3IU3A

Crystal structure of the fab fragment of therapeutic antibody basiliximab in complex with il-2ra (cd25) ectodomain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWIKQRPGQGLEWIGAIYPGNSDTSYNQKFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of Fab fragment of Basiliximab
publication title Structural basis for the blockage of IL-2 signaling by therapeutic antibody basiliximab
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 215
sequence length 215
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2009-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iu3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iu3A02
5EU4A 1MRCL 2ICWA 1R5IA 3RY6A 4APQD 2BNRE 1CE1L 5D7IA 2IMNA 1NDMA 5ID0B 1MEXH 1OD9A 1B4JL 4V1DB 2AXFA 3FMGH 4QXTA 4RGMB 1MLBB 1TJIH 1JGVL 5CD5C 1WBZA 4WWKA 3SDYH 3OKDB 5JPMA 4KXZH 4F9PA 4L3EB 3H9ZA 5GGRB 2G9HA 4EUPG 4M9PA 2CGRH 5HDOA 1RVFL 1JF6A 1MUJB 1DP0A 4LF3A 4PJXE 2EYSA 2Z91B 4L4TD 4ZUTB 3MNVA 4GRMA 3EYVA 4ORGB 4LSQH 1INDH 1Q0XL 2BRRL 3PABB 4LLQB 3ARBB 2Y06H 1QP1A 3WHXB 3E8UH 4Y16D 3UTSD 3S36L 5F1SA 3BZEA 4JFHE 5IFHH 3O11A 3CAFA 4HF5H 5F70A 4U7SA 4V2CB 1OAXH 2C3VA 3QXTA 3U36B 4L8CA 3N85H 1D5ZB 4L3CA 5C0FB 1IKNA 5GGVY 5MEQA 4J8RA 4K3EL 4YDKH 3SKOB 3VXMD 2ZNWA 1JWUB 4Q9RH 1P7QA 5DZOA 3H6JA 3RHWK 1MAMH 4OLVL 4N0UA 3LQAL 2VXQL 3TN0D 5I76B 1BX2A 1UWGH 4D0DB 5C1MB 3HUJF 4QT5A 5FM5O 2FHCA 1V3JA 1XF2B 4KHXL 4OFIA 3CMOH 4S1DC 1ZSDB 2XA3A 3K0WA 4LCYA 4LKXA 1AGDB 4JKPL 4QGTA 5DZNA 1A7QL 3L3OA 4IDJL 4MJIE 1RK1B 4HK0A 2CD0A 2JJSC 1VPOH 5J9PA 2V7NA 4B7IA 1YPZA 3U46A 2FHBA 1NCDH 4PV9A 1DL7H 3BHBA 2ITDA 3LMJH 1CYGA 1ES0A 3RGVD 3NFNB 2F54A 3X11B 4M1CD 1M7DB 1BQHB 1V7NH 3BKCL 1CD9B 2W0FB 5DJ0A 1DBKH 4KJQD 4WIQA 1R5VA 1X5ZA 3NN8A 1DCLA 1RIHH 3STZA 3T0AA 3TVMB 4IRSB 3WEXA 3V6FB 1X6NA 4LDLB 2CUHA 1EEYB 2OZ4A 4O02L 1WAAF 4D9QD 1G9EA 2IQ9L 2EIZA 1BWMA 3MLRL 4JM2A 1INEH 1A6WL 1TFHA 4ETQA 2DOCA 1PG7L 4YIQB 3FHAA 4ONFH 2A1WL 4NPYB 5BRZE 4NZRL 4I0KA 1NGZA 4G80B 3MJ7B 3CLFH 4RWYH 3ZYZA 3BQUB 1KTKE 4HBCL 3HZYB 2EDLA 1J0JA 1KPUA 1L6ZA 1NSNL 2DDQH 1U8OA 2UYLB 4LRNL 3L7FA 3I9GL 4RAUA 1JUFB 2QQLL 3JBG7 5E6ZA 4PY8J 3L3JB 3V6BR 2HTLD 3ZE2E 1QO3A 5F9WB 4XP5L 3O4OB 1JBJA 5DRWB 3T0VA 4JHAL 2ZKHL 1HHKA 4HD9A 2QKIA 1OQXA 1DVFD 4LK4A 1AJ7L 2R0ZH 3C2SA 3S5LB 4PJCB 1I1AA 5DD0L 4U1GB 1IGFH 4Q2ZA 5D9SA 3G9VA 5ESAA 1SVCP 2ADIA 1ORQA 2IANA 2IAMC 4IOSD 5TDNB 3OKEB 4WEUD 1HQ4A 1UZ8B 1ZHKB 1VFAA 4ALAH 4PJFB 4E41A 2AK4D 3VGAB 5GRUL 5IK3A 5D2LB 4XNQA 1DN0B 2DQHL 1CK0H 1RJCA 1FGVH 1YECL 4J6RL 5IB4B 2OL3A 4S1RL 1XGTB 5J8OA 3AS2A 4FQ2L 4DK3A 2UVEA 4DK6A 4RZCB 3ULSB 3NABL 4JM4H 4P3DB 4YDVB 2OSLB 4GXUM 3ZLQC 2B2XH 2XPGA 2AJYH 5H8DA 2BVQA 3D39D 3L3HB 4NDMA 1FFRA 3NA9L 3ALXA 2LU4A 4NQDE 4U1NB 1AI1H 1RSFA 3HZKA 5D7IF 2H32H 3D2UD 5GS0L 2YKLL 4J4PD 5FO9A 1KG0A 2D31A 3MLTA 2X70A 4N8VB 1JPTH 2MTPA 3UTQA 2GAZB 4IRZH 5MI0C 1J8KA 1IL1B 4C58B 3P9MB 1KBGL 1IC1A 2O61A 1CU4H 1T20A 2VLKD 5IHZB 4M7ZB 1U3HC 3NCMA 4NNXA 1FYTE 3ZL4H 3S3PA 4WFHD 3B9KD 3ULUE 5KVGL 2WQRA 4LLUA 5MENB 3DSFH 4KGJA 4K07A 1T3FB 3NAAH 3HI6H 5HHPA 2MQ3A 3SCMC 4K9EL 4XP4H 2I9TA 2DJ4A 1WEJL 3BVNB 3LKPA 3ARDB 4CAGA 3WDJA 1ZVYA 4ZXBA 3QDHA 1D9KA 3GRWA 1SBBA 4G7VH 3QEQD 2YS4A 1QFWL 3GGWB 1YJDC 4OM0L 3PV6B 4MB5A 3S35H 4GO6B 5L8JB 1JNNL 4EUPB 1FYHB 1QZ1A 1SEQL 4PG9B 1UACH 2AV1B 4OCYH 4G6KL 2AJVH 5EOCL 3VMOA 4E0RB 2OMNA 3HR5B 4OZHB 4JHZA 3HCVB 4ELKA 3AY4A 1FSKC 3TO4B 1FFPB 3NA4A 3QWOA 5DUBA 5FECA 4TTGA 4OZGE 3HFMH 1MHHB 1NMBH 4NWUH 3U0WL 1HXMB 4RMVA 1DEEA 1KJ3H 4PLJD 4QRRE 5JIIA 2WBJA 1GSMA 3QWRD 5J1TC 5JOFA 3W0WE 3EBAA 3TM6A 5TJWK 2ENSA 2H1PL 1N6QH 4Z7VA 4YDIL 2V2WA 3MLSH 4LLYB 5J06A 1SYVA 3IDIB 4PY7A 1IC5H 5AG9A 1MQKH 3RVTD 2A9NL 5ITBH 5I1LB 4O5LL 3SGJA 1PKQA 4AM0A 1AO7E 4PJBA 2GJ6E 3TO2B 1YYMH 2OK0L 1B0RB 5D2NB 1NGQH 5A16A 4ZS7H 4NKIL 5SWSE 3MYJB 5BV7L 5MP6H 3PHQA 1M71B 2DQCH 2UUDH 4X80H 1JNHA 2CPCA 1OPGH 2BX5A 3HHRB 4WHCA 3IJSA 3Q1SH 4ZFGL 1SJHB 4WWKD 1DQQB 3NZ8A 4RAHA 4RMSA 4YGVA 4KDTC 1HH9B 3V7AE 5C9JA 2IH1A 1MFBL 2P42B 4O2FB 4ODHL 1QR1A 4UQ3B 4JM2F 1Y6NR 3MLUH 3DYOA 4Y2DA 5D7KD 3CFKB 2FX9L 1UCTA 3V0AC 4Y5VA 1R6VA 2XN9A 4F2MA 1QSEA 1CLYL 1AGFA 2W9EL 3O45B 2H3NA 1R0AH 5FUCC 1MRFH 2VQUA 1K6QL 5C0GB 2BVYA 2Z92A 4D0BB 5IHUH 1K8DB 1FIGL 4KVCL 1YY8A 3RVVC 3BWUC 4QHLA 4OLUH 4H0IA 3SKJL 4LVNB 5FHAL 3FO0H 3FFCB 2JB5L 1EX0A 3IDUA 4HIEB 3VGFA 2D0GA 1H5BC 1T21B 5L7XL 3SE8L 4F37K 4YHLH 5E4EB 2VH5H 5KSAA 1CXKA 2GJZB 4UB0H 1T2QL 4U6XB 5L2KA 1WJ3A 1MVFA 4XP9L 5DWUH 4XCCL 3HZMA 5E6YA 3CXHJ 4GKOA 3OWEA 4BQBA 1MLCB 3I3DA 3QO1A 4F33A 4NC0B 3DVGB 1CVRA 4OM1L 2VSDA 3UJTH 2R8SH 3ZE1F 3UC0L 1XGPB 1WK0A 4Y19E 3IXTA 1IKFH 2JLLA 2Q76B 4N0FB 1ZVHA 4MCYB 4K23H 3ZTNH 5CEZD 4ZFFA 1EUTA 1Z9OA 3EJYD 4UOW0 5INDB 3QUZB 5HHQB 1BAFL 1MRDH 3AREC 3HRPA 4MYWB 3H42L 4JZJB 4F7CA 2NLJA 2F53D 2FLRT 4HDIB 3S97C 4KAQH 2VL5B 5KJRH 2F5BH 1NANI 5GXBB 4JM2D 2EH7H 2JCCF 1WIPA 4HV8B 4UT6H 4HX1A 3WO4B 5C0IB 1R3KA 5FOBB 2QADC 3EYUH 4H20L 4U31A 5D1QA 5EUKA 4PRHA 5TE7H 5C6TL 1EHLL 2NY6D 3O41B 5F7FA 3VWKB 3TPUB 4IMLA 4ZDHB 2D9QB 4FQQA 5E4IA 3EOTH 3C2AL 2E6JA 