4M5YH

Crystal structure of broadly neutralizing fab 5j8
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
224
structure length
217
Chain Sequence
EVQLVESGPGLVKPSDILSLTCAVSGYSISSNYYWGWIRQPPGKGLEWIGSIYHSGSTYYKPSLESRLGISVDTSKNQFSLKLSFVSAADTAVYYCARHVRSGYPDTAYYFDKWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 5J8 heavy chain
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 217
sequence length 224
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5yH01
4K3DH 4MZ3A 5E8DH 1MQ8A 4Y1AD 4KGJA 4MJIA 2PYFA 5DJZB 3NCJH 5EU6B 1AGFA 1S3KH 1FAIL 2HWZL 4Q9RH 5HHOD 43CAA 5BV7C 2A74B 1YYMH 4ZFFB 1GGCH 1VKXA 5CP7A 2VOTA 1DQQB 3F12A 2OTUB 3HUJB 4LL9A 4GAJL 3V5DB 1OW0A 3IDUA 3BX7C 4ELMA 4HUKB 1CFNA 1OVZA 4BSWA 4KTEH 4KRLB 2H3NA 5JR1H 4I3RH 5J3HD 5DFWH 1UVQA 4BQ8A 3D85B 1OLZA 4X6EA 4YWGH 2HTKD 4PUBL 1FJ1A 3EYFA 3D39B 2X1WL 4K71B 1A6ZA 5A3IC 1SBSH 2EDJA 4GS7C 1BFOB 1AIFB 3ZTJG 2PTTB 4PRAA 4CVXA 4QO1A 1KT2B 4B0MM 3MACH 4ODWB 2EDBA 4HCRL 2EDXA 5EC1B 3SDAB 4WY7H 4LLVA 4ZMAT 4XB7A 3CXHK 5IB3A 4IIQA 5EU5B 1FZOA 4KHXL 1X7QB 3S98A 1IAMA 5JW4N 3C60C 1D5BA 4UIMB 1BEYL 2CH8A 5E08H 4Q6IC 3VXPB 3NCCB 3MNZB 4QCIB 3ZHDA 5DA0B 4MD0B 4HS3B 5IVOA 1FYTB 3NIGF 1F6LL 2R39A 2IH1A 8FABB 3C5SB 2VLJA 1LO5B 2Z0BA 5C6PB 4LNRB 3BXNB 4XWOC 2OX5A 4NZRH 2Z35B 5KS9F 2X1QA 3VFSA 4Y19B 4OZ4B 3KLSA 4JHBA 3MLVH 2E9IA 3QUYB 1DANT 3RIAK 4WJ5A 3QR2A 4BZ1L 2XZZA 4S0TD 4IBLT 4XCEA 3NA9L 4NM4L 4YBLC 2QQKH 2GSIB 2K1MA 5CKAA 3DMMA 1KB9K 4KMTL 4MAYC 1RZKL 2V7NB 2Q87A 4GW1B 2VQUA 5CWSA 5I1KL 4KRPB 5JZ7D 4KJWC 1U2HA 1FIGH 5FM8A 2ORBH 3B9KC 1NAKL 2XG5A 5DDHB 3EDKA 2VE6B 3LSOA 3LDBC 4D8PA 5IB1A 5C07B 1P6FA 1J8KA 3N85H 3QQ3B 1MCWW 5HVHC 5EUOE 5DD6B 3MRBB 1XZ0B 4U1SA 4M1GH 3R06B 1LWRA 5T33L 1FFNB 2FBJL 5EWIH 3ZDXF 5D7SL 1QSED 1IEAA 1GGIH 3MRMA 2NZ9C 4OFYD 5B3NA 1MI5A 4LLQA 4RFOL 3JUYA 4PRHB 4XCYA 2D7TL 1FAIH 2HWZH 5SWQB 3RKPA 2QADB 3QDMB 4OLEA 4JZNA 4HWUA 2EEAA 4L4TD 3CFJA 4GAJH 3VXTA 1WTGT 3TP4A 3MA7A 1AO7B 2ICWB 3HAEG 4EI5D 2OS7A 5IMLA 2GSGB 1U58A 4KK9C 4PUBH 1U6AL 3UC0L 4LLYB 2EYTA 4JFDB 1JPST 1PEWA 1LGVA 3ARQA 2YBRB 4U4BA 4MNQD 1T0NA 1QVOB 4KTDL 3C6LD 2GK0B 4HCRH 4JN2B 3MCLL 3SDDA 1SJVA 2YWZA 4HF5H 4Z7VF 5J4MA 4KHXH 5HHMB 1OWRM 1A9BB 1CL7L 1OD9A 4HLZG 1BEYH 2UZYB 4WI3A 2NX5A 4RAUB 4WU7A 3VXRE 5HGHA 4LCUB 1KPUA 1NDMA 2ZJSL 4JFZL 2AJXL 1JJUA 4XPHL 1H3XA 1RHHA 2VXSH 4J23A 1EHXA 1XF1A 4LKXB 4PG9B 2HG5A 3CFBB 4OFVA 5E4EB 1CFTB 2OI9C 3D1MC 3HG1E 4JHWL 3HR5B 4HZLA 5BVJB 3S4SG 1A4JA 2VDRL 4UUJA 4XP4L 4BZ1H 2DMCA 2F54E 4QRTA 5HTSA 1F97A 2P45B 5D7IB 5DQ9A 5JIKA 3NA9H 3QNZB 1IEHA 5A3ID 1XIWB 5JORB 2AQ1A 1ZT7A 4PRDA 2HKHL 1RZKH 5F3BA 5I1KH 5E99L 2HT4C 4HKZA 4Y16C 3HPLB 5I1CL 5F72S 3PGFL 4OM0L 1U95A 4UOJA 3C60D 3V4VL 1Z9LA 2ADJB 5I66B 3G5ZB 4G3YL 3TIEB 4QXTA 5T33H 2AKRB 2XN9A 2FBJH 3OXSB 4K3EL 5D7SH 4TQEH 4JRYA 1XGYL 4CMMA 5K9KB 4DZ8A 4RFOH 1T20B 5DSCA 3C9NA 5AZEL 4I48B 4X6CB 5JOPD 5JPNA 2O26U 2D7TH 3MRLB 5E6IB 5EB9A 1JBJA 4XWOD 4WWKB 3ELAT 1FSKC 1J0KA 4M62L 3UTPE 4YDVB 3M17B 5C0BE 4PRPE 2OK0L 3LVEA 2HFTA 1FVDA 5EBLA 4HIEB 32C2B 4P4KC 4UQ3A 2X4SA 2NR6C 2JE8A 5EORL 2ZOKB 1ZHLA 3HRZA 4JGMA 5T5NG 1JRHL 1Q9LA 1U6AH 2VLLA 4MAYD 5C0AD 3UC0H 5JOFA 3B3IB 1QA9A 4KJWD 3B9KD 4LVNC 4UNVA 2P47B 5EOCJ 3DRQB 3FO2A 3BDYH 4TUOA 1IAOA 4HDIB 1DP0A 4UB0L 3MCLH 4R4NC 1U8QB 3VCLB 2AK1L 1UM5L 1T22B 4PJFA 4LGPB 4XPGL 4H1LB 5D2NB 1XMWA 4MDJB 1CL7H 2DICA 2EZ0C 5EIIB 2NZ9D 2G75B 3MV9A 3IJHB 3MZTA 3EW3B 4WGWB 3ZT7A 1QRKA 3QULA 3O45B 2ZJSH 4JFZH 4MQ7B 3GM8A 1VGKA 3HZYB 4XPHH 1BD2D 1JPGB 5TE6H 3MCG1 1LEIA 1BQHB 1MHEA 2D03L 3HI6L 1ZTXL 3ZYOA 3ARBC 4JHWH 1HOCA 5J6HB 4N5EC 4XXCC 3STBA 2VDRH 4R0LA 4FQQA 4XP4H 3O8XC 4HHAB 4P2QD 4KK9D 3VXNB 3EIFA 5FYKD 1EGJA 1CGWA 3DO3A 5FO7A 5M7QA 2R2BA 3ZYZA 2VIRA 3EFFB 4Y5YA 4LMQI 2HKHH 5HVGB 1CWVA 1MFNA 4NSKB 5E99H 1UM4L 5D7KD 4IJ3B 1BOGA 1JPTL 1P4IL 5I1CH 3PGFH 4OM0H 1FPTL 2HLAB 1C16A 3KPPA 3DURB 5EU3B 3SDXA 3V4VH 2M2DA 1NGWA 3ALXA 4MSWA 4G3YH 3OXRA 3DXAE 3BZFA 5JHDA 4ORGA 3HE7B 4K3EH 4RX4A 1D9KB 4XNMB 2CIIB 4WHYH 4L4JA 5ISZA 2XICA 5F8QC 5FYLD 1LEKB 1XGYH 5HHNB 5AZEH 4PJIA 4PY7B 3F6LA 1FBIL 3AREB 2NY3B 1MCRA 2IBZX 3EJYC 2FH6A 4RMVA 3Q6FB 2FHFA 4YPGA 4ISVA 4M62H 3C09C 3HG1B 3KAAA 3Q5OA 1WK0A 2FLRT 4NRYA 2A6JB 2OK0H 4MLIA 5E8OA 2NTFB 3SDXF 3BP6A 4JKPL 5EORH 1FDLL 1RJZB 1TQBC 2A9NL 4KAQH 3S3JA 4V1DD 2D7PA 3MNVA 5HDOA 3WUWA 5IFJB 3CX5J 1A6PA 1JRHH 4HJGA 4AENA 5GGQL 1C7TA 3FHAA 2HT4D 4ZOBA 4Y16D 4GW4B 4M6ML 4QHKI 5CJ8A 5LAXB 3PIQB 3FQNB 3VGGA 3PJSA 3NIFE 4CVWA 1O5DT 4M5YL 1IGTB 3MV7D 5ITBL 5SWSB 4XWGL 2AK1H 1UM5H 4NQDB 3KPSE 3MRDA 4XPGH 1RUML 4NPYA 3DRTA 5JDSA 1A7BA 4HUWA 1F58L 1MJ8L 5ETUA 5FYJD 3G5YA 3PGDA 4PJGB 2Z31B 4AIXA 5ICYB 2JCCF 4NQEA 3C8KB 3FB5B 5F1NA 1XCQA 4FQ2L 2BERA 5AAMA 5FB8B 5C08B 3QA3A 2D03H 3HI6H 4OF5A 1HE7A 1ZTXH 3O2VL 3E0GA 3L5IA 3MRKA 5E03A 4L8BA 4I18A 2VERN 4P5KB 4P4KD 3C8HA 2NR6D 3KGRA 2QLVB 1U8NA 4KROC 3MJ7A 1NBYA 2KBGA 1H3UA 5F9WC 1IC7L 1RUPL 1VFOA 3PL6C 1S7SB 3LIZL 5CJOL 1UM4H 4L8DA 4MJ5B 1L7TL 1N64L 1S7XA 4PY8J 3LOWA 5DHVB 1JPTH 1P4IH 2EO1A 4R4ND 2NLJA 