2O6PA

Crystal structure of the heme-isdc complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'GSDSGTLNYEVYKYNTNDTSIANDYFNKPAKYIKKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVYIDEKVNGKPFKYDHHYNITYKFNGPTDVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein C
molecule tags Transport protein
source organism Staphylococcus aureus subsp. aureus
publication title Crystal structure of the heme-IsdC complex, the central conduit of the Isd iron/heme uptake system in Staphylococcus aureus.
pubmed doi rcsb
total genus 30
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6pA00
2ITFA 2O1AA 4H8PA 3QZOA 5D1XE 2Z6FA 3OVUB 3QZLA 4FC3E 2ITEA 2O6PA 3QZNA 2H3KA 3S48A 2Q7AA 3VTMA 3SIKA 3QZMA 5D1ZI 4NLAA 2K78A 2MOQA 3SZ6A 3SZKC 4MYPA 5D1QE 4YMPA 3QUHA 2E7DA 3QZPA 4H8QA 4WJG3 3VUAA 3RTLA 3QUGA 3RURA
chains in the Genus database with same CATH superfamily
1WF5A 3IMSA 3TJPA 2WLLB 1FO0A 1I8LA 4PLOB 5DHEA 4XNDA 5T33L 1DCLA 3MFFB 2UXGA 3WNKA 3UH8A 1C12A 1MF2L 4PG2A 2V2XB 2Y06L 3DRTB 4YZFE 4X4YA 4UTBA 3IGUA 1IGMH 1QLRA 1ZANL 5JW4N 5I0ZA 4UU9B 4TTGA 3B6SB 2P28B 3WDHA 3GM8A 4ZOBA 5IFHL 3O6LL 1XSJA 1JBJA 4FFZH 1HNYA 5ICXB 1J1OH 5HDOA 4QRPD 1T7XA 2B08A 4Z7WA 5F71A 3ML8A 5JW4R 2APSA 3ARXA 2R4SH 4MXWL 3WKQA 1DE4B 5KSBF 4HFWB 1NGPL 2FL5B 1FBIH 2X4RA 5EFIA 4P46A 3CHOA 5DHYA 4FFYL 1WCQA 4GLRI 5K5YA 3CWGA 3RKDD 6FABH 3MLSL 2VDNL 4BWWA 1KEML 3CQPA 2JK5A 3H2PA 3MA7B 3DTDA 1A1NA 4NKDA 3WY1A 1PEWA 2E9IA 3LIZA 4W9GC 4Y9EA 1U2CA 4RZCA 4PWHA 5E4EC 1DBML 2ZXQA 3KJ4B 5ID1A 3L4WA 1KGXA 1HHGA 4NPJA 1BM3H 3R8BB 4UT9H 3GPSA 4OLVH 1RZPA 1T7ZA 4LSDA 1T6VN 2VMFA 3E3QC 4M29A 2O30A 1X9UA 4PWEA 1TITA 5IG7A 3IS0X 3OMZA 4KXZH 4FTVA 3VTAA 5A2BA 4XXDA 1NKGA 5LCVA 3RIFF 1IAII 5KUMA 3CFTA 2WXQA 3MRJA 2ADYA 3K0WA 1NCWL 2QSQA 4J23A 3VRLF 4AJWA 3U6XS 1CLOL 2X87A 4MDJA 4JPSA 5I1LA 4G6KH 4JJ5A 4K5LA 2OYPA 3S3SA 2Q8AL 4G9FD 2WQ8A 1B2YA 1K8IA 3EYQC 3UPRA 4CJ1A 2MNJB 1B9ZA 3CGTA 4PQXA 2VZTA 1S3KH 1S5IH 1USQA 1XD0A 3EIFA 1RULL 2LE9A 4UAHA 5J89A 1W0WB 4Y5YA 3CX2A 3MV7A 5AUMB 1OP5H 4C47A 2PYEA 3P3YA 5DO2D 4M5SA 4Y5XB 3K74B 1T21A 2BNRE 4ZPTB 3R8QA 2AHIA 4MD0B 1L9PA 1LDPL 3HG1D 3AG2B 4QO1A 1NM4A 4G7YH 1M2VB 2B0SL 1NPJA 3RDTA 4Q6YA 4C56B 4TLKA 4CC1A 4N2FA 4P3DB 2ZAIA 4TUKH 4Z7NF 2X28A 4KQ4L 2QL1A 4S2SA 1J11A 1OHZA 5C6TH 3QCUH 3ROOA 1FJ1B 1X4ZA 1X5LA 3S3PA 2OM5A 2WAHA 1I9IH 3GD1C 3LPFA 5HHPA 4JUTA 4XO3A 1BVZA 1E67A 2P44B 4GUPA 1LDSA 3CFMA 2X7LA 4U31A 1EANA 4O2CA 1SLXA 3L6FB 3IFLH 1PU0A 3O6KH 4YSCA 2A0LC 3CXHK 2IBZY 1XL6A 5SX4H 2JLPA 1G1CA 4NERA 4Y1SA 5FO7A 5I0WA 2QSCL 1EAOA 1B90A 2XTSA 1Q9OA 3B7YA 2QQLL 3V5HB 5I0VA 4CVUA 1NCIA 3BP5B 1OEZW 1KTLB 3B9KD 4KMQA 3N41F 4LSUL 3OLGA 4PLKC 4KROB 4QHLB 1R24B 4WRLA 5ALBH 3KWVA 4QF1A 4JW3A 1JZGA 2NQCA 5C0BD 5JQ6H 3B9AA 4G6AC 2YKLL 1DVFC 4Y7MA 5HTSA 2AQTA 1AC6A 1YNKH 4JFZH 4ZO9A 2DH2A 3CFKA 3NFSL 3K6OA 5IHWA 2ADFL 2AZAA 2VDRH 3JQOB 4FHKA 3LKOA 1EZSA 4NUPA 4XXCC 3ZJAA 2K4WA 1T21B 4BK8A 5ICUA 3W9DA 3TYGH 2B0SH 4WWKD 3VFUA 3N2JA 2K7PA 2PWEA 1HSAA 2G5RA 4HKZA 4K4KA 4LIQH 1SY6A 1BXAA 3MJ9A 4M62H 4QWWD 4YXKL 1RCYA 4HQQL 2WC7A 5C6PB 3FCTB 5DHDA 4O2CB 4OLXH 3B37A 1U42A 3D39B 1QSFD 3X1NA 3GLEA 4JREB 2VQTA 5EIIG 1G9NH 3NDYE 5I1DB 2FIRT 4RVBA 3MBXL 2XU9A 2D0GA 5HSFA 4H2CA 2F1BA 2CGYA 4LIQL 3HE7B 5I8KL 4OT1L 1KJMB 4HFUL 4RSVA 4FNSA 1YJDH 4LPWA 4CADB 2V37A 5CU9A 1QFUH 4G8IB 2A73B 3OAWA 4ZSOB 4HUXA 5BO1L 3X17A 1YYML 3SE4C 2OX5B 3DK2A 5GRXG 4YDLB 5DVLA 4OF7A 1THCA 5FPIA 3BQUC 3U0TB 2P1YA 1YYLH 3KCPA 3TBWA 1M05A 2EYTB 2D8KA 3RWJB 2HVKB 1GGCL 4FA8A 5BV7H 4UZSA 4TUOB 6TAAA 3W9EB 1OF0A 5GZOC 3NSFA 4KWUA 5K93A 2LGNA 2QJDA 2OJEB 4HK0A 3OJDA 4FCHA 4U05A 4QHUA 2ZX7A 4ODSL 3VA6A 5IW6B 3W0WB 4DP6X 5CBEB 9PCYA 3QEUB 4OV5A 4G43B 1MFCH 3OAZK 1RZGB 5KVEE 4J39A 2KMWA 4TSAH 1FZMA 4BH8B 3MGTB 5D7IE 4CVXA 3SOBH 2VIRA 4WI4A 3S4SG 2CBQA 3B9KB 5IQNA 3AB0C 5EA0L 1I8KA 2OMUA 1YEFH 4AL8H 1GSKA 1G9NL 1BMWA 3K2KA 1KCUH 1AHMA 1IKFL 1G1OA 2IOIA 1J0JA 3UG3A 4I13B 2UVFA 3Q6GH 4UTAH 4YNYA 1QHQA 2J1WA 4UMGA 5DTFB 4LHUA 2V17H 4W6YB 1XGPB 2HLEB 1CIDA 1TQTA 4PW4A 1KB5H 2WLLA 5E6UB 4KJPD 1Q94A 1IL1B 3LEYL 2VITB 3DSNA 2HCZX 5HY9A 1QAWA 4PJHA 4RISL 3WHE1 3WNLA 3RTQB 3JVGA 4CBPA 4N86A 2A6IA 2C9XA 2BIIA 5IB3B 2FL5A 2APWA 1CFMA 3ASWA 4OGAD 2ESVA 2UXTA 1I31A 3WDIA 2P5ED 3NJMA 1L5GA 2BWQA 3PL6C 1V7MH 3APFA 5IVXB 2XI9A 1IAIH 1OKEA 5LBVA 1D9KC 2R7EB 5DFVD 3GFUA 3L4VA 4ETQB 4CILA 4NZRL 2FLBT 3DRQB 3BAKA 2HRHA 5DMJB 3LTVA 4PTTB 4EZJA 1RIVL 1D5MA 4H13C 3QFDB 5H37A 4GG8A 3IGAB 5F93C 2P8MA 5GIRB 2DQGL 5HGHA 5EEYA 3KL0A 5T33H 5DJAA 1K6QL 4TNGA 4FQ2H 3RGVC 1R46A 2H0JA 4Y9CA 4N20A 3RVXC 1IBZA 3VFRA 4PJEB 1ZHLB 3GJFB 3LRMA 2WZPD 3QUYA 1MUJB 1C5CL 2WLIB 3PAYA 4D9RD 1FO0B 5LNEA 1F4XH 4OLWH 1XXDC 2OCFD 4D0DB 5EUOB 3DV6B 3I2CH 1INDH 1N0XL 4FXLA 4NFBA 3RWHB 7PCYA 5ITFA 2QADB 2H1XA 4JY6B 2VDQB 2X10A 2Z4QA 2ZUYA 4K7PH 1GZPB 2FSEB 5L4JA 5C3LD 2PWGA 3GNMH 3P9LB 4MXVF 3UPAA 5A7BA 2EDQA 3BEVA 3P9WB 4FG2A 1YEIH 3LNIA 4G6KL 1KB5B 2YXFA 2ADIB 5ESVB 2WUBH 4WI9A 3VXUD 1MCPH 2LLLA 1KN4L 2APXA 4H5SA 4OSUL 4DFHA 5J6GB 2GJZB 2ZX9A 3ECVA 3TVMD 