5LGKA

Crystal structure of the human ige-fc bound to its b cell receptor dercd23
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
307
structure length
307
Chain Sequence
VKILQSSCDGGGHFPPTIQLCLVSGYTPGTIQITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig epsilon chain C region
publication title IgE binds asymmetrically to its B cell receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 307
sequence length 307
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lgkA03
3P4NA 4X7CC 3QG7H 1I8LC 5A3ID 1XF5B 3DVNA 3PWUB 2LVEA 4X4XA 3DX6B 2BC4A 4X6DB 3MJ8B 4KROD 1MY5A 3BZDA 3O8XD 4KK8C 4S0SD 1LEKB 5BS0A 4KZEL 2BRQA 3KPRE 5SWZA 4RGOH 4HPYL 5DTFA 4FFWD 1A1OB 4N0CC 5DYOB 2DWEA 1KJMA 1ZANH 2FIKA 4M1CC 2CO7B 4M6OH 4Y5YB 3ORJA 1PYWA 4G80B 3E6HA 3TT3L 1J1PL 4L5FL 15C8H 4LGSB 4ORGA 3E3QE 3EJJX 3C5JB 5BCAA 1ZEAL 3TCXA 1VEOA 4FQPA 2DBJA 3Q6GH 5I8KH 2EYTB 5JHDB 4KHTH 2L7JA 4PJIF 2VUOA 2EDDA 3G5ZB 1NCAL 3PNWB 3GBNL 2DLFL 5D1XA 3RWJA 3LSOB 1X5XA 1RHHA 3ZYOA 3ZE1F 3OAZK 4EJ1C 1CD1A 1FP5A 3DNKA 1H9VA 5C07B 2KKQA 4GXUN 4FP8H 3RWGA 3TJEH 3CXDL 1D5ZB 2GY7B 4RFEA 2AEIT 2OK0L 1DEEA 1EJOH 2DIAA 4IRSA 5E0QA 4E5XA 4UI2A 1JNHA 2LAAA 4A2MA 4HK3J 5SWQA 5T1MB 2ED8A 2YN5A 1WZLA 3GHBH 3BD5A 4HV8A 4H26B 4RCAA 5K9JL 2P5EA 1JTTA 1Q9WB 4G8IB 3UTTD 1CR9L 3I84A 1UACH 4KVCH 1QYGH 5AYUH 1EH9A 3AM8C 4GXVL 4M7LL 4F37F 1EFQA 1UCTA 2ZG2A 4KQ4L 1N5AB 3SGJA 1KLGB 3VXSD 4RIRA 43C9A 5GHWL 3ETBF 2CDFB 3G6JF 5B8CB 5AZEH 5E2TL 5F89B 3QEQB 5BV7B 1OGAA 3ILQD 4GQPH 2A83A 3O3BA 1HHHB 4LQFH 5CSZB 4PJGB 3CDFA 1LEIB 5ABDE 5MP6L 1FZOB 3S35L 3NIDE 5TDPB 5JQHC 5JIKA 5GS1C 2FSEB 2HRLA 2DQCH 5HPMB 4I3SL 4U31A 1OARL 3I9GL 2FL5B 1YEGL 3BWAA 4OLZL 1CCZA 2EKSB 3IFPA 3QIWC 3GJFH 4X80H 4ODWB 1AR2A 1L4IA 4R8WH 3C6LC 4JB9L 4HDIB 1H3UA 4PG2A 2F74B 5BO1L 3U6RA 4IIQA 2QSCH 2FX7H 4I0PC 2X1WL 4P5KA 3DUUA 4U7KA 4OZGB 2AW2A 4OV6F 4QRPD 1I75A 2VDQL 1CK0H 3THMH 4OZIE 2GEEA 4MA8H 5JHLH 4MMXC 1MQKH 4LGPB 4X6EB 5E5MB 4BK4A 4KK9D 4XP6L 4EUPA 2HJLA 4C56A 1D9KD 2PW1B 2E3VA 1FNAA 2C3WA 1S9YB 3HI6H 3FJTA 5EN2A 2CUIA 4WEUD 3LKNA 3RZCC 5F7EL 1ITCA 1T04A 4YDIL 2AGJL 4UQ3B 3B6SB 1JZ3A 4X6DE 3DJ9A 5DWUH 2YK1L 5FHAL 4ODTL 3AS2A 2B20A 1G7JB 4LSVH 5FM5O 5GIRA 2VXQH 3QPXL 2J8HA 5B3JE 1SEQL 2NW3A 3QG7L 3AU1A 4HH9A 3K46A 5D4QA 5GGSY 1S7TA 5ICXA 4W4OC 1B0WA 1KEMH 3MREB 3UTOA 2UVFA 1IKNC 1Z0MA 3ARVA 4YHKH 1W8OA 4HKJB 5L8KB 1JPFA 5JHDE 3U2SA 1DLHB 2A74B 5IMKA 4G43B 4RGOL 4N1HB 3VD3A 2Z93A 4IEFB 3GSNH 5MI0C 4YO0B 1ZANL 4OGAC 3RHWF 1SJHA 4M6OL 3NCBB 4WNQA 4Z8FH 1A7NH 5E8EA 2P46B 5C0CD 3Q6GL 1T66C 5I8KL 3MXVH 2MFNA 4KHTL 5DXWA 2H1PH 5K9KA 3N1PC 5GGRB 1HSBA 4P9MH 5DRNA 5TH2A 5F7MC 3WO4B 5BMFH 1YEDA 3DARA 3TN0C 5GGUA 3S5LB 5FYJD 4X4ME 1NFDB 4FP8L 1I3RA 5D2NE 1I1AB 5MEPB 2I9TB 3DO3A 1DL7H 4MMZC 1EJOL 1H15A 5KW9H 1IGYB 3GDBA 4XBGB 3PUCA 1ES0A 3V6FA 4OCMC 1FV1B 3GIZH 1C16A 4L4VA 2CLRA 1NGPH 5IR1B 2RIKA 3GHBL 2BSED 2OR9H 2I07A 1I9JH 1Z5LB 2IMMA 1UACL 4KVCL 3QEQE 3W5NA 1QYGL 4KZDH 5AYUL 1N6UA 1OP5H 3F7VA 1CGTA 3HC4H 1HHJB 4PJGE 3D85D 2J4WH 1QNZH 1SMAA 5DEGB 3C8HA 1LILA 1S9WA 2OYPA 2NXZC 1UG9A 3PGCB 1P7KA 1QACA 5AZEL 2AXHA 3L95A 3TVMB 2FO4A 3NFSH 3VJ6B 2F53A 2WM0A 1XR8A 4NQEA 1DEDA 4LQFL 5D7LB 1OW0C 2ITCA 2VQ1B 4ZDHA 3WHXA 4HXAH 1X4YA 4PV8B 3QIUA 4U1HB 1JPGA 4PJCA 3LDBB 4FQJH 3W9DB 2DQCL 3NBNA 1GCFA 4MQXC 5IMOB 3W11D 4HJGA 4OZGE 2BDNH 3E6FB 4ODUA 5ICZA 4X80L 2UY6A 3W0WD 3PWVA 4NYLB 1FNHA 1QZ1A 1JGEB 4R8WL 3RIFF 2I26N 2WWKT 1XCTB 2NLJB 1B4JH 4MWFB 3D2UA 4GW4B 2QSCL 5EA0H 3HE7B 1Z9OA 2FX7L 4PJFA 5FO8B 1WWCA 3HZKB 4QRRA 1X5HA 2XNAB 3JVGC 3Q0HA 2DM3A 3SGEH 4WW1B 3U0TB 4OAWB 5ANMB 4OF7A 4LNRA 1UZ6E 3QDGB 1CK0L 3H7LA 2DI7A 3THML 2ZNXA 5I1GH 4MA8L 5JHLL 3ROLA 4OLWH 3VA2C 4ZAKD 4Z77B 3W39A 1MQKL 1ZT7A 3MBXH 4I48A 2EYSA 3EDKA 5C0EB 3KAAA 3DROB 1U8PB 5EU4A 2CD0A 4WWID 3VXQA 5EU7C 3HI6L 4Z7VB 5TQ0H 2OXHA 4Y4KC 3FN0H 5IQ7H 1A7QH 1PKQA 5F3BA 2G9HB 2V2WA 1B2WH 1GC1C 4IRJD 1Q9KB 5DWUL 4MDIB 1B4RA 5C0JA 5A43C 4LSVL 2PW2A 1U6AH 5HI3C 4P23B 1U8HA 1G1YA 3BRGC 5I0DA 4YPGA 1HXYA 1OD9A 1LDSA 1CIUA 1AXSB 1Q8MA 3RP1A 3OZ9H 4GG8B 1KEML 5I1AA 2IANB 5KTEH 4F9LC 3SDXA 4HSQA 2H9GB 2P5WA 2X4UA 3H9SA 4YHKL 3GUTA 4PG9B 3MMEA 1H5BC 3HG1B 1YJDC 2BSSB 3F65A 3QXWA 4WFEE 2YA0A 4MD4B 3IRZA 4O2FB 3GSNL 4JFZH 4ODHH 4PJ7E 4C57C 1VCAA 3IDIA 2H2PC 1XZ0B 3O2WH 4Z8FL 2AS5M 1CQYA 3L7FA 4POZC 4Y4HC 1NFDE 7CGTA 3CSYA 5FAAA 4EBQH 2VJXA 3MXVL 43CAA 2H1PL 4KRLB 5JNYB 3I02B 2P8PA 2Q7YA 4P9ML 5IB4B 2JKXA 5I16A 3OKLB 4PJ5A 1ZLWK 5BMFL 5EU3B 4RFNB 1GC1H 2WBWB 4P99A 2C4XA 4P5TD 1EHXA 5C0DA 3C60A 2NYYC 2XKNA 4IBLT 4F7CA 3CSGA 4XH2B 4LVNB 2LAGB 3U48A 3HR5B 4LCCA 3H8NA 5IB3A 5D5MA 5KW9L 1A47A 3OB8A 2O5XH 4Q97A 1XAUA 1N64H 4JQXA 1RZ7H 1AGFB 2BOBB 5IB5A 1OVZA 3GIZL 4QHMB 4WDIB 4DKEL 5FXCH 3ARBA 1Z9SA 4XNUH 1NGPL 2GT9B 2OQJB 2VE6B 1R3LA 2OR9L 4XB7A 5B4MC 5TJWK 1I9JL 3JV4A 1NMCC 5F9JB 1VHPA 1EPFA 5DI8A 5ALBL 4HX1B 4C55A 1YJDH 4U1KB 3PL6C 2VZUA 4KZDL 1QKZH 4ZS7H 1ADQH 1KOAA 5ESAA 5D7LE 3HC4L 1DSFH 4KKBD 5LKNA 1EEYA 4QXWA 1G9MH 3K1KC 1ZS8B 4DN3H 4MB3A 3NFSL 3OKNA 3QXVA 