4M5YH

Crystal structure of broadly neutralizing fab 5j8
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
224
structure length
217
Chain Sequence
b'EVQLVESGPGLVKPSDILSLTCAVSGYSISSNYYWGWIRQPPGKGLEWIGSIYHSGSTYYKPSLESRLGISVDTSKNQFSLKLSFVSAADTAVYYCARHVRSGYPDTAYYFDKWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 5J8 heavy chain
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 217
sequence length 224
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5yH01
4OCWL 1M71A 5E00A 4MDJB 4DKEH 4Y2DA 1AO7D 1DFBH 2DDQH 3VFRB 4M5ZL 2NZ9D 3L3HB 3WS3B 5MEOB 1TITA 2IJ0C 3OJ2C 4POZC 3SGEI 2BNUA 2C4XA 2IANB 5DJYA 5EU3A 3EJYD 5CP3A 2EXYC 1H8OA 5EC2B 3RNQA 3ARBB 3BN9D 3I3EA 1JFQL 1K8DB 1ZHKA 1XIWC 4UZGA 5F9OH 2DWDB 3GMRB 3INUL 4J4PA 5KSAC 5KVDH 1OY3B 5D7LA 1U91A 4P57A 5FYJU 3HI5H 1INQB 1IGML 2OS7A 2D9QB 3MLXH 3GMOA 4Y5XA 3UTPD 3L5JA 3S6CA 2DYPD 5D6CB 4ZFZB 2I27N 2PYED 4NQCE 3FTGA 1P84J 5FF6B 3REWA 4N0UE 1A3RH 3B9KB 4QXUL 1MQKH 3RIFF 3WSQL 3MRCA 2O5XL 3P11L 1FNLA 3BD3A 5TDNA 4FQXA 1AGBA 5EU6A 2B4CH 3RU8L 2A73A 4JHAL 1UB5B 2EDJA 2NNAA 4UNUA 2JB5H 5IKCB 1EFXD 2X4OA 1G6VK 3C2SA 5CWSA 4YK4C 1G1YA 3LQMA 2SEBA 5CJOH 5EO1B 2WLZA 4TQEL 3MUGB 2ZUVA 4WO4B 5I1IH 4PJ8D 1NFDB 1MCHA 1XT5A 2X4PB 1JK8A 1EBAA 4LSVH 5CJ5A 2YSSB 3BPNC 2I9TA 4IRSC 5HHQB 5FV1L 3QPXH 3DRTB 1MCRA 1T20B 2BVYA 4O58H 5GISH 4NZTL 2Z31C 3UTZB 1U8LA 5DEGA 2H2SC 5CILL 1IGTB 3PQYA 3QAZB 3QDJD 4DKEL 4D8PB 4HUKB 3V4PL 3DURB 2DDQL 3BHBA 3IAPA 1N2RA 2HP4A 3IFPB 3TBVB 4ZAKA 1OPGH 1S5HB 4K9EC 2YK1L 3CU7A 2VUOA 1OAKH 3LH2H 5F7YC 4U1KB 1A4JA 5JXEA 3O6KH 3OKOB 4OGAC 1YEEL 1S9WA 3L7FA 3L9RB 4G8GB 4GKZA 2DI8A 4MJ4A 5HDBF 5KVDL 1KULA 3FMGL 5EO0A 2OZ4H 5CKGA 4XBGB 2B5IB 5JHDA 3HI5L 3UEZA 3BD5A 2FB4L 5FHAH 5F1NA 1KJ3H 2VZVA 3DUUB 5J3HD 4F7TB 2BNQB 3GDBA 4FQJL 1VFMA 1N6QL 4QTHA 4JO1L 4XWGL 4QRSA 1A3RL 2C7UB 3RVVC 3OAUH 4G8EB 1DTUA 4XHQA 1N8ZB 3G6DH 1QEWA 3P0GB 2EC9T 4WW2B 3DX7B 1CIDA 5H37G 5HI4D 3T0XA 2Y5TB 4DZ8A 1WLHA 4X6BA 5T1LD 4KU1A 5JW4R 4LRIC 3ULSA 5E2JA 5DT1L 1AC6A 1Y6MR 1V05A 5F1OB 4LAJH 5I1IL 3DBXB 2Y36H 3VJ6A 5BCAA 3SPVA 4LSVL 5D2LE 1GH7A 1TPXC 2FIKA 2HJLB 2VC2H 3FO0L 3NZHH 4GXVH 1VFAA 4DGIH 4NP4H 2YPLD 4U1LA 2P43B 1EUTA 4UUJA 4ERSH 4Y4FD 5EUOF 4U31A 3RWHA 4FFVD 5AD0A 4P9ML 2FD6H 1MWAL 5EUOE 4KGJA 5FFLA 3VWJD 5EU5A 5H8DA 4YFLF 1IGIH 3GHBH 3SE3A 2VDQL 2CMRH 3D0LB 3H7BA 4KAQH 1FFOA 4C56B 4TULH 4CN1A 1CU4L 4PLKD 1OAKL 5KVGH 3O6KL 5HYJB 1P69B 1YDPA 3D18A 2VE6B 2C3HA 4YXHH 1IAKB 3S5LA 4MA7H 3QWOA 2OZ4L 5IMKA 1CXEA 2IMMA 4GSDH 2BOCA 2QADD 4YBLB 5HYQA 1INDH 5IMOA 1BD2D 1KJ2B 1ES0A 1HOCA 1KJ3L 1TFHA 5D1ZA 5FHAL 3TGXA 3VFGH 2BX5A 4HPOH 3MC0A 5I76B 3EYUL 1UM4L 4NO3B 2QHLA 4H5SA 1I4FA 4X4XB 2WNGA 4OCRH 4KDWA 3OAUL 4P5MA 2XG4A 2GJ6E 4OLZH 3G6DL 1XH3A 5I75B 4ZOEA 1JYWA 1WC7A 3X14A 1WBXA 3CXDH 4OFPA 5IM7A 2CGRH 2J5LB 1BVLB 4RBPK 2CXGA 3HNVH 1KTLB 4ZPTA 1A7QH 3PL6A 2R56H 3GIZH 3BISA 4D9QE 4H26B 3O3DA 12E8L 2AP2A 2NY3D 5ALBL 4RMTA 4OZIF 5EBLA 2Y36L 4ZUVA 1R6VA 1B0RB 4LLWA 4QOKA 1JGEB 4QHLA 4QNPE 5D7JA 3O6ML 1X3DA 2VC2L 3NZHL 4L4VA 3RBGA 4YFEA 2CR3A 3WDHA 4NIKB 3ARDB 4DGIL 4NP4L 4KHTH 4ERSL 5LGKA 1FNHA 1YN6B 2FD6L 5H2BA 5E6IB 5HJ3B 5C0JB 1R0AH 5FOJA 1J0IA 1SEQH 4KRLB 1RFDH 4DKFL 1IGIL 3GHBL 3CFEB 2CMRL 2GSGB 1ZS8B 2EEBA 3B2VH 1IAMA 4PRID 4TULL 3IDJA 2I9LA 5LWYH 2ATPA 2XKNB 1JL8A 1SYVA 1MHHA 3SDCA 1XF1A 4F7CA 3TNNA 5KVGL 3QNYB 1KIPA 5SX4I 4M1GL 5C0FA 1ZSDA 4YDIH 4WENB 4HAGA 1D3CA 3LKQB 1EMTH 3BDBA 3BVNB 4YXHL 1D9KC 3PGFH 4MA7L 4GSDL 2V2XA 3MRMA 4DOHE 1Q38A 4KZEH 4N0FB 4WFED 2CUMA 3VFGL 1X7QA 5KN5A 4KVCL 2VMFA 4HK0A 1DLHB 3MBED 4N5EC 3IRPX 4HUXA 1ZAGA 2E6JA 3SJVD 3ZTJH 4Y1AD 1CD9B 3I3DA 4K8RD 4X4ME 4Y4KD 1KB5B 2CGRL 5KW9H 3HNVL 4HFUH 4K94L 1A7QL 2R56L 3GIZL 4UQ3B 2C3WA 5GGVY 2BMKA 5DK0B 5EORH 2JB6B 3FQRB 4PJEA 5E56A 2R29L 1PKOA 2R4RL 3ZYOA 5LJYH 2Z93B 1QYGL 2ZUTA 4FQCH 4XHJD 4JPIA 2VR9A 3N9GH 5EIIB 4ZOCA 4WFGE 3B5GA 1LE5B 1UZ8B 1PD6A 1MAMH 3ILPA 5BRZB 7FABH 3DSFH 3JBG7 4MQSB 5GS0H 5I8OH 5M7QA 4NN6C 1HYSD 1R0AL 1M7IB 4YO0B 5L2JA 1SEQL 4F2MA 3VG9C 4RMSA 5LQBL 3D87B 4ZOAA 5E9DE 2IPTH 3B2VL 4HS6A 4UMGA 4EOWH 5CGMA 1DQDH 3T04D 1ZK9A 4CVZA 3QA3B 1UA6H 2BHYA 3OWEA 3EFFB 3NFNB 3ARFB 3VGDA 4YDIL 1RVFH 4OLEA 5MP6L 1FO0B 1OAXL 1MAJA 2AJYH 4RRPG 1YZZA 2FNBA 2UWEB 4CMHB 4KZEL 4M61A 4Z78B 4K7PX 4F7MA 4JDTH 3QO0B 4XP4H 2AK1H 3MCKA 5DK2B 4H1LG 3QUYA 4XNMB 1AD0B 2XACC 3MREB 4N1CA 5F3BB 5KSBB 3CFKB 2ESVD 4FFYL 4GRLC 5A1AA 1ZA6A 2PXYA 5TJWK 3VXME 4NKOB 4GKSA 1FFQA 5JOEA 2XRAL 1VB9A 1WJ3A 3KXFB 3MBXL 5I74C 4LOUD 4EVNB 3QXDA 2F5BH 1G84A 1ZHLA 1GJIA 5KW9L 3GSUA 4G9FD 1CLYL 3T4YB 2W0LA 5F1IB 1QFPA 1DUYB 3B43A 1PQZA 3ES6A 2ZSWA 1IM3B 3TBTB 3VXQB 3QEQB 5IQ7L 3Q2CA 5EORL 4PR5A 3D0VA 5IEKA 3GGWB 4IOFD 1U8NA 4D0DB 2PO6D 5EZOH 3NACL 1P4IH 5FA3A 3BUYB 4HWNA 3TM6A 2A83B 3A6BL 1TXKA 1U3HA 1G7HA 2H32B 1IAIL 1KLUB 4FQCL 4ZFFB 4GAYB 1HZHL 4ZNCD 4L8BA 1QSEE 4YJZL 2WBWB 3BXNA 2W65B 5GS0L 2V2WB 1N26A 4PJIB 4TNWK 3TYGH 3ULUF 1WCQA 5J1AB 4JKPL 1AH1A 3IYLW 2IPTL 4EOWL 1HEZB 1AP2B 5EU4B 2ICWI 5HHPB 3F12B 2AK4D 2Q6WB 1UA6L 3QNXB 2DKSA 