3IU3A

Crystal structure of the fab fragment of therapeutic antibody basiliximab in complex with il-2ra (cd25) ectodomain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
b'QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWIKQRPGQGLEWIGAIYPGNSDTSYNQKFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the blockage of IL-2 signaling by therapeutic antibody basiliximab
pubmed doi rcsb
molecule keywords Heavy chain of Fab fragment of Basiliximab
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 215
sequence length 215
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2009-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iu3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iu3A02
3EO1B 4W4NA 2XN9D 3VFTA 3WFBH 4PUBL 4X0KB 5EU6B 1F4XL 4WI5A 2A77L 5FOJA 1E27B 3QA3A 4YWGH 3RDTA 4N8VA 3ARQA 1U3HA 4KKAD 1DDHA 5L7XH 4GMTH 1X5GA 3WO4B 3BAEL 2GI7A 2GSGB 2VB5A 3C6LD 5LWYH 5B39B 5CJ8A 1T7WA 4Y16D 5D1ZB 4EUPB 1EFXB 1KTDB 1S3KH 3BI9X 1ODAA 1SYVA 4GBXC 4KDVA 4AENB 3SCMD 4JB9L 5C08E 4QXWA 3O3UN 5INCB 2WUCL 4HGMA 1MIEL 3MRMA 1AGDA 3VFSB 1MFCH 4K8RD 2H8PB 2X1OA 3FOMB 1FGNL 5HHVL 2ESVB 1T1XB 4P3DA 1JBJA 4JPWL 1J11A 1WC7B 3TH3T 3VXSD 2WP3T 1BF8A 1PZ5A 1RZ8B 3W11D 1MCEA 2ZUXA 2AEQL 2CIIB 4X7DC 3KLAA 4KDTA 1MUJA 4LLUA 1GPOL 4WRLA 2I24N 1YMHB 3O3AA 4KRMB 4RX4A 4XCNB 3I3DA 3ULVC 1FYHB 1QFHA 3VFUB 4NQUA 5CJQL 1S9KC 2Y36H 1I1YA 2XWTA 3QSKB 4UT6H 12E8L 4GAGL 3RWFB 3RWEB 1MHEB 4OZGE 4MNGE 4OZHA 1TLKA 2H9GA 1G7JB 3MYJA 4X6EB 4QHLA 3WNNA 5JTWA 5BZWB 3LEYL 1MRDL 5DRNB 2ZCKH 5L2JB 1F42A 5DYOA 5EOQL 4PGEB 3VG9B 4E41E 5KJRL 3UX9B 3BO8A 3IDXH 1IC5H 3MFFB 5ELIA 3VCLA 3VFPA 4IDJL 4ZSOA 1CT8A 4HZAA 4QOKA 2IFGA 2O5XL 2Y5EA 1HWHB 3MODH 4XC3H 2H41A 3TIDA 1ZLVK 2BC4A 5FO7A 4WUKH 4YHMH 2P5ED 5E7FA 5MEPA 3MLTA 1FFNB 4PJFB 4RX4D 25C8L 3ZMRA 2OZ4L 3D39D 4LSPL 3U7YH 1U58A 2XT1B 2IADB 1M71A 5ALCL 3TZVA 4M1CD 1JGVL 4OI9A 5HGHB 4KPHH 2A9NL 4YDJA 1EA9C 4X98B 1IBGH 5IKCA 2FHBA 3JV6A 3QFDB 4MZ3A 1CBVL 1I1RA 1N64L 5DJ8B 3HE6C 5L0QC 2B4CC 3MLWH 3BZFB 4OBSA 3P0YL 1MEXH 1R5IA 4M4PA 4M7KH 3GMMA 4FP8L 2PO6C 7CGTA 4P4KB 1Q94B 3DMMB 1WAAA 5I19L 2R4SH 3PNWB 1TFHA 5KVGH 4XNQA 1OF2B 4BFIB 1KB5L 4Z78B 5FB8A 3DV6A 2VDKH 4UB0L 2CUHA 5HVGB 2OZ4A 1F4AA 5FUZL 1IAMA 2G2RA 1MCJA 2EH7H 5A2LH 2X6MA 1BECA 4F80A 1QBML 3MLYH 4TPRH 5KSAA 3TZVD 2R0ZH 4G8GE 4ZXBA 1EUTA 3UP1A 5JOPD 4D9LH 1AGCA 4GKNA 1LMKA 3MJ7B 3GBMH 4KKBC 4PYHA 1UJTA 3DV4B 1R6VA 4LLVB 4LVHC 4R4NC 4MAYC 1G9MH 4J8RA 1KFAH 2VUYA 4RSVA 4HUMB 1OLZA 1FFOA 3L7FA 1VFOA 5L8KB 3Q3GA 3HZYA 1AQDA 1FAIL 1LO4L 2OXHA 1M4KA 3OAZK 1KB5A 3B2UD 4I3GA 1T5XA 2HVKA 3GSNB 4CW1A 3BZ4B 4KFZC 2D7TL 1WCQA 1WZ1L 4WFHD 2ED9A 3WJLA 5DQJB 1HHGB 5E8NA 1AD9A 4LF3A 1IL1B 5IVZB 5I71B 4P2QB 4TVPH 4UOW1 3SJVA 1INQA 4GW1B 3WFHA 4MD5B 4ODXA 3CH1B 5HI3C 3EYSH 4JZJA 2FEDC 3MV01 2X4TA 5DHXB 1RHHB 1JWMA 4O2CA 4YPGA 1MCNA 5B22A 5GZOD 4PRHD 5IBTL 3ES6B 3H7LA 4L4JA 4QTIH 4L1HA 4AL8L 2VLJD 2UVEA 1KF9B 2P44B 2XTJD 1KIQB 4LU5L 2OP4H 3FB5A 1UZ8B 1XF1A 5FYJD 2YZ1A 2OL3H 4KUZH 2Z92A 4R90H 1K2DA 4JQXA 1R0AH 5GS2H 2UZXB 3LRSB 3EFFB 1LDPH 5JHLH 3T2PA 4C4KT 1T4KA 4NOBA 2KUTA 3QO1A 3QQ9D 3V4UL 5I15H 4NBZB 3OTTA 3SDXB 4IS6B 5C0GB 4UBDC 3STLB 5DR5H 2F9BT 2YD5A 1ZVSB 3SJVD 3DRTA 1V3LA 2Q86B 4J3SA 2D31A 1HILB 5DHVH 4PRNA 4QTHB 4MXVE 3MRDB 2VKWA 1N5YL 1E0OB 2VIRB 4MQSB 4MVBD 1T1YA 1IGJA 4JFPB 1FNFA 4WJ5A 3IU4L 5JLZA 1LE5B 4NJAH 4IIQB 1AKJD 4ODVL 4F15B 4P2RD 3VGAB 4FXKA 4DAGL 1A0QL 1A1OB 1U41A 4JY5H 3D0LA 5JZ7C 1YNLL 3SGDH 2VE6A 2AXGB 1YN7B 2ZPKH 3WFBL 1ZT4A 1I9RH 4FTVA 5TFSH 5IQ7H 2EE9A 5AG9A 3QQNA 5FUOL 1PW3A 4HSQA 5HHPA 2AQ3A 2DQEL 2DQIH 4ZOEA 1AIFB 5HI4C 1KPRA 5BRZE 4FQ2L 4LKCB 3P9WB 3HMXH 1WBYB 4NJ9L 3D69A 3CGTA 4HGKC 3QIUB 5I74B 3B9KA 3D48R 4G8FB 3NGBC 3A6OA 1X5JA 4PJBF 3KPSD 3AM8C 1HN1A 3QRFM 4JRYA 2R0KH 4ONHB 3VGEA 4XPHL 2HWZH 2WW8A 5DEFB 4O58L 1S9YB 1ZA6B 4CVXB 5IQ9A 1CD9B 4GRMA 1NC2A 1JYVA 4LQ1A 5CP7A 1YECL 3AVEA 5F9DC 5HGDB 2Y07H 1MFCL 5C0EB 4FQXB 4KDWA 1VADB 1D6EA 1KXTB 5SV3A 3WFCH 4YHKL 2YWYA 2ZZUT 4FTVD 2EKJA 3NIFF 5F1KC 1VPOL 2I9TB 4CL7A 1I8KB 1U8MA 2EECA 3G08B 3VFNB 1P5UA 3VU2A 3DARA 3VFWB 1CXIA 3HG1E 1T21B 3D25A 1MWAH 4F37K 2J8OA 3VI3E 4QRTB 1YQVH 3N0PB 2DIJA 4X6DE 1Z9MA 3RNKB 1JPGB 1FCGA 3QHTC 4HIIB 3O3DA 3IDUA 1IKFH 4JQIL 5IHUH 3AROA 4Z7VE 3BJ91 4CJ1A 1J0IA 3U9UB 2VLRD 4PJ8B 5EZJB 4KY1L 2O61B 3HI5H 4R3SA 1SVZA 1PYWB 3MV8B 3DETC 5J3HD 4XP5H 1MOEA 2VXTH 3ZDZF 2NY6B 4NWUH 2WAHA 1GGIH 2V6HA 1KCKA 1UWEH 5J56B 1QEWB 1HSBB 2ZCKL 2BCKA 5D7JB 3MRPA 5FO8A 1CQKA 2DQGH 1G9NC 1KCRH 5IT2L 1HOCA 1KBGL 2X4SA 4YXLH 1P53A 3P40A 4TTDD 1A3RH 4OM1H 1J9CT 2OMNA 4G8EA 5D7IB 3WN5B 4U3HA 3MODL 4XH2A 2EKSB 1CFQB 1G7MB 4TSCH 5ICYA 2HA1A 3VXOB 3U7YL 1KN4H 5AWNH 4ZFFB 3RBSA 1MLCA 4Y4HB 1U3YA 4RGND 5J9PB 4J6RH 1TPXC 2E9WA 1DN0B 2APWA 1IBGL 3E2HC 1KJMA 4ZAKA 3QCVH 4M43H 4NRZB 5D7KD 2AQ2A 3QG6A 1P1ZA 3UTPD 5F8RC 4QXGH 5B38A 3RHWK 4N0UB 1BPVA 4Y5YC 2BK8A 3LN4B 4NO5B 1YEDA 1A6TA 2R4SL 5KVGL 2OQJA 2DYPA 2VXSL 4Y8DC 3QJFB 4PJFF 3QDGB 4KTDL 3O6FB 4P23A 2G9HB 1B4JH 5DC4B 2GY5A 1JGUL 2JJSC 2CMRH 2VDRH 4LAJH 2ZWLT 