC 3VXRB 1DSFH 4KMTH 1L7IL 2C3GA 1MFAH 1DANT 4PG9A 4DW2L 1J1XH 3LMJL 5IJVA 1HHIB 3G6JA 1WWAX 3K8LA 3ULUL 3FONB 1PKQB 2VLLA 2RFXA 8CGTA 4M62H 2A83B 1PYWA 4JG1L 2XA3A 4N5ED 5H35B 1EEZB 4DCQA 4ENEC 1RY7B 3C09B 4PJAA 3GMMB 4OFYD 2NZ9C 1UWEL 3P11L 3GSNB 3O2DH 3X12A 3N06B 1U6AL 1F2QA 2HJLB 3BN9C 1T22A 3VFMB 1U8NA 4OLXL 4Z7QE 2AXFA 2FZ3A 4PJIE 1IEAB 1RUKH 4NDMB 2OZ4L 2VAAA 1YMHA 3QH3A 1AGCA 5C0BD 1CF8H 4DQOL 5E7FA 3U6RA 4MNHB 4XP9H 5C6WH 3WFHB 4HH8A 3Q6GH 5HGAB 1F97A 4ZFGL 5E6IA 3MRRA 12E8L 3LN9A 1U8QA 2R0WH 4FFWC 1ONQA 4NKDB 1WBXA 3DVFA 1L4IA 3HMWH 3CVIH 1ADQL 3QPQC 4Q9CA 1Y6NR 3IVKB 4YDLB 4KJYB 1IEBB 1CIUA 1ZSDB 4DVRL 1OB1B 2BDNL 2UVEA 3C08H 2X4TB 1UACH 3EDEA 2KBGA 5I75C 3VDBA 3P77A 2A9NH 5CSGA 1DBMH 3QFDB 3WD5H 1H3XA 1ZTXL 3WS3A 5I71B 3QFJE 4O2CA 1CD1B 3GJFH 4RSVA 4BQ8A 2FYYB 4Y5XB 1I9JH 4I48A 5C0RH 4IRSD 4QTHB 4FQXC 4XNZC 3CDFA 3QQ9D 5AD0A 1NL0H 3S97C 3BKCH 1NDMB 4LKXB 2FGWL 4Q2ZB 4CJ1A 2R15A 5IW1B 4XNQA 4NRZB 3IJSB 4L9LB 2Q86B 1A7OH 4PYGA 3PWJA 2KQNA 2QKIB 3QO0A 4N90D 3OGCA 3SCMD 1U8JB 3O81A 5F9OL 4UV7H 4RFEA 2WINB 2AERT 1A1NA 4W4OC 3NA4A 2GY5A 5TGBB 2OTWA 3BZ4A 4K94H 5D2LB 5ERWA 5DRXB 3GZKA 35C8L 3VWJD 5KZCD 4IDLA 2YA0A 4K71B 4AT6B 3D9AL 1G7QA 4D0DA 1JF1B 5K33A 4YBHA 3MRDA 3N1MC 3MOBH 5DUPH 1CGXA 3GNML 1FSKB 2AJ3A 2AKRB 1UGNA 1XCQA 5FEBA 3QDJE 3HUJA 2EO1A 2IH1B 5E8OA 1CE6A 4AH2A 1N64H 1JV5A 3QI9D 4NM4L 5MENE 1VCAA 3OB0H 2HN7A 1YZZA 4F7PA 3AC0A 1SY6L 1N0XH 1K4CA 3KPSE 3BEWB 4XP5H 3KPRB 4BELD 3RDTD 5C9KA 4MAYB 4U3HA 4XP6H 4H26A 5D7SL 3SDCB 1HEZB 4HF5L 4NNYB 3D39D 4G6KL 2VLKD 3TT1H 2D0FA 3INUL 3KR3H 4ESKA 2E7LA 2OK0H 3EYOA 4JFOA 4LVOC 4RBPH 2UWEB 4GW1A 5MP6L 1WSST 2BVPB 1A9BA 1KEML 3V6OC 3FTGA 4PUBL 4RGNC 1DBBL 3T4AB 3U0PB 1WLHA 3B9KD 4MA1B 4JFEE 4KTDH 2F54B 3U7WH 3O6FA 4K3EH 1JZ5A 2R2CA 2WV3A 3TZVA 2BZDA 2A6IB 4XB7A 1MFCL 2VXTH 3C87A 4NNXB 1ZHLA 1UA6L 1DBJL 1YPZE 2NY7L 1PDKA 4TVPD 4Y19E 3MLSH 4KROD 2YC1A 2FD6H 3TBWA 3ZLQC 4AEIL 1U9KA 5E5MB 4F9PC 1A6TB 1WEJL 2B2XL 1KN4H 4HK3J 3S4SB 3QEGL 1N4XH 2VXVL 3LKRB 4BFEA 3B5GA 2PO6B 3TA3A 4K2UH 4UIMB 1Y18B 5KVFH 4RMUA 3EYVA 5I8EB 2W07A 4FFZL 1DJSA 2DQJL 3SE4C 2Q8AL 4KAQL 4UNTA 1L7TL 2ZUYA 3QXVA 3V5DA 1U8HB 3VRIB 2P44B 1KIPA 1QFHA 2IFGA 4N8VA 4WY7L 4ZUWB 3QDHA 1H3WM 3BO8B 2R2EA 1IGIL 1X5JA 1QKZH 4MNGB 5FM4A 2Y06L 3SOBH 5IHZA 1BF8A 1T1XA 5FXCH 4FFVD 5C6TH 3BIBX 2MPAH 4BH7A 3NPSC 3SO3C 3MRBA 1NGWA 2FATL 1FL3B 3DI2B 4QWWC 4XVSL 5DUBA 3DRQB 5I17A 4JY4A 3D2UB 4O5LH 4GRWH 2BY2A 5C07D 1TZIA 2BSRA 4G43A 1MHHB 4M1CC 4UT7H 4HS3A 3VXSD 2HFGH 4DEPB 4WIQA 5IM7A 5TDOB 1KCVL 4AQOA 1QFWM 4JFZL 4ELME 1HDMB 4LRIC 3T1FA 1CR9L 2PXYA 3RWIB 5IB2A 4WUUA 5IQ9A 1U8KB 2FX9L 1JHKH 4ZFOL 3DHMA 1JZ6A 1MVUB 2NR6D 5JHDE 3SQOH 2EIZA 5GRUL 2PN5A 5IMLA 4OF8A 3EO1A 