3IU3A

Crystal structure of the fab fragment of therapeutic antibody basiliximab in complex with il-2ra (cd25) ectodomain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWIKQRPGQGLEWIGAIYPGNSDTSYNQKFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of Fab fragment of Basiliximab
publication title Structural basis for the blockage of IL-2 signaling by therapeutic antibody basiliximab
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 215
sequence length 215
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2009-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iu3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iu3A02
4PB0L 3SDAC 2W0FB 1P4LB 3L3OB 3PGFH 3H9SA 4ZS7L 4LBEB 3KYKH 2CK0H 3O2VH 5C07B 4NZDA 3ARFA 3MOQA 1A4JA 1V3LA 2BOBA 3K2UH 1H8OA 2IAMB 4P46C 5F9DC 3VXRA 4PRDB 3S34L 1AKJD 3OZ9L 3JTSB 4E41A 2GSGB 2K3TA 3GMQB 3GK8L 3QWOB 4OFYA 3NAAH 1QBLH 5E8OA 3MREB 1PLGL 3HUJE 5DZOA 1OQOA 3F7PC 2XG5A 3OKKB 4JDTH 1S5IL 5EC2A 3EYFA 3N1MC 2A1WH 2ENYA 5JHLH 4M5YL 5DR5H 1HHIB 2GEEA 3WLBA 3L3KA 5C0BB 2DM3A 2PUQT 2VB5A 2RIKA 4MJ6B 3U1SH 1ERNA 2DTMH 4K2UH 4BFIA 1LNUA 5IK3B 1RIVL 2HMID 4TNVK 3LKNA 5JIHA 2OL3H 5T5FL 1UH3A 2W9DH 1RIHH 3FN9A 4RGNE 5ISZA 3SOBL 4BQ9A 3OKOA 1DQLL 3DRQB 2VR5A 1TIUA 4YZFE 5D7IA 2P8MB 3I6KB 3PIQB 3HNVH 2B20A 4RAVA 3CK0H 4PJ5B 1NC2A 5GIRA 4BZ1H 1FIEA 2NR6D 2VNCA 3KGRA 3FFCB 2APTA 1P4IL 1YJDL 2BNQB 1RHFA 1YEJL 3B5HA 5FO7B 4GKZB 2K9UA 3N06B 2GW5A 1AIFB 3WKNA 1FORL 3D3VB 4YBHA 1U8NA 2NY5L 5I16B 3TCLB 4Z7WA 3PV7A 2AXHA 1NUDA 5EU4A 4BZ2H 5DJ2B 5C0CA 3QG6B 3H9SE 3QEQD 2LVCA 1A7QL 3EO0A 5GJTH 5DDHA 3ULUE 2GKIA 5EB9A 5EUKB 3QUZA 5E2VL 4WDIA 1MCOH 2NY2C 3QCUH 5LQBH 3MV01 4RMQA 1JUFA 1I8IB 5K9QG 5T5NF 1NGZA 1FNEA 3S7GA 5E6YA 4WO4A 1LEGB 2WLZA 3ARYA 1LP9B 1J0ZA 5L2JA 5C09E 1IMHC 1FBIH 2BNUA 2AV7B 2F53B 2HVJB 3U48A 3B9KD 3W0WE 2EYTB 1JZ2A 2B7DT 1XGRB 4YWGH 1G7JA 2CKBH 4XCCL 5EO0B 5I1LB 5EOCJ 3BH9B 3OAUH 4NUJA 4X6EA 5ESVA 5HYIA 3RDTD 4CN6A 3Q6FB 4HT1L 5ALCH 5IQ9A 4DEPC 4K7FB 3SE9H 3IDYB 1T0MA 1BVLB 1NUGA 4OCWH 4PRHA 4M7LT 3DX8A 3R06A 1E4JA 3VXNA 2DDQL 4MJ4A 5JW4R 4LRIC 1OP5H 2X1XR 3U0TB 3OAZK 4H1LA 4JM2C 4Z7OF 1NGPL 4U4BA 4ORZC 4X5XB 5ISZE 2R39A 4GT7A 1ZXQA 5E8NA 2EE6A 2C1OB 4R97C 1A6VH 1MIMH 1OAXL 4PJDF 5GGVH 1KENH 2X7LA 2VZSA 5H37H 4B53A 3HLAA 5EZLA 3MLVL 1YYMH 1J0YA 4NP4L 1T0NB 1B88A 4B5EA 5C0CE 2Q20A 3OHXA 3ZKXC 5GZOD 5F7HA 5JW4M 4PGBA 2DWEA 2WWMC 3EJYC 4LCWB 3TVMB 1JYXA 2DKMA 4FFWD 3GIVA 1MJ7L 4MD5B 1OGAB 1HZHH 3LMJH 3U4EB 1NPUA 1V8HA 2ZNWA 1ZLSL 5I74C 1INDH 5DEFA 3WFHA 5ICZA 3BPLC 3GSQB 3KJ6H 1OAZL 3RNQA 4WW2F 4DKDC 1FSKC 3T77A 2VISB 3TIEB 1AGCA 5ADOH 3L3DA 2JB6A 4ZQKB 4OZIE 2DB8A 4PJFE 1N3NB 5LAXB 3WFZA 2BC4B 1IGML 5FFLA 4JPIB 2APWA 4K3GA 3T2QA 3B9KB 1RUAH 3FAWA 3PWUA 3LY6A 1DQJA 4X6FA 5I75C 5DQJB 3IDNA 1L7TH 4ZUSA 3DSNA 3RDTB 2WBJD 1RSFA 4Q0XL 3G6JE 1U3HC 5DJ6B 3IKCA 3CCHA 5FKPA 4RA3A 3P0VH 1JPFA 2ITDB 2OR8A 3CLEH 2EDQA 1CDBA 4ZMAT 4QOKE 4U49A 1I1FB 4GRMA 2Y36H 4JO2L 3TH3T 1OVZA 4BA8A 1ZSDA 3ABZA 5I66B 4MHHI 2Q76A 5IEHA 2Q8AL 4BSWA 3S4SB 1BJ1H 2XQBL 3FT4B 2BP3A 2IADB 4PJCB 3ARBD 2FLBT 3OR6B 3MGOA 2HFEA 5J8OA 1ORQA 4HKZA 4KWUA 1TNMA 4C83A 4MJID 3SE3C 4KGLA 4EVNA 1AGBB 4GRWF 4RBPK 1I8KB 5JXED 5CJBA 3ROOA 2FHCA 1T89C 5I1KL 2R2EA 4MCZB 2ZUWA 5JIPA 3NPSB 2NY3C 4Y88A 4EI5C 2FJFA 5CWSA 5KANG 5KN5B 3IVKA 4YE4H 3K74B 4HBCL 2NNAA 4LLMA 3AY4C 1J5OH 1XF2A 4P48A 2J5LB 3CVHH 5IMOA 1AHWC 1I75A 4PS4L 1YNLL 4G9DB 4TVPE 3AS3A 4P3CL 1CGVA 2JJTA 4ZS6C 2AP2A 2D03L 3MRFA 4MVBD 3WIHA 4GH7B 3BWAB 1P5VA 3F6LA 4WI6A 2WWKT 1A5FL 5CGYD 5GRJH 5L2KD 3EYVA 4PV9A 2IGFH 5J89A 1LO3L 1LE9A 3V6FB 2YPKB 4M3KB 4XP1H 3TYGL 5IB2A 3RWHB 1KJ3L 2AJSH 5SX5K 4QHUB 4U1GC 5EC1B 4AIOA 1D3CA 3W39A 4ONHB 4HIJB 1GC1H 5FYKD 2HJKA 4MA8H 1EEZA 2CDGB 4DKEL 2EDNA 4ZOEA 3KR3H 5D1QC 1H3UA 1HXMA 1GCFA 4WNQB 1I4FA 4HIIB 3QIBD 5IMLA 4KRLB 4S0TD 4YFLI 4X99A 5C0IA 1MLBA 4F33A 1ZS8B 3L3GB 5F7FA 3MRDA 3B2VL 5IBLC 2DQHH 2VXSH 1EMTH 3STLA 3Q48A 3EHBC 3VFVA 2AJYH 2NX5D 1XCQB 3OR7A 4OF6A 4YHYC 5FXCH 4JFOB 3ARDB 3MLWH 2PTTA 1YUHB 3MLXL 1KJMA 1ZT7B 5SWSD 2DYPB 5MENA 3AROA 3C5ZC 3WL9B 4GKNB 2YD4A 5H35B 4AG4H 1D6VL 4R7DB 1YEEL 5DRWB 4JFFA 2F5BH 3FOLA 4MJIB 1KIPA 1C12A 3QQ4B 5DJDA 5GRUH 1GHFH 2NMSA 5I1DB 4YDJB 1WC7B 1E28A 2NTFB 2AK4D 4NQTA 4QGTA 4M48L 4OB5L 2NW3A 4KQ4H 3V5KB 3FFDA 3KLAB 4M7LH 2OTPA 1RJZB 1JV5B 1C16A 2YK1H 2FX9L 5DUML 2DWDA 3PHSA 3D0LA 3MLRL 1DLHB 3L9RA 4PYHA 2IC2A 5DXWA 3FQNA 3ZSSA 4Y4HB 1NCDL 3T65B 3V5HA 4G5ZH 4YHOH 2J2ZA 4PRAA 5I9QB 3CNKA 4M1CD 3U9UA 1JPTH 2HT4C 4O2FB 3VXUB 2EE9A 3F58H 1Y0LB 4M4RA 4KH2A 1IE5A 4OGXH 1NJ9A 4AENB 4HLJA 1FQ9C 4QXUH 3FB6A 4MXWL 3QXWA 5EA0L 3MACL 3CDFA 2Q3AA 3ALPA 1D6EA 2NY1C 2VAJA 4U7MA 2UZIL 1CCZA 5FGBA 1P2CA 3NGBB 3QDHA 5C2BL 5B39B 3O6KH 3D9AH 5HGDB 1J9CT 1RV6X 1IQDB 2X70B 3QNXA 3QIBB 4G6FD 2DQDH 3BI9X 3G6AB 4QTHB 1F4YH 3GJEA 3T0WA 3GMRB 1BQUA 5IT2L 1L7IH 2EO9A 2FH6A 5JQHC 3WIFA 5CEXA 3H2WA 4Z0BH 3RVXD 3NBNA 1QO3B 5FYJH 4AEHL 1A6ZA 1EHLH 1HQ4A 4KDTC 1RZGA 2SEBA 4L4VD 1QOKA 4R8WH 4CU6A 1TZGL 2XY2A 4Y1AD 1BVKA 1NMCB 4JFFE 1OSPH 1EERB 4BJLA 