2O6PA

Crystal structure of the heme-isdc complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
GSDSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the heme-IsdC complex, the central conduit of the Isd iron/heme uptake system in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transport protein
molecule keywords Iron-regulated surface determinant protein C
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6pA00
2E7DA 3QUGA 4MYPA 3RTLA 3SZKC 2ITEA 4NLAA 3QZMA 2K78A 4H8QA 3VTMA 2H3KA 4FC3E 5D1XE 3QZPA 2ITFA 3SZ6A 3QUHA 3QZLA 3OVUB 3VUAA 2Q7AA 5D1QE 2O1AA 4H8PA 3QZNA 4WJG3 3S48A 3RURA 4YMPA 3QZOA 2MOQA 3SIKA 2Z6FA 2O6PA 5D1ZI
chains in the Genus database with same CATH superfamily
4KRPD 3LOWA 1E7VA 5DXWA 2XYCA 4Y5XC 5EFIB 4Z7OE 1V27A 5KSAD 2EEXA 3C12A 2KLRA 3WEBA 1I9IL 4NQEA 3ZK0A 3DJRA 3KDMB 5ADPH 3BVNA 4O5LL 5D9SB 3PHAA 3LKQB 4PJAA 4PJ9A 4NGHL 4NM4L 3ARDD 3RNKA 3FB5A 3SGJC 2WMPB 4O2CB 3D30A 1U58A 3IKKA 2FECI 4XCFL 4JPKH 5HHPB 1A0QL 1IFRA 3CFQA 2EC8A 1S78D 5DD6A 3QUZA 4WNQB 2WSPA 4OCXH 5DD0H 5ECJE 1GH7A 4M8QA 4N8CL 2EJ1A 2P8MB 4X50A 2MEJB 1ICTA 2OV0A 3WHXA 4M43H 5CEZL 4UT6H 4ZW7A 3IGAB 3KYKH 3KYAA 5CCJA 4PJ8D 3LB6C 1BPLB 4AIZB 4DVRL 1R3IL 2GK2A 2P3YA 1RPUA 1TZGH 4MD4B 4P07A 1S9WB 1XSJA 5BRZB 2HKHL 3D87B 1QNZL 3HE7A 3NSDA 3ZTEA 1JZEA 3FO1B 4OT1L 1I53A 3Q5YA 2VUKA 3B9AA 3SO3B 4ODWB 2K7PA 1PL3A 1DQLL 4RGMB 4HXBH 3ZBMA 3BAXA 3FFDA 3ZRFC 4TOYL 4P8QA 4E41A 5AW8B 3DX4A 5K59E 2VXVH 3ZE0E 1SY6L 3AWEA 5ADOH 2W9DL 3AS1A 5IEKB 5KJ7E 1DQQB 2XCMC 4N2DA 3C2AH 3D8MA 2X6CA 1NGXA 3I6SA 4NDMB 1LO2L 4ZUVB 5HHOE 4LQ1A 3NCMA 1G7QA 1IKOP 4BDVB 1MCHA 2CWRA 1BXUA 5I1KH 4J5VA 3FH7A 2CH8A 2K8MA 4LXFA 4DN3H 3TF4A 1CFTA 3MRRA 1BDYA 4FE9A 4H0LC 2JKXA 2OMNA 1QABA 3VSQA 1IEAB 3NTCL 1AR1C 5FO2A 3AXHA 5LJYH 3NPSB 4EZLA 4D9LL 3S2AA 4YAQA 1Y0LA 3I9GL 1NSNL 4U4BA 1FORH 1YO4A 2A7BA 2YIHA 3HC2A 4XNAA 3U1PA 3L5XL 4R2GB 3HG1A 3VMOA 1A4KA 1QSED 2E8YA 3N55A 3FUDA 2EYRB 5EZJB 2H0PA 1F13A 3DGCR 1F4YL 4PTUB 3RB5A 1FLRL 2QADB 5EEZA 3STBA 1PG7L 1QBBA 3NIGE 1W8NA 1KCSL 1CFNA 3RVUD 1B0GA 4YXHL 4GG6E 3VFVB 4QRPD 3QIWC 3DSNA 1YNLH 2F53E 3ARBA 2R4SL 1MI5B 2CHWA 4G2AA 5DJXA 5D71L 1KJ3L 3BKMH 2UY6A 3MC0A 2A0LC 3IWUA 4I3RL 4HCRA 1UH2A 3QRFM 2EKSA 2ARJB 2VDNH 5D1XD 1R3LB 4IIQB 3C6EA 3ILEA 4JLRA 4X7SL 1R0AL 4OI7A 1OGAE 4XI5C 1M05B 4KKCC 4MMXB 5TTRA 5MI0B 4MWFB 4HJ1A 1JXJA 3QDGE 2NXZD 4YBLB 1NDTA 1IAIM 2EUVA 2NYYD 4YBLC 3PIQA 1XGUA 4ZX5A 5FYLE 1DTUA 5HDBF 4XNDA 1JK8B 1HFUA 3MV7A 3ATAA 2VUYA 5AUMA 1YPZE 4Y5YC 3O3EA 3DJTA 4KKAC 2CKBH 1EGJL 3OZ9H 3HBQA 1FLTX 1UA6L 2K78A 3U79A 4EI6A 2HRLA 1EFXD 3BMVA 2ITCB 4HK3J 3IDIA 1XGRA 1EHNA 3ARGC 4N20A 2NY2B 2EDDA 3VCLA 2YAMA 3MRGB 2F54A 3BZ4A 5GZOA 1HEZA 1PMYA 4B0MM 4PBXA 5I74C 2DL2A 1D5MA 4UUJA 4B96A 4Q6IC 3BKYH 5E6ID 2MNWA 3QRBA 1LEKB 3NJHA 4JPWL 2DDQH 3MJ9L 1JN6B 1QI5A 4GI8A 4YSCA 1JOIA 4ZNEE 2XN2A 4NB7A 4RMUA 3KPRD 4FNRA 4ZTPH 3ZO0A 3V0EA 5C71A 4ADJA 4U7KA 5BV7B 3LNFA 1KCLA 2E9WA 4HKXB 4KJQD 5DEZA 2CUIA 4DZBB 5C0CA 3WFDH 1OGTA 2ZXQA 3TBTA 3BJ91 4I77L 4GAJL 4RSYA 2V2TA 2V2TB 4X9YA 2WQ8A 3OSKA 1EFXB 2OYMA 3BZFA 4Y4FB 3DBSA 4EN3D 3HLAA 3CSPA 1F3JA 4NQCD 3VD9A 1T1YB 2HT4D 1H15A 3OKOB 5LAXA 3RNQB 4NKMB 1MUJA 4UQ3A 3OZLA 3D25B 3DX0A 4NRZB 1QATA 5HJBA 1WWCA 3QO1A 1CGYA 3HJEA 4KDTA 1HE7A 3L3OA 3DTUB 2J8UE 2XY1A 3MRLB 4XMKL 1NEZA 4JRFA 4FABL 4K73A 4WLCA 4QXUH 4IGBC 1A7OL 3ULUF 1BVZA 3B7YA 4HD5A 5A7EA 3EXLA 2XG4B 4F27A 5ICZB 1SXBA 3BSZH 3FFCD 3FFCB 4G7YL 3SDCB 4ZSOA 3LZLA 4WI5A 4QXUL 4C54A 5IQ7L 4HAGA 2UZXA 1F90L 4TNEA 15C8L 1X5YA 4L3EE 4LRIC 3VVWA 4EMZA 5HD8C 4HCFA 1R33A 3U7YH 2VXQL 3V0WH 1CXIA 2FSDA 2FTAA 4QYOB 4U1KB 4AGLA 2PCXA 2HFEA 4CU8A 4JZJA 2RCSL 2XSKA 3DPDA 4HPHA 2J3SA 4O2FB 2EE2A 3PWVA 3RWFB 5AW4B 4OSUH 4TSCH 3ZTJG 4RRPG 4GS7C 4P23A 3D3VB 2VAAB 3V0AC 2VAAA 4HK0A 5DJ6A 4CKVX 4HJEA 4XZ4A 3OR7B 3BO8A 4LFHD 4Z3JA 3U0WL 2EUXA 1G9HA 1O6VA 2IPTL 1NC4A 2W0PA 2X6MA 3GKZA 5B1BB 3CQFA 2Q8AH 3CBJB 1DN0A 2VQ1B 1AAJA 4X42A 1FG2A 4YHZH 4P49A 2WIMA 4MA8H 4JJHA 1A6TA 4UT6A 3VTMA 1M7UA 4DAGH 3SGEH 1F6LL 1YNKH 3DIVA 4AIEA 1TVHA 3C6LC 4PUBL 1G9MH 3D69A 2O6FA 3UO1H 3GBEA 2D03H 4MB5A 3TT1L 3T4YA 2MNJB 1ZAGA 4RFEB 5GRWA 3GQFA 5LCVA 1WDAA 4CSTA 3PUUA 3UTTD 5HYFA 1SBBA 4KK8C 4Y88A 5AVQB 4BH8B 3FTUA 2DQHL 4GO9A 1U36A 2X1XR 4LLVA 3WN6A 1NC4D 4I89A 2ADIB 2VXQH 4N86A 2QJDA 4O02H 1VRSA 5K33A 1DQKA 1A1MB 2GCYB 1E90A 4HAKA 3IJEA 1D6VH 4RMVA 5EU5B 4H8WL 4Z95H 3P69A 3U4KA 5D1XC 3HG1E 2HG0A 5KBKA 1D5BB 2FYVA 3QJHB 4NHUB 5IHHA 3U30B 3TS8A 5TDOB 3HHRB 5A2CA 4N5EC 2X3BA 3F3HA 3JT2A 3KLLA 5L8LB 2HFEB 2PABA 3JBG7 4MKTA 2VLJE 5IV2A 2X6VA 1PBYA 4J4PD 3J2PA 3ABLB 1MI5E 4O2FA 4ESKA 1EQWA 3PHSA 4EN3A 5E8NA 5C86A 4U0QB 4M1CD 4S1QH 1JPSL 3NCCB 1HCFX 4R0LB 5D71H 3SBQA 3JZ7A 3IU3B 3NCBB 3D52A 4GYBA 1WWWX 3S4SG 1F42A 3WAKA 4A7QA 1PNDA 5GGTA 2HUEA 2KS0A 3T0EB 1DEEA 3HOGA 3KPRA 1FZJA 3HE6B 2WINA 4I77H 1R4XA 5HHNA 4UNIA 1A4BA 4ZFOA 4ILDA 5IVXE 3FYIB 2DWYA 1HAWA 5GS1A 2OSLB 5I0DA 4MA8L 5E2TL 4OF5A 4AQ8C 1YEGH 2J4WH 1NFDE 2VDLL 5FGRA 2PO6A 3P77B 4FN0A 4D9LH 2WSDA 3PHQA 5EO0B 