2O6PA

Crystal structure of the heme-isdc complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
GSDSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Iron-regulated surface determinant protein C
publication title Crystal structure of the heme-IsdC complex, the central conduit of the Isd iron/heme uptake system in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6pA00
2O6PA 3QUHA 2E7DA 2ITFA 3QZNA 3QZOA 4NLAA 2O1AA 4MYPA 2ITEA 3QZPA 3SZKC 3QUGA 2K78A 3RURA 3RTLA 4H8PA 3S48A 4FC3E 3VUAA 2H3KA 5D1XE 3QZLA 3OVUB 2Z6FA 5D1ZI 3SIKA 2MOQA 3SZ6A 2Q7AA 3VTMA 4YMPA 4WJG3 5D1QE 3QZMA 4H8QA
chains in the Genus database with same CATH superfamily
1Q9OB 4GPVA 2AQ2A 1XEUA 5IB5A 1ZT4B 1R3IH 3HCVA 5I2IB 1J0YA 2Q76A 1KGWA 4LVHC 3VGGA 1MFAH 3JTTB 2FH8A 4HEME 4OCLC 5JW4M 2ODIA 4NSKA 5MERB 3H55A 3VFOB 5F3BB 3GSUA 3IGAB 1KWGA 5I1LB 3D3VB 2AXGB 2F74A 5K9QI 1GS7A 3ECBA 5FO9A 3ZE1B 3NRQA 3ZE2B 4Z7OE 5HJ3A 3BD4A 1JTPA 4JMNA 3CN0A 5FV2A 4UBDC 3U7YL 3IGKA 2E9WA 2DWEA 5EIIG 3S5LB 2JTDA 4B5EA 1SHXA 1PZBA 1VFOA 1X5HA 3ZVVA 1U3HB 4WFFE 4XNQA 1RIVH 4OCSL 1TTAA 3VVWA 1DCEA 3FTWA 3BOVA 3DUHA 4X4MA 1KC5L 3DSNB 4ZMYA 2I7OA 1CTNA 5IB3A 4ZW5A 1D5XA 1TYJA 1ZLUH 2H6PA 5IQOA 3QCUL 3TBTB 1RZIB 4NYLB 1TZGL 4NX0A 1E5AA 1I1AA 2JJUA 4PJGA 1JZ8A 3NRPA 3O6ML 1OLLA 1FVCA 5EU4A 1DLHB 4N26A 2WZPA 2HRGA 2C3XA 3VE0B 5DLLA 2QQNL 2VJ8A 3C6LD 3CPLA 4JL1A 3S88H 2Q7NA 1P4LA 2OJZH 4N8PA 4ZOEA 1KPRB 3RTQB 4NQUA 3SZKC 2EUZA 4B7LA 2DYSB 1RZJC 2EIMB 1D9KC 3ARVA 2QQQA 1C16A 2YBGA 1SM3H 1YNKH 3ESNA 4KKLD 3KLAA 5EN3A 4JAMB 4H8WL 3CUPB 1KY6A 4W68A 5IHHA 2HWZH 4B41A 4HJEA 5C08E 3JUYA 1BZ9A 1RLWA 3AU0A 5JQIB 5DS2A 1CFTB 3BVDB 3TH3T 1DBJH 1P2CB 5F7NC 3MXVL 3KH4A 4FXKB 1AYRA 4AC2A 2Q86B 3CLFL 3D33A 1N26A 2CWRA 3IFOB 3L3DA 3MLVH 1NFDE 1RQ5A 2I60H 4MA1C 4XB3A 1ND0A 4Z7VB 1DYZA 2VT0A 4AMKH 3FQYA 3EO0B 2CO7A 2NY4D 1S7XA 4HC1L 4LP4A 1XTLA 4HP5A 1BIHA 3QJOA 5FW8A 5BS0B 4MS6A 2CKBA 5EO9B 2XY2A 1DVYA 1J87A 5DQ9A 4N2AA 3CVIL 1OLZA 1ZV2A 4ZODA 2X40A 5CZKA 4NENB 4OCXL 1DJWA 3L1OH 4WW1B 5H8DA 5LGYA 4JM0A 5CJQH 4OZIE 3CZGA 4LEXH 3L5HA 4BGDA 3GBEA 2VRQA 1N3NB 1JUFA 5TK2A 1PLGH 2YD0A 4OUUA 4OIBA 1FNGB 1UJ3A 4NN6C 4PJEB 2C9VA 2IDQA 4KTGA 4PRAA 1PKQB 2EDMA 5E8DH 1X7QB 2GSMB 1TETL 3IJEA 4ZSOE 5BRZB 4NO2A 3S96B 5L2KA 1FL5B 3HC3H 2AQTA 3D69A 1KTKE 4YDLC 4B6ZA 1WIUA 2B1HL 3GT6A 3SQRA 4KY2A 1GAFH 5H37G 3VXNA 3V0IA 4MNQB 1J5CA 3EYFB 2AK4B 3A0OA 3QFJA 1AKPA 5FUCE 3DX7B 1K9TA 1CLYH 2N7SA 2PCPB 3SDAD 3O3DA 4FG6C 1H3TA 3FSAA 1UB5B 1P6AB 3BH4A 1MCLA 4LP5A 3VXOA 1QR4A 1WICA 3ZJAA 5D6CA 3TH2T 2AJSH 3C8KB 1LO0L 3N40F 4HPOL 5FXCH 4XC1L 1FZMB 4NRXB 5AOJA 3H8NA 3MV01 2XVGA 4ZDHA 2BHUA 2GJ6E 1IBYA 1QTSA 4PB0H 1Z5LA 3HNTL 1ED3A 5BRPA 5AVYB 4ODVH 5HI3C 1VGEL 4ALAH 3QDGE 5F9WC 4NNPL 4HXAH 3MCKB 3DBXB 5D7EA 2R4SL 4HIHB 3WN5B 3ZL4H 4X0NA 3MI6A 4BSWB 2GSIA 2V5SA 4UOW1 5CEXA 2D3JA 1N6VA 1EXGA 3ATEA 1MHEB 1EPFA 3EYVB 3CAFA 4OSUH 5HHNB 3SPVB 3U6XS 5I19H 5MENE 1SOXA 4ZUTB 5DZLA 3AU1A 4OGAC 3L13A 2P24B 2VLRA 2WIIB 3F12B 4WKXA 2YXWA 4K7FA 4EXPX 2B0SL 1MN4A 3MV9B 4IIZA 4FLOA 4JE4B 3T0EE 2Y6SC 3BT2L 2I5YL 4XHJC 2QADC 5EB9A 3S34L 3I9GH 4DT2A 5IF0B 1MXDA 2BC4B 4J3VA 1HKLL 3TEZA 4FQXD 1BF8A 4YHYB 4Z9KB 5E9DE 4UNUA 4WK4B 5LAPA 1CG9B 3B56A 3U7YH 2Z8WC 4APQB 2GY5A 3V6FB 1A4JB 1K4DA 3ZXAC 5K9KA 1JVOA 4RDBA 1XAUA 1FNHA 4WCYL 2B15A 2QDWA 1QSFB 5J0BA 4O51A 3T65A 2V7NA 2BNUA 1HJBC 1PTZA 2LU3A 1CICB 5D7IF 5I0XA 4M93B 1P4UA 2Q8AH 4J3OC 4LOEA 4NAQA 1W0WB 2AEOA 4M8RA 3I6KB 3WDHA 3V10A 3RWIB 1TZGH 4BFEA 2O1AA 4Y5VC 4GBXC 4IEFA 4IGBC 1I85C 4FZ8L 3LQAL 4WWKD 5IB5B 3HCVB 1S9YA 1I8KA 2JB6B 2WMPA 2J2ZA 3AAZB 3ZLQC 4HJSA 1NBZB 1PIFA 3GSUB 4N3UA 1CD8A 1Z9PA 2F74B 2K8MA 3PQYA 2QSTA 2YSSA 2JKSA 3ECBB 4AQOA 5FO9B 3FH5A 4FI6A 4UQ3B 1JPFA 1KTDB 2Z34A 3IDNB 1NQBA 4U6TA 2WN2A 4XMUA 5HJ3B 3MUUA 2ZYSA 1ET7A 2AJVH 4O4YH 5IHUH 1XQ4A 1L3WA 4GO8A 4E9RA 3ZT6A 2X0VA 3SBWC 3ZDZE 4H8WH 2HJKB 2DWEB 4Z7NB 3DK2A 5EZPA 2BCMA 4IBVA 4N0UE 4XNQB 3PWUB 3FTGA 2A9BA 2NSQA 4NHUB 5ACZA 4JZJA 1TQCC 4P23D 1A6TB 5I0WA 4W6YB 3MXVH 1DQKA 2X6CA 4EUPB 3A4AA 3CLFH 5KJRL 1YMHA 3ARFB 4MB4A 1G1YA 1LEGB 1TTBA 1FG9C 3BEWB 5TQ0L 2JJTA 4HC1H 3AT0A 4L9LC 3FW6A 4I2XE 4PJGB 1U8JB 4HX1A 3TH4T 2NY0C 3CVIH 3MOBH 5ADOH 1OOWA 3CH1A 4GXUM 4W1TA 1JGUL 5HDWA 1OAZL 1P4LB 3J7HA 2CO6A 2BVOB 1Z1WA 4QHPA 1T89A 2IWFA 4LCYB 5GZNA 1PX4A 3C8DA 3HI1B 3RNKB 1EO5A 1DBBL 4K7PX 4YPGA 1WGOA 4Y1AD 3BLPX 1EK3A 4X5XA 4WZ9A 3KLAB 3RPBA 5AUMA 4AENB 4U4BA 4W6XB 2G75A 2KDGA 3U4EA 4YSCA 3LH9A 3D85A 4GIAA 2D8KA 3FQ1A 1XMWA 3EGSA 2K6YA 3SOBH 3DETC 4KRPB 2ZWZA 3NIFE 3GIVB 5E2VL 5AZUA 1ZVHA 4QHUA 2JCCF 1GZPA 2ESVA 1CE1L 4EN3D 2B1HH 1BD2B 2ISDA 2YEZA 3WIHA 4BM7A 3CFKB 1WVZA 5FS5A 4NKIL 3HE6C 4TUKL 3VXME 4WEBL 1ND0B 3OKLB 2NZ1A 3FCGA 2CG9X 3SPJA 3ULUH 3VUAA 1G7LA 5FYLE 2WBXA 5AAMA 5E5RB 2X2IA 1XR9B 5DS1A 5AVXB 4E41D 5HYJD 3T1FB 1KF9B 2UYLA 4F8QA 1R46A 1D5ZB 5J6SA 4WO0A 3EF4A 3CZSA 5FAAA 5LGKA 2PWDA 1G9NL 2N3JA 4AOFA 3PV7A 4LOVA 5TDNA 1RZGA 3WENA 5IW6A 1NCAH 2E76C 1ZMYA 1V7NL 4UOW0 2B8OT 2WO3B 3OKKB 5LVEA 5E9NA 4Y9GA 3OMZA 