1BVKA 2HMIC 4Z9KB 1LHZA 5D5ME 5EC2A 3D69B 5K9JH 3MROA 3ME0A 1AGEB 3HMXL 3OAYK 1Q9OB 4MA7L 5EH1A 5LBSL 3SDDB 2I25N 3DXAA 3QXDA 2BX5A 3F7VB 5I15L 5JW4N 2BNQD 1W72L 3LB6D 1HSAB 4QOKA 1MELA 1A2YA 3M8OL 3VFNB 4NC2B 3ZDYF 4JZJA 1XF2B 3QDMB 3K4DA 4OUUA 2VLRA 3KS0H 3I2CH 2EH7L 4J12A 1Q94B 2CUIA 2D7TH 2VDRH 4HWZA 5IMOA 2FL5A 3MUJA 1BBJB 4WI9A 4H25B 1W8NA 1YEIH 1TVDA 2BY3A 3GM8A 4X0KA 5D1QB 1BLNA 1E0OB 4P2RB 3CC5B 4PJBB 4WNQB 3PWLA 4NJ9L 4NJAL 2HT3C 2EYRB 2G60H 3RWFA 2VXQL 2DTSA 3SGDH 3C9NA 1YN7B 4U31A 3QIBB 2HRLA 2QHRL 5F88A 5A3IC 4XBGB 2EDKA 1N5AA 2XKUA 3GMPA 5DD5H 4NZTL 3UYRH 1BPVA 4KKAC 5C0DB 2B8OT 4QRUB 4E42A 4JREC 3GMRB 4C58B 2BMKB 1CGYA 5IMKA 5DRNA 2NLJB 3M1BA 1P6FA 4WEUD 4Z7OE 3I85A 3ZE0E 3MMEB 5C9JB 2AK1H 4XCCH 2R69H 5E08H 1R6VA 4IIQC 3WUWA 5DQDH 3WNMA 4GAFB 3D3VD 5FIEA 1ZMYA 1KLFA 3P4MB 5DI8A 1RIVL 3BGMA 2H45A 1AP2B 2L4OA 5GJSL 3FQNB 2LTQC 4OZFB 4HKBA 3ES6A 4IHOA 2DQUL 3BPNC 1VPOL 4NBYB 5IVZA 4HEPG 1JK8A 3HI5H 4HXBL 1G7HA 3T0EB 2AQ3A 3FHQA 2N7BA 5LWYL 1FO0H 4GLRI 4P46A 4XI5D 1A7RL 5GRVL 1J0ZA 2BVEA 3C6LD 3FKUS 1TJIL 3TJEL 4WEMB 1O0VA 1PSKL 4P9HC 4PLJD 4OCSL 5KANI 1KENH 3C5ZD 3ARTA 4AEEA 2ITDB 1D5MB 3CK0H 1OARH 1P9MA 1IAIH 4JR9L 3EOBA 1G9MH 4NFCA 2NW2A 3WDIA 3O4LA 2Y9RT 3FQXB 1XT5A 3GKWH 3QUMB 4H1LA 1L6XA 3OR7B 1OAZH 1SBBA 5ICYB 4EN3A 3QNZA 1NANI 1CLOH 5T1LA 1Q0YL 4MSWA 4BZYA 4X6BB 1JPST 3QHZL 3VRLF 5M94B 5IIEB 3HRZB 4M3JA 4R4BA 1GAFL 3HRPA 1JTPA 3U0TA 5E4EC 2EDHA 4HSQA 4RX4D 4WTZG 4ERSH 3TP4A 3QG6A 3DO7A 1ACYH 2ZUTA 1TQBB 1EUUA 3HNSL 5FB8B 3IYLW 2MMXA 4J23A 1R5VB 2X1XR 2J5LC 2GITB 1WFTA 2OJEA 1A6PA 4M3KB 1LO0H 3BIKA 4HIIA 4LRNL 4P5MB 4O2EA 4Y1AB 1QBBA 3R8BB 5BV7C 3WE6B 3GSOA 2J8HA 1NMCC 4WHCA 4EOWL 2J88H 3V52L 3IF1B 3MLWH 4PJ7A 2HG5A 2J4WH 4UDUB 2R0ZH 4YZFF 5SWZE 5LGJA 5AZ2H 1IM9D 3WFBH 4U0QB 3M45A 4QRTB 1RZ7H 2CGRH 3MV7E 4KUZH 4L8DA 5DEFB 4YHYB 3EYFB 3QQ9C 2DM7A 2P24B 5IEKB 5C92A 1YEEL 2EE6A 4MJID 5TF1L 4U1IB 5KW9L 5BS0B 4P3DB 1ROWA 4RAVA 1AO7E 3P4OB 1SJEA 5LGHH 2IAMA 2OSLB 4JG0L 1KUMA 5CD3A 4NZJA 5HJ3B 1FYTB 1AE6H 3BQUD 4I1NB 4JFYB 3VXNB 4P9HL 1G6VK 3P0VL 4NO3B 1MY7A 4MJ6B 3RBGA 3T65B 5K9KB 4KZDL 2OL3A 1AI1H 1RJLB 2Z35A 2XRAL 2VXSH 1JMZA 5KG9A 5IBTL 3GMQB 5CEYA 8FABB 1OAUH 4POUB 3VWJC 4FXGB 3O9WC 3SGJC 1ORSA 1OTSC 4P2QE 3L3IA 2YS4A 2A6JB 4Y5VA 1RK1A 1T21A 3S5LG 1BF2A 1R3KA 3HE6D 2EH8L 1E4XH 4ZXBB 1MQ8A 4KKLD 3MV01 3RVUD 1JN6B 5T33L 3O2VL 1L0XA 4YIQB 1XIWD 3FB6A 1MREH 1JGLL 3S34L 1E4KC 4OZGF 3QJFA 1CDHA 1DVFD 3P4NA 5DMGD 2COQA 1CFTB 3IJHB 5ADPL 3MODL 4N0RA 4GRLD 2YN3A 3F58L 4LRIA 4FQQB 4JRXD 5HYEA 3MNWB 2NXYD 1EO8L 4HBCH 3C6SA 1BOYA 5E9DA 4APQA 1QLFB 3IKCA 4JQIH 2I26N 1A3QA 1QR4A 5EIIA 4XP1H 3KXFA 5C0JA 5E95B 1LO3L 5BV7L 4CW1A 5F7MC 5BOPA 2ZUVA 4I2XE 1A7PH 4HWEL 