4FMFA 4U1GB 4M1DH 4OZFG 5CIPA 4TPRL 2KPNA 3MX0A 4LIQL 4LL9A 1QRNA 1R3KA 1EHNA 1KIPA 2W60B 3PP3K 5D1QB 5D5MB 4IOIB 3GBML 1NBZA 4X4XB 1NLDL 4OTXH 5KVFL 1RUQH 4NO0A 2ZUVA 3BT2H 1KFAL 4OIIL 1MPAH 5EA0L 4R97B 3REVB 1CR9H 3VRJA 5EG6C 1GYAA 4BYHA 4NKIH 4IMKA 3VFVA 2DM2A 3O4LB 4X83A 4KUCD 4NKMB 1IAKA 5E6IA 1JNJA 3S8WA 1WBXA 4LSTL 5EIQA 3TBVB 5T3XE 1F4YL 4TVPL 1K4DA 4NPYB 4V1DB 1KG0B 3B8SA 1A6AA 3GK8H 4YHNB 5HY9B 1CGSL 1RD6A 2OJEB 5C09B 4N0UE 4QHMA 2VXUH 4CDGC 3L7EA 1U8QB 5HHQA 2XYCA 2X9WA 3QNZA 3LRGA 3MOBH 3FQRA 4NBXB 2GJ6B 3OB8A 3MO1A 4XCEB 3X12A 3MACL 4YIQB 3QUKA 3ULVD 4K07A 1JF5A 2NX5D 4GUPB 3VMOA 3C87A 4L29B 5DRXB 3QEHB 4R90L 4PJGA 4JPVL 4K3DL 5D93C 3CFEA 2Z4QA 3N1GC 4PJDB 4OIBA 1LDPL 5JHLL 4QRPE 3RWIA 4F7TA 1OB1A 5JQ6L 4ZPTA 1T0MB 1FN4A 2H26A 3OKNB 2ARJA 5IGXH 3RWHB 3JXAA 1WCBA 4LLDB 3P4MB 1DFBH 4ZUWA 5DUPH 2ZJSH 4YO0B 3O3BA 4PJXA 4K55A 1RI8A 4L9LB 1NMBH 3I6LD 3IDNB 2GFBB 1IM9A 1Z6JT 5BMFL 1BQHB 4M48H 1H5BB 1ZLVH 4G6JL 4RFEA 4XXDB 1AD0A 5EZLA 3D2UD 2OI9B 4NJAL 1GGYA 3D87B 2Z8VC 2EDYA 1M1SA 4XX1G 5CGYD 4RISH 4S2SB 5DJAB 3TCLA 2NXZC 1SBSH 3SDXF 5FDYA 2ZPKL 4HF5H 3WFDH 5F7NC 5E2UL 3CDGB 5IQ7L 2GJ6E 3FB8A 4H1LG 4FQJH 5E2WL 2XICA 4K7FB 1MI5D 5FHAH 3SBWA 2PO6D 2A83B 3EJZC 4JZOB 1A6VH 3HMXL 3FJTA 2DI7A 4NKDB 4GRWE 3R8QA 5KSVB 2VH5H 3GSXA 5EUOA 4HIXL 4LRIC 4U1MB 3L6FA 2YKLH 4JJ5A 3FN0H 5IOPB 1HHHB 4ZFOB 1LP9B 3TYFA 5IMOB 2HWZL 4MGXA 3IAPA 5HYEA 3MLVL 3PHQB 1RSFA 2SEBA 3LPGA 3QXAB 2BVOB 3D85A 4O51A 1P2CB 1Y0LB 1VGEL 4OUUA 1XGPB 2P5WD 3IDIB 1F6AB 35C8L 3S5LG 4I5BA 1ZLSH 5EU5B 4X6CA 1IKNC 3PHOA 4F7CB 5DJYA 5SWSA 4MA8H 4LK4A 3GSRA 1M05A 4CGTA 3HMXA 3CSYA 1SEBB 5KVMC 3U0TB 3ORJA 2HG5A 1MWAL 2VLLB 3OAZH 4PB9H 5I16B 3WUWB 4PJ5B 1A7OH 1FNGB 3X17A 5JOFB 4LHQB 5EO1B 3FO1A 5MEQB 1P4IL 1IKFL 3MRGA 5IHUL 3PWVA 5GRVK 4BFGA 5J13C 5E94A 1S7XB 2FD6H 4P9HC 4EUPG 4CBPA 2GEEA 4YDIH 1G1CA 5L9DH 2FEDD 2BOBA 5GRUH 4S1QL 1EEYA 1X3DA 2JJTA 2VXTL 3REWB 4NWUL 3K2MC 1EMTH 3EBAA 3UZQA 1OWWA 1IAIH 2JK5A 3IU3B 5C07A 1W72H 2A2QT 5E1HB 1KCRL 1JNLH 3JV4A 2UYLB 4JKWA 1A3RL 4OM1L 4R7NB 1WICA 3NCYP 4AM0B 2A9ML 1DN2A 3U36B 3UJIH 4U1SA 2YPLD 1U3HC 4N0YH 5GGSB 3GMLB 4H25B 3RWGB 1EDQA 4WUUA 3BKCH 4PJ9A 1OTUC 2JB6A 5DI8A 1NGPL 1UM6H 1MFBL 1N2RA 1OGAB 5BO1L 3FO2A 4WHYG 1P9MC 4WNQA 3JVGC 1XF2A 2IQAA 2FJFA 4QXGL 3HRZA 4PJAA 1N59A 5JPNA 5GJTH 1UXSA 2IMMA 3ECBB 5C07D 4PFEA 5D7IF 1T20B 3ZDYF 3DX8A 3LD8C 2EIZB 3UMTA 3GI8L 3DX7A 3B8YA 5LGHH 4U6XA 4OZIA 3SN6N 5JZ7D 3H0TB 3BGMA 2YD7A 2A74B 4QWWD 4EI5C 2PXYA 4HZLA 1DQLH 1PJ9A 4LFHD 5FDWA 4NCC2 3DVGB 3GRWH 4GRWH 3BQUC 1JHTB 2VDRL 4JN1H 4QF1B 4M1DL 2C1OB 1DBMH 3IETB 5HI4D 3FTGB 3LZFL 3PGCB 2ITDB 3RZCB 2ARWA 4L4TE 1WT5A 1GC1H 1MREH 5C0BE 4RAUB 4X5WB 4OTXL 4JPKL 4U1NA 2ED7A 4HKBA 5CWSB 1V8HA 3BT2L 2VN4A 5K93A 1N8ZB 4NQVB 3X13B 1HWGB 1KEMH 2Q76B 3MLUH 4Z7UE 5TJWK 1CR9L 4I1NB 4RMTA 3VGGA 1S7VA 1DZBA 5AUMA 4GW5A 4JLRB 5DDHB 2IBBA 5DGQA 2E27L 2OK0H 2VMFA 3PUCA 2YBRA 3CXDH 2AJ3B 4M3KB 4TUJB 5DUMH 2BX5A 2MHAA 4NGHH 3GK8L 2AV1A 1HINH 4NQEA 1WITA 1EO8L 3LS5H 4R26H 2VXUL 1U8NA 1OCWL 3LHPH 4LSVH 4OM0H 5HPOA 3LDBB 2X4RB 3ARBB 4A6YL 3MOBL 4JFOB 1AFVH 4KRPB 3VRLE 2B2XL 4ORZC 5SWZE 1OP9A 2IANE 4L4VA 4MYWB 3P9MB 1XIWD 5BW7C 1S9WB 1S9VB 2XZCH 2B0SL 1YMMB 3QFJA 1A1NA 3DETD 2H2SD 2HFGL 4YGVB 1CFVH 2QQKH 3BPLB 4HWEL 3V5HA 4NZTH 3EGSB 4UIMB 1CE6B 5F7UA 1JGDB 5D2LE 3KPPA 5I8KH 1T5WB 1U8LB 1DFBL 4OV5B 2ZJSL 2DLFL 2ADJB 3FN3A 1MJJA 3MV7D 5HDBE 4A6YA 2OBGA 3BKMH 3PWPB 5FKAB 3PP4H 2XFXB 4JAMB 1UQSA 3JTTB 1KYOJ 1V3KA 3FFCA 3CZJA 3OZ9H 5GRYA 1U8HB 1T1ZA 2LVEA 4AIXA 3KDMB 4PJDF 5C6TL 3O8XD 4WDIB 3TA3A 2JJUA 2AGJL 4P49A 3UTZB 43C9A 4RISL 4WCYL 3DXAA 4UNVA 2R2EA 3BPNB 5HXMA 2D7MA 3SDAA 2KQNA 4HF5L 1MHPL 3ZYOA 2NW2B 2Z0BA 3PV6B 5MENE 1K4CA 5ISZB 5DSCA 3HB3C 1QR1B 1HXYA 3EFDL 1TENA 4FQJL 3VD7A 1CVRA 2UV3A 5EBGA 5EC1A 2H6PA 1PG7X 3NAAH 3H2WA 5GGVH 4DKFH 1A6VL 3P30L 3VRIB 4MNQB 1A7NL 1T0NB 3NABL 4JZJC 4JY4B 2OR7A 1OARL 3TO4A 3ARVA 4L3EA 1B9ZA 1JUFB 1KNOA 1HQRB 3BSZL 4G80A 1JN6A 1X4ZA 5DJ0B 3AUVA 3U1SH 4HWZB 2Q8AH 3MLRH 1PGRB 1NQBA 3TFKD 3DLQR 4N0CC 1TTUA 1EAPA 3BP5A 5BS0B 3Q5OA 4DK3A 4JQXC 5FA3B 3QDJD 2AJUH 4XAKE 3PP3H 3B5GA 1ZLSL 1TNMA 2MTPA 1GH7A 4EVNA 4LEOB 2P8PA 4NZRH 1IRAY 3C6SB 1NDGB 2W0KA 5IMMB 3MRLB 3F7YB 1YJDH 3KJ6H 5HVHC 3LKNA 3VXUE 3WHE1 2FJGA 1A7OL 3EYFA 2GUOA 1OPGH 1P7QD 1AO7E 4XMPH 3TO4D 4LASL 2NY2B 1AHWB 1J1OL 5B8CC 1JCKA 1NAMH 2FLBT 3QCTL 5T33H 4JE4B 1CICA 5AZ2H 2FD6L 5ISZE 3R06B 2ZKHL 4YDIL 5E2TL 1H3TA 1KPVA 3GJFB 5GRUL 3U9PL 1JYNA 4U6VL 5GGRA 3ROOB 1UEMA 2PYEB 4NRYA 1QLFA 3QIBD 4U1JA 4QRQB 4HMCA 1P4LA 3B6SB 5EORL 6CGTA 1XR8A 5K59F 1EMTL 2DQUL 3HNTH 3OX8B 1EEUA 1P6AB 5C0AB 3F7VB 1QO3A 5A3IC 4LKXB 2Z91B 4NQCA 1RUKL 3QEUA 3GIVA 3UDWA 4G9DA 2VC2H 1UACL 3BEVA 5KS9B 3DGGB 3IT8D 2NY3C 4H0GA 2YUXA 2HVJA 4E0RA 3B9KC 3HI1B 1I8MB 4I0KA 1DQQA 2QQLH 5HHOD 3T0ED 1UM6L 2VXQH 2XWJB 3V6FB 4EN3A 5I1KH 2Z31A 1N4XH 4LSUH 1E4KC 3RI5K 1WEJH 4RNRA 4KH2A 4ODUA 3TPKA 4F58H 1FG2A 3QEQD 5CD3A 1T0PB 5E8OB 4LCWB 2DL2A 2OR9H 3WEXB 1LEIB 3SQBA 5CD5C 1E4WH 5IB2B 1L0QA 3KXFE 4KK8C 1INDH 1YY9D 1BLNB 4JO4H 4PJEF 