4Y4FB 1LO0H 1KUMA 2EYRA 2XY2A 3C6LA 4KV5E 2PYFA 3NFPA 5J57B 3CFBA 1GGYA 1YEEL 3ARGA 4QRUA 2V5YA 1HKLH 5DO2C 1KCRL 3DV6A 1BQLH 4YLQT 1FZJA 3KGRA 1KB9J 4FFYH 5C08A 2ED8A 4Z7UA 5CZVL 3SQOH 5JHDB 3C5JA 2PNDA 1C7SA 2OP4L 4GRWB 2Q8AH 2OS7A 1I1AD 2AJXL 4HIXL 4EDXA 2DL2A 4G7YL 4NO0A 1MHEB 2XZCH 3KG5A 3V52H 1NL0H 4ZUVB 1OTUC 2NXZB 2OTWB 2J5LB 3L5XH 2AXGA 4ZQKB 1T03H 1AHWB 3R06A 3TV3H 1YN6B 3I75A 2J2ZA 4WTXA 2EDNA 5I9QB 1IGJB 1LE5B 4JFFB 1I1RA 2OZ4L 4JFQA 4D3CH 3MCLH 5E2VH 4WW2C 3VXPA 4MDJA 5GGQL 5JQ6L 3VXRA 4HWBH 4Z7VF 5E6IA 2PXYD 3QNXB 1CLOL 3O2WL 5F96L 3ROLB 5IWLA 3CDGB 2V5SA 3CSYA 2APFA 3LV3A 2DS4A 2Y7QB 2Z4QA 5T1DL 5F6HI 3V4VL 3PQYE 4MA3B 3T4YA 2OR9L 3LKNB 2Z8RA 1HI6A 2ZUQC 3P9WB 5C0BB 1CFVL 4PJBF 1QLEH 4MXQD 4FQLL 1E28B 3SGEH 5BVPH 2CO6B 4I2XB 3GK8L 1Q9OB 4GLRH 3R8QA 2GSIA 2OMBA 3TCLB 5C0EA 4L4VB 3MXVL 1S7WB 4Q6YA 4WI2A 5TGBB 3BPCA 1RJZA 1SEBB 1T89C 3GMMA 1P2CA 2FO4A 4LVHC 1WF5A 4R6UA 5E2UH 5AD0A 4PJDA 1RUKL 2ICEA 5DJXA 4EKXA 2XACC 2GUOB 1ZLSH 4H5SA 1IC4L 4OLWL 3WNOA 5HD8C 5GGTH 2Q87A 3K4DA 4NKQB 4CADB 3GSVB 4I3SL 3RL2A 5E8NA 1I9IH 4YHOL 3H9SE 5TQ0L 2EKSB 5D7SH 3L95A 2J88H 2NZIA 2OL3L 3Q48A 2J8OA 2DLFH 1UWEH 1T1WA 4YDJB 4TNWF 1BD2E 2FNBA 2GJJA 1MCIA 3HMWH 1LDSA 1E6JH 4LNRA 4X99A 1BGXH 5I1IH 5HYJE 1G6RH 1A4KA 3WIFB 3BH8B 3BP5B 4U7MA 5FO7A 4APQB 1J8HD 1NC2A 2J7LA 2XICA 3ABZA 1DQLH 4NO3B 1QBML 2RHEA 5ICZA 2NY0B 4Z7NF 1MFAH 5J0BA 2WBJD 4K7PY 1YN7A 2VXSH 1KXTB 4R26H 1AE6L 4P3CL 4ZYKA 3MUHL 3EO1B 4LSUH 4P5TD 1QOKA 3CVHA 4HZLA 4NWTH 1XIWC 4CVXA 4NIKB 3H7LA 3BJLA 3LHPH 5T5NF 3QUXB 2FX8H 1U8JA 2BFVH 4N8CL 5JHLH 4ZAKA 2R29H 3V9FA 4M7JH 4U1MB 3U82B 2I07B 1VKXB 1NMAH 1QSFE 1DBAH 4O4YL 1MFCH 5SWZB 4H0HB 3GSXA 2GHWB 3QDJD 5DJDA 5EFIB 1EDQA 4PLKC 2OQJA 2BOCB 3VXSD 3TIDA 1G7JA 3GRWL 4JFED 3ZSSA 4G6JH 1UVQB 2D0FA 2W1NA 4KQ3H 4BSJA 1GL4B 3ULUC 2Z31C 4DAGH 1S3KH 3VXMB 1CQYA 2CK0H 2PYEE 5K9OB 1T6WA 4KMQA 4XMPH 1CT8B 1KENH 4XPFH 3GSNA 5GSVB 3HZVA 1A7OL 2XQYG 4NNYB 1CD1B 1D6EA 3BESR 2XFXA 5JR1L 3LAFA 3KXFB 3WFBL 1BQSA 3EJZD 1WCBA 3EFDL 5HHOA 4XNMA 4JO2L 1F58H 1UA6L 3OHXA 1TITA 3OXRB 2HYMA 3NIDE 5FK9B 4X7FC 4OB5L 1VA9A 2X4UA 2YUWA 1S7QB 4P23C 3DX8B 2BSTA 5AUMB 4Z7UF 4JAMB 3ULVH 3CDCA 5B3NA 2I5YL 1N5AA 4L1DA 1KEGH 1AIFA 5B8CC 1U6AH 5C0AE 2ERJC 5J56B 4G5ZL 3RWFB 4XBGB 2LABA 3WIIL 3RTQA 3HKFA 1SVZA 2H26B 5EOTB 3IETB 3DIFB 4GBXC 5IJVB 4GRLC 1A8JH 3BZFB 1LWRA 2MKLC 1ZT4B 5C09D 1X5LA 3KPRD 1KPVB 3OKKA 5LCVH 3FQTB 3LEVH 4LARL 3OKLA 4XVTL 3O6MH 4U4BA 4ZO7A 1LO3H 1B88A 1QHPA 4BH8A 3BPLB 4I18A 3L5JA 5EO9A 1TQCC 2HJLB 1JGLH 1GRWA 5KSBA 1KPRA 3F7RA 4DUWA 4YXHH 5IF0B 4GKNA 3U6RA 4AQ1B 3WFDL 1P4BL 5EORH 4UTBH 3MRGA 3KR3L 1YY9C 1TQBB 1ORSB 3UYRH 3QDME 5GRZA 5I1HH 2ZCLH 4JN2A 4XC1H 4X5XB 4B5EA 4U1LB 1MIEH 1DLHA 5DI8A 2BERA 2X89A 4JANB 4U1SB 3WE6A 3DETC 4HUVB 4OGAC 4L9LC 3S8WA 3O6KH 1OP5H 4GG8A 4LSVL 2J6EH 3HUJB 3QAZB 1I1YA 3H7BB 4PJDF 1EEUA 2IFFH 3FOLA 4AENA 2R4SH 2C1OB 5C0DA 1K4CB 3QA3A 3CNKA 2CQVA 1DQJB 8FABA 1Q1JL 1V8HA 2YMXH 4U33A 5E2JA 5IFJB 1AC0A 1I7UB 1DDHA 5JUEH 1DZBA 4I3RH 1OLLA 3TZVB 4P2QB 3K4AA 3QFDA 3VFMA 5CP3A 3VWJB 1GZPA 4ZPTB 3MV11 3OKMB 1S78C 1SJVA 1F3JB 3A0OA 4HT1L 1OLZA 1T6VN 2R4RH 3PWJA 2H45A 4WI8A 1NCWH 5DQJA 3SDDC 3SY0B 2YD7A 4POZC 3VI3F 4MQXD 4NO0D 4CJ0A 3LIZH 4ONOA 4LKCA 1KTDB 1A1NB 4XHJC 5GRVK 2IEPA 3BEWB 2CIKA 3MNWA 4TTDD 3PNWA 3B5HA 5H2BA 3T09A 2CMRL 2BY0A 5I19L 4HC1L 2PW2B 3VFOA 4JQIH 1NCTA 4P2RA 2LFGA 4Y4KB 2CRMA 4OI7A 5F7EL 3MBXL 4JGMA 5HGGS 4OZFH 4KDVA 4PTTA 1U58B 5DJYA 5HVHB 1WWBX 1X5YA 2VDKH 1BECA 1NBYB 4NFCA 2XG4A 1VFMA 2LU3A 4R96B 4MNQE 3HRZB 5BV7B 4G9FD 5E5RB 3BP4B 4Z77B 5DF0A 1BZ9B 4YXLL 4QXUH 4P4KA 4BELD 3QUKB 4HUWA 5J12C 5EZIL 5EZLA 5I15H 2AVGA 3DSNA 4P2OC 1OL0A 4M4RA 1FBIL 4MJ5B 4WFGE 2IPKB 5F88B 3L3GB 1NFKA 1IAIH 4PJHF 1CN4A 1XGUA 3TA3A 5I18H 1YMMB 3QIUA 1RZIA 4PGEB 3MZGB 3RL1B 4U0QB 4KJPC 1EJOH 3HC0A 2VZSA 4MA8L 2OLDA 1G9NH 2YPVL 2K7QA 4U6YA 3ZKND 4LSTL 4IM8A 3VXUA 4P46A 2UZIH 4DN4L 2YPLA 3MOBH 2DKMA 1KIUA 3I85A 3MLWH 3NTCH 1KACB 3OSKA 3HG1E 3MQIA 1REIA 3DWTA 4I0PA 1RU9H 1MEXL 3UJJH 5C2UB 1QD0A 3PG2A 1TJIL 5HDBE 3T2OA 4NRYB 2ZG3A 1KIQB 4MQSB 3VA6A 4Y5XA 3SDYL 5DC4B 4QRQA 1N8ZB 5EU4B 3SPVA 2VIRA 1MCQA 2NX5D 3WLBA 2CGRL 1QLRA 2B8OT 3HNSL 3L3DB 1Y0LA 4MNGA 5D7IB 3SJVD 1NDMB 3MFGB 2AXFB 4QXTB 3MV7E 1GC1C 3GBNH 3V4UH 1BIIA 2P44B 2X4TA 3NIFF 1IBGL 1J11A 1INDL 1WBZB 1CGSL 3MJ6A 1F13A 2Y06L 5FGSA 3E8UL 3HN3A 3X14A 5JPMB 4DZBB 3OX8A 3P4LA 1WWCA 3BDXA 3O8XC 4JPKH 5GRJH 2BY3A 3BISA 4DJMA 5IFHL 4CNIA 1ED3A 3TGXA 3OZ9L 4R3SA 4LGPB 4HF5L 4LF3B 2EYSB 4TQEH 1T7ZA 1OAXL 3MNVB 3GSOA 4GRMB 4NCC1 4DGIL 4XTRD 3EYVB 5FA3A 3U7AA 2AI0H 5KSBF 4XPGH 4AEIH 3RIFK 4YFDB 3UYPA 2QHLA 2VTFA 3BZEB 4CMHB 2E7CA 4J1UA 3QPQC 2NY7L 1FLRH 2AEQH 4WNQA 3ZT5A 4CL7A 4H1LA 1OCWH 3IDYC 4MXWL 5EU7E 2I26N 2C3VB 4P5MA 3CC5A 1ODAA 4L3CB 5MEQB 2YEZA 1QPPA 5IBTH 5CIPA 5FO8A 1P7QB 2YD5A 4U0RC 1RIUH 5EBMA 1BX2B 4QT5B 1ZXQA 3LMJL 4UV7L 4PRIE 2EDXA 4KK8C 3QB7C 1QFUL 4LCYB 1T66D 2Y6SD 5C0JA 2CLZA 4GKSA 3S9DB 5DJ8A 3NPSB 3L3OB 4HK0B 4K7PX 5IMKA 4RGNB 3QEHA 3L3KB 2V7NB 1KCUH 5A2JH 4KKNA 1IGMH 