4M5YH

Crystal structure of broadly neutralizing fab 5j8
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
224
structure length
217
Chain Sequence
EVQLVESGPGLVKPSDILSLTCAVSGYSISSNYYWGWIRQPPGKGLEWIGSIYHSGSTYYKPSLESRLGISVDTSKNQFSLKLSFVSAADTAVYYCARHVRSGYPDTAYYFDKWGQGTLVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 5J8 heavy chain
publication title Antibody Recognition of the Pandemic H1N1 Influenza Virus Hemagglutinin Receptor Binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 217
sequence length 224
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5yH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m5yH01
1CFTB 2EIZA 2EIDA 4UIMA 3REWB 1CGVA 1LO5A 3WEXB 4Y8DC 2V17L 1CLOL 3NCBB 5JHLH 4L8DB 1CZ8H 4H88L 4QRSB 1VEOA 4UAOB 2DMKA 3O2VL 3RZWA 2L0DA 4NQDD 4JEGB 4R2GD 5GGRA 4FQQA 1OAQH 2EYRB 4FZEL 5HGDB 3WLWD 4OQTH 5INCB 5D96C 3VW3H 4K9EC 3U7WH 4PGDB 3WNPA 3I3BA 3INUL 1JF1A 3RZCA 5DJCA 2NX5E 1N2RA 4PJBA 1KULA 3MV9B 5JDSA 2G5BA 5F96L 1AJ7H 1OL0A 1PZ5B 2JIXD 4M7KL 4JE4B 3UC0L 3VFNA 2NZ9D 3T0EE 1CFQA 2P8LB 2YOCA 4LQ1A 4Y16B 4Y5XA 5A2LH 4DW2H 1YEKL 4QRRB 3VGFA 4KZDL 4ONHA 3L6FB 5DUPL 5KZCB 1AKJA 3P4MA 3CFJA 3WFCH 3MRMA 1RZKC 3IB4A 3TBTA 2P7TB 5GSVA 3TV3L 2AV7A 1OSZA 5GJTH 1EMTL 4JLRA 1A4KB 4DAGH 5KS9B 3JWDC 2W0PA 2LV4A 4RDQG 1BD2E 1T21A 2IF7A 4BM7A 3NIGE 4ZXBD 2VC2H 2XICA 1T0NA 3ZMRA 2CDEA 2V7HB 4N9GB 3B4NA 5T3XE 1NUFA 4KMLB 1FJ1A 5GGQH 3ZT6A 4X6BA 1XCQA 4OLXL 5FYKU 3ULUL 4AYFA 2PW2A 4LU5H 3G04B 3C2AL 1I1YA 3WIHA 5IEKA 4GXVL 1IQWH 3MRNB 4Z9KB 1S5HA 3RNQA 2VWEE 2BFVH 4JN2B 2C5DC 3ECBB 1TITA 3L7EB 1YMHA 1FH5L 2OR9H 1M4KA 2CLZB 4S1SH 5E8PB 1W72L 3D6GA 1NUDA 3RA7H 3QWRD 5I76B 3MJ9L 3TC9A 1QZ1A 1XGPA 2X1OA 4WV1C 4ZFZA 43C9A 3BE1H 2O5YH 2P48B 4KVNH 1IEHA 4WI3A 4YK4C 1OP3H 3GSWA 4YX2H 4PRHD 3SOBH 1Z9SA 2YS4A 4KROD 3QT2A 4AEFA 5ADPH 1EEYB 2I07A 2F8VA 5D7LE 5E8EA 2OX5A 3SDYH 4OLUH 3WJJA 4FQXC 3FO0H 3O3AB 3VFTB 3TYFB 1LD9B 5MEPA 1EA9C 2APVA 2APTA 3QNXA 3M8OL 5GS3A 3QI9C 5K9KB 3B83A 5C9JA 3OAYH 1U8NA 4L1HA 1UQSA 1ZWIA 4ORGB 4O2FA 4JB9H 4UIKH 1MJ8L 4KAQH 3RBGA 4W81A 4X7CC 2OTUB 3OKNB 4IMKA 4R0LB 2J8UF 3UYRH 5KAQF 1K8DA 4PGJA 4BH8A 1UYWH 1QSEB 3JWNC 1B0WA 1CT8A 4HV8A 3RU8H 3DX9B 1P5VA 2JCCF 2X7LA 5AG8A 2WINB 3OJDA 1PKOA 1NAML 4RCAA 2VLJA 3U79A 4M6ML 2R2HB 5FUOL 1LE5A 2FX9H 3PGDA 4I3GA 4RQQA 2AEIT 5D7IE 5I30H 2DICA 4YAQA 1W8OA 1A6WL 2FD6L 2NR6C 2J6EL 4BA8A 3ZYZA 1Q9KB 1UZ6E 1OB1A 4GLRH 4LOUD 3D9AL 5AUMB 3ARED 3BD3A 3TN0B 4AY0A 4BQ9A 2B8OT 2ZUUA 2GUOB 2XFXB 3GNML 3CSYA 1N5YH 1J1OL 3C5JA 2G75A 1Z9OA 1IGYA 3GI8H 1SYVB 5F7FA 3X14A 1MCCA 1A6PA 3C60B 1HH6B 1J1XL 3L3IA 4RWYH 1CFVL 3H7BA 4CVUA 3ARFB 2Q1EA 3PWNA 4U6YB 2EDBA 1F02I 1ZXQA 1Y6NR 5F1SA 5DD0H 4EXKA 4IIQA 2X05A 3T2PA 1QBMH 3T3PE 1ZGLM 1JPTH 3FOMB 4CVXA 3O8XD 3FN0H 4P49A 5HD8D 5GS2H 5IUSA 3I6GA 4ZDHB 4R8WH 1WVZA 4EQ2A 5E03A 1TNNA 3DUSA 4NZRH 5E7FA 3V9FA 4DCQA 2K1MA 2Q8BL 5EORH 2PCPA 4OFIA 3RY6C 4FQ2H 3CMOL 1A9BB 5E8NA 1U8QB 4RWHA 1MOEA 2DTMH 2ED8A 3VXSD 3LY6A 5FGRA 4ZXBB 4OFYD 4XTRD 2CR3A 2YPLE 3MJ7A 3C6LC 4QKXB 4M7ZB 4L9DA 1NFIA 1YEFL 1UM4H 5GISL 4I2XE 3SE9L 5F21B 3B9DA 2VLLA 3H9HA 5MP6L 2DLEA 3SKNA 4PLJD 4PJXA 4JFFB 4ONOA 5C0AD 5DQJA 2VQ1B 5SX5K 1CTNA 4NKIL 4GJTB 5F93C 4Z7QF 1VDGA 2X4PA 1JGEB 5AD0B 2ARJB 3KYMA 1BFVL 5I8EA 2OSLB 2ERJB 1A7PL 5F1IB 2XV6B 4JRYE 1U91B 2X4TA 3IU4H 4NWUL 1S9YA 2XN9E 4XAWH 4XCEB 1FG2A 3V6OA 1HHKA 3V0VB 1FO0B 3IRPX 2VDRH 4G43A 1I8LC 1YEHH 4DVRL 3T8XA 1OGAD 1WBZA 2A73A 3STZA 3PWVA 2WQ8A 2GJ6A 4NHCH 2ZJSH 3RPKA 2PYFB 2BNRE 4PJHE 4KMTH 3MLZH 3TT3H 1XGRB 1G7HA 1JNLH 3DRQA 4APQA 4FXKB 4MJID 2VOTA 5LBSL 4RX4D 4X80L 5CSZA 5IW1B 3V6ZA 2JB6A 5D1ZA 5TGBA 4KK5C 4XHJC 2B4CL 3CFDA 5D1QC 3KPMB 4KY1H 2OL3A 2LAGB 1FYTD 3MLVL 4MXVE 3IDJB 4PY8I 4XBPA 4LP4A 1F13A 2BVQA 4NWTL 4PP1C 3Q6FA 1LVEA 3VFPA 1AE6H 4XCCH 3C5ZC 5CJXC 2DYPA 3RI5K 3QFJB 4PJCA 3EYQD 2D9CA 1PG7X 5E8DL 3V5KB 4POUB 5HHQA 2X70A 3QDJA 4YC2B 4WDIB 1Q9OA 4GSDL 5HVWA 4L4VB 3EYUH 5CEZH 1IBGL 3S8WA 4PJEB 5C0IB 1T6WA 1C08B 4XRCA 3MV7E 1NFKA 5CBAA 4HC1L 4KZEH 1B4JH 2DQDL 3VFWA 2ICEB 3DX8A 4ZNEE 4LGSB 4AEHH 2C7UB 2D7PA 4F15C 5DYOB 2RFXA 4QO1A 1IRAY 1MWAL 5F8RC 1FNGA 1Z0MA 2YD1A 1K6QL 4JGJA 3TNNB 4TNWF 5ALBH 2EZ0D 3AMKA 3O8XB 4IDJH 2W9EL 4PJBF 3VMPA 4OCRL 1MRDL 1QA9A 5TFSL 1JHKH 2GKIA 4LLMA 4C83B 4BELD 3IGAB 2P24B 3IJSA 4HJJH 3DI2B 2ESVA 1G1CA 1FZMA 4KQ3L 4WUUE 5GS1C 3QEQD 1Z3GH 4L3CB 2HRPL 3IF1A 4WV1B 4XMLL 4LKXA 3RDTC 1T0MA 1YN6B 3VXSB 4Z7WE 1NGZA 3RHWK 1UC6A 3OKEA 4YZFE 1FV1A 4WO4C 3U4BH 1EJOH 1S7SA 4M6AA 4JCMA 1ZS8A 3GIZL 3P4NB 4RBPK 5IB4B 5LQBL 4NKDA 3V5HB 1MIEH 2MOVA 3QDAA 3TT1H 4QXGL 4EUPG 1NBZA 1SEBB 3W82A 3FB6A 4CKVX 3EOTL 4QOKD 4ALAL 1I3GH 3J7HA 1L4IA 3ZT7A 1TVBA 3B6SB 3JWOH 4U1HA 1ZT4B 3BEWA 3TA3D 5ID0A 4TN9A 4CMMA 4XNYL 2AJSL 2DKUA 4I1NB 1LEIA 2ID5A 5BS0D 4L5FH 1IFHH 3ZE0E 4K3DH 4D9QD 3P11H 4NQED 3OTTA 4NQUA 4RGOL 5J1AB 4LASL 4WU7A 3WIHH 2B0SL 3BQUA 4C57C 2AQ3A 1L7TH 1WT5C 2VDML 2P49B 3O81A 4R90H 3FTGB 3QFDA 4D0CB 4MJIB 4GKSB 4UDTA 1KPVB 2GSGB 3NTCH 5EU7E 5GRVK 1RMFL 1YEIL 4HUXB 2AK4A 2NW2A 1JPST 3ES6B 1P9MA 1QBLL 