4M5TA

Disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
82
Chain Sequence
b'GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERGFISRCFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-crystallin B chain
publication title The structured core domain of alpha B-crystallin can prevent amyloid fibrillation and associated toxicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 18
structure length 82
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4m5tA00
3L1GA 3W1ZA 4PCKA 2Y22A 1WFIA 3L1FA 3QORB 4RZKA 2N3JA 3QORC 2WJ7A 2Y1ZA 3EUDA 3AABA 3J07A 3AACA 3Q9PA 5LUMA 1SHSA 4PBDA 3QORD 4FEIA 4YE0A 2K8QA 2XCMC 3GT6A 4YL9A 2KLRA 3N3EA 2CR0A 4M5TA 3VQMA 2N0KA 2KMWA 3L1EA 4JUSA 4YLBA 3QORA 4ELDA 5DS2A 2O30A 2JKIS 2CG9X 2Y1YA 2WJ5A 2BOLA 3Q9QA 3VQLA 1WGVA 2MNWA 4MJHA 4M5SA 1X5MA 3GUFA 5DS1A 4I88A 4YDZA 4JUTA 2RH0A 3GLAA 3IGFA 1EJFA 4YLCA 4ZJ9A 1WH0A 1RL1A 1GMEA
chains in the Genus database with same CATH superfamily
4RAVA 4OFVA 1G7MB 2HJKA 1N4XH 4RZCA 2VRKA 5FW7A 5SV4A 2Y2TA 2CCLA 3RDTD 2VLRE 2B15A 5GZNA 1ZANL 1S7RA 1G1YA 3SO3C 3BW9A 4MZ2A 4TRPL 3QDHA 3MFFB 3BCDA 4AYID 3VXQB 4WW2B 4O02B 3X3FL 3L3OA 1CTMA 4HD5A 1IAOA 2B0SL 2A1WL 2R69A 4NQED 4QLRA 5AAWC 1U9KA 4N8CL 5HGBA 3FHAA 5E2UL 2E7DA 3MC0A 1T7WA 5JPMC 3QDGD 5GSVA 2FUTA 3BP7A 3BSGA 2UZIL 5GGTL 3WHXA 1MLBB 1JWMB 1X6NA 3FH5A 3OHXC 4IKJA 4MJIB 4NKMA 3VJ6A 4EQ3A 1SYSB 5J3HC 3AB0B 4AE1A 4U4IA 1A7RH 1OTSC 3IRPX 2CO1A 3TPKA 3GC3A 4FQXC 1G7PA 3FFDA 3S37H 3S8FB 1ZDQA 2WWMD 1M42A 5DUPH 1D5RA 2PCYA 1Q0EA 2NUTB 3BAIA 3CPLA 5F7WC 1U6AL 1B0GB 1K4DB 4F9PC 2JSFA 5DI8B 4OJDH 3VXTA 3MN8A 4K5PA 2UY6B 3LRMA 3RWIA 3RNKB 1T4KA 3MRBA 4RISH 1EFXA 5I30L 5IJBC 3P0YH 1INEL 1FF5A 1BWMA 3UPRB 3QEUA 2E3VA 4HXAH 4K3EL 1PIFA 4RETB 3MRPB 4NXSA 4WCYH 5JHLL 3PWNB 1EMTH 3S36L 4KJYB 1KPUB 3MBEB 3GSQA 1QFOA 3DYOA 3PJSB 1N3NA 2DQEH 4X6DF 1THAA 1MH5B 4AUYA 5C3IA 2VR8A 2KUTA 2FJFB 3N9GH 1JGLH 3C9NB 2G60L 2VZUA 2FTAA 3KPPB 3QXDA 5DFWH 5HYEA 1HXYB 3BO8B 3V4LA 4YVNA 3T71A 1P0SE 1R3KB 2C5DC 2X6UA 1F3JB 3FRUA 1FO0L 1R0AH 4TULL 2UXGA 5T1KA 1JZ6A 3RTLA 1ASOA 3Q01A 3HW7A 3TYFB 4OB5L 5AB0A 1RMFL 2Q3XA 4GT0A 1FGVH 4XPAL 3HE6B 4ODTH 1FN4B 3B3IB 3S0PA 3MKKA 1AJ7H 1UHVA 1MXGA 4MYPA 4BD4A 4M48H 4RVBA 2JH2A 5KYUA 1NAKL 5C0JA 4PS3A 3NRPA 4H7VA 3TBTB 2BW5A 3WMSA 2QKIB 2WYIA 1U21A 1IAII 3ATDA 4MJIE 3FTSA 3MR9A 4MKMA 3WFEL 3H6AA 2BIMA 4X6EB 5K39B 3QUYA 3RL1B 5J6GA 4F7CB 1Y6MR 1WAAA 4AQ8C 5KW9L 2B4CH 2QBWA 4ATTA 1VFMA 4OLEA 4LNRB 4L3AA 2YIHA 4LSQL 4GS7C 3VVVA 1J5CA 2I9LB 2P24A 2CALA 4MD5A 3U0WH 1MG3C 3QIUD 1LHZA 4JFED 2C34A 2K6YA 3M8OL 1JCVA 5C0AB 3IPEA 2GUOB 5CIPB 2YA2A 4TUUA 5F6HJ 1UXSA 3BQUA 3P77B 3POCA 3VFOA 4BK5A 4PP2A 3MJ7B 5DA4A 3CXHJ 4QAMB 4X99A 3HMWH 4CJ1A 4QRSB 5C0EB 1U33A 4XNBA 3MUJA 4ZS7L 1IIIA 5I6KA 5IMOB 3MLVL 1T2JA 3V7AG 3ZVVA 5DRZA 1XFPA 4MB5A 2EIZA 4M6ML 2R7EB 4U2YA 3MLZL 3S8WA 2CO6A 3WFHA 2F54A 1DZ0A 1RZJH 3IJSB 1A6TA 2A9DA 1SDDB 4U1KB 4XBMA 3W1ZA 1MPAL 1YUHB 4G6AD 2IAAC 3CMOH 4HIXL 3RY4A 2W65B 1CLZH 1E2ZA 4QHPA 4NSKB 1KNOA 2J6EL 5T8IA 4N2KA 3MBXL 4JE4B 2A74B 4OZFB 4XAKD 4Y16D 4R7NB 3QUMH 1KACB 5KYWB 4IU2B 5FECB 4BSJA 1BOYA 4ODXA 2GBTA 3UTSA 1AZBA 3VXRA 1FYTD 1RK0A 2P5EB 1D5XB 3NVQA 1FFQA 5TE7L 1NAML 1NC4D 1HWWA 3L3IB 5I1AA 1NMCB 1SHMA 2IDQA 4OZ4A 3ZT5A 1KLGB 5J6HA 2PPCA 4YFEA 1V7NH 3NIFF 3VMOA 4KUZH 3FQWA 2H9GB 2OAAA 1LD9A 1Z1WA 4DZBA 1MIMH 3L08A 3JWDL 1QPXA 5BO1L 5C0AE 2V5RA 2VMDA 4AUUA 4Y8AA 1F1DA 5C8JB 1MCOL 4ZRGA 2Y06L 2LLNA 4FABL 4I9XA 2CUHA 3LPWA 5MHSE 2EXSA 1HEJC 4M3JA 4IOSA 1KYFA 3D4GA 2BC4A 4LLUA 1XCWA 1AI1L 3EDEA 1A14L 3KG5A 3NABH 4C54A 1CK0L 5D72L 2EQDA 5IKCB 1CICD 1VGKB 4XCCH 2BM3A 4KKCD 1G5AA 3Q13A 1AHWA 4N2GA 4MA3B 4QDGA 4HK0B 2C9RA 3MNDA 3AQDA 3QZBA 4KK8C 4RA3A 4U1MA 4YX2L 3IDMA 3KXFA 2I60H 3VQMA 3CJJA 1N0XH 5IEKA 5EU6E 1OALA 3U7WL 1QRNA 5HP5A 2QPEB 2PN5A 4P23D 3I02B 2YWYA 1FVEA 4D3CH 2JTYA 5E00B 3UYOD 4IU3B 4OKDA 2A3TA 2PCFB 3WEAA 1E65A 3P9MB 3FN0H 2H6OA 4WI3A 2DAVA 3T04D 2YPKB 4HCRA 1MJ7L 4LHUA 3VXOB 1EZLA 4KXAA 3LN5B 3OQ3B 1OAZL 4RESB 2AMGA 3HCVB 1T21B 3H56A 3ISWA 4PJEF 4MNGE 1ZLSL 2P43B 2MFNA 1HHJA 1IQDA 4NC2B 4UYPA 4PD4K 5AW1B 3SKMA 5C0RH 4WKZB 3AT9A 3W9DB 5JLZA 1MNUL 2F1AA 4F7MA 1ZTXE 3MLRL 2QV4A 5IT2H 3B5GA 1HE7A 1MCPH 2EEFA 1ZHLA 1FZJB 1Q8MA 3RX9A 2G5RA 3C6LB 4MDIB 1V3LA 3SGKC 5CLYA 4U1NA 3WN5B 4JM2B 3SQBA 4L18A 4PREA 3RZCB 1IVLA 3S3DB 3VXPA 4Y1TA 4HOXA 3EFOA 5IW1A 3WAJA 4EOWH 4HKXB 4E41B 1QWUA 4MLSA 3J07A 2E6JA 2F0CA 4UOZA 3NA4A 1YG9A 4YSRA 5L6YL 3NYKA 1XL6A 1UUSA 3DJZA 5FGCE 3E9TA 1BGXL 1ILSA 1QUNA 2XWTA 5KANG 1ML0A 3GKWL 3CU7A 1NGQL 2W38A 1MCDA 3D4CA 5I18H 1AG0A 1JGDA 3FSOA 4DOHB 4C4BA 4R0LA 1S7QA 2XG5B 2ZXEB 1PY9A 1JUFB 3KGRA 1TVHA 3KPSD 3KPRD 1EAPB 3NSJA 1AGFB 3QI9A 3BAEL 4HS3B 4KZEH 1SXZA 4OUOA 3MRQB 5J11B 4KQ3L 4V1DD 1KGCE 2VUYA 1BPLB 4BSVA 3FMGL 4ZI8A 3QK0A 3I9GL 5B39G 1OCCB 1AO7B 3VTTA 1G6RL 3ZDXB 4PP1C 4AW7A 4Y5VC 3UAEA 2XKNB 4K7PX 4XVSL 2AGJL 3LQMA 4HJJL 1UM5L 4JPIA 5IFHL 4TPRH 4OJCA 1ZSDA 4WF7A 2YPVH 4K94L 4NHUA 4UINH 2A9NH 1RL1A 3K1KC 7PCYA 2AHIA 2QSTA 1X9UA 3I50H 4X6CB 