4XCEB 3CFBB 3OKMA 3TBYB 3HNSH 3IYLW 4JB9L 4K3EH 4J2XA 3EDEA 3LKSA 1BECA 5EULV 3P77B 2BSRB 4HWEH 1J18A 4LSTH 4YBLC 5LXGL 4HFWA 3P4OA 4FABH 3L3IB 3I9GL 3N1GC 2V2WA 3DBXA 3IF1A 2FO4B 4O02L 4XWGH 1JF1B 1TCMA 3E2HB 4PGCB 4JG0H 3SHSA 1KCRL 2VXQL 3O6MH 1S7QB 3X17A 2F5AL 2MHAB 1ADQH 3MOBL 4RMTA 2OZ4H 5IVXF 1RURH 1DLFH 2VQ1B 1FNSH 3D18A 1YN7A 2VLMD 5HYFA 2VLJD 5DHVH 3A6BH 4PRPE 1O0VA 5E2TH 1E6OL 3BP4B 4ONGL 5B38G 4WV1A 4MNQB 3ZKMD 2CIIB 4NO0D 2DI9A 3DV4B 2J6EA 5E1AA 2H3NB 3FRUB 5HD8C 3OXRB 4G9FD 3HMXH 3MCLH 2IAND 4X4XB 4TUOB 3QI9D 3SKMA 3N50A 5FYKU 5BZWB 5IFAL 5DJYB 3WIIH 1PKOA 4IMKA 1Q94A 4LHUB 2CO6B 3EOBB 1WFOA 4QY8A 2BNRA 1MLCA 1P6FA 4NWTH 4ZO7A 3LQAL 4W6XB 4RX4D 3NA9H 2F54E 4IOFC 3P73A 5DD6A 4LQFH 4BELD 3UPAA 3I6GB 4HWNA 4HHAA 4NQXA 2JJTC 5IW1A 2CIKA 4JPVH 1MY7A 4C4KO 3UTTE 4RDQG 3L95A 4NJAL 2OJZH 4KAQH 4HUXA 1N0XH 5FYJD 1UM4L 1CLYL 4HH8A 4WW2C 5E4EB 1YEIH 2E6QA 4N5EC 5F9AC 1QFPA 3LD8B 4NQDD 5HJ3A 1YECL 5E2WL 4GG6F 1ND0B 4Y1AB 2B4CH 5A2LH 4ZDHA 5D5MB 5CEZH 1OL0A 1IT9H 4AEIL 5JDSA 2B8OT 3G04A 2Q6WB 4OIIL 3IJHA 3ZYIA 5D4QA 5J12B 4F7EA 1IGCL 1LO0L 2CR6A 3HI5H 2YZ1A 5GGRA 1A8JH 5CD5D 3F5WA 4WENB 5HYSB 4XNZB 3GSWA 5KOMC 4N0YH 4P9HL 1S7XA 5D1ZD 5L7XL 2EDHA 5TQ2H 3RNKA 3PDDA 1LO2H 1RZKL 5IM7A 5TF0A 3DV6B 5E2UH 3D2UA 2R0LH 2LFGA 1SM3H 3V7AG 5KVGL 2OSLB 3O9WA 3BN9C 1U93B 1GAFH 1U8KB 3DVIA 1FVCB 4NO0B 1HIMH 3H3BC 1V3JA 5FGCE 1TQCB 3ZTJG 5JZ7D 2R0KH 4JVWA 2IANB 4LASH 1ZANL 2VDMH 1QYGL 1WFNA 3JTTB 2D7NA 4PJ8B 4C56B 2P5EA 5GPRA 4R4NC 2CRYA 3ZE1F 1WTLA 2JB5L 1S7RB 3B6SA 3V4VL 1II4E 2OXGA 4MXQD 2D4DA 5D7KD 5AAWA 2DQTL 1AGFA 3CPLB 2EIBA 2QBWA 5DD3H 2R1WA 3UBXI 5HGGS 1KCVH 2ADIB 2ZPKL 1DL7H 3MLSL 3RBSA 3RIFK 1D5XB 4HUKB 2VLKD 2EYSB 2GITA 1I3RA 3SCMA 5ICXA 4MSWB 5I1HL 5K9KB 4UT6L 4PIRF 3U9PL 2P8LB 4HAFA 4HCRL 4L29B 3LS5H 3TIDB 2W91A 5D2LB 1JHLH 1AO7E 1VFBB 1CVRA 5CEZD 1V3KA 1KB5L 3VRLE 3BQUA 5B4MC 4PYGA 2R4SL 3O8XA 3WFCL 1JGDB 1KB5B 2O5ZH 4OZFG 4CVZB 3K0WA 1H3XA 4TUJB 3IRZA 1QRNA 5D72L 1EK3A 1UCBH 4OM0L 1KTDA 2AKRB 4LLQA 3AU1B 4PTTB 4PRBA 5E0QA 1IQWL 2AGJL 4YHIB 1NCBH 4P2RE 4UT9H 3SDXB 2HJLA 1DUZB 1HSAA 43C9B 1WBXA 4U1NA 3M8OL 1PG7W 5D1ZB 5L9DH 3OKLB 1MJJB 2XFXA 2G5BB 4HGWA 5DHYB 3PL6B 4XAKD 4YDLC 5IB1A 1ZHLB 1URLA 3TFKC 3G5XA 5IIEB 1NBZB 3VFPA 4GAJH 1MAKA 4U7KA 4DVBB 4GS7B 1RZIB 1FZKA 4HJ0D 4JRXA 3PWLA 2Y6SC 3BVNA 5EUOE 3RI5K 4QHLB 2W92A 2FCBA 1P7KA 4U1SA 4NFDA 3V52L 1H3PL 1NCAH 4QT5B 3QRGL 3I50H 1GSMA 4OD2B 1BM3L 4HV8A 3I3EA 2B1AH 4AEEA 1D5BA 4P4KD 1JPGB 6FABL 4U1HA 4M6OH 1QQDA 1LO5A 5C2UB 3SY0B 1PEWA 5EU6A 4D0CB 3E6FB 4NN6C 3QIUA 1QSED 5I2IB 3TZVD 4KRMB 4AM0B 2XYCA 2X4QA 1EGJH 5EZJA 4EZMA 4TTDC 5HHMB 4QEGA 1WEJL 4YDVB 4YNYA 4NT6B 4OT1L 1FYTD 4RA0C 4X5LA 4MA1B 3QQ9C 4Z7NF 3T0XA 5FO9B 1I9EA 1HINL 1OB1A 3WFDL 3ARXA 1SHMA 4MX7A 2DQIH 3TJHC 2VDRL 3MYZA 1HKLL 3GB7A 2OYPA 3FN0L 4NO3B 2A73A 2H2PD 2GY7B 5K33A 2P24A 2A77H 4Z7VE 1JNNL 5IUSA 3QZWB 4RFOH 3IDJA 3H7BB 4HS6A 1MEXL 5ERWA 1HSBA 1EV2E 4NN7B 2LU3A 3U83A 4DW2H 2DLIA 4K94C 1JMXA 4JRXE 4YHZL 4DZBA 4ODBD 4AEFA 3QG7H 1VEPA 4HKJB 2QV2A 2JIXA 3SDCB 3PDGA 3OPZH 3P40A 4Z7QE 4HUVA 4JQXA 5HHPB 1LDSA 1V7NH 2I5YL 1G6RA 2AQ1A 3FOMB 4IM8A 1HWGB 1MCRA 4WI3A 3FO2A 4JHAH 2AJVL 5TFSL 1WAAF 3QUKA 4LLUB 4DK6A 4P4KB 2UWEB 4NZRH 4GBXD 4MA3A 5ITBL 4ZXBA 1SYSB 2FL5A 3MTRA 3T2OA 5I76A 1ZHKB 3TF7C 2G2RA 1QD0A 4ORGA 3ULVE 3H42H 1CG9A 5EU6E 1WFTA 5DK2B 4P2QA 4MCYA 5ILTH 5HI5C 1B4JL 3MUHL 4M6ML 3C60D 3UO1H 2J4WL 4OD1H 2FHBA 4LEOA 1KELH 3EDDA 4PG2A 5EFIA 1YPZB 1G7IB 1Z9OA 4UQ2A 1QA9B 1V7ML 1R24B 1FYTB 1K4CB 2CRMA 2HLAB 4MD4B 4KK9D 1VFOA 3BZ4A 3QUYD 2AEQH 1R5IB 5EORL 4GMSH 4WFHD 2VDPH 5KSAD 4R2GB 1EVTC 4ODHH 2VLRA 2NQCA 1YY8B 3NCJH 1N5AA 5ICYA 1KJ2L 2HRPL 1BLNB 1KJ2B 4ZUWA 2D31A 1TQBB 1F6FB 5HYJB 2FZ3A 5D8JH 1OPGH 1YNTA 4K9EH 1PAMA 3UYPA 2R15A 2YPVH 2AXFB 1SJEB 3DXAA 3S4SG 1V5JA 3BZEB 3MBEA 3DO7B 1MI5D 4JRYE 4S1SL 1DBKL 4BH7A 4Y2DD 3BPCB 3CLFH 4I1NB 1AE6L 1DEDA 3JV4A 1L9NA 1U58A 3O8XC 4UV7L 4NSKA 3IGAA 1MWAH 5AD0A 2EDTA 1BQLH 1HHKB 1F42A 5C08B 4NNYA 2NY0C 5IWLA 3BIKB 3TBTB 1ZHNA 3MRIB 2ZP0T 1R3KB 2CUHA 3VFTB 2W0FA 1P4LA 4JDZB 3L3OA 4ZS7H 1D9KC 4WU7B 3O45B 3QDJB 2Q87A 4LBEA 5I1CH 5HI3D 1MCCA 3O41B 4RFEB 2ICWI 3VDAA 1F90H 1I3UA 2J3SA 3UEZA 3D39D 1B0WA 1E6JH 3ARGA 2CK2A 3HUJF 4PRDA 3S34H 3V0AC 1A3QA 3KPSD 3OZ9H 3JTSA 3ZL4H 4JZJC 3CAFA 3SKJH 2Z31C 4KKBD 1QLRB 2DBLH 3U7YH 1ZV5A 2VDOL 2CLZA 1PLGH 4MDJA 3RWJA 5FB8A 4OZFH 1PSKL 3T0VA 5CSZB 1DE4B 3N0PB 4M9OA 4J8RB 5GRZA 4GW1B 3VXSD 2IEPA 2VLRE 1CF8L 4M5YH 3WD5L 4QRPA 3KPRE 3BZDA 3MV8A 2VERN 3O2WH 4X5WB 2AEIT 4NQVB 2PXYB 3VFMA 25C8H 2Y4SA 5EH1A 1XCTB 3FQXB 4MJ6A 3O3DA 4EUPA 5IK3A 3SGDI 2XQYG 1TVHB 4JVPA 4X6DE 3OG4B 3SO3B 3QIUC 2P5WD 1A22B 3MXVH 1DQLH 1EEUA 3DXAE 3MUJA 4BZYA 1BHGA 4TUKL 3DRQA 3EOTL 4C59B 4IRZL 5I0ZA 4YPGB 4JO4H 4NHUB 3RPKA 4B0MM 4X6CB 4F7PA 4Z76B 2BY3A 3RGVD 3TA3C 1H5BC 4YHNB 2X1WL 5FO7A 3UJJL 3ZSTA 3R1GH 3W81A 1RVFH 2H6PB 3F7VB 4P5KB 3UJIH 3ULUF 3KHOA 4QLRA 1RZ7L 2YR3A 2MWCA 5D1XC 4PLKD 3VGBA 3QG6A 3ZLQC 3S36L 1RFDL 2IF7A 4OLYH 5ESAA 3H9ZA 4HKXA 4JKPL 1UM5H 4GOSA 5C07E 1H3GA 3O6FC 