2VIRA 3EOTL 4BA8A 1J05B 5J11C 1JRHL 2E7MA 3SDXA 5EOCH 1I7ZB 2R8SH 2F58L 2VDNH 5FECA 4WWKB 5CLWA 2VDML 3DSNA 1J9CT 2NY0C 4EEEA 3LD8B 3CFKA 3MX0A 1FFRA 3LKOB 1FYHB 4LAJH 4I13B 3VFUB 4UBDC 2XT1B 3DUSA 4Y4HA 2W59A 4P3CL 4S0SD 1RZKH 2HJFA 4OZGB 1MAML 1EEUA 1YQVL 4I3RL 5JXAL 3QIUC 2HJKA 4GAYA 4LSVL 1PG7X 3VDAA 2CJUH 4PPTA 1NCUA 5HYSB 3EYSL 3SDAD 3G5VA 3HG1B 5CZVH 1WICA 1X5YA 5F8RC 4HIEB 3TBVB 2CD0A 3L3KA 4YGAB 3PWVB 1I9RH 2EDEA 1U93A 1HQRB 4QHMB 3RGVC 4JY5L 4QRSB 2A0LC 2QSVA 1ZS8B 4P59H 4ZMAT 1KB5B 3HUJE 4G5ZL 1XGQB 4XPGH 2QSTA 3UBXB 1LO5B 2VQUA 5EA0H 2VOTA 5I0DA 1QSFD 4G6JL 5CKAA 4WI4A 4EKXA 5IF0A 4JKWA 4G8IA 1FNSH 2CIIA 3G5XB 4U1GB 1Z3GH 4JFDB 1JGUL 1V7NH 1E28B 5GRJH 4GMSH 4NQEB 3OAUL 2Y5TB 3ECBA 4XPFL 4WWID 2FJGB 3IJYA 3RU8L 3NFPB 1CFQB 4HFUH 4ZOAA 3DLQR 2ZCKL 3G5YA 2K1MA 1HILB 3GJEB 4PJXE 5IGXL 3ARED 1BD2D 1WJ3A 3TC9A 1RZ8A 2ED8A 1E6JH 4P5KB 3U9UB 4EI6A 3D0VB 4JPIB 5KOVC 1W0VA 2Y07L 5ISZD 2NX5D 5EPMA 4MVBC 3DMMA 1T1YA 3E8UL 4S1RH 4GQ9H 4YXHH 2IQ9H 1A7QH 3MRGA 4H20L 2JKXA 4HUWA 3GMNB 1GGCH 1MNUH 1LP9E 4DWHA 3RY4A 4LCYB 2X70B 4X6EA 1MCFA 1KXQE 2I9TB 1K85A 4Z7VF 5BQ7B 1RMFL 1VFAA 1GIGH 1R3JB 2P5ED 3BXNA 4NOBA 3OGOE 1T89A 1QBMH 1CFNA 2R56H 4CGTA 5HHOB 4F7TB 1G7LA 3WJJC 3ULUE 3UPRB 4XVUD 3LOWA 4LIQH 3ZE1E 1T5WB 4GRMB 2Z8VC 4OFYA 1FFPB 4A6YL 1U8PB 4K9EH 3TEUA 4HS6B 1H3VA 5DA0B 1B4JH 4LLYA 1Y6MR 5DJAB 4XWGH 3EDJA 3QDAA 3STLA 2FEEI 5C0BA 4ONHA 2GI7A 5DMJB 3RVWD 3L3DA 3OB0K 2ATKB 1CU4H 2AABL 3L5IA 2UY6A 2EDOA 3O3EA 4LPYA 1TLKA 3MC0A 3VCLB 2UYLB 1H8SA 1JHTA 1G7IA 1RSFA 2NPLX 4M5ZH 3MLUL 1R3LB 2EXWD 1BFTA 3NIFE 2VXUH 4BQBA 2HYMA 5D93C 4QYOB 3VDCA 4LHUD 3S6CA 1H3UA 4LSRL 4RBPK 4UUJA 1NGPH 1RZFL 2VC2H 3GHBL 3BP4B 1YEDB 1SM3L 5JDSB 4N9OB 4OLWL 5SWSD 3MXWL 3ZL4H 4OGAD 1SEBA 5KSUA 5MHSD 4IRSA 3BKMH 1E4WH 4WJ5B 4LNRA 1ZT1A 4WUUE 4H88H 2PNDA 4EDWH 4JRYE 4Y16B 4ZYKB 5JW4M 1KB9J 1KBGL 3MCKA 4XCNA 3DRTB 1XH3A 3FT3A 1CK0L 4NN5C 4ZS6D 1X7QB 1P4IL 3REVA 1ES0A 2D9QB 3SCMA 4IJ3C 3O41B 4KKNA 3VWKD 4XNXL 3DXAE 4PJIB 1CICD 4UMGA 1OSZA 1ZGLP 3QYCA 4QF1A 1I8LC 1WQVT 5TE7L 4QOKE 3WKNA 2LABA 2D2OA 1Q0XH 3QUYB 3ISWA 3DURB 3U0WH 4PLOB 5EULV 3HA0A 4XNUH 1VFBB 3NA9L 2J8UF 5CJXC 2ZNXA 4QRQB 1OCWH 4P4KC 2Z31B 2YPVL 1WZKA 3RHWF 1FJ1A 1TETL 2D31B 3QI9A 4L8SA 4LCUA 5C3TA 2MCPL 4U6HB 4ZAKD 4XGZA 5IQ7H 1KC5L 3BMWA 3FO9B 1BJ1H 5DJYB 4PRHD 1NAMA 4WO4B 4PJHA 5F93C 3RDTA 4L8CA 1R3HB 2BVOA 3TNNB 3U2SA 5IWLC 3WFCH 1CT8B 3QEUB 2VLKA 3DSFH 5INDB 2X4UA 3AAZB 4LPTA 4QHUB 4YQXH 3V9FA 4ZS7L 3EOYG 1KIRA 3GSUB 3VD5A 3VW3H 3FO0L 1SEQL 1UJ3C 2RQ8A 4O02L 4XBEL 2XFXB 1A1MB 5K9OA 2H32H 3ARZA 1AGFB 3B9KA 4NQSB 1KYOJ 2JB6A 1B2WL 4CN6A 5E94B 1T04A 1KJVA 2MJWA 3UZQA 5IW6B 3CMOL 1LO2H 4JY6A 3IRZA 5I1KL 3KJ4B 5T3ZH 4DN4L 2DLEA 3IU3A 4CJ0A 