4M5TA

Disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
82
Chain Sequence
b'GMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERGFISRCFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-crystallin B chain
molecule tags Chaperone
source organism Homo sapiens
publication title The structured core domain of alpha B-crystallin can prevent amyloid fibrillation and associated toxicity.
pubmed doi rcsb
total genus 18
structure length 82
sequence length 86
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2013-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4m5tA00
2N0KA 4I88A 5DS1A 3GLAA 4FEIA 2BOLA 3VQLA 3Q9PA 4ZJ9A 4ELDA 1SHSA 4PCKA 4YLBA 2MNWA 4YL9A 4YE0A 1GMEA 1WFIA 2KMWA 2WJ7A 3QORD 4RZKA 4M5SA 2CR0A 2Y1YA 1WGVA 2KLRA 3EUDA 2Y22A 3GUFA 3J07A 3AABA 3L1GA 2N3JA 3L1EA 3QORA 2CG9X 1X5MA 1WH0A 3Q9QA 3IGFA 4YDZA 4MJHA 1EJFA 3GT6A 5LUMA 2WJ5A 4JUTA 3AACA 2RH0A 3QORB 3VQMA 2K8QA 2JKIS 1RL1A 5DS2A 3QORC 4YLCA 3L1FA 4PBDA 2XCMC 3N3EA 3W1ZA 2O30A 4M5TA 2Y1ZA 4JUSA
chains in the Genus database with same CATH superfamily
4WEEA 2NXYC 3UJJL 3BISA 5CZRA 2BM3A 4GRMA 1EZLA 3F7YB 1A6VL 4HUWB 2ZUVA 3Q1SL 3TBWA 2Y2YA 1RK7A 4LKXB 5KANG 1JGUH 1NIDA 2D7TH 3MV9E 2MQ0A 3X13B 1AOHA 3GMLA 4YPGA 2B0SH 5G55A 2EUVA 1B0GB 3IDMB 4MGXA 4HQQL 3BWUC 3DVGA 4JFOB 2GHZA 5AOLA 1CTOA 1I82A 1S5HB 3LKQB 3DPDA 1NDTA 3FFCE 5HDBB 3PJNA 4FYSA 2CMRL 4P2RA 3VFVA 5C0CE 5E8NA 5HDBF 5T3ZL 4WW1B 2A73B 4FE9A 1SJHB 1FPTH 1FL6B 1BJMA 1VAHA 1QFWI 1A7RH 1ZV5A 3PJSB 3WN6A 4HHAB 3U7YH 2HYMA 2Y7QB 2MOQA 1NJ9B 3W2DL 4XMXA 1G7PB 1TTCA 3D4CA 5GS0C 1JVLA 4MWFA 4UM8B 3W57A 1ZGLM 4QGYA 5B1JA 3BX7C 3TH2T 2Q20A 3RGVC 4P23A 1DN0B 1LTXA 3WGUB 1S7TB 2DJUA 4J3VA 5DJCA 2P44B 4F5CE 2FDBP 3ELQA 1RP9A 4WRLA 3D18A 2FEEL 1ZT7A 1ADWA 5DXWA 3F64A 4AGNA 1P1ZB 2D3JA 4EN3D 4X5XA 2VDMH 4W9IC 5E1IA 4LVHB 3KLHC 2M83A 1E65A 3DXAB 4HAFA 3VXSB 3WKQA 3MNMA 2ZPKL 1A1OA 4QRRB 3APFA 2V33A 1P5VA 3JTTB 4HK3J 3HVDA 1T89A 2GTQA 2MQ3A 1HCFX 4PCSA 3CZJA 4HJ0D 1Q1JH 3BWSA 5A3IC 4GW1B 4JFFE 4OSUL 3R8QA 2R69L 4ZW8A 5H8DA 5G4NA 5JZ7C 2CO2A 4AIZA 5KWYC 1GCFA 4OM1H 1EJOL 5D2NC 1FF5A 3PAZA 5DVNA 1YEFL 3GZPA 5IB1B 3RVUC 4FNUA 4M56A 2BLFA 4DGVH 1UWYA 1HC1A 3MCLL 1PGRB 3MX0B 4EI6B 2BRRL 1LO0L 5JA9A 4BHUI 1XXFC 4YR6A 1LDSA 1WZMA 2UY7B 2YEZB 3V6OE 4ZTOH 1ZLSH 5FB8A 3AQZA 3L5HA 4N20A 4J12A 3QZWG 3SKOA 1A3RL 5DVMA 4KVNL 4QXGH 3T1WA 3CZFB 1WA2X 1YQ2A 1MH5B 4KVCL 1AZVA 3CVHB 3HE6A 4HKXB 4KAQL 1KLUA 4H25B 2BNUA 3G5XB 2Z7WA 2KI6A 5C7ZA 3WDHA 3LAFA 3O8XB 5ACZA 4HPYH 4ZUSA 3QWOA 3PGCA 1VLXA 5DLMH 4LESA 4PHZA 1WLHA 5EEXA 1K9TA 2PWHA 1MKFA 5GRVL 4Z8FL 4Z77A 1F4WH 4NKOB 2KKQA 3BH8B 5J6HA 2DWYA 2NDFA 3TYGL 1XBDA 1S7UA 5EDSA 1WK0A 4U1MA 4XNDA 1U8CB 4RSYA 1KJ2A 3AT8A 5ICYA 5E9DA 2O5XL 2QADB 1LVEA 4WI0A 3UTTA 1I7UA 4IU3A 4KHXL 4XX1G 3RPIB 1CTNA 1CE6B 1LDPL 3RFRA 2BP8B 2WGXA 3WSQL 4M8QB 3RWHB 3NZ8B 3QXDA 3ZTNL 1KEGL 4FNQA 3L3KB 2DYPB 5A40E 3TFKD 5E2TH 4YFLF 5D9SA 1GA2A 3NJXA 4JX0A 5DJ8B 2WMPB 4L5FH 1E4XI 2E59A 4H26A 4Z5RA 3O6MH 2K9UA 3LDBC 2IOMA 2XPGB 4R4BB 5ENWB 3C60B 1I3RB 2OSLA 4KTEH 5SX4I 2CJUL 1Z9PA 3K6FA 4AYID 1F4HA 4CDGC 3DWTA 3GPSA 3KS0H 4YQXH 3ZUNC 4A2EA 2EEAA 4YOKA 3QNXA 4L48A 1MJJB 3BO8A 3DVNA 1WC7A 2JIXB 4LVOC 2UZIH 1E9OB 4UAOC 4AH2A 1OGAA 2CDGB 1T03H 4HIIA 5M7QA 2X12A 4PG2A 2QR0B 1J12A 4E41E 4Q8BA 1OF0A 1AS6A 2ERJB 4XHJC 4Y16A 4EI5A 5E5MA 1A7PH 4R5VA 4HOXA 5IB3B 2VLJB 2NY3B 3OKKA 4H5SA 1KTJA 3PQYD 4YDZA 5C0EB 2ZONA 3UTSB 5H94A 3LKRA 2IH9A 4U1NA 2D7QA 4B9CA 3PGFH 2BNQE 2HZHA 1MCNA 5J1AB 2PYEB 2DIEA 1Q72H 1JHLL 1UM6H 3OL2A 4ZTEA 5G4OA 5AW6B 3CHOA 5IKCB 1D5BA 3VCLB 4XBPA 3WY2A 1T6VN 4IRJB 4P9HL 1GR7A 5CN1A 4HFUH 3MBEC 3LEYL 2CJSA 1PSKL 2VUYA 4F3FA 1OD9A 3NCYP 1ZLSL 2WXRA 3NCFB 4AKPA 1CICC 2WLNA 3PP3K 4NIYE 3ZDXE 3I3EA 1LO5A 5MEND 1UEYA 3DX8A 4LSPL 3VD1A 3CN0A 3SJVD 3IMWA 3LZRA 4OLUH 1BX2B 4W9JC 5DHVA 4LHUD 4EUPG 1G6RA 3GS4A 2VABB 3G08B 3LZNA 5DC4B 3ZIYA 4DP9X 3L7EA 1H6FA 4HFWA 1TJGH 4WU5A 3VRIA 3I50H 2G0LA 5CZKA 3LPFA 4LCYA 5AW5B 3OSVA 1NIBA 2R0LL 2XQYG 3GEWB 1E6JH 1TENA 2ZCKH 2X4TB 4J8RB 4UQ9A 4NQCE 2OR8A 2DKUA 2FZ3A 3ARBB 4OUUA 5AOKA 1E90A 2BSSA 4D0DB 3VB8A 4X4ME 3NCWA 1RVFH 4RX4A 2F7OA 4TMPA 1V3JA 4N2FA 1K85A 1QNIA 2AW2A 2VWEC 3AXHA 1BV8A 1EDYA 1I1AC 1MRCL 3LZOA 1IBZA 4IGBB 4QHNA 2CDEB 1NMAH 2BVQA 1N18A 4Y5YB 1Z9NA 1JP5A 2YSSB 5F0PB 1QSEA 1UADC 1Z9MA 2WXMA 3DO4A 4K5PA 3K4ZA 2GQHA 3M1BA 4NJ9L 5K59E 5DD6B 3RYMA 4ZFOA 2B16A 3JZ7A 4CBPA 1SFHA 3HE7D 1H6UA 3K2MC 3NFPA 4JZNA 3EYUH 5FW6A 1HHJA 2ICWJ 3LMJL 4KROD 1JK9A 2Z0BA 1QUPA 5ESVB 2ZOKB 1J8HB 4ELMA 5F1KC 3DX8B 4WWPA 1JWSA 3EBIA 3SJVB 3WS3A 1MPAL 3Q2VA 4NUJB 3HC3L 4DK5A 1NFDB 4N6RB 4FMKA 4DTGL 1PZBA 1WV7T 2MQCA 4YL9A 4P5RA 5TFSH 1CGXA 4XNQB 2VO8A 4ZPVA 3QXVA 2GJ6A 3MMEB 1LMIA 3QS2A 4OY9A 5CEZH 1U58B 1S7UB 5F0LB 1C5DB 5EORH 5J1AA 1SLWA 2NRDA 4Z77B 3K91A 1DBML 3AG3B 3LRMA 3I3BA 5FO7A 5T5FA 4HVBA 1JL8A 3UBXB 5HVHB 1G7MB 4JG0H 4LEEA 2ROXA 4AY0A 1QYGL 3VXTB 2WSPA 2WB1A 1XCTB 1OT2A 2XWRA 1PLBA 2DOCA 4H20H 1MCHA 4XWOC 1F13A 3PQYB 3U30C 4PS3A 5LBSH 4M93C 4P46D 3Q48A 3TBSB 5FLUA 4YO0B 2HX9A 