3NCJH 1JNJA 2R39A 3K80A 5I9QC 3U30B 3HZ3A 1ZA3B 5JDSA 3SCMC 2XG4B 4Z3HA 4E9LA 4EIUA 4KOCA 43C9B 2R59A 5B1CA 3ZK0A 4QRFA 1IFRA 1F1AA 1IFHH 4RX4A 1H0DA 4AQZA 1BHGA 2DH2A 2X2HA 3EFDL 5EO0B 5EU7C 4YBQD 2YLHA 4N0YH 5EU4B 2ZCZA 5DFVC 2PTUA 2VSCA 5D7IA 1M4KA 2R23B 1NCHA 2OYPA 1TYRA 3HC4L 1RZ7L 1TENA 5C09A 4E41E 4N90E 1L0XA 5KS9A 4NQDD 2DLIA 2UUDK 2VMJA 2I07B 1PJWA 3DVNA 3F7KA 4XE0A 3BUPA 3KL3A 1MIEL 1OARL 1FPTL 3D25A 4F7EA 3LZOA 4ZOEA 1QR1B 2X1PA 3L45A 3MROA 4X4MA 3ES6B 4AH2A 4Q9QH 2J21A 4AQAB 3BPNC 1A5FH 1YYLH 2ICWJ 1S5IL 2R29L 4JM4H 3P4NA 4ONGL 1Z9SB 2QHRL 3L4YA 4XNQA 5IQLA 4TS6A 4MXQC 1U8KB 4DGYH 4UQBA 2GI7A 2MNWA 3ERXA 2GW5A 3S34H 1RIVH 3IKCB 1IGCH 4ZUWA 3CK0H 5H4YA 4JQVA 3SBWC 5J0BA 1TXKA 4L37A 4X5WA 3ARYA 4MQXD 2BVYA 3KBHE 4GJTB 4TLSA 3U0PB 5IB2A 1KXTB 4H1LA 4GSUA 1C5CH 3MXVL 4HUWA 5D93B 1PZBA 2IWFA 3ABLB 3K4DA 1AO7E 4U6HA 2VR9A 3ZDXE 4ANUA 2GC7C 2FWUA 1E7VA 2Y1VA 2L7JA 1FAIH 5KZCD 5DK3A 3QUKB 1ETZB 4GSDL 5EO1B 3VRIA 3SJVE 3PDGA 1FZMB 3QQ9D 4OGXL 1HXMB 3K5RA 5ID1B 4KRPB 3BDYH 1KCVH 4BSWB 2DQHH 1KIUB 4Q4EA 2F7QA 4HCIA 4I4WB 4G6MH 1M56B 1BMZA 1LQBC 3BKJH 2FGWH 1CLVA 2XZAL 3L4WA 4WK2B 3EH1A 4F2MA 3K71A 2MTAA 3AZUA 1XGUB 2R9HC 3SCMD 1TQUA 1SJVA 4XNZC 4N9GB 1BBJA 1B88A 5AAMA 3T5WA 1MFEL 4TNGA 4WFGD 5C0FB 4FKEA 1BOGB 5DUJA 3IGAB 4D9RE 3KBEA 1CG9B 1NC2D 4OR1A 4PIRF 4M1GH 4BK4A 2W60B 1WGVA 2YD4A 3VXMA 1FL3B 3JWOC 1RI8A 3CGTA 3MRGB 1SQMA 5HGHA 1IT9H 3KDMA 2FEEL 3JWNG 3I6LE 1I82A 1KBBA 2EVIA 1MAMH 3QEGL 2R0LH 4BQBA 2DKUA 1CDUA 1GZPB 4NN5C 4O02L 1IEHA 1KY6A 1T2QH 1VIWA 5ALCL 3SZKC 5JIPA 3QG7L 2NQCA 2PXYB 4FG4A 3BLKA 1XTMA 3CFQA 4LU5H 2VABA 3ALPA 3I6KB 3Q2WA 1S7TA 3EBGA 1OZUA 4P2QB 3OGCA 1CU4L 3ZSSA 5KTEL 2XETA 1KYOJ 4EUPH 4I8DA 4R4NC 4J3OF 4LCCB 4UT6A 4CDGC 4N5EC 4KVNL 1TZ8A 4LKXB 2E74C 1LP9E 1Y18B 2V7NA 4OKVB 1GGIH 2V2TB 4M7KL 1MCBA 1QI4A 3B7RL 2ODIA 2I25N 1NFIB 2VN7A 1PX3A 2OM5A 1CFVL 1QFPA 3EHBB 4FGMA 4UOW0 3FT3A 3DNKA 3LDBC 3OHMB 1XR8A 3IDJA 4P5TC 4UM9A 3RHWF 3OD3A 3CC5A 3ZYOA 4KTDL 5CBAB 5IB4B 4JANA 4H8HA 3H3PL 4FXKA 3HS0A 5I5JA 5C0BA 1VENA 1HAWA 4ZTEA 1QQDA 3JVGC 4FTVD 1A6WL 1NGWB 1IM9A 1G9NC 3FT1A 4CNIA 1BIIB 1XT5A 1SJXA 2YMTA 4M62H 2LVCA 3TO2B 4YDZA 4CSSA 5IW6A 1KJ2H 3ULVH 5AVVB 3NRQA 2FSEB 5F7HA 1MY5A 4MDRA 4PV9A 1WFUA 2IMNA 1CIUA 4Q0XH 1UA3A 5E95B 1U8JB 2GITB 3PLYA 4XBGA 3RPBA 1E42A 4JREB 1B6DA 2JWYA 4K3JL 3AGVA 2ITDA 2P5WA 1SN2A 4NUMA 3SGEH 3G6DH 4WVRA 2QADB 3LMJH 3PWJB 3MO1A 1M1XA 4KROD 1RJYB 4XCNA 3QJHA 3Q8EA 4PCTA 2X3AA 4W93A 1EXUA 1I7TB 3L3JA 4UWQB 1JDDA 4PRHD 5E94A 4DKFH 1R5WB 3OC8A 4HGMA 4KNUA 4PJ7F 4DPRA 2EXTA 1DUZA 1GJWA 3ZZSA 3Q1EA 1NCGA 4BZ1L 3BP4A 4L1DA 4MA7H 5IVZA 2XV0A 5EIIB 1JPTH 1D5BB 2B1AH 5HVHB 3O2WH 3PIQB 2X12A 3BGAA 4DP0X 4KK6C 1HWGB 2ZUXA 3B1UA 2PPEA 4AEFA 1GSKA 3R0MA 4GI6A 5JORA 1OF2B 3VFPA 1DDHB 2RQ8A 4Y1AB 1XF2A 1GYCA 1NICA 5DJZA 4C4KO 4GG6F 5FLVA 4LEOB 2CXKA 3WIHH 2VMCA 5GRYA 2YRPA 3PWPB 3DX7A 3TBSB 3BVTA 1O7DE 4PAZA 2DD8H 1R33A 1IGYA 3SD5A 4EIZC 4B9ZA 3PQYA 3TBBA 2J73A 2ITFA 1NLDH 2R1YB 3C87A 1EO7A 3SDAA 1D5IL 4UYQA 5TGBA 4ANXA 2E47A 3L1OL 4HSAC 1ZPUA 3ZHFA 4J2XA 4DEPC 3FCSB 2N1KA 1BXXA 1CFQA 4KFZC 4BH7A 3QWRD 3VGHA 4AIXA 3KEDA 3GSOB 1UCTA 3ULVC 2Z0BA 3EGSA 3OSVA 4XN7A 4XX1G 3B9KA 3DOSB 2WXQA 5JW5A 3BZ5A 4FS0A 2JIXD 2V7HA 4HJSA 3VFUA 2FATH 2UYLB 5EDXA 4NGHL 3I75B 2YXFA 2PNDA 1TJMA 2GYSA 1Z5LB 5LWYL 1J0ZA 1KDIA 1UGNA 2VWEE 4LLMA 4PQXA 3VAEA 4R90H 3ZYZA 3NSFA 2ENQA 3TBVA 4IGBD 3CBJB 2OP4L 4TTDC 3S7GA 4GUOA 1YEEL 2UX6A 4LP4A 1RSFA 4LF3A 3LAFA 5DJ2A 4CA4A 5B38B 1C12A 4DUVA 3MRIB 2JELL 3MGAA 35C8H 2AABL 4OLWL 1F42A 5DZLA 4TVPH 3U83A 1PQZA 1NBZA 4NLAA 4N2LA 1JL8A 2BVPA 1G9ML 3QVAA 2MQGA 1ADQA 4UANA 3QEQD 4EE2A 3LZRA 4Y1AE 3O45B 2DQIL 5HVFB 1TQTA 3REWA 5HDOA 4PJCA 2K7PA 3ETBJ 4J6RL 3BE1L 3GI8H 3PWPE 1J88A 3ML8A 2VISB 3V8OA 2OYMA 3Q6GL 2EDJA 2NOYA 4ZSOE 2ATAA 2RTTA 5GRJL 1ZA6B 3NGBB 3EH5B 1KFAH 2JCCF 2R51A 4WI6A 4NZTH 2OL3A 2IQAB 3QFDB 1XEUA 3VI4B 4ZXBB 5HPOA 1SLWA 3MMEB 2QZ5A 3SE8L 1XCQA 5KSBB 1UOWA 2O6EA 3BZEA 3HNVL 4AYFA 5FYLD 1WA1X 4UZUA 3UAFA 2VSMB 2Q6WA 1BZ9B 4Z7VB 2WLZA 4P5RA 4IRJC 2OS7A 1TTCA 2PR9A 3ZZQA 1VF5C 3ZN6A 1TU2A 2C4XA 1KCSH 4GMSL 1ZS8B 1DLHA 5KVDH 1L9OA 4HJGB 5ETUA 1MWAH 2AJVH 3O6LH 3CFUA 1GS6X 4ONHB 3BMVA 4FQ1H 1DJIA 4YE4H 3OKMB 1SLXA 4D0DA 4V2CB 1QW9A 5F9OL 3U1SH 1BG1A 2Y23A 3HLAB 3DX3A 3DURA 4IOFC 5LXGH 1JHLL 4JRXB 5HYIA 4JR9L 3L7EA 3ZZ1A 3RVTC 1KIQA 1NCJA 4Y4FC 4FX5A 3R1GH 1IM3D 3WY2A 1RIUH 1MCLA 1JYNA 4U3HA 5I1EH 4P2OD 5C2BL 3VDBA 1IX2A 1V3JA 4N2NA 5CZVH 4I18A 3QYNA 3V4PB 3HBQA 2OMYB 2QVIA 1T7YA 1TKWA 1W72H 3NSDA 3OKDA 5ADOL 4KDTC 5C9KA 2JJSA 3KZ8A 1R4XA 2HKAA 3PGFH 5KG9A 1AC0A 1U93B 2NDGA 1JFQL 1LILA 5G4MA 2IAMC 2G75A 4YR6B 4Z0XA 4ODSL 5CMAB 1F90L 2JKLA 3NMEA 4WU7B 3DWTA 4UV7H 1R5IB 4RA0C 1OQOA 1G0YR 5EOQL 4ES8A 2WZ6A 3RFZC 2N4IA 3LHPL 3FB6B 3I2CL 1XBDA 3GMLB 2YBGA 3NAAL 4O51B 1QSEB 4TL5A 1ASPA 4BFOA 2VMEA 5CJOL 5DJ8A 5KSBE 1INDL 1OSPH 3B6SA 3GLAA 5DWUL 2X4RA 1J10A 2WGXA 1QOKA 2HPTA 3RJQB 3RIKA 4Z7VE 3NCCB 2Y7MA 4LVNC 4CMHC 4UILH 1AGCA 4BQCA 4QRRB 2NY0D 4XO8A 1SOKA 2C7UA 3WNPA 1EZVX 3M7FB 