1GYAA

N-glycan and polypeptide nmr solution structures of the adhesion domain of human cd2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
105
structure length
105
Chain Sequence
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Adhesion glycoprotein
molecule keywords HUMAN CD2
publication title Conformation and function of the N-linked glycan in the adhesion domain of human CD2.
pubmed rcsb
source organism Homo sapiens
total genus 10
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1995-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gyaA00
5GS0D 4XBPB 2DQTH 4LLWA 3X12A 2YOCA 3VDCA 2YD6A 5L7XL 4BFEA 1CYGA 4JQVC 4NQXA 1KTLB 5E5MA 1HH9B 5KG9B 4MXWH 2J6EA 1LP9E 2R1XA 4JO1L 4Y19E 4OCXL 5JW5B 1YN7B 3L5XH 1SHMA 2DIAA 3L3KB 5HHPB 1Z9MA 5D1QC 3CXDH 5GGRB 1EK3A 5HHNA 5I15H 4CVUA 1TCRB 4GRLA 43CAB 4EOWH 1KGCE 4GW1A 4WI8A 4L3AA 2QSQA 1MCDA 1KCLA 2UY7A 1F4AA 4LMQE 5GHWL 5E6IC 5FKAB 5K59E 3BPOB 4OCYL 1CDCA 1ZT7B 3F7VB 4JDTH 1GSMA 2JJTC 2BDNL 4ELMF 3EJJX 5CSGA 1IGCH 2NY7L 1JUFB 5ADOL 5BRZB 2Q76B 3L7FB 3V79C 2AJYH 1RU9L 3W0WA 4JPKL 5CILH 1VACA 2MFNA 3SKNA 4PG2C 1L0QA 4RIRA 3UTTA 3C60D 4FQXD 5E2VH 2NX5D 3ME0A 2ARJQ 5DVOA 1YECH 4NKOA 3TA3A 2EO9A 5C3TA 4QHUA 5EO9A 1YEHH 4XNUH 1WWWX 3B83A 4YHML 4HEME 4NFCA 4YXHH 2MHAA 1YPZE 3DRQA 3T2PA 3ZTNH 3ARBA 5HGGS 4ELMB 1QSED 2CRIA 2OZ4L 3V0VA 5I19L 1CL7L 2F15A 3V5HA 1TVHB 5H37G 1U8KB 2APFA 2DM7A 3GZKA 3R06B 5C6TH 2JF1A 2NXYC 1MCWW 5C2UB 3ARGC 5DVKA 4EKXA 5F3HA 4P2OB 4O4YH 4YHIA 5DUML 5E2TL 4X8XA 3IDJB 5GSRB 1MHEA 3QCUH 1P84J 3GHEL 1MIEH 1Q9WA 2QHLA 4PJHE 4EEEA 1UM5H 2I9TB 4ZFZA 1IC1A 1T7YA 3I02A 1MJ8H 2VB5A 5T1LD 1Q72H 3M8OH 4PRBB 2DD8H 5D96C 5F1NB 3W39B 5KSBA 2FO4A 4LEXH 4LIQH 1ZA3B 4K7PY 2UWEB 3RWGB 4NIKB 3ROOB 2DWEB 3MRDB 3ZKXB 3HNTH 4LHUA 5K9QI 4NQUA 1R5VA 3RIAF 2W60A 25C8H 4TOYH 1EPFA 4IS6B 5C0CE 4PRAB 3C09B 4QXUH 3RVUC 3MRCB 5JPMA 1ZLVK 5TQ2H 4XX1G 2C3VB 5D2LF 4JRYA 1HHJB 4WO4D 2F53B 3U0WL 4YHOH 2JCCA 1WFOA 2FX7H 4A6YL 3P2TA 4EUPG 4IRSB 4OZGE 4JY4B 3GSXB 1T1YA 2K9UA 4JFFD 4OIAA 1NKRA 5FYKH 4P5KB 5BV7C 1NBVH 4BZ1H 1PYWB 2GCYA 2EIZB 2ITCA 4G43B 3SCMD 1I1FB 3GJFH 2X05A 1KENH 5GS1C 5HI5C 3LV3A 3P73A 1F58H 4TYUA 1C7TA 4NKDA 4PJ9A 5D2LB 3BAEH 4FTVB 5FYJL 1IM3A 4U31A 1NC4A 5BCAA 3DVNB 3MCG1 4ZS7H 3CU7A 3RKDD 1IAIM 3GMNB 3D3VD 3I6LE 5DJXB 1INQB 4L9LA 4P49A 1OWWA 5D1QB 2OL3A 3VCLB 2D7TH 4JAMA 1H0DA 3D0LA 3O2VL 3DSNA 1A0QL 3TPUB 3EW3B 4FQJH 1HHKA 4JQXC 5E6IB 3K8MA 5I75C 1Z3GL 3OMZA 2HG5A 2X89D 4MS8C 4OZ4A 4DFIA 1H3GA 2P5EB 2NY3C 3EYQC 5H94A 5I66A 5DJ0A 4RNRB 1Z9SA 2GK0A 5F1KC 1XIWD 4UQ2A 2FJHA 4Y19D 4JFDA 5MERB 1J8HB 3MRJB 3UC0H 4U0QB 2AAVA 5E0QA 3U83A 5DQJA 1FFNA 4TNVK 4YNYA 1YY9C 2XICA 4YHZH 1FBIL 5IMLA 5C0DB 5C1MB 2YSSB 3BKJL 5DK2B 1II4E 1FL3B 1KGCD 2IG2L 3MJ9H 3KPPA 4DVBB 5HVWA 1TJGL 1NCDL 3BP7A 3MGOB 3QRFM 3NCYP 3C8DA 2IBZY 2DI9A 4GUPA 2NXYB 4P3CL 3ARGB 1X5JA 3RWJA 2OCFD 4LFHG 5I9QB 3SDDD 1CF8H 5JQ6H 1G7HA 2EO1A 2XWTB 4Y4HD 1A6PA 1F3JB 2PYED 4KKLD 2Z35B 4ZD3H 1VFAB 2YWYA 3Q6GH 2VL5A 1MLBA 4P2QA 35C8H 5E08L 3HI5H 1PJ9A 2DQFB 4WRLA 5DZLA 4ZPVB 5C0FB 3VXPB 4DZBB 1CU4L 5D96B 4P4RB 3KPNB 1JPSL 3EJYC 4ZUVA 1B4JH 1GGBH 2AP2A 3KR3L 1URLA 2PYFB 3GM8A 5DC4B 4LPUA 2ICEA 5IT2L 4DCQA 3E0GA 4HGWA 3HI6H 1E6OL 2QLVB 3AAZA 3TO4C 3P11L 4H0IA 4MNGA 1J86A 4Y4KD 4NGHL 2ZJSH 2YKLL 5FKPA 3FOLA 5C0EB 4LPTA 2PO6D 4ODBD 4ZTPL 4H8WH 1RZKH 5MEQB 1KCRL 2PCPA 4X7SH 2NY1D 5B39G 2BSSB 5GS2D 4KH2A 4FN0A 2XKUA 4LSTL 5BV7B 5SWQB 4PJ5E 5H35A 2VIRB 4GW5B 4TUOA 1CFNB 1A6TB 5CJQL 1GGTA 3QQ3B 3V6BR 1MLCA 3O3AB 4PJDE 3DX6B 2NW2B 5GS1B 3RNQB 5I18L 3RL1B 2FB4H 5HBBA 2X4SA 2EDFA 3FAXA 1AGCA 1NQBA 4JPKH 5I16A 1DEDA 3KPOB 5KW9L 3BDYH 4LSSL 1VADB 4OI7A 2DQHL 5C0CD 3S5LG 3QHTC 4CADA 1MFDH 2ADFL 3TT3L 5DS8B 4KJPD 4MHHG 4JPIA 2A6DA 1E6JH 3C9NA 1TITA 4PRIB 4UV4L 5GQBA 2ATPB 4NUGL 5BQ7B 2WV3A 3C5JA 2HN7A 1GZPA 1MAKA 3MOAH 1XF3B 2OZ4H 1NEZA 4M1GH 4BH7B 3CSBA 2E8YA 1U8JA 4ZDHB 5I75B 3BIBX 1AGDB 3VW3L 3LZFH 4NQVB 1B2WL 3IAPA 3KXFB 1AD0A 2EZ0D 2DIJA 1CGXA 3HKFA 4L8DA 4M3JA 4PJGF 2NY3B 4LCWB 1OGTB 4XI5D 1ZEAL 4OM0H 3V6FB 5E2TH 3RGHA 5DRZA 4PGBB 4D0CB 2Y5TB 3ARVA 2HYMA 4TVPD 2DMKA 1GGIL 1CLOH 4HV8B 4M43L 3Q5OA 3KNBB 3SGJC 3L3JB 4XNQA 1JI1A 3LQAC 1KLGB 3QUYC 3I6LD 4Z0XA 5IBTL 1U8HA 4YDJA 4F7EA 3HZYA 3EO1A 5DSCB 2ZNXA 2MCPH 4PJGB 4OLUH 1FDLH 5SWSB 4R90H 2Z0BA 4PG9B 5IK3A 1SJEB 2IADA 5DHYA 4X99B 1M05B 4AEHL 3OSKA 4EIGB 4H25B 4AH2A 5GGUB 1EDQA 1YY8B 3EBAA 2IMNA 2XZCL 4X7FC 3VWKD 2Z92A 3X3FH 1K2DA 4O2FB 3GSNB 1RZ8A 3H7BB 1QYGH 3TP4A 2BVTA 2FD6L 1YYLL 3U0WH 2C3GA 5DQDL 3ZDYF 3CCHB 1ZA6A 1F45A 1EBPA 4IBLT 4A6YH 3RY6A 1YMHB 5EU7C 3LS5L 4X5WA 2G60L 4DKEH 4DVRL 2C3WA 3QFJB 4BM7A 5IHZB 3FQUB 3GMOA 1VB9A 2V2WA 1VA9A 2YMXH 3CC5B 4N8VG 1F13A 2P5WB 4KI5E 5DT1H 3VD4A 3VG0L 3RIAK 3U79A 4U1NB 3T1FA 4Z7WA 2LU4A 2I26N 2GJZB 1MVUA 3RX7A 2DQUL 4BFIA 3IDUA 5T5NF 3TO4B 5BVPL 3MXVH 1IAOB 5EH1A 1HHIB 3QNXB 4WHYG 4G8FB 4N9GA 2GK2A 3BD5A 4MWFB 3PHSA 3QPXH 1JFQL 4N68A 1DLFL 1HWHB 1IAMA 1UC6A 5E6ZA 1S5IL 2ICWA 3K2MC 3MGAA 3SKJL 2IFGA 4ALAL 2ZG3A 3FO2A 1DSFH 1KNOB 5F6HI 1J9CT 