4M5TA

Disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
82
Chain Sequence
GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERGFISRCFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Alpha-crystallin B chain
publication title The structured core domain of alpha B-crystallin can prevent amyloid fibrillation and associated toxicity.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 82
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4m5tA00
3AACA 3IGFA 1WGVA 3W1ZA 3QORD 5DS2A 4RZKA 2KMWA 2MNWA 3QORC 4FEIA 1WH0A 3GT6A 2N3JA 4PCKA 2Y1ZA 1X5MA 4YLBA 5DS1A 2BOLA 1RL1A 2XCMC 3VQMA 2WJ7A 4M5SA 4ZJ9A 5LUMA 4JUTA 3QORB 2N0KA 1EJFA 3VQLA 4M5TA 2KLRA 3QORA 4PBDA 4YLCA 3L1GA 2K8QA 3GLAA 4YDZA 3GUFA 2Y1YA 2O30A 1WFIA 4JUSA 2CG9X 3L1FA 3Q9QA 3L1EA 3N3EA 1GMEA 4MJHA 4YE0A 2RH0A 2JKIS 4I88A 2WJ5A 3AABA 3Q9PA 4ELDA 2CR0A 4YL9A 3EUDA 3J07A 2Y22A 1SHSA
chains in the Genus database with same CATH superfamily
2BY3A 5CCGE 4Z7VA 1NCWL 4JKPL 3FTXA 4RVBA 5D72H 1CDHA 3GRGA 4PI2A 5IR1B 3KDMA 4ZW3A 1PZBA 2FEDC 1AY1H 2QDWA 3D2UD 3EH1A 3FUJA 4H20H 3HZKA 3ZMNA 3FO9A 1SBBA 3OTTA 4I1RA 4JFXB 4P2QD 4A6YH 3QWNA 4X5XB 4JRXD 4G3YH 5I71B 1MVFA 2CJTA 4RGND 3MLRL 2VYRE 4X5LA 5IJDC 3RL2A 2GBAA 1PKQA 1XSKA 4MLSA 4D0CB 2CLRA 3MCLL 5B38A 1WITA 4U1HB 4PY7B 1R46A 5IVNA 2JIXB 2DM2A 3MBXL 4WW2C 3RNQA 1E30A 4NI3A 1HX0A 2GTZA 1AQDB 1WVZA 4M43H 3P30H 4PJCF 3TBCA 3RFRA 4PAZA 4HSAC 4YC2B 3D69B 2YD7A 4PJ7B 5IEKB 4A6YA 2VLKE 3H3KA 2AGJH 2XTJE 3LB6C 1R0AH 2GHZA 2VWEE 3AY4A 3WFEH 2QKIA 4JDEB 5EEVA 1YPZA 5HDOA 4IGBB 4UUJA 4PV8B 5IV2B 5I1LA 2EE0A 3OMNB 4MJIE 2I32A 4CADB 1J5IA 2VE6A 1MIEH 1GC1C 1V3JA 3EF7A 5J13B 3L5HA 3QEUA 1L0PA 2IFFL 3B9KD 3M46A 5DS2A 3F7YB 5ISZA 4JY6A 1CICC 2PCYA 2NY7L 2Y6SD 3FSZA 1J1PL 1JWMA 4C4UA 3WYRA 1OKEA 1GKOA 4NFDA 4UTAL 3GK8H 3CSPA 3ROLA 4WWNA 2HXAA 3VSUA 1LP9E 5E2UH 1J5DA 2B3RA 3UP1A 1AR1D 4KKLD 3CVIH 3SD2A 3RWJB 3MRGB 1EZLA 3FHAA 1WFUA 4M7JH 2VR3A 8CGTA 2CKBH 4PCKA 5KBLA 1MG3C 3W9EA 5D5ME 3NEEA 2OL3L 2WQUA 1ZK9A 2MH4A 4OLZL 3FB8B 1TJHL 4JK0D 2BSEA 3TBTB 3O9WA 1SOXA 1JL8A 2XX1A 1IL1A 1FFTB 2BRQA 1OSZB 4N0UA 1WS8A 4JFDD 1AYOA 5TK4A 35C8H 4EUPH 1NBVL 3FUIA 1VKXB 1LILA 4LBEA 2CHXA 4GLRI 2FVNA 5J11B 4MXWH 4NUGL 3MFFA 1JF6A 1XXFC 5SWQA 1FV1B 1ND0A 3QS3A 3AY4C 3GZKA 4JAMB 2FAUA 4KRNA 3WNOA 2QKIC 3SDYL 4MKTA 1CK0H 2J5LB 1KTJA 3I6LE 5D2NB 1C5DB 5IMMA 4EUPA 2ITFA 4MX7A 4WHYH 1H15B 3CLEL 3FKUS 3E8UL 3ASOB 1OY3B 1SMDA 4FI8A 3S8FB 3QC6X 4HXAL 2J8UF 1L9NA 4JO1H 2WOBA 1D5BA 1S5IH 2ZWKA 4HISA 4UINH 2HN7A 4CBZA 4LKCA 4A7GF 2G60H 3SE8H 3RDTA 4FQHA 1ZEAL 3QORD 3QXAB 4YDKH 2RD0A 1GSKA 2VSDA 2FWSA 4FL4C 3PL6D 4KQ0A 3WFDL 2QHLA 1FVDA 1GGBH 4E5XG 4EIGB 1OAZH 4NHCL 4LRNH 1KCRH 4AM0A 1MN4A 3FTWA 3F58L 3I75B 2C1PB 4LB8A 5HYFA 1NM9A 1EFXA 3B7YA 1FC1A 4OLYH 2NYZA 4UT7L 2ZOOA 3VXQB 3NIGB 1BJMA 3HAEG 4YWGH 3VXNB 2Y1AA 3MLYL 3Q9PA 4I18B 3PQYA 4PLKD 1SJMA 2ZF9A 4N2KA 3O9WC 1WE5A 4WGVB 1WD8A 1XL6A 3L9EA 3IJHB 4KX7A 5HJDA 1MLCB 5AB9A 4O02L 1Z0NA 3HE7D 5CF3A 2O61B 5C92A 1HZHL 5JW3H 1JOIA 2NW2A 2GJJA 3DPBA 1SFDA 1UWXK 2WGXA 3TS8A 1NBQA 3K6FA 4DO4A 3BPOB 2IC2A 1CIUA 3ZOAA 4JMXA 3QIUA 3G6JE 3VI3B 2D8KA 2K8MA 4PJAB 4KJYA 4Z3IA 1FHGA 4L1DA 1A3LL 3W0WE 1MCRA 1F1DA 5EV7A 1RJYA 3RUGB 4Q2ZB 1EHKB 3QZMA 2VN7A 4OZHA 4U4IA 2VMJA 3E3QE 1NMCC 5C71A 4ESKA 3HFML 3TH3T 3VD9A 2WP3T 4CMMA 4U1MA 1AGEA 3RDTC 2D7OA 3BXNA 5AW8B 1AD0A 3LDBB 4H88L 1DSYA 5LCVA 1FYTB 2C4XA 4IOSA 2OSXA 3QRLA 3TYFA 4TUUA 5LNEA 1A6WL 1AD9B 2BSTA 5J6GA 3FT2A 4JNXA 1T0NA 1WIUA 3MGOA 3VI4A 1HDMB 3ZE0E 1AE6L 2EO9A 5GGSB 4Z7QE 1ZSHA 1S7RA 4MD5B 4PB0H 3NSXA 4NPJA 3NA4A 4OJAA 4YR6A 2KH2B 4RETB 2GSGA 4WFGE 1DBJL 1T4KB 1UM5L 1N6VA 2KLRA 5KUMA 3G5XB 3V8OA 4X9IA 4LLUA 3MJ7A 5C6PB 2BP3A 2WN2A 1MJJA 5CJQH 1DBBH 4O4YH 4IDLA 1YEIL 4HPHA 1KIPA 4JFSA 1TTCA 2X6MA 3AG4B 1A7PL 2CUIA 3BVUA 4JGJA 3RTQD 5JW5B 4E9TA 3NCCB 1C12A 4OFIA 1W72H 5I15L 4WRLA 1W8EA 2DKMA 3BZEB 1YEKL 2WLLB 2GT9A 3KLDA 5T3XD 2WJ7A 1P53A 4ONGL 1VF5C 3I6GB 3GMRB 3SN6N 4PD4J 1I8IA 1QQDB 4TL4A 1KGIA 4FXKB 4ONHB 3KDPB 3QIUC 3UTQA 4A7TA 3PHQA 3TPKA 1ZS2A 3OQ3B 4LLAA 3ZE2E 5GGRY 4FJ6A 3MRHB 3NZ8B 3QEQA 1GS6X 4MXQD 3LY6A 1SJVA 4DN4L 5BRZE 2L7JA 4HHAA 4PJGE 5EU7E 4RGMB 3WKML 2HLAB 3L5XL 4XXDA 1W72A 3GSXB 4QTHB 1RUQH 2PPAA 4RMWA 3AY2A 3TJPA 1VACB 3IWUA 3M17A 1NWPA 1ORQA 3RIAF 2VLKA 2XN1A 3LH2L 4XZUB 3ZZ1A 1CF8L 4Y2OB 1TLMA 1NBCA 2ZWSA 4CN4A 3V9CA 5K9QI 1CUOA 2OMWA 4QXTA 2QSTA 3PLYA 1INEL 3BH9B 4LEXH 1CZ8L 3L3GA 4MJIA 3OJ2C 2ZOUA 4Z3FA 4FTVD 1QBLL 3IN2A 3B5GA 5CJ8A 1BAWA 5I8CA 3TZVB 2MCMA 5JO5B 1HILB 4NQDE 1TCRA 2BNRE 3R4DA 5F88B 5IGXL 3DA0A 2YRLA 5GGTH 2Y36L 3CCHB 2MPAH 1EUUA 5LBSA 3E1F1 4LHUG 5GS0H 2FWUA 3QUZA 1DQKA 1J05A 1F3RB 4W9DC 5E2WL 2YPLB 4JLRA 4FNTA 2V0AA 1BPVA 4N6RB 3B9DA 4LQ1A 1L0XA 1LP9A 3WO4C 4L9LA 1JXKA 1UURA 2WXQA 4X7DC 4U1NA 2D3VA 1A66A 3RWEB 4JG0H 3O45A 1HEHC 2XXGA 5E4IA 3KJ4B 5ETUA 4DK5A 4N6QA 1U8HB 1SDDB 4Y5VA 4HXBL 1OAKH 5GGTA 3E6HB 4XPHL 3ZE1E 1ZWIA 4HJGB 3TJHC 4URKA 2MKWA 4WWKD 1Z2KA 2EYSB 3C5XA 3L7EB 4EDWH 3CSFA 1U8IB 2BHFA 1OT2A 4MASA 5C0AD 4S1DD 