4JRYA 5CJOL 4XMTA 5IWLA 1OP4A 1AFVL 4LF3B 2AEQH 1NMBH 2BOCA 4YC2C 3O4OB 4F37F 5FYLD 5AB1A 1FQ9C 5D6DA 3SDDD 3UAJC 1OTTC 1CG9B 1SLVA 1HJCA 4NKOA 4H26B 2I26N 4KROB 4JO2L 4C4KO 1S5IH 4QIRA 4ZMQA 2X4NB 1IC5L 1DDHB 2BWQA 2O6FA 4ODSL 3T2LA 1OCCB 1KEML 4ZMNA 5EFIB 4KZDL 3G5XA 2D31B 5IGXL 1MLCA 3T1FB 3Q5YA 2DYPD 2OMXB 4TNFA 3G5VB 3CZFA 2W8CA 1JGLH 4RISL 1UA3A 5TQ0H 5JORB 2FNWA 3UTTB 4RAUB 4PRDA 4K4KA 2J6EA 2VDLL 4HKZA 1J18A 3T4AC 2WLMA 4M6OL 4DGWC 4XPHL 5DEGA 3ROLB 1EHNA 1FO0H 3L5XL 3KGUA 1AZNA 3LKPA 2A9AA 1KN2L 1GY1A 2YKLH 3GI8H 3BC9A 5CP3A 3IPFA 2Y06L 3NT0A 4MS6A 3T2QA 4AOFA 4DQAA 3VFUB 5DZJA 1HNGA 1IC5H 1WF5A 3TC9A 1U8NA 1X5LA 4KPHL 1JMXA 1NGYA 5LB1A 1K5NB 1JZHA 2JWYA 2VN6A 2C3VB 3CFQA 5K69A 4M43H 2AK4A 2X6BA 3NPZB 4MB1A 5IWLC 2D8KA 2PPCA 3EYQC 2DJSA 5IW6B 1TTFA 1BW8A 2ZOKA 4KRPB 1BAWA 1XTLA 4KUZL 2G75B 3IJEA 3MRGA 1BLNA 3FU8A 5CZXC 3KPOA 1RMFH 2WJ5A 4NHUA 3V0FA 1P69B 4V2BA 3MNWA 1JZJA 1W9XA 4DPRA 1YY8A 2Z8WC 1IGML 2R7EA 5T1LD 1UH2A 1N6QL 4N8VB 3QK0A 2J1ZA 1NUFA 1RQ5A 1H8NA 5LGJB 3GBLA 2ZCHH 1QRNA 1IBBA 3QJXA 3V9FA 3MPCA 3PXJA 2YPVL 4YDJA 4Y19B 1IQWL 3FXIC 4TLTA 2A9MH 2F7PA 4FGMA 5EEUA 4F7PA 2BW5A 1FPTL 5KZCB 3KCWA 3STBA 3WY4A 3T4AA 5DRWA 1B0WA 1LMKA 4Y1AB 3V0VA 4RLDA 5IK3A 3VXUB 5KSVA 1WFOA 1X5AA 1SNRA 3BDYL 3KWWB 2WP3T 2X40A 3HC3H 4FNRA 4MD5B 4J1UA 1F4AA 4PJXA 1BQRA 4A2DA 3RNQA 1ZRUA 4KNQA 3QDMB 3JVFC 3QZWB 1NLDH 1WCBB 5IROA 1G9HA 1I7RA 1JXKA 1E30A 5ICZB 4X98B 4FF9A 2OMZB 4CN4A 4JCLA 2Q3AA 2HB0A 3EYUL 4XCFL 1KCVL 3UPAA 1AMYA 4OF5A 3FCUB 4K7FA 5I2IA 2LU4A 2VTFA 5CGYD 2VL5B 4KDVA 1PD6A 3ZT7A 3Q8EA 2P80D 1OP5H 2CDFA 4ABVA 1R3HB 1U92B 5E8DL 2QLVB 2FIKB 3FRPA 1IGYB 2PP9A 1LEGB 5CLYA 2GCYB 3HZYA 1BVLB 3AG2B 4GYBA 4YDLC 4YHZL 1GC1C 3DHJA 4RRPM 3STLB 2R69H 4WI6A 1RFDH 3JT0A 1ASOA 1MREL 3T2NL 5IMMA 1M6UA 3SY0A 5DFAA 1S7SA 1P7HL 1CFNA 4PRNB 5E0QA 4G1MB 5HGBA 2QFPA 4TXVB 5TH2B 4ENED 2H3NA 2VRKA 4Y9BA 3P77A 4BSVA 1L9MA 4K9EC 5DC9B 5CEXA 5F96H 3V4PL 1GSKA 4DK6A 2XWTA 4N0FB 1F02I 1J87A 2RB8A 2ZUXA 5I6KA 2P24B 5F7DA 3SN6N 3VD7A 2UV3A 4RESB 1WD8A 5DFVC 4S1QH 4IIZA 4FNLL 2YKKA 4ZMOA 4O02B 4GAGH 2R2EB 4GH7B 1FYTA 3FH8A 3JWDC 3W9DB 4B9YA 1T1YB 3WKML 3O6FB 1T83C 4JFUA 1BCIA 3N9GH 1GYVA 2LT9A 1QEXA 4NWTL 2GTZA 4FQQA 4EMZA 1FLRH 2AAVA 2OAAA 2F18A 5F1SA 1RZFH 2F74B 3FMGH 2DF3A 2GIYA 1GGBH 3HI1B 2YAQA 4FQIL 1A8JH 1CIDA 1CTMA 4KO9A 3OKLB 4GP4B 5GS0L 1JGDA 1P4LB 3AXIA 4OJAA 4Y4FB 1L5GA 4H88H 2VKWA 1FFRA 3QIUD 4M48L 4KUCF 32C2B 2ZF8A 5I5RA 1O9VA 1M6OB 3IJHB 5C9JB 5TGBA 3K72B 5ICYB 1BA9A 1ZSHA 1E67A 3OAYH 1OAUL 1ITCA 5D1XC 3IRZA 4QNPE 1JOIA 5AUMB 4KK6C 1ITBB 2GK0A 4YHLL 1JGUL 3DETC 5J3HD 1U3ZA 1GZQA 1UVQB 2IAMC 4GKOA 3INUH 4HSAC 1N0LA 4YVUA 1VACB 3L81A 3DOIA 1GGIH 2C7UA 3EYVB 5ITBH 5I8CB 5DR5H 2Q1EA 1XCQA 2GPZA 1FORL 1H6EA 4ZOCA 3VSUA 2CKBA 3VFSA 3QJFB 4YSTA 2Z31B 1HL4A 2YK1L 4JPWL 5KOVC 4G6KL 5CR8A 1DFBH 3DOHA 1TTUA 4OI9A 1FFNB 2VLMD 4BZ1A 1J8RA 3ARDC 4LLQA 2DLFL 5L7XH 4QRPE 5LDUA 2JKSA 3HMXA 1RV6X 1BQUA 4BBWA 4GSQA 2VIRA 4ALAH 2BVOB 1JHKH 5CEZE 1KEGH 4PJ6A 3TFBA 2YPLE 5A2FA 3C5ZD 5FYLE 3VGGA 2VC2H 3VI3B 3WSQH 1JXDA 2NZIA 4N0YH 1MDTA 4Z7UB 4IBQA 2XQYK 1T5WA 4CC4C 3NGBB 1AGCA 4D9QE 4ERSH 1JZ6A 3FOLA 1FV1B 4HIEA 2F54A 4RZKA 1N8OE 5A7EA 5CFAA 2CLRA 4XMVA 3NP4A 3QUXC 3QXTA 4WFHD 4QLRA 1OAXH 2YOAA 5JIIA 2GI7A 4QY8A 5IW1B 2EDYA 4CVUA 2JF1A 4NBZB 1Q9OB 1ZDQA 2R1XA 2N0MA 2DWEA 2UX7A 4HS3A 3VE0A 4NQQA 3WOVA 3TO4A 2AEIT 4FTVA 4U1SA 4XN7A 2WNXA 2WP3O 3S88L 3FONA 2VR6A 2P7TB 1IGIL 2F68X 4E9LA 4WI5A 1NCBH 3NDZE 2OSYA 3KWWA 4G6MH 4I5BB 4HMDA 1VZIA 1K8IB 2SEBB 3MKGA 4ES9A 5KSAC 1I4FA 4PLJD 2L7UA 3T0AA 3O4LA 4GI8A 4NXKA 4P9MH 2D7NA 3HG1D 1YEHH 1MFMA 4OCLC 1N4XH 1ZOXA 5DWUL 4PY7B 1HVXA 3EJQA 4MD4A 3T08A 1A6UH 1UWXH 3AUVA 3EBGA 4CILA 5IEKA 4ICWA 4PIRF 4PLOB 3BE1H 3H55A 1UURA 5GSVB 3QIBB 4UU9A 4AEHL 3H7BA 4H1LG 4JR9H 5CCGE 1J11A 3B8SA 1PX4A 4S2SB 4ZPTB 3VGDA 4LLUA 3IAGC 4L2LA 2H3XC 3ILDA 1A47A 1Y1UA 2OL3B 4F7TB 4YXHH 1N10A 3WE1A 1FNGB 4BKSC 2CLVA 4J3OD 3WKMH 3SCMC 4ELME 3ATEA 3PNWA 4QHUA 3UPRB 4U7MA 1T1XB 2AAAA 3D3VA 1ZY9A 2H2PC 4BSVB 5HY9B 5LDSA 1D5IL 1RUKL 3O11A 5FCSH 1GZQB 5SX5H 4JZOB 2UZPA 5BZDA 3MUGA 3S36X 1J5OH 1ADQA 5KTEL 3X2QB 3IDMA 4FTDA 2MEJB 3KYMA 4KKAC 4JHAH 4UB0L 5HGHB 1BZ7B 1FUNA 1ZA6A 1NKOA 4RMQA 1HOEA 3BD3A 1SBBA 1BFSA 3RU8H 3CVHH 3EFDL 4R83A 2YXMA 1DBAL 2EEFA 4DO4A 5BVPL 5LWYH 4J28A 4FXKB 1XR9A 2R56H 1FHNA 3QRGH 2ZTBA 3N9GL 4KK9C 3D39E 5H35A 1BGXL 4P23C 1JZEA 4YL4A 3KH3A 4OF0A 5BPPA 1N26A 3QORB 4G1MA 4MJIA 3SGKC 5IHZB 1Z5YD 3ABGA 4BWUA 1TZAA 2O30A 2NZ9D 3DGCR 3KXFB 4G7SB 43CAB 3STLA 4BDVA 5SWSE 3O2VL 5T3ZD 5L2KD 4R9HA 1AHKA 1HDMB 3RUGB 3ZL4H 3K6NA 3RVWD 3D5OF 2WVSA 1OARL 1WWCA 2DTSA 3KBFA 4PVMA 5DRWB 1HX0A 1YDPB 1KCUH 3PRZA 2MOGA 3D85D 4LIQL 1JPSH 3WHE1 1A9EB 4R3SB 2BSRA 5IBTH 1BGXH 3QQNA 5E1HB 2EUZA 4LOUC 4JRXB 2W91A 4Z7VE 1TO4A 5HDQH 1XXDC 2XG4A 2KH2B 5I0XA 3VH8A 1EZVX 3CHSA 4Z3IA 3PP4L 3QEGH 3GNMH 1BZ9A 3FT9A 5B8CC 1IEBA 3L95A 4J1UB 2A7BA 1XB6A 1KV7A 1S7RA 3PG2A 1AI1L 3EO0A 4PRIE 3FBQA 2FX9H 1XCWA 1J9RA 4XVOA 1IJ9A 1BD2D 2VL5A 3MC0A 1DLHB 3O3AA 4YNYB 3S96A 3FUEA 5LGKA 