3VWKB 2CGRH 3VXSB 3SY0A 4ZW7A 2EKJA 2YQ3A 3C08H 5DRXA 3BZ4B 2QZQA 3KWVA 1IGML 3OXRB 4K9EC 4NUJA 5JW4N 4YDLC 4OFPA 1W9XA 1Z0MA 3ARDA 4I3SL 1OPGL 3KL0A 4JFQB 1ZS2A 3D85D 4PGJA 4JRXE 2CHNA 4EI0A 1E5AA 4A39A 4H8VA 2X53A 4RCAA 5D4HA 4NJAH 5KYXA 4IIQB 5BVPH 5K59E 4OD2A 5I2IA 3DVIA 3LQAL 5I1IL 3T4AB 5IMLA 5AZEH 5LQBL 2WMPB 4FQ2L 4R97C 4NQCD 1DVFA 1OCWH 3WDIA 3US1A 3PU7A 4QRBA 2X6VA 4HK3J 4Q4IA 3VDCA 3WTXA 1VPOH 3SHSA 4L8DA 1DBMH 1YY8A 3KHOA 5D1QB 3MNVB 2D03H 3SDYL 3A24A 3MRRA 3FO2B 5AVSB 4GQ9L 4B9KC 2MSPA 3TPUA 3RDJA 2DLHA 4YHZH 4Z95H 5FO8B 2EXYC 1ANUA 3A3YB 5I1KL 4WY7L 4M7LL 3N40F 3SDXA 5FYJE 3MRKA 5HYJB 3L3KB 2OXHB 4HXBL 3C60C 2XTJD 1NQBA 3FUMA 3G08B 1JPST 3MX0B 1G7QB 4PJIF 1NBYB 3GBML 3IDNA 3IJHB 1QSEE 1FL6A 4OM0L 2WVSA 3QJVB 2HMIC 3BT0A 2Q3AA 4PTTA 3ULSA 4MNQD 5KJ7E 2PWEA 1DO5A 2HVJA 2P5PA 3CSFA 4FERA 4PGDB 4NDMB 1TTUA 3E1ZA 3WUZA 3K4ZA 3K2MC 4QRRE 4EI5C 4URKA 3VXSE 2SEBB 4ODUA 3NA9L 1YYCA 3LRLA 3PHSA 2ED9A 2WUCL 2H0FA 4G83A 1X5IA 4V11A 4Z7WB 4N87A 1XIWA 3RIAF 2VQ1B 4OT1L 1JZIA 1NANH 2Y25A 4RQQA 5SWZD 3EYFB 2G0LA 3LNIA 1HSBB 2E75C 3MUGA 4MXWL 4YDJA 1ADWA 5AW7B 4I1NB 4LVHC 2O4EA 2VDPH 4WWKA 4L48A 3DBXA 5CJQL 1U58A 4ICXA 4GP5B 1EO8L 4DO6A 5DQJB 5HI3D 2DMHA 4ZJ9A 1E9PA 4NO0A 3BGFB 1OM3H 4ESKA 4YDIH 3WJJA 1ZIBA 1KN2L 4BELD 1UURA 1GR7A 4XB3A 2KERA 3WXWL 1OB0A 4K3DH 3G5VA 4X98A 4PJAF 1NIAA 4QHLA 4CC4C 2XDHA 1CLOH 5DD6B 5D1QE 2J8UE 3WCYA 3C6EA 3ZHDA 1TJIL 2BS8A 5D55A 4OSUH 3ZDYF 4A2GA 1NTDA 1WC7B 1SY6A 4H20L 5EIIG 1L3WA 1NEZA 3LXBA 3BUDA 3NZUA 4KJPC 3ZE2F 1QSFB 5CJXC 3OWRA 2A83B 3CVDA 5HYJE 5JW4Q 1YQ2A 5CKAA 4FP8H 4RFEB 4WV1B 4LVOB 3F62A 4U1GC 4Y9GA 4I2XA 4N8VB 5DUBA 4NWTL 1WZMA 1QLFA 2QQKH 1YEKL 2Z31D 4GMTH 1SDYA 3E1F1 4P5MB 3TIEB 5F44A 5IIEA 4JG5A 5GSRB 2Z93B 1W0WA 4PJ5A 4M00A 1VGEH 1EGJH 2NY5H 4E2OA 2DLFL 2VR7A 4TQ8A 1KPVB 2ICWB 3L17A 2K9FB 5TDPA 1DBJL 3GSUB 4M43L 3UH8A 3V0AC 1FFOA 2NY2B 3G5WA 3FOMB 4J12A 3ROOA 1AGEB 5LBSH 3I85A 5CR1A 4HFWB 2HMID 4HS8L 5F70A 5AOZA 5D70L 4F8QA 1ZV2A 3D39B 5DVNA 1XR9A 2IALA 4NRXB 1XHHA 4JFDE 4UIKH 4F92B 3VTMA 4GEIA 4X9YA 4BBWA 4Z7WE 5F7BA 3HFML 4W1TA 5KOMC 4YSPA 3H4FA 3FSVA 2WQRA 4G11A 3TBWA 1KFGA 1XF5B 1OK0A 5FK9B 2A6IB 1H3UA 3QUXA 2DI7A 4WO4D 1NBQA 1TLKA 1KTRL 3NCEB 4OCYL 4HEPG 3W38A 3G6AB 3TCLB 1H6UA 4JUTA 1GKEA 5LBGA 3LEXB 4M03A 4PJBE 2DWXA 3EG9A 3O3EA 3TIDA 1XF4B 4QNPF 5KOVC 4MA1C 5HDBB 1XH3A 2IG2H 1AD9A 5B1BB 3TO4A 2DL2A 5B38G 2ADGB 4DJMA 4TL4A 2C9PA 3TH4T 5DO2D 3US0A 4U49A 3QDMD 1A4AA 3MLYH 2APTA 3O0LA 4ZUSA 2EVHA 2ZF8A 4UT9A 5I66B 5IJVA 1DJGA 3WIIL 2JI3A 1AQMA 4Z3TA 1QSFE 3OR7B 5I6XB 1T0MA 2PKDA 4UBDD 1JP5A 4JMXA 3DO7A 4I3GA 3MRDB 1HH9A 1J7VR 3DMMD 1ZTMA 5DS8A 4HPHA 2GTQA 4NPJA 4EIGB 4A7UA 1JHKH 4MQ7B 3VRJB 4B9IA 2OZ4H 3UGXA 4DEWA 2J88H 3JUYA 4D9LL 4X9IA 2X2YA 3GMNA 3BVXA 3B43A 1XZ0A 2C1OB 2YARA 2WTRB 5I5IA 4M1CC 5BMFL 4LPXA 5ANMA 3AFLA 1MNNA 3IGUA 2CKBL 2ZAIA 3BKMH 2R2BA 1MCRA 3MLPA 1G0DA 1NDGA 1PLBA 5BRQA 3QORA 3ARED 5I8CB 4KZ0A 3D39E 3DARA 4RFNB 3BVWA 5EH1A 2MTPA 3QIBA 3VXNA 2Q8BH 3DDGA 1FNLA 3T8VA 4Y9FA 5TTRA 3WLWC 3UTOA 3UABA 2F8OA 3CG8A 1CTOA 2RH0A 5HYFA 5I5MA 5KAQG 4ZMNA 3QG6B 1R5VA 3NJLA 3SKJH 3TEUA 2GPZA 2OSLB 4LAQL 2P8PA 5ISZB 5JW4R 1YEDA 3KW8A 5I1GL 2NX5D 2ZYIA 2DWTA 2NRDA 3FH8A 1CD1A 4MQSB 1DO6A 2XQYK 1JWSA 3EJQA 2JKTM 1GC1L 2FWSA 3RWFA 1WAEA 5I1DB 5HDBE 3IU4H 1K2DA 4HLJA 4QY8B 4DP1X 3ESPA 4OLUH 4WLCA 2HWZL 4XPTH 2FECL 1X5GA 5KVFE 2BWDA 3H9YA 4Z7OE 4W68A 1KENL 3WTVA 3DTDA 1ODUA 5C07E 5F7DA 4I0KA 2WIIB 4ICWA 1RUQH 2ENPA 3MODH 6CGTA 5EEXA 5EHFA 5F1NA 1VB9A 4NS0A 1B0RB 4LSVH 4MAUH 3UAJD 4EKXA 2XNAB 3APNA 1VEMA 4PJDF 1WFOA 3UMTA 3FT4B 3STZB 1RP9A 4M4RB 5JOFB 3WHXB 1BF8A 2BWIA 2XOTA 2NR6D 2WLJA 3CHQA 4I88A 2QEJA 4NKMB 3RX7A 4F7TA 2WO3B 1YECH 1N64H 1NCUA 1TJHL 2PW2B 4CSTA 2WOBA 3HI5L 1DBAH 3INUL 1KT2A 1UM4H 5DRWA 2XICA 5GS0L 3FFDB 4ZW5A 4JEGB 3FHEA 3TTYA 3GMMB 3D33A 4RGND 2GTWA 3T0EC 3GIZL 2EIJB 3KS0J 2BNQD 4Q14A 4XCYB 5BRZB 3VXTB 1OAXL 1ASQA 1DBKH 1PNDA 2DYRB 3CZFB 1T4KB 4JFXA 3QUZD 4J3OD 2G30A 3R4RA 3D51A 2G3MA 4PJ9B 2ZUTA 1RCYA 2KPNA 4NRYB 4O58L 4AENB 3MJ9L 5ISZE 1WEJH 3MRFA 3QDJD 1FE8H 2AQ1A 1YPZA 2ZG1A 4CC1A 2FYYA 3GSQB 2XWBB 4YHOH 1SJHB 3NCFB 1L7TH 1N3NB 3AXLA 2OR7A 32C2A 2KQNA 4H88L 3SB3A 2AJZB 3FZUC 1I9IH 4ACPA 2NY3B 5CILH 2KLRA 4JFFB 4HT1H 4PVNA 4DO5A 2R8SH 1CD9B 3ESOA 4PWHA 1I8LA 1PG7L 5B1JA 3CDCA 4UZSA 1SHXA 3MXWL 4NO5A 3FRUB 1H5BC 2C3XA 3CVHL 3T2PA 1TVBB 3PP3K 3IMTA 4AM0Q 1BBDH 2G3NA 4NN6B 1QSZA 2GTZA 1GOHA 1NGPL 3SPVB 3VWJD 1MG2C 3PNWB 4JHWL 2AJSL 1AXTL 5HJ3A 4ZX4A 2Y4SA 5EF0A 4DQOL 4ISVA 3RPKA 2IOOA 1E4KA 2ZSVA 5AYUL 4CKQA 1J5OH 3PL6A 4XWOD 4HOZA 3W39A 2V9UA 2WWKO 3GZOA 3IXAB 4S1SH 5KYUB 4XX5A 3WY1A 1G4RA 2K9UA 3P0VL 3AADB 3L2NA 5IP4A 1ZVHA 4YOKA 1U2YA 1RURH 2EDDA 2I27N 2W07B 1N0LA 3G9AB 2CO7A 4EDXA 2DLEA 1E6JH 3DIFB 3P3UA 1H8LA 3MRMB 5JZ7D 3ELAT 5J6GB 3VSVA 1AG6A 3K7UA 2MHAB 2YXVA 4GRLC 1BM3H 4L0YA 5J89A 3V4PL 3U6XA 4LE8A 3GPEA 3BPLB 5BRZE 1PD0A 4KPHH 3CUPB 1ZE3C 2C3VA 1HYSD 2VC2H 4HKZA 1P4BH 4G1MA 4HPYH 2QLYA 4XVUC 4HJEA 3BQUB 4LL9A 4R96B 1OEZW 3PNRB 4X99B 2WYZA 2UXFA 