1TPXB

Ovine recombinant prp(114-234), arq variant in complex with the fab of the vrq14 antibody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
212
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTNYGMNLVKQAPGKGFEWMGWINTFTGEPTYADDFKGRFVFSLDTSASTAYLQINNLKNEDTATYFFTRGTDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the PrPC -> PrPSc conversion from the structures of antibody-bound ovine prion scrapie-susceptibility variants.
pubmed doi rcsb
source organism Ovis aries
molecule tags Unknown function
molecule keywords major prion protein
total genus 41
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2004-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tpxB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1tpxB02
5I1LB 2HN7B 3DXAA 3T08A 4MQXC 1BJMA 2ILLA 2BNUB 3GBML 1PG7L 2OP4L 3IB4A 3DMMB 3M17B 4PJ5E 4RBPH 5F7WC 5GS2H 1T1ZB 3K8KA 4H25A 1I1YB 2LU4A 4ISVB 2VR4A 2MPAH 1BFVH 4CMHB 3OAUL 4WWKB 2BVQA 1AGCB 5C9KA 1QSVA 2R69L 3V5HA 3EYFB 3HNVL 2DJUA 4JG0H 3TA3B 1CT8B 1TJIL 4X80L 4LIQE 5E08H 3LIZL 2RCSH 1A5FL 2NY4B 3DGGB 5CJQL 2ERJC 3HC0B 3K80A 4OZHE 3V9FA 1I1CA 4FQHB 5I1HH 1FYTA 4PP1C 4UT7H 5ETUA 3B2UC 4NQCA 4NQCE 1KCUH 3CZFA 3BUYB 3DURB 5SWZB 1YEFH 3NAAH 3RVVD 1BREA 1OAZL 5ELIA 2AK1L 1U8LA 1P4IH 4GRWH 3AMLA 1MCJA 4FNLL 4WV1B 5DVKA 5ID0A 1RULH 1A6VH 1FDLH 2R0KH 3GSNH 4PJBF 4Z76B 1OF2B 4X6FB 4ZFFB 1BM3H 1EAPB 4HK3J 5EZLA 1G6RH 4FG6C 4MNHB 3CK0L 3BPOC 4Y4FB 4CU8A 2IGFH 2DD8L 3C09B 9CGTA 1FNAA 3ULUD 2PF6A 1EXUA 2BVTA 5FCUH 1MWAH 2AKRB 5L8KB 3HZKA 3F7PC 4HWZB 4N8VA 1S7QA 1J87A 4NN7B 1AI1H 5C8JA 1AP2B 5E4EB 3MUJA 4KVCL 1MFDH 4TOYL 3VW3H 3DIFA 5HY9A 4FQ2H 1N8ZA 1MNUH 4IRSD 1RUQL 3QFDB 5F7UA 4L3EE 1KN4L 3Q3GA 4I77L 4LLUB 4O2FB 3F58H 3BQUA 2VIRA 4XZUB 4OFYA 5BV7B 4U0RC 3R4DA 3PHQB 2JIXA 4S10A 3SKJL 4HFWB 4HWNA 5J6GB 2H3NA 4HJ0D 1A7RH 4RMUA 5K33A 3UTSB 4WI2A 3TP4A 1RMFL 1HOCA 1VESA 5ICYA 4LQFL 1MFCL 4MXWL 4P5KB 2XTJC 4XZUA 4L9LB 4U1GC 3NACH 5H35A 1A9BA 5HHOA 5EN2A 3OG6B 3RP1A 4UV7L 4NQTA 3WLWD 5JW3H 1OLZA 4J1UB 4ACPA 4J4PD 4E41B 4UILH 4HQQH 3TA3D 3D0LB 2BJMH 1DEEB 1NLBH 2IMNA 3QFDA 1MSPA 3GMMB 3CH8A 4PB9L 4ELKA 4NRYA 4BFEA 3FQNA 5T3XE 1T1XB 4ALAH 3NIDE 4KDVA 5T5NG 5HY9B 3B2VH 4S1SH 4X6DB 3T65A 4QT5B 4YK4B 1MCHA 1GH7A 4FTVE 3LOWA 2Y72A 4NN5C 2FR4B 2OCFD 5KS9B 5I8KH 1A64A 2A73A 3MLXH 4ZQKA 2IJ0C 4IRSC 4PG2A 1ED3B 4MA3B 1NBZB 4I3RH 5FB8B 1OT2A 4PRIA 4JDTL 3QIWC 4G8GA 1A9BB 3EGSB 5ITBH 1EXUB 4M93B 2OZ4H 3L1OH 3W9DA 5B3NA 4M3KB 1M05A 3P0YL 1E4JA 4LVHB 3GI8L 4LRNH 2D7QA 4G6KL 4G3YL 1OSPH 1J8HD 4X6FA 4P9HH 3DSNA 1T7WA 4LSSL 5ID1B 1AXIB 3DX7A 4KUZL 4MXVF 4PRBB 5E7FA 3WFEL 4QHLB 3OXRB 1FNFA 4YXHH 2R0WL 4Y8AA 3OKKB 2AV7B 1OTSC 3EFDL 4XMPH 3T0EA 4MAYA 3A67H 1GL4B 1IZKA 4D9LH 3VFOA 3Q3GB 1UM5H 1BZ9B 4YXLL 5BW7A 1LDPH 3DX8B 5EBLB 2BNRB 3VDAA 4D9LL 1F13A 5KSAA 1JCKA 4NO3B 2H26B 5FYLE 1A7QH 1HYSD 1XIWA 4IRSB 4D3CL 5JOFA 5DYOA 3KGRA 4LSSH 1JRHI 3BO8A 5FDWB 3I75A 4G6KH 1IEBA 5EOTB 2O5XL 3QNYB 2OBGA 3FQUA 4M61A 5MP6L 3WS6A 5KG9A 1EGJL 5HYIA 3B5GA 3LKNB 3QXAA 2FHFA 3ULUL 1UWXK 2YD3A 1DQQB 4MWFA 3MRLA 3ZYIA 1XGYH 1AD0A 1JWMA 5GGRB 1RZ8B 4NQEE 1MHHA 2A1WH 1L4IA 1CLOH 3ARBC 5I8KL 2B0SH 4EI5A 1FPTL 4GKZA 5DZNA 4S0TD 1WFNA 5CD3B 3KLAB 1PEWA 2P45B 4PGEB 2A0LD 5EULV 3F7YB 4GW1A 2ATPA 4C55A 1TPXC 4NM4H 4P5MA 5K9OB 1OSPL 2RAMA 2X89A 1UVQA 1XT5A 4AIZA 1AGEB 2FZ3B 1MFCH 4HIXH 2WUCH 1J1XH 4R8WH 4J3UA 3MQIA 3MV7E 1I3VA 4MLSA 2WIMA 5IB1A 2H6PA 4I4WB 4RAUB 3MLUH 4WWKA 2OXGA 4Y19E 1SVCP 2NY5L 3RJDA 1IGIH 4KH2A 2FL5A 4H20H 2P5EB 5DJ0A 3OPZL 3DETD 4YDVB 5J11B 1AKJA 5E4EC 5E8EB 2D03H 5GSRA 4QXWA 3T3ME 4BZ1H 3OQ3B 1OAUH 2DWDB 2V5RA 3RL2B 2YRZA 3GMPB 2GIYA 2VZSA 4K3EH 4FQ2L 3UYPA 1H3PH 4U1JB 3EFFA 2NTFA 3VW3L 1CDIA 3FL7A 4HDIB 3P77A 2MCPH 4OLYL 5F6HJ 5TJWK 1QFHA 1U2CA 5F1NB 2B5IC 4TUJB 3WFZA 5HHPB 1C1EH 1GZPB 3KLSA 3O3EA 3LKNA 3QXAB 3RVTC 1CE6A 3U7YH 4Z7WA 2IGFL 1FCGA 5I8EB 4L4TB 1FV1B 1D6VL 3GI9H 5IROC 1BM3L 2DJ4A 3KPTA 1ZLVH 4I4WA 4RAUA 3MRRB 1P2CA 5TFSH 3O6FC 4KZEH 1MFBH 1RULL 4PJ5A 5ICXB 1TENA 4ZFZB 1YQVH 4XT1C 4ETYA 3WSQH 5FHAL 5FO7B 3RU8L 3DETC 1Q9LA 2JELL 2EYSA 4NO5A 1VGEH 3VGAB 2GJJA 2BHUA 4RQQB 5F7LB 5HHVL 1WEJL 1QBLH 2HFGL 5GS1B 2EXYD 3EO1A 3VA2C 2EIDA 1SBSH 3C5JB 3OX8A 2VR5A 4QNPF 4TULL 2RCSL 2P5WA 2DQHL 3IVKB 2CUMA 2FJHB 4CU7A 2GQHA 1ZKAA 1UXWA 1AD0B 5ALBL 5KJRL 4G43A 1EMTL 4NQXA 2LVEA 1QR1B 2FYYA 4YAQB 4DK3A 2FNBA 5LBSL 2PYEE 3V95A 2ZOKB 4G8EA 4DCQB 4KPHH 5EOTA 3ZO0A 5BVPH 1GOGA 1P1ZB 3O2DA 4PJAB 3VXUB 1OGAE 1INEH 1DP0A 3GBMH 4DKEH 1PEZA 4EDXA 2LU7A 4KI5E 5ICZB 4OD1L 5BS0B 4K94H 3TVMA 2MQCA 1DFBL 5TGBB 1KLUB 4HIEA 4N0UA 5D7SH 1X5KA 4LOUC 4FRWA 1BBJA 4BSJA 5CJQH 3ELAT 3I9GH 1DEEA 3HNVH 3H9SD 5FXCH 2XG4A 1VB9A 5FYJL 3TH2T 5KSBB 3N1GC 4TVPE 4YNYA 4U6HA 5EDXA 4PP1D 5IHZA 2FRGP 3HUJE 2BSSB 3PP4L 4JO4L 1HCVA 2ADIB 4ZD3L 2XY2A 3MCLH 2VLKD 1JI1A 3PP3K 3U7WH 2HJFB 3IKCA 1MCDA 3UTSA 1DQTA 3TGXA 3O2WL 3JWOL 4DTGL 1HE7A 1U91A 1Q0XL 1FFPA 4QLRA 1VGKB 4FXGA 4YHKH 5DUBA 4OV5A 4NZTL 3HZVA 3QAZB 5FYKD 4QYOA 1N2RB 2LAAA 4WI3A 5C0DB 3O4LD 4M43L 5E7BA 4JHZA 4BM7A 4XMKH 5DMGC 3T0VA 1HHJA 