1QR4A 3U6XA 3N44F 1T1XB 2R29A 4PH8A 3LH2H 4Y9CA 5F44A 4FQ2H 3ZQWA 1MFVA 1BVLB 1CDGA 3MRMA 2YSSA 4C8XA 5C0ND 1U8HB 4F92B 1U8HA 1GZPB 3ILQC 1O6SA 1KLUB 2GYSA 1LO2H 3VG9C 3GSVA 1KACB 1AO7B 1VF5C 3A4DA 3QNYA 4N24A 5DZVA 4IS6B 4D8PA 1YEDB 4LAJH 4ZT1A 4TQHA 1CXHA 2W0FA 3HKFA 5C3IA 4E9TA 1NCAH 1TLMA 1ZKAA 2PR4H 3IXTA 1CLVA 3RDTD 2ORBL 5GS2H 4OF7A 1RJZA 4HKJB 4IK6A 4G7YH 2BNRA 3PWLA 5CJ8A 5AZ2H 2WP3T 1CUOA 1ESOA 3JV4B 4GKSB 3DC0A 2J25A 1JPEA 1RFDL 4Y9GA 3H7BA 1Q9OA 3NK4A 1E4KC 2O5ZH 2NSXA 1R3IH 4MBRA 4K7PX 5FFLA 3L1OH 5K9JH 1F00I 1M7XA 4Z7UA 5F89A 2NSQA 1D5XB 4KXAA 1OCRB 3APFA 5SWSD 2Z91B 3IGUA 3PQYB 5FYKE 1IC1A 4ZFFA 5EUKB 2ZAIA 4JMXA 2ADJA 2EE3A 4GW1B 3VI4B 4MXQD 2NNAA 1JZ4A 3STLB 3ULUH 2AK1L 5FHBL 3BWAA 1KDIA 5FW6A 3X1BA 2LTQB 1KN4L 1P5UA 1EJFA 3MV01 4TTDC 2XBDA 4W70A 5DHYA 5FGSA 5IF0B 2OZNA 5T1LD 5KZCD 1K4CB 3VD4A 3QZLA 3TZVA 5JHAA 1JGLH 5FHAH 2I85A 1Q4NX 4OF8A 5AOMA 5ESAA 3RI5K 4MCMA 2AK4A 1C1EH 3FQXA 3F2LA 4JN2A 3HS9A 4ANVA 1QSEA 1RUAL 3FQRA 2QELA 4JHUA 3F05A 1H6EA 4XMZA 5A6MA 1C08B 1MELA 3PGFL 1I7RB 3LYRA 2KBGA 3VXNB 3WY3A 1QHQA 5IIEB 4Z7WB 3QDGA 1IGTB 1JWMB 2NUPB 2AV1A 4DGWC 5IB3B 2OR7A 3I6KA 1X5MA 3S97C 5HDLA 5DGRA 3VFSB 1JXKA 2X88A 5D5ME 3Q9QA 5IHWA 1UJ3C 4JG1H 2NZ9D 4NS0A 3IVKB 3QORA 3BPLB 4QJ5B 2DOCA 1DLFL 1OCWL 4WFEE 5CR1A 2VR4A 4MFHA 3ZKXC 1UZ6F 3CDFA 3GMOB 4KK9D 5TK2A 2FBJH 3KHOA 4QCIA 1RJYA 5ENWB 3GLDA 5I1AA 2DQTL 5D2NA 1AQHA 4OR1A 4QEGA 4YQXH 2VR7A 3KCPA 1TYRA 3NAAL 2A73A 4OIBA 2R69A 4KUZL 4J23A 4J3OH 1CFSB 2EDMA 1WUZA 7TAAA 5E00A 2VT0A 4Q58C 4QJ4B 1HJCA 1BGXH 1UM5L 4JUTA 4J6IA 1OWWA 1AXSA 4FFYH 3ZE2B 1WG3A 1ZV9A 2UUDK 4FJ6A 5F1OB 3PNWA 2Z91A 3L4UA 4L1BA 4YX2H 1TJHL 2A6DB 4MJID 1FNFA 3VI4A 4LCIH 3H9SB 2DQDL 2X53A 1BJ8A 2WYTA 2GT9B 5CU9A 1W2KT 3TBWA 2CLZA 3ZDXE 5JA9A 4HJJL 4JZNB 5E2UL 1FAKT 4JFHD 4BZ2A 3TOPA 5DS2A 4JPQA 2WTPA 4AITA 5BZDB 3RY6A 3IGLA 5E2VL 5CFHA 3IDJB 3MNDA 4U1MB 4UQIM 1GIGL 5IESH 1PD6A 3LRHA 3Q8FA 2G0LA 2V2XB 2ZOOA 1NMCB 4HEME 4X8XA 1LK3H 2E76C 2ZWSA 4WTZG 4JPKL 4WWKA 3LD8C 5FA4A 2OXHB 5ETUA 2KUTA 5KBLA 1I7UB 1L7IH 3C5ZB 3ETTA 5C70A 1VIWA 3X14B 1VFUA 4LHUG 3ES6B 2ZKMX 5HGBA 4XVOA 4HUCA 3WLWC 1ZSDB 4BA0A 1J8HD 3D39A 4Z0XB 3P3RA 2OMVA 3UBXA 4IKIA 1BM3H 1UUNA 5IW1A 2B1AL 3QZWB 4N2NA 3H7LA 4UDTB 2I07A 3CSTA 3ROLB 3NCJH 1ZSHA 3VTAA 2ILLA 3SCMD 3ZXAC 3VI3E 5INCA 3UTZA 3G5ZB 4QOKB 5JO5B 1S7WB 3A5VA 1S7WA 3HNTH 5I5JA 2MHAB 2CO3A 3CGTA 4TVUA 1R5IB 2Y5QA 1Z9PA 4H8UA 3EDJA 3LZPA 5C0AB 3CSYA 4YE4H 2DQJH 2HUHA 4PWGA 4JANB 3VM7A 4A2GA 3ILPA 4PVBA 4U1GB 2VXSL 2C9AA 2VNCA 5JHBA 1BVOA 3NFSH 3V5DA 4PRAB 1GXEA 4R90L 4Q9CA 4WTXA 2EE0A 4JCWA 4LLWB 3QIUB 1G1KA 3QIUA 4J3TA 3BC9A 2BVEA 2YXMA 1PY9A 4QTFA 4RGOH 1M9WA 4JZOA 2Z4QA 4Z7UE 3BQUC 1CCZA 5I18L 3G9AB 1L0YA 3FXIC 3VVVA 2RACA 4B9FA 2HLFD 3N9GH 2YPLA 2EILB 5M94B 1WPCA 1MFCH 5GJSH 2XFXB 1ILUA 3ET9F 5ETUB 4MDJA 3LCYA 1NGYB 3HI1A 3QUKB 2V7NA 4LLMA 4LLMB 4PLOB 2YPVH 4I4WA 2I9TA 1OSZA 1KZQA 4JDZA 5SWQB 4GRLB 3SQBB 4OB5H 1VEPA 1KY7A 3VXRD 1N64L 4IIQC 4ZOBA 4U1LB 4NUGL 2JKJA 2R29H 1P2CB 5DJCA 2J2ZB 3O2DL 4GUPA 5DC4B 4RNRA 1BMGA 4POUB 3IU4H 4JFHE 4Q9RL 1VADA 1D3CA 2VKWA 5KW9L 3Q06A 2YD4A 3V0IA 5SV4A 1PZUB 3TO4A 4X5PA 4CA4A 4ZYKB 4URTB 1DEDA 3FU8A 3MV7E 4MJIE 1LP9F 4P2QA 4TUOA 5F72S 2IQAB 5FKPA 3LH8A 2FO4A 4LPCA 4KMLB 3EDKA 4ZX3A 2HWZL 2XKUA 1OCOB 1R5IA 4KRMB 4LL1A 2BS9A 3MGOB 5CN3A 4DEWA 3OKMA 4XPHL 1GMIA 1KUMA 12E8H 1UWXK 4JFDD 3ARGB 4ZTOH 1DYZA 2QDVA 2Z93B 3GSVB 4J12A 1VGKA 2R1XB 3C8DA 1Q72H 3A24A 4N2HA 4UCFA 3KXFA 1UCBH 1YEHH 4GPVA 1PFCA 2I60H 4PCTA 2VRQA 4XVJL 2VSMB 4Q6IB 1C8PA 2ZWKA 1MAMH 4MA1C 1AKPA 2W9LA 3MLUH 2ZKYA 5TH2B 3HG1B 5CJXC 3ZMNA 3V7MA 4JFOB 3SO5A 1X6NA 4HKJA 1OQOA 2XFXA 1KCRH 4HH8A 4GY4A 5CIPA 2Y69B 4HS3A 3HNTL 4WFFE 5D4JA 1YPZA 3EKCA 4TPRH 1S8DB 5ESQB 4GKSA 2XG5B 4PJCE 1SF3A 2OK0L 5JHDE 5E94A 2B77A 4F91B 2ICWI 1SNRA 3JV5A 5DFTA 5DJCB 5TE6H 4FL4C 4G5ZL 3L5IA 1AYOA 2EIBA 3P11L 4LCWA 2J5LC 4OD3H 3SD2A 4X4YB 2BSSA 2UX7A 3EJJX 2Y7SA 1CICC 1CFMA 3PQYA 3DGGB 3PP3K 4LLUB 4RMSA 4ZFFB 5GRVL 3BD3A 2WQRA 4N2BA 3L4TA 3MXWH 3HG4A 4G42A 4KTEL 3WEXB 2Q7YA 4Q2ZA 4ICWA 3HBZA 5AW9B 2VDRB 2YA0A 3ARFD 3HMWH 3KL5A 3DO4A 4IMKC 2E0PA 1PKQE 3QDMB 1NM9A 1CDJA 1KCUH 4W68A 5I71B 1ZWIB 1V3LA 1BLNA 3CX5K 2XPGA 3QEQA 5FB8B 5IMLB 2MPAH 4IMLB 4MQSB 2ZPKL 2YD2A 1URLA 4H0HB 4ZQKB 2OJEA 1IKFH 1EMTH 3T1FB 2JNZA 2HRPH 2G9HB 4WKZA 3H56A 2GTZB 1E40A 1TVDA 5IIEA 1CBJA 1QQDA 1OAXH 5E5RB 2FDBP 4YL9A 3VQMA 1GOFA 3AFLA 3ARTA 2V9RA 3L4XA 4KJWD 3ZHDA 2E86A 4DKDC 5LNDA 4PRPB 4ZUTA 2IH3B 3NIFB 3K2KA 3ARFA 3L1FA 3H2QA 2ENSA 1E2WA 4ALAC 4YWGL 3UH8A 4UAOB 1YQ2A 5IBTL 1ZTXE 2XQYA 4FFYL 3P9LA 3WFCL 5KVFH 1OAZH 4KY1L 3IJYA 3LNIA 3O11A 3GMQA 4TQIA 3RKPA 1USZA 4WDIA 1PJ9A 5JQHC 1XMEB 1RZKC 1NMBH 5I0XA 1U8QA 2GJ6B 4BA8A 1ONQB 3VXOA 2IDUA 2YKLH 2YQGA 4JFZH 1F02I 1DJWA 4HGWA 4IHBA 3S3BB 3HPLB 3V52L 3HPLA 4BSJA 2Y1ZA 3ZW3A 5F7EH 5K1JA 3ULSB 2BZCA 1P5VA 1P5VB 4UU9A 4WEMB 3UO1L 4MLSA 4YPGB 4OFDA 2SEBB 1FYTE 4JFUA 2NNRA 4IRJB 4A2FA 1L9NA 3QEQB 5DUBA 5IMLA 3BH9B 1NA8A 5AD0B 2HVJA 1ML0A 4YLBA 4UQ9A 4P9HC 5D1XB 3SODB 4L8SB 