5BS0D 3FMGL 1FPTH 3WXWL 1L0YA 5ICXB 4LF3B 1UZ8A 2FCBA 3QI9C 3L3DB 5J1AB 4J4PC 2EZ0D 3DIFA 3FT3B 1NAMA 1VFBB 2DTMH 3MRIB 3WFHA 3DV4B 1T3FB 2OMNA 3NCYS 4I9WE 3GSWA 3X12A 1JYNA 1A6AA 3UPAA 3RIFK 1K3IA 5T1KB 5IJKC 1FBIH 4NZTL 1A6UL 3T0BA 4HFWB 5IW3A 5IMKB 4R26L 1KXTB 4U1HA 2FIKB 3ARBD 1OTSC 3TA3C 1KN2H 4G9FD 3U0PB 4LHUA 1NCAL 4D9QD 1PX4A 2A0LC 4NUJB 3O8XD 4L8SB 4HH9A 1I9JL 2A77L 4RGOL 2OR7A 5E1HB 3HE6A 4G8FB 4JKPH 1K85A 4D0DB 1FDLH 1JGDB 2A9NH 2HJLA 3BP5B 3HCVB 5DC0A 3QFDA 4R96B 3FAXA 3X11B 3L9RA 5DR5L 3BDBA 4YAQA 3LN4B 4M6MH 4FTVD 3KVQA 4DN4L 4WFFE 3BDXA 4BQ6A 2X4QB 1XAUA 4M5YH 4RBPK 1HSBA 5ITBH 3LKNB 4JREB 3RVXD 5DZOA 4XWGH 2W1NA 1S9VA 3V8OA 1NL0L 4BUHA 4LEOB 3EHBC 4YHPB 4QHMA 5FKAA 1RUMH 3V4PL 2CRZA 1F58H 1MJ8H 3BKML 5E5MB 4YXLL 3S35L 1D5MB 5EUOF 5DEFB 4R2GB 4MA3B 2V9QA 4U6HB 3EBAA 4OF0A 4PJ5A 1QSVA 4ZQKB 1H15B 1H8NA 3EJYD 4FQ2H 4TN9A 2MQ3A 4RMRA 4H26B 4ZD3L 2XTJB 4NNYB 1AP2B 3O2VH 1XGQB 5CFHA 2ADGB 1HHIA 3STLA 4NN7B 5IB5A 3SBWA 4QRRE 3S3PA 5JIHA 2R2HB 2BOBB 2ICEA 1IC7H 4MJ4A 5F89B 1U9KA 1VSCA 4X9IA 3ZDZF 3BFOA 4BH8A 1A21A 3T3ME 4FMFA 5DS8B 3LIZH 1N59B 3NN8B 5CJOH 3Q3GA 1L7TH 1N64H 2ZOLB 2MQ0A 3QUKB 1U93B 3OKLB 3OB8A 3MRFB 5F1SA 4EDXB 3RUGA 1U3HA 4PGZA 1HHGA 4I4WB 5C6TH 3FMGH 2ERJC 2Y9RT 2HN7B 2YA0A 3WXWH 3PHOB 5HGDB 3FB8B 4L3EB 2Y72A 4O2FB 3UJJL 1Q9OA 2DLFL 1S7VB 4OZIB 3FKUS 1ODAA 1FNEA 5GISL 3RWIA 3T1WA 1RZKC 5DMKA 2FJGB 3O4LE 2FEDC 4LGRB 4LCCC 2MPAL 4HK0B 4LCWD 1HHJB 1I1AA 4L3AA 1MHCB 3CFKB 4NRZA 3UTTA 4ONHB 2IAMC 3V5KA 4NZTH 1A6UH 5BRZB 2FYYA 4R26H 3PXHA 5K9JL 4MA1B 4CN6A 5B38B 3WO3B 5D6DA 1WAAA 3EYOA 1IZJA 2ZUXA 3RUGF 4RBPH 3WLBB 1NCAH 4E42B 4KROD 4U1LB 3HNSL 2BNQD 1I9JH 2A77H 4WUKL 3SE9L 3TWCL 3K1DA 2BVPB 1S5IH 1E4KC 5DR5H 1X4YA 3NA4A 5IMOA 1ACZA 4DN4H 2IANA 2GT9A 2HAZA 5DJYA 3QG6A 1XR8A 5CUSL 3WHE1 2LU7A 3QI9D 1H0DB 3QPQC 4J4PD 1IAKB 3V4UL 5BQ7B 3LN5A 2EDHA 3MRJB 1JUFB 3NMEA 1EZVY 1WAAF 1NL0H 2W59A 3S9DB 4HKBA 1F42A 1FE8L 2CDFB 1BP3B 3V4PH 3QEQD 4W6WB 4YXLH 3BKMH 1MNUL 2R0KL 3GMNB 3K2UL 5DD5L 5I74B 3S35H 2Z93B 1TCRB 4EIZC 3Q1SL 3WHXB 2ZPKL 1RJYB 1W8NA 2AW2A 3ECBB 5F9JB 4TUJB 1OTSD 4ZD3H 3TA3D 4KKNA 2AXGA 4OI9A 4U1MB 5D7JC 1I7RA 1SYVA 3PWJB 5T1MB 5B39A 5CZXC 4D94A 2A0LD 4L9LC 2JK5B 1R3JB 3KXFD 2ITDB 4S1DC 4C56D 3I6KB 1R0AL 5CJBA 4Z5RB 1ZANL 5C0IA 2DL2A 3WNLA 5DRXA 1PBYA 3FQWA 4JFEE 3BRFA 4WW2A 1FYHB 4ZPTA 1HXMA 1YN6A 1A1MB 4GSDH 4GUPB 5D9SA 3TIDB 5BZDA 3SGJC 1WZ1L 4BKLA 2D3VA 2JKXA 5D2LB 5EZOL 2YD4A 4KKLD 5ERWA 1MI5E 3VFRA 2FGWL 3D25B 3MRQA 3Q5YA 3DV6B 4FQJH 3EHBD 4K7PL 5ACMA 5KVEL 1RK1B 5GSRB 2NY1B 2YUZA 3TYGL 2DLFH 4ZOAA 4M9PA 1MHHB 5GISH 4LLDA 4HKJB 2F19L 5HGBA 2UVEA 2MPAH 3EDJA 3RZWA 5DJXA 5C0EB 2ESVA 1UCBL 5HYJB 2C9AA 3O0RL 1QEWA 5FO8B 4I1NB 1VENA 3LQZB 5K9JH 1PG7L 5GGVY 3QXWA 4AIZA 3C6SB 1I1CA 3G5VA 3G9VA 4RRPG 1JYWA 2AQ2A 1H3VA 2FX7L 4M8VA 3KPRD 2X1OA 4F7TA 3HNSH 2AV7A 1BVLA 5KSAC 4WUKH 3SE9H 3MBEA 1J18A 3TWCH 4HIHB 5CEXA 1MH5A 4OUOA 1B0GB 3O11A 1C8PA 4HC1L 4LHQB 4R7NB 4QRPE 1QBLL 3FQRA 2H1PH 1BX2B 2X4PA 1UWXK 1KYOJ 1PDKA 3IDNB 3UJTL 3ILPB 2PW2A 2NX5E 5T3XD 1GRWA 4WI6A 4MJIB 5CUSH 2PYFB 5F44A 1AGFB 2YSSA 4P2RD 4E9LA 3AS0A 1MLBA 43CAB 4PRID 1NUNB 3W2DL 5FO9A 5CP7B 1FE8H 3F12B 4Q74A 3MRRA 3K2UH 1MNUH 2R0KH 5DD5H 4ELMB 5ANME 3TBYA 3D69B 4RGMB 1CFNB 4BSWB 2OQJA 2H3NB 2VH5L 3ULUF 5F7WC 1UVQB 2IAMD 3B2VL 3Q1SH 2ZPKH 4X6EB 2FHCA 1I7TA 3FQXA 1FJ1B 3EYFB 1UZ6E 1A6ZB 3RVUC 4PRAB 4CVXB 2EKJA 3P9WB 3MOQA 2D2OA 4IOIA 4JLRA 3PHQA 1R0AH 4LLVB 1ZANH 4NQCA 1EERB 3VG9B 4IIQB 5IB3B 1FZOB 4W68A 3PP3K 1D5BB 5E9DD 1FC2D 5IJVA 1WZ1H 3TN0C 4AY0A 4Y4FA 5EZOH 2HFGL 1CFBA 3QPQD 2FGWH 3OKMA 5FDWA 2AXJA 2IH1B 3ESVF 1EHNA 4I2XA 4ZFOA 2VLJB 3VFNA 3NIFF 1IAII 4K7PH 5KVEH 5TDNA 5EO1A 3TYGH 4HUNB 2OR8A 1I8LC 2VNCA 4XNZB 1ZGLA 2VDLH 4GMTL 4PS4H 4R6UA 5CP3A 3VFSB 5FHBL 2F19H 4WJ5B 2I9TA 4K7PY 4YHZH 3MFGB 1UCBH 4XCEB 3O0RH 5DJAA 3B5TA 1DN2A 3BD5A 2ADIA 5LKNA 5D7JD 3DMMB 1PG7H 1T0MA 2B20A 4OCWL 5CZXD 5CWSB 1UWXH 4DGIL 1NCTA 4S1DD 2FX7H 5HGAA 3LSOB 5JXEA 3ROLA 3S34L 1C1EL 4D8PB 5IB1B 3QXTA 1RZFL 2R0ZH 1NANI 1UKSA 5J1SC 4YH6A 4U1JA 4U1SB 1U41A 4HC1H 5I9QC 1QBLH 2AJYL 3MRPA 3KPOA 1RPQA 1IEAB 3LCYA 3MLXL 3MV9E 5ID1A 3UJTH 5IMMA 3DNKA 3VFGH 3MRMB 1J87A 1MI5B 1IGIL 4OLVL 4LLQB 3ZYIA 4XPFL 5FA4A 2GK2A 2GKIA 3WIHH 4E41A 1UACL 1TTUA 1AFVL 1B6DA 3OB0K 4IEFB 3P77A 2P46B 4JZNB 3W2DH 3BD3A 5DURB 3CFJB 2E6JA 3VXTB 3MA7B 4HMDA 5GIRA 5FEBA 1MCOL 2YRPA 3MJGX 5TDOA 4DTGL 5IMLB 1V3MA 2QR0A 1U58B 3RWGA 5DRNA 3TVMC 3SKUD 2EYTB 4HZAA 1OQOA 1A47A 5C3TA 4ZFGH 3NTCL 5DMGC 2B5IC 3P4OA 3CDYA 4I0KA 3RWHA 3S5LA 2MFNA 5INDA 5KOVC 4HPOL 3VE0A 1UKTA 5KSAD 4DFIA 3SDDB 1EVUA 2D7OA 3VH8A 3ARSA 4CUCA 1U8IA 4NBZB 2BVUA 5F7MC 3IDXL 2NX5B 3SDCC 4WU7B 2QV2A 5HGHB 2HFGH 4H1LH 1UENA 1KPUB 4PGCA 5JQ6L 1NDMB 4HWBA 4EJ1C 3VWJA 5CEZL 1RV6X 3JWDL 2WK2A 3NPSC 1RHHB 1QNZL 3SGKC 1FNGA 4U0RB 5J13C 2HG5B 2WP3O 1ZVSA 1G7QA 4JFFA 4MVBD 4G7YL 4GMTH 4Z7UA 1UC6A 2CGRL 2YEZA 3LS4L 4HZLB 5FHBH 1SYSA 1A4JB 4HUUA 1EJ6A 4UUJB 4IMKA 4OZGA 4QRTB 1HCFX 1MREL 4G6JL 5DQ9B 3GJFA 3W0WD 1EUTA 2IMNA 3RVUD 1ZT7B 