4M5TA

Disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
82
Chain Sequence
GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERGFISRCFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-crystallin B chain
publication title The structured core domain of alpha B-crystallin can prevent amyloid fibrillation and associated toxicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 18
structure length 82
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4m5tA00
2Y1ZA 3Q9PA 3GLAA 4I88A 5LUMA 3J07A 2K8QA 3W1ZA 3QORB 4YDZA 4YLCA 3GUFA 2XCMC 1EJFA 3QORD 4YE0A 3VQLA 2WJ7A 3QORC 4MJHA 3VQMA 2Y22A 4FEIA 2KLRA 4M5SA 3N3EA 2KMWA 3Q9QA 1WFIA 4PBDA 4RZKA 1WGVA 4YL9A 1GMEA 2CR0A 1SHSA 3QORA 5DS1A 2RH0A 2CG9X 2WJ5A 5DS2A 3AACA 3L1GA 4JUSA 3IGFA 1RL1A 2JKIS 3GT6A 1X5MA 4YLBA 2O30A 1WH0A 2Y1YA 3EUDA 4M5TA 4ELDA 2MNWA 3L1FA 2N0KA 3L1EA 4ZJ9A 2N3JA 2BOLA 4PCKA 3AABA 4JUTA
chains in the Genus database with same CATH superfamily
4KTDH 2QQQA 3WMPA 3EO9L 3ES6A 3PF2A 3OKLA 3V52H 5AZ2L 1G0YR 2AMUA 3PAVA 1BJ8A 4TRPH 4YDZA 1SY6L 2L7UA 2WWMC 4KUCF 4NUJA 5FOBB 3WDIA 3S3JA 3OR6B 2QFPA 2J6EH 2H0JA 3MBEC 4WZ9A 3L4VA 5GS3A 3QHTC 4CRPA 2H6OA 3GSOB 3MTRA 3ARYA 3EJPA 3HKFA 5C7XL 3OZ9L 1BD2A 1HCFX 1TOXA 4QMEA 4ZOEA 1XDTT 3IFLH 4MNQA 3ZU8A 4AGNA 3RVXD 5I17A 2H26B 3L7EB 5I5RA 2VWEE 3O6KL 4KHXH 3QUZA 4AMWA 1XH0A 4PJIE 3RHWF 2G9KA 3P77B 5I18L 3VNYA 1UUNA 2Y07H 4XO3A 4XODA 4ENZA 2R2EB 3ZN6A 1MHHB 3B2PA 5ANMB 4ZX6A 1SDAB 3TS8A 5AQ0A 2O5YL 3HOGA 4JDTL 2R29H 3S35H 5CCJA 4PJEF 4XOAA 4E9LA 5GS2D 2FGZA 4M3JA 4CUCA 5CGYD 4QCIB 1H3TA 2OMVB 4BQ6A 1KUMA 2D03L 1FL3B 5AW5B 1LE9A 3UBXG 3QJOA 4W93A 3GXFA 4UOQA 5K33A 1NCDL 1NIAA 4MJIA 2B08A 2DQEH 2HLAB 4GO8A 2DM2A 3DNKA 4RAHA 1ED3B 3GGWB 3IPEA 3FT2A 1QSEB 3UBFA 4N2DA 1FFRA 4OZHA 4EN3C 4YXLH 3N85H 1SOSA 1T6VN 5E1AB 4Q58C 3EO9H 3RIAF 4ZS6D 2OSXA 5AZ2H 2AQSA 1NGZB 1MPAH 3RVTD 3QQ3A 1GY1A 3H9YA 2Z4QB 3NIGF 4S2SB 1SY6H 4XVJL 1WH0A 4JM2C 5B3NA 1KGUA 1CYWA 4UOZA 3MO1B 2ADGA 2CDEB 3CHOA 1F41A 2K70A 4R7XA 2X4NA 3FOLA 5FV2A 1KLFA 3WDHA 3QEQB 1BQHG 5GISL 1KF9B 1F42A 1P2CA 4GLRH 4P5TA 4Y4FA 2QDWA 5T5NF 3CFDA 5C7XH 1CFNA 2H32H 3OZ9H 1LNUA 1MRDL 4B50A 1N68A 1ZVNA 1KJ3H 4YE4L 2ITEA 3CDCA 2ZIDA 2HYMA 2MH4A 2XYCA 4UDTA 4YDMA 5HHQB 5I0XA 5AKRA 3O6KH 5T1MB 2ZOUA 1KGCE 1TVHA 2RCSL 3EJZD 5I18H 2J8UB 4KDVA 5LB1A 5FGSA 1XGUB 3SDXA 2HKAA 3KGTA 3T04D 1E5CA 1MJ8L 3L4ZA 3SYAA 4FE9A 2O5YH 4JDTH 4K3GA 3DWTA 1BIIA 1YDPB 4FTVE 5HGDB 5EU5A 4KDTC 1KEGH 1AGCB 1ECZA 3CBJB 1KN2L 4W81A 4WENB 2D03H 1K4DA 4FXGC 5SX4I 2HKFL 2Z93A 3PGDB 1NCDH 4N4YB 3BVVA 2XDHA 3FU0A 3GDCA 3QE5A 1OOWA 3OL2A 4OY9A 2MHAB 3GBLA 2WN2A 2W5PA 1FGNH 1GSKA 4FMFA 1U2YA 2QFRA 2BLFA 5DMGD 4H8HA 3MODL 1TSHA 2LV4A 4PJ8D 3RGVA 2X3AA 3T4AA 4HWNA 4U05A 4ZMNA 1R3KA 3PQYE 1KTBA 5AAMA 1IZKA 1IGJA 2E6PA 1J8HA 4UBDC 2DWEB 2QDVA 4C57C 1JZ7A 2X2JA 4XVJH 4F7CA 2CSPA 3TIDB 3ECVA 4G1EB 5I6PA 1RFDL 4MNGB 1XF1A 5F7NC 4L1LA 4UDUB 4G6FD 3RNQB 4PRIB 5GISH 2MRYA 1S7TA 1L6PA 1XIWA 3GB7B 2EXSA 4NEHB 5DEFB 3MFFA 4UM8B 5FYJD 4YE4H 4GG6E 4IIZA 3DURA 5IVXB 1IEHA 2BSRB 4MCZB 5B1JA 2H2SC 5T5FA 5KYWB 5D7JB 3ARBC 4MLIA 4LFHD 1F11A 4PJ7E 5GRXG 4ETQA 4RZCA 2RCSH 3SGEH 1MZYA 1GC1L 5FHAL 1K85A 2QGEA 4NFBA 3BZ4A 1D5XA 2EEXA 4O2FA 5FDWA 2YPVA 1MJ8H 1VCBC 3MOBL 1EWHA 2WJ5A 2X4QB 1IAKB 3FH5A 4JHBA 4AQ1A 3N41B 5B8CB 1CO1A 4OJYA 2X2HA 3C60A 1KN2H 1U3HA 4JY4A 3PQYA 4HUVA 2LOEA 4O02A 3NA9L 2HKFH 3UTZA 1CVSC 1LEKA 3EYSL 4L2LA 3T65A 5DEGA 2OBGA 2BP8B 4GEIA 4BIKA 2XFGB 4PRHD 1WP6A 4P2YA 3WN5C 4LEOA 2APSA 3A3YB 2IBGA 1EJFA 4U6TA 8FABB 3WMSA 2WJ7A 4XNMA 4M5SA 1TTRA 3MODH 4JFQB 2BHYA 2D7TL 4A68A 4GO6B 4U3SB 1JGEA 5FW8A 2ZG1A 5BO0D 4PJGB 4OZIB 1AQDA 1H9VA 4TTGA 3HHSB 1ACYL 4WUUE 5E8DL 3DVFA 4EUPH 3EJSA 5KYYA 1A6ZA 5DQJB 3ISRA 3PWVA 1S7RB 4N9GB 3QUMA 3Q2LA 4MLSA 5F7MC 1RFDH 3ZTJH 1X5JA 5JIIA 5J6SA 2F1EA 1T03L 2WTRB 3L54A 3RZCB 1TQVA 3PNWA 5DRXA 3JTTB 5G2NA 4UZGA 4HMDA 1BVLA 4KTEL 4BK8A 1CFMA 2V2XB 2LLGA 1I3GL 1JZIA 2HLFD 2AXFA 1QLRB 2AKRB 2D7MA 2ATAA 5JW4R 1GC1H 5FHAH 5IROA 1CDHA 4X5WB 5F71A 2PUQT 3MOBH 1YYLL 3LN9A 5HPMB 2O93L 2JIXD 3NEEA 3V6OE 1U58A 4J3OC 3TVMA 1UD2A 4L3AA 1F02I 1I1FB 2XG4B 4RFOL 3V5KA 3EGDB 2X53A 3QQ4B 4F80A 2DLGA 1URLA 3AWGA 4FYQA 3TCTA 3QULB 3TTYA 3TBSA 4PBDA 3QT2A 3V9EA 4C4BA 3NA9H 1L7TH 4GAAA 2X1PA 1MCWM 4CN1A 4UQEA 4TLSA 2H47C 3EYSH 4Y2LA 3R4DA 4PRPD 1HSAB 3WKML 3TO4A 5IR1B 1L9RA 3BN9C 4BXVA 3EJYC 3EG9A 4M7ZB 3QZLA 5BQDA 3N1GC 1WZ1L 2D7TH 4HJTA 4FXTA 1UYWL 2AABL 5DK0A 3FK3A 5DJAB 5D1XE 1JNJA 1CTMA 2BIMA 1U30A 3GK8L 1G9MH 4CVWA 1A0QL 1H3XA 4N5ED 1FWXA 1S7VB 5E8DH 3BCDA 4X8JB 1S7SA 2VLJA 1QR1B 5LDUA 4DP2X 3T6QC 2AJZA 5ISZA 3PJSB 4PCTA 5TE7L 4J8RB 5EU4A 1T03H 1DQLL 1T0NA 3CZUB 3OR7B 1T1YA 3AADB 4ACTA 3DXAA 4JG5A 2O5NA 1UB5A 1DQJB 1JXFA 4KTEH 5HI3D 2BOBB 1EANA 3D06A 1G9NC 1ZT1A 2IO5A 3MJ6A 4BINA 1I3GH 4POZD 3DX4A 4Q9CA 1UWGL 1UCBH 3SKMB 3RFRA 5E5RB 4QF1A 4L1HA 4HKXB 1N6VA 4D3CL 5T5FL 1ID5I 4WNJA 2ICWB 4ZNEE 3TASA 3FO9B 3TV8A 5IVNA 1Y6NR 5F7BA 1SHSA 1YYLH 3VO0A 4R2GD 3TIEB 4CGTA 2FUQA 2BSED 1DBML 2APBA 2YKLL 3VGAB 3BD3A 