3IU3A

Crystal structure of the fab fragment of therapeutic antibody basiliximab in complex with il-2ra (cd25) ectodomain
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
215
structure length
215
Chain Sequence
QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWIKQRPGQGLEWIGAIYPGNSDTSYNQKFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of Fab fragment of Basiliximab
publication title Structural basis for the blockage of IL-2 signaling by therapeutic antibody basiliximab
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 44
structure length 215
sequence length 215
chains with identical sequence C, H
ec nomenclature
pdb deposition date 2009-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iu3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iu3A02
3DXAE 4GW5A 1ZT4B 4F15B 4PTTA 2XNAB 2EH7L 3T0EB 1LD9A 4WV1B 3RIFK 1MCKA 1X7QA 1YMME 2Z8WC 4QRUA 5LG1A 5GZNC 2QSVA 2FX8L 2EZ0C 5IOPB 2DQIL 1YN6B 1II4E 3QG6A 5D7JC 5E4EB 4GG6B 5EWIL 3RPKA 2OYPA 1BM3H 1NUDA 4ZO6A 5FIEA 3MLZH 5J1TC 1A6WL 1E6JL 3AY4C 1G0XA 1QFWM 1OP9A 3IJHA 3L6FA 3QI9C 3RVWC 3DOSA 1BBDL 3F65A 2GTWA 3BN9D 4NJ9H 3S4SA 3QUXA 3PP3H 3K8LA 1S5HA 4WU7B 3RX8A 1U3JA 2YD5A 2CDEA 4UV4L 2PYEA 5SX5K 4C55A 2RQ8A 3CPLB 2HLAB 1CK0H 3NGBC 5JW5B 1IVLA 2F15A 4NO5A 4YDKL 1XF5B 3B9DA 4JN1H 1ZLWH 1U6AH 1ZANL 1XF4B 4NO3A 4DW2L 1YEEH 3R8QA 5HPMA 3ARGB 2MCPL 3MACL 4MJ5B 1D5BA 4M7JH 5FYLL 4LCWA 2WANA 5DJAB 5C0GB 2VZ1A 3WJLA 1NC4D 1D5MA 3DX9B 4M5ZL 4LLWA 1G0YR 1ZA3A 5E8OB 5KVFL 3OX8A 4WI8A 5E00B 1LK3L 4M48L 1NCTA 4WI5A 5BS0D 1CFVL 4HW6A 1QBLH 1HQ4B 3RDTD 3VRIA 3MUHL 3QXDB 4OLXL 2VLLA 3HS0A 5LQBL 1TVHA 1T5XB 5CEXA 5ID1A 3N1GC 3GB7B 4GRWE 3PHQA 3T0VA 2DS4A 3U0PB 4OZFG 2B7DT 2DQHL 3FL7A 1JBJA 4OD1H 2G75A 4HF5H 1XGYL 1F3DJ 5CWSB 2BOBA 4QCIB 5GGSA 2FB4H 1OPGL 1IZKA 4XP9L 3VXPA 1UJTA 1MAML 4ODSL 5B8CC 1BFOA 1CDJA 