3NAAH 3S98A 1SUJA 5EZOL 3ULVF 4LCCB 2EE0A 3FO2B 4XT1C 1YNKL 4LCUA 2G3ZA 5TQ0L 1I7ZA 2R0ZL 3PWJA 4U1HA 2XPZA 2C1OA 5EMYA 4ZO8A 2ZUWA 4N8VA 4QTIL 5EO9B 5CJ5A 3KPRD 3BUTA 3P30H 2YUXA 2AJZA 2X4PB 2EKSA 2OMYA 3Q2WA 4KBPA 1EEQA 1J1OL 3QZMA 2WBJB 3GYRA 5HHNB 1USQA 4AW4A 1QRNE 5LUMA 4U1IB 4KJPD 4JO2H 3CXHK 4OV5A 3QO0B 4BE5A 4G7VL 2E27H 4J23A 4G1EB 4OGXL 2VXTL 4ILDA 1QSFD 3S9DB 3UX9B 3MI6A 4YSDA 2HG0A 3SZ6A 3M46A 1PX3A 1RMFL 3GM0A 5DYFA 5JDJA 2BHFA 4PMFA 3NJNA 5HHME 3HJEA 4ODWB 1JNHA 2OP4L 4ELKA 1MW0A 4NPKA 4EI0A 4G43A 3G6AB 1X4YA 4MZIA 5KS9F 4Z78B 1CI3M 4OTXH 1N12A 2V9RA 3AB0B 1FFQA 3ARGD 2D0HA 4PJXE 4MXWH 5SX5K 4LARL 1EFQA 3NCCB 4HUVB 4M7KH 5CJXA 3BUPA 2ZT9C 3KMDA 4N22A 1WZ1H 2AKRA 3BEWA 3L3HB 1U8LA 3LKOB 1UWEH 3A6BH 2IQAB 4P5KB 4G7QB 3EADA 1QUNB 5FFLA 1RZPA 5FEBA 2ADFH 1ZV9A 2F15A 4LE8A 1HH6A 2E9GA 4KI1A 1WCQA 4LU5H 4E9YA 1R46A 4HEPG 1V7NL 3IDXH 3S5LG 5JXAL 1AXSB 4XBMA 2FQEA 1U2HA 4P4RB 3HAEG 2ZWSA 4DP8X 4JM4L 1KPUA 3AVEA 4S10A 5T5NG 5E6UB 4X0KB 5EEYA 4OFIA 4JCMA 4M3JA 3GSOB 4FRWA 3ARTA 5J5EA 1AO7D 2J72A 2GBUA 5D6CA 4YGVA 4JDTL 3UTOA 2G3XA 2D4FA 4QEGA 5C2BH 1CUOA 3RIFK 3RHWK 5IKCA 3L9RB 4AI7A 2JIXD 1WITA 4LLVA 3BPNB 4CU6A 3D85B 2LU5A 3RTLA 3BAWA 5D5ME 1A7OH 4F7MB 4NFCA 1H3XA 2NY0D 3HC4H 1KELL 3IDXL 5JXAH 4PPTA 1NWOA 1FNFA 2BCKA 3SE8H 5CJXC 4X4YA 2QGDA 2Z7YA 3VVWA 1JXJA 2YLKA 4FNTA 4BH7B 3NJVA 5F0JB 5GS1C 4F7TA 3BIBX 1H5BA 1ACYL 3IXTA 4AVJA 1E3XA 4JRYE 3TH4T 4DGIL 4HC1L 2GJ6B 1XDTT 1QFOA 5GGQL 1JPGA 1FC2D 2NY4B 1EFXB 2I85A 1QD0A 1BBJB 2LGNA 4IBZA 5I1GL 4PY7A 4J8RA 2VMEA 2DMKA 3RILA 4L4TD 3LHPL 3JYCA 3HI6H 1LE5B 2VXUH 4YC2B 1G7MA 3F6JA 4E42B 2YUZA 1FAIL 5AVYB 3H4HA 2F8OA 2EE2A 1U21A 4WEMB 4A7GA 3QUZA 5AKVA 5K39B 5CBAA 5GS1B 1XHHA 3FTSA 4WO0A 4HEMA 1G9ML 3MLWL 4EUPH 2ZYIA 4NWTH 3VACA 1KMGA 3RWFB 4AE0A 1VFOA 3QXDB 3E9UA 1SQMA 1D5RA 1U2CA 2FGWL 3EFFA 5FOJA 3PXHA 3I6KA 2A9BA 2FSEB 3FW6A 4IOSD 4OM0H 2YAOA 3DRTA 3V5HB 4IBTA 1H8OA 1EPFA 4TUOA 5FC9A 1SGKA 3FYIB 2BWIA 3WEOA 4ELMB 5EUOB 5C97A 1QSEE 2IH3A 3BHBA 1NAKH 4FP8L 1P2CA 5IM7B 5F1NB 1V3LA 4TUKH 1JK9B 3RURA 3GKWH 3K5RA 2JSFA 3JYBA 1KENL 2WSKA 2HJFB 2RACA 4PJ5D 3MRDB 4MNQB 3VSQA 5K1NA 5DHYA 1UWFA 4KDTA 4HOWA 2CLVB 3FQ4A 5ANME 4G8IA 1FGNL 3QUYD 4MQSB 3RWDA 1KYOK 4A2GA 1A14H 4H25A 3PWPE 2IANB 3WFZA 2YSSA 5EZLB 5JOFA 3N41B 4D0BA 3ZQXA 1SDYA 2GFBA 2V2TB 2J6WA 5DC0A 4WW2B 1KXHA 1OAKH 3KWXA 2X6MA 5TE4H 4NN7C 4A66A 1CCZA 2Z31D 3AACA 4PJBE 4M5YL 5I1CH 2Q3XA 4NUMA 3ZX1A 1JGVH 5KVFL 4F80A 1MCEA 1T66D 3WUWG 4ZW3A 2BSSB 2WAHA 2G5BA 1R19A 2XYCA 2COQA 1ODAA 2F5BL 1MNUH 3A21A 2CGZA 4IGBC 4JM2D 4F20A 3K6SA 3ZT5A 2UWEA 2ZNWA 3D39D 2HVJB 1AQHA 2DDQH 2FLBT 3MRLB 1FH5L 4AGMA 1UKTA 3DDGA 3QZPA 5EWIH 4M1CD 1CDCA 3QEHA 5CFHA 2CK2A 2AJZB 2X9YA 4LARH 3ZDZB 3W0WD 4N85A 1MHHB 4Q58C 1B3JA 3RX9A 2P5EE 5C0JA 3FOLB 3EOTL 3PABA 5CR1A 5FUZH 1J8SA 2FVNA 5IVXF 5I0VA 5I26A 1XD1A 4I0CC 1EMTL 4QYOA 3PWNA 5ALBH 5IFHH 3VCLA 5AW9B 3HI5L 2JQZA 1NBCA 4QPEA 4U1MB 1C1EL 3ZO9A 3FB6B 4X42A 3GSNL 3KLKA 3I9PA 1OZUA 4GW5B 5DZNA 1CFTB 2NY6B 2FJUB 2XQYA 3Q1SH 2J57A 2AJ3A 5F7WC 1KGJA 4GSDH 4YLCA 6PAZA 5JXEA 5I6MA 3QARA 4FQJL 1GJWA 3QGVA 4BFEA 1UJ3B 4KHTH 1IEBB 3VWJA 1SY6L 4WVRA 2X05A 3V0AC 3WKNA 4O2CB 4TQEH 4ZS7L 3UAJD 5D93B 2EUWA 4PJHA 3S5LB 5D1ZC 1YEGL 3C6EA 4UDTB 2EXYC 3BIKB 5CINL 3S7GA 5FYJD 4ZUUB 3HPJA 4MNGB 3BH9A 1S78D 3MV8E 3R1GH 4XBEH 2EZ0D 1BOYA 2DMHA 4LDOB 1PG7H 3O3UN 4K94C 1AQDB 1TVHA 3TN0A 1NAMB 3H0TA 4L3EA 3HZYB 4LRNL 1LWRA 3L3DB 3C5SA 4RISH 5JW5B 3MDJA 5HHMD 3O8XD 4ZFQA 5F7BA 3UG5A 1H0DA 4PJ8A 3EJPA 4HC1H 2HH0L 4U0RB 4Y9EA 1MIML 1H3VA 5EO9A 1X5FA 1ZXQA 4JRLA 43CAA 4UTBH 4AG4L 1S7QA 1JRHL 4HIHB 1E3ZA 5GS2D 3LNGA 5JUEL 1GGIL 3KPMB 5GRUL 3AADB 3Q3GA 1JGEA 3DDFA 1MG2C 2IGTA 3VH8G 1AQMA 4KRPD 4HISA 3ZKNC 1FCCA 4IRZH 5D2LA 4W9DC 4GINA 1ZLEA 4JQIH 4QTFA 3QORC 3U36B 2D9QB 4G3YL 4PJXB 2W38A 2CO6B 2FTAA 2I25N 5F71A 3O3EB 2L0DA 3T3PE 3L9BA 1JFHA 1X5JA 2RCSH 4L05A 2YZ8A 4D9QD 4DKFL 3B7SA 1EHLH 2V5MA 1DR9A 4MAYA 5T8IA 1CT8B 3X1EA 5E24E 1S7WB 1L6XA 5SX4H 2FL5B 1YYCA 2QKIC 3QHFH 4NNYB 2GK2A 2H6PB 4OKVB 4PWKA 2ZSVB 4Y2LA 4F15C 1CVRA 3NACL 2R9HD 3VFVB 5J56B 1ZT4B 2GJZB 4AJVA 3ULVD 2DH2A 3KPRB 2C5DC 3PWUA 2X4PA 2AXHA 5IR1B 5MERA 1GTFA 5DS8A 5BOJA 3QULA 4KK5C 3AS0A 43C9A 4PV9A 5ALBL 1K6QL 5E8PB 4QRPA 3FTUA 1VPOH 3KYOB 4NGHH 3ZGHA 4ZDHA 1LEGA 3K71B 2V8LA 2WD0A 1E42A 3FRPB 3ZKSD 1E4KC 3FK3A 1WGVA 4L37B 4JPVH 3RG1C 2J8UF 4OLXH 3E3QC 3PPSA 4Z0XB 4MNHB 5C0BA 4MMYA 2QHLA 4NZUH 3CCHA 3Q7JA 4GW4B 5D7LB 4MQXD 2J44A 2N01B 1A6TA 1IGCH 1RZQA 2GJRA 4GP5B 3MOQA 3IT8D 4GAJL 1EHXA 3V10A 4I2XA 2CHDA 2J71A 1KBGL 3DXAA 3KR3H 3PJSA 3LKPB 5CMAA 4YDNA 2Q86A 4C59B 3ULVC 3JV0A 1OGAD 1U6AL 3QUGA 1K8DA 1SJHA 5IG7B 3WXVH 5EF3A 1P7QD 1JZ4A 3NESA 3RNKA 4XNMB 1DVFD 1YO4A 4GAGL 4UOW1 4MJJA 1FL5B 1BF5A 5BRZE 2ZAGA 1I8IB 4FQ1H 3EG9A 4OZFH 5DQ9B 3K6SB 5L4IA 2H6PA 4OKVA 3TT3H 4RAVB 3FT2B 3NA9L 2EILB 4PS8A 5DMJB 3WUWB 1LO4H 2B8OT 3L4WA 4KHTL 3T04D 2XBTA 3FU3A 4C57C 4LKXA 2X09A 4NP9A 3EBAA 3ZKND 1EO5A 2HRLA 1F1AA 3QUXB 1PIFA 4JY6A 3FQRB 4XCYB 3D2UB 4PV9B 1Y18B 5ETUA 1MFAH 1DVSA 2X9WA 5F7AA 3NGBC 