3KGUA 4W6WB 2OX5A 3S37X 3SDDA 5DMKA 4N8PA 2YN3A 2HKFL 3T0XA 4GFXA 2ED8A 2WAHA 4HJTA 3SKOB 4PWJA 3GI9H 3L3GA 1JCVA 4QF1B 1N2RB 3LRSB 3B2MA 1BBDL 3FSAA 4AGMA 4F37K 1G9NL 2D7NA 3KHQA 1CGWA 1MI5D 3S3PA 2NMSA 3RAJH 3S37L 4GQRA 5DVOA 2ZYIA 3VFGL 3M1BB 1LO5B 1B0RA 1WFOA 3T4AA 4B53A 1MCSA 1KC5H 2OMYA 2EYSB 1BWWA 3HG1D 3MNVB 2PKDA 4D9RE 3WEAA 1Z9LA 1E3FA 3PE9A 4N2LA 1WC7B 4QD2E 3U36B 2BW5A 4HFWA 5GQBA 3BXNA 3R4RA 4AK2A 3M46A 4LCCA 1HKLL 1WZKA 5BXFA 4N9GB 1P4LB 4QGTA 5LQBL 4KH2A 3UMNA 3S4SA 2JJTC 4JFDB 1XCXA 4QLWA 2BS71 3NIDB 3LPOA 2R56H 3IFNH 1PQZB 2ERJB 5GRYA 3NEEA 2CK0L 3BGMA 3NZUA 2AXGB 3DVGB 5BUPA 4JRYD 4GSQA 3NYKA 2Z1KA 1EO8L 1G6RB 4XP1H 4JDVB 3KL0A 5F7UA 2X0WA 4BFEA 3KLHD 1PY4A 1ZPLA 3CFKA 2WZ6A 3O41B 3DTDA 4XNUL 5AL8A 3QI9B 4GAJH 3SGDI 4WHYH 1YNKL 4WAFA 4WJG3 1P1VA 3T0BA 2OL3H 2X7LA 4WF7A 4J3OG 4FTVB 5HJ3A 1BQLL 5DK2A 2AJSL 2OI9C 5I1GL 4AYMC 3TYFA 1WCBA 2ZG2A 4XBGB 5E2TH 1A5FL 3FU7A 5I1DA 4JO8A 2X1OA 1RZQA 4Y2DD 2X4NA 1UZ8A 5DS8B 3WXWL 2JFCA 5D55A 2HRHA 4Y2OB 2Y36H 4IEFA 5JXEC 3QP3A 3QQ9C 2BRQA 2IQAA 2CBQA 4HUNB 3SE8L 4D8OA 1I8IB 3EJQA 5AVRB 5AFAA 5FECB 5JUEH 2ZOKA 4W9GC 4MS6A 3V0WL 1AO7E 4XVSH 1TZHB 4L3EB 3SB3A 2BIMA 4XX1G 3SKJL 3SE9H 4GEIA 2XXCB 3EOBB 5FYKH 1DJSA 3FU3A 5D7JB 2XIIA 4Z8FL 4YGAB 2VLRD 4GIAA 4NJAH 5EIIA 3V9CA 4MJHA 5ACZB 3IDXH 4RLDA 1MLBB 3ZIMA 4WU7B 5AAMA 4NQCE 5ABDE 4DW2L 1ET7A 1NKRA 3WYRA 5DJ2A 2IALB 1E4XI 5F3FA 5K9KA 4ZOCA 4NCC1 4K8RL 1RK1B 2W07B 3O4LB 4CBPA 3ZL1A 1DZBA 3BUTA 1DFBH 2ODIA 2VLRA 5LUMA 4YXKH 3SQOH 3T2OA 5I1LB 2DY2A 4LASH 5I8CB 3VFPB 2G75B 3K5SA 1TTUA 2GBTA 1A7QL 4W9KC 2AJUL 3R06A 1S7SB 1WICA 3U4BH 3D85D 2IDCA 2MCPL 4DSYA 5FS5A 2R8SL 1CDIA 4PQXA 2DM2A 5E70A 2QPSA 8PAZA 4X4YA 3GHBL 3HFML 3DRTB 4PJBB 4ZMAT 5LDSA 3I6LE 4A6YH 4X6BA 4CSSA 3ABKB 3BH8B 4QAMB 4YDLC 4BQ8A 1QFWH 2IPTH 5DVPA 3EBHA 1EJOL 3MRDA 3DSFL 5KS9B 2JJVA 2JV6A 4HLJA 1AZZC 4P2RB 4WUKH 4UF7C 5HDOA 2D31A 2LLGA 5C6WH 5E6SB 4HUUA 1WK0A 2WYZA 3GIZH 3AREA 5FFOA 5JDSB 2NCMA 3SPCA 5MP6H 1DDTA 1KNOB 2G4EA 3GSNA 4PJXA 1CLZH 4FQIL 3VD5A 3EO0A 2J5LB 4K07A 2VLJB 4EUPB 2W9DH 3NIFF 4WK4B 1KIUB 4KFZC 4M6MH 3L4VA 1ZCRA 1XR8A 4UTAL 5DYOB 4QHNA 4WWPA 5ISZE 2AEIT 4MTMA 1TITA 5DJAB 3HZ3A 4Y0GA 3GNMH 2OMTA 4BWWA 2P5EB 1F90H 3GXDA 2VE6B 5IHLB 3NEXA 4APQB 3I2CL 3IXAB 1E65A 4XVUD 4ZO8A 3RBSA 3AY4A 3O6FC 1NCHA 3ASWA 1FRGH 1IBYA 4WDIB 3O6LL 3T3PF 4OAWB 1K6QL 4OF6A 1H3VA 1NINA 4LVNB 3QJUB 5D1ZC 1AE6H 1CYWA 2XT1B 3MLRH 3MNZB 2VW6A 2YGVA 4BHUA 4ZNEA 5DSCB 4G5AA 3VMPA 1KIRA 1UQSB 1F1GA 3AZUA 5D1QB 1VKXB 4FQQB 5C07E 4KZDL 3KPPB 3ZGIA 1B4TA 1O6TA 2OYLA 2JB5H 3E1ZA 4M43L 5CWSB 4AUYA 4Z3FA 2JSFA 5EA0H 1BMZA 5DDHB 1I8LA 4RX4A 3ULSA 5AAWC 2J8HA 3GKWH 3OC8A 3L13A 4JM2B 3RB7A 3T3MF 4KJYA 3HG0A 2IAMC 1FZMA 2DJUA 1QFUL 5HVGB 2HRGA 3ULVH 3MPCA 4Y4HB 5GGSY 1TENA 4XN7A 3EZJB 4NI6A 3CVHH 3EJUA 4BZ1A 4O5LH 4PJEB 3LNEA 4UQ2A 1K8IB 1CFSA 4FYQA 3MV8E 1X4YA 1FORL 4U1GC 2CR0A 1FSKC 1OGSA 4RDBA 5KVGH 5DA0B 4LHUB 4OLWH 3QR0A 2C1PA 4DN3L 4GBXC 2EXTA 4KMTH 4JY5L 5B1JA 4AEIH 1P9MA 4AYDC 1LP9B 5JOFB 4TV3A 5H2BA 1HOCA 1MFDL 1HOCB 3FN0H 3HC3L 4HJGB 4N90E 2ISDA 3WFBL 5ID1A 1RUPH 2CHNA 3FHEA 4QHLB 1TCRA 3T2LA 2XWEA 2ZONA 2J43A 1B0RB 4XPAL 1PCXA 1UVQA 5A6LA 4YN3A 4NQDE 4HVBA 1N0LA 1OALA 2F53A 3GIVB 3GMLB 3MBWB 2DQEL 3VXUB 4DOHB 2FAUA 1MWAH 1RZ8B 1ZS8A 4JO3L 1QLFB 4M3HA 5JHMA 1PX3A 1PDKA 1ZA3B 3QPXL 1RJLA 1K2DB 3GO1L 4DO5A 3TESA 2XPZA 1P4BL 3FHQA 3TM6A 2ADGB 4YDJB 4JREB 3P73A 4PS8A 1T04B 4LLDB 3RGVB 4BFJA 2B16A 3C2SA 3WEMA 2VDKB 3T0AA 4AMKH 4TULL 2F54D 4U6XA 1U41A 2D9QB 4PY7B 2BP3A 5LB1A 2XWCA 2HMID 4FQJL 4AL8C 1YYLH 4X8CA 4KK8D 3KPOB 3SSGA 2FO8A 2OL3A 2AI0L 1ACYH 1DQJB 2WZPA 2VN7A 2N7AA 2YMOA 2B7DT 3OJMB 4R4ND 1KN2H 1JGIA 2HX8A 2WBJD 1CQYA 3S5LA 1BFOB 4A68A 3GUTB 1JGDA 1JK9A 1FVCB 3LJ3A 3II1A 1BF8A 4DKEH 3NZ8A 1OP3H 3AM8C 3C9NA 3H0TA 4JDTL 5E7BA 4DERA 1MZZA 1ES0A 4FTVA 4KNSA 4X4MA 4YXLL 4TQPA 5GRZA 1U8JB 4O2EA 5HPMA 3JVGA 2XTJB 4UM8B 5BS0B 1E0OB 5E8DH 2VRKA 5ADPL 3QVAA 4LOVA 3AG2B 1X5LA 5DD1L 4UDUB 3HMXA 3MOQA 4JRYA 4XC3L 5ID0A 4HISA 3GJFH 5EC1A 3G5VB 3QC5X 3ZYIA 5I19H 2B2XH 1L6XA 1S9YB 1QFWM 3TEXA 5ESVB 5KTEH 1L7TL 2XBTA 4NO3A 4BELD 2BW4A 1LO0H 4OM0L 1BHGA 3QWOA 1YEEL 2BNQB 2BSBA 3GS7A 1J8RA 1BAWA 3O9WB 2F74B 3WN5C 1CQKA 2NX5E 4PRHE 4FXKA 1TZAA 5F6HI 3SKNB 2Z1PA 3BSGA 4MNHB 2EVHA 2WLIA 2FYYA 5DLMH 4S1SH 3EFFA 4ZTEA 1EHLL 4J3OF 5F9OH 4LP4A 5GS2D 3M7OA 3CFJA 1NBZB 2BX5A 2DLFH 2Y6TE 1CIDA 2A9NH 1NBYB 3ZYOA 1NBYA 1NC2D 1KV7A 4PWEA 4PLJC 43CAB 4F1ZA 3MTXA 4TUKL 2JJSC 4DVBA 3HBPA 1QFHA 2ESVB 2ZWNA 2FX9H 4TNWF 3GK8H 4X6DA 1BP3B 2D4FA 2X89D 4PP1D 2WTRA 3V4VB 1TQBC 4GMTL 5T33H 4ZMVA 1DBJH 3OKNB 4JRXB 2HVKB 4GINA 4M4RA 1NAMH 1AZCA 4JGUA 2ZCLH 4F93B 2GJZB 5SWZD 2V0AA 5JUEL 2VR5A 5C2UB 2F54E 2CPCA 1IGJA 2NZ1A 3V0HA 1KBVA 5I8EA 1RMFH 1IM3A 1OAJA 2WWKT 3GZPA 2F0CA 1D9KB 1T80A 3VXPB 4OF3A 1J9SA 1YEEH 3HC3H 3IGFA 1CLYL 4TNWK 5DRNA 2R1YA 5DRNB 3D0LA 1N7MH 2Y25A 5SWSB 4ACTA 2XV6B 4XP4H 4AQ1B 2ROYA 1UOWA 2CO1A 3QFDB 2CGYA 3MNMA 2RHEA 4HG4J 2B2XL 1ZANL 1XIWD 4AI7A 4R7LA 2R7EB 1QHOA 1WA0X 3G08B 4G72B 3ECBA 