5LGKA

Crystal structure of the human ige-fc bound to its b cell receptor dercd23
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
307
structure length
307
Chain Sequence
VKILQSSCDGGGHFPPTIQLCLVSGYTPGTIQITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig epsilon chain C region
publication title IgE binds asymmetrically to its B cell receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA03
4OF8A 5TJWK 2XNAB 5FV2A 4AH2A 5KTEL 3HZVB 3HG1D 4NZRH 3KS0J 3QUMA 3S35H 1X5FA 3BN9D 1CICC 3D9AH 1P7QB 3IAPA 1QRNE 4MJIA 4AIXA 4JY6A 4ZPVA 5J9PB 5DUMH 4NNYA 4HJGA 4WEBH 3KDMB 1TLKA 1LK2B 5JXEA 2R29L 4OAWB 1RURL 1NFDA 4GRMB 3ULUD 4ENED 1AGCB 3L3DB 4XNMA 2MPAL 3F7VB 4CW1A 2R0WL 2D2OA 4X4YB 3OF6A 5C07E 3HPJB 1ZAGA 5I74B 2XZQL 4CBPA 4HV8A 4IDLA 1J12A 1MEXL 4MDIB 4PRDB 5SV3A 1F00I 3VGEA 1GGBL 3PWNB 1ROWA 4HIXH 1HILB 3IDJB 1GZQB 2YRZA 4ONOA 4LCYB 2OBGA 4Z7WE 3ZKND 2RCSL 1NUDA 2GTWB 2HLFC 3BE1H 2WINA 4PG2C 1CGVA 5E6IA 4U6XA 5D5ME 3WNOA 2D7MA 2FJFA 1N8ZB 1A6AA 3CZJA 1L7IL 3MRBB 3BQUD 5D72H 2X05A 5F7DA 3GO1H 3C5ZD 4QEGA 1XGTA 4MSWB 3WD5L 2YR3A 4RGNE 4I48B 2R0LH 2IANA 1CG9A 4JFDA 4N0RA 1AGBA 4TQEH 5I19L 2HG5B 1DLHB 1AQKH 2J3SA 4LLWB 5L2JB 1P1ZA 1IC1A 4U6TA 1CK0L 3KPSE 3MNVA 3DUSB 1FGNH 1F4XL 4JZJB 1K6QH 5KZCD 1L6XA 4LP4A 1FVDB 5E8PA 5JW4N 3WXWL 5KSBA 4WFGE 4IOIB 2COQA 1N5YL 4OUOA 2IQ9L 4Z7VF 3GMMA 3D69B 1JZ6A 5C3TA 1Q38A 4P23C 4ONHA 1MHHA 4OLXL 1LO2L 3UTSA 5JIKA 1V3LA 3I75B 5CJOL 4LVNC 2QQKH 1GGIL 1CWVA 2AABL 4CVUA 2Y07L 4O51A 3HI5H 3CDCA 2V2WA 1KG0B 2B4CH 2XRAL 5J8OA 3FT4B 3AS0A 5MEOA 1RFDL 4XBGA 1KUMA 1WITA 5D71L 4F7EA 2YS4A 3P4NA 3ZYIA 3V6OC 4M8QA 1DANU 4WFED 4F57H 2HT2C 1U8NA 4U1JA 4OCWL 3MBED 1IAOB 2NY2D 4WY7H 2GK0B 3OWEA 2XPGB 2NY6C 3QISA 2YWYA 3SGKA 2NNAB 5C0AB 3VFNA 1YEGL 3ZTJG 3FFCE 1MJ8H 3DMMA 5FAAA 3O8XB 3BZEB 4WNQB 1S7WA 5T3ZE 4Z77B 1CD1A 1VERA 3TP4A 4WDIA 1UA6H 1I3RB 1JGDA 5F1NA 1XF3A 4P59L 3RWEA 5JIPA 3VRLF 3BSZH 4KK8C 3QIBA 3S34L 2Q86B 1X5ZA 1ZLWH 3VD7A 2JIXD 5GS1B 3PJSA 4F37K 5LAXA 3QUXC 4HG4K 4LLMB 1NAMB 4NQCA 5JOFB 1CGUA 4PJFE 3HRZB 5KBNC 1TQBB 1S3KL 2A6DA 4XCEA 4RIRA 1SVCP 4ZS6D 3WFEL 4FQHA 5DYOB 1MREH 1GGCH 5K33A 3RL2B 3T0DA 1BJ8A 5T1LD 5GIRB 5JDJA 3AY4C 3ARYA 3V0AC 2JJWA 3PDGA 3L95B 5BMFH 5K9QG 3CFIC 4AEHH 1UJ3C 3QQ9D 4MWFB 3OXRB 1EO7A 2H2PC 3A6CH 1N6UA 2YKLL 2AV1A 4PGBB 1FNGA 3O6LH 3MRLB 4P46C 4P2QE 1RVFH 5F9OH 3ZKSD 1C1EH 1KPRB 5IB5B 1HKLL 4I3SH 1N4XH 5DHXB 3S3JA 2VRAA 2AK4A 3H3PH 1UENA 4JQXA 2GCYB 3SCMA 2BRRH 2OTWA 5KVFL 4Z7UA 4ZAKB 4OIBA 1EVTC 3D18B 1MCIA 4G80A 3QT2A 1I1AD 1W0WA 2HH0H 3KXFA 3DX7B 3MRQA 3TNMB 4FFVC 4AEEA 4UOJA 4U6VL 3KYKL 3T0AA 4N0YH 2X5PA 2XFXB 2ITDA 5F7UA 1CLZL 1V5JA 2XY1A 5F3HB 4KROD 1EX0A 3RL1A 4C4KT 3MRNA 3VFUA 4TUKH 3QG7L 5TF0A 1VB9A 1IQDB 1IGML 5I1GH 2BVPB 2ESVA 1CDYA 4C55A 2XZQH 1MEXH 3QJFB 1A6UL 4WWKB 3TWCL 4H0GA 5BXFA 5C0EA 2YUZA 3T1FA 4CMHB 2EO9A 4QOKE 2DJ4A 4NQUA 3BPOB 1AIFB 2R1WA 4WHCA 5B8CA 5KSUB 1NSNL 1CFNA 5IJVA 3ARDA 5CUSL 2AJ3A 1A9BB 3HI1A 4S2SB 2NR6C 1XR8A 4YHIB 1G1CA 2B2XH 4KRMB 1ZLWK 1ZHBA 1L7IH 3N1FC 3GMOB 2VLJE 4ZFZB 2R0KL 2XWBB 1MFAL 3PL6A 2ICCA 3NIFF 3OR7A 4OF0A 3ULVL 5GRYA 4LKCB 3QEGL 1FVCB 2BY0A 3NPSB 4OZHB 5I19H 4FQ2L 3KVQA 5EOQH 1JMXA 3NABL 1X4YA 4TULH 3ARGB 4AIZB 1K4DA 3D3VA 2VXUH 4M6NL 1BF8A 1L7TH 2VXQH 1N6QH 2WP3O 4NO0B 1YEIL 4LSRL 1KIUA 5D2LA 2PW2A 3IDNA 2QQNL 2IQ9H 4NQTA 1Q9WB 5F8QC 4PD4K 1LO5A 4MJIE 4L29A 5DQDH 4OLXH 1LO2H 1VADB 1VACA 1KJVA 4ZUTA 4G9FE 2P8LA 3VGDA 4EN3C 4ODWA 1GGIH 5IV2B 4U6YA 1P5UA 4LLAA 2DQEL 3KR3L 3SO3C 4NP4L 1RFDH 2YA0A 4OZGF 5HYJE 2J6EH 5KS9A 2ADFL 1HEZA 1LD9B 4ISVA 4WFHD 4I0PD 1IGJA 1F5WA 3T3ME 2VLKE 1B4JL 3LKRA 2AJZA 4NSKA 4PP2A 1F2XK 3EGSA 3UXFA 2UVFA 4UT9H 1PKOA 1X6LA 4K7FA 5TH2B 1JZ7A 4K2UL 2BOCA 3G6AB 1ZT7B 3IJSA 4HCRH 3HR6A 1IT9L 2ZUWA 5DD0L 4PJHE 5ID0B 3O45A 4NJ9L 4R4BA 4D0BA 3MLUH 5HVGB 2D9QB 1CGSL 2WBJA 4ZO9A 4IHOB 4HF5H 1CF8L 2WWMC 4P59H 4HGWA 3BW9B 3RZWA 1KPUB 1XIWD 4GAGH 2IANE 4F33B 5TFSH 4PR5A 3GMLB 1KTDB 4LIQE 4MXVE 3QXUA 4R9HA 1FRGL 1JRHH 2IJ0C 2IPUG 3IJYA 4J3WA 4XCNA 2D7NA 1A3RL 5IB4B 3D87B 4DFHA 1R5WA 2CUHA 3QH3B 4YDVA 4TUOB 3DBXA 3GSQA 5L7XL 3TEUA 5IFJB 3GSUA 3U6RB 5D7LD 1RZKC 5AD0A 2QKIA 4IRJD 3WLWD 1I8KA 2I5YL 2HLAA 1KCRH 5GRVL 4APQB 1DBMH 5BZWA 1U8LB 4PJ8D 3KLAA 1J0HA 3AREC 1DBJL 1BQHA 4Q7DA 3GK8H 2YN5A 1CDCA 4U1GB 2CRZA 3U2SA 2YKLH 2D03L 3G5ZA 1MF2L 4HJ0D 2YEZB 4TVSa 1UEMA 3SY0A 3MCKB 5I8CA 2HT3C 4PGJA 2ZZUT 4XC3L 2IFFL 1HKLH 3S3SA 5DJZA 3VFRA 4LRNH 2HMID 4QT5B 5LKNA 3ZE0E 3RWDB 3S8WA 2D31A 3SGDI 4HWZA 3DHMA 3T0ED 3DRQA 1RK1A 2XXMB 1D5MA 1YQVH 3L5XL 4IMLB 5DFVC 3QXTA 3EW3B 4XH2A 1DTUA 1CICD 3QUYA 5D6CA 1JGLL 1GZPA 1MCOL 1RUMH 3UPRA 1JN6A 4G43A 3V7AE 4WUKH 1CLYL 5D7JA 1EEUA 1HSAA 3CMOL 1LILA 1UM6L 2BSTA 3LRGA 3L3JB 1G6RH 4G8GB 3N50A 4MJ5B 1ORSB 3LCYA 3TWCH 3TPUA 1AXTH 1I1YB 1UM5H 4MGXA 5A2IH 1DUZB 4QTHB 3EFFB 4NQCE 5I75C 4MLSA 3MUGB 4Y88A 2CIIA 2I9LA 4RFNB 5CUSH 5BRZA 4YJZL 1A7RL 2CDEA 3LKSB 4YX2L 3GMQB 3NN8B 1Z9SA 2HLFD 4BK5A 3EJZC 2HJFA 1KFAL 4OZIB 3RNQB 2R0KH 5C70A 5TF1L 1MFAH 4MJ6B 2O93L 