2CLZB 4HX1A 3HHMA 3QQDA 4X6DA 5FIEA 3SDDD 5EBGA 3UZQA 3MACL 5JPNC 5FYJL 1TVDA 4UQCA 6PCYA 3C5ZB 4ORZC 1ZANH 2VITA 2K6ZA 4KV5E 3CH8A 3ASWA 3T0AA 4MAYB 1B9KA 1YEHH 4JQXA 3WKPA 4P3DB 4PWGA 4TRPH 1YEWA 2BY0A 4JFFE 2VDRB 4L0ZA 3UTZA 5A43C 1G43A 1I7ZA 2A77L 4LOEA 2CGYA 3GXPA 1T4WA 2UWEA 3MJ8A 1M6OA 1U3NA 4XAWH 2EDTA 4N8CH 1KPRA 3UTTD 1C5DB 4H40A 4W9LC 3ROLB 3RWEA 2YUXA 4S1DD 5ESQB 5LAXB 3VFSA 3DRTB 1U95B 4QAWA 3VO0A 4EIBA 5B1AB 1T89C 3TVMC 1KNOB 1I1FA 2VE6A 4XC3L 5HDWA 5MEND 2PO6D 5DJYB 3Q06A 4BKTC 2VW7A 3FB7A 1TYEB 3TCXA 4AGNA 4KO6A 4Y4KB 3HKFA 1J11A 2ZKXA 5GQBA 1PZCA 1LE9B 4H8WH 4M8RA 1FH5H 2OMTA 3VXRB 5DMGC 4JL2A 1DVQA 1XGTA 1D9KA 2G2RA 3CFMA 1L0YA 5I1AB 4N8VG 3MRHA 1DCEA 4JG0L 4U3SA 1JMXA 4E36A 4E9VA 3UP1A 1RQ5A 1AKJA 5BO0D 2WXIA 4P4KC 5JOPD 2RQEA 1XTLA 2HCZX 5I8KL 3S36H 4DSYA 3MNWA 1LD9B 1UXWA 2BIOA 3GS7A 4P46D 4XNYL 5EULV 3QJRB 4CU6A 4N0UA 4ATWA 2ZX5A 2KI6A 3POHA 3QAQA 3JWDC 2N3JA 3EYVA 1MF2H 3KLHD 5F2FA 3MJ6A 4J4PC 4XNMA 4PRPD 2G60H 3OMIB 1BVNT 4PRID 5LG1A 1CL7I 2BC4B 5MEPB 3PWVB 3ARGC 3GQFA 1HXKA 2ZF9A 4L4VD 4TULH 4BCYA 4HETA 3L9YA 3KBFA 1BECA 4FQLL 3QRFM 1HZKA 3M7OA 2J6WA 4G82A 4OB5H 3BAJA 2BO0A 3DSFH 3GWJA 2FT6A 2FX8H 3BAYA 4XPAH 5FR3A 2WVUA 1JGEA 1DJSA 5GZOA 4FXGC 1F8TH 1LO2L 2F68X 4PJFF 1NAKH 4HISA 4Y4HD 3HZYB 4I0PC 7FABL 3LKNA 2VLKB 3SE4C 4OF5A 3WFEH 4OM1L 2PYFA 3B9DA 3O8XC 3HC3H 1JGVL 2QQLH 4XHQA 1QYGL 3SN6N 4LHUB 3HVDA 5KW9H 4OY9A 1H9DA 3BFOA 1IEBA 2HYMA 4ZFOA 4LSQH 3BAXA 3UJJL 3HLKA 3GSVA 3VXUA 1HHJB 1T5WB 3SKMB 4P3CL 3T3PE 5D96B 4KGJA 1ZE3H 3VXRE 4ZMTA 2JQMA 3LRSA 3M8OH 4MZ3A 3QA3B 4KI5E 1E5YA 3HNSL 4ZS6D 4LDEB 5E6ZA 4QRTA 2CK0H 2CM5A 4OGYH 3UP6A 1ZLUH 2XCMC 1XCTA 2MMXA 5E6ID 1MHCB 3K0WA 1KTCA 2ITCA 4POYA 1V8HA 3R8BB 3WY3A 2HVKA 1DQDL 1U3HC 4CC0A 4RMVA 5DK0A 3EOTH 2LQRA 4UQDA 3P2DA 3ZKQD 3EFOB 1F3DH 4FULA 3G6JF 3UEQA 4BZ2A 4F80A 5I17A 1L5GA 1SUHA 1T1WB 1MN4A 5A6IA 1Y6NR 4MMXB 5E70A 3MLVH 4B50A 4D2NA 3BEWA 1YYML 1UZ8B 1G0XA 1NEUA 4MRBA 4GBXB 5CEYA 1DLFH 4OCLC 1NINA 3IETA 3ARFC 3D2TA 3DUSB 4KJQC 3UBFA 3ARZA 4ZZKA 4AVKA 2BX5A 4XMKL 2OA9A 4DK6A 1NL0L 4B0MM 1GGYA 2C8NA 3BIKA 2NXYB 4W9JC 5E5RB 1A7OH 5T5FA 2HJFA 5DS2A 2HT3D 3QFJE 4GUPA 4HIXH 5L4MA 5IESH 2WSKA 2CDGB 2KZBA 5DSCA 2AANA 2J6EH 1ZLVK 3WV0A 3WN6A 5FYKH 4F9LA 3MBXH 4S2SB 2E56A 1RZIB 3UX9B 4BSVB 1A7BA 1OTTD 4U31A 4ZAKB 1W0VA 3ARSA 5EEWA 2B14A 1BAFL 2ETWA 2YSSA 4Y2LA 2VLKE 1NPNA 1MFVA 2ROXA 5BV7C 2BPBA 2QPSA 4PY8I 4Y2DB 3ZKMC 5AG8A 5EZJA 5DZAA 1NZRA 1T6BX 4GKLA 4RNRA 2VXQA 3Q2VA 1NAMH 1CLYL 2G2NA 5D1XB 5TE7H 3SGEI 5HD8C 5KYNA 3FFCB 3O2DL 2OMVA 2WBWB 4I48B 3HS8A 4K07A 4K94C 5FA4A 5FFOA 5GGUA 3LRGA 5DLLA 4BWUA 3PV7A 1VRSA 1PKQB 5JDSB 2VH5H 1CDGA 3GUFA 4UDUA 4MLIA 1LE5A 4Z0BH 4A66A 1HL5A 4OFKA 2Z0UA 1U3YA 1R3LA 1GAFL 2WSPA 3HE7A 2WZ0A 4NBYB 3V2AR 2DIBA 2Y06H 1I9EA 1U4FA 3QXAB 4FABH 2DYPD 2QDWA 5IM7B 4B7IA 1PYWB 1D7BA 3ARUA 4Z7UF 5H37G 5I1JL 5LGHL 1IBBA 2YA0A 3FL7A 2P42B 4G43B 1ZVNA 1FRGH 3WFCL 1S7XB 1A14H 1JGUL 3GGWB 1CK0H 3ABMB 5D72H 5DZNA 3RHWK 3ZDZF 2CH8A 1I8KB 5KVFL 2VDKB 4XP5H 1HOCB 2Y7QA 3IWVA 1WBZA 3CVBA 5LHDA 2ENSA 3D25B 1M7IA 4F7EB 5AD0A 4YX2H 2GB2A 1QVOB 5I71C 1U8OA 1E8YA 2NMSA 3BIAX 4X6FA 1KN4L 4AC4A 2E27L 3U7WH 1RP8A 3D52A 4MA8L 4Z77B 3RU8L 4ZW8A 1T04A 1J86A 2WKGA 3LIZA 3BWUC 3HB3D 4JFUA 4YSTA 2HRPH 5ABAA 4NLHA 4WGKA 4L29B 3SDCD 1HI6A 2NXZC 4L37B 4X5WB 3U1QA 5KSVA 2IOIA 3CN1A 1G94A 3NIDB 3UYPA 2NUPB 1LMKA 3LV3B 4H1LB 1RLWA 1A8JH 1T6VN 2YKKA 2B59B 4GP4B 4PYGA 5DC4B 3HR5B 4ZW3A 1ZLSH 1HFUA 4YH6A 5KSAD 4Z7NB 5F6IC 1MNUH 3QJSB 4P57A 3PDDA 5D1XE 1NCAH 4WI0A 1GGBL 3FFCE 3GMOB 4ADJA 4RGMB 3EGDB 3EZJB 2DEWX 1JV2B 2DZEA 3WSQL 3KLSA 3IDXH 1PKQE 1YEJL 5EA0L 2N0KA 2VDOB 1VZHA 5A2BA 5CD3A 4I1RA 3BRFA 3NT0A 2WK2A 4QO1A 4GXVH 3VQLA 1F4XL 2EYRB 2KT6A 2D31B 2XPZA 2W0FB 1N70A 2YUVA 4XPGL 5BCAA 2IH3A 2EDOA 2X7LB 3C09B 3TNNB 5I73B 1BZOA 1YEGL 4YLBA 3FUDA 5L2KD 4G9DB 1J0HA 4WJG3 4FG6C 3DGGA 2I7OA 3ZJAA 1IBGL 4E9WA 2XA3A 4AYBA 4QJ5B 5ID0A 5DHVH 4HS6A 2GT9A 3DBSA 3WJMA 3BAEH 5D7JB 1CE6A 4HC1L 3UPAA 3VE0A 3ZGIA 3VH8A 5SWSE 1B9ZA 1GJUA 3FW6A 2XWJB 4WW2C 2DJMA 3F05A 3K3QA 1FSKC 2R69L 4TUKL 2VABB 5BV7H 4LKCA 1G6RH 1TZGL 1A1OA 1FUNA 4QHMB 3AITA 3BQVA 2W94A 3GXTA 2BSTB 4HIEB 3VQ2C 4XVSH 2AK4E 2ODHA 4HJJH 2VRAA 4AGOA 5IFHH 1KB3A 4A2MA 3NIDE 4QEGA 2UV3A 4P9MH 5DJAB 5J13C 4K94H 3LPPA 3AB0C 4NZ8A 5G4OA 3EYOB 4LFHD 2Z4QB 3W3BA 4HUNB 1JD9A 5HDQL 4IW4C 5C0DA 5JW3L 1XR8B 2HG0A 1ERNA 4GKSB 1OE3A 3HS0B 1MJ8L 1MCSA 4BHUA 2XACC 4AITA 4FL4B 3B37A 3RDTB 1JMZA 4HU2A 5K93A 1IZKA 2OTPA 2YJQA 2ITEA 4LCWD 1NFAA 1JPSH 3X12B 4AIEA 1OW0C 1P9MC 4Z1PA 3HC4H 4XMWA 1FVCA 5IF0A 4PCSA 4A2FA 3Q5TA 3DSNB 1QP1A 1UZ6F 3FC8A 1JPGB 2LLLA 4J27A 4NQEB 2Y69B 4PRAA 3CFKA 5DO8A 1MIEH 1XEDA 5LAPA 1FPTH 1WGOA 2YN5A 1WBYB 4FFYL 5LXVA 4H0IA 3Q2CA 4Q6YA 4O2CB 2P5WB 3S8GB 1K85A 5B8CA 5IG7B 2AXFA 3QIWB 4EXKA 1CC3A 5EV7A 1S5IH 1M1XB 4ONGH 2XLLA 2QHRH 2QSQA 4YDVB 1DJHA 4LSRH 4UMSA 3TBYB 4C56A 3HG3A 5HJGA 2N7AA 2X09A 1EXUB 4Y5YC 3Q48A 4UB0L 4YL9A 1J9TA 5B21A 1ONQA 5EB9A 3HMXL 1EIBA 1MFDL 5BS0D 5IV2A 3HE6C 3JTBA 2K8MA 2P8MA 3LVTA 