1D9KD 1Z3GH 4U1SB 3KPLA 2FECI 4ODUB 5TDNA 2A6JA 4ONOA 4F15C 5E8OB 1MJ7L 4XZUB 3SDYH 5I1JL 3RVTC 1FZJA 3FB8B 1NMBL 4JO4L 5MP6L 3SKOA 3HMWL 2XTJC 5ICZB 3C60A 2VXQL 2ED7A 3D18B 2YRLA 4FQXA 3MJGX 2NX5A 2GITB 3A67L 3I3DA 4OGZA 4GO6B 4Z7OE 4X6DF 3NA9L 3VWJC 1PVHA 1T1ZB 2L7JA 5TPWL 4P9HH 3WEXA 1L0XA 3RZCB 2VITB 4ZFOL 1QSEA 1ZT1A 5J3HD 4JDZA 4WU5B 1L7TL 2B39A 3DX7B 2VLKD 4HIHA 4HWBL 5EZLB 3BJ91 2H2PC 5E95B 3M1BA 1KEML 4HQQL 1UQSB 4MJ2A 8FABB 3QXDA 5AZ2H 1YUHA 4PJ5D 2GTWA 1NGQL 3EYUH 1J5OL 1NANI 2EXYC 1SM3L 4JKWA 4X6DB 1AKJD 1G6VK 1NFDF 4UDUB 3G6JF 1N59A 4Y5XC 4HS6A 1FO0H 1D5BB 3ARWA 1OF2B 2A77H 3BZDA 3CAFA 5CEXA 3I6GB 1A3RH 4NQSA 3LEVH 3QUYB 1AO7B 4XBEL 4FFWC 5C7XL 1QLEL 1R24A 5T1LA 2HJKB 3WFEL 4ZNCD 3IFNL 4I0PC 2X7LB 1A02N 4MQXC 1NFDB 1CU4H 4K3GA 1NDMB 1TETH 2V17L 1RIHL 4LPXA 4PJEF 4AG4H 4UIMA 3KR3H 4IDJL 3VFUB 1HQRB 3KPMB 3N50A 3P4OB 5FO7A 4N0YH 4MZ2A 1P2CB 5EO0B 1G7LB 5D7SL 4JM2C 1UM6H 3DROA 2XG4A 2F19H 4WO4A 4P57B 4LLYA 1NFIB 5IB1A 4ZTPH 4Z7VA 3K74B 4IMKA 3W81A 2R4RH 4JFFA 1KCRH 1HXMA 4UZGA 4PJEB 4LSTH 1HINL 3S4SG 4U7KA 3SCMA 1T3FA 3FFCB 4YDVA 1J0HA 2YPKB 5CJQH 3HFML 2EYTB 3LEYL 2P4AB 4JN1L 3KPSB 1CXKA 4U1MA 1TZIA 3NCCB 4ZOBA 5D5MB 3MLVH 1HCVA 3D3VA 2HJLB 5KW9H 3BP6B 4LSSH 3D0VA 4LAQH 3K7UA 1A6UL 3KYOA 2ADFH 4H26A 4JCLA 4ZTOL 1U91A 5K9KA 4N90D 1YNKL 4WHYH 5DUBB 4I2XA 1K6QL 2CRZA 3GSRA 3FO1B 1U92A 3X11A 2X89A 3KVQA 1S7WB 1FE8L 4CU6A 2QKIA 3QWQB 3MV8B 4KAQL 3I75B 1I8LA 4F15B 4HFWA 5DZOA 4C56B 1LP9A 4Y19A 4KI5D 2CIKB 1QFHA 5FCUL 4RZCB 5ILTL 2FGZA 4LSVL 3O9WD 3PIQA 2XTJB 1IC7H 5JZ7D 3WN5C 1D6VH 3QCVL 5IBTH 3K81A 5CKGA 3VWJB 1CFTA 4HDIA 1MRCL 4HKBB 4DOHE 5ITBL 2GUOA 3CFIC 4Y2DB 4F9PC 1DBJL 1OSPH 3N9GL 4LBEB 2JIXD 1WTGT 3BKYL 4JKKA 5IGXL 3H7LA 2AQ2A 1RUMH 4Z95H 4HX1B 4BELD 2XNAB 3SDDA 4WI9A 4PJBE 3ECBA 4M48H 3A0OA 4F7CB 2YZ8A 4UT7H 4Y4HA 4I3SH 4Y5XB 4MXQD 4ISVB 5C2BH 2HT4C 2PYEA 3RNKB 4P4KC 1CXIA 3VXNA 3VH8A 3V8OA 4AMKH 1WCBB 1FV1B 2Y5EA 4X98B 1IFHH 1V3MA 3FTGA 4HUNB 5EOTA 4Z7UF 4JM2F 2XZAL 1OAXH 4QWWC 3KDMB 2IBBA 3QUZA 5T33L 1K3ZA 5EOQL 4HLZH 3GSNL 4NP4L 2NW3B 3JVGA 3H3PH 4FQCL 4LSRL 4LEOA 4M7KL 4YUEL 3QI9C 1BVKB 4RAUA 1WWBX 4QRRB 4GRWF 1U6AL 1U3HC 4NNPH 4X4MA 4Z7UB 4JM2B 2EDDA 3CXHK 5DVLA 2PO6A 1S9XB 4OV5B 2QQKL 3FJTA 1RUKH 3DBXB 2HFEB 1MREL 4ZUTB 3TGXA 4EZMA 1WZKA 5KZCB 1DDHA 2VL4A 4YXKH 4PJHA 4D2NA 3SKJH 2EDEA 3U9UA 3KYKL 4ALAH 2BRRL 1IEBA 4HS8L 1TTFA 1WFNA 3U36A 4J8RA 2AVGA 1C5BL 2O61A 4JY6A 3K80A 3IRPX 1BX2A 3HRZB 1TZGL 2NR6C 2Z93A 1QRNE 1NFKA 1V7MH 4NYLA 1MJ7H 2Z4QB 3ARTA 5E99L 2ORBL 4GKOA 4X0KA 1KB9K 1XF4A 4OD1L 5D8JH 3RVWD 1S9WA 4XCEA 2VXQH 2J8OA 5EBMB 1MCIA 1YN6B 2VMFA 3K3QA 3G6AB 3AB0C 1FZMA 3PQYD 3QIUD 4GAJH 1C8PA 3RBSA 3NA9H 3D6GA 3HI1B 1NDGA 1CDBA 4M6OL 2W9LA 5KVEL 1E4JA 4Z7QE 4OZGA 2W9DL 2VWEC 3SKMA 1XCQB 3NCEB 1KEMH 1RIVH 4JZOB 1QOKA 3QEUB 3QHZH 3KLAB 1KIQA 1OAZH 5BO1L 2VXVH 4M9OA 4FABL 2YZ1A 1SM3H 1Q9OB 2I60H 1CIDA 4GRLC 4JFXB 4K2UH 4QEGA 5FYKE 1OP3H 1ZHKA 3QFDB 1HIMH 1UZ8A 5I30L 3VMOA 2C26A 3WN5B 5DMKA 4M61A 4KTYA 2B20A 4XBEH 2C7UB 5I8OL 3WFHA 5C7XH 4UOJA 3P9LB 2GTZA 3OGCA 3EFFB 4M5ZH 1UWXK 1XR9B 3SJVE 4NQTA 1NH6A 1KIPA 4FS0A 3K4ZA 5JDJA 2O5ZL 1ZS8A 1FLRL 1T0MB 1KTKE 3QZWB 3MOQA 2HFGL 2XA3A 1EO8L 3I9GH 4QGYA 2VAAA 5C6PB 4NO3A 3VWKA 4FQIH 4WUKL 3TA3C 3BZEA 3DI3B 1OT2A 5D7SH 1MCNA 3IDNB 4W6XB 1ODAA 4NC1C 1JHKH 2F8VA 3ARBC 1AGEB 5FYLH 2IGFH 3VFMB 4P4KB 4HUUB 2RGSA 3D39B 2FX8H 3REWB 3ZKQD 5FO9B 4GG8A 1AXSB 4AEIH 3K4DA 4HMCA 2MQCA 4BKLA 2LV4A 5D6DA 3GRWL 1J0YA 4GOSA 1ZANH 5AYUL 3MUGB 3ET9F 5FFLA 2D7OA 4JN2A 1A47A 4UB0H 5TDPB 1E4WH 3DX8A 3AVEA 3MFFB 3TF7C 3QI9B 4V2BA 4HIXH 4TULH 4HF5L 5DYOA 1EHLL 1ORSB 3RBGA 1U3HB 2B2XL 2FEEI 5E8PA 3WNLA 1MWAB 1J0ZA 1EEZA 4KVNH 4MCYB 1ZWIB 1YNKH 1LEKA 4KTDH 3BP5A 1N5AB 3LQZB 3IXTA 5M94B 4G6FD 5LKNA 1D9KA 1T1XB 3OXRB 5F96H 3FO0H 3LPWA 3QWOA 2R0WL 5F7KC 5HHQB 4M02A 4JPVH 4PJ7E 2XYCA 5KS9A 4QHMB 4U33A 5GGSY 4PB0L 4FQ2L 5KN5A 2ZPKH 1N0LA 5CJOH 1D6EA 5FCUH 3ZL4L 3X14B 5IB5A 4LSVH 1JWMA 3H9YA 3QO1B 3O2WL 3KYNB 5ICXA 1E28B 4TN9A 3VXMB 4PRNA 3QCVH 1H9VA 3AB0B 1P53A 3HS0B 4HULB 1FYHB 4JQIH 3DHMA 4LLWB 3X12B 4FQPA 5ITBH 4NQXB 4PJ9C 5E5MB 3N9GH 2VLKA 3OTTA 2R1XB 4XHQA 2DQIH 3MRQA 2CO7B 4OLWL 1NCTA 4PJ5A 5EZIH 3TBWA 3DX9A 4L9LC 4G6AD 1MNUL 1AKJA 1NGXA 1NGWA 4X6EA 2NMSA 5HHNB 1I7TA 1QRND 2A1WH 1AQDA 4GRLB 4XX1E 4N5ED 4GW1B 3S96A 4XVTH 1Q38A 2W0PA 1NLBL 1K3IA 4XVJH 4KFZC 1U8QA 2XZAH 3EYFA 5T33H 4RMQA 2E3VA 3CVIH 5EOQH 3V52L 4WWKC 4TRPL 4NP4H 3W0WB 3T0VA 4LSRH 1VACB 3BESR 3SKNB 2FBJH 4JVWA 3UTTB 3VFTA 2MJWA 1FNHA 2QQNH 4WTXA 4NKOB 3TA3B 4UIKH 4QHUB 4DGVH 3S36X 5EO9B 3DO3A 4XAWL 3HUJE 2BCKB 3T2NH 4JKPL 3L1OL 3C6LD 2MHAB 3DRQB 3DGGA 5FYKD 3ARBB 3V0VB 3V5HB 1CLZH 1MREH 5B8CB 5MENE 1GOFA 3BN3B 5F3HB 1BQLL 1PEWA 4YHIB 4Z7NE 5FGCE 5KSBF 3CMOH 1NCWH 3SJVD 1CR9H 4LP4A 1MHEB 1UEYA 2GI7A 3CLEL 5J6HA 2IAMD 1ZGLP 3BO8A 2APWA 4D94A 5HYQA 1CG9A 2ORBH 5TE7H 2HTLD 4OD1H 1I1YA 1Q9WB 5F6HJ 3JTTA 1SVCP 3FN9A 4OKVA 4ZFZB 3VI4F 3MUHL 3EYOA 3I02B 2M26A 3TFKD 2JCCF 4LCUA 4OT1H 5KSBB 1EVUA 2FO4B 5B38G 5C0IA 2R1YA 3ZE0F 4XNXL 1MCBA 