4R90H 2AJUH 2DQEH 3U46B 1IFHH 4XP1H 4PV9B 5GZOD 3CVHL 3BHBB 2ITDB 4HWBA 1INEL 2HAZA 1ES0B 2MQCA 3PDGA 1YQVL 3V5HB 4OI8A 2F54B 4TUOA 3CPLB 4FXKA 5F7NC 5F7YC 1GYAA 4ONFL 5DJ0B 2XTJD 1IC7H 4RWYL 3CLFL 4YFEA 3NN8B 3STZB 1FNAA 3WEXB 3JWOH 1HHGB 2FIKA 5DFVD 4P59H 4HWUA 1A1OA 4LPWA 2EIZB 2AJ3A 4JM2B 4GQPH 1WTLA 4WFED 4ETQB 1P5UA 1VADA 2VJXA 3PIQA 4CU8A 5F7DB 3NCEB 3MRPA 1CDJA 2QJDA 4MSWA 5IVZA 1ROWA 1NGZB 4XAKE 4YK4B 2XZAL 3DUSA 5LGJA 1AY1L 2EDEA 4RGOH 3WJLC 3GSNL 1IGFL 1PBYA 1KPUB 5IOPA 4WW1B 1OTTD 2NNAA 5AAWA 1U8OB 1OWRM 4C55A 3L7FB 1I7TA 4RAUB 5GGVH 3TP4A 4ALAL 1QO3B 4WV1A 5DHYA 4OQTA 4RMUA 1DTUA 4B7LA 5DQDL 1HHKB 2APWA 2QKIB 3OMZA 1CK0L 3EDDA 1VERA 3FFCE 4MVBC 3ZYIA 5T5NG 1QYGL 3EHBC 5HI3C 4JRXD 3IU3A 5FYJE 4QRPA 4Q2ZB 5D9SB 3CX2A 2P5ED 5ESAB 1HXYA 1Q72L 4UINH 1FORL 2ADIB 1ORQB 2IANB 1DQDH 3NH7H 1GHFH 4G3YL 1G6RA 1VFAB 4E41B 5D8JH 4PRPD 4XNQB 2AJYL 4WUUE 2EC9U 5IW1A 3X3FH 4NN6B 1OGAD 2OL3B 1AI1L 2PCPA 4IIQA 3MV8E 1QNZH 1KGCE 4EDWL 4JRYA 1JPTL 3AC0A 2X4SA 4IRZL 1LEKA 5F9OL 2R1YA 1MI5A 3O3EA 2BVQB 3P4NA 4NDMB 5SWQA 2H9GA 3JTSA 2ZG1A 1YDPA 2P8MA 3HZKB 4Y4HA 3DSFL 4F9LC 5FO9B 1KG0B 2D31B 4LIQH 5SX4I 3MLTB 2X70B 3HI6L 4WHTA 3UTQB 2AGJH 4MXVF 1TVBA 2JCCB 1CR9H 3QCUH 1WV7T 2O61B 1T20B 4JB9H 3BJ91 3JV4A 4XVUC 1VGEH 2LU7A 1MOEA 5IVXA 1DE4A 1CF8L 3QIBA 4LLUB 3S35L 2FYYA 4LGSB 2MFNA 1LO4H 1UACL 4OCYL 5HHPB 2AJVL 1G7PA 2I9TB 5T3ZD 3LKPB 4DKEH 4K94H 4ZXBB 1D9KB 3C60B 3OB0H 5KVMC 3D1MC 3LN5A 5DT1H 1CCZA 4NWUL 1FFNA 4CBPA 1S7TA 5E24E 3S4SA 3E2HB 3QIUD 3C08L 4P9MH 4IMKA 4JQVA 4OCNC 5IEKA 5IM7A 1Q9KA 1QRNA 5I2IB 3MLSL 5CBAA 5F93C 4HKXA 4ELKB 5D1XA 1Y6KR 3KPQA 3QH3A 3ILQC 1MQKL 3JWNC 5ITBL 3QWOB 4U1KA 5DUBB 5FECB 3EO9H 2EZ0D 1DEEB 1YYML 2XKNA 4RA3A 1NGQL 2WBJB 4EIGB 4ZS7L 5ACMA 5JOFB 4BQ8A 4Z7VB 2DQCL 3DMMD 1OPGL 2V2WB 3RNKA 2JJTC 1SYVB 4NQTA 4PY7B 5ISZD 4XX1E 3D3VE 4LLWA 2HLFD 5I8OL 4AM0B 3MLUL 3PGFH 4PJBB 4HIHA 3I84A 1J1PL 5A16B 4LBEA 5I8CA 3NIGF 4O00A 2GW5A 5D7LE 1L0QA 3PHQB 1L9MA 1JNHB 5C2BL 4D2NA 3MRMA 3IJSB 4FTVA 1R0AL 1X7QB 1MRFL 4MAUL 4UU9A 3O6LH 3NZ8B 2EXYD 5IHUL 5C9JB 2IH1B 2YPKA 1QR1B 4JFDD 2FJFA 5KSVA 5JDSA 4OLUL 4Y2DB 3OAYK 1KN2H 3BUTA 3H8NA 3ARPA 5IP4A 1WLHA 5C0CA 4Y5VB 3QCTL 5CGYC 2XN9B 4F2MB 1QSEB 1AGFB 3MLVH 4H26A 5DFTA 3QDAA 3SE4C 4YHLL 1E6OH 2DYPA 2VH5L 2H3NB 4UB0L 4BA8A 1GIGH 7FABH 5C0NC 1F2XK 4A2MA 1LK2A 1UZ6F 1YY8B 4QHLB 1TCMA 5CEXA 2GIYA 1C1EL 3GMNA 1XFPA 1IEAA 2VR4A 3TBSB 3U48A 4RIRA 3ARYA 1ZGLA 3F12A 4M48H 2R8SL 3WUWG 5KSAB 1GGUA 2XI9A 2Q86A 4XRCA 5L2KB 2VWEE 5FUOH 3EKCA 3GKWH 5FDYA 3HZMB 1Z2KA 4K23L 1U8IB 2P5WA 1XGYH 3QP3A 4EN3A 2LTQB 3QO1B 4RRPA 4TVSa 1XMWA 4F33B 1FZMA 4DEPC 4NSKA 1EUUA 4PUBH 2E7HA 2R15A 1JNLH 1DN2A 1CZ8H 1FFQA 3RI5K 2HJFA 3HMXH 3V6OA 1P4IH 3IXTB 3P11H 1KC5H 2ESVA 4JN1H 4KAQL 2BSSA 4LMQI 1AKJA 5TQ2H 1JZ2A 4QOKA 2V9QA 4LLVA 2DLEA 1CXHA 3LDBB 4PJ7A 1ZA6A 4UT6L 5L8LB 4L4TE 3VD7A 3EYUL 4OZFA 5TE7L 4Z0BH 2R2CA 5D6DA 3GSUB 5D70H 4HULB 4F7CB 2NLJB 4YHKL 3BKMH 3EOTL 3NMEA 3NOIA 2BMKB 3UTSE 4K55A 3PP4H 2MWCA 1NCAH 4OF5A 3EW3B 5DVMA 2HFTA 2PR4H 4KC3B 2XRAH 4OAWA 2O5ZL 3MLYH 4PBVC 4HHAA 5DMGD 4HX1B 3RIAK 1R3KB 5D1QB 4MQ7A 5EUKB 1BQLL 4PRHB 1S9WA 2V5TA 5I1JL 3LOWA 4IMLB 3VGGA 1LP9A 4FQQB 5IVXF 3VXME 5D7JD 3SQOL 2X4QA 3BW9A 4FZEH 5C07D 1A6VH 2EYRB 4G8IA 2Q8AL 3C6LB 3SGDH 1FE8H 3W2DL 4Z7OF 2PYFB 4Q7DA 3NFPB 3CFBB 1JHLH 2XZCL 3ARGB 3R8BB 4QRUB 2VR9A 5E2TH 5BS0A 1P69B 3NCYS 3QJHA 4TUJA 4YPGA 3BRFA 3DV6B 5EU7C 3L5XL 1FZJB 1N7ML 1T03L 1CQKA 3TV3L 4LHUG 5C08B 1TJHH 3LD8B 4Z7UB 2ARJA 3C5JB 4FQXC 43CAA 4D3CL 5E2VL 1MVUA 5CILH 5EZOH 1WBYA 4EDXB 4HWBL 1BOYA 5HSFA 1RD6A 3UMTA 3ULVF 5A43C 1I1FA 2ZUYA 2AXGB 3RKDC 1C5CH 1S5HA 3R06B 3T2PA 4HWZA 3I75B 1FFOB 2HVKA 3MBED 1EMTL 2XY1A 4JFQB 3BWAA 3CFEA 5BVPL 4D9QE 1Z0MA 3VXRB 5E6IB 5AZEH 1MF2H 4OGYH 3CSYB 3LV3B 2PO6D 2Z4QB 1MI5D 1RZFH 5K33A 2YUZA 3T4YB 1HI6B 3PDDA 4M6MH 5LAXA 4PJ9A 5E2UL 4PJ5D 1AD0A 1A3LH 4MJ2A 1ZLSL 1HWGB 1RUMH 1CL7H 4KRPC 4OIIH 4Y4HD 4M5YL 3O9WC 1P6FA 3C5ZC 2GSIB 5GGTL 5C0EB 5HYEA 1CICC 3U4EA 1MAJA 3BPCB 1RJZB 3FZUC 4JJHA 5ESVA 4OJFH 3PDOB 1JZ3A 3FQNA 2FO4B 3GMMB 1P2CB 1FL6B 4LPYA 5D7SL 4XWOD 1JF5A 5DMIL 1ITBB 1FG9C 3DBXA 5AD0B 4PJDB 2DLFL 2ICEB 5DJXB 3HC3L 2OI9B 1FNSH 4H5SB 3ARFA 5D71H 5E8DL 4I1NB 5L2JA 3HMWL 1BGXL 3SDXA 5HI5D 1G6RL 4LSRL 2AK4E 4NQCD 1KB5A 5CBEA 3RL2B 3RWEA 2D7TH 5E8NB 2B20A 5D1ZA 2QTEA 4OV5A 1DQLL 2EDHA 4NQEA 4NM8H 3L95B 1MFAL 1QVOA 1T1WB 1VEMA 1NLBH 5GHWH 2IQAA 1FIEA 1C16B 1JVKA 3IAGC 4LNRB 4X99B 2EH8H 2VXSL 1A4KB 3BRGC 4R26L 3QXWA 3FFDA 4LSUL 4NWTL 1I3RA 4CUCA 1NC2B 5D1XD 3D39E 3EOYG 3X3GH 2XWJA 3LHPL 3S34H 2BOBA 5ECJE 5ICZB 5JHLL 1CFSA 2GY7B 4OCLC 1MSPA 3QR2A 1LO2H 3K3QA 4M7JL 3ZKSD 3G9AB 1VACA 1NMAL 1DBAL 1MFCL 4RA0C 1YN7B 4ZUSA 4DW2L 5EIQA 5HHVH 3RWGA 3NCYP 4ZYKB 4R97C 5GGSA 4WDIA 2VLKE 3CVHB 4HZLB 4CVXB 2E7MA 3SGKC 1ZWIA 4JFXA 4WFHE 1BM3L 1U8JB 3EZJB 4ZAKB 4PJ7F 1AR2A 5JNYA 4DAGL 3OKNA 4HIIB 4XPHH 2BNUA 3QUZC 2ZUWA 2VLJA 4XMPL 3GSXB 3RZCA 5TFSH 5DJDB 1KENL 4ZG1A 5DURB 3TIDB 1G7JB 1WFOA 3UPAA 2DQTH 3QEQE 4PJHB 3TBVA 4DGYH 3QHTC 5K59F 2YC1A 5M94B 1NGPH 