1L0QA 3L3HB 1PJ9A 2VERN 4KK5D 2YOCA 4IDLA 3SDDC 4MNGB 4V1DD 4DUVA 1AH1A 1C16B 5C71A 3CVHH 3QCUH 1NL0H 4QTHB 4PRNB 1ORQA 4MAYD 4X8JB 4NBXB 1XMWA 4GXVH 2Y7QA 1QFWM 5EZOL 3RL1B 3P4OA 2X2YA 5J8OA 1TZIB 3IDNA 3WFHB 4JQIH 3S4SA 1OW0A 4NRXB 4QXUL 4CVUA 3VXSE 4OKVB 1S7XB 5CLTA 1P7QD 2I07A 5EZLB 4H0GA 3MOQA 3WJJA 5J06A 1NGZA 4G7VL 1IGYB 2P43B 4MB5A 3BGFB 4P4RB 4UTBL 1QSED 2HT3C 4HV8B 3MA7A 2J5LC 5JZ7C 3TNMA 3HI5L 5D7KD 2W60B 1ZHLA 5F44A 1K6QH 3EYUH 4LFHG 2BSTB 2XTJE 5TE4L 1DEDA 1NC4D 1NLDH 2YPKB 1QUNA 4Q9RH 4Y5XC 1U92B 5H2BA 3U4EA 5HDQH 3L5XH 1HQRA 4H88H 1NANH 1KJ2L 4YHYC 4GLRI 1XR9B 3G9AB 5L2KE 1UM6L 5EUOF 3H3PH 5KAQF 1B0WA 1MCIA 1P9MC 4H1LG 2XKNA 5H94A 4AMKL 1F4HA 3UYRH 3MREB 2G60H 4OCWH 2YPVH 3QXDB 5CUSH 5BZWA 3RWGA 5T5NF 3RUGB 4LCYB 2KBGA 1AP2A 4TULH 4Y2OA 2VXSH 5T3ZH 1CXKA 4DGVL 1OTTC 1NCWL 3RA7H 3HFMH 4X9HA 5C0FB 1WEJH 4UT9H 5DURD 3WLBB 3FCTB 5IB5A 1SEBB 3JWNC 1ZOXA 4PD4J 5E8NB 2AI0H 1VFOA 5TH2A 2A9NH 3VMPA 4YE4H 4AEHH 4JFEA 3U9PH 3TBSB 5F96H 5IB4A 4PJDF 1JVKA 5IMMA 1RI8A 4WV1A 5ID0B 2BNUA 5DZLA 5EU6A 3MFFA 5ALCH 5IVNA 4YGAB 1S7TB 4LLYB 5EO9A 2ESVB 1D6VH 3HI1A 3MV01 5C3TA 4S1RH 4GQ9H 2J12B 4LEOA 3D3VB 1A1NA 5AYUL 4NUGH 3BUYA 1YEHL 4DGIL 3W2DH 2HT2C 2AEPH 3WN5C 3H2WA 3LH2H 1UWGH 4RFEA 1AIFB 1H8SA 1S9KC 1CFSA 3OKMA 1XF2B 1EEQA 4YHNA 3IXAA 4WNQB 5C0IA 3BP6B 3IGAB 4G6FD 4PJGF 5I0ZA 1F6AB 1DBKL 2ZCHH 1YY8A 4K8RH 3QUKB 4LCUA 3WO4C 4IHOB 1LP9B 2DWEA 2R0LL 5LQBL 2YWYA 4HUUB 1SJHB 4L8BB 5E6ID 5C3LD 5C2BH 2Z9TA 5JW4R 2XZCH 2DQTH 2QQNH 4IOIA 3FFDB 5KVGL 1KJ3H 4YPGA 5I75C 3FTGA 4GAYB 1QFWL 3FQTB 5CKAA 4JN2B 1AGBB 1C12A 1E28B 2G5RA 2AJYH 4IIQA 1S78C 1DSFH 3VD7A 3TJHD 5C0NC 2EYRB 1FO0B 2VMFA 3RWDA 4R9HA 4HK3N 4MNQD 1PYWA 2A77H 2KH2B 4YFLI 2FEDC 2Y5TB 5F88B 5FIEA 4O5LL 4RGNC 4WUKH 5HYJD 4E0RA 1A1NB 3KHOA 4HJ0C 4U6XB 3N06B 1BBDL 2X89D 3VRIA 4K71C 1KTDA 1KNOA 4C83A 2FSEA 3QA3A 3WEXB 5FF6A 5HBBA 4CADA 4QWWC 5EU7C 1IARB 4ZAKA 4OLZL 5IJVA 2V9QA 3OV6A 3PJSA 5KSAD 2FH6A 1KIUA 5D7IB 4OJFH 4L4JA 4R4BA 5DRXA 3UTOA 5FM8A 1QBBA 4U49A 2WUBL 1CXHA 5JPNB 4LQ1A 1VKXB 2R1XA 1IVLA 4K7PH 3G9VA 1CDUA 5BV7C 3QFJE 4HKZB 5CJXC 4L9LC 4OAWB 5D70L 1TVHA 1ZVSA 4JG1L 4OCMC 1BFSA 4LCYA 5DLML 2VAAB 2PR4H 5CSGA 3RWCB 3FOMA 4Q9CA 1MAKA 5JMRA 3REWB 4S1QH 5CMAA 3VI4E 3ULUF 2ARJQ 4JQVA 4KUCF 4ZPVA 2LU3A 4YDIH 3QUXB 4JFYB 1JGEA 5L88L 2HVJB 1JYXA 2OI9B 4Y16D 1RURL 5DJYA 1CFQB 2CH8A 2WIIB 4JFXA 4NNXB 5ITFA 4RNRA 4PGDB 2P8LB 2H2PC 1DQDL 2YD2A 1T21B 4H0IA 1HHGB 1ZVYA 2YKLH 3U82B 5J3HC 2V5YA 5C0BB 1BQHB 3C09C 4XP5L 1CF8L 1AQDB 2AJSL 2P48B 3QEHB 2RFXB 4QRRB 3AMKA 1W0YT 4PRDA 1WZMA 3HAEH 4D9RD 2M26A 5IF0A 3QFJD 5I66A 3K7UA 5ESQB 4DEPB 2XQYG 2NXZD 4JFZL 1HI6A 2EDTA 3S36H 4GW4A 5HHQB 5I1GH 1LE9A 2XNAA 3AS0A 3DYPA 3N0PB 2YBRA 2BNQA 3KXFE 1YMMD 5E99H 3UROR 1RZKH 2CDGB 2DQDH 3RWJB 4NQVB 2JCCF 4XBPA 5C08D 4PRAB 5E8PA 4I3RL 4NC1C 2FIRT 1Z5LA 3QEQA 3MLXL 2XI9A 2DBLL 5HGAB 4A2MA 3K8MA 1RIUL 3VXNB 4J3XA 4XRCB 1P1ZA 1OB1A 1YC7A 1G7HA 1HHGA 2ADJA 2IPTH 3G6JA 4U33A 2W9LA 4RCAA 4M4RA 5D2LF 5DS8A 3O4LA 5FHBH 1CR9L 1FFPB 1HSAB 4L5FH 4GQPH 4NOBA 3MJ6A 2BVEA 4W6WB 3Q6GL 1DE4A 5C0AD 4RIRA 1TJGH 4YZFE 1VDGA 2A0LC 2XFXB 2C1OB 5IFJA 4KRNA 3MXVH 2XWJA 4G6AD 4KROD 4PJEE 5K59E 1CGYA 3OBAA 2A77L 2WQRA 3LKRB 1FL5A 3HR6A 4RQQA 4JZOA 2XRAH 4DVBB 1U8QB 4X9IA 5F93C 1D5IH 3FB6A 4TTDD 4X99A 4JFDE 4LLWA 4N1EA 5TGBA 2XACC 4M7ZB 1PX4A 4K3JH 2BNRE 1KN4H 5CGTA 4JY5L 5F7NC 4DQOH 1RJCA 2HWZH 1PY9A 2UZIH 4UINL 3KPQB 3HE7C 5E56A 1NUNB 4B41A 1BFOB 2R4RL 3G04A 4LVHC 5C0RH 2R2EB 5HYJB 5HJ3B 2F9BT 3PJSB 1MFDL 5D5ME 5I8EA 4UT6H 5FEBA 4M8QB 5D2NE 4YGVA 3A6OA 3IKKA 1W72H 1M1SA 3X13A 4JM4L 4NZUH 1EO8H 1IGJB 4HH9B 4AENA 4HCRH 3PGCA 3X3GL 1CLZL 1UXWB 4HF5H 2YMXH 4QHMB 1YEHH 5L2KB 3E0GA 1GGCL 2BY3A 4MNGE 1FORL 25C8L 1RUPL 1U3ZA 4IOSD 1F8TH 4LARH 3O2VL 3EO1B 1AHWC 3LQAC 3MBEB 5C9JB 5E2UH 5EU4A 1NAMB 3EYSL 1CFVH 2R0KL 1A6VL 1FDLL 3ARGC 1MCPL 1QRNE 4XWOD 2DIJA 3P73A 4HWBL 4QF1B 1QHPA 3BRDA 4MD0A 1MLBB 1YJDH 3GSWB 2RR3A 5E8EA 5SWZE 4AEHL 1WUNT 4NFBA 3NAAL 4M6NH 1BOGB 3TC9A 1BEYH 2FECL 4P48A 4POZC 2Z91A 2AAVA 1S8DB 3HB3D 3MV8D 3PIQA 1QLRB 1V3MA 2RJMA 3ALXA 3IU3B 3S35X 3ECBA 1E27A 3E6HB 4PR5B 1A1MB 2VWEE 3MV8B 2W0KA 4LBEB 1II4E 5EBGA 3R8QA 3KPRA 1H3GA 4EUPA 3VXRB 1KTDB 4GXUN 1T04B 2APBA 4LLQA 4K94C 4BFGA 1BFVL 1HHKB 3LS5H 3RY6C 1JHLH 5KZCB 1U3HD 4ZO6A 4KK9D 3L5XL 4WU7B 4TSBL 3QULA 4PJIA 4X6CA 3HE6A 3HI1B 1CE1H 2JJSC 5F7EL 3VFSB 4AM0A 4EZMA 5HHOD 2I5YL 5IEKB 2FX8H 3LEVH 5IQ7L 3JTSB 5IEHA 4PJ7A 4F15B 3WNKA 3G08B 1BPVA 1A14L 1JGVH 3I6LD 5B8CB 5CWSB 4OZIA 1Y6NR 4WO4A 4L4VA 1ES0B 1VPOL 2IAMB 4XH2B 3GM8A 2NPLX 2XIDA 5E95B 4KK8C 3UZVB 5JW5A 3SN6N 4L3EB 3NH7H 4Y5VB 1NGXB 1ZVHA 4NQDA 3OXSA 1SJHA 3MRQB 4KK5C 5IW3A 3EUUA 4JVUA 4X83A 2D7MA 1RJLA 3N1PC 1SEQL 4TNWF 1RU9H 4P4KA 3INUH 3BN9C 1NDMB 5C0IB 1T83A 1ZGLP 5EU3B 1UH4A 5DWUL 1MHCB 1JWSB 5GRYA 3BP4B 4NNPL 2XKNB 1TQBB 1YDPA 4KTEL 5BV7L 5F6HI 3VFVB 4LDOB 1NFIA 3O6FB 1MUJA 3BPNC 4EI5C 1AGFA 1J11A 4JQVC 1C7SA 3QZWA 2EDJA 1K85A 4PJIF 4X6CF 1S9YB 1JJUA 4R96A 4XMKL 2Q20A 3PWPB 5GRVL 4UDUA 5JIHA 1DL7L 3LQZA 3IFPA 1B0RB 1T89A 2W0PA 5DDHA 