1TPXB

Ovine recombinant prp(114-234), arq variant in complex with the fab of the vrq14 antibody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
212
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNLVKQAPGKGFEWMGWINTFTGEPTYADDFKGRFVFSLDTSASTAYLQINNLKNEDTATYFFTRGTDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords major prion protein
publication title Insight into the PrPC -> PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants.
pubmed doi rcsb
source organism Ovis aries
total genus 41
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2004-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tpxB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tpxB02
1W72A 3L5IA 4X8JB 1WJ3A 3H0TA 4NRZA 1U0QA 3NA9L 5T1MB 5EC2B 3V0VB 3A67L 5IT2H 1N2RB 1I3GH 4F9LC 3MRDA 2PYEE 4CAGA 3RX7A 4UIKH 4KK6D 4LLMA 2Q3ZA 1RZ8A 2BSRA 2YC1A 4F9PC 4HJJL 3QEUA 32C2A 4ESKA 4HUNB 1YJDL 4BFBD 4ELMB 4KTYA 4K8RL 3E8UH 4I0PD 4A2LA 5CIPA 5JOFB 5C9KA 3MRIA 4PY7A 3S88L 2H32B 3RBSA 5H94A 1AR1D 2X9XA 1GGCL 5I76A 3E6FB 2W9LA 2I5YL 3HCVA 3MUJA 4ZFOA 2B5IB 5DRWA 4NKIL 1ZA3B 4UOW1 2LV4A 1CU4L 1J8HD 4MXQC 1KJMB 2BVYA 1Q0XL 4AQOA 1OB1B 2BSTA 1MCQA 4JZJB 3KPMB 1VCAA 4J6RL 1EXUA 1FNEA 4QRRB 5GSRB 1K4DA 5CZXD 3CX5J 1JWUB 1U8PB 3W0WA 2B4CH 5ETUB 5HJ3A 5HHVH 1Q9OA 4Z76A 4U7KA 4DEPB 3RTQC 1F13A 4UINH 1HXMB 2XICA 4PLKC 4UU9B 5C7XL 4HCRL 5DJYA 3VFGL 5FHAH 2DDQL 1RZFH 5L88H 4U1JA 4HGMA 3IETB 1F8TH 1L4IA 4XPTL 4U6VH 1VGKA 4QYOA 3GHEL 4Z7UF 5ESVA 3DETD 3FRUA 3H9YA 5K9OA 1NCDL 5DDHB 4PJGA 2CKNA 4YDLC 3W39B 4KJYB 5J11C 3H7BA 1T89A 3MZGB 3ARGD 1RZJL 2YRPA 4PYGA 1S8DB 3DVFA 3SJVA 3MBEA 1PFCA 3SKUD 5CLTA 1NBQA 5DZNA 1A6ZB 4WHYG 1QFPA 1JZ3A 1RVFH 2FJGB 1PX3A 3DROB 4CNIA 2F58L 4QHLB 4G6FD 2I9LA 1I3UA 2RR3A 5F7LB 3CXHJ 1UQSB 2EYSA 3TH2T 3UCRA 3TVMB 4LSRL 3WKMH 1YYLL 2FLRT 4R3SA 5BO1L 1FSKB 1EO8H 3H3PH 2XXCB 5I1CL 4M7KL 4Y4HA 4CW1A 4XPBL 2CKBL 4KKLC 3B2UD 5FM8A 2X40A 4MNHA 2AV1B 4M00A 4N9GA 3U4BL 4FTVA 2ZCKL 4HC1L 2DYPA 4NKMB 1S7RA 1Q0YL 1UENA 3U6RA 4YHKL 3HTLX 3MRFA 2C3VA 2FEEI 4JFEB 4MWFA 4WUUE 4OJFL 2DI7A 1ACYL 4P3CL 1S7XA 2ADIA 3BX7C 3HI1B 4GRLA 4X9HA 1ZT4A 5JW5B 1FIEA 3WIFB 1KFAL 3CFKB 4MJ5B 3L3HB 1EFXD 5C6TH 1CL7I 4QT5A 1CVRA 1ZHBA 4YPJA 1P53A 5I8CB 2BOBA 3QIUB 1NMCB 2I07A 4K7FB 4P57B 3I6LD 1A14L 4L3AA 5E8EB 3IDGA 1FLRL 1MRDL 5C08A 3QYCA 4TQEL 3FO2B 3BGMA 4M1GH 4LL9A 1DLFH 4YGAB 5F3HB 3HZVA 2BVPB 5KSBF 1UCBL 5DGQA 1JRHH 3MFFA 3ZT7A 5D7IA 5CIPH 1YMMD 5KN5B 3LS4H 1MIEH 3U9UB 1QG3A 3V6OE 1N7ML 3VXRE 1LEGA 2XPGA 5CEXB 1B4RA 2VTFA 1JWMA 3OKKA 4JM2B 4JZOA 5IB3B 1JP5A 5B3JE 4P2CG 2D9CA 2EDNA 4OLZL 2VMFA 3VXTA 4HUXB 5JO5A 3NGBC 1CBVL 1IKNA 4LSPL 2X1QA 4KJQD 5GHWL 4GKNA 5ACMA 3AM8A 5EDXA 4HWEL 4ZXBC 1KIPB 3R4DA 5D4QA 2ZPKL 3RWJB 1BEYL 5IEKA 3WUZA 1RJLB 1TZIB 5ANMB 5IG7B 4KZEH 4X7TB 1IC5L 4OLWL 4ELME 4FQCH 1CLOH 3ZE1F 4HS3A 4E41A 3KNBB 4XPFL 5GS0H 4EI6B 1YDPB 1A1OA 3DX6A 3IU4H 4LLAA 1KV3A 2BCKB 4PREA 5H37H 2IG2L 1BGXL 3OGOE 4N5ED 1NGYA 4RAUB 4FQIL 2RAMA 2H2SC 5C6WH 1DBMH 4UBDC 1FNAA 3C5SB 1B4JL 3DBXA 1J1XL 5D9SA 3WHXB 1A9EB 1GHFL 1SM3H 3BZ4A 4HWNA 2A6JA 3DYOA 1FVDB 2VXTL 4LPUA 2F74A 4YHML 1KTDB 4QRRE 3RNQA 1A6UL 1KNOB 3UBXA 3VFNA 5CD3A 4XC1L 5C0DA 4X98B 4BFIB 1S9YB 4OD3L 5ISZD 1CFNB 4PJAB 5DK0A 5HSFA 3M17B 3RHWF 3ZTNL 3MNZA 5IROA 4Z7NF 3ARBB 3T0EA 1F58L 2DI8A 4A6YL 4HT1L 4JANB 3I2CH 5E0QA 3TIEA 3E1F1 3SGEH 4DN3H 1AC6A 3BQUB 3KPNA 5HYSB 1J05A 1ZANL 5FXCH 3D25A 3VH8B 3BUTA 4HHAA 2DQFB 4WI7A 3FB6B 4LCIL 1YEGH 1BZQK 2G60H 2X4RB 5IWLC 1DQJA 1YNKL 1ORSB 4XCFH 2Y25A 3D3VB 3SY0A 1RPQA 4AM0B 4BH7A 3L5XL 5D2NB 3L5HA 2E9IA 4KVNH 5MEOB 3IJYA 4GAYA 5KTEH 1GH7A 4OKVA 5C0AD 2A6IB 3CLEH 5GGQL 2G5BB 3U4EA 1ZV5A 5DK2B 5B4MC 1UWGH 1VFOA 3ZL4L 3L6FB 4YBHA 2EE9A 3N9GL 1T1WB 4KHXH 3WO3B 5FEBA 5IR1A 4TUJA 1V3MA 3QJHA 4DCQB 3GDBA 4N0YH 3VA2C 3MRCB 5KS9F 4EI5C 5I1LB 4LFHG 2A38A 1P9MA 4QTIH 2G2RB 2ZSWB 1AGEA 4YAQA 2WBJC 3PP3K 4WFED 1J5OH 5E9DD 2Q6WA 2DJ4A 3QUKB 4KDTA 2NXZC 4EXPX 4JCMA 5FIEA 5DSCB 2Y36H 1UVQB 2ZCHH 4NJAL 1NDGB 4BSWA 5IW6A 1N3NA 1OTUD 1KLUB 5HDLA 1MCPL 4KMLB 3O0RL 4IJ3B 5KVGL 1J9CT 4NRYA 3DV6A 4XVSL 3TP4A 2EKSA 3QH3A 2F8VA 2QV2A 4I9WD 4QRTB 1ZOXA 1A7OL 4DVBA 3BKJL 2UWEF 4CUCA 4FABH 4XAKD 3BEVA 4B0MM 1BJMA 1WLHA 5IHLB 3KR3L 1XF2B 4JDZA 2AK4A 4EVNA 4GRWF 1HEZB 1YYML 1U8MB 2CRIA 4KJWD 4D8PA 1MJJB 4G8GE 15C8H 2LFGA 3UJTH 2YPKA 3QDAA 3H9SA 2BSSA 2X09A 1QSFA 5KVFH 4ODSH 4B7IA 4WHTB 4P2YA 3CSGA 4GKSB 3IFNL 3HZMB 4DN4L 1SVZA 3HB3C 4HZLA 1NAMB 5I15H 4PGEA 3U36A 4X7EC 1JZ8A 1I8MB 5TQ2H 2AJSH 5ANME 3OKLB 4U1IB 1N0LA 4K3JL 4LDLB 2APBA 2PO6B 2XFXB 5HHNB 4MXWL 4PB9L 5I75B 3L3KA 4JRYD 3LN4A 3PWLA 4J3SA 5LQBL 3BYTA 4MAYC 4S1QH 4FP8L 5EBMB 3ET9F 1WBXB 5M7QA 5LGJB 2DM4A 5TDPB 2CXKA 4OD2B 4S0SD 5K9JH 3QXDB 4KPHL 1BHGA 3BDYL 1GIGH 1BQLH 4OF6A 4U1LA 3EOTL 1G7HA 4XXCC 1INEH 2A9MH 1R5VA 3SDAA 3MV7B 1OCWH 1NCCL 3MNVB 1B90A 4LRIA 1IM3A 2FX8H 4GW4B 3LKRB 4V2BA 3GSVB 5EZIL 5E8PB 4MJIB 4PJAE 4LNVA 5L2JA 3TBTA 4G80B 4MA3B 2F54A 4IM8A 4JG0H 1MELA 4X4XA 5IUSA 2JLLA 1DL7L 3RIAK 4GW5B 4PJ5D 1F90H 1OAYH 1VA9A 3HUJF 1UXSB 3R06B 1WEJH 