3RVUD 1L0XA 3S35X 1S7WB 3U30B 1FSKB 1J8HA 4P59L 3ZE0E 3E6HB 5IF0B 1JNNH 3V6BR 4XVJH 5FYLL 5ERWB 3PQYB 4IRSA 4RWYL 5I17B 1JHLL 2Q7YB 4D0CB 3DECA 3RNQA 4S1DD 4GXVH 2AK4A 1JYWA 3P77B 2AXFB 3EJZD 1KCVL 2DM4A 4HUWB 1GC1L 1MREL 1S8DA 1GZQB 2ADFH 1FGVH 1RZGA 3ZKXC 2EE3A 1P7KB 4MA1B 4K71B 3RKDC 1BD2D 5E9DA 2IPKA 2GY7B 2XN9B 4KQ4H 1M7DB 3FONA 4Z5RB 2IBGA 1IAII 5EWIL 3OGOE 2DLHA 3D9AL 5AZEL 3MRRB 3RUGB 5F1SA 3VFGH 3GM0A 2W0FA 3ULUL 1KELL 3WXWH 1HQ4B 4IJ3B 5DUML 1ND0B 3BUTA 4NGHL 5FK9A 1D5BA 3DTXB 4D0DB 3C6LB 4LCWE 4I8DA 5FGCB 4Y16B 5CILH 2RFXB 3IJSA 5GSRB 5IM7B 5FO9A 3C08L 4LSVL 2BZDA 4FQHA 4PRPB 5D8JH 5IEKA 4NQXA 3SCMB 4POZC 4XX1E 4S0TD 3L3KA 1IT9L 2FGWH 4PJCA 3WD5H 4ZAKC 4WW2A 3CZFB 4ZNEA 2LFGA 3ZTJH 2JF1A 3O2DL 5D2NC 5TF1H 4WO4B 1R5VB 2OYPA 2FDBP 3PGDA 3VXSB 3SDYL 1KTLB 2XZCL 5CMAB 4N90D 4LP5A 1CFVL 2QQKL 4JRXE 2DM3A 2YSSA 5KBNC 2R1XA 4PLKC 4FFYH 3W82A 4FQCH 4MLIA 1G7HA 3MCG1 1DDHB 4FNLH 5I1IH 3HCVB 3V5KA 4OZFH 4J23A 4P23C 3FB7A 2DQDL 2VR5A 3PWLA 4X5XA 2CGRH 1RUMH 1FLRL 3PP4L 3OKKB 5F1IA 1N6VA 1L4IA 3ZE2F 2FSEA 3VE0B 4DCQA 2BY0A 3RA7L 1BGXH 3O2DA 4O5LL 2XXCB 1M6OA 1NEUA 1Q1JH 4YFLF 1J8KA 5IG7B 3U79A 2FWOB 3G5VA 1PZ5B 1N0LA 2QBWA 1J18A 4PRPE 3E1F1 1Q9LB 3SKMA 5E6IC 2DIAA 3WKNA 3VXMA 1BQSA 4X8JB 2P5EB 2NY0C 4PRBB 4OLZL 5J4MA 3EYQC 4HT1L 1QSFA 3D39B 4DKFL 5GGVL 4TRPL 3DO7A 1ES0B 4YBQC 1QPXA 4O02L 3L3GA 1RZFH 4WI3A 4WENB 3QNYA 3R1GH 4PRID 4EI5D 3U1SL 3TIEB 5KSUB 1ZS8B 3CXHJ 1KT2B 1LD9A 4HKZA 3M8OH 5BOZG 3BQUD 4HIJB 5BV7H 2GK2A 2VDLH 4F7PB 5KTEL 2B39A 4NT6B 3SDDC 4RFNC 3ILPA 3TT1H 4I13B 5EBWA 4YHYC 1A9EA 4HXBH 4AEIL 4L8SC 5E5MB 5I73C 1CLZH 2VDNH 3QAZC 3VCLB 3KJ4C 4NO3B 4O2FB 4NZRL 1U8IA 5INDB 1LO2L 3TIDB 2FIRT 2JTDA 3VXMD 5J6HB 5EUKA 1DP0A 2IH1B 1BBDH 1TZIA 2BVQB 5F97E 3W0WD 5F8QC 2QR0A 4MJ2A 1WUNT 5IMKB 5E8EA 2VXVL 4ZOBA 3TP4A 1NCWL 1OPGL 4XMPL 1XGYH 3RY6A 1RULL 3G6JB 4WTWA 5B3JF 4JFFE 4YHPA 1CZ8H 3O6LL 2P8LB 5DO2C 3OAUH 5F3BB 5F1NB 5JHDB 4LLWB 4EKXA 2PCPB 2AEIT 2NPLX 3BDYL 3L5WA 3NN8A 3BESR 1IARB 2CIKA 3T4AB 5E8DH 1E6JL 4HC1H 4HWNA 5C0IB 3G04A 4FQQA 2X05A 1BWWA 4H1LH 4X4ZA 3GSWB 3WIIH 5F9OL 3DX6B 3CLFL 5L88H 4HKJB 3SE4C 3VWJA 2ICWI 2GSIA 2VISA 4DEPC 2WBJA 3NCCB 5C70A 3QULB 5GS0D 2HJFB 3HFMH 2M26A 2VC2L 1C16A 1RIHH 5FXCH 1UH4A 1FLTX 1FFPB 1A9BA 1F8TL 4PRHB 4FABL 1R5WA 5C7XH 3P11L 3R0NA 4X9GA 2J8UA 2VLJB 4P9MH 2XTJB 3WIFA 1XGRA 3MLSH 5I1KL 5EIIB 3HS0A 4LSUL 2NXYC 4ZO8A 4AK1A 3JWNC 3N1FC 3VGHA 3BWUC 4GQPH 4N9GA 4F58L 3OR6A 4HUVB 4L8BA 5MI0B 3VGDA 1DQTA 2QQNH 5T1LA 5JOPE 1C5DB 2QHLA 2JCCF 3OKLA 3WSQH 5E8NB 5D72H 3VWJD 5I8CA 3SJVB 5IJVA 1BQUA 5C0CD 5JHDE 2FIKB 3R4DA 3V8CA 1ORSB 3IDGB 2LV4A 4PTTB 3SQOH 4BJLA 4C56A 1M7IA 5FFLA 4XVJL 2E3VA 4KV5E 4LPXA 3FOLA 4ODHH 4NZDA 3LKPA 3HB3D 4EUPH 1HIML 1RK1A 4WWKA 1QKZH 3SGJC 1N3NA 5T1DL 1S7SA 3SO3C 4GXVL 1AKJB 1Q72H 1T3FA 4P2RB 5D7LD 4H5SA 1U2HA 4WI9A 3IAGC 4F57H 1NCNA 2C9AA 4PJ7F 2ZCHL 3OXSB 2GJZA 4LOUC 3TJHC 1SY6L 5F96H 5E00B 4KQ4L 3LS4H 5D9SA 5T1LD 3T8XB 4I48B 2R2HB 4XP9H 1XT5A 2W9EH 2W65A 4LLAA 1QA9B 2F54D 4UNTA 1KLGA 4P5TD 4Q9RH 1UADC 3I2CH 1RZIB 3VFGL 3IGAA 3DRTB 3I84A 3WIHH 4DOHB 1HHKA 1WIUA 4Z7WF 2V2WA 4HBQA 3NACH 5TQ0H 1D5XB 4KI1A 2FEEL 3GO1H 4H26A 3P4OA 3CX2A 4ZOCA 4ZUUA 3KPSB 4PJ9C 4JDVB 4RMVA 2ZSVB 1UWGL 1XF5A 4WHYH 3P4LA 4NYLA 2CLRA 4UMGA 1MCQA 3M17A 3QEGH 1SY6A 1DQDH 2JELH 1UZ6F 2EXYC 1R3LA 3CSGA 5TGBA 3IKCA 2X4UA 4ZTOH 4C83B 1CFSA 1NBQA 5GRVL 5TF1L 1U8KB 4FTVB 3B3IA 2G5BA 3LKQB 1OSPL 3GMRB 2JKXA 2CDGA 1NFDE 5CJXC 3HR5B 2C7UB 5ESVA 1KGCE 2XWBB 3BIKA 1JYXA 2EDXA 2FL5A 1CG9B 1EZVY 1G0DA 2PXYC 4P57B 5I1IL 2X7LB 3V2AR 4MXWH 5J8OA 4CVZA 4P3WA 4F3FB 3DSFH 2F8OA 2VLRB 3JWOH 5DURD 1IZJA 2PTTB 2CGRL 43CAA 2NY7H 1RUML 3MMEB 3ZL4H 3O9WC 5IQ9B 3GMOB 3BW9A 3ZT5A 4PBVC 3STBA 1FZKB 1A4JA 2H1PH 2NY3D 4D9RE 2EYRB 4HX1A 4DOHE 1J10A 3BD3A 3PGFH 4MX7B 2VR9A 1VEPA 3BGAA 3CMOH 4EI6B 2Y9RT 2DDQH 1A7QH 4NDMA 2DMKA 5DFVC 3EOBB 1Z9LA 4Z0XA 4LVNC 4OD3H 4JZNB 3BDXA 3F6IA 5IESH 1JK8B 5IW3A 5BVJB 2YN5A 4AIZA 4KI5F 3ARGC 2MSPA 1HZHH 4OZFA 5IB4B 4Z7OF 2Q8BH 3F58H 4XWGH 3SOBL 2VNCA 5K9KA 1DBBH 4JM2C 2CJUH 1UM4L 2VAJA 4IEFB 4QHUA 4RGNB 5GGUA 1TVHB 5FYKD 1RZFL 1U8PB 1G7QA 2A6KB 2FB4H 5KW9H 2PTUA 3R1GL 1MCDA 2ERJC 1CD8A 2QTEA 3TM6A 3M8OL 5JPMB 4ZYKA 3TJEL 4HS8H 2NTFB 2VDLL 2UWEB 1LEKA 2R0LH 4OCSH 5H35A 3BUYA 2VLRE 4EDXA 1EEZB 4HXBL 1B2WL 5T3ZH 1BZ7A 1XF3A 4GRLC 1CLZL 3H9SA 2VZSA 1OTTC 1UXWB 2O26U 3BOVA 4JGJA 3E3QE 3NIDF 3QXWA 5FYJU 3RKDD 5FV1L 3CFDA 1FVEB 3U6RB 1G9EA 5GS1A 4P5KB 3WHXA 5LAXB 5CEZE 2NY1C 4P4RA 2DWDA 1BBDL 4HCRA 1X5LA 4RMSA 5DUBA 4OZHF 3QDAA 1N7ML 1LE9A 1HH9A 3QDMA 3V95A 1C1EH 2EDOA 2VR4A 1VKXB 2DQCH 4YAQA 2DQJH 2IFFH 1TJIH 1KJMB 1FVCB 2HYMA 4NHCH 5EZIH 1N0XH 3SE8L 3TA3C 1XGQA 3MRNA 1HXMB 3KPRD 1HHJA 3L95A 5ANMA 3DHJA 1JPFB 3VD9A 2HLAB 2AJZA 2ATKA 1OAZL 4QY8A 2CKBB 4JHWH 3WIIL 4DN4H 4AT6A 2IG2H 3L3IB 3D3VA 5L88L 3BRDA 4M5YL 4JO2H 1KJ2H 3MV9D 1GIGH 4M7LH 4X4YA 1CYGA 1F11B 4PYGA 3T2NL 1KIUA 1RIHL 1PKQE 3G6JF 1X7QB 4QXTA 5GGTH 5DC9B 1RZJL 4JO1H 4TUKH 2B7DT 3GUTB 4PJIB 3QDMD 4AH2A 2OXGA 1S78C 3GHBH 3W5MA 1P5VA 4JFXA 3WS6A 3UJJH 