4BFIA 3N1QC 1JNHB 2H9GA 1EVUA 3QHZL 4NZTH 2B5IB 3OXRA 5IT2H 3O8XC 4LHUD 3VG9B 4MD5A 5GGRA 3L7EA 2VDPH 5IQ7H 1A7NH 1KCLA 4HHAA 4M03A 1AR2A 3QDAA 4XNYL 5ECJE 4IMKA 1M05B 3S4SG 3QNYA 4JCLA 4ZOEA 1OARH 2GJ6A 2QHLA 3CH1B 2AERT 1KG0B 2EIZB 5IVZA 1VFBA 4Y4KA 3T04D 4Z7UF 3LV3A 5FYJH 4P2CG 3GMRA 2B7DT 3VWJC 2ZSWB 1A6AB 1KOAA 3P11H 4NN7C 3O3BA 3PWVB 5BZDA 1DJSA 3RUGA 4X8JA 1YNTB 1NMAL 5D7SL 5E6IC 3VXMD 5KSAB 1HKFA 3SY0A 5BS0E 4MQTB 4ZOCA 3BIAX 1R3IH 4F58L 2J7LA 4YHML 3GMNB 3STLB 4Y4FC 4YJZL 4CMMB 4HC1H 4JM2A 1T7YA 3DRQA 1BEYL 3FRPA 5AUMA 4OZFA 3IJSB 3MLYH 1I1AA 1CK0H 3U0WL 5C0ND 4P3CL 3TN0C 4JZJB 1HH9B 1Z6JT 2Z8SA 4KUCD 2ITDA 4KPHL 4Z7QF 5HD8C 1TPXB 5JZ7D 2OM5A 2YC1B 4XC1L 2BVOB 5D96C 3UP1A 1B2WH 4G8IA 4HSQA 1RQ5A 1HOCB 3VWKD 3FMGL 1J1PH 1R3LB 1CD1B 1FRGH 5B3JE 4L3ED 1QLEL 4U6YB 5JOPE 2I9TA 1MCBA 1HEZA 4C56A 2EZ0C 4NWUL 4U3HA 4DAGL 4OCYH 1UJ3B 1SBSL 3FO1B 4H26B 5J9PB 3NCYP 1HXMA 3ZKNC 1CBVH 4RDQG 2GTZB 4YZFF 4TVSa 2OMNA 3P9MA 5F8RC 2FHBA 3HC3H 1S7WA 4BSWA 3UO1L 3TA3C 4NRZA 1ZT4A 4A6YL 1XF5A 3AY4A 2DQEH 5F9OL 4R4NC 4HWBA 1MRCH 1QG3A 2I25N 3ULVD 3V8CA 3T09A 4JPKL 1E6OH 2ARWA 1N7MH 4Y16A 1CL7H 3FQNB 3MLRL 4ZUSA 4XP6L 5JNYA 2JE8A 2WM0A 1S7WB 6FABL 4Z0XB 1IQWL 4WIQA 1INQA 1TMCB 4K3JL 5JIKA 4MB4A 3I6GB 3V52L 3CH1A 3QIWD 1EBAA 1ZGLM 1DBMH 3BD5A 3QB7C 4FFYL 4CW1A 2ED8A 4K3DH 5EPMA 5GRUL 1M4KA 3Q5TA 4HGWA 4NJAL 1OSZB 3QI9A 3CD4A 5B38A 4NNYA 4I0PC 3NIFE 3C6LD 3O4LE 2SEBB 4NIKB 3VWJA 3LQZB 4FQXB 3P4MA 3OKYA 1QYGL 3BIKB 4ZTPH 2E7CA 4GSDL 4K3EL 4BQBA 4JO2H 4UZGA 3R0NA 2H1PH 1A4JA 1NAMH 5EOQH 3BAEL 3BI9X 4CAGA 1WTLA 5TQ0L 2H2SD 4K7FA 4UOW0 3QIWB 3UPRB 1G9MH 4JM2C 5IVXB 4X7CC 2AEWA 3TVMB 4LASH 3MA9H 4LSVH 4EOWL 1MQKH 2AXJA 3AFLA 3EYFA 3W5MA 1HYSC 1PFCA 4OUUB 4R0LA 2R29H 3VXUA 3FT4A 5KANI 4GRWE 5ADPH 1VFUA 3G6JF 4KXZH 1EDQA 4OI8A 3S8WA 5GGVH 2H32H 1MFEH 2DQFA 4NQXB 3W39B 3WUWB 4NQDD 4F8TA 5FK9A 5BRZE 1QSEE 4NM4L 2R4SH 2YPLB 3RWEB 5CKGA 4KXZI 2GSGA 4X98B 1MVFA 3IS0X 3VG0L 4YBLC 2GK2A 1J8KA 4BSVA 3DXAB 4LVOB 3HE6C 1ZT7B 5D4QA 1JF1A 5EUOB 4LLMB 1PLGL 3CMOL 1FPTH 3MRFB 5GJTH 3V5KB 4ODHL 3BJLA 2WAHA 4BZYA 4U0RB 4U3XA 3GK8H 1XGYL 3LN4B 1FGVL 1E4XH 3QQ9D 4J3TA 4AT6B 3AXLB 4WW2A 2MTPA 2LABA 1QA9B 1ZHKA 5D5MB 3L3GB 2DTSA 5BO1L 3O6FD 3DUHA 1UQSA 1RJLB 2QQLL 1CN4A 1KIRB 3QDMB 5FYJU 2E8ZA 5F7YC 2IH3A 1KTKE 3KAAA 4NCC1 4Z7WB 2E9BA 4ZG1A 4JY4B 1LILA 4HK0B 4OCRH 4PRPD 4X4YA 1ETZA 3O9WB 1MJJB 4UUJA 4JVWA 5IW6A 3DVGB 4LHUA 4L8CA 1MWAA 5GPRA 3FB8B 4WO4B 3D85A 4YXKL 2MCG1 3AROA 2WUBH 3WIHL 5JXEC 3QNZA 3L3OB 2NTFB 1JPGA 2GHWB 5EU4B 1JPGB 1NCBH 4JHAH 4AL8H 2V5SA 1BVZA 3OJVC 1GIGL 2E9JA 5KOVC 3FB8A 3QPQC 3UJIH 1IEAB 4Q2ZA 1T04A 5EU5A 4P23D 5CBAA 4FXKB 4A6YB 3D3VE 4JY4A 3S3PA 4E9LA 1TNMA 1BBDH 1BMGA 3DHMA 3QZWB 1J5OH 4HUMB 3WJJC 2J2ZA 1FNEA 2BOCB 4O5LH 4WUKL 2X05A 4Z5RB 2V6HA 4IRJC 4JDTH 3D9AL 3I2CH 2R29L 1LNUB 3MV9D 3MLVH 4J6RH 3UJJL 5HGHB 5BS0D 1GPOH 5JQ6L 3IAPA 4FQLL 1U8MA 3CIQA 4GW5B 1NDMA 4Z7VF 3ZYJA 4HG4J 4EQ3A 1KJ3L 2NLJA 3O9WC 1Z9LA 2CGRL 1X44A 1X7QB 4LSTL 3EOTL 4PJ7E 3BYYA 2W65B 3SPVA 3LPWA 5DRZB 2H8PA 1HK6A 5H37H 3BKML 4OF7A 5EUKA 4HS3A 3T3MF 4PJHE 1ZTXH 4UV7H 3GKWH 1HILB 4I2XA 4JGUA 2GKIA 3GRWA 3SOBL 2XV6B 3RRQA 5B8CA 4ORZC 5C0EB 1AE6L 3O6ML 1BZ7B 3RDTA 1NGYB 4JHBA 1JWMB 3NCEB 5GRUH 5A2FA 1I1AD 2Y5EA 4ZUWA 4KROC 1LO3L 3CX5K 2Y6SC 3IJYB 4FFYH 4Z6AT 4ZNCD 1FZOA 4LLQB 4BKLB 5D2NA 3L7FA 2UWEF 3V4UH 1MCLA 2HJKA 4OTXL 5FA4A 3HG1B 2VXQL 2A38A 4XP6H 4JFEE 3E6HA 1JGLH 5DEGA 3JWDL 4POUB 1MRCL 2A9MH 4NHCL 3SDDA 1T4KA 3FRUA 1JRHH 4O58H 4MXQD 1RK1A 3DUSA 2IANB 3UO1H 1QNZL 1TJHL 4YUEH 1DLHB 1JYWA 4F57H 3GSUB 1MJ8L 1WTGT 1AC6A 1I3GL 3QWRD 1EEZB 4KKCC 4WCYH 3ISWA 3N9GH 2HVKA 4XP9L 3H0TA 5EZIH 3T0EE 1XCTB 1P7QB 1G6RL 5T1KD 1VFAB 4GKSA 5GRJL 1P53A 5EIQA 3G5YA 1J1PL 1KENL 2DM4A 4MAUL 1HSAA 4XC3L 2IQ9H 4FABH 1NH6A 4XC1H 1UACL 3IFNH 2DQCH 3GIVB 3W9DB 1JFQH 3U6RB 1EEYB 4XMLL 2ED9A 4LLUA 4O2FA 4P5TC 2F19L 1K6QL 4JFFE 3CNKA 3TYFB 4HH9A 5LGKA 4Z77A 4ZDHB 3BMVA 1BJ8A 4EVNB 5A3ID 4Z9KB 1W2KT 3FRPG 3QUXA 2Z8WC 5CJXA 1K3IA 1LEIA 1R3IL 4YHMH 2ZCLH 3WFDH 3GJFA 4ZSOB 2XQBL 4PTTA 3EZ8A 5D1XA 3NVQA 3S9DB 4YFEA 3PL6B 5DK2A 4XPBL 4M7KL 1TJIH 1F4XL 1BIHA 1GGTA 5IBTL 1HI6B 1KPVA 5IKCA 1KN2H 2CDFA 2AJZA 4DUWA 3KXFB 5IKCB 2X4OA 1GGBH 4X99B 5F1KC 5JPNA 2PXYD 4C56B 1D9KD 3PL6A 1W8NA 4EI6A 1A4KA 1K3ZA 2RBLA 5D7IA 5EG6C 1CD1A 2QQQA 4XWGL 4QHNA 5IT2L 4NP4H 1H5BC 2JIXB 4YHOH 5FGBA 5GISL 3S36X 5KSVB 2NXYB 1H3XA 1T7ZA 3TYFA 1B88A 4XPGL 2EC8A 5JPMB 3MGTB 3FO2A 2GEEA 2P24B 5SWSE 5EFIB 2HVJA 4U6XA 2FO1A 4YHKL 2HKFL 4NP4L 2ICEB 4M4PA 5T1LD 1L6ZA 3DECA 1ZLUK 2X9YA 1NPUA 2AK4B 1T66C 5KS9E 2DQJH 4MA7L 2P46B 4XNUH 4Z7NE 5D7KE 1OP3H 3X3FH 3QZWG 1SM3H 3MUZ1 4GRLA 1AGBA 3QDGE 3CSPA 1IC4L 4MCZA 4G9DA 4RDQF 4YFLF 1N59B 1JGDA 4W6XB 3PNWB 4PJXE 2D7OA 3BVNA 4G5ZH 1F97A 4FQ1H 4H25B 2G5BB 3NH7L 4DN4L 4C57C 2R2HA 3VH8G 3MRGA 5C09A 3W0WE 4ZAKD 4M48H 5K9JL 1FH5H 2D9QB 3EJYD 3G5VB 4K8RD 1T03H 1FVDA 3MJ9H 4MD4A 3GMLB 2BY0A 5DO2C 2HN7A 4PJ9B 1HWGB 3MRCA 3OAZK 4U1SA 4GKNB 5EWIL 1UB6B 3VRIB 4K7PX 1N5AB 3H9HA 3F8UB 3B9DA 1L0YA 4FP8H 4PGDA 4HMDA 4NKOB 4LPWA 4I0PD 