1B4TA 4AI7A 4CMHB 1VGEH 2EINB 2JQMA 1A3RH 2UZYB 2X4PA 4MMZA 4NNPH 1NL0L 4NB7A 4PGBB 5A2LH 4NOBA 1QHPA 4F7PA 4LARL 2DJ4A 3KVDD 1VSCA 2ZYIA 2VQ1B 1U8MA 4YHOL 1EAPB 4JHUA 1Z9SA 3V0VA 1WT5A 3N43F 2KQNA 4PRAB 1GTFA 5AB1A 4HJ0C 4EI5A 3IJSA 2XWEA 4HJJL 4NO2B 4JKMA 5FB8A 2OA9A 1WV7T 1ZS8A 2PO6D 4K9JA 4KXDA 4ZX4A 3ZHLA 1XF2B 3T3PE 1I8MA 2B0SH 2BNQA 3LRSA 1U4FA 4H1LH 5CS7A 1U8QA 4B9KC 4NZDA 3VXNB 3S34H 7PAZA 3QSKB 4R4ND 5EZJA 4DESA 5AFAA 1HKLH 1UURA 5F44A 1A1OA 1QWHA 3O3DB 1MLCA 3P1VA 4G7QB 4M6ML 1CDUA 3VXOB 4IRZH 1TJHH 4MBOA 4P0DA 1ZKAA 5HI5C 1CL7I 2WC7A 2HRPH 1NLBL 3SKJH 4JANA 1BSIA 5KJ4A 3RDTD 3VXUA 4HBQA 2J88L 4ZDHB 1TPXB 5INCA 5IGXH 3MZGB 1ED3B 4A6YB 1BVZA 4WCYH 4K07A 1WUNT 3B2XA 2J8OA 3FTVA 4QTHA 1AR2A 3BYYA 5E94B 4AYMC 4E9LA 1MRDH 4XXCC 2HKHL 3FU9A 4JQVA 3LCYA 3MUGB 1SJXA 5A1AA 4YNYA 1SHSA 3QPQC 3HBQA 5GGUA 1DJZA 3SO3C 3QB7C 4DGVH 5SX4H 3MKKA 3FTUA 2C7FA 3IS1X 4YL9A 4OV5B 3EGXB 1S4IA 2Z7ZA 2OXHA 3FZUD 4FZ8H 3LQAH 3HPJA 3TBYB 3MR9B 5KSBF 2GBTA 2XKUA 3FUDA 4NWTL 5SWQB 4M61B 2ZZUT 4M62H 3BDYH 1AS6A 3QIUB 4PRHE 3RWFA 2RFXB 5E5UB 5PCYA 5C0IA 1N19A 3QWNA 4R97C 2H32H 4N2EA 2R7EA 4EJ1C 1FYTE 4IOIA 1RLBA 1W72L 1CFNA 2VLLA 3VGFA 3QZLA 2JIXB 2D31A 3GXUB 1YYMH 1FVEB 1K4DB 3FC8A 2R0WH 2DQGL 1NM9A 3KXFB 1F5WA 3HR5A 2J12B 2V7NB 1L5GA 2OR9L 3QISA 1RUML 2FJGA 4GLRI 4JDEB 1HHGA 3L45A 1SDAB 4XNAA 2WZ6A 4E5XB 3BESR 5BXFB 5KJRH 4UT9L 2P9RA 4RRPA 1WS7A 1AO7B 2WQVA 2K4WA 3BISA 1WFOA 3SE8H 5TQ0H 3EOTH 1AZBA 1NSNH 1SHMA 5LXVA 4YDJA 2MJWA 3ARZA 2JB5L 1HXMA 4HOWA 3W9EB 2NDFA 1S9YB 4DO6A 4DK6A 3CZUB 2X4UB 1MAJA 2I07B 1T1WA 2X28A 2Y2TA 1ZHBA 1MHCA 1OAZH 3AXLB 2ADGA 2NZ9D 4FMFA 3OWEA 3NCWA 1J9CT 5ID0B 4UINL 6PCYA 2NY4C 4TSAH 4PWFA 3W3BA 3LHPL 4ZXBA 2ICWA 2ED9A 1DBBH 2KZKA 5SWSE 1F3DJ 1NIBA 3EH5B 4QWWD 4XP5L 2ZOTA 4JJHA 4PI0A 4CKQA 2CIKA 1J9QA 1SY6L 4I5BB 5C07E 4BSVB 1FAIL 4IRJA 4I1NB 3FTGB 1JF1B 5ACZB 1EO7A 3S4SG 1HHHA 5E2VH 1T83C 5GGVY 3LZPA 5IHZA 4QRRE 1CE1H 1W16A 3KCWA 3N9GL 4BSJA 4DN3L 3VI3F 4XC3L 1A64A 3KL3A 5IG7A 5DRWA 4ZS7L 2Y7QA 1UA6L 1QATA 4R7VA 2C7UA 4OB5L 2KT6A 2F1BA 5JOFB 1AQKL 3MNDA 3VD7A 4ANKA 3UJJH 1M1XA 1H3PL 2AW2A 4AGQA 2R56L 3W11C 4NQEE 1QTPA 1S78C 1NAKH 2J6EL 5LKNA 4RGOH 3DGGB 4C56E 1G9NH 4AE0A 5FDWA 4XXWC 3HRZC 4Z8FH 3IBEA 1V7NH 5AZEH 3FHAA 2H8PA 4YOKA 2ENQA 4MNGE 4PCYA 2OMTA 3OXSA 3P69A 2ZUXA 1NL0H 3F01A 1SZNA 2ALAA 3DV4B 3IJYA 3LIZH 4LARH 5AOMA 3ZRSA 1IL1A 4GXFA 2I24N 3GINA 4X5XB 4L3FA 1TO5A 2ZCZA 5AUMB 1EJ8A 5F88B 1WG3A 3IWUA 1U3NA 4FA6A 3D0LB 3FTYA 1CCZA 3NSXA 5ANMA 5HGDB 4FA7B 4HWBA 1J86A 2GABA 1TNMA 3BZ4A 5IW1B 4PYHA 2Y3AA 1GZPB 4PBXA 4L29B 3K8LA 4LAQL 4WJKB 2CR0A 4G43B 1HL5A 3C6LA 3FCTA 1JYWA 1ROWA 4WJG3 1UACL 3VTAA 5C0JA 4FQ2L 4KROB 4N9GA 3BJ91 3S3JA 5AVZB 4K3EH 3VFUB 4X5RA 1TQUA 2C4XA 5J6HA 1W0VA 3D4YA 2UYLB 1AQDB 2Z8RA 3GSRB 4YK4B 1S7SB 4MA8L 1NLBH 4F57L 4R2GD 4YFLF 5TDNB 2J88H 3O6FC 5EV7A 3PIQA 2F2HA 5EH1A 3D4ZA 1OSEA 1GGTA 5ESVA 4WUKL 3T8XA 5D71L 1VZHA 4QXTB 4MMZB 3B2VL 4YO0A 3SIKA 4F7PB 2XXCB 1MRCH 1CD1B 3DHMA 3SGJC 3MLSL 2COVD 4IOSD 1MCEA 2BW4A 3FQXA 3X1GA 2Z8SA 5D2LE 1YG9A 2DQIH 2QQKL 4KV5E 4PRPD 1KUMA 1CDGA 1ZJAA 3E9TA 4ELKA 2ZXCA 1Q0EA 2NLJA 1E9PA 3BUIA 1MI5B 1XAKA 2D0HA 3GUFA 1CF1A 2ZKHH 4KO7A 4ORGA 3X1BA 3DJRA 3GC3A 3QPXH 4DP5X 1I8MB 1K3ZA 2KDYA 3LRSB 1HL8A 4WO4A 1MW0A 4WK0B 4NWTH 1BOGA 3IN2A 3UZQB 4FX5A 1LQBC 4EZMA 3FSZA 1TSHA 5A40E 1AS7A 2K8QA 1C7SA 3JYBA 4GAGL 1A1OB 5D7LB 1AZZC 4WW2F 3IWVA 3Q01A 1NKOA 2IAND 1GIGH 3ULSA 2YPLB 3G6DH 1JGIA 1ZV5A 3Q2VA 3L3GB 2HX9A 4FXGA 4LQFH 4ONGL 4MD0A 5JHAA 4YSRA 5E2UH 3UTZB 4F5CA 3VXUB 3VQ2C 4Z76B 3H42H 5D1XD 5B1JA 2C3VA 4JFQB 4NQCD 5LNGA 2JI3A 4YL4A 3PUCA 3Q1SL 1WAAF 2BP3A 4IRZA 2IPUK 1ZE3C 2OR9H 3AT9A 4U1IA 3DRTA 1WFUA 1Z9NA 4GIPD 1DLFH 5E6RB 4OZHA 3FT2A 3QP3A 2Q3AA 4F7TB 5IMOA 5KAQF 1MEXL 3AS3A 4LDLB 2C9XA 1H5BC 3SDAA 4Q6IA 4GAFB 3SDCD 1WTGT 2JB5H 4XVJH 3R4DA 4CVWA 2EVGA 5IREA 3ZKMC 2MRYA 1WZ1L 2NPLX 4PRID 3ARQA 3OKDA 3QNZB 5E08L 3UEQA 4F8PA 2CLZB 3HAEA 5JZ7C 1E4KA 2N59A 4UINH 4HUWA 4RAUA 5C0IB 4Y9FA 1RK7A 2FEDD 3LHPH 2D7NA 3GMRA 3T2PA 1F1AA 3BGFB 3II2A 4XP5H 2DWSA 3S0PA 5IEKA 2HFFA 4GW4A 1MFMA 4FTVE 4I13B 4FS0A 4YDIH 3CWGA 3LTVA 5HSFA 3N85L 1N4XH 1GZQA 4JRXE 4XP4L 4G59C 3C2AL 4JGUA 4PW3A 4X9GA 4F8OA 5CCGE 3O6LL 5AOLA 5J6GA 4BYHA 5DURB 1F90L 1FWXA 3WO4C 3MV11 3T1WA 2B5IB 5EZOL 3FF8A 3O11A 3N9GH 5EULV 4DN3H 3X2QB 1HHGB 1NBVH 4PV8A 4Y4KC 1I7ZA 4AJYV 4ZS7H 4GP4B 4OLVH 3TCTA 2DLGA 5DMGD 3FNKA 3HG1E 1I9IL 3LRMA 1Z2KA 4OB5H 5BO0D 1AQKH 1FSKC 2Y7OA 4X99A 2R56H 2DMKA 4FQXA 5H2BA 3V0GA 2VDQL 1HXMB 2BW5A 2J6EH 2XT1B 3UYPA 4EI6A 1UM5L 4DWHA 4PJ9D 2F7IA 3K6IA 2IGFH 1T1WB 3CSGA 1J8HE 3LXBA 4N0CC 2M83A 1YQ2A 4UTAL 4PUBH 1ZEAL 2OMNA 4RRPG 1QA9A 2ICWB 3MRHA 3MSPA 3LMJL 3LN9A 4K94H 2BY1A 2VO5A 3G5VA 2R2EB 5T3XL 3CSYB 5GGSB 4KX9A 4QYOA 5I15L 4Y7OC 3QI9D 4F27A 1JMZA 3ULVH 4LHQB 5BV7L 4WWKA 1WFTA 3PREA 3A21A 2DRUA 1D5RA 4MCZB 4AEFA 4IRSD 5DRWB 5EZLA 2Y7QB 3AREA 5DVLA 4K3GA 3P40A 2C7UB 3VGAC 1UACH 4J3UA 2DQUL 2X3CA 4FQ2H 4AEIH 2FWSA 3V0AC 3LKQA 2ZKWA 2AAAA 2FQEA 1G9MC 4MKMA 4KNSA 4XBPB 2XG5B 