1WFTA 5HHMB 4EDXA 3WNNA 4LHUB 1F6LL 1R5VB 3VXRD 2W60B 2DTML 5AAMA 4V1DE 5E2UL 3MRIB 4RAHA 4RFNC 5JPMB 4LPYA 3EFDL 3T04D 4JRYB 1LNUA 4S11A 2JCCB 1HCFX 3O9WA 1PDKA 3MNZA 2VZVA 1JK8A 3WXVH 5E7BA 1CE6A 1GC1H 1T1YB 3HZMA 1ZVHA 5I30H 2O93L 1NCUA 5I2IB 2ITCB 3TJHD 4MA7L 5JXAL 2A83A 5I8OH 4QY8B 1G9MH 4JREC 3LV3B 2FWOA 2Y6SC 2ZSVA 2JIXA 3P73B 1JZ3A 2F74A 2LVCA 5FYJE 3MJ6A 3HG1E 1QA9A 4NKDB 4PJ9B 3UTSB 1IAKB 1TLKA 5DJ2A 1IM3B 1S7VB 2BSTA 1DBMH 2VDOH 1FZOA 1NC4B 5I76A 2WM0A 3QUMA 4D0DA 4G9FE 5JO5A 4WI7A 1BOYA 1HN1A 1EO8H 4L9LB 2OL3B 4Q9RL 1KSRA 3MZGB 3O6ML 4QOKE 4B5EA 4JAMB 1JZ5A 3HMXL 1KOAA 1H0DB 5GGTH 3D0LB 3S3JA 3GSVA 2B1HL 1BP3B 4XXDA 2COQA 3GSQA 3JWDH 2VISA 5DMIH 1HHKB 3K4AA 6CGTA 5JR1L 2HG5B 5BOPA 4OZ4B 1FFQA 1FNSL 4Y7MA 5H94B 5I66B 1QBLL 5DJ0B 2GK0B 1JWSA 1BM3H 4JZJA 2FLRT 3MV9E 4UQ2B 1HKFA 2G9HA 3IU4H 4HXBH 2FJHB 2IANB 4I3RH 4JFDB 1KULA 4L4TE 2R56L 3U30C 3GBML 3ESVF 2FGWH 5DQJB 1FFNB 1MH5A 2HKFL 4YNYB 1QFWL 1G7QA 5AWNH 1Z2KA 3WNOA 1T0NA 5IMLB 3WUWG 2W91A 4BZ2L 1H8OA 2CLZA 2SEBA 3VFNA 2ADJA 2XKNA 2FHFA 1AI1L 1PX3A 3BIKA 5LGJA 3KPPB 1SY6L 4POZD 3BP7B 1IKFL 3KHOA 1O5DT 4GUPB 3NTCH 1G6RH 5E56A 1X3DA 3MXWL 1S7XA 3RWJB 2VXTH 3L5IA 2G75A 2VYRE 2R0WH 4WV1A 4OLVL 2L7UA 1E0OB 1WBZB 5IQ9A 3OKLA 2H26A 1G7HB 4P59L 1CD0A 3N0PB 5KAQG 5DA0B 5LAXB 2R2HB 2NYYC 4UT6L 3QB7C 3RY6C 2VL5B 1MLBB 2IH1A 4Q0XH 5HHOE 4P2QB 3O2WH 1PAMA 3PQYA 3QIUA 5CBAA 4M5YH 4R4NC 3DPBA 1W8OA 5GS0C 1G9NH 1VFBA 4RAVA 4U1JA 3V4UH 2R8SL 3VD5A 1MEXH 4IHOA 4ZUVB 2DM2A 3C87A 2AJUH 4YPJA 2IEPA 5KVDL 2ICEB 3BMVA 2BRQA 4DCQB 2XXMB 4XWOD 4HGWB 5MEND 3AAZB 1J87A 4ZFFA 1KCVL 1A9BA 1D5IL 3QEQA 1RD6A 4MNGB 5KVGL 4RFNB 3IDXL 1I8MA 5FKPB 3FOLB 1Y6NR 4YQXH 4MYWB 3PNWA 2GQHA 4ZPTA 1FGVH 3ZE1E 3A6CL 3QZWG 2NY4D 2PCPB 3OV6A 1TJIH 3LRHA 4G6KL 5FV1L 1S9YA 1OM3H 2BVPA 5INCA 1Q8MA 4TUOB 3SY0A 4OCNC 1MLCB 4JREB 4WCYL 3BUTA 3MRRA 1AE6L 1UB5B 1DQQA 4IOSD 1AY1L 1WBYA 4HC1A 2X4SB 1AGCB 4YC2C 4YXLH 3OAZH 2W59A 5I16B 3C60C 4FQXC 1HQ4A 4WU7A 2CR3A 1RUAH 5FGSA 5DFWH 1LK3L 2VDNH 1QBML 4LFHD 1MI5D 2EDTA 4JPIB 2A6DB 3C9NB 4OZFH 1A1OA 4TSBH 4XAWH 3EIFA 3RIFF 5LJYH 1QFWM 5I8EA 4R8WL 1Q9LA 3CVHA 5DRWA 5GJSL 3C5JB 2HN7B 4LCYA 1GZPB 3V7AG 4Y5YA 1NEZB 4P2RE 3INUL 1TVBA 3QQ4A 1U8JB 4L4JA 3OX8A 3RP1A 1AD0B 4L8DB 4Z0BH 5GGVH 1JF6A 2A74A 1IQWL 5DRZB 5FYJD 3K46A 2ARWA 5CEYA 3IAGC 4O51A 2YPLE 4NZJA 4JM4H 4Z6AT 3CLEH 5L2JA 3HC3H 4XNQB 3U30B 5E1AA 4P46D 4N1CA 4G9FD 5GXBB 5M95B 4OGXL 4HCRH 4Z0XB 2NNAA 4E42A 3GBNL 1U8HB 4YDJB 2B7DT 3WO3B 1NCBH 3NACL 4F7EB 3O6FA 3NCYS 3HZYB 5TF1L 3EO1B 1JRHL 1ED3A 2RR3A 3GO1H 4UV7H 5IK3B 1OL0A 2IADB 3U7YH 1HI6A 5GPRA 5DHYB 4OZHE 1MELA 1QACA 1ITCA 1MVFA 5F7HA 2Z92B 1BIIA 1K2DB 4MJ6A 1RZ8B 1U9KA 4WO4C 5DQ9A 2DJ4A 2X6MA 1I9JL 3EFDH 5HDQH 3UO1L 4Z7WF 4YBLC 5EZOH 4UTAL 5LGHL 4L4TD 4IMKC 5HTSA 1ZA6B 2CKBL 4X5WB 3U0TA 3IYLW 3SCMC 2FX9H 3GMOB 4HK0A 2OK0L 3MRFA 3HAEH 2X4RA 5DWUH 5CBEA 3TBTA 5GSVA 1YEGL 2Y4SA 1EA9C 1YEKL 1AGBA 3DLQR 1LD9A 2KH2B 3L3GB 3T1FB 3GUTA 4Z7WB 1KN2H 4G7VL 3RKDC 5ID1A 1KELH 1MVUB 4YBQD 5FA3A 4BFIB 4K8RH 4HLJA 3VRLF 2AEIT 1BFVL 1OPGH 4N9GB 2VRAA 3LHPH 1FRGL 1QRNA 4POUB 5HYIA 2EDLA 1BQHG 4LVEA 5T1MA 4KDVA 3HMXH 1QSFE 3QDHA 4WEUD 2ICWB 2H41A 1KC5L 3BFOA 5HHOD 3FO2B 3R1GH 3JZ7A 2HJFA 2QQQA 2X70A 3KPLB 2K7QA 1TVDA 2D0HA 5TDNB 3WIHH 1I8LC 2A6JB 1X6NA 4H5SA 3LKSA 1MPAL 3B3IA 4KV5E 5L8KB 1J1PL 1UWEH 3U82B 4YHNA 1FZJB 4OB5H 4YC2B 3SKOB 4XPGH 4ZUWA 4AT6A 3C60B 5I1CL 5JW4N 3WXWH 4FQXB 3VRJA 2NX5B 3BUYA 4GLRH 2EEAA 3ULVL 2HKFH 1T5WA 1FL5A 2R29H 1XCTA 1A4KA 3BD3A 3WEXB 4MCZA 3C6LA 5JW4R 3DOSA 1ADQA 3CX5K 1QSEB 1ZT1B 4JDZB 2J8HA 4JRWA 1AI1H 2W0FA 4HIHB 3U48A 3SEPA 2RHEA 3M1BB 5DD3H 1IKFH 9CGTA 2VLLA 1NSNL 3QXDB 1YUHB 4QNPF 4EXPX 2GTWB 3B6SA 3MXWH 1UJTA 1B6UA 3SDDC 2EC9T 2OTWA 3SJVA 2IPTH 4TQEL 1NLDL 2A6KA 4PJXE 4Y4HC 1NL0L 3WKML 3WS3A 1CGSH 3ZHLA 1N59B 5GRZA 2IAMA 5INDA 4HS6B 4KKLC 3GSUA 1A9EA 1BQSA 4FZEL 5CEXB 2C4FU 4UT6H 4NQSB 1QR4A 3FHAA 1I4FA 1F2QA 1MCPL 1J8KA 1F11A 5JHDE 4DAGH 3FO9A 1R24B 3QUZC 5T1LB 1T7VA 1DE4A 3LKQA 4Z7VF 5MHSD 3BSZL 4TSCH 3JVGC 1CGVA 5KBNC 1FPTL 3IDMA 1NCCH 4UIMB 4P2RD 3VGAC 4W4NA 3VXRA 3EO9L 5E03A 5FO7B 3BMWA 1CWVA 4BK5A 1X5KA 3GDBA 3DROB 4CMMB 1KJ2H 4WO4B 4GQ9L 2PO6C 4HH8A 5I8CA 4H1LH 4Q74A 4LLYB 1FORL 1Y6MR 5IB1B 2YPLD 4K94L 4Z7VB 5IQ7H 2BVUA 3A6CH 4JFFB 1HXMB 1IE5A 3MJ9A 2D3VA 3QHFL 3B2UD 1T3FB 3SCMB 4YDVB 3NIGE 5KSVA 3LCYA 4WCYH 3PHOA 5E1HB 1ZLVH 4YHYC 3UBXI 1UACL 3EDDA 1KFAL 1TZIB 4JVUA 4U1MB 3S36L 3NIFE 1CDGA 3O4OB 3QDJD 1PSKH 4O02H 3D3VB 2JB6A 1RQ5A 4KJPC 3KYOB 1LP9F 5JW3H 1ND0A 1U91B 4WW1A 5K9KB 5TJWK 4KQ4L 4WFFE 3EAKA 3OZ9L 1H3XA 3NBNA 2BNRD 4R8WH 2ZKHL 3BEWA 1N2RA 1T2XA 4I2XB 2DLHA 3GSRB 1NUFA 1U92B 3X11B 2EZ0C 1CLYL 1A3QA 3FHQA 4OZIE 4XI5C 4NNXA 2BJMH 1NCNA 2QKIB 4LASH 5C0RL 2HMID 1XIWB 3NAAL 3O8XD 4HFWB 1LP9B 3VA6A 1IQWH 4Y19B 5K59F 4NRXA 4RMWA 1X5FA 1IGIL 3PIQB 4LCIH 3OHXA 1ZAGA 4IRZH 3FB5A 4U0RC 1NC2D 3RIFK 1RJZA 1CFTB 4HDIB 2X9YA 2F8XC 1JPFA 2GUOB 2NY5C 1QSFD 4J3SA 2OR7A 5TE4H 4XCCH 5ECJE 3GNML 3KPTA 4U6VL 3VWKC 2A2QT 3HE6D 3TYFA 5CJBA 3SDDB 1YQ2A 1S8DA 