1XGRB 1CFQA 1A9EB 1OTSD 3CCHA 1NGYA 2LAGB 3C6LC 5GRJH 4FQHA 5LWYH 4P2RE 4LDEB 1WAAA 2VZ3A 2VUOA 4FZ8H 3O8XB 1B6UA 3EYVB 4PG2C 3NIDF 1OAYH 1ORSB 4M7LL 1A3RL 3WNPA 3CAFA 3NGBB 2BSRB 4X7FC 3IU4L 4M6ML 4EBQH 1F4YH 3CC5A 1JI2A 3SDCB 2FH8A 1HKLH 4KQ3H 3MGAA 4R4ND 1YEEL 1RJYA 3LKOB 4Y5VA 1TVHB 1ZVSB 4NZDA 4NHCH 5IFAH 3G6JE 1QZ1A 5CZXC 2NX5B 4GJTB 4UDTB 5C0CD 3JWDH 3IXAB 1TQBC 3ZKXB 4G6JH 3A6BH 2BMKB 2ERJB 5CWSA 4OZIB 3CUPA 3KG5A 3OKNB 3T0EC 4KZEL 1ADQL 2P8MA 4PJIE 3BHBB 4X6CE 1FN4B 2J3SA 3KS0J 3V4UL 3PQYB 4PREA 1YYMH 3DV6B 3KYAA 5KSUB 1BECA 2VXTL 5SX4I 2FJGA 2VDOH 3MOBH 3WN5A 3JBG7 4O9HL 4LSUH 5C6WH 3CJJA 3SJVD 5HYSA 1AXTH 2HRLA 3UJTH 1OAXH 5H8DA 3I6LE 2WANA 4Q2ZB 5EU5B 2A6IA 2VISB 4Y19A 3ZT6A 3AGVA 1IL1A 3ECBB 3NIGE 2YD1A 2AJXL 3GKWL 4X5LA 1AXSA 4LSQH 1NGZB 4YEFA 1SMAA 1QLRA 4JANB 5ILTL 1FBIL 4LPTA 5D9SB 3TO4D 2XKUA 3MX0A 4JRXA 1NQBA 2AS5M 4IS6B 3JSSA 4WDIB 5I9QC 3H3BC 2H2SC 1DLFL 1JWUB 3F62A 5AAWA 1UEMA 3WUZA 2V2TA 3UDWA 4WEBL 1HIML 4N9GA 3OPZH 2APTA 4Q9QL 3MSPA 1RJYB 1HXYA 4CVXA 1D5BB 5D8JL 1CLYL 5D9SA 4F3FA 4TSCL 1YECH 3Q6FB 4KAQL 2CRYA 2QTEA 3DARA 4MNGA 4PV9A 2P1YA 4WVRA 4KKAD 2FB4H 1ZWIA 3BX7C 4PTUB 1EO7A 1FL3B 5IQ9A 5JQHC 4N68A 2FEDD 3PGDA 1OPGL 4XB7A 1AD9A 2B2XH 4QRUB 4G8FB 1HN1A 1IAOB 1OGAA 4XCCL 5FHBL 1IM3A 4MXVE 3DV4B 3FO9A 4JFFD 4YHIA 5JDSB 5AZ2L 2IPTL 2R9HC 4J2XA 4OB5H 1WITA 1LQSR 3FQRA 2O5ZL 3RIFF 3G04B 3WMSA 3IDIA 3L3IB 3OZ9H 3O6LH 3J8F7 3LRGA 5CJBA 4LLDA 4D0BA 2BSSA 4WV1C 3PQYE 5IHZB 1NUGA 2A83B 5CGYC 4F7EA 5DQJB 3C60A 3GRWL 1JZ5A 5KSBA 4PJXA 1G7QB 4KI5F 1XCQB 3LS4H 1U8JA 2FLRT 4LMQE 4F7MB 3GFUA 5MP6H 1KIPA 3BVNB 1F90L 2O5XH 4QTHA 4WENB 1FZKA 3LKRA 3W11C 5JUEL 3Q5YA 5DJXA 1NAKH 5C0GA 1KBGL 2YN3A 5L2JA 1KCSH 1Q1JL 1HHJB 3TWCH 3T1WA 4AK1A 3BUTA 5FYLL 4PJ8B 4ODVL 1LE5B 2EICA 1Z9MA 1JZ7A 3GIZL 2WP3O 4UAOC 5DD0H 2GY7B 1DQDH 4HW6A 3GSXA 4RFNB 4YXLH 2P24A 3VDBA 1QD0A 4ZFOL 4S2SA 3GSVB 4NT6B 1P7QA 1AY1H 5HDLA 5L88H 1IEHA 4WFED 1EERB 1NAKL 1BGXL 4KDWA 4MA1C 5J11C 5CSZB 1JBJA 3RVTD 4S1QL 4OCLC 5E2TH 5KSBF 1S5HA 1ZLWK 1T0NB 2YHGA 3QJFB 5SWZD 4FQPA 2IANA 3DUSB 5IB3B 1Q94A 2C1PB 3G6AA 1JV5B 1QLFB 1GHFL 1DCLA 2VE6A 1T5WB 5ICXA 4O00A 3E8UH 4WFFE 3RIAF 1A6WL 1RZFL 4KHTL 3SJVA 5LCVH 3SDCC 2BVPA 3JUZA 3UTQA 3WNNA 1JNLL 1MELA 5T3ZE 3MNVA 5EO1B 2VSDA 5E2VH 2PTVA 1FIGL 3THML 2VRAA 4OGYH 2VH5H 1HXMB 2XZQH 1UENA 2DAVA 1CXIA 1ZA6B 2UV3A 4MZ2A 4WI6A 3KDMB 4XP4L 5EC2A 5KSVA 4HS8H 1Z3GL 5CP7A 3T4YB 3T0BA 1F45A 2ZUTA 3VXTB 4OZFH 5I6XB 3ZTJG 5F7DA 4QXTB 3GSOA 4HAGA 1OTUD 2PO6A 4RISL 4WI4A 1JPSL 2DQIH 3QFJA 5DMGD 4PJFF 4PGJA 2KZWA 2VQTA 2VQUA 2YSSA 5EUOE 2VJXA 3WD5L 2EYSB 4MA8L 4NO5B 4I13B 2RHEA 4JZJA 3WHE1 2AJZB 1E4KA 4U6VH 3F5WB 3GSUA 3T2NL 1NCDH 3SGDH 1ONQB 3BXNA 2ITCB 2R0LH 3D39B 4N0FB 5DD1L 3GMNA 4PS4H 5HVHB 4PTTB 4OGXH 5KOMC 1G9NC 5I6XC 4JAMA 1K8IA 2CK0H 5TQ2H 2ADFL 5DEGB 5T3ZD 1XF1A 3PWVA 5TE7L 1HHHA 1KIQB 1D3CA 4TPRH 1CGUA 1UVQB 3QQ4A 4RMSA 3SGJC 4AIZB 4KVNL 2HJKB 2VZOA 1A2YA 1ZSDB 1N0XL 3V7AG 2VDOL 2O5YH 4IDJL 4KJYB 5HSFA 2ZWLT 1RZIB 3QJHA 4NWUH 2W9EH 1MVUA 2DD8H 2X42A 4KI1A 3EOYG 5F3HB 1JNNL 4XX1G 3MUGA 3OHXA 5DJDB 5DR5H 1UCBL 2C7UA 3ARVA 1W72A 3LN5A 1TFHA 3VH8B 4XP1H 2NCMA 4XHJD 5DJ8A 4OCNC 3AREC 3O8XD 3PABA 3QHTC 4G6JL 1E28A 2AK1H 2X4RA 3NFPB 3NTCL 4HIHA 1T0MB 1M7DA 4XNMA 1MRDL 4P3CH 5DSCA 3DVNA 4HLJA 5CINH 1NCTA 1CK0L 1YEFL 2E6JA 5FKPA 4H8WC 3ULUC 5MHSD 1FNGA 3WL9B 3ZDYF 2VC2H 3GGWB 3NZ8B 4P2OC 5F9AC 2VLJA 4PJ5D 4OI9A 5KVDL 1DUZB 3KPSE 4F2MB 4OZHF 5IB1B 3TCXA 12E8H 3ES6A 4OD2B 2QR0B 3O6KL 1OCWH 2OXHA 1NEUA 3BH8A 4OFYD 1JZ6A 4JFFA 5F89A 3D0VA 3VRLF 3EOBB 4JR9H 1QFUL 4PY8J 1SJXA 2DDQL 2RB8A 3KJ6L 2E7BA 3QUMA 4WHYH 2P5EE 4ONFH 3F7YA 4GW1B 1S7RA 2X09A 5D6DA 5E2WL 4QY8A 1HQ4A 1FAIL 3ARYA 3AU1B 2CLVB 2APFA 3SBWA 5HPMA 2ED7A 1CD9B 1M7IA 1JGUH 1EUUA 1J10A 3MO1A 1DBAH 3FONA 1EV2E 4QRRD 5J1SC 1ZA3A 5K9JH 3FONB 4I48B 4WW1B 3LN5B 5FK9B 4MWFB 1IBGH 2YRLA 2NW2A 3MUGB 4WW2C 2LQRA 5DUPL 2ZCKH 2VR9A 5CILL 4QXUH 1P6FA 3TBWB 4ZPTA 4GT7A 1YC8A 2P42B 4MMXC 5DUML 3TNNA 4Y4HC 5FDWA 3S96B 3T2QA 4LRIC 3H7BA 4MJIE 3IDMB 4P3WA 1G7LA 4NOFA 4P46D 3MRNB 1IGTA 4YDVA 4GUPB 2CR3A 2EDDA 1HHHB 4OLUL 5IVXA 4PJCE 1F11B 1MOEA 2NY2D 4YHPB 3KYOA 5D5MF 4JJ5B 2PYED 1IAKA 4Z5RA 3BPOB 3WNMA 2F53B 1N4XL 5C07D 2EIBA 2NY4D 2BSTA 3SDAD 1KFAH 1WISA 1IBGL 2NY0C 4Y1AB 5GISH 2WW8A 2IMMA 1VPOH 2EDXA 3PABB 4P5KA 3KPSB 5IWLC 3FO0H 4F9LC 1N64H 3WS6C 3HN3A 4U1IA 4OZ4A 2C7UB 2OYPA 4PIRF 4TUKL 1WVZA 3QO1A 4XVJH 3FT2A 3D85D 2X7LA 4MJ5A 5HGDB 3CDCA 2AXGA 2X4SA 4QGYA 3IDNB 1F4WH 3MRHA 1FNSH 5DEZA 4EN3C 4AENB 4PGBB 3ZKND 4MQ7B 3C2AL 3ZDYE 4M9OA 4OQTH 2NXYD 3ZDXE 1G9NL 2R2EA 3MOAL 4JCMA 3HG1E 1C16A 1LMKA 4ERSL 2ZCLL 3WFDL 4ZYKA 5D5MA 4LMQI 1P4BH 4HGKC 1XF5B 1LK3L 2X4PA 3T8XA 3BXNB 3SE8L 1FC2D 2FX9H 3LPFA 3MRMA 1INEL 1CGSL 3WE6A 2DQGL 4OIIH 3NTCH 2R15A 5E6ZA 4MJ6A 3T0ED 3RGHA 1SY6L 1YMHA 3TJHC 3V5KA 4QO1A 2XXCB 5I73C 5JXAL 3LKQA 3HNSH 4LLMA 4L8SA 4C58B 3MRJA 4ZFFA 4FQXA 3C5ZC 5D7JB 2HTLD 4PJCB 3TJEL 3ZTNL 1RV6X 2BVOA 3KYKH 4HWEL 4UTAL 1A3QA 1MCEA 4P2YA 3G6DH 1WBXA 1OM3H 2K7PA 4IDJH 1U8OA 4QXGL 5TDPB 2BY1A 3V2AR 1HH9A 4GG6B 