4JRWA 1NGYA 3ULVH 5DRWA 3M8OL 2KPNA 4DVRH 2UZYB 3QEGH 4JRYA 4R97B 3DVGB 3KWWA 3QHZL 1D6EA 3QDAA 5D7SL 5HYQB 4RNRA 1JE6A 2IC2A 3OZ9L 2A9NL 2PXYB 1J11A 3HLAA 4BH8B 4ZO7A 4LSVH 1JK8B 3BMVA 3B2VL 1MWAL 5C09A 2PTTB 1TJIH 2YSSA 3ZTNL 5DD6B 3GB7A 3UZQA 5J7CC 2VDMH 4LSRH 3OKKB 1U92A 5CCKL 4N8VA 2IPUK 4Y5XA 1M4KA 3F7YB 4PB9H 3TA3B 4TSAL 3WS3A 4JM4L 3CIQA 3H0TA 4RMWA 3VFTA 2IALB 5F1OB 5MEQB 1NAKH 4K23H 4ZSOA 1DVFB 4PJXF 3X13A 3QUML 4I18B 5JPMB 3SDYL 2A0LC 4XVJH 1W8NA 5BS0E 4NP4H 2Y36L 3L6FB 3JWDH 1F2QA 2CGRL 3PG2A 3F58H 3N06B 1R0AL 3F7RA 2NTFB 2MQ3A 2DLGA 3FQWB 4FTVB 4NWTH 3ARVA 4UDTA 3IDXL 5F7LB 4DK6A 4JE4B 1B4JH 1PYWB 3IJHA 2F8OA 4R3SA 3OAZH 4BQCA 2EXYD 1CN4A 3L3GB 1AQDB 4LLVB 5HHMD 1T20B 3DOSA 4K2UH 3HUJA 5BQ7B 2Q76B 2G2RB 5B39B 1ZT4B 4OSUH 1IT9H 4XP5H 5DD0H 2VLLB 1HSBB 1KNOB 3O11B 1Q9KB 4LASH 2DBLL 4Q9QL 1KB5A 1M7DB 5E95B 1KCLA 5EO9A 4WEMB 1F11B 4O58H 1FCGA 1TQCC 1E4KA 2HTLC 3VD5A 1J8HE 3BKML 1J7VR 1ZVSA 2BNRD 4KK8D 3EOTH 4IRSB 1A3RH 3MRGA 2ENSA 5C7XL 2XTLA 2P44B 1W0VA 3QUXD 4LCCA 1INEL 3QIUB 2DM2A 4A6YH 4LIQL 4ZUSA 1B88A 5HD8C 3DNKA 4GQPH 2VLMD 3Q6GL 2RHEA 1KF9B 3SDXB 3NZ8B 1EK3A 4N5UA 1PSKH 2VISB 1HINL 1DBJH 3OKMB 4B5EA 1MQKH 1RZFH 3MPCA 2VZUA 4NKIL 1HOCA 2ATKB 2D03H 5IVZA 4AMKL 3VRJA 1MF2H 5FYKU 4ZYKA 4M00A 2H2PD 4Y4HC 1MFBL 5A3ID 5F8RC 2OJEA 4ONGL 4P46D 4XC3H 5DSCA 5TQ0H 2IFFH 3TBVB 2X42A 2G5RA 2V5RA 2VE6B 1OQXA 4I2XA 3JTTB 3HKFA 3U82B 4NQVB 2YUWA 1YC7A 4C57C 3EDKA 4N0UE 3JTSA 3H7BA 1FG2A 3W2DL 1I75A 2G9HB 4PJEB 2BHYA 1OTUD 3LRSB 5BZDB 5F6HJ 1U95B 2CXGA 2R23A 4ODHL 8FABA 5JLZA 4Y8AA 3UBXG 1II4E 4FFVD 4QRRD 4HXBH 1ZVYA 2ARJB 4G9DB 4U2YA 3EOYG 4RCAA 1OAQL 1E4WH 4WTXA 5CSZB 4PJAA 4PJ9A 5DF0A 5EU7C 3BPCA 3OAZK 1IILE 1EV2E 3MACL 5DJ0B 1FAKT 1OGAA 4JFEA 4Y4FA 3U9PH 5GZOD 3QDGD 1Z9LA 5TPWL 4ZXBA 3CFBB 4LCWD 5ISZA 4EIGB 4JR9H 4KQ4L 5D2NB 4CNIA 1LE9A 3CGTA 1I9IH 4UQ2A 4M3KB 5HI4C 1E6OL 3PDOA 4PLKD 1C5DB 5I71B 4K9EC 4L4VB 1CL7L 4OCYH 4W70A 1MVUB 2IF7A 1IGIH 1JWSA 4FQXC 4KY1H 3V6ZA 3T1WA 3BRDA 5I1JL 2CLRB 4YX2H 3AXLA 2WBKA 3QNYA 3BIKA 4LSDA 3GM8A 2RBLA 1ZA6A 2KL6A 3WHXB 4U1SB 3M8OH 1IM9B 4KMQA 4PRID 1YUHA 1G9NL 4YZFF 1QO3A 3GKWL 1CLOH 1VHPA 2ICWI 4URTB 3VDBA 5GRVK 1N5AB 3LEVH 3LIZL 2EDEA 5C6TL 3QJHB 2BSRA 1H5BB 1WIPA 4D8PA 2F53D 4NCC2 3BN3B 2P5WD 3GGWB 5DJAB 1KJ2H 1X5HA 4X7CC 2H32H 3B2VH 4HWBA 3JUZA 3ZTNH 1RI8A 1WWWX 2AAVA 3CLEL 2BOBA 1T1XB 3RWFB 4LFHD 4X5XB 4JM4H 5J6GA 3LDBC 1UT9A 1MH5A 3MRCB 3GDBA 4JB9H 2H1PH 2X4NB 4XPFH 2IQAA 2FZ3A 1KJ3H 2FX8L 1PX3A 4HXAL 1GJIA 3DI3B 4POYA 2V6HA 4EN3D 3W9DA 4DZBB 3VXOA 2BDNH 3QUMH 4CMMA 4RA0C 1C16A 3VXTA 4UV4L 3QEQD 4PGDB 4F2MA 3UC0H 4J1UB 5DRXB 5F7FA 3STLB 2VAJA 3MLSL 2DWEB 1YA5A 5HXMA 5HYSB 3IDXH 5B38B 1HWHB 1RZ8A 3WN5C 3TO2A 1J5OH 1CFSB 3QPXH 1CFTA 1HHGA 4GBXA 3TJHD 4I9WE 1AP2B 3DROB 2NXZD 1UEYA 3C09B 5C0CA 2V17H 4Z76A 1YNKH 1YN7B 3HG1A 4XP1H 4C56B 3RWHA 2L7JA 5IHUH 1UC6A 3TN0B 1LWRA 4IEFB 5CILL 3P4MA 4ZQKA 4ZUWB 3DV6B 3ZKXC 4LCIL 2YMXH 1I7TA 2P4AB 3TIEA 4CN4A 4X5LA 3EFDL 2WWMD 5D7IE 4TUJB 4PJ5D 4AQ1B 3L3OB 4V1DE 3LEXA 4PJCA 3GHEH 3SDAB 1LK3L 2A6IA 4ERSL 3QWQB 5E5UB 5DLMH 5C0JB 4OLZL 5HY9B 4M6MH 4AEIL 5I66B 4NZDA 4QRQA 3QIWB 1NMBL 3AAZA 2IADB 3NGBC 5D70L 4MB5A 4EDXA 1G7IB 3G5YA 3MRRA 3OPZL 4BSWA 4HPOH 3VRIA 5GGUA 3MBXL 3FB5A 3IFOB 1UWEH 3V9FA 1YMMB 1X44A 2KUTA 3ARED 1IZJA 1X9QA 5IMMA 5GSRB 5E94B 1EFXB 3RTQA 3BQUA 4OV5A 1UM4L 4ONGH 2NX5D 2AV7B 2NY4D 5TDOA 3C5ZA 3DUUA 4Q2ZA 1V3KA 2HT3D 3HE7C 1RZ7H 2W9LA 2MSPA 2AJXL 4NRYA 4DQOH 1TJGH 1JMZA 1YECL 4FQ1L 1YEDA 3W2DH 3HAEA 4OLUH 1S9WA 1CGYA 3TYFB 5J3HC 3S88H 3ARTA 1ZT1B 3QXVA 1EGJL 2XZZA 2C3WA 1MCEA 1WTGT 3EYSL 2WUBH 4PV8A 3KJ6L 3KYMB 4XI5D 4BM7A 4PRPB 3S36X 2I9TA 1JUFB 4PJGA 1OAQH 2Y72A 3ZZ1A 3DSFH 4OTXH 4PG9B 1I3UA 1OAXL 5I8EA 4Z7QE 1UACH 4HK0A 5JDSA 4GKNA 4NO3A 2AEPL 2X9WA 5ERWA 4ZNCD 3KYNA 2HFFB 4LDOB 3RKPA 3SDCB 1PG7H 4M5ZH 4NM8L 4NT6B 2F74B 3D2UD 1LNUA 1E6OH 1BZQK 5CBEB 1UKSA 4BJLA 4YLQT 5HGBA 3BDBA 3RU8H 3KPPA 3MBEA 4E41A 1J0KA 3EJZD 4MA1C 3X11A 1T0MB 5T1KB 1KLFA 1G6RB 4P2OD 4V2BA 2PYED 5E7FA 4XNXH 1RUKL 5GS0C 4F3FA 4RFOH 3LIZH 3ZHDA 1FE8L 4AJ0A 2AP2A 1RIHL 4LPCA 3CUPA 4OD2A 3HPLB 4L9LC 4CVXA 3O8XD 1A4JA 3JSSA 4KKAC 1QFUH 1YPZE 2JIXA 3CLEH 5LQBH 5CSGA 3MV7D 1XCTB 4HPYH 1ZK9A 4HEME 3V8CA 4GMSH 4YE4L 3KPLB 5IQ9B 4YNYB 1EEYA 4MAYB 1EPFA 5GRUL 5EBWB 4U1NA 5T1LA 4DKFL 3T65B 4X6DB 1NCAH 4XVUD 4NYLA 2H6PB 2XTJE 3RZCB 5DT1L 2J5LB 4DZ8A 5D1QC 3FOLB 1QLFB 1UCBL 2CKBA 3NACL 3PGFL 4NRZA 5C0IB 4OZFG 1WZ1H 5F93C 3WJLC 4MAUH 3DX9B 5CSBA 4PBXA 1YN6B 1ZANL 3N0PB 2GSIB 1W8OA 3O6MH 3P9LA 4ZD3H 5E2TH 5IVNA 2RQ8A 2X1QA 5ACMA 5EDXA 5JXAL 3LQZA 1YJDC 3RY6A 4PTUA 2X70A 4LGPB 3RKDC 4GG6F 1I1AA 4HBCL 2AXHA 1T89A 4NN6C 4DOHE 4XCFL 1MHCB 5FB8A 3RWGB 1JHTA 2CRMA 3MLPA 3AGVA 4ELKA 4WI5A 1HHJA 2Q8BL 1C8PA 1CDUA 3EFDH 1FNAA 4H1LG 1I85C 4JY4B 2NY1B 1IEBA 3WS6A 1BJ1H 3VFMB 4LSUH 4GSDL 5H94A 1T2QL 3CJJA 4HDIA 1VFMA 3TO4C 1IJ9A 2X4TB 1T7VA 3STZB 2V5TA 2VXTL 2R1XB 1NMBH 3MLRH 3HCVA 3ZLQC 2FB4L 2I60L 1A1MB 3T4AB 5C0GA 3OPZH 2CDGB 3CH8A 5HD8D 4XCCH 3TZVB 4KK5C 