5GRUH 5T1DH 1ZHKA 4P5TA 3WN5C 1U8IB 3BIKB 4MQ7A 4OCWH 4PTTB 4L3AA 4X8JB 4G3YL 3GSNA 5FO8B 1T2XA 5DJ8A 1DL7L 5KBNC 3EDDA 2V5SA 3TM6A 2WP3T 1JGDA 3ISWA 3B2VL 4YHMH 1NC4B 2HJLA 2UYLB 5B38B 2VNCA 3P0VL 1BAFH 3GMOA 5D2LE 5INDB 4KPHL 3AAZB 3NFPA 3QNYA 4LAQL 4ELME 5SWZD 2F74B 5FV1L 4PJ5E 4R4BB 3PWLB 3NIDF 1OSPH 3LD8C 1AI1H 5IV2B 3PP4L 2O93L 2R0LH 4KQ4H 5EFIA 3H8NA 2ICCA 5D8JH 3MACH 1I1FB 2HKHL 1QFWH 2CK0L 3VXRD 1E28B 4OV5A 4MX7B 3BGMB 3QIWC 3VFUA 4ZFOL 1UJ3C 2FEEI 5D72L 1R3JA 2B7DT 1E6JH 4HKBB 4S1RL 1NCAL 3G6JB 3JTTA 3FONB 4N8VB 3QDMD 3QXDB 3PUCA 4NPYA 1HSAA 5CEZE 2ZUYA 4YBQC 4NNPL 5IFJA 3RGVC 2X9WA 4NHUB 1LEGB 3QUML 5GRXG 2H2SD 2C9AA 3FFCD 3CC5B 1S7VA 4NZUH 3X3GH 2RJMA 4ZUWB 3PWUB 4WW1A 3I02A 3MODH 1AR2A 3D48R 5C92A 5IHUL 5HGAA 5D6CB 4P5MA 1DUZB 3WDJA 3ZL4H 4K8RL 3BAEH 2E27H 2ADIB 3G9AB 3O9WD 1TDQA 5FYJL 5JLZA 1MCOL 3UJJH 4RZCB 1P4LA 2A9NH 2W0LA 2IMNA 3LVEA 4GAFB 2VDPH 1EIBA 3SGDH 4J8RA 5CILH 4KFZC 3LQZA 2B5IC 4QOKB 1RUKL 3TF7C 3HC3L 2XTJC 3VXOA 1SM3L 4KDVA 4WWKD 5D1QB 4HGMA 1SJVA 5EU6E 1BVLA 3RVWD 2GK0B 1KT2B 3EIFA 3ARQA 1MRFH 5F3BB 5T3ZH 3WDHA 1RY7B 5D71L 3HR6A 4PJXF 5DLML 1XZ0A 4J6RH 5FM4A 5DMGC 5BS0B 3WO4B 2JELL 5DK3A 5L8KB 3C5ZB 3FQWB 5GS0H 4HGWB 2X42A 1PD6A 3N1PC 5IR1A 1RPQA 1ZSDB 3LEXA 1U6AH 4NQCE 2R8SL 4AL8H 1A7QL 1TIUA 3OXSB 3JSSA 4HIHA 5DT1H 3S37H 2H3NB 3CAFA 2EC8A 4F7MA 1BMGA 3UTQA 3D2UA 3WIFB 4U7MA 2MQCA 2H9GA 3ARYA 3BN3B 1I9RH 1YNKH 4KUZH 3MLRH 1U8PB 1MCSA 5KVFL 3VMOA 2X4QA 1NDMA 4HKXB 4F37K 2N4IA 5A2IH 2AXFB 4M3KB 2D31A 5K9OB 1KBGL 4OAWA 1CK0H 4MMZC 5CHNB 4LSSL 3UX9B 2YSSA 1Q0YH 3HZYB 5JW5A 1JHLH 2C26A 5KSBA 4YDLC 4JO4H 4PV9B 1WZ1H 2GJZA 5J6GA 3IXAA 3MR9A 3QWQB 4QF1B 3ALWA 1AQKL 3LMJL 4M62L 1KG0B 2D9QB 2K7PA 2VR4A 1CGSH 2PO6B 4P9HL 4KKBD 3EOBA 3C6SB 4RAHA 3KG5A 4MVBC 2EDHA 3V2AR 3L5IA 4LIQH 4QTIH 5DD5L 3PWJB 2ZCLH 4I0CC 4G8GB 1CR9H 4TVPL 3RY5A 4G8EB 3HE7C 2OL3H 4PJCF 1FBIH 2A6KA 4JPKH 3SDXF 3O0RL 2DDQH 4JDTL 5H37H 3QXVA 4MB5A 2HKFL 4LF3B 5E1HB 1WIPA 4HWZA 3KHOA 2AJVH 3RKDD 4U1JB 3FQNA 3QXWA 2XA8L 1U8OA 3HKFA 3U0PA 2K7QA 1RZJC 1T04A 1ZANL 3AM8C 3F58L 5AZEH 3GMNB 3BDBA 4XXDB 3UTTA 4LLWA 1C5BH 1EEZB 3UTPD 4PV8A 2V2WA 4M6NL 3QDGE 2KPNA 3FFCB 4HFWB 5JHDD 4Q2ZA 3FKUS 5JIKA 3PGFL 4KKLC 4Q74A 4O2EB 4RAUB 5C07A 2VLJE 2L4OA 3CFBA 4JO2L 1DBBL 4F7CB 3MRGA 4YIQB 4HK0B 3RGHA 2YZ8A 3HCVA 3VXQB 1J86A 1BHGA 2CKBL 3DHMA 1E4WL 2EXYD 3DTXB 5I1EL 3FT2B 5DSCB 2FX7H 4P23C 4JVWA 3IAQA 3KS0J 4S1DC 2IBBA 1FYHB 1XR9A 3VXUB 1F6AA 2FH6A 5HYSA 4OKVB 3CFEB 4OB5L 1CU4H 3TIDA 4Y4HD 2LU3A 1RIVH 2BVPA 2Q87A 3V79C 2B1AL 2NLJB 2X1PA 2CUMA 2XZZA 5ANMB 4JY5H 5JPNB 2X10A 4C59B 1I7UB 4N0CC 3WS6C 1G7JA 5TDPB 2DQEL 2VXQH 3EO9H 1HEZB 5JO5B 4LGPB 4IMLA 4OIIL 1CDGA 5TDNB 2HWZH 4EDWL 1JPGB 4NZJA 3V5DB 4EDXB 1KXVC 4JY6B 4RISH 4J1UA 3GJEA 1A6VH 1IC4L 2YK1L 3RVVC 4HS6B 3LD8B 4HHAB 3SCMC 4BUHA 5T3ZE 3LRGA 1OQOA 3ZSSA 3MFFB 4PJFA 5HI5D 3QUXD 1WAAA 4LARH 1YUHA 3FO2A 4M00A 4G42B 4F9LA 5A2FA 1TVHB 1EUTA 4QGYA 3GSRB 5F3HB 1HXYB 3QIWB 4YO0B 1RVFL 3P9LA 1UB5B 1UJ3B 1WLHA 5C0CB 2PR4H 4WY7L 4OZHB 1I9JL 5C0FA 2NY5C 3DMMD 4LSPL 1G6VK 5HI4D 1DQQB 1ZA6B 4MHHI 3QCUH 5IEHA 4I77H 4R26L 1DQJB 3MYZA 4PJ9D 5DJDA 5E99L 3WLBA 2DI9A 3RGVB 4PGEA 4JFEA 2YD3A 3MRHB 1GGBL 4MNGA 4OD3L 3LH2H 5CJQL 4HS8H 1OAKL 3MRBB 1DVFD 4G9FB 1RIUH 5BOZG 1CICC 3SE8H 1DQLH 3V6OE 1K8IB 2AJZB 4PRIE 5DMIL 1NC2D 1X5AA 4LSTL 1VKXB 4N0UA 3HZVB 3Q1SH 3ZKND 2LE9A 1Q9WA 1CDBA 4OFPA 1UZ8A 2CQVA 4PJ7A 3AVEA 5DEFA 1WZMA 3I6KA 4X4YB 4PB9L 5KVGH 2V5TA 3H9YA 4JM2F 3T1WA 4LRNH 2ADGA 1KTDB 2WLYA 3B9KC 4JHAH 4MXQD 3S37X 1R6VA 4HWEL 1YNTB 1XGTA 1FLTX 5I15H 1NEZG 5I8KL 1V05A 4LCCC 4P3CL 3LZFH 5HHME 1J9CT 2DWEA 4V1DE 1QSFE 2B5IB 2FR4B 1C1EH 2XTJB 2UVEA 2VZSA 5DHXB 2EYTB 2QKIB 2NY6D 2P46B 1JYXA 3FT4B 3OAYK 4L4JA 3MRIB 5MERB 2NTSP 4J4PD 2FIKA 1F5WA 1SY6L 5DJ6B 3T0DA 5EOTA 5FYJE 1BX2B 4MCYB 3OR7B 3CDCA 5C2BH 32C2A 4K71C 4KI1A 3HMWH 1QYGL 1K2DB 2W0FB 1N6QH 4ONGH 4MJ6A 3ZTJH 1U95A 5IJVA 4HT1H 1OTTD 4E41D 1CN4A 4PRPA 4UU9A 2R69H 5DGRA 4S1QL 1AO7B 5L2KD 1UM6H 4Z7UE 3CFIC 3GMQB 5F9JB 3C5SB 1S78D 1MHPH 2C1PA 4EVNB 1JYWA 1UKQA 1MNUH 4JRXE 1X5HA 1S8DB 2E9JA 4DKEL 4GAYB 3FMGH 3MJ9A 4UT6H 5I1IH 5CIPB 3WFZA 2A9ML 3PHQB 4HKZA 2PF6A 2VO5A 3H42H 2FSEA 1YEEH 1L9MA 3O4LD 3MRJB 5EDXA 4OF5A 1T5WA 4P59L 2ATKA 3VD3A 1ZA3A 1MFEH 4YDLB 3IVKA 2IEPA 2BHZA 4Z8FL 2XYCA 3O45B 4YHPA 1QFWM 2IQ9H 1H3PL 2IQAB 3PJSB 3V6BR 4FFYH 1J8HE 1Q72L 2APBA 5ISZD 3BSZL 5IB3A 4XVTL 3MROB 1OPGL 1T0PB 4Y2DC 4NFBA 2ESVE 1I4FB 1MCRA 4XZUB 2BCKA 5D4QA 4I0PC 5BCAA 4EOWL 4FOMA 4FQJH 2A77H 3QUZA 3W0WA 2R2EB 2QJDA 4F8QA 2BRRL 4LHUB 4JR9L 4JG0H 3HE7B 5CMAB 3QUXB 4ZODA 3FO9A 5B39G 5J7CC 1F2XK 5H94B 1RJLA 4JFYA 3E8UH 4HIXH 5JR1H 3HB3C 4GAJL 4MJ5A 2DQGL 3T0WA 5K33A 1MCNA 3A67H 2HFFB 1N64L 1CL7L 4I18B 4EI5C 3GSUA 1D5BA 4ZTOL 2CO6B 3QQ3A 2HVKB 4PGCA 3ULVF 1KCVL 4BSWB 2J6EA 1CE6B 3B3IB 3NCJH 2G60H 3QO0A 4PUBL 1BJ8A 2Q76B 1QG3A 4XP5L 1KTLA 2B1HH 1X6LA 3CFCH 3IJHA 4LPTA 5H2BA 3EW3B 2QR0A 1Z2KA 1ONQB 3F5WB 5DA4A 2NW3B 1FC2D 4Y4FC 5LWYL 3EFDH 3KXFD 1MVUB 2LFGA 1FDLH 1CI5A 5ID1B 5KSBF 3I9GH 4KJYB 1DVFB 3GSVB 