4G8GE 4NZUL 3WMPA 1X5AA 1MCQA 2VDOH 4PIBA 1MHPL 1ZANH 5E08L 1H0DB 1G9EA 2A74C 3WSQL 4HUWA 1AD9B 5ITFA 5JOEA 5J6GA 4HHAB 3HE7D 4N0CD 2IBBA 2EDOA 4L23A 3NN8B 1BYPA 3HG3A 4MMZC 3GSRA 3FTGA 4CL7A 2H9GB 4IYKA 1E9QA 3TA3C 4QUOA 3WO4B 2UXTA 3TFKD 3VD3A 4YDLB 1UEYA 4FYRA 1ITBB 2APSA 4GJTB 1JPTL 1ITCA 2Q7NA 3FH5A 1EPFA 4L8SC 4W9CC 3GPEA 1V5JA 1DVFD 3WS3B 5FM5M 4AGNA 4F9LC 4JFEE 4BE5A 3CVHB 5C08A 3T6WA 2KPNA 5AOLA 3B4NA 1E3ZA 3TBVB 2GTZA 1Z5LB 2WNGA 4E42A 5C07D 4R96B 1I1CA 3L5WA 4QRTB 4F5CA 3W11C 2WVSA 5T1KB 5C3LD 3GMPA 1MWOA 1KPVB 2DEXX 2K4WA 5D72H 5HHOB 2ICCA 3NRFA 1NCOA 3B9KC 3E1F1 4AKOA 4DP1X 1FG9C 4GXVH 4KROC 3CPUA 4NC1C 2EXWD 4KWUA 5IJVB 1II4E 1IAOB 1QTYT 4CVZB 5DEFB 4KO6A 1Q9KB 3IAGC 2NTSP 1YYCA 2CK2A 1SEQL 2VZUA 2X2UA 2ZOLA 4HCGA 2MCAA 3CZLA 3WKNA 1GOHA 2WCSA 2C26A 1PLCA 2FT8A 3QRGH 4DEPB 4DUVA 2KT6A 2O6CA 3WNPA 4LSQH 2DTML 3D4YA 1EFQA 3V9EA 3D25A 2QZQA 1WAEA 2R4RL 2Y06L 3GS0A 4ZS6D 3OHXB 4WCYL 1BW8A 2UYLA 1IEBA 2R59A 3MTRA 3GHEH 2PYFA 4XVTL 1ZT7A 2Y6SC 3D50A 1SGKA 3RJOA 3SGDH 1T4WA 1WZ1H 4XH2A 2V33A 2X9XA 3VFTA 1GR7A 3U48A 1N5YH 1CPUA 2PWHA 1IAKB 2VO5A 1NCBH 1SJMA 2EO1A 4JFXA 4X7TB 4Z3EA 2XWBB 4J4PC 4QHUB 3W9EA 2YGOA 1UWEH 4QXGL 2Z0UA 4Z5RA 3LH9A 1A7QH 1A9BA 3CHRA 1PDKB 1MCWW 1ZA3A 4N22A 3PL6D 3UZEC 3WFZA 5KN5B 1CGSH 1E6OH 5FA3B 4WHCA 3WE6B 1TKWB 3PY9A 2CSPA 5LGYA 3AWGA 3U6RB 1JN6A 4TRPH 2R56L 3IFNL 3O8XB 2QQQA 32C2A 4CSZA 2A38A 2QPDB 3GDCA 3O8XC 4YO0A 3F7QA 1C7TA 3M07A 4XNZC 5J3HC 2BRRL 3WUZA 4E5XB 2IIJA 4K3GA 5E6RB 4L9LB 3QIBB 2ZUTA 4X5LA 5BVPL 4AMKL 2AQNA 4L9LC 4H1LH 3B7RL 4OIAA 4HIEB 3BDYL 3FO2B 1IGYA 5GGRB 1SHSA 2XVGA 1Q9KA 1P4BH 5FV1L 3D5OF 3RDJA 5IBUG 1S6NA 3L7EB 2F5BH 2WLHA 2BXYA 4WHTA 5CU5A 1MEXH 1TJIH 4EJ1C 4B9CA 4HBCH 4FQ1L 1XZ0A 4H0IA 4H7VA 1Q0EA 4HXAL 4L3FA 4PJIB 3GRBA 1TTGA 1YUHB 2N1KA 2WXMA 4FD0A 4R7NB 5H35B 5IQNA 2EEFA 4QHMB 4FX5A 5F9JB 1U30A 2VLRE 4EUPH 1JZGA 3X11B 2EUWA 3QCTL 4JN1H 1KCWA 3I02A 2Y36L 4FHKA 1G7LA 3SDAB 1BJ1H 4Z76B 2BHYA 4M7JL 2EVJA 4YDKH 2VTFA 1JPST 2MKWA 4G59C 5AYUL 4AIZA 1CICD 4M03A 3ZRCC 3QUZD 3IDYC 3BHBB 5DTFA 1XSKA 2YGPA 2X2IA 5I1GH 4H8WC 1WT5A 2QTEA 1OHZA 3ZKND 2ARWA 4I9WD 4OFKA 4ODWA 3PGCA 4I0CC 3DVFA 3AJ7A 3GHBH 4N2CA 3DJ9A 5G5DB 1FP5A 3NH7H 1T3FB 1UACL 1X9UA 2IDFA 4TLTA 1BZDA 1EBAA 2X2JA 4KH9A 4F20A 1YA5A 4EN3B 4DOHE 1I1YB 5I15L 1OWRM 5EF2A 4F7TB 4FQHB 4B41A 3LZFL 2KZBA 3VJ6A 4I88A 2FLBT 3K1DA 5H37H 3POHA 4AVJA 4JFFD 5EBMB 2C7UB 1GJUA 3U7AA 1S7VA 3DUUA 5EOCJ 2VMFA 2DN7A 1IGML 3CZSA 1HKLH 3OJDA 3RRQA 1GZQA 3H53A 1MPAL 1RH8A 2C3VA 1MFEH 1KYAA 2CDFA 4HJ0D 1OVZA 1UYWH 2OTPA 4TN9A 1OT2A 1QSFA 1PKOA 1T0NA 1CDUA 3DJSA 7PCYA 2ZKWA 4XAWL 5K1VA 1FI8C 3LQAC 4GAGH 2JKIS 5KJ4A 2XN1A 4DGVH 1SVCP 3SKJH 4RFEA 1XD0A 4WU5B 4JFEA 4JFEB 2WO3B 4NBYB 4O58L 2VZVA 2H5UA 1COBA 4APQC 1W80A 4KRPB 1JMXA 1QYGL 2G4GA 4H20L 1XTLA 4YH6A 5E4AA 1VFBA 4D9RD 1OT1A 4XOEA 2FNBA 4NUMA 2ED7A 1CO1A 2R2EB 2EDKA 1NIFA 4GAAA 4ZUWA 3O9WD 4P05A 1K8DA 2NXZB 5F3BB 1FYHB 1ZT4B 2CUMA 2P24B 3JTSB 4M5TA 3P0GB 4O00A 2D3NA 2QHRH 4GLRI 4LRNL 5EZLB 3R06B 5CJQH 2X4TB 1H5BA 5JMOC 4G7SB 1S3KL 3GUFA 3K4ZA 5J6GB 3ABGA 5GSVA 5KYXA 4FFVC 2A99A 2GHZA 1SYVB 1ROWA 5L4JA 4FFZA 4B5EA 2BMKB 1CL7H 1MIML 5DJ8B 2J8OA 5FW8A 2E7LA 4QRQB 4FF9A 2QEJA 4HFUL 3U4BL 1HAUA 2BC4B 2EDJA 4BWUA 1FL6A 5BMFL 3CZNA 3W0WA 5CKGA 4PGBA 4CADB 3UERA 1IGCL 4Y8DC 1FYTD 3FSOA 1FPTL 3GC3A 3IAQA 2BIQA 5HDQL 1IC5L 3VX0A 3RTLA 3NFNB 4OCYH 1GZHA 4NZFA 3TYGL 2H1PH 4NSKA 1Z7JA 2V2WA 2E74C 2YS4A 3P9WB 4KQ4L 5HYJB 3DVNB 4NKIH 1D5MB 4XB7A 2XQBL 3O6MH 4AGOA 4BKSC 4HJ0C 4F7PB 1N0XL 3ABZA 5FYKU 3S96A 3F12A 3EYVB 5LHDA 5BW7A 5JPMC 2ZXEB 3WO4C 3H9YA 1HN1A 4EOWH 2CJ3A 3QYNA 3EJCA 4OTXH 3D12B 5EWIL 3WL9B 1IBGL 4RX4D 4ELKA 5D7LB 2J21A 3CFEA 4G43A 1UT1A 3DX7B 1AGEB 3CFDB 3K2IA 5C7XH 4NQUA 1IBHA 1ERNA 2B9AA 4XHJD 3BP5A 4ONOA 4KUCF 1OANA 1BD2A 3VSTA 5IQ9A 1Y1DA 1IKFL 1EMTL 2Y7OA 4OZGE 4AV4A 2XBZA 1BX2B 1Z9NA 1LDPL 4N2EA 3QPQD 2NX5A 4PRHA 5FLVA 3KM1A 3PUCA 3Q13A 4PW3A 1KB9K 1NIBA 2W91A 2R27A 4HUVB 3RURA 2D73A 3DNKA 5AG8A 3O3DB 4Z7AA 1GHFH 1R3HB 5C9JA 3GSUA 1AGCA 4JHWL 3L6FB 3HNVL 3LKRB 3PU7A 1IKNC 3AS2A 2W80C 3CUPA 3KPLB 4C4UA 4R3SB 3EXJA 3W9DB 5AZEL 2UZPA 2HFTA 1KBBA 3TBBA 5JO5A 4NYLB 4L3CB 3NP4A 3FPXA 4MQXD 2IANA 4NNPH 2AEOA 3W9EB 1FO0B 2VJ0A 3MCKA 4HOWA 5PCYA 3FZUD 2NY2C 3LPWA 4DO4A 5FXCH 5DFAA 3STLA 1Q94B 2ZX9A 3CDGA 3BT2L 2F7PA 1GSMA 2QPEB 1JTTA 5EU6D 5I1JH 5I74B 5AVUB 2BSTA 3FQYA 3QWRD 1M1XA 3RE0A 1VACA 4FZEH 4K94L 1MXGA 4LHUA 3VGDA 5BZDA 5I8KL 2N1TE 4U1JB 4N87A 5F71A 1NGPH 3GXIA 3FQRB 4P23B 4RETB 3LQAH 3JVFC 1BEYL 1RUKH 3MBXH 5IZ7A 2MTPA 3PF2A 2ZUVA 3QUMH 3B56A 1OP4A 4TVPH 4PJGA 3E6HB 3C87A 3ZRSA 1Q72L 4JDEB 1HIMH 3WN5B 3KNBB 4LGRB 5EZPA 3OF6D 2WZPD 5IQ9B 1SPDA 1KB5L 3BP6A 2P5WB 4ZPVB 5F96L 2VISA 3ARDC 2DQUL 4QHMA 3X3GL 3UAFA 4R97B 3B3IA 2ATAA 5J6HB 2AJZB 2Z92B 4APQD 3AQDA 3X11A 3FFOA 4N8UA 1M7IA 1LK2B 1KV3A 1OSEA 5KSAC 1ET5A 1AGBA 4HUXA 1AGBB 4DGIH 4A2LA 4OCMC 1QVOB 1NEZB 4C4BA 4EIZC 4JQVC 2BNQD 1CLYH 1P7QD 2XG4A 1TO4A 4NO0B 1JDDA 1PYWB 4OCNC 2EDEA 2WYIA 3V79C 1SXAA 2BHFA 1CIUA 1MY5A 