2EXWC 4YK4B 3MBXH 1C5BH 5SWZB 1NCDL 3I84A 3SPVA 3MLZL 4MD0A 4YGAB 3SOBL 4M02A 4JZOB 4QYOB 1FCCA 4JFPB 3H9ZA 5FDWA 4K3JH 3MODH 5BW7C 1J8KA 3B9AA 5HDQL 3Q5TA 1J86A 3BYTA 5EC2B 3H9YA 3VFVB 4NQED 5INDA 3ARZA 3SE9L 4I3GA 5T5NG 3LS5H 1NJ9A 5T1MB 4A6YB 2AJXH 3G6DL 4N1EA 4XGZA 1MCKA 1NMCC 5EO1B 1YECH 4KI5E 1WBZB 4FP8L 2KH2B 1CI5A 3MFFA 2DQFA 4E0RB 3EYSH 5CFHA 5GGVY 3KJ6H 5C0CE 2DQUL 5TDPA 2JJVA 5IF0B 3OX8B 3MXVL 4PJ7A 2GJZA 3HC4L 5E5RB 2AEIT 3CFKB 2GT9A 3TH3T 4TRPL 3TH2T 4N8PA 4LPUA 3GJFA 1HQ4A 2RFXB 4N9GB 3H8NA 4NC1E 3OKNA 1G6VK 4NIKB 2LU7A 4O00A 3QCTL 2CLZB 4IJ3C 1A6TB 1BQHG 5GGSA 1KB5L 3OMZA 5L2KD 1M05B 1ES0A 1MRDL 1HHKB 4I0PA 3EYOB 1JV5B 1WWAX 4MD5B 5HHOB 1X5XA 1DQML 3ARWA 3WNKA 2WLYA 2VH5H 3FT2A 1IKFL 1YYMH 1Q94A 4OD1L 3L7FB 2DAVA 1WZKA 2DM7A 2F54B 2VL5A 4ZUVA 4NO2A 3W5MA 4NKQB 1JVKA 1YNLL 1FYTB 3B83A 4P4KC 4PJDB 1RUKH 4JJ5B 1DBKL 4PGCB 1ZWIA 3RUGF 5I1EH 4FFZL 3B9KD 2VQ1B 4ALAH 1OSZA 4HX1A 2JELH 1E6JL 2IWGA 3V4PH 1XIWA 1DQQB 2V5SA 2VMFA 3IT8D 1T4KB 3UBXB 1U93B 2FYYB 5JHDE 5ESVB 5SWQB 5AUMA 5DFTA 3ARFB 1FFNB 1Q72L 4U1IA 4JRXE 5F7MC 4YE4H 3ZSSA 4QY8A 2J8HA 5F1IA 3C87A 3S36L 2C9AA 2HT4D 3QI9B 5D7LA 4WUUD 3VG0L 1I9EA 4L4TD 4X5WA 1YEKL 2ZUQB 5J12C 4HGMA 4DKFH 4D3CL 4PJ8A 3LSOB 1LDPL 4GKZA 5DR5L 4KVCL 3UPCA 4NQSA 2DQJH 5DT1H 4ELMF 4OFKA 1BZ7A 1KJ2B 1NEUA 2H32B 4XNZC 3TIDB 4XNUH 4M9PA 1ZANH 4KUCF 2Z92B 4YPGB 3V6FB 3MOAH 2EE2A 5F70A 1YYLL 4BSVA 5JXAH 4CN6A 1FC1A 4YHPB 4XP4L 3NIDE 4IS6B 4TN9A 4YHML 1QFPA 3T0EA 1N64L 5GGVH 1CDBA 3BHBA 3QSKB 4HBCH 3PQYE 4E41E 5ITBL 2WIIA 1LE5B 3O2WL 5DQ9A 2VDPH 1CICA 2BFVL 4ZPVB 1C08A 2X6MA 1AI1L 1D9KD 4NNYB 2Q8BH 4HJGB 3EO9L 1F13A 1Y6MR 5FHBL 4N8VG 3FB7A 1NFDB 4GSDH 3SE3C 3QUKA 2VB5A 4XNMB 3BVNB 2EIDA 4NKMB 4Y1AE 4CW1B 5ACZA 1NCCL 1ZHLA 4HV8B 3VFSB 5CINH 1UVQA 1D5IL 1FAIL 2I60H 1AR2A 4KTYA 1EO8L 3GKZA 7FABH 3CLFL 3TT3L 2PO6C 5AAWA 1RMFH 2E27H 4KRPB 4HAFA 1WBYA 3R8QA 3RPIA 1GL4B 4YQXL 2WINB 4HWBL 5GJSH 4U3XA 5E6IB 4QNPF 4U6XB 2FJFB 1A6AB 4Q58C 4NWUH 5F7DB 4UAOB 1Y0LA 2CDFB 4XB7A 1XGTB 3DARA 1J18A 5IGXL 1CG9B 4JFDB 1AGBB 5CD5C 2EH7L 1KGCD 1P1ZB 3NTCH 1EHLL 2AJSH 1A0QL 2FL5A 2C5DC 2ZUSA 4PRAB 3DI2B 5CJQL 1LP9E 5J3HD 2X4OA 5JHLL 4ODTH 5E8PB 3VRLE 1ZEAH 3QCUL 2DQUH 2LQRA 5KSBB 1LO3H 3MZGB 1QLRA 3GMMB 4WI4A 2XQBL 3RVXD 2Y4SA 1DR9A 3INUL 3IETA 3P2TA 4ONHB 4R4FH 2H45A 4XNQA 4ZFGL 3UTSB 4OQTA 4UT7H 3X12A 5FO8A 4O51B 1L0YA 1MCFA 2EDDA 2V2WB 3TA3D 1FH5H 2NY3C 2C26A 3REWA 1LEIB 1MCWW 5MEOB 4XBGB 3RAJH 3WUWA 4JN1L 1S7QA 3RBSA 1ZSDA 3FRUA 5IBLC 1DLFL 1TVHB 2D7TH 1QA9B 3EJJX 5GRXG 4F7EB 1MAJA 2V5YA 2VDKL 2RAMA 1ETZA 4M8QB 4V2CB 1FFPA 3N1QC 4JFHD 1VPOL 2QQQA 3TT1L 3CXHK 3D39E 1FN4B 4U1JB 4OD1H 5B22A 3W0WE 1CCZA 2H8PB 5EZOH 5KN5A 2GY7B 4D9RE 3ILQD 3VXNB 3PHOA 3IYLW 2ADJB 2LTQC 1MI5B 3GBML 5ESAA 3MV8B 5EUOF 3SKUD 2GY5A 3DMMB 3UZEA 3MLVH 1RD6A 1QNZH 3K1DA 4JDTL 1N0XL 4WDIB 1J0IA 3BWAB 1JGDB 4QXGL 3SDDA 5F1NB 3GSXA 4P2RB 4JFOA 1GAFL 4AENA 1MOEA 3PABA 4X7SH 3HMWH 2BNRA 3ABZA 1A1OA 5GJTH 3C6LC 4L8CA 4MA7L 4KKAD 1KEML 2IBBA 5IESL 1I7ZB 5FECA 4WTWA 3QUXA 4JCMA 4JO1H 4PJEF 5T33L 3WNMA 4WFFD 5I1CL 2A6DB 4RIRB 3LV3B 4FQHB 3ZDZF 2DJSA 4K55A 5EO0B 3OKLA 5JO5A 3ARBB 1LDPH 4K3EH 4KVCH 5E6ZA 2BZDA 2NY0B 5A2FA 5F21B 4HSQA 1TCRA 1FNGB 2NW3A 1QSFD 1X5YA 2B39A 1VGEL 4P46A 4R96A 1T2JA 5JUEL 2MKLC 1KSRA 2ZKHH 1RJCA 1U8OA 2A6KA 2VC2H 4AY0A 3NIFE 3A67L 2AK4B 4K3GA 1YYLH 3QAZC 1NGPL 3O9WC 4FZ8L 3SCMB 4QHKJ 4YHMH 4Z7UB 3BGFC 4U1LA 2X40A 5E8OB 4UQ3B 3TNNA 3K4DA 1W0WB 4BZ1L 5ITBH 3KXFB 3LQAC 4RGMC 5L9DH 1NLBH 3MRFA 1H3UA 1QR1B 1VFAA 1AI1H 2YD8A 1SBBA 1ZA3B 5KOMC 1KN4L 1GOGA 2ITDB 3VXPA 1S78C 4H26A 5FHBH 1ND0B 2JJSC 3PIQA 2WLZA 5EU4A 3VFUB 3C08H 3O3DA 3QDGA 4U05A 5ILTL 4JM2B 4WCYH 3Q2CA 2ESVB 4EI5C 1NCCH 4FOMA 4LCWA 3I50L 4OLEA 1OY3B 4WWID 1U8MA 3GSOB 4MX7A 4DW2L 4Z6AT 1REIA 5FYKE 1BIIA 1D5IH 3T1FB 1A02N 1A14L 1KELH 1W72A 1JTOA 2FX9L 3ORJA 3ZHLA 3KPRE 5B8CB 2VZSA 1QACA 3D48R 2JCCF 2AJ3B 1JHLL 1IC5L 1OHQA 3HI1B 1AO7E 4LVOC 4BELD 4HWBH 1XR8B 1XEDA 1A6WL 3VD3A 3IRPX 2GJ6E 4E5XA 1SJEA 1WCBA 5I17A 3PL6B 3OR7B 1JTTA 4PRIA 4WHTA 2XA3A 4MZ3A 1F4WH 5IGXH 3FAXA 3MXWH 1J1PL 1JF1B 5JA8B 3U4EB 5GQBA 5F3BB 2JK5A 4F58L 4JO3L 1A0QH 1IM9D 2P5WA 5FYJU 5IB3B 4JO4L 1K4DB 2VZ3A 1OB1B 2CKBL 3X3GL 2E9BA 2YUXA 4R0LC 2PW2B 3IDNB 3PHSA 5D6DC 3UEZA 2XQBH 1LEKA 3INUH 1LO5B 5L6YH 2XN9D 3FQRB 4M4PA 2DQIL 3JWOH 1VACB 2ORBL 3FT3A 2X4SA 4B7LA 4ZUTB 2P8LB 32C2B 1ORQA 4DAGL 4ODWB 4EN3A 1NBZA 1WZMA 3SE4A 1UYWL 1MJUL 4XBEL 4Z18A 1R3JB 1YY9C 3S5LA 3G6JF 4JN1H 4Y16B 1WIOA 5KS9B 4KDTA 5HHXL 1HEZB 4ISVB 2VDKH 1IGJB 4OBRA 15C8L 5AWNL 2NTSP 2HP4A 2AJZB 4NSKB 1VPOH 3FOMB 1FORL 3ULUH 4FQLL 3EGSB 3CVHA 1KENL 1WUNT 5BV7C 4K7FB 1IBGL 5K59F 3EHBC 1IAKA 3BZFA 2C3GA 3HNTL 1XGRA 3O45B 2QHRL 2EYRB 3L3KB 4R4BB 1YMHB 2QSTA 3HAEG 3BP4B 2ED8A 4HS6A 3OKEA 2PUQT 2WUCL 2WBJB 5GS0L 3BP5A 4HGWB 4HUVA 2UYLB 4PJ5A 5LXGL 1GH7A 4ODSL 3IJYB 2UZIH 1R24A 5DJDA 4OI8A 4PFEA 1KEMH 2R0ZH 2GK2A 4YDVB 4HWNA 5JOPD 1KCKA 3KDMA 3DBXB 1T04B 1LK2A 3GSQB 4LDEB 4I4WA 3GSUB 4OAWA 4F7TA 4S1SL 5AD0B 2QKIB 