1T0NB 2DDQL 1KC5L 1ROCA 1LO3H 2KLTA 2L3BA 5JORB 2QKIC 5E8OB 4GSDH 5HYQA 1PAZA 3SD2A 1JVKA 4PN6A 1XF2B 1YJDL 2VL5A 3HG1A 5DJZB 2UZYB 4OGXH 4ONFL 3GJFH 4NQVA 3DJ9A 4NEHB 5H2BA 2N7SA 4HSQA 4MCYB 1KLUA 3KM2A 2LU5A 3DX7B 4P59L 4P05A 2WBJA 2QDVA 3L5WA 3MRCA 3T2LA 5IR1A 1I3GH 1IGYB 2XZAH 1PZSA 1R1CA 4R6UA 1B2YA 3JUZA 1ZT7B 3PQYB 5EZIL 1L4IA 3T1WA 1FLTX 1OSEA 4G7YH 3CX5K 4R3SB 3RNQB 4GLRH 2Z8VC 5AZUA 1I7UA 1CFQB 1PLGL 2V17L 4QOKA 4IRZA 3DV6B 3FTXA 4XT1C 1CB4A 1VCBC 2IEPA 3P54A 1U8IA 4FA7B 5JDJA 5JXEC 1KZQA 4DZ8B 3B9KB 1MFAH 4LHUG 2BS71 1LMIA 1O7VA 1S9VB 4NQEE 4PW4A 1PEWA 2MWCA 3H9SA 3AC0A 3VFUB 5AAPA 4Q9RH 2W9EH 1HESA 5T1JA 1IJNA 3QEGH 3HEIB 2VDRL 1MOEA 3DJTA 4KO9A 3MBED 4O02H 5D2NA 1AC6A 1KWKA 1EEZB 5ALCH 2IFGA 2F5AL 2JE8A 2VLJA 3K74B 3L4XA 3QG7H 4O2FB 2IPKB 4LLMB 4XCEA 3SOBH 2E7HA 1ZSHA 4XMPL 3D08A 1JF1A 4PJ7A 5KTEH 1XGQA 1CU4H 5DJ2B 2ESVA 3CFNA 5DUMH 3L13A 1BZQK 5D2LB 3K2UL 4FFVC 1OAYH 5DZPA 1SFDA 2Y07H 3ULUD 4EZMA 2XWXA 1S7SB 3UXFA 1RUPL 1ZGLB 4H26A 4JFEB 5E8PA 1N5AA 3GSRB 6FABH 2ZXWB 4OV5B 1WIPA 1DBBL 1PQZB 2A74C 1VA9A 1R3JB 1JIBA 4WEBL 1AQDB 4HIQA 4JZNA 4KTDH 1X5MA 4NZUL 3TA3C 3BWAA 3H3PH 3T1FA 2PR4L 1G9MC 4KMTL 5E9DA 3RA7L 4WEEA 3V8CA 3MHZA 4PJCB 2CJSA 3MLSL 4KK9D 4ZPVA 4YXKL 1HKLL 3FDWA 2XSKA 3LKQB 1NMCC 4Z5RA 3FAXA 1BQLH 1O6SA 5GRUL 3BPCB 5D5MA 4LRNL 4X9BA 3W37A 2NT1A 4X9GA 1FP5A 2HKHL 4HCRH 4Z23A 1NANI 3GF8A 3V5KA 2UZPA 4A2DA 1J9QA 2VKWA 4UM8A 3RLSA 2FQGA 2VN6A 3D4ZA 5DR5L 5IJDC 5ACZB 5CD5D 5CFAA 3JBG7 3SGJA 2WVTA 5HHQB 3S35X 1TU2B 2F7PA 4XNDA 1DLHB 1E67A 3S35H 3D8MA 5ETUB 5DJCB 4Y16B 1KCBA 1KV3A 1OP9A 1T83C 1SXBA 4S0SD 1XSKA 4ZOBA 2YPLA 3OBAA 2EDQA 3CDGA 4KQ0A 4BZ1H 1Q94A 4PYHA 4CRPA 1FYTB 2APSA 5LCVA 1RJLA 4JPWL 4LOUD 3L7EB 1NC4B 3PGDA 4PPTA 3UL4A 5HHMB 3KYKH 5D2LE 1EHKB 1AZUA 2A9AA 3V0HA 3H7BA 1X7QA 3A0OA 4TUOA 4K8RD 1E7UA 3U0TA 1I1AC 3MV8D 4JFEE 1I8IB 1TJGL 2VAAA 2H3XC 5IBTH 1TKWB 5GS1A 3OZ9H 1Z3GL 4HD9A 2Y36H 2AEPH 3DYPA 5IFJA 1IAMA 5I24A 5LO7A 1DTUA 2IDUA 3ASOB 4CSZA 1MDTA 2PABA 2VDQH 2O61A 4BUGA 3UG3A 4YHNA 3MRNB 2G75B 5IJKA 3VD4A 3RIAK 2V5TA 3HKZA 4PTUB 2NLJA 5C0IA 1VFBA 3DIVA 4MCMA 3ZKSD 3C6LC 1OAQL 1X3DA 2P5ED 1UACL 5DMKA 1ZWIB 4L3FA 4U6VL 4L2YA 4P4RB 4UT7L 3RZCC 5A3IC 2YWZA 2V8MA 1D6VL 4H1LG 2FX7H 4JCWA 2I9TB 5I6LA 4YWGL 4TN9A 4X6BA 2FLBT 4UTBL 3TZVD 1M6UA 2Z9TA 1U8LA 3U9WA 3BH4A 1X6LA 4D0BB 2AJUL 2L8AA 2XIIA 3LH2L 4UUJB 2YEZA 1FORH 3B56A 1BFVL 3P4MB 3O6FD 4TSAL 1Z9NA 1ICTA 3IM1A 4LLWA 2OP4H 4Y0GA 3U7AA 2K78A 2A9CA 4OQ1A 4XAKE 4Y5XA 4YEFA 3L1GA 1XX9C 5DYOA 1HZLA 5MP6L 2JELH 3WUWB 3E3QE 2VL4A 1KB9J 4GP8B 3ARBA 3DVGA 4YXLH 3WI9A 4XH2A 3RP1A 1A4CA 1FBIH 1FYTE 2MCAA 3E8UH 5IVXF 2D3JA 4YSDA 4OZFH 1ZGLM 3ALXA 2IIJA 5F7YC 3ZE0B 3B8SA 1BP3B 2JKNA 1DR9A 3GO1H 4FLQA 1AOHA 2CD0A 4L4TD 1G9MH 4J23A 3ZKXB 2C9XA 2CIIB 5BZDB 1NIEA 1NUDA 4JE0A 4KKLD 4XWGL 5I2IB 2HRHA 1ZTXH 4RMTA 2JJVA 3LQAC 3O11A 4Q6KA 1Q9OB 3NFPA 3EFFA 3N91A 4NZRL 4NOFA 1I31A 1BD2A 2R56L 5DVMA 2DQFA 1RZ8A 3QARA 5EMYA 3U30C 4JFTA 2GSGB 5GRJH 4JO8A 5AAWA 4RMSA 3TPUB 3QS2A 3PHQA 1EDQA 5JPMA 1CUOA 1F4YH 2VDNH 2ZXQA 3SE8H 3B7YA 3C5SA 3HNVH 3OHXA 4TOYL 3L9BA 5ITBL 3D0VA 3KPSB 3KPRB 2ZAGA 1J12A 1DQJB 2IQ9L 5EUOB 2A6JB 3LKPA 3DUHA 1EJFA 4UV4L 4FQXA 1IBYA 4V1DB 1TTGA 4RIRA 1CR9L 2VDKL 4OLXH 2ATKA 3QUMA 2DRUA 3ZE1F 4JM2D 1KIPA 2HTKD 4Q2ZA 5B7MA 1MELA 3N44F 2APXA 4F9PA 1Q9LA 4P5KB 4GAYA 4XBEL 3ULSB 1RU9L 5I74C 3T0XA 5I26A 1P4IH 2HVJB 3NUKA 2L4OA 3GXMA 2R2HB 5F9OH 1DE4B 1KTDA 1LDPH 3QWQB 4N1HB 4E68A 3GXUB 4PEEA 2XV3A 2AXWA 5DDHA 5FUZL 2V2XB 3RVXD 2ZQKA 1A9BB 4XB7A 3U4EA 2Q7NA 5C2BH 1JGIA 1L9PA 1KJ3L 3LZLA 1M9WA 4DKAA 3LY6A 1DFBL 4PY7B 1A3ZA 1E9QA 5FGBC 4F37F 3BH9B 3U46A 3BKCL 3ZE0E 2PP7A 1XGYL 2ZWYA 5D93C 4ZTPL 4G8GD 5AW4B 1U58B 4NB7A 2J2ZB 4ODBD 5EO9B 3UJTL 3RY5A 2HTLD 3MCLH 4AKOA 1AANA 1JFQH 3EOAB 2WW8A 3GXDA 5E2JA 3MZTA 4ODSH 1F90H 1IGIL 1D7FA 2H2SD 2HFFA 2ZOKA 4NQDB 3V0GA 4X98B 1CGSL 3NEEA 4QHLB 4CU8A 2VDOL 3LHPH 4KRPC 3I2CH 4R4BA 3QZWA 1KJVA 2WLYA 3NAAH 2F15A 4K7FA 1YMMA 4PG2C 5T5NF 5CJOH 2XZCL 2VB5A 2UY7A 1INDH 5DWUH 1X4XA 4DNLA 1I1CA 1QO3B 3KPSE 5T33H 1IILE 3FB5B 4PJIA 2WWNA 3KPRE 3AJ7A 4CJ0A 4H25B 5DUBB 4ZFFB 1II4E 5IZ7A 1PSKL 4NYLA 5EUOE 4AQ8A 5IIEB 1DSFL 1NSNL 3NZ8B 3SKNA 2YAHA 3GRWL 3FYEB 4PJ5B 4V1DE 4XXDB 3VFRA 3O4OB 5TDPB 3EYQD 3RTQD 3IFOA 5EOTA 4MJ5A 4N25A 3OJDB 1IGMH 5KBKA 3OZLA 3LS5H 3U2IA 3QCTL 4NNXB 1ZJAA 5KZCB 2MQCA 2R0ZL 4I3SH 2BXYA 1OPGH 3NZHL 3S5ZA 1OD9A 4MRCA 2ZCLL 4QPEA 2EYTB 2MCMA 2ZP9A 2E5EA 3ISYA 3KNBB 2IALB 2VLLB 2P1YA 4BDVA 2BOLA 4JDZA 3LQAH 4KX7A 4NM8L 3ZLQC 3KYAA 4E42B 1ZHNA 2DW5A 1H15B 1M3JA 3TJHD 1C8QA 4NC0B 1WPCA 4XNXH 3T0DA 1XMWA 1BEYH 4P23A 2XA8L 2EDEA 2BIIA 3B7UX 4EN2A 2EAEA 3IJ7A 1F18A 4M61A 2CSPA 4G7RB 1NCWL 3SBQA 1DQQB 1MFUA 3SDYH 3T77B 3T8XA 1JZ5A 1NC2B 4GQ9H 1O7DC 1X9RA 4PJ8D 2ZP0T 3WNIA 4PJAA 2BNRD 1U8PA 3EG9B 3K8KA 4NQDE 4OCRL 4WY7H 4MMYB 1EHLL 4M7LH 1AD9B 4MX7B 4JO4H 4CMMA 4XVJH 3L95B 1I9JL 2FL5A 5HPMA 2ADFL 3UO1H 2GBUA 1K8DA 2YLKA 3QW9A 4JFWA 4X7EC 3VW3L 4LEXH 5A40E 5CZRA 5IFAH 2BSED 5G4NA 4OM0H 1CF8L 1KIRA 3M1BB 2IPUK 4CN4A 4NNPL 