4PRDB 3DX8A 5F3BB 3K8KA 4KKBC 4DGIH 4RWHA 1UH3A 4HKZB 3O9WA 5DD3L 2XZCL 4OFIA 3HI5H 4XPAL 3S34H 1C1EH 1U95B 3WMSA 2WBKA 4Q2ZA 5BVPL 3MA9L 4JPWL 3W39A 1S8DA 3OB0H 2NNAA 1KGCD 1CLCA 3TN0D 4QXTB 4NC1C 5C0CD 2AJYH 2XN9B 3P0VL 4JKWA 2NCMA 4JRYB 3CAFA 3MUHL 4LMQE 4CMMB 1IGIH 4OLVH 4DZ8B 4PJBF 5DSCB 3C9NB 1G7PA 4XPFH 2C1OA 4R97B 1SJEA 5JPNB 1UACH 4LGSB 3UMTA 4F80A 1AFVH 3MLSL 2BX5A 4P49A 3EOTL 1YECL 4Z9KB 5C6WH 2BZDA 4CAGA 1FH5L 2ZUYA 2YK1L 2F8VA 1FVDB 3GMOA 5EBLB 5FGSA 2HMIC 5EIQA 4UQ3B 1WT5C 2X4SB 3SGEH 5GXBB 4H0GA 3DX6A 4WFGE 1ZHLB 5IBUG 3HRZB 3C2AL 1Q9LB 2EDKA 1B90A 2VLLB 4QT5A 1QRND 1L0QA 3HA0A 5JOFB 5M94B 4WCYL 2YUVA 1QA9B 4N8VG 4WDIA 5IR1A 2J88L 3FO2B 3NTCH 4I0CC 4TUOB 4LNVA 2YD1A 4HPOH 3F7YA 2F53A 3JUZA 5J06A 2VQTA 3IXTA 4OF8A 4N68A 4U3CA 1X5XA 1K4CA 3SDYL 4PJFB 2BSED 4X4ZA 3SJVA 1X5GA 4Q7DA 3IDXH 2WM0A 2AQ3A 5FA3A 3MV9B 2VC2L 1YQVL 1T66C 4Y4HC 1MUJB 2IH3A 2PO6A 3F7VA 1HWHB 4K71C 5JQ6H 3QULB 4DVBA 5CEZH 1VGKB 3JWDH 4HD9A 1LEIB 4FQXA 3BYYA 4JG1L 3AAZA 1QNZH 1MHEB 2BVEA 3RX5A 3PQYE 4Y4KC 2GJ6A 3MJ9A 1I4FA 1HOCB 4G7YH 2CGRH 3LS4H 1CS6A 3RHWF 4FZ8L 1CXKA 3U1SL 4R0LB 3BZ4A 4FQQB 4DUXA 2EE9A 3TZVA 2E7LA 1LP9A 4GXUN 4Q9BA 3TVMD 3BP7A 3QFJA 1MREH 4G6JH 5EIVA 5IVNA 2XY1A 5FO7B 2E3VA 2R2BB 3RJDA 2VIRB 4IRJC 5DMGD 4Y5YB 3GHBL 2K7PA 2VR4A 4P48A 5HHOE 3RX7A 5CIPA 4WI7A 5DD3H 5B3JE 1BOGB 1CQYA 2XZCH 1ERNA 4LP4A 4XPAH 5D70L 2AAVA 2VLKA 1C16B 3KPPB 5BVPH 1W2KT 1O7SA 3MA9H 3T0WA 3SDXB 2DQDL 1RIHL 3QUYC 1IJ9A 4JPWH 2NQCA 1NGWB 1UADC 4W81A 3IT8D 4MSWB 3K74B 3OXRB 5I18L 4HBCL 3BZFB 5FGCE 3QUXA 1T83C 5JHDB 4ORGB 3SDCD 1JTOA 1R3IL 3P0VH 3QIUA 1IGYB 5ISZB 4XCNA 4PJIB 3T2QA 4KRPC 1NGPL 1KB5A 4LVEA 1YN7A 3MLSH 4XP9H 4OAWA 2E7BA 4YPGB 1CXFA 4ISVB 3FL7A 1FH5H 2BNRA 3FO0L 4OFDA 4XB8A 1FHGA 2OL3L 4N0UE 5D1XC 4NRYB 2YK1H 5E8OB 3VD9A 3IS0X 3TBVA 5F9OH 2E7HA 3V79C 3BP6B 2IPKA 1FNLA 3MNVB 3C2AH 4XAKE 3WUWB 3BH9A 1YEIL 4HJGB 2VZSA 4AENB 4KKBD 4WCYH 2DIJA 2FB4L 3A6OA 4LDEB 1U8KA 5J7CC 3AM8A 2J88H 4P3DA 1CDBA 2WMPA 3PJSB 5FUCC 2OZ4L 2AABH 4YBQC 2QADC 2Q86B 3MYZA 3LEVH 2KKQA 5ITFA 4WNQA 1F6FB 1X5YA 2PYEA 3MRDB 3SDYH 4NPYB 2YZ8A 4PG2C 3DRTB 2C3GA 4U7KA 5JDSB 4HUWB 5ETUB 1N6QL 3G5YB 3PGDB 4XX1E 2VC2H 1YQVH 2VXUL 4NQEB 4EN3A 5F1NB 1TNMA 1XCQB 1CD1A 1CXLA 3R0MA 2HFFA 3FCTA 3JWNC 3BD4A 4JG1H 4Y5XA 3QA3B 4EDWL 1VADA 1AHWC 3O3BA 5DYOA 2PTUA 3B4NA 5J12B 5MEPA 3NH7L 2FECI 4X6BA 3MRKB 4L29A 1DANU 3MUJA 4L8BB 4I18B 3PF2A 3VMPA 4PTUA 5DA4A 3CXDL 2Q1EA 4FZ8H 1MRDL 3U1SH 3WO4C 4DUVA 1U8NB 3UTOA 3MJ7B 4NN5B 1NBYB 3MQIA 4CN4A 1BBJA 3HMWL 4JRXD 5EU6D 2GCYA 4FQCL 4QY8A 2ATKA 1T1WA 1S7RA 4NFBA 4L8DB 5EA0L 1S7XB 5CJXC 3VDAA 2CRYA 1UZ6F 1ND0A 4MXQD 5E4EC 3VFUA 1P7QD 4U33A 2VO5A 1JHKL 2NLJB 4PJ8C 4PJAA 4L4TE 5D70H 4X6FA 4KPHL 1UZ8B 1RIHH 4A2LA 4RSVA 3TYFA 3MROA 3DIFB 4RGNB 3RY6C 5HYFA 1NAMB 5I18H 4HBCH 5JXAL 3DO7A 4WHYG 5CGYD 3WFHB 1T66D 4Y4HD 1R3IH 1PKQE 3GSWB 1XIWC 3LRHA 1P84K 2DS4A 4DAGL 3X12B 1A6AB 2CRMA 2XZAL 4MNQE 4NNXA 1NGPH 3R1GL 4Y4KD 1EZVX 1EO5A 2VYRE 4U1HB 1OB1A 5C09E 3B9AA 1KTDB 1Z5LA 2XPGA 3QWRD 4E0RA 3FO0H 4KTYA 4LHUB 5D71L 5EZIL 2CKBL 4OTXL 1G7LA 4PJAF 5D5ME 3NCFB 5GJSL 4YXKL 4HH9B 2CXGA 4ODHL 3HE6B 4JAMA 3NGBB 3VI4E 2HJLB 3QFDB 5L0QB 2NXZB 3DPBA 12E8L 4M03A 3L9RB 4IRJD 1BFSA 1YEIH 5J56B 4YAQB 5MEOA 1CL7I 1MY5A 2FB4H 3VXME 5E6IC 4N1CA 2V5SA 2HRPL 4WWKC 1RIUL 5H8DA 2V6HA 3EYUL 4PGDA 4Z7QE 1HSBB 3QUYD 1IM9D 2IG2L 2VUOA 3LPFA 1S9VB 5TH2A 4LHJB 4QHMB 5FKAB 5FGCB 1K8DA 4NKDA 1TVHA 5E6ZA 1NGZA 5I1AA 5KSBA 1N6QH 2O5YL 3TGXA 1OTUC 1IQWL 2VXUH 4PJ5B 3GRWL 4KRPD 5HYEA 4B5EA 1BVKA 3L1OL 1MCQA 4EDWH 5C07D 5KTEL 1EEZA 1K6QL 5BW7C 3FONA 3H9SA 3NH7H 4PIRF 1U42A 4FN0A 1IKFL 5D1XD 1X6NA 5I1HH 1M7IA 5K9OA 1HHIB 3RPIA 5IB5B 2AI0L 4NP4L 3CXDH 2DLGA 2AEPL 1MRDH 2DQEL 5ICZA 3EGSA 1F3JA 5E00A 2ICEB 1D6VL 4FXGA 1N5AA 3HMWH 5IKCA 3OV6A 4OZFA 5KSBF 4BH8B 3GK8L 4FQCH 1PKOA 1LE9A 2UZXB 1GPOH 2XKSA 3DUSA 5EA0H 3Q3GB 3T3PE 5FM4A 1QSFA 2QADD 3NFNA 3QDMD 3OSKA 4AT6A 1BVZA 4NBXB 3UO1L 2A2QT 3RUGB 1U3HB 1HHGB 1JHKH 4P23A 2WZPD 4XRCA 2QBWA 4KPHH 5K9QG 1DBJL 4DCQA 1MFDL 4DKAA 4EUPG 1Q9OB 4P57A 5A2JH 1G7IA 1FNEB 2Z4QA 3QDJD 3B43A 3RWIB 5DMKB 1CD9B 3TJEL 3QRGH 4H20L 3N06B 4TOYL 5EU4A 1CZ8L 4JFQA 4DAGH 1I1AB 4JDZA 2XZAH 1JZ5A 4NRZB 5ILTL 3UTTB 1O7VA 3V5KB 4IJ3C 3R1GH 1EAPA 2FYYB 1JRHI 3Q6GL 4LPCA 5SV4A 3EYOB 5E1AA 3DETC 5HHMD 3H3BC 3R8QA 5EZIH 2CKBH 4OTXH 3ZKXC 4H25A 3HC0A 5GJSH 4YXKH 4ODHH 4GBXA 4D0BA 3V0WL 3HE7C 2UUDH 1EO8L 5KW9L 4MB5A 12E8H 4G8GE 2CLVA 5IMOB 7FABL 1TITA 1MAJA 4KI5E 2HLFC 2NY3C 2QSQA 3OR7A 3GB7A 2IANB 2GT9B 1WVZA 2HRPH 1IGJA 2IALA 4X6DE 4PJ8D 1RIUH 5DJYB 3QG6B 1XR8B 1BREA 1K4DA 3EYUH 1SJHA 1ZOXA 2IG2H 4JM2F 4N0FA 3LN5B 4HT1H 1WZMA 4FNLL 4HKBB 5TE7L 1EUUA 3S37X 3RX8A 5K93A 3W9DA 4LEXL 3O6KL 2O5YH 1XIWD 1V05A 1MIEL 5LG1A 4LSRH 1BZ9A 1IQWH 3GRWH 5ACZA 2O61A 4P5MA 4FMKA 2IFFL 3E6FA 2GAZA 3VDBA 3L1OH 2G2RA 5KTEH 2AXGB 1K6QH 1I7RB 1SYVB 1UM6H 2M1KA 3RU8L 1IKFH 5B39B 4DGVL 4HGWA 4G7VL 1RFDL 1CK0L 2AI0H 3ZHLA 5CBAA 4K7PX 2AEPH 3UBXA 5C0IB 2DQEH 5DRXB 1T7VA 4K9EL 3FQWB 3JWDC 3BVNA 