1F8TH 3WO4C 4Q6IA 3L5WB 2C7UA 1NGWA 3IF1A 3WFZA 1A6UH 1RQ5A 3CK0H 3HPJA 1N0XH 1LP9F 3GSNB 5KOMC 3ULVL 3HZVB 4NOBA 3U9UA 1TETH 2V2TA 1KIPB 5IJKC 2DQGH 1D6EB 1U6AL 1A1MA 1P84J 3KS0J 2DLGA 2NY3B 4JRWA 1NFDE 3U7WH 1G7QA 1WCBB 4YQXH 5HHOB 3WFEH 4XNMB 4EI5A 1UG9A 3IDJB 2WW8A 3OHXB 5F1OB 2X7LA 4MLSA 3M8OH 2X4UB 3HE7A 1NCCL 4R4NC 5CGTA 2BSTB 2WM0A 3LEVL 1N5AB 1AIFB 2YRZA 3O6ML 3WXVL 5E56A 1FNLA 4K7PH 5D96C 2XTJB 3RTQB 1IARB 2YD9A 2DLHA 5EU6D 4ACPA 4M6AA 2P5WD 3B83A 1J05A 5JW4R 3O3DA 2GEEA 4QRSA 5B4MD 1HNFA 4XT1C 4RBPK 5D7IE 3KYAA 4BQ9A 2RGSA 4YXHL 4LCCC 4PJIA 1URLA 3OKKB 5F7HA 1F4XH 2RAMA 3OKLB 5D6CB 3P0GB 5EORL 3GZKA 2ESVD 2EDTA 4ONGL 3UYRL 5I1HL 3DLQR 2ZCLL 4XC1L 4N0RA 1NC4D 5HI4C 4BH8B 5D7KE 3ZSTA 3B5GA 4I18B 4HCRA 5C70A 4MHHG 5EO9B 4OLZH 5F71A 4KROC 5HY9B 1R3JA 5KSBB 1KPRB 3KWWA 4YDLC 4TNVK 1XH3A 2H8PA 4GKNB 1NCNA 3U6RB 1NCBH 4PLOB 1Z3GH 3HNTH 3O6KL 4Q9QH 1MELA 4BK5A 4MD5A 4YHNA 5HGAA 5C6PB 3LS5L 3MRGB 2IFFL 4JN2B 4XPBH 2A9MH 2HWZH 3FB8A 1CDBA 4TRPH 4X7TA 5T1KD 2YMXL 1TIUA 1BREA 1DLHB 5DI8B 1PQZA 4PP1D 4I3RL 4MNHB 3WE6B 5C71A 1B6UA 2NY5C 4GG8B 1EFXA 1VFBA 4CRPA 1I1YB 4HKBA 3JTTA 4WTWA 4WEBH 2N1KA 3FOLB 4AENB 4N0UE 3I50H 2R4RL 5C0DB 1UM4H 3QA3B 4UAOB 5ITFA 1B90A 1NCWL 3SDXF 5HHMD 1UJ3A 2VXUH 4CMMB 5LQBH 4X6EB 1DDHB 1J0HA 1WUNT 5BS0D 2IALA 4KRLB 2R0KL 4H25A 3QFDB 5CWSB 3VFMB 1HYSC 3AUVA 1GZPB 3LKOA 2Y5TA 4NC1E 1F6LL 4ZO6A 1JZ6A 2VWEC 1MJ7H 1BZ7A 5FYLD 4JQIL 3BN9D 1TZHA 1YPZE 3PWJB 5DQJB 2EDFA 3UAJD 1IQWH 5CEZE 1D5XA 4NNPH 5E7FA 4P3WA 4LKCB 2CJUH 1IEHA 2CIKB 3MNWB 5LBSL 5H2BB 2F53E 4KFZC 5FOJA 3RBSA 3VFOB 4Y1AD 4U3CA 4BQ6A 1OT2A 4NZDA 4P2RB 3VA2C 3CCHA 4JCMA 2ZSWA 2VDMH 5FCUH 1IAIL 5I18L 5DJYB 1LEIA 4Y8DC 4OZIE 2BNQA 4Z8FL 2C3WA 2BDNL 1EJOL 2MSPA 1KJ2A 2DWDB 3MRCB 4P9HC 2EEDA 4Y16C 4GFTB 2FSEA 3SKNA 4I13B 4P4KB 4HUWB 2YD4A 4HEME 2IPTH 5B38G 5EZLB 3MUY1 4X5LA 4Y5YC 4TVPD 3FQXA 3NTCL 3MA9H 1D5IH 1UB5A 1XGUB 3TA3B 1MWAA 5B3JF 3UJJL 3MRHA 3QI9A 5DD1H 3HC0B 2Y07H 3ET9F 5D5MA 4PGDB 3O4LA 1NUDA 4U6YB 1MY5A 3TN0C 1I3VA 2A38A 1XEDA 2DQUL 3J7HA 3VXUB 4P46B 3BT2H 2YPLB 1K3IA 2X4OB 3D0LA 1B4RA 5F9DC 4M93B 4JCLA 1BEYH 4LVOC 2J8UA 4H8WC 4HH9A 4I0PB 1BOGA 5ALBH 3GBNL 3S37X 4NQED 4C83A 5IBUG 4FFVD 1LNUA 3BPOC 4Y5XB 5DXWA 4QRQB 5MERA 3RGVC 5LG1A 3SPVB 2VIRB 4JPKL 5GRJL 4M1CC 3VMPA 3WLBB 1QLRB 1Y0LB 4MNGB 4KJQC 4TQEL 2VDPH 4LLDB 5IHLB 3K80A 1BIIB 2X4TB 3CLEH 2NY2D 3HE6A 1OB1A 3MROA 4NCDA 1LVEA 4XPGL 5J13B 3X14B 4PJIF 5I1KL 3G5XB 3S4SG 5L6YH 2UZXB 4CNIB 3C8KA 1ED3B 1FLRL 1ULVA 1Y6MR 2AEQL 4U6TA 4R3SB 4X9FA 1OCWL 1OTSD 3NGBC 2VAAA 2AEWA 5IB3A 2VB5A 2LV4A 2ZUVA 2ATPA 2VLJD 1RIUL 1WFUA 3VD3A 1IE5A 3FB7A 2WWMD 3LRSA 4JE4B 1BP3B 4N68A 2HTLC 4H88L 2MMXA 4J1UB 3G6DH 4WNQB 1QA9A 4H1LB 3QG7L 1DVFC 4KI1A 4P5MB 2DKUA 2E3VA 3CC5B 1A6TA 1T0NA 3VD4A 5DQ9A 3WD5H 3ETBF 1KELH 2YEZB 2NQCA 1U93A 2XOTA 5CIPB 5FO8B 4JPWH 4PGCA 4E42A 2NW3A 3SDCD 5J6HA 1KCUL 5EBMB 2NY1B 4OD1L 4R90L 4WI3A 1EGJH 4XP1L 1J8HE 1ZGLM 5I8KH 1FVDA 5JA8B 3OKDA 3V95A 5C0JB 1MFEH 2CLZB 4GKSB 5HGDA 4EI5D 3MLPA 1IC7L 5DJ8B 5DRXA 1MUJA 1IRAY 5IMKB 1RUAH 3QEHB 3JWOL 1JWSB 1QEWA 5IMMA 3BOVA 4P59L 1LD9A 4IOIA 2VLRB 4XCNB 4M3KB 3SDAD 1PX4A 3PHOA 3KPSA 5EU3A 4TUOB 1F3RB 5CKAA 1P53A 3WHXA 4FXKB 5EOQL 1I3GL 1K3ZA 1PKQE 1S9KC 2AQ3A 4PGBA 1T5WA 5ICYA 5J3HD 1NAMH 4J4PC 3X17A 3V79C 3QDJE 2FIKB 4WHYH 4RGOL 4X9GA 1A1OB 4FFZH 3C09B 2SEBA 3AB0B 3VXSE 4JFEE 4ZNEA 2AJ3B 5CS7A 2AXHA 5EC2A 2BRQA 4MWFA 5F21B 2BVOA 1VADB 4AG4H 3PIQB 1JWUA 4F37F 2JJSA 3MRPB 3B9KC 1J0KA 3ZDZF 1EFQA 5IVZB 3W9DA 5I76A 5I66A 3HAEH 5D4QA 3DUSB 3V4PH 5LGJB 2FDBP 1CD8A 2X1QA 3OR6B 3MRJA 5FF6A 4RRPG 5IOPB 2NNAB 2DQJH 1MAKA 4UT7L 3EDEA 3T0BA 3DX7A 4HFWA 1I7TB 3QCVH 4GXUN 3T4AB 1I9JH 1GHFL 2W92A 3FQRA 1F00I 2LAGB 4WV1B 2GTWA 5DHYB 2WIIA 1HIML 1HSAA 2JK5A 4K8RD 4PGJA 3NCBB 3IU3B 4QRPB 1MJ8L 3BN3B 1EIBA 4AL8H 1HXYB 1EFXD 1SBSH 5D5MF 1IMHC 4OZFG 5IB1A 5EH1A 1G6RB 2KDGA 4I8DA 2Q3ZA 4KRMB 3WNKA 1BFSA 1AQKH 4X83A 3T1FB 4WI6A 4PLJC 1WZMA 5IW1B 1X5KA 3TJHD 5C09E 2PCPB 3REVA 4KI5D 3KPRE 4LCIH 3TT3H 3P3YA 4IIQB 2HFEB 3ZHDA 4GS7B 1T5XA 1ZMYA 5A2FA 4JVWA 4XP6L 2NY4D 4JRYB 4LIQL 4M7LL 3BQUA 4HQQH 2FZ3A 2AERT 5DD3H 2X4SB 2AGJL 3RVTC 3AU1A 1MNUL 3QCUL 1LEKB 1T1ZA 2R1YB 1UQSA 3N50A 4JB9L 4HCRL 3O3EB 4MAYD 3ESVF 3P4NB 3RY6C 5SWQB 1VGEL 3JTSB 1JUFA 1OT1A 3JUZA 2GCYA 1YDPB 4J12A 2P8MB 5M95B 1UM6H 2DJUA 2RQ8A 3L3JA 3S3JA 1DR9A 1LO4L 2APVA 4Y4HB 5DRWA 4WWKC 4WHTB 1RI8A 1ZAGA 2H2PD 1TVBB 3ARSA 4IEFB 1F6AA 2Z8WC 4DKEL 1NFIA 2IGFH 4XZUA 5DVNA 4TVPH 5IBUB 2CK2A 3JV4B 3QFJD 2DRUA 5JLZA 3L3IA 5MHSD 3BE1H 4O2CA 3V8OA 5IVXB 1DE4B 5DT1L 3KLHD 3QIBB 1ZHKA 2EE2A 5J7CC 4GH7B 2BNQD 5F8QC 4RCAA 4S1QL 1ZLUK 1R3IL 5KG9A 3BIAX 3FCTA 3MFFB 1NEUA 2VAJA 2O93L 4IRJB 3ZE0E 3FB6A 4CMHC 3NACL 2GK0A 1RFDL 4L3AA 3U4AA 1BBDH 1JGDA 1T0MA 3LN5B 4TSCH 3QDGD 1FFNB 3CD4A 3MRFA 1S7TB 3QBTB 3S4SB 1CWVA 2AABL 4RNRA 4Z7QE 3T3ME 1FV1A 2OXGA 1CIUA 1JYXA 3QI9D 5IEKB 5IM7B 1BLNA 1Q9KB 1QRNB 2ICWJ 1U3HA 2JB6A 5CBAB 4HKXB 5L88L 4U1NA 4OF7A 5FYJU 3HI1A 3KPQB 5KBNC 4QNPF 4U1KB 3EAKA 4N8VA 3OR7A 5AG8A 4R2GB 3Q2CA 3PGFL 1RHHA 2XKNB 