2AP2A 2G75B 4NHUB 4PJ9B 1QQDB 4AM0B 4F7PB 5JA8B 2CXGA 4HXAL 3TFKC 3QEGH 1FSKC 4FQJL 4BZ2H 4NZDA 4WJ5B 3BO8A 3RVXD 2BDNL 2A6JA 5ANME 4P2QB 1MCCA 2PO6A 1YMMD 2C1OB 3QDGE 2C9AA 1H3PH 3FQUA 2YD1A 1MCOL 3KPTA 3SQOH 3L6FA 3VXNB 4RWHA 1VPOL 4FTVB 1B4JL 1UA6H 4RGNC 3MLXH 4U1LB 4FOMA 4NBYB 4ZUSB 3VGGA 4JJHA 4Z7VE 2BP3A 5EH1A 4X83A 2X44D 3TIEA 4HS6B 4BH8B 2N7AA 5I1GL 4P2OC 1D7FA 4OLWL 1J9CT 5MEQA 3DLQR 3AB0C 3S98A 4LPUA 5CBAB 3MBXL 2ICEB 4OFYD 4OIAA 3D1MC 3QDHA 4BQCA 2NY2D 4LCYA 2G5RA 4R0LA 2H2SC 1IBGH 3ARDD 5TQ0L 3SDAD 3FN0L 3ZKXC 1A7QL 5IQ7L 1B2WL 4XHJC 4U6VH 2VNCA 2IANE 5C6PB 1EERB 1KIRA 5B39A 4GAFB 3S4SG 2AI0H 1LK3H 4I4WB 3T0XA 1U3HB 1S8DA 1U6AL 3HG1E 2XN9A 3RTQD 5K93A 1YQVH 4HQQH 1YUHA 2VDRH 3I6KB 4KJWD 5D7KD 3WFBH 3D39B 4FQ2H 3OZ9L 5EOTA 1A7OH 3WIFB 2CR6A 5KTEL 4KK6C 3V6OC 3SY0B 4PV9B 4R7NA 1GJIA 2GQHA 1KJVA 1JF5A 1FGNH 3BH8A 1FL5A 4M9OA 4JFZL 4ODHL 1BIHA 4JZJA 4P2YA 4ZUVB 3MACH 3BJ91 3O2WL 2N7BA 5HGHB 5T1KA 3CFBB 3X3FH 1VEMA 3NIDF 4H0HB 5FCUH 1DQTA 1U8NB 2Y25A 1J8HD 2X7LA 4CJ1A 2GW5A 1BZ9B 4PRDB 3ZE0E 4HWUA 2J88H 4HD9A 3FQTB 3RVWC 3MLUL 1GC1L 1JF6A 5IFAH 4X7EC 3QUYB 3WLWC 4P3DB 3DRQB 4BKLB 3LKOB 2X4SB 1T1WA 1ERNA 5KSVB 1A6PA 2ZWLT 2O5XL 1FVEB 3N1GC 5GGTA 3OXSB 2AQ1A 2QSQA 1N64L 1RZ7L 1XFPA 4LSPH 1VFMA 1TVBB 4LU5H 1QRNE 5DD3H 1I3GH 1CICA 3VG9C 3WSQH 4ERSH 4XNUL 1JNNH 4NSKA 4U1IA 2MTPA 4JREB 3WN5B 1PBYA 1NANH 4RA0C 3VXRA 2GCYA 4H1LH 1OQOA 2QQKH 4PRHB 4LRIA 1YJDL 1EZVY 1FO0A 1GIGH 1QKZL 4ZS7L 1ADQL 1HI6A 1DSFL 3PQYB 3VE0A 3F8UB 5E8PB 3MGOB 4Q0XH 2C3GA 4DZ8A 1G9ML 4O51A 3GO1H 4RZCB 1DANT 5TQ2H 4DN3L 4Y16D 3QUKA 3W2DH 2X9XA 4P2QE 2PXYB 1HKLH 5B3JF 3D9AH 3T1WA 4F2MB 4G6FB 5J11B 2H32A 2MWCA 3QEGL 3LKSB 2YEZA 3U7WH 4FQXA 4FTVE 4J1UA 4BZ2L 3DUHA 2DMCA 1CFTB 5IEHA 1QFWM 3DBXA 4YGVB 5BS0D 4LOUD 5F3HB 5SWZD 1TETH 4G8FB 4DEPB 4IRZH 5IROC 1H3PL 3GRWA 4FQ1H 1K4DB 2JLLA 5LGJA 1I7TB 3LB6D 4HH8A 1ZV5A 5E94A 3SQOL 5C0BA 2J8UB 4KI5D 1M7DA 1UA6L 3BXNB 3G5VB 5JXAL 2XYCA 3MLXL 5C08D 1JNLH 4Y2DC 4H1LG 1TVHB 2QEJA 3I3DA 3O4LB 4OF6A 4LLYA 2ICCA 5D1XD 4S0TD 2BVPB 2H3NB 5EC1A 2DYPA 3SN6N 4OBSA 2Z92A 1TTGA 1GGBH 1GVIA 4X5XB 1CS6A 1KB9J 3SKOA 3GKZA 5KBNC 1MHPH 2MCG1 1ZLVK 1IBGL 4KROB 2EEDA 5KG9B 1XF1A 2RGSA 4IRSD 4P59H 4PJIA 2W0LA 3O8XB 1JE6A 1NGWB 1CG9A 2HT3D 1JHTB 4YIQB 1I3VA 3TH3T 1C12A 1NCBH 3SE9H 3D39E 1NGYB 4TUJB 2C1PB 4ZTPH 1W72A 4GMSH 4X9GA 5TGBB 2P5ED 1Y0LB 1LK3L 5EUOB 4XNZB 1YQVL 4HQQL 3ZSTA 2VDRL 1ORQA 4XCNB 1Z0NA 3UBXB 5FUCC 4AMKH 4ODXA 3WFBL 4FQ2L 3IDJB 1A9BA 1A7OL 2CLVA 4PJ8A 4PJGF 3BIKB 3JTTB 1DBMH 4QHKJ 1IZJA 2JIXD 5J6HB 4QHKI 2EDOA 2XA3A 3RVTC 1FGNL 1S7WA 1OGAD 4EVNB 4JFEA 4E41D 3GMRB 4D9QE 3MACL 1IGIH 4LLMB 4Z7UA 3RKDC 2IADA 4YHNB 4CVXA 3X3FL 3QQNA 5FM8A 5FCUL 4KXZI 3OB0H 3WIIL 4X5WA 5T33H 4UBDD 3WIHH 3CFEB 4MD0B 2JJWA 3NCYS 3HFMH 4UU9B 3X3GH 3O2VH 3ZDYF 5DR5H 4LVOB 4OZGF 3UP1A 4EQ2A 1QA9B 1QRKA 1JUFB 2J88L 4M62H 2R15A 4W81A 3UTTB 3DI2B 2AXGB 1CQKA 5IFAL 4P5MA 3DRTB 1BOGA 1P1ZB 4RMVA 5GS2D 3VXSB 2MKLC 4PRHE 4R2GD 3HAEA 3AUVA 2EYRA 3N0PB 2R1XB 4GQ9H 1AKJA 1CU4H 2GKIA 2MPAH 3WDIA 1NUGA 1W0VA 4LSPL 5E8NB 1YYMH 4LU5L 5DD3L 3WSQL 2DM2A 4ERSL 1JNNL 3B5HA 3P9LA 4UNTA 5C0FB 2QQKL 2HVJA 3KYNA 5FIEA 1GIGL 1G6RH 3G5YB 4P2RA 5IM7A 3S3PA 3FFDA 4Q0XL 1U42A 5FUOH 2XWJB 3JWDC 1IAMA 1JIBA 1E6OH 2AJSH 3GO1L 5TQ2L 1WWAX 5FCSH 2P24A 1FYHB 3D0VB 5DJXA 2BVOA 3W2DL 5KANG 5H94A 1A6AA 1EUUA 3EYVA 5INDA 4JHAH 5J0BA 1RK0B 2XOTA 2IQ9H 1MWAA 1HKLL 3D9AL 4YR6B 2OL3H 3ES6B 4ZOBA 4ZNEE 4PRNB 2J8UE 3U7WL 4QRPB 4NRZA 3MBED 5HDQH 1VESA 4GMTH 3UYOD 1G7PA 1W0WB 4NFBA 1INEH 1TETL 4K7FA 3O4LE 2HJFA 4IRZL 2IPUK 2FDBP 5I8EA 3ULVE 3RVVC 1D9KB 1ND0A 4FQ1L 5TE7H 3UPRB 4DK3A 4NO2B 4YFDB 1TCMA 2YN3A 3VGBA 1JNLL 5GSVB 4S2SB 3R0NA 3D3VA 2YXMA 3EFFB 3FRUA 1KG0B 2GJ6A 3V4VH 4P4KA 3VFMA 5D2LB 3N06B 3WCYA 5FKPA 4OUOA 1GGBL 3QULB 4HUWA 4ZYKB 1J05A 2YPVH 2VYRE 3K1DA 4PY8J 3VFSA 3JWDH 4PY8I 5EUOE 1MHPL 5KS9B 5D7JC 4JO1H 5KVMC 1GL4B 3PE9A 4P59L 2EDYA 5DJ6B 1UXSA 4XVTH 4NN5B 1NCBL 3SE9L 4QF1A 1KBGH 3RGVA 4ZTPL 2IH3A 4GMSL 1DQJB 1M05B 3C9NB 4HWBH 3KLSA 5MENA 3QZWG 4HJ0C 5BW7A 1OAQL 3QWOA 5DHVA 5EZLB 1GGUA 1L9NA 2H32H 3V7AG 4OM0H 1VB9A 2NY6C 5C0CB 4AMKL 4M1GH 3ZMRA 1MHCA 2JCCB 5FB8B 4MJ6B 3DMMA 3DVGB 1DBML 4Z7WA 3GRWH 2HFTA 2J8OA 3SE3A 1E4XI 1GZQA 1T21B 4L4TA 1FNGB 5ISZA 3VFVB 5DS8B 1QHPA 3DOSA 3RWIB 4QHNA 5DFWH 3T2OA 3UTTE 3QIUD 1SJEB 4TN9A 5A2FA 1IGIL 3QUMA 4N9GB 5KOVC 2YZ1A 1E28B 3B8SA 5IVXF 3AMLA 4R7DB 5T33L 1FJ1A 3WIHL 1QR1B 3HFML 4KTDL 3X3GL 5IT2H 3O2VL 5DR5L 1MLBA 1MCWM 4G8GD 1IQDB 4HIXH 1EFXA 4M62L 3K0WA 2EDXA 3D0LB 3GMLA 5BXFB 1BD2A 1IAII 4WEBH 4WGWB 3KLHD 4I8DA 1QSEA 3MRGB 1PDKA 1M1SA 1VSCA 2C4FT 2GI7A 2V6HA 5CGYC 3UJTH 5FYLH 3BX7C 2NY1C 1H3VA 4G8EA 4HUUA 4F8QA 5JDSB 3RY5A 3HRZA 1A6UH 2VWEE 3ULUD 2W0KA 2EIEA 2CUHA 2QADD 1YY8A 1QTYT 4GQ9L 5AEAA 4ENED 1CU4L 2MPAL 2W91A 1UADC 5CLTA 4M7ZC 3VD9A 4G6AD 1YYML 2VXUH 2P43B 3PABA 1RZ8B 5FOBA 1AI1H 3M1BB 4AIZA 5IMMA 5KVEH 3RWDA 1U95A 2BSRB 4LHUG 1H0DA 3RDTC 2R2EA 4YDKH 4RNRA 3M07A 5FYKH 1T22A 4QRPE 4QKXB 5FUOL 3W0WB 5E8OA 5I76A 5GRJH 