5F6HI 3SDAD 2IANE 3MLVL 3U48A 1RPUA 1FL6B 3TO2B 1I1FA 4K5NA 4AGNA 4JQIL 3CWGA 1BM3H 4U0RC 2FZ3B 2N01B 5HJ3B 2ZUXA 1UJ3A 5D7IF 3V0JA 4XCNB 5IJVA 3S8GB 2FIKA 2PWEA 5ADPL 2X44D 4PG9B 5E6SB 3VDAA 1Y1UA 2XTJC 1J8KA 5CEZL 2Y22A 4R96B 5EN2A 5CU5A 2VWEC 1IEHA 1G7IB 1SY6H 2CA3A 3N9GH 1WH0A 2I25N 2YKLH 1BFOA 2ZJSL 3NEOA 4KK9D 4FHBD 1JZ5A 3PGFL 3CDGA 2BW5A 2IDTA 1N59B 3JUYA 4YHZL 2Z8SA 1VGEL 4Y2DB 2F58L 4ZS7L 4XXCA 4JO3H 4C55A 2XXFA 5LAXB 1AZNA 1IQDB 1CDCA 4UOW1 5IIEA 2WOYA 4J4PD 4U1GB 4XN7A 2DTML 4WK0B 4X6DB 4QHNA 3QIBA 2VC2L 3OQRA 1UC6A 3QUZC 5CSZA 3JT0A 4FQ2L 3D25B 2C7FA 4ZX3A 1TQBB 2ITDB 3MV11 5CJBA 4ZT1A 2A74B 3PWPB 3DOSA 2WD0A 2IPTH 4L9LC 3RWDA 3ULAB 3ZXAC 2J71A 3B2UD 4ODUA 4TSCH 3VWJD 4KTGA 1FGVL 2DAVA 2H8PA 3U0TB 4Y5VC 5BV7B 1Y0LA 1XBDA 3MRIB 3P0VL 5DD1H 5T1LB 1KEMH 1PCXA 3SY6A 3K6SA 1LEGB 2W65A 3T2LA 1B0GB 1UQSA 3DI2B 4GW4A 5IMOA 3CSBA 3LXUX 2R39A 2WNWA 2PR4H 4EOWH 4AYMC 1PD6A 1G7PA 1CFSB 3P9LB 7CGTA 2ESVD 1T0PB 2VMFA 5H37H 5EU4A 2BSDA 3LZFL 5H4YA 2Y1VA 1AS8A 1BBJA 1CDBA 3HW7A 1UJ3C 1E65A 5HYJA 4UAOC 5FW7A 1P84K 5TPWL 5CD3A 5KVDL 2PW2A 3KPNB 3IAQA 4P5TD 3TF4A 3QAQA 3CX5J 4P2OA 5AAMA 1JZ7A 2C3VB 3G6JA 5DMKB 2G30A 4HV8A 4FFWC 4P06A 4Y19D 3DJ9A 5EBLA 3T3PF 1GMEA 2DBJA 1UB6A 1KDIA 3TH2T 3VH8G 1RERA 4KJPD 2A99A 2WBJD 1DE4A 2A2QT 4G7YL 4IJTA 4LLMB 2ATKB 5H37A 2GKIA 2A1WL 4PJHF 3B8YA 1BQKA 4Q6YA 1CQYA 1G7LA 4P2AA 1BAFH 1N0XH 4XXCC 1XZWA 4M3KB 5F9AC 1IM3B 3MRFB 4EXPX 3NACL 1RUKL 1NAML 1OQXA 3Q48A 4S1RL 1QLEL 1C5CL 3N40F 3QIBC 3ALXA 3WTWA 3N44B 2EXYD 2Z8VC 5CSBA 2ZAHA 1EXUB 4K9EC 4KKPA 4OGAC 4PGEA 4AIZA 3QQ9D 1J12A 1FLTX 3K80A 1VGKB 3VVWA 2OMUA 2CK0L 3QNZB 3R0NA 5GHWL 2IFGA 4HLZH 4BEIA 1KGXA 2LW3A 1KZYA 3L4UA 3VYPA 3X1NA 5E2JA 1NKOA 3L95B 4M6AA 4KV5F 2O5YH 2O5ZL 3BGMA 3BZ4A 3OAYK 2ZSWA 3D4YA 3L6FB 2GSIB 2ZF8A 3MLWH 4KI5E 4LP5A 1CLCA 3H54A 1JVKA 3U7YL 4D9LH 1R3HB 5I2IB 1UD5A 1KTLA 4MA7L 2AXGB 5E70A 4QWWD 4H8WH 2NRDA 2W60A 3B2VL 4NQCD 2GBVA 3LHAA 3EYOB 1E5BA 2Y24A 1JHKL 2H6OA 4RDQG 4P2OC 5AAMC 4JRWA 5DHDA 3EAKA 1G5GA 3FBKA 2VXQH 3IMUA 3LNGA 4UNUA 5ABAA 1S3KH 2EXTA 3OJMB 5K9JL 3QRGH 1UD3A 3O3AA 3VACA 3JWOH 4JY4A 4IBZA 4J3OG 2A83A 2B2XL 3OKEA 1PJ9A 5D1ZB 4YOKA 2B59A 3CK0H 3DVNB 3E3QC 1BZ9B 1YA5A 5ECGA 4R26H 4ZMTA 3AWGA 3UTTD 2K6YA 5E94B 2GUOA 4F7EA 4RMUA 2FWLB 4I9XA 4BA8A 4NBZB 2EEAA 2JI1A 2XFXB 3BKJH 4LSQH 3WIFB 3K2UH 4JFOA 1UZ8A 2F19L 4QXUH 4FNRA 1TJXA 2FATL 2WKLA 4YHKH 5B8CB 2EUXA 5F1IA 4O9HH 5C0DB 7FABH 3H2WA 3CVBA 3IFLL 3SDXF 3VXRB 3V4VL 2XTLA 2DQIH 3HCVA 1EAQA 4Q14A 4IBUA 4YDNA 3UZEA 3L3KA 3ZIMA 3II2A 5EU3A 4NQDA 3WUWG 3GBNL 2BNRA 5JR1H 3Q6FB 4XMPL 1HQ4A 1WWAX 1FG9C 2D9QB 4HG4K 3BRGC 1Q0XH 3DBXB 4XE0A 5AVYB 1LNUB 5EIVA 4A37A 4NQEB 2EJ1A 1P84J 4YLBA 6CGTA 5DO8A 4ZAKA 1YDPA 1XMEB 3BAYA 3PFQA 1BWWA 3GF8A 4KTEH 3UTSB 3ZBMA 2R0KL 5CIPB 2NQDA 4QHUB 2Q8AH 4QRBA 1IFHH 2HVKA 4GP8B 5DYOB 1GGUA 3UBXA 4Y9GA 4JFQB 4MCYA 1RU9L 3PWLB 3V5HB 5I1DB 3BUBA 1JFHA 1U8MB 3HB3D 2VDRB 3N42B 3BD5A 4WFFE 3SBQA 5D1XB 3LD8B 3MGTA 3L5WB 2H47C 4OF8A 4NT6A 4J1UA 1HWHB 25C8H 4R84A 5HVHC 4JHBA 2H4EA 3ZDYF 2BP8B 5C0ND 2WZ0A 3ULSB 4MQTB 1NIFA 3VW3L 4WU7A 2Z7YA 2KPWA 4S0SD 5C8JB 4R90L 4KTYA 1A9EA 4LSPL 4N1CA 4YHNB 1JWUA 1HJCA 2BSSB 2LAGB 2QEJA 1S6NA 1WA1X 1AHWB 3FFCD 2WVVA 2I9TA 5JLZB 4H8WC 2CGRH 4GW1A 2VMCA 1PZDA 4ZOEA 3TBYA 4ZMLA 4JFZL 3WS3B 3ES6A 3F7RA 5AYUL 4EO5A 2WAQA 4OFYD 2OMXB 3JV4B 5MEOB 4KNTA 4XO9A 4ADIA 1OM9A 3EJJX 3ZKXC 4CSTA 2X0VA 1QO3A 3DVGA 2VDPB 4B3VA 1O6VA 2TRYA 2E46A 5DJYB 4PJBE 3JWOC 3WNMA 4A67A 1MH5A 2ZCHL 5C0JB 3SCMD 2WGNB 3MV7D 3R7RA 2VDOB 3UZEC 3FZUD 4PJFF 5E4EB 1XF4A 2PCPB 3IVKA 1DDTA 3PJSA 2Q1EA 3OGCB 4PW4A 5T5NF 2I60H 1AIFB 1N8OE 4LDLB 3WCYA 4UF7C 3GO1L 3N91A 1K8IA 5ANHA 3WY4A 3O8XD 3LKNB 1ZT7B 4KZDH 3CU1A 3WFHB 4ZAKC 1DYZA 1SYSB 1E9PB 1S7TA 2IH9A 4HUUB 1TEYA 1QFPA 3CLFH 1Q9LB 4IJ3B 4QOKD 3PWJB 5BRQA 2FD6H 2FT6A 5DEFA 1PEZA 3BX7C 1ZHKB 4PVMA 3ZO9A 3ASWA 3DX8B 4ECNA 3D30A 2AK4B 1CG9A 5J12C 1E50A 4DVBB 4PJ5D 4YQXL 1RIHH 2GK2A 3GEFA 2A9AA 2WO3B 3C5JB 4TTDC 4YEFA 1PZ3A 5GSVB 1A9BA 2DBLL 1CGYA 1DQTA 4BE6A 1ACYH 5D4QA 3TEWA 4ZFOB 2OJEA 3MVSA 4LNRB 3UC0L 5HGBA 5FV2A 4H26B 4OZGF 1DANT 4ONFH 2Q86A 1EO8H 1F11B 4QF1B 1QBMH 2YD6A 1ZHLA 3TVMB 3LVEA 3O6FA 1CXHA 4M1GL 4KKCC 3NGBC 1YEJH 2PWGA 2IOMA 3ERXA 3FRPG 5IREA 1EHXA 3EGDB 3PYCA 1QRNB 2JKWA 1AMXA 1ED3B 1MRFL 4PJ7E 1KOAA 1EV2E 1AC0A 1XGPA 5E5UB 1U58A 2ICWI 2EDXA 3AS1A 3QDJA 5MI0B 2OR9H 2KQMA 3BEWA 2DB8A 5EWIH 1J5CA 4MA8L 4XP9H 2UXGA 2NUTB 2AJVH 4YSAA 3NT0A 4OVUA 4UYPA 5KYXB 4TPRH 2AEQL 2CA4A 5FLUA 3FQ1A 1MIMH 1VPOH 5JNYA 3HG2A 2QSCH 3QIWB 1EIBA 3TFKC 2WTOA 4Y16A 3BAWA 2WVUA 4EI5B 1OCRB 2X4TB 5DJ6B 3T8MA 5M7QA 3HZMA 3P2TA 1GPOL 1JGVL 3NOIA 1JMXA 3MOAL 3QJVB 4X7FC 5T1KA 4AV4A 5IHUL 5JPNB 4GAAA 5E08H 1VZIA 3O6ML 3UJJH 3FUKA 2BLFA 2VH5H 2W59A 3BWAA 3HMXL 3JZ7A 1K2DB 4MB3A 4P3CH 4RSVA 5HI4C 2RAMA 1N5AA 1HZKA 4XNBA 5E24E 1OAYH 5DD0H 3UBHA 2A9NH 4JZJB 4NC2B 2FX7L 5MEQA 3I3EA 2VERN 3BP4B 4PJCE 1G7QB 4KY1L 4NP4L 2IWEA 4GQZA 1W0VA 3W11C 4XO4A 1M2VB 3O6KL 4UAHA 4XTRD 3UP6A 2FWOA 4B41A 2VAAA 2V7HA 2VDRL 4JANB 5J0BA 