1D6VH 2WQ8A 4WW2B 3RL1A 4ZPTB 1HXMB 5FYLE 5K9QI 1YN6B 5D9SB 1OLLA 5BZDB 5E6ID 3GK8H 4BKLB 4QHNA 4WWKD 5K33A 2HRLA 1LQSR 3MUY1 4Z18A 5ERWB 3UO1H 3VFRB 2OTWA 2AJUH 3MRQB 3VXUA 4M6OH 2FHBA 2VLRE 2CK2A 1DBJH 4U31A 1MFDH 5T5NF 1BJMA 2C3XA 5JPMA 1DQTA 5JTWA 4O4YL 4CN1A 3ARDD 4HQQL 4LLDB 1OGTA 1ZEAL 3TJEH 4H20H 1OTUD 5HGBB 5EO9A 4TOYH 1CZ8H 2Q8BL 4YFEA 5DJXB 2ICCA 2ESVB 5SX5K 5ILTH 4Y1AA 1IVLA 5E8EA 5GGTL 5E2UL 3Q6GH 2D4FA 4AIZB 4PBVC 3G5VB 4F8TA 5LGKA 3MRHA 3B5GA 3IDJA 5SWZE 5T1LA 1EDQA 1UJTA 2EIEA 4F7TB 4NKOA 2AV7B 4UOW1 2BCKA 1BVLB 1YY9C 4M48L 1LE5A 3O3UN 3V0WH 1EO8H 5F7LB 3MBEB 5FYJE 5KW9H 5CEXB 4HGMA 1MH5B 5EH1A 3CZJA 1QO3A 3O11B 4XNXL 7FABH 2F8OA 3FQRB 2X4PB 4OV6F 2ZCHL 1KELL 3NZHL 2PW2B 4ACPA 1JV5A 4WW1A 2YSSB 1BIIA 4YUEL 1P9MC 2BMKA 4M7KL 5B3JF 4BK4A 1MLBB 5IV2A 1AQDA 5TE7H 5FO9B 3OHXA 4LEXH 3VD5A 3MRRB 4IRSC 3BPCA 4LVOB 1JN6A 4JE4B 3TBYB 1MIEH 2OQJB 2ZZUT 1SBBA 5CCKL 4Y5VA 1HKLL 5IK3A 3B9VA 4MNGE 2AS5M 4FQHA 4QHUA 4NN6B 5FXCH 1I7TB 2IFFH 3FQXB 5ESAA 3FFCE 3QXUA 2AJZA 3DETD 2F8XC 1U8MA 3RU8H 4DGVH 1FZJA 2A6KA 1YY8A 4G7VH 1RFDH 2IGFL 1CK0H 4IOIB 3HE7D 1IC1A 4JLRB 3PHQB 1IC4L 3QIWA 4NQCB 3MGTA 5D6CA 4K9EH 4R2GC 1OCWL 2ZCLL 4LFHD 1E6OL 3VGAB 1QZ1A 2HLFD 4HMCA 4YHYB 2NY3D 3HC4L 5IJVB 3OMZA 4Y4FB 4Z76A 4AYFA 3HG1D 5SX5H 2B1HL 3SE4A 3OKMB 5FDWB 2CJUL 3D0VA 4N0RA 2J7LA 4I2XB 4ZFOB 3VFNB 1PFCA 3KHQA 4XH2A 4JQVA 4D9QE 5TDNB 5EO1B 4TTDC 3KG5A 2R29L 4O4YH 1YPZE 2WV3A 3I6LE 1ZGLB 3IGAA 3U82B 2W0FA 4HQQH 1ZA3A 1ZEAH 2EIBA 3S8WA 5LGHL 2WNGA 4XI5C 1QSEA 1FRGL 2Q8BH 3T1FA 2I9TB 4PJXA 4OFYA 2UYLA 1A7NL 3WJJA 1J0IA 1NJ9A 4FTVE 3I85A 5DJAB 5GGTH 5E2UH 2ADIB 1Y6MR 1T0MB 5E8NB 1M7DA 4OM1L 3AS3A 3HN3A 3DBXA 4RFEA 2N56A 5HGAB 1V7NH 3C5ZC 1IT9L 2FD6L 5CEZD 3ROLB 1PY9A 4M48H 1W72A 1TJIL 4EI5A 2JJWA 4ENED 4NQUA 4KQ3L 4U1JB 4W4OA 4IM8A 3LY6A 4XNXH 2W9DL 1AGCA 2VKXA 3MRPB 4UIKL 3KPOB 5HI4C 4PB9L 2ZCHH 1T7YA 1KELH 4PJXF 5ID1B 5IMMB 3NZHH 3UTPD 2J1KA 4YPJA 4KMLB 1ZE3C 4MA1C 5C0BD 4PRPD 3C6LA 5FA4B 4GAGL 2X40A 1JZ2A 3GSXA 4E41B 2MNUA 4YUEH 4NYLB 2EO9A 4AEIL 1P6AB 1TZGH 2Y4SA 4LASL 4M7KH 4Z95L 4O2CA 43C9A 2R8SL 2PETA 3P77B 3WN5A 4Z8FL 4YGVA 3T08A 1X5FA 3MRGA 2R69L 5GIRB 4H88L 2X70A 1KCRL 5CCKH 5TDOB 1HKLH 2QR0B 3RWGB 2CKNA 2Q7NA 3MSPA 4JFXA 4JVUA 5DRNB 2YKLL 2X9YA 4X4ME 5ENWA 4H5SA 4AEHL 4YHNA 2KH2B 3P4OB 1A2YA 5KZCD 2P42B 3RWHB 3S5LB 4NQTA 5INDB 1YY9D 3IAQA 2IGFH 3VE0B 4PRNA 3VH8B 1IC4H 1CR9H 2E6PA 4PD4K 1OCWH 2ZCLH 5D5MF 1E6OH 5T1KD 1HDMA 1U8IB 3KLAA 1NSNL 4N1EA 1ZWIA 4TULL 1MCWM 4C57C 2HKFH 2BHUA 3KYKL 2BRRL 3SE8L 4PGCB 2B1HH 2E9WA 3VWJB 2CJUH 2HT2C 2W0LA 1TZIA 1FNGB 3UP1A 1ZVSB 1G7QB 2BNQE 3C60A 4JFFB 1JGUL 4Z7QF 2R29H 3H7BA 5SV3A 1GXEA 4IRSD 2BNRE 2KPNA 4Z7UB 4EEEA 2YEZB 3BJLA 4OCSL 5GGSA 1SYSB 5LGHH 3ZE1E 3IB4A 4I8DA 4MA8L 4HUUB 1FRGH 3AMLA 4OZGB 2XWTA 4JY4A 1A7NH 5ALCL 2E7CA 3GJFB 3RVWC 3EDFA 4NIKB 1WIPA 3G6JA 5F97E 3WCYA 3DX8B 3ESUF 2QHRL 1CGSL 3O9WB 3BYTA 2Z91A 2Q76A 5J11C 3WFZA 1NH6A 4Y2DD 1EFXD 1ROWA 2NY1C 4NJAH 1YQ2A 1IT9H 2FD6H 3DI3B 4DEPC 1EH9A 4BQCA 4AEEA 3HAEH 4PLOB 4R2GD 2LU3A 4Q2ZB 4QTIL 4B41A 1TJIH 3W39B 1S8DB 4KQ3H 4M8QA 3BKYL 2NNAB 2W9DH 3STZA 4MAYA 5C0AA 2VL4A 4UIKH 4PB9H 3B9KA 4PJDE 2J8UA 4PBXA 3D0LA 3OBAA 2J4WL 1G7PB 4UOW0 2C1OB 4GAGH 1SJEB 2F9BT 3X14A 1DSFL 3T3PF 4AEIH 3G6JF 4LASH 4Z95H 5MI0C 2R8SH 1HKFA 5GQBA 2ICWI 2HJKA 4HG4J 1Q8MA 2EH7L 4HLZH 4Z8FH 1WFUA 3FFDA 4WTZA 2G60L 4XI5D 3GMOB 2R69H 1UB6A 4H88H 3BE1L 1KCRH 5JLZA 2AEQL 4HIIA 1BD2A 4QXUL 3PWVA 1YEEL 4QT5B 5ADOL 1YA5A 2R2CA 4AEHH 3H3KA 4WDIB 1JL8A 5IR1B 3KPSD 4HXBL 4PJEA 4ODSL 3C5ZD 4ZSOA 5IB2A 5TPWL 3F7YB 2F53B 1JZ6A 3LPWA 1IAIM 2LV4A 3IXTB 4OIIL 2XQBL 3BPOB 3H2WA 5EULV 3BESR 1S9YA 4RGMC 1K4CB 2P24A 4WVRA 3T4AA 3GM0A 5HI4D 3SJVB 3V7AG 1JNHA 1N8ZA 4M6AA 1NSNH 2YA2A 4J8RA 4TULH 5FA3B 4WEBL 4OCNC 4H1LG 4R90L 2VL5A 1F3RB 1DBBL 2IH3B 2PO6B 3F7VB 2RIKA 3KYKH 2BRRH 2DYPD 3SE8H 4DVBB 3NIDE 1Q9KA 2FH8A 2P8MA 1U8LA 4KI5F 1DQML 4UNTA 2AK4E 4FQXB 1AD9A 2VWEE 3AAZB 3TF7C 4X6DF 3QHFL 1A22B 2GJ6B 1CBVH 1A9EA 1I4FB 4PJEF 1C08A 3MFFA 5FK9A 1JGUH 3VG9C 1BQHG 4IIQC 3EFDL 1TTGA 5DFVC 4NRXA 4GH7B 2V9RA 4OCSH 4MA8H 3BZ4B 1HNFA 3TZVB 1LP9B 1RHFA 3BP7B 2FATL 3GSNA 3QFJB 5TE4L 3BP4A 3U7YL 1CXHA 1HH6A 1MHPL 2WWKT 4TVSa 3ARGC 1ACYL 4P2RE 2QHRH 4OZHA 1CGSH 3UTSE 1IQDA 5CIPB 3O4OB 1J0JA 4TRPL 3VXOA 2XNAA 4XNZC 1EXUA 3GIVA 4X7CC 3VD4A 2VLKB 3L5JA 4QTIH 1FGNL 3VGBA 3BKYH 4V1DA 4YC2B 3U0WL 2YRZA 3QUXB 4PJHA 1DN0A 1WBYA 2AXHA 2YA1A 3QIUB 4Y16A 1LK3L 3CH1A 2EDLA 5IT2L 3DMMC 2HT2D 2J4WH 3GBML 4XCNB 1KB5B 1KNOA 1DSFH 3MV7A 4OKDA 4PV9A 1YN7B 4OAWB 2W0KA 3UEZA 4ERSL 5ELIA 4B7IA 2OTPA 4DOHE 2EH7H 1KV3A 3DSFL 3JWOL 2BNRB 5E56A 2W91A 5KJRL 2G60H 1JYXA 1MELA 4KK5C 4NM8L 4N90E 2ARJQ 1EX0A 3D2UA 3TBVB 3BE1H 2IPKB 4OI8A 2EH8L 2XQYK 4WFFD 3RVWD 2AEQH 1MWAL 1I7ZA 4PJHF 3BH9B 3SKOA 4QXUH 1YEEH 2EXYD 1U8KB 2WWMD 3ZKND 4HXBH 5CAYB 4P3DB 2NY1D 4ODSH 5HHXL 5TPWH 5DXWA 1MFCL 5J57B 1QBML 3UYPA 3GI9L 4OIIH 2XQBH 5ITFB 5HPMA 4WNQB 5A1AA 2PYEB 4ESKA 3MOBL 2I5YL 4OGXL 5IOPA 4GKSA 3G9AB 2DI9A 4WEBH 5F7EL 4N8PA 4R90H 3AC0A 