3FAXA 5G4MA 1NDGA 4KK9C 3WKPA 3L4TA 1WSST 2VN4A 4U1LA 5D71H 4U1MA 3VYNA 1ZPUA 3NFSH 3OXSB 1A6PA 1TCMA 4P23A 1XB6A 4Z7QF 4FG4A 5KYWA 4M6OH 3WXWL 2XQBL 3TZVC 3DTUB 4V2CB 2NXYC 2ZUQC 1HHJA 5JPNC 1JPGB 2QQKH 5ANMB 4O2CA 2D7TL 1OE2A 3TPKA 2WZ5A 4GJTB 4FFVD 4KHTL 5EPMB 5EBWA 5F6IC 3WAJA 4GRWF 3X11B 3LIZA 5T1LD 2ZSWA 3K0WA 1F4WH 2IH3B 1BQRA 1UM4H 3I74A 4HUXB 5HVHB 4LSRL 3HI6L 4NDMB 3SKNB 1MJ8L 1DN0B 3MBWB 1JGLL 3THML 4DN4H 2A74C 43CAB 3TL5A 2XV3A 2ZTBA 1KACB 3FF7A 5F3HA 4GOSA 1H3XA 2BOCA 4MMXA 3R06A 1JV2B 1UQSA 5F97E 4Y1AA 2AI0L 1VEOA 3QO1B 4ONGH 1YJDL 5EWIL 1R3HA 3F7VA 4GKSA 2C9UA 4J3SA 1KN2H 3TVMB 1NMCC 4JK0D 3KYAA 1PZ5A 3GSXA 2X5PA 5H4ZA 1L9MA 1XL6A 3NOIA 5FLVA 2XJKA 1ES0A 2B4CL 4EN3A 1M05A 5KUKA 4C4UA 1ZSHA 2NR6D 4N8CL 4JW3A 1X5FA 5JDSB 2ICCA 2KERA 4E41A 1ZHLB 5HYJA 2YKLH 2W60B 1QBML 2HFGL 5CINH 1PD1A 1PD6A 2MNWA 2DH3A 5C0CE 1F6FB 5CGMA 1MNNA 4FQCL 1BYOA 4WO4B 2J5WA 1NTDA 4YAQA 2W59A 4JHZA 3LS5H 1NANH 4CGTA 2NQDA 1A14L 2VUKA 2CH8A 2O6PA 3UACA 3CQPA 4FEMA 5KVFH 1E27B 2UWEA 5IMLA 4QTFA 3OD3A 4OZIF 1GSMA 4P3WA 1I9RL 2ZX9A 4YIQB 1WS8A 4FXGB 4NO0D 4H1LB 1T66C 1XGPA 4UIMB 4P2QE 1X7TA 1IM9D 4MNHB 1B88A 3O9WD 2NT0A 3O6LH 3P9MB 4P57A 1F90H 3HUJB 1SOQA 2PO6A 4QXUH 5EZOH 5I18H 1NEZA 1U3HC 4X9YA 3EH1A 5GGSY 3DRTB 3VGEA 2WINA 2L04A 2CUHA 1B9KA 3FUNA 1WDAA 4Z7AA 1DBML 3FT2B 1A1MB 3ATDA 2L8AA 1ORSB 3WNKA 2H1XA 1X44A 5AAPA 5IR1B 2H0EA 1TQWA 5BVPL 1HZLA 1FC1A 3PU7A 4QOKE 2HAZA 3KYNB 1AZVA 2ZXAA 4JO1L 4HIJB 4NERA 1T3FA 3RDTA 3RWJB 3VSVA 4UM9A 3W9DB 2P8MA 2BSRA 4O5LH 4RAUB 1BLNA 4UTAH 4K8RL 1ZVYA 1BPLB 3QULA 4D7PA 1UGKA 5AOZA 3RTQC 1J5OH 2Q7YA 2AQRA 3T4AA 2HKFL 5IEKB 5JQ6L 4WFHD 3WNMA 2HLFD 3GSQB 4ADGA 1HHKA 3VB8A 3MN8A 1BVLB 4RZKA 3CZFA 4OKVB 3L4ZA 4BCZA 4U6HA 3LDBB 4IU2B 5E1GA 5BV7H 1D6EA 2KH2B 3O11B 3HAEG 4W9GC 2H32B 3QXUA 5JHLL 5KS9A 5T1DL 3ZUNC 1J12A 4FXKC 1JGDA 1FVDA 2X1QA 3SKMB 1RZ8A 4X99B 3FQTA 3MOAH 1CDBA 3MLRL 5D4HA 5EU6E 1PL3A 2I85A 5GSRA 3UYPB 4EI6B 3QQ4A 3SQOL 4NWUL 2PETA 2V17H 4X50A 1FFNA 1YY8A 1FZKA 5GRYA 1U8HA 3CD4A 4KQ4L 4OU3A 5IBUG 1J0HA 4AKPA 5IWLA 3JV6A 4KI5E 2EDLA 4ZT1A 1ZGLA 4KK6D 5C86A 1FFOA 4XNMA 1PZCA 2J1WA 3NQKA 3UAJD 3C9NB 4RWYH 1EHAA 1BJ8A 1QA9B 4Y4FB 4Y5YA 5HTSA 3RWDB 2XQBH 1KENL 4X9HA 3JTBA 5DI8B 5G55A 1A9BA 4AK2A 2IC2A 4FFWD 1GHFL 1DE4B 4P2CG 5DMKA 2WO2B 3BKCL 2D7TH 3E3QC 3IPEA 4PJDE 2G9HA 3BHBB 4QR7A 3U2SA 4X6CB 4KHXL 1NOAA 1PY0A 1NC2B 5C09A 5IQLA 5FA4B 3U82B 3OJMB 1UKTA 4LSRH 1V27A 1F42A 3JSSA 1NDMA 5EZLB 4CC0A 3AREB 4CNIA 5CLWA 5I16B 4OD1L 2XQYK 3X3FL 4ELME 3IRZA 1MFCH 3VFTA 4NXSA 1RMFH 3UL4A 3EO1B 5TE6L 3KAAA 4Z95L 5CLYA 3UAAA 3EFOA 2CLVA 3LKQB 4IKNA 4MJIE 3VXRB 1ZHNA 1DVXA 2PPDA 4PJCE 3L3OB 4HA1A 1ZOXA 1MWOA 4JO5A 3W0WE 3NCBB 1HINH 2OSXA 5ADPL 1KIQA 1QPXA 2M1KA 5EWIH 2HKAA 3ZDZF 2QLYA 1NCOA 1JOIA 2KKQA 1PPIA 4FQPA 3SGDH 1JG9A 4NRZA 4NQTA 1EEQA 3UMNA 2W9DL 1L7IL 2WCPA 1HHJB 1QPPA 3B37A 3CFCL 3IJ9A 4JFEA 4KRLB 4MDJA 3DX9B 3L9RB 3WN5C 1FLRL 4I0KA 3MJ6A 3DURA 1QBMH 1CT8B 4LRIC 3V0DA 1KFGA 2VH5L 3IDJB 2MPVA 1L0QA 3MBED 3NJIA 4FQCH 1M71B 5GGQH 3QEUA 2Q8BH 4LCWA 4U3CA 3RZCB 1CDJA 1HAUA 4NC2B 2XC8A 3AXHA 3IFLL 1XF5A 2ITDB 3N1FC 4DTGL 4F2FA 5IEHA 3JZ7A 5LCVA 3T0AA 3L4CA 2CJTA 1UQSB 3QVAA 4LP8A 4OCWH 4DKAA 1D2PA 5T3ZD 4FLRA 2FO4B 2FWOA 2HRHA 4YHYC 3LS4L 3MV7B 3X14B 1GJIA 3IETA 4YEEA 2HFEA 1R3HB 3CHQA 4GKSB 3QT2A 1UB6A 4WIQA 4APQC 2YSTA 5CGYC 5E8NB 4AGPA 4UNVA 4KU1A 4NO5B 4TNWK 1ES0B 3BLKA 3A6BL 4YLQT 4ZW8A 4C83B 5CD3B 1M05B 4YWGL 4WU7B 5CKAA 5JW4Q 3CQFA 4QRFA 5DUML 2E75C 3HLAB 5DUBA 1DBMH 2F15A 3KPRD 1TKWA 3M17B 3IF1B 1CICC 3GZPA 4M93C 4CKVX 4IMKC 3I75A 1MCWW 1UTDA 3DBSA 3DPBA 4PJAB 3MMEA 4UDUA 3IDIB 5D1QE 4J4PA 2AAVA 3VD4A 3U9PL 3F7PC 4DGIL 3JV4A 4JO1H 2DDQH 2E3VA 1CGVA 4UTBH 4Y89A 5C0BE 2UWEB 4V1DD 1U8OA 3EJUA 1A4KA 4K8RH 4N6QA 2WLHA 3MLXH 1WCBA 3B3IB 1FYHB 3EHBB 3NFNB 1ZK5A 1F86A 4L2LA 4L8SA 5JQ6H 3CXHJ 4UANA 4IOSA 2JKTM 4ZZKA 2EYSB 2P26A 4HGWB 2Y7NA 3ILDA 4I77L 4D0CA 2IPKA 4JEGB 5I82A 1P84K 3KWXA 2O72A 2YLKA 3CDFA 5CSBA 3VWJD 4BZ2L 3HBZA 5DHDA 3ARGD 5JHLH 1UGNA 1JMXA 4ETQA 5I1HL 3ARRA 5H94A 2X4RA 4LEOA 3TO4B 4R5VA 3T0VA 3ARFC 1JAEA 3WUWA 2A4ZA 1KXHA 1NAMA 3CN4A 1U42A 4O02H 3JBG7 3TNMA 1X4XA 3QXTA 4Z0BH 3SDDB 5FGRA 3RUGB 3AMLA 4N2GA 3U7WL 1RU9L 1OGAD 3NAAL 4UM9B 1NEZG 2MPAL 4NQCA 3QDMA 5DUJA 1BVOA 3BP5A 2BSRB 3C5SA 1X5IA 2BOLA 1GRWA 4CC4A 2OK0L 1UXSA 5DHXB 3MGTA 4Z5RA 5LN4A 5A2AA 2DJSA 1BAFH 1XTMA 3GBNH 3QRLA 3KDMB 2YK1L 4HAGA 4POUB 2YD8A 3HR6A 5JIDA 1UENA 4D8PA 3SD2A 5KTEL 3SDCA 1A7RH 2B59A 5KVGE 3VFWB 4KHXH 4RMSA 3O2VH 3NSFA 3O8XD 3PWLA 4M00A 5JNYA 5LN8A 3DYMA 1N6UA 5D1ZD 4KKCD 1TYEB 2J8UF 3NMEA 3U6RB 4KRPC 5KS9B 1PKOA 3X3FH 1FVDB 2QSQA 4G7YL 4NN7B 4R7NA 5C0GA 3MX0A 3QG7L 1RZ8B 3EJSA 4L4TD 5TE6H 5IT2H 1HL9A 5LWYL 4K7PH 3QQ4B 1YNLL 4KY1L 3KLHD 2MNJB 1G7PB 3QZWB 3C60A 1YY8B 3UTOA 1XHHA 5FECA 3VX0A 3D7PA 3A6CL 3AROA 1JXJA 3QGVA 5DRXA 3NCYP 5ILTL 2ZICA 4WTZA 1NFIA 1ZGLB 2R29L 1WPCA 1LO4L 5D7IA 4X7TA 4AL8C 4LFHD 5F2FA 5JIHA 4Y5YB 3GSNL 2LVEA 1MIML 5G2NA 3H7BB 3I50L 4CMHC 1XZWA 1L7IH 2W9DH 5T1KD 3D4GA 4N2NA 