4X4YB 3LKQA 4O2EB 3V2AR 5KYWA 2QSVA 3Q7JA 1BBDL 3RFZB 1QI5A 1P7QB 2IG2L 1YEFL 2HG5B 4GG6B 3JVGA 2UX7A 4K23H 2MEJB 4MB4A 2K3TA 3U4BH 4CRPA 4H4NA 5C2BL 4CJ0A 1NC4A 1LDPH 2Q76A 4XGZA 1SOQA 5FYLH 3LKRA 2PTTA 3VGAC 2EYRB 2DH2A 3WJMB 1SM3H 3ZTNL 3SYOA 1S3RA 4WDIB 2BOBA 2IFFH 1GY2A 1JAEA 1ULVA 3NSYA 4FJZA 3RURA 4BFNA 3A4EA 2ICES 5BPPA 3IMVA 3D39B 4N2DA 4J6RL 2HT2C 5D7LD 2NY7H 1CFVH 1E4XI 3LAFA 5INDA 2C9RA 2XG4B 4YXLL 3MKKA 2PPCA 1QLRA 3WEOA 2LVCA 4ANUA 2VDOL 3CN4A 4BIKA 4Y16C 3J8F7 2ZXQA 4I48B 1E9QB 3H6JA 3Q2WA 5FECA 4JFHE 4HH9A 4AQAB 1AIZA 1TQSA 4NFBA 4WV1B 5L2JA 1VFAB 2A77H 3OKLA 2QZ5A 2BDNL 3ECUA 4AGMA 5I1GL 1C1EH 1JN6A 2F74A 2NYYD 3VWKB 4DGIH 5E4AA 1ZA6B 4XBPA 1LEIB 4JG5A 5DC9B 3LKOB 4YXHH 1RZ7H 1S46A 1N5YH 4JPKL 2IH3B 4XC1H 5HVFB 2ADGB 5EZOL 3AREA 3MOBH 3MNVB 2UZIL 5F2FA 5PAZA 5I0VA 1L5GB 4M61A 1FLRL 4A2MA 4D0BB 2OL3A 3JVGC 3I9GH 2H2SC 3VGGA 4BH7B 2IQAA 2AV7A 2BIPA 2J44A 5AW3B 1CL7L 5I6NA 4I89A 3T3MF 4ERSL 2X6AA 4AMXA 2H9GA 1PY0A 2CRIA 1OPGH 4ZMZA 4FXGA 5CR8A 3BAIA 4CGTA 5E7FA 3SBRA 1HKLL 5GISL 4RWHA 2JJSC 3RTLA 4PM1A 3C08H 3DV4B 1UVQA 5HHOD 2P26A 5CD5C 4RA0C 1ZSDB 4X0KB 5CEZE 3U4EA 4QTIL 3HPLA 2R9HC 2VAJA 3UO8B 4Y1AA 5EBWA 3U2IA 5B38G 1CYGA 1UZ6F 4QRSA 1BZQK 1I7RB 2JCWA 3B2PA 4KK8D 1QFHA 4HC1H 1H0DA 3OB8A 1NUDA 2VLRA 4G8FB 4JVPA 4ZXBD 3DRTB 3MNMA 4EI0A 2X38A 3D87B 1JF1B 1TZGL 2CDFA 2YEZA 4G9FE 2EZ0C 3QJFA 1I9JL 4E9LA 4UT7H 4BZ2H 1NSNH 1T2JA 2IJ0C 5E2TL 5GQBA 4PLNC 3QEHA 5ID1B 2CJUH 2JSFA 5EOQL 1KY6A 1RUAL 1KCKA 2NY3C 1B0RB 2MPVA 2YJQA 4FULA 4Z6AT 1B0IA 1CDJA 1CYWA 4HC1A 1L9QA 3HR6A 3MOQA 1LO5A 4TVPH 5J6HA 3W38A 2F53B 4Z18A 4K7PY 4G43A 3GGWA 5DMKA 3AREC 5AZUA 3RAJH 2YD1A 4WWOA 4U1KB 3EFFB 4ENED 4KO6A 3BT2L 4BHUA 3BUQA 1KN4H 5IR1A 4GSRA 4GG8B 4KRPD 1AI1L 2FGWL 4X8GA 2VQTA 5FYJH 3E6FB 3L9BA 2APBA 3I6KB 4B60A 3IWVA 4FFZL 4JFXA 5F0JB 5E6RB 4X5XA 2AZUA 1YNTB 1NCCH 3T0XA 4Z7NF 4FQLL 4YK4B 1QMUA 4FXGC 4D0CA 5CCKH 1BLNB 2BIHA 4U1HA 4PY7A 2VKWA 2BP0B 2JIXA 3D0VB 3O2DH 4LSUL 1OCOB 4OAWB 5KVDE 2Z31B 4UQAA 4Q89A 1H3UA 1AQDA 4GINA 3HNVL 1AP2B 1B3IA 5EO0B 3IKKA 4OZ4A 3ULUL 4XHJD 3D69A 2X1XR 1BXXA 3REVB 4PJ7A 4RQQB 3WE6B 5IEKA 3ZHFA 1QWHA 2GJ6B 3QUHA 5DRWB 1G9NH 1UWXH 1XCQB 5GSRB 4ZO6A 3VGDA 3WIIL 5EIIB 2IOIA 4B7IA 4WLCA 4JDEA 5E8PB 5HJGA 2XN9E 3HI6L 3EJCA 3DX0A 3O2DA 4PV8A 2JB5L 4Y9CA 5IV2A 1DBJH 3GNMH 5K59E 3KBFA 1GOGA 2C8NA 5E99H 4CADA 1OPOA 3GXMA 3EJYC 5FDWA 2N56A 3FBQA 2H2PD 3B5HA 3EG9B 4GKZA 1MI5B 3F7YA 4A2FA 5KVGL 3WLWC 4BK8A 4Q0XH 2EEXA 4N0RA 1UEYA 2NNAB 4PJ8B 4DKDC 1J18A 3MLZL 4DN3L 2BHZA 4LL1A 3RGVD 3QZWG 1F2QA 2F9BT 3ZT6A 3BMWA 1S7UB 3RWJA 3MRGA 4TTGA 1S7VB 1IIKA 3FN9A 4P5SA 2GY5A 3QS2A 4NN5B 4RGOL 5C6TL 1GIGH 1I8MB 4GBXB 4P23D 4YO0B 5JHDE 2HTKC 4TQHA 2O6DA 4HPYL 4X7EC 4JKNA 5I71C 1T04B 1XQ4A 3FB8A 5EUOF 2DYSB 3TBTA 2ZUUA 5IESL 3QYNA 2VZ1A 3BPCA 2X4OB 3RIFK 1TCMA 3D2UB 2FR4A 3DNKA 1OSZA 1WBZB 4HFUH 1P7HL 1RK0B 2FYVA 4JRXB 5AZ2H 3S9DB 3MNWA 4OJFH 4RGNB 1VKXA 1ZPUA 1EEZB 3PNRB 5I18L 1MREL 4MS8D 2BH0A 4YC2C 4I87A 1VRSA 1RJZA 4TNVK 2BP5M 4QHKI 2OQJB 1XR8B 1AAJA 2JH2A 1FV1A 2ZOKB 3HC4L 1VERA 2RCSH 1JCVA 1DBKL 4FOMA 3PJNA 5D2NA 1C5DA 3JT2A 4A55A 4XXWA 4XVJH 4HF5L 3FF8A 1JRHH 1H15A 2Y06H 1MRDH 2J43A 2QQKH 4BFEA 4I8DA 5J13C 2AJYH 3KL5A 4D9RE 1SZNA 3FNKA 1NPNA 2FGZA 1G9NC 3KGUA 4X6DE 3ILQC 3QXAA 4DKTA 3PAVA 2LTQB 5DDHB 3V0DA 3WI9A 3WFZA 5HHME 4Z7UB 2F7IA 3M6DA 3B9KB 4DOHE 5JMRA 2QQLL 1BZOA 3FH7A 2JQMA 1EFQA 3QQ3B 4HQQH 3I75A 4NCDA 5MP6L 4B9FA 1MW2A 2A38A 5L7XL 2WXJA 2EDYA 3VXQA 1TVHB 3ISRA 3MLVH 4N68A 4O5LH 3VXNA 5JTWA 1AR1B 2JJTA 4I18A 2HPOA 4QLWA 4YHYB 2KMWA 2C4FT 2CHWA 3O2WH 5F9WB 2EDWA 5B1JA 1Y1DA 4ONOA 3ZPDA 3IJHA 2D2OA 2EVGA 1XO8A 2WO2B 1MLCA 5ADPH 1YYMH 2EDLA 2ADIB 2O61A 1KGYE 4DK6A 4HUNB 4NNPH 4N0CD 3KHOA 5FO9B 2PXYB 3FQWB 4OBSA 5J1SC 3M7OA 1CF1A 2E86A 2MJWA 1LTXA 3B7TA 3HC3L 3UJTH 1SYVB 5J11C 5CILH 4JFDB 5LNDA 1PKOA 5KJRL 1FPTL 3HS0B 1NFAA 3VFPB 3IM1A 4PJAA 4YS4A 1NCNA 2E56A 1WBXB 1LO2H 3ZQWA 2J5LC 1D5ZB 4HT1L 1GR7A 4Q2ZA 5D2NC 4XNUL 1FO0L 4KNSA 3RUGA 5DHYB 4XXWC 4ANWA 2XCMC 4KAQH 2A9DA 1KDJA 2DTMH 2J1XA 2X4QB 4BYHA 2V8MA 5KS9B 3TONA 3CFJB 3TLRA 4ATWA 2AJZB 4XWGL 1BW8A 5KBDA 2WLHA 3MJ9H 1V10A 2FCBA 1EZVX 3KPRD 5IT2L 4JG1H 1MXGA 2YRZA 4M56A 5KUKA 1MZZA 3OMIB 2HKHL 4P2YA 4TOYL 1II4E 2JXMB 1AD9A 3N04A 5IMLA 2P24B 1FGVH 3MCG1 2AQ3A 1HDMA 1K5WA 5GGSA 3V55A 5TQ0L 3ZL4L 1ETZB 3OX8B 4TF4A 1YECH 1KY7A 4Q9BA 2JKXA 2NZIA 3PL6B 2J88H 1T4KA 5BXFB 4N24A 1EK3A 3MJ9A 4P9MH 3G5XA 1H8NA 1EUTA 3BMVA 1G4MA 3FCSB 3NP4A 4AKOA 1ITCA 1A7OL 1BP3B 4PQXA 2JJTC 4ELMF 4I18C 3T6ZA 4AJWA 2ATPA 5D2LB 3T3PE 5B1JC 4L5FE 3NN8B 1IC0A 4X83A 1ITBB 4MNGB 3DHMA 5JW5A 5I0YA 4EBQH 3FXIC 3OKDB 1DJIA 3BZEA 3QYMA 3VD0A 1ZHNB 1G0YR 2WLLA 3L8QA 3GXIA 2DY2A 3GZQA 3BPOC 3GMPB 3K81A 2KL6A 3I6GA 1IBFA 3GMRA 1JZJA 1QQDA 3PHSA 4FXKA 4ONHA 1P9MA 2DQCH 3HE7B 3L9RB 3NZUA 3GI8H 2AABL 3U9PL 3NA9L 2WZ5A 3MRHA 3NZ8A 3OG4B 2E0PA 3GTTA 3KYKL 4PBXA 2AJSL 2HLAA 1CD0A 3H0TB 3NTCL 5EORL 3GSXA 1GYVA 2RB8A 3FOMA 4QTHA 4E41B 3VYOA 2ZX6A 1PDKB 4ZOCA 5DWUL 3HOGA 1CR9H 1VACA 3SE9H 3LPGA 1ZMYA 1I3UA 4XZUA 