2UX7A 4BCXA 4M8QA 2WZ5A 5KSAD 3RNQB 5C09B 4WU7A 3UEZA 5MEPB 5C0BA 1IBGH 2MPVA 4M5TA 4LHQB 4FG0A 3C5SB 4FQJL 4I0PB 1TF4A 1YEGL 1GRWA 4JANB 1WWAX 1X5ZA 2XV3A 5E1AA 5I1AB 2Z0BA 1NEZA 2CHXA 4HCFA 2NX5D 4XBGA 2R0WH 1CBJA 4UNVA 2BRQA 1AP2A 3PDOB 4UQCA 3WEXA 1KLFB 4H0HB 4HIEB 4K3JL 4BH7A 1FE8L 3RFRA 4XZ4A 4Z6AT 4Y1AE 3CFKB 4LHJB 3DETD 4ZOAA 1JZJA 2AGJH 4L8DB 4R96B 4KV5F 3V7MA 3BSGA 1BWMA 1TLMA 3I3EA 3QZWB 2WUCH 4KI5F 2VO5A 3VSUA 3I75B 1AGCA 3GKZA 1V7NH 3A4AA 1KTLA 2NY1D 3SDAD 1YNLH 4FYRA 3VFSB 4PIBA 4NKMB 2DQEH 2V8MA 2A7BA 1N64H 4PJEE 4CSZA 1GJWA 1R0AH 1RKRA 2C9QA 2R2BB 2X1PA 3DVNB 4DP1X 2X6CA 4F7PA 2VLJD 2AXJA 3EFFB 3CFEA 3CN2A 4OBSA 3L9BA 5KVMC 2W94A 3EYSH 1HKFA 4HZAA 3HNTL 2DEXX 2WUCL 1BCIA 1MEXH 2CIIA 2G5BB 3JWOC 4KI1A 1EZLA 4QOKD 2AJXH 1VERA 1OP5K 3VUAA 1U30A 4BDVB 1WCBA 2PO6C 3MODH 3M45A 4X7FC 1AXIB 1BA9A 1IC5L 4NJAL 1S2EA 3BVNA 1I8UA 3RVTD 4AVKA 4B27A 3FOLA 1T22A 2C3VA 2V2TA 3HMXL 2NY5L 1PDKB 3E0GA 5ICYB 3WGUB 2QQKL 3TO4B 4LLUA 2XZQH 3PWUA 3R4RA 4UV7L 1IGFH 2FEDC 3L9YA 3RL1A 5T1JA 2V5YA 4AVHA 1MNUH 3ETSA 2HFTA 3S35X 8CGTA 3L1GA 4H0GA 2G9HB 4R8WL 1HYRC 3ZDZB 2GVYA 2VDKB 1JZIA 4A2EA 2ZKYA 5KSUB 3O6KL 4WHYG 3U0WH 5T1KD 4HUCA 4J3OH 3VXUA 4IRJD 2F15A 1KWGA 5DURB 3PP3H 4XOEA 1CYGA 5L8JB 1RZQA 3E6FA 3HHRB 4UI2A 3V4PH 1LP9B 3SQOL 3BH9B 3U4EA 2EEDA 4NO3B 4UOJA 2MCPL 4JAMA 3G6AB 4Z7VB 3NQIA 3UCQA 2WNKA 1DJHA 5FHAH 3HEIB 1B0GB 1J18A 1C9SA 3F6LA 1QFUL 1Z5YD 2FECL 2EDDA 2XY1A 3ZKQD 4MJIE 4JRYA 1N2RB 2NYYC 4Y1AB 4ELKA 4MYWB 4PS8A 4LDOB 3BN9D 4I0PD 4YHNB 4A2DA 5M95B 1SZNA 2NNXA 5AB9A 3MLWL 2H8PB 1UFUA 3W0WD 2CMRL 1QVOB 1QFWI 2G5UA 3S34L 5CZVL 2WZ0A 1M9SA 1AGFB 3EH1A 1KXTB 4FP8L 4PRID 1GGUA 1X5AA 4XNAA 1U33A 1Q90A 3GGWA 4C56D 3QIUD 5HDQL 4HHAB 2GHZA 3WTSA 3D0VA 3PJNA 5AZEH 4FYSA 4IBLT 3JWNG 3LB6C 3VQ2C 2OZNA 1N0XH 4L3AA 3MO1B 2AVFA 4WQOA 3EF7A 1YZZA 3BT2H 3HA0A 4LF3B 2B4CH 3BKMH 3IFPA 2WQVA 3H7BA 4GNKB 1MCNA 2W9EH 3DGGA 4N8PA 4MMZB 4NYLA 4QTFA 1XF1A 4IBTA 4WO4C 3PJSB 1I7UA 3QXWA 3FTSA 4J3XA 4HIXH 3UTSD 1ZVSB 3C9NB 4KKRA 1ASPA 1QA9A 3CU7A 4IQHA 5F88A 1D6EA 2UUDH 1NAKH 3MLTA 1EFXA 1JE6A 1HT6A 1ZS8A 2F7OA 3FOMB 5FGCE 4CAGA 4E41A 5CD5D 2YAEA 3WIIL 2ZPKL 1UYWL 2JCCE 1NIBA 3CLEL 3IJSB 3WNMA 4F3FB 1FC2D 3VWJD 2O6EA 5IJKC 1BD2D 4EI5A 1KXQE 1NGZA 2J88H 2WB1A 5H94A 4HZLB 5D1QD 5E6ZA 5BZDB 1G7PB 3U6XA 3NVQA 5T5NF 4MCMA 2F68X 5C2UB 4NQCE 3TPUB 4PFEA 4N28A 1X4YA 4CL7A 2K0RA 3BFQG 5I17A 5KSVA 5E08L 2UYLA 4P2OA 1NGYA 4E9TA 2UZIH 3D3VE 1N70A 2DV6A 4F1ZA 5JW4Q 3TO4C 4OZIB 2NYZA 1F18A 1QQDA 4GBXA 1AP2B 1ZANH 1ET8A 5HJ3B 1M1XA 2F2HA 3HNVL 3GMNB 3A4DA 3VJ6B 5BRPA 5T3XH 1LE5B 1TTBA 3VI3E 1AHWC 4PJCF 3EADA 1YEGH 5DJDB 2OMVB 3AJ7A 4ANXA 1AJ7H 3L4TA 4MXQC 3HKZA 1IILE 2R9HD 1K3IA 1REIA 1RIHL 4ZMOA 5L7XH 5E00B 5D71L 4GRWE 2ITCB 4GS7B 4KKBD 4GAGL 3CZGA 3NN8A 1R3HB 5HHOA 3CX5K 3LRSA 1F3DH 1G7QA 5CU5A 5IQ7H 2Z31A 3I50L 1MI5A 1KELL 2Y07L 5GRVL 4YHML 2BHYA 4PJ7E 3P9LA 5DFAA 1HOCB 3HI6L 5SWSD 1KN4H 5CM1A 3QC5X 1CVSC 2Y36L 5KBLA 4D8OA 1WIPA 3UC2A 2F53A 1XCTA 5I1JL 5EO9A 1LMKA 4JUSA 4TVPE 4WFHE 5T1DH 5FUOH 4OZHE 4MNGA 4XMTA 4GY4A 3RWGB 5CILH 2W59A 3HG3A 2OK0L 3IDXH 1OTTC 2YJQA 3PGCB 3D50A 3D12B 5EIIB 2UWEB 3JV0A 1YPZB 2P8LA 1H3GA 4IK6A 5EOTA 2B1HH 2A4EA 4MAUH 5GSVB 4JDTL 3UTSB 1FFNB 2KLRA 3LEVL 2C4FU 2YK1H 5EDSA 2XTJC 1C7TA 4QWWC 3CHSA 4UTBL 4XVUD 1XH3B 2GBUA 3OB0K 5D1QA 2I25N 1DCEA 5IEHA 5BVPL 1DANU 1S5IL 4GINA 5DK2B 4R2GC 1ZHNA 2O6CA 3KPMA 2C9UA 1ZEAL 3ZZSA 3Q06A 1XO8A 4G5AA 4X6DF 3O4OB 5HDBE 2QSTA 3IU3A 4OTXL 1HXYB 3MLRL 3MHZA 2HG5B 3HC4L 1BVLB 3Q8BA 5F7DB 3V6OA 3SJVB 3OMIB 3ZE1F 4GAGH 4OGZA 2WVVB 1ZPUA 2DQCL 2YARA 5D6CB 5AKSA 3ZLQC 3N44B 4MA7H 2COVD 1ZXKA 2FE0A 1AYRA 1FPTL 4KJQC 3EJUA 4KQ3H 4C83B 4CDHA 3K2UL 4GO6B 1ID2A 2CHNA 5D4IA 4LSPH 5GZOA 3BZEB 4U1GC 2R4RH 4E2OA 4OIAA 5CEYA 1HHHB 2BP8A 3UBXB 2WNWA 2VC2L 3B2UD 3ARZA 4HT1H 2BOLA 2QTEA 3O11B 4XB3A 3RWDA 4ENED 1JXFA 1CFQB 1E27A 1EERB 3SGEH 3QPXL 4MMXB 2Z8WC 2BNQB 5IFAH 3A4FA 4K7FA 5EO1A 4QRQB 2A38A 2Y6SD 3RL2A 2FHCA 2JXMA 4RWHA 2MNWA 4G8GB 3UTTD 1LDPH 4ZD3H 5KW9H 2ZYHA 4EN3A 2W81C 2HWZH 2QVTA 3X3FH 1R0AL 4KZEL 1TVHA 1XSIA 4A7TA 2WIIB 4WI8A 3Q2VA 4WU5A 2W92A 1E8YA 3IFPB 5D2LF 1C8PA 2FJGB 4XZUB 2FX8H 3F2LA 1N59A 2IPUK 4LCWE 2HRGA 1RK0B 3PHOA 4NO0A 1QPPA 1F2QA 2W9DH 3BC9A 1CLOH 5F9AC 3PWLA 2XPZA 4JREC 3VSTA 1B4TA 2X9XA 1VZHA 3N44F 2XN2A 3ISRA 4M3HA 4YE4H 4F7CB 1MRFL 5LWYH 5A43C 4URTB 1QUNB 4OFKA 3BRGC 5DSCB 3UTZB 1BMGA 4GSRA 1TZGH 3QUZA 1ZA3B 1BG9A 1B3IA 2GAZB 1UEYA 2HA1A 2EINB 2JI2A 3KPOB 2HKAA 1BVKA 1RMFH 1D9KA 1GOFA 4ACTA 4BQ6A 3SHSA 3ARBC 3WEOA 1CGVA 4NXSA 5J06A 1S7UB 4ADJA 2LU5A 1S5HA 4JB9H 3U36B 3OZ9L 2ICWB 3C09B 3Q0HA 1WZ1H 2EEAA 5D1ZD 4ZFZB 3W3BA 2W65B 2JKJA 3I9PA 1MNUL 3PAVA 3ME0A 1AQKH 3QS2A 4Y4KD 3TJEL 1F58H 1H3VA 2OZ4H 4U6VL 1QD0A 2AANA 4Y88A 3DJSA 3EDKA 4R4ND 4ZQTA 1A25A 1FYTB 4JM2B 3WJJA 2FUQA 1KENH 1RUKL 1UZ8A 4WENB 3WN5C 4F7MA 1Q0YH 3WKML 1TETH 2ZUUA 1NPNA 1D3CA 4L8BB 2EE6A 5C0ND 2E3VA 1F4WL 3MOBL 5A2JH 3GHPA 3UABA 3CFIC 3MLXH 4PRBA 5CJBA 2J5WA 4CU7A 3U4BL 1U3HA 3I9AA 1OTUD 3B8YA 1JI2A 3LVEA 3MLWH 4LLQB 5DRZA 3OR7A 1JF1A 