2PO6D 5E2VH 2ICES 2F58L 3DUUA 5DUPH 2H1PL 2H32B 5F9WC 1CE6B 5IKCB 1I8IA 1EUTA 1AKJA 4NHCH 1CL7I 3VD7A 1OAUH 4Q6IB 1WQVT 4KKCD 1LQSR 3LRSB 4S1RH 3B3IA 32C2B 1BZ7B 1TCRB 2AV7A 5C71A 2JCCF 2HVJA 5MI0B 2ATKB 3MLZH 4JDVA 3TBVB 1LEIB 1XGRA 4ZTPL 4XCCH 4EDXA 3OB0K 1OTTD 3LV3A 3PP3H 2JTDA 2GUOA 3VXSB 4XP5H 4HT1H 3Q6FA 1NAMB 4JLRA 3RTQD 3RVTC 3BKYL 4X6BB 2UYLB 2OLDA 5C0BE 3NIFE 3BJ91 4PUBH 4NRXB 1IC7L 4ZXBC 3VXOB 1WGOA 1BVLA 3QR2A 5JOPD 2ZUQB 3WXVH 2E8YA 5JPMB 1KT2B 1AD0B 4IOIB 1D5IL 4X5XA 1FG2A 2EXYD 1YA5A 3V9FA 4IRJB 1GZPA 3QPQD 4YXLH 2C1OA 3FZUC 4ODUB 4QTIH 4PJ5E 1MFDL 3HNTL 3IJSB 1G7LB 3FFCE 3DETC 5DA4A 4HUWA 3MRMB 4C4KT 3RGVB 5FF6A 4G6ML 2BNQE 4QWWD 1YY9D 3MLVH 1ZEAH 5I71C 3HN3A 1ZVHA 1FGVH 4V1DB 5M95B 1BX2B 1AQKH 3D3VE 1E4XI 1P69B 1X5XA 4Q9CA 1S7TA 5F7DB 1CT8B 1A6TA 3WFBL 1J12A 5LGKA 3GMNB 3UBXB 3HRZB 1IAIL 1G9MH 3LSOB 3MV7B 3TVMA 4QHNB 1OTUD 3U7WL 3NTCH 3IETA 3C6LC 4J4PD 3ALWA 2X9YA 1A3LH 3U4EA 1F45A 4XMLL 4OZIF 4KMLB 1SJXA 2FB4H 2BCKA 3GSQA 1OAZH 3TNMB 1M6OB 4HWBH 1AXTL 3V6BR 3PWPD 3TIEA 1HCVA 1LP9E 1HNFA 3MBEC 1OP9A 2YEZA 2BVUA 1NUNB 3BP5A 1N3NA 4IS6B 2F53E 4M7ZC 4Y19D 5TDNA 3RIAF 2C9AA 1IGMH 1NLDL 3TJEL 2AABL 1CICD 4C58B 4MQXC 3QDMB 3B9KA 2KQNA 3KYNA 3L1OH 3QA3B 5DVOA 4RMSA 5DQJA 4LSVL 2CDFB 1G0XA 2BVOA 1A7OL 3WEXB 3RWIB 3RDTA 1AI1L 4D9RD 3RTQB 5T33H 2A0LD 3BAEL 4LHUG 3VXMD 3LHPH 1EAJA 5F8RC 4BQBA 1OSZA 1LK3L 1GPOH 4JFXB 3RU8L 3VMNA 4QGYA 4UILH 1I1FA 5DO2D 1T1XA 4LP4A 3ARGC 1Q1JL 3IDMA 8CGTA 4IOSD 1T21B 1G9NH 3KS0J 4HLZG 3GBMH 4F3FB 1FO0L 5E24E 3FQRB 3WJLA 1WCBA 2W0KA 1ZK9A 1K9TA 1FO0B 3W11C 2VMFA 5J7CC 4M6NL 3OR6A 1JTPA 4U1JB 5FM5O 3H9HB 1N7ML 4ALAL 3L7FA 5GS0L 1DTUA 1KB9J 3QJHB 2BSSA 5I1KH 4X0KB 3K81A 4LCWE 4MGXA 3FHQA 4O2CB 3W9EB 5KN5A 3K2MC 5HYSG 4HBCH 5FA3A 4PJHB 3NFSH 1OGAE 4JJ5B 5MEPA 5GGUB 1ZKAA 4QRRD 3OGCA 4F15B 5SWZD 3RL2B 1KPVB 1VEOA 3S5LB 4OSUL 4P59H 2I9TB 4G8FB 5MEOB 2R29L 5MEQB 1UXWB 3T2NL 1MCBA 3BWAA 2DF3A 2JJWA 3O3BB 4U0RB 4CVWA 2D0GA 2J8OA 5DZNA 1XGPA 4WI8A 3V2AR 2A6KA 4HKBA 4LIQE 5EIQA 2VDLL 3V6FA 3TYGH 1DBJH 1KJ3H 1UJ3A 2OM5A 4ZPVA 2CKBA 1FFOB 4MAYB 2DQEH 3AMKA 4Y4KD 4IJ3C 3B9VA 1QUNA 3T0ED 4DN3L 2WBJA 4HIJA 1FAKT 4LCIH 3VG0H 3NZ8A 4DKEH 3DJ9A 3ZZ1A 3PJSB 3PGCA 2Z8RA 5ETUB 1RI8A 1Y6NR 2NY7H 4XP4L 1WZLA 1DVFC 4WNQA 4HIIA 4PJ9B 1KIQB 3RZCB 1FG9C 1ZT1B 2W9EL 1U2HA 4L8SB 1QFWH 4KQ3L 4PJXB 1ZS8A 4RQQB 5KS9B 4RSVA 3J7HA 2X4SA 4XWOD 1DQDH 1Z0NA 5I1AB 4K7PL 2R2HB 1XCQA 2XG4A 1VCAA 4XC3L 4M1DH 4PJCE 1FLRH 3BDYL 4GG8B 1YUHA 5ID0B 1S9VA 3Q6GH 3ARBA 3O6LL 4PJBF 1DN2A 5I15H 3DGCR 3LKPA 5T1KD 3WL9A 1HHGB 2MCG1 3VW3H 1CR9L 1YQVH 4LPVA 5H35A 3TT1L 4MJIA 1RULH 4NJ9L 4YHPB 5JXEA 1H8NA 1N6QL 3GHEH 5TE7L 3IFOB 1H3TA 5GHWL 5I1DA 3MRJB 1SYVB 2NTFA 1DBAH 4U7SA 4D8PA 1EJOL 1I1AD 3KLAA 1ZLUH 3V4PL 5DUMH 2HMIC 3REWB 2QR0B 3C08L 1FZOB 4F57H 1I8LA 1DLHA 4EN3D 2MQ3A 4Y4HA 1FCGA 4MS8D 4RZCB 1BFTA 4AMKL 4P57B 5L2KA 2NR6C 3IKKA 4WIQA 1EO7A 4AENA 4WTZG 1AP2A 3FT3A 2UZIH 5K9OB 4Y4KB 4OZGF 5MERB 1BVZA 2C3XA 2Z8WC 5B39A 3KYAA 2V5TA 5HGDA 1N64L 5D70L 1A6UL 3QIBA 4MHHG 5BOPA 3V6OA 4KRPB 3G6AA 3DMMB 5C7XL 4QTHA 3GMRA 2DI8A 4ZUUB 3P4NB 4PJAA 4RFNB 3SJVB 3BFOA 5FOBA 2KDGA 5JW3H 3S35H 5BZDB 15C8H 4UDTB 1SEQH 1EIBA 1KPRB 3BN3B 1VFAA 2NX5A 1MREL 4ZFGL 5E99L 5AWNH 4YUEH 4PJIF 2LTQB 5SWSA 3I3BA 3RA7L 1TZGH 2E7CA 4H0IA 2X4TA 3T4AB 4NUGL 1X5AA 1CGXA 4MJIE 1NDGB 3CFBA 3TBYA 1SQ2N 1OTSC 1ZT4B 3OGOE 1NMAL 3RKDC 2V2TB 2YZ8A 1FDLH 4LSDA 2BSTB 3TPUA 4RIRB 3MFFB 1OLLA 4XVTH 2FGZA 3MOAH 5F3HA 2C1PB 3VG9B 3MGTB 5JHDD 4OF5A 3O4OB 1B0GA 3I9GH 3L3IA 4R3SB 2VR9A 1OAQL 2D0FA 4EN3B 4PGCA 1RZJH 3QZWG 1YEGH 1EAPB 1YC8A 3KJ4C 3TV3L 5BO1L 3I85A 4FG6D 4MD0A 5FGRA 4X83A 4WWKD 3M1BA 4NZUH 3SN6N 3WJLC 5EWIL 1T66D 4ELKA 3OSKA 1IGYB 1OY3B 4JM4H 3S8WA 1KCSL 5GS1B 1CK0L 4KK8C 3BP4A 4KHTL 4ODSL 5I8CB 5C0DB 1KIRB 5DC0A 5JLZB 1R3LA 3OXRA 5FYKE 4LEXL 2YOCA 4TUOA 2D3VA 5GZOC 3K80A 5BZWA 4U6XB 3SKNB 3AREB 4JR9H 2UZYB 4M00A 2V9TA 3RWDB 1LE5A 3CX2A 2OMNA 3LQAH 5E9DB 5JIKA 4KJPD 4UNUA 5JNYB 2HLFD 1MRCL 4X98B 1A7PH 5GS3A 5GGTH 5I6XB 4DUXA 3OG6B 3LEVH 1CLYH 1ES0A 2P45B 3SE4A 5IROA 2OP4H 3WS6A 4YEEA 1NEZG 4XCYB 2PNDA 9CGTA 5D2NB 5J4MA 1PQZB 3OXSA 2QSCH 1YECH 1UJ3C 5DD1H 5TDPB 4L4VA 3QNZA 4ODXB 4Y1AA 3IAQA 4EOWL 3NFPB 3EYUL 4R0LB 3CXHK 3AMLA 3RWEA 1K3IA 2WBJC 2Q6WA 4OFKA 4DOHB 3P0GB 5BV7B 3SDDB 3HMWH 5JIIA 1QBBA 4XVUC 2DQCH 1CL7L 2QQLL 3BXNB 5FECA 1QSFB 4P9HH 1JNHA 5L7XH 1K4DA 4OD3L 1IM9B 1IGIH 4ZG1A 5CBAB 5J3HD 4P2OB 4JY5H 4FA8A 2A9NH 4BQ6A 4ZFFA 4MJ2A 4D9LH 4S1QL 4LLAA 4TNWK 4WJ5B 2WQ8A 1PGRB 3UROR 3ARBC 2FJHA 2VLJA 5C0EB 1TJIL 5DEGB 1I3VA 2JF1A 4MNQE 1U93A 1U8KA 4FXGB 4NO0A 2BZDA 4Q9QL 5MHSD 4G9FA 1ITCA 5I73B 3HE6D 4M8QB 2IANA 1ZANH 5EBMB 3X3FH 4TSCL 1RZFL 3QI9A 3QPXL 4H20H 4JEGB 3CC5B 2XV6B 2VKWA 1W2KT 5FUZL 3VJ6B 3KXFD 4CVXA 1JN6B 2KBGA 3MA7B 1K2DA 4L3ED 4RX4A 1F97A 1S7RA 1F8TL 4XPAH 1X4YA 4XPFL 1GGIH 4BQCA 1ZHBB 4NZTH 2ATPB 2JJUA 4RNRA 1I8LC 4P23B 3UYRH 5C9JA 2DL2A 3G08B 2ZCHH 3C8DA 5EO9A 2ENSA 5DQ9B 2HWZL 4MSWA 1G7MA 5K9KA 1WZMA 3K8KA 4JCLA 1A64A 4I18A 4L29A 4M7JH 4NQDA 5D2LA 2OI9C 4Y1AE 1VFBA 