1A9BB 5ISZD 3A6OA 3CFDA 1HCZA 2VDRL 1DEEA 4G11A 3ATFA 5KVEH 4IKJA 2OMZA 3U2SB 3PLYA 1RP9A 1HCVA 3G6JB 3BN3B 2F53A 4DUVA 1EZSA 1FDLL 3K1KC 1A6ZB 1AIZA 1W8OA 3M8OH 4PJ9A 4QRPD 5F1OB 5C09B 5IB1B 2NY5C 3QH3A 2WQAA 2Q7AA 2XWTB 1NDMB 3DO4A 4CNIB 5LXGL 2EH7L 5I5JA 1OK0A 1U8CB 4QY8A 3IFLH 3ILPB 3RKPA 5IQ7H 1MHPL 1BMZA 3F7RA 4WUUD 1NMBL 4PWJA 3EFOB 2CLVB 4DTGH 4OTXH 4F2MB 1MFDH 4OGYL 4X8CA 4U1KA 4CSSA 1SXAA 4AUYA 1FGNL 2WUBH 1HIMH 1SYVA 5FGBC 3QI9A 3PJLA 1HYSC 1TPXC 2AKRB 3C09B 3ZGHA 2NW2B 1V3JA 1KYAA 3MRIB 1QQDB 3WY1A 3E8UL 5EO1B 5IBLC 2H1PH 4JGNA 3HZKA 4DKTA 2PW1A 2E7DA 4Z7UB 4JFEB 1E3ZA 1MG3C 4PCKA 1ACYL 1KBGH 4GYBA 5GGTL 3LPWA 5EBLB 3QQ9D 1CGYA 1F45A 5F89A 3E6HA 4B9PA 4N3TA 2BHYA 3SJVB 4LAJH 4FQJH 1JDAA 4XBMA 3U9PH 2CDFA 1O6TA 4B9YA 4DGIH 3ABLB 5CJ8A 4LCWB 4DP8X 4FYRA 2ROXA 1T4KB 1UC6A 2GTWA 5TK4A 2IH9A 2BS8A 1M2VA 1WHPA 4HFUH 5EU5A 3MJ7A 4JO4H 4BK4A 4GQPH 4HJGB 3QIUC 5FC9A 4E9VA 1RUQL 3OB8A 4MLIA 2GJJA 2WYHA 4J6RH 1MPAH 5IIEA 5K59F 2MOVA 2Z91B 1FHGA 1NGWB 4Q89A 2FWOB 1XO8A 3N2JA 1FV1B 1WH0A 2JFCA 3MRLB 3T2OA 4CBZA 4K3DL 5B39B 5KJ7E 2VLJD 1JZ7A 4X4YA 2WY3B 1V05A 2GJPA 2JCCA 4PG9A 4HUVA 1A7NL 1UB6B 4G6FB 1DQMH 3GFUA 4CSTA 2ICES 5HHOE 2YQGA 1G7HB 4AVHA 1G4RA 1ZT1A 1R5IA 3K4DA 5B1KA 1IM3D 1EDHA 5C0AB 3IDGB 4L4VD 4WI8A 5E6IA 5I1EL 3ES6A 1OZUA 1JI1A 2HT3D 5JA9A 3CVDA 2PXYB 2XG4A 4ANVA 2ED7A 3CX5K 2CDEA 5CBAB 3MUZ1 3OAUL 3QEQD 1S7TB 3I75B 5B3NA 1IAII 4L5FL 1XGZA 3WIIH 3DI2B 4BFIA 3CVBA 1DUZA 5CNHA 1SLUA 4YXHL 4Z77A 1AY1L 3S2CA 4Y2NA 2VKXA 1ZIAA 2QL1A 2ZX5A 4KVNH 1VACB 3KWTA 3NJNA 1RU9H 3NAAH 5C9KA 1C5DB 2MPAH 1XIWD 3HIZA 3T0XA 3OG4B 4NEHB 2J72A 3UGUA 1U8OB 2Y36H 3HMWL 4DW2L 5EUOE 5JHDD 4YDZA 2AJZB 4NQXA 1AZNA 4RDQG 1KJ2L 4P5MA 1SXCA 3KWWA 3P30H 3QZMA 2NR6A 3MJWA 1PMYA 1MW3A 2YK1H 5GGRB 1KBBA 3QJTB 4JM2D 4PJ8B 1IGML 3N41F 4FGMA 2AEIT 2V6HA 2VISB 1HE8A 3EOYG 4HAKA 5B38A 4QJ4B 3SKUD 1BFSA 2DLFL 4LSVL 3TJHD 1IX2A 1HL4A 3R8BB 1LJMA 3R1GL 4QRQB 3TM6A 2HJFB 1SGKA 2V9TA 1N18A 4JFUA 5ALCL 1IAIM 5A43C 2VZ1A 2VZ3A 3GRWA 3MYJA 4MSWA 4JQXC 2ZCLL 3O0LA 1YZZA 2P45B 3PHQB 4ETQB 2HG5A 3VFRA 4E9QA 2X4RB 1II4E 1CVSC 2BXZA 4N2IA 1IVTA 3PGFL 1E40A 4LNVA 2QSCH 1T1YA 4FJ6A 2JJTC 2PR4H 2D0FA 4NO0A 1GYCA 4RA0C 3I2CL 5TDPB 1H6FA 3QJFA 1T2QL 1IM9A 1BZ7B 4QHLB 2AZAA 4PY7A 3O9WA 5INDA 3QJZA 2EC9T 3PRZA 1U8IB 3BAEL 3CFBA 1LO4H 5FM4A 3QUKB 4BRJA 2CXGA 3BUDA 5D5MF 2R0KL 1T89C 2OQJA 2IBGA 1MIMH 4O02A 2BNRA 3QIBD 4RISH 5FYKL 5GZNC 2AV1A 4MXQD 3OLGA 2X4SA 1RURL 5D7HA 3WUWG 1HILA 4WNQA 3X17A 1NJ9A 2B59B 1G1OA 2JJWA 2X53A 5GJTL 2AEWA 5KSBA 3O81A 4QF1A 2DMHA 4MJHA 4YSEA 5IFJA 2UY7A 1KGCD 3UTQA 2EH7H 5IP4A 1J9RA 4NHCL 2K4AA 1INEL 4AZUA 1MHPH 4P3DA 2TRYA 1NMBH 4G8AC 5DU7A 1U92B 5BV7B 1E9OB 5L88H 3QHFL 1NGYB 4YHIB 4ZUSA 4CC1A 1KYOJ 4KROC 5I26A 3WTSA 2DM4A 4X4ZA 3U79A 3ZHKA 3MXWH 2IAMD 3WSQL 5E00A 2DTSA 4YK4C 5GS1A 2UXVA 1NFAA 1NFIB 3Q2WA 1BA9A 3VMPA 4KNUA 2AJYL 3KYMA 1DVSA 4NRYB 4X9IA 2PTVA 3BCFA 2V7HA 3LHAA 4UV4L 1U95B 3AM8A 2VXTL 3DX8B 4MMZC 3RGBA 5F96H 3MNZB 4NN5B 1KY7A 5CCKL 2WKGA 3VRLE 1ACYH 5GGTH 2KLTA 4LCIL 2R2HA 3RY6A 3VYOA 2PPFA 1SFHA 3QRBA 4F37K 2F53B 1GZHA 1URZA 3L1EA 3FONA 4WTZG 2HMIC 3QH3B 3UAEA 4K55A 1BFVL 1SN0A 1M1SA 3Q6FB 3D25A 2EDEA 4S1SH 3MKGA 3LQZA 1A02N 4MBRA 3UAJA 5L2KE 3FTXA 4R26H 1WA1X 2WLIA 1C5CL 4JHAL 4LKXA 1A1NB 6CGTA 4GG8A 2V3DA 2Y22A 3QJXA 3QFJE 4NIYE 5DZNA 3MA9H 4X42A 4ABQA 1A7NH 2WTRA 5GGRY 3VI3A 4CADA 1HEJC 1ZVSA 4LKCB 1QUPA 5I0YA 5I8OH 2BP8A 3AADB 3HZKB 4J5VA 2HSIA 2PW1B 2NQCA 5LBSL 4GXVH 2XQ0A 4HWUA 3SBRA 2DL2A 1T5XA 2QV4A 4JN1L 5AL8A 2VLMD 3OAUH 5IV2B 1UXWB 5F89B 5LBGA 1JGVH 4S11A 1EUUA 5I6XB 4E42A 1B3IA 4G9FE 2OSLA 4A63A 2CDFB 2XRAL 3UO1L 1AY1H 3ILQD 5E1QA 1CGXA 2H0JA 2YAFA 3LRHA 2YOAA 1HSAB 3MBXH 1RZKL 2XFXA 3KM1A 3OSKA 4HW6A 4BKLB 4Y88A 3HMWH 1CFQA 1F3DH 1BYNA 1D6VL 3BVNB 3IGLA 2XZQL 1KJ2H 2EXYD 2VLRE 3WD5H 1OZTG 3D4CA 4P49A 3ETBF 4KAQH 3VXSB 2JV6A 3MCLH 1IGMH 4P4KD 1JYNA 4Q74A 3BGFC 1OM3H 1OE3A 2B3RA 5KVMC 4YXKL 2JCCB 4PG9B 4HUVB 1BX2B 2DLFH 4RSYA 1I3GH 1XGQA 1IAOA 5HVFB 4BCXA 1ZT1B 3MBEA 1R5IB 3QXAA 4S2SB 5E6IB 4PWGA 4XB7A 5ALCH 4K5MA 4AX3A 4BZ1A 3QYNA 3ES6B 2B5IC 2ZCLH 2CJ3A 3KZ8A 1BPVA 2XG4B 1XGRB 2D9QB 2CDEB 2NX5A 1VADB 2Z31D 5CU9A 3FBQA 5CSGA 5EBMB 1L0XA 5DA0B 1YN7B 2JXMB 3PGDA 3O8XC 4OFPA 3I2CH 4Z77B 1A4CA 3LX9A 1NIFA 4HF5H 1E67A 4O9HL 1T2QH 1X4ZA 3OJ2C 1FE8H 4XPAH 3MV8D 5D9SA 2X4NB 1O9VA 3DUSA 2JELL 4F91B 1ASOA 1CK0L 1P4BL 2X4OB 2EZ0D 5CGBA 1SJEB 4N6RB 3SY6A 3UBXA 4Z78A 5GJSL 5C8JA 2CCWA 4L3CB 1J0ZA 5C1MB 1YEIL 4KKPA 1IFHL 3N43B 5E6YA 3BZFA 2JKNA 1RIHH 2B1AH 2A77L 4FFYL 4X6BA 3KPRA 1P4IL 3LXAA 3O4LD 2CM6A 5B38B 3EFFA 1PG7L 1WZLA 1Q1JH 4JM4H 3PQYE 3ZDXB 3RWGA 1A7QL 2FGWL 4LOUC 5E8PB 4LDOB 5GJTH 2OZNA 3H3KA 2AERT 5AVRB 5H35A 1XCQA 3BSGA 2FEEI 4FFZL 2UVEA 2E46A 1KJMA 3BVWA 2OYKA 3IXTA 4GO9A 4MS8D 2QHRL 4OFVA 1IFGA 1RZJL 1T5KA 2YUXA 4G8EA 5AWNL 2A0LC 3NQIA 1INEH 3SDDD 4H8WC 4JFPA 3VFRB 4GSQA 4V1DA 1KB5L 3P0YH 4QXWA 2VN7A 3DGCR 1B0WA 5CR1A 3MRDA 2W0LA 5B38G 1DHKA 5F21B 3VH8A 3BIKA 5DHVH 1NWOA 4PR5A 3QJFB 3KMDA 1A8JH 2O6DA 