1H8OA 1NFDB 2W0KA 1IEHA 4IU3B 2CSPA 1KGYE 1SY6H 1OE2A 4KZCA 1R3KB 2BIOA 2WLJA 3KVDD 5A7EA 4O58L 5C8JA 1M4KA 4CN1A 2WCPA 5G55A 1JV5B 4XX1G 4PJAB 2AAVA 2Q9OA 4QT5B 2FD6L 5JHLA 3TYFB 2V2TB 1U3ZA 5CGYC 4GMTH 1CBVH 1UUSA 1HHKA 1PLCA 3FT3A 2XZCL 3BPNC 2HJFB 1HKLL 4JZNA 2XVLA 4H0LC 4HA1A 1B4JH 1CDCA 1E30A 5B21A 1F8TH 4P5KA 3ZY7A 4O9HH 3ZE1E 2RHEA 1QZNA 1SBSH 4ZNEA 2QPEB 1J0YA 3MLZH 2XWTB 2XSKA 3GEWB 4YGVB 4AY0A 5C0BB 4IKKA 4YOKA 1IAKA 4RQQB 3GINA 4M8QB 1ZT7B 2BSDA 1NEPA 4EJ1C 4PGBB 5AW4B 4EXPX 1RZ7L 1RLBA 3IDGB 4OI8A 3UO1L 1JWUB 4D8PA 2WWOA 5IEKB 3T3PB 1I8IB 1AAJA 4BFOA 2Q3AA 5DC2A 2IALB 4YXHL 1S7TA 4AIOA 4CN4A 1FDLL 5F89B 1O6TA 2X38A 3FSOA 2R0KH 4KTYA 1PX3A 3WNNA 3BISA 4LESA 1Q9WA 4LXFA 5TE4L 3TWCH 1J12A 4F37F 1MI5B 1S7QB 1Q38A 4NC2B 3HR5B 3PXJA 1RL1A 1P5VB 4XBGB 3NABL 4ZQKB 5EC1A 3UFIA 2EUWA 1DBKH 1T0NA 2KUTA 4K8RH 1X7SA 4EI0A 1ZWIA 2CLZA 3T04D 2WTPA 3BDYL 2APVA 5EEUA 5E1HB 3ZGIA 2B9BA 4WF7A 2XXFA 4BZ2H 1TJGH 5FUZL 3HBGA 4OM1H 3RVTC 3H53A 3OHXC 4F7EA 1KSRA 4YHOL 8PAZA 2VDLL 2DIEA 3BSZL 1KXVC 1NC2D 1YA5A 3PXLA 4UIKH 1NFIB 1GKEA 3NAAH 4NB7A 2FNBA 4YDIH 5BRQA 5I1IH 1UC6A 1C5CH 1UHVA 2P43B 4WWOA 2IAMB 2ARJQ 3L3OA 2LOEA 1KB5A 5DMYA 4GBXB 5GZOD 2UY7A 5E23A 4WGVB 3LQZA 4L29B 5T3ZL 1OLZA 3FSAA 1OE3A 5INCB 1ECZA 3BLBA 3F62A 4JVUA 3S2AA 2VXQL 2GEEA 3BGFB 4RZCB 3DHPA 2ZJSH 4LSSL 3GHBH 4HUUA 4DVBB 4Y5XC 3GB7A 1O9WA 4Y16B 4AOFA 3ARGC 2ZOWA 2AK4E 3N50A 1P4UA 2HJLA 1EMTL 4KVNL 4PWGA 3KLKA 2FIKB 2YPVH 2CKBH 5K9QI 1EEYA 3R0MA 1RHFA 4HPYL 2A4ZA 4PWIA 1GS7A 3NRQA 4MD5A 2BS71 3GHEL 5JHLH 2YPLD 4OFQA 4Q89A 3T3PE 1W0YT 2NXYD 4E41B 3W2DL 5LXGL 3ARFD 3OKMA 4UILL 2PXYA 1V55B 1FBIL 5EUKB 2YXVA 3X3FL 1YEDA 3AY2A 4JRXD 1SYVA 4DUWA 1WAAF 5IMKB 4GBXD 4E0RA 1ORQB 5DI8A 2EICA 4I8DA 3QEQA 4P2OC 1SYVB 4OB5H 2ATPA 5CEXA 2H3XC 2E6JA 1ONQB 2Z6FA 3DIFB 3QIWB 1HESA 1G0DA 3NOIA 2FQDA 3T3MB 4HWZB 6PCYA 4F9LA 2HKHL 3VXSA 4Y4KA 1R3IL 4A66A 5D5MA 5IK3B 5EORH 3FUIA 3WSQH 1HH6A 2YAFA 5C0CD 1NLDH 1D7CA 5CINL 3RPIB 5J7CC 4XB7A 2DI7A 1HHJB 2HJLB 4UZGA 5EWIH 1WUZA 5C0CE 2RFXA 3BJ91 3GB7B 4Y16A 3SDCB 1YNLL 3T0DA 1F3RB 4DUVA 1MI5D 2AI0H 3UJJL 2X4PB 2G2NA 5AAWC 5B3JE 1PD0A 4DN4H 2VL4A 3QRFM 1A7NH 4NZJA 1NAMH 4EUPA 4FQQA 3MR9A 4KVNH 4S1QL 4CKQA 3C5JB 1UTDA 4P9ML 3UXFA 3RHWK 1Q0XL 4OTXH 1MHEA 2X0UA 1SUJA 3BMVA 3L95B 3JXAA 4BKLB 1NJ9B 2R0WL 2VH5H 5ILTL 2KKQA 1JTPA 1JVLA 5BUGA 3BKYH 2AI0L 3UJJH 1K5NB 5DWUL 4Z7OE 3VRIA 4K3HA 4R7NA 5D9SB 4EKJA 3F85A 3IJ7A 2DLEA 1I7TA 3MCLL 2Z92A 1E4WH 2DJ4A 4X2UA 4PI0A 2NY5H 1SGKA 5DRWA 3K8LA 4QOKE 1DQDH 1FNGA 4KK9C 1QBMH 3QR1A 4TSCL 2VAAB 2V9UA 3EHBB 4IGBA 4LVOB 4Y19E 3O6FD 4R83A 1QASA 1X5HA 5I8KH 5DEGA 4WLCA 4M1GH 1HSAB 1GW0A 1OSZB 1OK8A 3X12A 4Y19D 3IETB 4OJYA 1D5IL 1DL7L 1YVLA 1FIGL 2PMZA 3PHSA 5ETUA 3FT4A 3RGBA 4E41E 3WTXA 1H3WM 5DZAA 3KPQA 4OD2A 4LL1A 4QXGH 4IKJA 2QLVB 1JYXA 4QRRB 2X4NB 3O3DA 3ARFB 1TENA 3SBWA 2CBMA 4TQEL 1X5KA 3NJKA 4Y2OA 3PWPA 3ELAT 1R24A 5DJ8B 3QYNA 5CJ8A 1PDKA 3RLSA 1E7VA 3I84A 3BAXA 4HAGA 1DBJH 3VM5A 2X6BA 2IOOA 3VFWA 3ECUA 2HTLC 3MRMB 5D1ZI 1I1CA 1XAUA 4OZGF 3TBYB 3QQDB 3BZ5A 1X7TA 2P7TA 3L3GA 4PBVC 4NZUH 4PREB 1MCIA 3UAJD 3ORJA 1JZEA 1KCRL 4LEOB 4KKZA 4G72B 5JOFB 3QQ9D 4RBPH 5K9KA 4ZTPH 1W6LA 4RH4A 4NZDA 3F12A 5GGRY 3TNNA 1AHWB 2YA2A 4H25A 4RX4A 4ZAKD 4FQLL 4X83A 2WTRA 2VDPB 3TA3D 3C8KB 3QHFL 5IJVB 5EF0A 2NY6B 4N2KA 1WAEA 4JKWA 1E9OA 3BD3A 4S1RL 2BNRB 3S2CA 1QBAA 2ZNXA 3A5VA 2NMSA 4YR6A 4EVNA 3RFZB 4NN7C 2K78A 1CE6B 4L1DA 5IOKA 3JWOH 2E6QA 3M86A 4NI3A 5DO2C 1R3KA 5FYKH 5GGVY 1JRHL 5SWSB 1GC1H 1CO1A 1ETB1 1UM4H 4GO9A 5F96L 2ROXA 2WD0A 2R39A 1KTDA 3EG9A 5AVXB 2EKSB 4PB0H 4GAAA 5JPNA 2N7AA 1CR9H 4QF1B 4NENA 8FABA 1I3VA 2WKOA 5D5ME 1HJCA 1URLA 1CTMA 5K9OA 1YPZF 2YEZB 3PGFH 3OB8A 3CN3A 5I28A 1LYQA 5JZ7D 4KKCC 4N8VA 2CKBL 1UZ8B 4I3SH 4JGUA 1E40A 5B1BB 1IGJA 2VQ1A 4LEOA 5K9KB 1XF2A 2ZPKH 3UTQB 4X4ME 1P7HL 5M94B 1JCKA 2D7PA 2P7TB 3G9VA 3L3GB 2GFBA 3RNQA 4ICWA 1NOFA 3SDAA 5E0QA 1OANA 3BVDB 3KW8A 4KROD 5T1KB 2Z34A 1H6UA 2OQJA 3VG0H 3VFOA 1HI6B 3NA4A 5D7LB 2AK4A 3KPOA 3FH7A 3T77B 2WY3B 5HVHC 5LQBH 4TSBL 1GZPA 4HH8A 4U1IB 4Q2ZA 3MBED 2ED7A 5DSCA 4LFHG 3ZGHA 3P3SA 3RILA 2RQ8A 3BXNA 4GW1B 4WY7H 5JIIA 2O61A 2BP0B 4DP9X 2CO7A 5ETUB 4KH2A 3ARDD 3MLSH 3TBSA 4AQEA 3VMOA 5I6KA 2YWZA 5CJXC 3NJIA 3ARPA 4BHUA 2ZUWA 1C5BH 1N3NA 4Y4HD 2R59A 1YQ2A 3K81A 1E2ZA 3GJFA 1SJHB 5D7SL 4JFPB 2J57A 5EU6E 3UAAA 4N3UA 4EUPG 4OQ1A 2CRYA 3BVVA 4QTIH 3BSHA 4O5LH 4Z7WB 2IPTH 5D2LA 1YNTA 1G7JB 3KL3A 2IWEA 4F8LA 2R1WA 3O6LH 5ICZA 3CE1A 2EKJA 3CN0A 4GG8B 1EEZA 1IJ9A 1NBYB 3OV6A 3ZQ9A 2HLFD 3C6SB 2D4DA 3H7LA 2R0KL 2Y0SA 4MMXA 1KY7A 4FLHA 2WAQA 1XF3A 4ETQA 3U6RA 3T8XA 3C6LC 4ABQA 1DO6A 1KIPB 4MAYC 1PIGA 4LLVB 4XWOC 1U2HA 2DQTL 2XPGA 4FLSA 3LAFA 3VACA 3H42L 4JO4L 2X4PA 3FQNA 4PLJC 1UEMA 4Q9RH 4HF5H 4J3BA 1N4XH 4LVEA 5FW6A 3O3EB 3MV8E 2F7RA 5LKNA 1RHHB 3AGVA 2XQYA 4Y4HB 5DZOA 4YBQC 1X4XA 5EZJB 4CC4C 2X0WA 1NAML 4JCLA 3O2WH 1X5YA 4UT6L 4AQ1B 4DTGL 3HZYA 2UZPA 2Y06H 4RFNB 2CHDA 5FHBH 1AD0A 3LN9A 4M5YH 3QQNA 4HCIA 1WPCA 3D6GA 1WTGT 3CDCA 4RMWA 2IMMA 3EH2A 2P46B 1CXLA 5DJ0B 4MKMA 1AQMA 