1MCKA 4Y2OA 2C1OB 3LDBC 3HHRB 3P0YL 2EUVA 2F61A 1BWMA 2YXVA 1KELH 3BH9A 4KWUA 1LWJA 1JGDB 4Y9FA 3TA3B 3TEUA 1TQUA 4JRYE 1C7SA 4MCZB 2OMYB 1A5FL 1IB5A 4WEEA 4CC0A 1NLBL 1U36A 1TZAA 2YLHA 3TZVA 3WU1A 1YQVH 3O9WD 1HILA 5JO5A 1SEQL 4LMQI 5F88A 4XVTH 3MAWA 3LQAH 4KTDL 3CCHA 4E0RB 1IT9L 1C9SA 2MNUA 3RWGB 4OJEH 1TZOA 1NUGA 1T6WA 5IUCA 2FECI 2YPLA 4N6RA 3AQZA 5BZWB 3UTSE 1WFMA 3B2VH 2BVQB 4NNYB 2DL9A 4K15A 3UXFA 4S2SB 4HKXB 3RWEA 3N3EA 4MLIA 5CM1A 3VXUB 5IHZA 4NBXB 5DUML 1U8HA 1SDDA 4MZ2A 4EAEA 4P07A 4NPYB 3E6HA 4MA3B 4HJGA 2ADFL 2OFQA 4U1JA 3D85D 3WKNA 3O6LH 4FXKC 1P9MC 3L7EA 5ACZB 3TJEL 3DGDA 1U8IA 4GXFA 4W6XB 3UOAB 4R5TA 1UXWB 5G2NA 1P4LB 1MRCL 2XA3A 4BSWB 2IOOA 3FHEA 5TE6L 1V54B 1IGML 4HLJA 4BSJA 4RGMC 1FL6A 3TO2A 1L3NA 2VZTA 4P4RB 1XGUB 3DX2A 2CJ3A 1U92B 2FZ3A 3L1FA 5HJ3A 4AQOA 1JZDC 1MF2H 4IW4C 4XCNA 4W4NA 4Q9RH 4FG0A 2E8ZA 3KXFE 4MAYD 5DQJB 4PG9A 1U8JB 1MY7A 4EZKA 4JO5A 4U3HA 4R96A 4O51B 1E5YA 1DQQB 1G7IA 3CVHL 3P9MB 2OJZL 1OGSA 4M7ZB 2D2CC 5D55A 1EFXD 4L3EE 1CD9B 1NFIB 4G6JL 1KXQE 3K2KA 1UM6L 1N59A 3L3HB 4IKIA 4QCIB 5A2CA 2F1EA 4Y2DA 1FHNA 4C54A 4XAKD 3EDJA 3GB7B 3PQYD 1DVUA 1MUJB 2IEPA 4JY5L 4X8XA 3ET9F 5LAXA 1SOKA 3TZVC 1RIUH 1IQDA 3KM2A 4U1LB 5CEYB 2WY3B 5BV7H 2OTWB 3IDJB 3Q2CA 2FX9H 5F96L 3BHBB 1RURL 3OXRB 3SDDB 2IBZX 3IBOA 4X6DA 2CSPA 4ZDHB 1ZA3B 4LDCA 4DJMA 1Z9SB 2DJUA 3D25A 1L9PA 2ITDA 1KB3A 2A74A 3PWPA 3R06B 3NZHH 1AQHA 3RWCB 3QIUD 4R8WL 1ZTXL 3TEYA 2IPUK 3RU8H 1WEJH 3KJ4C 4AXWB 1BVOA 3U0TA 1YN6B 3KE0A 2YGVA 3MRIA 4GRWE 4R7DB 5T1LA 2BMKB 5DMGC 1BIIB 4OJDH 3VW3H 4N2LA 1LEGA 4KNQA 1JXGA 4LSPH 5C9JB 2AQNA 4I3SL 1MLBB 1B0GA 2E7DA 4GP5B 3VAEA 1BVKB 1P4IH 4JPSA 5KW9H 1MFBH 2X10A 4GXUN 5C3TA 1JCKA 4GJTB 3Q6GL 4NGHL 3GEWB 3L4CA 3P9LA 1CFSA 1BQLL 2W1NA 4AYSA 4JFZH 1TETL 2X1OA 4FCAA 5G4OA 1IUZA 3MTRA 4WWKB 1WSST 4MXVE 2VSMB 1HIML 5TF1H 4OI7A 1KT2B 5C0AB 4UT9H 1SLWA 3KPNA 1MAKA 1PZAA 2DTSA 2Y7MA 1E67A 1H3VA 5E9AA 1OGAE 2C3VA 4AGPA 5E6YA 1F42A 1D6VL 2WZPA 1QA9B 4IOFC 1HHHB 3LPFA 4KXZH 4YHIB 3RA7L 3U0WL 1XB3A 1NKRA 4LCYB 1JVOA 4LLMA 4XPAL 1CBVH 3V0AC 2ATKA 4EIZC 3OHXB 3UYRH 2R15A 1YUKB 2ZNXA 2QGDA 3GO1H 4FD0A 4Y2DC 1A64A 2NCEA 2E7CA 4UT9A 4G70B 5GJSL 1IM3A 2PABA 3MRFA 5KOVC 1RQ5A 1Z9NA 4LASH 4WTXA 3NAAH 4IIZA 3MJ6A 4H8VA 1RH8A 2J8UB 3VFNB 2WLJA 4KMTH 3TCLB 2FJGB 3IGAB 3G3LA 4NRYB 3RWIA 1I9EA 4PVLA 1UHVA 1W91A 3IU4L 1EXUA 1HCZA 3T71A 2XV2A 4BV1A 3TJHD 1TQBC 1IKFL 4L5FH 4KFMA 1IGIL 2A74C 4RFOL 1VGKA 4GO9A 4TNGA 2AQSA 4XPFL 1QSEB 4W9HC 1R33A 3N85L 3QNZA 3C8DA 4DKFL 3QEQD 1YJDH 1CYXA 4OB5H 3MXWH 3L95A 3OR6B 3VWJB 4G1EA 3L6FA 2GSIA 1C8QA 4M1GH 4L4TE 4YXKL 3BWSA 3LMJL 4G8GB 5JHLL 3DGGB 3MX0A 2OMNA 3N1GC 5BS0D 1R3HA 2XYCA 5I2IA 3FOLB 2AXGA 4IKLA 5EZLB 5L4IA 2LAAA 5TQ2L 4LQFH 1N7ML 2VXTH 4OI9A 3LNFA 5T3XL 1BZEA 4YHPB 3PS6A 5I1CH 1U91B 3GPEA 5FM8A 2P45B 2XKUA 4JB9H 4W9KC 5E8DL 3UBXG 1P6AB 2YJLA 1HYRC 1OB1B 2DQDH 4H8PA 5LXGH 5J3HD 1I3GH 3UYPB 1U3ZA 3ULUE 1AZZC 2IADB 1FQ9C 2DQTL 4HZLB 1PQZB 1UG9A 1GGIH 4RLDA 2UUDH 3O11B 2QVFB 1WWBX 3D39E 3L54A 3QUZD 3U0PB 4Y19B 2YC1B 3D34A 1CWVA 4WY7H 5D1ZA 3DVNA 2JELL 5HDRA 4N2CA 1BZ9A 1BQ5A 2GJRA 3LEVH 4KVCL 3RZWA 1GHFL 2WBJB 5E94A 4QNPE 1OARH 2YMOA 1U95B 3K5SA 3Q05A 1KMGA 1IQWH 4WVRA 4PBWD 3X11B 4C4KO 2XFXA 1N26A 4FFYL 3WIFA 3SE4A 4DVRL 1DQLL 1HXKA 5B8CA 4P57B 1RK1B 2HT4D 2EINB 2D4DA 5CIPH 3NQIA 4L37B 3IN0A 3KLAB 2FYYB 5KVGE 5GS0D 4J2XA 3MRBA 1LXMA 2BNQD 2RA1A 3F7PC 4JW3A 4X99B 4DGYH 5I23A 3Q6FA 3GIZL 4WEUD 2ZKHH 4F80A 3DBXA 3FCBA 4ZFGL 3H3PL 1G9EA 4HEMA 5DVOA 4NQEA 1L4IA 3L4XA 2OI9B 3LRHA 3IDXH 3KPQB 2FQFA 5I74B 3UTSA 1RZFH 5CIPA 4QHUA 3V52L 3BN9D 5DYOA 4E9RA 3TN0B 3SJVD 2DEYX 4FFWD 4XPGL 2K70A 1KB5L 1IGCH 4JFQA 1QI4A 3PWLA 5HHXL 3T2NL 5I1DA 4HIIB 1U8MA 1YJDC 1RV6X 4UZGA 1NFKA 4J3TA 1M1XB 4BCYA 4K3EL 4GS7B 3AZUA 2XJKA 1DVYA 4LEOB 5D1XA 5D71H 1DBAH 3L5WA 3CAFA 3ME0A 3MXVH 5JOFB 4OFDA 4L0YA 3F6IA 2YXFA 2ED6A 2BP8A 2L7EA 4H25B 3ULSA 3I74A 4J6RH 4UDTB 1MY5A 5FGCB 5C8JA 2VDPH 4YHNA 2DWEB 1HQRB 2AEWA 1AHWA 4NLHA 4RMQA 5JLZA 2WMPB 5DFTA 4JHZA 2VDOH 3K6DA 2QMKA 1O6TA 4J8RB 5D1ZC 3WS3A 4QHMB 2OMXA 3JV4A 1ZY9A 5DGQA 3GHBH 1ZKAA 4ZTEA 4XCCH 5MEOA 1GYAA 4F1ZA 5DZJA 2KZWA 5ICXB 1J5OL 1OAXL 4UQBA 3OZ9L 3SE4C 2YOAA 3I9AA 3QDMD 4NXSA 5B8CC 1AANA 5FM5O 1KXQA 3ELAT 2WCGA 5DJYA 3UTTB 5I1GH 1A0QL 4KDWA 5C0JA 4XMKL 2NY2D 3AC0A 1K4DB 2PCPA 2Y7LA 4OLEA 1PJWA 3H8NA 2EDRA 5MERB 1WYJA 1UH3A 4HAFA 1NL0H 4JPKH 5E1AB 1XCTB 3LKNA 1ZT7A 3T77B 4HULB 3L81A 1GZQB 2AJXH 3OF6A 4NQVB 3WFHA 4BFOA 3CHOA 3WAJA 1PFOA 2FJUB 3T3ME 4C56E 1E9PA 3BCDA 4HUUA 4Y1TA 1Q9LA 1VFUA 4GYBA 3PWJA 4CILA 3AVEA 1DFXA 4P46D 1HL8A 1X3DA 2AK4A 1AS6A 4ILDA 3LN4B 2OPCA 2DWDB 2F5AL 3L1GA 4DVBA 5I24A 2EDKA 3Q2NA 1TSHA 1F90L 1UD4A 4OF3A 2C4FU 3LD8C 5D1XC 5GSVA 2HKFH 4HHWA 4QRPD 4ZFOA 1U4EA 4LNRA 1WWCA 4GKLA 1KTDB 1SXZA 2WYIA 4H26A 5HHVH 2GVYA 1FORH 3NABH 1F11A 4QF1A 1L6ZA 2YBRB 5GRWA 1ZGLB 1YMMB 3TVMA 2W0FB 4J2QA 2X05A 1AHWC 3QXVA 3F2LA 3D8MA 2F8XC 3LRMA 3AQXA 3G9VA 2YAHA 3EYFB 4K71B 4W81A 4XCYB 2XWXA 5D96B 1AG6A 1QBBA 3N41F 3EGDA 3FK3A 1QRNA 2X4NB 3AU0A 1OGAA 4L48A 