1OVZA 1KLGA 3MMEB 1I8KB 4UTAH 1J05A 2XZAL 6FABH 1EXUB 3FN9A 5GSVA 3HAEH 3L5IA 3SGDH 2QEJA 3HPJA 1RZJC 4OF6A 3VJ6B 2C4FT 3AREA 4PRDA 1B2WL 3G5ZB 5IW1B 4HS8L 1QFOA 3OBAA 4QHNA 4RMSA 2R8SL 1HILA 5JNYA 5HYIA 2NX5A 2V7NA 3QXAB 4M1CD 5I8CB 1NCWH 5I8OH 4J2XA 3L1OL 3N9GH 2GTWA 2JJTA 5CWSA 5DJZB 3VFRB 4KTEH 2QQLL 1BMGA 4Y5VA 1NGPH 2X89D 3NCEB 4QLRA 2D31B 2BVUA 3C2AL 4HWZB 1VSCA 3DRQB 5SWSE 5CZXC 3QRFM 2VR9A 4I48A 3UDWC 5H37G 2PW1B 1CFQA 4XH2B 3AVEA 2HG5A 2J4WL 3QUYB 1AGDA 4LLWA 5D6CB 3CFCH 3B2UC 3H9SB 1HCFX 2V2XA 4RMTA 5I73B 4FZEL 1F45A 1I7RA 3UPRB 3DUSA 1T21B 4HIEA 4JZJA 1JN6B 5DRNB 1FVDA 5CP7A 5D7JB 5IR1B 4BH7A 2GAZB 3C2SA 2BSTB 1OTTC 2WSKA 4P3DA 4MCZA 3TPUB 4JHZA 4ZAKC 4PJXE 4QTIL 2FX9H 1CYGA 4P5KA 2CH8A 1S7XB 5DS8A 3MROA 2CIIB 1NFIA 5D7KE 2I9LB 1LDSA 4P99A 2CDEB 4M1DL 1JHLH 5E2UL 3SDCD 1EH9A 2VLME 5FYKL 5T3ZH 3TVMD 3ULVF 5HI3D 1WFNA 3FT4A 4LHUB 3FO0H 3H2WA 2P46B 4GW5B 1MRFL 5C0BE 4XAWH 1NGYB 5DRWB 1NBYA 5ICXA 4P2OA 4JFQB 3UJJH 2NW2A 4LK4A 1X4XA 3ZT7A 4R4NC 5E00A 2Z91A 1D6EB 4L3EE 5CD5D 2VDQL 2GK0A 4WWKC 3EYFB 4RNRB 4K3DH 2H2SC 2JB5L 2XACC 3RVUC 3R1GH 2UWEB 1NEZA 4JO3H 5EOCH 1ZOXA 2NNAA 3HLAB 4JANB 5C0AA 1RZGA 1KB9K 5C09B 3O8XA 3N85H 5MP6L 2YSSB 2CKBH 4WNQA 1NCUA 3P3YA 3S4SA 1I3RA 5DC9B 1U92B 2P8PA 4Y5XB 2E6QA 4TVPD 4M4RA 5DD3H 2NXYB 3D0LA 3NCJH 3H0TB 1X7QA 3CX5J 2Q86A 3VFTB 2Z8VC 4XP6H 4Q0XH 3PV6A 3L9RA 2FWOB 3WIHA 3FN0H 4A2LA 5MERA 4NCDA 4NQDE 2FO4A 4LLMA 1NAMA 2IFGA 5FOJA 1UYWH 1WZLA 1MJUH 4XBEH 5CS7A 2Y9RT 4MAYD 2PYFA 2NY3D 1SMOA 4G8FB 5DYOA 5DURB 5DMJB 4UDTB 5BVPL 1BAFH 15C8H 4HWEH 3DSNA 4R3SB 2VSDA 4N8CH 4TNWF 4DKEH 2QSVA 4PGBA 4KDWA 5F9JA 5FGCB 3HUJB 1CGTA 2W65A 3U30B 2APBA 4WO4C 3H42L 4ZDHB 5FOBB 1KPRA 5IB5A 2QHRH 5I30L 1EJOL 4MD4A 2DLFL 1AGEB 3LS4L 1G9MC 3A6BL 5I1HL 4FNLL 4I5BA 5EO9B 3MRJB 2NY7H 1KT2A 1XAUA 2XKNA 3HNSH 3QUZC 3W9EB 3EDDA 2X4PB 1ACZA 3UTPD 3MRHA 4NZTH 3CAFA 3TNMA 3MRGB 5FGBA 1KTLA 1KCUH 4AG4L 2HKHL 1VEMA 3C6LD 4H88L 2HFGL 2HN7B 1W0VB 1WWCA 4LCCB 5GISL 4XRCA 1OAUH 4XWOD 4WIQA 3K2UL 5ICYA 4NUJA 3OJVC 5E1AB 3GFUA 1IQDA 5DEGB 2BVPA 1B0GA 4OCXL 5HVHB 1T0NA 1VFBA 2Z93A 5IVZB 1R3IH 4HS8H 1ADQA 4ZYKB 1J0YA 4XCYA 2FJHB 3QG6A 4TYUA 5C2UB 5IM7B 1K9TA 5DSCB 2VYRE 1FBIH 4GLRH 1QBML 1F3DH 2BNQD 1A9BA 3GJFH 3ALWA 4I2XB 4OQTL 5T1DL 4U7SA 1ZTXL 3QXWA 4YDJA 1IFHL 1I8IA 5FA3A 3JTSB 3OKOA 1V8HA 3CU1A 4ZFZA 2XWBA 4YZFE 2BP3A 5IBUB 5GGQH 3C2AH 4LKCA 2F15A 4JO2L 2R23B 3UTOA 2B5IB 3GI9H 2FGWL 5JLZB 4JG0L 4JPIB 1I9RH 2C3VB 3IKCA 3CD4A 5I9QB 3HNVH 1QLEL 3KS0H 4PJAB 4PJ9B 1U2HA 1NDMA 1S78D 2DL9A 3NAAL 2AEQH 1OGAB 4JFEB 3RA7L 4S1RL 4YC2B 2X4QB 1MHPH 3LB6C 3OR6B 4I1NB 1Q9WA 5ISZB 1SY6A 4HEPG 5L0QC 1LE9B 1XF1A 3ME0A 1CZ8L 1VADA 5L2KA 4XXCA 3PDOB 4X9BA 1AC0A 3K3QA 3V6ZB 1JWSB 2ZOKA 4MNQD 5J11B 5LWYL 4M1DH 1RAMA 2EDTA 3QNYB 3BIKB 5L8KB 4M48H 4JFFB 1LD9A 5EBGA 1AKJD 3BEWA 4KV5E 5HHOD 1YUHB 5IG7B 2ERJC 3DIFA 5ALBH 4DN3H 5TH2A 3B9KA 3G6AA 1ZT7A 1HIML 4OB5L 2BSRB 4JVWA 1KBGL 3MJGX 3MLTA 5ID0A 1NC4D 1WISA 3VH8A 3CVIH 4G42A 1IGTB 3DECA 1HXMA 4UU9A 3DURB 1KPUA 3J7HA 4F33A 3PWUA 3ECBB 5J6GB 1LEGA 3DXAB 1HYRC 3BP6A 4WUUA 4L4TA 1RU9H 3GJFK 5IB4A 1CD0A 5DUPH 3HRPA 4R97C 5C9KA 4GW1A 2ZCLL 2YN3A 3KPNB 3W9DB 4U3CA 4NFDA 4CMMB 2NZ9C 1QKZL 1C16B 3PGDA 5BVJB 5L88H 4ZG1A 2AW2A 4B7IA 4NC2B 1P4LA 1U8LA 3MLWL 3RQ3A 3JWNC 1B0WA 3WKMH 2K3TA 5FK9A 2FBOJ 1MLBA 1RZ8B 4OKVA 3TO2B 2MQCA 4X8JB 4G6JH 2CMRL 2FLRT 4BFBD 1JRHI 1HHGB 4XNYL 5JW4Q 4RDQG 2YEZA 4CU8A 4JCLA 3MCKA 3LH2H 1E28B 1FV1B 3EHBD 2I26N 3KPMB 1EZVY 1EEZA 2JJUA 4Z76B 1IAIH 2DN7A 4W4OC 2BMKB 1DVFC 1Z9MA 1P7KA 3EYUH 3RWHB 1EJOH 2DLFH 3LPFA 3FQNA 3P4MB 4ZQKB 4OIAA 5FYLD 1DBBH 4I18C 1D9KA 2AXJA 4LLUB 1I7TB 4OIIL 3TIEB 2GJJA 2PCPA 5DWUH 1OAYL 5E4EB 1BHGA 4Q74A 1BBDL 5D8JL 1F6AA 2DQCH 2DLHA 4LOUC 3LEXB 5EZIL 3KGRA 4PJCB 2A6IB 4MXVF 2YPVL 1T1YB 5EIQA 5C0AE 2C1OA 2DTSA 1BVKA 2HAZA 4Z7VA 1SM3L 4EDXB 1IEHA 3G5YB 1TMCB 3MRRB 4WV1C 4CDGC 4MMXC 4BSWB 4OCXH 4J3UA 5TE6H 5GGUB 3VRIB 3FB5B 4PRBA 2XXCB 3L3JA 5CEZE 5KSBF 5DHVA 1I4FB 1MCSA 2OXHA 4MJ5A 5HHNB 4YAQA 3IXAB 1UFUA 5BJTB 2GHWB 1T83A 1WAAA 1DUZA 1QRKA 1CVRA 2DM4A 1T22A 3EFFA 4QTHA 4WI9A 4OV5B 4EI6A 4BQBA 4IRSC 5TDOB 5CGYC 4Q2ZB 4MJ4A 2ATPA 2UZXB 3GMQA 3NN8A 3GUTA 1G0YR 2DOCA 5D5MB 5F9WB 4JG1H 4Z0BH 2Z8SA 2KQMA 1QR4A 2YXFA 3HB3C 1IGYB 3QIUC 4PLJC 4TSCH 1YEDB 4WRLA 3HAEB 1U8IA 4R8WL 4PY8I 5F97E 4Y89A 1LHZA 5KZCB 4QXUL 1JPTH 2YZ8A 4JO2H 5CZXD 2WP3T 1FNSL 1SHMA 4PV8B 2FGWH 1KXVC 5HYQA 2DQDH 4PJGB 1CDGA 3U0WL 3KPSB 4FXGB 1IC4L 5KVGH 4F15B 5I8EB 4JHAH 4OV6F 4TTGA 3CVHL 2PTTA 4GKNB 4NO3B 1UB6B 4MJ2A 3MGOA 3VXSD 3IS0X 2R2EA 2FGZA 3T0VA 1CTNA 3QBTB 3TA3A 4YBLB 3V5DB 4PJIB 3N1MC 1OTTD 1LNUB 3K4AA 4WU7B 3V7MA 3PWPD 4D94A 1DEEA 3BRFA 1A6VH 4MS8C 2ED9A 1RJLA 5EIVA 1JL8A 5HGBB 5JPMA 1RIVH 1ZKAA 4NM4H 2A77H 4ORZC 1JNHA 4FQIL 2OR9L 5EUKA 3MBEB 2NY2B 3LD8C 2FDBP 5E03A 4LHQB 1JNNH 3QDJE 3X11B 3EYVA 1HQRB 4KKNA 2AI0H 2IG2H 2XYCA 5IBTH 2AKRA 3L3GA 3SQOL 4LLVA 1T20A 3T2NL 3EOAB 4GXUM 4R4ND 4OB5H 4X6BA 2W38A 2VLLA 4HC1L 1MI5D 2EH8L 2QTEA 5I71C 3MV8D 1UH4A 3CUPB 