1XGUB 3ECBB 4R9HA 4Y4HB 1F42A 5I1GL 1BZ9A 3OJVC 2VQ1A 2PYEB 1YEEH 2Y07L 3VXNB 3VH8B 1OY3B 32C2A 1RURL 3O6LL 3CSGA 3FTGB 5EOTB 4NT6A 2CKBH 2VLRD 3ZO0A 4LARL 5D6DC 4JPWH 2OZ4A 3MRLA 3QEGH 2P43B 4OUUA 3JUZA 5FF6A 5HY9A 1YEGH 4CNIA 1HOCA 2JELH 2MPAL 4LEOB 1YEKH 4NOFA 1JGLH 4J2XA 5MENA 3VGAB 2VKXA 3MLZL 4RAUB 1F5WA 1N5YL 5ICYA 4RMSA 2DQGH 3HNVL 2XXCB 4Y4KB 1MFBH 4FP8H 1FNFA 4OBSA 2QSVA 2PO6B 5HYJE 3T3ME 1RV6X 4XPTL 4ESKA 3AM8A 2NY1B 1U36A 3NGBC 1WV7T 1P7KA 2QL1A 5CZKA 1DDHB 3ZE2E 3X13A 4PJHB 3U9UB 1D9KC 1IEBB 3U36B 4J8RB 4R26L 2UZIL 3HC4H 1UKQA 3LH2L 1PG7X 3EYSL 2O61B 3MLYH 1BX2B 2Z93B 1KTRL 4NQDE 1NEZG 4NYLB 1A14L 4YHYB 4JRXE 5IB3A 2D9CA 4Z8FL 1EUUA 5CD5D 3EGSB 4X0KB 3UJJH 1XF4B 5CINH 4OQTL 2VJXA 3MROA 4XCEB 5I1CH 5C0CB 4IM8A 3T8XA 5E2WL 1FZMB 1MI5A 4JFPA 1J1XH 4A6YA 2R23A 5HXMA 4GSDL 5J3HC 1PGRB 3P0YH 5E8EA 3AS3A 2YA1A 4OZGB 5DUPH 2J2ZA 1RZ7L 4KI1A 4OTXL 4RWYH 5GRVK 3SKMB 1T0PB 3BGMA 1GAFH 1KIQB 3VI3F 1BFSA 3PL6D 3GKZA 3JV4A 3CLFH 3DV4A 4O5LH 1NGPH 2DQJL 4TQEH 3QNZA 1FJ1A 1NLDH 1NL0H 1WF5A 2ZG2A 4Z9KB 4NFDA 1ZHKB 4WFGE 1UZ8B 4P46A 3OKOA 4G9FA 4GAGL 4LSPL 5DMKB 2OTUA 4JFEE 2X4TA 4ZUUA 1DEEA 4U0RB 1MCPH 4YHKL 3WFHB 1AH1A 2GTZB 3OGCB 4LLDA 4NOBA 4WFFD 2WUBH 3MR9A 5HGBA 4PJCA 1KIPB 5I1AA 1ZS8B 1DFBH 5B39A 5EU3A 2VAAB 4KQ3H 1OAYH 4NO3B 3VWKB 4LLQA 3BZEB 2K1MA 3ARQA 2FJGA 5AZEH 3NCFB 2E7HA 4HSQA 3CX5J 3DURA 1QTYT 4L4TA 2X2YA 5IHUH 3QDMD 4M8QA 4CMHB 3LRSA 1WWCA 3G9VA 4GG8B 4R4BA 5A3ID 5IMKA 3S5LA 2FATL 4BKLB 3MFGB 5MEPA 1JZ4A 4OJFL 4JFZL 2X4NA 4HWUA 4POYA 2FNBA 5FHBL 1HEZA 4JN2B 3MRMA 4KROD 1UACH 3DX8B 1KFAH 3PJSA 4N0FA 1MRDH 1JIBA 5DYOB 5ESQA 4LCCA 4NJ9H 4LRNL 4O58H 1DQMH 4QGTA 3IGAA 5EPMA 5KS9F 5E8PB 3B9VA 2Y25A 4S1SH 4GT7A 1EEZB 4QYOA 1IT9L 1LEKB 3RQ3A 3IDGA 3NGBB 3BP5B 4PBXA 5HHOA 2ZKHH 3IXTB 4RSVA 1D9KB 3RY4A 2BSRA 2MSPA 3QWOB 1OHQA 1UM4L 2EH8H 5KS9B 3FT2B 4TTGA 4PBWD 2LQRA 1VFMA 2R2EA 3MREA 4KI5C 3ULUL 5KN5B 2GIYA 3O9WC 1INEH 1D6EB 3D25A 2R0LH 5IB5B 1JWMB 2OJZL 4WEBL 4HG4K 4X7TA 3BOVA 2ZWLT 5ICXB 4PRNB 4YDLC 2EDKA 1KTLA 3B4NA 2KKQA 5HYJD 4Z78A 5FIEA 5HDOA 3P0GB 1LO2H 2VLKB 4EI5D 1T03H 3UZEA 1A7OL 1CDJA 3MLSH 4X80H 1SJXA 4GKSA 2P8LA 4PJ5B 1AGFB 3S88L 3FONA 3TBYA 4U6VH 3TBWB 3DX9B 5DD0H 3ZDXE 3BKCL 1AKJB 1NGXB 1NGWB 4FQHA 4X6EB 4D9QD 3OPZL 1I7TB 4MXQC 1A21A 4TPRH 1CFQA 2XWBA 1AQDB 1ZLWK 4NQDD 4N8VA 4JRXD 3HB3D 4Q2ZA 3S96B 4BUHA 1RZJC 1INDH 3VD9A 5CZVH 4G3YH 1WC7A 2B0SH 3ZT7A 2ADIA 2CQVA 3ARDD 1U8QB 4Q58C 4HKJA 3EYFB 4LARH 4K23H 5DHVH 5K9OA 2HLAA 4JZJC 2VDQL 4PRHE 1MFCH 1LDPL 4P2RA 2A6IA 1UCBH 3VFTB 3QP3A 3QXUA 3MLZH 1NGZA 4Z76A 1N5YH 2DLFH 3HNVH 5T3XH 4LQFL 3WHE0 5EU6D 2YPLA 1U8KA 3IDIA 4XPTH 4WFGD 5GJTH 2CRMA 4MDIA 2A9ML 2E7CA 4NRZA 1WISA 2AEWA 1VERA 3Q6FA 1Q0YH 4OLZL 3DXAD 5E7FA 5GGQH 3SOBL 4R7NA 4YDIH 1JTTA 5I1KL 5CSZA 4LNVA 3TLRA 1RPQA 4WV1C 4CUCA 3RUGE 3EYSH 3TESA 4KVCL 5J6HB 4QTHA 4OZHA 1A14H 3BO8B 3LPGA 3RVWC 3QDJA 1CG9B 4Z8FH 1WZ1L 4KC3B 2Z8VC 1RULL 4HK3N 2WW8A 3JTTB 3QIUC 4OKVB 2W1NA 1S78D 4N9OB 5SV4A 3BX7C 4KI5F 3EYOB 3CDYA 1Q1JL 4M7LL 4OKDA 4LCUB 3GKWL 2BNRA 1X44A 5C0IB 4JR9H 5BV7H 2R1YB 1OAQH 4Y1AE 1JPTL 4JE4B 4N8PA 5FUZH 4EDXB 1PY9A 3HZKA 3ETBF 5DK0A 5C0AE 5TH2A 4KHXL 5EU4A 2BFVH 2P8PA 2I25N 3O8XA 5T1DL 5L6YL 2HKHH 1NMCC 4CDHA 1LNUB 2DQJH 4S1QH 4IRSA 1G84A 2DYPD 3GSXA 3O9WB 2YRPA 1UYWL 3MNZB 1JK8B 4P5KA 4GS7C 3LY6A 5ANME 1CE6B 1MFAH 2GJ6E 3HZMB 3QUKB 1JGUL 1UEMA 4LSPH 1NC2A 2WNGA 3LDBC 5I8KH 3ES6A 2VDPL 4YHKH 4YDLB 2A83B 1GPOL 1X7QA 5JPNA 1MAML 5CJ8A 2FWOB 1LO0L 3IFPB 2ZSVB 1QSFA 2JIXB 3FN0L 2F74B 5DO2D 1QA9B 3PWPE 5BZDA 2V5RA 1M1SA 4OCRH 5DJ2B 2BSTB 2X1OA 1FZOB 2HT3D 5I76B 1KLUA 3QUMB 4D0DB 5JO5B 4GW4A 4MJIE 3QISA 2YC1A 1SYVA 3HE6A 3S4SA 4OQ1A 1UB6A 2DBLH 2VZ3A 1J18A 4Y16C 4K3DL 3ZKMD 3GSVB 4TTDD 1A7QL 1A7PL 1CQYA 4Y5YC 5BMFH 1VESA 4XXDB 2IFFL 3GSQB 2VISB 2X4OA 4X8JA 1WGOA 2VLRA 1IGTA 5A2IH 3W9DA 3HN3A 4RNRA 4ZFOA 1LGVA 2O5YH 4HXAL 4W68A 3B9KD 4HWBA 1JWSB 4I18A 4XPAL 2E9JA 4LLMA 4JZJB 3WL9A 2G9HB 3HNSH 3CD4A 5HGAA 4JFZH 3OKKA 1KYOJ 5FHBH 1JYXA 3OKNA 2OR9H 1MH5B 3L5JA 4DTGL 4E9LA 1G7QB 1T0NB 4G5ZH 3O6FC 2CLZB 2SEBB 3VFNB 2ADJB 4F9LC 2XKNB 5D9SA 4MD5A 1QP1A 3BIKB 5DD1L 1KACB 1RMFH 5ITFA 1X6LA 1Y6KR 4K9EL 4AZ8A 2E9BA 3C08L 5IW6A 5ENWA 1JGEA 1S7XB 4PR5A 4R3SA 3ARED 5CFHA 5CJXA 5IEHB 4LU5L 3AMLA 2G75B 4WV1B 5IQ9B 3OKLB 2H26B 4HIEA 2NQCA 3ALXA 4PRHD 4LSDA 4KTEH 4M6ML 1JWUA 1VFAA 4HJJH 5DC9B 2FJFA 2OJZH 4WEBH 5K93A 2IH1B 5CBAB 3PQYB 3QIUB 1D5MA 1TFHA 1U8OA 1WJ3A 3E6FA 4L3CB 1VFBB 4RAVB 4PS4L 4U1JB 2DN7A 4HJ0D 2CUHA 3B2VL 2B8OT 3PXHA 3QBTB 1NANH 4IHOB 1ONQB 2D7MA 1MCWM 1BGXH 1W72L 5AG8A 1VSCA 1A6AA 4FNLH 3PL6A 2JB5L 4G6AC 4ZFFB 5HHXH 2NXZD 1A9BB 1BFOA 5DA4A 1WEJH 4GXUM 2VZ1A 1I8MB 3PNWB 1NMCB 3E1F1 4ZO9A 1O0VA 4N5EC 4ZPTB 1JV5A 5LQBL 4XB8A 3B9EA 5DVMA 3QG7H 2X10A 4GS7B 1JNHA 1F4HA 3I2CL 1YEIL 1K8IA 2D4DA 2Y72A 3LDBB 1S9YB 2BVPB 1RZFH 1WAAE 5INCB 4H20H 3SY0B 4L5FL 4WENB 4XC3L 1WITA 2DQDH 1DQQB 1YJDL 3GMPA 3S35L 4Y1AD 1WBYB 2WUCL 5LCVL 1G9EA 1MUJA 4HG4J 1HQ4B 4WU7B 4HT1H 2AEQH 5C0AD 1MIML 4DKAA 4OZIA 5E8NA 2CK2A 2X5PA 1HDMA 2OI9C 