2DQGL 4XHJD 5E0FA 4ORZC 3KLAB 5E94A 4Y7MA 2OTPA 3TT1L 5MEOA 4B9GA 3HZVA 4JS7A 3QDMD 5GRVK 2VDPH 1CFTA 4MAUL 4WWKA 4M1DL 5KYXA 3TJEH 3CFNA 4NSKA 1UD5A 3U4KA 4D2NA 5CM1A 1CD1A 4XMLH 1DQIA 4LLDB 5TF0A 1DSWA 1QQDA 2AI0H 4NO0D 4Z7OE 5JLZB 3NIDF 1AD9A 2JK5B 3HG0A 3KLDA 3CDZB 2N56A 3QFJE 1AMXA 1HNFA 3N5AA 3VXPA 3KPTA 4Z7QB 4YHNB 4MB3A 1R24B 1MHHA 3NRPA 1QAWA 4P2OB 2QKIB 2IANE 4FLRA 1M6OA 3IJHA 4M48H 5BQ7B 1BD2B 3RAJH 4TSBL 3UPCA 4RMVA 1E4KA 5MEPB 1UACL 4NQSA 3RA7H 4U1LB 5E4AA 3OPZL 1Z0NA 2H4EA 1H0DB 4PJ8B 4XWOD 4DH2A 2J1XA 4KJYB 1SY6A 3P1VA 4JVUA 3D4YA 4MB4A 4Y4FC 1AO7A 1TZ8A 3G04A 1QR1B 1FFPA 4RSVA 4ZXBD 1YC8A 5J6GB 3AT9A 4K3EL 4PQXA 1NFIA 1L7IH 1WWWX 1A2YB 3A67L 4M4RA 1I8UA 3LS5L 5HYQB 4OKDA 2UXGA 1R5VA 3IJYB 4E9QA 4O02A 2ALWA 2Y6SD 2ATKB 2YUVA 5IB5B 3PJLA 4B53A 3CD4A 1U2YA 4BA0A 5L9DL 1UGKA 4M6MH 4HK0A 4PP1C 1P4UA 3LKNB 2WQVA 4TTGA 4QOKE 4TVUA 2XN0A 4GRWH 2Q2LA 1HE7A 5CGMA 4YZWA 4IRSD 2IXQA 2APFA 5GGQH 3ZY7A 3FMGL 1SLXA 1IKFH 5KBPA 2OTWA 4LASL 2P1YA 5D4IA 4B0MM 5BS0D 3QAZB 4N86A 4Q9QH 4X5WB 1XH1A 5EORL 4FADA 1RK1A 4NQCD 4C56E 3H9SD 3A4FA 3MRRA 1T21B 1FV1A 4HIEB 3I9GH 3WNMA 3P4OB 3OJDA 3DURB 5FYJU 3P3YA 1GHFH 3UMNA 2PR4H 4JQVA 32C2A 2A3TA 4QLWA 5BS0B 3WTUA 2NLJA 4KKAD 1R3HA 4IK7A 2FBRA 4FHKA 4RWYH 3UFIA 1WJ3A 3C8DA 1KWGA 4X9GA 1JIBA 2BVOA 1JF1B 1JPTH 3MBEA 3H4FA 3SDXB 3ULUF 4L29A 1GPOL 5EBMB 3KDPB 2HLAB 2HVJA 2IGFH 2TAAA 5DSCB 3WV0A 4AQ1B 1KJVA 2CE6A 3J7HA 3V6OA 1F90L 1ZHLA 4TF4A 2PYEA 1QABA 3ERXA 4CMMA 4WWNA 3RBGA 1W8OA 4WEUD 2C3WA 4G71B 4F37K 1NEZA 1ED3B 3PABB 3IKKA 2WBJD 3ZE2E 2IALA 3ISWA 5IGXH 1HXKA 1Q9KB 3G6AA 1IGTB 4WSGA 3ZZLA 4G8GE 5C8JB 2DWTA 3OR6B 4ZFGL 1MWAH 1N5AB 4JPQA 3CFBA 4BH8B 3HN5A 2X28A 4ENZA 3OX8A 5EPMB 4JKPH 2K78A 3GI8L 4ESKA 3LOWA 5IMMB 5F7HA 3L5XH 1IQDB 2ZCKL 4XZ4A 1C08B 3K5SA 2XPGA 5C70A 4I48B 5I30L 1KPVB 2OYLA 3PV6B 1PQZB 1TKWB 5LN8A 1CBVL 4MBOA 5I1LB 1ZHBB 2E7LA 1OO2A 4IKKA 4LLMB 4E36A 3QJTB 4J3SA 4LNRB 3UG4A 3HR5B 3EBHA 1EV2E 3HE6C 3BAEL 3B9EA 3WY3A 1KPUB 1U95A 2VLKB 2X87A 1AVAA 1PY4A 1YJDC 1IT9L 1IFHL 4JHVA 1AQKH 2ZICA 3GBDA 4Y8AA 2Y23A 4HWBA 4ONGL 4OZHA 4JDZA 4L8BB 4JRXD 1N4XL 1ZIAA 3BEVA 3D2UD 4WTQA 5FX3A 3F12B 3KPLA 4MZ3A 1MVYA 2WUCH 4Z7NE 1MJ7H 3ME0A 1QPKA 4AVIA 1F2XK 2R1WA 2NNFA 4G9FA 3L08A 4GB9A 1NOFA 1DBKH 2BHZA 2X4RB 4FZ8L 3RTQC 2GSIB 3D9AH 3UO1H 3ESVF 1EVUA 4QXWA 5DCCA 4AH2B 4GG8A 1MH5A 3NSCA 3KCPB 2XG4B 1R0AH 4PSPA 1M2VB 3MXWH 1A4JA 4UIMA 4XXWC 4U33A 3OMAB 3DUSA 4F91B 1KYUA 2VC2B 5ANMA 3WKPA 4JPIA 4L2YA 1X9UA 5DRXB 4NCDA 1MHEA 4HWUA 2WBJA 5JHLH 3ZDWA 5IB1A 1HH6B 4P59L 2OL3L 1T22A 4OFQA 4FQLH 2E47A 3GGWA 3T3ME 8PAZA 1XCTA 3UP6A 4Y7OC 3HHRB 4IOFD 3FT1A 4MD5A 2ARJB 1VFAA 2WZAA 4J2XA 2KMWA 5AVSB 2KS0A 3U30B 4X0NA 3ZJAA 3BVDB 2D3NA 3KWUA 2XN9D 5EULV 4JFSA 5AWNL 5IQ9B 1UB5B 5T3XL 3CV5A 5DURB 2EDFA 4HULB 1HZLA 1DJHA 4U6YB 2AC0A 3EOYG 3OLEA 2GSMB 3F5WA 4XPHH 5HVHC 1C8PA 1T20B 1M42A 2IDCA 5GIRB 4WUUE 3F62A 4J3OF 4XAKD 3Q8FA 4XNQA 2I7OA 2FBJL 1K72A 2UUDH 5I9QB 2CUAA 3SJVA 1SXAA 4G7VH 2BX5A 3HE7A 4G6AD 4G1EA 1L0PA 4LT7A 4XP1H 5IJVB 3O3AB 4YNYA 4JGJA 3ISRA 1QVOB 2EH7L 3I2CH 4GKSB 3OHMB 1MIEL 3FO1B 1OF2A 5F7EL 5C0DA 4JRXA 5AWNH 3RPKA 5F6IB 2F19L 2XJKA 3SYPA 2JKTM 1SMAA 5JIDA 1L3WA 3H2WA 3ZRFC 5FYKU 3WUZA 5J1TC 3GNML 4Z78A 1NPJA 4X0KA 4Q74A 1TETH 6CGTA 1BPLB 2CGRH 1QSEB 3ARFA 4UNUA 4HGWB 5DA4A 2B1OA 3NJMA 4ZUVB 4FFYA 2EINB 2KPNA 4EEEA 5C2BL 4Y5YA 1VFBA 2KZWA 2WQXA 2C8NA 4PLJC 1OK8A 3E7JA 1XTMA 2JQMA 3MV01 3L3JB 2G4EA 3AB0C 3S96B 3US9A 2JKLA 2Z3FA 3HNTH 1U8LB 5FYKH 4Z7WE 3CLFH 4PRIB 3MRJA 2NNAB 4N2KA 4UT9L 1IEAA 2E6QA 3NFSH 3ZQWA 4TNVK 1I1AB 4ZZFA 1C5BH 4H13C 3ZKQD 3THML 2D31A 1MCJA 4NQDB 5ESQA 4G43B 3QDHA 4GFTB 4DZ8A 3OX8B 5EPMA 3VRIB 3V4UL 5CEZL 3AJ7A 4XCCL 3ILQC 3HS8A 4WUKH 2X4QB 2RJMA 4G6AC 5DO8A 4GIPD 4MJ4A 3G5ZB 3RVWC 2WBJC 3QG7L 2V9QA 4AUYA 4WNQA 2QV2A 3U1PA 1KTLB 4AQ1C 5IROC 3N43F 3MZGB 1YECH 3VFWB 2OMTB 2W92A 5C0RH 3BT2H 2OLDA 1UC6A 3NEOA 1TDQA 3P2DA 4N2LA 2Y1VA 2Y72A 4Y19E 4HWZA 1CLOL 5M94B 4AQZA 3ZKXC 4Z95L 1MCIA 4P04A 3P4MA 3CN3A 3QPQD 2R2BA 4ZMXA 3TT3L 5SV4A 4OBSA 4MDRA 1T7ZA 2XNAB 3VYOA 2PWFA 4EN3A 4YAQA 5EUOE 3TA4D 3EDEA 4YS4A 2F0CA 1I7ZB 3OJ2C 4PY8J 2NYKA 4IRJC 3H85A 3K4DA 5TE7H 5IJKA 1PEWA 5T1KB 3F12A 3OXSA 2M1KA 1PY9A 1RUQH 1MFAL 2NW2A 1T5KA 4AIXA 2FGZA 1LK2B 4JFXB 4HJSA 4P46A 5FUOL 2WZ5A 3WELA 5B8CB 3D87B 3WFHA 1QSFE 5FGBC 2J56A 2E9IA 5DA0B 3RKDC 4BJLA 1HE8A 5MENE 1UUSA 1KB9J 4M4RB 5HYQA 3WS3B 2B4CC 4H8WC 2XWCA 5I23A 4IS6A 1OWRM 2IMNA 3QIUC 3WIHL 4NZFA 4AEIH 3HMWL 3O4LE 1JZ5A 2VLRD 3L3GB 1CF8L 1BFVH 4PGBA 2VJ0A 2YA0A 2AANA 3PV6A 2M26A 1M05B 2H41A 4M02A 4G6FD 5TQ2L 3MFGB 4WV1A 2IFFL 4IMKA 1R5WA 4YLQT 5CGBA 4OFYD 3KWVA 2YFNA 1F3RB 2JQAA 3MXVH 5D7IF 3LQMA 1NDMA 3TBBA 2H1XA 3GBMH 1NLBL 2Z8VC 4NM4H 3IJYA 3SE4A 3MLPA 1F6AB 1T6BX 4DQOH 4R8WL 1SN5A 1AQDA 3TN0B 3NJIA 3GTNA 5IVZB 3RZWA 2ISDA 1NBQA 1QLRB 5B1CA 4BQCA 3KBEA 5DD3H 3GJFB 1A7BA 1FH5H 1EDHA 4WK2B 1T5WB 3C5ZA 3IFNH 5DMGC 3QWOB 4X7CC 2Q8AL 2CCLA 3F58L 3E1F1 1PZ3A 4CDHA 1OIOA 1UT9A 5F7LB 4FQXC 5DFWH 3CFKA 5GJSH 1F11B 2A38A 4AQ1A 4LLUB 3BXNB 4ORGB 3MCKB 