2IPTL 4YHKL 1DUZA 4JO2L 3BQUC 4CL7A 4EN3B 4U0QB 1DQMH 4P99A 1CD1B 5BS0A 1KBGL 1RI8A 2EDYA 4K9EC 3T2PA 1OP9A 2HFFB 3FCTB 1J86A 4Y5XB 1VADB 3LPGA 3O3BB 3QHFH 5DYOB 3GHEL 2X7LA 4M93B 3X3GH 5MEPB 3VGEA 1VESA 1X3DA 4AIOA 3CDCA 5JW4R 4X6BB 3EFDH 4L29B 5FIEA 1TJHL 1OP3K 3SY0A 4PTUB 4WFHE 1VFUA 1QLRA 1YMME 1GAFL 2FATH 1BBJB 4WV1C 5TE4H 1OP5K 3U7YH 1MHPH 2GCYB 4QY8B 2X4UA 2ATKB 1T1WB 1ACYH 3I3EA 1S7RB 3ARBA 4PGJA 1TPXB 3QUZD 5KVDL 4M61A 4MXWL 4TRPH 4R4BA 3IFPA 4XXCA 1ND0B 3VFUB 3O4LD 4PJAB 2Y23A 4X6FB 3O8XA 4M7LT 4YFLI 4G8IA 1FGNH 4ZS7L 3TYFB 3MROB 3OAYK 3DO7B 3U0WH 4M6NL 2DMKA 2GY5A 2NY4B 4HJJL 3DVFA 1LK3H 1CDHA 2FL5A 5IT2H 1FVCA 4XP1L 3GBMH 5IWLC 2MCPL 4J1UA 1TJGL 4NNXB 2P5WE 4F9PA 5MENE 3IFOA 1OB1B 2GITA 4ERSH 5DFVD 1Z5LB 2XPGB 3SKJL 4LRNL 3DSFH 4U1GC 1TVDA 3JWOH 5DJ2A 4E0RB 5E95B 5KJRH 4KI1A 4Y8AA 1G7LB 4NM8H 5IVXE 5KN5A 2YPLE 4JAMB 3E3QE 2EH8H 5FM5M 1MWAH 5FCSH 4DJMA 3ARGD 1I75A 4PFEA 3I50L 5MEOB 3QBTB 4BFEA 3T0EA 3JXAA 5FUOL 2FIRT 2EYRA 5HHXH 5GZOC 2LTQC 2A38A 1IGCL 2HT3C 1MFCH 2UWEE 2R0LL 1HYSC 1QBMH 4PGDB 3GI9H 1FN4A 1SMOA 3CNKA 2BVYA 1WBXA 5I19L 4NUGL 2X1PA 5TH2B 3MOBH 2I5YH 4OGXH 2H2PD 4KK8C 1K8DB 4NKDB 1TVHB 1NGZB 5I1AB 1BQSA 1VPOL 4OUUA 1OP3H 5KSBB 5B8CA 3DMMD 5F7EH 4GKZA 4XC3H 1IEBA 2IPTH 4YHKH 5AWNL 4JO2H 2YUXA 3THMH 4J12A 3PNWA 1BVKB 5F96L 1KBGH 1VFAA 5EU7C 1T80A 4F7PA 1AKJA 1EEZB 3FONB 4RISL 3GHEH 3H9SB 4JFED 1B0RA 4KK5D 1M7IB 2H32A 5K9OB 3RPIB 4PJ9D 3ZSSA 1TJHH 2VN4A 3AU1A 5LBSL 3ULVE 5ICZB 4LCWA 5I0DA 3EGSB 1F3JB 5E00B 3SCMA 1ADQA 1MI5D 1GAFH 4FXGB 1N5AB 3EOBA 5IKCB 1CDGA 3OAYH 4OZFB 2BY2A 2CMRL 3REVA 4G6ML 2FLBT 3WL9A 4L8CA 1LE9B 4RFNB 2R1XA 3DUSB 3RY4A 1J1OL 1QSFB 3NFNB 4AT6B 2OLDA 5KVDH 4MXWH 1AGDA 4Z7OE 4P23B 4XRCB 2EC8A 4DCQB 3IU4L 3B8YA 4ZS7H 3PWPE 4WUUA 3ILQC 1K9TA 4P57B 1G7IB 2Z4QB 1FZMA 2VDQL 4M6NH 5D7LE 5GGUA 1A6WL 3BQUD 4HJJH 5EU4B 4JFQB 1QRNE 4G6FB 4FG6C 5EPMA 2X1XR 4JDZB 4XP1H 3S88L 4Y5YC 5L8KB 1L9NA 2EYSA 2MCPH 1TJGH 1XCTA 1SM3L 5F7DA 3QI9A 1EAPB 4J4PA 2P1YA 3OKOA 2FJFA 1HK6A 3ES6A 2AJ3A 3SKJH 4LRNH 2JJTC 5E1AB 2ZUVA 5HY9A 1BJ8A 3O6ML 5B38G 3IYLW 3QPXL 4QRPD 4H25B 5FKPA 3QEQA 1CIUA 3EZ8A 1FZKA 3HC0B 4GBXB 4P2YA 3MLUL 4QKXB 3RBGA 4D0BB 2NX5D 2GY7B 3O6FA 2BRQA 1OT1A 1MCEA 3ZE1F 3MGAA 4NQXA 4ZG1A 2CLVB 3I50H 4MB3A 3FB7A 3LAFA 3TA3A 5IBTH 3ZDYE 1AY1L 3OR7B 3GB7B 1CXEA 2IALB 1IGJB 1AC6A 2BP3A 4HBQA 1IGCH 1OT2A 2R0LH 1K4DB 3KXFA 4C56A 1SJHB 5AAWA 4N0FB 3D3VA 3SKNA 1NPUA 4HK3J 1QFUL 4ZAKC 4YJZL 5I19H 2RGSA 4NUGH 1E6JL 5I0ZA 2LVEA 4LRIA 4BM7A 3W9DB 3PV6A 4JO4L 2CSPA 2P5EE 5CINH 3VXSA 1WWCA 4PYGA 1UH4A 1EEUA 4KVNL 1BZ9B 5D1QD 2CK0L 5ACZB 4R9HA 1N5YL 2O61B 1UT9A 4KMQA 4P5MB 5F96H 1WLHA 3E6FB 2GAZB 4LLUA 2ARJA 5DF0A 3QDGE 2DN7A 4PJDF 3V6ZA 1MRFL 2G2RB 4RISH 2APWA 2XOTA 2BJML 4WI8A 1VFMA 2XXMB 4HGWB 3ZHKA 5F7HA 1T04A 1F4XL 1G6RL 2JIXA 1H3TA 2BOCA 5CBAB 5L6YL 2YPLB 5LBSH 3UBXB 1IAIL 1NFDE 3OAZK 3JV4A 5D1ZA 2YD6A 3CD4A 3BVNB 3RL1B 1BIHA 3T0DA 2CMRH 1WFTA 1MCHA 4G6MH 3CSGA 4QHNB 1BFVL 1GSMA 1MF2L 4LBEA 5GZOD 1I7UA 5FDYA 1J1OH 2HT3D 1N7ML 1HYSD 4CNIA 2OTWB 4OD2A 3KPRA 3VXUB 3MC0A 4QHLA 3WJLA 3V95A 3QDHA 3ARUA 3WNPA 2F5AL 3IU4H 4KK8D 4HWBL 2P48B 2UVFA 5CILL 5JPMB 3FOMA 1HCVA 4JDTL 4AQ1B 4NN5C 2VDQH 1OGTB 2FR4A 4MA7L 1A6WH 5EO9B 3X13A 2DBJA 3S88H 4MB4A 4Y1AB 3EUUA 5E8EB 5CD5C 5C3LD 4NCC2 2BFVL 2NY7H 1EIBA 3HMXL 1OQXA 3C8DA 1NDGA 3NIDF 1LDPH 3RIAF 1J8HA 4PRIA 3MRHB 2CIKA 2K9UA 3WFDL 1M6OA 3O6MH 1N2RB 3IDJB 1GC1L 1RZJL 4JPIA 5T1LB 3QPXH 3SOBL 4NC1E 4NKOB 2PUQT 1EAJA 2BCKB 3MV9D 3ZSTA 3MLUH 1LE5B 1IRAY 4ETQA 2IAMA 1QO3B 5J1TC 4MDIA 1DVFC 4LARL 1AY1H 1GOFA 2IPUK 1JV5B 1NGXA 3GJFK 3U2SA 4WW1B 1F3DH 4S1RL 4P2CG 4Z77A 1BIIB 3TLRA 3UYOD 3MREA 2BMKB 3ILQD 1QFUH 1H9VA 1MCJA 4L4VE 5IV2B 1E6JH 1AQDB 1DUYA 2HVJA 2EDNA 3JBG7 5IHUL 3NGBC 1F02I 3OHXB 5E9DA 4JO4H 3WFBL 1CG9A 1KIRA 1VCAA 2NXZC 3BPCB 3EYSL 1JN6B 1GZPA 4FG6D 4PB0L 1IKNC 2X4NA 5EU6E 3OAZH 4Y5VB 2CK0H 5HSFA 1H3GA 5F6HI 5IK3B 1N5YH 1E4JA 4FQHB 4QHUB 1QSZA 5ESAB 1QBAA 4QOKA 3BW9A 2AJZB 3HUJE 3UCRA 5DC9B 1U8MB 4TPRL 2CR3A 3MODL 2BJMH 4M1CC 2A6KB 1FZJB 1F4XH 1G6RH 1YY8B 1ONQA 5JQHC 3A6CL 3NABL 5L6YH 4KV5E 1N6VA 5DGQA 2FRGP 3QIWB 1IAIH 3MGTB 1HN1A 4UV4L 5D6CB 3D39E 4C58B 4QWWC 5D96B 5J6GA 4CADA 5D7JA 3N1MC 4KRMB 1BFVH 4AH2A 1MF2H 4F33A 1D5XA 3WS6A 5TGBA 4Z76B 4L9LA 5DHXB 1N7MH 5I73C 4W6YB 3FTGA 4DGYL 3D0VB 2HJFA 4NKMA 4ZAKD 1UXWA 3GZKA 5DVNA 4PJCA 4XH2B 5DEGA 3MGOA 3SBWC 4GRMA 4HWBH 3GSOA 5CILH 3BOVA 4JDTH 3IGAB 2W0FB 2YWYA 1ZA3B 1ZLUH 1FYTE 5C0GA 7CGTA 4LPXA 4MA7H 1QSEB 4GRLA 3T1FB 3D6GA 1NANH 4PJXB 2CDGA 3MLZL 4HK3N 5EOQL 1UJ3C 5F1IA 1NJ9B 5AYQA 1MJ7L 3MLWL 3VFVA 3N1QC 3AS1A 2BFVH 3HMXH 3I9GL 1U3HC 1M7DB 2EC9T 3AVEA 4Y19E 3DBXB 3WFDH 4RFEB 1GC1H 1RZJH 2ED8A 4MLSA 3SOBH 4KDWA 4NNPL 4WO4C 4NC0B 4X7FC 1BZ7A 4BH7A 4Q58C 1W72B 3OG4B 1RQ5A 4FQ1L 4EI5B 4PJ7A 1I1AC 1AGCB 5KVMC 1UWGL 3JWOC 4LARH 2A6IA 4PGBA 1IMHC 2FO4A 3V6OA 3C6LB 3SKMA 3ZE2F 4S1RH 2IADA 2P44B 3GSXB 3S96A 5KSAA 2O5ZH 2ZUSA 2VXQH 1EO7A 2MSPA 1LHZA 4O2CB 4YGAB 43C9B 1H5BC 5IF0A 2DRUA 2X2YA 3EO9H 3OAUL 4WFGD 3WN5B 