5DJZA 1NDMB 4EN3D 3EYQD 3VWKB 5GS1A 5HGHA 4ZS6D 3A6BL 4J3VA 3HLAB 4ZD3L 2UV3A 5KVMC 1K2DA 1WCBA 5MEQB 3U2SB 3FQTB 4RGMB 2AXGB 3OR6A 1GGBH 3B6SA 4WV1A 1P4LA 4P2RD 2AJVL 3MRNB 4G7VL 4LHUB 4K2UH 5FYLE 3GMLB 2NY7L 3D3VE 3Q1SL 5GRXG 1NCBL 1J88A 2VDLL 5D6DC 4BSJA 1K4CB 4PP2A 2R2BA 1CDJA 3IFPB 4XH2A 5KW9L 2AJYH 3VFWB 2HFFB 5E6IB 1CICC 3BWAB 5EN2B 4IRSA 1KIRA 4C59B 2VRAA 2WBWB 4MB5A 4P4KA 3CDGA 1U8JA 3ESVF 4YC2B 4HKBB 2W65B 4S1DD 1BFOA 5DQ9A 2UY7A 3MRQA 2X4NA 1JV5B 1LMKA 1QFWI 4I2XA 5JZ7C 3CVIH 3QDJA 2R0WL 3MRGB 1X4ZA 1EFQA 1K3ZA 1TZGH 5DEGB 3RVXD 5CBEB 2MWCA 1AXSB 1MFAH 2AEQH 4OLYL 1MRCL 4IRZL 3QSKB 1VSCA 5BVPH 5C1MB 1A4JA 2M8XA 1JL8A 5E95B 2FIKA 2MKWA 3MOBH 3WFBH 1J87A 1H0DB 4OFPA 5AAWA 4Z7UA 5FYJE 4QOKA 3RX8A 5JHDD 2J8HA 4NT6A 3BKCL 4PB0H 1J0KA 4Z7QF 2HT3D 1DR9A 2YBRA 1Z0MA 2NX5B 5AZEH 4KTDH 5IVZB 4JGMA 4QHUA 4QRSB 5AZ2L 3MLSH 1CGYA 1H8OA 3B9KD 3UJIL 5DA4A 4G9FD 3GMRB 1DVFC 4M1DH 1TQBC 2F19H 3JTSA 2BJMH 4D3CH 1QSEA 4NUGH 4PJCB 1RIHL 2DLIA 3VD3A 4X6EB 2IH1A 4JFXB 3BKYL 4IOIA 5C3TA 4X7DC 1J1OL 3QIWA 3BIBX 4RGNB 3WDIA 3RWIB 4XCYA 2HT4D 3WUWB 2R8SH 4LSTL 5IM7A 3MV8A 1YPZF 5L2KD 3VGFA 4I5BB 5E2VL 4ZDHB 5A1AA 5L0QC 1DE4B 1R3HB 3RVWC 5KBNC 4MD4A 3VCLB 2VXQH 5J06A 2X4UA 1JWSB 2W9DH 2NY3C 2OMNA 1HQ4A 4JPIA 5FGRA 2PCPA 2A6KA 2EZ0C 5ICYA 3QUXA 1RIVH 4NNXB 4OFDA 1S7WA 3HMWL 3GBML 5FOBA 5FYJL 2ZUSA 1X5FA 1DANT 5DZLA 1F3RB 5I6XB 4Y19D 3EYVB 3P77A 1SVCP 2J12B 4JKWA 3S5LB 4NSKB 4R26H 3SGKA 1T04A 1UKSA 4F37K 2A6DA 4LSUH 2D03L 2IAMC 3VFRA 2DS4A 3LEVH 4PJDB 4G7YH 3TYFB 4XI5D 4XP4L 3MV7E 4R2GB 3RWDA 2WM0A 5KSBA 4P5KB 1GOHA 3WIHL 4R97C 5IHZA 4D9QD 5CEYB 3GBNH 3OF6D 5C0CD 3O4LA 1F5WA 1ZVHA 4PJ9D 4MJIE 1CQYA 4N1HB 1PY9A 5EBGA 5I8KL 4YPGA 2HFEB 3SO5A 5HI5C 4XX1G 3C9NA 3LH2H 2V2TA 1U58B 4HFWA 1BVLA 1NLDL 5D5MB 3QEGH 3RZCA 4JY6A 3RHWK 1A1NA 4WNQB 5E5RB 3ARQA 5EORL 2R2HB 4RAVB 3V5KA 4MYWB 3TT1H 5MENB 6FABL 3HE7A 1OGAA 3MX0A 3UYRL 2VWEE 4W6YB 5I1KL 3GMMB 1JGVH 1YZZA 2JK5B 4XCCH 4YXLH 4XCEB 3MCLH 1MEXH 2B1HH 1JI1A 5DS8A 1XGPA 1CGXA 4XP5H 2P5ED 2A0LD 3MJ7B 1LP9B 3EHBC 5TE4H 4OCLC 5TQ0L 4OIIH 3MMEB 3NFNA 4LVEA 1FO0A 1I3VA 1JTPA 3HPLA 4LCWA 4OV6F 4PRPB 2DIAA 3VI4E 3ZDZE 1NEUA 1LK3H 4ZUSB 3ARFB 4GAJL 2I9TA 1WZKA 1U93A 1MHPL 4KK9C 1JFQH 4HQQL 5BOPA 1T1ZB 5LXGH 2F15A 3FN3A 5AYUH 2OR7A 4Q58C 4QWWD 4QXGL 5BV7H 3LB6C 5IB4B 2YHGA 4MA1C 3DUUB 4HAFA 1JF1A 4XMLL 5I1AA 3LKOB 4X80H 4EDXB 5A16B 4LPYA 4YHIB 1QD0A 3VXOB 4XCNB 4Z7VA 4APQA 1UJ3A 2KDGA 4MCZA 2R2EA 12E8H 2HN7B 4LEOA 2ILLA 4NP4L 1T80A 4HKJB 4MB3A 4HBCH 2ADGB 1R3JA 2NCMA 2NY4D 4DUWA 4KRPD 1J0HA 4JO3H 1ADQA 3NACH 3O2WL 4OF3A 4YIQA 3FO1A 3LQZA 2V5TA 4LP4A 5EB9A 2D7QA 1LEKB 3QG6A 1AE6H 2FRGP 1LDPL 1X44A 4IRJB 4BZ1L 3I3DA 4P5TD 4KMQA 5HYJD 1MWAL 4O02H 4RMVA 4LCCB 3AB0B 5C9JB 1VB9A 5EOCH 2NX5E 4O9HH 1U92B 4OLEA 3BN9D 2DMBA 1QBMH 3STZA 1CI5A 4W70A 2B4CC 4PD4J 3RBGA 2O61B 4U1HA 4I0PA 2VABB 4GXVH 3H2WA 4HIXL 1MY5A 4IOSD 3G5XA 4KWUA 1G7QB 4PJCE 4MVBC 3QNYA 4WW2B 3H3BC 1SY6L 4Z7WA 1YNTA 3RL1A 1MCBA 2J2ZA 2R56H 5E2TL 1J8HA 3LEYL 4RGNE 3F5WB 2DBJA 4Y5YB 4MAUL 3FOMB 3AMKA 4FMFA 3DYPA 3V4VH 2QEJA 2DQEH 3I84A 5HHMD 4PLOB 1MJ8H 1CFSB 3CMOL 1QACA 3K1DA 3FB5A 4PGZA 3KLAB 1DFBH 1G9ML 2ATPB 1MCCA 4ZUVA 4NUJA 4ODWB 3RWHA 1OAQL 1N8ZA 3RJDA 1OTTC 2AAVA 3P4LA 1FNGB 2Y5EA 3KYNB 1OF2B 4IMLB 1R24A 4TOYL 2Z93A 4OV5B 1Y6MR 4LHQB 2WIIA 1ZHLB 3CD4A 4X99A 4PG2C 5CJOL 4PJXB 4DZBB 3BISA 3MRKA 4LLYB 4RAHA 5DQDH 4EUPB 2ED7A 2PTVA 2UWEA 4KGLA 1KPRB 3O11A 4PJDE 4Y16C 3LKNA 1UG9A 3CX5K 3BSZL 3WE6B 3VI3E 4DGIH 3ARGA 3FT3A 2PXYD 3S37H 2KZWA 2VQ1B 1FNEB 1RJZA 2FL5B 4P23B 5DI8B 2DWDA 4M48L 2H8PB 5MI0C 4L3CB 1ORQB 5DTFB 4UOW0 4JFDE 4RNRA 5TF1L 4QNPF 3GJEA 5D5ME 3GMOB 3FZUC 2J8UF 3VXPA 3NAAL 4WCYL 5GGRY 3FO9A 1IAII 1Q8MA 2X10A 5BS0B 1AGFA 1T21A 5DVNA 5HGDA 3KPPB 3PV7A 3PV6A 5EBWA 3DIFA 5MENE 4KROC 4CU8A 5IMMB 3F7QA 4PUBL 1OGTA 1NC4B 3X3GL 4JPVH 1D7FA 3PE9A 1M71A 1XR8B 1ZSDA 4IMKA 5E2UL 1A8JH 3P2TA 3T3PF 1LP9E 3VFTB 1ADQH 4MNGA 1X6NA 4W6WB 2ITCA 4PRPE 1ZGLA 2P5WB 4I1NB 1NFDF 4G6JH 4NQSA 3CXHK 4HFUH 1EFXA 5CJ8A 5D70L 5IT2L 1W0VA 4F58H 1I3GL 2I60H 3BVNA 4XNZC 4UTAL 4Q9BA 3AMLA 1HI6B 4UIKL 2AERT 3PGCA 3E2HC 4HK3N 4F7PA 3ARZA 4ZMAT 3ALWA 5IVOA 5LCVH 2DOCA 4HIJA 2YUZA 2FJFA 3E8UL 1IGTA 4BM7A 4NFDA 1YMMA 5D7LE 5MEPB 4W4NA 3EDKA 4ZYKB 2PKDA 5GS0C 4BQ8A 1G9EA 3C09C 1LE5B 3G08B 1FJ1B 1ND0A 4MDIA 5GRZA 1MCHA 4HJGB 1KJVB 3HUJA 2W60B 4GXUN 1GPOH 1FAIH 2P42B 4C57C 3CH1A 5D93C 5E99H 4PRDA 2IEPA 5INCB 1MCOL 1ZXQA 5GGTA 3VWJD 1ZLSH 3FONA 1YA5A 2IAND 4YHYC 1EJOH 3PHSA 5DJDB 5JOPD 1A3RH 2KKQA 4HKXA 3QXAA 1UWXH 4I3SL 4NN5C 5HHVL 1NBZB 3FAWA 2ZUQC 1MRFL 4NC1E 4OZFB 1JN6B 3VD5A 1OPGH 4NYLB 2UYLA 3WEXA 4Y8AA 1DBAH 4WUKH 1RJYB 2V2WB 5FHAL 1T0NA 5L88L 2UY6A 1F8TL 4U6VL 5T1LD 4HUVA 3ILQD 1QFWM 3WJLA 4Z0BH 2AEIT 5I74B 3D2UD 3NIDE 5D1QB 4PGJA 1QLFA 1U8IB 5ESQA 4Y4HC 1W0WA 2PW2A 4UDTA 3DRTB 3D5OF 4EDWH 3IFOB 5DHYB 3P4MA 1HILB 4GRWH 3QA3A 2FX7H 1PZ5A 4WU5B 5ISZA 5HY9B 3QO1A 1HSBB 3ARWA 3WLBB 1BBDH 1R5IA 4M4PA 5ACZA 4ODHL 2R23A 3OG4B 1RVFL 2HRLA 1T6WA 1E6JH 4GRLC 4NQEB 3ULUD 3BKMH 2HTLD 3FCTA 4PLJD 4Y5VB 