2GJZA 2HLFC 1F3JB 1O5DT 1OB1A 2VISA 2UWEA 1H3TA 4L4VA 2XA8L 2NY4B 4XP4H 2Q20A 1GZQA 1ZT4A 5DGRA 2XNAA 2F74B 2YPLA 3P4MB 1QKZL 3O2WH 5DRXB 1KPRA 2BC4A 2EDKA 4PJBA 5IESH 1E28A 1X5FA 4JFQA 1YNTA 5JQHC 4O9HL 3ELAT 2Y06H 5HHXL 4WW2A 2DM3A 2WQRA 1I8KA 4XTRD 5HHPA 3G9AB 2B0SL 4XPBH 2FLRT 3P73A 4RFEB 2Y6SC 3P4NA 2NYYD 5GJSL 4M6MH 3RWEA 1QA9B 4KKBC 1BIIB 2EIZA 4ZD3L 3EO1A 2C9AA 1KTDB 2YUWA 2XV6B 4X6CF 1QLFA 1WLHA 1H8OA 4ONGH 2MTPA 4PRBA 1SJVA 3LQZB 2R1XA 5BRZE 1T7WA 4XVUD 2CIKB 2PCPB 5EUKA 4Z7WA 1BZ9A 4I3RH 1R3LB 3RKDC 3PP3K 2X4TB 3IU4H 1S7XB 5T1MA 2BERA 3UXFA 2EC9T 2R1YA 4MB4A 3SEPA 4DVBA 3TIEB 4ZUVA 4LLMB 2E8ZA 3RL1A 3CSGA 3UZVB 2WWMD 5ENWB 3ARDB 3IGAB 5DVOA 2FX7L 2WBKA 1XF5A 3L1OL 2X9YA 2WUBL 2AJYH 2I60H 1FNFA 1FDLH 2BY3A 4MSWB 2HFFB 5GS0L 1TJHL 2HFEA 3SGEH 1U91B 3KG5A 1OAUL 2W1NA 3MV8A 4NKIL 3M07A 4JCLA 2QQNH 4IMLB 3ARFA 5D7SL 5DUBB 3C8DA 3CUPB 3OMZA 3QDJB 3S37H 4POZC 3VI4E 4BELD 2OR9H 1HHGB 4YHZL 4UB0H 1Z0NA 2R2EA 4CN4A 4AYFA 1ADQL 1NC2B 3PE9A 1SY6A 1CIUA 4KQ3L 5F9OH 3HC4L 1U8QB 4GLRI 4NDMB 5IBUB 1T5XA 4HBCH 1Q8MA 2AEPL 1GJIA 3QUZA 3M45A 3GIZH 5T5NG 1DQMH 3RA7H 2LU4A 2XZAL 4WI2A 1FIGH 3KPRB 1ZHNB 4XNYL 3GSNB 2BMKA 1DQDL 5DVNA 4ETYA 3BPNB 2FL5A 3QHFH 4G3YL 3MPCA 1RJLB 5DJ2A 1GSMA 1EHLL 1T20A 4QKXB 1YEKL 1WWWX 5DDHA 2YK1H 5EB9A 1WGOA 2ZG3A 2FYYA 4OFVA 2BDNL 1PY4A 2BOCB 2VQUA 3BRDA 3QHZL 4GAGL 2VC2L 4M4PA 5C0AD 4JDVA 1T1XB 3NFNB 2GIYA 1D6EA 3HUJA 3WIHH 4MQXD 3KNBA 3SOBL 4WO4D 1MSPA 1IKFL 4Q2ZB 2EE3A 4HUMB 1OT2A 3GMRA 4K94C 4MD4B 5I71C 2HT2C 1FL6A 3V8CA 5I1IL 3MYJB 5MI0B 3GFUA 1R3KA 4NRXB 4EN3B 4GMTL 4Y5VA 2AS5M 4IMKA 1JNJA 4G7YL 1MFAL 4H5SA 1DFBL 3KPSB 3DMMD 1HXYA 5IFAL 2X4OB 3MR9B 4RNRB 5IGXH 5GGQH 2H32A 1KOAA 5F1SA 1M05A 3SKMA 2G60H 4M8QB 4Y2DA 1YMHB 3GSRB 5JOFA 1YDPB 1PEWA 3U7YH 1B90A 3K7UA 4NOBA 3UJTL 2UV3A 5JXEA 1U8NA 1SQ2N 4HWUA 4PGCA 5JW4R 2VDKH 3BPOB 3HPLA 2P5WD 