3RGVD 2XG4A 5IHUH 4YGVB 3F58L 3UAJC 3WFBH 3MRGB 2P8LA 3EYSH 4HS6A 5TQ0L 1RUQL 4PRHE 4PB0H 5EG6C 5CSBA 2X70B 5GGRY 5CD5D 3WE6A 5MP6L 1F2QA 1RK0A 1AH1A 2DKUA 2DKSA 3NAAL 1P53A 3QDME 4JFXB 4NZRL 5ENWB 4H5SB 3FO1A 3MJ8A 4YHNB 1B4JL 2BY0A 2VLME 4TPRH 4W70A 1I85A 3MODH 1A2YB 1X5AA 4CW1A 1AO7E 4X7DC 4LSTL 3A6CH 3NABH 3VWKA 2ZSWA 1Z2KA 1PLGL 4PRNB 2MTPA 4F58L 4IRZL 2IQ9H 2VDKL 4UV4H 4JFDE 3DJ9A 5IVXF 1DVFD 1V5JA 1HDMB 4GLRI 3W0WA 3KLAB 2CUIA 4OGYL 1ZWIB 5C8JA 3DVGA 2DQJL 5FM5O 2YN5A 3NFPA 1BWWA 3R4DA 3N85L 3FOLA 4DGYH 3MXWL 3G5XA 3IAPA 1S9WA 5JNYA 4U6XA 1XEDA 1RD6A 5HHME 1XF4A 1F45A 3FT4A 1JHLL 3MV01 1TZIB 4N9OB 5EWIL 5F9DC 4CVUA 2D7NA 1DLFL 3C60B 8CGTA 3H7BB 3RTQC 2NXZD 4TUKL 4WW2C 4YZFE 5C0CA 5GGSB 4C83A 5H37H 3U4BL 4ALAL 4K7FA 2XWTB 4JY4B 2VDOL 3MLZH 5EOQH 5H2BA 1MJ7H 3MLWH 3I9GH 3FRPA 1JF6A 1NC4D 4UMGA 3TV3L 3G6JB 4KJQC 2WLZA 4M1CD 1A7QL 2NY6C 2Z91B 2Q76B 4HEPG 1W8OA 4KU1A 2FZ3A 4NNPH 2WBJC 5D7IE 4QWWD 4JY5L 1F4HA 3SQBA 4FQ1H 3U36A 3JV5A 4M8QB 1A7RL 2A6DA 3ULVF 3IXAA 3STZB 4MAYB 1G7JA 5C0AB 1UWGH 5KS9A 3B9KB 3H9YA 2J8UB 3HZKA 5DZNA 3D0LB 4HF5L 1DBML 3LDBB 3VRJA 3X14B 2ZSVA 3MX0A 5HVHB 2HJKB 3O3EA 3OAUH 4OBSA 4XAKD 3FFDB 3F58H 1I3GH 3CGTA 5F6IB 4X6CE 5AZ2L 5TQ0H 1RUQH 4V2BA 1CDUA 1UB6B 5HHPA 1SJXA 2VXSL 5MP6H 3W5NA 1VEOA 5JLZB 4XAWH 3LRSA 3NAAH 1FFOA 2BHYA 1BD2B 3QJFA 3PWVB 3BGAA 5DD1H 1J0HA 1B4JH 1RZ8A 4PJEB 2YD3A 4ZSOB 5IB2B 4LSTH 1DE4A 4WO4D 1IILE 1S9KC 1PLGH 4F58H 3DI2B 4IRZH 3LEXA 4ELKA 2VDKH 2VAJA 1B88A 1S9YB 2FECL 3TVMA 2P24B 3ME0A 3UTTD 4GKNA 2ZCKL 1CE6A 1QP1A 1G9ML 1JNHB 3BWUC 3CZFA 1N8ZB 1AR2A 4J8RB 4JQXC 1E27A 4OGYH 2R2EA 3LKOA 2DM7A 2DQJH 2VL5B 4NFDA 2FSEA 3MXWH 1Q9KB 4EQ3A 4PLKD 2P8MB 1U8LB 3V7AE 4CKVX 3RWEA 1JHLH 1AD9B 4C55A 4GRWB 5D2NE 1EJOL 1DLFH 1A9EB 1QPPA 1C08B 3MFFB 4TQEL 5FK9B 1A02N 3LRGA 4NRXB 4OGAC 3SHSA 4TUKH 4WTWA 3VRLE 3U4BH 3VGAC 2NY2C 4P9HC 4ALAH 2QJDA 4G5ZL 4KI5C 1ZA6A 2VDOH 2GJZA 1FO0A 3GSNB 4Y4FC 2B7DT 3BP4B 4Z7VA 1HH6B 4QGTA 2Z92A 1A1OA 3TV3H 1RZ7L 3CDGA 2OI9B 3T0EE 1WTLA 1A7QH 4OZHB 1IQDB 1CGTA 3VXOB 5INCA 2XNAB 3TO4C 3DUUA 1EXUB 3GIVB 3DYMA 2K3TA 4JY5H 3DWTA 5EFIA 5IFHL 3FHQA 4OFPA 1W0VA 3QUMA 1FNHA 1A0QL 1J0ZA 1A7RH 4V1DB 3BDYL 1NFDF 2C4FT 2W38A 2YZ1A 1OGAA 1GGBH 1DN0B 2ATPA 1WBYB 3I3DA 5C09D 1URLA 4Y16B 3CH1B 1OAUL 2VB5A 4PD4J 2R1YA 4Z7WA 3NOIA 4LLWA 4MD5A 1DBMH 5E5RB 5I1LA 4JRWA 1DEEA 4AEFA 1KNOB 3MV7B 2BNUA 4PV9B 1PD6A 4G80A 3N1FC 3RTQD 5JXEC 2X9WA 5F70A 3RIFF 3BN3B 1KEML 5AZ2H 4BSVA 3VXMD 1TCMA 3CFDA 3D2UB 5TE6L 5DTFA 3KR3L 3PDGA 3QZWA 1NUGA 1I7ZB 4KJQD 3SKOB 4DK3A 1IBGL 4UAOB 2NY6D 4S2SA 4XC1L 3BI9X 3WUWG 4U6VL 4Z7WF 4HS8L 1WZLA 2WBJD 5DMIL 5DI8A 5HPMB 5IBLC 4RDQF 3LEYL 5IOPB 2ZCKH 4GKSB 3SGDI 1G9MH 4JRXA 5IEHA 5IUSA 5SWSE 1C7SA 1DUZB 3GIZL 1XF2A 4NQDE 1P7QA 1TXKA 2I26N 4O9HH 5BS0B 3JSSA 1V3LA 3N0PB 4YO0A 5EO0A 5CEZE 1EJOH 2VZ1A 2X7LB 4PJGE 2DWDA 2D31A 1JWSA 3WDJA 3SY0B 4R4FL 5H35A 4Y4HA 4G5ZH 4LDOB 1KCSL 5C08E 3VMNA 1QLRB 3CFCL 3CSBA 2FEEI 4MAUL 4F7EA 1NLDL 4Y4KA 1NMCB 1G0DA 2X4UB 2MJWA 1RZ7H 4OF3A 3ARBB 4CBPA 2ILLA 1S9XA 5DUML 1LDSA 3QWRA 4M61B 1R5WA 2KDGA 4OZFH 4R4BB 3IFPB 4M7JL 1E28A 4KAQL 3HUJF 3LD8C 4QHKJ 3O8XB 1AD0A 3I75A 5IFHH 4G8IB 5TDPA 5IG7A 4KKAC 4NT6A 4L9DA 3CVHA 4QLRA 1A0QH 4KV5F 4GFTB 4KZEL 4IRJA 2H26A 4UDTA 4P2OC 3ARVA 3VXSE 2OXGA 2FL5B 1GC1C 1OAUH 1RZJC 4HFUL 1FVCB 1ETZA 2WIIA 1WWAX 4J1UB 3O9WC 1N3NA 3IFOB 1IM9A 2GITB 3TFKC 4NQCD 4L5FL 3IDYC 4OGAD 3QG7H 5DJ2B 1QACA 4G8GD 2NY2D 5ESVA 5EBGA 3HZVA 4O02L 1KEMH 4KI5D 15C8L 5KN5B 1DLHA 2J8OA 1CFQA 4LHUG 3KR3H 4Y4FD 4NWUL 3H6JA 1C5BL 3IU3A 1MRCL 3ULVL 1IBGH 2VE6A 3IS1X 4XC1H 3T0EB 4U6VH 5L88L 4MNHA 3G04A 2EYRB 4P3WA 5D1XA 4HS8H 3TO4D 5C2BL 5DMIH 3P3YA 1FN4B 5GRWA 3QWQB 1PJ9A 1WBXB 3OKDA 4X9GA 5BCAA 3DARA 2V9TA 3LEYH 4IDLA 1JWMA 2EE3A 1T1YA 1ITCA 1NC2D 4OUUB 1TMCB 5B8CB 1UKQA 4GKZB 1IEBB 4U1IA 4OFKA 5HXMA 1T4KA 3E1F1 3L3OA 3GIZH 4ZUUA 4XHQA 3QNXA 3PNWB 4F57L 1VFAB 5JXED 4F7PB 2OJEA 1AKJB 2ARWA 2DTML 1CGVA 4CMHC 4YDIL 1B0RB 2H32B 3BPOC 3QDJA 1KJ3L 3AU1B 2BK8A 2Q6WA 4R4FH 3PWNA 4GKOA 3KJ4B 2Q3AA 3IKCA 2MKWA 4LCWB 1KCSH 5KG9A 3SCMB 2XTJE 3CFCH 5ACLA 4ZUVA 1AR1C 3EOBB 3MO1A 4NO0D 5BMFH 1KN2L 1OSZA 4MAUH 1FNSL 1NLDH 2XTLA 1AHWA 3REVB 3WL9B 2VLRD 4L8CB 2R1XB 2I60L 5DUMH 1FFQA 2VZUA 2JCCA 2G9HA 1AGDB 4M7JH 5I6XC 5A2LH 5FCUL 4QNPE 5IBLD 1FCCA 1FFPA 1CFSA 3HC3L 1CGUA 3J8F7 3MV8A 4WUUB 3I3BA 2E7LC 2FX8L 1FZMB 4KZEH 5GGUB 2XQYG 2Z8VC 3HHRB 4NO2A 4Y2OA 4HFUH 4KZDL 5EPMB 4XX1G 4XBEL 4PJ8A 5SWZD 2EYSB 4L3EE 1XCTB 1DZBA 5F7DB 4OZIE 1B9ZA 3QI9B 4U05A 4FQPA 1J7VR 3OKOB 4I0PA 2FJFB 4L5FH 3RY6A 4XMLL 1A8JH 2AJ3B 3ES6B 4EXKA 1L0XA 1XF3A 4PREA 5HY9B 2NW2A 3TNMA 2VKWA 4FQLH 5FKPB 3QEQB 2E8ZA 4O02H 15C8H 1JPFA 1FZKB 3L95A 4PR5A 4YC2C 3QUXC 1Q38A 5BRZE 2ED9A 2EIDA 3O6FB 3G6DL 4NWUH 3QIUC 4FQIH 1C5BH 1N0LA 4NCC1 1BQUA 1MRCH 4NQXB 3ULVH 1WUNT 4HC1A 4GG6E 3FB7B 3TA3B 1W72L 5IEKA 2P49B 3G08A 5L88H 3K80A 3T2OA 3EJZC 3QNYA 4XP5L 5C2BH 3MXVL 2VJXA 3KXFB 4C56B 4P46A 4F3FA 1OF2A 3F7QA 4KKAD 2Y36L 3D3VB 3SKNB 1CD8A 4D0CA 5GRVK 3RPKA 1Q0XL 2QKIA 4P2OD 