1GGBH 2FWOB 4XWGH 3QIUA 4PJXB 2AQPA 2C7UA 4B9CA 1KXHA 4K3DH 4WSJA 5CJ5A 5CP7A 4AKOA 3EYQD 1LMIA 5E9DB 1J8SA 4OLYH 5F1OB 5FS5A 2VR7A 3RX8A 5LLIC 4JZJA 4CVXB 1VFAB 4IKLA 3PIQB 2DPKA 1KGWA 2F5BH 3SDXE 1O6VA 1BJ1H 5FX3A 3TEZA 3I3DA 3FO9A 1T5KA 1IQWH 1AZVA 1K2DB 4M7ZB 1SRDA 1T5XB 4BM7A 3VH8G 2ZX5A 3B3BA 3O41B 3SYPA 4B9GA 4KKLC 1U4FA 4HMEA 1GOHA 4JRLA 2OL3L 3WV0A 1Y6KR 1DUZB 2V7NB 5DD6A 4XP6H 1DJXA 2N59A 1RJZB 4N0YL 4KO7A 4LQ1A 3RHWF 1NBZB 4MAUL 4YFLI 1HL9A 2CPUA 1WH0A 2OYMA 3HPLB 1HXMA 3QORB 3VB9A 5A16A 3G04B 1CLZH 2X09A 1BP3B 1F2XK 5EDXA 5IVXE 3T6VA 5HGBB 1HX0A 1IC7H 4HUXB 4KAQH 3NIGF 4HKBA 4KMTL 5CLWA 1QTSA 2EVIA 2CBPA 4PY8I 4B9PA 3VU2A 1CZ8H 4IU2B 4B95C 4BQ9A 1LP9F 3TJHC 5JMOC 2AQ2A 3HE7A 4PM1A 1N0LB 4G3YL 1XGRB 4HCRH 1E0OB 3CFQA 4PV8B 5JW3H 5I5MA 5FA4A 3UGUA 2I07A 4OF0A 4XWGL 2GJ6B 4WGKA 3WIAA 2AJZA 1I3RA 4XPBL 3QG7L 5AW7B 3HFML 1G4MA 3LXAA 2WB7A 3BW9B 4L2YA 2ZX8A 4U3CA 3ZMEA 1BQKA 5I6LA 1E5ZA 1JHTA 3FCTA 3LKRB 5EZPA 4PHXA 5HI4C 4JE0A 2P5EA 1MREH 5D7KD 3ZHKA 4AYDC 3FU0A 4R5TA 1HSBB 4I1NB 1E4KA 5ANMA 3L45A 3EOAA 3CZNA 3MN8A 4FG4A 4MZIA 1I7RB 1OM9A 5D8JL 4RMVA 3ZZ1A 1DFXA 3P2DA 3QJHA 1BXVA 3A6BH 1LO2H 4JR9H 4ZNEE 5I66B 2VO8A 2F54A 3IKCA 3G6DH 1VSCA 2EIDA 2UY6B 3T0EC 5KBNC 3SO5A 1KDIA 1MHCA 3SO3B 5DD1L 4K94H 3EJCA 3OAZH 4TNFA 5JXEA 4UQ9A 3VXTB 5T8IA 5D7IA 1CICB 4GUQA 2EYSA 2NUPA 3UJTH 2DEWX 2DQHH 4H8PA 3GMRA 1IBDA 4YSDA 3WUWB 5F9WB 4TNWK 1DEDA 3D52A 3WMSA 3FBQA 1X5FA 5J6HB 3WL9A 4PJGE 3QJXA 4TKWA 4JE4B 4PJFB 1RZFL 3GI9H 4JFSA 1IZJA 2E5EA 4WSGA 3W82A 1QMUA 1RJYA 3L4YA 1HFUA 3S3CB 3TYGL 3TNNB 3P2BA 5ANHA 3UP1A 1IX2A 3ETBJ 4PJ9C 5AW9B 3CZFB 5CSZA 4ZK8A 5AKRA 3GO1L 4PYGA 3V0FA 4XOAA 4ATWA 2HT2D 3MLTB 3HG1B 1IRAY 1YN7B 3OF6A 5AAWA 1QA9B 3CMOH 3ALWA 3HW7A 5J57B 2VR6A 3MRMA 4XP1H 5C0EB 1GY1A 2J1YA 1DJWA 2E7CA 3DOHA 3STZB 1S7UA 3ZIYA 5KVEH 4M6OL 3TYFA 5FAAA 1NANH 4NQXB 1BVKB 3NACH 1MPAL 3FQRB 2Q3ZA 4QHNB 3NGBB 4K5PA 3PL6B 2GAZA 1RUML 2VGLM 3O3DB 3JWNE 1OCOB 4U3HA 4LSQH 4UUJB 4X8JA 4DPRA 5EUOE 4KX7A 2D31B 5L7XL 4YFDB 3IPFA 2A9BA 5GS1A 4JNXA 3HE7D 1MFDL 3CHRA 2ZF8A 3NCXA 1HINL 1OARL 4KKAC 4KXCA 1F1DA 4HXAL 4ZO8A 3AQYA 3DYPA 1QSFA 1XR9A 2GW5A 3B1UA 4NFCA 4HKXB 5JO5B 4EMZA 2OV0A 2GQHA 3G5VA 1ZV9A 2VYRE 3WNIA 1FYTA 5IP4A 1KN2H 2R0LL 4BQBA 2BJML 5GGUA 4LARH 5MI0C 1BJ8A 3LH2H 4I5BB 4NO2B 3RBGA 1Q72L 5LVEA 3ZU8A 1TJMA 5GSRA 3LKSB 1VPOH 4X4XA 1HYSC 4QYAA 5IWLC 2X4OA 3LZLA 2QV4A 2WP3O 3DPBB 4JZOB 2R2EB 5E5RB 5BVJB 3J8F7 1KB9K 2DMHA 1Z3GH 5E6RB 1WZLA 2FAUA 1SMAA 4RAVB 2MWCA 3FUKA 1E2WA 2Y1YA 4L4JA 4PJGB 1U58B 4FGMA 2VDMB 4LLMA 3WS6A 3N43F 5DFWH 1XZWA 2JKLA 4XH2A 5GGSB 3ARRA 3D4CA 2XG5B 3FO2B 3ECWA 5LG6A 3T0ED 4GXUN 2NR6A 3W5MA 4AYSA 2E7HA 3RIAF 1MZZA 1ZEAH 3OF6D 1WC7B 2K9UA 3VG0L 2VXQH 2ITFA 2NY1B 3ESNA 3MRRA 3WJMA 2WHVA 3IDUA 1UM5H 3TT3L 1H8NA 3CZEA 2X4QA 4P4KB 5L9DH 1R9FA 4YXLL 4DVRL 2RJMA 2JH2A 1RI8A 2H32B 4RAUA 1JWSB 4LLUB 1QO3A 3SDDA 1EPFA 1FL5A 2XN1A 2J5LB 3IJHA 5MENB 4XNMA 1KEMH 2RH0A 3QHZL 2ICEC 4MJIB 4PP2A 5C07D 5HDWA 4XR8C 4J7RA 4MVBD 1U8JB 4ORGB 4NX0A 1YEDB 1S6NA 5KVGH 2NY6D 1Q1JL 1IAOA 5DQDH 3W57A 2R56H 3OL2A 3Q48A 5FKPB 3KH3A 1YEIL 3HPJA 3FH8A 1A3LL 4I3RL 2AV7A 4HJTA 2VXTL 5I8OL 1E5UI 4OLZL 1SJMA 2WK2A 4L05A 5F0PB 3FT9A 1YSOA 4Y5YC 4Z7UE 5F97E 3PJLA 3DVNA 4NZTL 3CCHA 3MV01 3PGCA 1MCQA 3NABH 1ZGLB 3L3IA 1BYPA 2B5IB 3QPXH 3VXNB 1QABA 2VDQH 3JV4A 4F27A 1R3IH 3SE9L 1HE8A 3MQIA 4P5MA 5TDNA 1DN0B 2QSVA 4R6UA 1CGSL 2ALAA 2XIIA 2JTYA 4OLWL 5T5NG 3CPUA 4FXKC 1ZK5A 4WWKB 1W8EA 3O3UN 2H6OA 1SVCP 3EFOA 4IBZA 2Y2YA 1HXKA 2LU3A 1F4AA 1EFQA 2E86A 3ROLB 3CH1B 2QZQA 4HEMA 4HX1B 4FZEL 3QIBC 2P8PA 1JXDA 1BOYA 1CT8A 3SCMD 5AVRB 4N22A 4Z7VE 1CQYA 2D73A 4Z18A 1SOQA 4LPXA 4XPTH 4MX7A 3SDYL 3VRJA 5L4IA 4DPBX 2BNUA 4JG1L 2AMUA 5ABZA 3ZR5A 4YDZA 3P4NA 4URKA 3AQZA 2P8LB 5I74B 4F2EA 4YSOA 3VE0A 1BX2A 1CT8B 3CDZB 5JIQA 3DUHA 1BBDL 4YJZL 2YPKA 3L3HB 5GRUH 5J9PA 1LO4H 2R29H 4JM4L 4MZ3A 1IMHC 4O2FB 5E70A 2H2SD 1KMGA 2OL3B 1LILA 3JYCA 2F53B 1IFHH 1U9KA 1I53A 3VRLE 1IC1A 3P9MA 5I1IL 2XBTA 2NY3B 3Q5YA 4QRPB 5TE6L 3HR6A 1PFOA 1CGSH 3MJ9L 2CM5A 4NM8H 3MBXH 4A2FA 1MFEH 5GXBB 4M6AA 3S4SA 1ZTXL 1OW0A 3KPRA 5C0IB 5KG9A 4ILDA 5GS0C 2Y7SA 5G2NA 4FA7B 3HLAA 3FB7B 3QR2A 1LQBC 3GI8L 4YDVA 5FC9A 3W11D 4NAMA 3BLPX 1TU2A 2V33A 3WN5B 3ETTA 4G7VH 1UA6H 3FONA 5CIPB 4F7KA 5B4MD 1F3JB 1FFRA 1WITA 3Q2WA 4XXWA 1ACZA 2BNUB 3TBTB 1Z1WA 3GRBA 2YBGA 3HB3B 5K59E 3ULUC 4DKDC 1U92B 3AY4A 3I2CL 3LQAC 5HYJE 1JPSL 3A21A 3QNFA 5LGKA 4CC0A 2AITA 4GMSL 1OM3H 3FO1A 1IE4A 3QS3A 3C60C 3L3OC 2XN9D 5I0DA 2XWDA 2GYSA 2VLJB 5ABAA 4KFZC 4BV1A 2AV1B 4HIIB 5BV7B 1UA6L 2HUHA 2FX9H 4F8NA 1KWKA 3L7EA 2Y7MA 4KHTH 5B7FA 1L7IH 2FWLB 5E8OA 4QXGL 3P40A 4L3EE 1P5UC 5DEFB 4YWGL 4H8HA 3D25A 5DRZB 4LLQA 4NJ9H 4BK5A 4EKXA 2ZOKA 1LL1A 4EUPH 4WEUD 1C7SA 2OS7A 1IBGL 2EDRA 4N8CH 1Q94B 5J4MA 4YSSA 1Q9LA 4XC3L 1AXTL 1QHOA 1CDHA 1EX0A 4EZLA 2D7NA 5BS0E 2C26A 1WHPA 1JGUL 4Q9QH 1U8CB 1AGFA 2DJUA 2WXRA 5CR8A 1G7MB 4ZAKC 1TSHA 4JFDA 4GT7A 2YZ1A 3LDBB 3QJQB 2MOGA 3EYVB 3T5WA 3QRGL 1ZD6A 3A3YB 4H40A 4KUZL 3T0EA 2EDNA 3VI4F 2GPZA 1RZKH 1UCTA 1FFPB 3PF2A 