1VEMA 5C6TL 1B9ZA 1VACA 2GI7A 1RZJC 4QHLB 1U91A 2CUMA 4NM8L 4ODHH 4CU7A 4PLKC 2QJDA 4V2CB 3QDJA 2B20A 3E1F1 2ED9A 1IM9A 1N0XH 4M62H 3BP6B 3WXWL 1LE5A 1YNLL 1OSZA 1QQDA 1XGRA 4K9EC 1XAUA 4PY8J 4IRJD 4UILH 1U8QA 3UYRH 2D7TH 2KUTA 4NDMA 5BVJB 3QIBC 4P57B 2VO5A 4S1QL 2C1PB 2ZJSH 3O41A 5L0QB 3LN5A 1A7QL 4APQB 5IMLB 2EH8L 4EDXB 3W9DB 5TQ2H 3Q6GL 1A0QH 1U8PB 4Y19D 3WFCH 5IMMA 3EOTL 1SJEA 3IDYB 4O02H 2OL3L 1T1ZA 3RY5A 4NNXB 2UYLA 4DQOL 1QFOA 1AO7E 2GUOB 4PJ5E 3EHBD 2R0LL 3ZKXC 4WW2F 3UDWA 4NQCE 1GHFL 2YUXA 5BXFB 1U3YA 2IWGA 3RWHA 1AGDB 1JGVL 3DXAA 1IGIL 5GGRY 5KG9A 4FTVE 4HEME 5I1EH 1WBXA 1BJ8A 1ZT7B 3JWOL 2OTWB 1YMMA 4NRZB 4ODWA 3TBTA 3O9WB 1FHGA 4HKBA 5L6YH 3SBWC 4Z7WF 2BSED 1MCNA 1WUNT 5GQBA 3WN5A 3L3GB 1LO2H 9CGTA 2EE9A 4PLJD 3O2DL 3I84A 2JJTC 5CP3H 3B9KC 4R4ND 3NIFF 2ICEA 1IAIM 1KT2A 2FR4B 4XCFL 5CBAB 1G9NC 3U9PL 3ULSA 1FYHB 4YXHH 4FQCH 1CXLA 3U4EB 2CGRH 1CDHA 1GIGL 1IQWL 1A1MA 2W0PA 1HINH 4P9HH 4M8QA 4L8SC 1JNHA 2NMSA 4WUUD 5EC2A 4JO3L 4LCUA 3O2VL 1OP5H 1EHNA 3DYOA 1X5IA 5DD3L 1X5ZA 4W6WB 4RFNC 3S6CA 2VIRA 2YA2A 5HI4D 2FCBA 4TTDC 4FXGB 5FHAL 2VABA 1J8HD 1R5IA 3BP7B 4JHWH 4I9WD 2WUCL 2H9GB 4HGWA 4YHPB 5F7UA 1A7BA 2A9ML 3QG7H 3G5ZB 5HHVH 3BUYA 4JJ5A 3FFCE 1TETL 2VLJB 5LGHH 4KWUA 4UDUB 2W9DL 1EEZB 1F45A 1JWUA 2XWBB 1JTPA 2WINA 5CEZE 4P46B 5BZDB 4JRYE 2GSIA 3B4NA 4BFGA 1B0RA 4R0LB 5BVJA 5JDSA 4CUCA 5JIIA 1F8TH 3KYOA 4HUXB 5IR1A 3G08B 4JPVL 4Q6IB 3GUTB 3ET9F 5DRNA 3IETB 1TTFA 2AABL 1TVDA 4JY5H 4XHQA 4QRSB 4KU1A 4LMQE 3GSXB 2NX5E 4YR6A 3H2WA 4DGVH 1NGZB 1V8HA 3FQUA 2HT3D 4X7SH 5HI5C 3SDCA 3OXSA 4LSSH 3EJYC 3HUJF 3TBSA 1NFKA 4PD4K 1U9KA 4G5ZL 1J0HA 1NEUA 4OJFH 5LBSH 1DE4B 2IPTL 5IEHA 1MPAL 4OFYD 1Q0YL 1I9RL 4WFFE 4JQIL 1AGDA 1MY5A 5B4MD 3BZ4A 4U1HA 3ZE0F 4WFGE 4I0PD 4HDIA 4LBEA 3MRDB 2X9XA 3PWPD 4DOHE 5DTFB 1A5FH 1W0YT 2VR5A 4MWFB 3KJ4C 1OQXA 1Z9MA 3V79C 4LNRB 1EO8L 