4RFOH 4FQXB 4JGNA 4QRQA 1ITBB 4AJVA 4XX1E 3G6JE 5ITFB 5D1XA 4PJAB 4O4YL 3QUYD 3QG6B 2ITDB 1SOXA 4F7EA 3UPRB 4O02L 1X7QB 3SYPA 3WKMH 5LHDA 1T0MB 2CA4A 5LXGL 4WWID 4DZ8A 4U1GB 3DX7A 1WZ1H 4EXKA 4BV1A 4DQOL 1Q8MA 1UYWH 2AABH 2IAMA 2ESVB 1IMHC 3TNNA 3N0AA 4HFWA 3QJUB 3II2A 1DCEA 3GK8H 4XBGB 1A0QH 1D5BB 3DO4A 3QEUB 4UB0L 3V0DA 3GSWB 5F6IB 4CMMA 3L9RA 1CQYA 1I7UA 4HJIA 4MDIB 1ZLWK 3NRFA 1ZSDB 3FCSA 3AS3A 3IJHA 3JT0A 3K6OA 2DLTA 4MVBC 5TE7H 4UCFA 4KH9A 4BFNA 1YUHA 4ZNEA 2D3LA 1DQLH 5DJ6A 2YQ3A 3UFIA 3FQRA 2WXGA 3QUML 5SWZD 2EYTB 4LAJH 3NPSB 1ANUA 1TTFA 2VQTA 2VDNL 2XN9A 2ZOLB 1TQTA 2RJMA 3D6GA 4JFUA 2NY6D 4D0DB 1T2QL 1LEIA 1UWGH 2OA9A 5KBMA 1TLMA 1CXLA 3ELAT 4Y4KB 4NO2B 4D3CH 5HHOA 5T5FH 5E8EB 1DJYA 4NM8L 2WD0A 3P9LA 5GSRB 1X9QA 1SQ2N 3N1FC 4MAYB 1DBMH 2YKLH 3BCFA 1C08A 2AXJA 2XICA 4RISL 3UYPA 3MJGX 3GLDA 4LE8A 2GJPA 4JFEB 3B9KB 1D5MB 1XQ4A 2P5EE 3NIDE 3QJZA 5F9WC 5BVPH 1J9RA 4O4YH 3QIUB 4M7LH 1Z7JA 2Q2EB 3A4FA 3ZZQA 2VXVL 1FL5B 5MHSD 3DX8B 4BK5A 1C1EL 2R56L 3FYEB 3GJFH 3IFPB 3OKYA 3GBNL 3QG7L 5LXGH 3BWSA 3LQAC 4K7PL 3L5HA 5A2LH 3AABA 2AF2A 5C8JB 4DQOH 3ALWA 2F53E 3QDME 1P5UB 5KN5B 2K6WA 3N91A 2XHNA 5IBLD 3I3DA 2HJKA 4AEFA 4UB0H 2H45A 2JXMB 5C0ND 4H8PA 3TJHC 2V7HA 4DOHB 2Q3ZA 5DYOB 4I1RA 1IBZA 3KAAA 4NRYB 5G4NA 4Z3JA 5LDSA 2GBUA 5EBWB 2LU4A 3ZKMC 3QUMH 2HRPL 1M7XA 4DQAA 2FJGB 1JHLL 3W11D 1J0ZA 3L6FB 4S11A 1NPNA 4GW1B 5F3BA 5FKPB 4P3CL 4NUPA 2E27L 1REIA 3QJTB 4LLMA 1ZGLM 3EFDL 4PV1C 3AS1A 1WHOA 2KS0A 3MLTA 1EXUA 2HH0L 1LP9A 1FVEB 4PJCB 1RHHB 2CO6B 2R0ZL 1AZBA 1KJMA 3DUHA 4WJG3 5C2UB 1WQVT 4GFTB 2F7RA 1U36A 5E8PA 1JZ2A 4GKOA 5JW5B 2OMUB 2FEJA 4PGCB 3IDYC 4AGOA 3D25B 3V0VA 3MCKA 5FGCE 4RISH 2Z65C 2F53A 3DSNA 1NCJA 1A21A 2JCCB 3KVQA 1E4XI 1XGQB 1XXFC 4Y16A 3PWPB 3V5DA 3O3DA 4ZMPA 2VZSA 3AB0C 2IPKA 1OP4A 1CG9A 4P46C 2VXVH 1YEDB 4HUMB 4IS6A 3MUZ1 4YFLI 1C1EH 2R56H 4ES9A 1XZ0A 1M2VA 3GBNH 4MJHA 3ZZLA 3QG7H 4JCLA 4HMEA 4K7PH 4UM9B 1ETJA 2P8MA 4W9ZA 4OM0L 2DJ4A 4R7NB 3A24A 1JD7A 3MRBA 3HI6L 1ZLEA 1VDGA 1AR1C 3CH1B 3MLYL 3N1MC 1M71B 4ZUUB 4NX0A 3INOA 3HBGA 3ATEA 3O3AB 2VDQL 1FFQA 4IRJD 4JFFB 5D93B 3ARDD 1DUZB 1GS8A 1ZGLB 4JRXB 2OL3B 1F6AA 3X13A 4OB5L 1QOKA 1U6AL 3NCBB 4EPSA 1BP3B 4H0HB 4DP5X 4F91B 5H2BB 1PGRB 4NYLA 2HRPH 1EO5A 3QCVL 2KLSA 2X6AA 2F54D 1PS3A 1SYVA 3GRGA 1J05B 3O11B 3TCLA 1JHLH 1GXEA 4IBYA 3STBA 5TQ2L 2K78A 4P3CH 3ERXA 3LV3B 2E27H 5I71B 2AQ3A 4FMVA 1UA3A 4BUHA 4ZFQA 4WFHD 3EFDH 2X88A 1YCSA 4I18A 2HH0H 5MENA 3W39B 3FDWA 2R0ZH 4AC2A 2YZ1A 4TLUA 4NRZA 4GW5B 4PI0A 2WANA 3PWNA 1DVFA 2FSEB 3GTTA 1JPEA 1KCWA 3E1ZA 4KY1L 4Q7DA 4ZUTB 2D2OA 2JVUA 3U30C 4N6RB 3PU7A 1VFBA 2DN7A 4PJXA 3BVXA 2CKBL 2Q8BL 1H19A 2FRGP 1H9DA 2VN6A 4ONGL 1JK8A 3ARUA 2WY3B 2B20A 1OAXL 2JQZA 3CZSA 2IOMA 3C6LA 1J1OH 3NCCB 4NQUA 4PJDA 2DI7A 3GMPB 3PPSA 5IZ7A 3VRJB 3P3UA 3KVDD 3MA7B 4OM0H 4NO3B 3NJMA 3HI6H 2F0CA 4R4ND 4NQCA 4L05A 3LMJL 3VRIA 3MLYH 1WT5C 4ODVH 4X7CC 3BZDA 3CHRA 3FKUS 4KXBA 4MX7A 1UKSA 4QRTB 1KYOK 4PCYA 5B21A 4CGUB 2VDQH 4HGMA 4H20L 5TGBA 4WUKL 2QVTA 3J7HA 5BXFB 3D39E 5L2JB 4HA1A 4OB5H 4RGOL 2JB6A 4KX9A 1KJ2B 5B1BB 2BMKB 4MNQD 1JJUA 1S8DA 3QCVH 3IDIA 3LEVL 4IRZL 1BZ9A 2VDPL 3QUZD 5TQ2H 4DPAX 3PDOA 4LBAA 1DANT 2Z9TA 1L9SA 5JYMA 1ROCA 3AUWB 4ATTA 4G8EA 4P2OA 5F7WC 3CFCL 2P7TB 4UUJB 4MQXD 1AY1H 3UC0L 5HVGB 3T6ZA 5AKTA 3WAJA 3X11A 5JO5A 4MMXC 2E9IA 2ZUWA 2A74A 4OCWL 3EUUA 1U33A 1FNAA 4KY1H 2MKLC 4G70B 4MJID 1OF2A 1F1AA 3DGGA 3HIZA 1EDHA 2VJ8A 3OXRB 4FZ8L 5L0QB 1SXCA 5JPMB 2OXHB 2CKBH 2EIBA 5AW9B 3BWAB 1UXSB 3SB3A 1HDMA 2CLVA 5EIVA 4LIQH 3O3EB 5HJ3A 4X6BB 4ONGH 3C2AL 1Y7VA 4FA6A 1MF2L 4R0LB 3CBKB 5F96L 3VGBA 2ZSVB 1BM7A 1U8OA 4Z7QF 2QVMA 3BQUC 3S3BB 4UV7L 1NLBL 4Z7IA 3OXSA 1R3LA 4ZYKA 4JG9A 4QI3A 4AENA 1U91B 4FL4B 3LMJH 3SPGA 1MG3C 2F1AA 4RBPH 2BHFA 1IEBB 1NC4D 4ABQA 1A02N 1RZ8B 4H20H 4WUKH 1QSFE 2WYIA 3G04B 2VRQA 2X4PB 4P5TD 2APFA 4RGOH 2PW1A 3H2WA 5KJ4A 1VGKB 2XTJD 5BJTA 4P0DA 3QJRB 2YN3A 4IHOB 4TNFA 4M43L 3LEVH 2NY2C 4IRZH 5IB1A 1I8LA 3NCYP 2AW2A 3GUTB 2O6PA 3ESMA 5EPMB 3FULA 2WTPA 3U0TA 1BQHA 5ID0A 3UCRA 4XI5D 1HQRA 3KNBB 1MI5E 2C9VA 3IETB 1OE1A 4XXCC 1BQKA 4ISVB 4K3JH 4LVOC 3X12A 3CFCH 3LKNB 3UC0H 3GSRB 1SFDA 3ZT6A 3AW5A 2R59A 2RB8A 3FUKA 5C0BE 4ZMLA 3L3JB 1BQRA 3BWUC 4MMYB 3NAAL 5KSAA 4ZD3H 1QPXA 4HQQL 4OCWH 1JWMB 3CBRA 4NKDB 4AK2A 1O7DE 3G5ZB 3NOIA 4L3CA 4X5RA 4P4RA 1JP5A 4FX5A 3B5GA 1D7FA 1WC7B 4HUNB 1L6XA 2XA3A 3QWOB 2CHWA 3STZA 2CR6A 2NPLX 1F86A 4CC0A 3QR0A 4R84A 2D0GA 4Z6AT 3C2AH 3KXFE 4TUJA 3VA6A 4C83A 4JW3A 4NXKA 4WDIB 3OWRA 1MF2H 1CF1A 5DZNA 5F96H 4KX7A 3Q06A 1J8HD 4P4KA 3SDAD 3OKKA 4UV7H 1NLBH 3CFIC 5J12C 5HD8D 5HSFA 1U8KA 2BS71 2Z1PA 4OFIA 4A6YL 4L37B 1ZVYA 5ID1B 5DDHA 3RTQB 1MIEL 3K1KC 5ETUA 4F9LC 2VZOA 1XB8A 1NFDB 2FIRT 2R1XA 3RX9A 3GMLB 3V0IA 1C16B 1GZQA 2FCBA 2H8PA 4JN2B 5I1DB 2WIIA 3EOAB 4KO5A 4YDIL 4HS3B 1VADB 3EJUA 3GIZL 5C0BA 3PP3K 2GUYA 2Z64C 3BE1L 5GSVA 5IF0A 4DVBA 4NQEA 3WL9B 4RNRB 5DVNA 3VMOA 4R83A 1TF4A 4H1LG 4OZGB 2VUKA 4V1DB 4ZQKB 4WHDA 5DO2C 5C0AB 5CEXA 1XD0A 4XBPB 1EMTH 4DFIA 4K5MA 1RIVL 3HE7D 4HUKB 2PXYB 5DJ8A 3VI4E 3PABB 