2O6PA

Crystal structure of the heme-isdc complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
GSDSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein C
publication title Crystal structure of the heme-IsdC complex, the central conduit of the Isd iron/heme uptake system in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6pA00
2Q7AA 3S48A 2MOQA 2O1AA 2O6PA 4H8PA 3SIKA 4MYPA 4WJG3 4NLAA 5D1XE 4YMPA 3RTLA 2H3KA 3QZNA 2ITFA 3QZPA 2K78A 5D1QE 3OVUB 4H8QA 3QZMA 3SZ6A 3QUHA 3QZOA 3QUGA 3SZKC 3QZLA 2E7DA 3VUAA 4FC3E 3RURA 2Z6FA 5D1ZI 2ITEA 3VTMA
chains in the Genus database with same CATH superfamily
1FNFA 1RXLA 4GRMA 1JWUB 5F88A 1XGTA 2O5XH 3C9NA 2Y7NA 4TNVF 4ANXA 5D8JL 3TV8A 2P5EA 1E8YA 1DEEB 5FECB 1A0QH 5JZ7D 2WQVA 1PU0A 4NHCL 4MYWB 1KTKE 2BNRD 3W56A 2X6AA 4FI7A 1YNKL 4NUGL 2OFQA 4JG1H 3FCUB 1S7WB 1TZGH 3HN5A 3F7YA 3MLUH 1LP9B 2FLRT 3ESUF 1YEWA 5LG6A 3AS1A 3GS4A 3IWVA 3PRZA 1WBXA 2WANA 3C5XA 3NN8B 4OFQA 4JFDA 3GQFA 2LTQB 3MLWL 1S6NA 1WZKA 3QUXD 4ISVB 4Z78B 2XZQL 3BUBA 5EUOA 4CRPA 1OK0A 1R3LA 3OSKA 3VXQA 1MG2C 2K70A 5F1KC 1IGIL 3DIFA 2BIMA 2WZ6A 4CW1A 1JZHA 1TITA 1OSPL 3CFEB 3CFTA 3FN0L 3CDZB 4TSCH 4A6YA 4WFHE 3RKDC 5L4MA 5EF0A 4AIXA 5GZNA 1NMBL 3FSZA 1VFBA 3S8GB 3NCYP 4HAKA 1BIIA 1QKZL 2F9BT 4YUEL 4U3CA 2ZSWB 3L3HB 2ZCLL 1EUUA 2HN7B 4M5SA 3QEQB 4XPGL 4PGBA 4QRPE 4C4KO 3T8XA 5DZVA 3KPSB 4O4YH 5AVXB 3TS8A 4WWOA 1FO0H 4ODSH 4XO3A 1J0JA 4G6JH 3EGDA 3BQUB 1IJNA 2QADD 4FGMA 4Z5RA 4ELMA 3G9AB 1PNCA 1ZSDA 4GLRI 3V7MA 1QRND 4QRFA 2XWZA 1OIOA 1AE6L 5D7SH 4L3ED 3LRMA 5CIPA 3UO8B 4DZ8A 2XA8H 4N8VG 5JW4M 2OV0A 4YZFE 2O6EA 4NXKA 2VXTH 2R15A 1YN6A 2BZ7A 5CD3B 3QH3B 4GRWE 2N7SA 4XT1C 3D2UA 5D5MF 4ORGB 1TYRA 4Y2DB 2NX5E 4ONOA 3VQ1C 3W5NA 3O4LA 2YD7A 5KBDA 1MVUA 2VH5H 3S9DB 1IM9A 5GGSA 4X80H 5IHZA 3MUUA 3CFDA 2W92A 5E70A 5CSZA 1L7IH 2HG0A 5IQ9B 4OCNC 3L9EA 3VFGL 3AT8A 4JO1H 4LL4A 1FNEB 1MI5B 5L7XH 3LKSA 3BYTA 2ZUTA 2XG4A 3GJFB 3KL3A 3N2JA 3V4UL 3BHBB 4PS4H 1IIKA 3QC6X 4MXQC 1IT9L 4U1NA 4UM9A 1I3RA 1QG3A 5ID0A 4HKXB 1MIEH 1CDUA 2DKSA 3QS3A 4KROC 2XJKA 4FTVB 1BLIA 1F42A 2WXRA 2YBGA 4OZIA 5I1HL 4P23A 4ATTA 3E8UL 4JFXA 1JGVH 5J6HB 2AQ2A 1GXEA 1YMMA 2WLMA 3RWFA 4P3WA 3LN9A 3EOBA 2DQJH 2WAQA 4X98A 4S1QH 1T20B 1SQ2N 4YK4C 3CFKB 2F5AH 3LIZL 1QEWB 2OSLA 1WV7T 5EU6A 3U0WH 4P9HC 2IH3B 1K72A 3DJZA 2HFEB 5IQ7L 3V5KA 5KSAA 3W5MA 3NCWA 1NDTA 4X6BB 4ZXBC 4K9EL 5GGVL 3UYRH 5HYJB 2IDFA 4AM0A 2D0GA 3QEGH 1LK3L 4HC1A 4OW6A 4KNQA 2Y2YA 1VB9A 5C3LD 1CG9A 1P9MA 3PG2A 1U6AH 1KTBA 4MJIB 4WI4A 3GXPA 1S7SB 5F0MB 3QQDB 3KYKL 1YUHA 1QWNA 1G87A 4FXKC 1EGJL 4IS6B 3U25A 3VM5A 2RJMA 4WHYH 1DP0A 3K6NA 4PTUA 1ZMYA 4F58L 5C09B 1M1XA 3VFVA 3LQMA 2V9QA 1E4WL 4H20H 3WY4A 1GHFL 3TO4D 5EPMA 1TDQA 2XN9D 4NWUH 4U6XB 2WUBL 3DX6A 4X7SL 1PIFA 5DC2A 2DRUA 2Y5EA 4N0FA 3KYNB 5HTSA 1D6EA 5T3ZD 4MSWB 1GGBH 4K3DH 1FRGH 2VR5A 5L6YH 4DP1X 1A3LL 5DUPL 3GKZA 5SX4H 2VJXA 1I1AD 2OSXA 5EO1B 5ABAA 1D3CA 3FCSB 4YEFA 1J1XL 4MCZB 3MFFB 4K8RD 1PBYA 2GJPA 3F65A 3N9GH 1KB3A 4HDIB 2CR3A 3FQTB 3ABMB 3QIWC 3WIFB 4ZMPA 5KAQG 1BD2A 1SEQH 4F2ME 2X1QA 3ZKSD 2FD6L 5FO7B 1FH5L 5CZVL 3WXWL 1ETJA 1CFMA 2R7EB 2X4SA 1JDAA 3KJ6L 3L1FA 1LILA 4HWNA 3SDXA 5C0JA 3CH1B 4NNYB 1IKNC 5C2UB 1XAUA 1V05A 5CFHA 2JKLA 1YY9D 3QUYC 2IJ0C 3MRPA 3A24A 4IKJA 4BFEA 1KCWA 1CR9L 4QNPE 1YMHA 4JFQA 2WZ5A 4PW3A 3B7SA 1A6VH 2PW2A 4IJ3B 5DWPA 3DX8B 4ICWA 4WY7H 3RB7A 3BVWA 3O4OC 2HUHA 8PAZA 4XGZB 1XSJA 3UGUA 1TVBA 4PLOB 4Y89A 3MHZA 1AGFB 3PP3H 4O02L 4UTBH 1WFJA 4X6EB 3I02A 3NIDF 3OWRA 5J11C 3C5ZB 2FQFA 3Q05A 1IL1A 1G43A 3P2BA 3L7FB 1HJBC 1LO3H 4XN5A 5FV2A 5BZZA 4AQEA 3JVFC 4ZI8A 5KVDH 3OBAA 1RURH 5KBPA 2AV1A 4L4VD 4KJWD 2Z31A 2XPGB 3M88A 5C0CD 1IGTB 3BO8B 2ZUXA 2VDOL 2C3WA 3K2UL 3RI5F 3ZTCC 3QC5X 1TQTA 2VW4A 5CU5A 4O2CA 2VLRB 4F57H 4P2RB 3SODB 4EI5A 4EOWL 3MKGA 2EH7H 3PL6B 4F7PA 4FJYA 2YKLL 4HGMA 1NDMB 4KBPA 4UQ3A 4AGOA 1OTTD 5D7IE 4MA3B 3V0WL 2WVVA 2VLKB 3GUTB 4G7YH 1EZSA 4GP8B 4KOCA 5GGQH 5CCGE 2E4FA 1IAKB 1C5BH 2QPEB 4PVBA 1NOFA 4NDMB 5IY5B 1R0AH 2B1AH 2IAMB 2YLKA 3MKKA 3GJFK 1BHGA 2YPLB 2AEPH 4X42A 5A2IH 5JW5A 2YARA 2ZAHA 4XBMA 5C0BD 2VSDA 3V4PH 4JL2A 4LSRH 5ID1B 1SVCP 4BEIA 1CZ8H 4E36A 4N2OA 1VEMA 1NPJA 3LIUA 1Q0EA 1WK0A 2WCGA 4OQTH 3R7QA 3VRIA 2DM3A 2ENQA 3FUMA 5JPMA 1OW0C 5DS2A 5I26A 1ID5I 1PLAA 2ODIA 5GHWH 5DRNB 4NGHL 5F3BA 5JHDA 1AHMA 3RFZB 1N68A 1QFWM 1W16A 3E6HA 3I9GH 1WICA 4C56A 4QF1B 1RUAL 1H3TA 2IPUK 2F2HA 3MV9D 4MA1B 1D9KC 4DKTA 3AQXA 4PGEB 3V0DA 4NKIL 3NSCA 2X4QA 1P4BL 1TTAA 5LGHH 5IT2H 1L9SA 1RJZA 2DM4A 4RMBA 3CHQA 3VGHA 5CEZD 4FKEA 4BK8A 3KS0J 3DMMC 5B7FA 4FYQA 5B1KA 2H8PB 4OGYL 1MRDL 1XCQB 2GTWA 1NFDB 4EDWL 3HB3C 4PJ8A 1LEGB 1VERA 4JY4B 3RIFK 5DEFA 4MQ7B 5TK2A 4AQ1A 1CF8L 5E2UL 4F7KA 3TONA 5D7JA 1T1XA 4ANVA 3P0GB 4GAJL 1OGAB 1LXMA 5ITBL 2N0MA 1WWAX 2QMJA 2VDLL 2CLVA 3DDFA 3W9EB 1RCYA 4N87A 3O45B 1HHGB 4PRPA 4WI3A 5EUKA 2E4TA 4KTEH 1KEMH 1DFXA 4KQ3H 1AOHA 1BDYA 1P4IH 3OJ2C 5TD4A 4FZEL 2B2XL 3ARED 1NSNL 4YIQB 4DGWC 2C9VA 4IRJA 5CCJA 2DM7A 1OQXA 3HRZC 4LP8A 5FUZH 5IJBC 1IEBA 1OE3A 2FHBA 3B9KB 3AB0C 1IAIM 