2P8LA 4N28A 3BUIA 3HAEA 4WI4A 2Q76B 1T0MB 1GPOL 4FQCL 1S78C 4HJ0C 5AKVA 4FCAA 5C6TL 4AT6A 3MUZ1 5GJSH 3IRZA 4JREC 4DP9X 4QRQA 4HIJA 3FS9A 1QEWB 2FGZA 3AXIA 3KYOA 3PYCA 5CO1A 2QADC 2VWEC 4F8LA 2CU9A 2FHFA 5IQ7L 3NA9H 3N43B 1AZRA 3RGVD 3OR6A 2N1TE 4U2ZA 2EVGA 2D7QA 1EH9A 3OKLA 4FQHA 4KC3B 2M83A 3T2QA 4JG1L 1GOFA 1OZTG 3IDUA 1OP5H 1FNAA 3LN9A 3QORB 4MXWH 3G7TA 1FV1A 4XGZA 3CIQA 3F6IA 5CJQH 4KQ4H 3FCTB 3Q6FB 1J05B 1EO8H 4S0TD 4FTVB 3AAZA 5HHNB 4U1HB 4P2RD 2XXMB 2PXYD 2ADYA 4WJ5B 2V3EA 4R7LA 1FI8C 3CSYB 1KN2H 1BDYA 1LNUB 4FXLA 1ES0B 1MCHA 4EQ2A 4QXTB 4MTMA 4N24A 4P2QD 2V0AA 5CP3A 3MOQA 3LN4B 1PNCA 2BW4A 2CBTA 4WFGE 4U0QB 3A67L 2AEWA 4Y19A 5DHDA 3NCBB 2UXVA 3WGUB 3H3BC 4B6ZA 1JRHL 4H20H 4GUCA 1JFHA 2DB8A 1RY7B 3EHBD 4KROB 1BQUA 2B7DT 1GC1C 4WDIB 3H4HA 3WEXA 2B9AA 1XDTT 1K2DB 4OZIB 3ESMA 3V0VA 5INCA 3EOBB 1I3UA 1CQKA 1KCRL 4NWTH 1Z5YD 4PRHB 1YEKH 2PETA 3C12A 5IVNA 2WPGA 3BEVA 2PYED 3B1TA 1EXGA 5AW0B 4TNVF 3MREA 1NGZA 4OI8A 1Z9MA 4M43H 5IK3A 4FYQA 1E28B 2PLTA 5I8EB 4HG4K 5F1NB 3AROA 4IOIB 3X2QB 3FPXA 3CFEA 3VA6A 1S7WA 4DCQA 1JNLH 2YD0A 1YMHB 3MGTB 4HS8H 1D6EB 1P4UA 4U1SA 3SGKA 2XN0A 3TEZA 3VGFA 5ABZA 5KYYA 2FO4B 3QJXA 3FO1A 4HWZB 3TNMB 5E1QA 2IJ0C 3FU7B 4YLQT 5MEQB 2FEDD 4IJ3B 3QJQB 1JHTA 1W91A 5GS0C 3QH3A 4JFOA 5E9NA 4WNQA 1YEFL 2LFEA 1OAKL 4WHTB 1K9TA 1USQA 4RLDA 3TN0D 5DZVA 1IAIM 1T66C 1WAAF 2C3WA 4FTVE 1JK9A 1UOKA 4YNYB 2VN4A 3CFIC 1MCWW 5J12B 2Y1ZA 5FF6B 2LVEA 4PJGA 3QRLA 3GKZA 2HSIA 4QT5B 3BN3B 3MRFB 3GZQA 5JHBA 3D9AL 3BWUF 2EDKA 2J1YA 1YA5A 5DJXA 3F8UB 4GQRA 2J5LB 2JIXB 1NUGA 3MZGB 3WUWG 32C2B 1HHHA 3VFMA 3OAUL 3TT3L 5HHPB 3QGVA 2D7OA 3PFUA 4RMRA 4JO1L 2OMUA 2DS4A 4DFHA 2O72A 4PUBL 3WIIH 4Y5VA 3GMPB 4OZIE 1WQVT 4IGBB 4EUPA 3KJ4B 1JTPA 3DX9A 2GJPA 4NO5B 2F7RA 3WNJA 5JIDA 2XWRA 4PRHE 1OAUL 5BJTB 5JUEL 5LKNA 4Q6IB 1TQVA 3ZL2A 4HLZG 3NCXA 3SCMA 1J8HA 1G7JA 4AKQA 3TFKD 4UU9A 1TETL 1CE1L 2RD0A 4PJDA 2CKBH 4S0HA 2E46A 2ZXBA 3WOVA 3QEQB 2CO7B 3BP6A 3NEXA 2P47B 4HULB 4XMTA 3L3HA 3QRBA 4X80H 1KY7A 4JAMB 3AMKA 4O9HH 3IEAA 5B7FA 3M07A 1MHEB 2EXWD 2OJEB 3QC6X 4F3FB 2P9RA 4HJIA 1VKXB 4IRSD 2A2QT 2HN7A 4FTDA 1KJ2A 2AP2A 4PSRA 3IBEA 5FLUA 2Q9OA 2EIBA 2BRRL 5I1GH 2ZCHL 1TO5A 1UADC 2G5BA 3DYMA 4FKHA 4N5UA 2XN9A 3ZZLA 5M95B 4PI2A 5L4JA 4UQEA 1IRAY 5HYSA 4JKNA 1RV6X 4WW2F 5DTFA 3E80A 4QI3A 1GC1H 1VZGA 5AW6B 5TF1L 3FQUA 4RDQG 3SBWA 1QA9B 3HPLB 3V4VA 3DI3B 1EAQA 4F8PA 3B4NA 3EIFA 2OJ1A 4ELME 3N1QC 1LO5B 4B3EA 4MDJB 2DKMA 3F6JA 1P2CA 2VXSH 1DL7L 3OJMB 2V9RA 2ZWNA 3GTNA 2VLMD 5T1LD 3PF2A 3AG4B 2NZ9C 4LCUA 2Q10A 1ACYH 2WINA 4NIKB 3QXWA 3C5JA 1M6OB 3F7LA 4LBAA 2NY7L 1WA0X 1JPFB 1CGVA 1WHPA 1IM3B 4XC1L 1AACA 3DA0A 4P2AA 4ZXBD 4P2OB 3EJPA 1S7VA 2OZNA 1S9YB 3EDFA 3WIHA 4A04A 2FQFA 4ELKB 2VE6B 1TJHH 3UACA 3VWKC 3ZX1A 1UKTA 2HT4D 3BT2H 3INUH 5GS0H 3GM8A 2A38A 1W8EA 1TYJA 1CXLA 3FB7B 1MCWM 4HAGA 4FLHA 3BKYL 4FNQA 3QEQE 1TZIA 1LEKA 5I19H 2AQRA 1U91B 1WCBA 3GIZH 3OLDA 1C8PA 2A4EA 5IB3A 1MHHA 4PMEA 2NCEA 1OAXH 3T3ME 3HC0B 1V55B 2K3TA 1A2YA 1IJ9A 3HIZA 4Z8FH 1A3QA 1WTLA 4JY4B 2X4NB 4IIQC 4OF8A 4NQXA 2R2EA 4AIZB 4GW5A 3KPQB 4WI8A 4ZUUA 3T4AC 5HY9B 4P8QA 4L9LB 1BEXA 5DD1L 3WMPA 4BCZA 3WFBH 4XPBH 5JQHC 4BYHA 2WLKA 3KWWA 2XU9A 5FYLE 4ZUTA 5D1QC 3EO9L 3O2VL 4XNMB 1PG7X 3RWGA 1PG7H 3HNTL 2NY0B 3TOPA 3HZKA 1N19A 4AV0A 1H8SA 3CVHH 4K9JA 1NIBA 2DM2A 4M3KB 3HZMA 1NGPH 2BK8A 2AJSH 3SIKA 4LDOB 3ZT7A 1FFTB 4DQOH 1O5DT 4UTAL 1RJZA 4R4FL 5AYUH 1JGEB 4P5TA 1T1XA 3D85B 4RAUB 1X5YA 3HG2A 4G8EA 5IBLC 2F58L 3KPLA 3GRBA 3D2UA 1KJMA 3JVGA 3LXAA 3S9DB 3OV6A 3P0GB 4G5AA 5CGBA 5FO7A 3O9WC 3F6LA 1HJBC 1TEYA 2VRQA 4HHGA 4LMQI 5E0FA 3WXVH 4RSVA 2ADIB 5D7LD 4HBQA 3WEMA 4A63A 4HZLA 4YE0A 2B08A 4LOFA 4ZFOB 1H6EA 4ZTOH 5F9WC 1I9RL 3QNZB 2ZOLA 1LK2A 2ZJSL 1SFHA 1L9TA 2LW3A 3OAZH 1CXIA 4UQ2B 4DP4X 4K2UH 4NP9A 5KJRL 3LRSB 5IOPB 1BIHA 3DPBA 3HHRB 5IHUL 4QRTB 1O9WA 2ZWKA 1P84J 3C6SA 2IF7A 1FZKA 1SEBA 1ZHBA 1IBZA 5I1LA 3PDOA 4B60A 2WZ5A 3BISA 2AQTA 3BGFC 2IWEA 5BW7C 5DJ6A 5LG6A 1EO5A 3MACH 1MWAA 4JJHA 3NH7L 5DD0H 5FYJH 4BRVA 1L5GB 1GTFA 3DXAA 2NY1D 4MNQB 4LZKA 4OF7A 4BKSC 4KAQL 3NFSL 5ENWA 4MXVF 4XXCC 4B5ZA 2PTTA 4EMZA 3DDFA 4QYAA 2A77H 1A3RL 4JO3L 5FA3B 4ZNEA 4UOQA 5CGMA 4YSAA 5I75B 3RVUC 4FNRA 2EC9T 1C16A 1OPOA 2XFXB 2APWA 4WV1C 4LVOC 3ZQ9A 1P7QA 4DT2A 4PB9L 1EFQA 1NPJA 4GUPB 2IFFL 1X5XA 3CHRA 4PJFA 4PLKC 1W72A 2NY6B 3HHSA 4X0KB 2BJMH 4KZDL 2F53A 4ZD3H 4B7LA 4XC3H 5SWZB 1WG3A 2A4ZA 2XXCB 4U6XB 3GSNH 5FGSA 5K1VA 3MV9D 4WFED 4IQHA 5B3JE 2ZCKL 3F12B 3K6OA 2CHXA 1IE4A 2NY2C 4NKIL 3GEFA 3TJEL 3CFJB 4GRMA 1GY2A 5B3NA 2KZKA 2W92A 3BI9X 4F33A 3VACA 3WS3B 4NQCE 3SEPA 1EPFA 1S3RA 2NNRA 2CHDA 5C3LD 4LGPB 1H3WM 5F3HA 5TD4A 2QL1A 3TH3T 3V6ZA 4GW4A 4PJEB 2OMVB 5IROC 1UKQA 3QAZC 4JFPB 4GAGL 2XHNA 5DC9B 2DQTL 5EG6C 2GSIB 4OF6A 2K6WA 4FLRA 4XMVA 1IAIL 4OF3A 1OOAA 1YQVL 2V33A 4W9HC 4JRYD 4XNYH 4N3TA 4OGAD 3UYRH 2J3SA 4R7DB 2Z1PA 5D7HA 3KEHA 5FUOH 2VM3A 4JVUA 4L8BA 2XTJE 3V7MA 1E4JA 3G6JA 2Z31B 3ARWA 3NPSB 5FHBH 4DGVL 4ZG1A 3CQFA 5FFGA 4GKNB 5I0ZA 4MNHA 4AMKL 4PJXA 4WTZA 1SMDA 2F18A 1K4CB 5FCUH 1WFIA 2J56A 1NDTA 