1UC6A 4GAFB 3TJHC 2B59B 2YJLA 3OF6A 1KBKA 2X28A 3HS0B 3BZEB 2H6PA 3KZ8A 4GT7A 2VM3A 2GSGA 3FQNB 4FNTA 3ZKMD 3PHOB 5IK3A 2RFXA 1A21A 1ZK9A 5CGYC 4YFLF 1NAML 4ZMZA 5LGJB 1FVCA 1E5YA 1L9RA 3DHPA 3QZMA 5D5MB 4PGDB 1BAFH 3AM8A 4OD3L 5D6CB 3ULVC 4AZ8B 5EHFA 3OAZH 3IDMA 4X5WA 5FX3A 2P8PA 4LGPB 3UTSE 1RL1A 3C60B 3SDAC 1FNAA 1CXLA 4MMYA 4UT7H 4MJIB 1FL3B 4MJIA 3SYAA 1KCKA 3VFNB 1NTDA 3JUYA 3SJVD 4M6NL 1RPQA 1KTKE 4M7LH 1TSHA 2GAZA 3QUMB 1ZVYA 4XHQA 1J87A 4HOMA 2L0DA 4KK5D 1TO5A 2ITDA 2ZXAA 4OFPA 2OJZH 3FCSB 5HYSG 5DLML 1J7VR 4Y2NA 1IGFH 4R5TA 4PJ6A 1T7XA 1JP5A 1GGCL 1OE3A 5J11B 3I50L 2J1YA 2OR9L 1SUHA 1D2OA 4G70B 2EDXA 3O4LD 3VB9A 2F8XC 1OCWH 2F1BA 2GIXA 1F58L 4GRMA 2P43B 3TA3B 3JTBA 5BVJB 1XQ4A 1KGIA 4XPBL 4WI3A 3WSQH 4AQOA 2XN9A 1C7SA 2J5WA 4GUOA 1AZNA 2AEWA 3D0VA 5AKVA 4EPSA 4P59L 4XC1H 1U92A 4URKA 4B27A 1LD9B 1AHWA 1HQRB 2DMKA 1TFPA 1NFDF 2ZNWA 2JJSA 3DV6A 3FT1A 3TBSA 2CO7A 3C75A 4KRNA 5FCUH 5I30L 5T1MB 2FEDD 2DWDB 3AT0A 1H3TA 1U8KA 1AMXA 3UYPB 3THMH 4DPAX 4E36A 5FAAA 1HL8A 1J8HE 1W9XA 5IKCA 4HLZH 5GGTH 1FO0H 2R29L 3HMWL 3TFBA 1UWXH 4POYA 5TGBB 4PRPA 4ZUTB 3UPAA 4XCNB 3IXTB 5J12C 5T5NG 3Q8EA 1B90A 3BEVB 5I2IA 3SJVA 2YPVL 1J1OH 1QLEL 5EN3A 1UURA 2O6EA 4ORGB 4ORGA 4PM1A 2EO9A 3GJEB 2LFGA 4YHML 1PKQB 5T33L 4HS3B 4XBEL 3EOAA 5IVZB 4WVRA 1F3DJ 1NFDA 2DICA 1Q1JL 4MLIA 3SQBA 2WN3A 1E8WA 2C3GA 2ATKB 4F58H 3HCVB 4HSAC 3UACA 4PRIA 3TIEB 2NXZC 4ENED 2EC9U 5HY9A 3ZT5A 2GTWB 2LU4A 2VDOB 4DKTA 2H2SD 2NY3D 3ME0A 5EUKA 5CSGA 2RGSA 2QSTA 3R1GH 1F1DA 1ZLVH 3BOVA 1IVTA 3MOBL 3RUGA 1HS6A 3EDFA 5ITFB 4NM8H 3RVTC 3IMSA 4OZFG 3D0VB 3MLUL 2ZIDA 2E3VA 1ETZA 1R9FA 4DJMA 4NC1E 1XH3B 1UCBL 3Q7JA 5AD0A 4C56D 2CRZA 4IU2B 4KKZA 1RK0B 4ZTOL 2D3JA 2Y72A 1WAAF 2K6WA 3FQUB 5TPWH 4G1MA 4I85A 1MAKA 2FWUA 3NPSC 1N6QL 3QRLA 3VD7A 4OLXL 4Z7NB 2D2CC 3MODH 1KGCD 4PTTB 1JYXA 3HHSB 5TFSL 5IKCB 1OY3B 4MXVE 1T6WA 3A0OA 3MBED 1YEGL 2J4WL 1YEFL 5CR8A 4YHNA 3AU1A 5IB5B 5LN8A 3B9EA 4AJ0A 1KCVH 1IFGA 4LKCA 4IOIB 3QIBC 1BZ9A 4Q74A 3AUWB 1FYTB 1PSKH 4TLKA 1TZIA 4XMWA 5JPMB 4YEEA 5F1KC 5EV7A 2YC1A 3IJ7A 2BVPA 4ZO7A 1KN4H 1H6FA 3O2DH 1M71A 3EYUL 4TUUA 3JV6A 2CALA 3B8YA 1N64H 1JZJA 3NJNA 3CFTA 2MOQA 3OKDA 4MB1A 3EYQC 3CUPB 3RL1A 4DPRA 2C1OB 1TETH 1NCNA 4A2HA 3HZKB 1YPZF 5E2UH 4E9VA 4FA8A 2AI0H 3CHOA 4OFYD 4APXA 1HINL 3ETBF 4OTXL 2HPTA 4KJPC 4AYFA 5CZXD 1T83C 4BUQA 4Z3HA 4XOCA 4H26B 4YHOH 5LDUA 4M9PA 2E9BA 2DF3A 5FYKD 4YDVA 1H15B 3OKOA 3QUML 3FOMB 4GKNA 4LT7A 5TK4A 2CNYA 1IIKA 3MRFA 1TOXA 4GAYB 1QKZH 4GAYA 2A6KA 2ORBH 1TDQA 4OKVB 2WQUA 5FPIA 4YHPB 4IMLA 1KGWA 3ILDA 5E2JA 4X4XB 1ASPA 5HYJE 1B88A 5C6TL 5I8KH 4QIRA 2LFEA 1OLZA 1ADQL 2F68X 4JO2H 4TL4A 2RTTA 3SDDB 1R5WA 3ZDXB 5FO7A 3QNXA 3AG1B 2EDLA 5EBWA 3KJ6L 2FD6L 1CLZL 5ACLA 2VLKB 3D2UA 4Z18A 4UOZA 5J13C 1DUZA 1DUZB 1ED3A 1WBXA 4FYSA 3BPLC 3T08A 2WBJC 2VIRB 5KYYB 4UT9H 4NX0A 5BUAA 3GSNH 4WI4A 1S7QB 1U8IA 2IOIA 4UUJB 1HKFA 5KSBF 1XEUA 4X80L 3RWCA 1L9TA 2WB7A 4NWUH 2ALWA 1J86A 1QOKA 4FFYA 4OLWL 2BVPB 3O8XA 4WGVB 3TO4D 1G1OA 1G9NC 4OLUH 5FWQA 3RILA 3KCPB 1A4JA 4P23C 4GW4B 4FNLL 2VDLH 2CGZA 4PAZA 3LPPA 1S7TA 4XWOC 1NJ9A 2PPEA 1B9ZA 2WUBL 4E5XG 3I9PA 5I6NA 5K9QG 5GSRB 2A6JB 1GGBL 4PVMA 1HH9A 3KLAB 1K85A 3UJTH 3F7KA 2AJUH 1HNFA 4RMRA 3MFFA 3WJLC 2CO6A 2SEBA 4MHHG 1BQUA 4WK0B 1MUJB 1ZLEA 5FV2A 1NGZB 2J12B 4B9KC 5I24A 3EG9A 1UASA 2JJWA 3QHTC 2ZXCA 5EWIH 4F8OA 1WS8A 3EYQD 3OSVA 4I5BA 4KKCD 4Z7NF 5EU6B 3KGTA 4LAQL 4LCUA 1EEUA 1I1AC 2R0WL 2VW4A 5BCAA 4K3JH 5ITBH 3IFOA 4FP8H 4HF5L 3HS0C 5CLTA 2E47A 5MEQB 4ATTA 2X10A 4JFTA 1WT5C 2I32A 2PR4L 4G8FA 3IRZA 3B9VA 1I7TB 4KVCL 2APBA 5HJGA 4LVEA 1G7IA 4HETA 3QPQC 4YZFF 1M42A 1HNYA 4YLQT 1DVZA 4JBSA 5ERWA 3NCFB 3UZVB 3LQZA 5I6XB 2DQMA 3BD5A 4HKZA 1AD0A 2CO4A 2N01B 1A14L 1OV8A 3KLHC 5GGQH 3MLXH 3BAKA 1O5DT 1XSIA 2EE9A 3N06B 4HFUH 4JFYA 4R4FL 4AMWA 1OAQL 3EO1A 4XCYB 2HKAA 3BAJA 1AJ7L 1FBIH 1OSPL 1SJEA 1T20B 4YHZL 2PYEA 2CD0A 1AVAA 1I3GH 3UTTE 1P4LA 1QO3A 1QFWL 1Z5HA 4L8BB 4UOW1 2X09A 1PD0A 4HWZB 4XP5L 4AJWA 3KPRB 2X6AA 2DWDA 2ED9A 3HRZA 4PB9H 5HI4D 3W38A 3U25A 1G0YR 3TF7C 5DD6B 1VZHA 4KXCA 5JLZA 2YXFA 4JG0L 4AQ8A 2QADC 2VRAA 1K5NA 3LVTA 2R8SH 5TH2A 4QTHA 4BFFA 4XNUH 4S0HA 4NP9A 2YPLB 3BGFC 2BOBA 4JO2L 3KBPA 1CTMA 5D1ZI 1QRNB 2M2DA 3T2PA 3GBNL 3ULVE 4NQDA 3L3JA 1JSYA 1KYOK 1RZIB 4HXAH 5HYQA 1XD1A 2ADIA 2XG5A 2WQWA 3GMNA 1WS7A 3U30C 4XZUB 1XGPB 3IN0A 2EYTA 3LEVH 4GRLC 2VOTA 5EDSA 3D18B 3QQ4A 3POCA 1E3XA 1LE9B 3LN9A 1JNNL 2EIEA 4DP2X 2BSCA 2XRAL 4N2FA 3O0LA 2PP7A 4E41B 1GGUA 1AOZA 5J12B 4NZDA 4AQZA 2Q7YB 4EI5C 2QDWA 3GSOB 2FGZA 3DOHA 4I3RH 4P46C 1E30A 4WFHD 2R51A 4Q14A 2ZSVA 2NW3B 3FUKA 2YD7A 2NW3A 5C0BE 5C8JB 1TMQA 4MVBC 1W72A 2KHAA 2ICWB 3GBNH 3QXWA 4M61B 5FF6B 1UXWB 8FABB 1FE8H 1E28B 4E9RA 4ZFQA 2NUTB 1KCSH 4GSDL 4OZGA 1S7XB 3HE6C 4R4BA 1V05A 4XE5B 3VDCA 5K1NA 3OX8B 3UIYA 1XH2A 4XMTA 2R2BB 4U1NB 4TTDD 5E99L 4BV1A 3IAPA 3BESR 3F7LA 3MX0B 2EE6A 3OAWA 4QOKD 3WE1A 1A66A 4LCYA 4M7KL 4MA1B 1ZVHA 1EXUB 5GZNA 1CE1L 1EZSA 3VXRA 1M2VB 2PO6C 1UGKA 1AHKA 5TFSH 1UM4L 3EFDH 3HN3A 5FDWB 4GW5A 5E8OB 4LSUH 5E6IC 5HVHB 2OKMA 