3RBGA 4KDTC 1I85C 1A6WH 4PLKD 1E6OL 2AJSL 1S9XA 2D0GA 4E0RA 4TQEH 4WI9A 3U0WL 4JHAL 2IQ9L 1HKFA 3QA3A 3BH9B 2OL3L 3M17A 4DW2H 1U2HA 2HFFB 2E7BA 2V5YA 3C5ZD 2K7PA 3U4AA 1JL8A 5HDQL 2P5WD 5KVDL 3H9SD 4E42A 2BOCB 4GMTL 3WS3A 4CRPA 1U8QA 3MZGB 4ZAKB 2VAAB 1INEL 1BFVH 1VADA 5D1QA 1PEWA 3ALWA 2R0ZH 2M8XA 4G6KH 3WNNA 2A6KB 4XPHH 3MJGX 1PY4A 5D2LE 2OS7A 3QG6A 4RGMB 3QCVH 3HAEH 5ETUB 1PFCA 4HWZB 5D6CA 2P8LB 3B3IA 5GGTL 4PTTA 5EUKB 4IRJB 5KS9E 1SMOA 4WV1C 5BRZD 5LJYH 4ZOAA 2CGRH 2A6DB 4HGKC 4L8CB 3V4VL 4PJ5D 4NQXB 1A1MB 4EN3A 4KKLC 2F19H 3O9WA 3C60D 2YPVL 4MJIA 3DVFA 1MCIA 2YSSA 3JWDL 2WUBH 3GMPB 2ZUQB 3L3JA 5BVJA 1MAKA 1KTKE 4JO1L 3NIGF 4OKVA 5C0CE 4XVTL 4Z7OF 3BD4A 1YN6A 3TO4C 1KBGL 4XWGH 5E00A 5BQ7A 1U93B 1EIBA 4PP1C 4HWBL 2IJ0C 1BLNB 1XGPA 1XMWA 2AQ2A 4OCNC 5DK2B 3QEHA 1OP5K 4MNQA 4JO4L 3UZEA 5HY9B 2VABA 4GRLA 2ZP0T 4OM0L 5FYJE 1BWWA 4XX1G 5GRWA 4M1GL 5JTWA 5AAMA 1B0RB 5HYJD 1LO3H 1X9QA 3L5WA 4JQIH 3AMKA 1N26A 4OFKA 5K9QI 2JK5A 1UKQA 4GAJH 4YBQC 3WFHA 4Y5VB 3H0TB 3MNVA 3GRWL 5I18H 5F96H 3FO2A 4P5TB 4K7PL 1U2CA 3IKKA 3EBAA 1NBZB 1CGYA 1YEEH 4KMTH 3S6CA 4FZ8L 1X5KA 4U1SB 3BUYB 4XZUA 3PHQA 5HYSB 4FFVC 5IIEA 3B2UC 1OB1A 2J2ZA 2YD3A 2P1YA 3GI9L 4P4RB 3TBSA 1L7TH 2NX5A 4QLRA 5IEKB 1DJSA 5F9DC 1FFNA 1UB6B 3RQ3A 1MIMH 4Z5RA 3E2HC 2B39A 4LKXA 4ZUWA 5IT2L 4L3CA 4KUCD 1IAOB 4U1MB 1KCVH 4J8RB 4WEBL 1WBYA 1NEUA 3KYOA 3UJTL 4HUNB 3IJSB 1MI5E 4FQCL 1A6UL 3QJFB 4CN6A 4GW1B 4JFOB 1VENA 1KXQE 1N3NB 5D7IB 3RI5F 5DMGC 3SE4C 5I9QC 3CDGA 4L8SA 4YZFE 2HTLD 5IGXH 4YHYB 4QXUL 1MF2H 1UJ3A 5M7QA 2VXUL 3U4BH 4CBPA 3W0WE 1OOAA 4XXCC 1AI1L 3MRHB 2EIDA 4ZFZA 1RSFA 4IJ3B 5KVEL 1BJ8A 1IM9A 2Y7QA 4BSVA 4QWWC 5I1CH 1AGBA 4YDKL 4M8QA 3MRCA 1QSVA 3QNXB 5FYKL 1ZE3C 3IJYB 4X9FA 4HPOH 4PJDB 2J3SA 2HG5A 1YMMB 4DQOL 5IWLA 2XV6B 5GRJL 4C83B 1ITBB 1A6WL 2MJWA 1C5BH 1QLFB 2XN9D 3CDYA 2R1YA 4J3XA 3AREA 5JO5B 4TQEL 1WK0A 1FVDB 1U0QA 5FECA 2BNUB 3X11A 1F8TH 1KIUA 3GSVA 4DGVH 5SWSA 4DW2L 1MLCA 5AG8A 5L2JB 3G04A 5BZWB 1A6TA 2DAVA 3MRRA 3LV3A 4ZPVB 4HBCH 3EYFA 1AQDB 1X5AA 5I1JH 1N59B 2EC9U 1BFVL 5I19H 3KPNA 5CJBA 1ACZA 3FO1B 2R0ZL 1HK6A 4G6KL 2NY2B 1RZIA 4N0FA 2CDGA 4XPHL 3P0VH 3OJVC 1J88A 5JUEH 3Q6FB 4JPIB 1AP2A 3FOLB 5CIPB 3QCVL 5T1KD 3SDAB 4WO4A 3IB4A 1I7ZB 4K9EH 1XF2A 1MH5A 5CZXC 1PZUB 3HZYA 1KGCE 5CWSB 1XEDA 2CGRL 4QRSA 4UT9H 4W6XB 3QHTC 1NH6A 1D3CA 1A9EA 5ESVA 3RTQB 2D03H 4C4KT 2F19L 5A16A 2NY0D 5H35B 3MRKB 3CFDB 3RWEB 4O2CA 2WUBL 1U8OA 5I1DB 5I75B 4X98A 1CVSC 5DGQA 2IAMA 4LNVA 2C3VB 4NPYA 1S7QA 3LKRB 4GSDH 2RBLA 4JR9H 1JPTL 4I18A 1KC5H 5F7LB 4XWGL 1V8HA 1CICD 4CVZA 3PV6B 4BQ9A 1F97A 2WINB 4H25A 5IW1B 3A67H 4KC3B 4RMQA 3WEXB 1RPQA 4L29B 2NXYC 2JB6A 1RFDH 3QUXA 3RWHA 5C0GA 1KXTB 1CXFA 1LO3L 4JQIL 1J8HB 1MVUA 3STZB 5D93B 3UPCA 1J12A 2EZ0D 1AFVH 3V5HA 32C2A 2B2XH 4XHQA 5DJ2B 5I18L 5F96L 4L8BA 1LD9B 3IDGA 3EHBC 4OZHE 4APQC 2GY5A 1CL7H 4CMHB 3WKNA 4U1NB 1BF8A 1YEEL 4KMTL 5HHOE 5CBEA 2A0LD 3C8DA 5EU5B 4FQXD 3T0EC 4I2XA 2PNDA 1ZA3B 4U1JB 2J8UF 5EOCH 2Q76A 3DX6A 1L7TL 3QXTA 2X42A 2MCPH 1XH3B 2DJ4A 4X4YB 1MIML 3G9AB 3ARTA 2XG4A 3H7BA 5D7IE 3ILPB 4WU5B 2F5AH 1KCVL 3ULVF 5C0BD 1XIWA 4GAYB 5IK3A 1FQ9C 4MNGB 3PJSA 3BGFB 2DQFA 4Y5YA 4UB0H 1QEWB 4PPTA 1OP9A 3OR7B 2D4FA 4CU7A 2EO1A 1FZJA 3AXLA 3P4MA 2G2RB 1ZWIB 1CGUA 4NQCA 4HMCA 2EYTA 5EO0A 4QY8A 2DYPD 3CPLB 5HYQA 2HLAB 4Y16B 4PJXE 3FKUS 1MF2L 3P4NB 4X9HA 4TVPD 3NMEA 3PNWA 1RK1A 3DVNB 4PJDE 3WDJA 1T83A 3F58H 1QBBA 4QHUA 4X4XB 2BC4B 2EDFA 4ZTOH 3DETD 3VRIA 1X4XA 2BCKA 5C07A 3AY4C 3QQ9D 5I1CL 5F7DA 4AL8H 3CAFA 3E3QC 1M7XA 5BS0B 1QO3A 5SWZB 3HMWH 3V0VA 5DTFB 1K9TA 4HW6A 4HPOL 2DWEB 2OJZH 1KJMB 2FIKB 2HLFD 2VDKH 5DD0H 5KSBF 1EDQA 2Y07H 5LQBH 1PYWB 4XPAH 2E7CA 1C5BL 4MA1C 4QXTA 4ORGB 5IWLC 5HHXL 5FV1L 5IB2A 5JIPA 4Q6IC 4ZODA 1F4HA 2Z4QA 2Y72A 1F8TL 2N56A 5C08B 4PJEB 3LEYH 3ZKMD 4DGVL 4D9RD 4PJ8D 1BQHA 3B9KC 5DA0B 5DMYA 1YC7A 1IL1A 4LEOB 5D1XB 3RWJB 1AR1D 1HYSD 1RHHB 2VDNH 2OR7A 4PJHA 4HBCL 4NQDD 1KLGA 1CD1B 1OSZA 5I1JL 2QHLA 1A4JA 1IT9H 3UC0H 5E6IC 5I19L 4JFED 4NO0D 5EFIA 3SOBH 4GG6F 3P0VL 1DEEB 2OM5A 5JUEL 4IRSB 1HHHA 4E5XB 1JNHB 1BOYA 1FORH 1OWRM 4K9EL 4K8RD 1NBYA 5SWQB 4NGHH 2HJKA 4JGJA 4YHPB 5I0ZA 3BP7A 4HV8B 3QEUA 5CJXA 2P5EB 4UT9L 2A9NH 3NGBB 2D03L 5E1AA 1YPZA 3MSPA 1RZJC 3WS6A 5KSAC 2YXFA 4PR5A 2X41A 2MNUA 4HDIA 4RIRB 43C9B 2R23A 5D71H 1FYTD 2DQJH 1IGFH 4IOIA 2JIXB 4POUB 1AKJD 1DQLH 3L3OB 4C58B 4GSDL 4JR9L 1NMBH 1OGAB 1T7XA 3CD4A 3FN9A 3MFGB 2DKSA 3O3BB 3C08H 1I1YA 1MOEA 2DQIL 1QVOB 3IFLL 3SKMA 1BFOA 1DR9A 1KCUH 4WU7B 1G9EA 3A67L 3EOAB 2H6PA 3BN9C 1WGOA 3S8WA 1RFDL 2LTQC 4X5LA 3IFPB 2RCSH 3ZHLA 4JDZB 1AFVL 3UTPD 1JNJA 2B2XL 2N4IA 4J6RH 1WT5A 3QHFH 4IDJH 2N1KA 3P3YA 4NNXA 1N8ZA 1R3JA 3U6RB 4IIQB 1CD9B 1G1CA 1KENH 1U8LB 2DL9A 1GOGA 1T20A 3BN3B 3NZ8B 1NCTA 4F3FA 4URTB 4P5KB 3DUUB 2O93L 3FT2A 1BMGA 3RIAF 2E8ZA 2FHCA 1FC1A 5E4EB 3PWPD 1RZJH 1F2QA 3TWCH 2ZSWA 4NM4H 1OP3H 2C5DC 2IBBA 2MCPL 4L9DA 4EUPB 1JPSH 2Z31A 2HJLB 3CFJA 1EAJA 3O3UN 1DLHA 5CD5C 3PDGA 3QAZB 2F5AL 1KPUA 2P44B 2VL5A 5EU6A 4YO0A 5EN2B 4TRPH 4X8XA 4Y5XA 4NWUH 1N7MH 