1G6VK 5JO5A 3BAEH 3HR6A 2HKHH 3NPSC 4NC1C 3MGTB 3MCKA 4KZDL 3V7MA 4YUEH 3DVNA 3UPRA 3KJ4C 3TH3T 4N9GA 4LLMA 4LEXL 1EO7A 2VC2H 5T1MA 3EJYC 5DYOB 2WBKA 3TBYA 2DMKA 3QUMH 2BZDA 2NXYB 4JHBA 4HIHB 2E8ZA 1KN2L 3RUGE 4L8DA 1DUZA 4LBEB 5E00A 1TZGL 5KSUA 4JY4A 5I8CB 1FG2A 1CFNA 3MV9A 4G9FE 4GW5A 1D6VH 1KJ2L 3DURA 5I1DA 3MRMB 4FTVB 4RISH 1E6OL 1GIGL 4UV4H 4YHPA 2J1KA 2RR3A 4JM2C 3B9AA 3CIQA 5I17A 2YPKB 2FJFB 4UIKL 5KSVB 5JDSB 4LCWA 3L5IA 4OZHA 1MWAL 2NY6C 2YZ1A 4LFHD 3AVEA 3DROA 5C0CB 2ZOLA 3FQWA 4M3JA 4HGKC 4M48L 1TLKA 4H26B 4R8WH 5C6WH 4JDZB 4NN7B 2DYPB 2E27H 4NUGH 3MRDA 2KBGA 3T0EA 5DHVA 4GG6A 3GKWL 2YR3A 1LK2B 4M1GH 1WZ1H 4MMXC 4CJ1A 1B9ZA 3GMNB 5CZKA 5HYFA 1IEAB 2P45B 4WO4D 4RIRB 1IM9D 4UMGA 4PUBL 3NCFB 1JNLL 3F12B 1V3LA 4KDTA 5JMOC 3HMXL 1I1AC 2PTTA 1P4IL 4XRCB 2Q86B 3P11L 3W9EA 1A21A 5I73C 1PFCA 4Z18A 3MYJA 4V1DD 1MCOH 5TQ2L 1FGNH 2NX5E 2HG5A 1X5IA 4BQCA 2C3HA 4EN3B 3SJVE 2ZCKH 1A7RH 1FZMB 4KKLD 1DQQA 4NSKB 4PPTA 5JZ7C 1W8NA 3KYMA 1N5YL 4G43A 4L3ED 4NN6C 2HJFB 1D3CA 4JJ5A 3T0XA 4C4KT 4UTAH 1BJ1J 1VCAA 4HFUL 1Z9SA 3BKML 4LSPL 4ONHA 4S0TD 2BSSB 4DTGH 3O6FA 2PXYC 1AKJB 3PP4L 4MCZA 4QOKB 3GI8H 5DK2A 2PR4L 3DRQA 4LLVB 4PJ7B 2JKXA 4OFYA 1H5BA 1ZA6B 1MJJA 2G60H 3MLYL 3PV7A 4HG4K 3ARBD 2HRPH 4OZFB 4D0BA 3AM8C 3DARA 1B0GA 4MXQC 4F80A 4BYHA 3AFLA 4HIEA 2IPUG 5DD5L 4I48A 1A6VL 1FE8L 4X6CE 1T21A 1DLFL 1NBQA 3G6JE 4YC2C 5DEGA 3ARUA 1JHLL 3HS0A 1MCRA 4NRXA 3PWPB 5ADPH 3TFKD 4MQ7B 3V0WH 4WCYH 3G04B 2DQDH 1S9WB 1IGYA 4XNZB 1K9TA 1LP9B 3MRBA 4K3DH 1IZJA 2YXMA 4G8IB 2BNRA 5CILL 5EZOL 1S5IH 1XGPA 1JWMA 3AREA 5BS0B 4TUJB 3QJHB 4YPGB 4BK4A 1H3TA 5DC9B 2BY2A 3TWCH 5IT2H 2ARJB 3RA7H 1G9NC 3FB5A 43CAB 4OD3L 3IDNA 1MVUB 4X0KA 1WBYB 4PJXA 2F74A 5FGCB 5HHQA 2ATKA 5T3XD 3OXSA 4HDIA 1MF2L 4OGYL 3TVMD 1I1FB 4IRSD 5I1EH 4WGVB 3H0TA 2VRAA 1S5HB 5K93A 1OM3H 4HWZB 4JREC 3PL6A 3MUJA 2WBJC 3LEXB 4JZOA 4M6ML 4M6OL 5DRNA 3CDFA 3BWAB 3CFEB 1JRHH 2D4FA 1J1OH 1RUML 3FOMB 3KLAA 4P5TC 3TPUA 1MIMH 4WFEE 2DAVA 5LXGL 4EEEA 3BQUD 5CP7A 2R2HA 4DWHA 1S9VA 4XGZA 5TDOA 1H3XA 3SGJC 4RDQF 3P0VH 3ECBA 3RJQB 5LAXB 4ZFOA 5KSBE 4PJ9B 5KVEL 2D7NA 3B9VA 3TEUA 3VRLE 1AD0B 5CSGA 4NFDA 5D71L 1IM3A 5CCKH 3CU1A 3U4EB 5E94B 3TESA 4J3XA 3B6SA 4MJIA 5E99L 2QLVB 5TPWH 4YE4H 5IMOA 5SX5K 3FQNB 5SV4A 4WW2A 2GQHA 4NM8L 4G8FB 1BF2A 2OXHA 4JRXE 4QTIH 3DBXB 3QNYB 2AXJA 3ZKMD 2YUVA 1XGRA 2P5EE 3RWCA 3ARFB 1NLBL 4X4YA 2ORBH 5L2JB 3MOQA 5C8JA 3KPOB 3SDXB 4L5FH 4M43H 2X44D 5CBEB 1NPUA 4GG6F 3RWEB 1EGJA 3EJZC 1RZGA 4PRPE 5D1ZB 2HKFH 4OV5B 2Y36H 4Z7WE 2GITA 1ZT7B 3S34L 3VFSA 1FDLH 1OGAE 4XPTH 3QHFH 2MPAH 1RZJC 1QVOB 4PRBA 1TCRA 2EDOA 4WWID 1EO5A 2VZOA 4FFWD 2IQAB 1R24A 4MA3A 2XKUA 5BRZA 3STBA 5HHVL 1T89A 3ZT7A 3FFDB 5I0ZA 1KCKA 1I3RB 4D0CA 3LRHA 1FC1A 2XWJB 1D5BB 2LTQC 2BOBB 2VQ1A 1I9RH 1PG7W 3RX8A 1NLDH 3JWDH 2LVEA 1CFSB 1PSKH 1RUPL 4XBEH 4XPHL 1C7TA 1VACB 2YD1A 3WFCH 1NAMA 4ZUSB 1T7YA 1SEBA 5A2LH 5TFSL 1II4E 1PW3A 3RWGB 4Z78B 3D87B 5GGSB 4WDIB 3S36X 1A64A 1NEZG 2DQTL 5T33L 1Q0YH 5MEND 1UH3A 1ZWIB 4JFXB 2Y72A 4OCSL 2W65A 3RRQA 3WV0A 1F8TL 5JNYB 3OKNB 3NZHH 3ARDD 1S9YB 2BNUB 1ONQA 1A6UL 2GSGA 3CK0L 3RZCB 2IBGA 3OAUH 3MV9D 5T3ZE 1JRHI 1SMAA 4M62H 3MJ8A 3KPMA 5EBWA 3DYMA 4HPOH 1BVLB 3TBVB 1JHKH 5C7XH 4Z5RA 3U7WL 3ZDXF 2YC1B 4YQXL 3HC4H 3QRFM 3WIFA 5DSCA 4J3VA 4JG1H 2C7UB 1NGWB 2R0LH 1A4JA 4Y0GA 4X6FB 3M8OL 4TPRH 1JNJA 3HPJB 3TO4D 1G9MH 3U9UB 1RMFH 1U0QA 3SE3C 3T0ED 4KKAD 5AYUH 2R23A 4NQDA 5T1LA 1YMHA 4AY0A 5IVOA 3IVKA 1G7QB 4G6FB 3MUGA 4EI5B 4J3SA 3WNLA 2ZPKL 3EO1A 2XA8H 3QO0B 2X7LB 1CS6A 1EAJA 2JELH 2R69L 3HE7B 4AIXA 5D93C 3QUXA 2M2DA 4JHWL 5FYKD 1F4XL 5FFLA 1YJDL 2CLRA 3R4DA 5ISZE 5AWNH 4AJ0A 3FT2A 4IJ3C 4MQXC 3HLAA 4I0CC 3W11D 4PJXF 3OPZH 1BPVA 2J8HA 1PG7X 2CDGA 1J05B 3O3DB 2BOCA 4QRSB 4TTDC 3U1SH 4JY5H 4OLZL 4HW6A 3WS3A 3BPNC 1FRGL 5JTWA 5EA0H 4PJIB 2Q6WA 1Z3GL 3HNTL 2XQYK 3BDYH 3TJEL 5HYSG 4Q9QL 4ZSOE 2FGZA 2IFGA 3H3BC 4N1EA 3O6FD 4JFDE 1KCSH 2A9ML 4HXAH 5HGHA 2HWZL 3VG0H 5IWLC 1CGUA 4P23A 5I71C 3S88H 1R3JB 3KWWB 3GUTA 1UEMA 1XH3B 5B8CA 1O7VA 4OFVA 5IHBA 5E8EA 3LKRA 1A2YA 3ISWA 4MD5B 4OZGA 5HGAB 3IT8D 3OXRA 4CDHA 4QRRA 4GBXA 1UM4L 3W0WA 3FB8B 1UB6A 3UZEA 4X7TB 5LQBL 4YBQD 3O3AA 4C56A 1PQZB 4JKKA 3Q6FA 3ZKNC 4WW2F 3ESUF 1OSPH 1VFBB 4JFOA 3VGBA 1F4WL 3JTTB 4HKBB 1MJ7L 1AO7A 3DRTA 3DIFA 4K94C 2GJ6A 1JGUH 3B2UD 4FQJL 1OD7A 5ITFB 1YEFH 1IQWL 4OT1H 4XH2B 3K81A 4NNPL 1UJ3B 1VSCA 2RCSL 3OAZK 1IZKA 2CJUL 4D9LH 2IALB 3BDBA 3P4OB 1HHIA 4H25B 4M7KH 5EU5A 2BSED 3LKOB 2Y5TB 4FHBD 4R7DA 4IOFD 3VD5A 4H0GA 4NBYB 1TZHB 2EDBA 3BSZL 2WUCH 1IAKA 1M05B 4JZNB 2FD6L 2Q1EA 4X7CC 2VDML 5J1SC 1CDCA 1F4YH 5EB9A 4K71C 5FCUL 2WP3T 4MGXA 4AMKH 2DLTA 2V17L 1HDMB 2AS5M 5JW3L 1OAKH 2NW2A 3PL6D 2VLMD 2IG2H 3PWLA 2Z9TA 4Y88A 3HI5H 5JXAH 2B1HL 1JE6A 4JANA 3EGSA 2ZP0T 1JPGA 2DB8A 2IPTL 3ZE2F 3CCHB 3VWKD 1BFOA 2ZSWB 3ZO0A 4R0LC 5KVDL 4Y4FD 1D5IL 4KTEH 4XVSH 4XTRC 2C5DC 3VDBA 4HEPG 2BNQB 3B43A 5GJSL 4ERSH 5DR5H 4ODTL 3JZ7A 5DD1L 1CBVL 1P7KA 1KJ2B 2P47B 4G42B 5C07E 3SDDA 4DOHB 4YPJA 2FSEB 3SKNB 4OTXL 2ADGA 4BSVA 3PWUA 5F72S 4MQTB 5I74B 5EN2A 4NUJB 3OKMA 