3M8OL 1MJ8H 2J8OA 4HCRL 4S1DD 1BD2D 1W72L 3DURA 3RX7A 1SYSB 4OT1H 4R7DA 1O7SA 5I8OL 1G7HB 4FFVD 3EAKA 5ETUB 3U83A 5I17A 2AEQL 1RZ7L 1RHHA 4ORGB 4L9DA 2BRRH 1XGUA 4PJFE 1T5WA 4N8PA 2FR4A 2Q86A 5DT1L 5ACMA 1WICA 2W9DH 4ZSOE 3UPRA 3T2NH 4XCFH 1G7JB 1DQJB 1LO5B 1JZ4A 4NYLA 1Q0YL 3E6FB 3GI9L 1IKNC 1WQVT 3W11D 5ESAA 3FFCA 3FB5B 1R6VA 3SDYL 2A6JB 1T1ZA 3S88H 1KYOK 2XWBA 5CSZA 3KPLA 4HS6B 4WGVB 2JIXD 4Z7VA 1KCVL 1JP5A 2XOTA 5ICYB 4I0KA 1NFDB 3K1DA 4NQED 1T22A 5D72H 5FYJE 1R3LA 2ZP0T 2Z93A 4NKIH 1FJ1B 3SKOB 1CR9H 1FG2A 5I71B 4MSWB 3KPMB 1SBBA 5ERWA 3HMXL 3O3DA 4G42B 4QGTA 2GCYB 2QSCH 1QACA 4LSTH 4PJAF 4X6EA 4YO0B 5JIIA 4P23B 1YDPB 5I9QB 1QQDA 1I1AB 1JWSA 5HGBA 2CO7B 3BKYH 4IRJD 5TF1L 5FGSA 5T1MA 4PG9A 1FZKB 1Y6MR 3QT2A 4KKBC 4W6YB 3IDXL 2DJSA 4XAWH 3ZLQC 1U8JB 1FVCB 2DLTA 4MDJA 2ENSA 1S7QB 3BN3B 3IRPX 5C8JB 1JHTA 1NMBL 4JFZH 4NM8L 4Y4KB 3ULSA 1VFBB 2D4DA 1YUHA 4Z7UA 3CVHA 4H26A 4QTIL 3MRHB 5D2LE 3VI3E 4ZPTB 5FGBC 4MS8C 2VDRH 3WIIL 1GIGH 4UB0H 3VCLB 3BQUD 4P49A 3BKCL 2PW2B 4DVRH 4HHAB 3K4DA 4PJFB 4WRLA 3VFNB 2VABA 4U1LA 1NANI 1S7SA 4XP5H 4BELD 2IALA 2ZUYA 2ZOLA 3QULB 4PJIB 4X6CB 2YC1A 5CEZD 3VFPA 4P9ML 2L7JA 1BLNA 4OCRL 1MJ7L 5IB2A 3CXDH 4K23H 1ZE3C 2YS4A 4OLXL 4P23C 1GGUA 4QRSA 1R5IB 3BEWB 2YA1A 3VXPA 8CGTA 4LCIL 5DK3A 5F88A 2Y5TA 4NQCD 4WFHE 5IWLA 3LHPL 2QSVA 2AV1A 4PV9B 1V7ML 3CSBA 2ATKA 2NY1D 4L3CB 1YNTA 2QLVB 3JV6A 3NCYS 3UTTB 5C6TL 2NZ9D 4P3DA 3KXFD 3UTSD 4ODXB 5MHSE 5EZJA 2VLJB 3EDEA 3DJ9A 2F58H 4IIQC 1I85A 1FO0H 3DO7A 1UM5L 3K46A 1OWRM 2FWOA 4ZS6C 5BMFL 1JNJA 3GHBH 4ZO8A 1T2QL 4OZIE 4OF5A 4YHLL 4CN6A 4XMPL 4XH2A 4DVRL 4XTRC 2PYFB 5CEZE 4NZJA 3FN3A 5M95B 4XXDA 4RGNE 3IFPB 1S3KH 2FIKB 4NM8H 1WJ3A 5DJ6B 2PTUA 1MCOL 3ZL4L 5IBUG 1OPGH 3ORJA 3U36A 1X3DA 4PBVC 4ZO9A 4HUWA 3DV6A 5KSUA 3NCFB 4U1SB 4Z7VE 2AABH 2P8MB 1MEXH 3QRFM 5F72S 3RVUD 5JOFB 1KACB 1V7NH 2R2BA 4L8DA 4MGXA 1C5CH 3BZEA 3ARBB 1QFWH 3O41A 5JHDB 3B6SA 1EJOL 3LEXA 4P4KB 5KVGH 2IF7A 2Z4QB 3QXTA 3ET9F 3LKOA 5F9WC 1QSEA 4JFOB 1IGCL 1DUYB 5FYLD 1S9XA 4Q97A 5MEPA 1UB5B 3C9NA 3S34H 3TYGH 4G9DB 4PRHB 1QFPA 2CXGA 3W9EB 2CRIA 1KCVH 4UI2A 2KQNA 4EI5D 3UZQA 2D7NA 3RWGB 4KY1H 1NC2A 4RMWA 4J12A 2V7HA 3HE7A 3UJTL 4HT1H 1FLRL 3UTPD 3QQNA 1HQRB 1YNLH 3I6KA 4RFOH 3QDJB 5B39B 4YDLC 3ULVF 2CJUH 1DN0B 4PYGA 4XHJC 4MYWB 5GSVB 3V4PH 1RUQH 3BD3A 4W68A 5I30L 1NBYB 3RNQA 3QUYD 1CL7L 7CGTA 1Z5LB 1UZ8A 4X4ZA 2NQCA 3MV9A 2HG5A 4MNQA 1JPFB 3NFSL 4OSUL 5SWQB 1EGJA 3NCBB 2BNQB 3S4SB 2X4TA 3D18A 1BOYA 3FJTA 2XQYK 3GUTA 2F5AH 1PKQB 1MLBA 4WTZA 4DGVH 5I8CA 2OR8A 3O45A 1A3RH 2P8PA 3CXHJ 4KHXL 4UQ3B 3VD3A 2E8YA 3CGTA 4NFDA 4UTAH 2ICWA 4P2OB 5CHNB 4Z0BH 5TDNB 2EDHA 3QUZD 3TPUB 4OBSA 1ITCA 1NCCH 2OL3L 4PY7A 3Q1SL 4YBQC 2CKNA 3HMWL 1BQHA 2NY0D 3CZJA 5I2IA 1KEGL 1KJ2H 2YZ8A 3VGGA 2F54E 2IAMC 4EVNA 4Q9RL 4PJGB 1S7UB 1I9JH 3DUUA 3GSVA 3QHFH 3V0VB 2IADA 4FQIL 3UC0H 3S7GA 5LVEA 5DTFA 3GJEB 3OR6A 4YR6A 4N0CC 1JHKL 3IRZA 3P30H 4ELMA 1CU4L 4HC1L 3FB7B 4YDJB 5I2IB 3C60C 4YHZH 1KCUL 5EIVA 5HJ3A 2XTJD 3WXWH 3G5YB 4ENED 1N3NB 1OGTA 4F33B 5EORL 3OKLB 5T3XL 4AIXA 1B4RA 1IKFL 4MVBD 1NDGA 3UPCA 5EIIA 1EVTC 5DRWA 3BDXA 3K8LA 4X5WA 2IG2L 1JYVA 1I8IA 4R0LC 2ESVE 3QDGA 5CEZL 4PRHA 4PJDA 5C0JB 1HSBA 1FNSL 4TQEH 2DQUL 2Q7YA 5IB3A 4DZ8A 5I71C 3QG6A 2HLFD 1I8KB 5DD6B 4HUVA 1GAFL 4R3SB 2G9HB 3LQAH 2OL3B 3B8SA 3RBSA 1OF2A 1FFOB 1N64L 5T1DL 5CD5D 5I0DA 2R1WB 1YY9D 2FEEL 5F6IB 4Y0GA 5FO9B 1DE4B 3Q5OA 4M43H 3S98A 4AEIL 3WFCH 3QDHA 4IM8A 4U1NA 5CCKH 1WGOA 1I9RH 2WBJB 3PUCA 2OSLB 1F3JB 3G6JB 3U36B 5DFVC 1YEGH 4JEGB 2OQJA 1I75A 3RY5A 3JWOH 4DTGH 2XZZA 1H0DB 4RWYL 3V8OA 1IGML 1KELH 4RWYH 3UEZA 5DD5L 2JK5B 1EEZA 5SX4H 5GZNC 5IW1A 1XZ0A 2H41A 3PV6A 5CEZH 4D2NA 2VAJA 4OCSL 1CIUA 1EJ6A 5GQBA 1QSEB 1LE9B 2YPLE 4Y2DA 1GXEA 5GGUA 4N9GB 1R3HA 5T1KB 4KJPD 4KI5C 4X0KA 2XQBH 4KQ4H 1J8HA 5CSBA 5EORH 3LEXB 1SY6A 3MNZA 4RSVA 4HXBH 2WZPD 3EJJX 2HFFB 1PVHA 4WNQA 4YDKH 1S7VB 4RMVA 1CQKA 2NY4C 3DO3A 4PRDB 5CD5C 3P0VL 4RRPA 5JIPA 3RX8A 1JGUL 3MUY1 3UC0L 4ODTH 5AZEH 5D2NB 1AXSB 2VXVH 3V4VL 1FV1A 3LQAL 5GIRA 1R5WB 5LBSH 1T21A 2G2RB 3CX2A 1IM3B 3LS5L 32C2B 1ITBB 3ESUF 3I02B 4PD4K 5IV2B 1B0GB 5I1KH 4QCIB 2EDYA 1G7MA 2V2WA 3O2DH 1RZJC 1OD9A 2IALB 1IKFH 2BCKA 2XN9D 3TBSA 4KKLD 12E8L 1Q72H 1LO4L 3ETBF 1DDHA 4JKMA 2QKIA 3VFRA 3K3QA 4QRQB 2AXFB 2YPLD 5ENWB 5J6HA 1Q38A 1ZLWH 1CICB 5FUCE 3RX5A 1U2HA 5IW6B 3UBXI 2C9AA 4OFKA 4ZUTB 1CWVA 4KJPC 2FGWL 4G6FB 3WIFB 5DVMA 2NY0B 2GSIA 2LE9A 3PWJA 4D9QE 3ULUE 4LSPH 5I30H 4HMEA 1LP9F 5ENWA 3QXDA 4HWBH 3V6OA 3V4PL 1MFBL 5DRXB 4LCUB 4PRHD 3STZB 2QQKL 2DIAA 4Z7OE 2W0FB 3T77B 3O2VH 2CJUL 3FT3B 4YHNB 1FORH 2V2WB 4XNXH 1YNLL 2J1KA 1U8IB 4KHXH 3SE4C 3X12B 3LSOA 2HT4D 3PHOA 5A16B 4F80A 5IV2A 1C1EL 3SDXA 1LO0L 1AE6H 1H5BB 3C8HA 4X6BB 3PDOA 3GMQB 5ERWB 5TE7H 4E0RB 3TV3H 1U8PA 4XVUD 3SDAB 1AO7D 4Y1AE 3L3JA 3BGMA 4U1LB 1H15B 5DI8A 4PJBA 2R4RH 3OKDB 1T22B 1MH5A 1O7VA 4GKZB 1I8MB 4M6OH 4IIQB 4W81A 3O4OC 1NMCB 2UZIL 2GSGB 4U7SA 3VJ6B 3RTQB 3C5SB 4P57B 4Q6IC 4OM0H 1FGNH 3FTGB 3B9KD 5CGYD 5L2KD 4B5EA 4P46B 2NXZC 2DQFB 3QIUC 3AVEA 4RFOL 2D7TH 3LKSB 3CFEA 1IEBB 3MYZA 3RIAK 