3WKML 5KAQF 5IB1A 1PEZA 1EO8L 1IQDA 5FM5O 1O7SA 1TQCC 4N8VB 4NHUB 1YY9D 3H9HB 4XBGA 5D96C 3B9VA 3P4NB 4JO2H 1RIUH 5F7EH 1G7LB 1ERNA 4MX7A 3CXDH 1W72L 5DO2D 5C0ND 4XZUA 3IKCB 5GZOD 5C0AA 3PIQB 1T0PB 2NR6D 4J4PC 5C6TL 3PWVB 1IKNC 3DO3A 5DFTA 2J4WL 2CLZA 2W92A 4P49A 2CGRH 2AEWA 2FO4B 5BS0E 3V6FA 1YPZA 4Q6YA 5DJ0B 3K4AA 2V6HA 1XCTB 2Y7QB 1IZJA 1WBZA 1JI2A 1DLFL 3OXRA 2Q87A 1CGTA 3KYOB 1JRHL 3L7FB 4FQJH 4LSQH 3LS4L 5IB2A 1MIEL 5INDA 2Z31A 5HHQB 5GGVH 5GISH 5CJ5A 3JBG7 4YFDB 3DMMD 4OZ4A 4ZFOL 1G9NH 5E9DA 3L3OB 4EJ1C 2DB8A 3PDOA 4XWGH 3SGDH 1OLLA 3BMVA 5TH2B 4UDUB 1DN0A 3C2SA 4ZOBA 3QNZB 1LO3H 5GGTH 3KYMA 4NZDA 2OMBA 2A1WL 3INUH 3RTQB 1V7NH 4H0GA 4KZEL 1ZLWK 4Z78B 1HWGB 1MNUH 4HEPG 2VDQH 3MJ6A 4LEXH 4Y4KB 1CLOL 3C60C 4LPWA 1G6RB 5GS0L 1URLA 1T1YA 3P9MB 5L7XH 5T1KB 5IROC 2LAAA 4CN4A 3U0WH 3IU4L 5EU6B 2HKHH 4DUXA 2QJDA 1F00I 3GZKA 1RURH 2F5AH 2HMID 4AEIH 5IF0A 1LQSR 1U3HC 4OIAA 1WF5A 2ICWA 2IPKA 5J11B 1RV6X 1CGSH 1PDKA 1IZKA 4HKZA 5HHPA 4X9BA 1SM3L 4NRXB 3GJFA 3MREB 3EYOA 1N5YH 3KXFB 2Z35A 3AS0A 4KKCC 3CU1A 1LVEA 1RUAH 2P8LB 5EO9B 3ZKMD 2QQNH 5K9KA 1CXIA 1HYRC 2NY2C 5C08E 3PHOA 5IQ9A 3GO1L 1FBIH 1U6AH 3MRBB 4I4WA 5JIIA 3OJVC 4JRYA 4DZ8A 2VLLA 3TPUB 4WJ5A 5MERA 3I2CL 1C08B 4NGHH 4DN3L 4Y2DB 3NOIA 1MLCB 3HNTH 4BH8B 5SX4I 4KVCH 1ZVYA 1M6OB 3TM6A 1KC5H 1FE8L 3MA7A 2OM5A 3X12B 4WTWA 4KC3B 1YEGL 3HZYB 2FH6A 5DEZA 2G60L 1S9XA 5HHOD 3S36H 1C5CL 2VDNH 1CDGA 4XCFL 1XEDA 4H0HB 4UT9H 5A40E 2R1WA 3QI9D 3ZSSA 4NZTH 4PTUA 3OMZA 4Z5RB 2Y07L 3V7AG 5CSZA 1AJ7H 1C16B 4N9OB 4ZSOA 4N90E 1UWGL 4WY7L 4NQEE 1S78C 4PJ5A 4P3DB 4E41E 4KHXL 1A4KA 1CD1A 4PR5B 4ZNEA 1LK2A 5KANG 4LQ1A 1NANH 1JZ6A 4EN3A 2FGWL 1HHGA 4N0YL 5IJVB 3RDTB 2A74B 2C4FT 2ICCA 1O7VA 1WWWX 4YHOL 4TUOB 4LVNC 4WUUD 1KLGA 3RVVD 3U7WH 4P2RA 3L3DA 3O6LH 4JY5H 1J5OL 1X3DA 1F4YL 4HK0B 1UJTA 2Y36L 1UZ6E 5ALCH 4DJMA 5H2BA 4G43A 4RMWA 3VRIB 4NN6C 5BJTB 5ITBH 3M8OL 3Q6FA 1TZHB 2Z92B 4MA8H 3TN0A 3AREC 3T0EE 4MGXA 1XF5B 5I19H 1S7TA 5C0BB 2IQAA 1CG9A 1HIMH 1NBVH 1QRKA 3QAZC 1HCFX 3H9ZA 4E9LA 4FABL 3DLQR 3VXRD 3O2DA 1CTOA 1HKLH 3P30H 1BJ1H 5H8DA 1TETL 3MLYH 3QEQB 4U1MA 5HYFA 5IKCB 3UJTL 1T5WA 4POZC 3WNNA 3QZWG 3FN9A 1XF1A 5IK3B 3PF2A 5AAMA 4XAWH 4KK5C 3ULUF 2CRZA 2P24B 3GJFH 4RBPK 1HH9A 5JHDA 5LG1A 4ERSH 5I15L 3FTGA 3ECBB 1SMOA 2DMCA 1CD9B 3NIGE 3BEWB 4WHDA 1DLHA 3A6CH 5HD8D 5TQ2L 4LRIC 2J1KA 4FG6D 4QCIB 4R90H 3ZDYF 5I0DA 3B9KA 5C0JA 2R4SL 3F7YB 4G9FA 5DC4B 2YPLB 5FM5M 4WFFD 3IAPA 3T1FA 3QDMB 4O2FA 3C5JA 1NGZA 3SE4C 1MFDH 3U1SH 4S1QL 4M61A 3SKMB 1C5BH 4O2EA 5EU6E 3QP3A 3PWNB 4K7PY 3UYPA 2J8UA 3RWGB 1T1XB 1PJ9A 2C1PB 5EIVA 5FO7A 4F2MA 2GHWB 4KXZH 3IT8D 4PTTB 1FZJB 1QR1B 4QRRD 3S98A 3VXMB 3RL2B 2GAZA 1OCWL 5L2KA 1GCFA 1FFOB 2X1PA 3KXFE 3GSWA 4KK8D 2FX8L 2PYFB 5DMYA 2CH8A 1Z6JT 4X4YA 5JPNB 3P9LA 1UADC 5EOQH 43C9B 3PJSB 3LVEA 4PBXA 4JG0L 4ORGA 4OZIB 4KKBC 4YEFA 2XKUA 4G6AD 2EXYC 1E4XI 4JQVC 4XHJD 1NFDA 1F90L 4G3YH 4Y19A 3EOAA 2H2PD 5CFHA 3SPVB 4OCYH 4U1KA 3UTPE 4P4KC 1SJXA 2F8XC 4FFVC 5BCAA 1KCKA 2X4TA 5IBLC 5KZCB 1GGBL 1QEWB 5D2LA 1TIUA 5AEAA 1RK1B 3W9DB 4AL8H 4UILH 1I85A 2D4DA 4K2UL 3KHOA 4QTHA 3TZVC 5CILH 4R4BB 2CRYA 3OF6A 5C0CA 5ICXB 1U95B 3NFSH 4PJ9A 3SHSA 1MCFA 4U6TA 3ZMRA 2BNQB 3G9AB 1UKTA 2AJYL 3D1MC 2BOCA 4ZUWA 3H7LA 5KAQG 4HZAA 2HG5B 3TVMD 5I8OL 1LEIB 4JLRB 3F12A 5ESAA 3RWCB 4DGYL 3W5MA 5KSUA 1D6EB 1XCQA 5BV7C 5J1SC 1J11A 4XNQA 3MGTA 3OKNB 2EH8L 2R2CA 3CVIL 1IC4H 3MRJB 1DUYA 1EUUA 4BYHA 3REWB 1EEYA 3IDNB 1CD0A 4JFED 4L5FH 3U0TA 2VDOH 1TZGL 1EVTC 2P5EA 3U30C 3X14B 1MFAL 5J1AB 1ZT7B 2Y06H 3ULVE 5T3ZD 5BVPL 5I1JL 3MRRB 1I1FA 4LRNL 3T1WA 4NN7C 3QIUD 2EDRA 2EO1A 3MOBL 1RHFA 2F54E 3HI5H 3WFBL 3SE3A 3STBA 1CFTB 3BGFC 1PQZA 4DOHB 4FZEH 4U6HA 3WDJA 3SDXB 2A83B 5GJTH 1EHLH 5C0BE 4G9DB 2GTZA 2MHAB 1HDMA 3CVHB 5AZEL 4RRPG 3MLSL 4NKDA 1A6TA 1UM5H 2RHEA 1U8OA 4HEME 3MLTB 1I8KA 4HAGA 2HFGH 4M4RA 4LGSB 2BJML 4JM2D 1D5ZB 4OB5L 4D3CL 3KJ6L 3CSBA 5IOPA 4L8BA 2XWBB 4R6UA 3QEQE 3UDWA 4LARH 1AP2A 3EYSH 3G6AA 3K8KA 5DT1L 2HJFB 2R8SL 3MXWL 2NNAB 4O5LH 3WNLA 5CAYB 5SWSA 1KCUH 2CLVB 2DLFH 4P5TA 5HYJA 1C7SA 1LILA 4RCAA 3K8LA 2VXQL 1BOGB 4NO5A 1RQ5A 1R5WA 1YEDB 1XGYH 1LO5A 3RRQA 4U1NA 1RIVL 5CCKL 1TTFA 2YPLE 3VJ6A 4CU7A 3QDME 1UZ8A 3L3JB 3FB8A 5HGBA 3EUUA 3QULA 3OL2A 5BXFB 3RZCC 2FJHB 1B0WA 4HUWB 1PY4A 2EEAA 1SJHA 4K3DH 2YSSA 1P2CB 5DQJA 5JDSA 2XG4A 5JR1H 4LSUL 4KI5E 4YDJA 4CBPA 3QQ4A 3VXME 2V5MA 3ARSA 3GMNB 3VFSA 4G7YL 4UMGA 1E27B 2X89D 4Z7UE 3IDJB 2VXUH 3JV0A 4IBLT 1MJUH 2FECI 4PD4K 3ARBD 2EE2A 3GBNL 4MSWB 1F45A 3RY4A 4S0TD 5B3JF 3HR6A 4Z77A 2XQYK 3BQUD 4TN9A 4UT6L 3LH2L 5CP3A 3OAUH 4JB9L 1B0RA 1G0YR 4FQLL 5DJCB 1MHEB 1G7JB 3SN6N 5HYQB 3V2AR 3HC0A 3G5ZB 4U4BA 25C8L 4KDWA 5CHNB 2YEZA 4GMTH 2ARJQ 3BZFA 1IGJB 5FYLD 5DURB 1HHIA 3D3VD 2MCPH 4ELMF 4XCCL 4APQC 4ONHA 1UH3A 1MEXL 1SEBA 1UJ3C 2NXYC 3RWFB 3TBSB 1HCVA 2A77H 5I1DB 1FNSL 1C7TA 2PXYA 4QGTA 4HDIA 5TE4L 4HIHA 5F88A 1T0MB 4OIIL 3OG6B 3BE1H 2ZOLA 3GSOB 2GFBA 3IVKB 4ONGL 3OGCA 5E4EB 2BNQE 1S7UB 5E8NB 1IAKB 5KSVB 4X6BA 1E0OB 1JFQL 3W5NA 5LAXA 2WK2A 5EWIL 4X6DB 4Q6IC 5DVLA 4F33B 3LEXA 1MFBH 4LLDB 5BV7L 