4JM2F 4YIQA 1PVHA 2C9VA 4XC3H 2EDOA 1NMBL 4BSWA 4FQXB 4K5NA 4AXWA 3EO0B 1FZMB 3ZRFC 3X1BA 4HUWB 3H7BB 3LHAA 2H32A 4RAUB 4FXGA 3WD5L 1MXDA 5B8CA 4P23C 2CUMA 3NIGE 2K7QA 3OX8A 3P4OB 4Q0XH 4X6DB 3RGVD 3K4AA 1XBRA 4HKXA 2DWEB 5JO5A 1HH9B 4U1GB 1S8DB 1VCAA 3H3BC 1RY7B 1RPKA 2G0LA 2GC4C 2VSMB 3MO1A 1PJWA 1MOEA 2TRHA 2EUZA 2P42B 1HAUA 2I9TA 4ZUTA 3WEMA 2QPFA 2WVSA 4LRNL 1M05B 2ORBL 2ZCKL 1ACYL 5J13C 5IVXF 1AQHA 1FH5L 4OUOA 5JTWA 3KL5A 4X6DA 2UWEF 4PLNC 2FEJA 2NTFB 4Y4FB 3WU1A 1EVTC 3T2LA 3MAWA 5T1LA 1KJVB 2EIKB 3FQRA 4OJCA 3SKOB 2ENSA 4CADA 1A4AA 1ROWA 4F8TA 1GL4B 2H8PA 2R2EA 1Y0LB 3MYJB 3BVNB 4G7SB 3TFKC 3NEXA 4RGMB 4DP8X 3LKSA 4ENEC 5JYMA 1XR8A 4GAYA 4XCYA 2AERT 4NNYB 1BQHA 3EYVA 2IH3A 4XO4A 3FU8A 4RGNC 4PWJA 1G9HA 1R5VB 5ABDE 3WHXA 3P4LA 1OK0A 5JOEA 1IGJB 4W9IC 1FZKA 4DPAX 3C5ZC 4LMQE 4LDEB 5JDSB 1B88A 3IU4H 4G1EB 4IBUA 5C0RL 1RJYB 4WUUE 3KHQA 5BQ7A 3TF4A 1BVNT 2YEZA 4TNEA 4PJ9A 1DEEB 1DVZA 2C8NA 3GMRB 3E2HB 1K6QH 3TA3A 3BFWA 4RGNB 5C9JA 5CXPA 1JYWA 1J1OL 2Q5BA 1UM5L 3NK3A 3TT3H 4UOW0 5J8OA 5DU7A 5IWLA 4QPEA 1IVTA 3BPCA 2EIJB 3BVTA 5F6HI 4ZO7A 4CMMA 1A22B 2XQ0A 5CD3B 4L5FH 2XKNA 1P1ZA 1WBZB 1PFCA 2ICES 4YR6B 4EVNB 3WEXB 3RFZA 2PW2B 3OXRB 3KWUA 1U8HA 2IPUG 1S9KC 1M7IA 5DK3A 1CU4H 1E9OB 2YN5A 3NIGB 2L7JA 3QZWG 4JO2L 5FOBB 2AP2A 2BY1A 2Y6TE 2XQBH 5E1GA 3PWPE 3IGKA 4K07A 2YOAA 2XOTA 3RZCA 4G8EB 4YHOH 5EU6D 1YEKL 2R23B 2HYMA 1G0YR 1OAKH 2E7LC 1T04A 5BO0D 3QI9C 2COQA 3V10A 4A37A 3FRUA 3QUKA 2FYVA 1FVEB 2X89D 3N6YA 2P49B 4YHYB 4LK4A 5EOTB 1W0VB 3AS0A 4U6HA 2OJZH 5KJRL 5B38B 2QQLH 1ZVNA 1OOWA 1OAQH 4EOWH 1HN1A 4YX2L 1AANA 2FB4L 2BIPA 3LZQA 4H5SB 1PQZB 2YWYA 2AJYL 4XVJH 4GUOA 3OTTA 2HXAA 4TPRH 2HKHH 5M7QA 4LCWB 1FL3B 1F13A 4AK1A 4DKEL 4AGPA 5EO9B 3FSVA 4GW4B 5CCKH 1DLHB 5E6IA 1JTTA 3KS0H 5C7ZA 1G84A 2G4GA 2R69H 4ZMQA 5L8LB 4D0CA 3WY3A 3IEAA 3PFUA 2FATL 1EAPB 1NFDF 4AMWA 5ADOH 2YOCA 1G7QB 5IGXH 1JHLL 1KBGH 1FG2B 2GSIB 4KK5D 2HT3C 4MJ4A 1ED3B 2DYPB 1K2DA 5LGJB 1YEEH 5F7YC 4KGLA 5IKCB 1QFPA 3U79A 1EHLL 3N1QC 1HZHL 4B0MM 2IWGA 1YAZA 5I23A 3DX2A 5C86A 3F7VA 4ONFL 2WOYA 5D9SA 3R06B 4GFXA 1VFAA 4KPHH 4P5TC 3LN4A 4PV8A 4ERSH 5DVPA 3QFDA 1HL5A 2MOVA 4TNVF 4XO8A 1W16A 5CP7B 1KG0A 3KDPB 4UV4H 2P45B 3BAEL 3EBHA 3VXPB 3QIUB 3QGVA 2OP4H 2GTZB 3F7QA 4JHVA 1PBYA 3EGXB 3DXAD 1N5YH 5HGAA 3D0LB 1UD8A 4M5YL 2R83A 1AR1D 5TF0A 1N8ZA 1JOIA 3C60B 2ALWA 5F3BB 1JL8A 3IJYA 5EH1A 1AZUA 2DMCA 2LTQC 1O6SB 3WKYA 4WWKA 4OGYH 3MUGB 3IXTA 2IADA 5I1KL 4HIJA 4OCXL 3IS1X 3AUVA 3N40F 2XICA 3GBML 3IM1A 4KUCD 1IUZA 5ITFB 2HN7A 5CBAA 2I27N 2XWZA 2D2OA 2WPGA 1HL4A 1VADB 4Q58C 4EPSA 4F92B 5KANI 2B77A 4K94L 3WXWL 2HJKA 4XP4H 4JO4H 5LDSA 3TN0A 2PR4L 4FD0A 1OF2B 3FQWB 4U1MB 2J56A 1Q8MA 1KJ3H 2XPGB 3B4NA 3F7YB 2DQEL 3OR6A 1PIFA 1SMDA 3BHBA 4H26A 4K94C 3B3IB 4O2EA 5LAXB 1QR1B 3BGAA 1A9BB 1ZHKB 1JNHA 5I1KH 4PJBF 5KVDL 3WFHA 3WFDH 3LPWA 2ATPB 5AOJA 2HFEB 1IM9D 3OZ9H 4N9GB 1L9MA 1IFHL 2HFEA 2UZXA 3MROA 4WUKH 4H8WC 2M26A 1U8LA 4YHPB 2JELH 1TDQA 4OF6A 3T2NH 4Z78A 1KCVH 3SQBB 2PWDA 4UZUA 3MGOB 1CF8H 1UD3A 3Q5OA 1Z6JT 4GQ9L 5JHDE 2VR3A 3QJFA 5A2AA 1BVOA 2BW5A 2OJEA 3AQDA 3EYOB 3GMLA 4OF3A 1T66C 2D3NA 5IW1B 3WCYA 3EUUA 2HT4C 4TUOA 1SHWA 3N43B 3QB7C 1CFTB 3EH5B 5F1IA 3NH7H 4TTDC 2EYTA 1KJ2H 2WZPA 4JHAH 2FEEI 4MNQA 2WXOA 5I8EA 5E51A 2CQVA 5AW0B 4QRSA 3MUGA 4FABH 1G1KA 3QFGA 4PSRA 1GYAA 2WJ5A 2DQMA 1QHPA 1A3RL 5JQHC 4YDJB 3DI3B 3SGEI 3WEBA 1JHKL 3EZJB 4YZFF 4A2MA 3VNZA 1AO7D 4IIQB 3VI4B 1J9TA 3HE6D 1W72A 5HYSA 3ULUH 2IFFH 3BDBA 3GJFH 5CLZA 1HVXA 3KGUA 2NTSP 5IMOA 5I15L 4FI8A 2Q6WA 3GSNH 3LS5L 3MGTA 1MWAA 3C87A 3IDJB 3HUJF 1UJ3C 1WAAA 5DVKA 2DLIA 4YSAA 5I1DA 4M7LH 1D6VH 1NEUA 3FBKA 3D4ZA 3G6AA 2CIKB 4EEEA 4HJEA 2HT4D 3PV7A 4IJ3C 1GPOL 4TQEH 5CWSA 4YHIB 4CSPA 4EAEA 3T3MF 1BVNP 2EEBA 1ZWIB 2CLZB 2JKIS 2AABH 3FUMA 3W9EA 1JK9B 3MRKA 2CUAA 1P5VA 4ZQKA 5EC1B 3RWJA 4BYHA 3L5HA 3UO1H 2QKIA 3LKOB 1X9QA 3QDMB 2LVEA 2VM4A 4QHPA 3QO1B 3RX9A 2G30A 1MAMH 1KTDB 2QHRL 3BVWA 3EG9B 5F1KC 1UADC 4A7VA 2W8CA 1BZ7B 2PWHA 3MGAA 4Z7QF 2XXCB 4FS0A 4EDWH 1OPGL 3ARBB 4EIBA 3EO9L 3MJ7B 5AOMA 4MCNA 5ICYA 3SDXF 2ICWI 2LAAA 1N12A 3BQVA 3L9RB 1NCGA 3NJXA 2APTA 3CC5A 3GS4A 3HI1A 4P23A 4WDIA 3VFOB 1PQZA 1KIRB 3GBNL 4WTWA 1ZT7A 2WXNA 2GFBB 4GMTL 4AQZA 1CBVL 1KBPA 3MA9H 2X1OA 4ODHH 4BRJA 4WK2B 5MP6L 5EBWA 1BV8A 1CFNB 1CC3A 1KYUA 3ZO9A 5CN1A 3DKHA 4Y19B 4YPJA 5IMMA 3V4VL 3QZNA 4WWID 1L6ZA 4J6RL 1E6JL 1JJUA 3ATBA 3FFOA 3S8WA 1U3HD 5BRZB 5ECJE 3FTVA 4MFHA 2EO7A 5LHDA 1CYXA 1UQSA 5IUSA 2WXHA 1AGCB 5I1HL 1U6AH 5I18H 4LNVA 3CFJB 1L9OA 4GKZA 4MBRA 2XQYG 4PJ8B 1SY6L 1FNEA 2IBGA 2OTPA 3L3DA 4XPHH 5FO9B 3IPBA 4PJ8A 4YPGB 2AJUL 1XGUA 3F7PC 4YE0A 2DW5A 1FWXA 1F6AB 2VR8A 1TJHH 2N01B 4NGHL 2KLSA 2QADC 4ZMVA 2AFNA 2F58H 4NIYE 3LD8B 4ODVH 4NAJA 5F44A 2QR0A 4YHKL 4O00A 4Z3FA 3BESR 5DK0B 1FYTD 4LKCB 5DEGB 2YIHA 2NY2C 3D9AL 2H4EA 4YHYC 2OKMA 2ADJA 5FOJA 3UEQA 2PCFB 5DGQA 3VXUE 4UDUB 3B2MA 2BSED 4N0CD 4KJPC 4KRPB 3KM1A 5EEVA 4PJXF 4UV4L 5C09A 1I9RL 1B4LA 1KFGA 4LPYA 4KX8A 5FA4B 2IFGA 4IOIA 5AFAA 3T1WA 1RIVH 2Q2LA 3H85A 2DQUL 4JFXA 3CZLA 5A1AA 3P54A 2F8OA 4HV8B 4E68A 