2Z92B 3K4ZA 4X6FA 4JB9L 3LKNA 3W5MA 3QSKB 3NCCB 3BPCB 3T0XA 1QFUL 1AGDA 3NCJH 5E7BA 1JNHA 4AYFA 5DURD 1W8OA 1NC2D 2R0LH 3F8UB 2EZ0C 1MJ8H 1MLCB 3V5HA 1MCDA 2ZOKB 1TFHA 1T83C 3ARFD 3BD3A 3TLRA 1T1ZB 3DIFB 2X42A 4LLQB 5I19L 1EAJA 3RWHA 2W65A 4M6OL 5EUOF 4YHNB 2JJVA 3DUHA 1BIHA 3HNVL 3LEYL 4RNRA 2FECI 1IGCL 4NWUL 4N9GA 3GBLA 3PL6D 2FO4A 1EUTA 4P49A 1ZA3B 4RQQB 1OF2B 3QCTH 1DBAH 4LF3A 5HGDA 3DUUB 4XHJD 3I6KA 4R8WL 3PV6B 1QSEE 5KSBF 1UXWA 3THMH 2EE9A 2X10A 5DDHB 4LLDB 2DB8A 2NZIA 3MBED 3ALXA 4LEXL 5DHVA 5IVOA 1AJ7H 2ENSA 2EYSA 4HX1A 3QA3A 3ARDD 2NY3B 4JFEB 3FQRA 4ZSOE 4UT6L 4P23A 1FBIH 2H6PA 2MWCA 5GGVH 4DJMA 1NFIB 1YEKL 4JO2L 2ADFL 5EU6D 5FCUH 5C07A 2E6QA 4ZTPH 3VXSA 2JIXB 5DMGC 5B39A 2VERN 5DEGA 4OLUL 3EFDL 4Y19B 5IBUG 1EAPB 1DEEB 4Z77A 1MCCA 3GK8H 4RZCA 3W0WD 5IB3A 4YUEH 1P4LB 3VMOA 5F6IC 3MXVH 1G0YR 3CLFH 4LEOB 3V6OE 1EV2E 2EDBA 3T8XB 3VE0A 4DGVH 3WUWG 4O9HH 4PD4K 2IG2H 4FQ2H 3LEXB 2O26U 3IFOB 4HJGB 3C5SA 2ARJB 2H2SC 2Y5EA 4GKZA 5CBAB 5GSVA 2BNQA 4KHXL 3HE7B 3I3EA 3B3IA 1G6RH 4OCRL 3HCVB 4BSWA 4NQUA 4L4TB 2QQKL 1QFPA 2X4OB 3CVHA 3HPLB 1NEZA 3CU1A 2V9RA 2V2WA 2QQNL 5L8LB 5TE4L 1KPRA 1EVTC 1J1XL 2W92A 5I66B 3S88H 1KGCE 3ILPB 4M93B 3Q48A 1AHWB 1VFOA 4XHQA 4AMKH 1Z9OA 4DTGL 1X44A 3B6SA 4TRPH 1KLGA 3RIAF 5FA4B 5TF0A 3WNNA 5HDOA 4FMFA 3S3PA 4TUJB 3FJTA 3LV3B 2WMPA 4Y4FD 4OZIE 1A7NH 5I8KH 3FQTA 1IKNC 4JFXA 4OB5L 2JCCB 1BFSA 4XNMA 1UM5H 4HAFA 5J12B 4HUKB 4ELMB 4QXWA 4QT5A 2Q7YA 3K74B 1S9YB 1F4AA 4I0PC 3WJLA 3H3PH 4XP9L 1P84J 3WDJA 3MRPA 5IOPB 3EO9L 3IDMA 1F11A 4RAUA 5I6XB 2R0WL 1SJHA 4I3GA 4R96B 4TULH 4F15C 5KVGH 4M7JL 3AS1A 1XF4A 3D3VA 5DJ8B 1VHPA 3I75B 2OP4H 1EFXD 4NUGL 3EDKA 3PWPD 2E27H 3FT2B 4K07A 3BD5A 4LARH 3OKDA 2I5YH 3MLXL 1XGUA 2GJ6B 3EJYD 3UTOA 1C1EL 1CLCA 4K3HA 2B39A 1AH1A 2IEPA 3I6GA 2H8PB 1RIHL 4HZLA 4MNQB 5IP4A 4Y5YC 2G75A 4EJ1C 3P0YL 4GBXD 5ESQA 4YBLC 2I60H 5CJ5A 5C0RL 4GKNA 1XMWA 3C6LA 4QRPD 2MKLC 5KOMC 2WLZA 3CUPA 5FOJA 5JW5B 1M05A 5C7XL 4XT1C 5IVXF 3E6HA 3NIDF 4PJFE 3C2AL 4A2MA 2HTKD 1MH5B 3B4NA 3SDXE 1YA5A 2DN7A 2E7HA 2BVYA 1P1ZA 3C5ZA 1AC6A 3GFUA 3U30C 5FV2A 2IQAB 1ERNA 4YR6A 3KPNB 4BK4A 4LVEA 5GGTH 3V7AE 3D6GA 5GZOD 4JO1H 2D4FA 5JORB 5CEZH 3FQUB 3LSOA 2DJUA 1KCKA 2DQDL 4YX2H 4KRLB 4LASH 1OTTD 5B21A 2CXKA 3ZYZA 1F02I 3RVVC 2AJZB 3EHBD 2EDXA 3VMPA 1A0QH 3TYFA 1NCAH 4PP1D 3AM8C 1GXEA 4HC1H 2GAZB 1DQDL 4PRPD 4PJCF 5D96C 1NLBL 4O2FA 4F33B 2H2PD 1YEGH 3BRDA 1HIMH 3TCLB 3X3GL 2EXYC 2A6DA 4OIIL 4P9MH 5CAYB 25C8H 5J3HC 3BVNA 1U8OA 2H26A 4WHYG 5ACLA 3FN9A 1QFWH 2CIKA 2QADD 3TPUB 2CPCA 4XP5L 3MRMB 4K55A 4RX4A 1K8DA 5JLZB 2ICEA 2ZCLH 1IL1B 4K3JH 3GBNL 4LBEB 3S36L 1LILA 5A16A 4HMEA 5F7FA 5DO2C 3TT1L 4P2OB 4U6XA 4PJ8D 2VDLH 2ZPKL 3RPKA 2X89D 2BJML 2FIKA 2WP3T 3BZFB 