2D9QB 4NQCD 4P5TD 5D5ME 1C08B 4KZEH 3C6SB 3AS1A 1JGDA 1YEFL 4M8VA 4OLUL 4PJEB 5DD5L 4CVZA 5CUSH 3BEWB 3FT2B 4TUJA 4WEBL 1OARL 4Z78B 1VHPA 1CFTB 3AU1A 4PTTA 4OCSL 2AGJH 1T03H 2EYRB 3E3QE 4KI5D 5IVNA 3V6OC 4ZSOA 3QIWC 1JWUA 43C9A 1KG0B 1UM6H 4PGZA 5CSGA 5D1ZA 3OKLA 3MLUH 1ZOXA 4XVSL 4X4ZA 1RZ8B 5EOCL 5DLML 4F7TA 1OP3K 1UWXH 5I1IH 1H15B 2YMXL 1ADQA 1NBQA 1Q9WB 4LSQL 2H8PB 5C0FB 1PG7X 1NBVL 5IIEA 1NBZA 2OZ4A 1U36A 5GGSY 1TPXB 2HA1A 4DVBA 1RZIA 5DHVA 3FO1A 3P3YA 4XZUB 1XGTB 1W0YT 2OR9H 1K8IB 4O4YL 1G6VK 4QHLA 1UGNA 1QHPA 1S9WB 1Z6JT 3V6ZB 3QHTC 3HMXA 4TRPL 2IANE 3HE6B 4XP6L 2HYMA 2D7OA 4EBQL 4C56E 4QRTB 4XX1G 2DMCA 4JN1L 2Q8BL 5FKAB 4HF5L 1JPGA 6FABH 2CXGA 3SDAB 3UTQB 5DWUH 2IQAA 2OTWB 1EZVY 5I17B 4PJ7A 1BREA 4Y4FB 4U3HA 3VXPA 4KFZC 1QNZL 3SY0A 2UY6A 1QKZL 4LSUL 4D0CA 1WCQA 2AJZA 3M07A 1WFUA 1O7VA 5HGAB 4P46B 4AM0A 4S2SA 1T2XA 1G9EA 5LGJB 5D2LE 1WEJH 1JIBA 1F6AA 4YIQB 4YJZL 2FEEI 1P1ZB 3H8NA 1GOGA 1HXYA 5DMGD 4MDIA 5FO9A 4H0HB 2M26A 2V7NA 1CDIA 3WFDH 1RU9L 4OZ4B 5I19H 3ULSB 4JAMB 2APBA 3SDXE 5HYQA 1FNHA 1WUNT 2HTKC 2VRAA 2GTZA 3I02B 4GAYB 2A6DB 1HK6A 3Q5YA 4FRWA 5CJXA 4TN9A 4LLVB 3F7YB 1CFNB 1Q0XH 1IAOA 4JKWA 1TITA 3H7BA 5KTEL 1MCLA 3U0WL 5FCUH 2EECA 2DS4A 4KC3B 5L6YH 3DX7B 4F7MB 4XB8A 1MCQA 1P9MC 1NFIA 4LVOB 4DTGH 1WIOA 4I48A 1JFQH 5EU7C 4KVCL 2A6JB 5T3XL 4TQEL 1A6AB 2RAMA 2ZG2A 4NQEB 4GXUN 2AQ3A 4LCUB 2QHLA 1IGFL 4JGUA 2PYEB 4POZD 1K6QL 3HC0B 1B90A 3UBXG 5A3ID 5J11B 1HI6B 2LU7A 1CGYA 1SJHB 4R7NA 4P4KA 2UWEA 4G42A 5DD0L 5ITBH 4HXBH 5DTFB 3FO9A 1SYSA 4LL9A 3WXWL 3WE6B 4FQLL 4I3RH 1ZHKA 1UFUA 3UC0H 2J8UB 5ANMB 3LKRB 4P4RA 3S88L 4W68A 5C0GB 3HG1B 5E7BA 1P6AB 3AVEA 1VADA 5DMJB 2WUBL 1QSEA 2NY2B 3TZVA 5CD3A 3VFNB 3WFEL 1RJYA 5GRXG 5F88B 4NKDB 2O61B 3C87A 5HHME 4XVJH 1G7IA 2CJUH 1GOFA 5ADPH 1PFCA 2BJML 1QA9A 2APXA 5I0DA 3FB8B 3MNZB 1FYTA 1A14H 2HLAA 2A9ML 4CMMA 4X7TA 4MB5A 4O58L 5EORH 1MCPL 3DVNB 3QI9C 2OTUA 3O11B 4FQHA 4HZAA 3S35X 4AIZB 3H3PL 2HFTA 4JFDB 1BJ1J 5T1LB 5IEKB 1Q9OB 3N85L 4DZ8B 2VZ1A 4DEPB 4G8EB 3DRTA 3EO9H 4KTDL 3MJ7B 1CE1H 1TJGL 1J86A 3BPOB 3V4UL 3DYPA 5FCSH 2QKIB 4XAKE 1WT5A 3MV9B 1UYWL 4S1DD 4LLWB 4JM2B 4HDIA 1U8HB 2EE3A 2FJGB 3CDCA 3IT8D 3PWNB 3OAZH 4YHKL 3MRQA 3DO7A 4S1SH 4R97B 1VPOL 2HFGL 3NABL 4MLIA 1GH7A 1NFDB 2I60L 4NCC1 4K23L 5JA9A 4U3XA 3DTXB 1AC6A 2VSCA 5FYLH 5CLWA 3QJFB 2DM2A 3U4BH 1T3FB 3FJTA 4IMLB 3TBTA 1GIGL 1W72L 4UZGA 4L9LC 1ZAGA 5CD5C 4PY7B 1KGCE 2UWEE 4CW1B 5B8CA 1W72B 4RDQF 1IL1B 3ZKXB 4XAWH 4GBXA 2XACC 3DX6B 2NY3D 3O45A 4OM1H 2QQQA 4L8CB 2AI0L 3BW9B 1AR1D 3REVB 3S5LG 5ECJE 4HK3J 4YR6A 4RWYL 1JE6A 4UU9A 4OQTL 1QACA 2ERJC 3V0WH 5EOQH 2GTWA 3BPLB 5JOFB 1VKXB 3QHFL 1T7WA 3C60A 3SDYL 1YPZE 1VGEH 1FSKB 1G7QA 2QLVB 2PN5A 2HN7B 4WFED 1FYTE 5FUOL 1R5VB 1ROWA 3U6RA 1N4XL 3QUYA 4NRYA 4OQ1A 4D0DB 4F2MB 3HR5A 1JYWA 1DE4A 5KSAA 3LEXB 3QUXD 5I75B 3E8UL 4Q9RH 1CF8H 5EBLA 2E9JA 5HSFA 4X6DF 5ESQB 3WHE1 4N0RA 4FTVD 1U3HB 2EDWA 5H2BB 5C8JA 4X5WA 1P7QD 5HDQL 2CPCA 1A1NA 5D1QD 2CD0A 5HYJE 3I2CH 3DLQR 3BE1H 4QKXB 3ZDXF 3NCFB 5A1AA 4WHCA 1WZ1H 1BQHA 3ARFB 1A4JB 1U8LB 4QXTA 3VXRB 2X05A 3T09A 2FD6H 3VI3F 4IRZH 2QEJA 4YX2L 5ALBL 4NHUA 4E41B 4Z76A 1MI5A 1X5KA 1NGYA 4Y2DA 4Y5XA 3D85D 2GSIA 5FYLD 1U8MB 3WKMH 5C08E 3C5ZD 2BY1A 2H6PA 4HJGA 4GLRI 1AH1A 1JRHI 1WVZA 1RZ7H 5GISH 3EYFB 4Z8FH 4M9PA 4PY8J 1NMBH 5F89B 3STZB 5IB3A 1L6ZA 1Q9KA 2V7HB 1RFDH 2CDEB 3QDJE 4MZ3A 3WLBB 4EI5B 3L3KB 4RBPH 1CDJA 4BK4A 2AJ3A 2YUWA 3AGVA 5CJXC 5KZCD 4GRLD 2H32H 2F58H 4KTEH 2WUCH 5HDOA 4HMCA 4BFIB 1LNUB 3D39A 3LKNB 4K3HA 5IKCA 3EW3B 3KPSA 3IAPA 3L5HA 3UDWA 3OKOB 5IW3A 3L6FA 4Q6IA 1Z5LA 5IESH 3C5JA 3TBWA 4HW6A 5D7IB 4FFVC 5DVLA 3IFNL 4RAVB 5J13C 1U41A 4L4JA 1YMMB 5GIRB 2VDNH 2ATKA 4ZUTA 1HILA 1FGNH 3DOSA 5DVMA 3NIFF 4WFHE 2C7UA 4DWHA 4YQXL 3UTSD 2NY1D 3VXSA 1RK1B 5F21B 4U1GB 1NAMA 2EH8H 4OBRA 2BSED 4FQ1L 4Z7WB 5EU4B 3P0YL 2QL1A 3L5IA 5SX5H 4NGHL 1EUUA 3QUMH 4MNGA 2X4UB 2HKHH 1SJVA 3GSOA 5DRNB 3KLSA 4UTAL 3BESR 4KPHH 3FHAA 1D5IH 3QUZB 1QVOA 2X9XA 5BMFL 2YD7A 2P5WA 3TZVC 3MBXH 3QDGD 4PJGA 5CCKL 1MCWW 1FNEB 4LFHG 4N8CL 2E7BA 1ZLVK 4X6CE 1CGWA 4YBQC 1G0DA 3FO0L 2VC2H 5L2JB 3RHWK 2HAZA 3IJSA 1G7LA 4JGMA 4YHYB 3PF2A 4XHJC 4UV4L 3RGVA 4G6MH 1BJ8A 2CRIA 1OLZA 5E95B 4I9WE 3IFPA 3T04D 4E42A 2VXVH 1QR1A 1G7JB 3WFBH 4AH2B 2AJUH 2GT9B 5IQ9B 2GAZB 3GMNA 3HRZA 1S7VB 4N9GA 4XNQB 5F71A 3U7WH 4YHLL 4QHNA 4APQC 1T0MB 1MH5A 1SBSL 3N1PC 2H2PC 3BP6A 5KZCB 2XN9D 4PRHB 5ELIA 3DX8B 3VXNB 3LVEA 1QFUH 3ZE2E 3TNMA 4X9GA 2YA1A 1JGEA 3FCTB 5EU5B 1WWWX 4ZPTB 1RJLA 3KPTA 4KMTL 3O4LD 4IS6A 4KKNA 1NLDH 2X7LB 4JREC 1UT9A 5D7LB 3S3SA 4K3DH 4Y5YC 1C7TA 4M61B 3WJJC 4LSVH 3VXSE 2CDFA 4Y8AA 3RWIA 1AI1H 1QP1A 5HD8D 3QXTA 3RTQA 1KLUB 1QBML 5B8CC 1RIUL 3OHXB 2ZSVA 3GO1L 4PGBB 1C5DB 4MXVE 3HFML 1JPSL 1ITBB 4M4PA 2XTLA 3QEGL 4JO3H 3QAZC 4UT7H 2IQ9L 5DEFB 1YEHH 3L5XL 1JP5A 3WFHB 5ICZB 4F37K 3BIBX 1P53A 4FQPA 2XWJB 3C60C 1MCIA 1J88A 4QXGL 3RNQB 3GSNH 1AD9A 3BDXA 3CFDA 3FMGL 4F3FA 3FQRA 3L3DB 2IBZY 2JB6B 1FO0A 1R0AH 3NH7H 1PVHA 4V2CB 4N5ED 4KK9C 2XXCB 1CU4H 3QUYC 1B6DA 4U1JA 5DMIH 4V1DE 3O2DH 3PWUB 3MA9L 3VWJC 5GS0H 