1ED3A 3SKJH 3JSSA 5D7IB 1NDTA 2GJ6E 3RHWF 3FFCB 1PNDA 2Y2WA 2BIOA 3UBGA 4EQ2A 1OTTD 2XTSA 4DP4X 5FUOL 1ZLSL 3LZRA 2NY5H 1MVUB 3O4LD 3AGVA 4X6CB 2B9AA 2R59A 3MACH 4PG2A 2XV6B 2NUTA 3KL0A 5E4EC 4DKEH 1WAAE 3DX4A 4JFFD 1MI5E 5KYXA 1DCEA 3V4UL 3QIWA 3OLGA 1GAFL 1V7ML 1CDGA 4R9HA 3SCMB 4EI5A 2X4TA 3L3IB 4W4OA 2DLFL 2XSKA 2VXVH 4XN5A 2APSA 2XXMB 1GL4B 5JPNA 4Z7NE 5IJKA 4IJ3C 3BOVA 1AI1H 4FMFA 2G9KA 1K2DA 1NIEA 1B4JH 2XQBL 4FFZH 4IRZL 5DJ2B 1RMFH 1N8ZB 1KJ2B 2ZD0A 3NFSL 4M93B 4JZJA 3UABA 3BP4A 3T0VA 1G7QA 4QOKB 3EJPA 3ZKND 4RBPH 2J3SA 4Q58C 5HSFA 1G0DA 1M2VA 3SGEI 3W57A 5CLYA 3NCJL 1SJHB 1E6JH 4PJ5B 4JANA 5KSAD 2JF1A 4NZFA 4X4YA 4O2EA 3KPSD 2YZ1A 1T7ZA 2VXSH 4LCWD 3T9WA 3RFZA 5JORB 3TVMC 1IGFL 5EG6C 1JZ4A 1P7QA 3WXVH 4HJUA 4YL9A 1NQBA 4FFZA 4GG6A 5AD0B 3A4AA 1GA2A 2CLVB 4P2QE 1WDAA 4JRXE 1D5XB 2Q7NA 4TKWA 4OCWL 2C26A 3UL4A 1VDGA 3WIIH 4F24A 3GHPA 2ZOTA 5DUPL 1PLBA 3HI6H 1JPFB 1QTYT 2H32B 4NXKA 4FQIH 4AE1A 2O6FA 1F4YL 2EYRA 2WINB 3WJMA 1A1MA 2KPNA 3V5DB 4WDIA 4BD4A 4YNYB 5C6WH 4XR8C 5MI0C 3FU6A 1AGDB 3D39A 5IG7B 5B39B 1UUSA 4NNXB 1G4RA 4PG2C 5DK2B 4XMLH 3BPLB 5KANG 3DLQR 3ETTA 4KK5C 3S0PA 4XPBL 1IC7L 5HVWA 2XG4A 4I77H 5HHPA 2O4EA 3BDXA 1KG0B 2XZAH 3QIWC 3KVDD 3LZPA 1SFHA 2CXKA 2KERA 4XO8A 4EI5C 4W4OC 3FSVA 1UADC 4I48A 4JKLA 1E9QA 1A6ZB 2KLTA 3VG0L 4Z7UE 3M1OA 5FHAH 5JPNC 5IJKC 3NJNA 3WHXB 3Q06A 4FZ8L 2CO7B 3C87A 2VIRB 3QH3B 4AQAA 4IKJA 3UAEA 3ZSSA 2AJUH 4Z3TA 5C6TH 3GI9L 2YGPA 3DO7B 3APCA 5IFAL 4WV1A 1VFAA 4H40A 3UROR 5IQ7H 4I9WD 5BZZA 4M1DL 5DK3A 4C47A 4JZJC 4Z3JA 3QQ4B 5A2BA 4ODVH 3DDGA 3V10A 3VWKA 3F12B 1WD9A 4BUHA 3ULVH 4P49A 3D50A 4PJEF 4R4NC 1LEIA 2QJDA 2EVFA 3PP3H 1OP3K 2P1YA 4DQOH 3LKOA 4RH4A 4TQ8A 5I8KH 1ZLDA 1NPJA 2IH3A 4KPHL 1H6FA 1HOCB 2P8PB 1G9MH 3MNVA 4JPIA 4RDQF 3RFZC 4NKIL 5EF1A 2L7UA 1L5GA 3MJ8B 3FQRB 4FHJA 4GI9A 4D0BA 4CN1A 1F58L 5F8QC 3DROB 4TULL 3BVTA 4BH7A 2EQDA 1LO4L 3ESVF 4Q9CA 4J8QA 3QPQC 2OJ1A 4R97B 1I7ZB 3KHQA 4OD2A 4X7TB 4PGJA 3MUY1 4JFDE 2PWHA 2IPUG 2O1AA 1NLDH 5D8JH 2E7MA 3GRWH 2UXVA 4PN6A 5F7WC 4N8VG 4Z7WB 5DK0B 3IJEB 3ULUC 4J3XA 3DUUB 4KUCD 3STLB 3V9EA 4QO1B 2YQGA 3ARYA 3DV4A 4BKLB 4X0KA 1ZSDA 1FUNA 3U6RB 4OGZA 1CPUA 5LQBL 2YAMA 1M57B 1QATA 4F5CA 1BD2D 1JGLL 1SMOA 3TBVB 1BFSA 2DYPD 1ZAGA 3SY0B 4QT5B 5DI8A 5C97A 5KS9E 5GPRA 1MFCL 1I8AA 3NK3A 1UWYA 1IAIL 4GAJL 4OW6A 4GMSL 5CP7B 4JZOB 5KAQF 2CHNA 1UCBL 4PRPD 1MDTA 3GRWA 1F8TH 1U3YA 3IDIA 5D7LB 1UA6L 5F71A 3S2CA 4G8FA 5JW4R 4Y0GA 1Q90A 3DRTA 4JX0A 5DHMC 3SGDH 2AITA 1JF1A 5LN4A 5I66A 3QFJD 4S1QL 3W11D 5M94B 4LCIH 1PZUB 5L7XH 4NWTL 1Z32X 4WV1C 3ZMEA 2J25A 1M7DB 3QNFA 4CVXB 2BSCA 3FT1A 2APTA 5ID1A 4NENB 1QSVA 1D7FA 3VWKC 3Q9QA 1B0RA 3MLUH 4JRLA 1AZRA 3O6FD 4RESB 2K45A 5EULV 5BVPH 4ZMOA 5AAWA 2V3EA 5C2UB 4C56A 2ZYSA 1ZTXE 1M9SA 1CE6A 1MCQA 2F53A 5AFAA 3D09A 4NIKB 2X6BA 3E1ZA 4FZEL 4GOSA 4K94H 2V9UA 4M62L 1NCBH 1RZ8B 4AK1A 5EF0A 5E8NB 4U1KA 3EFFA 5DMJB 1D2OA 4ZTPL 3UBXI 6FABH 3AM8A 2CU9A 4GG8A 2DQHH 3K5RA 1E4HA 5IHHA 2V2TB 4UM9D 1KCVL 3UADA 4YBQD 3ULVC 5I1EL 3LXAA 3I6KA 1BCIA 5AWNL 3WEXB 2LU7A 3SBWA 1OK0A 2IIJA 5MENB 3FL7A 1UJTA 3EO0B 3BIBX 4F3FB 3QCTL 1UH2A 1YNTA 2Z6FA 4PGBB 1D7BA 4N90D 1N6QL 1JHLL 3KWXA 5LAPA 2WO4A 1G9MC 3KGSA 4J27A 4LP8A 1BLNA 4GH7B 5DD3H 1YYLL 2R2HB 2BP0A 3CC5B 3D0VA 4JGMA 4OAWA 5IB5B 2Z31A 3VFGH 1SDYA 2P5EB 4ZRGA 4FADA 5IT2H 1AP2A 4U3SB 2GEQA 5EO0A 3EYQD 3DURB 4S1SL 5AOIA 2EVJA 4HK0B 1EHLL 1JG9A 3BUPA 3C6EA 4TOYH 3IBEA 3REVA 4RQQA 3WE6A 4U1IA 1BHGA 5HHOB 2GJ6A 1ET7A 2BVYA 5DRWA 1D9KC 5FUZL 1CQKA 1ZVHA 1XCQA 4XMWA 5GSRA 2GC4C 5EIIA 5E7BA 5E8PA 3BZDA 4ELME 4YFLI 1CE1L 2W38A 3TURA 4RISL 3ARDD 2DQMA 1JMZA 4OIIL 1P0SE 3V0FA 4X4MA 3NJMA 1LD9B 1WAAA 3EG9A 3T0EE 4ATTA 2LLLA 1MI5A 1XAUA 2HRGA 3I6SA 3N55A 3QEGL 3U7AA 3DXAD 3CMOH 4HWBL 2JJUA 4PJ8A 3K6IA 1JNNL 5AAWC 2H2SD 4P05A 1JPTL 2LVEA 5I17B 3KCPB 5HI3D 1VEMA 4KH9A 2GEEA 1OAUL 5CCJA 5HPMB 2IWGA 4L4VB 3ZGIA 4BFFA 1S7UA 2BVEA 2H41A 3CDCA 3HZVB 4W1TA 1JTTA 3HKFA 3AM8C 1OP4A 3BUTA 2NQ3A 1N64H 1S7VA 1ZTMA 5J89A 2V5RA 3IS0X 1I8MA 4YO0A 1RL1A 3GXFA 5CD5D 3BAEL 1IAMA 5I1HL 2DQGH 3SBWC 3PV7A 2W0KA 1HI6B 1YCSA 2AJSH 5DLML 4ZX6A 4XODA 1T04A 2YUVA 3DI3B 2CRMA 4YK4C 4KRPB 4YVUA 2V5SA 2X4OA 3D2UA 4K94C 4L1TA 5K1VA 1JVLA 4G7VH 2ISDA 5T3XE 1WBZA 3VXPB 5FYLD 4N9OB 1UATA 2Z31C 2OZNA 4OZGB 1RK0A 1MFVA 4JRXA 5HYSG 1Q1JH 1EEZA 4K7FB 5AVVB 2V3DA 1MQKL 4Y4FD 2EZ0D 12E8L 1ZT4A 1AACA 2OQJA 1XR8A 3C60D 3CZLA 2ZOKA 3CD4A 1QZNA 4KUZH 1GSMA 5EZJB 1DQML 4AUYA 3LJ3A 3JV6B 5D6DA 5F7HA 4PR5B 1FZMB 4KJWC 1TTGA 4Z23A 3LQZB 2FX8H 4B9ZA 2HLFC 3OVUB 4BFKA 2NPLX 5J4MA 4QPEA 4OM1H 2CDEB 1JF5A 1H6EA 2ROYA 1R3KB 2DLHA 1A2YB 2MOGA 5IBUB 4KKBD 4QDGA 1DO5A 4I2XE 3BESR 5F7EH 3C75A 2YRBA 4PJ8C 2BOLA 1JPEA 1JUFB 1P1VA 4FTVE 5DDHA 1MAJA 3OHMB 2IO5A 1EQWA 4Z7UA 3WTTA 3B9KA 3O81A 3RG1C 2B1HL 5EA0L 1YEGL 4G6AD 3OXSB 1ZANH 1QFWH 2RMNA 4PRAB 4N3TA 3QQ3A 1NZRA 4JO2H 3VFTB 1NAKL 5A2FA 4WCYL 4DFIA 2J6EL 2GIMA 5FW6A 3M8OH 5I8OH 5MEPB 5LVEA 3CXHJ 2IF7A 4NN5C 1TVHA 1VAHA 4UTCA 5G55A 2OR7A 5AVWB 3JWDH 2ZX7A 2ZCZA 1E4KA 1VENA 1DBMH 3QJOA 4Y1AD 4PY8I 3X1GA 