2JKJA 4LSTL 4N0FA 4XRCB 4YK4C 3VA2C 2DICA 4MNQE 4FQLH 2O5NA 3MLWL 1M7IB 2XVGA 3ULAB 3VSTA 1TTBA 2Z8SA 3VI3E 1PZUB 4X6FB 3L6FA 3OKNB 1O5PA 3EF7A 2X4TB 2QJDA 1JD7A 1ZMYA 5I6XC 1IC5H 2ZX6A 2GJZB 1E50A 1A0QL 7FABH 1PJ9A 2QKSA 1NGYB 5AVTB 1W15A 5C0CA 4OM1H 3UTPD 5ILTL 1HZHH 3MBWB 4BQ9A 1QMUA 4J1UB 5SWZE 3UYPB 4QHUB 3K5SA 2CQVA 4FMKA 1XVSA 1MCCA 4NZFA 2DEXX 5HXMA 1NCBL 4WO4B 4K4KA 3TBCA 3BIBX 4G70B 3UJJH 4JMNA 3M17A 2B3RA 5BRPA 3D69A 4POZD 3S5LA 2H7WA 3HI6L 3QO0B 3HNSH 2CIKA 5JNYB 1DQVA 4BFIB 4IRJA 3IMUA 4RFNC 4YVUA 4PJEE 3KPTA 4FHBD 4JRWA 2ZUQB 1BLNA 3ME0A 4AQ1C 4JPKL 3QCVL 1FC2D 4C57C 1PW3A 1DQDH 3QDMB 5F71A 1SMOA 1IGTB 1T22B 3U36B 3GIVB 4GOSA 4QO1B 1CI3M 1CDCA 1CVSC 1Y0LA 2NY4D 2CR3A 3KVDD 2JMRA 1EEYA 2EKSA 4OZHB 3R06A 1I8AA 1OGAA 5CSBA 4Z7UA 2YKLL 1OAJA 1SLVA 2VERA 3DMMB 3UADA 4NOBA 4ABUA 4WUUD 3V5DA 4U3XA 4FADA 2EC9U 3ETTA 4Y4FA 3STLA 5LN4A 1YN6B 3DGGB 3RI5F 2ZTBA 2EVJA 1OCRB 1NKRA 4HDIB 4JO5A 4F15B 4LLDB 3H9HA 2PF6A 2GT9B 3ZDXF 3PGCA 5CCGE 5ID0B 1NL0H 3HUJE 2IDSA 5K9KB 4XP9L 3F7YA 4G42A 3MV01 1TZHA 4KDTA 1F2QA 2A73A 1GGUA 3VE0B 3GXFA 2RMNA 1A7QL 2OCFD 2YC1A 4KK5D 4AIOA 3AREB 5A16A 4OBSA 1IO4C 5HGDA 2IAMA 4LKCB 3ARPA 1BAFH 3G5XB 1GY1A 2FZ3A 3K6IA 4F7KA 1GMIA 1ESOA 3NPZB 4OIIH 3RFZA 4TF4A 3RL2B 1D5ZA 3RBSA 1CLYH 4JL1A 3IRCA 8PAZA 2NX5B 1QRKA 4JLRA 3JSSA 3D7PA 3PJNA 4G59C 2HFEA 4KTEL 1Q0YH 5BQDA 1AHMA 1MUJA 2CA3A 3ZW3A 5C0DB 3S2CA 4JDVA 1U8CA 2W5PA 4PBWD 3ZBMA 2W80C 3B2MA 4DTGH 4QLWA 5MEOA 5KVGL 5C08A 3D3VA 1WIOA 1I8MA 1XF3A 5I1JH 2ICCA 5LGHH 1EGJA 4PJ9C 2PPDA 3QDME 2N56A 5C0NC 1E4XH 2K70A 3MV7A 1FVCB 5DQDL 5IF0B 3S3BB 2VCOA 4HZAA 2XVKA 4OZHE 2CA4A 4PRBA 2YRBA 3U4BL 1SXNA 2EIEA 3L5HA 4KMLB 2AZUA 3DGCR 2QQNH 3U6XS 1KV7A 1HQRB 1JZHA 1WHOA 3AMLA 4O2EB 4QXWA 5IQ9A 4Q97A 2XQYG 1LP9F 3CVCA 4MD4B 1IQWL 2NY3C 3LZFH 4ZFGL 5B8CB 5LGKA 2UZXA 5F9JA 2Z91A 4RRPM 3UBHA 4EI6A 1J5IA 2AXFB 2E27H 3CN4A 4MA8H 1DN0B 3BAKA 5CFHA 5IHZB 3RU8H 4JQIL 2JKSA 3Q9QA 5F3FA 1I1YA 1A6ZA 4TQHA 5F89B 2GJ6A 2DJUA 4S1QL 3WTUA 2FBJL 3EJUA 2GFBA 4NN6C 4MSWA 2GY5A 1FLRH 2VXTH 4HAKA 4RBPK 4JFZL 2JK5A 2AJ3A 4NO2A 5EPMA 3GZPA 4FNLH 5EU5B 5GZND 2VDLH 4TV3A 3RY6C 3CIAA 3H1ZA 5K1JA 3FSZA 3TL5A 1G7HB 1K6QL 1BJMA 3OLIA 3QUZB 3RIFF 1JS4A 3FQTA 2DQUH 1GXEA 2IGFL 4QHNA 1JCKA 2ARWA 2YD3A 3C60A 3IF1B 3UG5A 3W0WA 1FNEB 1KB5B 3P2TA 2VL5B 3HG1B 1GGBH 2NX5E 1NFKA 1F11B 1YJDC 4N0CD 3WSQH 3QS3A 1YEJH 5EA0H 2B8OT 4GAJH 5DMIL 3L4UA 2OX5A 2FR4A 5F7LB 3MRCB 4HJUA 4KUCF 3WTWA 1JWUA 4KVCL 3MLUH 3BPLC 1N59A 3GB7A 4ACTA 2OSWA 5FKAB 3CZGA 4GW1A 4APXA 4EI5A 1E3FA 1RULL 5FYLL 4G9FA 2GSMB 3QUHA 1AH1A 4QF1B 2YOAA 4ELDA 1P4LA 2OZ4A 3RX8A 4HUUA 3VWJB 4Q8BA 2BVOA 1RFDL 5AOJA 1D2OA 4KTGA 5ICYA 3RURA 3IXTB 1EFXD 1PCXA 1T1ZB 2CUMA 3REVA 1BMWA 1JG9A 1IGFL 5IY5B 3C5ZC 1BJ8A 4G7SB 1YN7A 3LPGA 3GBDA 4MAYC 4MS8D 2W88A 4F24A 2VIRA 2ERJC 3O4LA 3SE9H 2VLJB 4XCEB 3SPIA 4DUXA 4QXVA 4TUKH 1MCNA 1E4HA 2EZ0C 2EDHA 1QLEB 3QHTC 1JF1B 3QPQC 5H37H 1JZ7A 4YFLF 4X50A 2WNKA 3AS0A 4RGNE 4CC4A 4UOJA 2BHFA 1XGPA 5CU5A 3O0RH 4IMKC 1M71A 2BNQE 1IKFL 4N2IA 5T1KD 2NW3A 1N5AB 1MVYA 43CAB 1GZQB 5AZ2H 1S8DB 5TE4L 3G04A 4JS7A 3NJVA 3SY6A 2JQAA 5CJXA 4DVBB 4Y4KC 4TUJA 4LCYA 3ZHNA 3QDJE 4GG6B 1SJEB 2FO8A 5AB2A 3SDDB 4J3TA 4PY8J 2P45B 1A8ZA 4KI5C 3FOLB 2A6DB 5ICUA 2A0LD 3AGWA 2ZOOA 2RFXB 3QUYD 5D4IA 4KVPA 3QE5A 3IWUA 4XP6L 3KPNA 3MI6A 2JB6A 5HGAA 3QQ3A 1KGXA 2GQHA 3QPXL 1FVDA 3V5KB 1LL1A 2OMXA 3K91A 4WW1A 4FFWC 1DVSA 3OF6A 4JN2A 2DQDH 4UM8B 4P9HL 3ZPDA 2XTSA 1ORSA 4RMBA 3CFDA 1BWWA 1QPKA 5E6RB 1KXQE 1MFCH 4P07A 3IVKA 3WFDL 3BQUD 1AGDA 5C0GA 4MJ6A 5MENB 3F7VB 4UB0H 1JZJA 3WO3B 2EIKB 1QSVA 4WTXA 3WIFA 1MFDH 2YPLB 4BZ2H 2E4TA 1RUMH 4NKOA 5BOZG 2HFTA 1Q94B 4YQXH 3NFNB 3RWCB 4O4YL 2J8OA 4YN3A 2H6PA 2E8YA 3ABGA 3F00A 3PAYA 4PS7A 2F54D 3RVWC 5EFIA 2EECA 4WEMB 5CZXD 3DETC 5EF1A 1YJDH 1FHNA 1LM8V 3U0TB 4F8NA 4ONFH 4P46B 3CH1B 2OW6A 3QRGL 4NT6A 1BVLA 2AKRA 4P59H 4G6KH 5I0YA 4HIHA 2X9WA 3RWHB 1JYWA 5DVLA 3SODB 1AXIB 4RRPG 3S96A 4PRPB 4GG6E 3ZMRA 3UGEA 1ZLUK 4FQIL 5D96C 1WS7A 3L9EA 4UCFA 1A9VA 3QR2A 2YGPA 4AI7A 1CD0A 3P9LA 5I28A 2YOCA 2W8CA 5F88A 2H8PB 5ESAA 4L4VB 5IEHA 2LFGA 3LB6C 5EZLA 1GGCH 1SBSL 4XHJC 1Z7JA 4F37K 4KKAC 3R18A 1PLGH 2CLVB 2JCCB 3GMQA 5D1ZC 3UTSD 3VXRD 4YSCA 4MBRA 3RKDC 5J1TC 4ZUVB 1EWHA 4KI1A 4WI9A 2VXQH 5DC2A 3IJEB 5HBBA 3A5VA 4OTXL 2G4GA 3CFBB 2IANA 4X6BB 5FAAA 4NQQA 2NTFA 3V4UH 2VXUL 1M9SA 1U8LB 3CVIL 4MMXC 3UTTE 3S88L 4H0GA 4MMZB 5E5UB 2VDRH 4GBXC 2IWKA 3OTTA 3AY4C 4XOCA 3PP4L 3LQZB 4NO3A 3AT0A 5AWNL 5DK2A 1R47A 4XZ4A 1VJSA 2B5IC 5MENE 1N6VA 3SZ6A 5HHOB 1JNNL 4IOSD 5EBLB 5EIQA 4L23A 3KYMB 1F4WH 5J1AB 4EXPX 3K2UH 2NXYC 1BQ5A 4JN1L 1ZLWH 5F0JB 5FO9A 4HUVA 3ARBB 4TQPA 1K3ZA 1X5KA 3QQXA 1CFBA 1DBBH 3JQOB 1IFGA 4WEBH 4OI7A 4TSCH 3KXFD 4XPFL 5E6IB 4ZAKC 2VQTA 3IGLA 1EEQA 4G72B 5JOPE 5K9QG 4Y2DC 1U8HA 1QRND 3Q05A 1CI5A 3A47A 3RA7H 3W81A 4IK6A 3O11B 1MI5A 4HIIA 4YXKH 3EJZD 2EO9A 1LO0L 5D1XC 1ZXQA 4Z7QF 4GIAA 3N5AA 2BY1A 1H3VA 4Z9KB 2FDBP 4Z78B 4Y7MA 3G5ZA 4XOEA 2BZ7A 4PRPE 1P1ZA 3LYRA 5GRUH 4HVBA 4APQC 4N6RA 4LRNH 1JV5A 2AJYL 4LHUD 