3IXTA 5DJCB 4P9ML 4APQC 3LKSB 2NX5B 3MLSL 3LN5B 4XB8A 2W9DH 4DZBB 3KAAA 3QQ4A 3GGWA 3WL9A 1D5IH 3G5YB 1CFBA 5E08L 5BVPH 2QQNL 4MDIB 4HXAL 3TEUA 2BNRA 1VFBA 4HK3J 3WSQL 2XOTA 3NPSC 1TQCC 3EO0A 3PWJA 1G6RA 3EOAA 1NGXB 3H8NA 4DKEH 2I9LB 1WBZA 1XGTA 4ODHL 1JTTA 3KPQB 4RQQA 2RCSH 4I2XB 2AVGA 4PJBA 1I3GL 5I1HH 5F7MC 3UEZA 5DJ2A 2NY0D 4J4PA 3UTQA 3D2UB 3EYQD 1NBVH 1T04B 4ZTPH 4YUEL 3S5LA 1SJVA 2WP3O 1RK0A 3FO0L 3QH3B 4YBQD 1KEGH 1QFPA 3EO1A 3CVHH 4BQ9A 5DQ9B 1WISA 4X0KA 1T2JA 5EU6A 5ITBL 4NN6B 4PJIE 4KTEH 3U48A 3LS4L 4GJTB 5EU7C 3KPNB 1V3JA 1L9NA 1E27A 1Q38A 4XP9L 5F9AC 5C08D 4AEHH 4ETYA 4OFYA 1JHKH 1MI5B 4Q9RL 4Z8FH 3ULVE 3HI6L 2PO6B 2VQUA 2CPCA 5IROA 3SDDD 4JFDE 1A5FH 2DLGA 2CH8A 2GSGA 4OCMC 5B39A 2UZIH 3PXJA 3T4YB 3G5ZB 4WWID 5D1ZA 1KTDA 3GO1L 1UB6B 2NR6C 4FRWA 4WTXA 4AENA 1X44A 5INCA 3W2DH 1AE6L 3L3HB 3VFSA 2V17H 2H8PA 2MPAH 3FOMA 1QBBA 2P5WB 2ESVA 1YEJH 1NCAH 4M7JL 1WC7A 1T89C 2F74B 2VDML 3O6KH 1RZ8A 5DO2D 1ULVA 4I2XE 2CIIA 3C5ZD 1FG9C 5I9QC 2R29L 4Q6IC 1IQDB 2F19H 4NZUH 3L1OH 4YNYB 4HPOH 1PEZA 1YMHA 4XCNA 1Q9WB 5ADPL 1BF2A 1IAOB 4E41D 5JXEC 4UDTB 4Z9KB 3UTSE 1ETZB 3SKUD 4IRSC 4MXWL 1MCPL 3RWFA 1GZPB 3RWEA 1MHEA 5IV2B 3EZ8A 4ZMAT 4Q2ZB 3OV6A 3V4VH 3CFIC 4JFEE 5FAAA 2VLKE 4X6EA 2YA2A 2DJUA 2EC8A 1NGWB 4FQ1L 3B43A 5BZWA 5DRNA 3STZB 5L2JA 4PP1C 4HHAB 4PGEA 2ICEB 2HJLB 1NFIB 3CMOL 3QHZH 4P2OC 5C3LD 2DDQL 4I0PD 3IJHB 3C2SA 1UH3A 3ME0A 5D1XC 1ZTXH 1ZLWK 2EYTB 3UJTL 4KMLB 2NXYD 4OD3L 2D03L 3CSYB 3MLZH 4N1EA 4RFOL 5IFAH 1V7NH 1FFNA 4PJFA 2YPLB 1HZHL 2ZNWA 1W0VB 4LSQH 5K9OB 2P5WE 2QLVB 1F3DJ 3RWJA 1JPTL 2IADA 1KENH 2Q8BL 3F58L 3H42H 4U0QB 4JCMA 5HGHA 5LGKA 2D7NA 1KV3A 4X98A 1JL8A 1Q0XH 1ZHKB 3QFDA 5LKNA 3FB6A 3QWRD 2B1AH 5DJ8A 5FF6B 3T0AA 1GC1C 4ACPA 4V2BA 5C0RL 3HC3L 1J5OL 3BZFA 3NZHH 1WFTA 3S37H 2IAMC 5CINL 4WHTB 2A6JB 2CR6A 1EJOL 4D2NA 1AQKL 4P4KA 1Q94A 1LNUB 3DMMA 4NQDE 4HS8L 1P4BL 3PNWA 4G8GD 4ZFGL 5J1TC 3WKMH 5C07B 1OF2A 5JNYB 2R0LL 4BFIA 2BERA 5GISL 1P7HL 2H32H 4Z78A 3TBSB 4U49A 3KWWB 3GSNL 2WBWB 2WSKA 5T3ZL 5DVOA 5EH1A 2I07B 1SEQH 3ULUC 5DRZB 3PL6D 2WWKO 1ZHBB 3A67L 2WQ8A 3TJHD 2YPVH 4W4OA 3X3FL 5DWUH 3MJGX 4TNWF 5ITFB 3GJFK 4NM8H 1D9KC 3D18B 1YA5A 3H6JA 3MJ7A 1IC1A 1C1EL 3EJJX 3DV4A 4LLVA 3CFCH 4XNYH 2DQJL 2IFFL 1TJIL 4C4KO 3NGBB 5HHME 1NEZB 4X80H 4NHCL 4WNQB 2FBOJ 5M7QA 1BIIB 1ZLUK 2P43B 2WV3A 5EZIL 1TZGL 2NY4C 4BQBA 1IEBB 3GSNA 3ZYIA 3BZ4A 1QSEE 1DQML 2X1WL 3DIFB 1URLA 4JFYB 2YHGA 5DQJA 1HHGA 4WFFE 1IL1A 2KZ1B 2GKIA 4GOSA 5IVZA 4DN4L 4P2QA 2AJVH 2EXYD 2BXYA 2IG2L 4GW1A 5HYJE 4MD5A 3BMVA 3CH1A 3BX7C 4ELME 1ZXQA 3AS0A 4PJEE 2OTUB 4EJ1C 4GAFB 1FPTH 4LDEB 1RHHA 5T1MB 3X11B 3QG7L 4RMRA 4K94H 3ES6A 4TUKL 4JO1L 2Z93B 4HJ0C 3MRKB 2BSTB 4M5ZL 1KIQA 4M7ZC 3GHBL 4KGLA 1RHFA 3UJJL 5DEGB 2X89D 4LCIH 1RU9H 4UV7L 2FX8H 1J87A 1XIWB 3DRQB 2W9DL 3LRSA 3EFFA 4B5EA 5GGQH 3PXHA 3O9WD 3JUYA 5CJOH 1XF4B 4P2CG 3LH2L 4KVNH 4OCXH 4GLRH 3SDXA 4IS6A 5C0GA 4KROC 4BFEA 3G9VA 3STLA 2IGFH 3L3DB 4ONFH 1A3LL 5B21A 1ZVSA 4L9DA 4FFVC 1JRHH 2Q86A 3SEPA 2WMPA 4JDZB 2MHAB 1HILA 4DKDC 3HUJB 4QTHA 2VDOH 2NLJB 4C54A 3MV7B 4TOYL 3MRDA 3F7PC 4JKLA 15C8L 1WSST 1K5NB 1DLFL 2VIRA 4Y4KD 2P45B 1MELA 1BJ1J 1FO0B 4JFPA 4B7LA 1V7ML 2QHRH 3ARGD 2I5YH 1LE5A 3OKDB 3RY6C 5MHSE 5I1HL 4IIQA 5EN2B 5BRZD 5M94B 4QXUH 4F8QA 3T65B 5C0DB 4ZTPL 1A1OA 4TSBL 4PGJA 1GHFH 3O8XB 4HBCH 4JM2D 1HSAB 5DC0A 3WLWC 2AXGA 1DBKH 4DN3L 1KEGL 1YN7A 4Z7VA 3CVHL 4FXGB 4R4FL 3OJDB 2E5EA 1EHLH 5K9QI 1G7PB 3C5SB 1F6FB 4Y2DC 4JREC 5ADOH 1G7IB 1AIFA 4TULH 4LKCA 4AEHL 1JZ4A 1UKSA 2Z8SA 1WBYA 2RHEA 5BZDB 1ZK9A 4Z8FL 2WBJC 3CD4A 3QIUA 1UT9A 4W6YB 2Q7NA 3WLBB 1YJDC 4W6XB 4GRLD 3OF6A 3V5DB 5EPMB 4ONHA 4YBLB 1TZHB 5T1KD 1NKRA 5DEFA 2EICA 1S9YA 1ZA6A 5IVOA 4CVXA 1I1FA 3HG1D 2NY1D 4G6MH 4HDIB 4PJGF 1JMZA 3WFEH 4EQ2A 1N5AB 5HGDA 1H3PL 5TE6L 2MKLC 3LV3B 4FQXA 5C0EA 2MPAL 3UO1H 1ZAGA 5IB3B 3QDJB 5DJXB 1CFNB 3MRCB 4LQFH 2I9TA 1I8KA 5L2KE 1U8JB 3G08A 4FZEL 2A0LD 3VFNA 2R39A 3VFWA 3VMNA 3T09A 5GJSL 1DJSA 1T21A 4NZUL 4OI8A 3L1OL 2YD2A 5IVXB 4PJXF 4HPOL 3NZ8B 4QRTA 2VDQH 5I1CL 3K74B 3RNKA 1JPGA 4JVPA 3VXPB 1BFOB 1P7QB 3TO4B 1B3JA 1VFAB 2Z8RA 3U9UA 4PJ8A 5EZJA 4ERSL 4NN7C 2O61A 3EKCA 3W9EA 2R56L 1RQ5A 4OLUH 1JNHB 1PYWA 3MV8A 4CJ0A 4WWKC 2EH8H 1HKLH 1UYWH 1AR1C 1T1WB 5DMGC 4U1LB 2CK0L 1QEWA 1HSBA 4Q74A 3QIBB 1ZSDB 5E1AB 5D7JA 3CC5B 1KTKE 5IR1B 4UQ2A 3QHZL 5FCUL 4APQD 4DGVL 2X42A 5D7IA 5I1JH 2HFTA 3WN5A 4M62H 3MPCA 2EKSA 3MLZL 5D93B 5EUOF 1L0YA 1MY7A 4M9OA 5AD0B 1CFQA 1G7MA 5F6IC 1YEHL 3VXOA 2CD0A 1L9MA 4W70A 4ZFFA 4X7TB 3H42L 4Y4HA 5J9PA 1DN0A 4X9IA 4F2MB 3O45B 1Q0XL 3T0EB 5HHOB 2ID5A 2VZ3A 2J7LA 4NRZA 2HJKB 3MREB 3MGTB 3QXUA 4X6FB 5A2IH 2C3XA 3QEQB 1QBLH 2W1NA 4N0UA 4HGWB 1DANT 5I1GH 2WINB 1DUZB 1F58L 3LN4A 5LXGL 1B90A 2NTSP 3CSBA 2AS5M 4LHUD 2FECI 4YHZH 3WKML 4XPFH 4XAWL 3QJFA 3QIWC 2PTVA 2HTLC 5I1EL 3QDGA 1OT2A 1PY9A 3O6FA 4UIKH 2GQHA 4KHXH 2B1HH 3C2AH 4DUWA 2G9HA 5IBLC 5JIHA 1F02I 2J8HA 4ZUSB 4BZ1L 3RGVC 1MCHA 4OV6F 4G7YH 3ZHDA 2W60A 2O5YL 4MJID 4RA3A 5D1QA 4MA3B 2Y06L 4OLYH 5D5MA 4F9LC 2J12B 4IOIA 1UJ3C 4XPTH 4X4XA 5T3XD 1NC4D 2XA3A 3BE1L 4JO3L 