4ODSH 2AGJH 4A68A 1WAAA 1CJYA 4PY7B 2UY6B 1TTRA 2AJYH 1BQSA 3I3EA 3QR2A 1PW3A 5I8EB 3K71B 2FUQA 3HHRB 4UV4H 1OQOA 3GXPA 4O02B 2VXTH 2BNRB 3ARGA 1AJ7L 2PF6A 2NCMA 1CO1A 1U8NB 5JORB 3FB5B 2A83A 1DFBL 5CCKH 1CURA 3NIDB 4ZJ9A 4WNQB 3QUGA 3VFSB 3CFNA 2F9BT 4K23H 2RHEA 1UD6A 2AITA 3QJUB 1EJOL 1Z3RA 3D0AA 1AD9A 3C8HA 4A38A 3CU1A 4JFXA 5I66B 4QF1B 1BFVH 2UY7B 1LILA 2ERJB 2IDSA 4GMTH 3UTQB 4MCMA 2F7RA 3RY4A 2GG1A 1V7ML 3TIEB 1OGAA 4RH4A 2FO8A 5HVHC 3FO9A 1M42A 4QRTB 3PE9A 1U9KA 2ESVE 4LLAA 4FE9A 4MAYA 3ZYIA 3OKMA 2EXWD 4Y19D 5CGTA 1INDL 2DLTA 2ZOUA 4N2CA 1S8DB 2FSEA 3TBWA 3HLKA 4KK5C 1YA5A 2GBAA 1FAKT 1U4EA 2XTJD 3ULUC 4PVBA 4HHGA 4YHLL 2ADFH 1XF1A 3WS6A 1MZYA 3TVMC 2X4QA 2Q2EB 2NDGA 3N42B 3D39D 5ELIA 1QFOA 1E4XI 2GJRA 4TNWF 5AKTA 4LBEA 2TRHA 2YC1A 4YHPA 4OW6A 2VUOA 3FJTA 4JB9L 4L4TA 2X1WL 2R2HB 3ZGIA 2W94A 4ODUA 3IAQA 4LPWA 2XRAH 1TJGL 3WJMB 3FONB 1PEWA 2DI7A 5FO7B 5F0LB 1JFQH 3C5ZD 12E8L 3JV0A 4G8FA 2V5TA 3TPUA 1E7VA 2IBZX 3D9AH 3IMWA 4XOEA 5DD6A 4WO4C 2WXKA 5HHME 5T33L 3FO0H 1I1YA 1VFAA 1OEZW 3IE9A 1MLBB 5D7KD 3L8QA 3OAZK 1M9SA 5E5LA 1BVNT 1IBDA 1OOAA 1NC4A 2WD0A 2DEYX 2XZQH 2WLIB 1NCJA 1ZXQA 4FP8H 4HD9A 5F7MC 5CN3A 2BNQE 5T1KA 3GRGA 1UD3A 4GXUN 3BXNB 1CMOA 4FXGC 3RIFK 1UWGL 3V7MA 1N0LB 3K74B 2KZBA 4HG4J 3LJ3A 3S8FB 2WTRB 4KGLA 1MREH 5D7JD 4CADB 3NPSB 5BW7A 4DP1X 1CBVH 1Z0NA 3H9SB 1ZVSB 4QRPA 1IEAA 1C9SA 4PJIB 4G8IA 1EGJH 4HEMA 3RG1C 2YRPA 2OJEA 3N40P 5FIEA 2BP8B 3S5ZA 4M7ZB 3SJVD 1XSJA 4A37A 3RJQB 1IMHC 3OJDA 2DQHH 3KW8A 4WUUA 3ALWA 3HBGA 2O5YL 1PAMA 2VSCA 1E4WH 1UFUA 1XV8A 2F54B 2KQMA 4PLKD 4XMVA 5EUKA 4UMGA 1OP9A 1G0DA 2OSLB 1RZPA 1MJJA 3LZOA 2VLKD 4O9HH 4ODXB 1N6QL 4PJBB 3WMQA 3UC2A 2WXHA 3UBGA 4ZUVA 4JDTH 2JELH 1NLDH 2XFXB 1CK0H 3MRMB 1E3FA 4WHDA 2ZG3A 4UQ9A 1VHPA 5GJSH 2OKMA 2AQ1A 4IS6B 3X1EA 5GRUL 1YEIH 2B14A 1H0DA 2VWEC 2ENSA 2FD6H 2PMZA 1IKFL 2WXQA 2GITA 2Z35A 3AFLA 3LQAC 3MREA 4UQEA 3HS0B 3BP7A 2LHAA 3P9LB 2HUHA 5GRVK 3SGEH 3WE6A 2Q2LA 1XFPA 4JKWA 1PYWA 1A7QH 4F7EA 1JCVA 1N5AB 1XGQB 4H25A 2G4GA 1UT9A 4FFZH 4RGNE 1G7JA 3QXAB 4G1EA 2YJQA 3R4RA 2OI9B 3FFCD 3LDBC 1CN4A 3HB3B 1VPOH 1KB9J 3T0DA 1DCLA 2FUTA 1WHOA 2HVKA 2X6UA 3ZRCC 4S1RL 3KPSB 4TQEL 5CZXC 3LN5A 4G82A 3UBFA 3T6ZA 4ISVB 5KSAA 2NX5B 4XN7A 1A65A 3IDMB 1D5MA 5FOBA 2ZAGA 4CU8A 3N55A 3PGDB 5GISL 4D9LL 2BMKA 1IQWL 4RAVB 4KUCF 3LEVH 4IBZA 2ARJQ 4XNZB 3UZEA 1THCA 5DJCA 5FYLH 5HDQH 2FO1A 4PJ8D 4GSDL 2ZE0A 4J3WA 2WSKA 4C55A 4A7GF 4Z78B 1YRKA 2P8PB 2X0UA 3FQRA 4NFDA 3WBDA 1IM3A 4L4VA 3BZFB 3L3HA 2YUZA 3C6SA 3UTTD 4Y4FC 3CXDH 1AQHA 5EZIL 2E7MA 4RFEA 5ICXA 3WTWA 3QEQA 4I3RL 4N8VA 1XH0A 4YMPA 4Z7WE 3MTXA 4PTUB 4MA3A 1GOGA 5H35B 3TCLB 3CNKA 5I1AB 1NMAL 3TOPA 3IXTB 5SV3A 1QLRB 5E1AB 5SX5K 3UBXG 1AG6A 4G8EB 4OZIA 3L3KA 1XIWA 2FDBP 2X12A 4ODTH 4NP4L 3AREC 1EFXB 4JY6A 1XGYL 3GPEA 1HDMA 2Y23A 2YZ8A 3RFRA 4ERSH 4WHYH 3BIKB 1HWHB 3L95B 1DBKH 1INDH 3L3OC 1OT1A 2APBA 4I7ZC 4XAWH 3ZKXB 4ZSOA 2NW3B 4GQRA 4GT7A 2EDOA 2B9AA 3U4KA 5L0QB 5JIIA 2OMWA 4OZ4A 1OQXA 2AJ3A 4R3SB 2NUPB 2UZXA 3VQMA 4O00A 4C8XA 1KYUA 4QHNB 1JFHA 1U2CA 5DD5H 2IXQB 2VQUA 2E47A 5T3XD 1RIUL 4HKXA 2KLRA 1G9NC 1JNHA 2OP4L 1J1XL 4GI9A 4XWGL 3VH8G 1AZRA 2J1YA 1FIGH 3QFDA 3MNVA 3M46A 2A9AA 1IC4H 1TJGH 1ONQA 4JFXB 1HXYA 2X2JA 4OI7A 1P5VA 4BIKA 5IVXB 2JJSC 3KPQB 2VC2L 2X3AA 4DP6X 1IV8A 3PP4L 5T33H 2X42A 3UBXI 5ES4B 3GLDA 1SXBA 3LH8A 3RZCC 5KAQG 1KCRH 2FBJH 1JZEA 1UT1A 2GTZB 1IE4A 4MAYB 4ATWA 2R1WB 1QRND 2J73A 1N9PA 1T4WA 2B2XH 3PV6A 1CFBA 4JFHD 2O5ZH 3CLWA 3E6FB 1OCOB 4P48A 4AYFB 3MYZA 2FQFA 4N0FA 4UQIM 3TBCA 3ZL1A 1HHIA 4ZZFA 3T0EA 1L9PA 1OAUH 4NQDB 1XGUA 4KJYB 3CC1A 5A16A 1WJ3A 4PBDA 4EOWH 2EVIA 2NNAA 3N50A 2XTSA 2WWMD 3FU7A 3Q8AA 3N91A 4FQLL 5FGCE 4EIZC 2O5YH 4ODUB 2YOCA 3P3RA 3D0VA 3C08L 4ZAKD 1B2WH 4TUJA 1KYDA 4XWOD 4YHZH 2YGVA 4NQSA 3LNDA 2IAMA 3APCA 3MRBA 4G8FB 4QCIB 3BPOB 3TPUB 5F9AC 2YA2A 2BY3A 4ZO9A 4J1UB 2KZWA 3DJSA 3G04A 1VFAB 4WSKA 1HU8A 5GRUH 4U6XA 2H41A 3ESVF 3WYRA 1NC4B 4UQDA 4XX1E 2AANA 4XO8A 1J1PL 2XWJA 4GRLD 4TSCL 2J55A 1GGBL 1AZUA 2KL6A 4HALA 1IARB 4JFZH 4PJ5D 1CU4H 3EHBC 3RIAF 1MNUL 1LP9B 2WNWA 2Z0UA 4DO5A 5KBKA 4QTIH 1JWSB 2DQFB 5DVMA 3H0TA 3NP3A 2HTKC 2JQZA 2EIEA 2X6BA 4YXLL 4L1SA 3HC2A 1FO0L 1KJVA 2EZ0C 4FQHB 1ILUA 4XPHL 4PJXF 1U6AH 2HT4D 1MCPL 2IH8A 5KSVB 2FJFB 4G8IB 2YD6A 1TEFA 3WNOA 3BZEA 3KPOA 3QWRD 4CRPA 1YC7A 1FFPA 1P7KB 5ICYB 4LFHG 4F5CE 4KZDL 3GTTA 2LQRA 3FOMA 4S1RH 4TQEH 5I30H 1CR9L 1OGTA 2BIMA 3ML8A 4YE0A 4Z7OB 3QZOA 2VZTA 3FS9A 3SDYH 4F9PC 3BO8B 5GISH 4D9LH 4A2DA 3EDDA 3TO4C 1EGJA 1J0KA 4J39A 5FO8A 2QR0B 4BH8A 4YX2L 4TQHA 4B9FA 4OZHE 2NY1B 2GJZB 3PG2A 5F6HJ 3ZHDA 4ZUVB 3SDDC 2JI2A 2VDML 2XX0A 3B2UD 3AS1A 5D1ZI 5ID1A 3ISYA 4PY8I 1PVHA 2HLAA 1M2OA 3L2NA 4R0LB 5TF0A 3RYMA 3WJJA 2FAUA 1GC1H 2GITB 2XCMC 1E9QA 3MREB 1PX8A 4MWFA 3BP7B 5DTFA 2H9GA 3WE6B 5DQJB 5IB1A 3GI8L 4W70A 2J5LB 2V5MA 4I3RH 3T09A 4FEIA 4C47A 3VDBA 4A7VA 3AG3B 4MD4A 4F7EB 5K9JL 3X1NA 2C5DC 1MFEL 1QEXA 2AQNA 1R75A 1KJ2B 2GT9A 1JRHL 4HISA 1I3RB 3UABA 1G7JB 3ARBA 4AQAA 3FMGL 1K4CA 3O45A 3OZ9L 4PJHF 4WI4A 1AYOA 3WDIA 1XWVA 