5D7KD 3JWNC 4G9FD 1WZAA 3W0WB 4HVBA 4JDZB 1XGZA 1INEL 4F20A 4Z3EA 3KXFA 3NAAH 2OCJA 3C60D 4N22A 3GBML 3MJ7A 1U3HD 3FYIB 2FATL 1SUJA 1MRCL 2IH9A 4YOKA 4G42B 4LMQE 4UQCA 3ESNA 3HB3B 4PLNC 1D6EA 3CVCA 3L8QA 2DMBA 3HG5A 4JY5L 5JQ6H 2GC7C 3FPYA 2R27A 4J3SA 1HHJA 4DKDC 3P69A 2EVJA 4P49A 4LSQL 4G8FB 2EIZA 1FA4A 1G7LA 1PIGA 1EUTA 3MV11 1NOFA 3FQYA 3WCYA 4NP9A 1GMEA 5DHVA 1G0XA 5E9DB 3I6LE 4NLHA 1E4WL 3UERA 2D3VA 5LKNA 1BMGA 1AHWB 2HVKA 1SPDA 1E3FA 1N0LA 3F7KA 3B3IB 4PN6A 2OZ4H 4WWKD 4A6YH 3KLKA 1BXUA 4U6HB 1QFWL 4MQ7B 1ZA6A 1MIEH 2JK5B 1YNKL 3DVNA 1WVZA 1QBBA 2EXWD 1J9CT 4HXBL 5HYJB 3JVGC 2WBXA 3E6FA 2DEXX 2AEWA 5ESQB 3UZEA 3BZFA 1I1AC 2I7OA 5HHVL 4YDIH 5E24E 1E28B 1RLBA 1XSJA 1CICD 3GIZH 2FIKA 3EF7A 3LPOA 4AQ8C 2Y22A 4HXAL 3BE1H 3BYTA 4MA1C 4O58L 4PGBA 4P3DA 4AG4L 4W9EC 3KH4A 1ITCA 1IFRA 1GPOL 1A3RL 1DN2A 1QQDA 3NEXA 5A3IC 2X7LB 1NL0L 1T1ZA 5A2AA 1MFDL 4QKXB 1U8MB 3HBQA 1HEHC 5DHYB 3MCG1 6PCYA 2DMKA 1RIVH 4PMFA 1J9SA 3TVMD 2R8SL 4KWUA 2H0EA 2O72A 5C6PB 1INEH 4XP6L 3ZDYF 4I1NB 3D3VA 4NC0B 4Q4IA 1LXMA 1EPFA 3GBMH 2DQMA 5D7IE 2FATH 1MRCH 1O5PA 3O41B 3LKOB 3WSQL 3PUUA 4P23C 5C70A 4N0FB 3DX9B 2Q9OA 4WAFA 4I4WB 4LVHC 3OHXA 1E4KC 4HDIA 3ZKSD 3TO4D 1A6PA 4JY5H 1PKQB 4JJ5B 1IBBA 5F7UA 4BKLA 4QHKI 1NGQL 3CSGA 1IT9L 3PAUA 4LSQH 5D7EA 5DJYA 4X5QA 2XOTA 3N5AA 5D1QC 2X9XA 1PD0A 3HR6A 2VNCA 1KTDB 2ADYA 1E4WH 1JGDB 2MEJB 2OR9L 3DKHA 2VLJD 2FEDC 5H94B 2Y6SC 4GI6A 1CGVA 1QFWH 3NDZE 4X9HA 4ZSOB 3VGDA 3ZKND 4Y7MA 3WTXA 2YLKA 5GGVL 3EH5B 3VI3E 5I1AA 4O51B 1JZGA 4PGZA 4YNYB 3APMA 1KG0B 4OIBA 1L5GA 4LOUC 4UT6L 4IOIA 3DHUA 4X6CF 5HHVH 5CSZA 4WWNA 4DKAA 3RPIA 4U1LB 4HXAH 5E6ID 4O58H 2D9QB 4XPTL 1RK0A 4U1HA 5D7IA 4AG4H 3TFKD 2YARA 3AAZA 1GPOH 1A3RH 4L5FL 1TUPA 2B39A 4HBQA 4L0PB 5I73C 2HFFB 1SJEB 3OKEB 2ZE0A 3MBWB 2B5IB 2OYMA 1YNTF 3ZPDA 3L3KA 2R8SH 3TBWA 4CA4A 2NCEA 4XP6H 3MREA 1J48A 1VPOL 3UPCA 4ZFOA 5GS2H 3GT6A 4AMXA 3UAJA 4EUPB 3T2LA 1CXHA 2CAKA 3WSQH 3IJ7A 1OQOA 3WE1A 3HG1B 1FL6B 4G8GB 1HHHA 1GZHC 1DQQA 3IWUA 1MELA 3LZRA 4GNKB 3UTOA 2PTVA 3P3RA 3NP4A 3RILA 1TXKA 2C34A 3ILPA 1JI2A 1NGQH 2HT4C 1IT9H 3ARQA 4MXVF 4N3TA 1OAKL 2WSDA 4FQIL 5F7EL 1IV8A 2QKIB 3EYVB 5EU6D 4GSUA 4GBXB 4OI9A 4EIZC 4PB0L 4EI6A 4FQHA 2X6MA 2OR9H 3FUEA 1NUNB 1YZZA 3QDJB 3EOYG 3EJRA 2EUZA 3KEHA 4LCVA 4ENED 2AP2A 4WU5A 2A6IA 1YPZF 5IKCB 4I77L 5BZWB 1A6TA 3ULAB 2ZAIA 3EH3B 3PWLA 4OZFG 4YFDB 5GGVH 3EJJX 4NSKA 5D2NB 4MGXA 2RA1A 2MJWA 2XN9D 4MDJA 5EO0B 1WHPA 2Q8AH 3FU5A 4MS6A 4UT6H 3OHMB 4GT0A 1U92B 4RRPG 4IGBA 3RUGA 1O7VA 1XGYL 2F19L 5C6WH 2CIIA 1CQKA 4XN7A 3VD7A 4EI5C 3MUGB 4XPTH 3T0EB 1QRNE 5DD0L 4L5FH 2IQAB 4JO4L 5HHOD 4PD4K 1T21B 4NZ8A 1RZ7H 4OBRA 5DZPA 3BMVA 3FO2A 4OKVA 5C0FA 2VLMD 1N3NB 1OY3B 1BVKB 3TX4A 2VIRA 2JNZA 4HPOH 4YPJA 1NGWA 4KRPB 1YEEH 3LNIA 1IAIL 1CD9B 1VPOH 2YC1A 1NIFA 4JRLA 5TF1L 3EFOB 3OX8A 3L4TA 2EYRA 3WJJC 4I3SL 4W1TA 3FQ4A 2ADJB 4YHNB 5GGUB 3O9WA 3T4YA 4HP5A 2Y2TA 3I9IA 4WGVB 4NN7C 2GVYA 3QUKA 1JZJA 4XP5L 3AM8A 4LLVA 4PJIB 5LGYA 2WUCL 2XJLA 5C2BL 4H8WL 4BCYA 2X9ZA 3HNVL 4GEJA 5HYFA 1OAKH 4FQIH 4YFLF 1FI8C 3BPCA 3H7BA 4N90D 4Y4FB 3VDBA 2DLEA 1KBWA 4AV5A 1ES0A 4PBXA 4OSUL 5CSBA 4PRBB 5DFVD 5DHVH 4TYUA 3TBTB 1CE6B 2DQJL 3CVHH 2VL5A 4G11A 4I77H 4K9JA 5E2JA 1X5HA 3ALXA 3CPUA 1BFOA 1V55B 2R1WB 5FWQA 5KANG 4AXWA 1FJ1B 2VC2L 1DCLA 3MBEA 1QUNA 3QIBB 2RFXA 5LNEA 4HUUB 2Y7QA 3FZUD 5GS0D 1EHAA 4CN4A 4HIHB 3QWRA 1XGYH 1H3GA 2F19H 3TBYB 5J6HA 2JKRM 3DDFA 3I9AA 1UCTA 3QNXB 1GS6X 3U2JA 4B9GA 3P2DA 3D9AL 4NAMA 5DD0H 1ZLDA 4JO4H 2X2YA 4FHKA 3PL6D 1BF2A 4XZ4A 3L95A 1QABA 3HS9A 3IF1B 4Y1AA 2WWKT 1HEZA 4ZTOL 4NWUL 3ZBMA 5DC0A 1IAIH 3ATBA 2A6JB 2XG5B 3I74A 4I3SH 1M6OA 3SGJC 1N6UA 4ZFOL 3NCMA 4RESB 2OZNA 3UAAA 3UL4A 4K3HA 2A7BA 3U0PA 3BFOA 1X5XA 1S9WA 4M8UA 1W0VB 1Q0EA 4XP5H 2WUCH 3CU1A 3DX6B 4H8WH 3ZDXB 4BRJA 1UZ8B 3G5XB 3HNVH 4KK8C 2ZYHA 2E9BA 1E2WA 3F12B 4QTFA 2JKXA 4PJBA 1EEZB 4NO5B 1KGWA 2BS9A 4L4TA 4NFDA 3S4SA 4FTVB 3KM2A 3QYNA 4C58B 4EN3A 3EO0A 5EEZA 3DRQB 4M8QA 2DQJH 4XO8A 1MWAL 2FO4B 1CXEA 3WO4B 3KPSE 3D07A 2MCG1 4JM2A 5JNYA 5FC9A 3Q7JA 3N55A 2K45A 4YHIA 2GHWB 3MRJB 2VC2H 3IYLW 1ORSA 4L8DA 3C5ZC 1UVQB 5G55A 2FWOA 1IC0A 2EDWA 4YUEH 2FJUB 4AJYV 1X5KA 4ANUA 7PAZA 1R5IB 2KMWA 4UMSA 2NY4B 1UWXK 1UJ3C 3D9AH 1M9SA 2D0HA 3DC0A 3PQYB 1X3DA 5I9QC 2LVEA 1JS4A 5MEND 2G4GA 3GJFB 5FA4A 1F0LA 1PBYA 3PUCA 3VYNA 1BPVA 3NCXA 4ZAKB 1IKNC 2F54E 4C8XA 5AZEL 4ZTOH 1HJBC 3QNYB 2ZYIA 4NKMA 3WHE0 2VDLB 4ZUWB 2V5SA 1EVTC 4NWUH 3OAUL 4FQPA 5HDWA 4PGDA 4UNTA 4P57A 1P7QB 3B3BA 3AS0A 1CURA 1EUUA 3NZ8B 4FKKA 3TBBA 4GG6B 4KDTA 2X4TB 1ZOXA 2M8XA 1B3JA 3BP6A 7PCYA 4PBVC 3MRMA 4PJ7B 4FXGA 4X4ME 1SHWA 3ZO9A 3C6LD 1C7SA 3SKOB 2ENQA 5L4FA 4OZHF 4F7TA 3TEUA 2YWZA 2DPKA 4FGMA 3DARA 4NQCD 5FA3B 5E94B 4ZDHB 1HNGA 2DIBA 3AU0A 4X6DF 1A9BB 4E9SA 1FHNA 2VW6A 3H9SE 3SDCA 3DHMA 4QYOA 1WFOA 1XWVA 1K4CA 4HLJA 2ZKMX 2VSKB 4MB5A 1MWAH 1VFOA 3O3BB 2FQGA 2A1WL 2ZKHL 1L9TA 4PJ5E 1BEXA 1E9QB 2WXQA 3JWDL 2NR6D 3KLDA 3T0XA 3GMQA 3VVVA 1ROWA 4ODWA 3VFMA 2CO7A 1U58B 3PS6A 1QKZL 4HSCX 4MNHA 3W82A 3MOAL 4DAGL 2I7SA 5I66A 1OGAD 4BM7A 1MKFA 