3K2UH 1KBGH 5AOMA 4DEWA 2ZJSL 4KFMA 1UA7A 4ZODA 3RZCC 5DMKA 2Q3ZA 1YN6A 4XMPL 5F88B 2WB7A 1WWAX 2XI9A 2O5NA 4FXGB 4PMEA 2M2DA 2VMDA 5HYSB 3SCMB 3TBCA 1JYVA 1XH3B 3VFTA 4MJIE 2EE9A 4QMEA 1ID2A 2JTYA 3VXRE 1FE8H 1NCIA 3ZL2A 1CK0L 4GXUM 1JFQH 4G6FB 2FWSA 5AOIA 3SBPA 3U6RB 1XIWC 2QZ5A 1SPDA 3IDJB 2AABL 5C6PB 4PJ7E 4NNXA 3BP5A 3VFNA 3UL4A 1C7SA 4TM9A 4J27A 2K4AA 4MX7A 5F7FA 1F6FB 1HCYA 4B3VA 4X6FA 2ZOLA 2O6DA 4X6DE 3B9KB 3LRSA 3VXSA 2VT0A 2O5XH 3WTWA 3U7YL 3W2DH 3SPJA 4CGUB 4F8NA 5KVEH 5DZOA 1WS8A 3S6CA 1C5BL 4HKJB 3WJLC 2PO6C 4AQAB 4Z3HA 3I74A 4PLKD 3QPQC 2F1BA 1N0LB 3QUMA 5EUKB 3H54A 3CZEA 5DLML 4Z3EA 3CCHB 4KRNA 4HPYL 2X1PA 2NNRA 4S1SH 3EHBC 5BJTA 4Z23A 2CCVA 5HYEA 3TO4B 4NX0A 3BSZL 3VI3E 4IBUA 1BQKA 2B9BA 3REVB 3ZRSA 5LJYH 5E2JA 5G2NA 4TYUA 1DN2A 4BQ8A 2JCCB 1ZGLA 1TZGH 1YPZF 4NPYA 1JN6B 3DBXB 1A66A 1D5MA 3LQAC 3N06B 3QUKB 4TSBH 1CFSB 1JZ8A 3U6RA 4FXGC 5F3BB 4IIQB 2CXGA 3NBNA 4Z7UE 1BXVA 1ZK5A 3KPRE 1YEJH 1ZT4A 2FHCA 3RY5A 1F58L 4BWTA 5J9PB 1N70A 2OYKA 2FLRT 3IVKB 1MLBA 1EJOH 4L9LB 1EUUA 1U8HA 3KPSD 4M6OH 4X6CB 4Q4EA 3VXPB 4MJ5A 2PR9A 2PW2B 3F00A 1A1NB 1HINH 2OCCB 3CVHL 4DO5A 1PS3A 3O6LH 1VHPA 2EH8L 4QXTA 4A7QA 2PPAA 1IL1A 2IAMB 3D09A 43C9B 4HS8H 1AKJA 2EVIA 3EZJB 1P1ZA 4R2GC 1E5ZA 4O00A 4O4YH 2VR4A 5B1AB 4EJ1C 5B1BB 4I1PA 2X7LA 3QYMA 4AXWB 3JV5A 2CM5A 2DL2A 3KPMA 4AZ8A 4R90H 5GGRA 1G0XA 2BZCA 3RGHA 3L4YA 4NNYA 5FAAA 1IJNA 2RMNA 2R2BB 1TMCB 3D2UA 3CFCH 2YARA 4PYGA 3WMSA 1FZJA 2LOEA 3BWUF 5L8JB 3SDAA 5KSUB 1KJ2H 3AS3A 2J3SA 1ZK9A 1U8PB 2CIIB 1G43A 2W0FB 5F7DB 3T8MA 3ZR6A 1QO3A 4PTUB 1GYCA 3P0GB 1FFTB 1L6ZA 1LYQA 4U0RC 3FCTB 1UQSB 4TLKA 4YX2L 2ZYHA 2WYHA 2Q9OA 3QIUB 3BIKA 3X11A 4M7JL 4JRYB 3ENEA 1FL5A 4LHJB 3OR7A 2A4CA 5CJQL 3DIVA 2BK8A 1A1OB 1KBPA 4YHLH 1UYWH 4QHPA 4I85A 4M7ZB 4XNUH 4XNYH 4ZZKA 4YAQB 3ZZSA 5IQOA 3ECQA 4RBPK 4X5RA 3F7QA 4HQQH 3MUJA 1G9MC 2UXFA 3IMSA 5D1ZB 5CLZA 1KZQA 1MDAA 5HYJE 2HA1A 4X2UA 1YMMD 4MZ2A 2Z65C 1TR7A 4OD1L 5A2JH 1FGVL 1ZWIA 4LPCA 5D7LA 4Z1PA 3U6XA 4F9LC 2XFXA 3AM8A 5KVGE 4YHML 1BEXA 3KYKL 3WFEH 2GB2A 3VMOA 4OZFG 2Y3AA 4LSQL 2NX5E 4MDIA 4HSQA 1DLFH 3HZVB 3ROOB 1CGUA 2YC1A 2C1PA 1UZ8B 2LV4A 1RZ7L 2Q0ZX 5GISL 1CFBA 3TEUA 3PUUA 4HHAA 4NUGL 2ARJA 2WIIB 4KTYA 4OQTL 4RMTA 3MTXA 5DRZB 2H32H 1Z66A 4G5AA 4NO5A 3ZTEA 4NJAH 3OC5A 4N0RA 3TO4D 3VMPA 4EBQH 2FNBA 3O2WH 4Y4HD 3WUWA 4MNQE 3M86A 1J86A 1DFBL 1SOKA 3BOVA 3ILPB 3DI2B 5JQ6L 4JUTA 2NUTB 2ZE0A 3VG9B 3WS6A 3HZKB 4OCSL 4JM0A 2CD0A 2H6UA 1MF2H 1NBZA 4D8OA 4EKJA 3EGXA 4QYOB 3IBEA 4QWWC 4YSPA 3A4DA 1W0VA 3IKCB 1EBPA 2DBLH 3CQQA 1U93A 1O9ZA 1CDIA 4HKJA 4MYPA 5A3ID 2IBGA 3ZQ9A 3IFOB 3NYKA 3ZSTA 4MJ6A 3E6HB 3HKFA 2WZPD 3O2DA 4JQVC 2IMMA 5DGRA 5ADPH 5I1EL 4EZMA 2R9HC 3BUYB 4F8OA 3G5WA 5BRQA 3JWNC 4GAJH 3ESOA 2EKSB 2OMYB 4UTAL 2YLHA 1RUAH 5E1AA 5KZCD 3IN0A 3JWDH 1XSOA 2P5EA 4OD3L 1DQMH 3FTGA 4ODSH 5IHBA 3AQYA 2XA8L 2R2HA 4NYLB 3VXUD 1BZEA 3BKCL 2EAEA 4UUJB 5FA3A 1V05A 1A3RH 1TTAA 4X9FA 3V5KA 5TE6L 4B9JA 4DP1X 4OD2B 4JO3L 5F6IC 3CWGA 2XOTA 2C4XA 4NUJA 5DGQA 1KLGA 5F3HA 5HHXL 1FGNH 5D1ZI 2OP4H 3CPLA 2Z7UA 4KRPC 5C0BE 2BDNH 3DJZA 2PWDA 4GPVA 4V2CB 2BW4A 3MMEA 3EJYD 1TTRA 1QHPA 2D7TL 1GIGL 1AIZA 2EYRA 4LBEA 5DLLA 1MXDA 1FAKT 3U0WH 4YBLB 2WN2A 3GMPB 1BVZA 4LHUA 1CYWA 4P2QD 3ZKMC 1RULL 4DVRH 1N0XL 5I1CL 1SDAB 4F7KA 4FG6D 4GI6A 1RK1B 4N90E 1X9RA 4PJAF 3EO1A 1OGAE 1D3CA 3B4NA 4FJ6A 1WAAE 2WJ7A 1RVFL 1KIQB 4LPYA 3MRBB 2BOBA 3JV6B 2BY2A 5PCYA 5MHSE 1DJGA 3KJ4C 4IRSB 1FO0B 2QQNH 1I9JH 4URTB 4ADJA 4K2UL 4PHXA 4JG1L 1HKFA 1YDPA 2YR3A 1ZVSA 3QHZL 3GO1H 4HH8A 1HHGB 3LZFH 1BWWA 4JDZB 4ZPVB 4W68A 3US0A 3K6OA 1YJDL 1OGTA 2OM5A 4MYWB 2AEOA 2JKJA 2Z9TA 2VSDA 2AERT 2XLLA 1ZHLB 2WPGA 4K3EH 4U1JA 2F2HA 4KQ4L 3UXFA 2V6HA 4UWQB 1G9NC 3O4OC 1KCSH 4ZW7A 4YFDB 3UBXA 4L3AA 2J8UA 2MNJB 4OLVL 5LNGA 1ES0A 1CO1A 4LSQH 4C83B 5CEZD 1KB9K 4P3WA 3K8LA 4CA4A 2BP0A 2F58H 3DSFH 3MU3A 1G9EA 3MLSL 2DQIH 2L4OA 5DVOA 3KXFD 2K0RA 3PWPB 4JFWA 3S34H 3BPLB 3MOAH 4G70B 3HA0A 3RTQA 4ANUA 4APQD 2EDHA 2WVTA 1NFDA 3BPNC 5AYUH 1JUFB 1ND0B 5IHUH 3W9EA 4PJHE 1NCJA 3P4OA 3BP4A 3FTWA 3IWVA 3LQZA 3LHPH 3AG4B 3R7RA 3F7RA 1COBA 1QYGH 3LEYH 2PCYA 5I1LA 4KOCA 1PIGA 1BQHA 1JPFB 1XF5B 3BZDA 3FFCA 4A6YB 2XA8H 4UUJA 2B7DT 2ZP0T 1Q38A 3MACH 1CLZH 1AKJD 4LLVB 4PWFA 1JG9A 3MGOA 1E43A 1GZHC 4NDMB 4GBXC 6PCYA 4LEXH 5DSCA 2P4AB 3PFUA 4OZHB 5D2LF 2AFNA 3Q0HA 5AYUL 1O5PA 3PHAA 2RTTA 4N6RA 4HUVA 2EYRB 1UT1A 5FDYA 3L5WB 2IH3B 3BHBB 1KCLA 3MHZA 4Y2OA 4K0OA 5FHAH 3QDAA 1GS8A 3BCFA 5EA0H 1UTDA 2P45B 1HS6A 2W0PA 4XTRD 1ES0B 1ZHBA 1MCDA 3V5KB 3WFDH 5BS0A 1WBYB 1YEIH 2HX7A 4NUPA 1P84J 2FZ3B 3ARWA 3GLAA 4Y5YC 3FU6A 3MRRB 4AVHA 1IC4H 3KBPA 2AQ3A 6FABL 4A04A 1E7VA 1VADA 1WHOA 3E1ZA 2JCCF 5KS9B 2FT8A 3VFGL 1XGYH 3MA9H 1A4AA 1CFVL 3PWVA 4Q6KA 3FRUA 3MJ9H 4GMTH 2VR3A 4LQFH 4XI5D 3UGEA 5EBMA 4AEEA 4Y4KC 1H8SA 3CZNA 5GGSA 2D2OA 3HIZA 5K5YA 5TDOA 4IGBA 1G9NL 4QHNB 5IOKA 1GIGH 4AMWA 2ZOOA 3ARBC 4N2HA 3OKOA 1OSPL 2JI3A 2ROYA 4P5MA 3A6BL 3L6FA 2L04A 2X9ZA 3FL7A 3IN2A 4F7EB 4FG6C 1NEZB 4OZFA 4K5MA 4FQXD 4K3JH 1VERA 1HILA 2NPLX 4PJ7F 2CJUH 3BT2L 3TA3C 3MNVA 3IAQA 1QUNA 1S7TA 