4XNYL 3RU8H 5IBUB 2BY1A 4I0CC 3REVA 3NMEA 4JFZH 3WO3B 1GGCL 1BD2B 2NR6D 4AG4H 2HLFC 4I3SH 3AC0A 3O4LA 4NKMA 2ZUWA 4EXPX 3TBVA 2JCCE 4X7CC 2AJVL 3VI4E 4BH7B 5LJYH 2LAGB 3TN0C 1GSMA 4NPYA 4V1DA 1KG0A 2ZSWB 4J3TA 4YHNA 5HY9A 2OJEA 4G9FD 5C09A 1LVEA 3QXTA 2QSVA 5TE4H 1U8QA 4QRPD 4WU7B 3RVTC 1ACYL 4K94L 2GJ6A 4BQ6A 5JDSB 1RZ7H 1MCBA 4XCEA 5F89B 4YIQA 4GUPA 2FO4B 5GGRY 5JXED 4L29A 5DRXA 3QEHA 3MQIA 2R1YB 4PJAF 5DMIL 2FGZA 3O3EB 4PJDA 3RX8A 2IPKB 5J13B 1IMHC 5C8JB 4HUUB 3I75B 1HYRC 4YK4C 5B38G 3B83A 1BWMA 4DVBB 4OZIF 2VSCA 5GGQL 1T0MA 2XA8H 3WV0A 3OKNA 2DQHH 4WHCA 4YGAB 3FAWA 3RWHA 4KVNL 3ARUA 4GG6B 1NCDH 4LLDA 5DVKA 3P4MA 1JV5B 4POYA 4P2OD 5F44A 2JE8A 3ARSA 5D1XD 4MMZC 1ZLWH 4NNXB 5FA4B 4EBQH 2VDOL 2BJMH 3IDNA 1D5MB 2GFBA 3GBNH 4L9LA 1BQHA 4ALAH 2GJ6D 4XXDA 1ZA3B 1T03H 2RBLA 2QHRL 2I5YL 3NIGF 3VFOB 4XHQA 3TV3L 2MQ3A 4FXLA 3ARTA 2R4RH 5CBAB 3UZVB 4ETQB 1H8SA 1BBJB 4HBCL 2W0LA 5DD0H 5F7LB 3KPOA 4GQ9H 4S2SA 4HFWB 5DJAA 5A40E 4X4MA 3EYUL 4NFBA 1JFQL 1DVFC 1CLOL 3CDGA 3PWNB 1JTPA 4WFEE 2IAMD 2YEZB 5CGMA 2O5ZL 4CMHC 5C9KA 2IPTH 4K7FA 3T0DA 2F5BL 5C0JB 3HUJF 5FHBL 2A83A 3O2WH 4JZOA 3P3YA 2HFEB 3VH8B 3IB4A 2NYYD 4NKDA 4LARH 5TPWH 5KSVA 4RRPA 1X4XA 3LD8B 4YZFF 1JWSB 4U1MA 1CGWA 5C1MB 3MBXH 1VESA 4HS6B 1J88A 1U95B 4G6AD 2LABA 5IOPA 1HHHA 4ZFOA 1LP9A 5IMOA 4RGMC 1FE8L 3V52L 3ALPA 4F9PC 1K8DB 4PRIB 4EI5B 4D0BB 3PHQA 3W5NA 3BHBB 4MQ7B 3QXAA 4G6ML 2BVOA 1EFQA 3WFEL 1P2CA 1Y0LA 3IDIA 1F6AA 3BQUB 2VABA 3KYMB 5CZVH 1D9KD 5JXAL 2XNAB 5EU5A 4F7CA 5HJ3B 2XXMB 3A6CH 4GFTB 2D3VA 4FZ8H 5HDQH 5CSBA 1NLBL 1Q9OB 4JN2B 1SEBA 4XWOC 4JQVA 4MDJB 3U0TA 4G6KL 4GLRI 3IVKA 1H8OA 2NY4D 3FCTB 3EJYC 2VLLA 3OAYK 3IXAB 5I16A 3WUWA 3A6BH 2C4XA 4OGYH 4X99B 3W0WB 4PJ5A 1FNGA 1J1PL 4PLJC 5JOFA 1FC2D 1JRHI 1RZJC 2EDNA 1IGTB 1DL7H 2YD4A 4XP1L 3QUMB 5EO1A 3RPIB 5MEQA 5HHXH 4AQOA 3MNWB 3O4OC 4IDLA 1S7XA 2V2XB 1BM3H 1WV7T 1KCUH 1BMGA 5GRWA 2EH8L 4QHKJ 4J4PC 3REWA 2EC9T 1FP5A 2IBZX 4XCFH 3T77B 1B88A 4HJ0D 4IRJD 1ORQB 3IU3A 4R0LB 2ZOLB 4UT7L 5I75C 5DA4A 4UILH 3MLXH 2B8OT 2UYLA 5IVXF 3KR3H 2VQ1B 4PRIE 4R7NA 4X9HA 4AM0A 5I1JL 2HRPH 3U36A 3VXTB 4TNWK 1FHGA 1RJLA 1SQ2N 3Q6FB 3ARDC 1D6VH 4CAGA 5GGSA 3NH7L 3GMLA 4Z7UA 4H25A 3RWGA 2CSPA 2GIYA 4V2CB 3VMPA 4PREB 4ORGB 4KROD 4HJJL 4UTBL 1A6UH 5D1ZC 4JKPL 5D7SH 1TQBC 1OGAA 2FYYB 1J7VR 4FFVD 4OZHE 1TETH 3QUXD 2X1XR 5IP4A 5E6YA 1LEGB 3M1BB 4S1RH 2HKFH 3U0WL 1DBJH 4FQIH 3I50L 4QRSB 4OGZA 4N8PA 4XTRC 3ECBA 1T20A 5I1GL 5EOCH 2EIZA 4ZSOE 4L4TD 4EDWH 4QOKE 2RAMA 3L5XH 5C0BD 1R3HA 3WBDA 3MNZB 1DQJB 3H0TA 5C0CB 3WLWD 2A74A 4DGYL 4UIKL 5HYIA 3IRZA 4KHXL 3EDKA 1IC7H 2GAZB 1GOFA 4WFGE 5J7CC 3GSOB 2W07A 3DVGA 1JHTA 4Y2DD 4QF1A 4GSDH 2C1OA 4HIHB 3IETA 3E6FB 3FTGA 3PGCA 3ZKMC 1MFEH 2ITDA 3RZCA 3KNBB 3IDYC 2EIBA 4QRRD 3VXRE 7FABL 1AY1H 4OLYL 4R7DB 3AREC 4RAUA 4XPTL 4X5WA 1IEAB 5EBLB 3INUH 5D7LB 3UBXI 3HS0B 2Q6WB 5CWSA 1CWVA 1J12A 1MJUH 3L5IA 1N8ZA 4NQVA 3X13A 2Q76A 4I18B 4K8RH 4JFZL 1WAAE 2X4QB 1DLHB 3V6OA 3VG9C 1C5CH 5I2IB 2AV7B 5T1LB 1I1CA 4I3SL 4IBLT 4JLRA 5DDHA 5HI5C 2F54B 5DJDB 5GGVY 4Z7NF 3BH9B 4P5TB 2AJYH 5KVDL 1QYGL 2AJ3A 4TUJA 2X70B 5SWZD 2VWEC 2IAND 4N5EC 4HS3B 2QJDA 3FN9A 3VWKC 4PG2A 3HR6A 2V9TA 4ZD3L 1ITBB 4KAQL 1UG9A 4LFHG 2FX7H 5ALBL 1NJ9B 3JWOC 4LAQH 2AW2A 2X4RA 3ARBA 3GI9H 1E28B 4JFOA 5JIKA 3HC0B 4S1SH 1PSKH 4Z95H 5HVHB 3FL7A 1I3VA 3P9MA 1W8NA 3TGXA 1BFSA 5B8CB 1S9WA 1NEZG 1S9VA 1YMMA 4P4KC 3MZTA 2A77H 5DZOA 3N06B 3LQZB 4YGVA 1KTRL 1OAUL 1AR1D 2W65B 4N5UA 1DSFL 3B9VA 2QADD 2XA8L 3MC0A 4OCWH 4HUKB 5LQBH 2QKIA 3EGSA 1VA9A 4UIMA 1CE6A 1JGDA 1WWAX 2APTA 4OLXL 4RWHA 1NCDL 3PDOB 1T5WA 1JZ7A 3BAEH 1U8LA 2ZUTA 4BSVB 4OV5A 2ADJA 1CE1L 3PWPA 1TMCB 1JPST 2XFXA 5DURB 1YPZB 5MEND 4JAMA 1T66C 3JTTA 4ALAL 1XF5B 4RDQF 1U8HA 3UTOA 1T7XA 3CFKB 1T03L 3KDMA 2VN7A 2VYRE 3VA6A 5HDLA 3IDMB 3M17B 4JY6B 2NY3B 1FGNH 4JKMA 1HH6B 4KJYB 4WDIA 2R4RL 5HHVH 4HQQL 4PJHB 1SJXA 4GQ9L 3F12B 1H3UA 3LIZL 2AJXH 3AAZB 4PTUB 4GG6F 3HN3A 2NW2A 3PV6A 5MERB 5ISZA 1QR1A 1GPOH 2IPTL 5I71C 4ODSL 4M03A 5DA0B 4HULB 1I7UB 3VRIA 4MNQA 5LVEA 5CJQH 1T0NA 5TPWL 4JY4A 3MRHB 4ZPVB 3LY6A 12E8H 4JGMA 3QIWD 1JUFA 3D5OF 1HQRA 2HTLD 4MA7L 3UYRL 2R2BB 1YEFL 1OP5K 5DJ0A 5F7EH 5FIEA 4HWZA 4DW2L 1CS6A 1NUDA 3H9HA 4WW2F 5H37H 1P69B 3MRBB 4BM7A 5DQDH 2WIMA 3LEYH 3RGVD 3OKYA 5EOQH 4XXCA 5BS0A 2WK2A 4U05A 3BKJH 5HPMB 3VXUD 1BOGB 5CZVL 5FA3A 1AO7D 4RAHA 4LEOA 4OAWB 4IDJH 4OQTA 3A6CL 2O5XH 1YPZE 1H0DB 1I7TB 5I8EB 3C6SA 3C8KB 1NDGA 1FNLA 4OCYH 5IMMA 5JW4N 25C8H 3MRLA 2OZ4H 3F7YA 4F7EA 2JIXD 2HLFD 2N4IA 5KN5A 4PJHE 2GT9B 4F37F 2A9NH 1T2QL 3ROLB 1AHWA 1DL7L 1QD0A 4NUGL 4JRYE 3KLHC 4P5MB 2BNQB 4QHUB 5GGUB 1CBVH 2BDNL 5DK0B 1N64H 1I8LC 3TN0D 5TF0A 3AY4A 3R06A 4WVRA 1S7RB 5C2BL 5H2BB 3GJFA 5F72S 3S7GA 4F15C 3ROOA 2PYEA 2NQCA 3BWAB 5FYJH 3R8BB 1CDBA 4QRQA 3VGAC 5FECB 3B6SA 3RVTD 4HEME 5GPRA 2WM0A 1F2QA 3OX8A 3O81A 5C0AA 3F7VA 3KPRB 4LKXA 5L8LB 4KC3B 3UAJD 4OF6A 2GHWB 4UB0H 1CFTB 4UILL 2Z91A 1LILA 1MJ8L 1A8JH 2VUOA 3ZYZA 3RJDA 1EXUB 3MV9B 4ESKA 5D2NB 2HRPL 3MUGB 1QBMH 4RIRB 5KS9A 3DGGA 1QSVA 3D0VB 3DYMA 3VGBA 3HI1A 1I8MA 3ZSTA 3QUYC 