3UZVA 1T03H 1OQOA 3WHE0 1TTUA 1OTSC 3E8VA 3UBHA 3K5SA 5F70A 1ETZB 1IM9A 3IXAB 3MRCA 3WE6A 5GS2H 3SJVD 4P3DA 3SKOA 3ZYIA 2IQ9L 1Z9OA 1OCCB 2JV6A 2ZAGA 4DVRH 5IROA 3QDJD 2CHWA 2UXFA 2X44D 4GKNA 2JJSC 3ZE0F 3THMH 1RK1A 1LK3L 1QX1A 2K8QA 5EPMA 4AEHH 1RJZA 2K45A 5BVPH 4Y4FD 2A77H 4U3SA 5T3ZH 5JHAA 2ILLA 2XTJB 2V7NA 2EZ0C 5DD6B 2JB5H 5D5MF 5EWIL 1KULA 4UT9A 1XBDA 2H41A 3EGSB 1EJFA 4X5WA 5TDPA 2ZF9A 1A14L 3MV7B 5ECGA 3SY0A 4ZD3L 3TCLA 5C71A 3RVXD 4KK5C 1UWFA 3BH4A 5KVDE 4ODVL 4Y4KB 1KPRB 3NPZB 4HWZA 2RA1A 3EDFA 4HWBA 3PIQA 1TQUA 1NL0L 1XIWD 2R2HA 2VZVA 2WOBA 4XMVA 3MROB 2WIMA 4G8GA 4RRPG 4MJHA 3TH3T 2X4TA 5I26A 5DI8B 1W2KT 3FB8A 2ITEA 2HUEA 2UVEA 3D4GA 3T0EB 4H20H 4GEIA 4U6XB 5GRWA 1BG1A 3RWDB 1E2VA 4JFDB 2VJXA 3TO2B 2EUVA 1JNHB 3K71B 2X41A 4HGWA 4F9LC 4HT1L 1HHGB 2AQ1A 3OR6B 4MQXC 4YDJA 4NUJB 4E41D 5IQMA 1EUTA 1EEYB 4PBDA 3TN0B 2X2IA 1FGNH 1P7QD 2B59A 3CPLA 2A0LD 3CXFA 2DM2A 4ATTA 3H54A 1RP8A 3CZUB 3GK8H 2NDGA 1EZVX 1F1AA 5I8EB 1GTNA 2C1PB 3ZMNA 2ZOTA 5CKGA 2ERJB 1CLYL 4M56A 5EOCH 3ARSA 2C1PA 2ZOKB 3R0NA 3BAEH 3I6GA 3WJLC 5T3XD 4BJLA 4Z7AA 2E6PA 5DEFA 4FFTA 2ZYSA 2QSCH 3UL4A 1NCHA 3BQUB 4LPVA 1YUKB 2D0HA 3FB5A 4NUJA 4PRAA 5E8OB 4DKAA 5D5MB 3ULVC 2VOTA 1XIWC 1YQVL 3SJVA 3IFLL 1UT1A 5HI5D 1IQDA 3L7EB 3SKJH 4UM9D 4XO9A 1NCOA 4Z78B 4OCMC 1V10A 4Z7WE 1FO0H 1NMCB 1RUAL 1U8LB 2ZT9C 2YUVA 2QMJA 12E8H 1XH2A 2OI9B 4GSQA 2QVKA 4OQTH 1JZ4A 3QEQB 4LU5H 4GQQA 5D7LD 1ZHBB 5B1JC 2KZKA 2R2HB 4UU9A 5JPMC 4XP6L 2BHZA 3IDIB 2XTJE 1YEHL 3P30H 3ZZLA 1VACB 4OGAC 2I5YH 1QATA 2ZYIA 3DHUA 3ZYJA 3K2IA 3UERA 4IOSA 5HYJD 1M3IA 4UM8A 2C1OB 3WN5A 5KW9L 1FFQA 1Z9SA 4HQQH 4WV1B 1LO0H 4ODTL 1YPZA 3NSYA 4HUMB 5A2LH 4JPIA 2HJKB 4MHHG 2VJ0A 1I4FB 1NC2A 3AROA 3O4LE 4FZ8H 3OG6B 3VI3B 4P46D 1UCBL 2K3TA 5CS7A 1ODAA 1AGBB 1T89C 4HIJB 5DMKB 1EWHA 1I9JL 1C16B 2AXGB 5D1QC 3HG0A 4JG0L 2IFFL 4G9FB 3QQ4B 4MDIB 4Z95L 4X4MA 1WZAA 3LNHA 5I2IA 4XN8A 3T77A 5BV7C 1OWWA 1S7WA 1I8IA 4NC0B 2OMYB 4BE5A 3UZEC 3SPVA 1CD1A 3MRHB 5IR1A 3DTUB 3M1CA 3KPNB 3PG2A 3V6FA 4U0RC 4N90D 3VW3L 2NPLX 5CN3A 2LVCA 4TL5A 1I9JH 3K6NA 2YRLA 2Y7QA 1T2QH 3DUSA 2YC1B 4R90H 4ONGL 3KXFA 4LEEA 2J8HA 1G9MH 1QZ1A 1AMYA 2CKNA 3OXSA 3U82B 1RJLB 4P5KB 3T4AA 3WO3B 5LO7A 3DO7B 2B16A 5C08B 4Z8FH 1MCSA 1YYLL 3ATFA 3PGDB 4MS8C 4YSPA 2UX6A 3PWJA 4M5ZL 5LGYA 1IC0A 2PTVA 1TFHA 3FU7B 3FTWA 3VFUB 3KPRD 4XX5A 2HLAA 3GC3A 1WUNT 4XNXL 1DDTA 4MVBC 1T0PB 2FRGP 5KVGL 3B56A 4PGDA 1QP1A 3CG8A 1XGUB 1PSKH 1ASOA 3D69A 4Z3IA 3QEQE 3NMEA 1HHIB 1OP3H 1CJYA 3VCLB 1NBCA 2HT3D 2CR3A 1U3HB 2YKKA 3TA3B 2GY5A 3WAKA 5DLMH 5IM7B 4D8PB 1DEEA 2Z91B 4L9LB 2D7TH 4UQBA 2J8UE 2ZONA 1A7RH 2BFVH 5IJVA 1NMAL 2EXSA 1DJIA 3CIQA 3VWKA 4DK6A 2CGRL 4HGKC 2XN9B 4X4ZA 3P0VL 5K1NA 3LS4H 4G6FB 3FQTA 1IGIH 3DSFH 2QEJA 3FOMA 2GHWB 2VERN 3JTBA 4Z23A 3DROB 3MNWB 3DDGA 1BZEA 2ZWLT 3WI9A 4ZFZA 3ZDYF 1TEFA 3RY4A 1QSEA 1YDPA 3BAIA 2YFNA 1JZ8A 2CK0L 3R1GL 3DX9B 1TJGL 5GZNA 2ATKA 2VE6B 4BD4A 3ARBA 1X7QB 3L17A 1JS4A 3M1BA 5F1NB 3RIFK 3U7WL 4DEPB 1OAYL 4P4KA 5C6WH 3O9WB 4XN1A 1MIML 2NZ9D 5JLZB 2AJSH 2GTWB 3B2VL 2PO6B 5FYJE 3QO1A 1PZUB 4FTVD 3R7QA 1UA7A 1AGEA 2BJMH 3ZRSA 5HHVH 3S7GA 1YEWA 2FO4A 1CFVL 5IJDC 2VUOA 4G71B 5TE4H 4D9QE 5BQ7B 1B6UA 4G83A 1EBAA 4CN6A 4U49A 3FQUB 3G08B 2QQNH 2CDEA 4UNUA 4WV1C 5TH2A 1FZKB 3W39B 3EXJA 1SXZA 4JDZA 1E3FA 4HOWA 3ULSA 2G2RB 1RVFH 3R4DA 3MJ9H 3ZHDA 1DSYA 4Q6IC 3REWA 1JI1A 1BQLH 3PFQA 1QYGL 4OCSL 3L95A 2K6YA 3TVMC 2Z64C 2I7SA 4HK3N 3Q05A 1K4DA 3BJLA 3HAEA 1VKXA 3L4UA 2JB5L 5LBSL 4LCYA 5JW5A 5KS9F 2J8UB 4U1HA 1XIWB 2VWEE 3QARA 4DN4L 1QRNA 2Z93A 1IB5A 3QXVA 1O5DT 4HD9A 3GDBA 3VFTA 5L9DL 3ZE0B 2Z7UA 5E1IA 4NUGH 2ZXWB 2EDMA 3EJZC 2WBJD 4XP9H 1XTMA 2Y3AA 4NQDD 3KVQA 4OW6A 5DVNA 3V8OA 1K85A 3JWDL 1MRFH 3ZBMA 4F9PC 3SDCA 1SEQH 2Q2EB 2VSCA 1KELH 3CSGA 3QZPA 4KJQD 3BRDA 3SPGA 4JFFD 3EYFA 4R4FH 1VB9A 5D1ZB 4I0KA 3Q2LA 3D25B 2FBOJ 3GXFA 3EYOA 5ERWB 5KS9A 4X5XA 2I60L 3CZJA 4NZ8A 1F02I 2QV2A 3COOA 4XP5H 1DHKA 2EO9A 2WNGA 3EYSL 2X6VA 1NC4A 1FSKB 4FQIH 4WUUA 3HE6B 4AV0A 5DD1H 1KXQA 2MCG1 4EZKA 3RJDA 2BH0A 1ZHNB 4Y9BA 4HBQA 1U3YA 5DK2A 1EVUA 1CL7H 2JI1A 4L18A 4GI8A 5IMKA 2OA9A 3X11A 5KN5B 1B9KA 3LZPA 1DBMH 4XAWL 2XACC 2BY0A 3KM2A 5LXGH 1A5FL 4PP1C 4HVBA 4FI6A 3F5WA 2YGQA 3FQYA 1EH9A 4LEXH 4OF8A 5GISH 3BAYA 4QXVA 4BFBD 4AK2A 1OF2A 4U1MA 4ZUWB 3BD5A 4GRLD 1U95B 5AENA 1ORSA 2FIKA 4XPFL 2VDKL 2YKLH 4NLAA 5LDUA 4KUZH 4Y8DC 3TM6A 1SJVA 3FFCD 2VR9A 1Z3RA 3N42F 5CP3H 4XPBH 5IOPB 1BFTA 2WZAA 1WAAE 2FK9A 2ZWZA 4I77H 4JL1A 4PVLA 1TO5A 4ADIA 4A7GF 2AS5M 4MS6A 4UOQA 3UAEA 3P02A 1H0DA 3F05A 3H56A 4M1CC 4TF4A 5C0BE 4Y2DD 5F3BA 3ISWA 1FYHB 3RJOA 4PU2A 3CZKA 4N68A 3NYKA 3IKCB 1R6VA 1BZ9A 4Z7VF 4YHZH 1NBQA 3NCFB 2UY7B 3L1OH 3WKNA 4ZMNA 1U91B 5E99L 4XTRC 1BJ1J 1EO8L 2FNWA 1KB9J 3QJVB 2JB6A 2WN3A 3EOAB 1B4JL 3FU7A 1FZJB 4KZDL 4LVNC 3VD9A 4DWHA 1WEJL 1OIOA 4DKFL 5IEHB 1NMAH 2ZCKH 5HHNB 1RPUA 1U4EA 3MRLB 3UZQA 3FQ4A 2GUOA 5LBGA 2FATH 3BUIA 3T2NL 2XG4B 2X53A 2GUOB 3VXRA 4XCCL 3U9PH 3IDMB 3ILEA 3WJLA 3S9DB 4U1JB 1N7MH 3DV4B 1HDMB 3FFCB 3T0AA 2XRAL 2DYPA 3Q44A 2EILB 2NY2B 5J11C 3WSQL 4FOMA 5GPRA 