3MRHA 1DVFB 3DOSA 3SEPA 5SWZB 1TQBB 1VEPA 3SQOH 2XTJE 4HX1A 1UGNA 4X80L 3CU7A 3WN5C 3X13A 1GXEA 1GGIH 5C0FA 5DMJB 2HTKC 4JR9L 3E3QE 4GT7A 3MUZ1 4Q74A 12E8L 3EO9L 1KT2A 4I0PC 2RCSH 5CJQH 3RU8H 4HBCL 5GGVY 3PL6B 3HC3L 1AR1C 4CMMA 1A6WH 3L7EA 2OP4H 4R7NB 5FYJD 4HIEA 1F11B 2ITDB 1OAUH 3MRMA 1BX2B 4BK5A 1G7PB 3E6HB 3WS6A 3BH9A 5L0QB 1QRNB 2DM2A 4K7PX 2ENSA 5IFJA 1I7ZB 3DVGB 2VN7A 1QUNA 5FKPA 2P48B 3TPKA 4DOHE 5BVJB 4O02L 5I8EA 1H3PL 3SDXE 3WMSA 5EOCL 3VXUB 3B9AA 4NNYB 1X9QA 3GSUA 2EDEA 3I75A 5CZXC 4UV7H 1T66C 3VGAC 5M95B 3DIFB 2EYTA 3JVGA 3PWPB 3QIBB 2OZ4L 4TSCH 4GXVL 4NBZB 4QXUL 1QA9B 1HHHB 4UB0H 4MNQB 4XXDA 2R1XB 4JGUA 2DMKA 3LZFH 4YFEA 2GK0A 1NEZA 2IAMB 3D87B 1YN7B 2R56L 2R0KL 1DANU 4JHWL 5I9QC 3CFBA 1S9VA 4XB7A 3O81A 4R97B 4LF3B 3DETC 1HQRA 4FNLH 3ZKND 2V7HB 2GCYB 4J1UB 1VHPA 3V4VL 5F3BB 2DQEL 2OL3A 3VWJA 2PO6D 2IANA 1FDLL 3ARGC 2VL5A 2X70A 3TO4B 5TPWL 3V5DB 1DFBL 5J12C 3RP1A 2JJSA 5CP3H 2CQVA 1SBSH 4Z7VE 5DFWH 3WO4C 1PGRB 5K93A 4YR6B 2Z4QB 2H1PH 1KTLA 5DWUH 4HSQA 4Z7NE 4PP1D 5SV3A 2J7LA 1FG2A 5AD0A 3V9FA 5T1LA 3MV7D 1JGLH 2XZQH 1TFHA 4OFYD 2BY2A 5DQDL 2A9NL 3D2UA 1JZ2A 1TVBB 3OKEA 4ODTH 1WZLA 2WWMD 1MCDA 1MH5A 1F3DH 5DJAB 4MJID 1P1ZA 2KPNA 3B2UC 3LKSB 3N1FC 3SDYH 3S37L 4JM2F 1EHXA 2JTDA 3RNKB 1FO0L 2VH5L 2VZ3A 4OM0H 4OGAC 1TJIL 2R1YB 3O3EB 5DD5H 3VWKD 2VR5A 1YC8A 4MA1B 1JNHB 1U8HB 3IKKA 4O51A 5C09B 4U2ZA 4OQTA 4JN1H 5T3XE 5FB8B 4NO3B 1AGCB 4Z7WE 3MXVL 4M9PA 1JUFA 2GYSA 5FK9B 1CS6A 4H8WH 2DIBA 4LHUD 4LLWB 2QKIA 3FQWA 1JPTH 2VERN 4JPVL 5DC0A 1QLFB 5TJWK 2MSPA 1T5XA 2OS7A 3DI3B 2V17L 3P4OA 4TNWF 5ID1B 1XGTB 1JZ4A 4GW1A 4ODUA 3IJSB 4YDIH 3OXSB 2VXSH 3LS5H 2RBLA 1ADQL 2QSVA 4KRNA 1VPOH 3ARDB 5F8RC 1G9NC 3IRPX 5E6ID 4BELD 3QRFM 4HH9B 1IL1B 2H9GA 3B2VL 3BJ91 3LD8C 1CGVA 5IVNA 5DZOA 4HFUL 4XGZA 4ENED 4KJQC 5ENWA 3O3AA 4X6DE 4DGVH 2I60L 5IEHB 2D7TL 2RGSA 4HF5H 3MACH 2BVUA 1XH3A 1WWBX 5SWZE 3BXNB 4PJHB 4Q0XH 5LCVL 3PQYB 4IDJL 5B39G 3J7HA 4PJAF 3S3SA 3U0PB 2LU7A 3L1OL 4OF0A 4P9HH 1BIHA 1B2WL 1AI1L 3FRPG 3L3GB 5JUEL 1LGVA 3MJ9A 2Y9RT 1E4JA 4X6CB 2UWEE 1J8KA 4JAMA 4NQVB 3TLRA 1RUKH 4MD5A 5SV4A 1VGEL 5E03A 1ZLVH 3PG2A 1T22B 3D69B 1HK6A 1FAIL 3KPOB 2MQ0A 2AJUH 4YGVB 3WJLC 5EU4A 1P7QB 3FT2B 3PGFL 1QRNE 1SQ2N 2NX5D 5E99L 1KPUA 1CYGA 2PTTA 1Q9WB 1WAAA 5EH1A 2OL3H 3VFUB 3EO0A 3VXUE 2XKNB 5FO9A 5KOMC 3EJJX 3U46B 4Y8DC 4L29A 3RQ3A 1YY8B 4ELKA 1MCJA 4JZNB 4LSDA 3VFPB 4ZPTB 4J3UA 1OPGL 2GITA 3KGRA 1DBAL 4MNQE 2JELH 4WUKL 3IU3A 4RGND 1JPFB 3KYAA 3UEZA 2XA3A 3PDGA 4NO0B 3BP6B 3OJMB 5KVEL 4JFFB 4Z0BL 3CC5B 4UQ2B 1UYWL 5GJSH 1FFNB 1X7QB 3CK0H 2IADA 3MROA 1QYGL 4C83A 2RQ8A 4WWKC 4JCLA 4WEBH 1I7RB 3VMOA 2WLZA 5DJ6B 5E70A 2FX7L 3M1BB 5IHUH 2DLHA 4KTEH 4TTDD 5CEZH 2V2XA 3I6LE 3SKOB 2JKXA 1WTLA 2B7DT 4H20H 1WZ1L 1BBDL 2E6JA 2QADC 4PRBB 4XT1C 2QQLH 1RHHB 4NHCH 3LV3B 2DQCH 1FL3B 1XGQA 5EU7E 4DKAA 4J8RA 2ESVB 4M93C 1YMME 4KROB 4J3XA 3ULUH 4LKXB 1ED3A 1LD9A 2AQ1A 5F1IA 1F6AB 3O4OC 4R2GD 3NA9H 4UQ3A 1W8NA 4PV8A 3DPBA 2BXYA 3A67H 5HHOA 1R0AL 5DJ2A 1TPXB 2OLDA 5F89B 3FOLB 4JO2L 5F7EL 4MCYB 2Z91A 1BREA 1YJDH 2OR8A 3CCHA 3CXDL 3QI9A 4L4JA 3WD5H 1RUQH 4Z7OF 2VR9A 4M5YL 3GMPB 4RA0C 1JTOA 5HYIA 5F96L 1I9EA 2WLYA 3HR5A 2DQHH 1F3JB 4QRUB 1OTUC 2V5RA 3QQNA 3E2HB 4W81A 5DUBB 5MEND 2WQRA 5TGBB 5FGCB 4U3CA 3ROLA 1CU4H 3DO7B 2VITA 5IVXB 2VZUA 2FBJH 1QFUL 3WV0A 1A7RL 4FFYH 3MO1B 1LE9B 1EX0A 4LSQL 5IB5B 1BFTA 1JJUA 5E8OA 2VLKB 4UNTA 2XWJA 5GISL 1DQLL 4PRPD 1NCUA 2B1AH 4WUUA 3KPLA 3QJFB 3ARFD 3BOVA 4KJWC 1RFDH 1G9NL 2O5XH 4ZOCA 3VXNB 2R9HC 1MAMH 1RJCA 4Z0XA 5EZJA 3PWUA 4PGDB 3FHQA 1J0ZA 5C0EA 4RFNC 1KG0A 5C7XH 4HCRH 5JNYB 4YHYB 3GSNB 4ACPA 2CLRA 4PGCA 1IAOA 1LO3L 4F15C 5GGTL 4HWZB 1KJ2A 3W81A 3INUL 1GYAA 4PJHE 1GZPA 1V7NL 1S7SB 1SHMA 1MUJA 3PQYE 3V6OA 2C1OB 4QKXB 3VXRA 2X7LB 1T20A 4YK4C 4Y5XB 2VZTA 2VDQL 5I30H 1MQKH 4LBEB 3SKJH 3U0WL 5L7XL 5JW4R 4X6CE 4X4MA 3T0BA 1RURL 1I3RB 4JPKH 2F5AL 4X8JA 2NTFB 4AEIL 4B50A 5DHVB 4IRJD 5T1MA 1HNGA 5EULV 4LOUC 5EC2A 3SCMB 3V0VA 1N2RA 3T8XB 5GRUH 4QHMB 3D0LB 1U8QB 3VFOB 1OARH 2V9TA 2APWA 5C0AE 1ONQB 3TN0B 3VRLE 1FGNH 4ELMA 4KUZL 5JOFA 1LO0H 1T7ZA 3ZZ1A 2H32A 4M7KH 2CKBH 3OJDB 3E6FA 2VIRB 4F80A 3ZDZF 1FBIL 1U6AL 3MYZA 4R96B 5GGRB 1ROWA 3VI4F 5B3NA 1EV2E 1ZA3A 2ZCKH 2EDDA 4HC1H 1M05B 4NGHL 4WU7B 2W0LA 1CZ8L 4W4OC 1OP5H 3HNTL 1IFHH 5F72S 2Q7NA 1KJMA 1ACYH 4P3CH 1KC5L 1FRGH 1RZKH 1OB1A 4JFFE 4XTRD 2DTMH 1VKXB 4PBVC 4JZJA 3EYQC 3KPMA 2Q1EA 1H5BB 4QRRA 1R6VA 5CWSB 5GSRA 3S36L 1JWUA 1ZEAH 2HP4A 1U8PA 5FUCC 5K9QI 1FZKB 4UT9L 5ETUA 1T7WA 3FQUB 3ZDXE 3H3KA 1RULL 4OGXH 4X0KB 4OD1H 3ZLQC 2VC2H 3FFCB 4NZTL 3N1MC 1UCBH 1HXMA 4UU9A 2IF7A 1FVCA 5A2LH 1N7MH 3ZO0A 1AJ7L 4CVXB 3IETA 4PRHB 5C71A 2ESVE 3U83A 2ZUVA 1W0YT 1RZ7H 5MP6L 1MCWM 5LGKA 5DDHA 3W39A 3HG1B 1AHWC 3BP5B 4KJYA 4TRPH 5GHWH 3L9RB 1U2HA 1G0DA 3RX5A 1AC0A 4S1DC 1A5FH 4P23D 1S8DA 1EHAA 1FC1A 5E00A 1CD8A 3I3EA 1BEYH 4IDLA 3U7WL 4PJCF 3O6LL 4JY5L 4LLUB 1EERB 1A6ZA 3LY6A 4M8QB 1ZVSB 2A2QT 1IC5H 2VLRB 1A6AB 3RVXC 4BQ9A 5ALCL 2FJGA 2MMXA 3DROA 4QHLA 1IJ9A 4OUOA 5IFHH 5BS0D 2EE6A 1UQSA 4MA8L 3TVMA 3FQNB 4QHKI 1A47A 1BGXH 2HH0H 