1LO4L 3L6FA 4LQFH 1MOEA 1G7PA 3C6LC 1A1OB 5I8EB 1UWXH 2D03L 3LQAH 1Q9LB 3CVHB 3RTQD 3V4VL 1G7IA 5DRWB 1YQVL 3QDMA 4LCYB 3KPRE 4Y5YB 4JHAH 1PG7L 2XOTA 3FQWA 1TVBB 3QQ4B 3OX8B 1P5VA 4JY5L 5E4IA 3V6FA 4GH7B 4DOHB 2V9RA 1JBJA 1U42A 2A74B 2X40A 1P4LA 2Q7YA 4PFEA 4E5XA 3ARFD 3MACL 2IAMC 5CEYB 1T7XA 3AY4A 4O51B 5DK3A 3V6OA 4KVCH 5L2JB 2HWZL 1W8NA 2HTLC 5JHLH 1F4YL 4FXLA 3GSOA 3W11D 5E1AB 2IPUK 3BWUC 4MJID 1JPST 5GZND 2ITDA 4E42B 1MRFH 4XP9H 3THMH 3RVXC 4WY7H 4PGJA 2AJXL 3MRPA 3OJMB 4OLXL 4KZEH 3TFKC 2AK1H 1ED3B 4EQ3A 1OCWH 5IP4A 4R6UA 4MQTB 5JLZA 4YX2L 1HI6B 5GGUA 4G6FB 5EB9A 4QTIL 1FG2B 4BQBA 4UBDD 1U8LA 3VXOA 4XHJD 1BIIB 5LBSL 2N1KA 4MJ6B 1OGAE 1FSKC 1ZGLA 5DQ9B 1F4XH 3DMMD 4P3DA 5T1DH 1JHLL 1U3YA 3WNPA 4FZ8L 1FAIH 5D93C 4X6FB 2FYYA 5F71A 3WHE1 1D7FA 2AJSH 5B4MD 1XR8A 1T1WA 5DEFA 3QFJA 1JGUH 3U0TB 5E9DE 3TJHC 4L4VE 5HYJA 5ACZA 4HK0B 3MRFB 5HI3C 2X4RB 3UYPA 1KEGH 5CBEB 1GPOH 3TBTB 1F90L 4XXCA 5GSVB 4EI5A 1S7RA 4NZUH 4WI3A 1KXTB 2VDRH 1AGBB 3LKRA 1LD9B 3T0WA 3GUTB 3K8KA 2EH7L 2NY0D 4JJHA 3ILPA 4KK8C 1C12A 2PUQT 3GHBL 5FA3B 4KK9D 2BNQE 1YEFH 4Z7QF 3BT2H 5C09E 1F4WH 4XH2A 4PY7A 1QRNB 4NQDA 5HGHA 5ETUA 1UADC 4JRXA 5T1MB 5EIVA 3CDFA 3S37H 4XCFH 4ODHH 1A7PH 2YD4A 3FQRA 1EH9A 4G8IA 5J56B 2HJFB 2ZUSA 3ARDA 3H42L 3U2SA 2X70B 1IJ9A 4KZDL 4JHBA 5J13C 1I3VA 2V7NA 3H3BC 4H5SB 3LKSB 3U4EA 1N6QH 1BD2D 1ACYL 4YHNB 2RFXA 1KB5L 4X7CC 3OKDA 4AT6B 1ES0A 1IGJA 4DGIL 3VRJB 3ULVE 3BUYB 1OW0A 3WIIL 3NZHL 4H8WC 1T5WB 1FL5B 4DTGH 3RZCA 4C4KO 4OBRA 2VDLH 1XCTB 2OI9B 5EU6A 1A4KB 2ATKA 4MCZB 1EUTA 3C6LB 4S0SD 1CK0L 2EIEA 4N0UE 4CL7A 2W0FB 4PUBH 4JO3H 4UUJA 2DQEL 3DXAA 4K9EH 2VLLB 1R5WA 2AXFA 3HR5A 4MVBD 3B6SB 1L0YA 2OTWB 1GH7A 3SJVB 2Y36L 2A6KB 3WS3B 3TYGH 4PBVC 2IAMB 5INDB 3GSUB 1A9EB 4OI8A 1T22A 2BVOA 5LG1A 1M71A 1XGRA 4JB9H 1I4FB 2XACC 5GGTA 1Q9KA 1F11B 1FGNL 2DAVA 4BQ8A 4U6YA 3FO9B 1X5XA 1DE4B 1IBGL 2Z8WC 3WFZA 1HHGA 3LKQB 1NBZA 3P9MA 1HE7A 2IF7A 4N5UA 4NWUH 5CCKL 3MCKA 4GMSH 3X3GH 2P24A 3KPRD 2W92A 3IDMB 3BPCA 5J1TC 3NFSH 4GRWH 4TUJA 1P2CA 1W72H 2YHGA 3VXRB 3GRWA 4ORGA 4NZTL 2FO1A 4CN4A 1OB1A 4AJ0A 4I4WA 2R0KL 2FRGP 1P7QD 1T7WA 1FSKB 3JWOL 5I8CB 5IBUG 2DYPA 2V9QA 1TTUA 3E3QC 3PV7A 4JG1L 5D93B 3AM8C 2NY4C 4N8CH 2VDMH 3SGEH 5E00A 2R69L 4NFBA 3P0VH 5FM5O 3CK0H 5KSVB 3RVVD 3PHOB 4LVHB 4RBPK 2VDKH 1FCCA 4XC3H 1T04A 1T6WA 4KUCD 5D5MA 3RAJL 12E8L 1YJDH 3S35H 2R4SL 4RMVA 1LO3H 2F53E 2APVA 3KJ6L 2X09A 1GGCH 5CHNA 2VZTA 1OWRM 4NQCE 5EC1A 2JB6B 1KUMA 2Y9RT 5I1HL 1DQLH 1FFOA 1ND0B 1LO4H 1SJHA 1VPOL 4WW1B 4KUZL 2AJ3A 4RMTA 4PLJD 5I74C 2D03H 2Q3ZA 3ILQD 3WJLA 4YH6A 1YQVH 4D3CH 3BEWB 1N2RB 1HKLH 2ZCHL 5D2LE 1K85A 5E9DD 4JY5H 3MLRH 4BJLA 3B9KA 2F5BH 3BE1H 1QZ1A 4NNXB 2YD3A 3WFDL 2ICCA 1IILE 3LS4H 5J13B 4NN6B 1PX4A 1MQ8A 5B38A 1PW3A 2LU3A 1GJIA 1E4XH 4LSQL 4NRXB 4P46C 2HWZH 3LIZH 3OHXB 2IH3A 2B4CL 3MRNB 4WGWB 1H15A 2DQTL 3FB5B 1JI2A 5F9DC 1MCCA 1RJZB 5C09D 1K4DA 3MYZA 2AJXH 4LBEA 4WI6A 1JPFB 5DLMH 3T0ED 5C9JA 2AJVH 3L5XL 5BS0D 1ZV5A 1OOAA 4YX2H 3BPLC 2EIBA 3BH8A 4HX1A 1T7ZA 3CXDL 3RHWF 3AREA 3O81A 5I15L 1J8HE 5AUMA 4EOWL 3TYFB 3V5KA 2DB8A 4XMPH 3V0AC 3VGBA 1S8DB 4PRHA 1WT5A 5T5FH 1BZ9B 2F54D 5HVFB 3MGTB 4ZOEA 1ZTXL 2BVYA 3MYJA 1A64A 1N26A 32C2B 3ULVD 1AIFA 2X4UA 4JDTL 1MWAH 1T2QL 3GI9H 1IGCL 1N6VA 3V7MA 2IPKB 2AJYL 3CFBA 3MRLB 1U8IA 5CILL 4J6RH 4OUUB 5FF6B 1D5XA 4BQ6A 5HY9B 6FABH 3MRKA 2LU7A 3N85H 5E2VL 2OXGA 4CNIB 1HOCB 4X4YA 1YECL 1M7DA 5MENB 4YBQC 4B7LA 5T3XE 4XPHH 3N1GC 4LCCC 5LGKA 1YEHL 4XNUL 5ICYB 4W70A 5IFAL 4FXGB 5F9OH 5H2BA 5IWLA 5FGCB 3PGFH 4HIIA 1PLGL 3RUGA 3ZTNL 1R3JA 2HRPL 3OGOE 1IAII 3NVQA 5C6TL 4MNHA 1EX0A 3BD4A 2NY4B 1P7KB 4XCYA 1RUPH 3X13B 3HZVA 3CSPA 3I84A 1WQVT 1XEDA 4HWZA 3WUWA 1WCQA 1FYTE 3MODH 4KZDH 4NO5A 1A4JA 3VDAA 4Y1AA 1MF2H 5JXED 3TH3T 1DVFD 4GKNA 1JCKA 1MIEL 5IB3B 3U7WH 3Q3GA 1UM5L 5IF0A 3MROB 5C0AA 4PGDA 1QVOA 2QHRL 1J12A 4DGIH 1D5ZA 1MJ8L 4CGTA 4G6MH 1Q72L 3M8OL 3T8XB 2DD8L 3NZHH 1MI5B 4JFPB 2BMKA 4A6YB 2R23B 4LEXL 4LIQL 3AGVA 3MJ8A 3RTQA 3EOTL 1JZ6A 2X1XR 5E8EB 5FDWA 2DF3A 5E94A 1DCLA 3HNTL 5I74B 5ANMA 25C8L 4TOYL 2CGRH 1CXLA 3HAEA 4QXUL 2DQEH 3BGMB 5DJ8A 3VXUE 2OP4H 2EDBA 4KJWC 5TQ2L 3CFKA 3JV4B 3GB7A 3DV4B 4YHOL 4MNQE 2EDYA 4KGLA 3ARFA 1VKXA 3F58L 4PJCF 2FZ3A 4L3ED 1FJ1B 1ZMYA 5IVXE 5FYKL 3ELAT 5E70A 1OP9A 1XH3A 3BPOC 4P46B 4BZ1L 1H8SA 3OKOB 4G9FB 3QRGH 4MJIA 5DTFA 2R0ZL 3SQOH 1P1ZA 2OTUB 4P9MH 2X4TB 3IJYA 1KENL 3AXLA 2XV6B 4PD4K 4NQCD 4ZUUB 1DEEB 3DSFL 3HMXA 1F58L 1JYWA 2BHYA 3EHBD 1X5LA 3BAEL 4M6NL 3M07A 1WIUA 1RFDH 3MLUH 4MAUH 3KXFE 4LLDB 2YBRA 3T4AA 1VEPA 4NBZB 3MR9B 5HGBB 4PJCB 1B0RA 4ZS7L 5I1AB 3BPLB 5EU3B 5KTEH 1QFOA 5C8JA 5C0GA 4P5TD 3NABH 2VE6A 4LLQB 2D7TL 1W0YT 4NQEE 4TUKH 2FJGB 5CMAA 3DMMA 2R0KH 1IQDA 5DJAA 3DURB 3VMPA 1J1OL 1JYNA 4L4TB 4L1HA 3EUUA 4M8QB 2QQLH 2C5DC 3GM0A 4V2CB 3LRSB 4XRCA 1RJCA 2BHZA 3B2UC 4R4BB 3S5LB 5IMKB 3B5TA 5MEPB 4YEEA 2EIDA 1XZ0A 1SY6A 3CDGA 5TDOA 1T66D 2VXSH 1BWWA 3UC0L 4QF1A 3S3SA 2X4NB 4M1CD 2VLJE 2XI9A 1HEZB 3N06B 1DTUA 2HVJA 2UYLA 3MRMB 4N0FB 3PJSB 1MCEA 5J11C 4LCCB 4NHCH 5EPMB 3IGAB 4MCYA 2V5SA 2J5LB 