4YXKH 2ZOLA 3UEZA 2PCPA 1TCMA 4X6CA 1Y0LB 4G80A 4IOFC 4AK1A 1ZLUH 1IM9A 3PWUB 4JGUA 4MJIA 3LVEA 1NLDH 5EFIB 5F8QC 4NYLA 4TSAH 4UQ3B 1ETZB 2DMBA 3PGCA 4NT6B 5CINH 4PJCB 3BDBA 3MCG1 3TN0C 3S5LB 4G6FD 3P40A 5F89A 1VGEL 3C09C 4C56D 2UV3A 1HCVA 5HHQB 2G5RA 4R7DB 1X6LA 3VWKC 3BQUA 1BBDH 1EFQA 1R3IL 4NQDD 1CFVL 2R4RH 4IMLA 1EJOH 1N4XL 1J86A 2RCSL 4HDIB 4S1SL 2ENYA 5I16B 4WW2A 1IQDB 1AD0B 5DS8A 3CNKA 5CSZB 3O2DA 3OKEB 4I9WD 3CCHA 4IRZL 1HZHH 3V7AG 1CLYL 2K3TA 2BOCA 3VFOA 3WIHL 1TJHL 2FJHA 3HE6A 4XPHL 1UENA 4OJFH 3QJHA 4G9DA 5E24E 1F4YL 5FYLL 2NY2D 3TBTA 3IKKA 4NO0B 5GPRA 5IJKC 2ZNWA 1NGXA 4YDLC 3MO1A 4HQQH 3WV0A 4DZBA 5EOTB 5CBEA 1XIWA 1II4E 1EPFA 2OTPA 4NQCD 2J6EH 3L3OA 4PJAF 4EI5B 4ZUVB 1DVFA 1O7VA 3O0RL 4OF5A 4ONGL 2FBJH 5J0BA 2YHGA 5I71C 3KPQA 4GRLA 4YDJB 4JRXA 3MV7B 3QHFH 1L9MA 4NP4H 4Y5XC 2ZSWA 4CVXA 3SE9H 1VA9A 1HH6A 4YAQA 3K8MA 3MLZH 3TO2A 3M17A 1UZ6F 3JWDH 2GJZA 1AO7B 3S8WA 5E2TH 2YD8A 2HFFB 1ZAGA 3HS0B 4L9LC 4IRJB 2BVTA 5DD6B 1HHHB 1A6UL 3HFML 1JHKL 1EH9A 4IDJL 5EZJA 4HKXA 4MS8C 2FH6A 5EORH 2XY1A 4FTVD 1CYGA 4PG9B 3IXTA 1EJ6A 2AJSH 5D71H 1EHLL 3MJ7A 5K9JL 5IJVB 1J1OH 5MI0B 3G6JB 2F15A 5MERA 1RFDH 2IFFH 4P2QB 4W6XB 1PYWB 2P5WA 1DQLH 4FQJH 5F3HA 2AEPH 4DCQB 4D2NA 2ZG3A 4PJAB 3AS2A 4HCRH 4XMPH 3P9MA 5SX4I 1T22B 1U8NB 2AXFB 2FZ3B 3WS6C 1NMAH 1S78C 3SDAA 2VAAB 5CD5C 1I3VA 1AGCB 5LG1A 1RJZA 4WU7A 2CKBH 4EUPG 5I74B 5DC0A 3U6RB 1L0QA 4MAYC 3SDCC 3U4EA 2VZ3A 1K2DA 1UWGH 5E6IB 3MRRB 1U8QB 4XHJC 1ONQB 5IB5A 5JNYA 1WBXB 3VH8A 2JE8A 1F6LL 1N59A 3A6CH 2GFBA 5CJ8A 3MBEC 3WFEL 5I1JH 3V5KA 1QSFA 3LZFH 2E9BA 3ULVF 3CFEA 2AJXH 1S3KL 5GS0C 5GZNC 3FAWA 2IJ0C 4MA1C 2XI9A 4FQLL 1AQKH 3HZMA 3P77B 4PJHE 4XPBH 1CXEA 1F3DH 4D9RD 3UPAA 3WS3B 3D39E 4O2CB 2NY1D 2VISB 3TH3T 5F7HA 2R69L 1PFCA 2XA8L 2BNRD 4I48B 4OD2A 3O2WH 3VI4E 5DQDL 4E41E 2O5ZH 5AD0B 3AREA 1BD2A 1G7MA 3HAEG 2EIDA 3LN4A 4KVCH 5I30H 1UM6L 4XNQB 2ZUXA 4XVTH 2BK8A 3DGGA 5T3ZD 2NX5A 2EDRA 1SQ2N 2X2YA 3L3HA 4K7PY 3PWJB 3OQ3B 1I7UA 3QO0B 5JUEL 3OGCB 4KQ4H 3A6BL 1R0AH 3WFDH 1A1NB 1NAKL 2I9LB 1FVEA 3OJ2C 5I1HH 2WBWB 3U9PH 2OTWB 3QQ4A 3BZ4B 1PZUB 5ERWB 2P5EA 5HDQH 4KK6C 4WFHD 1G7QB 4D0DB 1DFBL 1KTLB 1UB6A 3MRDB 4RISH 3AUVA 2V2XA 1RURL 2CK2A 2AJ3B 1XCQB 4PYHA 3V7MA 3HUJB 1KJ2H 4ODSH 4N0UA 5E8OB 1CE6B 3NCMA 1JV5B 1YJDH 4PRIE 2HN7B 3WNKA 2FJFA 3TIDB 3QWOA 2YPKA 5GJTL 4YHIA 1K4CB 1RJYA 4JM2F 2ORBH 3B8YA 4G9FD 4H26B 3STZA 1I85A 3RRQA 1ZLSH 4NKQB 3QRGL 2EDJA 2BHUA 1VB9A 5AUMA 5C08A 5DJ0A 2AJUH 2FHBA 1UT9A 1QRKA 3FTGB 4UIKH 4WTXA 2VNCA 3RA7H 5GS0L 3JV0A 1MI5D 4OZ4A 3ROLA 1J5OH 3GI8L 4JFPA 4LHUA 2DWEA 1UADC 3ULSA 3TZVB 1DQJA 3QG7L 4MJ2A 3OB8A 3SDDC 1FVCA 2X4QA 3VXSE 1ZHLB 5SWSA 1YNTA 5AYUL 1MCSA 1KCLA 4HPOL 3CXHJ 4YHMH 2YC1B 4RWYH 1K6QL 3TBWB 5HYJD 