4EKXA 1T66C 3RX5A 3GIZH 3UTTD 1AY1L 4LEXL 1Q9KA 5FUCE 4YWGL 4D9QE 1ZXQA 1M7DA 2JIXB 5TDNA 3BUTA 1OSPH 1CDHA 2G60L 4J8RA 3GSRA 2VL4A 3ESUF 1D7FA 1XR9B 1EEYB 4M1GH 4HLJA 5GHWH 4JQIL 4OZHE 1U3HC 5IT2L 1JYXA 1H3VA 5EH1A 2YPLB 5T1LB 3EKCA 3VXRD 2QSCH 1MCWM 1CT8A 3FQXA 5GXBB 4LPYA 1QKZH 3EO0A 1FPTH 4PB0H 4BZ2H 3DGCR 1QSFA 1W0YT 4NRZB 2MFNA 3MLWH 3ARBD 5DD5L 3VFWA 3OKMA 5FCUL 3P9LB 1XFPA 4JDZA 2ATKA 4M93B 2N7BA 5I1KL 1IGFL 3LMJL 2O5ZH 2AK1H 1FFOA 4HQQL 3VXUD 1VKXA 4PTUB 5DJYB 2X70B 5F6IC 4WO4D 2J88H 1I1AB 5FB8B 3CK0L 3AB0C 3PP3K 4NQVA 5BOPA 1W72H 25C8H 3D6GA 1JHTB 4KZEL 4JFZH 2OTUA 4PREA 2G9HA 5LBSL 3IB4A 3DLQR 2VLRD 4ZNEA 3LRSA 5FGRA 4KROB 5BZDA 4LFHG 4IIQC 3OJDB 4M5YL 5ADPL 5EZIH 4HDIB 3UX9B 4UOW1 2YPVH 1HI6A 1ZV5A 2EDLA 2WNGA 2Z31C 3HCVB 3JBG7 1G7JA 3C09C 3LN5B 1L0QA 5C0GB 5J57B 4Z7OF 3TN0C 1EHXA 3SPVB 5D2LF 4RISL 4OT1H 1WFOA 5FDWB 2ICES 4MA8L 4OLWL 5BW7A 5TQ2H 1YEEL 1IL1B 5INDB 3BPNC 2A83B 4BUHA 2AERT 4OZGA 1JJUA 2FBJL 3C60C 4ZFFA 5E8DL 1MCHA 1YY8A 3TBTA 3BKYL 3X14B 1A21A 4GS7B 4XGZB 4R26H 4UV7L 1NAML 5E70A 4U1SA 3S35X 4RRPA 1CU4L 1IM9A 3RUGE 4AIOA 5KS9F 3WIIL 3VGAB 3BPLC 1BOGB 3I9GH 1ZLSL 2DQFB 1MAML 4YXKH 3OSKA 2XZCL 4LLDB 1BP3B 3D85D 1BD2D 1N5AA 5TDPB 2DI7A 1WSST 1H5BA 3U0WH 2EEAA 5T5NF 1LQSR 4PJ7B 2GJZB 3UBXI 2VXSH 1VESA 3WFDH 4JPKH 3CVHH 1ZGLP 3BEVB 5F7EH 4ZO8A 1HQ4B 4I77L 4NGHH 3CSBA 3UO1H 3HC3H 3PP4L 1H8NA 1J1OH 3VD4A 1T80A 3VFOA 4QHMA 3T8XA 1LMKA 4M9OA 5T5FH 2W0PA 1T7YA 1ZGLB 5DD1H 1ES0B 3VCLA 2PR4H 5IEHA 1PEWA 3DPBA 4I0PB 1T2XA 3QHFL 1O5DT 2JKXA 2VDOL 2HRPL 5FM5O 3M1BA 3LHPH 3LEYH 4JQVA 1Q94B 3RVTC 1I8LC 1JGEA 3FB6A 4IRZH 4TOYL 3UMTA 4G8GE 4ZUVB 2AEWA 1H9VA 5B38A 4M7KH 1WAAE 2P1YA 1CFSA 1AFVL 4Z95L 5T3XD 3E3QE 3O4LD 4KGLA 1Q9OA 2OL3H 5FYJD 1MLCA 1OSZB 4HX1B 4X98B 3AU1B 2R39A 3VXQA 2EH8H 1YN7A 3DRTB 1CIUA 4C56A 1QSEE 4OZIE 4ZUWA 2YD7A 2ZCKL 5AUMB 2G60H 1RULL 1MIEL 4P3CH 1T5XB 1QYGL 4MQSB 2CRYA 2HJLA 5F1IB 4XAKE 3R0MA 3UPAA 5D7LB 1NPUA 2XA8H 4TUJA 4K94L 3L3OA 4IRJB 5IT2H 4YHLL 3VW3L 3O3AA 3VGGA 4PJ8B 3FTGA 1U42A 4LAQH 4GKZB 5C0JA 4NQSB 5HY9A 5I66A 4HIHA 3I85A 2IADA 4AT6B 2NZ9D 1NGXB 3X17A 4L9DA 2CPCA 4YDKL 3WO4C 4L8DA 2Q3AA 4QNPE 1MHEA 5DD5H 5B4MD 3QDMD 5D1XC 3V8OA 5DDHB 2W9DL 5FCUH 3IFLL 1XGYL 3GMRB 5GSRA 8CGTA 1QBLL 4PUBL 3ZKMC 3ULVC 5CJXA 4BSVB 2EDYA 1A7NL 1VFOA 2X89A 4HQQH 3NCYS 3T0EB 4JKPH 3HHRB 2NYYC 3MREB 4OBSA 2FD6H 3QO1B 2HJKA 3CK0H 2WIIB 4KKBC 2O5YH 4L8SC 5DQ9B 3TF7C 5HGDA 3HE6C 1CICB 5EORH 4FTVE 1AHWA 5DUBA 1G9ML 1QD0A 2W59A 4RGNC 5D1ZC 3O2DL 4PBVC 5IQ7H 3QNXB 2Z35B 3FB7B 3OL2A 1WTLA 1INDH 3KYMA 4HBQA 3QUKB 5J13C 2H3NA 3UJTL 4OFVA 3MV9D 1G7HB 3ZO0A 3H9SD 2ICEB 1A7OH 1ZHLB 4LAJH 4PG9A 1EAJA 3RBGA 1R3LA 1UVQB 4O02H 5H35A 4M6AA 4MB3A 4YBHA 1OT2A 2UVEA 4XPGL 4HUXA 2VKXA 1D5XB 3ZE2F 3BAEH 2HFFA 1WBYB 4UNVA 3AS2A 4M03A 3I02A 3SDCA 3TVMA 4NT6A 2F74A 2R9HC 2B8OT 4I3RH 4OLWH 4NZJA 1JZ5A 5E9DE 4JPVL 4L5FH 1Y0LB 1MIML 1NGZA 1J88A 4MXWL 5E8DH 5GRJH 4TTDC 3SDXE 3WIHH 3QZWB 3QRGL 4LBEB 4QXWA 2C3XA 1FYHB 3OGCA 3HB3D 3JV6B 4HKZA 5F89A 1CU4H 3JV4B 4PLJD 1K3ZA 4JLRB 4N0FA 3TZVC 1O0VA 1M1SA 4JZNA 1U91A 3G04A 3DV4A 3HUJF 4I13B 4R90H 4MNGA 1OW0C 3HPLA 3FL7A 4U1HA 4XNQB 5MHSD 4ORGA 5I6XC 4PJEE 1F6FB 4Z7QF 5FO8B 5J56B 3ZDZE 2V7HA 4YNYA 4MAYA 5C0RL 3S98A 2HWZL 5EBWA 2DKUA 3REWB 3U36B 1Q9LB 3JZ7A 4UUJA 3MJ9L 1NBVL 5AAMA 4XVTL 2IPKA 2DD8H 5FM5M 3T65A 3WUWB 4GUPA 1S7QB 2P5EE 1ZSDB 5GS2D 1TITA 4NRXA 3TFKD 2H6PA 1ETZB 1KIPA 1QHOA 4QXTB 5DMKB 2VDOH 4TPRL 5HHMB 4X6EA 1J0JA 1WK0A 5C0IA 3PHOB 1NCBL 3ARQA 1A9EB 5D2NE 2NY6B 2OM5A 3SQBA 3X3FL 2N1KA 3B9EA 2NY5L 1AFVH 4L4VE 4G6AD 5AZEH 3GSWB 1JGVL 3GSXB 1PDKA 4G8IA 4WI7A 3VWJD 4AENB 3PABB 4NZRL 2BNRB 1ADQH 4LP5A 3RWGA 3M17A 3GEWB 1T66D 2YA1A 3D9AL 4XMPH 4L8CB 4EOWH 2VDRH 3C6LA 1RULH 5DUML 5FECB 1MIEH 3B43A 2BJML 4WEBL 3QUXB 4NCC1 5E4IA 4HZLA 1YPZF 1VENA 4K94H 2J7LA 3LZFH 3VFMA 1J87A 4YHLH 1YEHH 1T5WA 4NN5B 1H15B 1U3HD 4FQQA 3MJ7B 5JO5B 2W1NA 4OD3H 3EIFA 4PGEA 3QO0A 1WWBX 4Y2DC 4HULB 2P8MB 3HS0B 4KJWD 5MEND 3HFMH 2MMXA 2MCPL 1TCRB 2NW3B 1UXWB 4P46B 5SWZA 1F8TH 2CR6A 2GITA 1BZ9A 5EBMA 2BNQA 3VU2A 5JIIA 2A6KB 1U8OB 3IFLH 3MUJA 2Y5EA 2ADIB 4JFPA 3E8UH 4XPTH 2ZNXA 4YDIH 2YBRA 4G6KL 5D72L 4AK1A 3QI9C 3VFVA 2FEEI 3M45A 4PRHD 4HJJL 4YHZL 3GO1L 1SY6H 4YFEA 1FO0A 4RWYL 3TNNB 4OCSH 5T1MA 4A6YA 4TQEL 3C8DA 3L5WA 4N0UB 5EO1A 4QRRB 4NNPH 4FQPA 4RAVB 2BVQA 5EU6E 3VXPB 1DQJA 1H3PL 4PBWD 1FGNL 1K6QL 4YEFA 2VAAA 3O3DB 4WJ5A 4J3VA 4ZTPH 3QDGB 5IF0A 3ALPA 1DN2A 4C56E 2FECI 4LCWB 3RDTC 3OX8A 4G7VH 1U8MB 4MX7B 3DVNA 3RY5A 1EUUA 1BIIB 3RWJA 3OHXA 2N56A 5F96H 2Z31D 5E24E 5F7WC 4N9GA 1W72B 2K1MA 3K7UA 1FLTX 2QQKL 2X10A 3BH8B 3HI5L 4MNQA 2B4CL 4HUMB 3OV6A 2KZWA 1A6TA 2GEEA 3MO1B 5JXEC 1SJEB 1HHKA 1FZOB 1AKJA 1VGKA 1JV5A 4RQQA 5HHOA 4MXWH 4PRIB 1OM3H 1A2YB 5IMKA 2Q8AL 3C60D 5C08D 1U0QA 4WY7L 2JK5B 1YMME 2F53B 1NC4A 4QRPD 2P5WB 4X0KA 4ODVH 3MRPB 1FYTA 1MJ8L 4PJDA 1HN1A 4KI5F 4KRPC 3KG5A 1MCPL 3P77A 5KSAC 4R0LA 4FFYH 5E6IC 5EPMA 3BSZL 1LEKB 4FFWC 5IVXA 2G5BA 3FT3B 2X4SB 3S96A 3ARFA 1CXIA 1ORQB 2A74B 