2BJML 4XBEH 4WU5A 1OTUC 1ITCA 5FCSH 4MXQC 3CNKA 5IBUB 1OP9A 3BP6B 2YC1A 5IW6B 1OF2B 1ONQA 4KKCC 2XN9B 3C08H 1Y6KR 2Y7QB 1BZ9B 2PTTA 3KJ4B 4EN3D 1R3LB 3CD4A 4XP4L 2AK1L 1ZOXA 4JDZA 4X80L 5CSBA 3VRJB 5BS0D 1NJ9A 1LNUA 2RFXB 4N9GB 4YX2L 4Z7WF 4LPVA 5J13B 5IB1B 5T33L 3FT2A 1ZGLP 3PABA 3AROA 2Z92A 3CMGA 1MWAA 1T1ZB 2GKIA 2RQ8A 32C2B 3Q6FB 3F7VA 5DYOA 3WS6A 5DURB 2VTFA 4KHXH 5F9WB 1NC4B 4PJDF 4YR6A 5I16B 4YEEA 1NQBA 3KPQA 1NGYA 4IIQC 5CEXB 2VXUH 4LK4A 1EJOH 4M43L 1JYXA 3CFDA 1SVCP 2K7PA 5A2LH 1RZKC 4FXLA 1ZWIA 4JQIH 2Z35A 1RJZA 3VE0B 1P4IL 5C0CD 1JTTA 4P2OD 4MMXC 1JE6A 3FN0H 1U93A 5IQ9A 4JLRA 1NKOA 5EPMB 4BZ1H 4PJ7B 1R5VA 1RK0A 4WTWA 4TYUA 1YNTA 4V1DB 4P2QD 1VGKB 4WI5A 1EEQA 4Z7VB 2Q7YA 1JMXA 2X1PA 3OTTA 4PJGF 4KMTL 4QRPA 2OTWA 2Z8SA 1C7SA 4PJGE 3UTTB 3HS0A 5IJKC 4NKMA 3TYGL 3KPRA 4R97B 3S9DB 4G6KL 1MPAH 5EA0L 3L6FB 4H8WC 4QHMA 4PREB 3IJSB 2NLJA 5TE4H 1BFOA 1CGTA 1VKXB 1GGYA 1UVQA 2HJFB 4QHKJ 1EH9A 3ZL4H 3ARZA 4KUCD 4CVXB 1MI5B 3UBXI 1MFEH 2LE9A 1CXFA 4XBPB 5ICXB 2EKJA 5FV2A 3C08L 4V2BA 3RVTD 2P5ED 4OFKA 1KTDA 1T0MA 1A0QL 3PHQB 3SKJH 4ZPVA 2P1YA 4Y2DD 2X4RB 3CSYB 1W72H 5BZWA 4NRXB 4F9PC 1CFNA 3ZDYE 1U6AH 4J8RB 5C6PB 5C86A 1FAIH 3L5WB 2W07A 1CDJA 3NCMA 1OD7A 3MLWH 1NCNA 4PLJD 2UVEA 4P2RB 3U4BH 5FK9A 3BJ91 1FH5L 3N85H 4HUUA 4P0DA 5ESAB 3MGTA 1EJOL 4JG1H 4WI8A 4J4PD 3EDJA 1FL6B 5IGXH 4JQXA 3O2DA 3P9LA 3RWIA 3FRUB 1I8KA 2DTMH 1OSZA 5D7LD 4HF5L 1L0XA 2BK8A 1KB9K 4HD9A 3B2UD 4JQIL 5L2KE 1OARL 4U6YB 4ZUTA 1YY9C 3WHXB 1TCRB 3FN0L 3QI9C 2P8LB 3KPMA 5IOPA 1JPFA 2RGSA 4FFZH 3RUGA 4UTAL 4R4ND 2EO9A 1LP9A 5GPRA 5DGRA 3WJJA 5IMMB 1ZGLB 1NAKH 1EVUA 3NMEA 4Y4HB 2P49B 4FQXD 5H35A 5EU6D 4XCYA 5A2JH 3BZ4B 3O41A 1IAIM 4MNGE 3MV9E 3NCJL 3U7YH 5C0RH 3GSNH 4YHZH 4C4KT 5CEZD 4WEUD 2FEEL 1DP0A 4S10A 5TE4L 4LHQB 2DLIA 1C5CL 4PJAB 4DW2L 1U58A 4BQ6A 3ZL4L 1FFRA 1MFEL 4PJCA 4WEBH 4XZUA 4JDVA 1NCBL 3O4LA 2P4AB 3PQYD 1T6WA 3P4MB 1W72L 3QEUA 1QR4A 3MXVL 3MRPB 2EDQA 4XP5L 4JFFB 1AIFA 3BPOC 1OP3H 4ZAKD 1FAIL 4BA8A 2R9HC 1UXSA 1T3FA 3NIDF 5DJXA 5CZKA 3MRGB 1WK0A 1I1AB 5C0AA 1S7TA 2V7HB 3NGBC 3U4BL 5JXED 3ULVD 3E6HB 5F7UA 4ESKA 3BKCH 4GG6E 3N85L 3UROR 5GGTH 1DDHA 3G6AB 4NQDA 4G6FD 3TPUB 1ED3B 1J18A 4PGCA 2HWZH 4HCRH 4XC1H 2DTML 3OGCB 3TVMC 2EDTA 5SWZA 4X6CE 3FO1A 5JHDD 1BJ8A 1I8LC 5DJ8B 4U1JB 4R8WH 4F58H 3OKKA 2GHWB 3MV7E 5ILTH 1A6WH 1HN1A 1KJVA 3GKZA 3ARGB 3MV8E 1JTOA 1BZ7A 3MTRA 4FFZL 3PE9A 5L0QB 5IESH 1DBKH 5GZOD 4GLRI 1KLFA 5D5MF 1NAKL 5D5ME 5DRNA 3K1DA 3OKLA 4PJBE 4X98A 4MDIA 2WIIB 1J0JA 3RNKB 4L3ED 2LU4A 1YMHB 2CLVB 3CH1A 1QO3A 2IBZX 3DV4B 5DTFB 3JWOC 3KPOA 1U3ZA 4DK6A 2GITA 5C0RL 4WWID 4YHZL 2NY0D 2IADA 2H41A 5BO1H 3S3PA 4YQXH 1NBVH 4R7NA 2QQNL 4KK5C 2ED7A 4M7LH 3IJHB 3QHFH 4PRPA 4U1HA 3R8BB 4FNLH 3IDGB 4GG8A 3LQAC 3I2CL 1K2DA 1Q9WA 4WEBL 4OZHF 4FG6C 1JV5A 3HZYB 1YNKH 1J05B 4KKLD 2QLVB 2YD6A 2FIRT 2ZOKA 4X7TB 2JJWA 1WBZB 5I19H 1M6OB 4XMLH 2H2PD 1M05B 2PTUA 4LLMB 3MR9A 4GKNB 2VDKL 4NQUA 5AZ2H 2CD0A 5GRZA 5T3XD 4BFGA 2QSCH 1SYSA 4FOMA 1CLZH 2GCYA 4L8SB 5F6IC 3RVWC 1WFOA 1OCWL 5D1QB 4U0QB 3O8XD 2OTUB 1Q1JL 1YEHL 3NIFF 3BKCL 2XKSA 5D96C 3V7AE 4P46C 2NTFA 4AIOA 5GGTL 4DQOH 2GW5A 3PXHA 2GSIA 4HCRL 4XC1L 1GZQA 3QUZD 2DBJA 3BGMB 4M48H 1PYWA 4KPHH 4OIAA 5FKAB 2VLJB 4F58L 4R8WL 3V79C 5D1ZD 3G5XA 2P5WE 4RCAA 5ADPL 1K5NA 4KJQD 3I85A 5IESL 1DBKL 1EUUA 2M2DA 2OMNA 3KLHD 2OXGA 2VLRE 1QSFA 5I73C 3ECBB 5F89B 1DBJH 1HSBA 3OJDB 5C2BH 3RL1A 4TSBH 2FHFA 4YHIB 4U3XA 4MA3B 5JZ7C 1F8TH 4XPAH 1QNZL 1NGQL 3PL6D 3RIFK 3JV6B 4Y89A 5I18L 5BO1L 5DXWA 3HNSL 1HCVA 2GFBB 2ERJC 3E8UH 4MDJA 4BFEA 4ELKB 4F8QA 4PJFF 1NUGA 4QOKD 5D7KE 4M7LL 1JI2A 3VFRA 3IU4L 3P77B 3W5NA 2HKFH 5D7JD 4L4VD 3L3HA 4ZG1A 2X4TB 4L9LC 4LEXH 5MEOA 1YNKL 4KXZH 2IANA 2VZ1A 4NQVB 1JNNH 3HB3D 1ODAA 4YE4H 5I19L 5EC2A 4XMLL 1QZ1A 1T21B 3ARBA 4HS3A 3EO0B 3EOBB 2IFFH 1K8DA 4M9PA 2I5YH 3ROLB 2DWDA 1GPOH 3PXJA 3GMRA 3ET9F 2E9JA 4K7FB 4ELMF 1CLZL 3C09C 3QQ9D 4OF3A 5JIKA 4U2YA 3DUSB 4KKBC 3SDCD 2Z8VC 1INQA 4Z7UF 2OX5A 2J8UF 5D6CA 2DQCH 1B4JH 5C0DB 2J8UE 2CO7B 3RGVB 4DQOL 2VLRB 4LGSB 2CIIA 5FF6A 4I9WE 1OGAB 3B9KA 5GZND 1ZTXH 2Z4QB 1AQDB 5I1LB 4PIRF 4A6YB 4M48L 4KPHL 4XMPH 1UB5A 4MQXC 2O93L 1QQDB 4L5FH 2EDRA 4ZO9A 4CVUA 2YEZB 3MRFB 4M02A 4X9HA 2FJHB 4S11A 4UOW0 3CFBB 3FAWA 4RAVB 3RVUC 5EO1A 1TVBB 3F7PC 4LGPB 3RZCA 1OT2A 3GM0A 3MYZA 5D71H 3MUGA 3VFWB 4KVNH 1U2CA 4WO4A 1NFDA 1BQLL 1DBJL 3BPLC 2QL1A 2X4PA 4HKXB 1AGCA 5C2BL 2YSSA 4TSBL 3HC3L 3CH8A 3QEHB 3QH3B 5HHQA 3QCUH 3DRTA 1RD6A 1I8MB 1F8TL 4H25B 1T20A 2XY1A 4NFDA 3UTZA 1JHLL 1IGTA 2XT1B 1PFCA 1UZ6E 3DIFB 5CZXD 3DURA 1T4KB 3VXPA 1NDGB 2FO4B 2HLAB 5B4MC 4PJ5E 3IFPA 4FTVE 5J6GB 3TBVA 1S5HA 4LEXL 1TZIA 1CVRA 4FA8A 4OQTH 3D6GA 5I8KH 5J7CC 3PHOB 1JNNL 3MO1B 3CUPB 4D0BB 4U1KA 4Y16B 4YE4L 2D7TL 1MY5A 3OKOA 5TF1L 4WWKB 3WKMH 2QSVA 1XGTB 3EKCA 2I5YL 1GPOL 3L9RA 4G8GA 1MVFA 1JGVH 2KL6A 4XBGA 4OZFH 4RGND 4Z18A 2NXYC 5I1AB 5EIQA 5A2KH 2EDDA 1Z5LB 4HLJA 3DUUA 2WZPD 2BNQA 4F7TA 2DQCL 1B4JL 5DJ2B 1CYGA 1OQOA 1T1YB 2C7UA 4EI5B 2XA8L 1ZTXL 4G8EA 3HE7B 1ZE3C 5AAMA 3BRDA 4XMPL 2HTKD 4WW2A 