1VPOH 3FRPG 4QYOB 1A22B 4QKXB 2J4WH 4KUZH 3GGWA 5HHOB 2X1PA 4G42A 1CF8L 4FRWA 2BSRB 5JQ6L 1NAML 4ODVL 3PGCA 4UINH 3ZDYE 1QLFA 2HMIC 3O8XC 4OFIA 3MREB 2R2EB 1CI5A 1BD2A 4ZD3L 1F00I 4IRSC 4IDLA 1JGDA 3D25B 4MHHI 35C8L 3AUVA 1EO7A 3HI5L 3UEZA 1KJ2A 4GKZA 4X7TB 2OL3H 4H1LA 4MA1C 1SYSA 3D69A 4K7PH 2FEDD 4PJAE 4GQPH 4ZODA 1B4JL 1GGBL 1CD1A 4Z78B 5E8DH 4XPFH 4PGCA 2A0LD 3HI6L 5IMOA 4ONFH 4ZNEA 2C4FT 4GKSB 2P8LB 5A40E 3C6SA 2JKXA 4NHUA 5CGTA 2ZJSL 3FONB 4UNVA 3TBYB 1WAAA 3HE6C 3EO0A 1FYTD 1R3KA 4H8WL 1RZKL 4FQHB 4WVRA 1EAJA 2BP3A 4F3FA 4X7SL 1CFQB 1VHPA 2XWBB 3U9PH 4N8VB 2QSCH 5HDLA 4Q2ZB 4YZFF 2B5IC 1ZTXH 5HDBE 2DQCH 1WC7B 4HKZB 3FT3A 2ADIB 1T2QH 2FB4L 4HKJB 2ED8A 1HNFA 4I18C 5K9OB 2HLAB 4DFHA 4YR6A 1BQHA 5JTWA 4U3HA 1I3GH 2CMRL 3KPRA 4X6DE 3RHWK 5HJ3A 1B0WA 3BDYL 4OIIH 4P2RB 2A6IB 4N0CD 2W07A 1MFDL 1CDHA 1A7NH 1BEYH 1QO3A 2YEZA 1OSZA 3PWUA 3VXUD 2YA2A 2HTKD 3RWFA 1NGZB 4Z76B 1E6JL 5IFAH 2BCKA 1P7QA 4MNQD 3VFRA 1PLGH 5F9WC 1YEJH 3MOAL 2YPLB 4OZHF 3SPVA 5FDYA 4M1GL 4KKBC 2HRPH 2YUXA 4ENED 4NKIH 4YDKH 2AV1A 3IDIB 5B8CA 1CICD 4MDIB 3LZFL 2OS7A 3IRZA 3SE3A 4NRZB 1NFDE 3G6JE 2XQBH 3Q6FB 4RISH 4WEMB 5ID0A 1W0VA 4R7NB 5I9QC 5T3ZL 5CJXC 4OM0L 4QT5A 2LVEA 5CSZB 3QIBD 4XP1H 3TN0D 1N7MH 4Q7DA 1CLOL 2UWEF 4ONHA 4PTUB 4KPHH 4PB9H 1MHCA 1UZ6E 4MMXC 4QTHB 1U3JA 5CD5C 2HVKB 4OZHB 3QDJB 3HLAA 1H3UA 1L9NA 5J11B 3EZ8A 2MCPL 2QHRH 4G8EA 4OLUL 4NQED 4HUWA 1FDLL 4PJEE 4R90L 2PR4H 2EC9U 1CGTA 1XFPA 2ICES 2BNRB 2CKBA 1X5AA 2Q86A 3EOTH 1JZ2A 4WUUE 1CFSA 4S2SA 3ZSSA 2VR5A 5F7EH 3X3FL 3UJTH 3KPSE 5E9DA 5ISZD 3MRIA 3HZKB 5DK0B 5TH2B 3PL6C 5EU4B 3NA4A 1QYGL 2P8PB 3O8XB 2HRLA 1A7BA 1V7NH 3F58H 2VLJD 4X83A 4G80A 2L4OA 4D8PA 4DKEL 2EE2A 5I2IA 1CZ8H 4MA1B 2R0ZH 1BBDH 1NC2B 4ZXBD 3UYRL 2YMXL 4QY8A 1IGMH 5C09A 4KV5F 3ES6B 4X6CA 1RJLA 3DSFH 5ADPH 2CK0H 3T0EA 1M6OA 5DT1L 1X7QB 5JPNB 4M6NH 3UTSA 2XN9E 5KSAD 1IAKA 1QSFB 5CEZL 2C3XA 1S7VA 5BS0A 5DGQA 1GGYA 5BZDB 3BN9D 4PIRF 3VMNA 3MUJA 3MXVL 2PKDA 3WFCH 1KLUB 1CCZA 4XVSH 4GG6E 4GW4B 1A5FL 3QPXL 2YC1B 1SYVB 3HE6B 2AGJH 3S4SB 4U7MA 2C1OA 3ULUD 4KRMB 1UB6B 4XP5H 5IW1A 4PRDA 3VFSA 4BK4A 2F54A 3UBXG 1J1OH 3TZVD 4KHTH 1DSFL 2B5IB 2NTFA 5CD3A 5F97E 2X4OB 4X8JB 2VLRB 1IGTB 5A3IC 3W9DB 4BQCA 2YD1A 4JGMA 2GHWB 4ZFOB 3SDYL 1UJ3A 3IKCA 3TJEH 4AY0A 2I9LA 3MLXH 1SVZA 4R7DB 5GIRA 3CMGA 4I18B 1C7SA 2IANA 4LLMB 1MCFA 3WL9B 4N0UA 3HTLX 3AY4C 5E24E 3V6OC 5HGAB 3OKKB 1XGYH 4KROC 2PW1A 3DV6A 4CVZA 3VXQA 3OKNB 5IFHL 4P9HL 5C07E 4K3JH 1V05A 1FL6A 5JIKA 5F9WB 5D9SB 4MD5B 5EIIA 4KK6D 1LEGA 5AZ2L 4U1GC 5ITFB 1K8DA 4JZNA 2EYSA 1QSVA 5GS0H 3EYUL 4M3KB 4G8GE 5IW6B 5ENWB 2QV2A 1JGEB 3ALWA 4PR5B 2GYSA 4R3SB 1WBZA 1U41A 4I8DA 1X5GA 1NAMH 4ODVH 5SWZE 2E9WA 1FO0L 1I9RL 4HIEB 2A77L 5JXEA 5LAXA 1DVFA 2R2HA 5ALCH 3CH1A 1A3RL 1JPGA 1JWUB 3LEVL 3H6JA 2FJFB 2WZPD 3NIGF 2XPGA 4YBHA 1D5MB 1U8OB 4LOUD 3E6FB 3KGRA 4UI2A 2QTEA 3V4PL 4LGSB 1TETL 1PG7W 4AG4L 4XXCC 4EI5C 4GRWE 5C92A 4F7MA 4HMEA 2G5BA 4OFKA 1J7VR 4N0YL 3CJJA 1R5IA 2DLGA 2XFXA 5BXFA 1A6AB 1UM6L 3SHSA 2F19L 2HH0H 3UDWA 3PL6B 3F7PC 2F58L 3MBXH 3MUZ1 1BFOB 1X9QA 4HZLA 3F5WA 3G6DH 2BHUA 4L3EA 3R4DA 2WSKA 2R4RL 5KVFH 3HB3C 1JV5B 4APQD 3VE0A 2MWCA 2D0FA 4OZIF 3H9SE 1EEYA 1JNHB 2H1PH 4NQCA 1K8IB 1L7IH 3H0TA 5CGYD 3RWDA 4OGAC 1PY4A 2NY2D 1UB5A 3TPKA 4U49A 4DN3H 1JZ7A 3UPCA 3U4AA 3S6CA 3GMQA 3AMKA 3MLVL 5DF0A 7FABH 3GMPB 1BVLA 4WUUD 2AKRA 2CMRH 1MUJB 5F7FA 3X17A 1BJMA 1QNZH 4M9PA 1UH2A 1GHFH 4P5TA 1QQDA 4LAQL 4EDWH 1OW0C 4XP6H 3MV01 4OZIB 3KLHD 4O9HL 5HGDA 5E8NB 4P3WA 3RZCC 1HDMB 4AL8H 2KL6A 3L6FB 2H32A 1G7PB 4ODWA 1BZ7A 4F7TA 4OF7A 4RX4D 5IFJB 1G7IB 3QDMB 1MJUH 3FMGH 3NPZB 4NBYB 1BHGA 3WO4C 2VN7A 4IRJD 3FQWB 3WFBL 4LDOB 1MCQA 5T3ZH 2BY3A 5DEZA 2IALB 2D0GA 4RGMB 2XN9D 3WDIA 1U8PA 1P4LB 1S3KL 2Q7YB 4E5XB 4I9WE 1IC7L 1HILA 4KRPD 4GJTB 4OFPA 2M1KA 1D6VL 3EDFA 2VOTA 4KROB 1Z9LA 3RVTD 3GSOB 3OKMA 3IJHA 5HPMA 1S78C 2ITDB 4NM8H 1OSPL 2AERT 1DJSA 3MRPB 4M93C 4HBCH 3DARA 3LKNA 1MY7A 5SX4I 3DYMA 4DGYH 1T83A 3BGFC 2Q87A 1RUML 4Z95L 3TCLA 5JLZB 4U1GB 1R3IL 4L9DA 2F5AH 1QBBA 3K2UH 4M48L 4UT7L 1U8LB 4I3SL 3VXOB 4FFYL 1OP5K 4DZ8A 5C2BL 1ZGLB 4LKXA 4P3DB 5DJDA 2VSDA 1CDUA 4AMKL 2FYYB 1IFHL 5IESH 2BNUA 5B3JE 1A2YA 1OAXL 3T1WA 5CUSL 5D72H 1P4IH 1XR8B 4P23D 1RZIA 1T1WB 5DEFB 5C07D 3RKPA 5IOPA 4EXKA 3UYRH 4O2CA 5DRXA 3P4NA 5HYJB 5ACZB 3H3PL 4FFWD 5IBLD 1OTTD 5DO2C 4EI5B 3L3GA 1S7RB 5CEZH 4I0PD 5FECA 4ETQA 3LKRB 1AD9A 2HT3C 1TPXC 5IVZA 1DQDH 1S5HA 2CIIB 3ARRA 2A73A 3ILPB 1C12B 4G8GD 3EJZD 4NNPL 2JK5A 3P77A 2AI0H 1KIRA 4KMQA 1FYTA 5TQ0L 1A5FH 1BWMA 1MCOL 1A3LH 1RUKL 2X4QA 5SWZD 4QCIA 3JWNC 4XH2B 4PY7B 3ZKMC 2X4PA 4NQDB 5ESAA 5HGHB 4OQTA 5ETUB 4IEFB 2VKWA 4JRXB 4F2MA 4TTDC 4YXKL 5I1EH 3WJLC 4W4OA 3P30H 4YWGH 2VABA 3VG9C 1AP2A 1C16A 3FQRB 4G8IB 4PV8A 2MQ3A 4R2GD 3ARDB 2P48B 3U4BL 3U2SB 4LP5A 5CLTA 3DVFA 3B9KC 1V7ML 2R1WA 1ZVYA 3T4YA 1SBBA 2ZZUT 1YC7A 2V7NB 4CKVX 2GAZA 3U4EB 4XAKE 2VR4A 4P99A 5D8JL 2BX5A 5J0BA 2RFXB 1ZLWH 3OKDB 1B0GA 4PJIE 1ES0B 4GAJL 1IGJB 3MRGA 3VXUA 1E4KA 4D9LH 5F21B 2QJDA 2WQ8A 1TTGA 1P4BH 3V0WH 5FGRA 5IFHH 4JANA 4MNQA 