5D7IF 1JNLL 4LP5A 4J3XA 1MAKA 3ABZA 3PV6B 3FFCD 3VXSB 1KPRA 5C6TL 4EVNA 4KVCL 5KAQF 4XBGA 2H45A 1F2XK 3AM8C 3BKCL 4K8RL 4F57H 3TFKD 4JEGB 4XXDA 4LLUB 2ARJB 4GQPH 4EUPH 3V6ZB 4YHML 5JHLL 3EZJB 2APTA 3R0NA 4YDIH 1LO0L 2ZOKA 1KF9B 1HH9A 2QEJA 3AFLA 1KJ3H 1T04B 2Q7YA 2JIXB 3ARDA 4OQTA 5B39G 2BOCB 2AV1A 2EEDA 4PTTA 4GXUM 3JV4B 5D1ZB 5C0JA 2WLYA 5GS2D 5L8LB 3QQ4A 1CT8A 1DDHA 4N5ED 4X6CF 1CICA 4PJ7E 1FNSH 4BJLA 4N0YL 1QFOA 2PXYA 4EN3C 3RI5K 4U1NA 3BAEL 4LBEB 2I60H 1I7UB 5EUOA 4OD3L 4Y5XC 1T1XA 4CNIB 3V6OE 3I6LD 4M93C 5GSVA 1RVFL 4LQFL 2Y5EA 4OD2B 5FCUH 3KPRB 1S5IL 1TFHA 4TVPE 4QHLB 3HC3H 4Z0BL 2FDBP 2VITA 2Y7QA 4ZO7A 5MHSE 4XPTL 4JGUA 4KC3B 4OLWL 5DUBA 5D2LE 3FOMB 1U3JA 2FX8H 2EE2A 3C87A 1S5HA 2YD8A 3V6FA 4WFEE 4RAHA 4P5TC 2WW8A 2FR4B 3DX7A 3X13B 4JPVL 4KZDH 3MV11 3WUZA 1WZKA 4QTHA 1I1YA 4XBEH 3PWUA 2EDDA 4JFOA 2F53D 2OM5A 1NDGB 4WU5A 5FYKU 4A2MA 4XMLH 5HYSA 1J8HB 4XVUC 3VI3E 4PRIB 3O3DA 2CIKB 1M6OB 4QYOA 4JPIB 1ORQA 5HYJE 3Q48A 1RULL 3EJJX 3TEUA 2Y6SC 1YYLL 4Y89A 1AR1D 1EVTC 3G6DH 5E2VH 4ETQB 1A6TA 2IAMB 5KBNC 2FBOJ 1SVZA 4MDIB 5L2JA 1W72H 1JFQL 2IWGA 2VWEC 1J12A 1NGXB 4XP5H 4NGHL 3VG0L 3U2SB 5I17A 3IKKA 1MCBA 3MXVH 2KZWA 4NZDA 4Z77B 2Y36H 4GSDL 3MREB 3CX2A 4E5XA 3NCBB 3VXRA 4ODXA 1Q0XH 1DUYB 1A6VL 2HVJB 1YC7A 2GEEA 1JNLH 3EOAA 5E9DB 3DUHA 5ADPL 1CG9B 1KIRB 3J7HA 4MJIE 1GZPB 3WDHA 4HJ0C 4C4KT 2J6EL 2X4NB 5I75C 1MVUA 4FQJL 4KVCH 4K07A 1VACA 1ZT4A 2BVQA 2WSKA 3BKCH 1LMKA 1MCLA 4K8RH 3MTRA 2CR6A 2EDTA 2V5MA 3TO2A 4YX2L 4QOKB 4YHMH 5JHLH 3BW9B 3WXVL 1REIA 2F54A 4ELME 1G9MC 1LO0H 5LQBH 1UH2A 1ONQB 3QUXD 1XH3A 2O5XL 1R24A 4JHAL 4YFLF 2E9JA 3QIUD 2DI8A 4RMUA 5IQ7L 5CGTA 4JR9L 2DTSA 1KTKE 4LSDA 4M00A 1GOHA 5J6GB 4N0YH 4WTXA 4CADB 4GG6B 5D7JB 1X5HA 3BAEH 5J9PA 3EJZD 4AH2B 4F33B 3CPLA 1D5XB 4K55A 5TGBB 2J2ZA 4L9LB 4OD3H 4U6TA 3U79A 3FTGB 2GFBA 2BNRD 2DB8A 3K4DA 1RVFH 4LQFH 3MNWA 5FYJU 3PL6D 2HJFB 4NKMB 5EOTA 3BRDA 1WWWX 3K81A 1UXWB 4FFWC 5DHYA 1ORSA 2YN3A 4PJCB 3GMQB 4Z0BH 5DEGB 3MGOB 3JVGC 4GRMB 2H1PL 4XPTH 3GSOB 4OLWH 3OX8A 1T89C 3C2SA 4OCLC 1CN4A 1NEZA 5C0GB 3L3IA 1OARL 4GRLB 4ZUTA 2QQNL 4JPVH 2VLJE 3V6BR 1CF8L 2QL1A 2CDGB 5F1IB 5C0BA 4PRPA 4RFNC 3VFVB 4ZYKA 3LKSA 5CJ5A 2JB6A 3QISA 3GSNL 1F3DJ 4MS8C 3ZDXE 2LFGA 1HQRA 4V2CB 1RULH 4N1HB 1BZ7B 4PJGF 3WSQL 4BH7B 1I3RA 1L6ZA 1YYLH 2PTVA 1JGVL 1HINL 5DRWA 3B2UC 3IRPX 2EECA 4PJ7B 1JVKA 2FX9L 3UXFA 1JFQH 4ZS6C 2A6IB 4PGBB 2FO4B 4OT1L 4NGHH 3VG0H 1WFNA 3SKMB 2IADB 1HXYA 1BF8A 3PG2A 4WEMB 3S96B 5KSAB 3A67L 4YHOL 1T0PB 2WP3T 5IF0B 1AXIB 5IFAL 1A6VH 1X4ZA 3CSYA 4G42A 4NJ9L 5HI3C 5SX4H 4P5TD 5T1KA 1HNGA 5ADPH 2P8LB 4HS6B 4JVWA 4LAQL 1TIUA 5DFTA 1PZ5A 2J6EH 5AUMA 4H8WL 3FT2A 4ZUSA 4LSQL 2YPKA 5I1GH 3WE6B 4BZYA 2MWCA 1RK0B 5CZVL 2V2XA 4OCXL 2MQCA 4IS6A 2WANA 4YX2H 2VDLL 3FO1B 3MJ8B 2QTEA 4PS4L 3SE3A 1EK3A 5LGJA 4XVUD 5A2KH 3WXVH 1UXSA 2ZUWA 4TYUA 1JGDA 3HCVA 4CW1B 4IRSA 4YHZL 2Y6SD 4UBDC 3VWKB 2J8HA 2ZSWB 2O5XH 4JHAH 3S5LG 5IQ7H 3GSRA 4JR9H 3BZEA 3VH8G 5FOBA 1QR4A 1AQKL 3S97C 4HUXA 2A1WL 3W0WB 2AK4D 1FCGA 5C8JB 1OGAE 3DVGB 2XXCB 4OLUL 4ODVL 4KJPC 3NFPB 5FOJA 3HS0A 1ZKAA 2R0ZL 3FOLB 5CS7A 3OKEA 3G5XB 5ESQA 1S9WB 1C5DA 4U6XB 5JNYB 3DXAA 4Y2DA 1EFXA 3K7UA 1XF4B 4OSUL 3FT4B 1OTTC 5JW4Q 3NBNA 4X8JA 4Y7MA 3E3QC 2E6QA 5T1DH 3VFGL 5IHZA 5CKGA 4HJ0D 1JE6A 5C0CB 4GRWH 4C83B 3WIHL 3ORJA 1OARH 3F7RA 4K7FB 2QQNH 4JCMA 5F7FA 3UTSD 4BFIA 1CF8H 5H2BB 2W07A 2OYPA 5C71A 1VKXB 2F5BL 2FEDD 2VAAA 2R9HC 3QXAA 2IPUG 3BT2L 1QHPA 3GSNH 5IHBA 1KYOK 2GQHA 2FZ3B 4X5WA 5HDQL 5FGRA 2YUWA 3WSQH 1HQ4A 1JGVH 4MCZA 1HINH 1RZIA 1LILA 3AS2A 3U36B 1EBAA 4ZFGL 4LPUA 2A6DB 5I1JL 2F58L 2FX9H 1G7JB 5KS9B 4B50A 3KPSA 1EFQA 3HZKB 2SEBA 1WITA 3C5ZA 4OT1H 3W81A 4FFWD 1H8OA 3VRJB 2NW3A 3ETBF 2ZSVB 3A67H 4YHOH 4N90D 3BJ91 3NZ8A 5HGGS 2XN9E 3QIBC 5IM7A 5IFAH 5I9QB 3O3EB 3ULVC 1VERA 4JRYE 4NJ9H 3H9HA 1QTYT 2KUTA 4URTB 2OL3A 4XCFL 4LAQH 5HHPB 4H8WH 4LSQH 4ZO9A 3SO3C 1QSFD 2QSCL 3CUPA 2DYPA 5CZVH 4OCXH 3LRSB 1FFOB 2R4RL 1A3RL 5HYQA 4JZJC 2YD7A 3MPCA 4MS8D 1RZ8B 2X89A 2DQHL 4C4KO 3N1PC 4OZIF 1DE4B 1GIGL 2OZ4A 3UTQA 1FNFA 3B2UD 3SPVA 2Y1VA 3U30B 4ELKB 3LEXB 5BJTA 1AXSA 1GGIL 3TVMB 1NFIA 4GKNB 1AQKH 1CE6B 2BXYA 4Y5VC 2A1WH 1SMAA 3CZFB 3L7EA 4ZS6D 1G0XA 2JF1A 4YDKL 5EU7E 1E27B 2R2EB 5IHLB 3LKOB 3HI5L 3P4LA 4YE4L 4OLUH 4ODVH 4YQXL 2YRLA 3M1BA 4GAYA 3MLRL 3KS0H 2FSEB 1OM3L 3ZLQC 4OLZL 2RFXA 3VGDA 4PJFE 4OSUH 4WFHD 3RWEB 4F37F 4ZOEA 5LCVL 4HH8A 1DQJA 1EEYA 1YMMD 1D3CA 3QIWC 3ZYJA 2F15A 5H37G 4F15C 4F9LA 4XCYB 3T77A 1QFWI 4EOWL 1AI1L 1ZA6B 4MXVE 2DIAA 2GJZB 1FO0B 4X7SH 4X99A 4Z7VB 1KLUA 2F5BH 4G9DA 5J13B 2Z92B 1JP5A 1A1OB 3CDGB 2EDFA 3EO1A 1Q1JH 1ADQL 4PLJC 3BT2H 3P0YH 4UBDD 4YR6A 1QUNA 1MSPA 5CLTA 3WHE0 1P5VA 5INCB 3I84A 3PP3H 5HDQH 5H94A 3DUUB 5A2FA 4TNWK 5EDXA 5EFIB 3N50A 3U7WL 3NVQA 1W0VB 3QUMB 2CO6B 4UQ2A 4UU9A 5C70A 1T0NB 5I1JH 2P5WD 2F58H 5MEND 3BISA 3GJEA 3WJJC 1OGAB 2ATPB 4XCCL 1L9MA 2R1YB 2ZKHL 4LLWB 4MD5B 2X42A 3A0OA 4Y0GA 1I8KA 4PLNC 3SDXE 5I1LB 1F4YL 1DEEB 1OTTD 5EZJA 2BHZA 2YPLD 2BNUB 4PRBA 5JHDE 4G80B 4MHHG 2HA1A 5C0EA 4W4NA 5IW1A 5ISZE 