1NCBH 3U4AA 5IJKA 1A6UL 3KXFD 3CFBB 5D7SL 1MCLA 3ZE1F 3V6FA 1MVFA 2XWJA 4GXUN 1U3ZA 2I60L 1TETL 2R9HD 3C9NB 4KJWC 1CDIA 1FAIH 1LO4H 4FQIL 4LCWA 4LSRH 1CGUA 4PV9B 1NGQH 9CGTA 4OD1L 3RL2B 3WEXA 1LEIA 1WZ1H 3RHWF 2BNQE 5EOCL 1SYSB 5IB2A 2VKXA 1RUAL 3JV5A 3NTCL 1BLNA 3QNXB 3RFZC 1AJ7H 1S7WA 2CQVA 2ICCA 3E3QC 4L3CB 3E6HA 4F33B 5IF0A 4LCYB 3O2VL 4ZUVB 2HMID 1DVFD 1WTLA 3PQYA 5ERWA 3IRPX 3SGKC 5I17A 2Q7YA 5IBTH 2IF7A 4D0CA 3V4PH 2GK0B 2F53E 3P77A 1MFEL 2AXFA 3HZKB 3VG0L 3UPRB 4HUWA 2NY0B 1AY1L 5HHNB 4OF7A 1GZQA 3ZSSA 2X4PB 3INUL 1P7KA 4JKKA 5DTFB 3MROB 1CLYL 1MJUL 2XN9A 4LCWD 5IK3B 3AGVA 2EE6A 1M7DA 4K8RL 5MEOB 1EV2E 4OGAC 4Z5RA 3GIZL 3MA7B 5BOPA 5C08B 5F7DB 3MRRA 4YFEA 3RUGA 2JJVA 1HQ4A 5D6DA 3SDDB 1ND0A 3S4SB 1YEIH 1JE6A 2J6EH 1WGOA 3DTXA 4YHYB 3VD5A 4L8SB 4D0DA 3C6LA 1CD1B 1N5YH 4Y16A 3HNVL 2RFXA 4EIZC 1QRNE 3IS1X 5GSRA 5IM7A 3IU4H 3FQTB 2WWMD 4PRPA 3SCMA 4JRXD 4LAQL 3EJYD 4ODVH 4NWTL 4DAGH 4PLJD 1IFHH 5B4MD 1DTUA 2F15A 3CZFA 4HK0A 1IC4L 1XAUA 4WO4A 1R5VA 5IBUG 1QLRB 2Q87A 1TJGL 3VXSA 1KTLA 5FYKU 5CMAA 2NNAB 5FUOH 2DQEH 2L0DA 1EGJL 3C5ZB 4MNGB 4NSKB 4OZGB 2BHZA 4DVRL 2OL3B 1U93B 4FQ2H 5KANG 4OCWL 4JPIB 2C3VB 5LQBL 1NMAL 4DUXA 5EIVA 4H8WL 1K6QL 3BRFA 4NJ9H 3RWDB 3FHQA 4LCUA 4LIQE 4PD4K 3HCVA 4E41B 3VFRB 4O4YL 4XPHH 3T3MF 1SM3L 3GSQB 3T1FB 3ZDXE 4DEPB 3I02B 4O58H 1X5YA 3OKKA 4P46C 4PRPD 4OF5A 2WIIB 2VTFA 3GZKA 2BHYA 3VE0A 2DMCA 1YECH 3BGFC 1QTYT 1ED3B 4HH9B 5DHVB 4XMKL 3TESA 3V79C 1FH5L 4YHKH 3ARFC 4WO4D 4RDQG 1CLCA 5IG7A 3MBEC 1EGJA 4I0PB 2FWOA 1VPOH 2EDRA 2Q1EA 2AJXL 1I1AD 4TVPE 2VITB 2NXYB 1MRCL 1Q9LA 4MQXC 3DBXB 1S7UB 2XKSA 4FFWD 2P5EA 4X8JA 4XTRD 4PG9B 4PRBA 3D39A 3CK0H 3PHSA 5TDOB 3RY4A 2KDGA 2PNDA 4PJXE 4JQIH 5ECJE 2YWZA 1ES0A 1P6FA 2BOCB 4KY1H 5IHZB 1CL7H 2AK1L 2YN3A 1YEGL 5LBSL 2CRMA 3CNKA 5F7EL 2R8SL 4WV1B 3TIEA 2VDPL 5KSUA 1ZS8A 1RZKH 4HG4K 4UUJA 1KT2A 5DQDL 3MJ9A 4CNIB 4HIJA 1F90H 4F7PA 4W6WB 4NT6A 2DWEB 5FOBB 3BKJL 5IT2H 1KBGH 4G8GB 3SO3B 5E5MA 1X5ZA 3ARED 3TH2T 1FYTE 1S5HB 5BQ7B 2E7LC 4NO3A 4JFFD 4O2FA 4F7MB 4Y4FC 5FGRA 5INDA 3PL6B 3RZWA 4OCYL 1MSPA 2E8ZA 5J6HA 2IH1A 2BVQA 5AYUL 4JFQB 1MCSA 3KPMB 4N8CL 5EUOE 5C0FB 3RWJB 3VH8G 2RB8A 2QSQA 5IMKA 1YYLH 5I1AA 2DJSA 3LPFA 4K94C 4PS4H 5CIPH 3KHOA 3G6JA 3OHXB 3WYRA 4OT1L 5JMRA 3FB6B 3ARPA 1MWAB 2P8LA 2EDKA 1H5BC 2DRUA 5F3BA 3CJJA 3VWKD 4CMMB 5F1NA 3SDCC 5JHDA 4LLWA 2OI9C 1ADQA 2PCPA 3LVEA 2J5LC 1YEKH 1LQSR 4YC2C 5FYJL 4X6CE 3FQNB 5EU3B 3T4AA 3DUSB 2UVFA 4MSWB 5C0IA 2VXSH 4W68A 3GSWA 3DX6A 1MQKH 1KOAA 3T1WA 3K0WA 3CX5K 4HKJA 4JEGB 4KTDH 5DZNA 3QULA 2HJFA 2LAAA 3VDAA 4YQXH 4CDHA 4UI2A 4LPYA 5H94B 4MCYB 1JGUH 3QI9C 4KQ3H 3UPCA 4NFDA 4R2GD 4LIQH 1FFPA 3RWCB 3VXQB 5IW6B 4PRHA 4OSUL 3OPZH 5E2VH 1NCBL 1VDGA 1NLDH 2VLJA 5KVFH 1XH3B 1JGLL 5EIIA 4OIIH 4XCYB 5JHDD 4EXKA 1DANU 5EA0H 4Y5VC 1HK6A 3B5HA 3OQ3B 4HUVA 4Q0XL 2EDEA 4LHJB 3JV0A 4LSRL 4NQSB 1C5DA 1TVBB 3BP7B 1NGQL 1O5DT 3O9WB 3PV7A 4LSTH 5IEHB 1F4YH 3RTQD 1UM5H 2CK2A 3QPXL 4NKQB 4BUHA 1AJ7L 3TVMC 2FIKA 1EBPA 5LCVH 1ORSA 3IDGA 1CGSH 4PTTA 4WUUE 2WWKT 3R0MA 4LVNB 5T3ZD 2BVYA 3B5TA 2YD6A 5DJ6B 2OCFD 2XQYG 4Y4KB 3V4PL 4MXQD 3ARGB 3MACH 1AKJA 1X9QA 5JA9A 5BRZB 4P2RA 2EO1A 3ARWA 1A21A 4OZ4B 4G8IB 3UROR 3K3QA 4JPVH 4M93C 4K3DH 5KOMC 3OXSA 4JM2B 4JCLA 4PJAE 4OKVB 2H2PD 5E00A 5HYSB 3G6AB 3T8XA 4TUOB 4I48A 2R2HA 5JQ6H 1QA9A 1XEDA 4KK9D 3S36X 5E99L 1RZIA 4R96B 5CBEB 2GCYB 2GYSA 4MAUL 3RL1B 1YEIL 1NGZB 2J6EL 1D5XA 2PYFB 1B0GB 4GRLB 1C8PA 2EXWD 3KPSA 5BMFH 1FFQA 4G6JH 4JDVA 5DVMA 2ZSVA 2XKNB 5T1KB 3HMWL 4YDVB 1BVKB 1ZEAL 3HG1B 2NY1B 1H15B 1KGCD 2ITCB 4PGBB 1NFKA 3NIGE 1IFHL 4X6DB 1RIVL 2L4OA 4C83A 1ZGLB 4Z7VB 1U8KA 5A43C 2K3TA 3LKQA 4OBRA 5E2UH 3RBGA 3GMRA 5E2WH 1MJ7H 1D5ZB 5E03A 2VZTA 2Y5TB 4HWUA 4WI7A 1KSRA 3HR5A 2C7UA 2UY7A 2J6EA 2XWBA 3SY0B 4D9RD 5DK2B 1CG9A 5DMYA 4XBGB 4HIXH 4P57A 3RVWC 4NQEE 2X7LA 4RBPH 3V7AG 2YK1L 4FQLL 4F3FA 1I9IL 2VLRA 4YZFE 4ZFZB 2PTTA 3MLVH 4U0RB 3MMEA 3RZCC 1I1FB 3GMOA 1Y6NR 5L8JB 3IDJB 4WU5B 5T5FL 1Q0YH 1FZKA 1VGEH 4Y0GA 1Z5LB 4L4VE 2EYRA 5F7WC 3E8UL 1Q9KB 4MX7A 35C8H 4IMLB 3QUYD 4EI6A 4R8WL 4LLYB 3VJ6B 3EOBA 5AG8A 2K7PA 1KN2H 1NMCC 2FX9L 3V6OC 4JZNA 4APQB 2DI9A 1JK8A 5BVJA 4KJWD 4PR5B 1OQXA 2D0HA 2E7BA 4Y5XC 4KHTH 2K7QA 1UCBL 1HCVA 3KYNB 1FNEB 4XPGL 5IB4A 4I3RL 1MVUB 2DL9A 5FV2A 3CK0L 4FG6C 5C2UB 3ELAT 1P4IH 3ZTNL 5ENWB 1TVHA 1U8PA 1CL7L 4TQEH 3W9EB 1C12B 2ZUYA 2A6KA 3O6ML 4KMQA 3NPSB 1OAKH 4S1QH 5E4IA 5DMJB 5CEZD 1RZKL 1Y6KR 1CDGA 4KRPC 1X4YA 1P84K 5JPMA 2H45A 5KAQF 3CPLB 5KZCD 1YEEL 2NTFA 1F90L 3EOYG 5C6WH 2UWEA 4ELKB 3DXAE 4Q7DA 5IB1B 2W92A 5CEYB 4UQ2B 1EEZA 2AJSL 4LHUB 4HKXB 3HE7C 2BSRB 1UXWA 2Y7QB 3BPLC 1QBAA 2A9MH 2CXKA 3U6RA 3S88L 1FVEA 4P5KA 2CKBL 3AFLA 5LAXA 1GOHA 2P48B 1UVQB 3JSSA 3T2OA 4L3EE 4HAGA 3FO9B 1NGPH 4BZ2H 3MUY1 1YYLL 1MFBH 4KJQD 4P3CH 4PS4L 4MJIB 1VKXA 5E4EC 5BO1H 4BZYA 3P9LB 2EC9U 3B9EA 4U3CA 5EO0B 1FVCA 1NC4B 5E5UB 3C60D 5IMLB 4C57C 3OG4B 2QSTA 3ZLQC 1YEKL 1F3DH 3OJMB 1HXMA 1REIA 4K9EH 1EEQA 3K8LA 3GI8H 1JPFA 2HLAA 4XNZC 2XQYK 2CKBA 2BRRL 1MQKL 2MCG1 3L3IA 1F6LL 2YRPA 1SVCP 4TSAL 1F11A 4LLQB 4U33A 4U2ZA 4YQXL 