2VIRB 4E41D 1MRFL 4JPVL 2N4IA 4D8PB 4DZBB 1X6LA 5IMLA 2HJFA 2J8UE 2LQRA 5DUBB 3IJSA 1B2WL 3D50A 1M53A 3MBEB 5CLWA 4FFWD 1EAPB 3BKYH 4M5TA 7FABH 1EHAA 2VMJA 4ZMWA 2QGBA 1AG6A 1CLCA 5E4EC 3AS1A 4IHOB 4LHUB 5E56A 4MQXC 2KYIA 1YY9D 1AI1H 1A7QH 4PW4A 1G7QA 3LRKA 1ZMYA 5JHLA 2R2HB 3NCEB 4HP5A 4NYLA 5IJKC 5MP6H 3FSWA 4M7ZC 3SQRA 3QO0A 2P5EB 3E8VA 1SXBA 1GAFL 3S0PA 3K72A 3QJRB 2J8HA 1X9LA 3PL6D 1B2WH 4AMKH 2V5YA 3JSSA 4CADA 3FHEA 1C7TA 3ZDXF 3N6YA 5LBSA 1NEUA 2FX8L 3D6GA 4NO5B 2P52A 4DGYH 2QLYA 2YBGA 5KANI 2CA3A 4AL8C 4N2GA 4RQQB 3UYPB 3DK2A 4ES8A 5HYJD 3HI1A 2EIMB 3DVFA 1T7WA 5D7IE 4I0PB 1ZE3H 3B2UD 5HHOB 4MNQD 1J1OH 3V0GA 3LNHA 3NTCH 2B59A 2LFGA 4L1BA 1LHZA 5DC2A 1DFXA 1DVUA 3M6DA 4XN9A 35C8H 3FCTA 4KV5E 4O58H 3MRFA 3ILPA 2EDMA 4P23B 4XMPH 2ZOWA 2IAMD 5JQ6H 1JSYA 4NQEE 3TT1H 3CC5B 1E3FA 4FFWC 4HKBA 4LRNH 3ZE0F 4MWFB 3IMVA 4R2GB 1KIQA 3C5SB 5AVUB 1E6OL 1VENA 4GQ9L 2QADC 1QACA 2MCPL 3X3GL 5F6HJ 3TU6A 1KJMA 2WIIA 3Q43A 1UM5L 2QHRH 2YWZA 4AZ8B 1NCTA 1T2JA 1XZ0B 2EDWA 5J4MA 2BNQD 4WCYL 4NQXA 4WI0B 3UZQA 5GRJL 3CHPA 3JV4A 3KLAA 3P0YL 3F8UB 1HH9A 4P05A 4O2CA 5BV7H 4ZTOL 3O8XC 4H44C 1B88A 2EH8H 3ARGC 1J05B 2W0FA 4LGRB 1W15A 1NCDH 2YC1B 2NY7L 1U42A 5IUSA 4Q14A 2DQCL 2UUDK 3O3EA 5JIKA 5B3SB 2PCFA 5D7KE 1KFGA 2YEVB 4JHUA 1QFWL 2VC2L 5GS0D 2H2PD 3ULUE 2HMIC 3ZHLA 3Q8CA 2WXNA 1ONQB 3CBKB 4DN4L 3JWOH 1VFMA 1MWAB 3BWAA 3DTXA 3QIBC 2EDBA 3KW7A 1TFHA 2EKJA 3SE6A 1Z5LA 3ARBD 4E2OA 5HJ3A 4OI8A 1NGWA 3APNA 4WFED 3WNJA 3H2PA 1IQDA 3ZDYB 4X5XB 1UATA 2WCGA 3K3QA 3ULUH 2HP4A 1QOKA 5G5DA 3TEYA 4X50A 2EDRA 4GKZB 4Y1SA 1Q9OA 2R1XB 5CWSB 4CW1A 2NCEA 4GQPH 3Q06A 4UQ3A 5IFAH 3PPEA 4Y1AA 4GW4A 1DCLA 4OCYH 4AGPA 3ZGIA 2PN5A 4AIZB 4OM1L 3M8OH 4MNHA 1KXVC 3X13A 3PL6A 3O4LB 2J1WA 5HXMA 5HHNA 1NC2B 2RALA 3GSWB 5FWQA 4JFVA 1EEYA 3L7FB 1CS6A 2H8PB 2JB5H 2JLPA 3O2VH 4Q6IB 3AC0A 4U6XA 5K1VA 3ZE2B 4Z7QE 1MUJB 3BP6A 1FI8C 5FS5A 3FONB 5BUAA 2VDML 2Q86B 3QNZB 4Q7DA 4FJZA 3VGEA 4B9ZA 5CD3A 5FKPB 3CMGA 2O61B 4M8UA 1W91A 4DQOL 2JE8A 4HCIA 4DZBA 4ANVA 4D8PA 4ETYA 2Y07L 1VZGA 2F7RA 4OSUH 3ARGB 4X6CA 5C0BB 3GBNH 2O5ZL 4UBDC 2F53E 4BK4A 2EC9T 2QVMA 1I4FB 3SODB 3EW3B 2DD8L 2Z31C 1UVQA 3VWJD 3OJDB 1BQLL 4FQXB 4K94L 3FT4A 4E9VA 1GOGA 2A9CA 3WO3B 2CHXA 1P53A 5SWQB 1KXVA 4HS3B 4DHLA 1LWJA 4OGAC 5DMKB 1TPXB 1NIEA 2XWZA 3NQIA 1T0NB 5KYYA 1UXWB 5IBTL 3BVWA 5TPWL 4F92B 1L9RA 5TDNB 5K9OA 2Q76B 3SY6A 3E6FA 5AOZA 1XF2A 4S11A 2UYLB 1L7TL 4JLRB 1KXTB 4ONHB 2WVVA 3VWKD 4CC0A 1FYTE 2Y24A 2QPUA 2AZUA 3N85H 4GAYA 4KKCC 3P3SA 5E9NA 1J8HE 2R8SH 1W72B 4IJ3C 3CZKA 3LH2H 4OR1A 2E4TA 2FHBA 1DJXA 4P2QB 3ZTJH 4PJCE 1Q94A 4NRZB 3U2JA 1YN6B 4LLQB 4X6FB 2ICCA 5HTSA 2HWZH 4UT6A 3TZVC 4E5XA 4JUSA 3S8GB 4P46B 1IAMA 2OMUB 3VGBA 3B9AA 5FECB 2NT1A 2BS8A 2ZKXA 4QT5A 2EC9U 5MEPA 3TNMA 5DJAA 5I15H 4XTRC 2IDQA 4F1SA 1UA6H 2F1EA 2X0UA 3F7KA 1JFQL 4OVVA 3BGFB 3FRUB 1BZ7A 1ZA6B 1FNSL 3L3GA 1P4IH 1DL7H 2R15A 1C5DA 2X6UA 5EG6C 3RWJA 5GS0H 5DRNB 4N24A 2K45A 3MRPB 4BHUA 2GIMA 4FTVE 3AY4C 1UXMA 5KVMC 3BAKA 4RVBA 3WD5L 3CSBA 4GNKB 4OZIF 4RGNE 1KY7A 5CS7A 5A2CA 4EF3A 1R3IH 4LAJH 1VPOL 4NGHL 1KGUA 4ZMTA 3PHQA 1AXTL 2OJZH 4FABH 1EAOA 3FTXA 3OTTA 1NMCB 2BSDA 2R4RL 4MQ7A 4NUGH 3SQBB 4LKCA 5B1JC 4F8PA 2WLZA 4R0LA 3C5ZB 2G2NA 3U2SA 1EO8L 2NUPB 3QYCA 2G9KA 4EIBA 4P2QA 2X0WA 3QEQE 1QSVA 3WG7B 2ENJA 1HXMA 4XCYA 4JY6B 5C0FB 1TT6A 1WZ1L 3LKOA 5I1GH 1I8LA 4MNQA 4PCKA 2ZJSH 2FIKA 3VVVA 1OEZW 4NZTH 1MFVA 3ETTA 1CC3A 5EIIG 5I66A 1I3UA 2A6IB 4FQPA 4ETQB 2MCMA 2K9FB 1UHVA 3PV7A 3MOAL 2A9DA 4O5LL 4AUJA 1E5BA 1FHGA 5C0IB 2AI0L 4POZD 5D1XE 4AYGA 4I3GA 3RVUD 2XNAA 3MR9A 5IY5B 1MZYA 4BGDA 4OZGE 4UTBL 4F58H 2QVTA 4P4KB 3AWFA 5K1JA 4I2XB 1K3ZA 4PVLA 2G5BB 4NCC2 2A99A 1XMWA 4WW2C 2A77L 4P0DA 5F9WC 3UG3A 4BK8A 3GSXA 5BW7C 1KBVA 1KJ2L 3SBWC 3NSYA 5F1NA 1NSNL 3ETSA 4KI5E 4MA3B 3EF7A 4K23L 2WXKA 4A55A 5LAXA 4NWUL 4MDJA 4D3CL 3WU1A 2GTZB 5JW4M 4EAEA 3DETD 3SEPA 3UTQB 3DTDA 1MCQA 2YQGA 5AB2A 4OFPA 1G7LA 1VEMA 4LQFL 1D2PA 3VFPB 5BZWB 4WK4B 4ZDHB 3K71A 3FQWA 2DM3A 2V9TA 3ZDYF 3OB0K 3HAEA 5K59F 3SD2A 3UIZA 3K74B 1LNUA 1CQKA 1SJVA 4PBWD 4QGTA 3D0AA 3IDYB 4U6HB 4URKA 5HHPB 1CDGA 1ORQA 4U6XB 3A4EA 2XN2A 4FLOA 4N2CA 3UZQB 3OD3A 3VXMD 2DMGA 1NCCL 5HYJB 1N6QH 2KC0A 3PWLA 1Z3GH 4WJ5A 2LVCA 3T4AB 1T0PB 3DYOA 4FHJA 4YZFF 3WIFB 5IQMA 2WLJA 1JVOA 4XGZB 2AGJL 3DECA 2Q7NA 2JB6A 3MLWH 1JYNA 5DFVD 1YEKH 4BFIB 1JGLL 3M88A 2WKOA 3FUIA 3QXAA 5EF0A 1NMAL 5T1MB 1ZAGA 1OAZL 3L4VA 3DXAD 1IBGL 2AZAA 2BIIA 4JDVA 3EH1A 4KX7A 3V4UH 2X1OA 1BREA 2DLTA 5JW4R 3NIFE 4Z7NF 5DK3A 1LJMA 3DROB 2R0KH 3HZMB 5EZJA 1RHFA 1J9CT 2HUEA 3RVVC 2O6EA 1ZLWH 4W9FC 2NY4C 2ZXCA 2KHAA 3KLQA 1FNLA 5IQNA 3T0EE 1CFQA 2WLYA 4GI9A 5I1AA 2APBA 1XZWA 3KVPA 3UO1L 3O6FD 4ADIA 3MJGX 2NXYD 3SIKA 4BZ2H 1Y0LA 4OIBA 3HB3B 5INDB 4ODXA 4XVTL 2ZXGA 3GMQB 4P5TB 4B60A 1I9IH 1U91B 3IETB 3KM2A 1R3LA 3T4YA 2EIZB 3BUYA 1F4XH 3SKUD 4MDIB 3C5XA 1N68A 5DRXA 5DJDB 5EO0B 3HG1E 3KL5A 4MJ6B 4N2EA 4PJEF 3ROLA 4YSSA 1ACXA 5D71L 3ZN6A 1JNHB 3AITA 5TE4L 5E23A 3CBRA 2ICES 3CHRA 4N1HB 4G5ZH 1DBMH 5EOQH 4PJHB 3S5LA 1QEWB 4U7SA 5KYUB 1GRWA 1K4CA 2MHAB 2P9RA 3V8OA 