5KOVC 3NT0A 3QULA 1HEZB 1FG2A 2GSIA 2GIYA 3VXSD 5F9WC 4IMLA 4XVOA 1ZDQA 3ARWA 3EYUL 4WI7A 5F0JB 3CFDB 2OMYA 5C92A 1MFMA 3BKJL 2NQ3A 4L1TA 1J1PL 2Z7ZA 3HRPA 1E4JA 5I2IB 2PPEA 3MRGB 1SMOA 1OLLA 5A16B 3HOGA 4BK4A 3TIDA 4AH2B 3RY6A 2DQIH 1PL3A 3FUDA 4KKPA 1T2JA 1IGTB 3WOVA 1RURH 1QR4A 2E46A 4V1DD 1G9ML 4WNQB 5ACMA 4DO5A 1OGAA 5IOPA 4JHWH 3EYUH 5GRVK 1JPGB 1MFCL 3MRNA 1PCSA 1AGDB 3G9AB 4BBWA 5ADPH 1A4JB 5FW7A 4V1DE 3N85H 3CNKA 3N91A 2KZWA 3RWFA 2E75C 2DBLL 5BJTA 2ZUQB 2NRDA 5AYTA 4BQ8A 1XSOA 3GSVB 3IDMA 3LNFA 5EBLB 2PKDA 2VKXA 3FO9B 3IJSA 4HS3B 4HU2A 4PLJD 4PS7A 4RIRA 5F3FA 4F3FA 3U46B 4Y16C 1TO4A 4J3OC 5KYWA 2ARJB 5L0QB 5HHNA 2GKIA 1L7TL 1ZV5A 3HCVB 4RRPM 3ZDWA 1HNGA 3MV9E 1D5MB 1EXUB 4ZMPA 4X8GA 1M1XB 1M7DB 1KPVB 2FJSA 2RALA 2CDGA 3AREA 1DFBL 2BSEA 4QYOB 2H26A 1UT9A 2QPSA 4Q4IA 3TZVD 2IO5A 1SFDA 3L7FA 2MJWA 1KJ2A 5CD3A 4U1KB 1LHZA 4WFEE 4Z7UB 5DZJA 3QORC 1AACA 4FYQA 1A7QL 3L2NA 4O4YH 3TXAA 4ZFFB 4WNSA 1VIWA 5GGRA 5B1JA 3OR7B 2SEBA 3HBQA 4E36A 3OC5A 2CGZA 5D72L 4ELME 3MLVH 2V7HB 5JPMA 3MOBH 3EZ8A 1RHHA 3TBVB 3BVXA 3QXUA 2ZP0T 5FDYA 3C2AL 1XF4B 4LBEB 4Q8BA 3VFMA 1NKRA 1T4WA 3MOAH 2EE3A 3CCHB 5EA0H 2GI7A 4QKTA 2P26A 2H1PL 3GZPA 5D55A 5DVOA 1CD8A 2W9LA 1D5ZA 1KXTA 3HHMA 5CCKL 4PJGA 4FA6A 3GXPA 1QW8A 2P5EE 3MLUH 4X6CB 3Q6GL 4UTAL 5T5FH 4R0LB 4R7VA 2BVOB 2IH3B 1ZSDA 2CR6A 4XCFH 3DX8B 3BZFA 5HYJB 4JZOA 4ZMZA 5A6MA 1KFAH 2FX7H 1JD9A 1WIUA 2KL6A 2ICWA 3US0A 3MYJA 3U2JA 2MCAA 2OTUA 1AO7A 2DLHA 4I1PA 4JFDD 1MFAH 4BH8A 1YNTB 1NDGB 1NM9A 3KXFE 2ZUSA 3V2AR 4JPVL 4GQZA 2WVTA 1X3DA 1D5XA 4KXBA 4YO0A 5IB4A 4DIXA 4HKJB 1T03L 3G5VB 4U7SA 3FU5A 2AEIT 2VW7A 1S46A 3LJ3A 4KVCH 4DGVL 3VXRE 4KDVA 1KT2A 4J3UA 4HD5A 3VVWA 2DIBA 3MBWA 2MQ3A 3EH4B 3OAUL 2P5PA 4RMRA 2ZOUA 5AZUA 2IPKB 1CDJA 3AT8A 5SWZA 4QOKB 2BINA 1RK1B 2O5NA 1MRDL 1IZKA 1YC7A 3MV9B 1KIQB 2OMXA 2BSSB 4U1IA 3BPNB 2RACA 1VFBB 1U58A 3P2TA 1OCWH 3P77A 4FNRA 3WELA 3CDFA 2JI3A 1A6TB 2ATKB 2VE6A 4GRLA 3HAEB 1VKXB 1K4DB 4RZKA 3BN3B 4XVTL 2ZQKA 1QWHA 1QACA 5F7WC 3EAKA 2OTUB 3BGMB 5C08D 3VX1A 5C0EA 5D7JC 2GBAA 5GJTH 1GIGL 4J5VA 3BI9X 5KSBE 4WJ5A 4WW1A 1OV8A 1MEXL 2IGLA 4TLUA 3W38A 1RUQL 2CIIB 1OAXH 2G5BA 2PCFA 4JRXE 4XVJL 5J12C 3IE9A 4QUOA 4D7PA 3PYCA 1T2XA 1GXEA 2JWYA 1VESA 3H4HA 3NJVA 1GC1C 4TTDD 4GH7B 5E94B 3D39D 2QMKA 2IBBA 4KH9A 1JNLH 2EH7L 1VJSA 3EBIA 2MPAH 5JHLL 1QSED 1UASA 2V5TA 4ZFGH 4W6XB 4AEIH 1FGNL 5FK9A 4L3EB 1T83A 2FO1A 1ROCA 3E80A 1WGOA 4R8WH 4JFYA 4Y1AD 3RDTC 2DS4A 4IEFB 3AU0A 5A6IA 4KKAD 2G3ZA 2Q76B 3VB8A 4BGLA 3M8OH 1O0VA 3GT6A 3QJHB 4RMQA 4NKIH 2BCKA 5FKAB 2VSKB 2GJJA 4HJGB 3KPMB 5HHOE 3KJ4C 1A7BA 3QBTB 4OIFA 2QPDB 5FO7B 1WCBB 5EORL 2Y4SA 3AC0A 1PZ3A 5J11B 4OD3H 1XH3A 1V3KA 1NTDA 4NC1E 4H44C 5I71B 3WIFA 5IMLA 4PJCA 2E4FA 1WP6A 1J1XL 4MGXA 2CCWA 3KBPA 2VDNH 3DUSB 2F8XC 5F9JB 1NIEA 5KBPA 3EFFA 3KYKL 5LAPA 3LXUX 4W4NA 3BUTA 3UAJC 4BCZA 3GSNA 3KLHC 1MCPL 4OSUH 5J6GA 3ZT7A 5ELIA 5FYLE 4TRPL 2BSRB 3VYOA 4CSSA 3DBXA 4MNGB 3UYRL 1TSRA 3CQFA 4Y5VB 1YMHA 3WFBL 4QRPA 3MRBA 1TJXA 3TIDB 2GG1A 1OAZL 4JKPL 4OI7A 4OM0H 3QE5A 4QRRA 4KTDL 6CGTA 1IO4C 1HXMB 1GYUA 2UY6A 4JZJC 1M42A 3MRQA 2JIXD 4LSRL 4OJFH 1ZLUH 4DZ8B 5L0QC 4HIEA 5EEZA 3QDMA 1IKOP 1AQDB 3T8MA 3U4AA 4UB0H 3CFDA 5BS0D 1FHNA 3H4FA 4DFIA 1GJIA 1FRGH 3KW7A 4FLOA 3RAJL 1GCFA 1NDTA 3D2UB 2V9TA 2XRAH 5KS9E 1S7RA 1UD6A 5E8NB 3GMOA 1JXKA 4NI6A 4R4BB 1K8IB 4ZXBC 4PJ7B 1AKJD 2CJTA 4N2AA 5L4MA 2AJZB 1FZOA 3MBEA 1JN6B 2XQYK 3PABB 3QI9B 1I7TB 3UTOA 1W91A 1MWAB 4EDWL 3TEXA 4LSQL 1OSPL 1TNMA 1ZTMA 3V6FB 4APQB 1NJ9A 1M56B 2XKSA 3QUXC 3S97C 3FQ1A 1CD1B 3GXDA 4YLCA 3B43A 1MFBL 4NO5A 4F93B 5E4OA 3SOTA 1T0MA 3NRFA 1BZ9B 5HHMB 3VMPA 3NFNA 4ZTOH 3VG9C 4WEEA 3T9WA 5HYEA 4OR1A 1QG3A 4HIPA 2Z1PA 3ULVL 1FNHA 5IB3A 1H0DB 4M7KL 2NX5B 4PHZA 1J0ZA 1NGWA 5GRZA 3UOAB 3WFEH 3IJ9A 4C56E 1NIFA 3PUCA 5D1ZC 4MNQB 1ZTXH 2DN7A 5D2LE 1LO5A 5TJWK 1U36A 1CFSB 3BWSA 3VI3A 5L2JA 1HYSD 3PHAA 1G7LA 2W38A 1PTZA 3K5RA 3HS0A 5AAPA 5I30H 2JJVA 4OJFL 4XVSL 4BEIA 5AZ2L 1T5XA 3FUFA 1NGZB 4J3OF 5EFIB 3U1SL 4QTHB 2B8OT 1BEYH 3BFOA 1PKOA 3JWOL 3TNMB 3P73B 5MERA 3F58L 4X7DC 4G11A 5ESQA 3HI5L 5E2TL 3WFEL 1NAKL 1ZS8B 2BOBA 3VYPA 5LUMA 4N6RA 3AFLA 4AWJC 4XH2B 1UVQB 4F33A 2ZKHH 1RZ8A 4XVUC 4YBHA 1NUFA 1HE7A 1I7UB 2R9HC 3PJSA 3SQOH 4CMHB 4M6NL 2HX9A 2MRYA 5A2FA 4AEFA 3ARYA 3H9ZA 3IJEA 1ZK9A 1MJ8L 3J7HA 1L5GB 1GGYA 1JZ6A 4Y4FC 3ML9A 1IGCH 4KX9A 1C12B 2VLME 3OJDB 3CUPB 4CKVX 1TOXA 1N3NB 5DMIL 5GGTL 4BZ1L 1SOXA 3F01A 1TTFA 2ORBH 3RTQA 4AG4H 1NDMA 4K0OA 2F54D 3SODB 2OFQA 4QLWA 1LO5B 3D0VB 1DQKA 1GHFL 3N1MC 5AVSB 3BEWB 5FYJU 3RNKB 4E9WA 4EF3A 2AEWA 4MLSA 2IADB 3RU8H 3V8CA 5FLVA 2X12A 4M8RA 3FJTA 3TTYA 1RZIA 3V5DA 2H9GA 4B53A 3DA0A 1KCKA 3UROR 2ZKMX 3ATDA 5LWYL 1XIWA 5L8KB 4G42B 4N0FB 1NBVH 2DLGA 4E5XB 2Q7AA 3JT0A 3K3QA 4JFFA 4LDCA 1AR1C 3D0LA 2F58L 1JGVL 1UWGL 3DJZA 4OFPA 6FABL 1A9VA 1ZDSA 1HI6A 1OB1A 4JDEB 3BPOB 3SGJA 2PCPA 4JX0A 1YEFL 4AL8L 1KY6A 5B1CA 3IF1B 4WTZA 1BPLB 1RD6A 2VIRB 3F6IA 4MBOA 4NO2A 5ADOL 4X50A 3OZLA 3HC3H 2L04A 4LASL 3DUUA 3UYOD 1JGVH 3DURA 5I82A 1GYVA 1PZ5A 2RR3A 2CDEB 3E6HA 5LB1A 3QUYC 2DWDB 1QSFB 