2AKRB 1WSST 3RWIB 3TBVA 4AMKH 1JPFA 3T0EC 1NC2B 4U3XA 4Y19D 3WD5L 4YWGH 1FFOB 2WBKA 3DUHA 3ZE1E 4H8WL 5BZDA 4YFLI 5D7IF 1A7OH 5C0GA 1F3JA 1VENA 5EIQA 1OTSD 3FQTB 4YR6A 5KVEH 1KIUA 2DBLL 1MFCH 1MI5B 2OJZH 4GKZA 3U30C 3NFNB 4P23B 5ACZB 4TSCH 4OT1H 3BW9B 5EBWB 5HDLA 3U46B 3W11D 1B4RA 3HE6D 5DC4B 1N5AA 4KXZH 2J3SA 5KN5A 4NBZB 1UWGL 4PJDE 1AY1L 2HT3C 5IW6B 2NY3C 5FAAA 2E6JA 2R39A 4QRPA 3LEVL 1FORH 4NQDA 3ORJA 4PD4K 1IC7H 3QXUA 3FN3A 2XQBL 3C09B 1IM9B 2VWEC 1KCUL 4MDIA 1QLFB 5CJOH 3LN4B 4OJFL 2C4XA 4X7EC 2F19H 1FN4A 1MEXH 1ZEAL 3EO0A 1OF2B 1G9NC 3U0WL 3DETD 4LSUH 3KDMB 4U1KB 2AK1H 1KJ2H 4GT7A 3VFOA 2FNBA 3R0MA 2JIXA 4KK9D 2VITA 4Z0BL 4HXBH 4P2OA 4KK6D 5ESVA 5ENWB 1JPSH 4ZD3H 3TH3T 1ZHNB 5SWSA 3VFSB 5BV7B 4ZPVB 3IFPA 4B5EA 2V2XB 2YD6A 1P6FA 4XWOD 3RUGB 3O4LB 5TE6H 3G5ZA 3V4PH 1MCIA 1WBYA 2ZPKH 1ADQL 3UJTL 4HH9B 4K7PH 4IRJC 1QSVA 1NCBL 3DVNB 5E6ZA 2FJFA 4GMSH 4XWGL 4X99A 1RJYA 1NAKH 3QHFL 2WK2A 1KN4H 3M07A 1FFNB 1XCTB 1JP5A 3WSQL 5KG9A 4M4PA 4QY8A 5A3IC 3MREB 5JQ6H 1IJ9A 2CIIA 4PG9B 1HH9B 4WRLA 1EFXA 4GRWF 1CICB 1NEUA 3CXDL 4MA8H 4DZBB 1TTGA 2DD8L 2XOTA 2AXGA 1TJHL 4H1LG 4LLQA 4N5EC 2D03L 4AIZA 2BVOB 2F54D 1RULL 4UV7H 2ZCKL 5KANI 3BPNC 3CVIL 4KRPC 1BZQK 1FVEB 3TBYB 5DD3H 2YC1B 5EO9A 5DRWA 4FXLA 2P8PA 4NO0D 2W60B 2XRAH 3B9KB 3NABL 4OM1H 2NY0C 4S0SD 2PTTB 5C08D 1WAAF 4IHOB 3TZVC 1MREL 4OLYL 3RAJL 3UAJC 1KB9J 1KB9K 1IQDA 4NZDA 2HTKC 1J05A 1A2YA 2PTVA 3P9WB 4G8FB 2FEEL 1XFPA 4X6DB 2J88L 3FRPG 2MWCA 3WHXB 3KXFB 2VLRB 4OZ4A 4PRHA 1TZIA 4HC1A 1K85A 5CWSB 5J89A 4Y1AD 3D0LA 3VRLE 4HUKB 1RSFA 4L4TA 3TPUB 5GGSA 2ITCB 1IEAB 3EJZD 4M1GL 3KYAA 3CU7A 1BEYL 4Z7VA 4Y19B 4K71B 3MA9L 2PW1A 1CLOH 1RFDL 1T83C 4HUNB 1U92A 4HF5L 4LCUA 2FWOB 3H9SE 1JWMB 2FJHB 4H88H 1KELL 3T77B 1T4KB 1LP9E 1HZHH 3O2VH 2CJUH 5FB8A 1S7WA 5EU4A 3VH8B 3DBXA 4TULH 4MSWB 4NRYA 1F11A 3GRWL 5FGBC 3OGCA 4GXUN 5D5MB 9CGTA 4Q0XH 1BFTA 4R4FL 4M7LL 3LS5L 3GSQA 1KPUB 2DL9A 4NOBA 3HE6B 2DQFA 3MRDA 1KN2H 2CKNA 2PTUA 1AGDA 3PQYD 4ZSOB 2R1WB 2IG2L 5IHLB 4P2QA 1YNLL 2A0LC 5F96H 4X6EA 1MHEA 4HWNA 2HTLD 3KPTA 2WW8A 4M7KH 3UC0H 4NQSB 2WP3O 4U1LA 5DUBA 3AY4C 3IJYA 5EC2B 3ROOB 5FDWA 4JG1L 3MUZ1 4XMPH 2YRLA 1O0VA 4KTDL 4MAYC 2AP2A 2DLGA 5I1LA 4NNYA 4KZDH 3AREA 4EUPB 5DUPH 1DP0A 3BEVA 2OQJB 4HCRA 1CXKA 1Y6MR 1VFBA 4XAKD 5D2NE 4ONFH 3WXWL 4MNQD 4NUGL 1GZPB 1ZGLB 3TV3H 4X6CB 3MBED 3P0GB 1TPXC 1AD9A 2EIBA 4I0PB 3SO3C 1JJUA 3ARGC 4JZOB 1EMTH 5DJ0B 2WQRA 5J12C 4XPAH 3ULUF 1VGKB 2FL5B 1BQLL 2VE6B 3VFRB 1X5IA 1AXTL 2CDGA 2Q86B 1MH5B 5GHWL 2XWBB 4WUKL 2K9UA 1W0YT 4GW5A 1X7QB 1ZVYA 5D7JD 4EI5B 1MLBB 2EH8L 4OLXH 3KPOB 3QR2A 4LAJH 4XP9L 1UKSA 4GAGL 8CGTA 5DD6B 4CAGA 2DKSA 4GXVH 5BVJB 5CCKH 3VCLA 2MHAB 4X5XA 1NMCC 1U93B 4ORZC 3QIUC 5I1DA 1A22B 4Y4FB 1MFAL 1A14H 5J1SC 2VDQL 1X5JA 4MDJB 1FH5H 3QJHB 4JFPB 4OFYA 4HIIB 5EOQH 1JFQH 1I7ZA 3MJ9H 1JN6B 5MEOA 3BPCB 4W4OA 1HNGA 1I3RA 2VLKE 3QIBD 4F3FB 2HLFD 4QHLA 3U1SL 4NC0B 3MPCA 5ESQB 1EXUA 1F4XL 1X5ZA 4GFTB 3BT2L 1H3GA 4OZGF 3HC4L 1OP9A 2PYEA 4JKWA 1CGWA 1OP5H 3TO4C 2NY4D 2Z35B 3NA9H 2WUCL 4UBDD 1BWWA 3U30B 2X4RA 4TNVK 1WV7T 2FX8H 4ZUUA 4DGYL 1U3HC 2AJYH 4G6JL 5HGHB 3OKMA 3LHPH 3I84A 2YBRB 5DR5L 1DLFL 3QEHA 3EJJX 4PJ8D 1IEBA 2HVJB 4LNRB 3SPVB 5AZ2H 2EE9A 1IAOA 3SKOA 2H6PB 4Y1AB 5BVPH 3QPQC 1IL1A 1T7YA 3L9RA 4DFHA 3CLFH 3H0TA 4K7PX 4ZFOA 4CJ1A 5TE4L 2QADD 4H25B 3BWAA 1RU9H 3ARTA 4M6MH 5FUOH 4CGTA 1NGPH 1RJCA 2D4FA 4RX4A 5CJBA 1KTRL 2DI7A 1YEGH 2FD6H 5EBLA 2J6EH 3AGVA 3SKMA 3D5OF 5HYJD 4ZUTA 2Y06L 3D9AH 1J0YA 3ULSB 3GNMH 3ARDD 4G5ZH 4L8CB 1J1OH 1RUAL 2F5BH 4EN3A 1LE9A 1VACA 3RWHB 5I1KL 1J1XH 2ED7A 5EUOA 5I0ZA 1A6TB 5JMOC 1FL5A 2ATPA 5DMKA 3LQAL 1HIML 3KLHD 1IGFL 5IVXB 4YQXL 3BMWA 5DHVA 5CUSL 4OLVL 1DCLA 5JXEC 3DO7B 5J4MA 2FEDD 5EN2A 1II4E 3IS0X 3MBEB 2R9HC 2AJXL 1FO0L 3PNWA 2DQTL 3RVXC 1M6OA 3L95A 3GJFK 1MVFA 3K0WA 1YEFH 1LDPL 1U8HB 1KCSL 4ZFGL 4X7SL 2MKLC 3HRZB 4DGIL 4LHJB 3P77A 3CDYA 3OV6A 5MP6H 3B5TA 3PL6B 4RA3A 3MJ8B 4JDVA 3EYFB 4K9EL 3TZVB 4F7TB 4HIJA 1ZV5A 2XXCB 4NKIH 1ES0A 3JTSB 4MZ3A 3TBSB 5EU7C 1V7NH 4XNQB 1BFVH 1PYWA 3VFGL 2OZ4L 4BQCA 4G6KL 1YEJL 4R3SA 2Z4QA 4DUWA 3SDCD 3BVNA 5IB2B 1UXWB 5EZOL 1NBQA 1KXTB 1IGTB 2BOCA 5GGRY 4RMUA 2JE8A 2P47B 3WHE1 1F3RB 2VIRB 1RUQL 2EDYA 4DVRH 4CADA 5LVEA 1RZKL 4UTBH 3UTSA 4MA1C 5IMKB 3DWTA 5MHSE 3GKWH 2YHGA 3MV9E 4OCMC 1R3KB 5I16B 1IE5A 4Q6IA 4RNRA 3R8QA 1G7QB 2NY4B 1RUPL 3JWDL 4IBLT 2W0KA 3TA3A 3GMMB 4KMQA 5IJKA 3G5VA 2BNQD 5LBSH 1R3LA 5ICZB 1BZ7B 1JHTA 2VR9A 5ITFB 1EX0A 4QRRE 1NCCH 4WFFD 4NQEA 4ODWA 4POZC 4PJ8B 2BSRB 4I2XB 5GS2D 3OR6A 1CDUA 5F9DC 3HNTH 3MO1B 2D4DA 5TE7L 4LLVB 4NWTH 2QL1A 3IFOB 2AW2A 5JUEL 4JY4A 3RX5A 5IMOB 4R7DA 4LCYA 1NMAL 2DF3A 2BVEA 5ETUA 1RZFL 3BGFC 4XNMA 3MMEA 3RL2B 1CXHA 5E8DH 1IAIL 4NUJB 4CW1B 1TPXB 4YHZL 2ZG1A 1UENA 2LQRA 3SO3B 4N1HB 2L7UA 5DJYA 1XT5A 4JRYB 5J12B 4GSDH 1KF9B 4PG2A 2J12B 2XN9B 3MA7B 2AABL 2ICES 1IT9L 1IBGH 4C56D 3AC0A 5T1KD 2CRYA 3IAPA 3ARDB 5IVZA 4AENB 4HC1H 1WITA 5IVNA 2HJKB 2YD9A 2DQIL 3V7AE 5BXFA 3O3EB 2HJFB 3UEZA 5E94B 3R0NA 2BNRB 4PJHB 5E9DD 4GRLC 3O11A 4O2CB 4XVSH 4P5KB 1HI6B 4JFDD 5HI3D 