1OAQH 3V9CA 1P7KB 2R15A 5EIQA 1PG7X 5C07A 4AGQA 5JOPD 3NTCL 4P2OD 1MQ8A 4LBEB 3SDXF 4UQ9A 4WUUB 5HI5D 3B7TA 4RAVA 2FNWA 2AEQL 2EDNA 5AZEH 4X0KB 2N7SA 3OAUH 4XZUB 2NXYB 1T20A 1WFMA 4FF9A 5T1KA 1BREA 4M1DL 5ITBL 4M1CC 5B3JE 4LLYB 1GVIA 2HFEB 3AQXA 2HTLC 2KZBA 2TAAA 1PAMA 3H9SA 2HUHA 2NY3B 3EYQD 3HFML 4Z76A 2BY1A 2WQAA 5C0EB 4HHAA 4HV8A 2X4UA 1CZ8L 1KC5L 5T3ZE 3L5XL 1JNHB 2UWEA 2WP3O 3WN5A 2ALWA 3AZUA 1MJJA 2FBRA 1J9QA 4JLRA 3UBHA 2KPWA 5D8JH 2E7HA 4F7KA 5DURD 3OM3B 1MUJA 4ZFGL 2A83A 5F1IA 2A1WH 2ZKHH 4OQTH 1RUAL 3CC1A 3UZVA 3HPJB 5DWUL 4JFWA 4P05A 3JWDH 5DJCB 7FABH 1OSYA 4EMZA 4DAGH 2J43A 1QKZH 5SX5H 4KKCC 3MOAH 1RZIA 3VFOA 5AB9A 1T89C 2KQMA 3TO2A 5FO8B 3AWEA 5MERA 5E7BA 5BZZA 4CC4C 1AS7A 3N42F 5GGRA 4PREA 1FNHA 3F85A 3NTCH 1DLHA 1JV5B 1NTDA 4AEHL 4S1SL 4W4OC 2ZP8A 3BHBA 2EUVA 1EEYA 2XWBB 2ERJB 4TL5A 1IE5A 3U4KA 3ALPA 4OGAC 4XO4A 4EZLA 2AEQH 3IDJA 1OT2A 5KSUB 3DPBB 2YKKA 3IJ8A 2GTWA 4LB8A 2ATPA 3TL5A 4QLWA 2RHEA 2PCXA 4DZBA 2XWTB 5CWSA 2VE6A 1U8NA 2IAMB 4ICXA 4OFPA 4M1DH 5ITBH 2I9LB 4X9YA 4TLKA 4QHMB 2VDQB 3S5LG 4ANKA 3S35X 4IDLA 3HFMH 4YDVA 1ZLUK 3LZNA 2WZ6A 5LJYH 4OLUL 1QLFA 4ELKB 5DZ9A 5IW3A 1T7VA 1B9KA 3J8F7 1KC5H 2YXFA 4A2FA 4WW2C 1A4KA 2EC9U 2J56A 3REVB 4P4KD 3D85A 1E6OH 4RMBA 3RVVD 2MIZA 1KLUB 1UGNA 2WXKA 3R0MA 5F9JA 3O6FB 3UP1A 3QK0A 4WFGD 1W9XA 4RDBA 1Q9WB 3RL2B 4N0UB 1JK9B 2F5BL 2OULB 4KI5C 5FKAA 4ZX4A 3G6JB 1YY9D 3BWZA 4UTBA 1RJCA 4ZFGH 1X5AA 3V4PL 3Q9QA 4Z8FL 4OV5B 1AS6A 1JPGB 2CR0A 2EE6A 3R8QA 4AZ8B 1RUAH 4DPBX 3I02B 1G94A 2GHZA 3VVWA 1HWWA 5EZLB 3QPKA 5DWUH 2P1YA 2YOCA 3WTTA 3AREC 4NQED 1QWHA 1EGJA 3U36A 2J5WA 1IIIA 2D31B 2ZXGA 4Z7UA 2Y69B 2UZYA 4H25B 2WLIA 1Z1WA 2G75A 2P8PB 2CKBB 2NNCA 3U4EB 1QHPA 1CXKA 1MFVA 1OQXA 4AEHH 3BVWA 3KEDA 4JFXB 5IVZB 4S1SH 3NK3A 3VXMD 4M3KB 4QHKJ 3EDDA 4Y5YB 5D7JC 2V17L 5A7EA 2B14A 3QZOA 3H9HB 1FYHB 2XPYA 1A5FL 4KJPD 4L4JA 3FTGB 4AZUA 5ADPL 2EINB 3OGOE 4JS7A 1FFPA 1HXKA 2NXZD 5DMJB 3ZMNA 5PCYA 1HCYA 2P46B 3LZLA 3CN2A 2OTWA 1NM4A 4H1LA 2EDEA 1CYGA 5CD5D 5ERWA 5C09E 5GJSL 2IMNA 2OMZB 3QRGL 3VXRD 4ELME 5LGKA 4YC2C 4HLEA 3LY6A 4OLUH 4PY7A 1U3JA 2AQRA 3WTSA 4U3CA 1Y18B 3DOSB 4I7ZC 1LE5A 4JAMA 2UVEA 4QEGA 1EZUA 1J5DA 3ILDA 1A7PH 3CFEA 1GGUA 4TV3A 2F5BH 3CE1A 3V10A 2AAVA 3FUNA 4PRAB 3H55A 4X4YB 1VEOA 4L3EA 4YSAA 2P5EB 3V4PH 5JDSB 2RQEA 4TF4A 4Z8FH 4DTGL 4N68A 4KXZH 1MFEH 1ZXKA 2HG5B 2W80C 2YFNA 2LT9A 1HFUA 1MXDA 5FO2A 3RZCC 3LPPA 2NSQA 4I0CC 3T2QA 5EN2A 5B39B 2A6KB 1KJVA 5DJ2A 3QDMB 3B1TA 1OTUC 4EDXB 3F83A 3P9MB 1IFGA 2HRHA 4WI4A 1OPOA 4ELMA 1CTOA 2V17H 3Q6FB 1ZANL 3K72B 3D3VD 1JPFB 4C55A 3CXFA 4X7FC 2BNQE 2JQAA 2DTSA 4WSKA 4IMKC 4QRRA 5C71A 3O45B 5GS1C 3RGBA 1AZRA 1CFTA 2FQFA 1JF6A 5T3ZL 3OKDB 5GJSH 2XWRA 3RNKB 4FFYA 3VX1A 5TK2A 5CFHA 3QRGH 3CIQA 4J3BA 4JKNA 4LOFA 5FK9B 2GYSA 4GKLA 3S9DB 4UV4H 5FO7A 1TZHA 2VKXA 2FZ3B 2ZAHA 4HJ1A 4N2IA 2X6VA 1DEDA 1FE8L 4M7ZC 1XAUA 3DIDA 2C3WA 3SE3C 3A0OA 3BIBX 2V5RA 4ZFFB 5DTFA 3RHWK 3NG5A 1RV6X 4KMQA 1NCGA 1AGEB 2MOQA 3AU1A 3CDGB 4DTGH 4F5CA 1T6WA 4LNRA 4UTBL 3QJFB 3MRNB 5ADOL 2JJUA 2ZX8A 1GGIL 2XV6B 1FPTL 1JDAA 4LKCA 4WTXA 1IC5L 5HY9A 5ICZA 5AOMA 2WGNB 3B8SA 4W4NA 3KYOB 1N10A 2BNQA 2OPCA 2QJDA 1PLCA 3O2DA 1JFHA 2YA0A 2ZWZA 4GMTH 2IBZX 2KZWA 3B9EA 1KXTB 3K1DA 4LKXA 4HWZB 3WNIA 3ZYJA 3CZFA 4CVZB 5KTEL 5IJKC 3TF4A 3ZDZE 2DEWX 2GAZB 1XTMA 4MCYA 2J88L 3VWJC 1CL7I 1G9NL 3BUPA 1ZANH 1NEZG 1ZAGA 2WB1A 1WBZA 5DT1L 5IQNA 2NY5C 3AXLA 4FKHA 4X8XA 1U8HB 1II4E 2WMPA 4A6YB 4MKTA 1HH6B 5BW7A 2GSIB 3VGAC 3CFBA 3L3IB 4FQXC 2Y1YA 3QDGE 3BP7A 3NJIA 2B7DT 2FYYB 3KPRD 4J3OH 5J9PB 2YMTA 3QFJD 3PV6B 2VLKD 1PZUB 1ZA3B 3ULUD 4DN3H 2WWNA 1BX2B 3GZOA 1XF4B 5TPWL 4QGTA 2QPUA 4WW1A 5KS9A 4L3FA 2DLFL 3FQUA 2AVGA 2OMBA 1IAOA 5K1JA 3VXNB 1FE8H 4ZO9A 3S3SA 1VESA 4U1GC 4HOWA 3ARFB 1M7DB 5KVFE 4UANA 1OHQA 3K2KA 1PPIA 4QRPE 2AJVL 43C9B 1T1WA 5LAXA 4WF7A 1X7TA 3CFUA 1QFUL 2PPCA 5F6IC 3FRUB 1P6AB 1UFGA 3CN1A 1UACL 4PJ9B 2P28B 2IANE 2C1PB 2PP7A 5E1IA 3NZHL 4IGBD 1FN4A 5ADOH 4JHZA 1FPTH 1IC5H 3FT0A 4WO4B 2AS5M 3DPDA 4NKIL 4BH8B 5LAPA 4RFEB 1UZGA 5ICYB 2JLPA 2N7BA 4NDMA 2C3VB 3M07A 3NPSC 2YQBA 3JTSA 3U46A 4E9TA 2PTTB 4NCDA 3DGGB 4U1MA 4OZFA 1J18A 4JRYD 3NIDF 4TNWF 1AZZC 3ASNB 1B6DA 2C3HA 3QDGA 2H9GA 4GKZA 1G7PB 1SJMA 1LP9F 3FU3A 2XWJB 5I75C 2J88H 1HI6A 1S7UA 4Y4KC 1E27B 1G9NH 4HW6A 5BUGA 3NGBC 5D6CA 5DT1H 1BBJB 3D39B 1DO6A 3OWEA 1JF1A 3KJ4B 3OLDA 3TWCL 2QSTA 3RWDA 3UXFA 1K8DA 1LK2A 3WUWA 5GGVY 4U7MA 3QQ9D 3J2PA 3GBEA 4MAYC 5EIIB 3MRGA 2ZG2A 2Y24A 5ESAA 4Z3TA 5ILTL 3JQOB 2LTQC 5GGQL 2APTA 2FJHB 1BAFL 1NBCA 2W07A 1FSKC 1NDGA 3B9KC 3CFQA 4M4RA 3QUXA 1O5DT 1A2YA 3QIUC 2G3NA 4ODUB 4FXKB 1RUQL 4K15A 2WXPA 1HL4A 2OI9B 2IANA 4XRCB 3T0AA 3QZNA 2J20A 3FRPG 4NQDA 2DLFH 5HJDA 4WFEE 2UYLB 3NEOA 3P4MA 2QLVB 1CF8L 1FZJB 2EE2A 3FTSA 1WA1X 4JPIB 1PMYA 3Q8CA 5M94B 2WZ0A 3PFQA 2WHVA 1P5UC 3HZVA 2YAEA 2AJVH 1G7MB 3FONA 5EULV 5EWIL 2WN3A 2WWMD 3LQAL 3GPSA 1QFUH 4K94C 3ZXAC 1YMMA 4U6XB 4N85A 1WT5A 1UACH 3MBED 1YAIA 4P2RD 4NAQA 2ENYA 2H7WA 3NZHH 1YSOA 3QWRD 4N8PA 5DHDA 3DV6B 3NJVA 1EEQA 1MLBB 3UTTE 1OGTB 4NKIH 4Z77A 1JRHH 