1LMKA 4Y2DC 5FYKU 5EU6B 15C8H 2ATKB 2AXGA 2DJSA 4NN5C 1CTNA 5IVXA 1DQTA 1CICA 1RIVL 2WP3T 3MLTA 3QHZL 3H9SD 3RU8L 5IB2A 2NLJA 4HH9A 4UUJB 3WO4B 1LO5A 1OAZL 3DXAB 2VXVL 3W0WE 5EUOA 1R5WB 2AXFB 3AREC 3HR5B 3QIBA 3TN0A 2I60L 2J7LA 4ONGH 4LPCA 5HYSG 4K2UL 1WT5C 4DUXA 4NRYA 1HIML 1V3LA 2D7QA 1I9RH 4DW2H 5A43C 5EUKA 3ZDZE 1ORQA 5I71C 1FH5H 2E7LA 4HLZG 4J3UA 1T22B 2BVOB 2XRAH 4LK4A 1M71B 1I8IA 1XGRB 2ARJA 1FP5A 1WSST 4NQEA 3FN3A 3D87B 3EOYG 4M5ZL 3TWCH 1Q9KB 4M93B 4XC1H 4U6YB 1F2XK 3QH3A 5GS2H 2Q8AL 3V4PH 1HHGB 1NBZB 3BGFB 3P9MB 3MCKB 3I9GL 2IC2A 1JVKA 2P24B 3BPCB 4FQIL 4XBGA 4TUJB 5ISZA 5FUCE 5GRJL 4ORGB 3RWHA 1G1CA 2YUVA 4NN7C 4CMMA 5IWLC 3HHRB 1OB1B 1KPUA 2F58H 1JHKL 4I4WB 5FOJA 4R0LA 5FYLL 2IGFL 1F8TH 4UTBH 4I9WD 4MAYD 5D5MF 2VLJA 2DYPB 4RGOH 2FX8L 1KJMA 2DDQH 3WCYA 1YDPA 1RIUH 2Z31D 4AEIL 2CJUL 5L88H 5E00B 1HHHA 4ZXBA 5DEGA 2RQ8A 1WK0A 3QXTA 4GXVL 2FLBT 4OGYH 1ZANL 5HHME 1A6WH 5KSAA 4KKNA 1DR9A 4UB0L 1G6RB 1E4WL 2DKUA 2CLRA 4HIXL 1T04B 4TULL 3L9RA 1MFEH 1TPXB 5HYEA 2JCCE 2WQRA 4X4ZA 1QR1A 5CHNB 4TVPH 3SGKA 4KVNL 4O9HH 5EC1B 4AM0A 2FL5A 2ZUQC 4KTDL 1FFOB 1ZHNA 1SJHB 3GMMA 5D7KE 1UWGH 3RTQC 3TZVA 2AJ3B 2OM5A 5F96L 4ZSOE 3FO0L 5C71A 3VG9B 3NH7H 3TIDA 4YFEA 4JPVL 4PJAA 3WFBH 3HC0A 4NBXB 2NY5H 5BW7A 1XIWA 2WLYA 5DJCA 4L8SA 3B9KB 2ZPKL 2H3NA 4Q6YA 3MV7E 3QIWD 2Q3AA 3ARFC 5CJOL 2D7NA 5C0JB 1YA5A 4OCSH 4I5BA 1S3KH 5B38B 3MLPA 2N4IA 4KK5D 3W11C 2WK2A 3C5SA 5GZNC 2IH3B 1WLHA 2Q6WA 4MLSA 4JQIL 3BWAA 1H15B 5D70H 3STZA 1K4DB 4Y2OA 1A7RH 3PDOA 2DQIL 4NN5B 5C9JB 4FMFA 1ERNA 5DMJB 5EZIL 3IU3A 3LKPA 4ZAKD 3TV3H 2FDBP 4MB4A 4E41E 3BKML 4KRLB 4PGZA 2PTUA 3BH8B 1R3IH 2E7MA 3DRTA 4AK1A 4JFDE 3AREB 4UBDC 4XHJC 1XGUA 5AUMB 5KOMC 4DK3A 2A1WL 4FFYH 5DURD 3V5KB 3DMMC 4PRHB 1V8HA 1TMCB 4XAKD 4XVTL 1OARH 5FGBA 4MQSB 2LAGB 1IC5H 5I71B 3DUHA 3VFVA 3U46A 3MYJB 4OM1H 5B4MC 4XVJL 4C83A 1IGFH 4FFZL 1AIFB 5EOCH 2DOCA 5CUSH 2Z91A 2X4UB 3LPFA 3SQBA 4JCMA 3CVIL 1YPZA 5J8OA 4J7RA 3CFBB 4JHWL 4KKAD 1U8IB 3NMEA 3NFNA 2EKSA 5IG7A 4IOIA 2FBJL 1D5XB 4K3EH 3MRKB 2Z9TA 2NY0C 2QQNL 4JO2L 4X4YB 3G6JA 1M7DB 4UIKL 4DGVL 4Y4KA 4KK9C 2O5XL 2P7TA 4HPYH 4NN7B 2NXZB 4LLUA 5H2BB 3T2NL 4HIIB 1N8ZA 1RVFL 5TQ0H 3RUGB 1MCOH 1R3JB 4XTRD 3E2HC 1CLZL 4PTTA 4APQA 4MNHB 4JHZA 4QRPE 5DMGD 1N4XH 4NC2B 4LSUH 4XCYB 4YIQA 5D1ZD 4ZQKA 5DDHA 2FH6A 3HZVB 2WBJD 2YD5A 3CMOL 4X6BA 3REVA 1NCWL 4HWZB 1X5IA 3O2DL 1CR9L 3WUWB 3Q1SH 3U4BH 5D4QA 4EVNA 3IXAA 4NO5B 4RDQG 4U4BA 1A4JB 1A6VH 5KAQF 1C5CL 3PUCA 4YE4L 4WUUA 3HRPA 4Y1AB 3EGSA 5TE7L 4WW2A 4GKNB 2ZUXA 1X4XA 5C0CA 3Q3GB 5IF0B 1BQUA 2PTVA 4W81A 5C0AB 4PGDB 1QVOB 3RX8A 1MJJA 5T1KD 1D5ZB 5DRNA 1LWRA 4YFDB 3MLWH 4LIQE 2CDEA 4OT1L 2BMKB 2UY6A 2ZUQB 1TDQA 2FCBA 3MJ8B 4RX4A 3RTQB 4FMKA 5FDWB 5E94B 4ZYKA 5ABDE 5ANMB 1X5HA 3VGHA 1UXWA 4DUWA 1REIA 3MMEA 4IRJA 3BH9A 1OLZA 4FQ1L 3HAEB 3RU8H 3OAYK 4MVBC 5DJ8B 3S34H 3CFKB 5FYJU 5HD8D 3QEHA 4I0CC 3GB7B 2V7HA 2XN9A 1DL7L 3MX0A 3ARFB 1VKXB 4F37F 3LN9A 3WXVL 3QG6A 2FZ3B 3WBDA 2VH5L 1GC1L 4HS3A 5JOPE 1ZE3C 1XH3B 5L8JB 4GG6A 4MJIB 5AEAA 5DTFB 5AD0A 1KCKA 3VDBA 1P1ZB 3FQXA 3IJYB 1G9ML 3AXLB 1U2CA 3ZYOA 5D7KD 3SGEI 3T4AB 2YBRB 1DBML 2MMXA 2VDOL 2Q8AH 2PN5A 4MJ5A 1EMTL 1B0RB 4Q9BA 3K1DA 5C8JB 5C0GB 1ZGLM 3NFPA 5GRJH 2VE6B 1FVDA 3MV7D 3O4LE 5GGTL 5CMAB 3DMMB 3MA7A 1IQDB 5DJAB 3IFOA 3SDAD 1AJ7H 2EEBA 3JWDL 5DMIL 4JFHE 5B8CC 3OJDA 3SE3C 3T3PF 4P23A 1LE5B 3DIFA 2CJUH 5C07A 4ZMAT 4XRCB 3T09A 5GRWA 3F6LA 1BM3L 3VFWA 4GRMA 4GXVH 3BHBA 3IU4L 1XZ0B 4HXBL 3RVVC 1N64H 1M7IA 3CDGB 4I3RL 4HPOL 1AFVH 4K7FA 5A2FA 5TDOB 2C9AA 2R9HC 1VEMA 4QF1B 5DJ6A 4I0PA 3WNMA 2FGWL 5EO1A 1CE1H 4E41D 4Z77A 2NY0B 2WLZA 4RFOH 2HVJB 2UYLB 4WWKD 4G8GA 5AWNL 2HT2C 1PZUB 2UUDH 5SWZA 3RA7H 1E4XI 4CN6A 1ZT4A 2VC2H 4HKXA 3E2HB 1GCFA 3P4LA 4PLJC 1KN4H 3NTCL 3UTZA 1G6RL 3ILQC 2ID5A 3ORJA 3GGWB 4WI5A 2WBWB 1VDGA 2VXTL 3G08A 4M4RA 2YXFA 3O41A 4G42B 1LK2B 3L3OA 4RFEA 1QFWI 4Z7WE 5I73B 3PP4H 1KIUA 5I17A 4FG6D 3DYOA 3FT2A 3PGCB 1QLFB 2JJWA 3UTQA 1W72A 4NDMA 3G5XA 4RWHA 1BD2B 2XZQL 3QUMH 1EJOH 3DWTA 4KWUA 1KG0A 3LEXA 4Q0XL 1JGDB 4M5YL 1NAKH 1CGWA 3BZ4A 1KJ2B 4GKZB 4U2YA 1FZKA 1G9NL 1KJ3H 3PV6A 4H1LB 3V4UL 2IQAA 1SYSB 1H3PH 3D69B 3QA3A 1MEXL 2R15A 5TGBA 1HYRC 3IDYC 3T0EC 1CD1B 3QUXD 2AJUL 3NCJH 1LHZA 1UA6L 3WKNA 1AC0A 4QRPD 4PGCB 2VXUH 3KG5A 5DR5H 4X5LA 5IMOB 2MKLC 4XMKH 3H9SA 1AGFA 3C6SB 1G7JA 4NHUB 3T0XA 5D2NE 3BKMH 1YZZA 1CFVL 3TT1H 1XGPB 1XF5A 4PJDA 1EV2E 4PREA 1F6AA 3RX5A 4YQXL 3EO0B 1R3KB 2H9GA 1FGVL 3OAUH 1ZHLA 4F3FB 3O6KH 1TJIL 3QCTH 5FV2A 4ZFGL 3TBSA 3NN8B 3OWEA 4AENA 3OAZK 3ULVC 3BVNA 2PTTA 1IVLA 1M4KA 1QSEE 2YK1H 3NCMA 1OM3L 4TSAH 4FFZH 3FT3B 1KCSL 3ZTJH 1UJ3C 2OTPA 1CQKA 2E9IA 4YXLL 4YR6B 4JHWH 1YNTA 1BQHB 3T0DA 3KPRB 1RUAL 3GMLA 2A38A 5HJ3B 3VGDA 5J4MA 2YEZB 4JO2H 1QO3B 2VDNL 5C08E 1OSZB 3PWUB 3RWFB 2O5XH 4TSBL 1TENA 1LEIA 3LKOA 1P7QB 2CSPA 3VFRB 1RVFH 4K71C 4MAYA 3W5MA 5EA0L 3SPVB 4QNPE 5JOPD 1DQJA 2AV1B 4RGNE 4CU7A 2Z31A 2ZUVA 1X4ZA 3VRIA 2ZP0T 5T3ZE 4Z0BL 5GGVL 1RY7B 4BH8A 5ID0B 1W0VB 4QT5B 4HEPG 2VZSA 5HHVL 3TVMD 4X7DC 1SMOA 3O2DH 3S97C 4Y8AA 4JM4L 5HYFA 4ONHB 