4MMZC 4ZNEE 5KS9E 2DQEL 2W9DH 4NPYA 4FP8H 4L1HA 5DD1H 3RL2A 4RA3A 1BQSA 1IKFL 4PY8I 3WFBL 4JN2A 3RBSA 3TA3B 4KUZL 4NO2A 5ALCL 3EYVB 1T0NA 3ZSTA 2FGZA 4MAUH 3VWKA 1I1CA 3GSWA 1BFOA 1RHHA 3V5DB 1CICA 1BVZA 3G5ZB 5ICXA 4DGYL 5D1QC 3T04D 1KIPB 1GOHA 1Z9SA 3MRLA 3JUYA 4OGXH 2OS7A 4ZFFA 1JIBA 3QUKB 3KLSA 4KI5D 1BZQK 3QIBC 4OGZA 4C4KT 1WCQA 1JNJA 2R2EB 2VSCA 4S11A 4JDVB 2SEBA 3U46A 3UYOD 43C9A 5IHZB 1T1XB 4QKXB 3RUGA 3NZHH 1MQKL 1MCKA 2A73B 5D6DC 2VXSL 1I3RA 4OGYH 4X7FC 4AEFA 3MRBB 4ZAKA 5IHLB 1FLTX 3N1GC 1NGWB 4PGZA 4GG8A 4RWHA 5DUBB 1OTUC 1I1AD 1LMKA 4PRHA 2YKLL 4JY4B 4GAJL 1PX4A 1TZIB 2BSRB 4G43B 1LO4H 1ZANH 5D7JB 1KN2H 4UB0L 5IM7B 4ZG1A 2P8LA 2P7TB 2VR4A 4R2GD 5J57B 3N85H 4XCFL 2Q6WA 3MRKA 4P57A 2PXYB 4OM1L 5IB2B 4WUUB 4O51A 5IQ9B 3NTCL 4HG4K 5TPWH 1JGVL 1BEYL 2HT4C 5K9QG 2EIZB 3T0EC 3EO1B 1BVKB 5ANMA 2YZ8A 5EC2B 3KYAA 3D85B 4ODWB 3D3VE 4WUKL 3MROB 2DYPA 3BH8A 4JRWA 3DXAB 5DLMH 3MNVB 4LCWD 1BAFL 3O3DA 1XEDA 1Z9LA 4QOKB 1A2YB 1FO0A 2HWZL 3R06A 1FORH 1NANH 2R4SH 4OUUB 1A6AA 5B38A 2VLRB 3I02A 4CU8A 3P30H 2DQGL 2Z4QA 5EOCL 4HWZB 4U7MA 3T3PF 5IMOB 2FL5B 1NC2A 1T2QH 1F58L 1U3HD 2EDDA 4KUCF 5EU3A 3I3BA 3C5JA 5FYKH 1CIDA 4KKBC 3ARFA 2LAGB 3BGFB 3GSQA 1IZKA 1BLNB 3KPLA 2JELH 4Z0BL 4FQIH 3HC0A 3QIWA 3RWFB 4ODVH 3C9NB 4X4MA 1BFVH 3PL6A 1J8HD 5F88B 5F7YC 1J1PH 3NFSH 1N5AB 4G7VH 3GMPB 3BMVA 4PB0L 2Q20A 2CJUL 3WXWL 4JM4L 4FQPA 4E42B 5IBUB 4RMSA 5ESAA 5IMKB 5DRNB 1RAMA 1KTDA 3VI3F 1TQBC 3ARDA 1I9RL 1YY9D 3FB8A 5I75B 4BZ1H 1A7BA 2VLJE 3IDXL 4LSSH 5HI4D 3WUWB 5EU6A 4O00A 4U3XA 1L6ZA 4KK8D 4EVNB 5DI8B 5KVDH 1MCJA 3BGMB 2IBZY 2GSIA 5L88L 4CAGA 4QRRD 4HKBB 3ES6B 4IHOB 3W0WA 5IVZB 4HGWA 1JZ8A 3UAJD 4YHYC 5GRJL 4ONFL 1JK8B 1RZGA 1QD0A 1G7HB 4FRWA 3FRPA 2V17H 3TT3H 5D1XD 3EJZC 5EO0A 4K3DH 5DR5H 4HFUL 5IB4A 1HQ4A 3LDBB 4P46B 3SKJL 3V8CA 2WQRA 4D3CL 4OKVB 2V2TA 1PX3A 3FN3A 3IU4L 3ULVH 3EGSA 1PLGH 3FZUC 1H3TA 3NZ8A 1ZVYA 4I77H 5IFJA 4NN7B 2V5SA 4WDIA 4ZO7A 3DI3B 1QFOA 3N1PC 3RY6C 2HRPH 5LXGH 3X11A 5EZIH 1OY3B 1S7WA 4DOHE 4UT9L 2VE6A 1A1OB 2L7UA 3SGKA 4DKFH 3EOBB 4HKJB 1BJMA 1JZ2A 2NW2B 3MA9L 1VEOA 1OVZA 3O4LB 2VR9A 4P2CG 1LDPH 3BKYL 2W9EH 4NGHH 2Z8RA 1GIGL 3QUML 2NTFA 4PFEA 4H1LB 5ITFA 2BFVH 4X83A 1CTNA 1PBYA 1J0HA 3MUZ1 4I18A 4EN3B 4ZSOB 5FDWA 1S7RA 5T1LB 3DECA 4MSWB 3BJ91 4Y8DC 1PAMA 4IOSD 3UJJL 6CGTA 1P4BL 3NGBB 4R26L 4Y4FA 4Y7MA 2B4CH 3E2HB 2H41A 5I8CA 4R4BB 4LU5H 5HBBA 4X9GA 2XZQH 1J87A 4UOW0 3U0TB 4HMDA 1EMTH 4U1LA 4K8RC 1FNEA 3QG6B 3DO7B 4Q9RL 4P4RA 1OOAA 2QR0A 2J2ZA 3L5WB 3OXRA 4U6TA 2OJEB 1A21A 2X05A 2VH5H 2WLYA 3ARGD 3BIKB 4HIIB 5L0QB 4O2EB 3L95A 3O8XD 2KL6A 3GSOB 4LKCA 4HWBH 4FHBD 4JAMA 1EFXA 4PJ7B 4Q6YA 2HG5B 3HZVA 4MCZA 1FQ9C 5TH2A 3P3YA 3PWPA 3ZDZE 5LGJB 2QQLH 2C4XA 1FZKA 4JRXE 