5K9OB 1ACYH 1GOHA 4L5FL 4LAQH 5C0NC 2Y5TA 3QUYD 5FA4B 1S7UB 3DVNB 2UVFA 1XMWA 1L9MA 2PXYD 3ARTA 1KCSH 1W72A 3WD5H 4Y88A 2EH7H 2JJTC 5T5FH 2HJLA 5F1KC 1HHGB 1A8JH 4J3OC 4X9GA 1T7YA 5F88B 3D1MC 2BXYA 4B0MM 5KZCD 4XCEB 3HE6B 2EC8A 4DGVH 4S1SH 1PG7W 4JCLA 4GOSA 5FUZH 5E5MB 1MJUL 1F4YH 5FYLD 1U3HD 3BOVA 3HC0B 3TLRA 2FX9H 3V6ZA 4C56A 1SY6A 5I8KL 1PSKH 5GXBB 1AGFB 1PW3A 5HYJA 4GFTB 3QDAA 3QIBA 4J23A 4MJ6B 3KWWA 1NCDL 1U8PB 3E3QC 4CDHA 2VE6A 2EIEA 2ARJQ 3RWCB 1JGVL 2NXZB 1IAKA 1I1RA 5TQ0H 4OGYH 4LPTA 4FQ1H 4NC1C 3SBWA 1KJ2A 4OI8A 5CIPB 4OD2B 4O4YH 5D7IF 5MHSD 5I76A 4P3DB 4OZGE 1RZKH 4NO3A 4RX4A 3S34H 4N0CD 4X4XA 3BP5B 1AXTH 1NBYB 3WEXB 4LCCC 5JO5B 3JTTA 1LDPH 2E27H 3WKNA 1KBGH 5D2LA 4MS8D 1BF8A 5HDLA 2KDGA 1ACYL 2JKXA 3WNNA 1IC7L 4XP9H 3R4DA 1BVLA 2X4NB 1JPGB 1R5WB 3GSOB 1X5LA 2HT2C 5TDOB 5DZOA 1KCSL 2J7LA 3MLPA 5ACMA 4H26A 3NOIA 3QEGH 3MLSH 1IKNA 3C9NB 3G6JB 3RTQC 3E3QE 5GSVB 8CGTA 1B0RA 5CZVL 1FNSL 1NFIB 3EAKA 3PWUB 1WTLA 5T5FL 1JF5A 2FGWH 4X5LA 1YUHB 4NC1E 2CR6A 5D93B 3ARDA 3PDGA 3L3DA 3FFDB 5F3HB 4XXDB 3ALXA 1CD1B 2DMBA 1UENA 1YN6A 1BAFH 3V6OA 5E6IA 5HJ3A 4Q9CA 5C0JA 2FO1A 4S1SL 1S78C 3CFEA 5FUZL 3VFPB 1SBBA 4LPWA 1PKQE 1YPZF 1ZS8A 2GSGA 4LMQI 4X4ZA 1YPZE 1X5HA 2XKNA 4K2UH 1ZLWK 4NDMB 3TO2B 2ZCHL 4QRPD 5HPMB 4KI5C 4HC1H 1CD8A 3KPRD 3LKQA 1A6PA 2NR6C 3LV3A 3BVNA 4XP1L 4OGYL 4JY6B 4RQQA 2GJ6A 4WDIB 1X4ZA 4PP2B 5J11B 4N0FA 4TUOB 4OB5L 1YEFH 3AMKA 2ZP0T 1OSPH 4O4YL 3QUXC 2R8SH 1DLHA 2J88H 5GGSB 3OAZH 5HVGB 2EYTB 4UIKL 3S34L 1RJCA 5SWSE 2HFGH 3HUJE 1AXTL 3KYOB 5B39G 1E4XI 1LDPL 1WVZA 2GTZB 1KBGL 4L4TE 4X0KB 1X5JA 1G0DA 1GOGA 3GM8A 2WBKA 1SVZA 1KB5A 4FQQB 7CGTA 3UDWC 3WNPA 4JFPA 2F53E 4N68A 4KI5F 2X4UB 2X9XA 3UYPA 5DK0A 3MROB 2NY7L 4K23H 3U30B 1SJXA 2JB6A 3FQRA 5JMOC 3MLSL 3ZT7A 3ILQD 2Z93A 5JPMB 1KEGL 3C6LC 1JNLH 2BSSB 2FGWL 4LVOB 2P44B 4KQ4H 2VKWA 5EIIA 3LB6D 1LE5A 1UZ8A 5AZEH 4G6AD 3DPBA 5DQ9B 5BRZA 3VDCA 5DJ0B 5I6XB 1BAFL 3AREB 4M8VA 4YO0A 1CGSH 4Q6YA 5DEFB 2IPKB 4O2CB 1RUQL 1M7XA 1BP3B 2F9BT 3W0WE 3TESA 3MRRB 5KSAB 3CX5K 3QA3A 3EFFA 3IETA 3C5JB 4ZTOH 3SGKA 1GIGL 3ARFA 1QKZH 4HC1L 3UTSB 4K55A 1FO0A 1BOGB 1U41A 4WTZA 4L4TB 4KMQA 2UWEA 3QO0A 1AO7E 2DLEA 1DQQB 2I07B 1YEFL 2B2XL 2YXMA 2LAGB 5DK2A 2FLBT 2DWEB 4QHKI 4XNMA 1AD0A 3MREA 5HHOB 5IW1B 4WI7A 4S1QL 2J88L 5F3BA 5KSBA 2R8SL 2QQKH 5F7EH 2UZYB 1A6UL 4QGTA 5JORB 5EZIL 3O4LD 3H8NA 1A6VL 2XKUA 4YK4B 4M4RA 4CUCA 1IGJB 3KXFA 4MNQD 3U7AA 1J1OH 4EVNA 5MENB 5HI3D 4J1UB 1WT5A 4XX1G 1YJDH 5B8CC 5JMRA 2HVKB 1F3DH 3T4YA 4WFHD 5F1IA 4N1HB 4BZYA 3BPNB 2FATL 1KN4H 1IM3A 3TBTA 3VXQA 3QEQA 3IVKA 4K23L 3SGEH 2FJGB 3PGDB 3GGWA 2Z31B 4L1DA 4D0DA 3UTPE 3BUYA 2A83A 1JNLL 2H32A 2PYEE 3PF2A 4NQDD 4GAYA 4KQ4L 1Z9OA 3S3SA 5SWZD 2DQFA 3R0NA 3LQZB 1RULH 1F3JB 2W65A 5JW3H 4HUNB 5K59F 2D7NA 3MPCA 1FFNB 2DQHH 1NC2B 1RUAH 5K59E 4PJIA 3S7GA 4LSQH 2ZG3A 5T1MB 4WCYL 5J6HB 1HEZA 1AP2A 5EU4A 4G5ZH 3RWEB 2ICWB 3AUVA 5DJ6B 1MLBB 1JUFB 2GJZB 3F12A 4LHUG 1RV6X 2Q6WA 1JPST 3QNXA 4PJHE 1EO5A 1QKZL 1TCMA 3CLFL 2WWKO 3BP6A 4KTDH 5DD1H 5GIRB 5IW6A 1OF2A 2QTEA 2E6PA 2XN9A 4ZUUB 4U6HA 1CK0L 4JFXB 1BZ9A 1T83C 3O9WB 1CDIA 4JPWH 1T80A 1T7ZA 1R3LA 1A22B 1T1WB 1K8IB 5I1EH 3VRJA 1J8HB 2RFXA 1T5XA 4PRPD 3TN0B 1CICB 3U1SH 3O11B 5IB1A 2QQKL 3FO2B 1MJJB 4LSUH 1T1ZA 2MSPA 2CJUL 2YUVA 32C2A 3Q6FA 3S35X 3O45B 3AM8A 5E2TH 1J1OL 2HTLD 3UO1H 1YJDL 3BKYH 5CEXA 3VFVB 3GJFB 4BK5A 2R1WB 2RR3A 1MJ7H 3QUKB 1QSVA 1HQ4A 1TPXB 1QRNB 3D85D 3LN9A 3SDAA 1HINH 4IMLB 1KELH 3HI1B 4BSWB 5IFJB 3VE0A 1T04B 3F58H 1EZVY 1UKQA 3KPSE 5EPMA 4PJ7A 1MCLA 5FEBA 3VWJC 3MSPA 1JPSH 1SBSH 2QSQA 5EULV 3TBSB 5F6HI 1HSAB 4V1DA 1VGKA 4YXKH 4RGOH 1TMCB 4Z7VA 5JW3L 2DTSA 4LKXB 3VFUB 4EDWL 4TSCH 3AS1A 4XNYL 1RUAL 1OTSD 3T09A 4HMCA 1JRHI 4LSQL 4Y19B 1EDQA 4ODWB 1EHNA 5IP4A 1QSFD 4PREA 3IJSA 4OZIB 1UGNA 1CIUA 2GK0B 1VKXA 1A7PL 2HJFA 1IBGH 2CRYA 2HMIC 3UBXB 4CVXA 1MI5A 1NMBH 2VQUA 1OW0C 4KTDL 3EO9H 4M7JH 4XBPA 5DD1L 5ICXA 5TDPB 1FNEB 2OQJB 1UFUA 2YPLE 5BVJB 1H0DB 3OF6A 1UM5L 3DYMA 1H3TA 5E03A 3CPLB 4KJWC 5EG6C 1CR9L 4KDVA 1MCIA 4AM0A 2YRPA 4NRXA 4JFYB 1DR9A 2R2EB 1ZLVH 1I1CA 4J8RA 4KGLA 3L5WA 4KC3B 4LSUL 3FN3A 2IAND 2QJDA 1U8QB 5E2TL 5IB3B 3ARBD 2NY3C 3D39B 3UO1L 3BKYL 4HG4J 2JCCF 4APQB 5ESAA 3PNWB 1FL6A 1MJ7L 4Y0GA 5E8OB 4E41B 3FRUA 1EHLH 5EFIB 4CBPA 1XZ0B 4NQTA 2MHAB 1HINL 5LCVL 1KELL 1RIHH 5H37H 2E7LC 1BD2E 2DQIH 4U6YA 3WHXA 3F58L 1TCRA 1GGCH 2P8LA 3QIWB 4QF1B 5E95B 4HXBH 4ZS7L 5IMMA 3B9KD 1ZGLA 4RGOL 1UCTA 4Y4HA 1MHPH 5I1GH 3OKNB 1AQKH 1XGRA 3BZ4A 4X5XB 5MEPB 2LTQC 4IJ3C 1HXYB 5CBAB 1LHZA 3RZCD 3C8KB 3NCYP 2NX5B 3JSSA 4WO4D 4DFHA 1JWSB 5FYKD 1AR1C 4PJAA 3TV3H 1DEDA 3SGJC 3BQUC 1H3UA 4MJIB 3EO9L 1AC0A 1NGPH 1BGXH 2ITDB 4TVSa 3VGAC 4D9LH 3G5ZB 4HUWB 2AJSH 2OR9H 1G9MH 3P4MA 2IEPA 1JJUA 2Z8WC 2ZSVB 4S1DC 1I1YB 4JFFA 4K8RC 4R7DB 4Y4KC 4PRIE 1AR2A 2AKRB 1E28B 1BPVA 4XB8A 2YR3A 1D5MB 1I1AA 4KKAD 2YA0A 2V7HA 3AB0C 1BIIA 4C57C 5GRXG 3E6HA 4LFHG 2VERN 1G7MB 1FNAA 4G8GD 4HIIB 3G6AA 5CJ8A 4YHLH 3TPUA 1ED3A 2X9WA 2ZUQC 5JW4N 3GMLB 1EHLL 2OL3B 1NMCC 3OMZA 3OGCA 4PS4H 4ACPA 3NCBB 3VDBA 