1XR8A 2HVKB 2VDPL 4F33A 2W92A 1XGTA 3ASOB 5KSAB 1KTLB 2GPZA 2YIHA 3EW3B 4NN7C 4NKMB 4P5TB 2Z93A 3QNYB 3B2DC 1SN5A 4G71B 5AQ0A 4X6FA 1K85A 4LLQB 5ESAB 1AHMA 1O7DC 1IEBA 3FOLA 5C08B 4ES8A 4NAMA 4N8UA 5GS0L 4LESA 2VN5A 4TL4A 3IFNH 1LNUB 5IWLC 1M6OB 3R8QA 1X9UA 1DQLH 1R3KB 3D09A 4GW1A 2Q6WA 3VGHA 3FQRB 1FL3B 4K8RD 1BQHA 3WHXA 1U93A 4PV9B 1NFDB 1WFMA 3QUML 3F7LA 2VL5A 4PJ7F 3S5YA 2YD7A 2Q9OA 5AOKA 1BBDL 4DP4X 1AD0A 1XVSA 3COOA 4RBPH 2Z31A 2CRYA 4ZTOL 5TTRA 1CFVH 3VWKD 2YMXL 3DPDA 5MEPA 2NNCA 4KK8D 4F37F 3B5TA 1TYRA 2VITA 1IIIA 3KPNB 3MJ8A 3MV8A 1JD7A 1H8NA 2YPVL 1LE9A 4OZIB 3L3KB 4K94C 1NCDL 2P1YA 2ZONA 4JY6B 4AQ8C 5J8OA 4JG0L 4LCUA 5EUOF 3ULVC 4LF3B 4DHLA 5CN2A 4N8VG 4DGWC 4MJ6B 3O4LA 1UCBL 1YMMD 2P7TA 1QFWL 2SODB 4ZSOB 5IHLB 1GYUA 1P7BA 4S1QL 2CRMA 2HB0A 5EC2A 1YPZE 3RHWK 4LNRA 1V8HA 3ZW3A 4OZ4B 4IIQA 2AJ3B 5IVZA 2DMGA 5I1CL 3GJFK 5DHVB 2CO2A 1WWWX 2MIZA 3HPLA 4ICXA 1U91B 5ETUA 4UT9A 4W9EC 2QPEB 1Q72H 5EEYA 3QDJD 4MQXC 1PU0A 4HKXB 3V9CA 2C1OA 3WS3A 3DJTA 1L7TH 2ZOLA 2BZDA 1W9XA 3B7TA 4LU5L 4HMDA 4IDJH 2VXVL 3GJEA 1HXYB 4E36A 5B4MC 2GJ6B 3HHSB 1M3JA 5D72H 3MGAA 3FL7A 4TVSa 3PPSA 3QDGB 1QWUA 5EU3B 4RWHA 3O3EB 4KO5A 1UM6L 2F5AL 5LQBH 5BOJA 3FB6A 4MXVF 3H3BC 1FG2A 5BZDA 3REVB 2FECI 4TSCH 3FT3A 4YDMA 3K91A 1GGBH 2JCWA 1ADQL 5MENB 5DYFA 3QQ3A 5C0RL 1SY6A 1AOHA 1BFTA 1MNUH 3K80A 3N1GC 4ANXA 4HLJA 2J8UA 1HEHC 4AXWA 4BUGA 4HKBB 3US0A 3NTCL 3PL6D 4K5OA 1NCBL 2CA3A 2X89D 1P7QD 4Y1AE 2O61B 1R5WA 3WHE1 2LAAA 2HT2C 2BWQA 4WDIA 1XD0A 3RBSA 4XCYA 1BZOA 2IFFL 3FN9A 3A4DA 5CP3H 3G3LA 1BLIA 5E23A 3GXIA 2EIZB 4JG1H 5E9DB 4K9EL 2PXYC 4KITB 4PHXA 4MHHG 5F7DA 1GY1A 3IPBA 4OAWB 3CHRA 1MJUH 4YGVA 1HQRB 2ZCKH 3B5GA 3G6AA 4NQSB 4YX2H 3KEHA 1S7WA 3AITA 5JMOC 1KPUA 1UVQA 3CMOH 4E41E 1L9QA 5HYJE 4GW5A 3IM1A 1XL4A 5AKVA 3WNLA 3WJLA 5AD0B 1B4JL 1PGRB 3O2DL 3T2NL 3U9UB 2XWJB 5GSVA 3D39A 4AG4H 1GVIA 5FHAL 2R69H 3FQWA 3KBEA 4TXVB 4N5EC 5SX4I 3MAWA 3OPUA 3GI8H 2E8ZA 3BUYB 4PJ8C 3SDXF 3VRLF 1WRFA 2JI1A 2YBRA 2XXGA 2VABA 4ZFGL 2A7BA 2EP6A 2OCFD 3ARDB 1KNOA 3OZ9H 1TCRB 3LZQA 3C5ZA 1FFPB 3QC6X 4G42B 2QVFB 2W65A 4ONFH 4OUOA 5E8OB 4FNQA 4WJ5B 4LCCB 2QKIB 3FOMB 4XTRD 3W81A 2WLZA 4UT7L 4X6DB 2B7DT 1EEUA 1YAIA 4FL4B 2FX8L 4WI3A 2RQEA 3TEXA 2VDLL 3ZDZB 1Q94A 3OHXB 2QMKA 4RMVA 2MNUA 4BH8B 4BQBA 25C8L 5IROC 4HWEL 1IBHA 2K7QA 4N0UB 5GS0H 5DFVD 5F7UA 5D7JA 5ID1B 2AK1H 5JW3L 3NA9L 3CJJA 1PNCA 3FUMA 1W8NA 3Q7JA 2EVFA 1S3KL 5C9JA 4CC4C 3OBAA 1QYGL 4MWFB 5DTFB 2VXSL 1BBDH 32C2A 1H8SA 1ZLVK 3DX3A 3KVPA 4NT6A 4WEMB 2N0KA 3BAXA 4KTDH 4LHUD 4WKZB 4WV1A 3WGVB 3ZTJH 4GG6F 4I2XB 4ELDA 1QI4A 1TMQA 2BS71 3KPSD 4EZLA 4MD4B 2K7PA 3GLAA 3GM0A 3DX4A 5FUZH 3J07A 5LAXA 2OZ4L 5DVNA 3ARBB 1DZ0A 4FCHA 2VLKA 4PS8A 1K4CB 5SWZD 3WEXA 2YPKA 4F93B 1WIOA 1DQDL 1XR8B 4NKOA 1MHHA 1NCDH 1UD8A 3R0MA 4MNGA 5CKGA 2AMGA 4JGJA 3L4UA 4F58H 4YSOA 4KGJA 4KUCD 4NNYA 4YDKH 2Z93B 1BYPA 3ARPA 1Q9WA 3QUYA 1TFPA 1XBDA 2RIKA 1INQB 1I9EA 4ODWA 3BQUA 4X8XA 5BV7C 5C7XL 4GAJL 2FT7A 3FOLB 1UCBH 5CCHE 5HY9B 2AEPL 1WBYB 1KCVH 1BVKA 5E2WH 4S1QH 2EQDA 3NIFB 4Z3EA 5A2CA 2R4RH 4FA8A 1CXHA 1KN4H 4GW1B 2JJVA 2Q6WB 4N2MA 2BSBA 2YD4A 5CO1A 3WHXB 4ENED 1UZ6F 2VW7A 4GKZB 5I17B 3KPPA 4QO1A 5I1CH 3VXMB 5HGHA 3FFCA 3V52H 1NBCA 3ABGA 4H26B 4I87A 3GMLB 3SE4A 2VZVA 1FF5A 1PSKL 4CU6A 4MQTB 1AD0B 2FLBT 3PWVA 3T71A 43C9B 4XO4A 3A23A 4NN5C 3WKML 1UD5A 4YE4L 3WMSA 4IBYA 4LU5H 1V54B 3VFNA 1YDPA 4M48L 3EDKA 3ARXA 4OF5A 3U2IA 1YUKB 2H26A 2TAAA 1A3QA 1UHVA 5J1AB 2X70A 1OB1B 4NCDA 2R1XB 4JCMA 4DSYA 1BQHG 4B95C 5IJKA 5HDOA 4EDXB 4HK0A 3S8WA 4U0QB 4XMPL 1CXLA 3US1A 2CGRH 4LCUB 4HCRL 3IU3A 5JXEA 3ARYA 3UTTA 3L9EA 3GHBH 1SNRA 4DK5A 1ADQH 2HUEA 2N4IA 1RUAL 5C0RH 2P7TB 1EV2E 1FRGL 2PPAA 4M1GL 1U21A 3HMXL 2XIIA 3BIBX 3GMPB 3JVFC 1WFJA 4LNRB 5DRNB 1NCNA 3RIFF 3HNSH 5JTWA 2ZWSA 3T3PB 2YS4A 1NCBH 5IVZB 4OCNC 2A3TA 4I18C 2ATAA 2ZOKB 5T1MA 5ETUB 1NBYB 1W91A 2QVIA 3CPUA 4GRLC 1Q9KA 2MQGA 4CVXA 2DQ6A 2QLVB 4YHNA 1YJDC 2ZYRA 5C0ND 1CLZL 2BSTA 3T8MA 4K9EH 5T8IA 4PD4J 4PGDA 4FKEA 4QJ3B 1KCBA 2HT4C 3LNEA 1LDPL 3KDPB 5DMIL 5I6XC 1AGCB 5KYUA 1YY9D 1MCOL 2VSKB 1MAML 5D5MA 4FKKA 3WFBL 4U4IA 2XWCA 4XPFL 3TLRA 4MAUL 4CDGC 1ZSDA 1B4JH 3FB6B 3CK0L 1AACA 4R7XA 3SN6N 3NESA 5IHWA 1FG2B 1BXAA 2SEBA 4ZOAA 4HU8A 4MJJA 4M7JL 3QQ3B 3I02A 1UADC 4R8WL 4L3ED 3H1ZA 4X8JB 4JO8A 4KPHH 3B2UC 4FMKA 4ZFGH 1KYFA 5JIKA 2HCZX 3AT8A 1N5YL 1KIRA 3EJZC 1ZVNA 5EC1A 1NBQA 3RGHA 4DVRH 2R8SH 3P11H 5F1KC 4PRHB 4WDIB 1AI1L 3P4OA 4NLHA 3TFBA 4JQIH 5E6IC 1P9MC 3GSWA 3BEVA 1OIOA 1E8ZA 1Q9LA 4N0RA 2FX8H 3LD8B 1S5IL 2VDLH 4OF3A 5EF2A 5KYXB 1FYTB 4TVPL 4YUEL 4ES9A 4YGVB 1VA9A 25C8H 1W2KT 4HWEH 4P2AA 3HFFA 1PEZA 2DN7A 2N7AA 4ZOBA 4DO4A 2OYLA 3T6QC 1FBIL 5KYNA 2DQTL 1IFRA 1N7ML 4XI5D 2EDNA 4GW5B 2R23B 3BDXA 4H20H 1YYLL 4FNPA 2X44D 3BVTA 5GSVB 4U1SB 4J3OF 1ESOA 2VXSH 3F6JA 3FQWB 1Z6JT 2L7EA 3F85A 4BUQA 1XCTB 3K2KA 4N9OB 2WJ5A 3ZR5A 1KCUL 3VM5A 3Q6GL 4HUUB 1Z9LA 4ZAKA 4JKKA 3UCRA 3RFZB 2NY3B 2VAAB 4K8RC 1HCFX 1ZTXE 3BC9A 2XACC 1J8HA 1DQDH 1IC1A 4WRLA 3LVEA 1QTYT 1UD4A 3CC5B 3MLTA 2QV2A 4PRPE 3V4PL 4WFFD 