2ZICA 1ZHNB 3CSGA 4JFTA 4PRIB 3UPCA 4A7TA 5E2JA 2VDMB 5G4OA 3S3CB 3WEOA 2OW6A 3L5IA 4L37A 4ZFOL 4YPGB 2NSQA 1FO0A 3X14A 2GJ6E 4S1DC 1NGZA 2Q9OA 5I75C 2UUDK 5BVJB 5DA4A 5E9DA 4LGSB 3UEZA 3V9EA 4UNTA 2WXFA 4PTTB 5AW7B 2VW7A 1C16A 1FFNA 2VZ1A 3N43F 4J8RA 3KL5A 3ARUA 3QG6B 3DOIA 1PS3A 4QTFA 1TTRA 2EKJA 4OGQC 3GBDA 4L5FH 1P7QD 1N7MH 2FZ3B 2Z4QA 1GC1H 4B53A 2IANB 2VMFA 1CFTA 4TNEA 1S7VA 3FUKA 4AT6A 2ICCA 3SD2A 2HKFH 2NNRA 5E23A 4HJEA 3OLIA 4FG4A 4AENB 1D2OA 2CJSA 3FB7B 4OD2B 1Q90A 4I89A 5D96B 3HBQA 2HJLA 1I8UA 3M1BA 4OF5A 4Y19D 2J1YA 1A0QL 4MS8D 2Y6SC 1T1WA 1ZIBA 3X13B 1QW9A 4HEMA 4XP1H 1DQJA 2ESVA 3OPZH 4F8PA 4HUUB 3DURA 3VXME 4DVRH 4ZMVA 3ROOA 4BZ2H 3B7UX 3FQXB 4MNHB 2CUAA 2R4SL 5CBEA 4D8PB 4G8GA 1L9NA 3GK8L 1MCSA 2DBLH 1CGXA 2YD4A 3TO2B 3B3IA 3VI4E 4QOKE 1ZIAA 1WAEA 4UDTB 4E9VA 1SFDA 3UTTB 4F2EA 3FZUC 3D12B 1LE5B 5E6ID 3NH7H 3BPOB 1JZEA 4XI5C 3U1SH 4NRYB 1MREH 3EJJX 4NO0A 43CAB 4AUYA 2EUWA 2ETWA 2FJFB 3NTCH 3OHMB 4NZTH 1YEFL 4AGQA 3O0RL 1UM4L 5BVPH 1XCTB 2GUOA 3TV3L 3JUYA 3HAEH 4HH8A 5JXED 1QYGH 4BFJA 1L3NA 4ERSH 4PY7B 4ZFFB 4I48A 2EE0A 2KLRA 2UWEA 2X12A 1HVXA 5DZJA 4K9EC 4TN9A 5A6IA 4O4YL 4JFOB 1BBDH 1X5LA 2L7JA 4BQCA 1AR1C 2DWYA 5EZPA 3VXPA 1SY6L 4G6JL 1GYCA 4IU2A 3DYOA 5IMMB 2D9CA 5CJBA 1CD8A 1J1OL 5TTRA 4LLDB 2BY1A 2QGCA 1BQLH 1QBMH 2QL1A 4PJAB 4Q6YA 2DMHA 4LFHG 2VM4A 2X40A 2J8UF 4UTAA 4XX1G 1KDJA 2ERJB 5AB1A 5J0BA 1FN4B 2EDLA 2GW5A 2D7NA 2IDTA 5MENA 4M8QA 1LM8V 4D7PA 2VXTL 2YD9A 4PCSA 1SYSB 1FVDA 4PJCB 1FFQA 1CL7I 3LN5B 5IHUH 3JXAA 3BI9X 5LCVH 2VLJD 2FGWL 1KPUB 2I5YH 1Q8MA 3VXSE 1Q9KA 4JRXE 3U36B 2CJUL 3SDCB 2F74A 2X2IA 4J3XA 4CU7A 5IFHL 4KNTA 3QUMA 4DTGL 5GSVA 3VVVA 5ES4B 2WTRA 1ZPUA 5EU5B 3BPCA 4X80L 3U30B 3X12A 4YZFF 2C9XA 4OGZA 1L7IL 4M00A 5T5FH 4NIYE 1DVFD 5KYYA 2J73A 2LABA 3OM3B 4JO1L 5EOQL 4KQ0A 4GRWF 1UWFA 1TCRA 1XSIA 2RTTA 2E47A 3C6LB 5FGCE 4PS4L 3T65B 4ZAKB 3ZE2B 4AMKL 1XWVA 1KC5H 3DX9A 3MO1A 3P3TA 3I6GB 3VXUE 3K1DA 4WUUE 3C8KA 2X4PA 4L9DA 3WSQH 4LLYA 3FL7A 5DJXB 2VXSL 4MS6A 5E51A 4AYDC 4H8WL 1UD2A 3RQ3A 1T66C 4ZT1A 1B3JA 2BCKB 3C60C 1C5DA 4PH8A 5KJ4A 4F20A 2DQJL 2AS5M 1YVLA 4LLAA 3L3KB 5TPWH 5FYKD 3QDJB 4D0DB 3N1MC 3TXAA 4HG4K 3QNXB 5ITFB 7FABH 1D5BB 4MBRA 4J6IA 4MXWH 1JHLL 3SGDI 2QR0A 3UYRL 1DQMH 4CDGC 1KIUB 3QEGL 5AKTA 2ZYIA 5DJ6A 1XZ0B 4OCLC 5DJAA 1U6AL 5B8CA 2NY6D 1QSFE 3U2SA 1TO4A 4HV8A 1ILUA 3U4EA 3DTXA 2DDQL 5I9QC 2QSTA 3CC1A 4PJHE 4XMLH 3EO0B 4W4OA 2X4OA 2ZYHA 3MUGA 2APSA 3AY4C 1MCBA 3FB5B 1IAOA 4RGNB 4ZOCA 2JJTA 1Z1WA 4HIIA 1MNNA 5BCAA 1S9YB 2IF7A 2OJZL 2VDNH 5I6NA 3IKCB 5E9AA 3UADA 5INCA 5CN3A 4BKLA 1UB6B 3WEBA 5BV7B 4U1SA 5C0GB 4M6OH 1LE9A 1T0PB 1FRGL 2W0FA 2Y3AA 5DJ2B 4JFHD 5L6YL 2LE9A 3NEOA 1D5MB 2GI0A 2QDWA 1NOAA 2ZSVA 1JZJA 1RJLA 5E4IA 3ZKMC 2QQLL 4PBDA 4FLOA 4FNUA 3CMGA 3TL5A 2I9TA 1NMCC 1P1ZB 1RIUH 1K6QH 2Y07H 3N9GL 3CSYB 3FT2B 4N25A 4PJ5B 4JPKH 2JVUA 1SEQL 3ZQWA 2V2WB 2QHLA 3MOAL 3W11C 3ETBJ 2NUPB 3PP4H 3FONB 1QR4A 3HS9A 2A77H 2NQCA 2O26U 2V2XA 2W65A 4OQTA 1DVTA 4G9DA 1I85C 2F54B 2QELA 3D50A 4G8FB 3SBQA 5G5DB 1OSYA 4HS6B 1AQKH 2FGZA 4ZX5A 1G6RH 5MEQB 1ND0A 3QWRA 3D85D 4TNFA 4L0ZA 3UJTH 3L4YA 1CGYA 4JZJA 1KB9J 3L13A 2A7BA 2P26A 1CFNB 3AACA 4K94H 3BRFA 4GXUM 2EVGA 1JPGA 1CICB 1QHQA 1CXKA 4DN3H 1H6TA 1IGJA 1Z3RA 2AJ3A 4WWNA 4UTBL 5AVRB 1ADWA 4MNGE 3FO0H 3BUPA 4OZGB 1E30A 1I7TB 3DOSB 1L5GB 3WNLA 1ULVA 4WTZA 1IAIH 3RNKA 4MQXD 5J8OA 1MFNA 5JLZA 4HCRH 3DUSB 5HPMB 3PABB 5IFJA 4PJ9C 2J4WH 1HOCA 1VCAA 2ARJQ 1LO3L 3WS3A 3UC2A 1B0IA 3CBKB 3WENA 2HX7A 5I2IA 3RWIB 3COOA 1ZT1B 4FQXD 1S5HB 3QJRB 2XVLA 2VDKB 1SZNA 4NI3A 3RVTC 1G6VK 3M17B 2EC8A 4XPTH 2EIJB 4NKMB 1KB5H 3OG4B 1NGWB 4F57L 1U8NA 1B90A 2OI9C 1YUKB 2CLZA 4G42B 4PLJD 2F8VA 4KHTH 3FCTA 2VDPB 4TNGA 3CU7A 4QHMA 3EF4A 3KGSA 3QJFA 3EYFB 1SJEA 3MOQA 4W9FC 5GGQL 1JVOA 2EABA 1C5BL 1OCOB 1U8CB 5K5YA 5CD5D 4H7VA 2B1AL 1HZLA 2F68X 5EOCJ 3QEHA 1YY8A 4PRHE 3V4PL 2G30A 4N90E 3VI3B 2R0LH 3FUDA 4LSRL 4LKXB 2WLIB 2WV3A 4P5KB 5IROA 3V0VA 1NBQA 1NCAH 2JFCA 5TDPB 4KUCD 5D7IF 3L3JB 1JJUA 5JPMC 2VDKL 4NJAH 3FHQA 5IWLC 3MRMB 5KOVC 4LGRB 3EUUA 4Z7VF 4X5XA 3KWVA 5H2BB 5T3XH 1OZTG 1DBBL 3MRGB 1GZHA 1MCLA 2H2PD 4DVBB 3NCBB 4GRLD 3NABH 5C3TA 4LLMB 4PS7A 3BP4A 3MSPA 3EHBB 2XVBA 3BSHA 4FULA 4ZFGL 3CHPA 1P0SE 4HIPA 5EOTA 3VFTB 5IT2L 3N04A 2YAFA 5LGHL 1H3WM 1KCRL 2H47C 5J13C 1EHKB 4IDLA 3H2WA 2LAGB 4XNYH 4PREA 4PJ6A 4CGTA 5BMFL 3BUTA 1G4RA 2BPBA 2X28A 3OVUB 1T3FA 3II3A 5H4YA 4NPYA 3VFMB 3MRKA 3QJSB 1PLGL 3AY2A 2FQDA 4BZ2A 2X1XR 4WI5A 1KJ2H 1SLXA 2IDUA 2HTLC 3D30A 4AQ1C 4L8CB 1QQDA 1RERA 3D3VE 2B3IA 3LH2L 2OAAA 4Y4KA 4G59C 3QRGH 3LOWA 2PLTA 2YD0A 3ABZA 1CXFA 1Y07A 4IOSA 3TN0D 2LV4A 5EIIA 1VHPA 4M7LL 1W0VA 3KYMA 1WC7A 1IBGH 5F7EL 5DXWA 2XU9A 4KQ3L 4LVEA 3IPBA 4BA0A 1RK1B 4D0CB 1ORQB 4EUPA 3O0LA 3L9RB 3FF7A 1Z5LA 2F5BL 1FC2D 4IRJC 1UKSA 1DVUA 2XTSA 1UQSA 4HXBL 5D1ZD 3AWGA 1NJ9B 5FUZL 3HAEA 4DP6X 3CSFA 3IM1A 4JAMA 3KGUA 3OXSB 5HDLA 4BQ6A 3QNYB 3O9WB 3N91A 1DUZA 3PV6A 4BIKA 1Q0XH 1UT2A 3BN3B 2Y24A 1AO7A 4Q0XH 4JKPH 3EG9A 4Y5VA 1OCZB 5K1JA 1F4YH 5D7KD 1J0KA 1GPOH 1U8QB 