4M1DL 3N50A 1FDLH 3CFBA 5GGQL 2LU3A 1I9IH 4WWKC 2ADGA 1S7XA 2C1OA 3LD8C 4KPHH 4RFOH 5CHNA 4GBXA 4RAVB 1SJEB 5E2JA 2DOCA 3ZL4L 4QXGL 2BRQA 1QSZA 2IAMB 3SO5A 4U05A 1ULVA 1QVOA 4QRPA 4YHZL 5CD3B 5C0ND 3GRWH 4MA8L 5EBLB 2OL3B 4DUXA 2Z35B 2IPKA 3FO2A 1X5IA 1P7QD 4OZIB 3V6BR 5E2UL 5CEYB 5D7LD 2VQTA 1ACZA 2JJTA 5FYKU 1BHGA 1DCLA 1ORSB 2R1YA 3L3IB 4Y5VB 1RK1B 1T21B 4M7LH 2GK2A 3K7UA 1R3KB 1WWWX 1CG9A 3T77A 3JWOH 2QTEA 4U2YA 2XN9D 1OSPH 4K7FA 2BCKA 2VL4A 4N1EA 5DFTA 1HSBA 1NGQL 1GHFH 4CADA 4XNUL 4X4ZA 4PRPA 2D4DA 1GCFA 3LKQA 4FQHA 4DN3L 3FB6B 5DJXA 5IG7A 4U1GC 5D8JL 1VGKA 3NAAH 3QJFB 2ZUQC 3P4NB 1N0LA 3BHBA 4UI2A 2VDOL 4PG2A 5L2KA 3OXSA 1I7TA 3W9EA 1H8NA 3GDBA 4K8RL 5J4MA 3C6SB 1MIEH 5E9DB 4APQB 2RR3A 1JCKA 4MGXA 3IKCB 4PJGF 1CDCA 5EIIB 2W91A 3TV3H 3WFCL 5D1ZD 3KXFB 1N6QL 5CZXC 5C0JB 1N6UA 3D18A 4PJ8A 4LDLB 3GI9H 4CW1B 1UJTA 4LNVA 4XX1E 1PG7H 2X89A 2QV2A 4M7ZB 3VG0H 4XAKD 2FRGP 3VW3L 3CSYA 2VIRB 3SDXB 4M03A 3OG6B 5DWUL 3WIFB 3KPPA 5KVEH 4PGDA 1FG2A 2ICWA 4KVNH 3L5HA 3H3KA 4UAOB 5FECB 2AEQL 5I1LA 4GMTH 4LVHB 3CFKB 5JOFA 4JANA 2IH3A 5C0AD 3DUSB 3PGFL 5T3ZL 3JV6A 4Y4HB 3FO1B 5ISZE 4KQ3H 4HGKC 4C56A 2HJFB 4MXVF 4NQVA 3QAZB 3LKSA 3MA7A 1MCNA 4GAYB 2ICES 4JQXC 4NQDA 3UTQA 3NCJL 3TVMD 1IBGL 3G5VB 2JK5B 5EBGA 4Q58C 4YFEA 2DDQH 2P5EE 1MRDH 2NY6B 4B0MM 3L3KB 1N7ML 4MX7A 1U93B 3U36A 3VFVA 3QUXD 1KB5L 2APVA 2IALA 3RP1A 1U8LA 1KCRH 4CVUA 3HB3D 1S9VA 2F74A 4PIRF 4F3FA 2ZUWA 3QCTL 2IMMA 1DBAL 4G8IB 2FH8A 2CIIB 1I1AC 3NN8B 4GG6F 4NQCA 5CIPB 4R6UA 5C0FA 4DAGH 2MKWA 2MNUA 3KYOA 2EEAA 2UZYB 4D8PA 1AJ7L 3MFFA 3IJYB 3MOAH 4PLKD 2IC2A 3ILQC 3G5YB 3ARBD 2PKDA 4KY1L 5GGVL 1A22B 3BZEA 4M8QA 2N1KA 5DJ6A 1B88A 3LHPL 5ILTH 2G5BB 3NABL 4GRWE 3BP5A 1RZ8B 4EI6B 4MDJA 3PNWA 4Y16C 1W0VB 5CILH 5DMIL 2CLRA 4S1QL 5EPMB 3QCUH 1AR1D 3DMMB 5I2IA 5DT1H 3WCYA 2A74A 3MRGB 2J7LA 2MFNA 5L7XH 4G42A 4HUWB 3RX8A 1A4KA 2EICA 4X6EB 5SWSE 3FCTA 4X80H 4FTVA 5CGYC 4DGVL 1YPZF 5F9WC 5J8OA 1JYNA 4F7EA 4EDXA 1WTLA 1A6VL 2VYRE 2P48B 2EDWA 3BXNB 5F9AC 5DUML 4XAWL 1CFNB 1G7LB 4OCMC 3OKMA 4YEEA 1JNNL 3V0VA 2FECL 4OLYL 4S2SA 2ZUSA 4FXKA 2E7CA 3OKOB 3CH8A 4L3AA 4Z7UF 1RVFH 4WEBH 3VJ6A 2PTTA 4XMLH 4PRDA 2F5AL 1XGTB 2OR9H 3LEVL 4LLYB 5CJOL 5JMRA 3MJ8A 4JPWL 3GSVA 1QTYT 4KXZH 5I73C 1T80A 3STLB 1IT9L 5HHVH 5C0BB 4NFDA 4ONHB 2XTJD 1XF3A 1JPGA 3AB0B 3FOLA 2DLFH 2P46B 3L3DB 1Z9MA 1BZ7A 3AS0A 4AMKL 1DN2A 5CCKL 3O3EB 2X4PA 1Q1JH 5C1MB 1LK2A 2O5YH 5SV4A 3Q5TA 3KLHD 3L7FA 5CJQH 2IBBA 1G7IB 3AS3A 3H0TA 1OAXL 2VDPH 1QYGL 3WSQH 1D9KD 1WCBA 3LPWA 3BP6A 4PRHE 1MHEA 2EEDA 2OLDA 3EW3B 3O11B 4UUJB 1MCEA 4Y4KD 3K0WA 3D0LA 4Z8FL 5E2VL 4XRCA 1S7VA 1BQHA 3ZKQD 1FPTH 3IFNH 1OD7A 2H32A 1SEBB 2BNRA 5KSUB 4IRSB 5FYJH 5AG8A 5KVGL 1MRFH 3MUHL 4LNRB 4RMTA 2OP4L 