4B7IA 2W38A 1BVLA 2OL3L 1CL7I 5IVNA 5D8JL 1SYSA 2ZX8A 3JWNE 4MRBA 2WJ5A 3QCUL 2CE6A 3PDOA 4P23D 1UA3A 3MLYH 3PDOB 4P5TD 1AGFA 2BFGA 4UTBA 3QG6B 3QQ4B 5FUOL 3QCTH 4HALA 1A14H 4WQOA 1YZZA 4ANWA 1J88A 3D08A 4Z7QF 1G7MA 3SOTA 4FXGA 4ZPTB 3OPZH 3A6BH 4XP1L 2IWKA 3DRTA 4PJBA 5KSBB 2J1WA 3MNWA 4AOFA 1VPOL 3LS5L 3BH8A 1XEDA 1AKJB 2A9MH 4KK6C 2QGDA 4IGBB 3ZR5A 5EUOB 3QUYA 1RZGA 3IPFA 3TCTA 1PLAA 3ZDXF 4OJEH 4WSGA 1N19A 5DURB 5DK0A 5D9SA 5IMOA 3SEPA 1KTLA 2OMUA 2ZZUT 2ZXGA 2DM7A 3IJHA 1BZEA 1CD8A 3K8MA 2YD3A 3S7GA 1G0XA 1INEH 4RQQB 1BJ1J 4WEBH 2WV3A 4LBAA 4NWTH 4G6JH 3RFRA 1NPJA 3AAZB 1A9EB 2O93L 1OGAD 4K7FB 2OMZB 1EAPB 5C0EB 5D1XE 4AW4A 4XO4A 1FNEB 3UJTL 5B39B 2YQBA 3ORJA 1NL0L 5ICYA 1E5BA 1T5XA 2ZJSH 1GGBH 3SKMA 1WAPA 1KG0B 1KCVL 2F53D 5I17B 1QZ1A 3FQWB 2VDNB 1S9VB 4ZTPL 2CJTA 3N3EA 5F97E 1JUFB 1WAAA 3PG2A 1LWRA 4XNBA 1QLFA 1XCQB 3BEWB 3I9GH 3P4OA 2GJ6A 2IPUK 3DX9A 2L7EA 3INUL 4JKLA 4OBRA 2BNQA 4AYBA 4PIRF 4Y2DC 3X1FA 1T21B 4M62H 3M86A 4QRAA 5IHUH 4OLVL 4ZODA 1QBLL 1EFXA 2H32B 5CO1A 3VRIA 4PY7A 3VRIB 1U95A 4CJ0A 1BECA 1OAQH 4EIBA 5HYSA 3LN5A 4DK3A 1HHHA 4LLQA 2X4OA 3K2MC 2OR9H 2BERA 2K8QA 3OBAA 2ZP9A 2RCSH 4FFZH 3QZWA 3CFCH 4HEPA 1U3HB 3L3DA 4KPHL 1TU2B 1ZGLA 1UFGA 1WF5A 3CMOL 4OCSH 2FGWH 4E9QA 1DBJL 5B8CC 2WLYA 4OD2A 3DIFA 2Y5TB 1GC1C 3AROA 4XNXH 1FZKB 5F7NC 4BZYA 4YSAA 5EOCL 1WYJA 1BFVL 1FFNB 4RAHA 3Q5TA 3X12B 4N6RA 2XTJD 1IQDB 5C0EA 4OJYA 2Y1AA 2GY5A 3MR9A 5EZJA 1AS6A 3ZX1A 1I3VA 3UTTA 4FTDA 2WPGA 5KVDE 1OF0A 4QHLA 3EBAA 2QV4A 5DRXB 2G5BA 5T5FA 1MCEA 3F65A 5EU3B 3ZQ9A 4LARH 2CIKB 2AABH 2DWEB 5M95B 3BQUA 4RWHA 3MREB 2YPVA 3ASOB 5AW2B 2B5IB 5EEUA 5JYMA 2FLRT 4X8JA 1OAUL 2B15A 1GGIL 2AXFB 4K9EH 5E51A 4WHDA 1NMCC 3RUGE 4EKXA 2G9KA 5J1AB 4E41E 3BN9D 1JGEB 2MPAL 2NR6A 4K71C 1I1AB 4F7EA 3SO3C 1E5AA 3L9YA 2BZ7A 3ZTJH 1U93A 1A1NB 4KQ3H 5FYLH 4WEEA 3IMBA 5IB2B 2VXTL 3QZOA 3EOBA 3CE1A 2RQ8A 4V2BA 4NQVA 4L2YA 5INDB 4K7PL 1OEZW 1RZ7L 2OL3B 2VQUA 4E9LA 4ZMYA 1XGUB 2MQ3A 3IGKA 3LZOA 4JM4H 1ORSA 3TV3L 5I18H 3Q9PA 2QQKH 3QUHA 1P84J 4UI2A 2X44D 1YEKL 3IDGA 4P5MA 3S3DB 1IEAA 3UAJA 5SX5H 2AJYH 2HX9A 3VNYA 1A25A 2FHBA 1U8JA 1I9RL 4PV9A 1IQDA 4Z7VA 3GLZA 5DJZA 4PJ7F 4KZ0A 2L7UA 4JPVH 5TF1L 1QMUA 4R84A 4UIMB 4FS0A 1O9ZA 3HMXL 3QQ3A 4DUXA 5JW4R 2BCKA 5JPNA 3PAZA 3DURB 2FX9L 4N0UA 4IBLT 4OT1H 2AQQA 5EF0A 2R1YB 4BINA 2HKHH 1CR9H 2AHIA 4YHOL 1D7CA 1T7WA 4DP6X 5JORA 2RH0A 1U2HA 3PWPA 3PWPB 1BAFL 5DI8B 4PMFA 3V6FA 2PCYA 4LOUD 2HWZH 1CLCA 4OGYH 5CEZH 1CK0H 5EUOE 2VMCA 5CZVL 3WNLA 1HCZA 4R7DA 4G8EB 5DRWA 4WW1B 5I6OA 1MAJA 4U6VH 1FO0L 2OXGB 1FF5A 2Z31A 3NK3A 5CILH 3EGDB 4P2RE 2P5PA 1Q0YH 3DBXA 3TO4C 2PYED 3U2SA 4NQCA 5I30H 4FMKA 4PJ7B 2DM4A 2FHCA 5IB1B 2OMXA 3SBWC 4XMLH 4DKFH 3SHSA 1AP2B 1U91A 2N4IA 3PAYA 4RZCA 3MODL 2MMXA 4PLKD 1ZJBA 5I8CA 2YLKA 1N26A 1TG8A 1YMMD 4P9HL 2OJEB 3T1FA 4DK5A 1GW0A 5T1LB 3QG6A 3UYRL 1WBYA 5FGCB 4JDTH 4YXLH 2XETA 4PJDF 3ZKXB 3KXFB 3QFJD 1UQSA 3NZHL 1KJ2H 2VL4A 1G7MB 2WTOA 3MRIB 4CC4A 3WNMA 4W9IC 2J6EH 4JFSA 5I73C 2WKOA 1D7BA 1MFAH 2XQYK 3V6OC 2WO4A 4NLAA 4M1DH 2WWMC 5DMIL 3K6SB 4RBPK 2OPCA 1R6VA 3TNNA 2F1AA 2X5PA 1IC5H 2YWZA 3UTSD 1I31A 3OGOE 2NY5H 4CDGC 3ZE1F 4TSAH 4Z7QE 1FZMB 3GMMB 2R7EA 1RZGB 4GIOA 1X7QB 4QY8B 1ZHNB 4S1DD 1FAIH 3GJFB 3TEWA 2VB5A 2WOBA 3KLQA 3MCG1 2VO8A 4MJ6A 4MGXA 3U2JA 1XSOA 5D7SH 2VDPH 2NY0B 2F8VA 3JTTB 3MSPA 4Y4FC 1IC7L 2V7HB 4ZMLA 3OKDB 5I75C 4V1DD 4E0RB 3JWNH 3BUPA 4GQ9L 5AZEH 4PCSA 2NY6B 1W0WB 4NC2B 4BFIB 4AJVA 3FTGB 3PGDB 1XR9A 5EZOH 2Y2WA 3LIZH 4QXWA 5JQIB 3V6ZB 4PJEE 2IXQA 3S5LG 2CM6A 2ALAA 2J88L 3UC0L 5KOMC 3SE4A 4JX0A 2CNZA 5BS0D 1UWGL 2W81C 4MA3A 4YFEA 1QW9A 2P45B 5IWLA 3HUJA 4I3GA 4J3VA 1X5ZA 5LGHH 4YS4A 2E7BA 3JZYA 3O6FB 3PLYA 3THML 3GIZL 5DUPH 4LP8A 2KLSA 5IM7A 4LIQH 3L3IA 3V55A 3U9UA 2FEDC 3BAWA 5FCUL 1KIPA 3FO9B 3OXRB 4PYGA 1QYGH 4QKXB 1LO3L 3MV9A 1IX2A 2FQDA 3DA0A 2LLNA 2XN0A 3HJ0A 2E56A 3MV9B 4MASA 5EORH 3ZR6A 4BIKA 3NSCA 2R0KH 1SJHA 5FA3A 3WE6A 5D1QC 1EO5A 1T04A 3DXAA 4OZHF 3HA0A 4K5OA 1LEGA 4ICXA 3RWEB 3K6SA 1HILA 3PABB 5T3XE 3F84A 2HJFA 1A6AB 3BN9C 3GMOA 4JM2C 3M1CA 1S7UA 4YX2L 1AFVL 2IAMB 3BT0A 4HDIB 3CBKB 5EFIA 4UIKH 1OGTB 2D7MA 3MYJB 3BP4A 3TV8A 4DPBX 4N0YL 5EU6E 4NPYB 3TJEL 5EO1B 4NKOA 3BZFB 4CBZA 1XAKA 2Y0SA 3WLWD 1DZ0A 4ONGL 3L08A 3PAVA 3QAQA 3RVTD 2NCEA 4Y2DB 3VW3L 4GKZA 1I1AD 4Z7NE 1E5UI 1TEFA 1YEWA 3IPEA 3MLRL 2QKIA 3VRJB 3VI3B 2FBJL 3RX7A 4O2EB 4DQOL 1ZE3C 4EI5D 1BQHG 4JPIA 1FDLL 4P2OD 4E9SA 5MHSE 4L4JA 2P9RA 1UB6A 1YEIH 5GGUB 1KSRA 3BGFB 1NLDL 1ZTXH 3BGAA 4ODVL 4K15A 1DE4B 4GG8B 3F7RA 3O6KH 4U1MA 4L0PB 4D0DA 5F9WB 2Q87A 3TH3T 2AZUA 4DP7X 1KPUB 4P2AA 5F9WC 3RYMA 5KBPA 5JW3H 3B5TA 4XPGH 1GPOL 2CU9A 1WBZA 1ZLSL 3FTYA 3MMEA 2MCMA 4C58B 4IHOA 4BH7A 2F2HA 3C6LD 2J1XA 2O5YL 2V6HA 2XU9A 5DC0A 2JKWA 1J05B 2UY7A 3HG5A 4XBMA 3VA6A 4MZ2A 4L0ZA 1VFMA 4HIEA 3L5HA 1A5FH 5HHME 5IB4A 5IBUB 1R75A 1O7DE 2A9CA 4R0LC 1USQA 1JFQH 1JPSH 4BDVA 1A3QA 5JXEA 4K4KA 5L2KA 3LDBB 3O0RH 4R2GD 1F3JB 5EOTB 3DXAE 4JQIA 3L45A 1BLIA 1FVDB 1A3LH 5IJKA 4NUJA 3J27A 3I9AA 1B9KA 1FN4B 1FN4A 4UTCA 2JKSA 5CP7B 5AOJA 