1XR9B 3IBEA 1JG9A 2ZUTA 5DK0A 3V52L 1OOAA 3QFJB 4MJJA 3LMJH 3ARGB 3QUMA 5HHVL 5CJOL 1Z0MA 3W1ZA 2PR9A 2FGWL 4DGIH 4QTIL 1MJUH 1DBBH 3CFNA 3AU1A 2EKSA 5JPNB 2KZBA 4YPGA 4KO9A 1PMYA 4N0UA 4TULH 1U93B 3PCYA 1CZ8L 3AREC 1OAUH 4MMZC 3CMGA 1UB6A 3DBXB 2IAMC 5FF6B 3IDGA 1YEKH 3UIZA 4F57H 4GI6A 2Y1VA 4AGLA 3MCKB 2NLJA 4YC2C 1BM7A 4K3EH 4P2AA 2HRPL 1QFHA 2NW3B 5FWQA 1DQJA 3RZCC 2I24N 4JO2H 4IRSB 1B2WL 2FLRT 4L2LA 4MYPA 4MA1C 3LRLA 4LSVL 3UTQA 5I8CA 2CO4A 4X7SL 3HB3C 1ZV2A 2PTTB 4DNLA 5F7KC 3T4YB 5TF1L 1Z3GL 3RKPA 4LGSB 5I8CB 4XCEA 4P4RA 2PR4H 1GH7A 2WNXA 3DXAE 1EDHA 3QWOA 5HYFA 1DDHB 3OLDA 5GGQL 4H1LH 2PYFB 2YAOA 3QQXA 2G3NA 1LE9A 1LO2L 5AKTA 5I8OH 3MX0B 3GXMA 4HC1A 3U25A 1U8HB 5G5DB 1N19A 4FKEA 2BVQA 1FNSH 5C8JB 3BWZA 4UQAA 4G2AA 4LSRH 1ASQA 3BWUC 5JHMA 4JQIH 4ZXBD 1NSNL 1PAMA 1X5GA 3EJTA 1A64A 1A14H 2EVFA 1DQQB 1J5CA 2CKBA 4K3DL 4YBLC 3CH8A 4EN3C 1IKNA 1A6AB 3DX1A 2BVQB 4QHLA 3VGAC 3LIZH 4UQ3A 2A83A 3LNEA 4JN2B 3OKNA 5J1SC 1LO4L 2R29L 3QUMB 4JM4H 3ILQD 4TULL 5SV3A 1MNNA 3FTZA 3SYAA 4AVIA 2BSBA 1TTRA 1QSFE 4K7PY 3V4PL 5SWZD 4IGBB 4JANA 2ZCHH 3CSBA 1JHTB 3LKRA 3QFJE 4P4RB 1VGEH 4L9LC 3K72B 2FSDA 2IANA 4OCYL 5IBLD 3C5SA 1OHQA 3HUJB 4EDXA 4S0TD 1QWUA 3IMRA 4I2XA 4AT6B 3KNBB 1N68A 1A6WH 1U3HC 2XWEA 3MRPB 3QEGL 5DR5L 2I07B 2FECI 3NCCB 5MEPA 3U0PB 1CXKA 3IF1A 3LOWA 3D1MC 3ROOB 5EZIH 2FX8L 3SGDI 5DJXB 3UIYA 1PLGH 2K4AA 4HETA 1MHEB 4S2SB 3T3PF 1ES0B 2VDLB 3QIBB 4PAZA 4QXWA 1KV3A 5IB5A 2YMTA 4A7UA 1FRGL 3RAJH 3QK0A 2PUQT 3KLAB 5I1EL 1JIBA 3V6BR 1G9NC 1YLBB 2J8UF 5JOPD 2PETA 35C8H 4G1MB 4MDIA 4CVWA 5KBDA 2FTAA 1NBZA 1NANI 2XX1A 4O02L 4Z7UF 3QUMH 4FXKB 3JV6B 3FTXA 4Z7QB 4ABVA 3HNTH 2IH1A 1PCXA 2J2ZA 3QRGH 2EDXA 2LLNA 2XFGB 2XVKA 3BKCL 5AZEL 4OU3A 5AUMA 1EZUA 4JFZL 4P2CG 4X5RA 4X9YA 5KOMC 4BZ1A 2WXJA 1MVYA 3U2SB 3D0AA 2YXMA 2DWEA 3ABLB 1ZY9A 2YZ8A 2DYSB 2EYRA 3JVFC 1Z9SB 3LZFL 4PWKA 4WV1A 3TN0C 1FNGB 4LU5L 3M07A 1Q0EA 1Q72H 4WFFD 2UXVA 5B38G 3L08A 5EEWA 3CU1A 3QXTA 1LK2A 1UWGH 3TJEH 1ONQA 5IY5B 3AUWB 2XFXB 4M93B 4YIQB 2YO3A 3QIBD 5CJQL 3KH4A 5TE7L 1T3FB 4XODA 4LPCA 5C07A 2VT0A 3X3GL 1A7PH 2FBJL 5ES4B 1GKOA 2EIMB 3RVVC 4NHCH 4PJCE 4R2GD 2EJ1A 3C5JA 5H35B 4PVBA 1U8KA 1CL7I 4UYPA 2DF3A 4U6YA 4JFFB 3X1EA 4NP4L 4FQQB 3BHBB 3TNMA 4QR7A 3DJTA 4PJDA 3JSSA 4QTHA 4GJTB 4HC1H 4FADA 3VXSE 2FJFA 2NY1C 2VW4A 4LGPB 3HS0B 4JG5A 1G5GA 1GGTA 4KITB 4CNIA 3BN9C 4I0PC 4U1NB 4PGZA 1CFSA 5IBUB 5JORB 5C97A 4HJJL 3AVEA 2B2XH 3BP6A 4D3CL 3MJGX 3U1SH 2CJUL 2SEBB 4ZFOB 2J73A 5EC2A 3GSRB 4JO5A 3S96B 3FH5A 2V17L 4N0RA 2CM6A 3L5XL 1M57B 3QAZB 3RY5A 1BIIB 4TVPL 9CGTA 4DGYL 4M43H 5CN2A 3A47A 1T0MB 4JG9A 4I77L 1H9DA 5KVFL 4ADGA 4M7KH 3DO4A 3BT0A 4YHPA 3ZTCC 2V9QA 5JR1H 4A2GA 4N9GA 1PY0A 3KPLA 1RERA 3K1DA 1T4KA 4Z7WF 3MNMA 1UXSB 4TSAL 2ARJA 5FYKL 2WKGA 4XVSH 3GSOA 1U8PB 3U4BH 1IAIM 1QLRB 2Y24A 4LSVH 2LT9A 3U46A 3U4KA 4FF9A 5HHXH 1F0LA 1IBHA 4O51A 4A6YH 4I9WD 4B9JA 2AW2A 4TSBH 3FHEA 4JB9L 1E6OL 3MKGA 5L4FA 3UO8B 4FG6D 4RFEA 3MRNB 5L2JB 4UT9L 1YY8A 3CTTA 5CCHE 3GSXB 4N2HA 3JUZA 4MA3A 4WFED 4G80B 1MJ7L 1WWWX 4DEUA 3D18A 4KVCL 4GT0A 4HJUA 4J6RH 5L2KA 3BAWA 3QQ9C 3K4ZA 4PJAF 5E8PB 4ANVA 4IRJB 3WUWG 4GW4A 5FM8A 4YLBA 2L7EA 4KUCF 3AS1A 4X8CA 2Y25A 3IMTA 1WD8A 2AJ3B 4FFWD 3ULVE 2EXWC 3LRSB 3MRFA 4AYEC 1DJYA 2W0LA 4XX1E 1RFDH 2XBZA 1XVSA 1MJ7H 1WA2X 2WWNA 4IOIB 2UZYA 3D33A 1SHSA 3C2SA 3Q8EA 2VM3A 1FVEA 3TN0D 3OJMB 1I82A 2J72A 2GK0B 4M7JH 4N3TA 1HEHC 2Y5EA 2VMJA 2YK1L 5I75C 1FF5A 4NUQA 1PX8A 2H6PA 3MLYH 3VXME 5D93C 4G8EA 1ED3A 4LOEA 2VN6A 5JUEH 3FT3B 1FGVL 4PH8A 4JFDE 2OMBA 1M7IB 2E74C 3MU3A 2GITB 4POUB 2VRAA 3OKDA 4XAWH 2BS8A 4TM9A 4UBDD 2AJUH 2MIZA 4CSTA 1WO2A 2CKBB 3UYPA 2B1AL 3GBLA 3V4PB 1NGYB 3L3DB 1OVZA 3QUHA 3VI3F 4FN0A 4M93C 3MRBB 4HHGA 5DO8A 3HI6H 2O72A 4P9HL 3SBQA 3KWTA 1MQKL 5C9JB 1I85C 1DSFL 3ABGA 1MW1A 5BW7C 4KNQA 5HGDB 2VLJE 4NM4L 2HMIC 4P3CL 5E8DL 4GS7C 2HRPH 4KDWA 2O5YH 1A7QH 2CK2A 3QA3A 1LP9E 3H6AA 4P9HC 2HKFL 4NXKA 3SPCA 2BRRH 3KAAA 1BFVH 1F4YL 3G7TA 3UBGA 3JTTB 2YSSB 1N5YL 2YD2A 3LD8C 5E4IA 5EBWB 4MA8H 4NN5C 4FERA 1BDYA 4WHDA 5C0DA 2O5ZH 5C08E 2R23A 1XCQA 5H37H 3ZT6A 4ALAL 3T65B 3Q1SL 3JZYA 4W9KC 1SXSA 1MAKA 1FJ1A 1NFAA 1SJEA 3WNJA 3IJ8A 2GSGA 5FFGA 3EO1A 4LOUC 5K39A 1M53A 3RB5A 2BCKB 2ISDA 1Z0NA 2QKSA 4GKSA 1HQ4B 4ZUSB 1RXLA 5DDHA 4NHCL 2DTSA 4IS6A 4FNUA 5CEZL 1PG7H 3OAYK 3MRIB 5JUEL 1E4XL 4NQCB 2FT8A 1JGEB 1Q4NX 1U3JA 1M2VA 3F6JA 4V1DA 4X5XB 4N0CC 4S11A 4YL4A 3MTRA 1OGAD 3MRRB 4KQ0A 3AU1B 1PZSA 4BSVB 5BZWB 1DQMH 3WFBH 3HZ3A 4F7CA 1IT9L 4MD0A 1BD2B 1EFXD 4OZIE 1EGJH 2PYEB 4HPOL 1X5MA 2XV0A 3HVDA 2XNAA 3X1FA 4HCGA 1ETA1 1W0WA 3BP4B 4Y89A 3KGRA 4MB5A 3CFUA 3VGFA 4EBQH 4NLHA 3FUHA 4X6DE 1RU9L 1J1PH 4XZUA 4AYID 2CDFA 4M6ML 5DT1H 3K6SA 1J9CT 2J1KA 2FJHA 2ODHA 3P11H 3KYNB 2WYHA 1XGTA 4EN3B 4JO8A 4M9PA 1G4RA 3FKUS 2K9FB 5D1XB 1FVDA 4W93A 5EO1B 4K7FB 3KBHE 5IG7B 5JXAL 3K91A 4BKLA 2A4CA 1BFOB 1E27B 4A63A 1CF1A 2FVNA 4R4NC 4W4OC 3ZYZA 2HMID 3K2UH 4FLQA 4GG6A 2CNZA 2OMTA 4U6VH 3MR9B 2Z35B 3GMMB 1IC5H 4NJAH 3H0TB 4AV4A 4OCYH 4EI6A 4NO3A 3U4EB 5T3ZE 2DB8A 2HPTA 4ZW5A 1ID5I 1C1EH 5FYLD 1Z2KA 1JPSH