2YA2A 1OAKL 4EN3B 5ANMA 5D96C 5E2VH 3QFJD 1EFQA 1PVHA 3R4DA 1XH3A 3QEQB 4PRPE 3UJIH 3S5LB 1NBVH 1MREL 4XVTH 3V5HB 4F7MB 1U6AL 3SO3B 3RVWD 1HHHB 5BMFL 1QFWM 3KPOB 4PJCF 4OM0L 3SGJA 5C0NC 4AEHL 5I15H 3GZKA 3U79A 1CGXA 4N0CC 3CVHB 3TIDA 1IAKB 2NXZB 3O6LL 3SEPA 1NCBH 3BZFB 4OLYH 1RVFL 4YPGA 5F9OL 3V6FA 1XGRB 1C12B 1F58H 5M7QA 3X3FH 1N4XL 3MJ8A 4AQOA 3QFDB 3H3PL 3WUZA 1IEAB 4HS6B 3OKEB 1GGTA 3DJ9A 2ZUXA 3CH1B 1JGVH 3SKJH 3SJVD 1KPVA 3BP5B 5DHVH 1A64A 4HUVB 4NKOB 4RMUA 4PJ5B 5E7BA 3UZVB 3T08A 2HH0L 2ARJQ 1LE5A 3TESA 1R24B 1IMHC 5DJDB 2DQTL 4GOSA 4N0YL 2BJMH 1AJ7L 3IDYB 4I4WB 4F7TB 1SBSH 5HTSA 1KLGB 4S1DD 1PLGH 4RBPH 4OF5A 1QRND 4TUKL 4V1DB 2FRGP 1J05B 1S7SB 5GSVB 3BVNA 4NKMA 5I1GL 2QR0B 3IFNL 2OL3B 4NNXB 2AGJH 2FJGB 12E8L 1LO4L 1BX2A 2F5AH 1BFVH 3AREB 4K7PY 1FVEB 4PJGF 4PJBA 3VFSA 3ZL4H 4QHNB 2MCPH 3IXTB 3THMH 2PNDA 5H8DA 3QIBC 5JNYB 2NX5B 2V7NB 5E2WH 5DC0A 5C07D 3RVVC 3ULVE 2NY4B 2FIKB 3GI8H 4ZOBA 1RZIA 5CWSB 3TV3H 4AYFA 4X6DE 1YEFH 2B2XL 4Y5VB 4G6KH 4NO5A 4OFYA 1OARH 3V52H 3QWOB 3JUYA 3QULB 4HJJH 4YHZH 1G9NC 2VO5A 4F9LA 2CDFA 5B39G 4RWYH 1I1FA 2NYYD 2BY3A 4NBZB 3NIDF 1CFQB 4KK9D 2XIDA 4X80H 4MQXC 1AGDB 2QLVB 3HE6D 5EOQL 2V2XB 3KPQB 4TULL 4G7YL 4PRAA 1Z0MA 1I7RB 1H3PH 4HIEB 4DVBB 4RGND 3GNMH 5D1ZD 2VXUL 4KWUA 5HDBF 2DB8A 3VXSA 4CU7A 1L7TL 2VXQL 1N6QL 1D3CA 4RZCB 5CP7B 4BH7B 4ZS7L 4MNHB 1CE6A 3KPSD 1ZHKB 3STBA 2FIRT 3SCMC 4P3DB 4MCZB 5DQDL 3D2UB 2JTDA 3PWPA 4P5KB 4U3HA 4WFGD 1GC1L 3FO1B 5I75B 5DS8B 3MROB 1NFIB 2W9EH 3HZYB 3TLRA 1LEIA 5HGHB 3DETC 5E6YA 3WDIA 2R9HD 1I3GH 2R4SL 4JAMA 4U0QB 1I8MA 1BFOA 2J6EL 5LGHH 1TVHA 1QA9A 1NBYB 2HFEA 4ONFL 5ICXB 4P2OB 1WF5A 2NW2B 2PYEB 1UXSA 2Q8AH 3B6SA 5DJ8A 4UT9L 1A7QH 1FN4A 5E00B 4RBPK 2Z91B 1OD9A 2H8PA 5SWZE 4HCRL 3VXNA 2XWTA 1Z5LA 3MGAA 2ADJA 4JDVA 5IMOA 1MI5A 1NEZB 2J8OA 3MV8A 1BVZA 3SN6N 3UTTA 3GBLA 1RZGB 2ZSWA 3MLUL 5I1AB 1MRCL 4GG6A 1MCPH 1MFCH 3ARDC 3K81A 4KAQH 3S4SB 3BWAA 3MV7B 1LP9F 4HF5L 2P8PB 5CKAA 4P2RA 4GAGL 1CBVH 5TFSL 3D0LB 3FFCD 5FUOH 1CIDA 1X7QB 3PL6C 1JRHL 5GS3A 4LEOA 1V05A 3MA7B 3PV6B 5T3ZD 3VXRA 3L9RB 4K7PH 5MERB 2OI9C 3QQ4A 1I7ZA 2FO4B 1OAKH 2DWDA 4GH7B 3EAKA 4HLZH 1P6AB 4NDMB 2PYFB 3LV3A 1FZMB 1KCRL 4QO1A 2YPLD 1DBML 4NHUB 5EO0A 1U6AH 4WW2F 3TBSB 4BYHA 5A16B 3ARBA 4O2CA 3IKKA 1I9JH 2DI8A 4OM0H 1A6ZA 2BY1A 2E7BA 3GK8L 1P2CB 4IM8A 1FFRA 4DFIA 2G75B 4UBDC 4K8RD 1EBAA 1X6NA 5F9JB 2W65B 2W92A 4S10A 4XTRC 3VXUA 5C8JA 2X44D 4WO4A 2FH6A 1R6VA 4G6FD 1TVBA 4MD4B 4LRNL 3AROA 4EUPB 3RWIB 1G7MB 3P0YH 5FEBA 1AE6H 4LARH 1BQLH 2ZG1A 4I5BB 1CQYA 4DTGH 2ZOLA 5HHOE 3WFCH 1KT2B 2XKNB 4P2QD 4XX1E 1OTSC 1TZGL 5E8OA 4UQ3A 1YQVL 5J4MA 5MEPA 3MRHB 3V79C 4JREC 2OX5A 4PY7A 2F54E 2DQTH 1KTLB 3NIGE 4LMQI 1QR1A 4Y4KC 1TNMA 1ZA3A 2DLEA 4DUVA 1FYTE 4PJDE 1AJ7H 1G1YA 1RUML 3KAAA 4XRCB 4LLYB 3DO3A 1XZ0B 3MRKA 1ND0A 3IVKA 1NDGA 2D3VA 5ICYB 4NUJB 2A2QT 4WUKL 1EA9C 5C86A 5HVWA 3O0RH 4JM2A 5LGKA 3IFNH 1B0GB 2HVKA 5AZ2H 4WI8A 12E8H 1LO4H 5DQJA 1G6RL 1TDQA 3GSOA 2WBJC 1T0NB 1VFBB 2Z93B 4Y2DD 1AXTL 1UM5L 3A6OA 5KAQG 4H20L 5J6HB 2VQUA 4XCYB 1C5CH 4NQEB 4TVPL 4B0MM 3QG6B 4GKSB 2J2ZA 2ZWLT 5JQHC 4LU5H 5HYSG 2B1AH 5B38G 2ZUVA 4QOKD 4YDJB 1I8IB 5FA3B 4U1KA 3NH7H 2EYTA 3E0GA 3OKOB 4DVRL 1FSKC 1T3FB 4ACPA 5CGTA 4XVSH 4X6CA 1JPFA 3FQUA 1JF1A 3D85A 5IVOA 3U4EA 2KBGA 5DGRA 2FEDC 5F3BA 2VLJD 5DJXA 2WANA 3IKCB 5ENWB 3PE9A 4G7YH 3L3HB 5IB3A 4LSVL 3B9VA 1NDMB 4Z5RB 1OB1A 1TJIL 2C3HA 1HZHH 3TM6A 2VDML 4ZS7H 4ZPTA 3FRPG 4PB9L 1FQ9C 5EG6C 1T7ZA 3RDTD 2OS7A 3FQRA 1T03H 4N1HB 1NAKL 5L2KB 2WBWB 4K23L 5CP3H 2E9JA 3U4BH 4EBQL 2XKUA 5DJCB 32C2A 4TNVK 1GC1H 2Y5TA 2ZOKB 1NFDE 3QUYC 3IF1B 4MJID 3BT2H 4XVJL 1R3JA 3HR5A 5FO9A 3JWDL 1IC7H 4G9FD 2R4SH 4Y16A 3F58L 3VG9C 2IAMC 1SJVA 5JZ7C 1SEQH 4NWTL 3BEWB 4ONFH 1S5IL 5DVMA 1MUJB 2APVA 1HXYA 3FOMA 1Z9OA 3DIFB 3B9KB 3O4LA 5JW4R 4LSQH 5HYJD 4BSJA 4OSUL 3QNZB 4LGSB 4XP5L 4XPAH 3MLTB 2DKMA 1IQWH 2VLKD 2EYRA 3L3KA 5IKCA 1YMHA 5ALCH 3BP4A 4LASL 3VH8B 1ZS8A 3SE8H 1MRCH 4G42B 4GRWH 3ZKQD 4WTZG 1HXMB 4UU9B 3MC0A 5KSAD 4YXHL 4O58L 2UYLA 3PWUB 4JFDE 1I7UA 2HFTA 1LEGB 4WUUB 3BP6B 5DFWH 4HK3J 4L4TB 3LDBB 3EOTL 5JQ6H 4ODBD 3GRWA 4GW1B 3ZYJA 3TCLA 1PG7X 1HHIA 1CXEA 4RSVA 1T04A 2IAND 1NQBA 1CXKA 3LY6A 3PGDB 4EXKA 4A6YL 1R3KA 5DA4A 2O61A 3MMEA 1TFHA 5KSBE 3G9VA 3Q1SH 4LPTA 1EXUA 1P4LB 3P73A 4YHYC 1PSKL 3TJEL 5FK9B 3VJ6A 1U8HA 5DXWA 1MQKL 1MLBB 1RZFL 4OKVB 2B1HH 3E6FA 1EHNA 3UTSE 1H3GA 5B3JF 3PF2A 3WN5B 5C0ND 3ZYZA 1OGTB 5IW1A 5EB9A 3SKNA 4EVNA 2EYSA 3QXAA 3TC9A 2RIKA 1EEZB 5TQ0L 1P7KB 1VA9A 2NCMA 4S11A 4EDWL 3FQNB 1Y6NR 1A5FL 3MZTA 5IK3A 4M7ZC 3ZKXB 1D9KB 2RR3A 1MCQA 3UTQB 3LKPA 1JWUA 2PCPB 3EO1B 4W81A 1TZGH 1GCFA 2PW1A 3GMPA 1F6AB 4RDQF 4QKXB 1MI5E 2WWKT 3MV9A 4HXBL 4Z78A 3H9SA 3IS1X 2A73B 1E4WL 1EHAA 2C1OB 5I1IH 3I6KB 1T21A 1BVKB 2YC1A 2R15A 4Z7VB 2OXGA 5DRNA 3NGBB 4JVPA 5I16A 4P2RE 1P69B 3U9PL 5IR1A 4LRIA 3U7YL 2GAZA 1LVEA 1CTOA 4PRBB 2X7LA 3LVEA 5DHVB 4YAQB 3MUHL 4JR9L 1Q1JH 1I9IL 4H20H 1T22B 1BGXH 1E4KC 4NJAH 2B20A 1YDPA 3BXNA 4OCYL 1S7XA 4TVPH 4EI6B 5KVMC 2WMPA 1IGIL 1AGFB 3QIBD 