3VFGL 3CVIH 3WIFA 5DMKB 4N1CA 1ULVA 5J12B 5D1ZB 1BQHG 4O02H 5T3XD 5C70A 4R97C 3IETA 4AT6A 1J5OL 4GMSH 3BKJL 3MREA 4NO3A 1JMXA 1QQDB 2ZG3A 2R1YA 2F54D 1S3KL 2HT4C 2VH5L 1QKZH 2BCKB 4M7JH 3WHXB 1KJ2A 2ICEA 2GCYA 1A0QH 4LGRB 1IGCH 4HIIB 3DX8A 1PX3A 1K4DA 2R9HD 3VFWA 1MFNA 1J05B 3D25A 3GHBL 3I02A 3STBA 5BMFH 5CLWA 4BSVB 1NFDA 1S7TA 4LLYA 1GGIH 1ZHBB 4J8RB 2W60A 3CPLA 3FZUD 4NNYB 1Q9OA 4LRIA 5ID1A 1QO3B 2AGJL 4OIAA 1L9NA 4AEFA 1EGJH 1U6AL 4JO3H 1D6EA 1YMHB 4JPIA 3R8BB 4DZ8B 1S9WB 4K7PY 4LKCB 3KXFA 4O2EA 2P7TB 4MA3A 3VFTB 1FL6A 5JNYB 2FDBP 5D71H 1AY1L 3BESR 1CGTA 4QT5A 3CXDL 4K23L 2AK4A 3WO4B 2AJSH 1RFDL 4ODHH 4Z78A 3FB7A 2F58L 1MCQA 3UTTD 4P2QD 3VD4A 3DX9B 2HLAB 1A6ZA 4LHQB 1XFPA 1UJ3A 3FO1A 4WFFD 5J9PA 1J9CT 4KV5E 1CGXA 1FP5A 2JJTC 5HYJE 3C5JA 5I1EH 5JUEH 3T4AA 5SV4A 1QR4A 3BW9A 4ZFGL 4Y2DD 4J3OC 3GI8H 3S97C 3BRFA 2WV3A 3F7VB 1NGQH 3PHQA 3WDJA 4FQQB 4XAWL 3VXRE 2HFEB 2J8UB 2A2QT 1PG7X 3I6GA 5ITBL 2QADD 4KJQC 3SDDD 5I1IH 1EK3A 4I0CC 2J88H 5IG7B 4Z0XA 4OZFB 1AGDB 2L4OA 2X4TB 3BE1H 4ZOBA 4X6DE 4ZUSB 1UZ6E 2DF3A 1GGIL 1CDCA 1TCRA 3ZDXF 4KZDL 3U9UA 3IDJB 4IRJA 2DMKA 2ESVD 4L4TA 4O2CA 4LIQL 1EZVY 1NAML 1CE6B 4DUXA 4PJ7F 3S35H 2BC4B 5BOZG 1D9KC 3MUHL 2YUWA 2GITB 3GO1L 2VDMH 3AM8A 2DOCA 1EFQA 3U6RA 2GAZA 1TLKA 2BDNL 5JHLL 1T6VN 5DK0A 4Y4FA 5IJKC 3EFFB 1I1RA 1G84A 1A22B 1TZHA 1U41A 5E1HB 5IOPA 1FFQA 2ORBL 1BZ7A 1J1OH 2XN9E 4WW1A 4NC2B 4I48A 1S7UA 4NO0D 1OTUC 5FAAA 4RGMC 1F6LL 4BJLA 4P5TD 3MO1B 4M7ZC 2JJUA 4OZHA 4D0DB 3AU1A 4DW2L 4MCYA 2QADC 4KJQD 1T66D 4OM0L 2W9DL 4KGLA 5FA3B 1T1YA 4WEMB 4W70A 4MNQE 3HMXH 1HNFA 3I84A 2NY2B 2OTWB 2X9XA 1B3JA 4H1LB 3ROLA 3BPCB 5FYKU 3RFZC 3B3IA 5D72L 4Y4HA 3O41B 5JHDA 5KS9F 5FOBB 3GSQA 1Q9KA 4JDVB 3REVB 1NBVH 1KPUA 3HG1A 1Q9KB 4JDVA 5A40E 4RMRA 1RVFH 4OZGB 1D5XA 2EEAA 3BPCA 4H1LA 4LSUL 3SGEI 3U0PB 4DGIH 4OCYL 4Q6YA 2Z31A 3KVQA 3DRTA 3RNQB 1OM3L 5A2LH 2VXTH 2VLJE 1G1CA 3EJYC 3L3DA 4L3EA 2DMCA 3U1SH 4MCYB 3PE9A 1V05A 4J3VA 4A6YA 2B1AH 2FJFB 3HZMB 4N8CL 1G1YA 1WFTA 2R2CA 2A6KA 5EC1B 2ZJSL 3MV11 3QAZC 1MHPL 3BEVA 4BFIB 1M7IB 1T2XA 2BHYA 2IBZX 1LEGB 3GB7A 5KW9H 3U0WH 1ZGLB 2G75A 4MX7B 4YE4L 5C92A 2QBWA 1RPQA 3HE6B 3GMPA 3BSZL 1FZJB 4PLKD 5GHWL 1P4BL 4EUPB 2WQ8A 1EHLL 1NMAH 4M7LH 1UC6A 3TVMC 4RWHA 1A1MA 3MTRA 2NXYC 2ZSVA 3O2DL 4V2BA 5E08L 3SKMA 3CFKB 3P11L 4PJ5B 1GGYA 2XN9B 1OGAD 5DEFA 4OD2A 3EYQD 2YUZA 4KI5D 1T2JA 3QIBD 5DEFB 2XA8H 1F4WL 3TT1L 2ITCA 3D39A 2OTUB 2XWTA 2CMRL 3NOIA 2ZSVB 1R5IA 1T7XA 1MCCA 3L5IA 2JCCE 3GBLA 1NLDL 3L6FB 1SJEB 4ZAKC 4OZHB 4D0DA 2X4UB 1IEAA 1ZANH 5DC4B 3SE8H 4PJDE 4PRHE 4KDTA 4RGND 2Y07H 4M1DH 4BYHA 4F37K 1FG2B 3H9SB 5HHMD 3DX7B 4KROB 4PRBA 1ZGLA 1NAMA 4J3SA 4YC2C 1W72B 4NKMA 1DQMH 3ALWA 5SWSA 4DN4H 2EDOA 3ZT5A 4OFDA 3JXAA 4HLZH 2DWDA 5CP7B 4BZ2L 5L2KA 3B9EA 5SWSD 5INDA 2Z35B 3VFMB 4APQB 3B83A 4QOKA 4WI8A 4WHTA 3CFDB 4KTEH 5BV7H 1NBZA 3WLWC 1IGJA 1ED3A 3L3DB 3QQ4B 3WNLA 1KTLA 3MJ7B 4HZLB 1HZHL 4M8QA 3TO4C 1RUML 1H3VA 1I7TA 4LEXL 3P9LA 3HKFA 4TUKH 3BO8B 3SO3B 4M02A 3T65B 5HPOA 4P4KD 1C5DB 4O4YL 1R3JA 5DD3L 1LEKA 1S8DA 2OZ4A 4GG6E 3QIBC 5DYOB 4GO6B 1MI5A 3FO0L 3OL2A 4JFDA 5J89A 2XTLA 1BOGA 3OJMB 4CN1A 2AJ3B 4L3CA 4YEEA 2ATKB 4P23A 3WFCL 4M5ZH 4P5MB 3H7LA 1FFRA 2HFEA 4G42A 3W0WD 1WBYA 2CUIA 5F9WB 4HXAH 3IFLH 2Y36H 3MMEB 2OR7A 5CP3H 5SX5K 3T0EB 3U7WL 5TDPA 1GAFH 3IDUA 1Q9OB 4TSBH 2CMRH 4Q6IA 1UJ3C 5AD0B 4GMTH 1PKOA 2XY1A 2XA8L 5D7JA 2XWBB 4IMLA 2V2XB 4NZRL 4JR9L 5F9JB 3X13B 3HR5B 5BRZB 3FB5A 35C8L 3FQUB 4QRTA 5D2LB 1OOAA 2H32B 1XH3B 4M5YH 3ULSB 4M3JA 4KMLB 3GZKA 1Y18B 1I7UA 2AQ2A 4IRSA 3SCMA 1JN6B 5DHVB 4E41E 5F6IC 5C0GB 4YPJA 4CNIB 1V3KA 3BH9A 4FQIH 3OF6D 2FCBA 2BNQE 1U95B 4CVWA 1JFQL 3LKSA 3UTZB 1BAFL 1IMHC 4KJWD 3TT1H 1T0NA 1VFMA 3HMWH 1KEGH 3BIKA 2PCPB 4HIJB 3BIBX 4LSRL 3E2HB 2DI8A 1KEML 5I15L 5E9DA 4P57A 5EZIL 5JXED 1RUPH 1DBJL 5AD0A 3WS3B 3O3DB 2W9EL 4Y5YB 3ARBD 2D0FA 4QHLA 4ZOAA 3QDME 3O6KH 1I3GH 3BW9B 3VXQA 1J05A 3D25B 4QHKJ 2JJWA 1J0IA 5DI8B 5DVNA 4F57L 1RVFL 1IC7L 1YMMB 5DS8B 4PJEF 3GSXB 3IFOA 3LDBB 1PQZB 3DV4A 4YHIB 3FZUC 3CFBA 5EA0H 4YBLB 3UMTA 4OSUH 5E4IA 2CK0L 1DBBL 2FEEI 5IGXL 4PRIB 1MRDH 1VEMA 5DA0B 5LGHH 4HAFA 3DRQB 5ADOH 4JFYA 5DGRA 1A6UL 1PGRB 2UY6A 4XP1L 1QP1A 5FUOH 4U6VL 4HKBB 4JGJA 4MA8H 3RWJA 1I3UA 2NNAB 1D5IL 3FAWA 5DRNA 3HCVA 4L1HA 5I18H 2O5YL 1T83C 2ZSWA 5T1LB 4OAWA 3DX6B 3LKPA 2D31A 3HE7D 2APVA 4K71B 2I24N 1G6VK 2J5LB 5HHOB 2PKDA 4Y4KC 5CGMA 5D2LA 4W4OA 3VD9A 2AVGA 4MS8D 4G9FB 2EXYC 2NW2B 3JV4B 5F8QC 3LB6C 4KV5F 4L5FL 3MNWA 5E2VL 4JPWL 4HFWA 1SYVB 4XVUC 4Y8DC 3BZDA 2KUTA 4APQC 2OK0L 2YD6A 2CQVA 4JFXB 2X1PA 4CADB 1NJ9A 1I1AC 2OR9L 3O81A 5LGJA 4AQOA 4QRUA 4N9OB 1TTUA 3QO0A 2QJDA 3E8UL 2DBLH 2AXHA 4M00A 4PTUA 1CXEA 5C0BD 1QSFD 4JN1L 2DICA 4JJ5A 5BVJA 3S37L 1YYLH 2JB6A 4M93C 3TIDB 3FOMB 4ODSL 1F11A 2WUCL 4U3CA 3P9WB 1D5BA 5GS0H 3L5WA 3RY4A 4HPOH 3O3BB 1NGQL 5EU3A 1C12B 2UWEB 1F3RB 1G7LB 2HAZA 4GRWF 5IMLB 3ES6B 3PP3H 3GO1H 3HB3C 3QDJE 2B4CL 3VI4F 2K3TA 3MV7B 5GGUB 5T1KA 4Z7OF 4L8BA 4H5SB 4ISVA 2FBJL 1F3DH 2VDQL 3S3JA 2R0ZH 4MNHA 2P5ED 4YHLH 1YEKH 1ACYL 4KZDH 3KNBB 1WCBB 1FC1A 4OD3L 5DJAA 2M2DA 