2OJEB 4I85A 3REWA 1ZEAL 5DU7A 2M83A 1G6RB 2B16A 4R7DA 4WI5A 5IMKA 4FNQA 4N86A 3DTDA 2DM4A 4EN2A 3DUUA 1CN4A 4Y1AD 5FF6A 3HE6A 3MGTA 3WLBB 3FQNB 1BVNT 2M2DA 1KCVL 2I69A 1T0PB 4U3XA 4CSZA 3CX2A 5H35A 4NBYB 2AITA 3UIZA 1U3ZA 2C4FU 3BSHA 1U8CA 2EEFA 4JHAH 1QSFB 5KVDH 1MFBH 2CXKA 1KPRA 3P4LA 3ZKXC 4A2LA 4Z0BL 2PYEE 1AHKA 5DUBA 3RYMA 4OR1A 3TWCH 2Q76B 5JHDE 2FQDA 4MMXA 3GXNA 5EV7A 3ZL2A 3AS2A 5IIEB 2YIHA 4PJXF 5GRWA 1FORL 5ILTH 4NZRL 1JZDC 1BAFH 4Y4HD 3FFCD 1FQ9C 5G5DB 3WE6A 2DKUA 4JG1L 1KPUB 3CN3A 1BFSA 2NY7L 2X4RA 4PW4A 1MI5B 3QH3B 4EXPX 4KZEH 4PJDF 4HMCA 4AYFB 2OXGA 4MD0A 1GY2A 3V0WL 1V54B 1CF8H 1CI5A 2ZF8A 2YJLA 4J6RL 4OUUB 1E42A 2C1OB 1VJSA 2CZNA 3BQUA 5EWIH 3GSQA 4NIKB 3D05A 1KCLA 5IW6B 3UYOD 3PXLA 1WLHA 3L5IA 1G1KA 4H0IA 5D93C 1FVCA 4JMXA 5HPOA 2RQ8A 4FQQA 5H4ZA 1C8QA 1VF5C 4QOKA 5C08E 5DJ0A 3MR9A 4EAEA 3UGEA 3KHQA 3MNZA 5IB5A 2WZPD 4EVNB 1NC2A 3L7FB 4LOEA 1PY9A 1ZEAH 2HG0A 5E5UB 3HRZA 1YJDC 5JHDA 1UXWB 2EVFA 2X70B 5F9DC 1NGYA 4TM9A 4WK2B 3GMMB 5I71C 2VABA 1IM9B 1KCVH 1ASOA 1FRGL 4TQ8A 3DVGA 2C3GA 2OV0A 2HKHL 2YR3A 4JFHD 3MV01 5J13B 1O9WA 4MJ6A 4PJ8B 4Z7QB 1OARL 2UY7A 3JT2A 2X9YA 4Z0BH 1VHPA 2MPAL 2Y1AA 5DHVB 1DDTA 5J6GA 3IJ9A 2ORBL 2X4SA 4NQVA 5DUPL 1VERA 3CVHB 2AQPA 4GKNB 4Z3HA 4FYSA 5AYUL 2WXIA 1FORH 3T0BA 4JFVA 4NZRH 1YQ2A 5BQ7A 2FJFA 4DK3A 1FVDA 3QO1B 4G6FB 4JG1H 5KVFL 2BIQA 2NY7H 3M17B 4HGWB 2FX8L 5ECGA 2AZUA 2ZXEB 4HSAC 3QO0B 4OJDH 1FZOA 3BZFB 4G8AC 3VI4B 5HYSG 3JWNE 4YMPA 3FCGA 4Y9BA 4YGVA 5C08A 3S6CA 1R3IL 4XN2A 3V0WH 3SDCD 1I7TB 1OTTC 1YN7A 4J6RH 1MHEB 1QVOA 3TN0C 3VU1A 4Q9QL 2EAEA 3LKSA 2PWDA 1QI5A 3CSYB 2OR8A 3DI2B 3VFRB 3MRFA 2F1BA 5DVLA 35C8L 4G7VL 3OAWA 2G5BA 3U7WL 4F9LA 1Q1JH 3MRRB 1DP0A 4PRNB 4AYEC 1MCWW 1S3KL 4OD1L 5KYNA 3VWKA 5C07D 4HIEA 1PEZA 1E40A 4LLWA 3S37L 4L8SB 4KKNA 4XVUC 3GRWA 4EZMA 4YXHL 4W9HC 3ABZA 2WXLA 3ECBB 3E1F1 4NIYE 3M1BA 1FO0A 4PRHB 5IREA 1DJSA 1MJUH 4PI2A 1BDYA 4FXLA 5EBGA 3H2PA 1P1VA 1FRGH 2C26A 2HKHH 1GHFH 1VZIA 4E9YA 2V7NA 3CLFL 2OW6A 1OIOA 5GZOC 2DMGA 3PHQA 3VW3L 3TV3L 1DE4B 2MPAH 4PV8B 3ZR5A 1NGXB 4ZFZA 1OAUL 3KW7A 2ORBH 4Z3FA 1B4RA 4KKAC 3DX3A 1AXSA 4KMTL 2R1YA 5AYUH 1T4KA 4AX3A 2HLEB 1UOWA 2I07B 3V9FA 3N50A 1SLXA 2VC2B 5L0QC 5JPMC 1CI3M 5HDBE 4LQFL 4P5MA 3VG0L 2FX8H 3ZIMA 5GHWL 5EDSA 3SPVA 5T8IA 3LQZB 2CDFB 4GRLB 4AMKL 5IW1A 2Z31B 1R3IH 1UENA 4LCWE 3LN5A 4R0LC 2WYZA 4CBZA 1AKJA 2ARJB 2R9HC 1Z5LB 1WA0X 3EIFA 3IAPA 3EDJA 4K9EH 1FFOA 3I6GB 4ADIA 4Q9QH 3LZFL 4WKZA 3IBEA 5DMIL 3V0GA 3V7MA 3MNWA 5KSVA 1AOHA 5JXEA 4FL4C 4MB4A 4HLZG 1PFCA 3EHBD 4Z5RA 35C8H 2DQDL 2FL5B 4OF3A 3P4OB 4LSRH 3U7WH 3JUYA 1HH9A 1S3KH 5EUOB 3JVGA 5FX3A 1DQIA 3PCYA 5CUSL 4UQ3B 5CN3A 3P0VL 5D1QE 3DO7A 1I1AA 4O2EA 1XCWA 4PGJA 2V4LA 3ECQA 4FQJH 4H8QA 3S37H 2VR5A 1SHMA 1AO7D 4P5SA 4AQ8A 5IHLB 5DJZB 1MCKA 2MTPA 4YXHH 2BCKB 3WIIL 5DRWB 2EDBA 4HUXB 2WLZA 4IBSA 5HYQB 3IGKA 1VA9A 4AH2B 3KYMA 5IQLA 2R39A 1IGFL 3KWUA 3VI3B 2FVNA 3FW6A 5CJBA 2NOYA 2WOBA 4BQ9A 2G2RB 3VW3H 3MROA 3TV3H 3W9DB 2WINB 1OAUH 2WQSA 1MWAB 4KMTH 1RMFL 3UACA 1T6BX 2JKLA 2WQ8A 5IG7A 3HBZA 1QYGL 2Z91B 3P3TA 1E4KA 4LQFH 1I3VA 1XR8A 3D85D 5CLTA 3VG0H 1ZTXE 1PDKB 5GHWH 5L8LB 5IB2B 3BN9D 3WTYA 3RWHA 4AMKH 2N3JA 2WNXA 5C0IA 3ILQD 1F4HA 1E7UA 4YBQC 1X4XA 4HEPG 4BHUA 5IQMA 5D1QA 3P2BA 4MB3A 1KLGA 5T1DL 4B41A 5I1HL 3LZFH 2NNFA 5HGGS 5FECA 5DMIH 1SYSA 3KPPB 2ZUYA 3T09A 3GSNB 5JR1L 5I2IB 2R2BA 3IJEA 2O5ZL 1S9XB 2FHBA 2HN7A 2JELH 3BUYA 5DD1L 5EZPA 3RTQC 4X4KA 3VFWA 3ZVVA 2PCPB 3P0GB 2DQDH 4R2GB 2BVQA 1FV1B 2NUTA 4D7PA 5C0DB 1LYQA 3IAQA 4RIRA 1NJ9A 5GS0H 3P0VH 2HZHA 3OX8B 2EXYD 1D5ZA 4DP4X 1H0DA 3AT8A 3F7QA 4YHLL 3D2UD 3QUYB 3VXTA 3BH8A 1WV7T 3LEXA 4FEMA 4JZJC 1ZTMA 2GIYA 4O00A 4Z9KB 4RX4D 5I1KL 1MW1A 3U1QA 3WIIH 1DBKL 4XP4L 4ZT1A 5GIRA 3S34L 3GHBL 3WLWC 4IRSA 3UTQA 3D0VB 2ILLA 3MNDA 4HX1A 1B2YA 1IGFH 3MRDB 3GDBA 4JX0A 2PXYC 2WBKA 3PRZA 4RDQF 5F7AA 5IHZB 3KLQA 4ANVA 1M05A 2OW7A 4CU6A 4U1NB 1NBYA 5E00B 3LH8A 4XBEL 4W6XB 4B9YA 4WGKA 5TDPB 1HKLL 4FADA 1RMFH 2WXJA 3HS0A 1UURA 3K71B 4ABUA 3V95A 1QRNB 3HB3C 3WJMA 1IGTA 2EEBA 1AGFB 1QYGH 4Y5XA 1OP3K 5DRNA 3PXJA 4GKSB 5JLZA 1RLWA 4WHTA 3VFNB 4Z7NB 1GZHA 4XPHL 3RWFB 3HUJA 3LDBB 2QV2A 2OS7A 5D7LD 4ONHB 4GRMB 2NY6B 4UQBA 1KB9K 3LB6C 4IKJA 4E42A 1DJWA 3DV4B 3CXDL 1G87A 1R47A 5I1HH 4FQ2L 4APQA 1AHWC 4L3ED 3T2OA 2ZKXA 4Y19D 1FC1A 5JR1H 4IKLA 3FQXB 2O5ZH 5DD1H 5EBMB 2CK0L 4M00A 1NKRA 3OMIB 3HAEH 2LW3A 3T8XB 4NT6B 4OLWL 3AQZA 1CK0L 1FYTE 1E0OB 2CJ3A 2NUPB 3FBKA 3KDMA 5AL8A 5CLXA 1OPGL 4WHYG 1X4ZA 4YHLH 3U1SL 3BSZA 1U8JB 1HCZA 3KPOA 4U2ZA 2VQ4A 1F97A 2A73B 4EI5A 1P1ZB 3CC5A 5I1KH 2DWDA 1CD1B 4XNUL 4JDVB 3RWEB 2AV7B 1DBKH 3ZHDA 4F33B 3T0DA 2YPKA 4I9XA 4XP4H 1ZLVK 3S34H 1O6TA 2X0UA 4QRRD 2WKLA 4QO1A 1I8KA 2EVGA 3QXVA 4K71B 1UB6A 2Y06L 2W0FA 3IXTA 5B4MD 4POUB 3U6RB 1SMAA 4L4VE 3LS4H 4NGHH 4XBEH 3IDMB 1U95A 3G08A 3GM0A 3O0RL 3WJJA 4E41E 1EFXA 4D9RE 3OG4B 3ULUF 3VXUE 1T5XA 3KLHC 4XPHH 4L8DB 5HHPB 2FWOB 3RVUD 2BVUA 4XHQA 4NHUB 3B83A 3P40A 2GITA 5EC1B 3CXDH 4LLUA 3FCTB 4OJAA 3RX7A 4FQ2H 3ZL1A 3E0GA 1WUNT 4ODHL 4P2QA 4XMWA 4PS7A 1G7IA 4TQHA 