4XHJC 4Z76B 1TLKA 3H9YA 2AJZB 4WFEE 1D5IH 2DQIL 5DJ8A 3U79A 4U1JA 2D4DA 5ITBH 1Q0XL 4OLXH 2BNQD 1PZUB 5SX4H 4NN6B 3ARGA 3T3PF 5CJXC 1LD9A 3VG9B 1JHKH 4HXBL 3QFJB 2XTJB 2FEDD 3SJVE 4PD4K 4Y1AE 3PJSB 1MHPL 5I1GL 1VENA 2VB5A 4LNRB 1MCSA 1XEDA 2WIIA 3RNKA 1NCWH 4XVTH 1YMHA 1JYNA 3DV4A 5D2NC 5DTFA 1K85A 1BM3H 1TIUA 2AI0L 4ZUWA 2YPVH 3EYVA 5GGRA 4PUBH 1CFTB 4AMKH 2V9TA 1JTPA 1LO5B 4NZUH 2WBJC 4XC3H 3RJDA 3SY0A 3IJHA 3WLBB 3IDGA 3DX9B 1MFBH 3MCLH 1B2WH 1BGXL 1D5ZB 3QJHB 1FE8H 2B1HH 3HZYA 4D9LL 3QT2A 4G7VH 1J05A 3HCVB 4D0CA 4GRLB 5LXGH 1G9ML 4X7TA 2AEQH 1WBZA 2CIKB 3DYPA 1M6OA 1M05A 4JZJB 5J06A 2IWGA 1IC5H 4LLMA 1NAMB 3ZE2E 4GKNA 4LOUC 2ZCKH 4X6CA 1BQUA 4C56D 4XVSH 3GB7B 4K07A 3RY6A 1EVTC 3OB8A 4L8SA 5L8LB 2XQYG 3ZHLA 3GBMH 4M03A 5D2NE 5D1QA 1REIA 4MZ3A 2RJMA 5HYJD 3L3JB 2OTUA 4I3SH 4QKXB 2DQJH 4PY8J 5C0IB 1QHOA 1P4LB 4PS4L 5FM5O 4NN5C 3W39B 5JR1H 3PGCB 4NM8H 1ZMYA 3BGMA 4AT6B 2FWOB 5FKAA 2VLJA 4M00A 3OBAA 2IAMB 3DO7B 4Z7WB 5ITBL 4OLVH 4OLXL 3MRIB 4PRAB 3SE4A 1INEH 1G1CA 2ESVE 4WGVB 3FOLB 4RX4D 4PJ9B 3X12A 1KCVL 3ECBA 3OJDA 5DUPL 3VI3F 4HGMA 1NCWL 4XVTL 4M8QB 2IG2H 2GQHA 4YHIA 4I77H 5FKPB 3SKOB 4G9FE 4MA3A 3TCXA 4M1CC 3RKDD 2HT3D 3JV6A 2YPVL 3EOAB 4QXTB 3RKPA 3KPPB 2GFBA 3PDDA 4PUBL 5J1TC 4AMKL 4NZUL 2A1WH 4Y8DC 4Z7QE 1EK3A 3T3MF 4GUPA 3P77A 1U8KB 5DFVC 1MFBL 3MCLL 2YA2A 1B2WL 1UH4A 2X4TA 3ARDD 3U9PH 1GC1L 1T7XA 2B1HL 5F7DB 1MRFL 4G7VL 4NQVA 5LXGL 2AEQL 2WANA 5E6ID 2IQ9L 1T21A 3JUYA 3EO0A 3EOBA 4WHYG 1IC5L 3WXWH 1MUJB 1J8KA 3N1MC 2VIRB 1Q72H 5IVXF 4ONHB 2ZCKL 4K7FA 4WUKH 4XVSL 1QG3A 4N5UA 1N4XH 2AK4E 3DUSA 4HK3J 1ZLVK 2ARJB 4H1LH 3RL2B 5GHWL 4I3SL 1K4DA 3T2NL 3UMTA 5C0DA 3VD3A 3RGVA 3RP1A 2VH5H 2VLRA 4P2OC 1EEZB 3EO1B 3GJEB 2FZ3B 5C2UB 4RMUA 1OGAA 2GJ6D 2KKQA 1AQDA 1FLRL 2Z4QA 3UJIL 5I1LA 4NM8L 4A6YA 4H0GA 5HHXL 3V5DB 1TJHH 2V6HA 4XAKD 5BS0E 5CFHA 1QQDA 4U1SB 2DIAA 5IROA 5KS9B 1XGUB 2YBRB 4TRPH 3MRFA 5E0QA 2FJHA 2X4QA 3CFBA 4RAVA 1TVBA 3KHQA 3AMLA 3VFWA 2DQUL 5GJTL 5F96L 1DVFC 4HKXA 4AH2B 4HZLB 1PVHA 2YPKB 3QEHA 2IG2L 4Y8AA 3QH3A 1GOFA 2BDNH 1I8MA 4MXVF 4H25A 2OK0H 2ADFH 5D8JH 4QRUB 4WI2A 2A1WL 3RVTC 1EGJA 3GMPB 3K81A 5LAXB 3V6FB 1RAMA 3MRJB 4POUB 3M17B 1T4KA 2F8VA 1NDGA 2FO4A 2HLAA 4JFQA 4Y2DC 2D03H 1QPPA 5J6GA 1ZT4B 4JHZA 3U9PL 3BN3B 4NO0B 5L88H 2OI9B 4P2QE 1FC1A 1FHGA 3PHOA 3VCLB 3MO1A 5BZDB 5BRZD 3CUPA 4D0BA 4KK8C 5E94B 1VESA 4Y16A 3LRHA 2GY5A 3FQNB 4EEEA 4WWKA 3X17A 4PLJC 3EYSL 1S7SB 1EAPB 1Q72L 4CJ1A 4M93C 4WUKL 1N4XL 3ZSTA 5I1AA 2R0LL 4KK9C 3U0TB 4KUCF 1Z5LA 3ARFD 1OAZH 4YXLL 2NY6B 4BUGA 5IFHH 3B2UC 3B9VA 2L7JA 4HH8A 1CD0A 4Y5XC 1EV2E 1UKSA 3L1OH 3QI9B 2P5EE 4CVWA 1G6RH 1T1YA 3VFMB 3EW3B 4R4NC 4EI5A 4AJ0A 3HE7A 3MLTB 4ZNEA 2NQCA 3QXAB 1CL7H 5K9OA 5TFSH 5FA4A 1S7UA 3DVNA 4TRPL 1P2CB 4OLYH 4O51A 5EBGA 2OYPA 1JZ3A 3MGAA 1AFVH 2P8MB 2XFXA 4LCWB 3KXFD 3LEVH 5IHZB 1MFCH 3TO4A 1CFVH 2BDNL 4FN0A 4LIQL 2VLKB 3LN4B 2FYYB 1HHGA 3QQ3B 1G7QB 4GO6B 2JIXB 4HDIB 1WFNA 2ADFL 5D7LE 5D8JL 3J8F7 1CI5A 5F8RC 3QEQD 5F88A 5IBLD 4XCEA 4P9HC 3HE6A 2FX7H 4OGZA 4KDTC 4OFDA 4CMMB 4KK6D 4F3FB 5T1DL 3HC0A 1J7VR 5AUMB 5B38B 5HXMA 1MRCL 5L88L 4NRYB 3BAEL 5JUEH 3U36B 1AGFA 5EU6E 2ADJB 1KV3A 4PJXF 4X7DC 4ZD3L 3I3BA 2AQ1A 2FGZA 3PWLB 3NGBB 4MJ6A 1U8PA 4NOFA 2WUBL 3RWCA 1VGEL 1WUNT 5JTWA 3MRBB 3ZKNC 5CAYB 5CEZE 3NCCB 3LKSB 2AXFB 5BVPH 3TVMB 3D2UB 3RWJB 5CIPA 3GSQB 4OD2A 1OAZL 3SDXB 4P3DA 1SEBB 2Y6SD 4OZHB 5C70A 4GXUN 2XN9D 3TYFB 3BP5A 1RZGB 1NBYA 3WEXA 3PQYE 4HWBL 4OF6A 5GZOC 4GAGL 2FBJH 2DICA 2KZ1B 4CU8A 4F7EB 6CGTA 4NT6B 1K4CA 1U8OB 2R23A 2X4NA 3S37X 5TFSL 4YDVA 1JPGA 1R5WA 3GSOA 1IRAY 4XPTL 3EHBD 5E2WH 4OLYL 5TDOA 2EZ0D 3TT1H 43C9B 5JDSB 3GO1L 1F5WA 4MGXA 3F5WB 5BW7C 3LY6A 1AFVL 4KTEL 2DB8A 5DURD 2R0WH 4OQ1A 4U0RB 3C9NA 3ULVE 2NY0C 1NC4D 3G6JA 1NEZB 5GRYA 3LEVL 1MFCL 3S88L 3LKRB 1EA9C 2QBWA 1NFIA 4JZNB 3F8UB 3PWUA 3VXUE 1CFVL 1YUHA 1SQ2N 4JO4L 3W11D 2GY7B 2PYFB 5F3HA 4XXDA 1CD1A 2FX7L 5JHDE 3UTQB 3ZKXC 2FR4B 4U49A 3MACH 2YD4A 1I9IH 4KKLC 4OM0L 3ARPA 3VFPA 1FDLH 2VQ1B 2H3NB 3DI2B 2H2PC 4EQ3A 2LVCA 3SE3C 2OMBA 5DO2C 1NUNB 4V1DD 3VXNB 1CXLA 1MOEA 4RGMC 4W4OC 4NDMA 4N90D 3TO2A 4K71C 4L3EE 3MRDB 3UTTD 3UCRA 1P7QB 3DX8B 1MLCB 5GRUL 1OHQA 1CCZA 5D96B 4P46B 1WFUA 2ICEB 3THML 4PP2A 2QR0B 2M1KA 4RNRB 2EDHA 5C9KA 4PJFB 2C1PB 3HRZB 3IXTB 2VXSH 1ND0B 1MI5D 5GGSA 1AHWB 1UJTA 2EYTA 1QBML 1JZ6A 4KJQC 4LL9A 2GTZA 3KLHC 4X0KA 3DROB 4OV6F 3VXUB 4LCYA 1HHIB 2QV2A 1ZVHA 4FQQA 3NPSC 4LSPH 5T3XE 1R24B 2BXZA 1MY7A 4ELMB 2X4UA 4KJYB 3MROA 4ENED 3WUWA 1PLGH 4P2RD 4Z7UB 5ABDE 5JPMA 1AI1H 4R9HA 2ARWA 4U1MB 2ERJB 2BSSA 3QXVA 5C8JB 3IJYB 4UQ2B 5EBMB 5D7JC 15C8H 2ED8A 5DQ9A 5DJ0A 4P5KB 1N3NB 3AREA 4RFEB 4IRJC 5DEFA 1I9IL 3HB3C 2IPKA 1F97A 1FDLL 3BD4A 4HGKC 3WL9B 2WIMA 3DMMC 5IG7B 4XCNB 3MRRA 5KSAA 4JRYB 1F3DJ 2ZCLH 4Y4HD 4WNQB 1MJ8L 4Y5YB 3C5JA 4K8RH 3C09B 4M6MH 3SDCC 4HKBB 3UTSA 4LLDB 1F4XL 5E8PB 1EHXA 1BOGA 2IGFH 5AG9A 1C08B 4L4TA 4B53A 5HD8D 4N8VG 5I1HH 1FQ9C 1Z9SA 2DJSA 3GZKA 4XX1E 4DCQB 4ODUB 5I1DA 1S5IH 1DQQA 3CXHK 2I07A 5GZNC 3V0WL 2F53A 2DWEA 1T22B 5HHOA 4L4VE 3UC0L 2ILLA 