3ARXA 5IESH 3FQXB 5JHDD 1BEYL 4W4OC 1UB5B 2IJ0C 1MWAB 3BGFC 1E4KA 3FT4A 4J3OC 1U8LA 3MRHB 1UXSB 1HH6A 1JGEA 5F6IC 5D5MB 5E8PA 3O4LB 2XWTA 2NXZD 1T80A 3TH2T 2BHYA 3MSPA 2YUXA 2ADFH 2X1PA 3G6AA 4WENB 3F5WA 3VFUA 1ITCA 1OAQH 3D0LB 4JVUA 3GSQA 5HVWA 2F58L 4JFFD 4L8BA 2C9AA 4HH9B 1T66C 2Y6SC 5F7KC 1BOGB 2VDPL 5LWYH 4NBZB 4J23A 3D9AL 3P30H 4C83B 1CTNA 4P2OA 5DS8A 5FV2A 3F62A 1XR9A 2E7LC 2W9DH 5TE6H 5GZOC 5MERB 4KK9D 1U3ZA 5C0BD 4Z77A 1BZ9A 3GI9H 5I75B 3U30C 3CJJA 3ULUF 1MI5E 2XTJC 3QUKA 2FJHA 4ZFOL 4G6ML 4JQXC 5DGQA 2DQFA 1MCEA 3HE6B 1OB1B 5DFVC 4PJ5E 2DBLH 3GBML 5A3ID 1PZUB 3MROB 3VXTA 1YMMA 3IYLW 4KUZH 5JORB 4JDVA 1G7HB 3WS6C 3EYSL 5EUOE 1RZ7H 2YD3A 3K2UH 1CXFA 4EUPH 3C8KB 3G6DL 3NCCB 5K9QI 2EDKA 5I6XC 2UY7A 4ODSH 4DGVH 5J89A 2VAAB 3LPWA 4LEOB 1KF9B 3WLWD 2HTKD 3WD5L 1KELL 2CH8A 5IB3B 1OSZA 1OTTC 3SE9H 4JPWL 1C5BL 4UNUA 3LRSB 1TPXC 4NQCE 3NPZB 1OF2A 1EGJL 4OZGF 2LQRA 1WWWX 4NRYA 1QA9B 4PRNA 5IV2B 1EERB 2C3GA 2C1PA 2P24B 3O2VH 1BFTA 3U2SA 15C8H 2AQ2A 1N8ZA 3SOBL 1RULH 3O2DH 4F7PA 1HK6A 1A6TB 1T0NB 1UGNA 1MFEL 5DQ9B 3B2VL 1UCBL 1U93B 3O8XA 4RDQG 1P7HL 4XCYA 1GGCL 3L3DA 5TF1H 1FC2D 3SHSA 4PGCB 4E42B 4A6YH 2NW3B 2UY6A 5J6HB 1JPFA 4FP8H 2YBRA 2NY0D 4S1SL 3PQYA 1U8PA 1ZV5A 3MOAH 5FUZH 3AGVA 1FVDB 2CR6A 1QBLH 4UQ2A 2C4FU 4GMTH 3D18A 1MPAH 4DZBA 3DGGA 1J86A 5HGDB 3VG9C 5DRXB 3MXWH 3VI4E 5ACLA 1NAML 1L7IL 2QQKH 1QEWB 5IMMB 1LD9B 5FKAA 4IOIB 3QUXD 5DVKA 3FTGA 2M8XA 3PHOB 1HKFA 2NMSA 2EYTA 3KPSB 2F8XC 2P49B 5EU3B 5SV3A 3WMSA 4AG4L 3FN9A 5SWZD 3MRLA 4PGBB 1T5WB 3H9HA 5ICYB 4OCMC 2L4OA 4JDTL 2L7JA 3CUPA 3WIHH 3H9SA 2SEBB 2DQJL 3F65A 4JFZL 4QTHA 3QCVL 5EC2B 4MWFB 2WMPA 1A3RH 2NTFA 2BVOB 3EOAA 4HPYH 4NJ9H 5FYJH 1E0OB 3W9DB 1UWXK 5I66B 5FGBA 4WY7H 4PJAE 5HYJA 4PJGA 3TNNB 3KXFD 3MRJB 3IAPA 2ED7A 5FF6B 5HHXH 5GJTH 1X6LA 4LQ1A 4AL8L 3DX7B 1AXTL 4HFWB 3KS0H 2BHZA 3IKKA 5E9DB 3WNMA 3FQRB 3L3KA 3B8YA 1F4HA 5CINH 2GTWB 5ACZA 2WIIB 1AQKL 1HSAB 1OW0C 2JK5B 3V5HA 3QIUC 2Q8BL 3QG6A 3UTPE 1RURL 2P8LA 3CPLA 5B39G 5GPRA 4C56D 1ZTXH 2IBBA 1RUQL 4LCIL 4OCWH 3TCXA 4P2CG 5D72H 3MCG1 1OP3K 5CJBA 4TNWK 3ULUL 2HJKA 2BSRB 4BZYA 5IB1B 1JV5A 1OAZH 2K3TA 1HHGA 2KKQA 4DKFL 1KEMH 5EU6E 1QSFA 2P5WE 4WI9A 2EZ0C 3T77A 2BXZA 4PJ8A 3I02A 1FQ9C 1OGTA 5ANME 2HT3D 5F7DA 3REVB 3L5HA 3RVXD 3DMMC 3RQ3A 3D0VA 1T5XB 1A14L 4L8SC 5GZNC 2ESVE 2FZ3B 5BQ7A 1ZLUH 2EDWA 3AU1B 3UYOD 3TT1H 1T1ZB 2HLFC 1UQSB 4HIJA 4HKZA 3MJ9H 2PYEA 4WW1A 2ZUUA 4U6VL 3IB4A 4OUOA 4FXGA 1J5OH 5GS0D 4KXZI 1FL5A 3BE1L 3V5KB 2GCYB 4KVNL 1A6AA 1W72A 2WBWB 3U7YH 1DBJL 4KV5F 1OQOA 4YZFE 4W70A 1L7TL 4HGWA 1EEZA 2VSCA 3RVUC 1F6AB 2EXYC 2F19H 1NFIB 2DM2A 4XZUB 1FAIH 4F7EB 2VDLH 5JLZB 4Z95H 3L3IB 1BBDL 4O2CB 2XIDA 2B1AH 4F3FB 3D85A 4XXCC 3GMQA 4QXWA 4WJ5A 1CLZL 5C0AA 4GUPA 1A6PA 4BZ2H 2V2XA 1IGIH 5DA0B 5KG9B 4ZPVA 1HILA 2QSQA 3FCTB 2A83A 4OZ4A 4RAVA 4RFNC 5EWIH 5DMYA 3TZVD 4P2QD 5HYQA 3FB6B 3WKMH 3QSKB 5HHME 2GK0B 3VWJD 4QY8A 3L1OH 2WWKT 1E27A 2FJGA 4N0YL 2X4NA 1JGDB 1T0MB 4F9LA 3MRFB 1U42A 1BIHA 4TOYH 4RNRB 5MI0B 4GAFB 1CVSC 1JF1A 1FV1B 5FYLE 3K8KA 1BLNB 2BJML 4AK1A 1A5FH 1U3HB 1CG9B 2JB6B 4X5WB 4YUEL 4J2XA 3HI1B 1ZT1A 3VRIB 3DECA 2Z35A 1WIUA 2VC2L 3OR7B 4OIBA 2JCCA 1RHHB 1YEJL 3SCMB 4Q74A 5JO5B 3RDTC 4Y4KD 1WICA 3QDMA 1EZVX 3C6SA 2DQIH 1CGTA 1D6VL 4Y1AE 3MCKB 3DVNB 1RVFH 2W07A 4RISL 3UPRB 3RWJA 4JKWA 4N9GB 4LLMB 3STLA 2Y25A 3QXDB 2NY5H 5T1MB 3TBYB 2XZZA 1U8QA 3F6IA 1EXUA 4DZ8A 1Q0XH 2BRRH 4L8DB 1N59A 1DUZB 5E00B 2ZUXA 5KSUB 4OIAA 4JY4B 4GAGL 1FG2B 3C60A 1CFNB 3MV9B 4GW5B 4YHYC 3DURB 1FSKB 4R8WL 1YEIL 5I1DB 3UTTA 4ZUWA 2E27L 4LSSH 4NUGL 4YHPB 1YMMD 5JXED 2EEBA 1WZ1L 4M1GL 4TVPE 5I17B 3QRGH 5DMGC 3K1DA 4LCWB 4GOSA 5I2IA 2AQ1A 5IG7A 1HZHL 1E4WL 5IBLD 4QYOA 1FO0A 3DROB 2ZOLB 4OLVH 3LQAH 3FQWB 5D7JC 2JJTA 3MRKA 3EYOA 3DJ9A 4KHXH 4PJGF 3WN5C 3MRDB 1W0YT 2UWEE 3T0EB 5DHVB 5CLWA 4FQIH 4GG6B 2K7PA 1MCOL 1FGNL 4JKPH 3Q5YA 3WDHA 2QSTA 2B5IC 1A7QH 4IDJH 1QACA 2ZCKL 1A7RL 2NR6D 4WHYG 5HPMA 3I6KA 4NQEE 4JO3H 3GMPB 1S7RA 2YK1H 1HSBA 2PTTB 3W9EB 4X7SH 1LEGA 3GNMH 3BKCH 4DTGL 2HG5B 5F89A 4UNVA 1AFVH 4HUUA 4MNQA 4NHCL 4P9HH 2G60L 1X7QA 1M4KA 4KK5D 4WRLA 4ZD3H 3SE4A 3P73B 3OKOA 1J1XH 3KYMB 4O02H 1JPSL 2B7DT 3MBEC 4G43B 4E5XB 2DI7A 4B0MM 1A6ZA 2JJWA 3JVGC 1A6WH 4JJ5B 4M6NH 5DRZA 4ONHB 1PG7H 3LH2L 3VGHA 3O6FB 5H35A 1BMGA 4MCZB 4JO1L 5DK2B 5B39B 2OCFD 3DRQB 4U3XA 1N2RA 2PO6C 4KPHH 1H5BB 2JJVA 1MJJB 5ADPL 4NKDA 1YEKH 3PUCA 4DVBA 3LEYH 2DQDL 3T3PE 3KPTA 4LRNH 1B0GB 2DBJA 2QQLH 5DLMH 5ADOL 1H3WM 4ZNCD 3MYZA 3GJFH 4JG0H 5DK3A 3TBSA 2VLJE 4H8WH 4Y4HC 5FXCH 4XP5H 1GGTA 4I48B 3HG1A 3G5YA 1TDQA 1GC1L 1TJGL 1D5MA 5DEGB 3HS0B 1X5HA 1M6OA 4NRXB 5FDWA 5I16A 5DD0H 1EHNA 5HVFB 5B3JE 1P7QD 4XWOC 3NIDF 1IGYB 1U8IA 3TWCL 3KJ6L 3RA7L 1FVCA 3MRBB 3IS0X 3IS1X 4ZO8A 5HI5C 2BNRB 3UJIL 4WI4A 5DDHA 3MV7A 1DQML 1JWMB 4CVUA 1YECH 3WHE1 5L8KB 3AREB 4RGND 4S1RH 1K2DA 3TLRA 1OM3L 1N3NA 5CMAA 3ZMRA 2X9XA 5DJZA 1IGCH 3FB5B 2VUOA 2F54D 4JQVC 4KY1H 3IDNB 4X0KB 4OLYH 1JRHL 4PJXB 2F74B 4Z6AT 1J1OL 2E6QA 1ACYL 3GSUA 2ATKB 4P99A 4XMLH 1MIML 3NA9H 3OXSB 4Y89A 5D1XC 2X1OA 5ID1B 4HC1A 2BMKA 