3KLHD 4NM4H 5I19L 4IIQC 1HIML 1NBVL 2ZUXA 1KJ2H 1NC4D 1X5IA 3C87A 1JZ7A 5IVXE 5A3ID 2AV1A 3C60B 4IS6B 2HT3C 4D9RE 2DIJA 4L8DB 3QBTB 4ISVB 5EOTB 3MV9B 4NKMA 3B9KC 5F7FA 1U3HB 2XZAH 1HKLL 2VLKE 4TVPE 2QHLA 4XMPH 4YHMH 4JFEA 2P5WD 3CUPB 3LMJH 5JW5A 5EC1B 3HI1A 1CCZA 5D1XB 1SBBA 1NSNH 3KAAA 3CFKA 4LCYB 4MJ5A 3WIFA 4QTHB 5IMOB 3L3HA 3ZTNH 4K94C 2NY1B 5I8CA 3BD5A 3QIUA 4WI5A 4A6YH 4HT1H 1CIUA 5E8EA 4K7FA 4P57A 3BIKB 4U2YA 1OSZB 4OLVH 5KJRL 1F4XH 2ATKB 1X5ZA 3O3BA 2HT4C 3FO2A 1X5HA 4XP9H 2OK0H 4PJDF 4RSVA 4ERSL 5F3HA 1KPVB 2BVPA 3VI3F 3HZKB 4ZNEE 5KN5A 1NH6A 5E56A 3U9UA 1HHKB 2H32H 3BH8B 3IDIB 3QWQB 1IGIL 5CEXA 1N64H 5HYSG 1GOFA 4LLQB 4JM2A 1ITBB 3U1SL 5IB3A 1MFDL 4I3RH 5F9DC 2IMMA 3UP1A 5D5MF 5BZWB 4HUXA 4KZDH 1I1RA 4P2RE 1FL5B 5GGQH 4K07A 1KIPA 1YEJH 3O6FB 4U1SA 3RWJA 3N9GH 5F7NC 2JB6B 4YJZL 1RJLA 1TZIA 5ANMA 2CRMA 5IG7A 2RB8A 4X7TA 4WTXA 2QSTA 4XI5C 2FEDD 1I85C 2ORBH 1ZE3C 1NMAH 4K71B 1BD2B 3KNBA 1KB9J 1LP9F 5EOQL 3B83A 1HYSD 4EI6A 1YDPA 5CKGA 2O5YH 4PRNB 2BCKA 1T3FB 4PJ9C 4RAUA 5J89A 4BQ6A 4WW1B 4G3YL 2JF1A 2MQ3A 5EA0L 3C5SA 4WI9A 5D1QD 3OHXB 2YN3A 4NJAH 3WHXA 2ZNWA 1A9EA 4YDKH 3GM8A 3NCJH 1FVDA 3O0RH 4FQXC 4ZAKB 5KVGH 2KZ1B 1B6DA 4X5XB 4BK4A 3VDBA 1KTDA 1KNOA 3T2QA 1FCGA 3C6SB 4YBLC 4BFIA 4H26B 4X98A 4XVTH 1S9YA 2DL2A 2X89A 5SWSB 1CFNA 2HJKB 4PJAA 4UILL 2JJTA 1X5YA 3BKJH 5K59E 5E1HB 3M17A 1DSFH 2OSLB 4M7ZC 3ARBA 3FFCE 2XV6B 3WXVH 5KSAC 3BPNC 3KR3H 3NFSL 4WGWB 4NQED 3OKOB 3AREB 4JANA 3UZVB 3IF1B 4DKDC 3BQUA 4R4FH 3UPRB 2X1WL 4YNYB 5HYSA 5L6YL 4G9FE 5E8DL 5T1DH 3VH8A 4ETYA 1JHKL 3WFCH 4P59H 2DQFA 4WHCA 1IGYB 3FB6A 1RUMH 3MODL 1J0IA 4ZO6A 5CP7B 3HG1E 1BECA 2X4RA 1ORSA 4Y1AB 3IFNH 3WL9B 4XVUC 4DN4H 3O2DL 2HT2D 3LN5B 3D3VA 4AM0A 5CD5D 5D2NA 1IC4L 5SX5K 3WFDL 5DFVC 2WV3A 4AK1A 1YNLH 4PJEB 5MEOA 4L5FL 2RFXB 2EDLA 2A6IA 4KFZC 3UTQB 2G5BA 5DK2A 2NY4C 3TBVB 3UDWC 5T3ZH 4KRPC 4MXWH 1LDSA 4PB9H 1Z9OA 2Y5TB 1ZTXH 3L6FA 4G42B 1PG7W 1T1WA 4FP8H 2PR4H 3HI5L 3NIDF 3MRPB 4FZEL 4DCQA 4OGYL 3CFDB 1EAJA 2QBWA 1EHLL 1FFPB 5I1EH 1OVZA 3HA0A 4P5TC 2NPLX 2W1NA 4OF7A 4Y19E 3MRCA 5FGBA 5I1LA 3CFCL 2Z9TA 4AIXA 5D8JH 3HHRB 2G2RA 2HFGL 2ZSWA 3MV9E 4MXQD 1CWVA 4O00A 4WEMB 3QUKA 2O5ZH 3IJHB 5DSCA 1UVQA 4Q2ZB 5D2LE 1NDGA 1P4BH 2GJ6B 4LARL 1KLUA 4PRIB 4F57L 3FJTA 2YN5A 1R3LB 4GQ9H 2KH2B 4P2QB 4D9QE 1KB5B 4F8TA 1DL7H 3TT3H 5C0CE 2UVFA 1ZMYA 4O5LL 4QRTA 4TNVF 2YD1A 1KCUL 3RTQD 3U79A 4P99A 3A6BH 1YEKH 3JTTB 1XF2A 4ZD3H 1MI5B 4PGBB 4Y4KD 1HEZA 1U8MA 5T1KD 2BP3A 3LPFA 2X1XR 5EU6D 1MJJA 1S9WB 1FL6B 3AAZB 4XPAH 2AJVH 4G7VH 2XZCL 4QGYA 2NY7H 5J6HB 3QCUH 2VDLH 4WHTA 4WTZA 4GKSA 4PJFB 2P5EE 3HZMA 3WYRA 3ABZA 4AZ8A 4UAOC 4K3DL 1NGPH 1AD9B 4Z18A 2GSGB 3EFDH 4JFPB 3KXFD 3LRSB 1NAMA 3PNWB 3FQRB 4ZTOH 1SMAA 1UC6A 1L7IH 3TZVB 1I8MA 4RMRA 2D0HA 2AK1H 3OKLA 3GB7B 4U1IA 4HG4J 2VXUL 1MJUL 2PO6A 2XFXA 1UEYA 2H45A 5EBMA 4AIOA 5FYKE 4OF8A 1KLFA 2PXYC 2X4PB 4Y2DD 1MCSA 1WBXA 3AC0A 1ODAA 5LGJA 5TDPA 1T2QL 4OD2A 4KKLD 3QXDA 4L3EB 2CR6A 3R1GH 4KJPD 1FYTB 1SYVB 2FHFA 4LASH 1MREH 5EZLB 4ZQKB 5T5FH 3VU2A 2BMKB 4RMQA 4GMTL 3MV7A 2Y1VA 4OFYA 2HLAB 4ODBD 3MNVA 3VE0B 2MCPL 5FYLH 5C0GB 4GW4A 3LKRA 3GSVA 4H8WC 1DQMH 3BKCH 4FQQB 4JGJA 5E8PA 4MJIA 5SWSE 1S7QB 4XMKL 4G80A 4MA3A 4P2OB 2XQBH 1CLYL 5HYJE 2YD3A 2WZPD 3UJIH 3GMQB 4AMKH 1U9KA 4KKNA 5TE7H 4GW5A 1FHGA 3BGFB 5C07B 1NAKL 4GG6B 2IBZY 3R06A 1UXSA 1XZ0B 1NDMA 2YD9A 3QDHA 3VWKA 1RUPL 4NFBA 1SJEB 3WS6C 3RDTD 3ZYZA 4YQXH 3HLAA 3LSOB 1J1OH 1I8LA 1MFBL 5MEQA 3U2SA 4ALAH 3FQTA 4AENB 1MFEH 2AXGA 3SQOL 3QQ9D 5A2JH 3JWOL 4Y1AE 1OAXH 3MRNA 4LHUA 4OI7A 3GMLA 2H6PB 3MLXH 3ULVD 3BW9B 4P9HC 4M6AA 4BQCA 2RCSL 5CJQL 4PJEE 1K4CA 3RU8L 2L7UA 3IFPA 3WUWG 3QWRD 5J0BA 1S7VB 1A6WL 3VFWA 5TFSH 1TCMA 2HFFA 2OP4L 3KPQB 1AQDB 5HHME 3B8YA 1E4WL 3HC4H 3HMWH 1S5HB 5E6IA 3GBMH 3BWAA 5EN2A 2HA1A 5FYJH 5C0BD 3U9PH 1GVIA 1I1AB 3KWWB 1X6LA 4L4TB 1SY6A 2OCFD 4WI6A 3JV4B 4HKBA 3DUSB 2W65A 1UWEH 3HFMH 4C4KO 4NOBA 1JV5A 1UXWB 4LIQE 4HLZG 3ELAT 2H2SD 2Q20A 4FQHB 4UV7L 3REVB 3MRGA 3QEQD 4UBDD 4XP4H 5CBEA 4TSCL 1AXSA 4XC3L 4UB0L 5BMFL 2JJSC 5FUZL 4U0QB 3LZFL 4WDIB 2GJ6E 1H3WM 4PRIE 5I8KH 1MF2H 1H0DA 3K3QA 5DF0A 2UZIL 3KPSB 3EBAA 1NAMH 4WENB 1UH4A 5F7YC 2FX9H 1QBBA 3B5TA 2I27N 4FNLL 2NX5A 5IVZA 4QRSA 1UEMA 1NMBH 3PP4L 1FQ9C 4AT6B 3MGAA 3GMRA 1KUMA 2YPLD 4LAJH 3QDMD 1V8HA 1J12A 4PJCA 3UYRH 1CDBA 1UZ6F 2NW2B 4X6EA 4JFXA 3CFJB 4N0RA 5GSVB 5CMAB 5HI3D 4S11A 3MYJB 1WCQA 3RVTD 2IALB 4KI5D 2H1PL 3RWIA 5DWUL 3WUWA 1WK0A 3VXMD 4F7CB 4PJFE 3ULUC 5DRXB 4NM8H 2XZQL 1JGUH 1I7UB 2HTLC 4I5BA 2NXYB 1AKJB 4HQQH 4PLJC 4ZDHA 1DE4A 1MJ7H 1R3HA 3S4SG 3QR2A 2K3TA 3VCLA 3UO1L 3E0GA 4E42B 1JWSA 4L1DA 4GXUM 3S35H 2EIDA 1Y0LB 3MUGB 3SDYL 3LOWA 4NNXA 5I1GH 4U05A 2V9QA 3V79C 1YJDC 2DF3A 4JJ5B 1KXQE 4MMXC 3EYVA 4OM0L 5C0NC 3N50A 4Q6IB 2NY5L 3IAQA 4E0RB 5DD5L 1QPXA 5E08H 4I18B 4ZFFB 5GZOC 4GKOA 1MCNA 3S5LA 1FYTE 4NSKA 2NR6C 4JHBA 4UZGA 2E8YA 3WN5B 4RDQF 2B20A 4R8WH 3MSPA 3NFPB 3NIGF 1A1MB 4PJDA 5KZCD 3TYFA 3L95B 4XP1H 4H8WL 4P5KA 4BZ1H 2YD7A 3ZE0E 3K81A 1JPTL 2YUXA 5EIIB 5CEYA 3WFEH 3TA3B 1K9TA 4YDIL 2BNQD 2HFEA 2VXSL 1IEBB 1I8IB 