5DD1H 4UB0L 1MCRA 4PP2A 4PS4H 1UWGH 4Y2OA 4KK8D 3D3VD 3O2DA 4Y5YC 5C0ND 4WFGD 5GIRB 4P4KD 4YUEH 5BS0E 1DZBA 5SWZE 2NW3B 4Q9QH 3AAZA 4AH2A 3AU1B 1HCVA 4HH9B 5GGRA 3RA7H 1S7TB 5ICXB 3F58L 4ZTOL 5ACLA 5F9OH 1KN2H 4JM2F 4AL8L 2AV7B 1AHWB 1JPFB 3DHMA 3RGVD 1TFHA 3HMWL 2Z93B 3T2PA 1J10A 5DUPH 2VDKL 2JCCF 1YEJH 2OJZL 3KJ6H 5DD0L 3V5DA 5MEND 5A40E 2Y07L 5LQBL 4JFDA 2OP4H 4WNQB 4XPAL 3KPMA 3H9ZA 4LKCA 5E8EB 2I27N 5JQ6H 2YC1B 3UJIH 3HZMA 3WUWG 5LG1A 3X17A 2Z8WC 3LEYL 4JDVA 5K9KB 3DMMD 3HMXA 2EH8L 1TZIA 4GT7A 3WL9A 1FNEA 1HSBB 5DRNB 2NTSP 2VDNL 5TH2B 1WBZA 1YEDB 4C54A 1R5VA 4L4TD 2E7MA 5ISZD 5ICYA 1IT9L 3UC0L 2UZIH 5CMAA 1I3RB 2P5EE 4AIOA 3SOBL 5EZOL 4KJQC 2CRIA 3BGMB 4I0CC 1CF8H 5B8CC 1H15B 1A6ZA 2BRRH 1N6VA 5J4MA 2VQ1A 2GK0A 3ELAT 4BQ8A 2GHWB 2KUTA 3RU8H 1FORL 1E4KA 3L3IB 1ES0B 3T4AA 3V6FB 5BV7C 3L3GA 1ZVYA 4U1HA 4NGHL 1C16B 4YHIA 1EO7A 2CLRB 3U83A 1P84K 1KPRA 3W9DA 1EFXD 3BKMH 2I07B 3OJ2C 3UTSD 2A9NL 1BD2D 1QSED 1OGAE 5HI4D 1K3IA 4Z7QF 3F7VB 4UT6H 5GGQH 5ITBH 5IVXA 1Y6MR 3MLSH 5D71L 1S9WB 3CU7A 1DVFA 4MWFA 2DQJL 3BPLB 1IGFL 3HE7A 1TTFA 1P7KB 2VDMH 1DQLL 4MQ7A 5F6HJ 3L95B 1NMBL 2FO4B 2OBGA 4MXVE 5F6HI 2GUOB 4ZUTA 2XA8H 1XR8B 3U7YH 5F9WC 2G5BA 2ITCB 2VLMD 4ZDHB 1F5WA 1KCUL 3MGTA 3WHXB 4U6HA 4PGCB 2DMKA 5TE6H 3QIUB 4PJCB 1U36A 3R4DA 1F11B 3OWEA 1E0OB 1U8PA 5GJTH 5CILH 4HJGB 3LEVH 4KK5C 4ODUB 4B5EA 2RCSL 3ARYA 5ICZB 3PWVB 4G8GB 3OKOA 4J6RL 3QHFL 4IDJL 5BV7H 4QRTA 5CP3H 3D2UB 2J1KA 1KENL 4C56E 5T5NF 3SJVA 5LWYH 5SX4I 2XQYK 3ARFA 2QQQA 2QADB 5EBGA 1NC4A 1EEZA 4GG8A 3TWCL 4NM4L 1CGSH 3FRPG 5IFJA 2EYSB 1S7SA 5D1QD 1JPSL 5EU4B 3VXQB 4JGMA 5IW3A 4MD4A 5CSBA 5F93C 3U1SH 1AXIB 4TRPL 1PKQB 2V2WB 4NWUL 3DURB 1N7ML 5DD1L 3LKQA 4PS4L 3CX5K 1CXKA 5LCVL 5FUZH 1UWGL 1RJCA 3EJYD 5GS0D 1FZKA 1T5XB 2PW2B 2FD6L 4ETQA 2JJTC 3UJJH 4YUEL 4EN3D 5JNYA 4Q9QL 4MJID 3RA7L 3ZO0A 1HXYB 3OJDA 4XCFH 1CLZH 5I1AB 2M2DA 1WICA 3O6MH 4EZMA 3WO4C 3SDXB 4IOFD 2P5WB 2X4UB 3H9SB 5F9OL 1KN2L 1LEGA 3MMEB 4ZFOL 4KDWA 2KZ1B 2YUWA 3REWA 4EDWH 4XC1L 5F9AC 1ZOXA 2YA1A 1HE7A 3MNZA 4XRCA 1JV5A 1I1AC 2BK8A 1YEJL 3KJ6L 3WDHA 1J0HA 2OP4L 2OX5A 4WDIA 4MNQD 3L7FB 1CBVH 5FK9A 2KQNA 5JQ6L 5FDWA 3CSYB 1EGJA 1UKSA 3NABH 1EHLH 4KQ3H 3SE8H 4JO3L 2XKSA 2P8PB 1K3ZA 1FFPB 2Q7YB 3NZHH 5I16B 3PGFH 4PJ5B 3VFWA 4L4VE 2FEDC 5IKCA 5C0DB 3C60B 3ZE2F 2VDOH 2UZIL 2XKNB 2EDBA 5HVGB 1NEZG 4LCCB 3PIQA 4PJ9A 4AM0A 1CF8L 5IB3B 3O2DH 5D5MB 2BRRL 1X5ZA 3RX8A 3TVMC 3RU8L 2NXZD 2NX5D 4NRYA 4OUUA 2ARWA 1KCRL 2VO5A 1R5IA 1OTTD 4WJ5A 1R3LB 3BKML 5MEOA 2X4NA 3JV4B 3LDBC 1MNUH 4M9PA 5DI8B 1NKOA 2F53E 3VH8A 5I1IL 4NQEE 3HNVH 4UT6L 3GIVB 5ESAB 5GGQL 5T1LD 2HKFH 3GM0A 5ITBL 5D7SH 5HYJB 1N4XH 1EEYB 1EVTC 5D1ZA 4MQXD 2CIIA 4PJCE 3MLSL 2HT4C 4U1LA 2AJUH 4S1DC 4QT5A 2MQCA 3OKNB 4QEGA 2BHYA 2XA8L 3QISA 3MFFB 2X4QA 5DVKA 2LE9A 4UNVA 4RGNE 5TE6L 1IM9D 2ICEA 3MJ7A 1V3JA 3STLA 1AC6A 4MQSB 4PJFE 2FNBA 3BO8B 4QRRE 1OTSD 5HDBF 1R24B 5D8JH 3LEVL 3CZJA 3KPSD 1S7UA 2OTWB 2PO6B 4WHTA 3FQUB 3KLDA 4F37K 1VFBB 2J12B 4DKFH 5DFTA 2HAZA 2VH5H 5C3LD 3TEUA 3ARED 1DUYA 3WUZA 1FL3A 4I4WA 4Y4KD 5F1SA 1U3HA 1TJHH 4OD3H 5SWSD 5LWYL 4MD5A 3EGSA 3S5LG 3I6KA 1PKQE 3TIEB 5IBLC 1UH3A 4P23C 4UOW0 2E6JA 5MEQB 4FNLH 3WJJC 3EYQC 5DJ8B 3HN3A 4DVBA 5C0IA 3FQNA 2AAVA 4WFFD 5IBUB 1DBJH 4OLEA 4WI8A 2IPKA 3CSBA 3P40A 3MLWH 4R0LB 3LPGA 3OAZH 3INUH 1T7YA 3MJ9H 3U1SL 3SGDH 3BOVA 4WO4D 3O41B 3ZYZA 4YNYB 5FUZL 3LN5A 3LPFA 1KIRB 5B39B 3SDXE 2P5WE 2AQ3A 3TO2B 1S8DB 2XN9B 2PUQT 3BW9A 1YUHB 2H2PD 5JXEA 3TLRA 4XI5D 1T0NA 2H26A 3GMNA 4XCFL 1CLZL 5EOTB 4JFFA 2VLLA 2P8MA 2IAMD 4OLYH 5AD0A 4R7NB 1KJVB 1B6UA 4RFNC 4CU8A 1RUPH 3DRQA 3BH8B 4EDWL 1FL5B 4MS8D 2VL4A 3TBYA 4LVNC 4JZJB 3OXSA 1P9MA 2X89A 3ZSSA 3DO7A 2RAMA 1M71A 4PJ5E 4UUJA 3GHEH 4R4FH 5J6GA 3BFOA 1CBVL 4MX7A 5KOMC 5T1KB 5EWIH 1OY3B 1CDBA 2F54D 4MAYA 3QUXD 3WN5A 4WENB 3NABL 3LVEA 1EHLL 3C6SA 4KQ3L 3SPVB 3SE8L 5D5ME 1JMXA 2DKUA 4NO3B 4OZFA 1OGTA 2EIZA 1KB5A 3NZHL 5FM5M 3PQYA 3PGFL 1L0YA 2WBJA 3P0GB 5LBSL 3LOWA 3MGOA 5FA3A 2NY0B 2VDOL 3D48R 4PLNC 5JW4N 3P77B 1UXWB 2L0DA 4LGRB 1T1WB 4KKNA 4JFPA 3O2DL 2HH0L 2V7HA 4KKAD 4DVRH 3NPSB 3L3HA 1C8PA 2PTTA 3RHWK 4JZNB 1OAXH 4KVNL 5JOEA 1CICB 1UQSA 1JYWA 1E27A 1G7MA 5IJVA 2YUVA 4NSKB 1GSMA 3BYTA 4U1IB 3WFDH 1NDGB 1MJUH 1MNUL 1XIWD 2ED9A 2GCYB 1RZGB 2MHAA 3VXRB 5B38B 1FO0B 3HNVL 1ZHLA 1T1YA 2HKFL 3KNBA 4UILH 5D7SL 3VE0B 3WV0A 4TTDC 1N4XL 1BM3H 4NJAH 2OR8A 4WIQA 3MYZA 2VUYA 1G7LB 4DZ8B 2ADGA 4O51B 5HHVH 2AJUL 3L5JA 2OZ4H 1WVZA 3QUKB 4ZS6C 3VFOA 3OHXA 2R9HD 5T1DH 3SDDA 4GKZA 1EGJH 5I2IA 2IMNA 3VXUA 4OGXH 5AAWA 3HE6A 2YEZB 4FQXB 4J1UB 3ESVF 3HNTH 5IEHB 1X5GA 3MV9A 3T09A 4KI5F 1J1XH 3DBXB 1CFBA 3MV8D 5D8JL 5EBWA 4P2OD 5KG9A 4GO6B 1BQUA 2EICA 3O8XA 4PJEF 1CI5A 4LCIH 4DKFL 5E94B 4X9BA 5C0BB 2VH5L 2NZ9C 1M7DB 4K3EH 2C3XA 4OGZA 1KYOK 4N5ED 4QHLA 3S36X 5DGRA 1TJHL 4OD3L 2D7OA 3OKMB 3IU3B 3VMNA 5TDNB 1FHGA 3CX2A 3C2AH 3OQ3B 3QQ3B 5EC1B 2DYPB 1ORSA 5KSBA 3ARZA 3N1QC 5DO2C 5ENWA 3KPOA 2FH6A 3AS0A 4Z0XA 3SKOB 4X99B 1DBJL 3MRJA 5FUCE 4GW5A 3MLWL 2XN9E 2Y1VA 3INUL 4PJIB 3MJ9L 1CG9B 