4UT9L 1W72B 4G9FB 1X7QA 3MUJA 2COQA 4KQ3L 3ZT7A 3QCUL 3O11B 3GUTA 3LZFH 4PJIA 4QRPB 5I9QB 4Q6IB 4NRXB 3BZDA 3LSOA 3OPZL 5CZXC 5E2VL 3G9AB 1CL7I 1MAML 5JMOC 2ADGB 1G7LB 5DJCA 1MY5A 4JHAL 3LKSA 2NX5A 4JPKH 3LN5A 2GITB 2C1PB 4LNVA 4DZBA 3RI5F 3G5YA 4UV4H 1QHOA 2YS4A 4GBXD 1KXQE 5EU7E 4P46D 4MDIA 4I9WE 4RGOL 2CKNA 2E27H 4MJIE 4NNYB 2Q3AA 4NQCE 3RVVC 2RGSA 1A3QA 1J0JA 1UM5L 2OJZL 3ARFD 4P99A 1MHHB 5LCVL 4P2OB 2KKQA 3WS3B 1UENA 3MBED 4N0FA 5D1XB 1NGXA 1EO8H 3CAFA 3DUHA 3DX9B 3QHFL 4DWHA 2I9LA 1OCWH 3T04D 4CADB 3HRPA 5IWLA 3KPQA 4A6YH 4I2XA 1AHWC 1KIRA 3AMLA 4XZUB 1DEEB 3D2UA 4IOSD 5I18H 1T04A 2B2XH 2C26A 2YA1A 3AY4C 4JFDD 3BPOB 4MXVF 3QH3A 4XMLL 1FZOB 4GRWB 2N7AA 4JVUA 4G9FE 5I30L 5DQ9A 2B0SH 2L7UA 1CK0L 3N85L 2HFGH 2Y6SC 4HWEH 3KPNA 4L1DA 1KJ3L 2IAMB 2X40A 1MI5A 4ZS6C 4H88L 2PO6A 3MGAA 5EBMB 3MOAH 4K2UL 5ETUB 3P0GB 2DLFH 3T4YA 1W0WB 3G5ZA 4GKSB 5D4QA 2LTQB 1UB6A 4Y4FD 2NZ9C 4CUCA 5C86A 2AK4E 3CDCA 3MRJB 2GW5A 3DVFA 5C6TH 3L3HA 4WY7L 4GMSL 1TJHL 2AGJH 4L5FH 1HNGA 2P5WA 4UTAL 3NCJL 5E9DE 1D9KB 1C5BL 3UTSD 3KPOB 4WCYH 4H20H 4KKLC 2F74A 3RQ3A 2AEWA 3HE6D 1BAFH 3BYTA 1MHPH 4Y88A 4OJFL 3U4EB 1BJ1H 3SDCD 3ZHLA 4JFED 5CUSH 5LGJB 3EFDH 1IQDA 1X5KA 1MJ7L 2VLKD 4YNYA 4MMXC 5FYLE 2EYSB 4HV8B 1Q9WA 4Q9QL 2NY4B 3U46B 3P30H 2LVCA 1IAOA 2HT4C 5FGBA 1A7NH 1FSKC 1L7TL 3NABH 5CP3A 3TNNB 3QZWB 4UDTA 4QYOB 1ETZA 1OARH 1DR9A 2AEPH 5EOTB 1FFRA 3S4SG 3BSZH 4QCIB 1YZZA 5DHYB 1GZPA 3S9DB 5IV2A 4Q2ZA 4KWUA 5E70A 4Y7MA 5EO9B 4G42B 3VI3F 3FRPA 4X6DF 4PJCE 1AXSA 3QI9D 1NGWA 3B2VH 1GOGA 4Z7VF 1Q0YL 3STZA 4ZNEE 4HHAA 4CN4A 2ICEA 2HJLA 2VABB 1NFIA 1MCRA 4IRJB 4KKBD 3IJHA 1QOKA 4EIGB 4M7ZB 2EYTA 4R4ND 4MAYD 2PF6A 3ULUE 1AC6A 1KN2L 1LO5B 5JIPA 2W38A 2LU7A 2YC1B 1SJHB 1UA6H 3HPJB 3IVKB 4YX2L 2YPLA 4KHTL 1IGYB 1W0VA 5K9OA 2V2TB 5FKPB 1UGNA 2ICWB 3QUZC 4NQDD 4LASH 1J1OH 4GKZB 3BPCB 3F5WB 3C6LC 4KROB 1IM3B 1ZHKA 3HAEB 4Y16C 3QCTH 2WUBL 5B39G 4IM8A 1Z0NA 3TVMD 3MSPA 5FF6A 4U1KB 3GKZA 5HI3D 4ODTH 2ZKHH 4TQEL 5E2TH 3QUXB 5F3HB 4DFHA 3HLAB 1OAKL 3U9PH 4U6VH 4X9FA 4WHTA 2A6JA 5EORH 2ED8A 4BK4A 3DURB 2DQUH 1LNUA 4K8RC 1KJVB 3MGOB 3NCMA 4FHBD 3DUUB 3RKPA 2FJHB 3SGDI 5JNYA 2CXGA 1DBAL 1C7TA 3TBSA 3KWWA 4L4TB 1RUKH 2I07A 3W11C 4Y1AB 5DRZA 5C0BB 5KAQG 1ACZA 1ZHBA 3RDTC 5ABDE 5CKGA 5HHMD 3IJYB 1RJLB 1UACH 4MWFB 1WZLA 1QSFE 4XNUH 4Z7UB 5ITFA 4K7PH 1OD9A 4ONOA 1QSED 4Y2DB 4KI5C 4JREB 3D18A 4UBDD 5H8DA 4BZ2L 1QNZL 4P3CL 4WFFD 4QRRB 5HYJD 3F7RA 1NEZA 3KPLB 4GT7A 2MCPH 1HDMB 1PQZB 1BIIA 1IILE 3I3EA 3ZYJA 1IEHA 4OLVL 1CQYA 1IEBA 1KULA 1NAMB 4IOFC 4G6FD 3LEVL 4K9EL 1DEDA 3DIFA 3QPQC 4JFYA 4M4RA 4DTGH 3L3OB 4XBPB 1R3HB 3ARRA 1BFVL 1NGYB 4P59H 1CVSC 4KDTC 3C09C 5SWZB 2IANB 1MQ8A 2KH2B 1B6UA 2OTUA 2BVUA 5FYLH 2M8XA 4RWYH 1JHLH 5T1MA 3X11A 1OSZB 1QFWM 5JUEH 2FZ3B 4K3GA 1TITA 1G9NL 2Z93A 4CRPA 3MRKA 4NOFA 4M1CC 2BSTA 4PP2B 1AGBB 4UAOB 1K9TA 3NVQA 1KCVH 4Y1AE 3RY5A 1FO0L 4OF0A 3K1KC 1LO0H 5DEGA 5D2LB 3PDGA 4OGXH 2ZCLL 5GHWH 3A0OA 1XIWA 3DRQA 4LLMB 5DF0A 3T3PE 4NC0B 3FT3B 4UV4L 4Z7QE 1CXKA 5EWIH 3ZKQD 1XF4A 3D9AH 5AZEH 5I1DB 5MHSD 4WGVB 4QRRE 2QADB 1OT1A 3L3DA 4CVWA 1KELH 5KSBE 3ULUH 4P0DA 5GGSY 4NNPH 4J3UA 4JDZA 3LKOB 2X41A 3HUJA 5EZOL 3TBYB 2NLJA 3MCKB 3MV7A 5D5MF 1K5NA 8FABB 2GTWB 5JIIA 1FO0A 3C08H 3TZVC 3VA2C 4AMKH 5MENB 2J8UE 3OKDA 1FL3B 5DD3H 5EDXA 5EN2A 1AXTH 1IT9H 5F6IB 5I18L 3T65A 5C0DA 4FG6D 3CVIL 2D7OA 3O8XA 2YUVA 1HSAA 3SE3A 3O2DH 3RAJH 4LVOC 4PRDB 3SDYH 4FXGA 3OJDA 2E6PA 4TN9A 3B2UC 1G7PA 3C5SA 1G7IA 2QKIB 3TC9A 4YR6B 3V7AE 1KUMA 5BZDA 3S34H 5CSZB 4KZEL 2VAAB 2DTML 3MOAL 5KOVC 3WLBA 1RFDH 5F88B 1T22B 4C56E 4CU6A 3GM8A 3GMQA 2DQDH 3UTTB 3HE7D 3KYOB 4I4WB 4YDKL 2R1WB 3V5DA 5EPMA 3QIWB 1EH9A 4ENEC 1TZHA 5KSAC 5L2KD 1JMXA 1FLRH 1I85A 4OD2B 4ZXBC 4IRZH 4KZDH 4HDIA 3T3ME 4KJPC 2P24B 3RA7H 5IUSA 4O5LH 1N5AA 4JFHE 3RGVB 4KVCL 2ATPB 3LV3A 4M02A 4L5FL 5IB3A 3VXUB 4NN5C 2V5MA 4OLWH 3QDJA 1TCMA 1XCTB 5DJXA 3S3PA 1AO7B 5MI0C 4H20L 1CFNA 3DYOA 1UJ3B 3MRCA 1U8JA 1BAFL 5HYSG 4MZ2A 5CUSL 4AZ8A 3WJLC 3DPBA 1R3IH 5ID0B 5IVXA 4OLZH 3NZ8A 4HT1H 4JHBA 2JIXB 4TRPH 5F7YC 2WNGA 2OR8A 3B4NA 4O02H 3VXPA 2KL6A 1BFOA 4WI8A 1P7QA 3QWOB 1VFAA 2AEPL 3T2QA 2R69L 1QACA 4U6TA 3O41A 5HBBA 2EDFA 1JNHA 3TN0B 3DI3B 3H9HB 3Q6GL 1XCQB 1T1WA 1BZ9B 4U1LA 1TVDA 5KTEH 3B2VL 2YPKB 3BMWA 3QIBA 1ZSDA 1ZT7B 3NFSH 5E1AA 2HRLA 3CC5A 1AC0A 3UTTE 5IR1A 4AEIH 4Z6AT 4LRNH 2J3SA 1L7IL 3THMH 1SJEB 4DZ8B 32C2B 4KKCC 1U92A 1LO2H 3FRUB 2F58L 3GEWB 1LO3L 4E42B 3GSVB 2P49B 5AD0A 1UA6L 3K80A 4ZQKB 4F7EB 1BFTA 5BCAA 5B3NA 5KN5B 2XPGB 1ONQB 2VXVH 3WNLA 1LP9F 1NCWH 4X7TA 4Q97A 5EOCJ 1RULH 3FQXB 3RVVD 4F2MA 3O45A 5HHOA 3T0EA 3KXFB 3O6LH 2NZIA 4MCZB 2RJMA 5EU4B 1PVHA 4ODTL 2HJKA 3MREA 3MGTA 4X6FA 3QXVA 3TO2B 1QFUL 3BDYH 3QEQA 4HGWA 4C58B 5F9JB 2P46B 1E6JH 2WINA 1DUZA 3MCLL 1HHIB 4Y19B 3V0WL 1OWRM 5F9OH 2BFVH 3CLFH 1QFWL 2B5IC 5HGBB 1GRWA 2DBLH 3BDBA 4UDUB 5BV7B 1PEWA 4X7EC 4ZUSA 3V6ZB 1DVFB 2CUMA 4KK5C 4XNUL 1OGTB 1F8TH 3BEWB 1NSNL 3IF1B 1JF1B 4HAFA 4K7PL 1OQOA 4XI5C 5TQ2L 4FABH 2WQRA 4LGPB 2BMKB 4CMHB 3P11H 4Z0BL 4ZS6D 1NCCL 4MA3A 1VCAA 2CDEB 4BQ8A 3VGFA 5GRJH 