1UENA 4X7SH 1IAKB 3U9UA 3PHQB 2H2PD 2HKHH 5JPMB 1AYRA 1QKZH 2X4QA 3K81A 3F58L 4CBZA 2F6AA 4L4VE 4IMLA 4EZJA 3C5SB 2I85A 3VFTB 5GGTA 2ADJB 1HCVA 2JCCE 5F3BA 1DQLL 3EJJX 5DR5H 1BREA 1RHHA 1QATA 4JPSA 4NERA 3DTXB 1HT6A 2DWDA 1Q4NX 2QT6A 3NJHA 1RH8A 1JZ4A 3T0EA 3NCMA 2FNBA 3QUMB 4AUJA 4Q2ZB 3WYRA 5K59F 1OHZA 1BVNP 1ZLDA 3TYGL 3PS6A 3GUTA 2X4OA 5D9SA 1J9SA 5JYMA 3QHFL 1KTDB 1XGRA 4W9GC 1OGSA 1HH6A 2GIYA 4AQEB 4X4YB 5DD3L 4E9YA 1PPIA 4POUB 2EH7L 2TRYA 5GGRA 4ZDHB 3V9CA 5DDHB 1B2WL 3US9A 5HHOE 3CZSA 1NDMA 1G4MA 4YHML 3ARTA 3U4EB 4A7SA 5IVXA 5DFAA 1YY9C 1JTTA 4GT7A 4OD1L 5L88L 5CN1A 3S4SA 3FBQA 1E9QB 1TJGH 5K9OA 2VSKB 4OJEH 5FM5M 1BX2B 3HRZB 3LTVA 4FI8A 3QI9D 1WUZA 3B2UD 3WLBA 4MD0B 4W9CC 2PW1A 4JJ5A 1HQ4A 2DYPB 2P26A 1QBMH 4PRDB 4U33A 3DX0A 2W1NA 2ZG2A 1H5BA 1NFDB 5A2FA 2FVNA 1KXVC 3KLDA 1F97A 2F5BL 1FO0A 3PABA 4AJWA 1TDQA 3WENA 3I9PA 2PO6A 1FA4A 2WB1A 2BP0A 3CLEL 3LEVL 3RUGA 1TSHA 4FYSA 4RGMC 4U6YB 1BW8A 4JFHD 1OAQH 5IB5A 5D1XD 1RD6A 4U6VH 2GJJA 2IOMA 2R83A 4UT7H 3KGTA 4HWEH 1D6VH 2X6CA 1YMMB 1NUNB 3VFWA 4NRZA 3Q3GB 4CAGA 1LEIA 4J3OG 3W5MA 3HB3B 1ZT1B 3C09C 4PJIB 5GRVL 2AJUH 1AP2B 5DT1L 5EC1A 4Z76A 3EYSL 4RX4D 3X14A 2AS5M 1BFVH 1A1NA 2LT9A 3WBDA 1N7MH 4YFLI 5C9JB 1Y07A 3BXNA 5EOTB 5TDOB 2ZUUA 2WQ8A 4PB0H 3CHXA 3VGDA 2DQJL 2YMXL 1MJJA 3NTCL 5D7JC 5E7BA 5C09D 1ZGLP 3DX6B 4PRIA 5C3TA 5KSAB 1GCYA 2YBRA 4XODA 1FFPB 3T2OA 4NN7B 3V55A 1GRWA 3GI9L 3T4YA 1FFNB 3FTYA 4YIQB 1BFOA 3KGUA 3PHOA 3QNXA 2J8UF 2NYYD 1UB6A 4TNVK 4ODWB 5SV3A 5JPNA 1JTOA 2EILB 5F7AA 4BDVB 4PGEA 4XWGH 2O5YH 2ORBL 2IH1A 4WQOA 4LOVA 1AGBB 1BAWA 3FXIC 2AI0H 5CGYC 4XO3A 1XSOA 4GG8A 1PL3A 2EUVA 3MTRA 4LL4A 4NZRH 4Y4HA 5CWSA 4R5XA 3V7AE 4Q56A 4BV1A 5CAYB 1KBWA 2ARJA 1IC0A 2R56H 4M61B 4JFYA 2Z6FA 3DRQA 3MJGX 5L2KB 1G84A 3TWYA 2OQJB 1NFDE 3ILPA 4CU7A 1NBVH 4FMVA 3VFVB 4PJAB 3N42F 5ESVB 4M6NH 3L5JA 1V10A 3GRGA 2COQA 2OTUB 3JTTA 3RDTC 1T89A 3TVMA 2FL5B 2OBGA 3V6OE 3ZDYB 3ZL4L 3ZKND 1I85C 3PJLA 2OXGB 2J6EA 4UV4H 2OYLA 1JN6A 2X70B 4JKPL 1CR9H 4G3YL 5BOJA 2P8LB 1L9RA 4JO2L 5KSUA 1FZOB 1KTLA 4XBEH 3TTSA 3CD4A 1F56A 1V54B 2LHAA 4JHUA 5EZPA 1YVLA 2NSQA 3FF8A 4FHKA 2CDEA 1NAMA 3FH7A 2H3NB 3NDYE 5FM4A 1U8MA 1CFNB 4P4KA 4D8PA 2N01B 1KBKA 1YNLL 1E8XA 4DK5A 2EDWA 1INQA 1AQKL 2BVQA 1KJ3H 2XQBL 3VXMD 2WWMC 4PJBF 3W9EA 1DFBH 3CHOA 4J4PA 3BKCH 2Y5EA 1XGYH 2M2DA 4U3CA 2FHBA 1FV1B 3HBPA 3RPIA 2G9KA 4ZTPH 4CVZA 2GEQA 3RGHA 2Z35B 4AYDC 5JIQA 1N6QL 4C58B 2FBOJ 2QV2A 3AAZB 3UJTH 2H1PL 3ARGA 5DLML 5C92A 4LCWB 2JXMB 4X4XB 5CUSL 3GJFK 4QXGH 5G5DB 2WXFA 3P30L 3I3EA 5JXAL 1KB5L 3N41B 1QFWH 4ENED 2I69A 4G6JL 4LARH 2FT8A 4RGOH 4WEUD 3P73A 2HH0H 1F00I 3NDZE 3ZYJA 1KLFB 1WT5C 1DCLA 2BOBA 2EDFA 4FXGA 4GI8A 4LPCA 5L2KE 5DZJA 3BN9D 1UQSA 2V9TA 4QYOA 1UCBL 3QEHA 2YD8A 4M9PA 2WVVA 5GS2H 4HKBA 4I0PA 1HWHB 2XZCH 4Y8DC 1U8NB 3SE4A 3WEXB 2D9QB 4UM9D 4QXUL 1K72A 2WNGA 3O8XA 4ALAL 3QJFA 5INCB 3X3GH 1PSKH 4AEIL 4IRZL 4DIXA 5DA0B 1I4FA 5C0BD 3K72A 4F91B 2DH3A 2YD5A 3GRWH 3VFNB 1QD0A 2ZT9C 5IBUB 3TV3L 5BS0B 1MRFL 1IM9D 1SEQL 1K8IA 3AQXA 4CN6A 3NN8B 1WTGT 3KR3L 5F1IA 2RALA 3QCTH 4PVMA 2EADA 2R0ZH 1M7DA 4DCQB 3NZHH 2NW2B 3RG1C 4RWHA 4X5XA 1X5JA 2VT0A 4U1SB 2ZCLH 3UMNA 2M8XA 1JSYA 4TLTA 2W0LA 1U3HA 1QLEL 1A25A 5TQ2L 2R0WH 3MPCA 2P5WD 5CP7A 5KEZA 3QIWD 1RZGB 4NM8H 5HI4D 1JHTB 1D2PA 4PBVC 1OP4A 4H2CA 5E6YA 5A2IH 5LGJA 1UT9A 1B4RA 4WNQB 2QTEA 3QYCA 5HDBF 3S37X 2AJXH 1PZAA 2R1XA 3QIUC 2RBLA 3ARFA 4OZGA 4TSBH 1UJ3B 4Z7OF 5H94A 1NCWH 1N4XL 1ZEAH 4LCWE 3NACH 2XPGA 4DP7X 2NT0A 5JHDA 2OSXA 4M8UA 2E86A 2GK0B 3SBPA 5D7KD 2R1WB 3BGMB 5DHVA 2WXMA 3E6FB 5LCVH 4KRLB 4NAMA 4OCRH 1EHLH 1IEAA 5DJXB 4LLQA 4GQZA 4ZFQA 3L3GB 4JKKA 1I9JH 3O3DB 2ADFH 4PR5A 1RUKH 3AW5A 1T1YB 1HHHB 3VFMB 4QRPA 2Y5TA 3FO0L 3II2A 3IMVA 4U1LA 3VM7A 2OMUB 1CF8H 3PWUB 2GEEA 4NNPH 2BP3A 1G6RA 1M05B 3L16A 4YBLB 4FQCH 4EUPB 3QO1B 3DX9B 4QUOA 5C6TH 4FCHA 5EBMB 4BGLA 2HUEA 3O41B 3PQYD 5IQNA 3SKOA 4ZMAT 5IB1A 4G6AC 1A7RL 3SDAD 3B2XA 3FO9A 5I9QB 1AOZA 4EDWL 5BS0E 1J8HB 4OLZL 4R2GD 2UWEF 3T0BA 5DUPL 4XBPB 4PJDB 3QT2A 3DV4B 1KSRA 4Y16C 4OD3H 4PS8A 4AMWA 3B9KD 1PTZA 1D5MB 4LL1A 5DJ0B 4UIMB 1PD1A 3E3QC 1CBVL 3U7YL 2FYVA 3V5HB 3P0YL 1DJWA 2GHZA 4MCZB 4ZPTB 3VGAB 1NWOA 4HXAL 4JZOB 4N20A 4N68A 3W2DH 1EMTL 1SXAA 3KS0H 4FJZA 4W9DC 2VLRA 4K23L 4YGVA 3TF4A 1NCDL 2CE6A 5FX3A 4G71B 2NYKA 2XN9B 3Q5YA 4B96A 3EAKA 1JGLL 3BPNB 4DGIL 5DGRA 5DD5L 4DK3A 5INDB 5L2JA 3OMZA 5DTFB 2R29A 3SGDI 1ZAGA 3IPBA 3P4OB 5ACMA 5L9DH 3FU8A 2D7TH 3EJYD 3DI2B 1NA8A 1EANA 1CICC 1KCRH 3QZMA 1FGVL 4KKCC 5A2AA 4F1SA 1AJ7L 1MREL 3O3AA 2Z92B 5B7EA 1P2CB 3LX9A 3D0LB 3FQ2A 1KCWA 1ZDSA 4V33A 1UC6A 5I76B 2F19H 2F74B 4J3VA 3UDWC 4B9GA 4ES9A 4P23C 3BPOB 1F6LL 4GIPD 2I24N 4OAWA 4R8WL 3ULUE 4ANKA 1S7VB 3GJFA 1YEIH 4X9HA 3UZEC 3T65B 4IKLA 5EIVA 3MV8B 4AVIA 3GHBL 2XWZA 3LNEA 3UC2A 1KZYA 1E4WH 1SF3A 1MHPH 1AD0A 3O3BB 4WAFA 3FQXB 4JB9L 5J9PA 4KZCA 4AY0A 4KJWD 1MY7A 1PGRB 3CSBA 3HPJA 1BA9A 1E27B 4ZQKB 3BVNA 5B39A 3FTWA 1E9OA 5IB3B 5AW3B 1S7UB 2EDMA 4KV5F 5AKSA 1A2YB 1BYPA 1I1RA 2MOGA 1WE5A 3ALWA 4ODHL 3HN5A 1NCCH 2ZUSA 4RMUA 2KHAA 3HOGA