4FFWD 1IC4L 5JORA 2J6EH 1V3LA 1CGYA 3OG6B 4UDUA 5EWIH 5F72S 2JLLA 1IGJA 5MENA 1Q0YH 4J1UA 1IM9B 4JFFD 2HVKA 5IV2A 3CDCA 4KTYA 1FZJB 3N06B 1A2YB 3GNMH 4AY0A 4WGWB 1I1AD 1PLGL 2FJGA 2Z31A 5D70L 1CXKA 2UZIL 2BVTA 1EPFA 2IH1A 4KMLB 5F7MC 1JGDB 5GJSH 4MD0B 3STZB 2Y9RT 2BVQB 5I1JH 1A7RL 5F9JB 1TZGH 5A16B 2R0ZL 3LQZA 4XNXL 4JFDB 15C8L 1F3JA 3T0BA 4JY5H 4UU9B 5DLMH 1FFNA 2E7MA 1NC2A 2ICCA 4BSVB 3VA6A 4YNYB 3ARGD 3LEYH 3I6KA 1NANH 5T1MA 1UWXH 5J6HA 4QGYA 2ICWA 1EZVX 5DJ6A 1JUFA 2ZCLL 4L1HA 5EH1A 3ZT5A 5IF0B 1GRWA 2BERA 4M6ML 4RGNC 5KSUB 5DHVH 2X1QA 1Q94B 3SCMC 5E08H 2XOTA 5GIRA 1F3RB 2IGFL 2XG5A 4JFXA 1UWEH 3O0RH 3O9WA 5F7NC 1GGBL 3QUMH 4PJEE 4EUPB 3MUJA 1S5IL 4ODTH 1T1WA 1K8IA 1H3GA 5D7SL 5CD3B 2B0SL 1DQML 1J8HA 1N6VA 3I50L 5DC0A 4GAFB 3TN0A 4OAWB 1CICA 3O11A 4ZQKA 5D72L 3FO2A 1G7PB 1MJJA 3QUYC 2Q8AH 2V5SA 1VFBB 4G7YH 5EWIL 5IJVB 4MYWB 3O45A 3EFDH 4LRIA 1IE5A 1GXEA 3FQUB 4G6MH 3LHPH 5C3LD 3VFVA 3GJFA 5HHMB 3L5IA 4P49A 2R1WA 2NY2C 3QUKA 5CCKH 3GNML 1QRNA 4RGNE 1TDQA 4IMLA 4HKJB 4YPGB 3PWVB 5D1QD 3HI1A 4BSWA 5IFJA 3KGRA 1T04A 2WAHA 2AJVH 1LO4H 4OJFH 5GJSL 5D7IB 2F19H 4OCSH 2A77L 4W68A 2I60H 1UKTA 3QDGB 1J5OL 1TZGL 3TBSA 1HSAA 4PJ8A 1U3HC 4TPRH 1T1XB 1FBIH 4JY5L 4LKXA 3QZWG 4Q0XL 4WJ5B 3VFUA 2XXMB 3CK0H 2VLJD 2X4SB 3VFOB 3I75A 3L3IA 2GTWB 3TP4A 1D6EB 5B3NA 3HN3A 3LEYL 4Y19A 2O26U 3L7EB 4HWBA 4ODWA 1P5VA 5DD3L 1FVEB 2G5RA 1M4KA 4WTZG 1TQBC 2VXQL 4X9BA 2GK0A 2ZUUA 1PG7X 3UBXA 5SV3A 4GAJL 5TDPA 1FNEA 3DVIA 1PY9A 2OQJA 3BESR 3S98A 1H0DA 5BVJA 5EU7E 3HAEB 3CPLA 1UWEL 2EDOA 1WGOA 3QUML 3ZMRA 2XZQH 4HIEA 4ODTL 2VWEC 4LCCB 1I85C 3P4NB 2VZOA 1S9YB 3IFNL 4MS8C 5FYLE 3S4SG 1IQWH 4EI6B 2R2EA 1P84K 5EZJB 1YMME 5CINH 4ODVH 2Q8AL 4MCYB 1RK1B 1YC7A 5D6DA 4G7YL 4HWUA 5CSZB 3EFDL 3WS6C 5IB3A 3KPSA 3D39A 3LHPL 1MCPH 5B22A 1FC2D 1CVSC 4APQA 1Z9MA 3PNWA 2G9HB 3HLAB 5KG9B 5CCKL 4G6JL 4E41A 5EFIA 1XZ0A 1FVCB 3E0GA 4OTXH 4OV5B 2MHAA 3UAJC 4UIMB 4JE4B 4PYHA 3T8XB 2AJVL 2OSLB 5T1LA 4OJFL 5I9QB 2F19L 4OCSL 2D9CA 2I60L 3RGVD 3QIWA 4NQEB 3SEPA 3TEUA 3UJTH 2VLRD 4QT5B 3VFSB 1BIHA 4YGVB 2VWEE 1OGAD 5JIIA 5TE6L 4TPRL 1FBIL 3EYQC 3OKNA 2B1AH 3CK0L 1IGYB 4X5XA 1DQTA 5MEPA 4JPKL 5ALCH 4X9FA 3RBSA 3FFCB 4JR9H 1RZFH 5IBUG 1FGNH 3C8KA 4PRNB 2NX5A 3BEVB 2YD5A 3SOBH 5CP3H 4HFWB 4W4NA 3QPQD 4GW4B 4E0RB 4GXUM 4HIHB 1YMMB 3H3PH 4X7SH 2W9EL 4MJIA 4HIXH 3BT2H 4IRZH 4U3HA 1HKFA 3PP4H 4K7PH 2ITDA 5K9QI 1KUMA 4LEOB 3FQWB 3MLRH 1I9JH 4YFDB 1JHTB 4O02H 4YDKH 2XZQL 2D0FA 4R0LB 5HVFB 2DOCA 2XICA 2ZSVA 4OGXL 4OT1L 5FGCE 2ZUYA 1NCCL 1Z9LA 2PR4H 1I1YA 1IQWL 4PTTB 4R7DA 5HSFA 5CINL 1U0QA 2AKRA 1E28A 3GMMB 3WHE1 3LCYA 1D5MA 5IHUH 1TTGA 5EO9A 1D5BA 4QRPE 4JZOB 1P1ZB 4RMVA 4Y16D 4OBSA 4XWOD 3KLAB 5F7HA 1H5BB 4WWKD 1ITBB 4QRTB 5IW3A 3KPRE 4ZTPH 1G7MA 4HIIA 4I9WD 4P5TC 3U7WH 2JELH 3C6LB 3AAZB 2YD8A 3GMLA 2OL3A 4IHOB 4Z76A 5CEZH 1JIBA 4F15C 2AJZA 4JQXC 2CKBB 3LB6C 2DM4A 4ZSOB 3UPAA 4XCCH 3JV4B 4BJLA 4OI9A 3UJTL 1CFSB 3BE1H 2A9NH 3ABZA 1KN2H 3C5ZB 4EI5D 2AEIT 3LS5L 5ETUB 3PJSA 3HE7D 4LNRA 2XQBL 2B1AL 4X8XA 3WJJC 3ZSSA 2OP4L 3GBNH 3K8LA 5DVKA 4CADB 2F8OA 1VERA 2WM0A 4JR9L 1RZFL 3TFKD 5EB9A 4P4KB 1CFTA 1LO5A 1H3PH 5L6YL 1E4XH 2CK2A 3ULVH 1I7TB 3AU1B 1G7JB 4ONFH 3WLBA 3H3PL 4HIXL 1ZLUH 4K94C 5KJRH 1D5ZA 3PP4L 4K7PL 1YEJH 4DGYH 3OJMB 4HS8H 3HCVA 3MLRL 4GRLA 3HE6D 4O02L 3IRZA 4YDKL 1W8NA 2CIKA 4RWYH 1B90A 4JZJA 3RUGF 4U6VH 5I15H 1NAMA 4XTRD 5GRJH 2PR4L 4PFEA 3RUGE 1MFAH 1J0ZA 5HI3C 1MEXL 4PTUA 3QDMB 1LP9E 1DL7H 4MVBC 3TH4T 1OP5K 1VEMA 1ADQA 3GB7A 2WQRA 5B8CB 1TVDA 4XH2B 1XFPA 3NZ8B 5KVFH 4YH6A 5IHUL 2V5YA 3L3JA 1MELA 3M8OL 2W9LA 4LCUB 4J3WA 4ZTPL 4OKDA 5C0IA 1A02N 4J6RH 4NC2B 2DQEH 2JELL 2NXZD 2AXGB 3HTLX 1P4LA 4E9LA 3W39A 5CEZL 4AEIH 2GYSA 3PGCA 3VI4E 4AT6A 2AJUH 1EO8H 2FWOA 5ERWB 2IAMA 3DO7A 4Z7WA 4PRAA 4JFHD 4HKZB 5C07B 4PJCE 2F54B 4YHKH 2X44D 3FOLA 3U46B 4PJ9A 1KC5H 1D6VH 1FYHB 3O4LE 4U6XB 4TOYL 1N59B 4EKXA 1AXSA 4BH7A 4MNQE 1VHPA 1RURH 5GGQH 3RX7A 5FKPA 3SKOA 3I6LD 2ZJSL 4WFHE 1ZEAH 5T3XH 1U2HA 3KLDA 4QXTA 1CDUA 3KPPA 4I18B 4PV9B 1E4XL 2YD7A 3ULVL 2EH8H 2VDNH 1U8KA 2HT4D 4ONFL 4HWEH 4I3GA 4NQDE 3MOBL 4GQPH 2ICWJ 5KJRL 4DGYL 5F7DA 4KROB 4HS8L 5SWZE 3MRHB 4W70A 1EJ6A 1QFHA 5L7XH 4CN6A 4RWYL 3IDXH 2EXWD 3O2VL 5I15L 4HH9B 1MUJA 1I3RB 3H9HB 1MFAL 2VIRA 4ONHA 4YEFA 5E6ZA 1DL7L 1QBLH 2GIYA 2VLLB 2ZKHL 4MXWH 2EIZB 1MCOL 5KVFL 1R3IH 4J3SA 5GS0C 2ARJA 1A6TB 3RL2A 4AEEA 4Q9QH 3NFSH 4NHUB 3O3BB 4J6RL 4MD4A 4IMKC 2DQEL 1EEZA 3EO1A 3GJEA 5I17B 2FZ3A 1GGUA 2J8HA 3MZTA 4NN7C 3VWJB 4AEIL 1P7KB 2VQTA 4ZYKB 2BSTA 1EO8L 3V5DA 3HMXA 3W82A 4U1SA 1GHFL 5DWUH 4PRPE 5KS9A 1XGUA 4YHKL 2YRLA 1OTSC 4TTDC 1JN6B 1G0YR 3VG0H 1D6VL 2CDFB 4YDLC 3RHWF 1TVHB 2NY5H 3BIKB 1I3UA 4LDOB 3V0VB 4AH2A 4HZLA 2YPKA 1RURL 1U8IA 2BP3A 2JCCB 1T2QH 1ZEAL 2O5YH 2X41A 1RZ8A 2P47B 5ADOH 4QY8B 4JAMB 4QRUA 4NJ9H 5GS2D 1JPTL 3V6FA 3GMPA 5LAXA 3MRJA 3H9ZA 1U8MB 2EH8L 3M17A 3BKJL 1LMKA 3O3AB 4HWEL 1ZT4A 1MREH 4NO0A 5HYFA 3HZVB 4PRDB 2WMPA 3VCLA 5BZDA 4OFVA 3UZVB 4POZD 4XMKH 5E94A 5KVMC 5L7XL 3ARED 3G04A 4WHTB 3FQNA 3BGFC 3KYAA 4DKDC 2EXYD 1S7SA 