1H6TA 3IGKA 4P23B 4PJ9D 3IB4A 1AKJD 1J10A 2ADIA 4FCHA 5DMIL 5E9DD 5FO9A 4RGNC 2PXYA 3KR3L 4J3OD 3STZB 3A6CL 5KYUB 5C0AE 1NGXB 3NDYE 4MFHA 3SKNB 1T5XA 2C9PA 5DQDL 1SYVA 3DDFA 4JFDA 4G6JH 5I1JL 5JIQA 3HS0A 2QPEB 3VFPA 1O5PA 3QULB 1S8DB 5BOJA 4FLHA 3U7WL 4P2RB 1WBXA 1NEZA 5D6DC 3ZN6A 1PG7L 1D5ZA 2QFRA 5DHYA 5AOZA 4WW2F 3JWNH 4LLQB 4YHML 1K8DB 4E9WA 2X4QA 2RACA 5KS9A 3CFJA 4PP1C 3IMWA 2AJZA 3M86A 4WJ5B 1TTUA 2UX6A 1A25A 2LTQC 1GRWA 4QAWA 2JXMA 2Y07L 3B9KC 2P24A 2Y2YA 1JDCA 2CGYA 1AGFB 2B1AL 1ETZA 2FJHB 2Y6SC 3OX8A 4TVPD 3FUMA 2VSKB 3RJOA 5LWYH 3PL6A 1QFWM 5BXFA 3CDFA 1AZBA 1XF3B 2NTFB 3GHEH 4L8CB 4HUXB 3FCSA 4NGHH 4YDIH 2VABB 5TDPB 1AR1C 5KTEL 1AC6A 5FYJD 4KKLC 4POZD 3BYYA 1E4KC 3DIFB 5D2LA 1HH9B 3HI5H 5F9WC 2C9UA 3NN8A 1RUPH 1B3JA 3CN1A 2EEDA 3OAZH 4MNGA 4Z7VF 1WZ1H 3D9AL 5EF2A 3OKDA 4UILL 4HAGA 3S37L 3K4DA 3MRPB 1ZHNA 1LO3H 2BXZA 2PXYC 1DVQA 1RJCA 5DRZB 2W9DL 4IGBD 5E00B 3WFBH 3GMPA 1R47A 4JG9A 3RA7H 3LZOA 3SEPA 2KT6A 2ESVE 2Z91B 3OAUL 1TTFA 3D6GA 4NM8H 3JWDC 3HE7A 3L9RA 3HS0C 4APQD 1ZDSA 2OSWA 3TIEB 1LK3H 3H42L 1VZGA 3UG3A 1M7IB 4Y5XB 5PCYA 3LNEA 2F5BH 5DJAB 3S34L 3H0TA 3BJLA 3FQYA 3VRLF 1DP0A 1UZGA 1EDYA 1XEUA 5GXBB 4E9SA 2WM0A 4E41A 3MLXH 3NRFA 2NTSP 1PDKA 1IBGL 1PVHA 4GUQA 2OM5A 3IU4H 4AEIL 3RVVC 3UJIL 4C4KT 5DD6B 4TLSA 3PXHA 2C1OA 2GTWB 4Z95H 1BQHB 4RFOH 2WYTA 1V05A 4MRCA 1IM9D 1BGXH 2O30A 3DOHA 1YPZF 4FXLA 4LPVA 4S0TD 4DUWA 3IJSB 3RPIB 3O3DA 1JGDA 3LV3B 3TA3A 4MCZA 4QRQB 3ML8A 2OMYA 2EE6A 4POUB 3HE6D 3KJ6H 1U42A 1L7TH 3KPRB 3QK0A 3VM7A 4PLJD 4DO5A 5FOBB 5KJ7E 1E43A 2AVFA 3FTVA 4BA0A 4NIYE 3PL6C 1IC4H 4J3VA 4E0RA 5GRVL 4I0PD 2IWKA 3BKCH 3BLKA 1OE2A 4XT1C 3WY2A 1UTDA 4E9QA 1HT6A 1Q0EA 3PGDB 4H44C 1XF5B 5BZWA 5EEYA 2EEFA 1MHPH 1ZVYA 5DD5L 1CT8B 2BVQA 4NNYA 1HAWA 4S2SA 1UOVA 4HKXA 4UQ3B 3ZDXE 4X8CA 5AYQA 1KCBA 3O2VL 2PMZA 4KU1A 2BIIA 1KFAH 1J5HA 2ID5A 4NPYA 1IAKB 2OSLB 2VT0A 4MA3A 5JHLA 3TT1L 3IMBA 1FNSH 1J1XL 4IU3B 1F4XL 1UWEH 4CVUA 1GTFA 1L9RA 2F1AA 5ACZA 4Y9EA 3HE7C 4XMUA 2QQNH 3OB0K 1Y6NR 1UXWA 2VB5A 4NQCE 1P4LA 5FGCE 2ZOLB 1JZGA 4BSWA 1FA4A 4N8CL 1PG7X 2EC9T 3WOVA 3BGAA 4JFVA 1K3ZA 4P59H 2DIJA 1QWUA 3IGUA 4P4RA 5KVMC 1XGUA 5JHAA 1U92A 3ZZSA 4DGVL 4TXVB 3DYOA 5DQJA 1SXAA 4AL8L 4TUKH 1U8JA 3I02A 3LRKA 4DZBB 4KDTA 2Q10A 3MROB 4O51A 1PZCA 1DQQA 3P9MA 1XF1A 1FAIL 4JFTA 3HI1B 4LPWA 5GS3A 2RTTA 1NFIA 3JYBA 2B4CL 3P1VA 1GGCH 3L3HA 4QCIA 3TA3C 1CFBA 4X5QA 3HG1B 4ZFGH 4QXGL 4WZ9A 3GB7A 3G6DL 1MUJA 2KLSA 5CEYA 3HN5A 1CI5A 4U1LA 2IGFH 4DQAA 5FAAA 2OTWA 4D7BA 3IDJA 4LSTL 3HBQA 5IB4B 5BRPA 3BHBA 3OXRA 4WJKB 5CU9A 3SDDA 4ZDHA 5F6IB 1B90A 1ZA3A 3H1ZA 1Z9SA 5EO1B 3GBEA 3ILEA 5A7BA 3S98A 3T2NH 1PIGA 3O3BB 4DETA 3RWCA 2Z93B 4A7QA 4OQTL 2OS7A 4JQVA 3L16A 4AXWA 3D33A 5C09D 1YN6A 3QT2A 2H5UA 2CKBB 4TUOA 3W9DB 2BMKA 1BIIA 3CZFB 4HBCH 5C9JA 2IALB 1MLBA 5HDBE 3QWRA 2YD2A 2VDML 2BVPA 3W2DL 3KLKA 5CCHE 1JGIA 2CCLA 2QR0B 2IMNA 4JO4H 4AW7A 4WWKA 1SMAA 3KL3A 3D85B 4P4KB 4IU2B 2MCPL 2DWTA 1FYTD 2DN7A 5DUBB 4HWZB 5DT1H 2EDEA 2WQRA 1KT2A 3GTVA 5C0AA 1E7VA 1OAXH 2WPGA 1T03L 3X3GH 5CP3H 1EJOL 1KENL 4MXQC 1BREA 4HIXL 2IXQB 3P3YA 4KDTC 1GC1L 1USZA 5AKRA 1QLFB 3FFCE 3UEZA 1XB8A 1IKOP 1HHHA 4YHIA 4M7ZC 3E7JA 4MAYB 5AENA 5KVEL 3IMTA 3LNHA 3ECQA 2IAMB 5CZVL 3OHXA 4XVSH 4O2FB 2FECL 4MMXA 4G1MB 1RIVH 4WIQA 1F6LL 4OZHF 5CP3A 3GJFK 4IQHA 4B9CA 1MPAL 4O58L 3LSOB 5LCVL 5JQIB 1XZ0B 3UX9B 3RX5A 2J8UA 3SDDC 3TCLA 2FJGA 3IGAA 3MV7E 4K3JH 3OD3A 1L9SA 4HWUA 3Q1SH 5F1KC 2WCSA 3VI4F 1S2EA 1F90H 5EBMB 1JRHI 4E2OA 4AV5A 2P5PA 4MWFB 1DVSA 4JQVC 2K78A 1QSEA 4K3DL 1OZUA 3CV5A 1K4CB 3M7FB 4PJXB 4ZI8A 1XGQB 5D72L 2CXGA 4QOKE 3ML9A 3D05A 4BDVB 1DEEB 2CG9X 1AY1L 3VWJA 4FQQB 2BFVH 4JN1H 4PJ5E 3ZR5A 4H20L 2EKJA 3SQRA 4UOZA 4JQXA 4PV9B 4A6YL 1ETJA 3NCYS 4G3YL 1OLLA 4WWKC 3FOLA 5H4ZA 5EZLA 2VQ4A 3DHJA 1XMWA 2MTPA 2IV9A 5B1CA 3KAAA 3WKYA 4YHPA 1U91A 2ESVA 2DQEH 5C0CE 3HS8A 5IVXB 4M43L 4NI6A 1RZIB 1OB1A 1T83A 4GKSA 4M9PA 3EW3B 1W6LA 1DJGA 5C3IA 1WS7A 3EFDH 4GO6B 2AGJL 5E2VH 2IADA 3S8WA 4DGUA 4H1LA 3OHXC 4HZLA 1PQZA 3P11H 4MMXC 3WFEL 3O11A 3ALWA 4YLCA 3U0PA 1E8XA 2YC1A 4PMFA 4Y19A 2YPLD 4G2AA 3BD3A 2CM6A 3DSFH 3JTSB 4NN7B 2DLFH 2GQHA 3IDMB 4KK9C 3UDWA 2IMMA 2WBJA 5C07D 5I5RA 2NY0D 1U95A 1XD1A 5IWLA 1MIEL 1J8SA 3X11A 3L5JA 3S3CB 3A6BH 1ZJAA 5I1IH 5JXAH 4RCAA 4P57A 1RK1A 2DPKA 3WN6A 1F97A 4QI3A 4ZBJA 2C9XA 4FMVA 3B43A 3NFSH 4L37A 3KLAA 2FYYA 4HMDA 1P5VB 3WMPA 1NCTA 3GK8L 2CK2A 3K0WA 1SN5A 3DWTA 4NZTH 4X99A 2A9ML 4A7SA 4L3AA 4M4RB 1TZ8A 5AW1B 1T22B 4RZKA 5E2UL 2EDTA 4XP5L 3CVIL 2HFEB 3D48R 4QUOA 4U31A 3DJTA 3GKWH 4XX5A 3KPQA 3F84A 2VTFA 3VWJC 4M7JL 2CKBL 3K2MC 4OD1H 5J1AB 1LP9F 3DMMD 4X5PA 4O2CB 2NNRA 4J3WA 3TN0A 5GZOD 4JQXC 5TE7H 3LPWA 4NJ9H 2Q5BA 3JTTB 3NCFB 4J3BA 5DUPH 4HIIA 3FO2B 2XPGB 4U49A 1YMHB 1F4YH 1M1XA 4BZYA 3IGFA 4LEOA 4OF0A 2WV3A 5D5MF 5JOFA 3ZKSD 5B1BB 1W0WB 4NDMA 5BS0B 4H25A 3QRBA 3N6YA 2A4CA 2DLGA 1T83C 1C16B 1UYWH 4UDTA 5EOCJ 5D7EA 3GXPA 4MXWL 5SWZB 1UOLA 3SZ6A 3EYSH 5IB2B 3GLEA 5KBNC 1MCCA 4Z7WE 2DWEA 4EIUA 1HQRA 1LHZA 4M6OH 2WMPA 2CHDA 1CK0L 2OTUB 4J8RA 4I4WB 4EXKA 2PNDA 