4KY1L 1OLZA 3RVVD 1MNUH 1T1ZB 2ATPB 2EDFA 3GUTB 3FB8A 2VZVA 3HE7B 1TZIA 1ONQA 4LHUA 4NQCD 2KZ1B 4GW5A 1NL0H 1U8IB 4D9LH 1BIHA 4JFQA 5EU5B 5CLWA 1CLOL 5DEFA 1R5IB 2DKSA 4HUWA 5EUOA 4NOBA 5CKGA 3LEVL 3EYFA 4MQXD 1RQ5A 1MFNA 2AS5M 2UWEA 4PS4L 1U2CA 3KPTA 2F8VA 2D4FA 2AK4E 1KJ2L 3H7LA 4JANA 4L4JA 3FCTA 2X4RB 4OI9A 1QG3A 3MGOB 5H2BA 2R2EB 4Z7UE 2EDRA 1WVZA 3MRDA 3P4OA 2HRLA 3KXFE 1EDQA 1PY4A 5FYLL 5F7YC 4JB9L 3CC5A 4P23D 2H1PL 4XPFL 1E4XI 4EBQH 2FWOA 1KJ3L 1DEEB 1MCDA 2OP4L 1RJLB 2F5BH 3MX0A 2EE9A 3C9NA 3PNWA 2BDNL 1DE4A 1JNHB 4G8FA 5EUKB 3UC0L 2ESVE 1XGPA 1TTGA 3T2PA 4PJ9C 3DETD 2XTJC 4F9PA 1DEDA 3EYVB 2H26B 4MA1B 5IROA 4JHWL 1S5IH 1OP9A 4Y4FC 3B5HA 2C4FU 1J5OL 2AKRB 5DC4B 4ZXBC 3QPXL 5BS0D 3BYYA 4GG8B 2HT2D 3VE0A 4X6BB 2V17L 3VWJA 2GIYA 1YNKL 2NY6D 5E8EB 5FOBA 4ZDHA 3UYRL 4XP1L 3CFDB 5CHNA 5IHUL 1QOKA 5EOTB 3VFGH 1AGEA 4L9LB 5TDNB 4AEFA 1F3RB 3BESR 3FQTB 2YMXL 4J8RB 3GSRB 3MRJA 3ARDD 1FJ1A 1XCQB 4YXHH 3W9EA 4JKWA 2E7HA 2X4PA 5C2BH 5FXCH 4LVEA 1G7PA 1U3HA 1X5LA 43C9A 4KMTL 2PETA 3GHEL 1J1XH 1TPXB 1OQOA 3AMKA 3CPLA 1NANH 5DO2C 4QWWC 1TENA 5DLML 2HN7A 3D3VE 1CT8B 1FO0H 3FQXB 4M6ML 1P84J 1HH6A 4Z7OE 1J8HD 3EO0B 3I6GA 3FZUC 4UB0H 3SBWA 5MENA 5E1AA 5D2LE 1GSMA 3RIAK 1WICA 2EE6A 1QSFB 2YD9A 4UILH 5DEGA 3TJEH 2XQYG 4HPOL 5ID1A 3VFWB 1DJSA 1UWEL 4GW4B 4BFIB 3UP1A 2P49B 3BGMB 4JDZB 1KXTB 4Z7NF 1KN2L 4XX1G 4UBDD 1PD6A 2EKJA 3DGGA 1FFOB 3NCBB 2FJHA 4PRHA 1VKXB 5IM7A 2Q6WA 5IJKC 3V0WH 1RZ7L 3O3BB 4EDWH 4NN6B 1JZ3A 5KS9E 1A5FH 4DQOL 1TJGL 1KTKE 5EU3B 2QSQA 4RWHA 3GM0A 2OTUB 4PREB 1KIRB 4OLUL 3S88L 1FIGH 3DTXA 3DWTA 1MFEH 4JGJA 4KKCC 4NBXB 2WUBL 1OTSD 1WC7A 4IIQA 2X1XR 4KI5C 4KDVA 4JPIA 4WGWB 1YEJH 2C3VA 1HI6B 5HVFB 3DSFL 4OTXL 1MCCA 4GBXC 4P5TC 4Y4KD 3KNBA 4GLRI 3BJLA 1UACL 1G7JB 2Z31A 3UCRA 2DQGL 5C0DB 3QPQC 3U7YH 3MNWB 2YHGA 3OAUL 3BN9C 2X4QA 4BZYA 3OR6A 4FQCH 3QWRA 2D0FA 2PN5A 4LLQB 1PG7L 4M5ZL 4R2GC 4NC1C 2VABA 3MNZA 3MTRA 1PZ5A 2J8UA 4ENEC 3E1F1 4OZGB 4YDLB 2OTPA 3FHAA 4ZFFB 1YY8B 3TBTB 3C60A 5C08A 4XMLH 4POZC 4OCRH 3RU8L 4ETQA 4R6UA 2NR6D 4CKVX 1S9YB 4JFFA 4QRPA 2EIZA 1E27A 4U49A 3WE6A 1MJJA 2N7AA 3L7EB 4XNXL 5IG7A 1YQ2A 4NFBA 1V7NH 5SX4H 3ZKNC 4N5EC 4RFOL 1FL3A 4YR6A 4HD9A 2FEDD 4N90E 2Q3ZA 4PS4H 3RTQC 1JPSH 4XMKH 3BQUC 2CUIA 2GUOA 2XN9B 2FHBA 3ZT6A 1D5BB 3C5ZC 4OJFH 5BV7H 1IGTA 1D6VL 1QFUL 1KLUA 3KHQA 2XICA 5LQBL 5E56A 4HPYL 1TJHL 2B7DT 3DURA 2Z8WC 4GMSL 3VFOB 3P30H 3QFJA 4QHMB 3T8XB 3ZE1F 3ECBA 3T3PF 4Y8DC 3DXAA 5CIPA 5I0ZA 4IJ3B 5FYLH 4FABH 1UADC 5ADOH 5KANI 1WQVT 3VCLB 1JZ2A 3F12A 1J10A 1NCAL 2OP4H 5IEHB 2ARWA 3KPNA 3BX7C 5BVJA 2VOTA 2XQYK 3M1BB 1KEGH 3QCVH 1KCVH 4FMKA 3FB6B 1JGEB 1WZ1L 4MAUL 3ARXA 4H8WL 4JHWH 2O5XH 4XB8A 2IAMD 3O6ML 4QHLA 4X8JA 4KJYB 5E2TL 4ZD3L 3QQNA 1DQLH 5ELIA 3MLYL 1M7XA 4KV5F 3ISWA 4P9ML 1Q9OB 5F7KC 1E28A 1PKQA 1MLCB 1FV1A 3SJVA 5BRZE 2I27N 3KPMA 1PY9A 1RZJH 4MMZC 3VXQB 3RGVC 2BMKA 3UYRH 4DUWA 1I1CA 5TE7L 4PPTA 4FXKA 4I9WD 1R5VB 4FMFA 4LLUA 4JRYE 3V95A 2HJLB 3I6LE 5EBLA 4LSUL 1QRNA 5LJYH 5FKPA 3O3AB 3PHQB 1G7QB 3RJDA 4KMTH 2FEEL 3FTGB 5J12B 4LF3A 1T1YA 5DZLA 4B53A 3R06B 5C09E 4Y5YC 5IW6A 4HIHB 1IAII 3MLRL 5FF6A 3ZE2E 2ZJSH 5J1AB 4GRWB 4V1DD 3MUZ1 4NUGH 4XNZB 4L8DB 4XCCL 5C07A 4OCMC 3WV0A 1MHEB 4AZ8A 1C5BL 4ZMAT 1I4FA 4OZ4B 5HHNA 2ZG2A 2GKIA 3IXAA 5BJTA 5IFAH 5F1SA 4KXZH 4ZSOE 4K3JL 3CFEA 3MODL 2V9QA 1KN2H 3SGEH 4Q6IA 3ALXA 2FECL 2BXZA 4XT1C 4Z7WA 3LS5L 3WKNA 1H3XA 2HJKB 3D5OF 5D5MA 1UJTA 4GRLC 2EDBA 3AS3A 2LFGA 4JHBA 5HGDB 3WBDA 1IE5A 2DQHH 1AHWB 1IGYA 2R4RH 3HE6A 5DUBB 3L5HA 4RMQA 1FLRH 5FGCE 3HUJE 5DFVD 3TYGL 4F7PA 4L3AA 2H3NB 4KRLB 3WNLA 2HYMA 3KPSA 4FXGA 1R3LB 3WL9B 1WGOA 2Y06H 3RY6C 5T3XL 5H35B 4JKMA 1UB6A 1NC2D 2DQGH 1RIUL 1I1AC 4G8EA 4HUXB 3LKNB 1MFDL 2PO6B 3OAUH 2VXVH 3V5DA 5MI0C 3I02B 4PJIA 5CLTA 3T2OA 3TVMB 2EDXA 4JPWH 1XGUA 2JF1A 2Z8RA 4WU7A 1JNLH 2P7TA 5KJRH 2EDJA 4WW2C 2DTML 1NGZB 3RFZC 2X1PA 3BKJH 5KOVC 3KYOB 2VH5L 5HPMA 1YYML 3OB0H 5C0BB 3RI5K 1ULVA 3OGCB 4O4YH 4HKZB 5F89B 1HQRA 2BERA 4HKXB 3VGHA 1BEYH 1W2KT 2YZ1A 2BK8A 4N0FB 1PBYA 3CX5K 4JFYB 1IM3A 3EOAA 3PDDA 4HFUH 1B0RA 3IDUA 4L3EB 4JZNB 5I1EL 1UWXH 4YUEH 1U91B 3G04B 4ALAL 2VITB 3V4PL 2JELL 3DV4B 2R2CA 4I2XE 4LNRA 3FFCA 4MNGB 2BCKB 5A2LH 1FHGA 1OW0A 1CFVL 4U1HB 4ORGB 1D6VH 5IMLA 1LGVA 1PJ9A 2ILLA 5FUZL 1HK6A 1TJHH 4L1DA 5D93C 3C8KA 1XR9A 2V7HB 1IVLA 3JVGC 4CADB 2NY3B 4NPYA 5E08L 4LMQE 4UUJB 2YPLA 1U9KA 2IPKB 3B3IA 4GUPB 5ESQA 4Q97A 4OGXL 2FHCA 4NRXB 4PJAE 4PJFA 2DQJL 1KIPB 1DFBH 3G08B 1OGAE 2QADC 4JFEE 3U7AA 3NZHH 3CSYA 2A0LD 4X6EB 1B6DA 2CK2A 4XNUL 3VXMB 5ISZE 3OJ2C 4H8WH 3L3IB 1XF2A 2XTJD 4YFLF 3MOAL 1SEBA 1P9MA 1SJXA 1K8IA 4Y4FD 3V2AR 1SYSA 3MLYH 1BFSA 4ZXBD 1U8KA 4P9MH 4X9IA 3Q3GB 3ELAT 4CL7A 4G8IB 5DJYA 2P42B 4FG6C 5GGVL 3HZKA 5TE7H 3C6SB 3M17B 4JFFE 5HHVH 4CDHA 2VDPL 3BDYH 3C6LB 4XZUA 1R3HA 1QEWB 4HZLB 1JNJA 3OJDA 1KULA 2HTLD 2CJUL 1T5WB 3E2HC 3U46B 4FQQB 3FFDA 3JV5A 4OZHF 4WENB 4PGEB 3QO0B 3MFGB 5DO2D 1MCBA 5CINL 3WFHB 4CAGA 3LN5A 1XIWC 3LRHA 3GSNA 7FABL 1B4RA 1UWXK 1RMFL 2E27L 4XWGH 5I76B 3DXAE 2GITB 1DQDH 