3ARBC 2NY3B 3TIDA 4Z7OE 1QBLL 2BOBB 5FM5M 4MXWL 1E4WL 2FHCA 1QSFE 2DL9A 4ISVA 5KSAD 1R3IL 2EDLA 1DE4B 1N5YH 3U0TA 3GSWB 4J2XA 3NFSL 2FJFB 3UTSD 3MUHL 1DEEB 1E6OH 5HHNB 4HBQA 4L4TD 4WUUB 3ZE1E 3MLTA 4DAGL 3QXAA 1V7MH 3LEXB 3B9KC 3LOWA 4BSJA 3INUH 2QHRH 5DWUL 3C2AH 4S0TD 2EE9A 4ZXBB 3CC5B 4Y5VB 5HHOD 3H6JA 1AY1H 1P2CA 3NABH 1KFAL 2MKWA 4GH7B 3VG0L 5D4QA 1OQXA 2IANE 2NY5L 2P8MA 3NAAL 5MERB 1CDGA 3NIGF 3RZCC 5IHZA 5MEND 4GRWB 3LKNB 3NIGE 4WO4C 3SDDC 5A3IC 4NJAH 5A43C 4DN4H 4QXUH 2O5YL 2VLKA 2YXFA 3LN4A 2FYYA 3H42H 3WSQH 3HR6A 3QQ3A 3ZDXE 1G7QA 1DLFH 2JIXA 2BHUA 1XR8A 4HDIA 3DVFA 3BQUB 3RU8H 4JHAH 4CNIB 5JA8B 4NJ9L 2Z31D 3V7AG 4CMMA 1KYOJ 4F3FA 5AUMA 5B38A 3H9SB 1MREL 1S9XB 4FQHA 1UG9A 4J12A 3U36A 1ZLUK 2ADJA 3FRPA 4XMKL 1X4XA 5ICYB 3KPNB 4M9OA 3VD5A 1KCUL 1NC2D 3Q3GB 4JANB 3V8OA 2P42B 3PWLA 4I8DA 4MAYB 4NZTH 1XAUA 3LS4L 5CILH 1IEAB 1EFQA 3MRBA 3OXRB 4NCDA 4YDJB 1R3JB 3LMJL 1NFDF 3LKSA 3V4PH 3X13B 5FYKE 1LO2H 4GBXB 5C92A 1NFDE 2AXFA 1N5YL 3TVMA 3CLEH 4PP1C 3D2UA 3RWJA 3GSQA 3AC0A 5JLZB 2YK1H 3Q5YA 3MRKB 3SDXA 4OZHA 1E27B 2V9QA 3L3OB 1JRHL 1E6OL 4HGWB 1RZGA 5LVEA 3O9WD 2HLFD 4F7EA 1V7ML 4H20L 1YEEH 4NT6A 4GRMB 1U8OA 1J8HD 2QHRL 5FB8B 1Q9LB 3FMGH 3C2AL 4KKNA 3TN0D 4R4FL 5FYLH 1CICD 1L4IA 4WW2C 1AY1L 3NABL 1MH5B 2YMXH 43C9A 5E8EB 3F7YB 5JDSA 1YEGH 5MEQB 1KPUA 3F5WA 2FB4H 5E99L 2ICES 1NEZA 4FQJH 3LKRA 1DN0B 1A47A 4JFEB 1NBQA 5IVZB 1N6QH 4NJAL 4JO1H 5DF0A 4XWGH 4G8GE 2WBJB 4X4YB 4DN4L 2BNRB 1WEJH 2PCPB 3H42L 4CW1B 1DLFL 1QRND 5ICZB 2PYFA 2MTPA 5SWQB 4HX1B 1H3XA 3UTQA 5IIEB 3K2MC 2FR4A 2VZ3A 3V7MA 4UBDD 1HYRC 4OBRA 2BNQE 1DQLL 5IFAL 3P2TA 2VQ1A 2QKIB 2H3NA 4FQLL 4NQXB 2W60A 5DT1H 3FKUS 1PX4A 5BV7B 3VXNA 3CX5J 4WW2F 2NW2B 4UOW1 2OTPA 2Q3AA 5TF0A 1A4KB 3FO0H 4I2XB 3MRDA 1CG9B 1P7QA 3ARXA 4ZDHB 2I24N 3DX8A 1MLCA 3QIBC 4Y19D 4X6DB 5C0BB 2HG5B 4P46A 5JHLL 3DYOA 4P9MH 4DWHA 2ICEA 1MWAH 2QR0A 4RNRA 1LO2L 4PJFA 5F21B 2VDQH 1LQSR 3HRZA 2OJZL 3CLEL 4NN5B 3SBWC 3IXTA 1ND0A 3CVHB 5BJTB 1AHWA 1CU4H 3B6SA 4LDEB 1J1XL 4LSTL 2YD3A 3EYOB 4LCIL 5HGGS 4Z77B 3KJ6L 3KG5A 4I0KA 3DNKA 3DROA 5E4IA 5CD5D 3VXUA 3ROOB 1YQ2A 2YUWA 1L0YA 5I75C 4YC2C 5FYLL 2ENYA 5CGYC 5IVXB 4ZFOB 1RMFH 2YMXL 1AKJB 5C9JB 1R24A 2J5LC 4KRPC 4C56E 4ELMA 2KQMA 3AY4C 1YEGL 4A2LA 4KJYA 2YUXA 2YZ1A 3RKDC 2HT3C 3A6CH 1N7MH 2ZPKL 5HYJE 4U1MA 3EYUH 3KPSD 4M6NH 3D39D 1UM4H 1P4BL 1IKNC 5C8JA 4APQD 1U8HA 3LN5B 2R39A 3IJYA 2VABB 4UQ2A 3OXSA 1WEJL 1OAUL 3CFCH 3VRIB 1OM3H 4E41D 2VN4A 4HJJH 3VXSB 4L3EA 2VSCA 3T0VA 4P5KA 1N3NA 3S97C 3CCHA 2EIBA 3F65A 1S7WB 3V6OC 12E8H 4KWUA 3QIWD 3WL9A 1KXQE 5ALBH 5D2LF 3VDAA 5IG7A 1KENL 4XCNA 2VXTH 2DJ4A 4JRYA 4WNQA 1W0YT 5ENWB 4Y5YA 3O6MH 4TUKH 2R1YB 1E0OB 3GBLA 4AENB 4HKBA 1JGLH 4I1NB 1Y6NR 4UNTA 4E42B 4LLDA 5E8PA 1C08A 4MA1B 3RX8A 2NX5D 3QXWA 1YYMH 4DKFH 4ODUA 4WV1C 2HRPL 5C08B 1WITA 3QWRA 3EGSA 1T22A 4MJID 5I0ZA 4K3JH 3W9DB 5GS1B 3O2DH 5KVEH 3O8XA 1KTRL 4N5ED 4M1GH 1WISA 1CFBA 3OB0H 3V6OE 4AG4H 4NM4L 3MJ6A 5DZNA 1IM9A 4NZRH 1DVFB 2NZIA 1RMFL 3QUZA 4WI4A 1FZJA 3FN9A 1A2YA 1NFKA 2W0FB 4MD5B 3BZFB 3A6CL 1T5WB 1V3JA 5HYSB 1N7ML 4KVCH 1F58H 2RBLA 1C1EH 3QCTH 4M6NL 1JGDA 4R4BB 4MD0A 3ZYIA 1U92B 2BVQA 3CFCL 1A1NB 1T89C 1OM3L 2MJWA 4HJJL 4JFDA 5DHYB 1I7UB 1R3HB 4XAKE 4UU9A 4K94H 4BSVA 1HH9B 3UYRH 2G2RB 5GRVK 3A0OA 4MQ7B 2R29H 2R4RH 4QNPF 3QFJD 2XTJD 1QYGH 2VXTL 3WMSA 1MCJA 4M93B 1GVIA 5IF0A 4TUKL 2Y25A 5KSUA 1NBZB 1Q94A 3VXRB 1JGLL 3MNZB 4LQFH 1EEYB 3LSOB 1HHKA 1K3ZA 4ETQA 3RDTC 4AYFA 4HLZG 5DRWA 3GMOB 1A7BA 2EECA 4EUPA 1YYML 2AEWA 4WHYH 5CD3A 3RZWA 4LHJB 5LQBH 1QLFA 2X1WL 3REWB 4OAWA 1AGEB 5ELIA 4HJ0C 1IKFH 4YUEL 5CBEB 4K3JL 1G7PA 3FB5B 3O2DL 5KVEL 3LVEA 1VFBA 3T0EB 5BRZE 4GRLD 3ELAT 4PJXB 4AG4L 3V5KB 3CU1A 3FQUA 3WUWG 5MP6H 3TF7C 2DAVA 3ULUD 2SEBB 1KPVB 3CFJB 1OAXH 4NZRL 1ZA3B 1NUDA 1WT5C 2JJTA 1FYTB 1VEOA 4KRMB 3FAXA 4YPGA 3WNLA 3PWVA 4PGBB 1F58L 4H0HB 5IBLC 3VWKC 3DLQR 1C1EL 3QCTL 3LRSB 4FFYH 2X09A 5D7IA 2XRAH 3QDGA 2UWEF 4HJGB 2ZUWA 2UWEE 3MBXH 1YEKH 1T1XA 1A6AB 1L0QA 4WJ5A 1LE9B 3R8QA 2X4SA 1JZ8A 1CLYH 2IAMD 3VFOA 5KSBF 1CGXA 1JYVA 2GTWA 3FOMB 1A21A 4UILH 3QG6B 5KSBE 1WBYB 3EDDA 3UYRL 3L7EA 5IQ7H 5DMIL 4PJ9D 2FH8A 5C6WH 1RZJL 1FVEA 3UJJH 5L8KB 3GMNA 3NACH 3ZDZF 3KXFE 3A6BH 1P9MA 3ZDZE 4RMRA 1IAIH 1S7RA 4GKZB 4XP6H 1HZHH 3OL2A 4LQFL 4NNXB 5F8QC 4AL8L 2W0PA 4MXQD 2JJSA 1ORQB 3HAEA 3QEQE 2BVPB 2YD9A 4KKCD 2XV6B 1J86A 4YHYB 5F97E 4LCCA 3P4NA 3TJHC 3KJ4C 1BJMA 4RIRB 4CU7A 4JKPH 4QTHB 2Q87A 1FCCA 1RZIB 4EI6A 5H94B 1IKFL 5J1SC 4LQ1A 4LVHC 1RK1A 1EEUA 5DVNA 2BJMH 2FRGP 5CSZA 2FBOJ 5M95B 1T7WA 5INDB 4I4WB 4PJIE 2VLMD 5B39B 3W5MA 3CMOL 4AQ1B 3AM8C 1OWWA 3ULSB 3HLAA 2C3GA 5HBBA 1I7RB 1WZLA 4FHBD 1VCAA 1FVCA 3U4EB 4OV5A 4X80H 3KHOA 4KI1A 4UIMA 3W11C 1RJLB 3TNMB 4YX2H 1VFAB 4PGZA 3T8XA 5T33H 2OSLA 4TVPD 3SDAC 2R2HB 3ZKXB 2ENSA 3WXVH 4NQEA 2XN9E 1V5JA 4LLYB 2AS5M 2YWZA 3VFSA 4YGVA 4R2GC 1QA9B 4PD4J 1YEKL 1KXVC 4MLSA 5E4EC 5GGVL 4ETYA 5HHVL 1IGYA 1C5BL 3H7BB 3S36X 1YN7A 2EEDA 4M43H 4RGMB 4UILL 4K71B 3FFCA 2UZXB 3JZ7A 4J3UA 1F11B 4R97C 5D1XB 4YHOH 3UJJL 4PRNA 1K9TA 