4X6FB 2RJMA 4WFGD 3IDNB 3QJHA 4ZUSB 3AB0B 4X0KA 3RUGA 1J0JA 4O2CA 3MV7E 3W9EA 3QH3A 5B22A 4XPHL 2XRAL 2Z35B 4PJHA 3CCHB 5FKPB 4JJ5A 1JPFB 4J4PA 4YBLB 3AS2A 2GJ6D 1MHEA 2XN9B 1KPVA 3NPZB 4G80B 4GRMB 2QHRL 3VWKD 5F7KC 2V17L 3NN8A 1UXWA 2WLYA 1ZSDB 35C8L 1MELA 3PWPA 2WW8A 1C5BH 4JY4B 2Q76B 5FIEA 5IEHB 3O3BA 1AY1L 3QP3A 4BSWB 2RQ8A 3O4LB 4Y2DC 4Y19A 2AERT 4UTBH 5AG8A 2CUIA 1MCDA 2GQHA 3MGOB 2HFEB 4MAYA 4XBPB 3GSVB 1M1SA 1ORQB 3BD4A 1OAKH 3GNML 2G60H 4H5SA 4C83B 4EVNB 2GHWB 2R2EB 1KXQE 3PJSA 3VXMA 5ETUA 3IVKB 1JWSB 5HPOA 4LLMB 4R4ND 4XHQA 5J06A 1KIQA 2FHFA 1XF2B 2W9EH 5IMOB 5F1SA 1JZ3A 1BEYL 1EH9A 2X5PA 4LF3B 4PJCF 2PETA 1GGYA 2X41A 2F15A 3CH8A 4B7LA 2XT1B 3WIHL 1J1PL 3UDWC 5I1GH 4TTGA 4KKBC 3INUH 1T1ZA 5IBTL 3BEVB 1OWWA 2R2HA 2XZAL 5I8KL 3HAEH 5KVEH 5BRZD 3P2TA 3UJTL 3BDYH 4JKLA 4OIAA 5E08H 1KFAH 4WW2B 4PV9B 4G3YL 4LVNC 2MNUA 1CR9H 1EHAA 5IB2B 3TT1H 2ZG3A 3DURA 5KSBF 4CVUA 3U4AA 5HVWA 5B4MD 1EO8L 4WI7A 4S11A 3VRIA 5TE7H 1AQDA 3W39B 1D7FA 1H8SA 2HJKB 1MQKH 2X40A 4ZFOL 4PJHE 1EJOH 1I9JL 1S7WA 3ZE0E 3IU4L 1EZVX 3OJ2C 1X5HA 1HXMB 4ZFOB 4QRRA 3LRHA 4MAUL 3V4PH 1I4FB 2R4RL 5IMLB 3QULA 4X99B 5T1DL 3REWA 3QCTL 5C0IB 1FZOA 4K9EC 1MLBB 2DLFH 3FAXA 3LZFH 2EE2A 1A7RL 2ZUTA 3JBG7 4OZHA 5IHBA 4UB0H 3TFKD 2PTVA 3VFVB 2NXZB 3OR7B 4ODTL 2ZKHL 2H26A 1J0KA 1MHHB 4HJJL 4WI2A 2PTTB 4K94H 1KJMB 1RMFH 3EYSH 3SGEH 3VFOB 5E5MB 5MENB 1QLEL 2Y6SD 5EIIA 2ED9A 5SV4A 5DJ0A 4FQXC 4Y4KA 3T0EA 5D96B 3FOLB 2N1KA 4NCC2 5KVFH 3EBAA 4PLKC 5CJOL 3RAJL 3VFSA 4M93C 1Y6KR 5DJDB 1KXVC 4F58L 1MFEL 5JTWA 1E28B 5INDA 3B2UD 1MJUL 2NW3B 3S9DB 3FFDB 3HKFA 4GRWB 1F2XK 2PO6C 3MJ6A 1C16B 4PJXE 1C5CL 3P4NA 5KS9E 2DWDB 3D0LB 3KPOA 3SJVA 3BGFC 3L9RB 2ZG1A 1WZKA 3FQNB 4JG1L 4NPYA 2BDNH 3V5HB 1NGWA 4OI7A 4PRAB 3U9UB 4ZFGH 2C4FT 4Y5VC 5E99H 5HVGB 2X1PA 2FO1A 2DQFA 4ZNCD 1NJ9B 3BUYB 1UEYA 4GSDH 4JFEB 4PRID 1YNKL 5A43C 1U8IA 2E7LC 1P2CB 1ZT4A 3KG5A 4TULL 1X5LA 1ACYH 3QQ9D 4G8IA 3BSZL 2V2TA 2IH3A 3BJLA 3WCYA 1JWMB 2UZXB 5F9JA 4X4MA 4RIRA 5KSBA 1X4XA 5IP4A 2C1PA 5C6TL 1I1AA 3TJHD 3MCG1 3CVIL 4RMUA 4R96A 3ZHDA 3GJEB 5IMKB 4PV8A 4EN3A 3BKML 4ENEC 3WIFB 4XMKL 1FVEA 2ZCLH 1OW0A 5E8DH 5JQ6H 1KCSH 1A6ZB 3JVGA 1HQ4B 4I4WB 4QWWC 1RZGB 4KHTH 4UINL 3GMLA 3TT3H 5C0DA 1KN2L 5AZEH 1KIRA 1MRFL 1BVKB 1HWHB 5JLZA 2E7HA 3QFDA 3X11A 1TTFA 4N0CD 4U6YA 4JRWA 4BFGA 4U33A 3SGDH 4U6XA 3SKNA 4WFFE 3MQIA 4J6RH 4U1KA 1OTUC 1J1OL 1IM3A 2O26U 5JOEA 4RRPG 5F72S 1R5WA 4HFWB 1J7VR 3BO8A 4OCLC 3TPKA 1MRCH 4WEUD 2V2WB 3DBXB 3IF1B 3GDBA 2B1HH 3SJVE 3RVWD 3VFGL 1FCCA 2D7TL 4LFHD 2WINA 3B9DA 4FHBD 4LQ1A 2CMRL 4NN6B 4DVRH 4ODWA 4XCYA 4XPGL 1JRHL 5D2NA 1CICC 1PQZA 3D18B 1YN7B 3QQNA 4RAUA 4ODXA 3MNVB 5EOTB 2E9BA 1Q72H 4EOWH 5MP6L 2J6EL 3NFPA 5HHVH 4BQ8A 2FYYA 5E1AB 2OMBA 2QADC 3ARZA 4EIGB 1Z9SA 5DUBA 1PKQB 5FUCC 3CZFA 4ZFZB 3QEUA 2A0LC 5HGBA 4NO5A 5CZVL 5AYUH 3SKMB 3VGAB 4QRSA 2Z8VC 3SGJA 3DO3A 1QFHA 2XTJD 2DKUA 3GBNL 4LOUC 5JHDA 4QY8B 3BXNA 2FATL 2BNRB 4CN1A 4ONFL 2L0DA 5DD6B 4KROC 3P9WB 4HHAB 4NQXB 5ENWA 5IW1B 2CIKB 4XBEH 4CAGA 2L4OA 3L95B 4MB4A 2R2CA 5HI4C 4WWKA 4G7VH 3RBGA 4DAGH 5KSVA 4LSSL 2IFFL 2YKLL 5K9JL 2AJXH 2WAHA 4Y16D 1TJIH 5C0EA 3QFJD 1ZLWK 1DFBH 4LAQH 1ZTXH 3I84A 4ZDHB 1BAFH 5IBUG 4M8QA 2R8SL 2FGWL 4TSCH 1QLFA 3CUPA 1TZIA 2EDRA 4M62L 3IJHB 1G9MC 2ORBH 4A6YL 1FNGB 4F7EB 3Q1SH 2VN4A 4I77L 5GGRB 5E9DE 1JZ5A 3MA7A 4A6YB 3F5WB 1IEAB 1AJ7L 3HI1A 4LGRB 1BBDL 1D9KD 2RCSH 3GSWB 4X8JA 3S3JA 1WTGT 3G08A 2MPAL 4OLWH 5F3BA 1AFVH 5K59E 1UADC 1DJSA 4OGZA 3RNKB 4DJMA 1HOCB 3MJ8B 5EZIH 1U3JA 4FN0A 3U30C 1E4XH 5D2NE 5JW4N 4XH2B 2Z31D 2R56H 3JWDH 4KJWD 2VIRA 1OM3H 3OKYA 4GAFB 4U6VH 1TLKA 3T0EC 4PJEA 2ESVD 2NXYD 1FL5A 1KNOB 2NTSP 4KI5F 4DOHE 3FT2A 2HKFL 5GSRA 5D71L 4WY7H 1OARH 1SBBA 3MLYH 1CFTA 3T3ME 4OCSH 2P5EB 3JWOH 1CGSH 1BIHA 1RUMH 2VDKL 3NZHH 2YUVA 1QSFE 2EEBA 1JNLH 3B6SB 1KG0A 2EC9U 1JI2A 4YLQT 1RZ8A 4FFZH 1FP5A 2C4XA 2EXWC 4XWOC 4KV5F 1I7RA 1G9NC 3LOWA 4E0RA 2BX5A 1BWMA 4FQ2H 1UCTA 2VDQL 4O5LL 1I3RB 3CMGA 4WUKH 3THML 2EDOA 5A16B 5ICXB 2PW1B 5EG6C 5I30L 1KTKE 4V2BA 1I7UB 1I9IH 3DECA 1XGTA 1UACH 2Q3ZA 4O4YH 4AQ1B 1GJIA 3S6CA 1OCWL 2P48B 2NW2B 2R1YB 3BQUB 4IEFB 3O8XB 3TA3D 3HE6A 3GRWH 5JMOC 1NANH 2AEPH 4PGEB 4XP6H 4OCRH 1EDQA 4EBQH 1QRNB 2NY0B 1FL6A 1KTDB 2Q8BH 3KXFA 4LLQB 4HF5H 3GM8A 4NC1E 5D1XD 1I1AC 4L3EA 2FR4B 4ZODA 3SDAA 3UTQA 2HJLB 2OTWA 1HSAB 5J9PB 5KSUA 1QNZH 2XFXB 4LSUH 4HGWB 3O6FD 3EJJX 1X6NA 2VWEC 4P46A 5L88H 3T1FB 3G5XB 1KIUA 2V6HA 4YXKL 3MMEB 3VFPB 3O0RL 5LGJA 4JZJB 1LVEA 3HZMA 1FZKB 3PWLB 4HSQA 4NQCA 4P5TA 3BVNB 4YIQA 3GZKA 1P7HL 3SDXF 4DGYL 2HTLC 4N90E 4PJEE 2ESVB 1X3DA 4FZ8L 4U1SB 1BIIB 7FABH 5DVKA 4GFTB 1YYLL 3H0TA 3CFIC 3WHXA 4ZTOH 4HV8B 1WF5A 1RUKL 1WWBX 4KVNL 4AJ0A 4PFEA 1CDYA 1D5BB 4X7CC 4BUGA 2Y1VA 4U1HB 4NKOA 3VCLA 3I02A 4GAYA 2A6DA 5JUEL 3E6HA 1QQDB 4EXPX 2AEWA 4I2XB 4PPTA 2NY6D 3ARDC 3DI2B 3QIUB 3ESUF 3DX7A 2C5DC 5KVDH 4R26L 2X4QB 1KC5H 4WI9A 4XC1H 1F00I 2DLHA 2YD6A 4YNYB 2A6JA 3DETD 3IJYB 4Z77B 4XP9H 1BD2D 1TJHL 4UIKL 5JXAH 4XPBH 1WV7T 5TDOA 2W1NA 4W4OC 2V5RA 2CLVA 5C0JA 4KK5C 4MX7B 5D1XB 4HK0A 4FQLH 3PV6A 3GB7B 