4QHMA 4WKXA 3CVCA 4KJPC 3UDWC 3PWPD 1NGQH 2A6JB 1AO7D 2WBJC 5TDNA 2C34A 2W94A 3U1QA 5IWLC 2RQEA 3OWRA 1E5UI 1I1RA 5GGQL 5IB3B 4I7ZC 4JO1L 5ICXA 2X2YA 2Q8BH 1S5IL 2QKSA 5D7LE 4IBVA 4UINL 3LXBA 5T1LD 3PUCA 4LGPB 2G60L 3SE8L 1EJFA 4OFPA 3UTTA 4M1DH 4X6FB 4ZTOH 3LIZL 4YDKL 2IDFA 4LKXB 4QGYA 4DEUA 1W80A 4Y2NA 1T80A 4RMRA 3SSGA 1RFDL 3DECA 3IAPA 3WUZA 1GGBL 4CSZA 2YGQA 3S88H 2EXYC 1OAZL 5MERA 4NUQA 4LRNL 2ZP0T 1BLIA 3QQ9C 5E1AA 1XCTA 1XB6A 5L4FA 3PABB 4UT6H 4YVNA 3T77A 7PCYA 1FG2B 2N1KA 4JVUA 3OJVC 1GZQA 2OI9C 4JM2F 4NQVA 5TE4H 5B3JE 3TX4A 2BNQB 5I74C 5BO1H 4OLYL 1NBZB 3P4MB 5CGTA 4YWGL 1TJIH 1F4WH 3KPLB 3TN0C 3PDOB 1X9LA 1HAUA 3NH7H 5A2JH 1RUMH 1IZKA 4WI7A 2C3HA 3LN4A 2DWDA 2MOQA 1L9OA 3BZ5A 4U6XB 5K9KB 5C0BB 1T1XB 3UO1L 4EQ3A 4PFEA 3UZVB 4GS7C 1Z5HA 2VSCA 4UT6A 3FQNB 5GRUH 3SJVB 5AVXB 5JW3L 2ENQA 1SF5A 3WL9B 1KTDA 4AEHH 5MHSD 3NJFA 1IM3D 4QWWC 1ZLUH 4MVBC 1EZVY 1I9IH 2YBRA 2HCZX 3BWUC 1ZGLA 1YMMA 1MFEH 1K6QL 5CLWA 1XH1A 1MFCH 2W0FA 4PPTA 5ESQB 3EHBB 1K5NB 3NIDB 1IAIH 1UCTA 4OQ1A 3EYFA 4XCYA 2LLGA 1UCBH 3EJSA 4TL5A 1A1OB 2E4TA 4B97A 4LSDA 2X4NA 3G6JF 2V9TA 4NQQA 4GQ9L 3WNKA 4WJG3 5D7IA 1RSYA 5HHOE 3FFCA 5AG8A 4Y7MA 1BFVH 1LYQA 5IBTH 5HTSA 1U8OB 1WGVA 1EH9A 1MVUA 3P3RA 4OFYA 4MNQD 3TYGH 3BAXA 1ETB1 4X6CA 4JN2B 5IEHB 1QI3A 1MJUH 1XGYH 4ZD3H 1MQ8A 5DZVA 4NOBA 4HUVB 3B83A 1DUYA 1MCBA 3QDMB 1KJ2H 4LOEA 4PB0L 4WENB 1XSIA 4HSQA 3S4SB 1OK8A 4YGVB 3SCMA 3L3IA 4M9OA 1UWGL 5FCUH 1TO4A 2Z1PA 2DMHA 4OKDA 3ZE0F 4Z7QF 1ZVNA 1KCVH 2V9QA 5L8JB 5CJQL 4R2GD 1DBBL 4O4YL 4B0MB 5DJ2A 1N8ZA 1KJ2A 1XWVA 2FE0A 2PO6D 1CJYA 4QOKA 1ZGLM 1W72L 1Q0YH 2ZPKH 5IW1B 3BVDB 4P46B 1HE8A 1DR9A 1KGJA 1MW0A 4HOZA 5H35B 1IRAY 1SJHA 2H32H 4PJ5A 5AB0A 4U0QB 3SGKA 4OCXL 4HU2A 2Y0SA 2VN5A 3Q1EA 5JORA 3EJZD 4S1SH 3BVNB 1WICA 5AW6B 4AMKL 2H1XA 5AD0A 3CH1B 4QRPB 3C6LD 3V0EA 2CLVA 1UXLA 3DO4A 1NEUA 4HMCA 4K71C 1SHXA 5C0NC 1R75A 1P4UA 2ZX8A 4E68A 5FKAB 2I5YH 4ZO9A 3RZCB 5LGKA 3VXRD 2QBWA 4KDVA 4W9LC 1JPFA 1RUQL 1IAIM 3HRPA 3VFUB 4D0DB 7PAZA 2H32A 1FL3B 3ZE2F 2Q9OA 4E42B 1BXUA 2WINA 3L4ZA 4HEPA 4NKMB 3VNZA 4BE5A 3GSNH 4M5ZH 1TYEB 4PJGF 2V17H 1XH3B 5G4NA 3V5DA 1GKEA 2YUXA 2JKRM 1KN2H 3EO1B 5IG7A 1AGDA 4DKAA 5B39A 3AWFA 4LIQH 4NNXA 4ODHH 5DK2A 3C09C 4LEXL 4U6HA 4P0DA 3KPTA 3MFGB 5K39B 5DURD 4JE0A 1KG0A 4LCCB 1URLA 4M5SA 3O4LB 4FABH 2WVTA 3SCMC 3ASNB 4E5XB 3FZUC 4JM0A 2OA9A 1A6ZA 4R3SB 2MPAL 4P8QA 4ODTH 5F0LB 5D1XD 4JFFB 1U8QB 3WHXA 4AIOA 2CO7A 1JV2B 4KOBA 3QH3A 3WBDA 4XOCA 2JKJA 5GS0L 4PUBL 1LVEA 4X7CC 3DO7A 2DIEA 4M7LH 1T7VA 3O8XC 3F7QA 1NOLA 2B8OT 5DZAA 2D03H 1P2CB 2ORBH 1MCDA 5I1HH 2WYZA 4BH8A 4F2FA 4HU8A 3HAEB 4Z0XB 4M93C 2AC0A 2DQJL 3W81A 4HKJB 3F12A 1U6AH 3ARVA 5ESVB 1RP8A 1OAKL 2LU4A 2F7RA 4WO4B 1MWAB 2A0LD 4TQEH 1XH0A 3SGKC 5K9OB 5I76B 1J88A 1HOCA 4R0LA 2P8PA 2XKSA 4EDWL 1X5XA 3MJ8A 3FQRA 4RMSA 4CA4A 1I4FB 2CCVA 3NK4A 2X1QA 5T1DH 3V4PB 1CXEA 3ZE1F 2J20A 3DX9B 3NJVA 3DROA 1QABA 5KSAB 2MQ3A 4PRID 3KPSB 3KPOB 4NEHB 4LCWB 3BZFB 4X7TA 1BM3L 1KPRB 3Q01A 2EC9U 4ES8A 1JERA 4HUCA 3EDFA 4LLYB 3GXUB 3RIFF 4B7LA 3CHXA 2X3AA 2IBZY 3QCUH 4Z7WA 3IJEA 5DK0A 3DUUA 1WBYB 3STLA 1M53A 1F3DH 4QO1A 1SY6L 3U6RA 3L5IA 3RVTD 2YKLL 3OF6D 3F6JA 2YAEA 3BPLC 3TBVA 3S7GA 3SY0A 4QT5A 4YE0A 2UXTA 5D1ZI 3HEIB 3I3DA 3QDHA 4TNVF 5DO2D 3BE1H 4JO3L 1WLHA 4JZOA 5CP7A 2AK4D 5D7LA 3MRJB 5SX5K 3QQDB 4WF7A 4HIHB 1ILSA 1YN7B 2ZUYA 4Q52A 4YUEH 3BJ91 1DLFH 4BSVB 2DM4A 1T7XA 1ECYA 1Z0MA 2D0FA 1M7DA 4CVXA 5K1JA 3VJ6B 3CPLB 2VRKA 1M71B 4XNYH 4NENA 2IPTL 3FSOA 2A6KB 2B5IC 3P2DA 4ZFFB 5IKCB 1I1CA 2CKNA 1E5ZA 3ARQA 4TSCL 1QHPA 5LGHH 4RAUB 3A3YB 4QXWA 5DD1L 1KEML 2J6EA 5IHWA 3EH3B 2FO1A 1U8CB 4M8QB 1QRND 1HTYA 4R0LC 5CUSH 3KR3H 1WFTA 1RZ8A 5C9KA 5E8NA 1A7QH 2L04A 3T4YB 1ASQA 1UA7A 2AQRA 3MV01 2YLKA 4LEEA 4N4YB 4BQ6A 2Z3FA 4EOWL 4L1LA 4WHTB 3MRCB 4F1SA 2K9UA 4MNHB 4EE2A 2Y25A 1G0XA 3U30B 2E9IA 2FEEL 3U7WH 5C86A 3WEXA 4N2AA 5MENA 3EO0A 1KYOJ 3CHQA 3HRZB 3N43F 3CN0A 4I0KA 3NYKA 4F3FA 5T33L 4PGBA 4YHMH 5J6SA 5KBMA 2ZYHA 3GIVB 2K1MA 1G6RB 1UGKA 4JKKA 2R2HA 3QIWD 4EEEA 3CC5A 5IB5A 3GDBA 2E7LC 2O5NA 4ZJ9A 1MJ7H 4UYQA 4U3SA 4LMQE 3AQYA 3DURA 3OWEA 3WHE1 4HK0A 3TV8A 3POHA 3QZNA 2HFGL 5KVEE 3II1A 4KFZC 2DMBA 1BAFL 1QSFB 1N0XL 5HHOA 4GMTH 4ZSOE 1W2KT 2KC0A 2YRPA 2ZWNA 1O7SA 2ZUQB 1BD2B 2JKIS 2BZCA 2DYPB 5C70A 2WIIB 3NUKA 2ICWB 2FO8A 3CTTA 1FF5A 5KVFL 2WXKA 3BH8B 1Y6MR 4H8HA 1J8RA 4NC1C 3WXWH 4PRPB 1LD9A 1QWNA 2G2RB 2F2HA 2XQYK 4HLEA 5ICYB 2A73B 3C5SB 4LHUB 3ELQA 4GQRA 4H5SB 4G6KH 1M3IA 3QFJB 1AHMA 2FBOJ 2AQ1A 1TPXB 4Q97A 5FO7B 1Z5LB 1CGUA 3VFSB 5I17A 1H19A 5EN3A 3H9SD 3KCPA 4HPOH 1PKQE 5FR3A 3DIVA 5HPMA 1A3RH 2W9DH 1I85A 2NY6D 2O5YL 4Q74A 3QCVL 4L4VA 4L2YA 1ZPLA 3MN8A 3MLWL 3HZVA 1CTNA 4C4BA 1HSAB 5C08B 4PVNA 4DPCX 4Y4KD 4M00A 4D9LL 2DWYA 5LB1A 5GRJH 1KACB 1D5IH 2QZQA 3H42H 3GPSA 1TSRA 4H8WL 1DJYA 3KW8A 1HI6A 1SGKA 1EX0A 4KI5F 4DSYA 4F15B 2YMTA 3TU6A 4JPVL 3FMGH 3IJYB 5IBLD 4LO9A 1MCWM 4UM9B 2ZONA 3KD4A 1E8YA 2VM3A 3VXPA 2X89A 3MJGX 2VXQL 4JJOA 4OZGA 3MRDB 1S3KL 1W15A 2ZOWA 4K7FA 3QRGL 3FO1B 4TM9A 5L8LB 3JWOL 2EDQA 1A4JB 1PEWA 4XP6L 