1LK3L 3D2TA 3R4RA 3NIDE 4MD0B 1NGQL 1NFDF 2YPLD 2W81C 3GMRA 2IJ0C 2VLME 2B1HL 3MNZA 2XIIA 3N1GC 2UVFA 3KPOB 3D30A 1TCRA 4E5XG 1CICA 4LBEB 4ODHH 2P8LA 2CDFB 3VFOA 5GIRA 1PDKA 2YN5A 1CFVH 5LGHH 4UV4H 1HEJC 3CPLB 2HPOA 4U6YA 4LF3A 4LPXA 3T0EA 1E8ZA 2GABA 1G6VK 1MIMH 3O6KH 1CDUA 3RE0A 2UXTA 4UIMB 3BW9B 5CU5A 1FZOB 1ORSB 2LE9A 4BZ2A 3AZUA 4P4KC 5IROD 1OD7A 4RDBA 4TNWF 4YLBA 3U83A 3MJ6A 3L3IA 3EH5B 4V1DE 5B38G 2ZWKA 1SHMA 4M03A 2ZXBA 1PZAA 4KZEL 4UILH 3R1GL 2DQ6A 4LBAA 5F7UA 3UAJA 2PW1A 3U46B 4NQVB 4N2NA 1N8ZA 1Y6MR 2FATH 3JTTA 5HPOA 1KN4H 2A1WL 2W9DH 3FQ1A 2Z64C 4YHIB 1YEKL 1HFUA 2VERA 4HLEA 2Y7OA 2FQGA 4HXAL 1DVZA 1CDBA 3HUJA 5C0IA 3W5NA 3MJWA 4Y88A 4DP7X 1WT5C 2V9UA 2AF2A 3CFBB 1CR9H 1KGIA 3A4AA 4NOFA 5GGTH 2YPVH 5JYMA 4PJAA 4QYAA 2K6ZA 2X6VA 1R9FA 3GUFA 4GSXA 2EE6A 1X5IA 3NH7H 3TBVA 1E4WH 2PPFA 2OFQA 3PAYA 4XGZA 3K80A 1ZVYA 1IGJB 3H1ZA 2GSIA 4KNSA 5KAQG 1HHIB 2VZUA 3EKCA 2QV4A 4XC3L 4CJ0A 1HZHL 3P73B 3AW5A 3IE4A 1DHKA 1NJ9A 4IW4C 2OV0A 4I4WA 1FFOB 1SXCA 2EIJB 4BDVB 3QHZH 4WGVB 3UOAB 4HG4J 4NBYB 4GO6B 2F53B 3QAQA 3ULUC 1JDAA 2XXFA 2PCPB 2PWGA 1J8KA 2VITA 2VMCA 3HRPA 3UTSA 4WEBH 1PJ9A 5I28A 4OJFH 4X9IA 4XODA 1S5HA 3FZUD 5HHPA 1THAA 3VFSB 4G42A 4NQDE 2IBBA 1Y07A 1DQDL 3U4AA 3BGFC 4OFDA 2HVKA 3VUAA 3RIAK 3RRQA 2NY3C 4JFYA 3AWEA 3II3A 3UAEA 3HBZA 3IETA 4O2EB 4LCWB 2ERJC 1K3IA 3FFDB 4HJ1A 5KVGL 4O02L 1VFAB 4C4BA 2ORBH 2B1HH 5I74C 2XICA 3RJQB 5TK2A 4P46C 2P7TA 3MODH 1IGIH 3TZVB 3IGKA 2FWLB 4GO9A 4I8DA 5ESAB 1BMWA 1RP8A 3S3BB 5DD1H 3V4PB 1U3YA 1IE5A 3HFMH 4MQ7B 3SQBA 1UXSB 3P30L 1BG1A 4YDKL 3VG0H 4IJ3B 5IBUG 1KIUB 3QBTB 5LQBL 3CUPB 4PBDA 1E27B 5EU5A 3U79A 4JFQB 1A21A 4O9HH 4UU9B 2J88L 1MFDL 1NLBH 1WBZB 4NM4L 4PJ8C 2HRHA 2XY2A 2CALA 2EDKA 2JB6B 4JQIA 2CR0A 4OI7A 4YUEL 4JG1H 4PJXF 1S9KC 2NX5D 4K3HA 4KMTH 3V4VL 5AQ0A 4W4NA 2DB8A 3ARSA 3DPBB 3S8WA 3BJ91 1GXEA 5I5IA 5D1XD 2IOIA 2Y7SA 1MWAL 1EXHA 3C09B 5C0EA 4N9OB 3UP1A 1A7NH 4S1RL 4Z7WF 3DX7B 5AB9A 5EN3A 2KL6A 3DJSA 2VRQA 2HUHA 4AJ0A 4CU7A 1DO6A 3LSOA 5E2WL 4IMLA 1ACCA 2XV3A 4YH6A 4EUPB 4FTVB 5CKGA 4M6NL 5GRJH 2W94A 4L9LC 4MZRA 3TASA 1J9TA 4TQHA 5F1IB 5E2UL 5DJYA 1ET7A 4JK0D 3EDDA 2L7JA 3FS9A 4IIQC 3MROB 5C09E 5C9KA 4YVNA 1JWSB 1SN2A 2ZXQA 3LNIA 4U3XA 3QIWD 4IKJA 4KVCH 3WTSA 2E86A 5TGBB 1O6VA 5ICUA 2GCYA 2B3IA 3Q01A 2Y69B 4HJGA 2C3XA 4L3ED 5DK0A 3MRNA 1WZKA 2FHFA 3PGCB 1LL1A 4KJQC 4XMLL 4B9IA 3UPRA 1JRHH 2OXHB 5JUEH 5DJAB 3VFMA 3SKJH 3T0ED 2GI0A 5DI8A 3FB7A 3LZPA 4AENB 3CFUA 3NN8A 3V5DB 1OGTB 1IAII 1SXZA 3LB6D 4PCYA 5D1QD 3VXUE 3PF2A 4KVPA 1A8ZA 2CR6A 3MLTB 5T5FL 4OLZH 1JJUA 5E2VL 3ZE1F 5KSAB 2IG2L 3GSVB 2DMCA 2IQ9L 5I66B 3QDME 1F5WA 5CSGA 3S2AA 4R96A 1OGAB 2CDGA 4DERA 4TUJA 5DS1A 5HI4D 3W9DA 1F8TL 1FE8L 3HC0A 5EZIL 2CBQA 2MNWA 4JFEE 1CIUA 1BZOA 4NZUL 1CD1B 2HLFC 5KW9L 1JD9A 4Z3TA 1HJBC 3WIAA 2VCOA 4CC1A 5C1MB 1OSZA 1RZ8A 3D69A 4GUQA 2A9ML 3HTLX 4PGEA 1OY3B 2ENQA 4UT9A 4K94H 1H3PL 1JS4A 2HKAA 3JXAA 3O9WA 5JHLL 4DF9A 4JMNA 1M56B 4QY8B 5C0NC 4K8RH 4LAQH 5JW3L 1JGDB 1P4LA 2ZP8A 3BQVA 3TZVD 5I6NA 3RKDD 3RY6C 4TNEA 5DS8B 3QJVB 3VQLA 5JXEC 1BM3L 3MRNB 4JRYD 1W8EA 3EYOA 4E9RA 4B95C 4Z7UA 3HKZA 4FFZA 1MFEH 3EGSB 1O7VA 4LLDA 1YPZA 1GPOH 5F93C 2PYFB 1SMOA 1XH3A 4X83A 1E40A 5ILTL 3VFTB 2Y1AA 4WWKB 4UB0H 1F4WL 4Z0XA 5CD5D 2XFXB 3EFOA 1QHQA 1TITA 2ZUSA 3PAUA 3GHBL 1S7RB 3LS5H 3QR2A 1FNAA 2E46A 2PTUA 1THCA 5CCJA 3U36A 5L4JA 5KG9A 1U9KA 4KOBA 4OGXH 4FZEL 1FDLH 4H2AA 4NBXB 1RUMH 1AZBA 5KVDL 2ZSWB 3QQ3A 1BVKA 2C9SA 2N7BA 4Y8DC 3TN0C 2W9EL 1T83A 2NXYB 3KW8A 1XD0A 4HH9B 5FM4A 3SKOB 4FCAA 1MN4A 2J5LB 5EBGA 3T77B 2EEBA 3OJMB 5HHMB 1LO4L 1ONQA 4ELMF 2DV6A 2WTOA 5T5NF 3GXFA 4JHAL 4LRIA 3DK0A 4NNPH 4OB5H 4I0PC 3QXUA 3U7WL 2BFGA 2GY7B 1IQWH 3UZEA 1HINL 1GC1H 3PXLA 3CXHJ 4LMQI 3D25A 2GY5A 3GBML 4JJ5A 3NFNA 5ISZE 2B77A 1CPUA 1KTLA 2BP5M 5F6HI 3VD0A 3QIWB 4XZUB 5CMAB 2Q7YB 5T33H 5D2LB 3P0VH 3LPWA 4W70A 4JFHE 4CW1B 2YQ2A 4F2ME 3DHPA 1IMHC 3V7AG 3O6FC 4MAYC 2DQCH 3S2CA 3U9WA 3RNKB 4WGWB 1EXUB 2HG5A 4PJBA 3DVGB 4JFOA 1J48A 4XN2A 2MIZA 3QDMA 3B6SB 3OGOE 3H7LA 4GT0A 4DK3A 1NBYA 1S6NA 5INCA 5C07B 3VJ6A 4NM8H 1K5NA 1ZWIB 1KGCE 1AD9B 2JK5A 3AU1B 4CBZA 5KW9H 4RMSA 4L3CB 1I8KB 1YEDA 1W6LA 2VZ3A 2Z35A 3CH1B 4GT7A 5DTFB 3VFUA 2X5PA 4WY7H 4TLSA 4C4KT 3ALXA 3KJ6L 3P9MB 4HIPA 2WW8A 1XCXA 4GP8B 1JPEA 5E5UB 1RJLA 2Y0SA 5AD0B 2VJXA 5MERB 3C9NA 1HCVA 2BHYA 2F5BH 1T5XB 2QZQA 5DT1L 5IQ9A 3RY6A 4ZX4A 4GQZA 3OZ9H 5E03A 5A6LA 4YDLB 4LNVA 4JM2F 4NT6B 4QRPB 1WCBA 4DKEL 3UEQA 4PGCA 3ZE0E 4G80A 2HJKB 3PWPD 3QHFL 3AM8C 2OMWB 4I4WB 3CAFA 3SKJL 1QLEH 3NUKA 4MCYA 2H8PA 3BZ4B 3LIZA 5D7IA 3VFRA 1TJHH 4MA1B 1W8NA 3DMMA 5F9JB 5B3JF 4KQ0A 3K2UL 3GSNB 3POCA 5DDHB 3I9GL 4OFYA 3BMVA 4L4VD 4ZFOB 5BJTB 4NI3A 1TZOA 4G2AA 2FB4L 2VQ1A 1NGYB 2Y6TE 3OMIB 1NCDL 4I77L 2OX5A 3U7AA 3EYOB 1BMZA 2PO6A 1JWMB 1BYOA 2I60H 3PQYA 1OZTG 4I1NB 1JZDC 5J57B 1A6WL 2D73A 3BMWA 1I1YB 3MRFB 9CGTA 2RQ8A 2NTSP 3T8XA 2ADJA 4QAWA 4NN5C 3TGXA 2EP6A 1JZ3A 3NA9H 2JJWA 4XWGL 4HKZB 3QFJA 1ADQL 1FCGA 3MUHL 1AGBB 4LRIC 3IJSB 5EOTB 3CMOH 5ID1A 2O93L 2JB5L 3CN2A 2NQCA 3V4VA 3J2PA 4AENA 4PGEB 1IE4A 2Q7AA 