4NBZB 1UWEL 3AC0A 4Y7MA 2A73B 5ANMA 5I9QC 1FJ1A 4H1LG 3GJFB 3KYOB 2P24B 5F44A 1F4HA 5F9WB 3WFEH 2JK5A 2IBZX 4HS6B 5ERWB 1HSBB 3DROB 5IGXH 3BP7B 1MFNA 1XGYL 3NGBC 4XBGB 2BJMH 4DZBB 4Q2ZB 2A9MH 3LIZL 4K8RL 4Z95H 2JIXB 4AYFA 4O58H 5D93C 1KACB 1SY6H 4HUVB 1G6RL 5F9OL 2HH0L 4AIZA 1G6RB 4JFDA 1Q0YH 5IEKA 4ELMA 3FO2B 2BHUA 1Q9OA 3EJZD 3OB0H 4KJPC 2HLFC 3MJ7A 2BERA 3S37X 4ZXBB 4FP8L 2FL5B 4U2ZA 3PQYD 4WCYH 2G2RB 1O7SA 1FAIL 2QKIA 4TNVF 3D25A 4D9QD 4LRIA 2V5YA 1MCSA 4P2QB 2ARJB 1LDPL 4MCYB 4HC1A 1PZ5A 3PWNA 4JANA 4YHKH 3NABH 4U6HB 2QSVA 5EFIB 2I60H 2JJSC 5T5NG 2IH1A 3QRFM 3MUY1 4NQEE 3W11D 3T3PE 5T3XE 3QCVL 1F3DH 3QJFA 1T3FA 4HG4K 3BZ4B 4X9IA 2GJZA 2PYEE 5I71B 2Y7QA 1CLZL 1GIGH 2A2QT 5A40E 4HPYL 4PY7A 1WIPA 1IL1A 1YEKL 1IBGL 1KUMA 1MAJA 1QR4A 2QSTA 2AI0H 3X3GL 1JPST 4L3AA 4L8CA 3BW9A 1YPZF 2J8UE 2DLGA 3C6LB 1RZJC 5ANME 3HG1E 3BRFA 3UTPD 1YNTB 1XFPA 1MJ8H 5HHXL 5A2IH 5JOFA 3G6DH 5E7FA 1UWGH 4LP5A 3VD9A 3MBEB 4PLJD 2XZZA 4U3CA 5FUOH 1R5VA 4M7ZB 5IFHL 4L4TD 2R0ZL 3LDBB 3ISWA 4NSKB 1M4KA 5I1EH 4E5XA 3LEXA 4GQ9L 4ZOBA 4NNYB 4JFDE 1FV1A 3HC3H 5ESQA 1ZHNB 2C3VA 4LSRH 1NEUA 3LQAC 3PDOA 1U3HA 5H2BA 4LGSB 5HDQH 5C6PB 4HWZA 3ULUH 3CFJB 1DVFD 4KZDL 3MV9E 1ONQB 5GGVY 4Z7UF 5F93C 1U8LA 1CTNA 1QSVA 3ARGB 4JGJA 4KKAC 4OCMC 4A2MA 1NDMA 3TBSA 4OLVL 5CIPH 3ET9F 3D5OF 1FZJB 1NFDE 3WDJA 4P5TC 2VXUH 2CLZB 2WBWB 4M5ZH 5B21A 3CXDL 4MDJB 3RWJB 1U0QA 3BPNC 1NGQH 2NY4D 3MSPA 1U8MA 1NC4D 5J12C 5K93A 1FH5L 5FB8B 4FZEH 3BKJH 4FQIH 1A7NL 4XMPH 3IDIA 4MNHA 3E3QC 1VACB 2YSSB 3SE3A 1DSFH 5F89A 3STZA 1T89A 2WP3T 4KI5C 4QRPB 2V7HA 2CDEA 4EI5A 3MV8B 4P9HC 4NM8H 1JGLH 2EZ0C 4QCIB 2CR3A 3AY4A 1I3GL 3VFMB 1EFXD 3C5SB 4H25B 3HE7C 1AHWA 1LO4L 3O3DB 4EUPB 1IGTA 3ZDZE 1UKQA 4RGND 1GL4B 1MIEL 1UJTA 4WHTA 3TWCL 1OAYH 3T0DA 3CSPA 4YK4B 5DT1L 1F02I 1G1YA 4UOW0 4HGKC 4J3WA 5LWYH 2KPNA 3MROB 5T3ZD 4F7PB 3IFNH 1YMMA 5L0QB 1IC5H 1P84J 1DBML 2MTPA 4TSAL 1UKTA 5C0AB 4PJ8C 5GGSA 3QHZL 1IC4H 2BMKB 1WBYB 3QUXA 1RK1A 1A9EA 4AL8L 3C8KB 1JTTA 3RPIA 4FTVA 4H26B 3VXTA 1P7QA 3GI8H 2FX8L 3UX9B 5D1QA 5ESAB 3ULUD 2X4UA 2R9HD 5DRNA 5D7SL 4X6CF 4HKXB 4HS3A 1MUJA 5BMFH 3DUUB 4TPRH 1I9RL 3KPNA 3VXRE 5DMYA 3WUWA 1MPAL 2BRQA 4DQOL 3KPMA 4N8CH 1AKJB 5C09D 4E41E 4DN4L 3GEWB 1D5ZA 2N4IA 5TE6L 5CMAA 1GGCL 2O5XH 3D85A 1HDMA 2BHZA 3B3IB 3W0WD 4YO0A 1CFSA 1I7ZB 2J8HA 4JDVB 4K3JL 2FDBP 4PY8I 4P5MB 3C5ZA 1T22A 3EZ8A 4HIXL 4PG9B 5DMGC 4EDXB 3LV3B 3ALXA 3TEUA 2GUOB 4XTRC 4AH2A 5E6IC 2GT9A 1OTSD 4JLRB 3FB5A 3ZE2F 2GAZA 2XY1A 3RKDD 1S9YB 1IKFL 1S7VA 4XNQA 4FQCH 2VLLB 1NL0L 3JWNC 1ZA6B 2ADFL 2VZ3A 2O5YL 3LN5A 3IS0X 3DUSA 4H1LH 4UBDD 4LSPL 3MJ9L 3L3JA 4OTXH 3VDCA 1T5WA 4JO1H 1RUQL 4QRUA 1FG2B 2DAVA 1QRKA 3FCTA 3AAZB 4G6KL 3HI6L 5EU5A 4F9LC 1GZPB 4ZPTA 5D7IE 3VD5A 1CBVL 4P2YA 1YMME 1ZWIA 3QXVA 1NGXA 1JK8A 5D7LA 4HUWB 5FF6B 1F4WL 1KN4L 4KK8D 4YFEA 4M61A 4POZC 3UCRA 4QRQA 5FM4A 5A3IC 1S7TB 3VDBA 4Z7WE 1ULVA 1A6TB 1KLUA 1QBMH 3V95A 3PGFL 3NIGE 5DGQA 1C5DA 3QEQB 3KYKL 4PD4J 1JPSH 3PGDA 5CFHA 3MZGB 1BOGA 2CK0L 3O2VL 4NN5B 3IETB 4GUPB 4YDIH 3PWJA 2R69H 4MJ5B 5FO8B 2IQ9H 3K2UL 4TVPH 1I1CA 3FN3A 1DANU 2C3GA 2P44B 4LVEA 3O3AA 5DJCB 4D94A 1EO5A 2BCKB 1YMHA 4LPWA 4JFHE 2XWJA 1MNUH 12E8H 2XA8H 3NAAL 1QBLL 2YEZB 4PR5B 5LBSL 1UH4A 3BP5B 2R0WH 4LIQL 5TDNB 1UENA 1KEGH 2QQKH 2VE6B 4KDTA 5EDXA 4JDTL 3KYNB 3CFCH 2A1WL 2XZQL 4S10A 5JHLL 4EDWH 3CJJA 5DR5L 2BVOB 2JCCB 1HYRC 3BKCL 5C0RH 5ACLA 2XRAH 1QFWM 2Z35A 1KXTB 4QOKD 4ZO6A 1A1OB 2DTML 2CLRA 4PRHE 1OSZB 4XVUD 2XN9A 3KPPB 4QHMA 2RHEA 4Z0XA 4P0DA 2OL3L 4G80A 1C7SA 4MYWB 4S1DC 2OL3B 5HGHA 1T1XB 2V17H 3ZKND 2BOCA 3IDMB 3VFWB 3KJ4B 1S8DA 3HNVL 4JY4A 1XZ0A 4BZ1L 3SDCC 1XF3A 3O4LA 1WCBB 5D7LE 1F11B 2EDLA 2ID5A 3BX7C 4I3SH 1KEML 5CZXD 1BOYA 4XBPA 3GSVA 4PJDA 3S97C 2X44D 3L7FB 4BZ2L 1G7PA 5I1JH 2BSSB 1ZE3C 3KPQA 1BFVH 2RB8A 2AK1H 3OTTA 3ZTNH 1BZQK 5GJTL 1JWSA 1AR1C 3GGWA 4LDEB 5FA3B 1T2QH 1XF4A 5MEPB 3OGCB 4GKOA 2PR4H 4LNRB 4TVPD 5IOPB 4LF3A 1MCOL 2J7LA 3VFUB 1QEWA 5LQBL 5DZLA 3T08A 5HDBF 3C09C 4KK6C 3FQUA 3BEVA 1FBIL 4TOYH 4XI5C 1XR8A 3T4YA 1SVCP 3CSYA 3LPGA 1XGPB 4WW2A 5DS8A 5CINH 2A6KB 3PHQA 4HKBB 4ZOAA 3ZT5A 4YWGL 4M03A 2CKBL 1UJ3B 2I25N 3ZE0F 3OAUL 2UVEA 2DQGL 3EFFA 4ZPVB 3GMMB 2CKBB 4L9DA 1T1YA 1EO8H 1J11A 3QUXC 1T7ZA 1P4BL 4UI2A 5ALCL 2FSEA 3SE9L 2AXJA 2WBJB 4ZD3H 1E4KC 1TQBC 3NZ8B 4OCWL 3ZT6A 1MF2H 3UTZB 3PGCB 4ZFOA 4MAUH 4TSBH 2GJ6A 2XN9E 3LS4H 5FDWB 3QCTH 3MC0A 3QIWD 1M05B 3JV0A 2NYYC 4IRSD 3LQZA 1BFOB 1A6VL 1MIML 2X4SB 2JELL 5ACMA 5GGVL 3O4LE 1KENL 5GXBB 4I5BA 4U1LA 2ZKHH 1MHHA 5J1TC 5CJ5A 1S9VB 3ARTA 3ARBB 3S3PA 3EO1B 1QLEH 3VFOA 1RUPH 3LKPB 5E5MA 1YYML 4OLZL 1UXSA 2F8XC 2YBRA 4CDHA 4RAHA 5CJOH 5IG7A 1UA6H 3B9AA 5LCVH 4F58H 1MFEH 4LRNH 2IALA 4D8PB 1HZHL 4HZLA 4GRLC 4J1UA 5A2FA 3SKOA 3KJ6L 1MCHA 3A67H 2G75B 3ZHKA 2VITA 2FWOB 1CFVH 3GHBL 4Y89A 1ZVYA 1CXFA 4NDMB 1NLBH 2EKJA 5BRZA 1N59A 4I13B 3NCYP 5KAQG 5JORA 5L2KB 5E8PB 4PBXA 4XNYL 1RUAL 3PABB 2GYSA 3IFLL 3BUYA 1FNAA 3BT2H 4HS8H 2XZCH 3O2DA 1AP2B 4JFEA 1L7TL 3FT3B 4WFGE 4X4YB 5TGBA 5FYKL 1S7SA 3B5TA 3ORJA 4HX1B 3RP1A 2FBOJ 3P0VL 2YD8A 1JWMA 3LPFA 