3TA3D 1F4AA 1KENL 1IGMH 4PLKC 2AQ3A 4OLZH 2ODHA 4KJPD 2J20A 2LU3A 2QSCH 1RZPA 4OGAC 1DSYA 2VC2B 1T2JA 3Q8CA 4OZHA 4WJ5B 2GFBA 1T1XA 3TYGH 1J0KA 3WY4A 4EEEA 3GMRA 3LZFH 4YIQB 3FOLB 2DLGA 3PWPD 4PN6A 4LF3B 2AF2A 1KULA 3CN1A 4D0CB 3DPBB 3ARUA 5J7CC 5EN2A 2HJLA 3AG4B 1C08A 1DR9A 4MNQE 5K39A 2BY1A 4LU5L 3AQZA 5HP5A 2VITB 4CRPA 1RJCA 2JE8A 3VFUB 5FYKL 4OI8A 1JIBA 5B1KA 1D6EB 1EAOA 3Q6FB 1OSZB 1HTYA 4XAKD 4KI5D 1CURA 4E9YA 1MW3A 4FLQA 2H0JA 2CLRA 3LZRA 1SMDA 1S5IH 2QFPA 1SF5A 4LOFA 3II3A 1A64A 1GHFL 1NCCL 2BK8A 1EDQA 3FBKA 2R9HC 6PCYA 1XMWA 4G8GB 4KY2A 5BRPA 4O4YL 1KT2B 3CWGA 3FO0H 4NN5B 3TO2A 4L4TA 3IE9A 3BFWA 5DZLA 5CCKH 1KXHA 4C55A 1ZEAH 2EC9T 1I75A 3BVNB 4XBPA 3WTYA 3QJZA 3ARZA 4EI5A 1S9XA 2IADA 1BF2A 3NIFE 2ZQKA 1OB1B 4GNKB 1CFTB 3MRRB 3FT3A 4OQTA 1ZLSH 1E9OA 3FB6B 4JJOA 4OCRL 4G83A 1XF2A 3NFNA 2Q76B 4O58H 1E6JL 1XGRB 3LXAA 3G6AB 4CVXB 3RVWC 3CVHA 5C08B 1J8SA 4OZGB 2AJSH 3UGUA 1C12A 4CGTA 3BWAB 1CF8L 5EF3A 4JFFE 1OTSD 3GPSA 4ADIA 4H1LB 3MA9L 2P5WD 3QDAA 2LTQC 4NO5A 5F88A 3GMRB 3GS4A 4WO4A 4Q6IA 5BZXA 1IUZA 3GSQB 2IMMA 3QEUB 3UGEA 1Z5YD 3HBGA 3HC0B 3ISRA 1NFIB 1GYVA 4PWHA 1JWUA 3GMPB 4YSTA 5F7EL 4RRPM 2MFNA 3V4UL 3UBGA 4F8LA 4L5FL 1TMCB 2VR6A 5IMKB 5DUML 2UZIH 1MJ8L 4PPTA 1WH0A 4JY4A 1BXXA 3CLFH 4JNXA 1WFUA 3CFDA 2OS7A 4UINH 5GRXG 3E6HA 3EJZC 5BV7L 1MHHB 1D6EA 3Q6FA 2EKSB 3MRJA 5D1ZA 2FIKB 2FIKA 1UJ3B 3TN0C 5KVFL 1V55B 3E38A 2WVVA 1A7PH 1N5AB 3OKKB 3PWPE 1N5YL 4J27A 5LBSL 3CFBB 3S34L 5T3ZD 4CVUA 4WTZA 4YNYB 2AMGA 5C09B 1A3LL 4L4TB 5D4IA 4ODUB 1ZXQA 5DDHA 5AAWA 3L3OC 5J1SC 3AGVA 3CVDA 1EZUA 4MXQC 4PP2A 5DFVD 4JB9L 4YHLH 1E6JH 3D85A 3X17A 4PGBB 4CADA 2X3AA 2W60B 3EGSB 3QR1A 4XCEA 1HHGB 35C8H 1SDYA 2QADD 2W65A 3DX8B 3TVMB 4W4OC 2NY0C 1X4XA 4DP8X 4F3FA 3TVMC 2YLHA 3B8SA 1HVXA 3CLEH 3V0VB 3VUAA 1SMAA 1HYRC 1JWSA 1JI2A 4NO5B 1UWGH 2NY6C 4NKDB 4OJFL 1ZA6B 3TWYA 2N0KA 2HN7A 1XB3A 4MJ4A 2ENJA 4GBXA 2ICEB 1SN5A 1P7BA 5C0RH 1JV5A 7PAZA 5IFJB 2UXVA 1VB9A 3TONA 5DYOA 4Y9BA 2UUDH 4TNGA 3SY0A 4GG6B 3S3JA 1JYWA 3VFVA 4MHHI 2KYIA 1J5OH 5HI4C 3KLDA 3IFLH 4Z3IA 1TEGA 4JVUA 3MUGA 1QZNA 3BP4B 3QEHB 1SMOA 4JFFA 3V4PA 1MFMA 3GTVA 1PLGH 3B83A 5SX4H 3VRLE 3WTUA 4K3HA 4OIIH 1T1WB 3LMJH 1ECYA 4U1LA 4HIXH 1U3YA 5F7HA 3RZCB 4H44C 2EDBA 3KPNA 3V5KB 3RZCC 4X7DC 1EHLH 3DX6B 5MHSD 4JL2A 4U33A 1R3HA 5AVTB 4UBDD 3S35L 1AGDA 1E27A 1B6UA 2B0SL 4NNXA 4ZUUB 2IFFL 3QT2A 1OAZL 4KY1H 1GTFA 4X6EA 4LESA 1F18A 3QB7C 2FO4B 1INQB 3BP7A 4WY7L 5DQDH 4FEMA 1SFDA 2OTWB 1YUKB 3PREA 4JW3A 4UM9A 2PXYD 3B37A 1WA2X 1XO8A 2P8LA 3WMQA 3BZ4B 4LNRA 4UV7L 3ZMRA 2VDOL 4XGZA 3HVDA 1XIWC 2H26A 3LSOA 5K9OA 5DD1H 3RWHB 4HGKC 3NTCH 5AKRA 2KC0A 1RV6X 1G87A 2RBLA 1BVNP 3H54A 3FUJA 5T3XD 4XMXA 2R69H 4GQQA 4QRSB 5D2NE 5KAQG 3JWDH 3MLZL 4Z23A 5K59F 4DKEL 2CHDA 3O4OB 2AZAA 2GAZB 5FLUA 5EEVA 4MQ7A 1LJMA 1JF6A 1MVYA 3O4OC 5GS0D 4IQHA 4BUHA 4ELMB 4GI6A 5EBMA 1NCCH 3F00A 3LRKA 5CEYA 1DN0B 2O26U 2F58H 3P4NA 4Y2LA 3SGEI 3FRPG 1U8MB 1RZ8A 5AYTA 5ANMB 3KVDD 4ISVA 4RAVB 4D7PA 1R47A 2WUCL 4RAUA 4ZFZA 4GUPB 1RJYB 2AXJA 3NJJA 1ZV5A 1CMOA 2GHWB 1OIOA 2DD8H 1ET8A 5JIQA 5CLYA 4MCYA 3M17B 2WQSA 2I7SA 3BCFA 3EGXB 2OYPA 3RVWD 5D1ZD 5AB2A 5AVXB 3VE0B 3WOVA 3A4EA 2WXPA 2GEQA 4LSTL 2WJ7A 2XN9D 3CC5A 2X4PA 3BFQG 3G5ZA 1DANT 4M8UA 1F6AB 1QLRA 1X5IA 1ND0A 3O45B 4HGMA 3NCYP 2BSEA 1CE6A 2X70A 5LXGL 3WY1A 2FBOJ 2CO7B 2H8PA 4OI9A 4YSRA 1OW0C 4WSKA 2NDFA 4Q4EA 5GRJL 4OCXL 2CBMA 5DD0L 1XHHA 4D3CH 4ZUWB 4MQTB 3TPUB 3BAEL 2QKSA 4G3YL 4HLZG 3V2AR 1NLBH 4WO4D 3DMMC 5IV2B 3PAUA 1MFDH 4TYUA 3WFBH 4LSSH 5I73B 2VAJA 4B60A 2VMJA 1AZRA 4ANUA 1HESA 1IGJB 3CC1A 1G0DA 1EAQA 5I19L 4P46D 1RERA 1WSST 2XWJA 5C92A 3RIKA 1BXAA 4Y1AD 2ZWYA 1FYTA 1ODUA 3R0MA 2GK0A 3UEZA 1N10A 3QFJE 3PV6B 4DKFL 4JFQA 3SYOA 1TVBB 4H2AA 4JY6A 4KQ3L 5FYLL 2XWZA 1Q9OB 4Z7VE 2V9UA 3CD4A 4KVNL 1TZ8A 4PJBE 1U8QB 1V54B 3K3QA 1PAMA 1ADQA 1I3UA 4Z0XA 2COQA 3UBXB 5DI8A 3N41B 4FL4B 1TVHB 1UATA 2BSSB 2PTTB 4FXKC 4O02A 4UDTA 4UM9D 2CCLA 3CFNA 1PZ3A 1ZVSB 3TPKA 2R0ZL 2KPWA 2ICES 1A8JH 4HX1A 1W15A 1E4WL 2VXVL 2WQAA 3EFFB 1LMIA 1KF9B 1FV1A 4P5RA 5CD3A 5CD3B 1ZTXL 1DQLH 2NY1D 1NGXB 3QNZB 4Z1PA 1AE6L 3F85A 1E9QB 3FB7B 1JHKH 3Q44A 4Z7QB 3DV6B 5JW4Q 1QG3A 1O6SB 2VDPL 3DHJA 1H3XA 4QXVA 1QSVA 3BPCA 1BBJA 5AUMB 1U8KB 2DD8L 2HSIA 2DRUA 3QUXD 5D2LB 3ZT7A 1JHKL 4J1UB 3K4DA 2RJMA 4I7ZC 4BK5A 1FIEA 3AWFA 3IB4A 4Z0BH 1EERB 3KBHE 3KLKA 3SDXE 1F4HA 1MCFA 1SHXA 3AQXA 4UT6L 3ILQD 1HI6A 1I9RH 1GL4B 3KW7A 1I7ZA 2IOMA 4N8CH 1CG9A 1SXCA 2EAEA 2CCVA 1DQML 1IC4H 5BZWB 4HH9B 2HVBA 1GKOA 5DD3H 1K4DA 5E1HB 3CFBA 4YJZL 4M02A 1X5GA 3T4AB 1HWWA 1TQSA 4U49A 3VRLF 3FRPA 4OZGF 5E1AA 4ZW6A 4JG1L 1AGCB 1PEZA 3VXMD 4FFWD 5PAZA 1OHQA 5EPMB 2CDEA 3N43B 5IHUL 4AM0Q 4QRPA 1JZ3A 4H5SB 3VXOB 5F1NA 2UY6B 1AMYA 5F0PB 3F04A 3HPJB 4Q4IA 4M3JA 2C9UA 4DFHA 1NEZG 4F7MA 1C1EL 3H3BC 4YBQD 4Y19D 4JAMB 1IZJA 1UHVA 5TQ2H 4N25A 4PJXB 2DJMA 3QO0A 2VDRH 3VU2A 2AQ1A 5DEJA 1Q0XH 2CUHA 4PI2A 4EXKA 4Q9BA 1XB6A 3EJZD 3H8NA 1JV5B 4QHKI 1FIGL 4B6ZA 2J56A 3EO9L 3L3OB 3NUKA 4S1RL 3NJIA 1WIOA 2Q20A 2F5AH 3WBDA 3MJ7B 1KGYE 4WEBL 5E2VH 3GRWA 