4FTDA 3BFQG 3SKOB 5L9DL 1HHGB 1M2OA 3CK0L 5DHXB 2PWDA 3VVVA 5M95B 3QHFH 4R26L 4OZFG 5EZJA 4PJDB 3JV6A 4KGLA 2EICA 4PR5A 3QHTC 3VWKD 4HD5A 3BKJL 3LQZA 3VD2A 4YHKL 3LKSB 4OCSH 2EEBA 4KK8C 3TBWB 4O9HL 2CDEA 4JREB 7FABL 4NZDA 3D1MC 1RK7A 1NEZG 4IRSB 4PP2B 2DQIL 1R3KA 2FHBA 3FHQA 1TENA 5KJ4A 2Y6TE 1A2YA 1O0VA 3ARDB 3LVTA 2D7QA 5JR1L 4LSVH 1JUFA 3I84A 5KN5B 1Q0XL 1AQ8A 3ULVD 2BHYA 1VFBB 3OXSA 2PYFB 4PRAA 2EDMA 1I85C 4N0UE 4UQIM 5J9PB 4WTZA 5CSGA 3LZLA 3VFTA 3D12B 4KTEL 4NZRH 3QNYB 3QGVA 3T0DA 2Q8AL 1F4XH 4KX9A 1IFHL 5MEPA 3LKPB 4RA3A 5CJXA 2WJ5A 3HPJB 4ELDA 4XNXH 1ZLWH 3MBWB 3ALPA 4YSTA 4MBOA 2ERJB 3IXTB 3IE9A 1QHOA 4IDJH 1SRDA 4J39A 2XDHA 4ENEC 3FFDB 2VM4A 5DVKA 4KRPC 4PYGA 1KCUH 1ZV2A 3AMKA 4M8RA 3UAJA 4DGVH 4JZNB 25C8L 3QNXB 4P23A 1W6WA 1EWHA 1IU1A 2PETA 3MU3A 4AL8H 2J5WA 1BXVA 4MB5A 4QRRB 3D2TA 1IAOB 5F9JB 4OGXH 1JNHB 4A2LA 4A68A 3STZA 2FLMA 2N4IA 3CFMA 3MCKB 5KYUA 1MHHB 1NGXA 3SKNA 2HWZH 3FC8A 3VH8B 2CGRL 6PAZA 4F8NA 2W88A 5ANMB 4YE4H 5A16B 1HXYB 3QULA 1S8DA 1CFNB 5FA4B 5HPOA 4XOBA 2EVHA 2UVEA 4XHJC 4OIFA 4Y4FB 4XN2A 1UACH 2KZKA 4D94A 4LLQA 1K8DA 5K9QG 2BERA 1GOHA 3C60B 4H0LC 4LSTH 4B9IA 3DOIA 3QXWA 5EMYA 1ET8A 2CM5A 5F3BB 3T65B 4N2BA 2BINA 4XI5C 4WJ5A 2WXMA 3C9NB 4LGSB 2R2CA 3OLIA 2I60L 1EXGA 2JWYA 4OT1L 3BKMH 4XAKE 3WEMA 3PQYE 4PJBF 1IMHC 1XT5A 3Q5OA 4KZDL 3A0OA 4MS6A 4OLXH 2XV3A 5DFAA 4ADGA 1AGFA 3SYAA 5BOZG 2D7TH 2FJHA 1SNRA 3WN5C 1ROCA 2AKRB 3BKYH 3CLFL 2AHIA 3IK2A 5CJXC 2CBOA 2WNXA 3ZDZB 2FD6L 4PJXE 3BW9B 2NTFA 1XF3A 4L8CA 1HINL 4HUXA 4HYTB 2Z31D 2GIYA 5TDPA 1RIHL 5EZPA 1LEKB 5DTFB 1G87A 3QISA 4P5MB 2OMTB 1MWOA 3S6CA 4BFGA 4EI6B 3FPYA 3DIFA 3WTYA 3FQUB 1HH9A 3BRFA 4RX4D 3UAJC 4PJEB 2QMJA 1ACYL 1AJ7H 4P23C 1S7SB 3V79C 3RJDA 3ECBB 4HIXH 3MRPA 4ONFL 1EO8L 1QBML 3WJJA 5DRZA 2GPZA 4Z77A 1DL7H 2FBJH 5JW4Q 5E00A 4KJWD 5HDLA 1JZ6A 1LE5B 3T0AA 3OJDB 2HLFD 1YEJL 1IBDA 2L7QA 2EVIA 2Z91A 4PJ9B 4WSJA 3EZ8A 5IVXE 4LL9A 1G7JB 1AKJB 4NS0A 4PHZA 2NY4B 5E9DB 2AK1H 3BSZH 3LS5H 1LQBC 1M7IA 1AMYA 4MS8C 4Y5XA 4AL8C 1NIDA 1U93B 5DJAA 4G82A 5C0IB 3S48A 3QDGD 2IQ9H 3BP7B 3X1EA 5LUMA 4X6EA 4P99A 4F9LA 2ZCKH 2DS4A 2OR9L 1OHZA 5EWIL 4PW3A 4PJ7F 4ZZFA 3WIHH 2VW7A 4XP9L 2E9WA 5DD6A 2AJVL 2GTWA 1BQHA 1MCWW 3RPBA 2ZT9C 3BSZA 4TPRL 5D6CB 5IHBA 1CGTA 1M9WA 2VRAA 1VPOL 4XVUD 2QSCL 4MAZA 1N12A 3D51A 5AKTA 1JDAA 3QHZH 3IJSA 4GBXD 4K3DH 3RPIA 3LV3A 2ICWJ 4QRQA 3WUWB 5AYTA 2UYLB 3G08B 4F7PB 2F54B 3FO0H 3KPRA 3QAZC 2X2JA 3TT3H 5FOBA 5F7DA 5E08L 2BSRB 4NQSB 4FMKA 3UJJL 3D3VB 2WB1A 2VH5L 4P3CL 4W9GC 3B9AA 5E4OA 1MCJA 3ILDA 3UCRA 2FJSA 1V5JA 1OAYL 1Q9WB 5DD0L 2A9NL 1QACA 4GY4A 3PGDA 4DUXA 5TFSL 1XF5A 5EOCH 4I1PA 2PUQT 3SGDI 3QEQE 3B1TA 1PFCA 4LOUD 3BUYB 2G3MA 1QW9A 4B9PA 1HFUA 2YAFA 4OH2A 4UQ3A 5KSBB 3B6SB 4G42B 3H4FA 4RMBA 2DRUA 5TD4A 5A7EA 4C8XA 3WJJC 1XDTT 1IAKA 3MRQB 3X12B 2OSLA 2GB2A 3L3JB 5HHNB 4WI0B 7TAAA 1AFVH 4K23L 4JDVB 4IU3A 1JD9A 4FYRA 3EBGA 2B08A 3U4BL 4GSDH 4OZIB 1HNGA 1GJIA 3GC3A 4GLRH 5FUCE 4GUPB 5KG9B 4NM4H 4N0CC 4PP1D 1CS6A 1LDPL 2HVJB 2ZOLA 3PDGA 3OAWA 3PREA 4Y5XC 5EBGA 5FYLL 2O26U 5F7AA 3U4AA 1FNAA 2V5TA 1SM3L 3HLAB 3GD1C 4LVNB 4APQB 3FDWA 4P5RA 2P47B 4YSSA 4ZG1A 4F9LC 2B16A 3SOBH 1P4BH 4YHOH 3BP5B 4I3GA 4UIMA 1XFPA 4GIAA 2YPKB 4HW6A 1CFVL 3MROA 5DQ9B 5F21B 4POYA 5FK9B 1NANI 5TDOB 2GJZB 3HI1A 4ZUVB 2A9MH 3S2AA 2BK8A 3BQUD 3AU1B 2BY2A 5DFWH 3WS6A 5C0GA 3HG1A 2Z0UA 4CKQA 4XP5H 5JPMB 4EVNB 5HGDB 1IM9B 4G80B 2DI7A 2YQ2A 1E2WA 2UV3A 3CVDA 3QYCA 1NFDB 2Z92A 4ANXA 3LEXB 1R17A 2A77L 5IB4A 1SBSH 3CG8A 1BQRA 3HE6B 1C1EL 4OD3L 2DW5A 5EO1A 1FCCA 2PXYD 2BNQE 5K33A 4XPTH 4DGIL 3O3BA 1V3KA 3I9IA 4LOVA 3JBG7 3V8CA 3VXMB 2MCAA 3EXLA 4Z7IA 2A6DB 4I0PB 2Z93A 1RZ7L 5GRYA 4YXHL 3ZX1A 1N5YL 4XC1L 5IZ7A 1A8JH 1OT1A 4IEFB 4CNIB 1ERNA 3MOBL 1XTLA 1A7BA 3RX7A 2CKBA 1XF2B 4NO2B 3W9DA 2I69A 3PGCB 1HESA 3CZFA 5D9SA 3NIGF 2P5WD 3HBZA 2D0HA 3PJLA 2IALA 3I9GL 3SJVE 4DCQB 1I1AB 2K7QA 1QNIA 1X4ZA 2QR0A 2VR7A 4AGQA 5I75C 5CN2A 3RVVD 3HR5B 3IT8D 4WFFD 3FRPB 3D85A 4P4KA 4IU2A 1OPGL 2BVOB 1F2XK 2VLMD 4A2EA 2AMUA 3NIDE 3CMGA 3IFOB 5DUBA 3P9WB 4HWZA 3REWB 3TOPA 5GGQH 3C08L 5F0PB 2HFFA 4A2HA 4ZMVA 3MBED 4ZQTA 4HJJL 2IXQA 1FIGH 2J4WH 3FUNA 2EDBA 2MCG1 1QPXA 4JHAH 1QLFA 3LIZH 3BVWA 4GT0A 1KIUB 1BYPA 4OSUH 5FFOA 2N7BA 2X4PB 4MAYA 1RFDH 1UT9A 4Z76B 3TBBA 5IF0B 2D3LA 2IAMA 4URTB 4V2BA 4O2FA 2VN3A 4G1MA 1CU4H 2Y5EA 4HC1L 5FKPB 2OYPA 3KLHC 1JTPA 3WS6C 2ENJA 4ZNEA 2Y4SA 4IBLT 5F89B 3LSOA 4BZ2L 3MI6A 1TVDA 1BMGA 1NSNL 1XZ0A 4H1LG 4JJ5B 3LIZA 3QWQB 4MQ7B 2CJUL 3DIDA 4HOWA 1FFOB 4GI6A 3UO1H 4B9YA 4YAQB 4NUMA 2HRPH 5EBMA 4PRBB 4ZMAT 4TVPL 2XBTA 5D7JD 2ZCLH 4MWFA 2FJFB 3TNNB 3IS1X 1KPUB 1OO2A 2K8QA 5F7BA 1K4CA 3RAJL 5HYJE 1HKFA 4PJXA 1JYNA 1XGQA 4PS7A 2J12B 1KN4L 2XN0A 1P7BA 4BDVA 1N19A 1K6QH 5FYJL 4E41D 2W91A 4FQQA 1WF5A 5C09B 2OCFD 2XQYG 1QD0A 2EILB 1TQWA 3OPUA 3ZKMD 4PV9A 1QFWI 3US0A 1NCCL 3T1WA 3WD5H 3B37A 5JZ7D 4P4KC 4IBWA 3ZTJH 1AGBB 5GGVH 4GQ9H 4QRPE 4GFTB 1TUPA 1KXHA 5CCKL 2XN2A 3N5AA 3J7HA 3O2DL 4MMYB 3CDYA 3TA3D 4AEFA 5E8OB 4MQSB 3BT0A 1KJ3H 5ACLA 5IVXA 1RZIA 1ANUA 4A1RA 3VFRB 1VJSA</