5IW6A 5ECGA 2H2SC 3V2AR 1NC4A 5CBEA 3LXUX 5GZOD 3NSFA 4LSUL 5I1KH 2OL3H 2OTUA 3N91A 3V0WH 5CP7B 4IBVA 3D05A 1TUPA 1AR1D 3N1FC 2DQTL 4N0UA 2HWZL 1DE4A 4GBXB 3U0PA 1NWPA 3T3MF 1CVSC 4R4FL 3EYSL 4BSJA 2XIDA 4L0YA 4KO7A 4NPYB 4DN3H 1I8LC 2P47B 4N0CC 2B14A 1YY8B 3FQXA 4R26H 3OJVC 1XH2A 4M62L 2FJGB 3DRTB 4MJHA 4PR5B 2E7LC 4NPJA 3TO2A 1JBJA 1HQRA 2RHEA 1IAKA 2ODHA 1PQZA 1TKWA 1VDGA 3JTSA 3N85L 1T0OA 4PGDB 4ZMZA 3I6KB 5EA0L 1FYHB 3BSZH 1C08A 3S3PA 5CF3A 2ESVE 5ITFB 4FEIA 5HHVH 2X2HA 2C3VA 3EUUA 3FCGA 4X4KA 4DJMA 1AIFA 1JTTA 3KJ6H 1Z9SA 1HZHH 4PP1D 5B21A 3D7PA 3BPLC 3H42L 3ME0B 5CILH 1AGFA 3GSRA 1WSST 4XVJH 1P2CB 2QMJA 2A5UA 4JFDD 5T1LB 3WCYA 4HJJH 2DQJH 4MS8C 4HCRA 3QFGA 2OZNA 3DSFL 2D03L 3BEVB 2FWOA 2IALB 2EQDA 4F7CB 1UB5A 3QZNA 4KNTA 4NUQA 4PRAB 4HCRL 2CO1A 4WI3A 5T3XH 2GG1A 4HPOL 5AVVB 2DD8H 4QCIA 5F9DC 2K7PA 2E7DA 3O81A 3FZUC 5T1KD 4AITA 4AW7A 4YFEA 4WDIB 3MRQB 2OS7A 4Y4FA 5A1AA 3FB7B 2XKNA 1CXEA 1E27A 4KQ3L 1YN7A 3JWNE 3VFMB 3K4AA 1QATA 3W11C 2DLGA 3QJOA 4LCWD 2WLIB 4LLMA 4DNLA 1CGWA 1JPFA 2R2CA 4A6YA 1BBDH 3M17A 4YSCA 1IBYA 2CKBH 3TF7C 3NCYS 2AK1L 4AC4A 3D85A 4PJGF 2W65B 3MRMA 3V8CA 5BVJA 3KJ4B 2F58L 8FABA 1A4CA 2YXVA 2CCWA 3UYRH 3MROA 1D5XA 1N64H 4I2XE 4QKXB 3MV9D 2D7OA 1KY6A 1UWGL 2MOVA 5JOFB 1LO2H 3V9EA 4OM0L 1MI5E 3O41B 3UBGA 3EFFB 3IXTB 1JCVA 1HHHB 4MXQC 4V11A 4YBHA 3SPGA 5DJ6A 3GHEL 4ONFH 4ZFZA 3UYOD 2XWTB 3S3DB 4L1HA 1V3MA 3RLSA 4C83A 4YSUA 2V3EA 1AGFB 1IBDA 1FNEB 2WQAA 3HC4L 4IRZA 4BRVA 3IGUA 1BF8A 3N0PB 1VEPA 3KPSA 3S48A 1QLRA 1OW0C 3MBXH 3EO1B 4EE2A 4EN3B 1IC4L 4N2MA 4G8IB 4ODBD 1WISA 3Q8BA 1OTSC 4HKXA 5IV2B 3CVHA 3HE6B 3Q2CA 1BXXA 5DHYB 3W9EB 4WU5B 3IFPA 3GMPA 1JPST 2ZWZA 4JFZH 1GKOA 5EWIL 2O6CA 1IGFL 1ZANH 4OFKA 3L48A 4R26L 2IDTA 3V6OC 4KKCD 4L29B 1OWWA 4WI2A 1NMBL 2VRAA 4UF7C 3WXWL 2CHNA 3UBXI 2OJ1A 1NPUA 4B7LA 2EE3A 4PJDA 4CSSA 2BZDA 4UTAH 2IPUG 4EI6A 1CXLA 4WNQB 1A6PA 1FZMA 5BO0D 3GSUA 4H8UA 1P7QB 1SMDA 5AW1B 3SPCA 2Y3NA 4N0UB 4JO4H 4WI4A 5FO8B 2XWBA 1WAPA 4DP4X 2ZX7A 5FA3B 3ZO0A 4V1DB 1OCRB 4MS8D 4KUZH 3L3KA 5LWYL 4L23A 4WKXA 3LXAA 1CQYA 3BN9C 5HP5A 1IAOA 1GW0A 2H32B 3EOAB 3WJMA 1XF3B 3LKRB 4MSWB 1ZS8B 2RCSL 3QNFA 4DKFH 3BSGA 4ZX3A 5C0AD 4XNXL 3L2NA 5I1IL 2ZP9A 4JL2A 4PV1C 1AKPA 1KB5A 1KN2H 2YKLL 4RFNC 3L4UA 4LB8A 4BFJA 3N0AA 3L3JA 1FO0L 1UB6A 4LQ1A 4PJIA 4L5FL 5AAWC 3K2KA 5T1KA 2GFBB 5F1OB 4XMWA 2HN7B 3HC2A 3DVNB 1DUZB 4PRHA 4UIKH 4F3FB 5ISZD 2AQRA 4NC1C 4X6CF 1S7XB 3HZKA 3BI9X 1FLTX 3FTGB 4D9RE 3B9KD 2P8MA 1FO0A 1A0QH 1YLBB 3CH8A 1RU9L 1A4KB 2PUQT 3HN8A 2A9NL 3IMRA 2VAJA 4KAQH 1WICA 3H3PL 1CD8A 1HQRB 1IAKB 3JTSB 4LCCC 4EZKA 3TA3A 3BIAX 2VUKA 1JF5A 3FQXB 2IDFA 2BO0A 3D08A 2PABA 1XGPB 5E95B 3FQTA 4R7DA 1YPZE 1TLMA 1HHHA 1I7TB 3WNKA 3DLQR 4HV8A 1M9WA 3PGFL 3G5ZA 3QAZC 3V5HA 1E8XA 3UJTH 2BVUA 2ZKHH 2C4FU 2VDRB 2H9GB 2UZXA 1Q90A 4HJ0C 1EK3A 1A9EA 4R3SA 3B3IA 1KJ2B 1UJTA 1BLIA 1RJLB 5AD0A 2CKNA 3L1GA 4D3CH 4X5QA 12E8L 1I3RA 1INDL 1EERB 3DSNB 1A9BB 4P49A 2WXOA 3QCUH 3IDIB 1T03L 1I1AA 2IBZY 1DCEA 3MXWL 4FI6A 3VD3A 3EDFA 2EUXA 5L6YL 1DJIA 5INDA 3TEZA 2NY1C 1CDHA 1N64L 3C5JA 3MQIA 4B97A 1II4E 2BJMH 3S35H 1ZPLA 2NNXA 2QR0A 3GS0A 4NHCL 4XP5L 5I16A 1CI5A 1TU2A 1TJGL 4WDIA 3DJRA 4L4VE 1FZOA 4X6DF 3LDBB 2YWYA 3GRWA 4KO5A 4OIAA 3TTSA 3T2OA 2PYED 2F61A 4ODTL 1O6SB 2HFFA 4ODUB 4HIXH 4FXKA 1X7SA 3NAAL 4W6WB 1OP3K 1JVKA 1K5WA 4QRRE 3R0NA 2QQNL 4NO2A 3ULUD 2XV2A 1TCRB 5FF6A 2P46B 3LPPA 3QXAB 3GMQA 4P5TA 3NZSA 1ECYA 3TCTA 3NK4A 2XTJD 3RGBA 3MLZL 4XVSH 5IJCC 2EXSA 2EDJA 2VR7A 1ETZB 3G6JB 5D71H 4PYHA 2BNUB 3RWHA 4C56D 3UGXA 4KU1A 5BZDB 5I0WA 1K4CB 3SE4C 4APQA 1I8MB 1DVXA 5BS0E 1BD2E 1PZCA 1F00I 2JV6A 1JTOA 2WQRA 2K4WA 4CVXA 5AAWA 5L2KE 3NK3A 2VXSH 2KLSA 2APWA 4WNSA 4G8GA 2O26U 4PRID 3HZMA 4LOFA 5EZJB 2UY7A 2YEZA 1DLHA 5J6HB 2WYIA 4MMZA 2FSDA 3RUGA 4GBXA 4HCFA 2EO7A 4XX5A 1QBLL 4QRQB 5EOCJ 1KV3A 1ZKAA 4YN3A 5GSVA 3DKHA 5TE6H 4JGNA 1E9QA 5BUPA 2XG5B 1FNHA 3RA7L 1UD8A 2E76C 2G60H 4MJ5B 4MMYB 4TVPD 2WAQA 1P5UA 4OLEA 3P9WB 4I3SH 5IHZA 3MUGB 1FZKB 1UKSA 2DJMA 3T6ZA 2HG5B 6TAAA 2QQKH 3AY2A 1OB0A 2C9RA 4XP4L 1K8IA 2AXJA 1WS7A 2H0EA 3HVNA 3KLLA 2RH0A 5J1SC 3PU7A 4A6YL 4F93B 1AKJB 1KXQA 2DQGH 2J21A 3RWGB 3MV7A 1J1PL 3CX5K 3IDUA 2P5WA 3MACL 2BINA 5CLTA 4IGBD 4JM2C 4UQBA 1SRDA 2PO6B 3QIBA 2W60A 2J2ZA 2F53D 3BRGC 4BFIA 2BSRB 2WTRB 1IM9A 4Y4KA 3QCUL 5C8JA 1HEZB 4M1DH 1T66C 2WXLA 4FHBD 5SWZB 4ZBJA 1A3LL 3QA3B 3DX3A 1N3NB 4AT6B 4C4UA 5JYLA 5CJ8A 1NGPL 1J5OL 5A43C 5DD0H 1RL1A 2L7EA 4PCTA 1L0YA 2ZKYA 4EIGB 2EDLA 5KOMC 1KCRH 1R1CA 5HYIA 4NQUA 4J3OG 5AW2B 5MI0C 3QWRD 4UT7L 3MJ8A 4HAGA 3L2LA 4ZFFB 3KXFA 3LS4H 5GQBA 1SVBA 1U6AH 1X7TA 1XGRA 5EU4A 4QXTB 4ZPTA 1EX0A 2TSAA 4YHPB 1AD0A 4IHBA 4NKDB 2AQ2A 1P7QA 3FF8A 1TYEB 4LSTH 3MTRA 1GL4B 1S7VA 1JF1A 4K9EH 4P2RD 3OKNB 5FFGA 1JK8A 3O2DH 3NA4A 4B5EA 3SCMD 3ARDB 5J9PA 3RZCB 1WWBX 4JZOA 1N6VA 4ABUA 4POUB 5EUKA 4H4NA 5EIVA 3UIYA 2BY3A 1NUNB 1VFUA 3CFCL 5IVXB 1A6ZA 2DS4A 3RI5F 3BLKA 2Z8SA 5I0ZA 1EANA 2CM6A 5C08E 4F15B 5HGDA 3AABA 2R1YA 5I76A 3VYNA 3ES6B 1OARH 5D7JA 5DYOA 5KUMA 4I9WD 3BCDA 4H0LC 1NCHA 4N28A 4PI2A 4IIQA 1OPGH 2G0KA