3EDDA 4YQXH 2B59B 3ULUD 4N2LA 3PQYE 4M7ZC 3ATAA 5BRZA 2YWYA 5GRYA 2EYSB 3DX4A 4L5FL 2ZOKA 3RL1A 4L1HA 5DO2D 3UGXA 3VWKA 3W82A 3TFBA 1OHQA 5KSBF 3S3JA 3LEYH 1JF1B 5LCVA 3FQNA 2X2HA 4YHYC 3H9SA 2HKFL 5D9SA 1HXYB 2QPFA 3UG3A 4P2OB 3ABKB 1DL7L 3AG3B 5A43C 5KS9E 1MFAH 2CIKA 4R6UA 2XN1A 4ODBD 1FZJA 2PCFA 1E5AA 4RRPA 4UOW0 3DROB 3GJEB 3OPZL 4PJFA 4K07A 1AGDB 1DQKA 2CHDA 2CNZA 2P5WD 5T5FA 1W72B 3MQIA 2IDCA 1IE5A 2FECL 1QOKA 1A7NL 3O2VH 5F7KC 5BOZG 2C34A 2DBLL 1KGJA 5DRZA 1A25A 3ARFD 3EBIA 3EJPA 4AQZA 1MH5A 5HGDA 5KBKA 3V7AG 2LU7A 2WIIB 1P2CB 4WWKD 1KIRA 1E67A 3U1SL 1P5UB 3QIUB 3WJJA 1INQA 1T80A 1YJDL 3P11L 4HSQA 2CGZA 3NTCL 4NZTL 1KOAA 4WEMB 3DBXA 4L8SA 4R5TA 1UA7A 2D31B 2JCWA 4E0RA 4Y1AD 2DQDH 3V4VH 3FBKA 3M46A 4ZMWA 3FTXA 1JXDA 5E5MA 1J5HA 1MCKA 3GSOA 5T33L 1QYGL 4ERSL 4PSPA 1PJWA 2NDGA 4JM2A 5DHXB 5C1MB 4L0YA 3NCJL 3ZDYF 3F12A 1FBIH 4JHWH 4QRTB 1JWSB 2ARWA 2Y69B 5AZUA 4ZZFA 4EZJA 2AJSH 3NFPB 5F3HB 5MI0C 1KY7A 3SCMD 2A9BA 5IB5A 1JVLA 2VKWA 4UYQA 2ZKHH 5HDRA 2A74B 3ERXA 1A4KA 2XQYA 3GSUB 3KDMA 1RSYA 4IRSC 3FO9A 2MQGA 1ET8A 4PGDB 2VYRE 5D1QC 4AK2A 4NQDE 5D2LB 1YEJH 1QACA 1ZGLA 1Z3GL 4OZHE 4A2GA 1S7XA 2Q20A 2HTKC 3ARXA 3V9CA 3MV8E 3D25A 3ELAT 1WUNT 2AVGA 4J3OH 4Y9BA 2BY3A 1KG0B 3BSZH 3VXRB 4NQUA 4WO4C 5F0PB 4EXKA 5IHUL 4PVNA 5E8OA 3HNSL 3KPOB 2I5YL 2OBGA 1QBLL 4J3OG 4HK3N 4TXVB 4FQHB 4LVNC 4G6MH 3B2DC 1TETL 2WJ5A 3UJJL 2JKSA 2OL3A 5I74C 4Z95H 2YK1H 3LKPA 4WIQA 3EOYG 4LZKA 2OJEB 4FQPA 4MJJA 4MD0A 2DLEA 2PTUA 3O41A 1OHZA 1SFHA 4KK8C 1O9VA 3BKMH 1LWHA 5FKAA 1NCNA 3FQUA 3KWWB 8FABA 1MFDL 3MBEB 5IGXH 3MA7B 5DVMA 1RK7A 4I9XA 1I7RA 3K6DA 2FO1A 1KC5L 2CIIB 3IU4L 3PWJA 3HI6L 1XVSA 3MODH 3QWOA 4JZOB 4Z7WB 3WSQL 2WBJA 3ZKNC 2ZXCA 2EC9T 2FWOA 1G6RA 1KULA 4R7XA 1U91B 3OXRA 3E2HB 2ITDA 4JY5L 4M62H 4NQVB 4Y16B 1TQCC 4KFZC 3A3YB 4LP4A 3RY5A 1MXGA 1B4RA 4OKVB 2CPUA 1JAEA 1H5BA 2X42A 3BVDB 3NFSH 4IGBB 4WUKL 4TQHA 1KJMB 4G6FB 3DO7B 4HUVB 1IM3A 2MQCA 1HQ4A 1IMHC 5TPWL 2W8CA 1G0XA 2E7MA 4HJGA 2NSMA 2B3RA 3UTZA 3P3RA 5HHNA 7FABL 1WHPA 4EBQL 1MJJB 1CE6A 4KK9C 1F3DH 3GSXB 4NAMA 3HUJB 3BWUC 1P84J 4LNRB 2JIXA 2ZD0A 1DQML 1YQVH 4JRYA 3FT4A 2H3KA 2J1ZA 5ISZB 4BQBA 4RCAA 2ZQKA 2NNAA 3KPNA 3RKDD 1X3DA 5DZ9A 3R06B 2MWCA 3FULA 4YSQA 1E27B 4U1JB 4HQQL 1HH9A 4XMLL 4X9BA 4M5YL 2RMNA 4Q56A 3WN5A 3FU9A 3NCXA 1SJMA 1JD7A 3H0TB 3VGBA 5K9QI 3SDYH 4J2XA 2VDNL 4WW1B 2CA4A 1KB5A 3QDGB 5D70L 1KDIA 4ZG1A 1N59B 4I0CC 3IVKA 4M6OL 2E6QA 3Q2VA 5E8DH 1ACCA 1IIIA 4TV3A 4OVUA 5F96H 5PAZA 3TBVA 2C1OA 1DDHB 2EVHA 3RUGF 4W9DC 2TSAA 1FVCA 2OMTB 2Y2TA 4YHZL 4HUCA 5JHLH 2AJXL 3FTYA 2P1YA 3P4OB 2DQGH 1GZQA 5E1HB 1ES0B 3LEXA 4P4KC 4QTHB 1QA9B 1Z7JA 4H5SA 1J5DA 1RMFH 3LRGA 5I5RA 1BLNA 5KZCB 2COQA 4FCHA 3RPKA 2A77L 4X4XB 3L1GA 3TCTA 1J87A 1OVZA 4YN3A 5GGRA 3RTLA 3W57A 1ZDSA 2P24B 2EXWC 1AQKL 3MNWB 3WEXA 1HYSC 3QYCA 2B1HH 3T09A 3UJTL 4RFOH 1HI6A 4NQEA 1HHKB 4Z3JA 2NR6C 4LU5H 4OFVA 3ROLA 3FC8A 1JPFB 1E4XH 4XZUA 4U1GC 3WEAA 2BVOA 1FLTX 1FSKB 2Q1EA 5IJVA 4MXQD 5G2NA 3LYRA 4KROD 3MNMA 3AGWA 2XTJC 3MLVH 2CG9X 4NUPA 1AIFA 2JB5H 4LVOC 1QASA 1L9TA 2V7NA 3EJSA 3O81A 4J3SA 1SDDA 1IAIL 3DRQA 2AZUA 2XY1A 1JFQH 3MRHB 3PAYA 5FHAL 5HHVL 4EIGB 1F13A 3BD4A 4HCRL 5FA4B 2JWYA 4C47A 4X9HA 1KJ2A 4UT9H 1MEXH 2J4WL 4N9OB 3N0PB 4A67A 4FA7B 5FHBH 1IC7H 4HWEH 2L7UA 3U1PA 2W9EL 1A9EB 3U9UB 4D7BA 2G9HB 4KDWA 3O6KH 4NC1C 1QI5A 1EAPA 3P4NA 3PNRB 3T0EB 1IZKA 2PR4L 4ZXBD 4FXGB 1KB5L 1RH8A 4ZDHB 3UAFA 3X1FA 3MXWL 5GRUH 2BS9A 4NZRH 3V6OE 3WTWA 5DJ0B 2Z91A 3CHRA 2E7HA 5FO9B 3GHEH 5DC0A 3FRUA 4MTMA 1FHGA 2OSWA 3AGVA 3QT2A 4ADGA 4AM0Q 4M6NH 2BSRB 1BVLB 1CC3A 3G04A 2WK2A 3MNZA 1NC4D 3Q8EA 5FUCC 3S96A 2JELH 3V0FA 5HGAB 2IV8A 3WO3B 1WBYA 5HJGA 3F58H 4GQ9H 1RVFL 2DWEA 1KXQE 4RISH 4TL5A 4NZUH 1L9MA 4OLWH 4GEIA 2R0LL 2Y4SA 2PWFA 5IROC 1KLFA 1WA1X 2J2ZA 1BJ8A 1E9PA 3V5HA 1IC4L 1FYTB 5LDSA 1WGVA 5DVPA 4NJAL 1OWWA 4Q9CA 4DF9A 2FJGB 5BZWB 4N26A 5SX5K 2EEDA 5HHQB 5T3XL 2FUQA 1AC6A 2Y06H 3HG4A 1QPXA 3MACH 4MCYB 2GJZB 4QHNA 4UM8A 5HGHB 3EF7A 5BXFB 3QIWD 1JGEB 3TBSA 4O00A 3DSNB 1PX8A 1XDTT 1AD9A 2QPSA 3P9LA 5DMGC 3G5WA 4ODWB 4TPRH 5BJTA 3WNJA 2GTZA 1KYDA 2IBBA 3T0BA 3H2QA 1U8MB 4UMGA 3VFNA 1GW0A 3D6GA 3T4YB 3GSRB 3WTTA 1P7KA 1NAMB 3G5VB 2CPCA 5F7MC 4ZFZA 4ADIA 4XNYL 5I8KH 3KR3L 1EJ6A 3QUYD 1INEL 3CXDH 4E9WA 3RIAK 2Q86A 3TPUA 5AAWA 5ILTH 1HL8A 3E8VA 1J9RA 1HDMB 1U8LB 3FYEB 2H2SC 3NGBC 5F71A 4KK5C 3SZKC 4MCNA 2IFGA 2YEZA 4QOKB 5FK9A 5BW7C 1Q1PA 1TENA 5F6HI 2JJWA 1UTDA 5B21A 3SOBH 1MPAH 5EO9B 3CFJB 1XHHA 4J23A 4Y4KC 4YSSA 1CE1H 3EOAA 4P06A 4XPFL 3ZYOA 2Q7YA 5FWRA 3DUUA 1W80A 1X6LA 1IGYB 4U6VL 4Q89A 3GMRB 4PV9A 1I1FB 3IEAA 1YJDC 2AV7A 3UROR 5BZDA 1ACYH 3TJEL 2NY4B 1R1CA 4PRDB 2HJFA 2DF3A 5IJKA 1JWUA 4QYAA 5DD1L 1PCSA 1W91A 5LNGA 4JM4H 3FFCB 1DN0B 5AW8B 3ZL2A 5IVOA 1AHWC 3V4VA 4A7GF 5CILL 3UP6A 3ZT6A 3ZDZE 5FECA 2RH0A 1HC1A 3VSTA 1S7UB 2W0KA 1NGYB 2ED8A 3Q9PA 3K6OA 3DSFH 4JANA 1JDCA 2MOQA 2G5BA 1S7WA 2OCFD 1Q0XL 4WI0B 4WJG3 2AJZB 1LP9A 2B14A 3D39B 1FCGA 1OSZB 4PJGF 4I7ZC 5I1JH 3MFGB 4N2BA 4R5XA 4Q0XL 4JKPL 4MJ4A 4XNZC 5JOFB 3LHPH 1F4YL 