1NPJA 1MFNA 4U6YA 5L8KB 2ICEB 1T1XB 1HHIA 1QNIA 2NW3B 2YRZA 4FA8A 1M42A 4RMRA 2CK0H 5CF3A 1J8KA 1W8OA 1T4WA 3PP4L 3RUGF 1BG1A 1KWGA 3S0PA 2BXZA 1CK0H 3IVKA 3VJ6A 3ZKMD 3CJJA 2B1HL 1ZHLB 5EO9A 3W2DL 2XZQH 1RJZA 1MCQA 3QXAA 3VSQA 3PHOB 3PFUA 1SDDB 5I1LA 1OPGH 4F37F 4QRSA 3U1SH 1KCUH 4HZLA 1EAOA 4XNUH 3DX0A 5LVEA 1NWPA 4BZ1A 5I8EB 3QJHA 4J4PC 4KK5C 5CP3A 1JPST 4GW4A 4E41A 1PG7W 1WFJA 2RIKA 3KPSB 4K8RC 3PDDA 2OCCB 3FPXA 4LSTL 4L1BA 5F88A 3BP5B 4F1ZA 2AJSL 3VXUA 4AJWA 3Q5TA 1S78C 2VL4A 5TDOB 2Y06H 4NBXB 3VTAA 1Q1PA 2DLHA 1ZTXL 4YHPA 3VXPA 4DETA 3V4PB 4ZW3A 4IRJB 1GYVA 3O0RH 4S0TD 3FT3A 3UZQA 1GYAA 3SGJA 1NEZA 3KHOA 1QSZA 1T66D 3K6IA 2N7AA 1S9VB 4X42A 1HKFA 1ZCRA 3SDDD 2YD4A 3TYFA 2X1OA 2F54B 1AFVL 2JMRA 2V5TA 3ZK0A 1NBQA 5DK3A 2CK2A 5DUML 3UTSD 2QKIC 12E8L 1K2DB 3CSBA 3CFKA 4AM0A 5GGRY 3IDUA 1INQB 3QFJE 2XA8H 3ZHKA 3C2SA 3HZYA 4KK9D 3DHJA 3DROB 1AR1D 3T8MA 4ODHH 2FSDA 5BZDB 5ES4B 5IHBA 5IHUL 4H5SB 4KQ3L 3FSZA 3UH8A 1R24B 3GO1L 3LKQB 2I32A 4JR9H 5AOLA 4HPHA 2WQXA 2Z7UA 5E4IA 4FFVD 1ADWA 3ASWA 3IJSB 3ARBB 2EKSA 2F68X 3GXDA 3T71A 2BY2A 3X3FL 3PP4H 2B1HH 1MCEA 3EH4B 2NY0C 2DQUL 3W2DH 3W9EB 1XGPA 2L04A 1LD9A 3NIFE 1ORQB 5FB8B 3T0EC 3V6ZB 4UT9A 3BSZL 1ETZA 5KOMC 3UEQA 3AT0A 3TH4T 3E7JA 2QR0B 3BUDA 3OJDA 2C5DC 4HISA 5FYKD 4WI3A 4DP9X 2FWUA 2PPFA 1FCGA 4J3TA 4PJ5B 5IOKA 4LSTH 4KXAA 1IKNA 2AJSH 5DLML 3NFNA 5AW8B 2C4XA 2XX1A 4JRYE 4KRPC 4D8PA 1I9EA 2K9UA 2ZTBA 5DQDL 2DYPD 1G9MC 1XSOA 3PIQB 2DS4A 4JY6A 2BSDA 3QUXD 4ZO7A 3TESA 5SWQB 2JKJA 2NNXA 2EVHA 4WJ5A 4DVRL 1WD8A 2XQYK 2XQYG 2FECL 4XXDB 3MAWA 1CDBA 3WS3B 1OTSC 4B9PA 1EK3A 5KUKA 4NQDD 5C0CD 2R2HB 1X7SA 1A9EA 1XH3B 2ODIA 1NMAL 1AFVH 1MCBA 2MNWA 4PJBF 5DUMH 3G5YB 5C0GB 4JFPA 3QQDB 12E8H 3VFOB 4KV5F 2DY2A 3K2IA 1BYPA 5HI4D 4ZK8A 3SOTA 3H3PL 4LLAA 4IIQA 1ZD6A 1QZ1A 1YMMD 2AGJL 4TTDD 1XEUA 4HPYL 5IHUH 4KQ3H 3GO1H 4JM2F 4HJ0D 2GKIA 25C8H 2G9HB 3TLRA 3TZVC 2VDRL 3IB4A 5FOBA 1KB9J 2F7OA 3OR6A 3WELA 3X3FH 1I7ZB 5AVXB 1KFGA 3WOVA 4FQLL 3VH8G 1OT1A 2NY1D 2X3BA 1BZ8A 1BOGB 1QSEE 3GSOA 1MFMA 3HE6D 5K1NA 3ZMEA 3UGXA 5HTSA 2X5PA 4B3VA 3MGOB 2CBTA 1HS6A 4YO0B 5ICUA 2P8LB 5KYUB 2H26A 3L7EA 4BZ1L 4DN4L 1FAKT 1FDLL 3P77A 4X6DB 1MEXL 4X5XB 5A16B 3FO1B 2C9SA 4OJCA 5DLMH 2R2EA 3HFFA 1MHHA 1OT4A 5ANMA 2DEYX 1AKPA 1XHHA 4RGNC 5ESVB 1NC4B 2VW4A 3FU8A 1QR4A 3BXNB 4DVRH 4QCIA 1JD9A 1J8SA 5JYLA 4P48A 2XKUA 2DYSB 2OMVA 2XTJB 4A7VA 3B6SB 1FL3A 2BW5A 3CZNA 4OVUA 3SQRA 4CDGC 4MKMA 4ZI8A 5FEBA 2J8UE 3WNJA 1NMAH 2BIPA 2H4EA 2NZ9D 3B9DA 3DBSA 2HLAA 5GGTL 4YDJB 4LSDA 1FG9C 1ED3A 1ZJAA 2D3JA 4UQDA 3ZTCC 3BQUD 3GGWA 5A7BA 3H3PH 1QSEA 1CXFA 1NQBA 4DEPB 3L16A 2AGJH 4TS6A 4HPYH 5E1AA 1ACCA 5FYLD 3HTLX 1MW0A 1TEGA 1JTTA 3T1WA 2J2ZB 1E8WA 1NGZA 3WO4C 5IV2B 5LXVA 2Z4QA 3VXSE 4S2SA 5E5MB 2VDRH 4KRMB 1NC2D 4FG6C 3TA4D 4I3GA 5LUMA 1B0WA 2BFGA 1OSPL 1SMOA 1KIPA 2CDEA 3L3HB 3MO1A 1Z32X 2HT3C 2XVGA 3MCLL 5F0LB 2VKWA 4FQLH 1URZA 1JCKA 4EI0A 2AJXH 3QEQA 4NFCA 2M1KA 3F05A 2A9NL 2VXTL 3MOQA 5J06A 2NY4C 1NCNA 1VRSA 2BW4A 3IDXH 2FQEA 2YD7A 1K5NB 2DD8L 4KI5E 4ZODA 4CC4A 1CBJA 3QIWD 4YZWA 2X2IA 5DCCA 1VKXB 5HHQA 5JHLA 2XKSA 4UT9L 4ZAKC 5T1MA 4OGYL 4DN4H 3NZUA 1FDLH 1K8IB 4PSPA 3NSYA 2D7QA 1BQSA 1MEXH 2J8UA 4V11A 5CP3H 2HSIA 32C2B 5F2FA 4Y2OB 2EDMA 1XGUA 1NCOA 5LQBL 1OP5K 2IF7A 2FWSA 4Z7OE 3LH2L 1YDPA 2VH5L 2GB2A 5HGDA 1K5WA 1HYSC 4NS0A 4BSWB 1D9KC 1LDSA 4YHYC 1AGCA 3L2MA 2UWEF 3QPXH 1U42A 1XCQB 1L9NA 2WZAA 2NRDA 1YNLL 2OLDA 3MJ8B 3PGDA 2FK9A 1VCAA 2XWDA 2MHAA 4OLXL 5GGTH 5I1GL 4I2XE 5BOPA 3GSVB 1HILB 3ARGD 5CZRA 3QBTB 5C09B 1E4JA 5DS8B 2G30A 3HE7B 5E6UB 3U0WL 5JOFB 4G9FB 4FYRA 2VM9A 4Z7AA 4OIAA 2DWEA 4JFDE 3VWKD 1E67A 1ND0B 3L08A 3KLLA 3GS0A 2PYFB 3V4VL 3TIDA 1OALA 1EO7A 4G1EA 2IADB 2O61B 1N70A 2XTLA 1DLFL 4MNGA 2FBJL 4UDUA 3RNQA 4PRIA 2A9NH 2VXTH 1GOHA 1NICA 5DO2D 3GB7A 2FYVA 2PP8A 2ZX9A 5D4IA 5DEFA 1A6WL 4UM8A 5B22A 2YPLD 2DD8H 5D2LF 5IVXA 2BSRA 1IGML 2QVFB 4MCZA 4A2HA 1HL9A 2P26A 4GSQA 5KYWA 1PNCA 4QNPF 3MZGB 5D7JA 4NZUL 4OGYH 1GTNA 5JIKA 2QKSA 3LD8C 3RBSA 1NWOA 2WKGA 1TJIL 4N8VB 2IH8A 3ARWA 2AAAA 2NCMA 3DGDA 3HVDA 3H7LA 2DKSA 2NXYC 4WWKB 5LQBH 1SHXA 1DO5A 1N67A 1R5WB 3AFLA 1C12B 4PW3A 3V6FB 2X4QA 1IAKA 5ANHA 5CEZD 3BAWA 3LH2H 2WSKA 3OB0K 5B8CA 1L4IA 2Z8RA 5H8DA 1N18A 4DPCX 2VN5A 1S7WB 1CICB 2VDOL 5KSBB 3FU7B 1M3IA 5FIEA 3MACH 1YNLH 2YBRB 4PRDB 4XNXL 3BFQG 4X9FA 3QFDB 1AKJD 2AERT 2BP8A 4NPJA 2BWDA 4OLXH 2D7OA 4UTAL 3T6VA 5I1GH 1ZS2A 8FABA 5JXED 5LO7A 2CO2A 1USZA 3FH7A 4JFQA 3H3BC 1RURL 2DYRB 1A3QA 3CGTA 5BPPA 2J8HA 4U3SA 3TEZA 5JW3L 3U0WH 4PJGA 2PKDA 2MPVA 4OZIA 1HHKB 4AT6B 1UT2A 3KPNB 3HHSA 1B4LA 3D4ZA 3VTTA 1I1AD 1TU2B 1C8PA 3V4VH 5DQJA 3NACL 4Z7UF 1YO4A 4XC3L 1AMYA 1S7RA 4N9GA 5SX4H 3LXUX 1ZLWH 2BY3A 1RHFA 1DLFH 3Q2VA 2WTRA 3CZGA 3RZCA 1DUYB 4KKBD 3JTTA 1C5CL 3F7LA 1HN1A 4XCYB 5A3ID 2GABA 1A6WH 4WEUD 4G7YL 4B6ZA 3BI9X 2V2XA 3CK0L 3QR2A 4IQHA 3AMKA 4IEFB 5FUOL 1IGMH 3SGKA 4CVXB 4GUCA 2ARWA 5DA4A 3MXWL 2ERJC 1QLRA 2AKRA 2EDKA 2ZYRA 4NZUH 4P46B 3WNOA 4HJGB 4K2UL 4NB7A 5E6ZA 5I0YA 5JHLL 1VFAB 5DK2B 2YA2A 4S1RH 3RVWD 1U8LB 2Q7NA 4X5WA 3UGUA 