5F70A 1CDJA 4UNTA 4NPYA 2J88L 3V6FA 4ZXBD 4IRZH 2ZPKL 1RURH 2VITB 1UH3A 3L3JB 1J12A 2APXA 4PGCA 1MVUB 2JB5H 1M71B 4ZUUA 4YDIL 3ARED 4XNZC 1H5BA 4KTDH 2QQLH 1MUJB 4K3GA 5M7QA 3MRCB 3QCVL 1I9EA 5BXFA 3LHPH 3BWAA 3DGGA 4H8WL 4PR5A 5EU6D 1S7VA 3LCYA 5MENB 4UDTA 5C07B 1I7RA 1L7IH 1P7KB 3MZGB 1AGCA 4MJ4A 2Q7NA 4AG4L 2DBJA 5ANME 3RGVB 1YA5A 2WK2A 1I1YA 3MFGB 3ZHDA 3VE0A 3MJ7A 4HZLA 1QBAA 3PWJB 3GIZH 3IDMA 2DM7A 5JW5B 4PJDB 5C0JA 1Q9WB 1F6AA 2BSRA 5CIPB 5MI0B 1KCKA 3BKCH 4UB0L 1EIBA 1BVKA 3QUZC 3VGBA 5IIEA 3QEGL 2C3HA 1A0QL 1T80A 4GXUM 3G08A 5D7LB 5I1DA 2PO6B 2VL5B 4NKMB 5C9JA 3GB7B 4G3YH 4HMCA 3AAZB 4LPYA 3P0YH 4NKQB 2VSCA 4HPOL 4JO3L 3SGEH 2OZ4L 3L1OL 1QSFB 3DOSA 4ODSH 5DTFB 2X4UA 1KJMB 2A6DA 4LDLB 5CIPH 1B0GA 3T0AA 3O11A 1B9ZA 2GT9B 4G7YH 3KPRB 1YYLL 4ELMF 3NZHH 5DJCB 1LK2A 2K1MA 3N85H 4CGTA 1J8HE 5D93C 3O6LL 4QHNB 1PY4A 5DC9B 4N5UA 1G9ML 5MEND 3U0PA 4IRJB 2V7NB 3AB0B 1F6FB 4JB9H 5EU7E 3NCJH 1BIIA 1FGNL 5EO0A 2OL3A 4PBWD 2AJUL 1D9KB 3SEPA 4JFQA 3HA0A 2IPUK 3REVA 2BJML 2Q7YB 1T3FA 1X5GA 2RGSA 3O45B 5ILTH 5C0FA 1PW3A 1DBKH 2ZCHL 4F2MA 2AJXH 2AQ1A 5GZOD 4OQ1A 4KDTC 2OTWA 1FYHB 5JA8B 4WWKC 4UQ2B 2R56L 1HH6B 3FOLB 5DRWB 5D1XB 1TVDA 5HYQB 5FUZL 3ZKSD 3TZVB 4NJAH 5IW1B 1QFOA 3MBEA 4N5EC 4KAQH 2NYYD 4M6AA 5FDYA 3TN0D 4K8RC 2XT1B 4UIKL 1IRAY 3CU1A 2A6KB 4Q9QH 4LGPB 5AAMA 1FNHA 3HLAB 1Q0YH 4S2SB 4JRYE 3VXSB 4I77H 1RZKC 4I3SL 1IQWH 1KT2B 3CLEL 2EXWC 3HZYA 1XF3B 4HV8A 4OV5B 4XCNB 2Q8BH 1RZIA 2P44B 3QJHB 5FUCC 3EDFA 2WBJA 2EZ0D 3I85A 2FGWH 3C87A 3EIFA 3NABL 5DVOA 1BFOA 1X4ZA 4GRMA 4EN3D 1XCTA 2AI0L 3H0TB 3L5JA 4PLKC 2ADIA 3RHWK 2IBGA 1BWMA 3V7MA 2ARJA 1VACA 2VQ1A 5GZND 2WLYA 5DJXB 3VFTA 1PD6A 5JW4M 1IILE 3PL6D 3ROLB 2C3GA 2Y7QB 2GUOB 3WIHA 3MOBL 1S9WA 3A6CH 3DSFL 5BJTB 2AK4E 3G6DL 1QBMH 5E00B 5DK2B 1H8OA 2F15A 4DKFL 2HLFC 3UYRL 4ZSOA 1JPFA 1KEMH 3NN8B 4HGMA 1XAUA 2CPCA 2OS7A 4NO2B 5TE6L 5KVFH 2NX5D 5C0CB 4N5ED 4FP8L 2EDNA 3QRGL 2VLKB 3MGOA 3NBNA 1SY6H 3B43A 3A6BL 1I85C 5C7XH 2VXVL 4Y19D 3V4VH 5EWIH 1EAJA 4UOW1 3M45A 4ZO7A 3OG4B 1I1FB 2VLMD 5DO2D 2CSPA 2IWGA 4N8VG 3QH3A 5IHBA 5I74B 3HI5H 2FX9L 5C0BA 5B4MC 2EXWD 1IAMA 1Y0LA 2EYTA 3VXSA 4LGSB 3TPKA 5A2JH 1LE5A 4LCCB 5F1OB 4TVPL 1VFAA 4GKSB 2I9LA 3P4NB 4NSKB 4GKOA 4PLNC 1A5FH 4D0CA 1ZLSH 5IQ9B 2OJEA 5B8CC 4Y88A 5AYQA 3X14B 4FFVC 4JKLA 5A1AA 4D94A 3QP3A 3OAUH 1OARL 1KB5B 3KJ4C 4LHUG 1HH6A 4FXLA 2NR6D 3E1F1 4XNYH 5I73B 3CVHL 3QCUL 5EZJB 3P0GB 2NLJB 3SE3C 4YBHA 4V1DA 2VLRA 1JV5A 1QLFA 1SJVA 5C09D 3ZKMC 1PG7H 2OP4H 2CIIA 3HRZB 2R1XB 1FH5L 4JFQB 1T03L 4LLDB 3C6LB 4GRMB 4P5TB 4RX4D 2IH1B 1KC5H 1S78D 1YMME 3AY4C 3KPRD 3F12B 3OKDA 3MV9B 2N7AA 3RJQB 3VXMB 1KC5L 5DFTA 3BGMB 1UZ8B 3D5OF 1BQSA 3CSYA 4XCNA 1BZQK 3IJYA 3FKUS 1B6DA 5GSVA 1CG9A 4N0YL 4NT6A 5DJ6A 5FF6B 3WEXA 3O11B 4EN3B 2GJ6D 1OP5K 3WN5B 4PLJC 4OLUH 1IGMH 1KELL 4ZD3H 5ESVA 1U93B 1QPXA 2DLFH 3INUL 5EU6E 5KANG 3TESA 3M07A 3RWCA 2H8PB 3P40A 1T20B 4HG4K 1HDMA 1WZ1L 5HHMB 2GSIB 4R6UA 2HJLB 8FABA 4LKCA 3TN0B 1WIOA 1IAII 3CFEB 4WDIA 5DJ0B 1S5IL 1U0QA 1DUYA 3ILQC 1VKXA 4JPIB 4ZFZA 1D9KA 4KRLB 1TIUA 2Z4QA 2FX8L 3TCLA 2F19H 1FE8L 1I7RB 1A3LL 3GJFK 1ORSA 1BHGA 1AGEA 2FZ3A 3QRGH 3SCMC 1CICC 1GGBL 4TQEL 5ALBH 4Z18A 3VFWB 1TITA 3QUML 3PWUA 4JDZB 1M71A 4X7TB 3UBXA 1N5AA 2BVUA 2PTTA 4CUCA 1EHLH 4PGZA 2CR6A 2HFGH 4J7RA 5EO9B 1AJ7H 5MENE 5C07E 1AD9B 3X12A 1QNZH 1TJHH 1J7VR 3BSZH 4X98A 4EUPH 2YD8A 3GDBA 5L8LB 5EOCL 1UG9A 4JQXC 1J0KA 3DPBA 3FQTA 3NFSH 3AM8C 3SO5A 4NN6B 3ZZ1A 3EJZD 2FWOB 1E4XI 3D48R 2EH8H 4OGAD 2P5EA 2VLRE 4OV6F 2NY5C 4Z8FH 1ZK9A 4OLEA 3V0WL 3HCVB 2WMPA 5D7IE 4FHBD 4XC3H 1JGDB 2YUVA 1MCPH 5C86A 3ABZA 3CXHK 1KENH 2UY7A 5TFSL 3X17A 5IR1B 5T33L 1K2DB 5DR5L 3RHWF 3VI3F 5HHXH 5C07A 1YPZE 5MENA 5E94A 3NCCB 1XIWB 3QNXA 1XGUB 4XNQA 5BZWB 4YFDB 3ZYZA 2EO9A 2XPGA 3O3AA 3MJGX 2F5AL 5DQ9A 3B9AA 4P2QE 4KVNH 3IDYB 4JM4H 1SYSA 1RIVH 4JRYD 5ESVB 3MRFA 1A4JB 4RAHA 1NBVL 4B53A 3BDYL 1JF1B 1E6JL 2A9ML 2SEBA 5HYSB 4ZXBC 1TETL 1WBXB 3DYOA 2PXYB 4C56D 4RZCA 3T0XA 3BT2L 5FFLA 4JY5H 4JVPA 5M94B 3RI5K 1L7TL 1WCBA 1W0VA 1WT5A 5ACZB 3ARTA 3PQYA 2Y9RT 3MRGB 2VLRD 2HA1A 4L8SB 1S7XA 5FYKH 3WYRA 4R3SA 4JRXD 2HP4A 3CUPB 3QIUD 3MRIB 3N85L 1FLRH 4HFUL 3E6FA 5ACLA 3WE6B 4G7YL 3SGDI 2CDFB 5IMLA 1WAAE 3O6MH 2IPKB 1INQB 3L3KB 4P2RA 5L7XH 4LVNB 3LRHA 2Q86B 2BDNH 4CL7A 3L5WB 1NDGB 4MXQC 5EIIB 4NDMA 2RIKA 3QIWA 1HYRC 5IFHL 5I1CL 4U0QB 4PLOB 1CIDA 1N3NA 1OGTB 4PG9B 3F7QA 4S0SD 3THMH 1ZS8A 3PHSA 4X6DF 2OJEB 1JNLH 4ELKB 3EYVA 3HR5A 2V17H 3LB6D 3AS2A 4J1UA 4E41A 1T2QH 1A9EA 1R5VB 3CCHB 1U36A 1KXQE 3DWTA 1XGTB 2B20A 4N0UE 2X7LB 1JMZA 3CSYB 2GFBB 3RZCB 3UJJH 4XBEH 4WFGD 2Z93B 4JPVL 2JTDA 4BFBD 4JRXE 1UADC 3ULUH 2X4NA 2O93L 4F7TA 4IEFB 4F9PC 2IAND 4QKXB 1X6LA 2D7PA 1D5ZB 3D87B 5I1GL 5E8OA 3QUYC 4U6HB 4NO2A 1V7MH 3R0MA 4HIJA 4KC3B 5DZOA 4M8VA 3FN0H 2VDKH 1DLHA 3MRMB 5GS1C 1R3HB 1TTFA 2BVYA 4HUVB 3D18B 4M1GH 3BP7B 1CXFA 43CAA 1LEKB 1LO5A 2ZPKH 3IDYC 2HG5B 1G7JA 2F54B 4G8GD 4CNIA 1KUMA 3WV0A 1NBYA 5GJTL 4QHKI 1LDPL 1A6AA 4WWKD 5KAQG 4ORGA 4N8VB 5C0DA 5IVZB 4I0PB 2H32A 3PDGA 2X70B 4DZBA 5F7MC 1ZV5A 3BISA 1EHXA 3JWOC 5EFIA 2HT3D 