1UT1A 1V3JA 4DP0X 1GPOL 4HJ0C 5T1DL 3MLRH 1MFBH 4ISVA 4KRPC 3O3EB 1T04B 4Z78A 2FWSA 3CU1A 4NYLB 3VH8G 2YPKA 3SDDC 4ZPTB 2O5ZL 3HJEA 3DRTB 4P57B 3CFEA 4KNSA 4QD2E 3DK2A 4XNAA 5TE7L 3BSZA 3S88H 3PDGA 5GGUB 5IESL 3VXSB 5I1EH 4LPWA 2CK0H 4DEPB 3I50H 4G5ZH 4O2FB 2APBA 1TQBC 5FV1L 1CLOH 3HC2A 4EMZA 3AT9A 1MFAL 4M8RA 4ES9A 2ZSWA 3L3HA 3NK4A 2HN7A 2VKXA 3QEQA 5C86A 5DUBB 1KIPB 4ODVH 1VKXB 5F9WC 2EH8L 3KPSA 1A47A 3OKEB 4KKLC 5CXPA 1ZLVH 4DPAX 2DW5A 3BQUA 3JQOB 1D9KD 2KDGA 1DBKH 4L1DA 2LOEA 1QBAA 2NT1A 4K3GA 2C1PB 2F1AA 5EUOE 2BFGA 1HNYA 2G60H 4G9FD 3TA3B 2YPVL 3DMMD 4MQSB 3LXAA 2EP6A 2XPYA 3O2WH 5D7LA 1DJXA 3D09A 1NTDA 4GLRH 5DT1H 2X89D 3T6WA 4L9LC 5IB1B 1T6WA 3QH3A 3HB3D 5E03A 1SM3H 3AITA 1J0IA 4JG9A 2IXQB 4PMEA 4ORGA 3IRZA 4FJ6A 3FU8A 4Y2DA 2K0RA 5LAPA 4X6CB 4Z7NB 2ZOUA 1O5PA 3AS2A 2LU4A 4X4YB 5EBWB 2ATPA 1V55B 2O72A 1SLUA 4JM2C 1XH0A 1L6PA 4OM1H 4WGVB 5IQ9A 5T3ZE 1BX2B 1IGMH 1TT6A 4JHWL 4ONGH 3RP1A 5JPNC 4KOBA 1MI5A 1HSAB 1AQHA 3GJFA 2ICWA 2V5YA 4JO2H 4QRRD 2ZKHL 3BHBA 2MCPH 2Z0UA 4PJHB 4DO4A 1JGUH 3APFA 3IS0X 1SDAB 2CRIA 4HKXA 4AUJA 1YSOA 4OCRL 3VTAA 1E5UI 4IEFB 4FTVA 4UQCA 3BEWB 4XNQB 3WTUA 1TJXA 4PUBH 5K9JL 4U2YA 2VR3A 3D69B 3X3GH 4AIEA 1KENH 2GEEA 4GKOA 1WTGT 5DI8B 1T20A 4S1DD 5EU3A 2WWNA 2Z34A 2I7SA 2BIOA 3CPUA 3U2IA 3TEWA 4U7KA 5TH2B 2AF2A 4UT7H 4X6BA 4Z95L 2PF6A 5F8RC 1GA2A 3CE1A 1NIEA 5HYJA 3RDTC 7TAAA 4XN2A 3GPEA 2AQTA 4HW6A 2CKBL 1Q9WB 4FTDA 3H2PA 3NCMA 4MJIA 4M93C 1IFHL 1S7SA 1E6JH 1AI1L 3QQDA 1M7UA 3MLXH 3KPQA 4OJFL 3GMLA 3EJYC 3FAXA 4UBDC 4OZIE 2Y25A 4IS6A 2EECA 2VO5A 3RPIB 5IGXL 5DVLA 2ICEB 2P5ED 1G7LB 1YMME 5C09A 4PR5B 3MODL 3PAUA 1RULL 1WS7A 2Y6SD 4U6XA 2X0UA 5CWSB 4ABVA 2ZF9A 4JG0H 5GS0L 1DBML 4OLYL 4DKFL 5DD5L 3KYNA 3MRIB 3PGCB 4MSWA 2G5RA 2F53A 5EU6E 3BVTA 3NFSL 2O30A 3SPJA 2BXZA 2DLGA 3KM2A 2C4FT 4XVTL 2RQ8A 1CFVH 5IVNA 2X09A 4DKEH 2MEJB 5EO1A 2PYEA 5CEYB 3FCSA 5D4IA 3JTTB 4MCZA 3MFFA 3FZUD 5FM5O 3TVMC 3GMMB 1E8ZA 3HPJA 4HDIA 3SBWC 3FQTA 4WK2B 4XI5D 3WIFA 2X3BA 3NOIA 5IBUB 5T1KD 3FT1A 5FO7A 2N56A 3QXDB 3IN2A 1KZQA 4WI8A 5JIPA 4NAJA 3ZBMA 2XN2A 4F91B 4CC4C 4NNYA 1XGQB 3D0LA 3S4SG 4ZX3A 3MC0A 3TBCA 3P69A 3WN5C 2OW7A 3FCBA 4WEEA 2NW2B 3DX8A 4ACPA 3LS4H 2VAAB 1JUFB 1R24B 4DKAA 4XGZA 2UVEA 3TIEB 1QLEB 1N12A 1X9LA 4RMRA 3KPRB 5E8DL 4AKOA 5SWQB 3NCCB 1AGFA 1LMIA 4X7CC 4W70A 3FAWA 1BD2E 4X6EA 5E56A 3DETC 4IOFC 5JHLL 2MNWA 2NY5H 1SEBB 3MV9E 3K1KC 3PJSB 4XOBA 3UH8A 3WKNA 3QUKB 4HUXB 1C9SA 2UXVA 1ZXKA 2A9NH 2R2HB 4P3DB 3KPPB 3SDXE 3QWQB 4XP9H 4YL4A 3L7FA 1CYXA 3L4TA 3R4DA 4FQLH 3FT0A 5LKNA 3O4LD 2XPGA 2YQ3A 3QORC 3WIHL 2YA2A 1J9QA 3BO8A 1KXTB 5E95B 1RUKH 4GSRA 1XIWB 4B7IA 4ZW5A 2VLRA 2B1HL 2G9KA 4P2RA 1UA6H 3JWDL 4K73A 5BV7H 3PL6A 4RFOL 4ENEC 1NDMA 2PXYC 3N50A 4PPTA 1N6UA 2UX6A 5F21B 1DN2A 4GW1B 2VLKA 4FP8H 4AV5A 3SY0B 1TFHA 1IAKA 3J2PA 4QPEA 4LEOB 4NDMA 1KCSL 3WE6B 2IAMA 2GSMB 2QQNH 2YPLA 1ZK5A 5CGTA 3MLVL 4GI8A 1XGPB 4J4PA 1QHOA 2EO9A 3BWAA 3BZ5A 5ID1A 4F7MB 3O6LL 1C5CH 2AGJH 2CXKA 3GXNA 2VERA 4K23H 4KZEH 1JFQL 1T66D 1YN7B 4UT6H 1SBSH 3PWPD 3C60D 2SEBA 2NXZB 3F83A 2YA0A 3TFKC 43C9B 4E5XB 2LGNA 4M03A 1MEXL 3QISA 1UWXH 4UT9L 5IF0B 3WTXA 4BA8A 1ZY9A 1QUNB 5FHBL 5B38B 4HWEL 2D7MA 2EVFA 2NMSA 5DRNA 2XFGB 1J8KA 5I76B 2A6KB 3RFZA 3V6ZB 3SPCA 3BGAA 4F93B 4HKJB 2VQ4A 3INOA 1GR7A 1URLA 4D9RE 1TEFA 4IMLB 3T04D 5AW6B 5LQBH 3E3QE 3BZ4A 1S7QB 2EXYC 5TFSH 4PGEA 5I5MA 3X3FH 2RALA 1EEZA 2XWDA 3OGOE 5C0AB 2X0WA 1ADQH 4AITA 2H8PA 3LH8A 4LCWB 3GM0A 4M6NL 3WOVA 3ULVL 1G9HA 1L9QA 4Q52A 3VD3A 1XCQA 1NFDA 4FF9A 2VJ8A 3B83A 4HALA 3OLEA 4PLKC 4RISL 2HSIA 2EIZB 4HFUL 4JY4A 4OLWL 4PSRA 3T4AC 3O2DH 4OJEH 3RKPA 4MQ7A 4AIOA 2MCG1 1TJGL 1U3NA 4R2GB 2V17H 5JHDE 2JXMB 5JIDA 3QO0B 3ZKMD 3UPAA 2GY7B 2A99A 1OO2A 1OGAA 1R4XA 2L3BA 4CN6A 4K0OA 3RWDA 1JCVA 2JK5B 3MLTB 4ZX4A 3W9EA 5DVKA 2ZX6A 2Y06L 1HHGA 3O45A 3MACL 3ILQC 4KXDA 4CAGA 1VAHA 4BHUI 1FDLH 2V7HB 4HPYH 2XWTB 4F27A 3CJJA 3W11D 2DI8A 1J8HA 3NPSC 1WF5A 15C8L 1CD0A 4YIQA 4GY4A 2OXGB 4LLUB 5F6IB 2EUZA 4MFHA 2X9XA 1E5ZA 4DGUA 2W07B 3B9KA 1BCIA 5M94B 5I82A 4PRIA 1ZHNA 1JOIA 4KGJA 2OM5A 4K9JA 3CXDL 4JNXA 5ACLA 3QP3A 4IKIA 5AAWC 3TEYA 1XCXA 4YPGA 3BT0A 2FTAA 2ZCZA 2BVPA 3B2UC 3HR5B 1NEZG 2R2EB 3VGAB 4K2UH 1G9EA 5BVJA 2YHGA 4F37F 4B7LA 3SOBL 4PTTA 4LDOB 4PRPE 1U4FA 4OKDA 2YN5A 3B9EA 3QG6A 2O6PA 1BZ8A 4HCIA 1GGCH 1ZHBB 2YSTA 3BLBA 2J8HA 3M7OA 5EBLA 1AS7A 2IANA 3EFOB 1ACYL 3I3BA 5CN1A 5DURB 4FKKA 4PJ9D 1BP3B 4UINL 4LSPH 4AENA 4JM4L 3FB7A 2XSKA 5DTFB 5CLXA 2BO0A 3HJ0A 3RVTD 2QZ5A 4QAWA 3RGVB 1EAQA 1WHOA 4HUUA 4Y5XB 4ZMNA 3G08B 3EUDA 5D1XB 2VLJE 2B4CH 4MNHA 3U4AA 4AQOA 3FQWB 4PG9B 3O8XC 3TO2A 4GYBA 4V1DB 3W37A 4N8CL 1EHXA 2YD1A 1M57B 3CBJB 4NQDB 2OMYB 3LHPL 4Y4FC 3UTTA 1OAYL 1VIWA 2J71A 1FORL 1NANI 2IC2A 1LE5A 3F7PC 4OZHB 4NQXB 4N0UE 3MLRL 1MFBL 2WXJA 1OCCB 4OTXH 2J7LA 5C08B 43CAA 3LRSB 3B2PA 2FJFA 2P5PA 3CXHJ 3DHJA 3ARGC 2W94A 1RZFH 1ZWIB 3F6LA 4J3OC 2XICA 2DZEA 1H8SA 4PRBB 1XCTA 3TT3H 5D6DA 3ARBC 2ZAIA 1OTSC 2PTVA 3DARA 2CK0L 4WGKA 2F8OA 3F7RA 3FUIA 3I50L 4FRWA 2Q8BL 3LRLA 4OLZH 1KXVA 2ESVE 