2YD2A 1BZ9B 5EBMB 2BNQB 3NBNA 5GJSL 1EVUA 4Q6YA 1BQSA 5A43C 2YBRB 4PTTA 1IL1A 4S1QL 1D5ZA 3QAZB 4NWUL 1K8DA 4Y4HD 3WLWC 4Q9BA 2DBJA 2A83A 2R69H 3BGFB 1FO0B 4PJ8C 5FM4A 3X14A 1AD9B 5CD3A 4U2ZA 1MCLA 5IOPA 3L5WB 4RGMB 1A47A 2VLJA 5FM8A 1WBXA 4D0CA 3NTCL 2BVQB 2AJSL 4C83B 3P4LA 1BOGA 1DQJB 1MWAA 5DJ6A 4OGYL 2VDNH 1G84A 2PTVA 2OJZH 2VAAB 4ODTL 1ZEAL 4KKCD 3KLDA 3LKOA 4LLDA 3HI6L 3TYGH 4WJ5B 1U8QB 4OGZA 4OQ1A 4KI5D 1LO3L 2EDOA 4YH6A 3HG1E 4LQ1A 3DVNB 3H3BC 3RDTA 2OZ4A 3Q6FB 3MV01 4I0CC 4GBXD 4P5TD 4J3SA 4R4FL 3RWJB 3OHXB 4KZDL 1Z3GL 3C8HA 5T3XH 3BEVA 3ZSTA 2W60A 5FYJH 5C0CD 1DN0B 1RIUH 4UT7L 4O9HH 1NMAH 1MFDH 2Q20A 5ACLA 4CJ1A 3QPQD 4MNQB 1FH5L 1B6UA 1OWWA 5C0FA 3ULUE 1MCRA 3F6IA 1KC5H 4LVOB 1ZGLA 4PJCE 4R2GD 4G9FA 3RAJL 5HI4D 5FA4A 4U7KA 1OPGL 2WIMA 2D7TL 1AKJB 1VGKB 3CX2A 1CXHA 4RQQB 3IRZA 2DTMH 4FQXD 1IKNA 2ICWJ 5IMKB 1ITCA 4M7LH 2FCBA 3GRWH 4I8DA 4MB4A 4POZD 1ZMYA 5EZOL 5HYJA 1SJHA 4AL8H 1AD0A 4YHKH 4ESKA 1NC4B 2W07A 2VLKA 5LCVL 1EMTH 4X0KB 4G5ZH 4MDJA 3MLVL 3RWCA 1RV6X 1WIUA 2ZCHH 1QNZL 4X6FA 3P77B 2E9WA 5C9JA 4IOSD 4U0RC 1BLNB 4GMTH 4R0LB 4PJHA 4N5ED 4X98A 1E4JA 3AU1A 5KSAA 4YHNA 2A1WL 1ACYH 5EPMB 2VN7A 3DRTA 1QQDA 4KHTL 4X7SL 1CDJA 3HMWL 5IVXB 3RTQD 3ESVF 1CFVH 2AJUL 3BIBX 4WI6A 5GJTL 2G5BB 4J6RH 3S96B 3GBNL 5E8NA 1X5IA 3OKYA 1T5XA 1RK0B 5FUZH 5ANMB 1U58A 4JO1L 5CZVH 1JZ8A 1XH3B 1NBQA 1FG9C 4IRJA 5JHDD 5E08H 1HYSC 1H8SA 4PJGE 3Q5YA 4OGXH 3O4OC 3P11H 4K3EL 4JRXD 1BWWA 2W0FB 3KJ4C 4AT6A 3D1MC 1NGXA 1CDIA 1KOAA 5BV7B 1K5NA 4FN0A 4DEPC 3VI3F 4FQJL 4PJIE 2WQRA 4LHUG 5DDHA 3VWKC 2ZKHL 3MJ8B 2VC2L 5DRZA 3GMRA 4KMLB 1A3QA 2APFA 4DGYH 1N2RA 1WAAF 3NMEA 4W6XB 3O2VH 4WFEE 1KPVB 5IB1A 1P7HL 3MREA 1F4HA 3QO1A 3RGVD 1EO5A 5L9DL 1RJYB 4YXLH 1NLBL 4LVHC 4RGOH 2EXYC 1F4YH 4NQXB 1OP3H 5HDBE 4OZIF 3O6FC 3LAFA 4K71C 4P9HL 2IPTL 3QNXA 2Z35A 4KUZL 1PEZA 3PQYD 4E41D 2CJUH 3C08L 1S5HB 4WCYL 1G7HA 1BX2B 1FNLA 2ICEA 4NKDA 2V2TA 1G0XA 3OKDA 4PJBB 3B8SA 3SDDC 1JGUH 2C1PB 5JMOC 2AVGA 1KELL 4U6HA 4Y1AD 4EXPX 1D5XA 4F37F 4ZTOL 4MCYA 1RZIB 2HKFL 2YPLE 4PG2A 3H6JA 1MJ7H 3BI9X 1OF2A 4NO5B 4S1QH 3CDGA 4M6OH 1Y18A 4NN5C 4CVZA 4P3WA 1I1FB 3W11C 1F4WL 3ZTJH 5CJ5A 3MXWL 4ZUUB 3HE7D 5DMIH 3QZWA 4LBEA 2JB6B 5GS2H 4GRLD 3QHTC 3RX7A 2CLVA 2SEBA 2A6JB 2OR7A 3JV6A 5AEAA 1A6PA 3JV4A 1H0DA 5A3IC 2CK0L 3EZJB 4JLRA 1GOHA 1U8JA 3AM8C 4OGYH 5EA0H 4L3CB 3VXSB 3HI6H 1FGVH 5EZLA 2VZOA 1ZE3C 3P0VL 4QHUA 4HS3A 1CE6B 3ROOB 4OM1L 2OMBA 5L6YL 3V4UH 2GSGA 4NZUH 4KZDH 4P23A 1Z3GH 3JWOL 1OTUC 3PWPB 5F88A 1CD9B 2YD6A 5KTEH 2ITCA 5ECJE 4HHAA 1TZHB 2EEDA 1NH6A 3U36A 1Q9LA 4CVWA 1UB5A 3G5VB 5EZJB 4JAMB 4MA3B 1I8MB 1BFOB 1OPGH 2R29H 1RURH 1OP3K 2HFEB 3V6OA 4QXTA 2ADGA 5DMKA 5GZOC 2H41A 5F6HI 1UXSB 3ULUL 2MPAH 4POUB 3B6SB 2R0WH 5BS0A 5DJ8B 3TBWA 3RGHA 3QDJB 2XWTB 1JWMA 4PP1C 1Z5LB 3DVFA 1FNHA 4JDVB 1A9EA 3SDXF 1GGBH 4PLKC 5IMOB 5DTFA 3V5KA 5LCVH 2X1WL 3UTTB 2ZUYA 2YD5A 2ZSWB 5IBUG 3D39D 4GG6B 4YEEA 3W0WD 5GS0D 4G6ML 2EC9T 2DYPD 4D9RD 2RCSH 2XT1B 3GSWA 4OGAC 3U0PA 2A1WH 4OZFA 1F6LL 4KHTH 4N68A 1I3VA 2AJUH 2F19L 4LEOB 2UZIL 2R2BA 3VXRB 3GBNH 4YHPA 3QQ4B 2R0ZL 3WD5H 2DWDB 2ZUUA 5IB2B 2RB8A 1KIQB 5CEXA 1J8HA 2V5MA 3WEXB 3QQ3B 1K2DB 4HIJA 4KH2A 3F7QA 4RAUB 1CK0H 4UTAL 2NLJA 1N26A 1H15A 6FABL 3MJ7A 4YFLI 4PJ7E 3S37L 2BHUA 4O2CB 3AY4A 1F4XH 4YGVA 3NCFB 2DL2A 3WXWH 1A6ZB 2P8MA 1UJ3A 3HS0A 4H1LA 2QADD 1N5YH 5D1QD 3AS1A 1UXWA 1K4CB 3VXUB 4FQJH 5C8JB 4H0HB 1NCWL 5I8OL 1BREA 4TNVF 4WO4B 5J0BA 3O3EB 3N9GL 1TVBB 4GJTB 4KTEL 2ADIA 3PUCA 5CJOH 2VKWA 2AABH 4WFHE 3MV11 3SE4C 2Y07H 5IIEA 4KVNL 2ZOLB 1JBJA 2XRAH 1EGJA 2VLRB 3JV0A 1P4IL 3QUZB 4FG6D 2E7MA 4KGJA 4KDTC 3RKDD 5MEPB 4QGTA 5D71H 4PY7B 3TPKA 4N0UA 2PTUA 4QRRA 1DUYA 3CFCL 4RAVA 4Y4KA 3TJHC 2FX7L 2NXZC 4P9HH 2IPTH 4OCWH 4DGIL 3MRKB 3IVKB 4KUZH 1NDGB 3F65A 1INQA 5IW3A 2HVKB 1YEGH 4ZODA 3W82A 5DQJB 2WWKO 1U8PA 4UZGA 3TO4D 4BQ8A 5AG8A 5J1SC 3BH8A 2LVCA 3S34H 5D7LE 5JIHA 2NQCA 1RHHA 2EXWD 4KK5D 4ZTOH 5FYKD 2HKFH 5T3ZL 3MO1A 3IDYC 3FO0L 4U1KB 2EYTB 3KPRD 1UH2A 4H25B 1FZOA 4XAWL 1S3KH 1C7TA 1T6WA 2DRUA 2IMMA 5CIPH 3WFEH 1FDLL 3UJJL 1A2YA 5GGRA 1AO7D 5KAQF 4X6CB 3MRMB 1RJZB 1JPFB 3FQUB 5I74C 4MQ7A 1E4XL 3D85B 1BD2B 2GJ6D 2WV3A 4X9FA 5DJXB 2EDNA 4K3DL 2F53A 4EQ3A 2BHZA 3R1GL 3RUGB 1HE7A 1WV7T 3K4ZA 2WK2A 4J3XA 5EOCL 2CK0H 3MRPA 1J0ZA 4K8RL 2NY4C 3N85L 2JJTC 3T0EE 1G9EA 3P0VH 4ZPTB 4OM1H 5DD3L 2AQ2A 4Y5VC 3NCJL 5GGTA 5L0QB 1JHKL 2VZTA 4XP6L 4RMRA 5KVFH 4Q0XL 4OLVL 4UNTA 4UOW0 3FN0L 1CXFA 4Y19B 2A74A 3EZ8A 2VUOA 2Y5TB 4XI5C 3IAGC 3A0OA 3QEQA 3QXDB 4U6VH 1MELA 3KYKH 4ELMB 4QRSB 3VDAA 3HR5B 4P0DA 3V5HA 5FO9B 2MWCA 4F7MA 1CLZH 5B3JE 4JZJC 3NFPA 1QFHA 1HHHA 3KPOA 2IAMA 1BAFL 2E6PA 1CLCA 4HWEL 4N8CL 3QG7H 1HXYB 4F8TA 2MOVA 4DKEL 1IGMH 2CUMA 2CIKA 1P4BL 2E8ZA 4LKXB 2VUYA 2ERJB 3O4LB 4P57B 4P2YA 4H5SA 3EOBA 3IDMB 3KLSA 1A6UH 1HWGB 1VCAA 4GRWF 4EIZC 1A4KB 3U1SL 4KKLC 1CVSC 1C12A 5IKCB 3OJMB 4YIQA 3QFDA 3GSNL 1IEAA 1ZS8B 4P4KD 4G6MH 3HC0A 1NSNH 3CH1A 5GPRA 2NY7L 4HH9B 4LCUA 3HNSL 4NKOA 3IDGA 1I7UB 1QSEB 3QDHA 4NZTL 2F19H 3WJJC 2QHLA 4WU5B 1NUNB