1REIA 1ZT1B 4X7SH 3CDYA 4LAQH 3HPJA 3VGGA 5LQBH 1NSNH 3TH4T 4LHUG 3MCKB 1EGJH 4XCNB 5IROC 3FT3B 5CP7A 2GY7B 3REVB 4OD1L 2DTMH 5D5MF 5BZWA 3SCMB 5BRZD 1FFNA 4LGRB 4D9LH 1OP3H 2FLBT 5BVJA 4U1HA 4KZEH 5I1IH 1OSZB 1OW0C 4QF1B 2ERJB 4J4PD 5EO9A 2OXGA 3HC3L 5HSFA 2QLVB 3VWJB 5KZCB 5D2LE 5FO9B 2VB5A 1AD9A 1AQDA 2HAZA 3O6KL 5FYKD 4U1SA 1ZGLM 4X9HA 3F6IA 5I9QC 2YXMA 3LH2H 4LCUB 3QI9B 4L8SB 1JPSL 3V6FA 3HC4L 1KELL 3UTPD 4XGZB 3ALPA 5GGTL 2NY3C 5GQBA 3STBA 1NAMB 4PJHB 1NBVL 3RDTB 5CEZL 4L8CB 2Y23A 3ZYJA 1M7IA 1U91A 4G9FA 3BDYL 4YX2L 1U92A 4LASL 3U2SB 4PGEA 3V0WL 2B20A 3D39B 5E8EA 2A9ML 4OM0L 5EB9A 3RWDA 2VLKB 5B4MD 2X4UB 1NBZA 3BD4A 2HTLC 1RUAH 3SJVD 1NGZA 2E6JA 5IHBA 1KIRB 3BN3B 5K9OB 25C8L 1EHAA 3JTSA 4PS4H 1MI5A 1YECL 3MRIA 1U8MA 3B9KB 4X98B 4RRPA 1P69B 3KHOA 2JB6B 3ZE0F 4Z7OF 2B1HH 1T04B 2F54E 5IR1A 1NGYA 5SX5K 4OQTL 1MJUL 4ONOA 1I1YA 1KCSH 3BE1H 1EEYA 4QXUL 1D5XA 3FT4B 4R7NA 3IU3B 2P4AB 3UC0L 3MGOB 2ARWA 2IGFH 4X6FB 4HULB 2PW1A 5KTEL 5HYJA 2LVEA 3LKNB 4MLSA 3W9DA 3KJ6H 1C5CH 3ULVD 4YXKL 4CU7A 1AGDB 2VAJA 4ZFZA 1DN0A 4B7LA 1JNHB 4NCC1 2Z0BA 3CZFA 3CZJA 5LCVL 1IEHA 4A6YB 1G6RA 3BSZH 1MFNA 3V5HB 1OGTA 5ECJE 1RUMH 4M93C 4MQ7A 2DI9A 1AHWC 1MRCH 1BQLH 1DR9A 2YUVA 1IGMH 3OBAA 2W65B 3RWHB 5TQ2H 4GW4A 3H9ZA 4N0CC 4RNRB 4N9GB 1G9NH 3LN5A 5GHWL 1FZMA 1KOAA 1BBDL 2JF1A 3DBXA 4LF3B 5HGDB 2DQIH 3I6KB 5EU7E 5J12C 1UXWB 5DJ2A 2P1YA 4M1GH 5DHVB 2EYSB 2Z9TA 4HX1B 1TNNA 3QA3B 3QNXB 4O4YL 3F12A 4Z7VA 3MLYL 2WP3O 3FQRB 3SKUD 2GQHA 1AXTL 2H6PB 2LVCA 5DVMA 5GISL 4OJFL 3O6FD 5I6XC 4LQFH 2G9HA 3ET9F 5C07B 2CK0H 2AGJL 4GKSA 4PJDA 5D72H 3SDYH 3VXSB 5B39B 3VFPA 5DEGB 3CXDH 1MPAL 3AXLA 4HQQL 4G8GD 5JA9A 1MF2L 4HJJL 1UVQA 1I7RA 4Z77B 4RZCB 1RUPL 5IESL 5DK3A 5IB3B 2FB4H 4ZNCD 1NEUA 3R0MA 43CAA 1ZT7A 1HHKA 4LDEB 4RFNB 3VE0B 2IAND 2FBJL 4WU5A 1YYLL 3PJSA 1FN4A 5CGTA 2W9LA 4JM2D 1C8PA 3JV4A 3RTQC 4G6AD 1IC5H 4NP4L 5L9DH 1NDGA 3MJ9L 5FUZH 1JRHI 1OAYH 1TCRA 4LCWA 3C5SB 2RIKA 4NNPL 4GKZB 4FABL 4HPYL 4XC1H 2BNQB 3IDGA 3Q1SH 4GFTB 3QUZD 4Y89A 3B3IB 4U7KA 3QP3A 5T3XL 3ZTNL 3L5XL 1FGVL 4N0FA 3QDME 1G0DA 2EC9U 3CVHB 3FRPG 2QJDA 1NEZB 1T3FA 2V2WB 4YE4H 1IAIM 1YNLL 5EORL 5MEPB 4DZ8A 2E6PA 5D2NC 1KPRB 4AZ8A 1U3HA 3C60D 2AJSL 1WT5A 4MJ5A 5A40E 2R2HA 4QRPE 4ZTOH 2NY5H 3WEXA 1RFDL 2A77H 3B6SB 4HFWA 4FQJL 1KLGB 2AEPL 1B4RA 1AKJD 4X7TA 4LMQE 4KDTC 2VZOA 5GGTA 1OAKH 4P2RE 4PJBE 3FFCD 2DMCA 3J8F7 2W38A 3TM6A 3FQTB 4XMPL 2XACC 4JFXB 3EYUL 4UQ2A 1OGAD 4XNMB 1TJGL 1NMAL 4TPRL 4YDIH 4QT5B 4HC1A 2QEJA 2Q7YB 5HGBA 5JXEC 1LE5A 5D7KD 4XBPA 2CKBL 1B0GA 5KVMC 3MBXH 3MRPB 1M1SA 5JOPD 3IDMB 4OV5A 1F11B 3HTLX 1MHPH 4RAUB 1D6VH 3ZDYE 3D3VB 1XF4B 5FGBC 3KYKH 1KACB 3MZTA 4HXAL 4DK3A 2D03L 2UY7A 3OKDB 3QT2A 4QRRA 4P3WA 3E6FA 3ARBC 1XGUB 3U48A