2HFFB 2XQBH 5DJZB 1USQA 3UTSD 1CLOL 3MLSH 4Z77B 4ZFFA 1OP5H 4KXAA 5C07D 4L3CB 4G8GE 5AOKA 3HZMB 4JFOA 4YBLB 2LR4A 4NFDA 1YNLH 4D9QE 5LBSH 4DGYH 5JYMA 3HN3A 1QFPA 5IUCA 2O93L 2R2BA 4X4KA 5IMMA 3F6JA 4OY9A 1BOYA 2VN7A 4LLDA 4AYGA 4F5CA 1KFAH 4Y7MA 4PJAA 3VDCA 2G60L 4P9MH 5DWUH 5LHDA 1O0VA 1TJIH 1NIFA 1FLRH 4JGNA 1WRFA 4GRWH 3GIZH 5GS0C 5DT1L 3CLFH 2ADIB 4O5LL 1SYSA 4B60A 2FBOJ 2P4AB 4PJCA 3T1FB 3LN5A 4P2YA 1WFUA 1SM3L 2YN3A 1EFXB 2HTLD 5JR1L 1GIGH 2GK0A 3U36A 2YFOA 3T2NH 4BKTC 5EUOF 2VITA 4BINA 3N5AA 1CL7H 2E7BA 3HE6C 5DMIL 3RILA 4OM1L 3DXAD 1PFCA 4TNVK 4YWGH 4AQ8C 1T7WA 1W72H 4ONGL 4JFHE 4LESA 3BC9A 4EXPX 1BXAA 1NM9A 35C8H 3H4FA 2JMRA 4B9ZA 2UXGA 3C6LA 3CCHB 4XBGB 2BOCB 1XTLA 4IRJD 1DLHB 4ZOEA 4ZAKA 5HJ3B 5GS1B 3I6GA 4QHLB 3OKKB 4XPAH 2F7RA 3LPOA 2ATKA 3LXCA 5DJXA 3BE1L 3PHQB 4PUBL 4ELMF 4FQJH 2HB0A 3EYUH 3PDOB 4KKRA 3X3GL 2BCKA 3S8WA 4X83A 1KENL 3FMGL 2IOOA 4FMFA 3MV7D 1QFUH 3L3KA 3MROB 3OGCB 1DJSA 3AUWB 2VTFA 2BY2A 4N2EA 5HHXL 3S2CA 4D0DA 5E9DD 4IOIB 1UT9A 5AVUB 4QGTA 4YHOL 2XZAH 3QNXA 5ITFA 4OZFB 1HHIB 1JPSH 1A4AA 3VCLB 2R0WL 1G7MB 1N6QL 5TQ2L 1WEJL 4UT7L 4OCMC 3U6XS 4RIRB 3HFMH 1KIUA 2V6HA 1XZ0A 4AH2B 3D9AH 4TNWK 1MW2A 5C0RH 1J05B 1TNMA 3MLXL 3OHXA 3SGDH 4HEPG 1UYWH 2FSDA 3QRBA 3SE3C 4L4JA 4RGMC 1EXHA 5F9AC 3EO0A 1JIBA 2NYYC 4ZOAA 1UWGH 1MJ8H 3S36H 5AW1B 4KFMA 3UJIL 5LB1A 4BFOA 4GOSA 1JXGA 1S9YA 3IKCA 5I30H 2IVFC 4XPHL 4RMUA 4XMTA 5IB2B 3MZGB 3JWDC 1UB6A 4JG0L 1PPIA 1CJYA 1ZCRA 2A9AA 5C0GA 4N9GB 1FL6B 5DJ2A 4S0HA 1D5MA 4NKOB 2D3JA 3WFCH 1QO3B 3N1PC 1BZ9A 4OZIF 1NKGA 1CFVL 2F0CA 4JFED 1TKWB 2GIYA 3AQDA 4WAFA 5TF1H 2NY3C 2Z92B 1P1ZA 3UP1A 5HHMB 4A7SA 4FHJA 3CSYA 4PJ5A 3WUWB 2I24N 5JOPD 1U3ZA 4JCLA 1JXKA 3ZGIA 1D5IL 2NUPA 4TM9A 4S10A 4UT6A 2VXUH 3FONA 4OLXH 4XP6H 5IK3B 2W9DL 5LNEA 3ABLB 4OI8A 4L48A 3THMH 2F54A 2YMXL 2VDQB 4G8FA 1OOAA 5G5DA 4HS6A 2YXFA 4F9PA 5HYSG 2BIHA 4OI9A 5MEQA 4Q4IA 4ADJA 2IG2L 5IM7B 1X5ZA 1RIVL 2ZF8A 1CFNA 3LS4L 4YSDA 1SVZA 4U3XA 1IC0A 5JUEH 4LHJB 2MPAH 3VA6A 1CICA 2P47B 4JB9L 1RZJL 1UXSB 4YAQB 4IRSD 4NZDA 3ALPA 4GMTL 5D1QD 4I18C 3K71B 1ADQA 4OZGA 2MCMA 1EHLL 1KCBA 3DOSA 1L5GA 4DIXA 1RU9H 2NY5L 2HTKD 3MJ6A 4JMXA 3DUSA 4J7RA 2A9NL 2JKJA 3PABA 2YZ1A 2R1WB 4XP9L 4NCC2 4WO4D 1C8QA 3OQRA 4FEMA 3LMJL 4UAHA 5D93B 3HBZA 4FQLL 4J5VA 2BNRB 1BM7A 4MMXB 1A3RH 1ZT1A 4Q9BA 4AE1A 2C9AA 3WS6A 2JLLA 5HDOA 3L4VA 3BXNA 1RUKL 3FQRB 4NKMA 4M1CC 1NGWA 2KBGA 1CFQB 4XH2B 1UA6L 2EE9A 2VWEE 3T3MB 4KK8D 2PUQT 3SDXF 2VN4A 4G42A 2DMBA 5I0VA 2CBQA 3QUXB 3QCTH 2J56A 2XWCA 5KYWB 4FP8L 2QVKA 3EYFA 2YFNA 2N4IA 4ACTA 1U8PB 2WB1A 2HT4C 2XY2A 3RZCC 4LSVH 4YFEA 2IAMC 5C9KA 3U0TB 3OX8B 3M1OA 4FNSA 2QQNL 1R6VA 4X8GA 1T89C 3ZKND 1R3KB 3WJLC 2F15A 2XKNB 3VI3A 1W6LA 1C5CL 2AGJL 4LKXA 1HEHC 1P5VB 2WLIA 4K23L 4Q58C 4UT6L 2QFRA 4P5KA 4XP5H 4ATWA 3CVBA 1WTLA 1KN2H 1RK0B 5TDPA 3L3JA 3SJVD 4LB8A 1AIZA 4GXUN 3IGFA 1AMYA 3V0IA 2COVD 1CFSB 1KCLA 3MRMA 2BIIA 4WKZB 5LN4A 4DP4X 3ZIMA 5H2BA 3N3EA 1OAXL 4Z7OE 4H0GA 3MRGA 3B9AA 2QADB 2WXLA 4KK9D 3NRQA 1PX4A 1U3JA 4DVBA 1QRNB 4FFYL 1BF8A 1E3FA 3T71A 1TVHA 3CFUA 5LQBL 4L3EB 2FE0A 4QLWA 5LO7A 1MWOA 4Y9EA 1P7HL 3TU6A 3VFTA 1FG2B 5FW6A 3ULUE 2XBDA 1GY2A 5FFLA 1TQWA 3MPCA 4DPRA 1ZLWH 1JTPA 4ETQB 1NMAL 1AZZC 2A6DB 4OFKA 3KPMB 4GUQA 3HZYB 5K39B 5TK4A 3VFMA 1OB0A 2FO8A 3AS0A 1KTCA 2JNZA 2BSTB 4Q2ZB 4NQTA 3BUDA 3JBG7 4QT5B 1NL0L 3O2DL 3TEZA 4L8CA 4IBWA 2O5YL 1F58H 1G7HB 3BAEH 3GZOA 2CM6A 3RA7H 5EDSA 2V17L 5IQMA 3QR1A 4P99A 5B1CA 4WQOA 5KYXB 1XF3B 1DE4B 5AG8A 5L0QB 4KPHL 5FIEA 2P5WE 4JHUA 4BZ1L 4M29A 2YUWA 5JDSB 2AJVH 4P4KD 1FDLL 2IIJA 4HPYL 4PJXE 5KSUB 1RK1A 4XCYB 1ORQA 4D0CA 1IU1A 3L9RA 4LP5A 3RI5K 3IMVA 2VSCA 3UAJC 2YJQA 2V8LA 3H3BC 3HG2A 3K0WA 4KV5F 1MOEA 4FLRA 1NJ9A 1R3HB 3NG5A 3AMKA 1HCVA 3OXSA 4D94A 2EXWD 1FE8L 3IDJA 3QNYA 4Y1TA 3O9WA 3Q06A 1HYSD 2Q3ZA 4TUKH 5A1AA 1AKJD 1A4JB 3BD3A 1HEZB 3Q48A 3FRPA 3BJ91 4IDJH 2NR6D 2P49B 1ITBB 3RYMA 1BFVL 3HG3A 1NCDH 3JWOL 5GRZA 2OP4L 1U8QA 2B59A 4AYSA 5KN5B 2BP0B 3D05A 3N1FC 4H25B 3BUQA 4ZUSB 5IB4B 3BFWA 4YGVB 1OOWA 1GGCL 2AQ3A 2EYSA 4LF3B 1OP3H 4OT1H 4DO5A 2XTJD 1KT2B 4N6QA 1T5XA 1NOLA 2X6UA 1X5HA 3MUZ1 2F58L 3QJXA 1ED3B 2CCLA 1ZEAL 1JF1A 1DJIA 1ODAA 5C0DB 1NAMH 1HXYA 4LSPL 3VFUB 4P2OA 4P48A 1Q0YH 2XN9B 3MUJA 3APMA 2J8UB 3QBTB 5EB9A 3LNFA 3J07A 5MEOB 2E5EA 3DROA 3KVDD 1AGDA 5TE4H 4XN1A 5ELIA 5JMRA 4G7VH 4XOAA 1W72A 2B4CL 5DJDB 1I1AB 4PHZA 2CLRB 2V5RA 1D6VH 4DFHA 3FU5A 2XRAH 5E6ZA 5BRZE 3OAUH 3QUZC 1HE8A 1XB8A 3PYCA 5LBGA 4P4RB 3JT0A 5AOZA 2WIIA 1P2CA 1Z9NA 4JFFD 4OTXL 3MRNB 2ZG2A 1TQUA 3QIUA 4FNTA 2C7UB 3BPNB 5KBNC 3QCUH 5FYJE 1VZIA 1UG9A 2JJUA 5FCUH 1EA9C 5IROD 1LO0L 4P2QD 2D31A 2HX8A 2PMZA 1M3JA 1OPGL 4W6XB 5LAXB 4L05A 4X7FC 2ZKWA 4HJSA 4NZJA 4PJFE 4CU6A 3GBLA 4UAOC 2RBLA 3S35H 3VACA 2V5SA 2HT2C 2YXWA 1HZKA 3B4NA 1JWSA 1V7ML 4QRTA 5BNXD 1A1OB 3NFPA 5F3HA 1VCBC 3WGVB 5LBSL 2N7AA 1Q9LB 3SKUD 4AVKA 2A74A 1F11B 4DGYL 1C1EL 4XNUH 2PWDA 4UV7H 1FJ1B 1KFAL 5ESAB 5D2LA 1ZDQA 3VRLE 1BFOB 3LN4B 2HRHA 3P2DA 3TTSA 3NACH 4NIKB 3CN2A 2VN3A 1QD0A 1AFVH 3GIZL 4GT0A 3FHAA 3TBTB 