4JCLA 2E8YA 5GIRB 5JOPE 3L3OB 3GHEH 2APFA 2CKBA 1K6QH 4UINL 3MNZA 1QLEH 3PV6A 1CXEA 5BW7C 1NMCB 4OGYL 3BO8B 3WUWG 1D6EB 1P4BL 2BNUB 1HHIA 4KTEH 2MSPA 5TFSH 4OD1L 5I74C 1FNSH 5BMFL 3HG1D 4PJAA 1YECH 2WBJC 5FKPB 2FHCA 3VXRA 4YH6A 4JHWL 2VDKH 2BVTA 4KQ3H 3CCHB 12E8H 4YBHA 4ETQB 3U7AA 1INQA 4NC1C 2LVCA 2HRPH 5CD3A 4PR5A 1QO3B 4Y5XC 4XMLH 2ADFH 2EDTA 1KYOJ 1KYOK 4MGXA 2YA2A 3QDMA 3MNVA 5DVMA 5F9WB 4NRXB 4CN6A 1EAJA 3OAZH 3FO1B 2Q3ZA 1VFAB 3OQ3B 5JIIA 1H5BC 1LEKB 5MEND 2DS4A 4YFDB 3GIZH 2HMID 3H6JA 1N8ZB 3TO4B 4HZLB 5LQBH 4HQQH 1CCZA 3JWOC 1D5XB 1CLZL 4HCRH 1TETH 3UJIH 1QSEE 5K93A 4QXGH 3P0YL 5L88L 3FQRA 1I9IL 5B3NA 1AC0A 4ALAH 5L9DL 5IG7B 3MV7B 2VZTA 4G6AD 8FABB 1BJMA 1WFOA 3S96B 4FQHA 4NQVB 5DQ9B 4ISVB 3K4DA 2NNAA 1U8LB 1IAKB 4XNYH 5BJTA 1BQUA 1DANT 2ITDB 4PY7B 3VE0B 4HFUL 4F58L 4M3JA 2JJSA 1H0DA 3KYNA 4ZYKA 4L8SA 2JCCB 5CZVL 4RGOH 4G7VH 4X5LA 1I7RB 4J3OC 5B4MD 3SDDC 5EUKA 3M17B 3MJ6A 5MEQB 2ENSA 4Y5YA 3BP6B 4N90D 2V9TA 1PW3A 2BRQA 4DEPB 3BD4A 3DV4A 3KLSA 2W92A 1GHFH 1CFSA 15C8H 2HT4C 5HHOD 3BN9D 1I8MA 5E2WH 1YEIH 4Z7WB 1QRNA 2FO1A 5FKAB 3D39B 3PWPA 2X4SB 1Z5LA 5FYJU 1T20A 1JGLH 1A1NB 3BP4A 5L7XL 3WJJC 1JK8B 2PXYD 1I1AD 4G3YH 3P9MA 3PHOA 4OZFA 3KPRD 1HHJB 1DL7H 2VXTH 5K9JL 3RZCD 4RGND 1JNHB 5FA3A 4LEOB 1JRHI 1Q9LA 4ZFFB 4EI6B 4JAMB 4KK8C 2ZKHL 4IMKC 3P0VH 1YYML 2Y7QB 1U8MB 4LAQH 1AQDB 1JCKA 5DJXB 2XTLA 2O5ZH 4LLYB 4BH7A 5FYKL 1SY6A 3Q3GB 2VSDA 3NCYP 3PP4H 1CDYA 4KDTA 3ZDZE 4KJPD 4JFFE 1OGTA 2ZNXA 1QEWA 2HKHH 5DVLA 1AKJD 2CK0H 3RPIA 1K4DA 5GSRA 2FLBT 2XT1B 3BH8B 3S35H 1EFQA 4HLZH 3T4AB 4BQ8A 3UTZB 1JUFA 4RFEB 3C2SA 4LSVH 5E9DB 2ZUTA 3EOAB 1XR8B 4S1RH 3UZQA 3QULB 4JFDB 5L6YL 4NNXA 4PREA 2Z91B 1M7IA 1LK3H 1FNLA 3MCG1 3LB6D 1PG7W 4RRPA 1G7LB 2RAMA 4J3TA 1AXSB 5JTWA 4WEBL 1IGML 3G6DL 3PGCA 4OGXH 5EUOF 4L8BA 4Z78B 4M93C 3VXPB 2AJ3A 2HFEB 5GJSL 2OJEB 3DUUA 3UO1H 1S7XB 3LKPA 3T65B 4F7EB 3HUJA 3CZFA 1BVKB 4HS3A 4Z7VE 5IHUH 2ADJA 2XZCL 5TH2B 4WVRA 3DIFB 2AXJA 1XGUB 3SJVA 5I1AA 4MA1B 3G5YB 5H35A 1DN0A 5FO7B 1VA9A 1QBAA 1V3JA 1DN2A 4OD2B 4LCWA 5D9SB 1I7TB 1Z9MA 2XKNB 4D0DB 1R0AH 5MENB 2P42B 2D3VA 3PP3H 3BUTA 4W6YB 1PEWA 3RWGA 2W9DL 5DHVH 3GKZA 5JOFA 4NKOB 5J3HD 4KHTL 5JHDA 1JBJA 2FYYB 4PJGB 1RUKH 4G9DA 3TFKC 5B39B 4M7LT 1ITBB 5GS0C 1FZKB 4S2SA 5JW3L 1G84A 4Z0XA 5GGTH 1WTLA 3C8KB 1QD0A 1XIWC 3K2MC 3VRJB 3NGBC 4RMVA 4HBQA 4KRNA 4NC2B 5IIEB 4TPRL 1MFBH 3CJJA 1FL6B 4NJ9L 3JVGA 1N3NA 1I8KB 3DHJA 3BGFB 2UWEA 3HAEG 2BC4A 2DN7A 5CJ5A 3HFMH 2CPCA 3KNBA 4Z77A 1OAXH 3Q5OA 3LEYH 5B21A 4NOFA 3U6RA 2O61A 4U3HA 3S36L 4M61A 4Y4HA 5DURB 1PY4A 3CMGA 3V6OC 2EIZB 4UIMB 3CPLA 5KVFH 1G7IA 4HPOH 1LO5B 1UXSA 4A6YA 2VDLH 1JWSB 5C7XH 5KVDH 3EDEA 3EZJB 2EICA 1MJUH 2VERN 3SQOL 4QRUB 5HHVL 4FNLL 1KBGH 5SV4A 4LSSH 4QT5A 1UWEL 3BXNA 3MYJB 5JIHA 2ZUXA 4OTXL 4R96A 1X5XA 4M5YL 2IJ0C 3GK8L 3ARPA 2QSCH 1V7ML 3L3JA 4DOHE 4NT6A 5TQ2H 3PDOA 1IZKA 1JWUA 5T1LB 1ZVSA 1KEGL 3DX6A 2A6JA 1OAYL 3LMJH 3O2DL 1JF1B 4NJAH 3RZCB 3U9PL 5I8OL 4ZUVA 3O6LL 1N2RB 3VXSE 4PJBB 1C16A 3TBWA 5HVGB 4B7LA 2VN4A 5EU6B 5JDSB 2G5BB 5CGYD 5J13C 2CO7B 5DO2C 1HYSD 1B0GA 4YHNA 2IFFH 4YNYA 5DI8A 2UV3A 3VFNB 5DD5H 1CFQB 5LG1A 3W2DL 5IMLA 4Y5XB 3UDWA 3DMMA 3ZE1F 5C0AE 3QYCA 3P4MB 1YDPA 3MRMB 5C09A 3O0RH 3TBTB 4BK4A 1LO4H 3VXMA 5GSVB 1S9WA 4PJ9A 4UILH 4YXHL 3ZKMC 3QUYC 2RCSL 3FFDA 3GSXA 3G5XA 5DFWH 3U2SA 2XA8H 5JXAL 1T21B 1TCMA 3L3HA 4GRMA 3BP7A 3DXAA 1ZANH 1D3CA 3F58H 3LN5A 1T0NB 3KWWA 4LPWA 3OMZA 2Z9TA 3CNKA 5KSVA 1WISA 2CDEB 1OGAE 1F90L 4PJDF 3O6FD 1FJ1B 4M6NH 5E5UB 4X6BB 1YY8B 3RVUD 5M95B 1FGVH 1XCQB 3NAAL 3NN8B 4Y4KC 2PW2B 4IOFD 3MBXH 1F4AA 1D6VL 3GMPA 2M2DA 3RNQB 1S5HB 3F6IA 4MJIE 3DPBA 4PJAF 4XXCC 1DBBH 1ZTXH 5IKCA 4JFZL 3DARA 4TUJA 3KJ4C 2HT2C 1FYTE 4JFQA 5FK9A 2EKSA 4P2CG 3WS3A 2FB4L 5I1EH 1T7VA 2DIAA 1YMMA 1XGPB 43C9B 4ZFZB 3GSWB 3S9DB 1R3HA 4OB5H 4XPHL 2I07B 2B1AH 2VXSL 3QA3A 3RTQC 5E8EB 3UPRA 5J11C 3KPSD 4APQD 2YD8A 5L2KA 4M9PA 2WWMD 4JFHD 5MEPB 3I2CH 3QNXB 1FE8L 5D1ZD 4DZ8A 5C9JB 1U8NB 2HFGL 1UQSB 4O2FB 4PGDA 4EDWH 3FZUC 2OXHA 2DM7A 5C9KA 1IILE 1K8DB 4QWWC 4FQCH 1UFUA 4BH8B 2R23A 1IC4H 3SCMD 1G7PB 3OG4B 1DBML 1MCWM 1PZ5A 4HV8B 1H9VA 1N4XL 2AJUL 1MHCA 2X7LB 4ZO7A 1LE5B 5FM5O 2VLJB 2DYPD 3QHZL 5I75C 1IC5H 4HEME 3PGDB 2F53D 4RQQB 4OCNC 4YAQB 3S4SA 3V7AG 2D0HA 5C0RL 4HJ0D 1QKZH 5ISZA 4R97C 3WYRA 1NCDL 4WFED 2Z31A 3BQUC 3QDJD 2P7TA 1EDQA 1OB1B 2IANA 4NM4L 4LSPH 4ZS7L 2CH8A 1M7DA 3DRTA 4U1SA 3QEQE 5DDHA 3CX5J 3CSYB 1WF5A 4CN4A 3AS1A 2ORBL 4QTHB 5KS9A 1CG9A 3C5JB 2G75B 4R26H 1C7TA 1IGYB 4L29A 4L3ED 2D7TL 1GGBH 3L3IB 3H7BB 4I4WA 4UT7L 5CJQH 3VJ6A 2AV1A 3WE6A 1NGWA 3DURA 2UY7A 1KCRH 3HI5L 3MJGX 4IIQB 5DMIH 2WSKA 4LSTH 4NKMA 1KPRA 3U7YL 3OL2A 1A9EA 4QOKE 3I6GB 3T3ME 5I6XC 5CSBA 3MOQA 4HAGA 4OZFH 4PRBA 4M1CC 4DCQB 5KSAD 4Q6YA 3DVIA 5BRZA 3HI1A 2ZOLB 3VWKC 4NGHH 2PCPB 2CLZA 1OP5K 5E8PA 3V4UL 2I5YH 2Q7NA 2YMXL 5E8NB 5I8KH 4P3CH 4LSRL 5BS0E 1JIBA 4L9LA 1JNJA 3EBAA 1SBSL 1KB5A 3OKYA 1G9MH 4NQEE 2FJGA 3D85B 4YDKH 4FRWA 1NFIB 1ZLVH 1S3KL 5IB1B 1SY6H 1LO0L 1PLGH 2VLLB 5I73C 3NGBB 2R4SL 5CZXD 4CMHC 4PJXB 2O5XH 3IDIA 1C5CL 4JN1L 