3CLEL 1JBJA 4OF0A 2ZWLT 2P1YA 2J88H 1CLOH 3SO3C 5GGQH 2Y36L 3QIWB 2HTKD 5IMKA 2ADJB 4CMHC 5CJQH 4PJAB 1S9KC 5F1KC 5B3JE 4NYLB 1T7VA 2B2XH 5FOBB 2BFVH 3MRRA 1MCEA 3CX5K 1VFAB 2NX5B 3AXLA 1OP3H 1DEEB 4YGVB 3OJDA 4I4WA 3ZYZA 5SWSB 5MENE 4JFFD 3LN9A 1KN2H 4L1HA 5LJYH 3OJVC 2X4TB 3BWUC 1DDHB 1OT2A 4PJBB 3DSFH 3H7LA 2WIIA 1GGBH 3BD3A 4LNVA 2AK4B 3TPUB 1OF2A 2HG5B 1Z3GL 2EDYA 4GRWE 4PREA 5F3HB 5J57B 2Q86B 4EXKA 1IAKB 1C8PA 1B0GB 2ZSWA 1NSNL 3IXAA 4FFYL 3R8QA 1AR2A 1D5MA 1H0DB 3VFGH 2D7TH 4HUUA 5TPWH 3RIFF 5J6GA 4NOBA 1CVSC 5KW9H 4Q58C 3HAEA 4MD0B 5MI0C 3A0OA 3BYYA 4LU5H 5GRJL 4KHXH 3M1BB 2IGFL 4OCXH 4GLRH 3TC9A 4PGJA 4ELKB 4PRPD 4XNMA 4XP1L 3D87B 2P49B 3T8XB 2G9HB 4JFEE 3MNVA 4BH8A 5EOTA 4YXHL 4PRIA 1GC1L 1FC2D 2LVEA 4MA8L 4F8QA 1PKQA 1R3LB 3EFDH 3B5GA 1FHGA 4ZFZA 3S98A 5IHLB 2DMKA 1U3YA 2QSQA 4NNPH 3WHE0 3TO2A 2FATH 4ZYKA 4OZGB 5C1MB 1LE5B 2F54D 3DYOA 4JFQA 4G6FB 4ONFH 2VUOA 3FQWB 4HMEA 4KUCF 1REIA 4KDVA 3UTTD 3GI9H 2W60A 1EMTL 2AJYL 3VMPA 4M7KL 4CJ0A 2ZCKL 3V8CA 4BKLA 1F58H 2IFFH 3MLWL 1ES0B 3NCMA 4KU1A 2PCPA 5BVPH 3ROLA 4HQQL 5JW4Q 3RI5F 3OXSB 4AG4L 4TVSa 4L4VB 3QNZB 2F5BL 5H8DA 2GIYA 4IIQC 3CFKA 3GBLA 3IDGA 2FGWH 2R8SH 3RWEB 4PJIB 5GRUL 1GHFL 2DD8H 3AFLA 5D7JC 1M7XA 5E2JA 4G6JH 4KQ4L 1FNGA 2DIBA 4A6YA 2Z8SA 2YK1L 1IEAA 3QNYA 5FECB 1EVUA 5F1IA 4GO6B 1JNHB 3VH8A 1K4DB 3VWKC 1X5IA 3SE8H 4YHOL 2FRGP 1JPTL 1MHPH 4P9MH 2RGSA 2UVFA 1HOCA 3MJ8A 4GMTL 4XXCA 3WYRA 3F58L 1S5HA 4ZFFB 1BZ9A 3W2DH 3KLDA 5HDLA 1BFSA 1PYWA 4OGXL 2DM4A 1EX0A 5F7EH 1IAMA 4QXUL 4XH2A 4N68A 2VSDA 2LV4A 2FJHB 1CQKA 2VLJB 5EBWB 5DJAA 3LEYH 1BP3B 1JZ6A 1T04A 5IVXA 1PKQE 1KNOA 2HKFH 3IDXH 3O6KL 1JL8A 3D9AL 4G9FB 1RPQA 43CAA 3QI9B 2GK2A 4CVXB 2DQDL 2BNRE 1F4YL 1K2DB 1L7IL 3HPJB 5CILL 4Z0BL 2PYFA 4RNRB 5ACZB 5C9JB 1UZ6F 5EO9B 2Y07H 1FPTH 2BVYA 1IAII 3TO4D 5FYJL 5I8EB 5DI8A 3THMH 3T1WA 4CDGC 1EHLL 5A16A 4P2CG 3M17A 2PW1A 4Y16A 1G7MB 1ETZB 4JQVC 1I7UA 4R8WL 1AO7D 1FN4A 2CGRH 4I18B 3QFJA 4NQDB 1OSPL 1TVBA 1EPFA 2NW2A 5GS0C 2R1YA 3HNSL 3KYMB 4YH6A 1DUYB 4OI8A 4PGEA 4HWEL 5F1NA 4GG6A 4LSTL 4P2RD 2FR4A 1FRGL 2FLRT 4ZSOB 1D9KA 2W65A 4XWGL 2YS4A 1JWUB 4JG0L 5J9PA 4EUPG 2AXGB 5IQ7L 3QWQB 3DPBA 4F7TB 1ADQL 4NNXA 1BGXH 3D2UD 2P8PA 4N0FA 2OZ4L 4IDJL 2ZJSH 3QXDA 4JN2A 3T1FA 1DLFL 4XGZA 5SV3A 1FNSL 3MMEA 2YRLA 2BVQB 4RGOH 2CRZA 3A6BL 4JZJA 3O9WD 4DGIH 5E2TL 2Z31A 5AG9A 5DHVB 3FO1B 2Z0BA 4FFVD 4OI9A 4DGYH 1JF5A 2E5EA 5D6DA 5IVXE 3HMXL 5DJZA 2ESVA 3MCLL 1BIIA 5TH2B 3CDYA 4ERSL 3QQ3B 1LD9B 1YYLH 4PJ9C 4GXVH 3B2UC 2P5EE 4NWUL 4NWTL 4GAGL 1I8MA 2VAAA 4L8SC 3NA9L 4LQFL 3MRLA 5JUEH 2H2SD 2IQAB 3ULVH 5DA0B 4JPVL 4PJ7B 4I2XA 3VXPB 4FQJH 1I85A 4KAQL 1N0XL 3SCMD 2AJZB 2OBGA 2VLKB 3N9GH 1VB9A 4J23A 1K8DB 1YEIL 4S2SB 5AZ2H 5FYJU 4YFDB 3NVQA 2B4CL 3CSBA 4YBQD 5CEZL 1IT9L 1L4IA 1N6UA 5AEAA 2XWTA 4XHJD 1F6AB 2KH2B 3IJYA 2NZ9D 1RHHB 3WSQH 3TA3A 1H5BA 4Z77A 4HPOH 1HXYB 4MDIB 1QRNE 3C8HA 2V7NB 3HI5L 2ARJQ 1MFBH 4W70A 3QEHA 3ILQD 4ZUVB 5D1XA 1LHZA 3UP1A 5HYQB 4N0YL 2OR7A 3DIFA 1N5YH 1MHCA 4MB3A 2GTZB 4APQD 3HB3C 2D4FA 1MFAH 1IFHH 5TQ2L 5E56A 2BRRL 3Q5OA 3GJFA 3KYOA 3O6FA 4R90H 4NQUA 3QB7C 3MV11 5J1SC 1IAOB 4PB9H 2AAVA 1SM3L 3DROA 4JRXD 3BP7A 2DOCA 2GK0B 3I6LD 4XBGA 1GAFL 4Q2ZA 1NFIB 1HIML 4I48B 5J13B 3IB4A 4K8RH 4YEFA 2ESVE 3EYQC 2R0KL 4N0CC 4LASL 2VDML 5L8KB 3V5DA 2ICCA 1G6RH 1N2RA 3X14A 4WTXA 4KRPC 4JPKH 5T1MA 3BH8B 3I75B 4R7NB 1AXSB 4PRNB 1MY5A 4G42B 5EZOH 2BXYA 4FP8H 3FO9B 1M71B 4I2XE 1KCVL 1FFNA 1FAIH 2Y06H 5EU6D 2IBBA 3RVWC 1DL7L 4LARL 4ZAKC 3EGSA 3ZE1E 4P4RB 2D9CA 1NCCH 5C0NC 2OJEA 2X4PA 4XXCC 1LDPH 3WNOA 1VADB 2ARJA 1QSEB 3TZVB 1RJYB 3LS5L 4KMQA 1INQA 3MXWH 4U6HA 1JHLL 2YXFA 5KBNC 5DFVD 5IR1A 1C1EH 2O5ZL 2Z91B 3QCVH 5FDYA 1ZLVH 2FNBA 3LKOA 2M1KA 3GRWA 4CMMB 3EKCA 4X7TB 4JFPA 4YGAB 3U36A 3L5WB 5EO1A 3VWJD 2OTUB 3TN0C 4FQHB 2MCPH 1NCBL 4C54A 2XTJC 4UT9L 3K7UA 1YEKH 1IBGH 5KJRH 1PEZA 2EDDA 3P11H 3DRTB 3N1QC 1T4KA 5L9DL 4K55A 3C6LA 4I3GA 5DQDH 4OUOA 3WBDA 1VSCA 2VH5H 2R2BA 3FRPA 4XCNA 3WUZA 4QNPF 4GAJL 4HDIB 1A1MB 3CMOH 3BRDA 4Y16C 4JRYD 2HT2D 1S9XB 1A47A 3BGMB 3MRQB 4NKMB 1FIGH 4BFEA 3HA0A 4HH9A 4OF7A 5DK0A 4JREB 4K71B 1NCAL 2V5SA 2O93L 3I50L 5M7QA 1KF9B 3AREC 3ZTJH 4HMDA 4GQ9H 4B41A 2BVPA 5J1AB 4LPUA 1QFOA 2B1AL 2V9QA 4Q97A 3A6CH 3BHBB 5I8OL 4PB0H 5B8CB 4NOFA 4M6OL 3QO0B 4GBXB 5I6XC 3CFJA 3PQYA 1UQSA 1MVFA 1WAAA 4YR6B 1ONQA 4CADA 4PD4K 4P2QE 4UU9B 3P9MB 2GTWB 1EGJL 3C60B 3GK8H 2J12B 1FZJA 1G7QB 3RWCB 4F7CA 4KJWC 3JUZA 5D6DC 3OF6D 1UC6A 3QXUA 4L8BA 2NXYC 3U6RB 1FH5H 2VQTA 3ILPB 2AQ2A 2X89D 3SDDC 3QUYB 4NRYB 1S5IH 2VLRD 2D0HA 3HR5B 3VWJB 5KSAB 2DQIL 1VACA 2YSSA 4I0PC 1CD0A 5EBLB 3KPRD 1GYAA 4Z7NE 5C8JB 2EDEA 2ED8A 4QCIA 2Z93B 1A1NB 3SQBA 3C5SA 1HH6A 2A77L 4H25A 1IKNC 4YZFF 5FOJA 1I85C 1RIVH 1MIEH 5T5FH 4C57C 1BQHB 3CH1A 3ARRA 4R4BA 4DW2L 4QXTB 5TE4L 1G7HB 5E00A 3SOBH 1XIWC 3GMPB 2APVA 2F19L 4WRLA 1QFWI 3MRPB 5FHAL 3QG7L 3MROA 1MI5B 5H37G 1NGYB 1INEL 4DKFL 3OPZL 5I73C 1P4IH 4Y2DB 4Y5XB 1HHJA 2GSIB 4L4TA 5C0AA 1YJDH 1YEJH 3QHZH 1SY6A 2BMKA 1WBYA 4JHAL 4FQXD 4OBSA 1FORH 1UKSA 4HJGB 2NY5H 4M1GL 3X12B 3C8KA 4NZRL 5INCA 