2X4NB 5CINH 3VB9A 5J12B 3C09C 1KG0A 1I1YB 3CLFL 2VRKA 4L4VB 3VXRA 3FPXA 5IVXB 2DYPD 2H2SD 1KGIA 4KK5D 5C0CB 3KPOA 5DHYB 3DOHA 1GIGL 4FQHA 5FYLH 1GY1A 1K9TA 2ADJA 5T1LD 4FYRA 2OJEA 1CL7L 3QE5A 2ZX8A 1G0DA 3KH4A 1B9KA 4XVOA 5IJCC 3H9ZA 5ADPL 4RX4A 3F3HA 4YWGL 1CDHA 3VWJC 3LVTA 4GAYB 1AJ7H 2GT9B 2V9TA 4LAQH 2G3XA 3PGFH 2JKWA 4L4TD 2HT3C 4H0IA 1LGVA 1AAJA 3KWWA 1QFOA 5I1DB 3BH9B 3MBEA 4X5PA 3MA7A 1CBVH 2EIKB 2UWEF 5C0BB 3FT3B 3BPLC 5JA9A 3CLEL 4BSVB 4JZOA 2V37A 4Z7WA 3S8FB 1KIQB 1U91A 4NQVA 4K7PX 4Y16A 4N68A 4FQJL 1ZLUH 4OKVA 4R4BB 2Y6TE 1F97A 4IGBA 3NDYE 2GBVA 3DO7A 1KJMA 4HUVA 4FL4B 3NSYA 1E65A 4LFHD 4OCXH 3WY3A 4Y4HC 4S1SH 4HOZA 1OSEA 1O9WA 2KHAA 4HJ0D 1JPSL 1MJJA 3MV9B 4KRPD 3EBAA 3GSXA 2OYPA 3HUJA 4LNRA 2NY5C 5AENA 1PNDA 4EIBA 3SDDD 1FG9C 3NCFB 3HFML 5ISZA 3H42H 1FGVL 3B7YA 3D9AL 2K6YA 3UIYA 2Z35B 3OHXC 2XX0A 2OMZB 4BGDA 1UYWL 2DYRB 1E27A 3AG4B 3FTSA 4IIQC 4U1JA 5A2LH 1NC2A 3H4HA 3WMSA 4AG4H 1MJ8L 3H0TA 1EX0A 4PEEA 4NQCD 3KDPB 3WAKA 3QDGA 3KXFD 1N59A 3P4MA 12E8H 4KKLD 4BFGA 5ESVA 1WBZB 1KGCE 5FKPB 1A6PA 1F0LA 3WFCL 4XCFL 1DDHA 1VLXA 3C2AH 3WGUB 3UMTA 1OEZW 4KHXL 4YXHH 2WTPA 5AL0A 5FX3A 5TF1L 4JRYE 3OB0H 2JF1A 2XZCH 5AOLA 3AREB 5TF0A 1ES0A 3KJ4B 4P59H 4PVMA 4XE0A 4P46C 4QTHA 1QA9A 5E8NB 3CH8A 1BQ5A 3MXVH 3EFFB 5B7EA 3PJNA 3OKOB 4OD1H 3P3UA 4X4XA 5CCKH 4JW3A 2MH4A 1RUPL 2VZOA 4W6YB 1JZ8A 3EH2A 1CGWA 4J28A 4IBQA 3G5XB 1CQKA 3MLYH 2PO6C 2PPCA 1P84K 3MGOB 5ANMB 4JM2D 5DD3H 2K9UA 1O6VA 1QSED 4NO3B 2Y1YA 4XWGH 4IHOB 2NT0A 1IGCL 1HHKA 4WTWA 3SIKA 1PZDA 3L95B 2QSVA 3EBGA 1JPFA 2PPAA 4FMKA 1QUPA 2OMBA 3JWNE 4B0MM 2MPAL 2LLNA 2CRMA 3P54A 2X5PA 5J1SC 1P7QB 1DO6A 3GBEA 4OCWL 4RFNB 3TC9A 2CD0A 1BECA 1II4E 2H6UA 1XO8A 2R69H 3N55A 4Q6IA 2CWRA 4X0KB 3O3AB 4NUJB 1RU9L 2Z65C 3CSBA 3U7YH 3VMPA 3VDBA 3MRHA 2LW3A 4NENB 5DUJA 4BJLA 1GRWA 1BAGA 2Z1KA 5FA4A 3SHSA 3CHOA 2FX7L 4Y19B 3HIZA 1MCNA 4HWBA 3U4BL 1UOWA 1VADB 1A9EA 3NZSA 4K71B 2G9HA 3U9UA 4DK3A 5I19H 1E9QB 1N0LB 4NQEE 1Y7VA 2GIXA 3QEUB 4U0RB 1I31A 3T0EA 4FQ1L 1RLWA 4FXGA 3FB6A 1URZA 5JXAH 1GTNA 1BXXA 3ESVF 4ZDHA 3RDTD 1T83C 2OYLA 2WLJA 2WVTA 3GXUB 4EO5A 2N1TE 3K7UA 3TCLB 5DJ0A 5JQ6H 1MCOL 5E6IB 2ZUQC 3GXDA 5D1ZI 3EJYD 4UBDD 2BXYA 2BW4A 5E8PB 2BSRA 4Q97A 1CBJA 3SE6A 3GBMH 4LSVL 2ZKYA 1AACA 2XVKA 3GMPB 3W38A 2AEIT 3GRBA 2QBWA 3SPHA 2K8MA 4CBPA 5HVHB 3SKJH 3V95A 4JPQA 2DLHA 4XP5L 4DP2X 1L9RA 3FBQA 1KN2L 1FYTA 2OKMA 3JWOC 5DGQA 4GG6B 1E6OL 3W0WE 2XWXA 4FG2A 3QSKB 4M7LT 3WO4B 3TURA 4X9IA 5H37G 5D4JA 1XEDA 5BZWA 2WQAA 1A1NB 3VRJB 4NC0B 4F15B 3NEEA 4MCYA 2GJZA 4K7PY 3TVMD 1GMIA 5HGHA 5BXFA 1J8RA 1JGEA 2R59A 1A6AB 2YR3A 5I18L 5T1JA 4X6DE 2X2UA 5E99L 3WHXA 2ZAGA 1PLBA 3BVNB 1BM3H 1U8MA 3L4UA 1PLCA 1A6UH 1PCXA 4LSQH 3T4YA 3GSRA 5KBLA 4QRUB 1NAMA 3CG8A 3LDBB 3OR7B 2GFBA 4MVBC 3VYNA 1BV8A 1J9TA 3BMVA 5L9DH 1XX9C 3VXMA 4Z7OF 3S97C 1U33A 4OJAA 2NXYC 2VLJB 4ZSOB 1PZ5B 4R97B 1PG7H 1U8LA 2B4CC 1MHCB 2ZXGA 3CNKA 1Z9MA 4JCWA 4Q7DA 2F1BA 4QOKA 3HNTH 4HBCL 1MCRA 3FTZA 5FYKU 1DZ0A 3SB3A 2V3FA 3BAEL 5EO9A 3CFJA 4PW9A 4N0UB 2JQZA 4JVPA 2DI9A 1DVFB 2J8OA 1EO7A 3GLZA 3DETD 4KI5F 3V0EA 1IGYA 4RSYA 4F1SA 3U9PH 3GMRA 1GGUA 5DUMH 3K4AA 3UG5A 4E9QA 4YSTA 1I1FA 4LEXH 4QXTB 4LHUG 4HK3J 4MAZA 4PRDA 1TZHB 4G9FE 3D0AA 5ALBH 3MRRB 2IALB 2EZ0C 3CN0A 3Q6FB 3FFCA 1DN0A 2G3ZA 3AM8A 4JREB 2YSSB 5HHOE 3Q1EA 3R1GH 2J21A 2XWBB 3BZDA 4WKXA 3QORD 4WSGA 2XV0A 3RY6C 2JI2A 1E5YA 1NGYA 3CN1A 3HE7C 5T3XD 5E5RB 5HI5C 4TUKL 1CPUA 4WI0A 2AJZA 2FIKB 3D39A 1OSZA 3QHFH 2NUTB 4ENED 2PXYD 3US0A 4IDJL 2FT6A 1PKQB 2WLKA 1BZQK 2X4UB 1V27A 5JOFA 5GZOA 1NLDH 1NCDL 1KPVB 3HEIB 4LOVA 4Y5YC 2WN3A 3WNMA 2XQ0A 1LL1A 2D7PA 3VQLA 2B15A 1BVNT 1GOGA 1T04A 2YRZA 3O3EA 4XAWH 4NYLA 1SF5A 3ZDYB 2NY6B 2FL5B 3LPGA 4ZPTA 3WNPA 3T6QC 2M1KA 3CVDA 3DRTA 4P57A 4QRRE 3UX9B 1DR9A 4FLQA 4A7QA 5I6OA 3GSNH 1S7RA 3IBOA 3LZNA 5GGUA 3VXSA 4JRXA 2HLEB 4PV8B 3TFKD 4FX5A 5CSGA 1PX3A 3WJMB 4O2FA 2Q2EB 1VJSA 3MCLH 5D7EA 4K7FB 4YX2L 1QABA 3KH3A 4NFBA 1WFTA 5DJYA 4Q74A 2CO1A 4NXSA 5F1SA 5DUBA 1KIPA 1A7OH 2JKTM 4URKA 4U7SA 1XB3A 2OTWB 2Z7UA 4JHBA 5TE4L 3FTUA 3QPXH 3MV11 3OKEA 4DP9X 4JKWA 3OKDB 4AK1A 3ZL4H 4PV1C 2EXYD 1LQBC 2C1PA 1VZHA 2XETA 1LO5A 2XRAL 4HIJA 3TA3A 7PCYA 3OAUL 1X9QA 4PJEF 4W68A 1XSOA 1TPXB 4F7EB 1MLCB 3CFMA 1WSST 1PZUB 5CGBA 2JKIS 4WJ5B 4N2KA 5TGBB 4U3HA 4PLKD 5IB1A 1AZNA 1PY4A 5IHBA 4OH2A 1HWGB 5C8JB 2MIZA 3NVQA 2JE8A 3SE4A 2EC9U 3L2LA 4ZODA 4AEFA 4DP8X 3IDYB 4GAGL 2CR6A 3D85B 2FT8A 5LLIC 4X4YA 5EBWA 2RFXB 2XXMB 4DQAA 4LOUC 3WNKA 1R5VA 4TS6A 4FFVC 1JZDC 4HHAA 1BX2A 1F2QA 1T0OA 1DBJH 4RDBA 3ILQD 4XRCB 4K7PL 5JIIA 4GUPB 4Z7QF 5E6UB 4YSAA 1CGTA 1HSAA 3QDMD 2A4EA 5G4MA 4FABL 3P30H 1MIML 4PJHA 4MRBA 3NBNA 4UV7L 3ZO9A 1RUML 3BP7B 4IEFA 3GGWB 1VGEL 2WO2B 1I9RH 2GCYB 2NCMA 3P2TA 4M6AA 4PJFF 5C0EB 3BEWA 1UJ3C 5I1KH 4XNQA 1A7QH 5DJCB 1YRKA 3NACL 1MCPH 4MMZC 3D69A 1AFVL 3KYOB 4YO0B 3IFLH 4QAMB 5KOMC 5CINL 1CXEA 2OMUA 2F19L 1GJWA 4FQXB 4IBSA 4MA7H 1ETZB 3B2UD 1DBAH 1GCYA 1WVZA 2EE6A 4HPHA 1BQHG 1GAFH 3ARRA 4L1LA 2EDEA 4FQCH 4JFSA 4P2AA 4JDEB 3GZQA 3HHMA 5TH2A 1G7QA 