5IF0A 4XPFH 3LPFA 1A7NL 1QYGH 3QDHA 1I1CA 4LCIH 4M48H 2X4PB 3KYMB 1HINH 2MMXA 2MQ3A 5IWLA 2DQUL 5I8EB 4I9WD 3AMLA 3HUJF 2Q20A 5FYLL 2VABB 3OKNA 1S9YB 1FG2B 4JQVC 1HHKB 4P48A 3FQUA 4PRIB 4G6FB 4TSBL 4G43B 3DX9A 4FFZL 4X4XA 2A73B 1WBZB 3STZB 5EZIL 3PWVB 2A9MH 2VZVA 2WINA 1KEML 2GJ6B 4HUMB 2R2HA 2D0GA 1BOGB 1K9TA 2NY7H 1G7HB 3DRQB 5E70A 4P59H 4RMTA 3UYPA 3WJLA 4LSQL 1Q9KA 3GHBL 5SWZE 1RZJL 4Z8FH 1T66C 2W59A 2WANA 4RAVA 2QSQA 1H3PH 3OJMB 4WU5A 5CSZB 3V6ZB 1DDHA 1CFNA 1QSFB 2EYSA 2GUOA 5D1ZB 5GGUB 2VDOH 2AK4D 4GLRI 3DGGA 2IADB 3CFDB 1CIDA 1NPUA 1KJ3H 5J13B 4N68A 5E6IA 4P5TD 4XBPB 1HH6A 4O4YL 3IFNL 5DS8A 2BVQB 4U6YA 2BRRH 4JR9H 4B7IA 2FGZA 4HXAH 1MY7A 2DQHL 1C12A 3QDME 5B8CA 3BH9A 3VGAB 2DYPB 5EWIL 3QH3A 5LAXA 4PJCB 2GTWA 2DQGH 1X5YA 4PRAA 4JKPL 3F62A 4XT1C 2GW5A 1CL7H 5HHQB 2X70B 4J3SA 3LRSA 4JM2D 4Z7UB 1FNHA 4ZTOH 4GW4A 3SDAC 4AG4H 1QR4A 3FFCE 1ULVA 5KJRL 1DTUA 3KPNA 1J0IA 3WFBL 4XCYA 4XRCB 5CBAB 2W07A 2YUVA 4KKAC 4K7PY 2NX5D 5LWYH 1YYLL 4ENED 2NQCA 4RMWA 3D1MC 3SE4C 2C3VB 5FF6A 3H3PL 5E0QA 4A6YH 4OF0A 5F7UA 1E4XL 4Y4KB 1BIIA 2RFXB 4JZNB 3PXHA 2NTFA 1DQML 5CAYB 4P4KD 1MSPA 3R4DA 5HGGS 1FNGB 4NO0A 3WD5H 4EIGB 5C08A 2MCPL 4JFOB 1J8HB 1ORQA 4OCSL 1QA9B 2R29L 1Q38A 1DBAL 2X4OA 4LLMB 3B5GA 3HRPA 3IJSB 3ZTNL 4WHYH 2ESVB 1FZMB 3KJ4B 5FHBL 3MTRA 2DBLH 5HGBA 1ETZA 1ACZA 5ANME 3IF1B 1P1ZA 2FH8A 4LKXB 3MRQB 1BD2D 1T0MB 2C3HA 2P5WA 3BKJL 1NGZB 3OKEB 5DFVD 4AQ1B 4HX1B 1U3YA 3MUGA 3IT8D 1ZLUH 1ZS8B 1K5NA 4ZNCD 5T3XD 2NY3D 5KOMC 5IFAL 2NY5L 4Z95L 4NKDB 2LTQC 3LKSA 3DSFL 3W9DA 2I25N 1CLYL 1XGRA 1IVLA 2R0KL 4N1EA 1NBZB 3IDUA 4UI2A 3GFUA 2W38A 4Q9RL 3FB6B 5C0DA 4FXKA 4FABL 2JB5H 3P4OA 1TVBB 3NH7H 4OJFH 3TVMC 5GRWA 4U1HB 5IW1A 4AM0A 4UMGA 1RI8A 1QLRA 3O3BA 2DM4A 1LEIB 2OZ4A 1D9KC 4OZHE 5C2UB 4XC1L 4Z0BH 5ALCL 4D0BA 2LABA 3OGOE 3ABZA 3IKKA 4WU7B 4Z6AT 4R97B 4WFGD 4XNZC 5JIPA 1GYAA 3QFJA 3NZ8B 3BQUB 4MNQA 3UJTH 2NXZC 4G9FE 3LN9A 4XWGH 1UM5H 3ULVD 4ZAKC 3IKCA 3QHFH 4EEEA 3A6CH 5DFTA 1RZ7H 4UDTB 4LVEA 1INEH 4L4VA 5C70A 2WIMA 2DIBA 1JMZA 3CVHA 4PJEA 5I2IA 1FNEA 4P9ML 1IGJA 35C8L 2NW2B 1OWWA 1DQDL 1E4KC 4E0RA 3ESUF 1XGQA 1B2WH 5JW4R 3IFLL 2AGJH 3WNMA 3VGDA 2ICEA 1ZHKB 2BJML 3EO1A 2KQMA 4U7KA 5I17A 3CXDH 4MQ7B 1YY9D 1EHXA 3C87A 4WGWB 2DD8H 5DYOA 4ZS6C 1EBAA 4X7DC 1JRHL 5JW4M 4OF3A 5J56B 5GRVL 4KRPD 1KGCE 5ACLA 5EB9A 2HJLB 5I6XB 43CAA 3GMOB 1KLGA 3OAZK 2IAMC 5IMMB 3UTPE 2NCMA 3NFPB 3QNYB 4OZIA 4PJIA 3VWKB 5ICYA 3IGAA 5FCSH 1F4YL 3ZYOA 2YA0A 5JHDE 1MREH 5EFIB 4OLYH 3RAJH 3U4EB 2Y6SD 1CD9B 2XG5A 5EBMA 5HPMA 1T1XA 2VXUL 5DHYB 2OTWA 4F9LC 1B3JA 2NY1C 4ZPTB 4YHYC 4OV5B 1OTUC 4K94H 3QIBA 3F7PC 3VFUB 3KPQA 5FA4A 3MXWL 1R3JB 1ZVHA 4HLZG 3D3VD 1TJIL 1AO7E 5I71B 2A83A 5I73B 3NIFE 3JTTB 4CMHB 5IB4A 2M8XA 5KS9F 4FQXA 5DMYA 3BDYL 4GBXC 4NPYB 1HSAB 2EXWD 1RFDH 5FECA 4HMCA 3F12A 5ILTL 4HF5H 3EYOA 4OSUH 3WUWB 2I9LA 1U8KA 2IPUG 5GRJH 2YA1A 3QI9A 1KELH 4FG6D 4PLKD 5CD5D 4G7YL 3OPZH 1S7VB 4WW1B 3I02B 4MD4B 1FIEA 3GMLA 1R3IL 4K07A 5F7KC 5C07D 4R4FH 5F7YC 4M7LH 5EOCL 3BKYL 5HYEA 1NLDL 1UACL 4GMTH 3PV7A 1ZLSL 5IESH 4KUCF 5LGHL 1K4CA 4LGRB 3THML 4ODXA 1G7MA 2IG2H 4RFOL 1YNLH 1P4LB 3B9VA 1G6RH 3BPLC 4KJWC 4U0RC 1F4HA 3UBXA 3MLXL 4PRNA 2XQYG 5HYJA 3ILQC 4HH8A 5FYLE 3TESA 4J8RB 4KTDH 1BQHA 3LQZB 3QQNA 3GUTB 4D0CA 1QFUL 1MIML 2G9HA 4GKSA 1NJ9A 4NUGH 5C86A 1BVLB 3B9AA 2GSGA 3CDGA 1W0WB 2DJSA 4HUXA 1FIGH 1MCDA 5FO9B 1H8OA 3TCLA 4P46C 4FFWC 5GRYA 1XZ0B 1CXIA 4NZTL 1J18A 1KB5H 1QVOA 1YPZA 3WKNA 4C4KT 1NCNA 4PTTA 1AXTH 4U7SA 4NCC2 2EDLA 2YD2A 5IR1B 1RJZB 3LEXB 4WUKH 2QLVB 2GSIA 1TFHA 4O9HL 1WEJL 1Y0LA 1BM3L 4HIHB 3S5LA 3QCTL 4F7MB 3UTQB 1BZ9A 3D2UB 5EZJA 4G80B 1NKOA 3AAZA 3MLWH 5E2UL 2X4QB 4U05A 5LCVL 1REIA 3RY6A 2CLRA 1DEDA 4Y16C 2UZXB 1YEDA 3TEUA 1D5ZB 2D31B 4XP1L 4DWHA 5KW9L 4OAWB 5T3XL 1E28A 5AYQA 2YSSB 4MX7A 3C6LA 2QSVA 5JW5B 4WTZG 1QFWI 3DGCR 4UT9H 4XH2A 2GJZB 4FQ1H 3IXAB 1MI5E 3MR9B 2H2PC 3G6JA 4TUKL 2DBJA 2C3GA 3A0OA 3U1SH 4JFED 3CGTA 1JGUH 1F4XH 1G9NL 1H3XA 5EU3A 3O2WL 4WCYL 4NQTA 2DJ4A 2XQYK 1AGEB 1KTKE 2VLMD 2J8UA 4N0FB 3PWUA 4DGYH 3BUYB 4G6JH 4JQIL 4XP6L 5HHXH 3RX8A 5GZOD 1S7RA 4QHMB 1INDL 1DLFH 3EGSA 1HHHA 2JJUA 2Z8SA 3IDGA 3MLSL 1DUZA 4E41E 5I1HL 4QRTA 1LGVA 4HWZB 3RIAF 2LTQB 3NACL 5L2KE 4ERSH 3FQNB 3TJHC 1S7QA 1U8OB 3OBAA 5DTFA 5LGJA 1T04B 5EO0B 3EYVA 2B2XL 3MOBH 3V0WL 1EHLL 1KJ2B 3MXVL 2ARWA 3I50L 3OF6A 4X4ME 5KANG 3UTTB 4LLWB 3SGDI 4PV8B 5F7EL 3VDCA 4KI5F 2V2WB 1NBVL 5E2JA 3QO1B 4U6XA 2X41A 4MMXC 4NP4L 3KPLA 2Y06H 3DOSA 3O4LE 4YGVA 4D9RD 1YQVH 1MJ7H 4Y89A 2R56L 3HPLA 5IOPA 5C07B 4D94A 3ULUD 3E3QC 4FMKA 5JZ7C 3MGAA 1FAIL 3ELAT 2YEZA 3C5ZA 3FQWA 3MRGB 4FTVD 4PRPD 1L9NA 5CJXA 4WENB 5HDQL 5FXCH 4LEXL 4JO3L 3HCVB 1P7KA 1ZSDA 1JV5A 1MFDH 2P5EA 2UZIH 1VCAA 2NXZB 5JMRA 5F89A 3OXSA 2RHEA 3LQAH 2XWTA 1HIMH 4KKNA 1XR9B 2CRIA 2WNGA 1F6AB 4YQXH 4J3UA 1IARB 2YR3A 5E5MA 4OLVH 1QQDA 3TIDB 1CZ8L 2WLZA 2BVPB 1EBPA 2R9HD 1KLUA 3ZYIA 1GZQA 1F00I 5E00A 3R1GL 5FOBA 2DB8A 4MQXD 3MX0A 4R2GC 3S6CA 1A02N 4HBCL 4OQTL 1N0XL 1G7JB 4PV9A 3WLWC 1VADB 2BMKA 1ZK9A 3MV8A 3VW3L 4IMLB 3U7WL 5TDOA 2R0ZH 4JPWL 1IKFH 