3HC3L 3A6OA 3A6BH 5JXEC 1DVFC 3D9AL 1C5CH 1MHCB 2NCMA 4YE4H 3OB8A 4AQ1B 4AEFA 4HCRL 2ESVE 3Q0HA 2WIMA 3UXFA 3HLAB 1NCBL 4Z7VE 4G8EB 4AQOA 3Q2CA 3P3YA 2Q1EA 4HUWB 4JFFE 2BXYA 3O4LD 3GO1L 4UV7L 2IQ9H 4K94C 1R0AL 4QXGH 3U7YL 3RPIA 1OVZA 2E8ZA 4JFHD 1S7UA 2CKBB 3T65A 2Q86B 2UZYB 3RI5F 1CFSB 3MRBA 4S2SB 5FXCH 1J10A 5TF0A 1EIBA 5E9DB 4EJ1C 4FQ1H 4X6CF 1U0QA 3CXHJ 3UDWC 3V5DA 5HDQL 1AC6A 5LXGL 3QIWA 1JRHI 1JNLH 5EZOL 4U6HA 3H2WA 1DL7H 3WLWD 4HFUH 3WHXA 4XP4H 2FHCA 4QHKI 3VJ6A 2VH5H 3MSPA 4G80B 4Q9QH 3QUKA 4D8PB 1ZLSH 2W38A 2FX9L 4JLRA 4FHBD 3Q5YA 1BVZA 4E0RB 5F9JA 4I2XE 5DWUL 5C09B 4X6CB 3CVHH 1RJLB 4F58H 3IFPA 3IDYB 5CEZE 1IC4H 3T0EB 1M6OB 3WSQH 1KN2L 5B21A 1KB9J 4NSKA 4LNRB 3ULVF 5BS0B 1LQSR 4ZAKA 1KELL 1EMTH 1CVSC 4PJFE 4K8RL 4OZFG 1OPGL 5ACMA 4P5TC 4I48A 3LHPL 2ZUUA 4F37K 2VNCA 2C1OB 1HYSD 4NKMA 4WNQB 5IW1B 1KB5A 4PRDB 3VFSB 2F54B 1UENA 3MA9H 4CVWA 3HE7D 1HSAA 4PJIA 3R1GL 1XGTA 2NTFB 4DKFH 5CD3B 4DN4H 5F89A 3WIHL 3BQUD 4O2EA 1UJ3B 3IKCB 1UWEL 2I9LB 1T66C 5GIRB 4OB5L 3SE8H 4LLAA 1FNGA 4OAWA 4HPOH 4XPGL 4M1CC 4N0UB 5FHAL 3WXWL 1ZSDA 1IAIL 3B5GA 3FT4A 1VGEH 1OAKH 2PW1B 3DV6B 4F80A 1N6UA 4M7LT 4J3WA 4PPTA 2PYEE 4G7YL 4CVZB 2R29L 3PWNA 3VXQB 4ODSH 1LDSA 4XCNA 1FL6B 4GMTL 3DETD 4K71B 1WUNT 2KZ1B 3KWWA 2DKSA 5J89A 1T83C 5DD3L 5EIIB 4YEFA 2C4XA 4Y4FD 1LEGB 2ZOLA 4MA3A 4PP1D 5IUSA 4YK4C 2JJUA 3G5YA 5D1ZA 1K8DB 4JZNB 2EYSB 2WBJA 5IEHA 2IPTL 1CGSL 4NWTH 3UP1A 4ZG1A 4RRPA 1BMGA 2APBA 5KVMC 2AXHA 3BDBA 4X4ME 1DVFB 3L95A 2XZQH 3CH1B 3GI8H 1JPGB 2Y06L 3HAEG 4MA8H 1RI8A 5C08D 1CLCA 5T1KA 1DN0B 4DAGL 1Q0XH 3DUUA 4L3CA 3SGDI 2XPGB 2FEDC 3BZFB 4S0TD 4TSCL 3ULSA 2DLIA 5DI8A 1ONQA 4XB7A 1NCCL 4J1UA 5EU5A 3S7GA 1UA6H 2A0LC 3VGFA 2ZCKH 4RGND 4S1RH 4F7MB 2G5BB 4MXVE 5C86A 5T3ZD 3JSSA 1R5IB 1GGUA 2XFXB 5BXFB 5D1XD 1KJ2L 3D2UD 4J4PD 1CFVH 5JOFA 4EI6A 2JE8A 4IOFD 4HZLB 3F5WB 1UH3A 4L3EB 5IQ7L 5CS7A 2PXYD 4PJ8D 4OCMC 4WDIA 5F7UA 4NCDA 2ESVD 2X9XA 5F70A 3VE0B 4ZFGH 1MCKA 1W2KT 4W4OC 5JW4M 5IIEA 1EEYB 3FKUS 4NQCB 4NZRH 3H0TB 5IKCB 4C4KT 1ADQH 4CN1A 4HBQA 3RWDB 3G5VA 1KCSH 1GIGH 1ZK9A 4UILH 5I1IL 3TO2A 2RCSH 2Q8BH 2QR0A 3GMQB 5DFVD 1PSKL 4ZSOA 1BVLB 4N0CC 4YHPA 4O02L 2AKRB 5GRXG 4TVPE 4LDEB 4V1DD 3OF6D 1E4KC 4HW6A 4R4FH 2HTKC 1ZLUK 4P5TB 1QQDB 5E2JA 5JW3L 2J88H 4RCAA 5HGDB 3MV7A 4I77H 3MCLL 2MCG1 3SDAA 2H32B 4ODWB 1BZ7B 4ENEC 1NCAH 3KHQA 4F7TB 3FB6A 3VI3E 1CICC 5EA0H 5IMMA 4M7JH 1BIHA 1ZVSA 4U1HA 1BFTA 2BJML 4LASL 8CGTA 5AAWA 1BJ8A 3QIBC 1RUQL 3TN0C 4OUOA 5CEZD 5HHVH 3HG1D 4J3OC 1U8PB 4LCIL 3GMRA 3QPQD 5KSUA 4QXWA 5GISH 1HILB 1OTUD 3T2QA 1OT1A 4QLRA 3D9AH 4E41A 4WWKA 4IRZL 2E7LC 3QWRD 3SE9H 2AQ1A 2BZDA 3QJFA 2IJ0C 3U0PA 3L3DA 3OKMB 4YO0B 4PJBA 3IJHB 5HPMB 3MZTA 2PW2A 4QOKD 3OBAA 4U1LA 3LKNB 5TE4L 1NBYA 4XCCL 2A9NL 4ACPA 1R0AH 4ZS6D 1DBKL 3TCLB 4YK4B 1MHPH 4H1LG 1I1AD 1FG2A 5DHVB 1F3DH 1BAFH 5SX5K 1B6DA 3RY5A 3QJHA 1WZLA 3MV9D 4DZ8B 2OSLA 5LXGH 4R0LC 1YEEL 3VXTA 5H37H 4LKXB 1NUGA 4X6FA 4MQ7A 5DJDB 4UDTA 1HXYA 4EBQH 5D7JD 3RJDA 4JG0L 2YXMA 5L9DH 2WWMD 2BNUB 3C2AH 1A2YB 3EYVA 1RZIB 2XWJA 4ZXBC 5CAYB 4JPWL 2AABH 4OLYH 3QEGL 5IOPB 1BECA 2B1AH 4O2CB 5DRXB 3P4NB 5DD5H 3QUXA 3RI5K 5KSAC 5K33A 4C59B 1IGYA 2JELL 3G9AB 4QRPA 1JGLL 3QUZD 3BN9C 4Q9CA 2JJSA 2I07A 5FECB 3LN4A 3O4OC 4XNMA 5KS9E 4ETQB 5L7XH 1AD9B 1AXTL 2DQGL 5IVZB 1MFBL 1S5HB 1IZJA 3DECA 4FP8L 2A73B 1RK0A 4JO1H 4OCXH 3RPKA 2JK5B 3P77B 3F6IA 1KIRB 5I6XC 1FYTB 3ULUC 1IM9D 3SGKC 1T21A 2X4QB 3TIEA 4QCIB 3QQ9D 3PDGA 2X4PB 5ESAB 1EAPA 3LMJL 3TZVC 4F2MB 2E6PA 2V9TA 1JYVA 5DJYA 2VABB 1AP2B 1C16B 2VLKE 3HC4L 4PV8B 3DO7A 1NUDA 2WIIA 2OQJA 3MLYL 2KUTA 4OD2A 3LRGA 1HWGB 5GHWH 5BW7C 1XIWC 1BREA 4L8SC 4EN3D 2W0KA 5IVXF 2R1WB 4OCYH 3T4YB 4EUPH 2GAZB 2CRYA 4QHNA 3UJJL 5CINL 3FRPA 2I27N 3B5HA 5FHAH 2BDNH 2NY7H 4AIZA 1IAIH 4HGMA 5EUOF 1B0GB 5ADOH 3DI2B 3MRGB 3VXUB 1DANT 1RU9H 1J1XL 2GY5A 4G7YH 1F6FB 3PWJA 3QULA 4JANB 4MNQB 1DUZA 3P0YL 4B53A 3RWCA 4GAYA 5DUPL 5J9PA 4GMTH 2AXGB 1RK1A 1EEUA 3U7AA 5IVXB 3D85D 4KK6C 4RWYL 5JIPA 3HA0A 4LVNC 1CICB 4YHMH 3UROR 3VU2A 5IHLB 3GJFA 3MLTB 1GAFL 5IB2B 3PDDA 2NLJB 4HH9B 5FEBA 1LO5B 1QPXA 3CLFL 2ICWI 5I19H 1CL7H 1WIPA 4NC0B 5EUOB 3M17A 4O5LL 1NGPL 3QIBB 3TVMA 1NEUA 3TN0B 1RHHA 2BOCA 2CDGA 2FH8A 1TNNA 3F7QA 5CIPH 4NRYB 3QXWA 5DUMH 2VERN 2BC4A 5FGBC 1OTSD 5EUKB 1ORQB 1HK6A 4QRQA 2Y06H 2ZNWA 5EC2A 3JTSA 1I8IB 2ARJB 1YMME 5MI0C 1VFUA 4NQEB 4LOUC 1JZ8A 4P48A 5CWSA 3BYYA 3O4LA 5IVNA 2WUBL 3N1QC 3GHEH 3CFJA 3QH3B 3KJ4C 1LE9A 4P5MA 1PFCA 1DFBL 1R3HA 2ZCLL 3WV0A 3PXJA 3KPQA 5DD6B 4KQ3L 1OAYL 2DICA 4XBGB 4M03A 5ISZB 3ABZA 4Y4KC 2Y1VA 5AZEL 3C8HA 5DFTA 3RWHB 4WWID 5FYLE 1KPUB 3DHJA 4R0LB 2VLJB 5IHUL 2NY1C 1S7QA 4APQC 4PRPE 1H3TA 2ZOKA 1KJMB 5I0DA 4N90E 1YDPB 3S37X 2CDFA 5CGYC 3ULUF 1HHHB 4I1NB 4KXZI 5DEGB 4ZXBB 1TIUA 2JTDA 1JTPA 1QD0A 2NY2C 4G6JL 4AEEA 1K9TA 4C57C 5KSAB 2NY6D 3NCBB 5I1IH 2X9WA 2EEDA 2CLRB 4DUVA 4WW2C 1MRDL 3L9RB 5JOEA 4NJ9L 1U58A 3F8UB 4O58L 1NAMA 3ZKND 1JE6A 3U6RA 3E8UL 1DQML 4PJAF 4PJ7A 3KLHC 5FYJH 2R2BA 1QR1B 4S1SL 5I6XB 5C9KA 2X42A 4GAFB 1JP5A 3L3IA 4AM0B 2VZUA 4MB5A 2FL5B 3ALPA 3MCLH