3QO1A 3BPLC 3IDGA 4W4OC 5C92A 4XCFH 4M7ZB 4PJIE 4BSVB 2CKBA 3CFDB 5D2LF 5DTFB 3AUVA 4NKIL 1KPVA 3BPNB 3QZWB 2QSCH 3PWLA 5C9KA 3VGHA 5GZNC 3EAKA 2R4RH 1A3RH 4QRRA 3C6LC 4S2SB 5E8PA 2BVOA 1G1YA 3RZCA 1NBQA 2DQHH 3TCLA 2V5RA 4Z0XA 1GIGH 5DI8B 3U46A 4ZXBC 4PJBA 3E2HC 3K46A 4HPYL 1JNJA 3VI3F 25C8L 1TLKA 1ZHBA 2ICES 4NOFA 1T1ZA 4K8RC 3X3FL 2BSRA 1FG2A 2AEWA 4JRXB 4YDKH 5IEHB 1J11A 3MZGB 3KYMA 4ORZC 4YE4H 4YQXH 5T3ZE 4YK4C 2YD2A 3MLRH 1BJ1H 1Q9WA 1XF2B 3QUZA 4LVHB 1OM3H 4A6YA 4I77L 4MWFA 3ARYA 3GRWA 4OLZH 5T1LD 3RGHA 1P7QB 3Q0HA 4QRUA 3O4LA 4LPWA 3QIBD 3RA7H 4XVJL 5GJTL 4YO0B 4ZUWA 3ULVD 3D69A 5LCVH 3VJ6A 3CXHJ 5EO0B 3A6BL 4JCLA 4LSPL 2D7QA 1CD0A 2DWDB 1T7ZA 2D31B 5I76A 2GUOA 4NQEE 3KLDA 1JWSB 1DQLL 5H35B 3T3MF 4Y4HB 3H8NA 1NKRA 4EXPX 2E8YA 4XVSH 4EOWH 1AI1H 2H32H 4XP9L 2EC9U 4ZOCA 3FAWA 4F7EB 4AM0A 1KUMA 4Y4KB 4J2XA 5CJQL 3F7PC 1Z9MA 1ADQH 1T2JA 1NUFA 1S9XB 3PWPD 5BO1L 5F9OL 4YDLC 4APQA 1R5WB 3DVIA 1E28B 2V2WA 4PP2A 5D7LD 4ELMF 1AD0B 1CGYA 3I75B 5DK2A 5TDPB 5IG7B 1NKOA 3U7WH 4NT6B 4TTGA 2EDOA 3CVHB 4U2YA 2WAHA 3ARGA 4IRJB 2H26B 4UDTB 1IAOB 4MHHI 1VEPA 2AABL 3ULSA 3WNNA 4Z78A 1KB9J 4HKXA 4XCCH 3LEVL 4HUVA 4M1DL 1QQDA 2ZKHH 1F00I 1ETZB 1PSKL 2WIIB 3BKJL 1IE5A 4LSVL 5GPRA 1F4YH 4RGNE 1N3NB 1CYGA 4U49A 1IM9B 1HHKA 4FXKA 3QIWD 5T3XL 4Q6YA 1NGQL 2L7UA 4DWHA 5ESVB 3HZVB 2XFXA 2X05A 3QYCA 1SHMA 4JFHD 2HVKA 1DLHB 1CFQB 2M26A 5GRXG 1F5WA 3IJYA 4NKIH 2A83A 3SDAC 3K4ZA 3IU3B 1KIUA 1DL7L 5E2WL 1N26A 4PLJD 3P9LA 5L2KA 2AERT 3IETA 4MNHB 4UT6L 5GS3A 4JFEA 3G04B 3V2AR 5D1XB 4MCYA 2JB5L 4LSSL 4PJ9A 3MRNA 2P5ED 4HPYH 1I9RL 5FUZL 25C8H 3OKDB 4Q97A 5F6IC 4HX1A 3X3FH 1Z9SA 1U8HA 2VRAA 3L7FA 1JWMB 4FABL 4FP8L 1T1YB 3FB6A 2BXZA 1TTFA 3QCVL 3QDGD 3K3QA 4HULB 3VD3A 4KXZH 2EIZA 4U1IB 4EI6A 1T4KB 2C3HA 3L3OB 1H3WM 4ZPVA 2E7MA 5TF1L 4ZUUB 3QNXB 5DHVH 4I77H 3CIQA 2HH0L 5E24E 3OJDA 5IB4A 3PXJA 3RVVC 2UY6A 1U8OA 4XVJH 3VU2A 5GJTH 2OJEB 3B6SA 3B5HA 3A6BH 4IOFC 3ZDZE 4BA8A 3DLQR 4LSPH 3QDJB 4PJ5E 1DQLH 2Q6WB 3V7MA 3PWNB 3EO0A 6FABL 3BQUA 3IKCB 1DFBL 5F1OB 5GZND 5KG9B 2VXTL 4FRWA 5JOEA 4ZUVB 1A5FL 3MO1B 5EBMA 1OSZB 4RNRA 1M71A 1AHWB 4N9GA 5CJQH 1CDYA 4OZFG 1WJ3A 4YLQT 2AVGA 5BO1H 1QD0A 4ZXBD 2JCCB 2G9HB 1TVBA 3QB7C 3WO4B 4QRPA 4POUB 4K8RD 5BOPA 1FFPB 1CFSB 4GMSL 1ZMYA 2NY0B 3SQOL 4WV1A 1KEGL 5DWUL 3MV8B 4AG4L 1X5LA 3V52L 5E4IA 3RUGE 5CSZA 4NO2B 3RDTA 4M1DH 5A16A 1PSKH 3KPNA 4QRSA 3BWAA 3BKJH 4PJ8B 2G5RA 4LSVH 4RMQA 1SY6L 5ANMA 5GGTA 4I0PB 5T3XH 3VDCA 1NGQH 3C5JA 1XF3B 4PREB 2NW2B 3U48A 1D5ZA 2R56L 3TNMB 4NM4H 3UTTE 1JPFB 3L95B 4PR5B 4YHIA 4KMTH 5IWLA 1RJLA 5D1QA 3CFEA 1X9QA 3OKYA 1NAKH 1WAAE 1DL7H 5E2WH 5I1HL 4YXHL 1P2CA 2HMID 1V7ML 2HTLC 3D18A 1JGEA 5IEKB 4L4VD 3G08B 4UT6H 3RWDA 4P4RA 4KK6C 4TNVF 3QNYB 2JB5H 4LSSH 5DO2C 2E5EA 4H8WC 4JB9L 4P46B 4KUCF 4F3FB 1OF2B 1I9RH 5FUZH 4D0CB 3W11C 1G0YR 4RZCA 1GPOL 2CLRA 2QKIB 1RUAL 4FABH 4TVPL 4FP8H 1TETL 2IANE 1CDJA 4MD4A 3QCVH 3CC5A 3UDWA 1KPRB 4ZTOL 2BSSA 4EVNB 4PGEA 4M5ZL 1KTLA 5DVKA 4UAOC 5TF1H 4XBGB 2E27L 2P4AB 1UG9A 2HH0H 4XXDB 3D85D 2UZIL 3T65A 3QRGL 3D39D 2XWBA 1OSPL 1NBZA 4R7DA 2ZUTA 1WC7A 1HH9B 2AJVL 1OAKL 4X4XA 4S1SL 2Q7YB 4LKCA 3ARDB 2AV1B 2QQQA 6FABH 4PTTB 4PYHA 2I9LA 4WHTA 3SDAD 1RURL 5C0JB 1DFBH 2R23A 2VXTH 3QQ4B 1CT8B 3UBXG 1A5FH 1DDHB 3AB0B 4KTDH 1CICB 4JZOA 3D5OF 2PXYB 3UTZA 3WV0A 4U1NB 1ULVA 3IDMA 3DTXA 3MLYL 1X5ZA 1IM3A 5EUOB 5KVGL 1T1XB 4R3SA 1T6WA 3S36L 2RCSL 4K3JL 1KULA 5JA8B 2VDNL 5GSVB 1K2DA 5DVOA 1FYTD 2H6PA 1I8IA 3S35X 1AC0A 4GMSH 2VITB 2Y7QB 3SQOH 4OI7A 1ZHKA 1KEGH 5DWUH 2C4FU 1MUJA 1OAZL 5DUBB 4PV8A 4AG4H 2AJXH 1S5HB 3V6FB 1KIQA 3V52H 4Y19D 3DX7B 3BEWA 4WI4A 3DROA 1NMCC 2DJUA 3ALWA 4HT1L 4D9RE 4QTHB 1I1YB 3RVVD 2JJSC 3P40A 3FN9A 1KOAA 3PWUB 3VD7A 2RQ8A 3QEUA 4JFOB 5CZKA 1SY6H 4IOFD 3IFLL 4WU5B 1NLBL 4ONFL 1YEKL 5HYSB 3O3DB 4LSRL 4PJFF 4QYOB 5DGRA 2R56H 4KDTA 5J89A 2ESVE 1ORQB 1FL6A 4IDJL 3UZEA 2I07A 1YDPA 5E94A 1P1ZA 1G6VK 3HAEA 5I8EA 3BIBX 1A6TB 3RL2A 5CSGA 1UM6L 3L5XL 4YXHH 5L2JB 1ED3A 3STLB 1U8PA 1GOGA 4MXVF 1V7MH 4XTRC 1XGUA 2JJTA 1KCLA 4F9PC 5C0NC 5D2NC 4POZC 1T5XA 3RVXC 4PBWD 4JY6A 4K23L 4MJ2A 5E7BA 3ZKXB 1WCBA 5I17B 3ULUE 4JB9H 1X4XA 1I1RA 4PRHD 4U7MA 4LLMA 4EKXA 3KDMA 4E5XB 1IGYA 3VXRB 4ODXB 1RUAH 4YBQD 1VHPA 4TVPH 1ITBB 1U36A 1TETH 3EOAB 4DW2L 3OF6A 3ARFA 4ZODA 2AJUL 4ZTOH 2L0DA 2IBBA 4M5ZH 4M6OL 2VLMD 1MVUB 4CDGC 3QSKB 1AO7D 1VACB 1ZT4B 4O5LL 2BVQB 2E27H 3T0EC 1I8MA 4P9ML 4ONOA 3TO2B 2UZIH 2CPCA 4ZAKA 3EYQC 1HEZA 1JPSL 1L6XA 1MQKL 1C5CL 2YMXL 3UBXI 4CDHA 2RB8A 4JFDD 2F54B 3DGGA 1OSPH 2XKUA 2DF3A 1T6VN 2AJVH 1OAKH 3UJIL 1FL3A 4S1SH 1CIDA 3S4SA 1XH3B 3CU1A 5DJCA 1R24B 5IQ9A 1RURH 5AG8A 2NY5L 4JM2A 3IDIA 3IAGC 2DKMA 5B8CC 1MVFA 4PJIF 1T5WA 5F7NC 4K3HA 2HTLD 2FJHA 2Q86A 1Q72L 2PR4L 4UB0H 4HXAL 4KK6D 5J9PB 5DK0A 3V0AC 3MLYH 2IQAA 3CPLB 3PGCA 5DO2D 2D7MA 5KVGH 3TT3L 4NQCE 3S36H 2RCSH 3MUZ1 4K3JH 2GFBB 5IROA 2VDNH 1D9KC 4X8XA 2PW1A 3MNWB 4XNQA 5EOTB 4NO5A 3W11D 1HSAA 5DHYB 1ORSB 1NGYA 3V0VA 5C0RL 4BELD 3D2UD 3AREC 2LE9A 1CFVL 1OAZH 4OIBA 2WUCL 3KJ4C 3OX8B 3T2NL 3MBXL 5JDJA 3U6RA 3SCMC