3H0TB 5FAAA 4OGXL 4GT7A 5L0QC 3PL6B 4KTDH 8CGTA 4EQ2A 1GCFA 4JZOB 4PJ8D 3FT3A 1JZ5A 5DK0B 5DRNB 3WKNA 2FCBA 4QHUB 2VO5A 4OCRL 4TYUA 3KLAB 5CCKL 2VE6A 3PWVB 5CP7B 1I8MB 2R2HB 3M07A 1S9VB 4XGZB 5TDOB 5TPWL 4FQXA 1J7VR 4YE4L 1VENA 3UZVB 3ECBB 2JIXA 3I2CL 3FONA 4K9EH 4PJEE 4ZFOB 4FG6D 1WEJH 4QTIL 1ETZA 5BO1H 5BJTA 4KHTH 4UUJA 2CKBH 1IM3B 1WVZA 4AEHL 4PRIA 2ORBL 1QFWH 1HQRA 4XC3L 43C9A 1I8KA 4JKLA 4W6WB 2E9JA 3IFLL 3B6SB 4MJIB 3V7AG 3QQ3A 1LK3L 1SEQH 2HKFL 2ADJA 5IMOB 1QFWM 5GRXG 4WW2B 5EOCH 1FDLL 3KYKH 4U2YA 3QHFL 2IAND 1HINH 5FIEA 1CXIA 2KPNA 4LOUD 4E41D 1XGRB 4AEFA 3RWCB 4X4YB 4CGTA 3A6OA 3TBTA 5C8JB 1FFOA 4A6YA 4NQUA 2ZUTA 3VXQA 6FABL 4D94A 3RWDA 3RPKA 2ZUQB 1RZGB 4F15C 4WUKL 3KHOA 5GS2D 4LDOB 4JFYA 2GITB 3VFSB 4YDIH 1I9RL 4I5BA 1NLDL 4PRBB 1PSKL 1TCRB 4KI5E 5I8EA 3O9WA 3C5ZA 2VDOL 1CICA 4LPXA 5I1CH 2R2EA 5J1AA 2A9NH 1R24B 3WFCL 4O5LH 4MDIA 1CDGA 5BRZB 5IB2A 1P9MC 3JSSA 5KANG 4BUHA 4NKIH 1PYWB 3EZ8A 4XAWH 5FKPA 4D0CB 4LU5L 4PD4K 4YBLC 5B4MC 2VQ1B 4PFEA 1W72L 2C3XA 2VNCA 3H9YA 4ZFGH 1OP9A 2OYPA 3O81A 3PDOA 1NAMB 4KRNA 4ODHH 3OAUL 5IGXH 2E5EA 1FL6A 2D7QA 4M62L 3BRDA 3QNZA 5ICXA 1NUGA 3QFJE 5CKGA 3RPIA 4DVRL 5MHSE 3X13B 2UUDK 3E6FA 2PTUA 3VE0A 2W65B 1NGYA 5DHXB 2R0WL 1K6QH 1I8LC 2R0LL 1ONQB 2BNQE 3OJDB 2GSGB 5D6DC 4ZXBD 1D9KD 1FIGH 3C60D 3LS4H 2DWEA 3SBWC 4WUUA 1RMFL 3MJ8B 3UTTD 3KPMB 5EBWB 1CIDA 3BGAA 3EJJX 3ZDYE 3CFJA 3PE9A 5AYUL 1C16A 5F1KC 4Z5RB 4FZ8L 3QDGE 4PP1C 3MV8A 1T2QH 2HFGL 5DSCB 4FN0A 5FM5M 5HDBF 2XA8L 1A4JB 1AR1D 4XP9H 4XCCH 2JELL 3P9LA 1XIWB 1ZLVH 4OSUH 1V05A 2DJSA 3SGKA 1MHPL 4IDLA 5AWNL 3IXAA 4X9HA 4MHHI 3GIZH 2R23B 4NQDB 5T1LB 4OM1H 2Y1VA 5AAMA 1YMHB 3OPZL 3UC0H 3IVKB 4XI5D 4ELME 3MUGB 5F8RC 1X4YA 2J8UE 3CVIH 3UX9B 3CXDL 4JY5L 3EO0A 4U6HA 3WUWA 4ENED 4EOWH 1B0WA 1O7SA 3RFZC 5CJOH 3MLZL 3BN9C 4NP4H 2CLRB 3BDYL 4X4MA 4HIIA 2QL1A 4ODWA 1FYTB 1S7XA 3FT2B 3UAJC 2Z31B 3ZYOA 3HLAB 4MS8D 2OTPA 5IW6A 1BAFH 4HXAL 2CDGB 2VLLA 3MJ9A 3VG0L 3B8SA 2P46B 5F1IB 1SJEA 5F9JA 1JL8A 4YWGL 1WFTA 4D9RD 4PJHA 3WS3B 2V9TA 5IJKA 2VQTA 2Q6WB 4HAGA 2PTVA 4Y2DD 3L5WA 25C8L 4WFGD 3G5ZA 1GGBL 4NJAH 2D03L 3SGEI 4DFIA 1EHLH 1G0XA 4BH7A 2XN9D 5HGHB 1QSED 2NZ9D 1KIPA 4P23B 1FO0L 2NYYD 3C2AH 4GLRI 4ZTOH 5JPNA 3GUTB 3GO1H 1WC7A 5BMFH 5B8CB 2ERJB 2YD2A 5AZ2H 3PJSA 2X05A 1N6UA 5E8EB 3LKRB 3TYGH 1OSPL 3IDJA 1A2YB 4MX7A 4OZGB 7CGTA 1KCRH 1MCPH 3VW3L 4DKAA 4QRRB 4PYHA 4GBXB 4GRLB 5DVLA 1YEFL 2R2BA 3W0WB 4LCCA 4OT1L 1UB6B 5KSAD 2MCPL 5TE4L 1I7ZA 3W81A 3O3AB 4C56B 5L2KD 2OP4H 4K3GA 2FB4H 3MMEA 3Q6FB 4M7KL 2AJXH 4ORZC 5CEZH 3ARVA 1PY9A 1H3GA 5E8OA 3D3VA 4JFOB 1AO7B 3DRTB 4V1DE 2GJ6B 4QEGA 1TQCB 2D2OA 2QHRH 3WCYA 3QXUA 4LPUA 5SWSB 2H32A 4F57H 5D6CA 1YA5A 4LHUA 1F4YL 1FZOA 1JTOA 4JR9H 4M7LT 4ZO9A 1RZKC 3EUUA 4L3EE 1HHIB 5GGQH 4CVZA 5EU5B 5JQ6H 4AMKL 2F8OA 1BJ1H 4FFVC 1OAKL 1CLOH 4R7DB 2IG2L 2Q20A 3DO3A 3HTLX 3HI5L 5HY9A 5JXAL 1WZLA 1V5JA 1IAKB 1CFVH 4L9LB 3QT2A 3N06B 3KYOA 4KTEL 2NY2C 3GK8H 5DJCA 1KTRL 4UI2A 5MEPA 2EDYA 2WUBL 3S35X 2NW2B 2BHUA 4XPAL 4ERSL 2EE3A 3MXVH 2DKSA 3PWLB 1KCLA 5BVJA 2CXGA 4HWEL 4MNHA 1ZGLP 4YBHA 5D1QD 2XWBB 2APXA 3QUYC 1UXWA 3EGSB 1JPGB 4PRHD 4ZOAA 3MLXH 5CJXA 1BFOB 1A02N 5M7QA 5E08L 3MA7A 5IESL 1BHGA 3CFCL 1OTSC 4NKOA 2DTMH 1A7NL 4OLWH 3C6LD 1EAPA 3INUH 1L9NA 1H0DB 5INCA 4CMMA 1P7KB 3ARGD 1A0QL 2VXTL 1S7VA 3DX9A 3SDDB 1S9XA 4X6EA 3RU8H 2WWMC 1A3QA 2ADGB 3QYCA 4BSVB 5CWSA 3PWUB 3S96A 1BJ8A 4XNXL 2ADFL 1UEYA 1UM5L 5EN2B 5C08D 3TC9A 2G2RA 2OL3H 2A6JB 3PP3H 1JP5A 3RY5A 4NN5B 1FH5H 4B41A 3FT4B 4Q6IC 1U8LB 4Q9BA 4MA1C 1HH6B 1JGEB 5LWYL 5E8PB 2CDFB 2XWTB 3QIWA 3SDCC 5I30L 1EK3A 3B9EA 4L4TA 3OGCA 2FL5A 5T3XE 3G6AB 5GRYA 4YAQA 3F5WB 4LFHG 1HWHB 3VFUB 3GSQB 3NCJH 4L8BB 3GI9L 5JOEA 3VCLA 2W60B 4Y16A 5F7LB 3UTSA 3VXRD 5J12B 5E6ID 3ARQA 1NKRA 2DBLL 4P2OB 5DS8B 1XR9B 5C0RH 1INQA 1XF1A 2VDRL 3QQ9D 3SDAC 1YEHH 4QXGH 1GZQA 5BXFA 2DWDA 1G84A 3MRCA 4BFGA 5CZXD 4Z76B 2FJHB 3RAJH 1J12A 3D69A 1HEZA 4ODSL 4DGVL 5J3HC 2FIRT 2DQFB 4KK6D 1ZEAH 3BXNA 3GRWH 4KMTH 3VXTB 3DI2B 3GIVA 1X4ZA 3SE9L 3ZKXC 5E95B 4JDVB 4HWNA 1XT5A 2ZOKA 4PGDA 4PJCE 1FAKT 4GAJL 3UTZB 2OJEA 4J3UA 1RULL 4DFHA 2X4OA 1NKOA 4G9DA 3JV6A 4PJFE 3RGVA 5JR1H 3F58H 5EULV 2VITA 1OSZB 1UH2A 5D2LE 4A6YL 3FMGL 4FP8L 4NQSB 3DXAA 1OF2B 3RVWD 1X5GA 1DFBH 1UA6H 3VFGH 4N1CA 3MOAL 3E0GA 4PRNB 1FN4A 4OB5H 1PD6A 2C1PB 2ZJSH 4CKVX 4YFLF 3U2SB 4GMTL 4HLJA 4F7PB 4K8RC 4FABH 5CJ8A 3HB3D 2V5MA 1KGCD 3O8XB 4XCYB 4ISVA 3MZTA 1NC2D 2QQKL 3WIIH 5MEOA 1JPFB 2A6KB 4LLDA 5E0QA 3VFVA 2YBRB 3QZWG 3BGMA 3PQYB 1U8PB 4LSQL 4UQ2B 2COQA 4LRIC 3D18B 3KYNA 3TJHC 3DGGB 3G5XA 1Q9LA 1T22A 4KI5C 4NT6A 4N0CD 3T0DA 4WI5A 2NY4C 5FKAB 2PETA 5GISH 3FTGB 2R9HD 3IDYB 3N85L 3DHJA 1DVFA 2VABA 2YOCA 4ZAKD 5BZDA 1ZANH 3UDWA 2EYTB 1A3RL 3L6FA 4JO4H 5MENE 4HPYL 4MAYC 4YDKL 4LP4A 1J0IA 1KYOK 4Q9RL 1HCVA 3E1F1 2A77H 1MAML 2HMID 3I6GA 3MRLB 4I77H 1P4BH 4U0RB 1UWGL 4WY7L 3B9DA 3H9HB 5DURD 3KR3H 1JI1A 2A73A 3CMOL 5E1HB 1Z5LA 2AK4A 3MRQA 3MV9E 5HHXL 4ZS6D 3SO3C 3CUPB 4B53A 2H2PC 1ZE3C 1ZS8A 3H9SB 3KPLA 3AS3A 4QTHB 4AIOA 1I7RA 2CKBA 1RZJH 1MCKA 2NTFB 3EOAB 1VPOL 2ARWA 