3BEVA 4JM4L 1LDSA 2IH3B 3SKUD 3S3JA 4HFWA 1CLOH 4GW4A 4XP6L 4E0RA 4HIHA 2IALB 3KLSA 1YMMA 2ZUSA 3TCLB 4QTIH 2PW2B 4LEOA 1N64L 1A1OB 1ZHBB 3FQWA 5IMOB 4KMTH 1BHGA 1HOCB 1OWRM 1BWMA 2IPUG 1AJ7H 3MNWB 4R0LA 3DX6B 3WHE0 3ZYJA 1GGIL 4G6KH 1ACZA 1I4FB 5FDWB 5IT2H 4PJ7E 4PTTA 3KS0J 5EA0H 3IT8D 2DIBA 1KEMH 4NO0D 5DJDB 5JXAL 4V1DE 3IDYB 3RFZC 3GMMA 1F02I 5ANMB 1EXUB 1WC7B 4Z7VE 1FV1B 3VGHA 4N90E 1CLCA 1P1ZA 3IGAB 1NH6A 3UTTE 4ENEC 3KLAA 1H5BA 4QRTA 2BCKB 1WTGT 3TPKA 5GS3A 3C6LA 1A0QH 2OLDA 3OAYH 4XRCA 4IHOA 2LFGA 4QOKB 4YFLI 2CKBA 5FYKH 1B9ZA 2J4WL 3FONB 4B7IA 1FZMB 1MI5E 3JV4A 2NY6D 4UT6H 4C83B 3WXVL 5J9PB 4IRJB 1CFSA 1YY9D 4GS7B 2VOTA 1G7LB 3C5ZA 1JNJA 4AIZB 2CDGA 3UX9B 2BHZA 4U3CA 5ETUA 1FH5H 2D31B 3DMMB 5DGQA 2AV7B 3ARYA 3FQXB 4Y4HC 5HGDA 4WTXA 3M45A 2VJXA 4KUZH 4CADA 3D25B 5HTSA 4LLVB 4HF5H 3UBXG 5ISZB 1MHHB 2AV1A 4P4KA 4YHOL 1S7QB 3CAFA 1TJGH 5EN2B 1OARH 4LVEA 4P2RE 3DJ9A 1LWRA 4NKIL 1CLOL 5HD8C 4UTAH 3K74B 3AU1A 4WFFD 1G7JA 4JRXB 3AS3A 2LABA 4LHUB 4QTIL 1CT8A 2V2XB 2VLKD 3MZGB 1C16B 1UJ3B 2JIXD 6FABH 3EYFB 1A9BB 4L3AA 3RX5A 1AJ7L 3IB4A 2VNCA 3EJZC 4RAHA 3NCJH 4MX7B 5IT2L 2NY1C 3BSZH 4RFNB 3QDMA 4HUXB 3S35H 2C4FU 1KEML 1RQ5A 5B8CA 1C5CH 3DGGB 4XH2A 3NZ8A 4DW2H 1PGRB 2R9HD 2APWA 3H7LA 1AD9B 1NCBH 1NSNL 4XPHL 2AXGA 1GYAA 3ZDYF 3CGTA 3MXVH 4Z5RA 3LPFA 1E4JA 5FYKL 5BV7L 4PJAE 4XP5H 3TVMD 5TQ2L 5ERWA 3D2UD 2E9BA 2AXHA 2MQ3A 5C07A 4UT6L 2EDEA 1IL1B 2F54A 3I02B 3U46A 3ARGC 4OLWH 4U6XA 5L0QC 4GJTB 1N59A 4AEFA 1OAYH 1NCTA 2XWJB 3WN5B 2WWMD 1J0KA 3DTXB 4KUZL 4JB9L 4JFFE 4XI5D 4L3CA 3SKMB 4JM2C 4MCZA 2Y07H 3CVHL 4L8CB 3SCMB 1HQRB 1HHHB 1SY6H 1TJGL 1BBJB 4I18A 3V5HB 4PV9A 1S3KH 2AGJL 1SJEB 1CE6B 1KPRB 5FDYA 2IQAB 3E6FB 3WFBL 4HHAB 1HWGB 3RHWK 3Q5TA 4JO3L 1T2JA 5T1KB 4DUXA 3MRHA 2DQGH 6FABL 8FABB 3MRLB 3V2AR 1KIUA 3C60C 1KJ2H 2RAMA 2Z91B 4HH9A 3C6SB 1ZANL 1I3RA 3H9HA 3BSZL 1WZ1H 1UACL 3S35L 3KYMB 1ZT1B 3B4NA 2VLLA 4HBCH 2QQNH 3P4OB 2NY2B 2EIZA 4JM2F 5EOQL 1A6TA 4M6OH 4L8SC 4KXZI 3I2CH 3RVWD 3O3EB 1P7QD 5D1QC 4NHUA 1OD9A 2CPCA 1N5AB 3O3BA 1S9KC 5LKNA 1WICA 5FIEA 5I17A 3ARRA 4P46D 4DN3L 4MNQA 1M1SA 4PRHB 3RY5A 1IAOB 1P7KA 3MYJB 4ZYKA 3QYCA 3VH8A 1VACB 1BQHB 2PUQT 4TSAH 2ZWLT 2VDKH 2W92A 4U33A 2VKXA 5F71A 2AVGA 2VDML 4M7LT 5FGRA 4L8BB 2VXVH 1JN6A 2YOCA 2CDFA 1OCWH 1VADB 4GG6F 1TVHA 1X5FA 4OLWL 4U1IB 1PX3A 1Q1JH 1YEHH 5ECJE 1BVKB 4F9LC 2W0KA 4D2NA 4PGEB 1OAYL 3V0VA 3VXUD 2MOVA 2HYMA 5E7FA 1HHJB 1TQBB 3BO8B 5F6HJ 4X6CF 3DECA 3JWDL 2Y07L 4QY8A 4JAMA 4HAFA 1SY6L 4WU5B 1DN2A 1E4KA 2G75B 2ATKB 1CTNA 1S3KL 4HT1H 1U8MA 5ADPH 1YJDC 3NH7H 1TTUA 3O3AA 4PJBF 4XVUC 5CSGA 3QIUB 2DQGL 4PRDA 4JDZB 4LSDA 2KQNA 2Z8RA 5DMGD 1H15B 2VLJE 4WHTA 1KJ2L 4U1GB 1LEIA 1J9CT 2ZUXA 1QNZH 1NGQH 4OFYA 2Z92B 4NBXB 5C09B 3WFHB 5I18H 1WZ1L 2GT9B 3HNSH 2BOBA 3H3KA 4LPUA 4HBCL 4YR6B 2J8OA 4OCYH 4LGRB 4JRYD 5IWLA 1X6LA 3IU4H 1DE4A 5FECA 4M6OL 5JIPA 5HGHB 2FJFA 1KB5H 2WUCH 4Z0BH 1K3IA 2KH2B 1CDHA 3NN8B 1DEEA 5HHNA 5J4MA 1A5FL 1ZVSB 3B5HA 2Z35B 5FXCH 4Q58C 4WUUA 3RGVC 4W81A 3LZFH 2VN7A 2HH0H 2N1KA 1SJHB 3LEXA 4XGZB 4TSAL 3OAYK 3H0TB 4FRWA 4X99B 5ID0B 3QWRD 3GSXB 4ZXBA 1QACA 4Y5VA 3ZZ1A 2D7MA 1RSFA 2VXVL 3D85A 4HK3N 2BZDA 3BIAX 5IROC 2OTWB 2XZCH 4BFIB 5MERA 3RVUD 2DMKA 3HS0B 1Q9KA 4NKMB 3LKNA 5DA4A 2V17H 3T1WA 1IM9D 2ADGA 4MB3A 2H6PB 3Q6GH 4MWFB 4D3CL 4P2CG 5C0GB 3BFOA 4QLRA 2WP3T 3BQUA 4R26H 4XPFH 4CNIA 2JE8A 1ORSB 3QJFB 1LGVA 3RWDB 2VDPL 3WE6B 4HT1L 2QQLH 4XCFL 2Q7NA 4U2ZA 1YEDB 3VGGA 3NH7L 4WW1B 2R2CA 1FO0H 3H9SA 4XXCA 1S9XA 5B4MD 4CAGA 1OGAE 1A3LL 4ONGH 3BDYH 1BQLH 5BZWB 4JFDD 1CFNB 1TETL 2JTDA 3HC3H 3WO4B 5ICYA 3KPNA 3Q3GA 4JANA 3TIEB 4MAYA 4Y16C 1JHLH 2GAZB 4XWOC 5HVHB 2NYYD 4PG9B 3OXRA 3QNZB 4YDJA 1R3JA 1F4WH 1UYWH 4OCYL 4P5TB 4GBXA 1WWAX 3WS3A 4F15B 4JREB 5EIVA 1KB5L 2D3VA 2WUCL 4Z0BL 5JLZA 3MRKA 4S1RL 1E27A 5SV4A 2Z9TA 4P3CL 3L3OA 1N6UA 3U82B 4HGWA 3HR5B 1N0XH 2D7TH 3MLYL 5TF1H 3SE9L 4U05A 3LZFL 3KPMB 2HH0L 4GRMA 4EI5C 5FB8A 3HE7C 3WFCH 4OF7A 2H32H 2YN5A 1MH5A 3TH3T 2D4FA 5E8EA 3F7YA 5MEQA 2H26B 1UB6B 2L0DA 2XZCL 3N0PB 4N8CL 4O2EB 2Y72A 4ZFZA 2AJ3B 3BEWB 5DD5H 1DN0A 3F6LA 2AABL 2V17L 5IVZA 3BYTA 4LRNL 3IFOB 1J88A 1IC1A 5HHMD 3Q6GL 4JJ5B 2WBJA 4X4YA 2BNRA 2WWKT 2PCPA 2XA8H 3TO4C 5BOZG 4CW1A 3VGEA 4LLQB 5ICZA 4R26L 4XPFL 4HX1A 5IKCA 4DJMA 5DZLA 2C3VB 5IIEA 2FCBA 5I2IB 1LO0L 2QQLL 3MLVH 2EE3A 4GQ9L 2QKIA 3MJ7B 4IOSD 1FO0L 4RDQG 3QDGD 5DVLA 4XTRC 3RIAF 3WJLA 1KSRA 1A6ZB 4ONGL 3BDYL 2NW2A 4ZNEE 3UPCA 1NUFA 1S8DB 2ORBH 2VAAB 1A4KA 5DMKB 4I2XA 1CGWA 1CG9A 1ZT7B 4ZDHA 2PF6A 3LD8B 1UZ6F 4X6DA 4B50A 1BJ1J 5C0BA 5C0AB 2HG5A 2E3VA 1GAFH 4D8PA 1F4WL 1UYWL 3Q48A 1G9NH 1RHHB 1F00I 3V4VH 1MJUH 1IZKA 1GGTA 4HXAL 1BZQK 4NWUH 3CVHA 5BJTA 1MCWW 1JZ4A 3S96B 2DJUA 2IFGA 1N0XL 3EYOA 4Z77A 3BRGC 4P23C 5TE7L 1KJVB 1NCDH 3ROOA 4O9HH 4KY1L 3WFCL 4K3DH 4ZFOA 1AKJA 3K4DA 5C9JA 3MFFB 2B7DT 1OP3K 3HG1B 4OIIH 4U7SA 5AEAA 3CH1B 1G9MC 4MHHI 1I1FB 5DD5L 1YY8B 2CLRB 4GW1B 2GITB 4ALAH 3LN5A 2MPAH 2VABA 3B83A 2WQ8A 3GI8H 5L9DH 3VRIA 2HT4C 3O6FB 1N8ZA 4R7NB 3ZKMC 2AJXL 3VXSA 3QISA 2MQ0A 5D93C 3DX7A 1FL3B 