1JWSA 3TA3A 5F6IB 1C12B 3RWFA 3WJLC 2NTFA 3RIFK 1W72B 5HI5D 5ID1B 1KIPA 4YHNA 5IVOA 3I75A 2EDQA 2NR6C 1V3LA 4UU9A 4GG6A 3DECA 1ORQB 1QA9A 1JZ6A 4Z0BL 1A9BB 4YDJB 4PJ8B 3T08A 2AXGA 4D3CH 4M5ZL 3U4EA 4OLYL 4RMSA 1OAKH 1G9NH 1RUPL 5DFVD 4MLIA 3VXSA 3QUYC 3CVHB 4JFEB 4WTZG 4NO0B 3E1F1 3UDWA 4W6YB 4Z7UB 1K8DA 3WLWD 5ERWA 4R4FL 4CVXB 2D7TH 5EWIL 2JJSC 3S37X 3EDDA 3MYJA 5L0QB 2YOCA 1A3QA 1II4E 5IVNA 2DS4A 4X5WB 2ERJB 5C0FA 4JREC 3HHRB 1CT8A 2H45A 3DX9A 3ZKNC 2YMXH 1NUFA 4P5MB 3G5XA 1BOGB 3VXRE 4M5YH 1FYTB 2BY3A 1XGUB 2Z8VC 3SKNA 2EYRB 3DVIA 5DJAA 1AKJB 4DUXA 4OQTA 1U41A 3DUSA 1W0VB 1F6AB 1OAXL 2PXYC 3OKEB 1RD6A 4HZAA 2Z31D 4RRPA 4BELD 5J11C 1WZ1L 3P9LB 3D5OF 3WFDL 4XBPA 1MJUL 5EU6D 5CZVH 5HBBA 2HVJB 3KYNB 3UPAA 1D9KA 4BSWA 3GZKA 4BUHA 3IF1A 1FBIH 4DEPC 3UPRA 3FN3A 5DD5H 4UILL 1BM3L 4NJAL 3FFDB 1ONQA 4Z7NE 3I6LD 4NCC2 1BQSA 5HHVL 1Q72H 2P4AB 3EZ8A 2OZ4L 2P24B 5DJXB 1CXLA 1T7WA 2AXJA 5H94B 1A6AB 3EFFA 5INDB 1H3XA 1MWAB 5T1DL 4MHHG 1WSST 1S7XA 1EGJL 2IG2H 4OZ4B 1NAKH 5JW4Q 2AJZA 1LO4H 3NCJH 3ULVC 5C0BE 1BQLH 3B9EA 3B2VH 4Y2DD 3PWPB 3HNTL 1KELH 1T6VN 1J1XL 1EBAA 1G7PB 3EO0A 5A3IC 4J4PA 4K7FB 1FVCB 2HJFB 3IXTA 4PRIA 5I8EB 3OKYA 1ND0B 1VA9A 4LCIL 4JFDD 4TSAH 4KROC 4NKIH 3JV6B 3UXFA 5I1HH 4K3EL 3O6FA 3KJ4B 4GUPA 4JM2A 4JRXD 1T89A 2WWKO 3D3VB 4NHCH 3BYYA 5JOFA 4PJIE 4HIEA 3CXHK 2VXVH 3FRUB 3IFOA 3C2AL 4HF5H 1JTPA 2GJ6B 4LP5A 4P4KB 4HEPG 4WI2A 4XNZC 3VFMB 2JCCA 4RISH 5HHMD 5FKPB 2DD8L 5FGRA 1UEYA 4HUWB 3ZE1E 1OWWA 3VFSB 2BSTA 3O6LH 5EB9A 1T21A 3CVIH 4X6BA 2F9BT 1ZLWH 3V79C 3W9EA 1UXSB 3EYUH 2IWGA 3MPCA 3ZTNH 2AJ3B 4QF1B 2VERN 3QCUH 3RGVB 2IH3B 2R39A 4NDMA 4BH7A 2DQHH 1WISA 1KV3A 3ULVH 3RVTD 5MENB 4ESKA 2V7NB 3QWOB 5DHVB 4R7DA 5FYKE 1VACA 4MLSA 4JFEE 4KV5F 3OAUH 1MCJA 4M7JH 2XG5A 5DMIH 1MHCB 1YN7A 4Z7UE 4LVOC 2DBLH 1QFWH 1DVFD 3DMMB 4D3CL 4DUVA 4Z7WB 1T03H 5DJCA 2PTVA 3D85A 1OAKL 1G9NL 1GZQB 2FZ3B 4L4TB 2HFGH 4LSQH 5ISZB 3DSNA 4PJBF 4XCEA 1BBJA 3MRNA 2X2YA 4QHNB 4WUKH 4KJPD 1KXVC 3QUMB 2YRZA 4PRPD 2D7TL 4PREA 2J6EA 4PY7A 5F1OB 3ILQC 1FJ1B 1DQMH 2E27H 4BFIA 3BKCH 1XGQA 1MLBB 3ULUF 3MUY1 1ZHKA 2VWEC 1EFXB 3KXFD 3HNSH 5IB1A 3UTSB 3C8KA 4JGUA 3GMLB 2YMXL 1BD2B 5LXGH 4Z95H 1QSEB 3O11A 3TJHC 2KZWA 4G8EB 3QWRA 4HUUB 3R8QA 4U3CA 3HRZB 5CINH 3SJVD 3OGOE 1JWMA 4M5YL 3FO0H 3ARFD 5KN5B 2W9DL 1YY8B 3QUZC 1NC4D 4P2RE 4OBRA 3QNYA 1ROWA 3D6GA 3PABB 5HVHB 4EI5A 4NQSA 5DZOA 2CSPA 5FOBB 4OZIA 4DAGH 1AO7A 4AIZB 5IMMB 4ZAKA 3RWDB 1U95B 2DTSA 4JFXB 1H0DB 5CZVL 1MCSA 3ARUA 4IMKA 2R2EB 2A6KA 1FBIL 3BESR 1GAFH 5DD5L 2D7NA 1CXIA 4KK9C 1FIGH 1T22B 2ITDA 1DUZA 3UBXG 4NT6A 5E8OB 2HTKD 2ILLA 1Q72L 3PF2A 1NAMA 4WI6A 4E0RB 5CZKA 1S5IH 4BK5A 3VDBA 1HOCA 4L8CA 4JANA 2IG2L 4NQXA 1NAKL 3M17B 1A1MA 4PD4K 1JI2A 1LO4L 3NCJL 3V6ZB 1BQLL 1O7SA 4LHUD 5EBMA 3B2VL 1FL6A 4E42B 2KL6A 3WS3B 1KB5L 5KAQF 4K94C 3GMPA 1U8QB 4HKXA 1RIHH 3W5MA 1VADB 3D3VE 5EO9A 5D1QB 4WFGE 1BF2A 3OSKA 4JAMB 2D0HA 1RURH 2GJ6E 4TSAL 4NKIL 4K23L 4LPWA 4KMLB 1EXUB 3QG6B 1JHLH 5I1HL 1NPUA 5D6CB 2R2BA 3B3IB 4PTTB 1MY7A 2W07A 3GMMB 1L6ZA 3VWKA 4LPTA 4NHCL 2VXVL 3MJ6A 1L9MA 4HF5L 5FYLD 5F8RC 1LE5A 1B0RA 1QBLL 1BX2A 4RISL 4EN3B 4M3JA 3O9WB 3VFNA 4XVUD 4Y5VA 4MJIB 1EHNA 2HT2C 1ZXQA 2YSSB 3H0TA 5MENE 3O6LL 4LLAA 1R3IH 3FL7A 3L3JB 5BVJB 1O5DT 2PR4H 2EDLA 4L4JA 4XWOD 4OKVB 4FABH 3EYUL 3WFZA 5K33A 1TJGH 3ZTNL 3BMVA 1YN6B 3BIAX 3QCUL 3FT4A 5E00B 5BQ7B 1A1NA 1PJ9A 1Q9LA 2DQHL 3ULVL 1D6VH 4Z7WE 4P4RA 4UIMA 2BVUA 1XGPB 2XTJE 3JUZA 1C7SA 3QEHB 4JQVA 4KFZC 4K94H 2GIYA 3O81A 4L4TE 4MNQB 5AZ2H 2FECI 5ISZE 1BPVA 4NNPH 2BVTA 4XGZA 3OAUL 4IHOA 1FRGH 3BAEH 2ZPKH 4H5SA 4M7JL 5DMIL 3L5WB 5D1ZD 2FBOJ 3WFEH 2JK5B 2DBLL 1QFWL 5IJKA 3WFHB 3MRQA 1YEKL 1T03L 1KNOA 1OHQA 3U30B 2EKJA 3I85A 3ZT5A 2HFGL 4LSQL 4TSBH 1CE6A 1AY1H 3RVUC 4KRPD 4WW2F 4WUKL 4N0UB 3T0DA 1HSAA 2XWTA 1BD2E 1QSEE 5FO7A 4XZUB 3PHQB 5IIEB 4KUCF 5C09A 4CGTA 1OB1B 2APFA 2NXZB 4PBXA 2NX5B 4RA3A 2W9EH 2Z8SA 1IAKA 1WTGT 2E27L 3BKCL 4Z5RB 4ZUWB 2V2TA 3VGEA 1D5MA 4HKZA 1G7HA 1IRAY 1T5WB 3HNSL 3TH4T 1HXMA 1W2KT 5LXGL 4Z95L 5FYJH 3KYOB 3W11C 1YMMA 3DYOA 5T1LB 1NCUA 4CVWA 5CINL 1MRCH 2R4SH 3FO0L 3BPCA 3TBVA 3CDGB 4L8SB 1Z9MA 1DP0A 1NCAH 1UJ3B 3GBNH 5BZWA 2ZUUA 5C86A 4MJ5A 4ZFZB 1K8IA 1AQDA 1IM9B 2OTPA 1Q94B 2Y7QB 4BSVB 1TQCB 3U9UB 1AGBB 3P0YH 4HEME 4ZAKC 4M8QB 5ILTH 3MRCB 1P84J 1GAFL 1D5XA 3ARDA 1FIGL 4EIGB 5FEBA 3OBAA 1MUJB 3SDAA 5GPRA 2HG5B 2CK0H 1F13A 2AK1H 4RGMC 4GRWB 3RNKA 1HWHB 3AREB 1S5IL 1JF1A 5FECB 3P4LA 4IRJC 3X11B 5SWSB 4JFFD 1MLCB 3BWUC 4V2BA 3G04B 1A6TB 3QIBA 3MRRB 3CFDA 3LV3B 5DRZA 4Y4FA 4X7TA 5BZDB 5I1DA 3BPNB 4DCQA 3QNZA 3EYFB 1JFQH 2XTLA 1RIHL 4F58H 4CNIA 2UYLA 1WC7B 3KPNB 4RQQA 2ZUQC 1RZIB 1RURL 4N0FB 2CDGB 2EE6A 3VXME 1LO5A 4LLDB 3TYFA 5T3XD 1JHLL 1AP2B 2JB5L 4GBXA 1NL0H 4MJIE 4MAYD 5JW4R 2P42B 4WO4B 2WINA 4PJ7A 2WUCH 3S35H 1XF2B 5DJDA 1IQWH 1MH5B 4OT1H 4HAFA 3HZYB 5F1KC 3TO4D 1OARH 2X10A 1KTLA 4ZQKA 4OLZH 2WBJD 5ESVB 2XQBH 2PYFA 5A16B 3BZEA 1GXEA 3TCLA 4JM4H 4O2CB 4FFYH 4NOFA 1R3IL 4P46A 1U8OB 2VR5A 3UTZA 4ACPA 5FFLA 1U8MA 4MNQE 5BO1H 2IAMB 2PR4L 4NPYB 