1MI5E 3WNNA 3CUPA 3VRLF 5KW9H 4OF3A 4RMTA 3MJGX 2HPOA 2F8XC 1G9NL 5D2NE 1F6AB 5DHVB 4R26H 2PCPB 5FUOL 5BQ7A 2V9RA 3ECUA 4H1LB 4XC3H 2DQFB 3V8OA 4JJ5B 1A7BA 4GINA 5DEJA 1YC8A 4TSAH 1FF5A 1NAKL 3RPIA 3NSFA 3GPSA 4JM2F 2E9GA 2ICEA 3NRFA 1G7LA 4MAYA 3LEVH 5DMJB 3GDBA 1EEYB 2AXWA 1AGBB 2WWOA 3LZFL 3NP4A 3NQKA 1ZLSH 4S1RH 1NDGB 3NQIA 4G71B 3CTTA 5CWSA 3ZZSA 1U8KB 3GNMH 4WV1C 3MRIA 3PGCA 4W9GC 1WO2A 3WAJA 1FFTB 4OB5H 1YAZA 1ZVSB 1JZ6A 4IRZL 3O8XD 3PUUA 1ZT4A 3VB8A 4MNGA 5HYJE 4Y4FD 4GRLB 5CEYA 3JTTA 4TTDC 2CMRL 4DSYA 1XXFC 4POUB 1GYAA 4PRNB 4WK0B 2I9LB 3INUH 3QYMA 1ZVNA 3GMMA 4MJIE 3L3OC 3BWSA 1M42A 4RWYL 3QJHB 4HMCA 1D7BA 2ZOWA 3ARGD 1CXLA 3QXDA 4H44C 2I7OA 3H42L 4J3OD 2QZQA 2FLMA 2N7BA 4OF7A 3HC0B 1T2QH 5C09E 3MJ9A 3ARBD 1OTSD 1I8LA 3HC4H 4UIMB 4LGPB 3MN8A 3ZHNA 1XGQA 4UQ9A 3RHWK 3US9A 3DX0A 1UZ6F 3TESA 4RZCA 4AG4L 3JV4B 2JQAA 2Y7LA 4UQDA 2Q8AH 4ABWA 3HKFA 4JFYB 1JHTB 2AZAA 2NW2A 2XBZA 4OIBA 4FDWA 5K59F 2VAAA 1JUFA 3HS0B 12E8L 4JRFA 3TIEA 3HPLA 3Q5YA 5E2TH 2EVIA 3KPRA 4I9WD 1M6UA 4TTGA 4OZFH 3S3DB 3TN0B 3C2AL 4Z3GA 4XP4L 1Y0LB 4YXHL 3N0AA 4ONHB 3WXVH 1OM3H 4QKTA 5HY9B 4PRHA 3NESA 3PJSA 3ZDXE 2XZCL 3B7RL 5D7LD 3QUKA 5LWYH 4AC2A 4HUXA 1MAML 4R5VA 2FIRT 4BFKA 2JTDA 2ILLA 4P3DA 3KPPA 4P59L 5D1ZB 5GS0D 3MXVL 1OAZH 2ISDA 2Y5TA 2AITA 4JQXC 1I3GH 4CMMB 1V5JA 5CCKL 5F7BA 4YXLL 2H0FA 3WN6A 2YAPA 3O6FC 4JJHA 1GZPB 1KXTA 3IJHA 1XIWA 3HE6D 1N8ZB 3O3UN 4JQIH 2P45B 2XPZA 3FOMB 4XWGL 1T03H 4R90L 3HHRB 2OCJA 1IKFH 3H85A 4LPYA 2VRAA 1HXKA 3TZVA 4LEOA 1C08B 4KTYA 3WE6A 2AK1L 4XO9A 4BFIB 4QIRA 4UI2A 4CGUB 4KZDH 4Y2NA 4Q6IC 2J57A 2VLME 2R69L 2IV9A 1XGPA 3STBA 4F7MA 3U7YL 1UWYA 1A1MB 3L5WB 1YN7A 1SN5A 1JWMB 2VL5B 3D3VA 43C9A 4E5XA 1UWEH 1A14H 1T7YA 3ZL1A 1L9PA 4E41D 5B38A 2R0KH 3S5YA 1RZGA 1I9IH 2YA1A 1R75A 4AMWA 2PW1A 4P2RE 2P5WB 1TJHL 5I76A 2A6KA 3EJCA 5E4OA 2GJRA 2FYVA 4HKJA 5MERB 2WHVA 5DHMC 4IMLA 2FQEA 3DA0A 4TVPL 2BM3A 5E6RB 3ARFB 1S7QA 2IWGA 4KKCC 2DEXX 2A3TA 2F6AA 2EDWA 1H3PH 4WWKB 4XMPH 5C0AA 2YS4A 5GZOC 4FYTA 4LCWA 1T21B 4BFFA 5AW4B 1CIUA 3GBML 2NYYD 2Q3AA 2Z64C 4ZMYA 3WHE1 4MDIB 5ICXB 3KNBB 2EIZA 2FRGP 4JVWA 4Y1AB 4AGLA 5GRJH 2G75B 3F7VB 2F53D 3CQQA 4I0PC 5IHLB 3M07A 4JO4H 2DQHL 2JXMA 2MTPA 1L6XA 2E6PA 3PQYA 2BVQA 2DQEL 3ZE1B 2PYED 3PU7A 3OLGA 3FB8B 2JK5A 3MLTA 2NY3D 4KKAC 4E9LA 4M5ZH 1MWAB 3SCMB 1HEJC 1JK8B 3VDAA 4GKLA 2V7HA 4X50A 2XWTA 5IW1A 1DDTA 4DQOH 3L54A 1J5OH 3GSQB 2OXGA 1CD9B 4LLUA 3LPWA 4FXTA 3UIZA 2AEOA 3TTYA 5KS9A 1A6UL 1NFDE 2W07A 1YC7A 3QULA 1HIML 3GKWL 1D5ZB 4OD3H 4EZKA 2ZTBA 4DW2H 2F61A 4W9EC 4IIZA 5EEUA 3L6FB 1ZT7B 4FZ8H 3MCKB 1HNGA 1GW6A 2HAZA 4TQPA 1PG7L 4XNXH 1PYWB 3HR6A 3RL2B 1CDIA 3HCVB 1F1DA 1OGAE 3HNTL 5E0FA 4Z0XA 3UTSE 2O6CA 4X8JB 5C07E 4G7RB 1DSWA 1NBYB 1MWAL 4Z7UE 5I8CB 4P5SA 1K3ZA 1T4KB 1ZHBA 3GB7B 3AWEA 3ULVD 2HFGH 2R23B 3NIFB 3SO3B 4KITB 3CQPA 1X5XA 4H8UA 5DUML 1MCIA 3V79C 5L88L 3EFOA 4LEXL 5CUSL 4XAKD 4HIHB 3IJ7A 1MG3C 1ZJAA 3MV01 4KTDH 3WFZA 1NCCH 2IQ9L 3JYBA 2JSFA 4WF7A 1J86A 5ALBL 1TU2B 3PPSA 5DHEA 2CDEB 5DTFA 5KJ7E 1EMTL 3SPVB 3HZ3A 5M7QA 2ALWA 1S5IH 4AYID 5I1CL 3WKQA 3RGVA 4HT1L 2ADGB 4Y5XA 3G08A 5D1XA 4HKBB 4M1CD 4OLUH 4QWWC 5ADOL 3HMXH 4HJIA 2DL9A 4G6AC 3FQWA 2ADFL 2X44D 3EO9H 4PG9A 3QHFL 1RP9A 4MZIA 5EN2B 3U79A 2XV6B 3CX5K 4V1DA 3O6MH 1RPKA 1KYFA 2GIMA 2OMYA 4NQDA 2YWZA 5AKRA 2FR4B 2OLDA 1Z5HA 1EANA 4DN4H 1V7NL 1HU8A 2HT4D 2IANE 1KN4H 4NQXA 4OZHA 1CVSC 3RZCD 2IAMD 1KTDB 5C08A 3LRSA 4NUMA 1YPZF 4U33A 2OR8A 3K5RA 3GRGA 1ZWIA 1CGUA 4J6RH 1HZHL 1NANH 4PRBA 1OWRM 1JZ2A 3GSNL 1TR7A 2YGNA 3LQZB 1AXSA 1N70A 4F7CB 1CVRA 1I3UA 2HFFA 4NPJA 4F9LA 4Z77A 3ZTNL 1M1SA 3N85H 4FC3E 2NYKA 3AROA 1S3RA 5F1OB 4L3CA 4ZOBA 1NBVL 4MXVF 4WTQA 4PS8A 4QDGA 3HZMA 1G9NC 4WU5B 1A5FH 3UCQA 4HLJA 5JORB 1B6UA 4MWFB 2KH2B 3QPXL 2EVJA 3ES6B 2P44B 4AE0A 1OLZA 3UTTE 4JHVA 5C92A 2JI1A 3K3QA 2D7QA 3ESMA 3V0GA 5DQ9B 2D9QB 3CFBB 4M43L 1IVLA 5TE6H 3LKRB 2OMNA 3CIQA 4ZW8A 4AL8H 3MYJB 1Z9SB 2J1XA 3QZWB 4NQSB 1EBAA 4N1EA 4KO9A 1LP9F 5LGKA 4R3SB 5BOPA 2ADIA 4F33B 3GI9H 3T1FA 3PNWB 4ZUTB 5CS7A 3K2IA 1WD8A 4TVUA 3UMNA 1RI8A 5DC4B 3KBPA 1SUJA 1PJ9A 4OSUH 4ZO6A 3GO1H 4ZD3H 3CSTA 1BAFL 3VX1A 5T3ZH 3M8OH 3VNZA 1UCTA 4AVIA 2C9RA 1XR9B 2YUVA 3KCWA 1OAQL 4X5LA 1PD1A 1VFAB 4LSTH 4B9PA 1A7RH 3WNIA 3T0VA 1WAAF 2ZYSA 2YAMA 3NJJA 5J5EA 4PGCB 5EN3A 1BZ7B 1O7VA 2WWKT 4GSXA 3BIAX 1HCYA 4PJAE 1AXTH 1T7VA 3VXTB 4EF3A 1J8HD 4GW5A 3CX2A 4JFEE 4KROB 3CCHA 4XBGA 3H1ZA 2BOCA 3UAJD 1WITA 1DLHA 5HJ3A 5GS1A 5DS8B 4NM8H 4U1MB 4F1ZA 4QHLA 3OKKA 1VSCA 5AG9A 2GB2A 4MLSA 1ZXQA 5JOPE 1FL3B 4I88A 4PJCE 3PHQA 1A7QL 2LLLA 5BOJA 1MCPL 1WUZA 1OARH 4YK4B 3PDOA 1DUYA 1KCVH 3WEMA 1Q1JH 3QR2A 3N42F 5DMKB 2FX8H 2D03H 2C9QA 4MA7L 3IETB 3MROA 1XBDA 1CYWA 2RCSH 1GAFL 3A6BH 4IOIA 4R4FH 4ZXBB 4LSUH 3U9WA 2H9GB 4OZFA 2Q5BA 3CVHB 4AVJA 3L3IB 2MNJB 4X5WB 1G7MA 3MRFB 3AUVA 1JGDB 5KW9L 1P7BA 2EO7A 2FBJH 4RIRA 4WW2A 1CI5A 2C26A 4AH2A 4R26L 4FXKB 3UZQB 1MQKH 4GXVL 3WFBL 4XC3L 3ZE2E 1KBVA 3MRQB 1WAPA 3FU3A 1BVKB 1J05A 4YHKH 1NC4B 2RD0A 1X7TA 4GBXC 5D1QE 3QI9C 3VFWB 3WD5H 3QFJD 2ICEC 