5KVGL 3DX2A 5I1KH 1F02I 5SWSB 5FR3A 3DMMA 1WC7B 1NKGA 2VZSA 2E7LA 5C07B 4GAJH 2OL3A 2IOOA 5DO8A 4PJ5A 3U48A 3UTPD 4N20A 2BVYA 2Y1VA 5IB4B 1HOCB 1JI2A 4RETB 3BZ5A 5DS8A 4AT6A 4QRRB 4XPTL 5MEQA 2IANE 1F2XK 2WBJB 4OM1L 2OW7A 1VDGA 3QWRA 3LZFL 4XNYL 2E9GA 2BFVL 32C2B 3GDCA 4JY4A 5D1XE 4WV1B 2VB5A 4NQCE 3QDME 1MRFL 4NQEB 4QAWA 1YUHA 4YE4H 2CHZA 3BUPA 3ECUA 4KXZH 3ECWA 5IMKA 3TJEL 3QUHA 4M48H 5KW9L 3HBPA 3BE1H 4C56B 1ICTA 1JNLL 2YQ2A 3JWNG 4ZX6A 2DKMA 4QGYA 4OFKA 1R34A 2YPKB 1RY7B 3CIAA 3IKCA 2ATPA 2WB1A 5KG9A 1WK0A 4L2YA 4FADA 1DQTA 3HTLX 5DUPH 4Z3GA 1R1CA 2IPUG 1MHHB 4NKOB 5D2NA 3BKJL 2ERJC 4Z18A 4XRCA 5J3HD 2DW5A 5HDBF 2JKRM 5JR1L 3CMGA 1UXMA 2CBPA 4PRIE 3QUYB 4OGXH 5D96B 4ODWB 3BQUB 3DJ9A 3OB0H 5EORH 4O2EA 3STZB 3RGVA 1BVKB 4M1GH 3PY9A 2J44A 3PWPD 3T77B 4JFDD 2XUWA 4AZ8B 1H9VA 5KYYA 5CILH 3OLIA 3HN5A 3MRGA 4EAEA 5HGHB 4YFDB 5DWPA 4H5SA 5FYKD 3DOSA 5CEYB 5TGBA 4UB0L 4G5ZH 4IU3B 2P43B 3AGWA 3B9KA 1RHHB 4AUJA 1CLZH 5D7IE 3UTSD 2A9CA 5DK2A 2BOBA 5T5FL 3GQFA 1C7TA 2IADB 2OTWA 1LDPH 4PP2B 5DMIH 1EBPA 3A4FA 3DVIA 2P5WD 2ICEA 4X80H 5IFHL 4G7RB 4HS3A 1J10A 1MCOH 1BZQK 3IMUA 3L48A 4KJQD 4NO3B 1DDHA 4R5TA 4YVNA 1AE6H 2IALA 5I8CB 3PHAA 4N0YH 5I28A 2VCOA 1HH9A 1FORL 4AQEA 3VCLA 2A9ML 2AABL 5D2LB 1D5BB 5HVGB 1PJ9A 1CGSL 1MFVA 4FC3E 4M7JH 4NIKB 1X5AA 5JLZB 1OV8A 3GKWL 3MLZL 4ZNEA 4BZYA 1T6WA 1HQ4A 3H9ZA 2XN9D 5CWSA 3K2MC 1FNSH 2GSGA 2I69A 3B9DA 4Z7WF 3GXFA 1EERB 2P47B 2CBMA 3NPSC 5FK9B 5T1MB 1S2EA 5DJYA 2XQYA 4YFEA 1KELL 5IESH 2A4CA 4KX8A 4YHNB 1JP5A 1XSOA 3D05A 4M5TA 4M7ZC 3LSOB 3LY6A 1TUPA 3NSYA 4P2RD 3TS8A 3LXCA 5TQ2H 4PGDB 2WAHA 1QO3B 1S5IH 5DSCA 1YEFL 3Q13A 4N2FA 4M1DL 2DQMA 5KYUB 1YMMA 3W56A 2RTTA 4XTRC 1M9WA 4HBCH 1FBIH 3NCJL 3O4OB 4X7CC 4I88A 1N7MH 3ZE0F 4ZO6A 4KOCA 2AP2A 4TUOA 4HT1L 4JL2A 3NABH 3FSWA 2G3MA 2UZIH 1YYLH 4CN1A 3U7AA 1OL0A 4DKEL 2FWUA 2SEBB 4IHOA 1QBLH 1GOHA 1RCYA 4P4RA 4DFHA 3WN6A 5HYIA 3P77B 3QDJA 2BSSA 4PJFF 3HS0C 5HJDA 3OR7A 3DA0A 4QOKA 5I1DB 1KCUH 1U33A 1KIUB 1SBBA 3V7AE 4MXWL 4P2YA 4CW1B 1KIRB 2QGDA 3GPSA 3OPZH 5E0QA 5C6TL 1NDTA 2QHLA 3ZU8A 5DJXA 3P4OB 5EA0L 5E24E 4AEHL 4JZOB 1XX9C 2OI9C 3V4PH 1OSYA 5HGBA 3HB3C 5KVGH 1WWBX 2RD0A 1Q9LB 3I6GA 4DPRA 4ZOCA 3E2HB 3TA3D 3UJIL 2BP0A 4WI6A 3WTXA 4FTVB 4N2DA 1JPTH 1DO6A 3K72A 1PD0A 4JRXB 3T6VA 4Y9EA 3NJKA 3FQNA 4JQIA 1HS6A 4OJDH 5K5YA 4XH2B 3S98A 2XWDA 4XNZC 2M8XA 3IJ8A 4MCYB 1P7QA 3Q8CA 4OM1H 4JDZA 2VDOH 2BZ7A 1SEBB 3HG1B 2W07A 2BFVH 3ARDD 4OLZL 1P69B 5A7BA 1NKRA 2CNZA 4G2AA 4JPWH 3P2DA 2GCYB 4DERA 4AYDC 5KEZA 1BEXA 2H2PC 4HLZG 4TTDC 2LTQB 4BKSC 5I5RA 4XCNB 3TJEH 1GKOA 3DOIA 4U3SA 1QASA 2VKWA 1SPDA 3NEXA 1JNLH 3PABB 5DF0A 2Z7WA 4F1SA 3CVHH 1JV5A 4QPEA 3LEXB 5CAYB 1J8HB 1XT5A 4CMMA 5F1IA 4B27A 3RB7A 1SXNA 2G60L 5H37H 4MASA 5LNDA 1OCZB 2P5PA 3EBIA 5DHMC 2ADJA 5CMAA 1ZA3A 2J7LA 4N1CA 4UBDD 5GS3A 5FYKU 3DMMB 1CDYA 2WOBA 2ZXGA 1T22A 4NZJA 2BSCA 4MMYB 2HYMA 4TYUA 2OMBA 2OXGB 1CL7L 2CDGA 4PWKA 5BNXD 1GCYA 5E2JA 5EEWA 3FK3A 1N8ZB 5AW4B 2V2XB 4GUPA 4LSQH 4H0GA 3ZKXC 1T1ZB 5E2TH 1T20A 1S9XB 1A7PH 1AHWA 1V3LA 5GZOC 3RHWF 1JL8A 4ONHA 4G6JL 1CDCA 5L0QC 1KBVA 4GP8B 2QQLH 3Q9PA 4UM8A 3FU5A 4U1HA 3CXFA 3NJGA 3J27A 3FO2B 3VXTA 3RWCB 1BGXH 5IMKB 5IM7A 1LK3L 1SVCP 4XCCH 3I3DA 5I6OA 2LU7A 3K7UA 4GRMA 5F1NB 4AL8L 4N28A 4AGMA 4D3CH 2HG0A 3SQBB 4LLUA 4ZUUA 4LVOB 4X4XA 1NFKA 3V6ZA 1N59A 2QVMA 5KSBE 2MOQA 3ROOB 1EEZA 3RPIA 1F4XL 4PRDA 1FORH 3BKYH 3KYKL 35C8H 1RD6A 5TDOA 1ORQA 1TQSA 2AABH 1HI6B 1HT6A 3QZNA 2OTPA 3JT2A 3RRQA 1F3RB 4JG5A 1N2RA 3OF6A 4O2EB 3SYQA 4LHUA 4MAYC 3GSOA 1QSED 2D7OA 3GKWH 4HK3N 4OQTA 3MLZH 3G5XA 1CUOA 1N64L 1W6LA 2ZX7A 5KYYB 1RK0B 1X9LA 1Y0LA 3PXJA 2ATKA 5SWZA 2CRIA 3Q2LA 4WFHE 3TBSA 3GXNA 1TOXA 1BZ8A 3FBKA 1T7VA 5DQDL 1EA9C 5TGBB 1I53A 3WS6C 1DL7H 2VO8A 1IJ9A 3OAYH 5TH2A 2W95A 4MCNA 1L0PA 3B9KB 4QHKI 2XA8H 3KPLB 1DFXA 3WL9B 3K6DA 1YEFH 2FNBA 3DOHA 3QCVH 3US9A 1EUTA 4M1DH 3GS7A 4HS3B 4A6YL 2FGZA 3SPCA 3UPAA 2J1ZA 3SGDI 2DEXX 2H3NB 1A6WL 3BPOC 3W1ZA 4HUMB 1HH9B 4DKEH 4AQEB 4EQ2A 3VCLB 1CQYA 3BRGC 2WZ0A 2K6ZA 2D03L 1Z3GH 3ZMRA 4NUPA 4OCRL 1MWAA 4P2OA 4C58B 3FFDB 3DV6B 1S7RA 3C12A 4JPKH 4LL9A 3A5VA 4ZFOA 3EJTA 1KMGA 3BRDA 4RAHA 2IOMA 3SBPA 2X4TA 3KYOA 5C0CB 4Y2LA 2LFGA 4XOBA 1CI3M 2FR4B 2WLLA 3OKEB 5BW7C 5C6TH 1OP3K 3SGKA 1PAZA 3QNXB 4FG6D 4ECNA 3MODH 2VE6B 3IDXH 1VZGA 2DWYA 3G08A 5BPPA 1A66A 3TASA 3VI3E 2CUAA 4E9WA 5IQ9A 4LSSH 1RUPL 2VM3A 3UJIH 1DTUA 5DSCB 1WWAX 1E2VA 4LPUA 1FI8C 4P2QB 3REWA 3IJ7A 3T3MF 3PWNA 2E9IA 2C9SA 1RJZB 4CAGA 3QYMA 5EFIA 5HI3D 3OGCB 2YAQA 1YEGL 2YD1A 1OGSA 4QIRA 2R29A 2EYTA 3KCPA 2NY1C 1OT2A 1YPZF 1KLGA 2XQYG 1MJ7H 4LSPL 1G87A 4KH9A 2ZOOA 2DY2A 1ZRUA 4R0LC 3V4UH 5EN2A 1IE5A 4NGHH 3J8F7 4OGAD 4G3YL 3VFPA 2C3GA 4FD0A 1PZSA 4NPYB 1MCFA 3P0GB 4IBLT 4DQOL 3TWCH 2J5LC 2Y6SD 1M56B 4XHJD 3P73A 2QADD 4XP6H 1BG1A 1E6OH 1RP8A 4NUJA 1JZGA 2XI9A 5DJXB 1ASPA 5L7XL 3IAGC 2X2YA 2EC9U 3PJSB 1JNNL 1Y6MR 2G60H 4KKQA 4BFNA 4OJFH 5HGBB 2WQXA 3FO1A 1PY9A 3MRCA 2CGZA 3G5ZA 1R3IL 1QLFA 3CFQA 3FRUA 2FNWA 3E80A 5KSAC 1MFAL 1YNTB 3FT4A 1SJHA 5IK3A 3T4YA 2IQ9H 4APXB 4P5TC 