5HPMA 2EDDA 4IMKA 3GI8L 4PJHE 5BS0E 1RUKL 5ACLA 2CBOA 1I1FA 1QAWA 2XG4A 3EGDA 5DEZA 3QQ4A 4G1MB 1IZJA 3U82B 2ZUQB 2E4TA 3QULA 2X9WA 5TE4L 1CB4A 3C9NB 2VDOH 3FTYA 3AROA 5E23A 4XNXH 5E6IB 4OCYL 4ZNCD 1WCBB 3GNML 2P5WE 4NOBA 1HSAA 4A55A 1AE6L 4GXFA 2X2UA 2BDNL 5IR1A 4UTAH 4IK7A 4QWWC 4G43B 2V6HA 1HINL 4U1SB 1U21A 1RURH 3EJCA 2Y6SD 1HZHL 5DJAA 1HAUA 2XVKA 4PJAE 4I0PD 2W94A 2VQ1B 4XNYL 1S7VA 4X8JA 4N25A 1QR1A 2G2NA 2JKIS 5DD3H 3NACH 3KWTA 2WTOA 3BW9B 4XC3H 3PJSA 3V2AR 2HRGA 4J8RA 5SWSD 5E7FA 3IGAB 4CSSA 3OR7A 3L9BA 3QZWB 2OYLA 2D7PA 1CFQB 4M93B 5E2UL 2CHNA 2ESVE 4QRPB 1DQJA 1UWEL 4WV1B 4H0GA 4IRSD 5AW6B 2BOBA 4L1SA 3Q2WA 5AW4B 2QV4A 3CK0H 3MTXA 5EU6B 4RA3A 5FUOH 1KIUB 4Y5YC 3VQMA 3N2JA 4S0SD 5AVQB 3MXWH 4FLRA 4B9ZA 3SKMA 4BUGA 4EUPG 1YG9A 4NRXB 1GAFL 1EFQA 2KKQA 1EBPA 4HKXA 1CDUA 4LHUB 1ASQA 2ICWA 2NW2B 3ZTJG 1KTLB 4F8PA 3FO9A 4OZ4B 5JXAL 5A6IA 1QI4A 1IJ9A 2CDGB 1J0JA 3GI8H 3TIEA 1U8PB 1RUKH 3C09B 5EB9A 2R4RL 5JQHC 4FQXA 2B1OA 1KEML 2ZXCA 1WRFA 5ITFA 2Z7WA 5TE4H 1RAMA 4PJAA 4YZFE 2ITDA 1KV3A 2PO6D 4OCYH 5LG1A 3UPRA 3GNMH 1FH2A 1X7QA 3DYOA 3II3A 1AE6H 1HOCB 2CUMA 4APQD 3I75B 3ZE1F 5F97E 1T0MA 5DO8A 4GSXA 1HINH 1KZQA 4ZOBA 5I76B 3FUFA 3RWIB 4U33A 3O6ML 1OCWL 1EHKB 2BM3A 2ESVA 2JTDA 5D1ZB 5D7LE 4HK3N 2F8XC 2E7LC 4XBGA 1D5BA 3QEUA 3GSWA 4XNYH 1KXVA 3WEBA 4MDIA 2Z34A 5ABAA 1VB9A 1ZSDA 5GXBB 4F27A 4RCAA 4XTRD 4ZO6A 3MRCB 3US9A 3QVAA 4BQ8A 4ZQTA 5F8QC 3C12A 2EYTA 1DVQA 4PIBA 2ZOLA 3AY4C 4FKEA 2X28A 1PQZB 1UWEH 2R0WL 4TSCH 2BERA 5CFAA 1TQWA 4Z7WE 4D0DA 4U7SA 2J8OA 4H13C 3I6SA 1CGXA 2BK8A 4Y4KA 3U9PL 1F13A 4NO2A 1H3PL 4PYGA 1OK8A 4HYTB 4HWBH 5E8EA 3UTTB 5JXAH 5GSRA 5HHMD 2E56A 2AXGB 1V8HA 4TUKL 1KULA 4B7LA 3C5SB 3HBPA 1EFXD 3LIZA 3QI9D 3UJTL 2ZUXA 4MAYA 4Q9RL 5TTRA 2R4RH 3QRBA 1KEMH 3MX0B 3RKDC 4JREB 4TLTA 2X0WA 4I0KA 2XWXA 3QXUA 3B9KA 4JFEA 1D5MA 5KS9F 4I5BB 3FB5B 3T3MF 3CD4A 3QIUA 4PJCE 3QJXA 3F5WB 1FL5A 2X12A 5DJDB 2PYEB 2YD1A 3DX8A 3M7FB 4P2QD 3IFPA 4RWHA 3IPFA 3PL6B 4GIOA 2OMNA 15C8L 4HEME 5GRUL 2YBGA 2V5YA 1N5YL 3P2TA 3O6MH 2NY2B 1YVLA 1CS6A 1OCWH 5C8JA 1P5UA 2WXFA 5KN5A 4F2MB 1CGYA 1BLIA 5BRZE 5KYXB 3ENEA 3CQFA 4WIQA 4E5XB 2JXMA 3MRLB 1KCRL 1EAPB 1E4HA 3QRLA 5DYOA 1D2PA 4WCYH 4NRYA 4YSUA 2YMOA 3D4YA 3IKCB 5EBWA 4EDWL 1NLDL 1PU0A 5GZNC 2VQUA 2FJGA 1DN0B 2ZX7A 4K5NA 1X6LA 2R0WH 3F3HA 3L6FA 4Z78B 3S36X 1GW6A 4GW1A 5J89A 5FKPA 2KZKA 4JFFE 3HS8A 2NNAB 1QHOA 4JRXE 2JJTA 3U9PH 1H3PH 4PJCA 1FVEA 5INDB 1RHHA 1IARB 2CO6A 5D71L 3PWUB 4TUKH 3V7AE 3D08A 3UJTH 4Q9RH 1NAML 2NY5L 4HEMA 5JW5A 2OMUA 3HAEB 4PGCA 4Q6IB 3D25A 4HULB 1NFAA 5D4HA 2AK1L 3US0A 3VQ2C 2FAUA 2JCCA 2J6WA 5B7FA 4OLZL 1XGQA 4FJYA 4KK8D 3NJNA 3PWPA 1OE3A 1ZRUA 1MWOA 3NRQA 4TULH 1GR7A 3ABKB 1YEDA 4MBOA 3K74B 2W60B 2ZSWB 1YMHB 5FO9B 7FABL 4IOFC 5FV1L 5GRUH 15C8H 2BSTB 1LWRA 2CGYA 3ARFC 4U1KB 4UM9A 3CLEL 1WISA 1IAMA 2KZ1B 1OM3L 1N5YH 4R7NA 5LBGA 3UPAA 1HIML 4FCHA 4NWTL 4KDWA 3CH1A 4ZUUA 1XBRA 1M71A 4PJ9C 3UOAB 1OW0A 2KQNA 3CDFA 1KCRH 3O3AA 1EO8H 4UQAA 1DYZA 5CIPH 4JFFA 1DUZA 1SN0A 1TT6A 1ZGLA 4WO4C 1DVZA 1E4XL 2OL3A 4JRXA 4MYPA 5DD5L 5I0ZA 1WAPA 2IDUA 3DETC 3LSOB 1NAKL 4PP2B 5H2BA 1QFHA 4ZUSB 3F00A 2DQFB 4EDWH 1NLDH 3SJVE 3SDAB 1DVUA 1J05A 3M6DA 3O11A 1W16A 3RLSA 4A7QA 1JHKL 2WAHA 2WKOF 1MCLA 1FG2B 3LV3A 4WSJA 4DPRA 3W38A 2GFBB 4XCEB 2QHLA 2VLRD 3RL1B 4PH8A 1WIPA 3N44F 2ZKWA 1AI1H 5MEQB 3KJ4C 3W39A 5KAQF 2NLJB 3QDAA 5D71H 4GW5A 3K6DA 1XAKA 2FSEA 1NAMH 4R5TA 5E2WL 1K72A 2GJ6D 2VCOA 1UXLA 1J88A 2AK1H 2B1AL 3MSPA 4ZUTA 1LO3L 4N6RA 2HAZA 4FXKC 1I8AA 1OGAB 4OLZH 2OI9C 4PWHA 3Q2CA 3GS7A 4W9IC 4L2YA 5AG8A 1MJ7L 2FEEI 3VA2C 3GMPA 2GIMA 4H44C 3VRJA 3CLEH 3MA7A 4J39A 1OM3H 3QNZB 1Q94B 1YYML 2IV8A 4NO3A 1HIMH 1MH5B 3KCPB 4NWTH 1SXBA 3GPEA 3WG7B 3WUZA 2P52A 3WTUA 2DRUA 3LKPB 3HNTL 5HDBB 4XOEA 1E2VA 2ODHA 1AZNA 4QRTA 1JGLL 4FJ6A 4K94L 2IIJA 1TTCA 4FP8L 1BWWA 1P9MC 5CGYC 3FSWA 4KNQA 5DD5H 1E4XH 5BXFA 2E0PA 5L2JA 4RGMB 3QYCA 4LCWB 4A67A 1KJ2A 1NAKH 4JKMA 4MJ4A 2BMKA 4OCXL 3O2WL 5GRVL 3MUUA 4P23B 3PP3H 2QQLL 5C97A 1O0VA 4KVNL 3UBXB 1AQMA 4LVHB 1AR2A 3WHXB 1J0YA 2HMIC 1UZ6F 3I6KB 4XWOC 5E2VH 4QRBA 1CVRA 3ATAA 1CYXA 4K3EL 1CGTA 3BWUF 2DL9A 5JW4Q 2P7TA 3FB7B 4KHTL 4NUQA 4ONOA 4MAUL 4MD5B 4UUJA 3DYPA 1U8IB 5DURB 4ZS6C 3TONA 3Q8BA 1UFUA 1X9UA 2RAMA 4U49A 2BOCB 3HI1B 1G7HB 1SYSB 3H54A 1XL6A 1D3CA 4M62L 4XN1A 1GRWA 1Z0NA 1WTGT 2WLMA 2E8YA 3GJEB 2XY2A 3MPCA 5E2WH 3WIHL 2B1AH 3QEGH 2VM4A 1LO3H 3B34A 4N6QA 3OXRA 1QTYT 1W0WB 3E2HC 5FGBC 1I4FB 3HNSL 5JPMA 2OXHA 1UQSB 3BWAA 1UXSA 4KQ4L 4F9PC 4IBVA 3T5WA 2VERN 1HXMB 4BGLA 3O3EA 4NM4L 3WBDA 4X6BA 3S98A 4FLSA 2EO1A 1H3VA 1RPUA 5B38B 1MJ7H 2D73A 4R6UA 2K7PA 4R0LA 4PTUB 2PCFB 2ZSVA 3C08L 4PCSA 2QLYA 1DJIA 2LU7A 5DZVA 3CDZB 1YYMH 2Y25A 2KC0A 1U91A 1HVXA 2K9FB 4X7SL 3VGGA 3L9YA 3BVNB 4BK4A 2BVYA 4JRFA 3ZE2E 1JGLH 1IEBA 3QEQD 5CILL 2Z92B 3QISA 4P2AA 4K94H 1RZ8A 4FP8H 5K9OB 3G04A 5CNHA 2P44B 5DVKA 2X4PA 4LPTA 4ERSH 1SEQL 1VGKA 3B9VA 3U7AA 2OL3L 3QWNA 5TQ0L 4OCXH 4IHOA 4HK0B 3C6EA 3O2WH 1QTPA 2YUWA 3U9UB 4RMUA 2D2CC 4GMSL 1KFAL 4K7FB 1S5IL 2QQLH 4ZUVB 5H37A 5LBVA 2YEQA 4KVNH 