1JXJA 4MAYC 1EZUA 3D48R 3F84A 1L7TH 3WFDH 2XWEA 4B5ZA 3BFOA 1JPTL 5FDWA 1S2EA 4S1RL 5IB2A 1I7UB 4TOYH 4JQIA 3KLKA 4LE8A 1TLMA 3IAGC 1S46A 3QDJE 3SPIA 4N9GA 1FL6A 2E7LA 4NKOA 3T0WA 1QO3A 2E27H 1E7UA 2NY7H 4APQD 2W81C 4HC1H 4HKZB 3CVHL 5CJQH 1QBBA 3RTQC 1JTOA 1CDGA 2NY1C 1TKWA 3QIWB 3QUZD 2Z92A 3QYNA 1K5NB 5B39B 3P02A 1KBPA 1HCFX 2E74C 4N2CA 5GGTA 1ZHLA 3WUWA 1FL5B 3VFSA 3OKLB 4QEGA 4ICXA 1AC0A 5MEPB 2Y7OA 5DR5H 1E4XI 4J3BA 3ZSSA 3OQ3B 3QUYB 4B41A 1LK2B 4LPCA 4RGNE 3BKCL 4OVVA 2EDRA 1LVEA 4NLAA 1QSZA 3TT1H 1UENA 3O4OB 2BNQD 1EXGA 2YRPA 5GSRA 5IM7A 4XVJL 5AW9B 2HT2D 3GI8H 1E4KC 2CA3A 1DJYA 4AKPA 1LD9B 4HU2A 4IU3B 2AI0H 2K7QA 5B7MA 1JYVA 1DFBH 2BMKB 2ZCHH 1BOGB 2J6WA 4CKQA 3RIFF 1E40A 1TF4A 5E2TL 1UXSA 3QA3B 3V55A 1JHKH 4H0LC 4YAQA 4PP1C 5SWSD 4L8BB 2DQUL 3K71A 2L4OA 3QQ9C 4EIUA 2KMWA 4DJMA 1XT5A 4Q14A 2ROYA 1F3JA 3MREB 4F92B 5LWYL 5F9OH 3UO1L 2VR9A 1CDCA 3ARWA 5ICYB 2R1WA 5PCYA 2F54E 3RB5A 3SGKC 3ZPDA 2W80C 4N0RA 1LO4H 2BNRA 2K6ZA 3PWLB 4HJJL 4MMXA 1KV7A 4CADB 1BBJA 2BP3A 2CUMA 3BOVA 3L5JA 25C8L 2Z8RA 1F5WA 1QLRB 1Y6NR 2BSED 1VESA 3SYAA 3EDKA 3FQRA 4M48H 3BN9C 4JFZL 3RWHB 3B5HA 4X6DB 1SHSA 4XH2A 3VWJD 4I13B 3S34H 4LLQB 2YQGA 2ZXDA 3FSOA 3IRCA 4ORZC 3QUXA 2HT3D 3IGAB 4OZGE 5KYWA 1PL3A 4OIIH 3TZVC 2ZXEB 4PIRF 1U8PA 3AMLA 5KTEH 2YGPA 1AY1L 3H3PL 1HOEA 3N41B 4XMZA 3OX8A 1C12B 2Q7NA 1UOKA 3CK0L 1QZNA 4KZDL 3LQAH 2XKNA 1CS6A 2XTLA 4CSSA 3ET9F 4XBEH 4BK5C 1DSFL 1P5VA 1YEDB 1M56B 1QRKA 2KLSA 3E9UA 3P40A 1OB1B 4A2HA 2BSBA 1RK0A 4XVSH 2VSKB 1UWEL 2MTAA 3EH1A 4KMTL 1EVUA 1ZVYA 1CFSA 2J12B 4KVCH 1B0WA 2ODHA 2LQRA 1UACL 2R0KL 4WKZA 2FSEB 4XB7A 4Y4HD 3UG4A 4N2HA 1BYOA 1QZ1A 5A2KH 3UTPD 1O75A 4OCYL 4U1LB 4UILL 1BVOA 4C59B 2NY2C 1D9KB 2GHZA 2AK4D 1JBJA 1G1KA 4UWQB 1MFUA 3HOGA 4JPIB 1QRNA 4KWUA 2YXMA 4XXWC 4G9FB 4L3EA 2H3NB 5L2JB 3UBXI 3DMMB 1FZKA 1WDAA 3B1UA 4Q9RH 3BAJA 1FZOB 4URTB 3RJDA 3CD4A 4ETQA 4RMQA 3ME0B 4M7JL 2WZPD 2A6DA 3C2SA 2BW5A 3GSVB 2OTUB 3HB3B 3KPMA 3VFPB 2XKUA 3HZYA 5EEVA 5K39A 3CHSA 4FYSA 5D6CB 1U2YA 2BSTA 4Q2ZA 1IEAB 3HMXA 3PWUB 1H15B 4QT5A 3UTQA 5J7CC 4WNJA 4JO4L 1G7HA 5T8IA 1HK6A 4FXLA 5DYOB 3ARTA 5KYXA 4NN6B 5EV7A 4X7DC 1UZGA 1PTZA 1CD1B 4I3RL 2ITEA 1NH6A 4M5ZL 4FQIL 4QRRB 2N0KA 1J8SA 1X44A 3I6LE 5A40E 5JDSA 3BAWA 3VGGA 3AADB 1ZLEA 1UFUA 4P46D 5KSUA 4XCYA 3HRZB 5GRWA 4DQOL 4P0DA 2DM2A 3PY9A 1J5OL 3IJEB 3AB0B 5C6PB 2PWGA 4MASA 4BV1A 4EN3C 4C55A 1OT1A 2DPKA 2IQAB 3KYAA 3B2MA 4JJOA 5FB8B 5I73B 3S5ZA 4GQZA 5E00B 2PO6D 5CJOL 3I3EA 4OD3L 2R4RH 5EC1B 4DW2L 2G3NA 5KVEL 3D18B 4DK5A 1IAMA 2YXVA 5I75B 5LXGL 3CPLB 1ZTMA 2VQ1B 1A4JA 4JQVA 3QJUB 1HEZA 4OFPA 4P2QE 5GGSY 3WDIA 4JKNA 1TZOA 1XF2A 2R8SH 4QHKJ 3SKMB 5BRPA 3G5YB 3ZT5A 1WIOA 2QVMA 3QO1B 2IAAC 2X3CA 3WBDA 5IEKB 1NFDF 2JV6A 3ZN6A 5J9PB 2BP0A 4H25A 4HD5A 5KN5A 2NYZA 4ZUSA 1GS8A 5IB4A 4YGVA 1UGKA 4CDHA 5JO5A 3W3BA 4LF3A 5TQ0H 3QIBA 1KT2A 5IMOB 4X9GA 1KJVB 1K4CB 2WO3B 1ED3A 1WA0X 2P5EB 2WINB 4KTDL 1JZGA 5C0DA 1NCCL 1WD9A 4HXAH 4BXVA 4AJ0A 1RIHL 3LAFA 1ZAGA 3CFQA 3N44B 4YMPA 2J8UA 2WGNB 5C6WH 1FAKT 3CFNA 3DO4A 5HP5A 4UQIM 2KLTA 1NCBH 2KUTA 5CM1A 2E9JA 4YOKA 2IFFH 3QNFA 1VFUA 4FHKA 3GRWH 5DJDA 4OLUL 3SGEI 1WFMA 1I1AA 1WBXB 2WKGA 4KXZI 3FJTA 2P8PA 1RZ8A 4EZMA 3EYSH 5FO8A 1A7PL 2CLRA 2EDNA 2WNKA 2IBZX 2EILB 4JPSA 3SGJA 3UC0H 3T1WA 3VXQB 1MHPH 4ANWA 4P4RA 2A73B 3HG1D 5I71C 4HUMB 5T1KB 5C3IA 3WLWC 4DN4L 3DIFB 1QEXA 1M6OB 5T1MB 2A9DA 1KN4L 2P7TB 3I9PA 4F8OA 4LRIA 3MRNA 2C7UA 3KLAB 4L4TE 3E0GA 3CZUB 1CUOA 1ZANH 2BS71 3KLQA 1I8IB 2IH8A 2VISB 3KCPB 4G43A 2R29H 1MVFA 3HZKB 1T0MB 4GT7A 3P3SA 5LAXA 4MNQD 4F9LC 5CJXC 1J1PH 1JYWA 1IEHA 3N85L 2PR9A 3VM7A 2AABH 3C5SB 5D2NB 3EGDB 4CNIB 2N59A 3VTMA 4ELMB 1DJHA 5D55A 4HOWA 5FYKH 3QDHA 1H8OA 1WIPA 5IOPA 4DAGL 1F11A 1PEWA 1N4XL 2QSCH 3ARDC 4Q4EA 5JNYB 4AMXA 1FJ1A 2DTSA 5ESAA 4CU8A 3DYMA 4MVBD 1OD9A 4A6YL 1BFOA 4AL8L 2DIEA 2C3VB 4FMVA 2FEDC 2EDOA 2CNYA 5F1NB 2VIRB 3UBGA 2NXYD 3TBTA 4QTIL 2AW2A 1I1YA 4L4VA 3GI9L 2CO6B 5IVXA 3FUNA 2GBUA 3O4LB 1IQWH 1SVBA 1TNNA 3KPTA 2ORBH 3DKHA 2LFEA 4G1EB 5GGSB 3LY6A 5DRWB 4OSUL 2CJTA 4JE4B 3RRQA 3GO1L 1VACB 5HSFA 1MNUH 1NFIB 2YBRB 1U3HD 3LKSB 4G8EB 1YQ2A 2XV2A 2EXTA 2APXA 1KGWA 1ZK9A 2XXCB 4GAYA 2GT9A 4ZTEA 4UTAH 4G2AA 5DEGB 5CAYB 5ID0B 4WFHD 1E50A 5D2LE 4YHML 3BH9A 4OUOA 2BRRL 1M7DB 2EZ0D 1CQYA 4WHYG 3FT3A 4PJBB 4JFXB 5K93A 3FO1B 5HYEA 2OTPA 4BSVA 2O6FA 1N18A 1X5JA 1KYOJ 4QRPD 1UADC 3F7KA 3PWPB 3C60B 3VXRE 1B9ZA 3OAZK 4J3UA 1KIQA 3HE7D 5HI5D 3WTYA 4PY8I 3QUMH 4ALAH 2PP7A 4R4BA 4LDCA 4RBPK 2HLFD 3F04A 4EPSA 2WGXA 2QTVA 2D03L 3DX2A 4O02B 4PJAF 5E2WH 1EH9A 3A6BL 3CIAA 1G94A 1ZA6B 4R4FL 4FAAB 5ETUB 4WFGE 1XR8B 1S3KH 3MV9A 3ZDXB 4TQ8A 1CG9B 3NZHH 1WFOA 4PJCF 4H4NA 2FBJL 1EDQA 2M2DA 4WW2C 2LVCA 1KWKA 1CLYL 1T0NB 3MOBL 1AVAA 2J6EH 3H8NA 3K2MC 4WI7A 5I9QB 3ZUNC 5DK0B 2Z35A 2NX5D 4KI1A 3Q8BA 3K8KA 4YHKL 3TYGH 4Z7WE 2OMZA 5ERWB 5HJBA 3SZ6A 5I17B 1J5IA 3WD5L 4ZRGA 2WZ0A 2VDOB 5EPMB 3PPEA 3IAPA 4WNQB 5E9NA 3EYQC 3BZFB 3MX0B 4Y2OB 1RZ7H 1MAKA 4I0KA 3EH3B 3WFDL 3EO1B 4N4YB 4LVHC 4RRPM 4J8QA 4B9JA 2ED7A 4TOYL 3EGSB 1NUDA