5J57B 1CL7H 2GQHA 3K72B 3QCTH 4JLRB 4L0YA 4J8RB 2BLFA 3VMOA 4PVMA 3UPRA 3BP6B 2MHAA 2VDNL 2WKOF 3QJRB 4L3EA 4KDTA 5D70H 2DYPA 2P5ED 3FHQA 5MHSD 4GT0A 3UZEC 2VDLB 4J3OD 2PCXA 4W9CC 5T3ZE 2VSMB 5HYSG 2VERN 1K8IA 3KWUA 2W07B 1I9JL 4KJWC 1FZOB 1RIVL 4O58H 4GBXD 4A67A 3QJQB 4IGBD 4P46B 3RJDA 2IWEA 5EU6B 1F58H 5HPOA 2CKBH 4YR6A 1WP6A 2A6KB 3F05A 3VDCA 4U3SB 1HSBA 4PBWD 3RWHA 2D3VA 4NUGL 5JHBA 2YRLA 3Q05A 3KPRE 3FUIA 1MUJA 4HIXH 4WFGD 3AY4A 4ZMLA 5F1IB 3EKCA 2GAZA 1IEHA 4MA7L 4OLXH 3NN8A 5DWUH 1T0NA 4AYBA 4ADJA 1EHLH 1TXKA 2LFEA 2X1XR 3FB8A 4I0PA 5E99H 4ACTA 1F4XH 2EDWA 4LLDA 3CVHA 2Z7YA 4QRAA 2HN7A 2WNXA 1T5WB 2CDGB 3CBRA 2K6WA 2AVFA 2OJZL 3VACA 4PJDB 3WEBA 4PJXA 4S0HA 4V1DE 4XMLH 2YARA 4GUPB 1D7DA 3DC0A 2C1PA 4Z6AT 1C08A 4QHMB 4OI8A 1CWVA 3INOA 1YNKL 5BZWA 4CSZA 2EIKB 3WIHL 1TTCA 3ZUCA 3B2MA 4M4RA 4PGJA 5ITFA 4ELMB 2HWZL 3SE3A 2HJLA 1MCNA 4C56D 1CDIA 4Y16B 5DQDH 4XXDA 4UM8B 1F3JA 1WAAE 4U1HB 3QBTB 2R9HC 1MF2L 4XBEH 4MJIB 4XCEB 2UXFA 2NY0D 1NOLA 3MRJA 4PJCB 5FUCC 4YS4A 5IM7B 3OR6A 3W0WB 4Q56A 2PYED 1ZLUK 1XH3A 2I60L 4GRMB 4MJ5A 3DUUB 4DUWA 3HHMA 4AMKL 4B9IA 5EF0A 1KEMH 1S7QA 5FF6A 1HTYA 3IU4H 3LRLA 4LLUB 4ZUUB 3G5YB 5DR5H 4KKZA 3N04A 5HHQB 1URLA 1KIPB 3CLEL 1YSOA 2XWBB 3RPIB 3BX7C 5GPRA 2VRKA 4X9FA 5TDOB 1ORQB 1AXIB 2D03H 1JGEA 5EOTB 1N2RB 1OGAE 5CJQL 4OCRH 2P52A 1NPNA 3DETD 3LKNA 3GSOB 3QRGL 4OZGF 3QUZB 3D2UD 4OF8A 4R4BB 1LQSR 3RVWC 1OAXH 3G5XB 2F8OA 4FRWA 1DVFB 3MRRA 3RVUC 1H3WM 3HE6D 2WLMA 1PLGL 2XN1A 4RMRA 2ATKB 1IBGH 4W93A 4HS8L 3K5RA 4X8GA 3TEWA 5I9QC 4I89A 5FLUA 2MCG1 1LDSA 4HZ1A 3MA7B 4Q4EA 4OLUL 3B5HA 3SCMB 1C8PA 3NIGF 3TNNB 3QAZB 4LHUG 4JO3L 1GAFL 1J48A 2DLEA 2OM5A 1YEEL 4P9HL 1I8LA 4Y5XA 3F7YA 1ZLWH 5K9QG 1GS8A 2GI0A 3B6SA 3V6OA 4EVNA 3QORA 4L0PB 1CLYL 4DKFL 1RJYA 4L4TE 1YEGH 4JFDA 5HVWA 5IKCA 3VW3L 1O6SA 4PJ7A 4J28A 2LU5A 1EBAA 5DJ0B 3CTTA 3RVVC 2P49B 2Y6TE 4GAYA 1REIA 2WLKA 1YAZA 3APDA 4PB0L 4HJ0D 4Y2DA 1HWWA 5IOKA 3NZSA 4P2OB 4ODVL 1V5JA 3A24A 4I4WA 4ALAL 3VTTA 2A1WH 5D1QB 4HXAL 1X5LA 3DTXB 5AW7B 4I48B 2ZUUA 3FRPG 3ZL4L 1B90A 3T2LA 3O6KL 4OI9A 5ISZE 1IU1A 5I19L 2R2BA 1BJMA 1IIKA 5L4FA 1JNNH 5C0BB 3ARDC 5B1BB 5EIIB 4BWTA 3UC0L 5EUOA 2L4OA 5HI5D 4LCCC 2QKIC 5BJTA 4JRYD 3ABMB 4QRPE 2XNAB 3CV5A 3FU3A 2DYRB 3AVEA 1L9TA 4AYID 3QUXA 3REWB 4FL4C 3ZE1F 3L5WA 3Q5OA 5B3JF 3I9GL 2W0FA 3T04D 1F6AB 2WXRA 3AACA 3OHXC 2VDNH 3HZYB 4WUUE 4F15B 1QABA 3DSFL 2QVTA 2XN9A 5JOPD 2BH0A 3D18A 1JK8A 3QPQD 2CHWA 4HQQH 2BSED 3DYOA 1OW0A 3NJLA 4AIOA 3JTSA 2YQBA 3BJLA 2W91A 1I9JH 1S46A 1SXZA 4Z7QE 4FYSA 1XCXA 1AP2B 2R39A 1CF8L 3FDWA 4P2RA 3RKDD 3KLQA 4FHJA 4V11A 3MLYH 4AVJA 1Q90A 1ZWIB 2QBWA 1NCHA 1WA0X 2Q8AL 5DHYB 4NUGH 2ZX8A 1ZLSH 1NIAA 6TAAA 2E4FA 4X6EB 4PWIA 1U3JA 4NUJB 1OCCB 4PIRF 1BBJB 4NNXA 4U31A 4MA7H 2F5BL 3ARBC 4GRWE 3S35X 3FO1B 1KLUA 3MRCB 5B8CA 1JSYA 2E27L 5DD3L 2DICA 3UDWA 3BFWA 5IJCC 1J05A 1OK8A 4A2EA 3VD3A 5FKPB 1OO2A 2FE0A 3FT4B 3HE7B 3V55A 3QIWD 3T4YB 1FN4B 2X9XA 2VIRA 2GIMA 4DCQB 2NY2B 3V4PB 1MFBL 4HHWA 1IGJA 1PQZA 2DYPB 4O4YL 3TEYA 2AJVL 5IHUL 5AAWC 5ERWA 3KBFA 1EAQA 1K6QL 3WIHH 1LD9A 1LHZA 4PRBA 5CSZA 3UGEA 3UCQA 3VXQA 4WF7A 1W80A 4GQZA 2VLJE 3QR1A 5FCUH 5LBSA 3LH2H 4OIIH 1Q4NX 1MF2H 4XMWA 2D7MA 4UOZA 4G80B 4M8QA 4BFRA 3H53A 3ILEA 4YR6B 3TA3A 4JFFD 3L3IB 3PFQA 1HSBB 3RWHB 2VDOB 3D08A 4L4VE 1HWGB 3ZDWA 1JZFA 5DJ6A 2EJ1A 1MUJB 4L8BB 3U36A 2GAZB 2VYRE 3NN8B 4MKTA 1FUNA 3QEQE 5AW1B 2OSYA 2JH2A 3RWEA 3QW9A 3CLEH 4I0PB 4LPVA 5B7FA 4BDVB 3MOBL 5ADOL 2WQWA 4XZUA 3RVXC 5HYFA 3CVHB 2AV7A 3IE4A 1J7VR 4RZCA 2Z92B 3P4NB 3TT1L 1MCDA 4JMXA 4Y4HB 3SDXA 1ZAGA 1SBSH 5SX5H 4L8CA 3QRGH 3NCXA 3BPLB 4OIAA 2DI8A 4HWBL 4PJEF 4FAAB 2WWNA 4HEPA 2WBKA 3BFQG 5JHDE 1E90A 2E7BA 1ILSA 3F3HA 4N2KA 4WHTA 1ZHKA 1ZV9A 1CLVA 5GS2D 3WNIA 2LV4A 4HS8H 3NJHA 2HJLB 4LRNL 4XXDB 4J2QA 1LK2B 1F3JB 1PZ2A 3W11D 2EDDA 1S78D 3TN0B 1COBA 3SOBL 2HH0H 5CN1A 3VFVA 4OLUH 4AW4A 3AWGA 4JFYB 4FQ1L 1ZTMA 2Z4TA 4ZRGA 4JO3H 3FN0L 1XH3B 4P9HH 1YEEH 1JHLH 5HGAA 1B6DA 2FRGP 5B7EA 3HG4A 3ULUL 3FB7B 5TF1H 3CSBA 2GBVA 4JCLA 5D6DC 4DKFH 1W0YT 2OMUB 4M7LT 4O2FA 4U6YB 3ZZSA 2XPGA 2B08A 3VW3H 1HH6A 1F4YH 4NUQA 2HVJA 3KLSA 2DQJH 4NBZB 2V8LA 3LV3A 4H88H 1NCAL 4GUQA 1JGEB 2N7BA 3FU0A 4FFYA 4U6VH 3A22A 2IVFC 3LKNB 4C4KT 1K2DB 3G9AB 4XNXL 2G9KA 1A3RL 4M6AA 4XVUD 2E5EA 4G9FA 3V8CA 3MCYA 4YSPA 4KNQA 1U8KB 1L9RA 2FJSA 3KNBA 4L8DB 4ZMQA 2ITFA 1CVRA 1R3LA 3O6KH 2MCPL 1K8DA 3O3AB 1KOAA 3WFZA 3KL5A 2Q5BA 2B16A 2X2UA 1DJIA 4FQQA 1D9KA 4FLSA 5IHBA 5J13B 4YSTA 1QZNA 4JZNB 3UC0H 3RA7H 2XX1A 2HX8A 1IGTA 4JUTA 4YZWA 2NRDA 3SY0A 1KB5A 4LSUH 4OVUA 8FABB 7FABH 5DEFB 2UX7A 3LRKA 1I1FA 1OTUC 3O6FD 3WLWC 5HPMB 1KGCE 4Y5XB 1AGEB 3F7YB 4K4KA 4PP1C 3LD8C 4CGUB 5L4IA 1JVKA 2D4DA 4EVNB 1U2HA 3QORB 5ECGA 4DZ8A 1N70A 5KBPA 1Q0YH 5ACMA 1QSEA 3ALXA 1GYAA 2E74C 4WLCA 1UZ8B 1QKZH 2DZEA 3DSFH 3O41A 5HHOB 5KZCD 1SYSA 4IRZL 5E95B 1TJHL 2V2TA 1BM3L 2O30A 2QKSA 2FEJA 1KSRA 1BIIA 2HRPL 2MTAA 4UUJA 3SKJL 2BIHA 3FULA 2RACA 5DD0H 4B50A 4ZQTA 3FUJA 5IGXL 4Y2DB 3K6FA 1GH7A 1R0AH 3K6SA 5I6KA 5TPWH 1EJ6A 2AXHA 1KCSH 1CF8H 4R84A