1IC7H 4Q6IB 1UH3A 5DA0B 3D3VB 1IILE 5J12C 3FRPG 3MLVL 5KOMC 1WF5A 4JFHE 4NSKB 4Q2ZB 3HNTH 4F80A 4MB4A 4NQED 1S78D 3DBXA 1AGDB 3VRLE 4HUMB 5CZVH 1FNSH 3FT3B 2NY4C 1EIBA 5ENWA 4YBQD 2ORBL 4R96B 2R1YA 4KH2A 4AENA 3I6LE 1EO7A 4E42A 2DBLH 3WFDH 3FFCD 4KI5D 1KOAA 1OT1A 3GIVB 2JJVA 1B0GB 5FGBA 1GAFL 3PWPB 3DXAB 3M1BB 3GI9L 2W91A 3G6JE 1G9NL 3V4VL 3D0LA 4JKKA 4NN7B 5C08A 5KANI 4NWUL 5F93C 1YMMD 1Z0NA 3OV6A 1Z3GH 3V52H 1FN4B 3W9DA 5J89A 2RHEA 5GS1A 2OR8A 3MRQB 2ZCHH 4N0YL 1RIUH 3EJJX 4O9HL 3SGDI 4ZMAT 1NEZG 4XP1H 2APVA 5CS7A 1WIOA 1DVFA 3FCTB 4K3DL 5EUKB 1XGYH 1GC1C 1U3JA 2W0FA 4OB5H 4MD5A 3BZFA 4OIIL 4PV8B 3H2WA 3TA3B 5HYSA 1T5WA 4I0PC 4R3SB 4OZGF 2XA3A 1A7NL 3QRGL 4XPBL 4YWGH 1FPTL 4R4BA 4UIKH 1U92A 4ALAL 1RHFA 2BY2A 4OCMC 2MPAL 1DCLA 1J1PL 3GI8L 3C6LD 5L9DL 1A1NA 4LVOC 4JN2B 4UT7L 3MGOB 3Q1SH 1C5DB 5DHYA 1I7UA 1R3HA 1KTLA 2XZZA 5I6XC 4QRQB 3AREC 3HNTL 1HH9A 5IUSA 2YKLL 1CE1H 5CP7B 1MF2H 2NY7H 2N7AA 2G2RA 3BGFB 2BY0A 4MQ7A 2BC4B 3C5ZD 4WI9A 1LILA 3FB8B 4HS3B 4BELD 1KEGH 1TNNA 1JGEA 2VSDA 1NBZA 4RAUB 1QHPA 4LASL 3VXRA 1DSFL 2DBLL 3MNZA 3WFDL 1IFHL 1EEYA 3LSOA 4P4KD 3RVXD 5D9SB 3OKEB 1JGUL 5IHLB 5ITFB 1RUQH 2YRZA 4YAQB 3N1PC 2CIIB 5LBSL 5ACLA 1AGEA 3CZJA 1Z3GL 3V52L 5CBEA 3FB5A 4KQ3H 1ETZB 3QNYA 1KCRH 1R3KB 3T0EA 1GIGH 3S37H 1NL0H 3TH2T 4PJXA 2VRAA 3V5KA 5GRVL 2ZOLB 1RIUL 3HA0A 5HI5C 1KPVA 3CFJA 1Z6JT 1ZA3A 3RZCB 2XWBB 3QDMD 5T3ZD 3SDDB 1XGYL 2HFEB 1FYTA 5E1AB 1AGCB 2PN5A 2B2XH 4WU7B 1L6XA 1TJIH 4PGBA 5DUML 1EHAA 3TZVB 4S1QH 4CDGC 5FOBB 3HUJF 1F42A 2CK0L 1RY7B 3LRSA 4YWGL 1H3VA 1A6UH 3UTSE 4Q9BA 5JW5B 4KDTA 5EZIH 4HWZB 1A6VH 1QFWI 2ZNWA 2AXJA 35C8H 4HJGA 3ZYZA 1F6FB 1UWGH 2P8PB 4LVNB 4NNPH 1DFBL 3Q1SL 1CQYA 1A6AA 3RRQA 3VXPB 4ORZC 1LE9A 2BFVH 2COQA 1KT2B 1TZIB 3FOMA 5HHOE 2FATH 3FZUD 3QG6A 4UQ3A 5C07D 2F54D 5TH2B 1WBYA 1CE1L 1MF2L 3GRWA 1T66C 1JWUB 4RFOH 4WVRA 2BSRB 4CN4A 4NQCB 4X7FC 2FHBA 5F9OL 4BYHA 5MENE 4S2SB 4N0UB 2BVOB 1X5GA 2DMCA 2LU7A 1HXMB 2EE6A 4YZFF 5HDBE 4EQ2A 2Y1VA 4NNXA 2NZ9C 4YZFE 5IB5B 2EDWA 1ORQA 3QO1B 1CFQB 1W8OA 3OHXB 1M7IA 2BVPA 3EZJB 3MLXL 3TWCH 2DM7A 3EJYC 4JQVA 3O9WC 2HLFC 4RIRA 3BN9C 4WCYH 1RZIA 2KPNA 5H94A 4MZ2A 1XIWB 3QULB 1MQKL 3S5LG 1M7DB 3TN0C 4FMKA 4KROD 2B4CL 1CICC 4KQ3L 2XZAH 1KCRL 3HRPA 3NFNA 2JB5L 2HN7B 4UOJA 3S37L 2W1NA 1NL0L 4P3WA 4G80B 3WDIA 3CLFH 5INDA 3N1QC 4I4WA 5BW7A 5B39A 2WP3O 5CJOL 4EBQH 1PEZA 1CK0H 1W72B 4JY4B 2DKUA 4X6FB 1I7RA 4Z78A 3U4EA 1O7VA 1RJLA 3TNMA 1TJIL 5FO7B 3QPXL 2XY2A 3CFKA 4RZCB 4YHNB 1F90H 2R2HA 4O58L 4OM1H 5GISL 4NKOA 4UBDC 2CJUH 4LLYA 2UYLB 35C8L 3ZTNH 1QA9A 1UWGL 3BH9B 2X5PA 4NNPL 3QHTC 5DUBB 3BH8B 1YQVH 4PJ8C 2BFVL 4LIQE 4ORGB 4X7EC 1J8HE 1OPGL 5CEYB 3V6ZB 4W4OA 1DUYA 4IRSB 5FHBH 2CDEB 3U2SB 3LH2L 1I3VA 2OR7A 1F11A 5D1XA 2DS4A 3QIBB 4NRZB 4RFOL 2IH3A 3VGFA 3KWWB 4EUPG 1KLUA 4ZFFA 5CJQH 5HGBB 2IALA 4YHMH 3TCLA 2PW2A 1URLA 4QYOB 1QRNE 4FQPA 2HMID 2DQDH 1A1OA 1ZHBA 3GEWB 2D7QA 2V2WA 4EDWH 4XNYH 3TWCL 5HPOA 3MNWA 3GSNB 3DX6A 5J1AA 4KJWD 4LPYA 4M7ZC 4N8VB 5FDWA 4X8JB 5CD5C 4RMWA 2K9UA 3JTTB 1KCKA 4PJHF 5LGHH 5BXFB 5DJDA 5HHPA 5D2LB 3T0AA 4YC2B 5ANMA 1A7PH 1EXUA 2XZAL 1FV1A 4KRPB 4A6YH 3IGAA 1P7HL 5D6DC 5J3HC 2BCKA 4EBQL 1UM5H 4OFYD 4Y19E 2Y7QA 5EUOB 2YZ8A 2ID5A 4APQC 1CR9H 3DOSA 4OZIE 5K9KB 1A14H 2X7LB 4N9GA 4FABH 3N50A 3PP3H 4GXVL 3FONA 1FZMA 1XCTB 1F90L 3L3DB 4OM1L 1VA9A 4QWWD 1V7NH 5HI4C 3CDGB 4DKAA 4C83A 5J9PA 3HMWH 4IRJA 3MUZ1 3KYNB 1G7LA 1NC4A 3ZTNL 1ZGLM 1XF3B 4AIZA 5I16A 4WUUD 3QIWC 2JK5B 2X2YA 2D31A 1YQVL 3DMMA 2AV7A 2RCSH 1EGJH 4WRLA 4LDLB 3FQXA 4HEME 4KAQL 5GQBA 4ZXBD 3D25A 4NHCH 4LLVA 3BW9B 5FHBL 3J7HA 5ISZA 5LCVH 4UAOC 1H9VA 1S7QA 5EN2A 3HAEG 4Y4FC 4FFVC 1F2XK 3WIIH 5MI0C 3VXOB 1RUKH 3D39E 3LV3B 5CJQL 1NDMB 3GUTB 4JRXA 4WV1B 4RQQB 4YHML 3U0WH 4OCNC 4ZS7H 4LHUA 1AR1D 2GJ6B 2OCFD 3QWQB 2MCG1 1C16A 3L3KB 1UJ3A 4E41E 4W6WB 2DQDL 1J10A 1INDL 3BQUD 3EYFA 1A9BA 2D0HA 1VEPA 2Y23A 4PLKC 3UTTA 4HPOL 4D94A 1A3QA 1PZ5B 2CUIA 4MX7A 2Q86B 1KIRB 3T08A 2C4FT 2DD8H 4PB9H 5EBWB 2CO6B 4IS6B 4OCRL 2XYCA 1A1MB 3H9SD 3L6FA 3OR7B 4S1DD 5LGHL 4OLZL 3DGGA 4F8TA 3CXDL 1VFUA 3PIQB 1O5DT 2MCPH 4A6YL 1BX2B 4FXGB 2QADC 3HPLB 4JFPB 1AD9A 1ULVA 5DRXB 3QXUA 4MAYD 1ZXQA 3OKDB 3ME0A 3C5SB 3T65B 1UT9A 3P9WB 1DUZB 3PHQA 1B4RA 2X4RA 3CSYA 2NX5E 1A14L 4GBXD 3X11B 4FABL 3OGOE 2R1XB 1V7NL 4KHTL 1HDMB 4MJIE 4AK1A 1IL1A 3I02A 3HMWL 5B21A 3OAZK 4P2RA 4P4RB 2QEJA 2A0LD 1RFDL 3AXLB 3R1GH 3GSVB 2RCSL 1EGJL 2XTJC 2XWJA 3WN5A 3DTXA 4U7KA 1OLLA 3UZQA 4DOHB 2J12B 3SKMA 5C71A 2GJJA 4NHCL 3QZWB 5LWYL 2E9WA 4L8CA 3SCMA 3IETB 1HQRA 1PG7H 1HHHA 3K7UA 3SQOH 1BBJA 3VGBA 3V5HA 1CN4A 3JTSB 1Q0XH 1T7VA 1KJMB 3RDTB 3WIIL 1EMTL 1SJEA 5F7LB 1RUKL 5I66B 3RAJH 1CE6A 4JFED 1KPRA 5E1HB 3PGFL 2IQAA 3E6FA 3U0WL 5DJAB 4HHAA 1EAJA 2WBJD 5CHNB 2BNRD 5T1KA 3OKMB 2FECI 8FABA 3MRLA 4CKVX 5DDHB 2N56A 3WIFB 1QVOB 5CIPH 4BH8B 2Z91A 2AI0H 3C6SA 3T2QA 2DD8L 4PB9L 1A7OH 5A40E 2E7CA 3KYMA 4JZJC 1ZT1A 3ULUC 1D9KB 5DFTA 3P4OA 3QFJE 2XTJE 3S4SB 3WCYA 2FL5B 2MCPL 3L5XH 4B5EA 4OF5A 3TBWB 2Q3ZA 4HFUL 2AQ2A 3O3EA 1N5AA 5L8JB 4ZUSB 3MBEC 3VWKB