1JGDB 1U58A 3DMMC 1VPOL 1I1YB 5D5MA 2IANE 4BZ2H 3Q0HA 4HIXH 5C07E 4GG6E 4WNQA 5GIRB 2R2HA 2WW8A 4RAVA 2XZZA 2EIZB 1SY6H 3VGDA 1WV7T 5KS9B 5MENA 2MQCA 3K4ZA 4DGVL 2YD5A 1A64A 4HF5L 3MACL 5E2TH 3Q6GL 3LEYH 3WHE0 3GMMA 3G6DL 1RMFH 4Q0XL 2BXZA 2JK5A 4XCEA 4L9LB 4P9HL 4FA8A 4RMUA 3MJ7A 1LP9A 5KANI 2J5LC 4M03A 5BQ7B 3MMEA 4PRPA 2HVKB 3HB3D 4ZUSA 3ARFA 5I9QB 2OTWB 1G9MH 1D9KB 3C08H 1OAQH 1RSFA 2YD4A 1T1ZA 3B4NA 3VRJB 3G04B 4D0BB 4YDVB 4TOYH 5IB4A 4L4TE 3AXLB 3DUUA 4ZG1A 3ULSB 3V8CA 3LKOA 3ZSTA 1PX4A 4EDXA 5A16A 4YHIA 2OL3L 5CJOH 2XG5A 4XCNA 1CE1H 3VXOA 3UTZB 5J12B 2XRAH 4BFGA 4MQTB 2HN7A 3RWEB 4LKCB 1FYHB 4GMSH 4NDMB 1MCLA 4HKJA 3ZKMC 3WO4B 4Y89A 2OXGA 1X5XA 2ADGA 2K1MA 1MVUB 3BSZH 1ZGLM 1GAFL 2P49B 3NCFB 2E7LA 4EQ2A 1NCWH 3VD4A 1LEKA 3GKWH 4M48H 1HSAB 4LLVB 4HPYH 1K85A 3AFLA 4IRJA 3QFJB 5I17B 4CJ1A 1Q94B 3KPSE 1RZKC 4LCCA 5C9JA 1LO4L 1B0GB 4WCYH 5GJSL 3TV3L 3CK0L 4JG1L 2MKLC 4ODVH 4RZCB 1U92A 2NLJB 5ITFB 3IGAB 2ZJSH 4WEBL 4GSDH 4TNVK 3V6BR 2O61A 43CAB 2VABA 2LABA 4KTEL 4PUBH 2HAZA 3ULVF 1G7QA 4HLZH 3QI9C 3X3GH 2QQLL 4WW2A 4NHCL 4KV5E 2DQCL 4EZMA 4OLUL 2LVEA 1RZGB 3F5WA 4OQTL 3ULUL 4Y5YA 2IBZX 3GSRB 1YMHB 3CZFB 2R0LL 1O5DT 4NJ9L 4OGZA 3FOMA 3EFFB 1PBYA 1FN4B 3GNMH 3BYYA 3P73B 5GRJH 5D70H 3ES6B 1CL7H 4TTGA 2E27H 1CFSA 3TNNB 4UTAH 3KLAA 2ATPA 2CUHA 1QBAA 4ODWA 5DJ8B 3WKNA 4ZOAA 1WAAE 3WD5L 1RUQL 5DUPH 4F7TB 3VGBA 1FNGA 3KYNA 5HVHC 1OF2A 4DKFH 4IMLA 4XX1E 1FFRA 4OV5A 5T3XD 2IMNA 2DQHL 1ZHLA 2OJZL 3DECA 4H0IA 5I2IB 4U6YB 4JQXA 1DEEB 4PJXA 4DZBA 5IQ7H 4LLYA 3RUGA 4EUPA 5DURD 3BFOA 1KPRA 2FBJL 1XGRB 1D6VH 4CN1A 4XPHH 4FXKB 4FFYL 3WE6A 4LSSH 3EJYC 3V6OC 3VMNA 3VXSB 1F4AA 1MCOH 4P23A 2BVQB 2VQ1A 5DI8A 2FL5A 3MJ9L 1U8LB 2H8PA 2B1AL 3KS0J 4L3CA 1ORQA 4QEGA 5DTFA 3RIAF 4LQFH 1RFDL 2O5XL 1EEQA 4I3SH 2ARWA 1MAML 2Z8RA 4RIRB 3GMOA 1MRFH 3P0VH 5ID0B 2J3SA 1TJHH 35C8H 5IESL 3MCKB 4MLSA 5BS0A 3H42L 2IQ9H 1FVCB 1DVFD 4KI5F 2X1OA 5SWZD 1GSMA 5F7MC 4R7DB 1U8NB 4JKMA 3KPPA 2W91A 5IMMA 1INQB 3IXAB 4LPCA 1NC4A 4OZFG 2YXFA 4P0DA 5CUSL 2C4XA 2WQ8A 2V5YA 1XR8A 5HD8C 5L8KB 3PL6D 4Z6AT 3CSYA 5I30L 2NY0B 5IV2B 1MQKL 3VFTA 3SKJL 3VA6A 3W2DL 1MY7A 4KMTH 4RISL 2FD6H 3JWDH 5HHOE 5E00B 4JPKL 1TJGH 2P5WA 4JE4B 2CIIB 3BP4B 1QRND 4ODHH 5EU3B 1BZ7B 5GRUL 4WWKB 1HI6A 3VXUD 1OARL 3K0WA 4JZJC 1FGNL 5IGXH 2QADB 5C8JB 2BY0A 3EIFA 3HNVH 3PWPD 3QIBD 1BOYA 1LO0L 4KK8C 4MNQD 4DEPC 5MEPA 1IVLA 2AVGA 4ZYKA 1A7PH 1LE5A 5DRNB 3G08A 3QUMB 1FJ1A 2IAMD 4K9EL 4HJGA 3T77B 1KJVA 3O4OB 2W60A 3JZ7A 1W72H 4G6AC 1IBGH 1IFHL 4XHJC 1BPVA 3NA4A 3VW3H 1FRGL 2H2PC 3QFJE 1RZKL 1JNNL 2DTML 5INCA 1XIWC 5F71A 2J4WH 4E5XB 5I73C 5L8LB 5DJDA 3LKQB 1ZEAL 4OT1H 3TO4D 3UBXG 4AH2B 3O3BB 5DD3H 1NBZA 3HNSH 4ODXB 4OGXL 4OD1L 2VC2L 1BIIB 5F9WB 1M1SA 4OZFA 1JN6A 1RD6A 3DTXB 4NYLA 1OL0A 3KYKL 4MHHI 1RJYA 2V2WA 3HRZB 1N4XH 3AU1B 1QOKA 2DKUA 2F53B 1CN4A 2XTLA 3TVMC 3GFUA 2JIXB 1RZ7L 5D1QA 3SDXF 4X4ME 4LPTA 5D7JC 1U8IA 4TSAH 4Q97A 5BW7A 4TRPL 5GGSY 2C5DC 3DRTA 4P46B 3IFOA 1CFQB 5DHYA 3WJJA 3P0YH 4XVJH 5JORB 1X4XA 1HILA 3V8OA 1A5FL 1W2KT 4L8SB 4WU5A 3I6KB 3MOQA 4U1SB 5HY9A 1KB9K 3WLBA 1HSBA 2A1WH 4NQXB 2NYYC 3EO1B 2XXMB 3O41B 3SQBA 4RFNB 4RDQG 2EH7L 5D7SL 4NQEA 2AKRB 5C09D 1T7XA 4F15B 5IFHL 1KEMH 1MLBB 3WS3B 1DN2A 4F37F 3QIUC 5AG9A 2OBGA 4Y5VA 2HH0L 4NZUH 4WFFE 4M7LT 4NM4L 4L4VB 5CJXA 2P7TB 1KJ2L 3C5ZB 4YK4B 3TWCL 5I1IH 5I16B 2AQ2A 5F8QC 4NOFA 1AO7B 1GOGA 1KYOJ 4N8VA 4NHUA 3TCXA 3C6LC 3H9HA 5LVEA 4FHBD 3MJ8B 3P4NA 3VXSE 1G7LA 2XZAL 4OCSL 1QVOB 3ARDD 1FLTX 4XMPL 4JM2C 1I9JH 4JDVB 4Z7VF 1XAUA 1VACB 3IKCA 4J3OC 1QLRB 1T03H 3ZHKA 3LMJL 1OOAA 2IFFL 3PIQA 5C6PB 3IB4A 1NSNL 4F9LA 2P4AB 3GO1H 3PWVA 5D1ZB 2VDKL 4F9PA 2FO4A 3P3YA 4OLVL 5DJ0A 1F4XL 4D9LH 1XCTA 2Y7QA 3PQYD 5I1HH 4XP9L 2OK0L 1JPSL 3GSQB 2HJLB 3KYOA 3ROOB 1FE8H 3L7FA 1SJVA 2QSCH 4GKZB 5HHQA 1UFUA 1N64L 1JF6A 1C5CH 1PKQB 3L3OA 4I3RL 2ADFL 1M7DB 2YWZA 4QLRA 4KZDL 4B53A 2GSIB 3OKMB 3JV6B 1P7QD 5TH2A 5JOEA 4UDUA 3LIZH 3HS0B 2Y07H 1XF3B 3QNZA 4Z7WF 1YEJL 4WY7H 2FDBP 1WFUA 4NBYB 3F6IA 3QXUA 1KJ3L 3RTQA 1BVZA 2VDRL 2FGWH 1N6UA 1IARB 4Z78A 3NBNA 2JJTC 1HE7A 2EDWA 4OCNC 4Y4KA 2ORBL 1NMAL 5ILTH 1G6RA 4OZFH 3DVNB 1IGFL 3P9MA 5DHXB 5T1KA 2O5YL 3ARBC 5EU6A 4LP5A 4YHOH 2Z31D 3VFVB 1GJIA 4M6OH 3QUYB 3BQUC 1HZHH 2R4RL 4NO0D 1F4YH 4JFFD 1EAPB 1AHWB 3AS3A 4IOFD 2AABL 3KG5A 4X6DF 3QEHB 4JFEE 4TPRH 1AY1H 4OUUB 4YDKL 4NRXA 3M8OH 5EPMB 3NCJL 3MREA 4X6FB 3KXFA 5T3ZE 4PJ8C 2P8LA 5EO9A 1A2YB 4XVTL 5J13B 2I25N 2VAJA 4NCC1 3OAYK 1M4KA 4R0LC 1DSFL 3MRBA 2YPVH 3WXVL 3TPUA 1OQOA 4F7EB 1C08A 2ESVD 4UNUA 4Y2DA 4R4FL 4N0CD 3D39B 4KROD 5JMOC 1U3ZA 4DTGH 1MLCA 4IIQB 4BH8A 1TETH 2F53E 4LVHB 1M6OA 5T1DL 4NC0B 5I71B 3HMXA 3WFCL 3X12A 4P59L 3UAJD 4ZFZB 3KPRB 1RUML 3HZYA 3T4AB 5HBBA 1VERA 1N0XH 4MMZC 7CGTA 4JM4L 4HG4K 2MPAL 1JCKA 1YNLL 3FO0H 1PW3A 4NO2B 4JREB 4Z5RA 1AR2A 1II4E 4JFQB 1C16A 4ZTPL 2R4SH 2V9RA 2BVEA 5T3ZL 1FVEB 1EEZB 1ZTXL 4P3DA 5HPMB 2Z8WC 3RA7L 4IJ3C 1DBJL 4PR5A 2PR4L 2VKXA 1CR9H 1MSPA 1HKFA 3SDDB 3N1GC 4RWYH 5IJVA 4D9RD 2AQ3A 5I1EL 3RDTA 2A74A 1HNFA 2BY1A 4OZHB 1RZIB 1UA6H 1WFOA 3SE9H 1AO7E 3B43A 2VLKD 4TUOA 