2K1MA 5C86A 3JV5A 3AROA 5KZCB 2DTSA 5CINL 3KLHC 4LSVH 5IQ9A 3WSQH 1NCDL 4OZHE 1DL7L 5HYJB 4PJGB 4KUCF 2DIBA 1H3PH 1GH7A 1V7NL 1ZTXL 1IAII 2NY3D 5D72L 1I8IB 1DBKL 3D39A 1JIBA 5HHOD 1RZ8A 4NQVA 3AS0A 5K9QG 5IFAH 3T0EE 3U79A 1RIHL 2F8VA 3D2UA 1JWSA 5ACZB 4S2SA 4J4PA 1KEML 2VLRA 4XCNA 4NM4H 3B3IA 1H8OA 4WFFD 3QXAA 3QG6B 3LZFH 5BZWA 2P8LB 4HT1H 3QI9C 3RP1A 2VLKA 2OX5A 2EO9A 5DZLA 5FYKE 3RTQD 4Z9KB 1ZLWK 3B9KA 2HJKB 5D2NE 4ZODA 2CRYA 4QHKJ 1JV5B 3MJ9L 1QSFB 3N9GH 2DDQL 3T77B 4PJ8B 2V5RA 3I02B 1HHJA 1OGTB 4LHUD 3MRNA 1MCLA 4ETYA 3QEQA 4PB0H 3D0VB 5F7EH 4NYLA 4N1HB 2Z8VC 2J12B 5BQ7B 2R0ZL 2F19L 3OR6A 4YHMH 4HIJB 4HKZB 2PYEB 4XHQA 1RY7B 4FXGB 4Z95L 3JWDC 3GHBH 1FL5B 3T4AA 3MRIA 5GGTA 1A6AB 1W72B 5EZIH 2WZPD 1F2QA 4PS4H 4BZ2L 1IGIL 3BFOA 3VRJA 4AH2A 1NFDA 1TVDA 4HGWB 1QQDA 1EEZB 1FGVL 1ND0A 2BVPA 5CGMA 3F6LA 3LVEA 2X89D 2EECA 4FNLH 3WKML 3CFIC 4HS6A 1MCWM 2VKWA 2FBOJ 4MA8H 3PWNA 2FATH 3BH9B 3I6LD 2G5RA 3D85B 4JM4L 35C8H 3GMQB 4WJ5B 2FHFA 5C0AB 4TOYL 4XB8A 3T1FA 4GUPB 4DN4H 2B2XL 1ZVSA 3BUYA 2V2XB 3DVFA 5EG6C 4RFEA 2Q7NA 4ZPVB 1HILB 4OZ4B 2A83B 5B38A 4RAVB 4O9HH 1A5FL 1ERNA 4BZ1H 1DUYA 3FQUA 5HYQB 3K4ZA 2HFEA 4QY8B 1E27B 2FJGB 2X4NB 4WO4C 5A1AA 3K1KC 1CU4L 1VESA 1JF1B 1G9MC 2DQIL 2PW1A 3ZL4L 4LAQH 1C08A 3QULA 3QIWD 2YWZA 3HNSH 5ERWA 4RGMC 1ZT1B 5EO1A 5F3HA 5GGSY 2Z35B 2FEEL 4G8GA 5H94A 2NY5L 3NAAL 2EDRA 4KKLC 3L7EA 1IBGH 4XP4L 3LCYA 5F9AC 1CGSH 3WBDA 2X1XR 5EDXA 4MZ2A 4NBXB 4P2RD 2VLME 3QDMB 1XGQA 3GSRA 4G7VL 1KIRB 3C6SB 3C9NA 3VH8A 4CN6A 1J0YA 1F6FB 3BX7C 4KMLB 4LSSL 2FEDD 3DI3B 3OZ9H 3RWJB 4KKBD 3CX5K 2FECL 3STLB 2FX7H 4DGIH 3QRGL 1U8QB 3MFFA 3ARBC 5LGHH 1EXUB 4DZ8B 4PLNC 4TSBH 4IRJA 1PGRB 1N59B 4P4KD 3QZWB 3M1BA 5F7WC 3SQBA 2IBZY 4ZTPH 3UTTB 2NY7H 1NMBL 1U8MA 3HFML 4ZUWB 1KTLA 1KJ3L 4O51A 3P0YH 4M5ZH 2FWOA 5BW7A 4FQIL 4MXWH 1LE9A 3TA3D 2D7MA 5FM8A 2VL4A 1CXLA 1N6QL 5JHDE 1CDHA 3TFKC 3MGAA 4X6DA 4Y7MA 1W2KT 4GRWE 5IG7B 2XKSA 4E9LA 3AXLA 4QYOB 1FO0B 2EC8A 5BOZG 1IC5L 4S10A 1WSST 4P46D 3VXUD 4HUXA 4JO3L 1RJYA 2YPLD 4JEGB 3MRKB 3EYOB 4FQ1H 4X4XA 1QBBA 2EKJA 2B4CC 2YK1L 1OAUH 4XMKH 1KN4H 2IMMA 4X4ZA 4X7SL 3BZ4A 4UV7H 3GNML 4YX2H 4I0PD 4XBPA 1QFUH 5MP6L 3MGTA 4JFFE 3KNBA 4X80L 3DXAD 2F53A 2F9BT 2CDEA 3P2TA 4GW4A 1AFVL 2D7OA 3Q1SL 4P9HL 3WXWH 1M7IA 4ZD3L 4KZEH 5ESQB 5HPMB 3I6KB 1J1XL 3OKYA 2V9RA 1QSZA 5DYOA 1S7RB 3CVHH 4K3JH 3QXVA 3E6HA 1HSBB 1YQVH 4M6NL 1LEGB 3EYFA 1OAYH 5C0BE 3K74B 4OZIA 3TVMC 4IRSC 5F89B 4KPHL 4HUUB 3TIEB 4MNQB 1PZ5A 4BFIA 4I2XE 1GOFA 3OKOB 1YEKL 3LEYL 2XTLA 4L4VE 1A6ZB 5CHNA 4QF1B 5DLML 3FO0L 5DRZB 4JG0L 4H8WL 5ILTH 4HK3N 3HA0A 5EZJA 5H35B 2P7TA 3BQUC 3GMRA 4JDZA 2XZAH 1N2RB 4ZOEA 2A2QT 2J6EA 1AY1H 4OD2A 1FZKA 3T8XA 5GSRB 4NKDB 3SKMA 3DNKA 3GSNH 5DWUL 3Q3GA 4DVBB 1UFUA 3UROR 5F9WC 3IFPA 3O4OC 3GB7A 2ZCHH 1EHAA 4MD0B 3HG1B 4DEPB 4R4BA 2WIMA 3G5YB 5DQDH 3UJTL 1D5MB 1NFDF 2MHAA 4OKVA 1M6OB 4U1GC 2WQ8A 1IKFL 2I24N 2PKDA 1M7XA 1QYGH 3ALPA 5FDWB 5ABDE 5I16B 2A6DB 4CW1A 3IKCA 3IFNH 2DIJA 1Q72H 1FORH 2NY1D 1CE6B 2PXYA 3ZKMC 4S11A 3ZTNL 3VGAC 1FVCB 4LQFH 3LSOA 1IGCL 1D7FA 4G3YH 4MD4A 1W8OA 2OBGA 2WLYA 1BVKA 4KY1L 2WANA 3GEWB 3NVQA 1BJMA 4OLYL 5DDHB 1MRDL 3MV7B 1X5FA 1DBBH 2MNUA 3AM8A 4XMLL 5DEFB 4DUVA 2O26U 1X5AA 4KJYA 3GMOA 1K2DB 2GT9A 4EIZC 5KJRL 1N3NB 5CMAB 2F5BL 2VLRD 4EDWH 3W5NA 4KTDL 5DJZB 2EH7L 4FFWC 1GXEA 5FGRA 2Y5EA 2IPUK 5F9OH 1S8DA 1GOHA 3TBWA 4EXKA 5DC0A 2VZTA 1FPTH 4N90D 4U1JA 5SWZE 1LO0L 5H37H 1V3MA 3ZTJH 4QCIB 5JW4M 2QR0A 3LKSB 3V5DA 4K2UH 3FT3B 1AGEA 4UIMA 2CUIA 3PWPA 4M7ZC 5DMKA 5BO1L 1HKLL 4KHTL 3G04A 2CKBL 2VE6B 4FFYL 1CF8H 4I9WD 4XX1G 1DQTA 4QGYA 1LMKA 3OBAA 4FQXB 2KUTA 2JIXB 3CGTA 3ARDC 3FONB 4QWWD 3KYKL 3V52L 3KXFE 1ETZB 1NL0L 1CXEA 1J8HA 3VJ6A 1HINL 3QWQB 2AKRA 5BJTB 4CVWA 4GMSH 4UUJB 1FNGB 4PRIB 1PKOA 2Y4SA 4LNVA 1HQRB 3N1GC 2EDDA 43C9B 1AQDA 1I8KB 4JGJA 3F7VA 4ODXA 5CP3H 4BJLA 3MCLL 2D3VA 3QQ3B 5I0DA 3C08H 4QRPD 2ADJB 1Z9MA 4UOJA 2X10A 3EYQD 4X6DF 1HN1A 3MO1A 4C56E 4P5TA 2HH0H 2I9LB 3TO4C 5T5FH 3OB0K 5I1CL 1NANH 1YPZF 3TBTB 1QPXA 5GQBA 4A6YB 3T0EC 1MY7A 1G7MA 3LEXA 4KKAC 3VXQB 3RWDB 1QLEL 2H6PA 2FO1A 5FB8A 4RQQA 4XAWL 3QDJA 3FOMA 4JFYB 5F7MC 3KVQA 4I5BB 4JRYD 4M4PA 4KRPB 3VXSA 4JFEA 5I8EB 3O9WB 3C5ZB 4ZMAT 1CICB 2R2EB 5J1AB 4MDIB 5GS1A 2FH6A 5IGXL 5I8OH 1R3HA 5D2NC 5IB2B 3W11C 1J1PH 2EC9T 1U9KA 3QJFA 1RIVH 1ZHNA 5FKPB 3GKZA 5T3ZH 4OZIF 4G8GD 5C2BH 5E94A 3ES6A 4FQPA 4MAUH 4G8EA 1HYRC 4RFOH 1I9IL 5DJAB 1P5VA 3FRUB 4JPIA 4FS0A 4ODVH 1MHCA 4BUGA 3LS4L 4XCEA 4Q0XH 4G8FA 2J88L 3A67H 4UBDD 3O6FC 1YYLH 2R1WA 3QNZB 3QIBD 3QNYA 1I85C 1QLFA 1UWEL 5ICXB 3RPIB 3QCTH 3E6FB 2VDNH 3HUJE 3VE0B 1E6JL 3KPOA 5I1IL 4BM7A 1NGYB 1FNEA 4IRJD 2RB8A 5CD3A 3ILPA 4LVNC 3VDCA 1ZT7A 2DWEB 1C1EH 4WHDA 4OSUL 4WUUB 2VYRE 2UZYB 4P2QE 4N5UA 3CFJB 3GIZL 5E4EC 5C09A 1XF5A 3KPRA 3SGDI 4YBQC 3V6ZA 1T1YA 1ZK9A 3MV8B 1QRND 5GGRY 2AJZA 3CVIL 3ULVD 4QLRA 4EOWL 4R97B 1BZQK 3BI9X 1WISA 4K7FA 3P9LB 4UNTA 1D5BA 3PGCA 2FX8L 5CJOL 2BFVL 3BD4A 3B2UC 4NP4L 2R29L 4R2GD 3VDAA 1CGWA 3IXAB 4POUB 3EOBA 1EA9C 1WAAE 4PBWD 5I1AA 2XNAB 1TXKA 2B0SH 1T4KA 3KAAA 1FP5A 1AC6A<