1HWGB 1LDPH 2W1NA 1KCSH 2R1XA 4LL9A 2EDKA 4J1UB 3KXFE 3QZWA 1GIGH 1F3DJ 3QUZD 3W0WD 1AJ7L 2DLHA 3W39B 5GS1A 4K9EH 1SMOA 5GGSY 3VD7A 2CMRL 3PWJA 4PJFB 4P3WA 2ICWA 2WUBL 3LPWA 3LKQA 2NZ9C 1YUHB 2Y1VA 3FO2B 4Y19E 3RDTA 2NY1B 1IM3A 1L6ZA 2OZ4H 5I1JH 4WO4A 2M26A 3B2UD 3F65A 5C0FB 3HS0A 1FLRL 1FNFA 5DC0A 5EO1A 4KRMB 3ARBD 5GJTL 4XBGA 3EKCA 1CBVL 5I1GH 2IALA 3NFSH 4GBXB 4PJEF 4DAGL 1KIRB 5IEHB 1T03H 5D5ME 3RIFK 1RZKH 3CX2A 1F58H 3WLBB 3WFDH 4PGEB 4OGZA 3SBWC 4MNGB 4ZXBC 2VC2L 3GMNA 2IWGA 4H0IA 2FECI 1PX3A 2Z0BA 1OY3B 2QQNH 3JWDH 4PJ5D 4XB8A 3CVHH 2V2TB 4HFWA 4N0UB 5CP3A 1BJ1J 2XI9A 2VQUA 1I1RA 4LU5L 1Q9WB 4YDIL 3ILPA 4HZAA 1UZ8B 4PJ7B 5DEFB 1IQWL 5IT2H 3I6KB 4BFIA 4UOW0 2R2BA 1EVTC 4OZIF 2ADGB 4P3DB 4U0RB 1FSKC 3LDBC 4S1SL 1CLCA 2XWJA 1TZGH 1XGTB 4DQOL 2YKLL 3EUUA 1E27B 2DWEB 5J1TC 5HDBE 2MNUA 3MZTA 5DMJB 2O5YL 4U1MB 5CS7A 4YXLL 1T1WB 4KVNL 4YX2L 5HHOA 2FIKB 3SOBL 4M8QA 1IAIH 4LPVA 2ZSVA 3CFEA 4KROC 5FCUH 1HQRA 5ADPL 5EOTB 3GI9H 1T5XB 4P46B 4QRPD 4MCZA 5CEYA 4PP2B 4GG6A 4M1DL 1DLHA 1FGNH 1PKQA 2AABH 1JZ8A 3SDYL 3WN5A 3VFVA 4EZMA 3FO0L 2PXYA 1I1AA 1I7UA 4J3VA 3KPRA 5IJVB 4PRPB 2BXYA 2VB5A 2OP4L 4UIKL 4JB9L 1JPGA 3BI9X 4CBPA 3V5DA 2C1PB 4FXGA 1UYWL 3W5NA 4HUUB 1DBJL 2X89A 3S3PA 4P2OD 3CZJA 4HHAA 4LQFL 4OGYH 1P4BH 1WWBX 4DN4H 1NCWH 5SWSD 2EC9U 1MLCA 4WFHD 2HP4A 4HKZB 2F54E 4QEGA 1YZZA 1XF5B 2FSEB 2FX9L 1TVHA 4JHWH 3RKPA 1T5WB 3GSRA 2ATKB 5F3HA 1ZA3B 3IVKB 5I9QB 1UB5A 5C0CA 4YC2C 5IVOA 4YHPB 4LOUC 5C08E 3AREC 2E7LC 5H8DA 1N59A 3TJEH 3E6HA 5IB3B 1N5YL 1IGCH 4IDLA 2OYPA 2SEBA 1FZOB 4GW1B 3QG7H 4I3SL 3MOAH 1EFXD 4RWYL 5ECJE 4NYLA 3VWJD 1KACB 3QUZB 2J1KA 3W0WB 5FUZH 1YPZF 4YFEA 4Y1AE 1TTFA 5A43C 5L88H 1I9IH 3FO9B 5L9DH 1FFQA 1MRCL 1JPTL 4JFYB 3RWCA 1RHFA 3UPCA 4YJZL 1NFDA 4MJ5B 3K2UL 1CS6A 3MUY1 3O8XC 5F70A 1PG7H 5ELIA 4KV5F 5HD8C 5HVFB 4JHBA 3GSUB 1D5BB 1ACYL 3RVTD 1ZLVK 3ZE2E 3QQ3B 4PGCB 1N6UA 4NZRL 4KGLA 5KTEH 1PBYA 3QO0B 1OW0C 4LMQI 5F1NA 2E6QA 1KTDA 5EORL 1KTLB 5D93C 1CF8H 4NN7C 5H2BB 4YFLF 4YHKL 5CZVH 3U48A 1BF2A 4HEPG 2QR0B 1QTYT 4B50A 2FR4A 4KDWA 3T0AA 4ODSL 2EYTA 4XTRC 3PQYE 4L4TD 5MERA 1UM4L 4OF6A 5DC9B 1JPFB 3G6JF 2EDEA 1RZGA 1FRGH 2GTZA 3AS0A 5IVXE 3OR7A 4PLJC 5BZDB 1MJJB 2Y4SA 1S7TB 1P7QD 5C0GB 4YDVA 1F3JB 1BP3B 4MNQE 2MFNA 2CSPA 5L7XH 4D8PB 4GKZB 4PBVC 4OM0L 5HHNB 3IU4L 4LHUG 4Z18A 2GITA 5K9JH 2VDRL 1N5AB 1NANH 4DKFL 5KN5B 2IPKA 1AGCA 4P2QD 2AI0L 2VDNH 4KJQD 4FFVD 1T7WA 2ZJSL 4NHCL 3BP5B 3TT3L 5CKAA 3GB7B 3JV6A 1TQBB 5FYKH 3T09A 1JNLL 4NQDB 5KSUA 5F1OB 2V9RA 4R2GB 5T5NG 1UB6A 3ESVF 2Y07L 2NY2D 3UROR 2F58H 1KOAA 2J5LC 3LPGA 3SY0A 4QXTB 5GPRA 4P2RD 4Z7NE 1FN4B 1EJ6A 3QPXH 4PJIE 1MCLA 1XMWA 1PQZA 5L6YH 2JIXB 2VITB 1ZGLP 3G6AA 3GO1H 1T3FA 1EGJL 5ESVB 3QQ9D 1GC1C 3NOIA 5SWSB 5F88A 2CDFA 3HE7A 4XCCL 1IAMA 3IFPB 2E7MA 5GZND 4WEBH 2MCG1 3G6DH 4EJ1C 4JQXC 2KKQA 5GJSH 3O6KH 3G5ZB 3EYQC 1WBYB 3D87B 3U83A 1J8KA 3O4OB 4NFCA 1A3LH 2FJFB 4LLUA 1RJYB 4A2MA 3CLEL 5D1XD 2XZCH 2QV2A 1Q0XH 3K1KC 5CEZL 1CE6A 4X9GA 5KG9B 4QY8B 1RZ8A 3HZMA 4CU7A 5EU5B 3AM8A 4HLJA 4BZ2H 2CIIB 1LO2H 4X6FA 2W9DH 4AEHL 7FABH 1EZVX 3O6FA 5ID1A 2AKRA 2AXGB 1B0RA 3LIZH 1P4IH 4LLQB 4AIZB 4QNPF 2C3WA 5ALBL 1FL3A 1XF1A 2EZ0C 1CVRA 2PYED 5JW3H 1JHKL 5EO9B 2P8PB 2LVEA 1FSKB 3LDBB 4HJJL 5AYUH 2APXA 2V5MA 1WCQA 4K3HA 2XPGB 4XC3H 3BKCL 1J1PL 1IQDB 3K1DA 4P23A 2RGSA 4IRSD 1A2YB 1AR1D 4QXUH 4D3CH 2YN5A 4KRLB 3K3QA 3U46A 1ZT7B 2M1KA 4OZ4B 2ZUVA 4LLDB 4PRHB 4M8VA 4KROB 3U4BL 1EJOL 3QRGH 5HDOA 1DFBH 3D0LB 3S88L 3O3DB 4KXZI 4Z7VB 2ZP0T 4K23L 4AT6B 3KPSA 2PW1B 4U33A 1U92B 3TT1L 1P6AB 4LCUB 1VEMA 4LSDA 1QLFA 5F7HA 1UWEH 1DSFH 5FB8B 1S7WB 2HN7B 3JWOL 4I5BB 4Q6IC 4PS4H 5EU4B 4MNHA 3DBXB 1AHWA 4ODTH 4M5YH 4NRYB 3TA3C 1F11B 5F6HI 2VH5L 1V7MH 1HDMA 3B8YA 3T1FA 3ZHDA 5HHMD 5J9PA 5E2TH 3SCMA 2Z92A 3GSQB 1OAYH 4EN3D 3U9PH 2AEQH 3WO4C 1IFHL 5I8OH 1UA6H 4K3DL 3MRDB 2DQFB 3O6LH 4OUOA 4GUPA 2EECA 4HIEA 1KENH 3KYOA 3P11L 1AGDB 1HHGA 1BBDH 4X6EB 1MHEB 2F53A 4K8RD 5CP3H 3SDXA 2V2XA 3VA2C 5FYJD 4U1LB 5DUBB 5FDWB 3IJYB 1KIQA 4LHQB 1HILA 5DEGA 4R90L 5I1LB 4NNYB 3AREB 5I1CH 4PIRF 3BEVB 1ND0A 1NMBH 3QSKB 1VFBB 4XI5C 4WEUD 1FFNA 3MREA 3QUYD 4Q9CA 1AD9B 4QHUA 4L3EA 2HYMA 4GG6F 3P30L 5GRUL 5T1DL 4OCWL 1QFHA 3MLYH 4DZBA 4D9LL 3FB7A 4H20L 3ZDXE 2JCCE 4GW5B 3MRRA 3VI3F 1F90H 4X7FC 4TTGA 3MCKA 4LFHD 3GIVA 2PO6C 3N9GH 1GGIH 2W65B 3RBSA 3VXNB 3J8F7 3VH8G 3WNNA 1IC1A 5KSAA 3HLAA 5D93B 3T0XA 4DOHB 2FDBP 3VCLB 2A2QT 3VXTA 2PTTA 4X5XB 5FM8A 1AI1L 4NN7B 4ESKA 5IHBA 2BNQE 2CUIA 5I1DB 3SGEH 4LCCA 4BSVA 2R0LL 3FT3B 1R5WA 3RWEA 5CBEA 4WFFE 4G8FA 4X6DA 1XF4A 1ORSA 1U2CA 4R4ND 4XNUL 3D39E 4U6HA 1I7ZB 3FHAA 3DX7B 4LPYA 1E6JL 2F8OA 4K3JH 1SBBA 3S34H 1A6ZA 1H3TA 2H32A 4S0TD 1LHZA 3UTSD 1WCBB 1KNOA 5C0AB 1IAIM 1WFTA 3L3KA 1EXUB 4XPHH 2PYEB 2VXSH 2LU7A 2C3XA 1LK2A 3FCTA 3BZFA 2H2SC 1IGIL 2X4RB 5AG9A 2X9YA 4ZUUB 1F97A 1FE8H 3CSBA 3OKMB 1NFDF 3E1F1 3QG6B 4TVPD 5GGVL 2PNDA 4C56E 2QHRL 2KL6A 2HFGH 4ODUA 4O02L 1A8JH 3AUVA 3Q5TA 3ZL4L 1IEBB 5K9QI 1OGAB 4Z76B 4C4KO 3SKOB 2WBWB 3O9WC 4X9HA 1IL1B 1FPTL 3X12A 5E9DE 1DBMH 3L9RB 3M45A 3H0TB 1PSKL 4IOIA 4JFDE 