2BZDA 4TVPD 2ENYA 5D8JL 2E9BA 5EBLB 3I50H 1EIBA 4KRMB 2ZKHL 3PHQB 3EAKA 4ZUTB 1ZWIB 2CJUL 4HK0A 2O5ZL 3RY5A 3K8MA 3T3ME 5KG9B 2HWZH 1FNLA 4RFEB 1JHTB 5J1TC 3MUY1 3VRIA 1P4BL 1JPST 3QWRA 5BJTA 4PPTA 3CJJA 1TZHA 2EC8A 4GQ9L 2Z92A 2PW1B 5C3LD 1K3IA 2GTWB 3TT3L 1XF5A 2GKIA 3QZWB 2V5SA 2CD0A 3G5VB 5C0BA 3W9EB 1YC7A 5LKNA 3UX9B 8FABB 3HI6H 5FV1L 3Q3GB 4YUEH 4U31A 1YEKL 2ICEB 5DJXB 3T65B 3ZKNC 4DKEH 4BUHA 3WIIH 3QG7H 4D0DB 4YHPB 2PO6C 1KEGH 5I75C 2OI9C 2AJ3B 3DX8B 3QEQA 4ZODA 4XPAL 5IKCA 1PKQE 4WRLA 4C4KT 2J88H 3QCUL 1PG7H 3SCMD 5D2NE 3THMH 3F6LA 2EDXA 2QL1A 4FQXB 5IK3A 4ZO8A 1NFIB 3AUVA 3I85A 4JO4L 1MCRA 1NGPL 1Z9SA 3O8XB 3EFDL 2G9HB 2P24A 1YEHL 3TN0D 4PP1C 2FZ3B 3ECBA 3MNWB 5I8OH 4ZTOL 3PWJB 3VDAA 1L7IL 2FHBA 3BEWA 3NZ8B 2IH3B 4DGYH 4M7ZB 2AK1L 4QCIA 4TSBH 1XFPA 5KSAB 4XBPB 2DKSA 2QR0B 3F7YA 4HS6B 2YPLA 3O6KH 2FLBT 3ZKSD 3QDMA 4FQ2H 3SKMA 2BVOB 2BNUB 2OR9H 3UPCA 1G1YA 2EH8H 3PWNA 1U3YA 1D5BB 4NQCB 1P5VA 3PGDB 1NKOA 4CJ0A 3KDMB 3RWGA 1T1XA 2C1PA 1DQDH 2W0FB 3R1GL 4LASL 5EUOB 1MREL 3VWKC 5FA3B 5I1JH 4PTTA 1FZJA 1H3UA 4HW6A 2YR3A 4LRNH 5T5FL 5B38B 1QR1A 3Q5TA 3RL2A 3VXMA 5F7KC 4JY4B 2VWEC 4PJHF 4RGMC 6CGTA 1K5NB 1FFOA 3BT2H 5FYLL 2PYFA 3O3DB 1DQML 3FFCD 4N0FB 4ONFL 3PP3H 3RGVB 5J8OA 5JPNA 4J4PD 3UTSB 43C9A 4X6CF 1Q9KB 2EEBA 2DQTL 2WSKA 2XQBL 3PJSA 5D7KE 1UB5B 1ULVA 3BZEB 4OZIA 4AMKL 4PRHD 5TE7L 4RX4D 2DAVA 1PD6A 2PTUA 4OB5H 3KJ6H 5E5MB 4OCRH 3D39E 3WBDA 3O45B 2WUBH 5E6IC 3SPVA 1U42A 3HG1D 4POUB 1HHJB 4Z7OE 3OAYH 4YQXL 1Z5LB 1NGWB 1B9ZA 2VDMH 4GUPB 5DT1H 1I7TB 5DEFB 4ENEC 4ALAL 3U48A 3VRLF 3KPRE 1MFEL 3MXWH 3BIAX 1QEWA 4PRAB 3W9DA 1RK1A 1OAXL 3QPXL 4M6NH 5FF6B 4WO4C 4GFTB 5KVDH 3MLXL 2CK0L 4GG8B 2VLRD 1H15B 4R4BA 4C56B 5FV2A 3ULVH 4BKLB 5ICXA 1U95A 5H35B 2BNQA 5TFSL 3S96B 4FZ8L 5L8JB 4GH7B 2CSPA 5J6GB 2HG5A 3HC4L 5F93C 1G9MC 2OZ4A 5CCKH 3UC0H 2FO1A 1LEIA 2BY3A 4JLRA 3U9PL 1ZLUK 4OI9A 3RWCA 1NGXB 3WXWH 1YEFL 3UZEA 2XT1B 2P8PB 1D6EA 5IBUG 4KGJA 3C60D 4DW2L 3DX9B 4H25B 4Y4FB 5KOVC 4DAGL 2BVTA 1N5AB 1UWEL 2EDYA 3HFML 3DVIA 3OKNA 3MV9D 1NL0L 3ZE2E 1ZA6B 4QF1B 1ZKAA 3ZDXF 1U3HD 5EFIB 3MRJA 4UIMB 1PKOA 2DD8L 3REWA 3IDNA 1P84J 3X14A 5D1XD 5J1AA 1ZT7A 4CU6A 2X2YA 3MRRA 2NY1D 4MD0B 3BZDA 5HVWA 2WANA 3MLZL 4KKCD 3G5YB 2FHCA 1MF2L 4RGNC 1CFTA 4UT6H 3LQMA 4JB9H 3SDXA 2A83A 4FQLH 1NAML 1ETZB 4G9DA 5JLZB 2MHAA 3ZT5A 2FX9L 1U8KB 4WEUD 2OXHA 3CVHA 5F70A 4JPWL 3UTTB 1NMBL 3GIZH 25C8H 5JW4Q 3MLTA 2P46B 1P7HL 4YH6A 2VE6B 3F58L 1D5ZA 5E1AB 4TTDC 5EO0B 3WCYA 2XWBA 2KQNA 5I6XC 3IS0X 5EO1B 4XXCA 5TDOB 5FOJA 1FNSH 5IP4A 3VGGA 5DMKB 2HJFA 3O6FD 2VN4A 3EZ8A 1YN6B 2NNAA 5TDNB 4UTBH 4ONGH 5E94B 4NM8L 1BBJB 2CLVA 5IVXF 1JGUL 3OPZH 1MJ7L 3SKNB 1CQKA 4GBXB 1C12B 4R2GC 1BOGA 5EWIH 3P9WB 5GRVK 1BD2D 1VENA 1YEDA 5FYKD 1IAIH 3S35L 1BWWA 1S78D 3QUZC 5I1GL 1F6LL 4JR9H 1UM4H 3L3JA 3EO9H 5BXFA 3F62A 4LDOB 2AJZB 5AUMB 5D72H 2FJHA 3N85L 1CLCA 3TBYB 5E08L 3HC3H 4HUWA 2YRLA 2KUTA 3C8KB 1P2CA 4ZAKD 5CBAB 3I6GB 4R8WL 3HE6B 4R9HA 3GMNA 3OX8B 1CDIA 1E27A 5SWSD 1A3QA 4XP1L 3IDJA 2VLJB 1WIPA 1H3PH 3RI5F 2NW3B 3WFEL 3U82B 4MSWA 1T83A 3UTSE 3ARED 1F4WL 2GY7B 2V7NB 1AIFB 3ARFC 4BZ2L 5D6CB 5DJCA 1MHEA 2OZ4H 1G7JA 5F1NB 5HYQA 4QXUH 1OW0C 1H3VA 1A7NH 3BDXA 3G5ZA 1Q9LB 5ERWB 1DBKL 5CHNA 1PEWA 3MRLB 4Y1AD 2GJJA 4CMHB 1IGJA 1BQHB 2R0KH 1P5UA 4LFHD 1RMFL 4JHWH 2IJ0C 4LGRB 2ZOKB 3ARTA 3RWFA 3TBSA 4L8CB 3NN8B 4X7FC 3DX7B 2DRUA 4POZD 3RAJL 5I1DA 1IILE 2B0SL 1G84A 4LSVH 1U91B 4C56E 4KK5D 1OSPH 1IEAB 2DQUH 1T0MA 5HDQL 1FDLH 2E7LC 3NCYP 1QQDB 3GSOA 3JWDC 1FCCA 5TPWH 3IVKA 2YUWA 1NBYB 1S7UA 5E8NA 4CRPA 1IAKA 5KSVA 3C08L 4OZGB 2BK8A 1CK0L 4X6DA 4IRJC 4F33A 1X5AA 3AY4A 1MAKA 4LLDA 5LGHH 3WDHA 1DVFA 5SWZA 1G7IB 3CVHH 4LCCC 4H1LB 3CZJA 4U7MA 4CVUA 1QO3B 2I26N 5IMLB 2FB4H 1CE1L 2XNAB 5K59F 2XRAL 3RUGB 2A9NH 4GMSL 2FIRT 5GZND 4NC1C 3TJHD 5B8CB 3PL6A 2GJ6D 1KCSH 4PRID 4M3JA 4MS8D 4P2QD 4R7NA 1NCWL 1F11A 4PG9B 1IGML 2ITDA 3RPIB 5I66B 1BX2A 1G7PA 3PDDA 3GKWL 1GC1H 3E6HA 1FO0H 4HPYL 1QRNA 1G7MB 2VH5H 5BZDB 4O2CB 4PJBB 1I7ZA 3DVGA 4Y5YC 1TJIH 5BVJA 2UZYB 4FFZH 4MQ7B 4OTXH 4YO0B 3V52H 4ZO9A 1MI5D 4XTRC 3VXUA 4ODVL 4KKBD 3HAEB 4NNYA 3UTTE 2ZJSL 5IBTL 1L9MA 2O26U 5EOCJ 4GSDL 3MXVH 3KJ4C 3PWPA 3QIBA 2EXWC 3TESA 2YS4A 1QA9A 1HHHA 2UUDK 4MNQA 2W9EL 1BFSA 2N4IA 2R1XA 1G6VK 2GEEA 2V17H 1BFVH 1Z3GL 1KGCE 5JQ6L 1Q72H 3CSYB 2IAMA 1QHPA 1YN7A 5IBLD 1MVFA 1X5KA 5E6YA 4OF5A 3U4AA 3B2VH 1U41A 4LF3A 3TZVD 2FEEL 1MQ8A 2OJEB 4PV9B 1VFAB 2V7HA 2GCYA 4J1UA 2Q76B 3GNML 2RJMA 4QRQB 5F3BA 5GRJL 1T4KB 3O9WB 1CL7L 1TXKA 2E27L 3NPZB 5SWQB 2D7TH 3QB7C 3TO4A 3DMMB 4MQSB 3OJ2C 3V5DA 5EZOL 4P23C 1PYWB 2W0KA 4IDJH 5EU5B 5D2LF 1LNUB 2EKJA 2QQKH 5DUPL 4XBEH 1JYVA 4L3ED 3L1OH 2XA8H 2BDNH 1FYTD 1B2WH 1AI1H 4DKFL 5JUEH 3RIFK 2PYEB 5J9PB 1Q1JH 1A22B 4YR6A 2Z4QA 4LNRB 5T3XH 3QDGB 4GQPH 5IQ7L 1VGEH 5FYKU 5IFAH 2Y72A 1FPTL 1BVKB 3KLHC 1BLNB 1TVBA 4FQ1L 5HVFB 1D6VL 5DJAA 1OTSD 4XPHL 2FSEB 3PGFH 3OBAA 4LSSL 1CLZL 3LKSA 2BC4B 5A3IC 4P2OD 5J3HD 2NTSP 1DUZB 3IAGC 3GRWA 3QFDB 4BQBA 1T89C 1EGJA 5C07D 1ZHNB 3RNKA 4LQFL 5CLWA 1AQKL 1J10A 3MBEC 1A3LH 2R1YA 3O3EA 3P0VL 5DYOB 