3SQOL 4H26A 5IB3B 4P23C 1E4WL 1Q9KB 5HHOD 2YA2A 1A7QH 4NRZB 4UNVA 5C07D 1N26A 3LQMA 1DVFA 1WAAE 2AJ3B 2H9GA 2IAMD 2N7AA 5ILTL 1I9RH 4ZNEA 4WGVB 1KLGA 3D39B 3UO1L 4OD1L 2P46B 1MOEA 3HS0B 4OCYL 3W9DB 1HQRA 3KPSB 4U1IB 3L6FB 3JWDC 2A83A 1Z5LB 1QG3A 1IEBB 3C5JB 3TBWB 3HUJA 3MUZ1 2AEQL 4ZUTB 3UMTA 1HILB 1I7ZA 1NC4A 4HXAL 1CZ8L 4HIXH 4GMSL 4P5MA 2VDPL 3DUHA 4LVNB 2DICA 4PG9A 4DGVL 1YDPA 3HZYB 1F4XL 4ODHL 2C7UB 5F7MC 1NAML 1W8NA 3NCJL 4J3OC 5B39G 4U05A 3JWOC 1DN0A 1L0XA 1PY9A 5C0BD 4QRPE 1S9YA 3MV8E 4PGDA 2VLLA 1J10A 2HJFA 1ZA6A 5SWQA 4MNGB 1EFXA 5D8JL 1OPGL 3GSOB 2WIMA 5D7IF 2DDQH 2DJUA 1IARB 3UTPE 5BW7C 2NY6C 2WQRA 4K9EL 1PDKA 4CNIA 1NGPH 3MJ9A 1QVOB 2YPVL 4LPXA 3MUGB 5GSVA 2P5WB 3AAZA 4PJGB 4ENED 4G6KH 3HI6H 2WSKA 2ZUSA 4PJ5D 4JHZA 1OAXH 1DP0A 3FFCD 3CLFL 3O3EB 4Z7WF 2GI7A 2BNQD 3NIGF 5C0AE 5EU3B 1BQLL 5C6WH 1X44A 4ONOA 1MWAB 2ZUXA 3D3VD 2D2OA 4N1HB 3IFPB 4E42B 1QR1B 4FQXB 4NP4H 1S3KL 4GJTB 1U95A 4M93B 4Y4FC 3QEQA 5HHOB 5I1CL 3MPCA 2Y5TA 4N9GB 1L6XA 1MJ7H 4GUPA 1MH5B 4MJ5A 5FO8A 1RK0B 1F90L 3BP6B 1ZLSH 4PJFF 4XT1C 2PO6B 1E6JL 5DJCA 4ZNEE 5H94A 5D6CB 2IPKA 3ZL4L 3SKJL 2D7QA 1JGEB 3BGFB 5CIPA 4P3DA 5C09A 2DBLL 3U7YL 3HPLA 2P47B 5LBSH 4PR5A 2F53D 1RJLB 5HHQB 4Y5VB 4LIQH 4J3VA 3BMVA 2BK8A 3G6JF 3W0WA 4BUHA 1EJ6A 1CD8A 4HIEA 2VE6A 4OUUA 1MSPA 3AS0A 4OZFB 1WITA 3JV6B 4QF1A 4OIBA 4JPWL 4YC2C 3RVUD 2XZQH 1UG9A 3WO4C 4DFIA 4MLSA 1XF5A 5DJXB 2VQUA 5IFJA 4PTUA 2JCCA 3FONB 2QADD 4Q0XH 3EJZC 3BKCH 3O2WL 3V0VB 5GRYA 1UB5A 1XAUA 25C8L 2ZSVB 3KWWA 1A1OA 4PP2A 3KPPA 4LOUD 3EOAB 2X4NA 4Y8DC 4LHQB 3KHQA 4JO2H 2OL3A 3MXVL 5IW6A 1SEBA 1OHQA 4KROD 4H0GA 4LVOC 3VFWA 4LCCC 4JO4L 3U0PA 3NCEB 1S7UB 1AD9B 4LK4A 5T3ZE 3CFDB 2NCMA 2Q8AH 5HI4D 3F7RA 4AT6B 4ISVA 2XQBH 3NACL 3WN5A 1F11A 2MSPA 3NA4A 3R1GL 1KEMH 2KZWA 1RVFL 1VENA 2P4AB 3UJIL 5DFTA 5J11C 3WV0A 3MX0A 4LCWD 3TVMD 3RUGB 4OLYL 4MQ7A 3QEQE 2EDFA 1OGAD 3QH3B 1N8ZA 1UM5L 2ZUYA 5DUPL 1MHEB 4LNRA 4PS4H 1N6VA 1YNLH 5IOPA 3VFUA 1FLTX 5KG9A 4Q6YA 3ES6B 4P3CH 4NHCL 2FECI 1OAUL 2D03H 1ZVSA 3NN8B 3CFEA 4OZIA 4PJFA 3VD4A 4S1RL 3PWPB 1YEDA 2YD2A 4PLJC 4XXDB 1A5FH 3MLZL 4Y19B 1LO3H 1CICB 2FEDC 3O3UN 5BOZG 2DQGH 3WLWC 3GMMA 4XP5L 2HFFB 1P4BH 1LK2B 3G6JA 2JCCE 2DJSA 4H5SB 2QADB 4PBVC 2I07B 1JCKA 4PUBL 2AW2A 3BPOC 4QOKA 3UTZA 1JZ7A 3VXMB 5IV2A 3WXVL 1KBGL 5FDWA 1AGEB 4LDOB 5JPNB 1M05A 1DQML 2F74A 2ITCA 3AM8A 1U9KA 3PWVB 1J1XL 3B2VH 4KROB 4YXLL 1BFOA 4QTIL 2J1KA 2EXWD 4BSJA 2JELH 1T1ZB 1V05A 3PXJA 3MLXH 3VRJB 1ZEAL 2NY4C 3EO1A 1FGVL 2XIDA 4OLZH 2E27L 1YN6A 1AQKL 1D6VH 1XGUA 1YEEH 3DURB 3VRIB 4UQ3A 1ZLWH 1AQDB 1G9ML 3NTCL 5DYOB 4M48H 4OB5H 4ETYA 1A3LL 1S7WB 5BJTA 4OF3A 2RR3A 4I0CC 4QRRB 4MMZC 2FB4L 2DMBA 5SWZB 2FX9H 3QULB 3MLRH 4RGNC 1L0QA 1T83C 1R3HA 1FFQA 2G75A 2A38A 4L1DA 4HWBL 4L3CA 1NCDH 2FWOA 3G5ZB 2AS5M 3GHBH 3PXHA 5AUMA 4OZHB 4NDMA 1X7QB 5J0BA 2LAGB 5CLTA 5DRZB 3U30B 4XNYH 5E8PA 4H8WL 2H26B 2LABA 3PABA 3IFLH 3L1OL 4MXWH 3TM6A 1XR9A 5EA0H 3MACH 2HVKA 3U2SA 1A2YA 5EIIB 4X4YA 1U8JA 5DJ0B 3WNMA 5FYKH 1H3WM 2YD1A 2HTLD 5T33L 4HX1A 3T0EB 5C2BH 3JUYA 3TCXA 5DRXA 3VFSB 3RY4A 5B3JF 2E7MA 3LHPL 4R6UA 3WNKA 1GPOL 3ULUC 5INDB 1AGDA 2R9HC 3MYJA 4UILL 3MLTB 3ARFC 5JW5A 3QIWA 1B2WL 4S0SD 5IT2H 2ADJA 4IRSA 5BQ7B 5J56B 4NYLA 3KPOB 1T20A 1G9NL 3GBML 1WIUA 4NPYB 4TNWF 4Z5RA 4RGMC 3ARDD 1NGWB 4AEHH 1DEEA 2DYPD 3KPLA 4YGVA 2DQFB 2I27N 4N8VA 4W6WB 1JMZA 5T1KB 5F6IC 1HYSC 1CFBA 2XI9A 1PG7L 4JY6A 3F12B 2HT3D 4J12A 1U8IB 4X7SL 1DDHA 4JB9H 4PJBA 4LKCA 1IC1A 4G6AD 4G8IB 4DUWA 5FV2A 2IH3B 3MRHB 3NFSL 2AK4A 1QTYT 5F9JB 5KSBB 5LXGH 1Z3GH 2HG5A 1JHTA 4KK5D 1U8QB 2Q86A 4P59L 1I1AB 3CVHA 1IAKA 4UBDC 4FFYH 1NSNH 1JGVL 1KJVA 4R96B 2IMNA 2PF6A 4Y4HD 4O02H 1H0DA 4PV8B 1KCRH 4LVHB 2VXQH 5DJ8B 3VXUD 2KQMA 3U46A 2F5AH 3MOBH 1JGUL 1FVEB 4UOW1 1G84A 5L2KE 3WN5C 5C86A 3VFRA 5D9SA 1DBJL 1KCUL 3PNWA 3T8XA 2G9HA 1E6OH 2DQEL 4YXHH 4ONGH 3GMLB 3WNLA 5TQ0L 3IS1X 4TYUA 3QFDB 3X11B 4LCIL 3VG0L 4U6YB 1NQBA 5E4IA 5IFAH 4QXWA 4BSVA 2NY7L 3QO1A 3GSRA 4U1KB 3QUZC 1IM3B 4OZGA 1TTGA 1R5WB 3BO8B 3V6OE 1F3DJ 1QFWL 4LMQI 4PJAE 3FQWA 3NCCB 4WO4C 2RFXB 1DQDL 4M7KH 5DGRA 5CD3B 4IHOA 5E1HB 2ZCKH 3J8F7 4NJAH 2WINB 3WMSA 4WEMB 4HLZH 2NX5E 4M1DL 1UM4H 3X13B 2XKUA 5KOVC 1FLRL 4DKAA 3Q6GL 2VN7A 4HQQH 5I15L 4ODWB 2X4RB 5SWSE 3VW3L 1YQVL 3RX7A 4KI1A 5E2WH 1P9MA 4RAUB 4X9FA 2NLJA 1RULL 2VXTL 4HAGA 5JR1L 3G5YA 4AEIH 3MRKA 3GHEL 2GFBA 3DWTA 2ZOLA 1MCWM 4PJIA 4PJBE 2FYYB 5IHZA 4OIIH 1DBAL 5DUBB 5BV7L 3CZFB 3PHOA 3QEUB 5HGBB 1HCFX 4NO5B 1IGCH 2AK4E 1LO0H 4JQIL 4QRSB 4UUJB 2JE8A 2K7QA 5JHDB 1OOAA 3BD5A 4F57L 1JYNA 1F3JA 4KKLC 2OQJB 3AM8C 3ZKNC 1YQ2A 1EEYA 5ENWB 1RZKH 1LEKA 2MMXA 3A6OA 4GMTH 1NBYA 1Z9MA 2R23A 4EI6A 4WWKB 5KSVB 5JA8B 4PRPA 2Z9TA 5KVGH 4MNQD 3JZ7A 5CZXC 5EBWA 2IMMA 1XH3B 3CU1A 5BVJB 3CIQA 5IMMB 1XEDA 1T5XA 3DGGB 5D93B 1QLFB 3CUPB 1QYGH 1TZIB 4LHUD 5IVZB 4G43A 1Q9LB 1OGTA 1NCUA 4OZGE 1U3ZA 2I9LB 4JZOA 3VA2C 2F54A 2JB5H 2APFA 3V4VH 4L8DA 3HI1B 3K4AA 2DQTH 5CILH 3HPJA 5JW3L 4X8JB 3S35L 15C8L 3UTTA 5ACZA 1U42A 3TNNA 1SEQL 3ECBA 5F3BB 2ZPKH 3MLSH 2I24N 3VRLF 1I7TB 1B4RA 1MCNA 5I8EA 5AWNL<