3GUTA 1GGCL 5DMGC 1T2JA 5EPMA 5J13C 3MV9E 2MMXA 3KBPA 4FS0A 4J3WA 5EU3B 3L3DB 1O6SB 4PJ8C 5M7QA 3IXAB 3KNBA 4P9HL 3IETA 1CJYA 3PDGA 4K3EH 4ISVA 2IOIA 1KXQE 4NQSB 1I9JL 2Z35B 3LKNA 3GSRA 4KHTH 4M02A 4MAUH 5AW1B 1PLBA 4F3FB 4Q2ZB 3L3JA 4GINA 3F7VB 4MMYA 2E59A 2Q3AA 3PGCB 3FO0L 3HG4A 3N06B 4PY8I 4YBHA 3SE4C 2NT0A 4M62H 1JWMA 4PVNA 2ZCKL 4OZGE 4NKDA 4D9QD 3WIHH 1KGJA 2J6EA 3G5ZA 2CRZA 4ANXA 1TZGL 3HMXL 4GQZA 3HNSH 1TYEB 1RCYA 1WC7A 1TZIB 4ORGB 4KQ4H 3EBHA 4NC2B 1BYNA 4XX1G 2CGRL 3QWOA 3ZTEA 5I23A 2IH1B 1JGVL 4NM4H 2MSPA 3FT4B 4HF5L 4HS8L 3VXMB 4WDIA 3O4LE 1JUFB 2VR7A 3RKPA 3C08H 4ZZFA 2TSAA 2JB5H 1MAJA 3WENA 1CLZL 1VACB 5C92A 4MCNA 4X7SH 1QFWI 4L37A 3ZYZA 2CG9X 4PQXA 5ID1A 3AACA 2ADIB 4HIQA 3RTQA 5I5IA 2EO7A 3G5WA 4Q9BA 5I6LA 5CILH 1NFDA 4PRID 3U83A 3GMLA 1C16A 1OCOB 4JN2A 3VXRB 5I1DA 3FL7A 3NA4A 3DA0A 3EOAA 4K07A 4YIQB 2XBTA 1SEQH 4HS3A 5E9DE 1VADA 4L8SC 4PIRF 2OL3H 5TQ0H 1RZKC 3QXWA 3A47A 2KLTA 3WL9A 4RNRA 4GMSH 4H8WC 1KFAH 1S5IH 1T7WA 1CXIA 4QJ5B 2I9TB 4OZGA 4ZQKA 4V1DA 5C0AA 3CAFA 3LTVA 1GGCH 2NTSP 3MRKB 2P5PA 1NBZB 4XBPA 3V55A 5CBEB 1OGPA 4LEXL 2H1LM 4P9HH 1FYTB 1I9JH 3OJMB 2PXYA 3PABA 3W0WA 2C9QA 4JDZA 3FO0H 1IX2A 2J4WL 3VD2A 3O4LA 5DVPA 3OQ3B 2YO3A 1G5GA 2ZCKH 4G42A 1GGYA 1TMCB 3CZKA 3HMXH 5DQ9B 2YEVB 4ZMXA 1OAZL 4D0CB 3ZE0B 3UG3A 1S9YB 2CGRH 4GRLC 1PG7L 5K1VA 2LU5A 1JGVH 1PYWB 3JTBA 4G8FA 3N9GH 4B7IA 4HF5H 4TNWK 3PV7A 4L4VB 4JHWL 2HLFC 5EF1A 5E9DA 2HA1A 1M56B 3BKML 1AHWA 2V8MA 3QCTL 4YBLB 3B3IA 3A67L 1CLZH 4E41B 3GKZA 2MOGA 2JJSC 1Q9OB 3MLUL 4U6HA 2AJYL 2VMFA 4MQ7A 2D4FA 2EYSB 2H6UA 3J07A 2JK5A 5F7FA 2BNUB 1JHTB 1H8NA 4Z95L 5HYJA 3H3KA 5HGBB 3GMNB 4LDLB 3FBQA 2F7IA 5ESQA 4N2GA 3C6SB 2XWZA 4AL8H 1E28A 2H41A 4G9DB 1ZSHA 2Z0BA 3SYOA 2F18A 3ECWA 4R5VA 1HT6A 5K93A 2GPZA 2IBBA 4XHJC 2YFOA 4BFIB 2F5AL 2HPOA 3KPMB 3ATDA 3LZQA 4ZSOE 3FHQA 4HCRL 4OW6A 3T77B 2X7LA 1A3ZA 3SYQA 1OSZB 1BXAA 2GBAA 1U8MA 4G3YL 1U93B 5DHYA 4LEXH 1PW3A 3HN5A 3FUIA 1S7QB 3P1VA 4QIRA 4DKEL 1WBYB 1MOEA 3IAGC 1WO2A 1CWVA 2J73A 4ICWA 3X1NA 1ZV2A 4JPVL 4LCYB 2J4WH 2MQCA 2OYKA 4KI1A 3O41A 3LKOA 5EO1B 5JZ7D 3HUJF 4N0FA 2BNRE 3DX9A 3P73B 1ZXQA 4I4WA 4WTWA 3OG6B 4AE0A 2J6EL 1OAZH 3CCHB 2LAGB 1PKQA 1GH7A 4JJ5A 4X6EB 1PG7H 2MWCA 3C5ZB 4POZC 2P42B 1J9TA 4I9WE 1JZ6A 4P06A 1KTDA 2ZICA 4WK4B 1UJ3B 3BKMH 1JGDA 3QCTH 1R75A 2CLZB 3CHQA 1WYJA 3A67H 5H94A 1SOQA 1OANA 2E9GA 3MLUH 4ZSOA 4R2GC 1MCJA 4ZXBD 1R6VA 4Z95H 3POHA 1MLCB 4O51A 3EYOB 4YNYA 1CPUA 1QWNA 3UJJL 3KBEA 4IOSA 3X2QB 1KG0A 3KPRB 2IDSA 2WVVB 3S35L 3SPCA 3QFJB 4CSPA 3NCEB 2VLKB 1EJ8A 3B56A 3QUYC 3RQ3A 4FC3E 4U1LA 3VGFA 2F5AH 4AQEB 4HCRH 8CGTA 3RURA 1B0IA 3AQDA 4J4PA 3VFPB 2DQEL 1SJEA 2HFFA 2QVIA 2WVTA 3NPZB 3OKEA 4G3YH 1QSVA 2XACC 3MBWA 4C56D 4YSPA 5EOCJ 4JL2A 4PB9L 4DP8X 1T2XA 2HCZX 4DKEH 2K3TA 1XTLA 4LCIL 2OSLB 4ORZC 2Q2LA 4JPVH 3ET9F 2Q7AA 3NIFB 3T0EE 4JZNB 4EUPA 2W65B 1BVNP 1MPAL 3LX9A 3V4VB 3JWDC 3Q8EA 3HG1A 1FL6A 4G8GA 3RWJB 1RUMH 3LDBC 3UTPD 3UBGA 2NY6C 4JRYB 4PTTB 2W95A 3Q01A 5FUCC 2QKIA 3EYVA 3SY0B 4ODXB 4GBXA 5IM7B 5CZVL 1KJ3L 4HG4K 1ZK5A 1PZ3A 4A2DA 3QDJA 4BSVB 3DJZA 3N40F 4JN1L 4Y8AA 5IKCA 5BZWA 1FAIL 3NP3A 3ECUA 5D55A 2AXWA 2LFEA 5D2NA 3SIKA 5G4MA 3A6CH 2XLLA 3UJJH 4OI7A 5EO0A 1U92A 3P0YH 3QJSB 4M6AA 3IE4A 2B4CL 4HCFA 4WI9A 2VDOB 4U1JB 1KEGL 3MUGA 1YLBB 1G7JB 1MY7A 1F2QA 3NJFA 3T0EA 4Y4KD 2IQAA 3ETBF 3FU9A 2CHDA 1UWXH 2UY6B 1T21A 3BIAX 5EIIG 5HGAB 2ZCZA 2IAAC 4HH9B 4QHNB 1MVYA 4OF8A 2WBWB 2HTKD 1RUPL 1FGNL 4UIKH 4EEEA 1N3NA 4PB9H 4K71C 1BVKA 5C3IA 5IBLC 1BF5A 3F62A 1V3KA 4MAYD 5AB1A 3L4YA 5DJXB 3MDJA 4LCIH 5KBNC 5ICXB 4N2KA 3WS6C 2Q1EA 3EFOA 2BVOB 4P2RB 1W72L 4JFED 3B9KD 5BVJB 2N1TE 3GTVA 2ADJA 1FFNB 4YHNA 5GGUA 5A2FA 1P4BL 5F3FA 2QQKL 3IMWA 4FNSA 4LRIC 5IK3B 4X4XB 3HG3A 3VE0B 3S8GB 1TQBB 2COQA 1KIPB 4PJIA 1L7IL 1GOGA 4NENB 5FHBL 3BKYH 3W11C 5MEOB 4MCMA 4HIIB 4Q52A 1CR9L 1QPPA 3ULSB 2EQDA 1AGDB 1M9WA 4RGNE 5FM5O 5DA0B 5CZVH 3LEYL 1KTJA 3VB9A 1AJ7L 4KJWD 1AACA 4PRBA 5CN1A 3WFCL 4DUWA 3C8KB 5F21B 4LPYA 1PZSA 2ICEC 4TVUA 1ILSA 1CE6A 3TBTA 4DNLA 4JN1H 3ZMRA 3BGFC 1FAIH 3ZDXE 3FB6B 3MMEB 2Z3FA 3IJYB 2R1WA 4R4FL 1FJ1A 2FLRT 3QIBA 4Y4HB 4XAKE 3FFCB 3PWJB 4HUUA 1R5VB 4HIHA 1MVUB 3MV7D 2B4CH 3TBYA 3KLSA 3QNXA 4EQ3A 1AOZA 2BSBA 3RB7A 5T3XE 1LQBC 3CTTA 4LGSB 4PWGA 3VXSB 4AQAB 4R90L 4GO9A 1HX0A 1JN6B 3IF1A 4AYID 4BCZA 1NUGA 1RUPH 1Y6KR 5F7DB 1RL1A 4M61B 1CFVL 4WW2B 4S0HA 3BAEH 4ZBJA 2C7FA 3BUIA 2HPTA 3SPIA 4K8RL 3ULVD 5CEZH 3EO1B 4TVPE 2YAMA 3QZPA 1CLYL 4GUOA 5JPNB 4KKZA 2A6JA 3LPGA 4IRJC 4MZRA 1W72H 2XG5A 1ZPLA 3Q2NA 4Y5VB 1P4BH 5LWYL 3M46A 2QQKH 1UEYA 2XXMB 1ZV9A 2FB4L 1WS8A 3KD4A 1W0VA 4E2OA 5FHBH 1L7IH 3OTTA 1OP9A 3ILEA 3DX6A 4QD2E 3AREB 1CR9H 1UZ8A 3G5XA 1BMWA 3IGFA 3NIGE 4PG9B 4DF9A 4GG8B 3F12A 3BUBA 4Z7OB 1V5JA 1EEZA 3D0LB 4NO5A 4X2UA 4BFBD 2YUXA 1QEXA 3CX5J 3LEYH 4FTVA 3TH2T 1AJ7H 5K5YA 2VZVA 3FQWB 3WFCH 4KO9A 1CC3A 3DRQA 1NCWL 1W2KT 1Z3GL 1NM9A 2AK4D 2C7UB 3P4NB 2FO4A 4LHJB 3NQKA 2JCWA 3MLWH 4KZDL 1ERNA 2HB0A 4GRWH 3SBWC 5J1SC 4IJ3B 2QELA 1UXMA 4FFWD 3R4RA 3MRJA 4R4FH 1BAWA 5K59F 3MV8E 4I2XB 1UVQA 3FT1A