2AJUH 4UNVA 4NQSA 4Z5RA 1A21A 3BWAB 4FQLH 4RDQF 3QHZH 2J5LB 4URTB 3K74B 1SEQL 3WCYA 3HPJA 4EUPA 3TIEB 3TWCH 3KYKH 1RUML 4Z7QE 3SKMB 3T2OA 5E2VH 3MFGB 1NCDH 3HG1E 3QP3A 4JO1L 4WWKC 1A6AA 4Y2DA 5E1AA 4ZUTB 3REVA 3RNKA 3UXFA 3RVWC 1MRFL 2YD7A 1FYTB 5T3ZL 1A0QH 1MCWW 3D25A 4J2XA 2P4AB 4J6RL 2ORBH 3TYGH 1LE9B 4EN3B 1VACB 5F8QC 5ABDE 5GS0L 2D7TH 5CJ8A 3U36B 2ZWLT 3QQ4A 4OLZL 3HI5H 2XWBA 1DQTA 4AL8L 5MENE 1DANU 1FL5B 2ATPB 5DT1L 1UH4A 5DMKB 1MLBA 4JM2A 1T22A 3KPOA 1YNKL 4JJHA 4KHXH 3U7YH 5DHVB 2VQTA 5DD6A 1JGVH 3HI6H 3V6FA 5BVJA 4PJGE 1NSNL 4TYUA 3MRPA 1U93A 5LXGL 1F8TH 3MC0A 5EN2B 2FO4A 4TOYL 2NX5A 1G9MC 1ZT1A 1CK0L 3EHBD 4JZJC 3GZKA 4HIIA 1NLBH 3PNWB 3S36X 1JHLL 4KDTC 4LSRH 1J0ZA 3ET9F 1WZ1L 3L95B 3T0EA 4P4KA 4X98A 1CQKA 1PGRB 4TSAH 5EOCJ 1PDKA 2X1QA 3BYTA 1HCVA 4XVJH 2RQ8A 2ZUQC 3LKOA 1A1MA 2P8MB 1UH2A 4ZQKA 1J5OH 1LO0H 2EEBA 3P77B 2Q7YA 4KKBC 2I60H 2R4SH 4N90E 4JDVB 4Y5VA 3QEQB 4QTIL 1C5CH 1FVDA 2ZCLL 3ALXA 4HIJB 1XH3A 1A7NH 1ES0B 5GXBB 1MAJA 5TPWH 2YD4A 1BD2A 5HHOE 1PYWB 4JPKL 5FUCE 5SWQB 5CKGA 1X4ZA 2Z4QB 1FFPA 2DDQL 1CVSC 2PKDA 2AJVL 3OHXA 4TSBH 3RKDC 5IHZB 4CADB 3UTSB 4FFZH 4WNQA 5F9OH 2FECL 1KEMH 4RGNE 4BZ1L 3I6LD 5AZEL 5DVOA 4PJBE 2X4NA 2ZG2A 1WICA 4X7TA 1F42A 4Q6IB 3PDDA 4RNRB 5IM7B 3BIBX 3TA3B 2GCYA 5I8CA 1T66D 1RZJH 3EJYD 3G5VB 1H3WM 4NO3A 3OG6B 4NC1E 1CGXA 4M03A 1R3LB 1ZAGA 1JHTB 1JNNL 1QRND 4NQEB 4IRZH 4ODWB 3PWPD 5HY9A 3RWHA 1A4JA 2DWDB 3IU3B 3OR6B 3LCYA 2NYYD 3IFNH 3K81A 4UB0L 5D7LA 1T7ZA 3ZHKA 3N1GC 5TF1L 4IRJA 2EXYC 3K4ZA 1TLKA 4LBEA 2FX7L 4LCYB 1RK0A 3JVGC 2IPTL 4GG8A 4JDZA 4ODHL 5ETUB 5IFHH 4XNMB 2YRPA 3MMEB 4OCYL 4TTDD 4JKPH 3AU1B 3RI5F 5EULV 4NKQB 5DJYB 5J0BA 1RIVL 4Y4HC 2Q6WA 5KJRH 4JY5L 2B20A 1I8IA 3VG0L 3QEUA 2GY5A 1X9QA 4Z7OF 1YYLH 4Y8AA 1F45A 2H1PL 4KVCL 5BXFB 3NBNA 4JANA 3O11B 1MAMH 2VZOA 5D7IA 1E4XH 4N0RA 4RISL 3R06A 1A6VL 5CP7B 5SWZB 4CU6A 3MNZB 2FRGP 4RFNB 3EYFA 3L7FA 3BPOC 4F7TA 1HHIB 2R29H 4LARL 5HI5C 3QUXC 1NGQH 3I85A 4TVSa 3R8BB 4DTGH 5LKNA 4PBXA 4PLNC 5TF0A 3VXRB 1NUGA 3ZTNH 2VL5A 3RUGF 5D7SL 4RMRA 3SGKA 4I18C 2PR4L 3O6MH 4PR5B 3D3VA 3UDWC 4IEFB 2FHFA 2C1OA 3DMMC 1IGTA 3SJVD 3LV3A 3BKJH 4N8CH 2HH0H 4HWUA 3QDMB 1JE6A 3RL1B 2F8XC 1A7BA 5HI4C 4LCWD 5JA8B 1T83A 3RHWF 4XBEL 4TRPH 5IFAH 5D7KD 4Z95H 4MS8D 4HS8L 4O51A 3MQIA 1CLYH 1DVFC 1DQLL 3FQRB 3OX8A 3NIDE 3WFEH 1Z6JT 4KKCD 5JOEA 1BZ7A 4AQOA 4FQHB 1VFMA 5ITFA 4MAUL 5BJTB 3O9WB 2YPLA 5CZKA 1MQKL 1W0VA 4YE4H 4I2XA 2VZ1A 2H26B 4K3EL 4MXQC 3AY4A 3KYNB 4ZYKB 4L8SB 3IFOA 3D0VA 4MAYA 3LZFL 4H26B 2KH2B 5IBLD 3BZ4B 4X6DF 5DVNA 5EUKB 3SKUD 2VR5A 3U0TA 4Y5YB 2NY6C 4WWKB 4J4PC 4QLRA 4CW1A 4NUJA 5HHPA 3QUKA 3ARGA 1TENA 2AEPH 1CFSB 2GAZA 1I8MB 5J6HA 5C2BL 4P9MH 4N5UA 1QRNB 3OKOA 1BLNA 3HMWL 3T4YA 1DQDH 3C09C 1BREA 2BSTA 5F72S 3C9NA 3IFLH 4ONGL 3PWPB 1Z5LB 1T20B 4AH2B 5DF0A 1OTTC 3BP4B 2BJMH 2H32H 1UM6L 4PJHA 3P9MB 3PHOB 4OZFB 4U4BA 3ARWA 5DJZA 4P5KA 1HI6A 1JRHH 5D5MF 5GIRA 4BKLA 3L3OA 2ZUSA 1J88A 2HAZA 2R1YA 5FA3B 1RURL 5ESAA 1MCPL 4PBWD 1Q9LB 3MV11 3QIUA 4UT6L 5I1IL 4QHKI 4ODVH 1RZIA 5D6DC 1UADC 5BV7C 1G1YA 3H42L 1ED3A 2E7BA 5CGMA 7CGTA 4JZJB 4XNXH 1RAMA 1YEEL 4K94C 3IXTA 3GM8A 1WIOA 3SE3C 4YHLL 5F7LB 4ETYA 4F2MA 3X13B 4MA3A 5EPMA 4GH7B 3Q0HA 4OQ1A 2CGRL 4PJXE 1OGTB 1HCFX 1QEWB 1SJEA 1QACA 2JK5A 1R5IA 3RPIB 3LOWA 5C09D 1UEYA 1K4DB 2IQ9L 1MFNA 4AK1A 5GSRB 4FFYL 5EA0L 3VXMD 1N7ML 2EDRA 5B3JF 2ZUQB 1R24B 1OM3H 4CUCA 1JUFB 1KFAH 4X6CF 3OXRA 2COQA 4FZ8L 4OFDA 4XMKL 3CUPA 5D70L 4NNXB 1M7IB 3TO4A 3ZDYF 4HZLA 2P43B 2G2RA 4UQ3A 4FQJL 3AB0C 2A77L 2GJJA 2HA1A 3BDYH 3DXAD 4XP4H 4P57A 5JPMA 5ILTH 2VYRE 4JG0L 1U3HA 3DLQR 4NO5A 4ZUSA 3KR3H 3PGCB 4WHTA 4L8BB 2AJ3B 4I3RL 3E8UL 5C1MB 3MV7A 5JR1L 2A1WH 3FQXA 2GJ6E 4G7YH 4JM4L 1OP3K 5C0BD 3DUUB 1ZHBA 3A67L 4NQVA 3GSNH 3CZFB 4ZNEA 1U8LA 3NCEB 4OV6F 3CH8A 2H8PA 3S97C 3KPSE 3PABA 5IQ9A 2ADJB 3NCJL 3SJVB 1RD6A 5I1AB 4JFHE 1MPAL 4LIQE 5H35B 1DN0B 1EHAA 1NLDH 2B1HL 1ZLSH 4RIRA 4GKNA 5LGHH 3CFCL 4XVUD 4LCWB 2R0WH 2CLVA 4RFOH 4WI8A 5DWUH 5F7NC 4KC3B 3EFDL 1T2QL 5MEQA 3I9GL 1YMMD 5JOFB 3P3YA 4WUUA 5JHDB 4WIQA 4HSQA 4Q58C 4AMKL 4L9LC 1BFOA 4Y88A 5FEBA 2BY3A 1QFUH 4I0KA 1H3UA 4YWGL 3LKRA 2F53E 4PJCE 4S2SB 4Z7WA 1Q1JH 4Z0XB 2Y36L 1A7OL 3DV6B 2NXYD 3GBLA 4FTVA 3KJ6L 1VGEL 1U2HA 3OAUH 5FKAA 3QDJE 4WW2C 3V8CA 4UUJB 1OTSC 3QXAB 1JK8A 1MFCL 2OJZL 4JGMA 1QR1A 4PLOB 1N3NB 1NEZA 2EE2A 1QNZH 1W72A 3NIGF 4TSCL 2J4WH 2UWEB 5IWLC 2BC4B 3HMXL 1HOCA 2D7NA 3W11C 4O9HH 1WEJH 1TNMA 1BM3H 3HE6C 3KNBB 3QCTH 4Z77B 3MV9D 1LILA 5JXEA 2O61B 3U6RB 4EI6A 4M61B 4Y4HB 4AJ0A 1U8MA 1IKNC 2AQ2A 3CPLB 5DJXA 4W6WB 4NIKB 5E2UH 4A6YB 1FORL 1V3LA 2IH1B 4LPUA 5KZCD 4YDJA 1L0QA 4MWFB 4F37F 5T3XH 4HJGA 5HXMA 4HKJA 5CJOL 4FMFA 4DN3L 4QT5B 2Z31D 3ZE2F 3WUZA 1FZJA 3BH8A 2F19L 3BXNB 3T4AA 2IAND 3P2TA 3SKJL 4PB0L 4R96B 5KVMC 4GKOA 2VISA 2FBJH 3L3JB 4OZGA 4NT6B 1RIHH 3OKLA 3Q6GH 3PDOB 3EOAA 1XR8A 2WIIB 5DRZA 3ZLQC 3DETC 4TUKH 1ZVSB 1KJ2L 1G0YR 5ADOH 3BJ91 2A6JB 1HKLH 3DX6B 4OFVA 4YHIA 5BO1L 1OAZH 4CVZA 3BPOB 4KK9C 4HXBL 4H0GA 4ZUVB 5ITBL 1M05A 1C16B 4KK6C 3TBWB 2D0FA 4XHQA 1AXSA 1EEUA 4WCYH 1B0GB 