4FABL 2WMPA 5I6XB 2E8YA 1WAAA 5D9SB 1TJGL 4U1NA 4P5TC 4I18B 4L3EA 1JN6B 1TZHA 4I3RH 1ZA3A 4U1JA 1D6VL 4CVZB 1KJ3H 3EZJB 4X6FA 5A2KH 1ZSDA 1CLOH 3J7HA 1CGXA 4K94L 5AZ2L 2AJXH 1PD6A 4NNPL 2X4PA 2F54B 2JB6B 3QUXB 3RWHB 4WU5A 4FFVD 5C0GB 1FRGL 3LRSA 3BAEL 2ZPKL 4LDOB 1MVUB 2VSDA 4MNGA 4MNHA 3M45A 4RFOH 3QJHA 4ZO6A 3I6GA 1H8OA 3V5HB 32C2B 4WUUD 4BUGA 2NX5E 4L8BB 1IJ9A 3KLAA 4MA3A 3IDGB 2YK1H 4K3GA 5FHAH 4TSBL 3UAJC 1AY1L 3CLEH 4KKBC 1NMCB 2VN4A 3SDDD 2CRYA 1RJLA 4XMPH 3DGCR 3VXUD 1T7ZA 4Y16A 5T5NG 1SEQH 5CBEB 3HE6D 2A6IB 4I2XB 4WWKA 1MFAH 5GRXG 1MPAH 3MV9D 2NZIA 2Q76B 2GJZA 4JY6A 2W9EL 5E03A 2OLDA 2Z9TA 2P7TB 2CR3A 3ARRA 3TZVC 3H7BB 2YD8A 2WQ8A 4IJ3C 1HYRC 3MRMA 4BZ1H 2IEPA 5JDJA 5GSRA 1XIWB 5IK3B 1BAFH 4NKDA 5FYJL 3PJSB 1IEAA 4PLJD 3GI8H 2DQFB 1FSKB 2GSGA 4FQHA 4G9FA 3RVXC 4RDQF 1FZJB 3AXLB 1MRCL 3P4MB 2R4SL 1R5WA 4NQCB 4YBLB 5EO0B 4HLJA 4QY8B 5C08A 3JZ7A 4PJEA 4S1QH 5DQDH 5HYQB 3RWCA 2NY5C 5C9KA 2XIDA 1RK1B 4LEOA 4GLRH 4QHUB 3QFJD 1CVRA 2AEPH 2IFFL 2VXTH 3C87A 3VRIB 3LMJH 2EXWD 2BCKB 4FXGA 4TNWK 1N0LA 1X6NA 4UMGA 5F7DB 3TA3D 3P0YL 5ILTL 2X05A 1B3JA 3ZT7A 1QO3B 2VZTA 5E56A 5SWSE 3V0VB 4A6YA 5J89A 2NY2C 1BVKB 2CK0L 1T7VA 1TQBB 4PUBL 2AK1L 1CLCA 2FB4H 4NJ9H 3MV7A 4QXTB 3AVEA 2ICWJ 3PWNA 1BVLA 3H42H 2ZJSL 4YHPA 2ICWI 5IB2B 4FHBD 2Z4QB 3VI4F 2Z35B 1DQQA 5T3ZD 2X1PA 1BQHB 1JWUB 1IL1B 2IPUG 3BKYH 1ETZA 1FIEA 4Z7UF 3RTQC 4PJHB 4L9LA 4YC2B 1JFQL 1OSZB 5EBLA 4F58L 5HYSG 1A4JB 4UAOB 2P47B 3QH3A 4JO2H 4WY7L 2JIXA 4AQOA 5EFIB 2ENYA 1FE8H 3L3OA 4N68A 3RJDA 1JRHH 3S3SA 2NY5H 4E41A 1QVOA 1NL0L 1UKTA 2XWBA 4WU7A 2FX9H 2WUCL 5HGAA 1NBYB 1IQWL 2HJKB 4P3CH 3EOAA 1GYAA 5IVZA 4OT1L 1E4WH 1PG7H 3BP7B 3QEUB 1QSFA 5FGCB 1F3JA 2IFGA 2V5MA 3ARGA 4F9PA 3QI9A 5E1AB 1YPZB 2XQBL 4FXKA 4JDZA 1TITA 5F88A 4GS7C 5D93C 4JM4L 4PR5B 4FFYL 2BVYA 3OXRA 2R23B 2ZUYA 5EC2B 5CIPH 3TBWA 1BZ7A 1U8LA 4IOIB 4KPHH 3NZ8A 5GGVH 1HINH 4Z6AT 4CMHC 1FN4B 5DDHB 2W0FA 5LGHL 5F1NA 4I3RL 1I1YB 3EHBD 4NOBA 4APQD 1KJ3L 1BFOB 3SKMB 4NKOA 1OPGH 4LPVA 4OF5A 1HILA 1CLOL 2E5EA 2B7DT 3DXAD 4BA8A 5C7XH 2AJXL 1SM3H 1QRNA 3IYLW 2H6PB 1JGUH 3ZYIA 1ZT4A 3T0ED 1EAPA 3SBWC 2XY2A 4LP4A 4J7RA 3QT2A 3T2QA 2VLKA 1IC1A 4I2XE 4RFOL 2GTWB 2VZVA 1ZKAA 4M48H 4PGZA 1A8JH 1DQDH 4AY0A 4NNXB 1N8ZB 1CD8A 3BGFC 1R3JB 4JEGB 1I8KA 3CLEL 3Q5YA 5EG6C 1T20B 4XMPL 1CDJA 1GZPA 4F3FB 2EIBA 3FT2B 1T2XA 2AKRA 4ZD3H 1MFAL 1MPAL 2PCPB 5CCKH 3PDDA 1KULA 2ZSWB 3HZVB 1X6LA 4J4PD 5TF1H 4KAQH 2IH1A 4UTBH 3MBEA 4PRID 2Z31B 4LPXA 4NQCE 3CFJB 2AV7A 1AHWA 4BZ1L 2Y5EA 2VTFA 3OTTA 1KPUB 4YQXH 2VL5B 5EU6B 4YX2H 1BAFL 1MJJA 3O6FD 1AE6H 3GI8L 4Y5XB 4LOUC 1S7VA 1CFVH 3MCG1 3P11L 4PP2B 2C4FU 4JM2D 2QHRH 3ARXA 3D69A 5C07E 2YC1A 3LB6C 1I1FA 3HC3L 5JZ7D 4B0MM 4S1QL 5DQDL 5I1EH 1JMZA 3AAZB 2X9YA 4AH2B 1A22B 4JRYA 4YXKH 2AEPL 5FOJA 2VXTL 3LMJL 5D1XC 5CEZD 2AXFA 4U2YA 4U3XA 4PBWD 3KR3H 4Y2DB 4ZFGH 2KPNA 3GSXB 3B9KD 4MB5A 4K3DH 1TENA 3BGMA 4HLZH 1J1OH 4OTXH 2EDKA 2HWZH 3V5DB 3L3IA 1IAIM 3OV6A 4JFDB 3B9VA 2FB4L 4PJHE 3KPMB 4IRSC 4NJ9L 4DKEH 4Z7WF 2RB8A 4XNMA 4LKCB 2HT3C 1SVCP 3H42L 3R1GH 3LS4H 5IMLA 3RI5K 4N8VG 2R0LL 3HZMB 5L2KA 2BZDA 2Y5TA 1ODAA 2VLRA 5ALBH 4JDVB 5HDLA 4JRXB 1WFTA 2BY0A 3TT1H 2GSIA 5E5RB 1TZIB 3WL9B 1FNEB 3BKYL 3NGBC 4DOHB 4JN2A 1I4FA 1WBZB 2UV3A 5HHMB 3GEWB 1R5VB 3CNKA 5ICYB 1PEZA 4JO2L 5CMAB 3SGJC 2UZYB 5HD8D 4ONGH 2R8SH 5FGCE 1FE8L 2GUOA 5CGTA 5KSAD 4ONOA 1A6ZB 1YPZE 1JRHL 1URLA 4XCCH 2NY5L 1KCLA 3LS5H 5EDXA 4HIIB 2GK0B 3T4AB 1P4LA 2FX9L 4PGCA 3L3GB 4OGYH 4P3CL 5EZIH 4YHIB 1E4WL 1PG7L 1W8NA 1KPRB 1F11A 3MZTA 4PJBA 5C0RH 3ZDYE 4NC0B 2ZNWA 4HLZG 3NIFF 1KYOJ 4Q9CA 1NFKA 3QWRD 4G8GA 3DX8A 1MCOH 3IKCB 3BN9D 2MMXA 2CIKA 1V05A 4KRMB 4PRBA 4OKDA 5IVXB 1AGEA 1VPOH 3RNQA 1DVFB 3MTRA 1SQ2N 4KPHL 5GGVL 1HINL 4K3JH 4UINH 4MQ7B 4PG2C 4UV7H 3EIFA 4ZUTB 4IIQC 4UDTA 5M94B 1QBAA 4EI5D 1INQA 2G5BB 4LFHG 3FB7A 3MCKB 1AO7D 3MGTB 4U6HB 1OPGL 1I9IH 1A14H 2L4OA 3FO9A 3U0PA 5C7XL 5E4EC 3CC5A 4PRPB 1SM3L 1SYVA 5C6WH 1JGUL 5DVMA 1CTNA 1GH7A 4Y1AA 3CGTA 4M48L 3DURA 3KXFB 2JTDA 3OKOB 4CN4A 1DQDL 1YMHB 3TNNA 4QRTB 5CD5D 3IVKA 1T5XA 1A3LH 2E7LA 2VZOA 3SJVB 1VFOA 2SEBB 1Q9OA 5GISH 3MRDA 1EEQA 4NO5A 5EU6E 5HJ3B 3ARFB 1RU9H 4ZD3L 2YD4A 4CN1A 1T1XA 5CCKL 1NC4B 1EEZB 3QO1A 1MCPH 1K4CB 5TF1L 5IFJB 3C5ZA 4KAQL 4I3GA 1S7SB 4UTBL 3I6LE 2WK2A 3LIZL 2B5IB 1S78D 3GNMH 5DRWA 2CK2A 1CIDA 2ATKA 4YQXL 3GBLA 4OF0A 4YX2L 3QPQD 1XF4A 3T3PE 1AE6L 1CFVL 4M3KB 3LKQB 3ZDXE 1D6EA 5GS2H 3VWKD 1I8IA 1G9MC 2QHRL 4PB0H 4N8CH 2CO6B 1FZKB 3VGDA 5ADOH 4MJ2A 1KLUB 2AJVH 4ETQB 1WBXB 1WFOA 1UB5B 5I1EL 5BRZA 3IXAA 4EUPH 1FFPA 3OJDB 2VDPH 4DN4H 2J5LB 4JFDE 2ZUWA 4YXKL 1JK8A 3MLUH 4QOKA 3IDYB 4W4NA 5MHSE 4LHUB 2IGFH 3KR3L 3K2UH 4ZFGL 1LEGB 1KSRA 2AERT 4Q6YA 4K3DL 4Z78A 3REWB 3RFZC 1F45A 2LABA 5E2WH 1J1OL 4OTXL 5IBTH 3MNZB 4XRCB 5E2VH 1JV5B 2HWZL 1FG2B 4DOHE 2AEQH 5H8DA 1IM3A 3KPPA 1KTRL 3V7MA 2FHFA 3VFGL 1MJ8H 4KJQD 5FK9B 1EV2E 3ARWA 1T1ZA 4KKCD 5FDWB 3R1GL 3LS4L 5KZCD 1SBSH 3T8XA 1I8MA 1XGTA 3TT1L 5EIIA 3GIVA 4NZRH 5DJ0A 4NIKB 5HYJA 3VFWB 2R4RH 3U7AA 5DC0A 5E5UB 2NY4D 5IKCB 2DMBA 