1NUFA 2A6DA 4LRIA 3ULSB 4K3HA 2MCPL 3NA9L 1BD2A 2NZ9D 5J1AB 2DKMA 4RGMB 2OX5A 1MCWW 4ODBD 4AQ1B 3H9SE 4P9HL 4DTGL 3J7HA 1J1XH 1U36A 2M2DA 5EC2B 4BH7A 4PB0L 4Z7UF 2EIEA 4KKLD 3FT4B 2ZSWA 1INEL 2N56A 2NXZD 1BREA 1JP5A 1E4JA 1GL4B 4H1LB 4G5ZL 4WU7A 1K8IB 5JUEL 1HIMH 4Y19E 1A4KB 2A1WL 4PGCB 5T1DH 5JDSA 4K3EL 4JRXB 2IWGA 5F89A 2LU3A 5L6YH 1QQDB 5CHNB 2FO4A 4UQ3B 4YXHL 4XPAH 1LO0L 4LSSL 2R1YA 1KCSH 2ZCHH 2FR4B 4OGXL 3O3EA 5GHWL 5I8OH 1A6WL 3WNOA 1SY6H 1H3XA 4K23L 3MRQA 3O4OB 5C8JA 4HUUA 3I75A 5D70L 4GKOA 4ONGH 4DVBA 5IFHL 5ANME 2X5PA 1QVOB 3VRLF 1N6QH 2ADIB 1BP3B 3FQWB 4XC1L 4GG8B 3EZJB 3MNVB 3D3VE 1BJ8A 1NCUA 4GG6A 3OKMB 3BP4B 1I3RB 1JVKA 4URTB 1XZ0A 1JV5A 2HN7B 3WMSA 3P0VH 4NNPL 5I75B 4MD4B 1NCTA 4NNXA 4M1GL 4QNPF 3I6KB 5FA4A 1D5MA 4XVUC 1UWGH 3DVNB 5D2LF 2WLZA 4WFED 1DE4B 3RIAF 5FYKH 4AMKL 1ZA3A 3ARDB 5DD3L 3VFOA 1AXTL 1RZKC 1QLEL 1FVDB 5CBAA 3QUZD 4ETQA 5HDBF 1FNSL 3H3PL 1BBJA 1XMWA 4HK0B 3GMPB 4HFWA 4N9OB 3DROB 1TQBB 3RAJL 4QRUB 1B6DA 1OSPH 1I1AB 3B9AA 4R6UA 4NUJB 3PWNA 2BNRE 2YEZA 1UB5B 1P9MA 5C71A 3JVGA 2IMNA 4YJZL 2QSCL 5C0JA 3CCHB 1YC7A 3OXRB 2HFEA 3VH8A 4YE4H 4XHJC 5K9JL 3PIQB 1AGEB 4LCUB 5I66B 3S34L 1GAFH 1IGML 3S6CA 1JZ6A 3QBTB 2MWCA 4O00A 1JWSA 1RFDL 1OY3B 4HS6A 4JR9L 1U95A 3MA9H 2EDWA 2G60L 3QUML 4PJBE 3RDTD 4J3XA 3ET9F 2PW2B 1K8DA 4PRIA 4EI5A 1TCRB 4D0BA 4IRZL 4QLRA 3BHBA 4KZDL 2CR3A 1U3HD 4MQ7A 3LQAH 3BQUA 1OTUD 3SE9H 3KYMA 4KI5D 4WHDA 5ICZB 2XNAA 1FJ1B 5KG9B 2V5YA 1BHGA 4HLZG 3GB7B 5EU6E 3VDBA 4OLWL 3IDYB 5HJ3A 1U6AL 3AREB 4IMKC 1Q9OA 4JFFB 4JN2A 3NIFE 3CMGA 4NP4H 2CUIA 4WEUD 4MDJA 2ENYA 3CUPB 1F4HA 3FCTA 3Q2CA 1XGUB 1R3IL 3FMGH 4IOFD 4M6OH 3IXAA 5JW5B 1PG7W 4X99A 3W0WA 3SOBH 5GS0L 3QPQD 3RPIA 5CCKL 1IGTA 3S96B 3QUMA 1UM4H 5D71H 1VSCA 4HCRH 4UU9B 1U3JA 3L3JB 3MNWA 3P73B 2V2XA 4RAVB 5IWLC 3AB0B 3SPVB 1RVFL 1A2YB 2FH6A 3OKOB 3TYGL 1BQHG 3VWKB 4UUJB 4D8PB 3VD4A 5KVEL 2ESVE 3TJEH 2Q3ZA 3T77A 3ZDZE 3DNKA 4NIKB 1ORQA 5CGYC 3NFSL 5I6XC 4R0LA 2ZOLA 1EVTC 1VGKB 1WFUA 1F5WA 1FBIH 1B2WH 4LRNL 4N1CA 4XNXL 3THML 3VXRA 4EZMA 4NN6C 2VQ1A 4F8TA 3MRIB 1R3JB 2HT3C 3MJ6A 5ICXB 4X6BB 3VXTA 3Q6FA 1IQWL 5BW7A 2H3NB 1PX3A 3QJHB 3OR7B 2CRIA 4R2GB 4PREA 1N7MH 4ORGA 3PE9A 4ZDHB 5I1AB 3QZWG 2BY3A 4RRPG 2FYYA 3BJLA 4QOKD 3VXNB 1AGFB 1LEGA 3M1BA 5CEXB 5I0DA 4QRSA 3SE8H 5HVFB 3AMKA 4WFGD 3S36L 1A1MB 3FHAA 2EDLA 3H3BC 1RJYB 3LRHA 1OAZH 1YNTB 3VXRD 2BFVL 4M5YH 3RTQB 2VWEE 4JM4H 3MNZA 2DBLL 1DQJA 5F21B 3MZGB 5C0CA 4J1UB 5JW4R 2DS4A 4O2EB 1S7QB 4PJFE 3T2NH 2GAZA 2V7HB 3SBWC 5A16B 3TPUB 1V5JA 1RZJH 2F5AH 1BZQK 3GSOA 4N1HB 2VOTA 4OCNC 1G6RH 5FGBC 3WUWG 5IIEB 4HIHA 4LCCB 1FDLH 2DQFA 3E6FA 1ZWIB 1MCIA 3GKWH 3KNBA 5HGGS 3TLRA 1PY4A 3ZE0F 4R7DA 1BJMA 3HAEG 1IEAA 5EBLA 1VACB 2XZAH 4MJ4A 5D7LA 4HH8A 4NBYB 2Q6WA 1MHCB 2HFFB 5GRJL 4I18A 4ENED 4D3CL 1F97A 5JOEA 1O7SA 5KSAD 2X4QA 1DLHA 5E08H 1U8OB 4ZXBD 5I2IA 5DD1H 4U6YB 2AV7A 4HXAH 4KJPD 1HCFX 2MFNA 4JDTH 2F54A 3HPLB 1OL0A 5DJDA 4NC1C 1R24B 3BH9A 4P5TA 1RUPL 1J1XL 3V9FA 5KS9F 2X70A 3QXDB 4HS3A 2X44D 2D4DA 2IH3B 1WLHA 4K3JL 2CDFB 2E8YA 2RR3A 1NJ9A 1I3GH 2RIKA 5C9JB 1E28A 3GNML 1KJ2B 3HC0A 1NL0L 1NFDB 1BEYL 4YUEH 2BVTA 5L6YL 3FO0H 4PRAB 4XPAL 1KCSL 2JJTC 5B8CA 4JG0H 5I8OL 1WIOA 2X9XA 5ITBH 5T3ZE 3JZ7A 3UCRA 3LQZA 4ONGL 5TE7L 3RJQB 1N6QL 4LMQE 4P2QE 4N0CD 1U91B 5JA8B 3HI6H 2R23B 2ZUSA 2XG4A 2Y23A 3PDOA 1FIGL 3WJJA 4BSVA 3P0VL 4QWWC 4QHKI 4O9HH 4KKCD 5J89A 1M7XA 2D9CA 1WQVT 1YPZA 4YWGL 4YHOH 1AE6H 5FYKL 3CFKA 4WW1B 3T0WA 1Z2KA 2A6IB 2E7MA 1J0KA 3IDMA 1I7RB 1F4WH 4JY6A 4KJYA 1HH6A 5L7XL 4GMTL 4PJHA 1HEZB 4M7JH 3QUYB 1ITCA 4JVWA 2VDMH 5LWYL 3F12A 3OG6B 2BNUB 3AAZA 4PTUA 3RUGF 2ILLA 1H3GA 1S3KL 1E4KA 4BQCA 5MERA 2ZUQB 2R29H 3SDXE 3F62A 4H0IA 4KK6C 3F65A 5ADPH 5HVWA 3CVHB 5I1LB 1I7UA 4S11A 4YE4L 5A3ID 5EFIB 3IFOB 3TBTB 3MRHA 4ZPVA 1GAFL 1LWRA 4RMQA 1MCPH 4NKOB 2R2BA 3EIFA 3MA9L 3V0VB 3DOSA 1WT5C 1I7ZB 4JJHA 3MRBA 4FQ1H 1MAJA 3CSPA 4QO1A 5ESAB 4KK5D 1U0QA 3B9KD 4XI5D 3LQAL 3LB6C 5DRWB 5HPMA 3SE9L 1BOGA 3EYOB 5KZCB 1XIWC 2Y36L 4KU1A 4UT6L 4K9EC 4JRYD 4OAWA 2CLZB 3UJTH 2V7NB 2X4OB 4U3XA 1H0DA 1I7TA 5I8EA 3TNMB 2D03H 2H2SC 4RZCB 3C8KA 1NC2D 4NP4L 4RFOH 3FMGL 1JPTH 4M6OL 4R9HA 5E8PB 2GT9A 5FUCC 5CD5D 4JANB 3ROLA 4KK8D 2NW3B 2P7TB 3DWTA 2FEEI 2BNQA 3IDXL 4P5MA 5D71L 1IC5L 5DD6B 5DK0A 4HCRL 2IQ9H 1FAKT 2HKHH 5C0RH 2X2YA 2BVPB 3HC3H 1J5OH 1S7RA 3MV11 4XC3L 1NH6A 5CINH 5H2BA 4WUKL 3C60B 4YHML 1EJOH 3BWAA 1AQKH 4HD9A 5FECA 3O8XC 1PKQB 4J3VA 1P4BH 4ZFGH 1TIUA 3SE3C 4ISVB 3KPRA 5CGTA 4GS7B 4YH6A 4KPHL 5GISH 2F53A 2V9RA 3WNMA 2KZWA 3GSNH 1FBIL 1S7TB 1CFTA 4AEEA 2ZOKB 4L8DB 1MCWM 2EEDA 3A67H 2HT2C 3MLWL 1UWXK 1EXUA 3MV9A 2AKRB 1ZHLB 5D2NA 3MUGA 2EIDA 3X3FH 2J1KA 1MEXL 4M7KL 4RIRA 5J6GB 5F7FA 1ZHNB 3D0VA 3ZTJG 4YLQT 1K3IA 4H0HB 2BNQD 3MR9B 3CFBA 4S0SD 1IJ9A 2VDKL 3MV8E 4YBLC 5E95B 1ZMYA 3GJEB 1I85C 3U0PB 3CH8A 4L8CB 3C9NA 3TFKC 4D9QE 2EH7L 1TZGH 4DK6A 2I27N 3MLYL 4Z76B 3BP6B 4XVUD 4PV9A 4GBXB 1DQMH 2R0ZL 3RL2A 4P46B 2XY1A 4POZD 2F53D 4D9LL 1SYSA 4B53A 3BGFB 2O93L 1CDHA 1WJ3A 2Q20A 3ZDYE 5D7IE 3QNXA 3SDAC 4ZAKD 4CKVX 1G9ML 1WZKA 4U1HA 4JM4L 3ARFB 4L3CA