1JNHA 4U6XB 1U8HA 5C09A 1TJHL 35C8L 1BM3L 3G6JB 4IHOB 2IQ9L 2P8MB 4LVOB 3GUTB 5FB8A 4RWHA 4NO3A 4U1GB 1IM9B 1AGCA 4NQTA 4NQDB 5FK9A 3U7AA 1V7MH 4LLWA 5KVEH 1KIUA 2CKBB 2X4QB 2JE8A 5B39B 1UYWH 5ID1A 1XGTA 1QYGH 4LHJB 4I13B 3IJSA 3OXSA 3SDCB 4KMTL 2FD6L 3ARDA 3JWDL 4M62H 5F21B 5FUOH 4HH9A 1WIOA 3PXJA 1IL1A 1TJGL 1I1AD 2ZUWA 4GS7B 4QHKJ 1WZ1H 4HK3J 4L4TD 1P7KB 4ZOEA 4OZGE 1TCRB 4FOMA 5IEHA 3ARXA 4YHNB 2ZSVB 1FP5A 3BXNA 4PJHA 3IYLW 1C5DB 3QHZH 3PQYA 1KYOK 4HXAH 1A0QH 5EUKB 3ALXA 4M43H 4OCXH 4F3FB 5IGXL 3U0PA 4PJXE 3HNVL 4U0RB 1YUHB 1P6AB 3B9DA 2WUCL 3RUGE 1JPGB 3L3GA 5F9JB 1AD0B 2FEDC 4WI8A 4X6CA 5GPRA 4NQVA 1R0AH 2VQUA 5F1OB 4MQXD 1A7PL 1HYSC 2IPUK 1HXYB 4DVRL 2CDGB 2B2XH 4FXGB 1T22A 1QLEL 1NPUA 3D69A 3KPSD 3KPOA 1IBGL 4M5YH 3NVQA 4YGVA 5GS2D 2H3NB 1P7QA 2M26A 3FT2A 1DP0A 4NPYB 5F96H 3VW3L 5D1QC 2P43B 5GGUB 1CT8B 1Q9WA 3GIVB 1WISA 1TVHB 5BW7C 4CADB 3VFUA 3EYFB 3AM8C 3WJJC 1V5JA 4OT1L 5J56B 2XKNA 3U46A 1YY8A 4JFHE 4YE4L 5DD3L 4JZNA 1QFUH 4PJEF 1A7RH 3HNSL 3VFPA 2DQGH 4ZPTA 4NKOB 2E5EA 4IEFB 5K33A 2VZ1A 4PG2A 3RJQB 1DDHB 2D2OA 1N4XL 4QRPB 1JPFA 5LBSL 5DLMH 1DQLH 1TTUA 4G6ML 5C0IB 2ZP0T 1MHCB 2DTSA 4NO0A 4JHAH 2ARJB 3BP6A 4JFFA 2NXYD 4M6MH 1AKJD 4Y5VC 3CC5A 4TSAL 4UQ2A 2P5WE 4XRCB 5CJXC 1FFNA 1X7QA 2UUDH 3BGAA 1KELH 3MLRH 2GY5A 1ITCA 3C2AH 2XY2A 3GSXB 3P0YL 4XVJL 1KULA 1I7RA 3JUZA 2E8ZA 5DJ6A 3GRWH 2HT2C 3M1BA 3NABH 3SKOA 1EGJH 5CD5C 4PRBA 2XWTB 2PNDA 1RHHA 3LV3A 5I18H 1FL3A 4A6YB 2ESVA 3LN9A 1KEML 4RQQB 3T0EC 4PJ7B 4RGOH 2HTKD 4LKXA 1AGBB 3QDGE 1F6AA 4NZUL 1Z9LA 4JKPH 4I3GA 3QWOB 4HPOH 2C3GA 5IW1B 1JVKA 2Q86B 3VFMB 3FQXB 1AFVL 4PY8J 4YDLB 5I1IL 2CMRL 2WMPA 1BQUA 5F7DB 3QNXB 1Z2KA 5F89A 1BAFH 3QPQD 3TA3D 4HUUB 1KTRL 4OBRA 3FOLA 3TFKD 4MCYA 1P6FA 3QXTA 1I9JL 4KUZH 1QSZA 3WFHB 3GMPA 1T03L 3IS1X 5DD6B 3RI5K 3HPJB 4HIIB 4AG4L 3D85B 1F3JA 5FFLA 4QRUA 1D5XB 4HBQA 4PJFF 5DUBA 2DWEB 3BP7B 5TGBA 3G6JE 1T66D 3DO7A 1CZ8H 4JN2B 3RKPA 4D9LL 5IVXA 4M8VA 5I1HL 2CDFB 4HMDA 5HGGS 4NQDE 3MO1A 5FKAB 4XNMB 1LE9A 2QSCL 2YA0A 5IB5A 3U7YH 2VZOA 2VLKA 2FNBA 4YFLI 3TIDB 2EO9A 4Y4KC 4POYA 3ZYOA 3QJFA 1OAZH 5JXAH 3FFDB 1D9KD 3VXNA 1P9MC 4BUGA 1RULH 4PGDA 5JDJA 5HGAB 1A7QH 1XIWB 4KDTC 3LIZL 5JNYA 3IFLL 1ZS8B 3DV4B 3GSNA 1T2XA 5I73B 3RVUD 5FA4B 4ETQB 4HWZA 1X5GA 2IPTH 1E4XH 3ZE0F 4XNXH 1CF8L 3D18B 1S7SA 5MP6H 2C1OA 3VD9A 1WITA 2X7LA 4Y5XA 4YWGL 3BHBB 3I02B 4JQIL 5ILTL 2NY6D 2G75B 4LBEA 4DK6A 1I3RA 4NWTH 1FZMB 2WWKO 2NTFA 4M6OL 4GG6F 4Y2DC 5D7JB 5DHVA 1HZHL 5CZVH 3QFJD 3K2UL 3NGBB 2VAAB 3SCMA 3X11B 4PJIB 3T8XA 4JFOB 4EBQH 4KJPC 4QHMA 2ZCLL 4ZXBB 4TPRL 1AY1L 1U8QA 3D0LA 3VFOA 4HUMB 1ONQA 2X4SB 2R29L 2FYYB 1EEUA 1WC7B 3RFZC 2APTA 4XP6L 1YEIH 4OGAD 3NPSC 3HRPA 3RZWA 3OR7B 3AVEA 3OJDA 3MBXH 4RMSA 2VIRA 5ACLA 2OQJB 3WLWC 4R96A 2YPVL 5GGRA 5BRZB 4KY1H 3NCEB 1M05A 4ZPVB 3J8F7 3BPCB 4WU7A 5HDBE 3W82A 2D0FA 5JW4N 1QFWL 2DM3A 4QRPE 4DTGL 1Q38A 2BRQA 3T0DA 1ES0B 5CJBA 4S2SB 3C6LB 2MCG1 5JIPA 2FWOB 1VKXA 3S34L 1HH6B 4D0CB 5E4IA 1H5BA 3RDTC 2FH8A 5CWSA 2HKFH 4G8GB 5JIKA 3L3IB 3L5WB 3GI8L 1I75A 1FZKA 4ZS7H 5KJRH 1N0XL 3QQ9C 3FQUA 3R0MA 1KN2H 1AXTL 4X0KA 3FFCA 3SDAC 3ZKXC 1HOCB 3FO0L 4J4PA 4ORZC 3DSFL 3ULVC 2GJZB 5HHXH 3BUYB 1OP9A 1IGIH 4CVXA 4PRHA 4RX4A 3T4YB 1KENH 3T0WA 3VGEA 1CR9L 3MR9B 3PXHA 4PJ7E 3HG1A 4RWYL 3BP5A 3HKFA 3L9RA 1UA6L 3SE9L 3VXSD 5GS1C 3N0PB 1ZLWH 1UB6B 1VADB 1PLGH 2VNCA 3CFEB 3EOBB 3DNKA 3I50L 4TVPH 1OM3H 4CDGC 4LLUA 4M8QA 5MHSE 1ZVSA 4KV5F 2VLRA 4WV1C 1A6AA 4JFYB 4NQUA 2HWZL 1FGVL 4EIGB 1OP3H 5FHBH 3QO0B 4V2CB 1N6QL 5ADOL 3FQNA 3GSNH 4EXKA 1TITA 1L0QA 1PG7X 3V0AC 1F42A 4JRWA 3JV5A 5EA0H 3HI6L 4LCUB 3UJJH 2L4OA 4J3WA 3CDCA 4IRSC 3C60A 4IS6A 4YUEL 2YKLH 4L8DA 4EI5B 4ISVA 4DKEL 5EOTA 3MV9A 4OSUH 4M9OA 4MDJB 3WIIL 2NY0D 3QG7L 4GAGH 4I48B 1U3HA 1WAAF 2ZUYA 1G6RL 5E5UB 2WBJB 1OHQA 1KEGL 3DRQB 2NXZB 3CUPA 5EC1A 5D1XA 1BJ1J 3LCYA 5FECB 1KIQB 5IMOA 2J88L 4I0KA 4LCYA 4M1CD 5DHVH 3F8UB 1PG7L 3TJEH 1BP3B 3THML 3ARRA 3O3UN 5GGSB 5HI3C 5E7BA 4WWKD 1M7IB 2ICWJ 4PJ8B 3RVTC 3BIKA 1OSZA 3VG9C 2ATKA 4KI5C 5L6YH 1NCTA 5E8DH 1KPVA 2AS5M 2QADD 4R0LB 1JHKH 1M7XA 3HZKA 1ZT1B 4YHZH 1S5IL 3FMGH 2XKSA 1HHKA 1YQVH 3BH8A 4TSBL 1IMHC 1N59B 3MODH 3SE8L 3D0VB 3IDIA 3JSSA 1OAKL 2BRRL 4LPXA 1P84K 3EZJB 3O6KL 4LLQA 1GZQB 3O2DH 4N8PA 4FQ2L 2OR9L 5FDYA 1QTYT 1FH5H 3WFDH 5BZWA 4HULB 4UNVA 1FL5A 1DQDL 1JRHI 1CXLA 5IIEB 3F7VB 3HMXL 3O6FA 4PJIE 3NCBB 4GJTB 2AXFB 3QIWC 5JXED 1L7TH 2JB6A 4OFIA 4U33A 3BT2L 4OGYH 3PABB 4NWUH 1QNZH 2VR4A 5DVMA 1BD2A 1SEQH 4GAFB 5JPMB 3CFCH 4PRNA 1Y18B 2P47B 1T3FA 4MAYB 4WHYH 5BRZE 2F53D 1KCRH 4WW1A 2BNRB 1I4FB 3QUXC 4PBWD 9CGTA 5I0ZA 4OCRL 2JIXD 2WUBL 3OHXA 5C2BH 2E7BA 2MNUA 1VDGA 3QXVA 2LU4A 2GUOB 1BZ9B 3WSQL 2NZ9D 2VDML 4F57H 4P46D 3A6OA 3OQ3B 3LKPB 4ZAKA 1OT1A 3ESUF 3G9VA 2XTJC 4X5XA 1QHOA 4HMCA 4LDEB 3C6SA 4H26A 2ZWLT 3SGKC 2R9HD 3E3QC 1A9BB 4M6NL 2HJKA 5KVDL 1FFQA 2ADJB 4X7SH 2OSLA 3BPOC 3ULVL 3K1KC 4P5MB 3TBWB 3OKOA 3AREA 1PSKH 3EKCA 3IF1A 3AGVA 3V4UL 4KH2A 3UPRA 4YNYA 3RY6A 3VDCA 5T33H 1VFBB 3UC0L 3TH3T 4G8EB 2YZ8A 3WXWL 2XZCH 2B39A 4L4VD 3C5ZD 4RBPH 1IGYA 3B3IB 1AO7D 2YWYA 3FB7B