3JBG7 4TUOA 4ONGL 1I7UA 2DRUA 5E08H 2R8SL 3DTXA 4HS8H 2P45B 3PIQB 5C09D 1XGRA 5B21A 4XCCL 2ZCHH 1KJ2A 3LS5L 3MFFA 4NRYB 3SGEI 4OUUB 4OGYL 5IVXE 1NCDH 2O61A 3MUGA 1BREA 5EZIL 1OT1A 1R5IB 2Z8RA 2D31B 3IAPA 3QIUC 5DD6A 4H88H 5C0RL 1R24A 5MEOB 2X4NB 4WW2A 5CJ8A 3VH8B 2OTWA 4XXDA 1VFBA 4XPBH 1MRFH 3CXHJ 2VLJA 5D1ZB 5J3HD 2CIIB 1J7VR 2X70A 4C4KO 5FA4A 5JXAH 3KPLA 2ZZUT 3HPJA 1K5NA 5DEFB 3KLHC 4K3JL 3K2MC 4UINL 3S96A 5E9DA 1IGTA 4LSTH 4QT5B 4UV7L 2ZCLH 5C70A 4LSSH 4KRPB 2A9MH 2X4QB 1I9IL 3DIFA 2F58H 3PHOA 3GSRA 1A14L 5DJ8A 2V5RA 2VN7A 3DHJA 1NLDH 3FQXA 5GQBA 3MJ7B 3STLB 3MCLH 4GRWF 2ARJA 5CKGA 4G6AC 2BVQA 3SJVE 2DTML 1RIUH 1S7UB 1NGZA 4MCZA 4ETYA 4WHTB 3O41A 4YNYA 1IGJA 1JBJA 2OMNA 1DUYB 3TO2A 1FL3B 1A3LL 2FLBT 2VR4A 4M6AA 2PKDA 3VWJA 5CEXB 4MD5B 3EGSB 5GISL 4FZEH 1RU9L 3QIBD 2IBGA 4Y4FD 1MEXH 1KTDA 1MCPL 2FWOA 5C0IB 3RY6A 4DVBB 3FQNB 4P0DA 2XZAL 3WNMA 5L9DH 2ORBH 2IPKB 3GNML 3LN4A 3PWLA 3H2WA 5GGSB 4GBXD 5E70A 2BNQA 1WUNT 3BEVB 2VKWA 3ZTJH 4GKNA 2ARJQ 3ULUH 3LN5B 1UFUA 3IFNH 4PB0L 3ZKQD 4N8CL 3ZT6A 4R4ND 5ADOL 4O9HH 3SDCA 2AJVL 2IPTH 3WIIH 5JOPE 1R6VA 3SPVA 3BW9B 4ZXBA 3RIAK 4NO3A 2EH7H 4LAJH 1F58H 1T0NB 1WWWX 1GRWA 2H26B 2VDPL 4DN4L 3GMNB 4P46D 4JFFB 5FHBH 4PJAF 4XNQA 2VLLB 3H9HA 4LL9A 2P8MB 1G7IA 3R06A 1ZTXH 5IFHH 5AD0B 2IGFL 3K2UL 1F3RB 2B0SL 3P77A 3NIGE 4HUMB 5JLZA 2VQUA 4Z7OE 1UXWA 3C60C 4L3ED 4RAHA 5E2WL 3TBYB 5IBTL 4LMQI 5E2VL 4LCCC 2AEQL 2FEDD 3SGKA 3RL1A 4JZNA 3DO7B 1M71B 4UUJB 5J6GB 1MJ8L 3OR6B 4MX7B 4JQXC 2CRZA 3TIDB 3OF6D 4MAYB 1KFAH 1TLKA 1HEZB 1SBSL 2X1OA 1NDGA 3ARBC 1TJIH 3C6SB 2V5SA 5B38A 1RZGA 4UTAH 3BQUA 3ARSA 3IETA 5HHQA 2DI8A 5C2BH 4OZFB 1OGTB 2EIZB 1KB5B 4NZRL 5D7LD 3ZTJG 2C7UB 2WBJB 3LD8B 2R4RL 2BXYA 1A3RL 5FA3B 1RZFH 1G7LA 4PD4J 3FHAA 5E08L 4JHZA 4HS8L 1DN0A 3S37H 1HH6A 3B5TA 5JPNA 4RBPH 3QSKB 4JFPB 2NPLX 4WWKD 2JJUA 2V7HB 2ZCHL 3L3HB 1BHGA 3B9DA 2DF3A 2PTTB 4HS3B 3HKFA 2HT4D 2YA2A 1NCDL 1UQSB 3UO1H 4L8DA 1JYXA 1E27B 1G7MB 2UWEB 5IJVB 5J1SC 4XPGH 4H88L 5A2JH 1VGKA 5E1HB 2MHAB 2K1MA 5I73C 1ZHLB 1T1YB 1KCKA 4G9FD 4XPBL 1MRFL 3KNBB 1BGXH 2EXYD 5D6DA 2OI9B 5F8QC 2PO6C 2ESVA 4NWTH 1OLZA 3K80A 5EIVA 1XR9A 2ADGB 4QNPF 4ZO8A 1X5YA 4NC1E 1H3GA 2GAZA 3OKMA 4LSTL 3IU3A 1LE9B 2ZCLL 3VFOB 5TDNA 3OHXB 3SDDB 5IF0A 3QQ3A 4LSSL 4GKZB 2A9ML 5I2IB 3VXUB 5C0AA 4DGYH 4QRQA 1J8KA 2F58L 3BDXA 3HE6B 4KTEH 3MRIA 1NLDL 3FB8A 4X99A 3MCLL 1OT2A 2HTLC 5A1AA 3MV9B 1KCSH 4ZMAT 1RIUL 5IBLD 4N1EA 5EBWB 1TCRA 3PP3K 2GFBA 3PHSA 4R0LC 3CCHA 5HGDB 2ICWA 3L9RA 4L1DA 4CUCA 2EEAA 2MSPA 3MV7D 5ID1A 1TXKA 1J86A 1NDMA 4PJHF 4QHLB 1OAQH 4QTHA 3HG1D 2Q6WA 4FZEL 5HYEA 5MERA 4YGAB 2X4RA 3X12A 2FH8A 2Z91A 1ORSB 5KSBB 4YDJA 1MEXL 3ET9F 5ENWB 3KPOB 4HUXA 2IBZY 4Z0XB 1YEIH 2HFEB 3HPLA 4O5LH 2Y9RT 1HHIA 3MRJB 5L9DL 2ORBL 3QFJB 4GW5B 1JI1A 1TTUA 4NQDA 4JHBA 3CVHA 1UYWH 2A1WH 3GSWA 3WE6A 4NO0A 1IZKA 1JWSB 4JVUA 3TA3B 1YPZF 3JXAA 3RWFB 2NTFB 3ULUL 4JFFE 2ADFH 1QOKA 1KIPB 3FMGH 4JZJC 3IFNL 3I75B 1QSFD 4XPFH 4O9HL 3KGRA 2IPTL 3ARGD 3QI9D 5CS7A 4GG6B 4KTDH 3QBTB 3ROOA 1C5CH 2EH7L 1F58L 1NANI 5JW4M 2FJHB 4LLWA 5FHBL 3RX7A 1P7HL 3SQBA 3U4EB 1ZTXL 5IFHL 5FGBA 2X1XR 2C3HA 2XZQL 2VQTA 1T2QH 1FYTA 5F7HA 3UTQB 1XGUA 2ZG3A 1J5OH 2B4CC 3BT2H 1I3UA 3EDEA 3PQYE 1F6AA 1IC5H 3NPZB 1K8DB 5ERWB 3NPSC 3OKEA 1KACB 1M6OA 1QRND 4CDHA 1KFAL 3MYJB 5GZOD 4Y0GA 1CICC 4UTAL 1TJIL 2VLKD 5C2BL 3RAJH 3AS1A 3P4OA 1CT8B 3V8OA 3DX9B 4LRIC 3X14A 3BDYH 3V52H 5C9JB 1RZFL 5JIIA 3G5XB 4NNYA 3AROA 4OJFH 3S37L 2EZ0C 4OZHA 4LVEA 1CDYA 3U0WH 5E6YA 5F44A 4P2QD 3T65A 3SKNB 3O45A 5DJAB 5KSUA 3SCMA 4OZ4A 3DUSB 3NA9L 4NKQB 4JFHE 3O6KH 5HHOA 4MVBD 2DIJA 3UO1L 5KVDH 1EO8H 3PWPA 2APTA 4APQB 1MCQA 4LBEA 4XPGL 2A0LC 4FQXC 3DXAB 4XBPB 1FVCA 1JZ5A 5B39G 1SEBA 1UZ8B 3DYPA 4I9WD 4O00A 3VRLF 3Q5TA 4BSWB 5GRVL 1ZAGA 1I8LA 3HUJF 3IF1B 3T0EB 1NFIA 3VXUE 1XF3A 2B4CH 3JV6A 1BGXL 3T3PF 1OAYH 4F15B 1ONQB 4NWTL 1P4BH 3ZDXF 3REVA 1U3ZA 4LIQH 2HN7A 5GGTH 4RX4A 2FECL 3CZFB 5J9PA 3MV9E 1PKOA 2BNRA 3ECBA 3LRHA 1QHOA 4DKDC 4ELMF 2A77H 1SJXA 2O5YH 1S7XB 4JRYD 4NM8H 3EDJA 3NN8B 4DGYL 2AJZB 2QQNH 4M6NH 4KTEL 1JVKA 1T0MA 1FO0H 4CL7A 1F6FB 5GGRY 1C08A 1KCSL 2FHBA 3MUZ1 3EO0B 2EDEA 3TH2T 3IXTB 4PRIB 1RJZB 5HHNA 3FB6B 2UUDH 2AJ3A 3LQMA 5KSBE 1U8KA 1OTUD 1MAJA 1N2RA 3K3QA 3NA4A 2CKBB 2XQYG 3O6FB 4H8WH 5T5FH 2V7NA 4GUPB 5L2KD 1U9KA 4JM2B 2VLRD 4JO4H 2HLFC 5JOFB 3GJFA 4WHYH 4HIEB 3ABZA 3IFOB 5BJTB 4HGMA 3MOBL 5KANI 1YNTA 1YEIL 5CJQH 4O5LL 4V2CB 2BSTB 3ZKMC 4PJ8C 1X5LA 2FZ3A 4X6BB 2QL1A 3O0RH 4PGBA 3FT3A 1AR1C 1HYSC 4K7PH 4GG6E 4PFEA 3W9EB 2BFVL 1UYWL 2A1WL 3EO9H 1WCBA 2YBRB 1FDLH 3B9KB 3KDMB 1U3YA 4FZ8H 1JP5A 3G6DH 2ADFL 4NDMB 4BH7B 3FMGL 3QDJA 3FCTA 3GI9H 1ZLSH 3WLBA 3WBDA 4QGYA 4XPFL 1LP9F 3VXSE 4TVPH 4TNWF 4ORZC 5L0QC 1VACB 1C5CL 5F1IA 3VCLA 3O3DA 2VZ3A 3BHBB 4K8RC 1HZHH 2ERJC 3UTSA 3MC0A 1YN7B 1WIPA 2R1WA 1CZ8H 3RY4A 5DJCB 4Z9KB 1P5UA 3D85B 5GS1A 3V4PH 4FQCH 3MRPA 1W72H 1V7MH 1T2QL 3P73B 5JW5A 4XCEB 1BBJB 3MRNB 4IS6A 5KN5A 4W68A 3QIWA 4M7LT 1J5OL 1PY9A 3BT2L 5GZNC 4QXUH 1IC5L 3EJZC 4FQIH 1EBPA 4HGWA 2FEEL 2XZCH 3C6LA 