5CLXA 4W4NA 5LXGH 3CQPA 2WXRA 2YAEA 3IXAA 2VMEA 4GMTH 4Z0BL 4UQDA 4WGWB 4F9LA 3RGVC 2J73A 3A67H 1V8HA 4ERSL 4Z5RB 4QF1A 3IMWA 3EADA 4U3SA 3FU6A 5DCCA 3WTTA 1WZAA 3IDXL 5LKNA 1ZGLM 3UROR 1G7IB 1VFOA 1K4DB 1BZ9B 1NC2B 3ECWA 4H8PA 5D1QA 5D5MF 1IE4A 3HMXH 1FAIL 2N7SA 3P9LB 3WHE0 1VFAB 3B2DC 4GT0A 1I3RB 4N90D 3GHPA 3ZSTA 3CAFA 1VPOH 3VXMA 4GW4A 2XTJE 2Y1YA 3ZU8A 5DHDA 3QARA 2JTYA 1V7NL 1UENA 1KLGB 4L9LA 4XNYH 1S7TB 3IRCA 3W9DA 1R19A 3AXLA 4NYLA 3FO2A 5GGRA 4XXDB 4LO9A 2GSIB 3F7VB 2K1MA 1F8TL 2ZOLB 1TZHA 4L3EA 2VMDA 5IEHB 3TV3H 4H26A 1HHIA 1SHWA 2GJRA 1E2ZA 4HZ1A 3FSWA 5ICXB 3LKPB 4FDWA 2AITA 4A7GA 3D33A 1Z0MA 4HIQA 4KO9A 4GKZB 3NRQA 1JPGB 1MJ7H 2APVA 3CDZB 3B7TA 3D2TA 2QTVA 1E4XL 3EFDL 3QDMA 3DYMA 4MJ5B 5AW7B 3UYOD 4AXWA 1YNTB 1CXFA 1RY7B 3V7AE 3CFKB 5C0JB 5K69A 3WJJA 4HWNA 3Q5OA 2XYBA 2VXTH 5B1AB 3REVB 1MJUH 4PJHE 2XFGB 3U4AA 3QI9C 1KYDA 4BGDA 3CQQA 4QYAA 2PP8A 2ZJSL 2X87A 1SDAB 3FFCA 4LMQE 5HGDA 3MA7A 3N42F 3MA7B 1VHPA 4P04A 3QJVB 3BVDB 2MCPH 4Y16B 4PGEA 4P3CL 2FNWA 1NAMA 5G4NA 3WKYA 4GUQA 2Y5EA 5DK2B 1HXKA 3OTTA 4UMGA 1AZBA 3DRQB 4PSRA 4AV0A 4P3DB 2OW7A 3TN0D 1HL9A 4ISVB 1HXMB 4DN4L 2OMVB 2CKBB 5IW1B 1HHJA 1RIHH 2BVYA 4ODXB 4AEHL 1JVLA 4OGXH 1EDYA 4HIXL 1EO7A 4NN5C 5JQ6H 1QVOA 1HHKA 5KANI 4A55A 4MAUH 2X2YA 4YHIA 5AL0A 3W82A 4H25A 3EO1B 3K5RA 4L29B 2C34A 5EU4A 2YD1A 3L9EA 4R0LA 5GSRA 3VJ6B 2XXMB 5C0CB 3ARXA 4K3EL 5H8DA 3JUZA 2H3XC 1SRDA 2YXVA 4ZAKA 4DWHA 1MHEB 3FT9A 4S2SB 1JNHA 2NQ3A 2OCFD 1KMGA 3VXUD 4JO3H 1XZ0B 2DMBA 4AH2A 1PQZA 2FQFA 5DQ9A 3O3BB 3OC5A 2EIZA 4ODSL 4HIJA 1YQVL 2A1WL 1H9VA 3IDJA 5EBLA 1I4FB 4RSVA 1M2VA 4L8CB 1CN4A 3GLAA 3VWJA 1EHKB 5A43C 3IBEA 5EU6A 4KKLC 5JIPA 2DYRB 1HSBB 4L8DB 4PW9A 4WJ5A 5EBGA 5I1CL 3GZQA 1H3UA 1PZCA 4APQA 1E8ZA 4LSUL 1WA1X 3C09C 5IFAL 1I7UA 1RZ7H 3FOLA 2FEJA 1B4LA 3IDYB 3UJJL 2FJHA 3INUH 2XXFA 4B3VA 5KEZA 2X9YA 2JXMA 3FDWA 5H94A 1ZDQA 1OARL 2C4XA 4G8FB 1FFQA 2FQGA 3F7YA 3DRQA 2FE0A 1OSPH 4KHXL 3MNZA 5DSCA 4OV6F 4W1TA 2V3EA 1AO7A 1BQRA 4PG2C 3SYPA 4JZJC 4QYOA 3FH8A 3S34H 2X9WA 3WIFB 2FH6A 4MMZB 2CA3A 4ADGA 1UA7A 3BKJL 1IAIL 4CNIA 1IEHA 5FK9B 2CRYA 2UWEA 1CICA 4TVSa 1J12A 2PPDA 2O4EA 2XVBA 2ZXWB 4PVLA 2A5UA 1U8OA 2XPYA 1NUGA 1B4JH 4YDIH 4J2QA 2A6IB 4OFVA 1OAKL 2ZT9C 1GS8A 4DH2A 3MRDB 4QOKE 3KPTA 4UNUA 1RIVL 1UH3A 5D1QD 2D0HA 4LARL 3ZZ1A 1I8IA 3BI9X 3RIFF 4IBVA 4IRZH 4LPVA 5D2LF 2C7UA 1IFHL 4IRSB 1S7XA 4R4BB 2VCOA 3U9PL 5FOBA 4H1LG 3P2TA 5E5UB 2Q3AA 4FP8L 4HF5H 5FUCC 3ZZLA 2J44A 3PQYE 4FQLH 3T8XB 1FRGL 3BSZL 3UP6A 1DBKH 3TZVD 4RQQA 4BCYA 4TLSA 2YBRA 2HVKA 4M4RB 4WFHE 1YDPA 4GMSH 5EZIL 1X4ZA 5IMMA 4PJ5E 3MRPA 1JD7A 4TL5A 4FQXA 1JFQL 3WIHA 3HAEH 4JFVA 4LVHC 3SPVA 4D2NA 1YY9C 1VCBC 3O4LA 3Q8AA 4XTRC 1KJVB 4P4RB 5DHXB 3SE8H 4BFOA 1R24B 1WIUA 2A9DA 4M1GH 3SBRA 8CGTA 2CHZA 4AGQA 2JKNA 1NFIA 2I7OA 1IM9D 3EYSH 4M4PA 1A8ZA 4NOFA 1WVZA 5D93C 3MJ8B 1I8KA 1KCUL 5DRZB 1XB8A 1LE9A 4PS3A 4DEPC 3QR2A 3PWUA 4L4VB 3ULVD 1WHPA 1YYMH 4RIRA 4HGWB 2IJ0C 4RIRB 1CU4H 3T0ED 1MHHA 1GYUA 5D6DA 5D7HA 2R83A 4GQZA 4JCLA 1IILE 2EDFA 2F7OA 3UJJH 1TNMA 4M7KH 1KB9J 2EECA 3PPSA 1YSOA 4M8VA 1W72B 4M61A 5FF6A 4N28A 1FCGA 3CZFB 1XGTB 3NCEB 1NMAH 1ZWIA 3LXCA 1GVIA 1U3HD 3II2A 4NIKB 2OK0H 4NBZB 4YGVB 4CC0A 4OSUL 2FQEA 4TSCL 2VDMH 3BKCL 1FVEA 3Q2VA 1DLHA 5I6MA 1CI3M 1WP6A 2A1WH 1EBPA 4TPRL 3OR6B 4LEBA 4ZW3A 1LLAA 1SBSL 2MPVA 1UXSA 4JM2D 5H37G 5KOVC 4LASL 2CKBL 3OZ9L 1T03H 4HMCA 4G6MH 2EVGA 3PYCA 1W0VB 5JW4N 3DO3A 4ZS6C 1WFJA 4DGYL 3TTYA 3CU7A 4BWTA 4Y7OC 1BJMA 3KH3A 4HJIA 5JTWA 2DBJA 5AKSA 1HCYA 2NNAB 3BYTA 1PX8A 2FLMA 2XXGA 3V95A 2NY5C 2R23B 3KPQA 1TCRB 4MXVF 4XVJH 3U9WA 5JYLA 2G5RA 1T5XB 5L88L 3TT3H 1R5VB 4XNMA 2F8OA 2F53B 3GMLA 3MBWA 1WGOA 2FWLB 1XL6A 5DLLA 1XVSA 1LEIA 2EQDA 3KVQA 1HINH 1RSYA 2H7WA 2EDWA 5B21A 2CPUA 2E8ZA 4ACPA 1MW0A 1EUTA 4N0UE 3L2NA 2P26A 3JT0A 5KYWA 1JGEA 1NUFA 3ZE1E 4PJFF 3MCLL 5IB3A 1K9TA 3WV0A 4LLDA 3BP5B 1DQDL 3EUDA 1R3KB 3Q2WA 3QJTB 1T1WA 2JI1A 1FFPB 1ID2A 3BVTA 1EXGA 1UD5A 4HU2A 3F5WA 3QCUH 2HFFA 1ZEAL 4P2OA 3T6XA 2R9HD 1ZY9A 4M5ZL 5CUSH 5C0BA 3QUYB 4BJLA 2H6OA 2PCPA 4GRWH 1T4KB 3SPIA 4QTIL 5D2NB 4GXUM 4F2FA 3BAYA 2Z7ZA 4HMEA 5LO7A 2MWCA 1UD8A 2X12A 1E4KA 2PPFA 3OQRA 5ILTL 3T04D 3FQ4A 2BVQB 3Q48A 4LKXB 4Y9FA 2NXYC 1CE1H 3WKQA 1U58B 3CZEA 4PHZA 1N6QH 1EJ8A 4X80H 2CKNA 4Y4KD 2G3NA 2EUZA 3DHMA 2ZXBA 2JK5A 4KK5C 1NAMB 4LSRL 1EZVX 1Q9LA 4KZEL 1BM7A 1HH6A 4YPJA 2JJUA 5ICUA 5E23A 5J13B 1LP9A 5JOFA 1CVSC 3MR9B 1QEWB 3JWOH 4JO4L 4HS8L 1JHTB 3IBOA 1IBBA 2VE6A 1KCRL 3NABL 3FCBA 2BCMA 2RD0A 1JG9A 5DZJA 4JFZL 1F6FB 2NTFB 2XI9A 5EC1B 2K70A 2G2RA 4N0FB 3I74A 2YZ8A 3FJTA 3CX2A 1S9WA 3EJYD 1S9VA 3O2VH 3WUWB 4HXBL 4UAHA 1NGQH 5AZUA 5FO8B 1MDAA 3ECBB 1XBDA 1KELH 5GHWL 1DJGA 1ZV2A 3E0GA 1N4XH 3P3SA 4OM1H 3DLQR 3W2DH 5D7EA 3VO0A 5CBAA 2DH3A 3TX4A 1J8KA 5HYJD 3ES6A 4P9HH 4HPYL 4F8PA 4NRXB 1T1YA 4GG6F 2HLAB 4LLQB 5D7JD 4FMFA 3NG5A 4X5RA 2QQNH 1OM3L 1J48A 2L7JA 3EH4B 3KPSB 1IJ9A 3EH5B 5ACZA 2NOYA 2OYKA 4KXBA 1HQ4A 3TIDB 3O8XD 3HE6D 1F11B 3NEOA 4P5SA 5AW0B 5AAMC 3I75A 4LPUA 3VE0A 2ESVA 1IJNA 4XWGH 2O5YH 3TCXA 4XCFH 2Y7NA 1LK3