1GGCL 2QQLH 4YHNB 4YNYB 5DI8B 1X5KA 3KLAB 1NAMA 5EC1B 3V4PL 4XWOC 3HC0A 4OBRA 5IMLB 1A6UL 1HNFA 2ZPKL 4RGMC 3VD5A 4F7EA 3DMMB 3ARBA 3GMRA 2YWYA 1LO3H 4XP6H 4YBLB 5B8CC 5I19L 1NAKL 3WV0A 1YDPB 1CXLA 1KN4L 1U3ZA 1CWVA 1INDH 1B6DA 3VXMB 4KUCD 1N0LA 4PJ9B 4NM8H 1MUJA 5D9SA 5BRZD 3FFDB 3GSXB 3G5XB 3ULVH 3U2SB 5D2LA 2JJTA 4L1DA 4NCC1 2WWKT 4ELMA 2O26U 2JJWA 2XG4A 3UCRA 3CFKB 3L3HB 4PJ5A 4MA8L 2GT9A 1OT2A 3STBA 3V0WH 3C08H 3I50H 3LN5B 3KWWB 1DE4A 3K8KA 1ZHLA 5KSVB 3NZHH 1EGJA 1J0JA 5F7EH 2DM3A 3P73A 1NBVH 2JJVA 1OCWL 1UGNA 1FZKA 2DJUA 3FL7A 3CSGA 1UZ6F 2IH3B 2XRAL 2R56H 3GMPB 2XXMB 3FOLA 3U9UB 4XGZA 1FAIH 3MCLH 2V7NA 3RWFA 4X5WB 3WFHA 4U1GC 5IKCB 2HLAA 2AK4E 4LEXH 4JO3H 4UTAH 5DEZA 2NY6B 4TUJB 1CFBA 5DQDH 4JFQB 5FK9B 3WS3B 2EKSB 4LMQE 1RK1A 4IOSD 5DJ2A 2VTFA 4XX1E 1QSED 1EHNA 3EJZC 3T3PF 2VSCA 2BY2A 3DECA 1R3HB 1MCKA 4PD4J 2XA3A 1JWSA 4EQ3A 5C0ND 1NGXB 3W9EA 3QA3B 5E95B 2APWA 4QRUA 4E41B 2NXYB 4M7JL 3UPRB 3R1GH 1HZHL 2CJUL 3BHBA 5L2KB 4GRLA 2BY1A 3MYJA 1U42A 5IGXL 4TULL 1BGXH 3KS0H 3L5XL 3TN0D 4HBCH 4JFXA 5FHAL 1J7VR 1N0XH 4YXKL 1KIPA 2W9LA 1EZVY 4DZ8B 3GBNH 4Q0XL 4M43L 5BW7A 2KBGA 5T1LA 3EYSH 4U2ZA 4JPWH 1KN2L 4UDUA 5E6ID 1MCFA 2BX5A 1M71A 2R23B 3C60D 4MYWB 5DUMH 5EU6A 2WBJA 3MLTA 1NQBA 2X4UA 3ARFD 2HTLC 3HZKA 1GAFL 3X17A 1NDGA 1MHCB 2CMRH 2WUBH 5IBUB 2EO9A 4XMPL 1T6VN 3WKMH 1YJDC 1MCHA 3OSKA 3S4SB 5ISZB 4ONFL 2Z31B 5SX4H 4EBQH 1H5BA 2FGWL 4F7PA 4OGAD 2IANB 1FLRH 4NQCA 4RA0C 2VXVH 1M1SA 3MBEC 5BZWA 1M7DB 3DRTB 4U1SB 5DDHB 1CBVH 3AB0B 3VWJA 1CG9B 4U6VH 4XPAL 2DLTA 4HPYL 1P84J 1P84K 4OKDA 4L29B 4TNWK 2E7HA 4I4WB 4QHNA 3VJ6B 1B9ZA 2AV1B 3WE6B 1NGWB 3DURB 4KI5D 1GH7A 4PJHF 4GRWH 1PAMA 4NQXA 1YY8A 5D7JC 1G6RB 4NKMB 3IDMB 2PN5A 3NN8A 4DGVH 4K7FA 3UYOD 1KPRB 3PL6C 4YDIH 1A9EB 4JFFD 1UG9A 5CCKL 4UQ2A 5A1AA 2XZQH 3I75B 3L5JA 1OD7A 3ZSTA 3E2HB 4PRBB 1A14L 5BRZB 3HI1B 3SDDA 4MXVF 5EOQL 3Q2CA 4DQOH 1FFRA 2YKLH 1JFQL 1U0QA 5EBGA 4PPTA 4L9LB 2P5WD 1F6FB 4XCFL 4E42B 1KB5B 4YXLH 1WFUA 2FJGB 3GEWB 2V17H 3MRFA 4H1LA 3QIBC 1EV2E 2BOBB 2BSSA 1MWAA 1UKTA 2HLFC 4U6TA 3MV01 1P7QA 1G9EA 1A7RL 4WFGE 3LKNA 4RMQA 4M1DH 4WW2B 3IDIB 3RQ3A 1TTUA 5IF0B 3NA9L 2NY4C 4FZEH 4CNIA 2ZCHL 4UBDC 4CJ0A 3ULVE 5FGCE 1W2KT 2DTSA 2FX8L 2AJYL 3NCYS 3EDKA 3LHPL 4F57L 3INUH 3QWOB 1SVZA 3F7VB 2OP4H 1WK0A 5BOPA 1Q94A 3FRPA 5AZ2L 4PJ8C 5KSBE 3QDGA 1YA5A 1DBJH 2MTPA 3FQUB 5BVPL 1LDSA 2X40A 5C0EA 1G7PA 4LQFH 3CLFL 4X4XB 3ZDXF 3VA6A 5T1MA 1YEKH 2QADC 1NL0L 1RU9L 1NGPL 2QQKL 2DL2A 3QFJD 3WL9B 1HK6A 4U1NA 4P2RA 2NMSA 3FN9A 1YEGL 2JF1A 1HWHB 1DEEB 1U8JA 1KJMB 1PY9A 3GBML 4RAVB 4DVBA 1CD1B 1VEPA 4L4VD 1X4YA 4WU5B 5I66A 1DDHB 1CFNB 4PTUB 2EYSB 3IETA 3V7MA 5T33L 3DGGB 1FVCA 4G5ZL 4QTHA 4Z7WF 2GIYA 3ARDC 4ZTPL 2F5BL 4YZFF 1SVCP 2WMPA 5IP4A 3QHTC 4I3SH 1E6OL 3QXTA 5DJAA 1AH1A 5E6IB 1EAPB 5DS8B 1R5VA 3IDXL 3D3VE 4RGMB 4RSVA 3ULUH 1C12B 5B8CB 3BH9B 3C2AH 1MRCH 3QH3B 4UV4L 5LAXB 3VRIA 3KLHC 3GSOA 3QNZB 5D1XA 2JTDA 3K2UH 4HUVA 2GTWB 1ROWA 3DROA 3UTTE 4PRAB 2EDQA 3BIAX 3F8UB 2ZOKA 3U82B 5LGKA 3LRSB 1ACYH 3T0VA 4NRZB 2FEDC 3BJLA 4GW4B 1LNUB 3AXLB 4N0YL 1XGYL 4X8XA 2KZWA 1W72H 1Y18A 3NPZB 1X3DA 3KPNB 2ZOLA 4O58L 4XCYB 4YHKH 2MQ0A 3ZE0F 5C07E 5BQ7A 2F54B 3OZ9L 2NZIA 5MI0B 5A2KH 2YUWA 4ODSH 5JA9A 5F9WC 1YC8A 3MRKA 3D85A 5FF6B 4OF7A 4GQPH 2I9TA 1BIIB 1T1YA 5IB1A 2NTFB 4QYOB 1XIWA 4YGAB 4U31A 4F80A 4FQXD 4NO0B 2DRUA 3G08B 5C08B 3SGJA 4H5SA 2D7OA 1ORQB 1QBBA 3N1QC 2X4OB 3QI9D 3M8OH 4U1GB 4V2BA 3B9EA 3WNLA 4IRSA 1XEDA 1OLLA 1V7NL 4PFEA 1MJ8H 4LRIA 2ED9A 3HR5A 4XCNA 5CGTA 5HGBB 1ETZB 1P1ZB 1UVQA 4OM0H 4GRWE 2VABA 5H37G 3SDCC 2P5WB 4PRIA 4IJ3C 3VGHA 4HUWB 3MUGB 4DKFH 1NAMH 4UTBL 1K5NB 2VAAA 2AI0H 3D18A 4NCDA 2BP3A 3GKWL 2NR6D 4BUGA 2E9WA 1A6WH 3LKSB 3W9DB 5D2LF 2XY1A 1BOGA 1CTOA 4ELMF 3MRLA 4GOSA 3FB8A 4DEPC 3H9ZA 1JZ6A 1KJVB 2Y07H 2YD5A 2YXFA 4KGJA 3SHSA 5C0DB 2B39A 3QUMA 1I85A 2GFBA 5HYQA 5D96B 4PJFE 1WAAE 3P4OB 4PJGF 5E8OA 3L3GB 2VJXA 1CDJA 4V1DA 1QSFA 5E5RB 5GGUA 4AM0B 1NCCL 1YN7A 1QLRB 2IADA 4DKAA 3GJFA 3O3BB 1NBYB 4OI9A 1UEMA 2OTPA 3PQYB 1CFVH 1P5UA 2AAVA 1RHHA 1VHPA 3N1FC 3HNTL 1TCRB 1EGJH 1OT1A 4D0BB 2V5YA 1EO8L 4PGBA 5C0JA 3UTOA 1JMXA 4JFEE 2YUZA 2A6DA 4MNGE 1NC4D 4MNQB 5CINL 5F7DA 1FP5A 3PIQA 4WJ5A 1BBJA 2YWZA 3QUYA 3GGWB 4Z7UA 3IKCB 2Q8BH 2QQQA 3CLEH 5IB5B 4BK5A 1L7IL 2VLME 3TH4T 3CMOH 1OVZA 4JREC 4N0UE 1CL7I 2F5AL 3CVHB 4IS6B 5I2IB 1FNEB 4JRXA 4AIXA 1IGJB 3MGTA 2Q8AL 4E0RB 4PJ7E 5DK2A 1XGQB 5JNYA 4MLSA 1GJIA 3C6LD 3TNMA 3ARSA 3EFFA 5I17B 3EO1B 5GISH 3BESR 2OS7A 3SE9H 2C3VA 5D7JB 1HXMA 2VL4A 4XVSL 4Y4KA 4JZNA 3JV4A 2UUDH 3JBG7 5HI3C 3GHEL 4N9OB 2EE3A 1QLEL 4J23A 4LK4A 1AGFB 4X0KA 43CAB 4JFOA 1J8HA 1KLGB 4KTEL 4XXCA 2GHWB 4OZIB 5FDYA 1FNSL 4PJIB 4NDMA 3ME0A 3E6FA 5ICYB 1YECL 5EZLA 2VDKL 3CH1A 1A7PH 3DVGB 5FOJA 4ZG1A 12E8L 4D9RE 3BKCH 4NWUH 1J1PH 5EBMB 4LKCA 5FYKD 5HPMB 1T1XB 3F7QA 2ADFL 3MRQA 2OTWB 4BFBD 3ULUE 5E56A 4YK4B 3QIBB 3F6LA 4HX1A 3KPQB 5AWNL 4FTVE 4PRPE 4I48A 5FA4B 2KZ1B 3S88H 5JORA 2A83B 4JPIA 5ICXA 4GQ9L 3RTQA 6FABL 1JVKA 4ZOBA 2HMIC 2Z93A 4HQQL 2AXHA 4FQXB 4K23H 4HCRL 5CLWA 5FECB 1TETL 3UJIL