4LVHB 1F90H 4PREB 4PY7B 1ZVSA 2OXGA 1SY6A 4I0PA 4JFXA 4DFHA 3L5XH 4BFIB 1A4KA 1XGQB 3VFRA 4Y1AD 3GSNA 1ZHKB 3RAJL 5IB1B 4MXQD 3C8KB 1Z9LA 3O11B 3CVHH 5TF0A 3BDYL 1J0JA 3V52L 4JDTH 4UIKH 2OMBA 4DQOH 4W6WB 1TZGL 4OJFL 4DKAA 1JWMB 3JSSA 4CADA 3MLVH 3MLZH 1T80A 1JGLH 4K8RH 3RZCA 3O6KL 4AEFA 3QNYB 3V6ZA 3QDMA 3DGGA 4EI5B 4NQSB 4LCWA 1EO8L 4OZIB 1N5YH 1AO7B 2ZG1A 1QLRA 4CVUA 3H3PH 4CMMA 2ZUSA 3BMWA 3CH1A 5E2UH 4JAMA 4AEIH 4MZ2A 3TP4A 4M43H 2B4CL 1I9RH 4W4OA 1LQSR 1OAYL 1EXUA 2ITDB 4YEEA 2DQUH 2XACC 2CDEB 4LF3A 4NN6B 1DUZB 1KPVB 1P4BL 3BIBX 4X6CA 4LIQL 4NT6B 1IKNA 1BFSA 2JELL 2DLHA 3G6AA 2CMRH 3GMMA 3SO5A 4JZOA 1NAMB 1V3MA 3KJ4C 1JGDA 4PRIE 5ACMA 1HOCB 2A77L 2O5YL 3IDMA 4NM8L 4JANB 1E6JH 3VXOA 5FDYA 4QOKD 3BZ4A 4NUGL 1AD9B 5C0NC 2QQNL 4M6NL 3RBSA 1FO0L 2ZOLA 5EBMB 1QLEH 1FL6B 4P4KC 2JF1A 6FABH 1RUKH 3T77B 5I1LA 4HKXB 1HHKA 3MOAH 5EO9B 2GITA 1AGCA 3HCVA 5IV2B 1JPTH 2JCCE 1TIUA 4YHZH 3VGHA 4E9LA 3KWWA 1A7PH 3VI3E 3Q3GA 2NMSA 3TN0A 1MWAH 1SVZA 2ZKHH 5T5FL 4H8WL 2R2BB 1JYNA 3RGVC 2PETA 1YEFL 3VWKB 4B53A 5CEZE 4RMUA 5BW7C 3OKDB 5A2LH 4YDVA 1LE5B 4DTGH 2NY3D 3FONA 2CQVA 1BX2B 4XTRD 1HHGA 5CEYB 3PXJA 1MCKA 1QBMH 3F6IA 3HAEG 3VFNB 3NTCH 3BKJL 5CJQL 4S1RH 5E4IA 5IHUH 3DMMC 2M1KA 3K8LA 3O0RL 1S9KC 2WIIA 2XFXA 2XTJC 3EO9L 4N0UA 3SE3C 5D2NB 1FDLL 5IESH 1WQVT 2GK2A 3FT4B 3G6DL 2NY7H 4QCIA 1A1NB 3HI1A 1Q9LB 5DMKA 1ZLSL 4UIMB 3C09B 3PP4L 3L7EA 4TVPL 5CP7A 4XGZB 5JMRA 3CUPA 3Q48A 5JA9A 4IHOB 1T5WA 2BMKB 4Z7QE 3V4UH 1HZHL 4H5SB 5KZCB 1OW0A 2VLJD 2VITA 1A7BA 3MRQB 5T1LA 1CZ8L 2O26U 3SO3C 3V4PL 1KNOB 3GB7A 4NQVA 5E9DD 1KLFA 1W72L 3ARPA 5HI4C 2NY4B 1CE6B 1V7ML 4QRUB 2VIRA 3VRJA 3TPUA 3TJHD 1HSAB 5DHVH 3MROA 2XWTB 4FQIL 5FO7B 2XZCL 3ARQA 2YPKB 5C09B 1F90L 4K9EC 2H8PA 3MLTB 1OCWH 2EE3A 1VFAA 3SKUD 5HVHC 1IAKB 1Q94A 1MFCL 1Z2KA 3I50H 3QUZD 3OJMB 3L5XL 3U9UA 3JVGA 4GFTB 1ACYH 3EOTH 3X13A 2V2TB 4JFYB 1D5MB 4HKZB 1G7HB 5HVWA 4TYUA 5F9WB 4EXPX 3EOBA 1HXMB 4OD1H 2W60A 2ZUTA 1MUJA 3KPSA 3CVHL 4P9HC 3RUGF 4JDTL 4UIKL 4HWEH 1K2DA 3O4OB 4UQ2A 5DRXB 1AO7E 4B50A 1T3FA 5DMJB 5F71A 3VWJD 1NEZB 1YNKH 3QUMH 5HHXH 3BPCB 3MLVL 4Y4KA 3MLZL 3TBVB 1HH9A 1JGLL 3MA7A 4K8RL 4MYWB 1MJ7H 5DF0A 4MJ5B 2VXSH 1N5YL 1MIEH 5BZDA 1K8IB 3OG6B 1FFOA 2VR9A 3P9WB 3T3MF 1R3HB 1WC7A 3B8YA 3H3PL 2BNQD 5E2UL 4AEIL 5I74B 4HFWB 4M43L 4X7SH 1D5XB 3GGWB 5D1QC 3VXPA 1I9RL 3ARDB 4LLDA 5E7BA 2DQUL 1GOHA 1U92B 1YDPA 3SDCD 4F9LA 1IEHA 2CMRL 3RNKB 3VGFA 4FFZH 3GMOB 1H5BA 4ZXBD 1JF1B 3HI5H 1ADQA 3TV3H 2W65A 2YR3A 1E6JL 5ID0B 3EJYC 5GS0C 4XMKH 1SY6H 5DHYA 4U1GB 5K9OA 1T4KA 4WRLA 3UX9B 3QIBB 1QLEL 6FABL 4P9HH 1RUKL 5DRZB 4L1HA 4Y4FB 4X7TB 4EN3C 4Y4HA 4NUJA 3O9WC 4DCQB 3QNZB 15C8L 4CNIB 2UYLB 3MOAL 4WTXA 4H0GA 4RQQB 3RL2A 5D9SA 4G7VH 4TNVF 4XNYH 2HT2D 4F7TA 1JN6A 4YHZL 1LO5B 1Q0XH 4IOFC 3TYFB 1A7PL 2DWDA 4GBXB 2DQIH 4PJAA 4WI7A 4OLUH 1MWAL 1NSNH 2ZKHL 3IFLH 4YBHA 3S4SA 4PJ7B 4GOSA 1CE1H 5DJDB 3LH2H 4QGTA 4BFBD 2KBGA 1CFQA 3BQUD 2F54A 4PGDA 1KTLB 1UENA 4ZQKB 3TJEL 3GFUA 4DTGL 4XP1H 3L5IA 4GRLC 1HQ4A 1J11A 1QBML 2PYFB 4XAKD 3NTCL 3BZEB 3TCLB 4S1RL 2E6QA 1MFNA 3ZE2E 5IHUL 4P46B 3UTZB 1NJ9B 3PWJA 1U8MB 2UWEF 1DE4A 1M4KA 1FFRA 3U30C 3F7YA 3PL6A 1JZ4A 2Y6SD 4ELKA 5IESL 3DV6A 1QFUH 4L3EB 12E8H 1YY9D 2A6IA 2NY7L 1TZHB 5F7KC 5GS0H 5C6TH 2XY1A 4RMTA 4CAGA 5FF6A 4X6FB 1ZSDB 3RVUD 4RAVB 4MCYA 2P7TA 1KT2A 4XP5H 1J87A 2X4PB 3N1MC 4ISVA 3T2NH 4OFPA 3LRSB 3V4UL 2CLZA 2Y36H 2D2OA 3FOMA 5FYKU 2ESVD 4FRWA 1OTTC 5HVFB 4MNHB 3MO1A 5C09E 3QJHB 3I6GB 4D94A 3SDYH 1MI5D 3K4DA 3KLAB 2YD6A 4MA3B 5DC4B 1F4XH 3HTLX 1U8JA 1RJLB 4ZUUA 5C0AD 1HCFX 4G6JH 4D2NA 1VKXA 4WWKB 2FRGP 4L8SC 1YMME 3CDCA 1NMAH 1OCWL 3STBA 1Y6NR 1UJ3C 2GJZB 1ZGLA 4JY6B 1L7IH 3I50L 4NCC1 5HDBE 4UT7H 2OJEB 1ACYL 3EOTL 4AEHH 3MRMB 4FMFA 2VDLH 4OIBA 4JKMA 3MV8A 1TQCC 5GSRB 2LU3A 3OX8A 3BI9X 4P2OA 4OD1L 4NKDB 4ONFH 1IEAB 2GJJA 1BVKA 1OTSC 4Y19A 3RX5A 2GSGB 4GKOA 4HWEL 4FQHB 5KVFH 4G9FB 4LLQA 1UT9A 4HMDA 5E24E 1YNKL 3QUML 1I1RA 1R5WB 1EZVX 2Z35A 3H3BC 3U36A 1JZ8A 3AREC 3RWCB 4KY1H 1JWUA 1MJ7L 2EH8H 4NN7B 2A2QT 5DUBA 1UEMA 2VXSL 1X7QA 1MIEL 3GSOA 4EI6A 3BE1H 4FXGB 1FLRH 3BPNC 5EZOH 2YWZA 1VEPA 2VXQL 4X7SL 4A6YB 1EO5A 4RAUA 5DK3A 2MOVA 3GSQB 5D7KE 3V6OA 2VMFA 4MSWA 2WNGA 1MHEA 3MV7B 4H1LA 4FFZL 2DLTA 3PWNB 1EMTH 1BVLB 4WO4C 1KGCD 5B22A 3P9MA 2DL2A 1S7RA 2QV2A 3HI5L 3ZKSD 3TV3L 1DQQB 4Y7MA 1E4JA 1M7IA 4XMKL 5IG7A 1SY6L 4TPRH 3SHSA 1WFNA 3KYAA 2QR0A 1ETZB 4P9HL 4L9LB 1F4AA 2BHZA 4FS0A 5EBLB 3MNWA 5EC2A 4XI5C 2H41A 4YWGH 3QH3B 5J13B 1A7NL 2APBA 5TDOA 1ZHNA 4G7VL 1PVHA 4GRWH 1FN4A 1J8HE 1NCNA 1CL7I 2IAMC 4XNYL 5DDHA 2FJGB 4D9LH 3S88H 1Q0XL 3ME0A 2NQCA 5I6XC 4U33A 3WNOA 1AD0A 4UNUA 4E41B 4OLUL 1NSNL 3C2SA 4I18C 2WW8A 2XWBB 4MS8C 5LVEA 3HLAA 1CE1L 3NCFB 4HFUH 5HGAB 1IC7H 4F7EA 3LH2L 5IVZB 5EOCJ 2Y4SA 1RJYA 1QSFB 2VZ1A 1EX0A 1P7QA 1F3JB 4HAGA 1WAAE 4XP1L 3VD4A 3ARGB 5DC9B 1RV6X 4L3EE 3QI9B 1BJMA 1DL7L 4FXKB 3HB3D 2GTWA 3QUXC 4DFIA 5HYFA 5F88B 5JIHA 3SKJH 5LAXA 5ADPH 4OLXH 4RBPK 3OXRB 5IP4A 4HBQA 3TBWB 3A6CH 1BZ7B 4OV5A 4K55A 2LVCA 3DI3B 1PZ5A 3SCMD 5J12B 5HHOD 1QFUL