1JL8A 3IAQA 1YZZA 2B4CH 3GHEL 4U1NB 5KBNC 3DLQR 5JW4Q 4Z76A 4OZ4B 1DVFB 2HJFA 4H1LH 1NUFA 4RX4A 1REIA 3EDKA 4R97B 4LLVB 2R1WA 3PXJA 1BF8A 1XEDA 3F7RA 3UAJD 3LS4L 2V9RA 5C0CA 1B0RA 3C60D 1SJEA 4JPVH 1JF5A 3S37H 5EBWA 5F7FA 4KMTL 4P9HC 3KWWA 1I7ZB 2C3VA 4LASL 4CMMA 2QADB 1AGFB 2YD9A 4Q58C 1A47A 4YHPA 1HSBB 1KLUA 4HIEB 4N0UB 1YEKL 2AJ3A 3ROOB 1KPVB 2XN9A 1L0XA 2VQ1B 4QRPA 3BN9D 2VLLB 4PV8A 1DVFC 4GRWB 2OX5A 4GUPA 4JPWH 4EDXB 2QR0A 4HWZA 2R4SL 5F7HA 1I7UB 1BIIB 2HMID 1PG7W 1X5LA 4PB0L 4XXCC 5GZOC 1EPFA 2BVQB 5JW3L 1URLA 2DTML 3R06B 3TNNB 1MCNA 1MIEL 2DL2A 1FNEB 4GMSL 2EC9U 3L95B 1KPRA 3GJEA 3OR6B 3GSNA 3O3EB 1RMFH 5ADPL 3WBDA 1IQDB 5L7XL 1T0MA 4MD5B 4JN1H 4DJMA 5C0EA 2AXGB 2X4SB 5I18L 2YK1L 5K93A 3K81A 3R1GH 2YZ1A 3IDGA 3PXHA 2ICWJ 5E8DH 4OKDA 2FJFA 3ARDC 3HZMA 2MQ3A 3RTQD 1MHEB 1HILA 1X5IA 5IEKA 2NW3B 2VL5A 5FKAA 1G7PA 1L7TH 4MB3A 5C2BL 6FABH 3V7AE 5SWZA 4WU7A 5J0BA 2BRRL 1YEJH 3H9ZA 1TETH 2GJ6E 5LGHL 1E6OL 4J4PC 4FA8A 1D5XB 1DBBH 4CRPA 2EKSB 1CD0A 1QHOA 3H9SE 5E5MB 3HPJB 4OT1L 1NCAH 5I8OH 4JRYA 2OTUA 1RK1B 3PDDA 1OTTD 4NHUA 1NEZB 1LNUA 1G7IA 3M8OH 4R7NA 1DUZA 3RZCC 4FS0A 4K3DL 2J6EH 4JKPL 2MJWA 3ARGA 3C8DA 4MJIB 3HPJA 3LVEA 4XCEA 3CK0H 3MRNA 3QXUA 3V52H 3OMZA 5ANMB 5HHXL 3DVNB 3V6OE 3F5WA 2QQKH 3DMMA 5K9OA 2ZG1A 3LN4A 3C6SA 5HXMA 3RDTD 1A6UH 3QDJA 5B39A 3BFOA 4PGEA 4FNLH 3MLRH 4P99A 5HD8D 2MWCA 2VITA 3GSOB 2FIKA 1CGSH 4PJFA 2EDEA 3RDTB 3PWPE 3ARSA 1WF5A 1JF6A 4N0RA 4PLJD 5DHYB 1UA6H 1LK3H 3HHRB 3TM6A 2ZNXA 1HKLL 4KQ3L 5L8JB 1F4YL 1J0YA 1Z9SA 1ZSDA 3MODH 2GITA 5JOEA 1Q72L 5I1HL 5ANMA 1F00I 1JK8A 2BC4A 1YPZA 3MRPA 1KIQA 3SPVB 4JFOA 2FL5B 1E27B 1TXKA 4H5SA 3TVMD 3LEYH 1QLEH 2Z31B 2MOVA 3C2AH 4LCWE 4PJEA 1KIRA 2B1HH 2R69H 1K8IB 3FT4B 4L4VE 4E41D 2NY3D 3VGAC 4Z95L 1UM6H 3GMOA 5JXAH 1NKRA 5DXWA 3Q48A 3HG1D 4MDIA 1A3LH 4QOKE 4I8DA 1GZQB 2VO5A 3QUYB 1HINH 1M7XA 3QIBB 3B3IB 3ZYOA 3IFLL 5I75B 3FB6B 2BNRA 1W0WB 2BERA 3P0VH 4JGMA 1H3UA 3F7VA 3RDTC 4PGCB 4IJ3C 1P69B 5A2IH 4YDKL 4F58H 3UXFA 1L9MA 1IM9A 1NSNL 4BUGA 4YIQB 1NJ9B 4PJHF 3VFPB 2FX7L 3T4YA 5EC1A 5IK3A 5IFJB 4G5ZL 4HJJH 2DM2A 4LP4A 1EX0A 4NZRH 4DK6A 1IAIH 1MF2L 3KNBA 4HGWB 1M6OA 5INCA 1TZHB 2NY7L 4X4MA 1IC4H 2CO6B 2JJSA 3A0OA 3SKUD 5FGCE 4CW1B 4CVZB 3D85B 3MLSH 4Y5YC 1JTPA 1GOHA 5E6IB 5KSAC 4XNUL 2D0HA 4WHCA 2KL6A 1DQJA 2Y36L 1G6RA 2WBJD 5T1LA 3JV6B 4GAJL 5HGAA 1XGQB 1FVCA 4JM2D 2AJVH 2X40A 2YEZB 1UXSB 4XCYB 4DWHA 5DUPH 1LO2H 1OAKL 2NNAA 3CFCH 3IDJA 4JKKA 3TIDA 4KRPB 3ILQD 3V0AC 4PPTA 1S9VA 3QUZA 5T1MB 2YRPA 4M1DL 2F53D 1KIPB 5L0QC 1ZT4B 2XNAB 1T1YB 3BEWA 5E5RB 4GAJH 1ONQA 2W1NA 1AHWB 1LD9A 4ZXBA 4KKAC 3CLFH 3RAJH 1ODAA 3BWUC 3P2TA 1E4WL 5TPWL 2YSSB 3S5LG 5IF0B 3TLRA 4BQ8A 3T3PF 1HZHH 2BNQD 3ESVF 3IFOB 1ZT1A 3OR7B 1OSZA 3JZ7A 4UNVA 3QIUA 2MQ0A 5J6GA 5IBTH 4G8IB 2WINA 4HIIA 1L6XA 2ADJB 1PBYA 2GAZB 4RNRB 4X8XA 1OGAB 1OCWL 4K3HA 5E9DB 4G6AC 4JHWL 4XRCA 4YHZL 4PY8I 3Q0HA 4OD1H 1Q8MA 3FFCB 3RWFB 4DKEL 5D1ZA 5E0QA 5E8PB 5CINL 2NY1C 3HI6H 1K5NB 5GGVY 2IANE 2AK4D 43CAB 4F3FB 1MHPH 3IFNL 5K9QG 2YEZA 4XCYA 4Y5VC 2BXZA 3WDIA 5E2WH 5KVFL 1RUAH 4N8CH 4BQCA 4ONFL 4MHHI 2V2TB 1Y18A 3HUJB 5FGCB 2KKQA 2P7TA 5EN2B 3SE9H 2DDQH 1KG0A 3HTLX 3QG7L 2ZKHH 4WHYG 5E6IA 1F8TL 3MRIA 3ARPA 3SDCD 4B50A 2Q3AA 1CICD 1QRKA 3VRLE 4NGHL 3KPMA 3H42H 5C0CE 3V6OC 5GXBB 5INCB 5ACZA 4GG6A 3T4AB 4YUEL 5GHWH 1UA6L 1ZT1B 3OR7A 5IK3B 2PXYA 4UT6L 4OF3A 2H45A 1BWWA 5HHNA 5FECB 1IAOA 4M6NL 3BQUB 1CD8A 3MMEA 2HLAA 4UMGA 1YJDL 3HC4L 3WSQL 5A16A 1CZ8H 2ZJSH 3D39D 1MAML 4DKAA 1N8ZB 4Z7WF 4PREB 2Z31D 5DQ9B 2B1AL 3DIFB 2L7UA 3MJ8A 3BP4A 2DLHA 2OLDA 4XNQB 4BH7A 1UM4H 25C8H 1A6TA 5BZDB 4LHJB 1LO3H 4K55A 4UIKH 5E94B 1CT8A 2XRAL 1WFUA 3TA3A 1IGTB 3HZKB 1ZHNA 2MHAA 4HKZA 4O2EB 1N5YH 4IOIB 5FUZH 5HI3C 4JREC 2V5MA 3O9WD 4M1CD 4TPRL 2GW5A 1OWWA 4G80B 4R7DB 5BRZA 2MCPL 4YH6A 1Z3GH 4QRQA 4HS8L 4BSWB 2QKIB 3Q6GH 1G7QA 5F9JA 1IZJA 5HDBF 4XP4H 2YXMA 1MY5A 4H0HB 3LD8C 3ARFB 3CFDA 4GLRH 3TBYB 4ZNEE 3MLWH 3U46A 2W0LA 4X4ME 1QTYT 3VJ6A 1F5WA 1G7MB 3VXME 1WZKA 5L9DH 4U1GB 4NQEB 4APQD 2Z8RA 4PJ7B 5SWSB 4DGYH 2V9TA 4EIZC 1EUTA 1EJOH 3WD5H 4NKOA 4IMKC 3MRJB 5SV3A 5TDOA 2UVFA 1MI5D 1LWRA 5DJ2B 2Y25A 1PYWB 5I1IL 4ZTOL 4OQTA 1INDL 3PHOB 3C5ZA 4KK8D 5EU6B 2XXMB 1QVOB 4LAJH 1BD2E 3GMOB 1V8HA 1VADA 1BJ1H 4OCXH 5FO8B 1VEPA 4X5XB 5SX5H 3Q6FA 1FIGH 5I1EL 4POZD 3BD4A 2VN4A 3ULVL 3CFKA 4LOUD 3WL9A 1Z0MA 3ZHLA 3LZFH 3OXSB 4NQDB 1LP9A 2J4WL 5E5MA 3TN0A 4MQ7A 1NCBL 4AL8L 4WHTB 4F8QA 4KFZC 1RIUH 1CF8H 3ME0A 4MD0B 2PXYC 1I9IL 2R8SH 1ES0A 5DHYA 2B0SL 4NUJA 3P73B 4QF1A 3OAYK 2KQMA 5JORA 2NYYC 5IEHB 2NY6B 2NW3A 4L8SC 4EXKA 1AO7A 5FYLH 3OHXB 4KK9C 5DJDA 5C6TH 2NY1B 5HI5D 3TWCL 3D3VA 3GMQA 1U92A 5JLZA 1KBGH 1OAQH 2MSPA 3SDXB 5KVMC 1A2YB 2VKWA 3HAEB 1R0AL 2F8XC 1J88A 3L6FA 4LBEA 3LSOB 1KPRB 1UKTA 4AY0A 2W38A 4FG6D 3WO3B 4CDGC 3FT3A 5IB4B 5D1QC 3PWPD 1UFUA 4KRPD 3VXRD 3QUMB 1RIHH 3V79C 1G7IB 4R7NB 4Y4HD 2R2HB 4PJGE 3OGCA 3EOBA 4OKVA 1WBZA 2FO4B 4XVTH 5DA4A 2QSTA 1I8KA 2XYCA 4P2OD 4S11A 4JRYB 3UZEA 4Y7MA 5I16B 4QRPB 4P2RD 3SHSA 4OBRA 2R8SL 3OZ9L 2NX5A 4DEPC 3PV7A 2VZ1A 1IC1A 4LLWB 1ACYH 4JRWA 4IOFC 5F71A