4LP5A 1AH1A 4JFPA 5DUPL 1N3NB 4HWZA 4N9OB 4XH2B 5ETUA 3TN0C 3LKPB 4LPUA 2Z92A 2YD9A 4ZO7A 4OZGB 1HDMB 3MLXH 4P3CH 2CK0H 5BRZA 2Q86A 4KHTH 4YIQB 4YWGL 4ZFZA 3FQTA 4Z77B 1CR9H 3GRWL 4MGXA 3V8OA 4MA3A 3FT2B 3DX8A 3SE8L 1J1XH 4RFOL 2DQEL 5INDB 1RVFH 4FQIH 4JR9L 5D7LE 3NCYS 1T7ZA 3SKUD 1NL0L 1EEQA 1NEZA 4JQXA 5J1SC 4NHCH 4EEEA 5SX4H 2WMPA 4KMTL 2HVKA 4LIQL 2ESVD 2QQKL 5TE4H 3EYQD 1MCOL 2FGWH 2C3WA 3ESVF 1DN2A 4GJTB 3LRSA 1RSFA 3IS0X 4L5FL 3HMXA 2H2PC 1DBML 1ACYL 3ARQA 5L88L 4AMKL 5C1MB 3H42L 3O6FD 4EQ3A 5CD5D 5EORH 3T4AB 4FXGA 1DLHA 4F7MA 3DTXA 4I77L 3DBXB 1J88A 4MX7B 3JTTA 1NPUA 4G6KH 4HULB 5JIPA 4JFXA 4ZFGH 1PEZA 4OLYL 3VXSD 4BUGA 3ULUD 5FM4A 5EO1B 1CG9B 1V7MH 3GMNB 4Z5RA 5F3HA 1BGXL 4ELMB 1ZA6B 3C5ZD 4GXVL 4DUWA 5HYSB 4WWKA 4ZUUA 1M7XA 5CZVL 5EOQH 5CSZA 1RUAH 3UTQA 4A6YL 4E42A 4JEGB 3UEZA 3GUTA 3FRPA 2DQTH 4MXVE 5FM5O 3QQ3A 5IBUG 4U6HB 1VPOH 4EI5B 3QEGL 4Y4FD 5DD6B 2IPUK 3WD5L 1NCBL 4D9RE 2QQLL 4YE4H 5F8QC 3SGKA 1K6QL 1IC4L 4M7KL 4U7SA 4DN4L 3LS5L 4FNLL 4PJ5B 1PG7W 1T2QL 2C26A 3CSYB 1DVFB 4XMLL 4ZUWA 4PY7B 4M8VA 2VYRE 5I74B 3NCMA 3DX7B 4BFEA 3INUH 3CJJA 1INQA 5TFSH 7FABL 3CVHL 5E6IA 4JAMB 1Y18A 1GGIL 3QSKB 5D72L 1MF2L 1WT5C 1ZS8B 4ZOCA 1Q0XH 2G5RA 3U30C 2EYSA 3QEQB 4PJGE 4NKOB 4J3XA 2BRRL 5IG7B 4PB9L 1GXEA 4ZUTB 2EC9U 1BZ7B 1RY7B 5IJVB 1BVLA 4NQDB 3X13B 1HDMA 1AJ7H 1BFTA 4KKAD 2XZQL 1A3LL 3IYLW 3PDOA 3MODL 5HJ3B 4GRMB 1HK6A 1A3RL 4MAYA 2NW2B 3U0TB 1T04A 4CJ1A 2ZUWA 3RWCA 5I16B 2D0HA 3SKOB 4Z76B 3BKYH 1WZ1L 1VEOA 2A2QT 4K3JL 5ESAB 5C0AB 4HIJB 3VGAB 5ICXA 4HUUA 3BEVA 2KH2B 5GSVB 4CADB 3BI9X 2GQHA 4ZNCD 2XTJC 4XMPH 4OAWB 4NWTH 3GGWB 4CGTA 1AD9B 5C7XL 5CFHA 1B4RA 1P53A 2R56L 1BF2A 5AD0B 5HYFA 5J56B 4P59H 2R1WB 4S1RL 1LHZA 2LTQB 1AXSA 5IHZA 5J9PB 3QRGH 4GW4B 1HYSD 1MJ8H 4GRWF 1L7IL 5ALCH 1B4JH 4O2FB 1UACH 2OJZH 3MUZ1 4D9QD 2VDLH 4PJXE 2BSTB 1NAMH 1NCWL 4FQLL 1XZ0B 4JGJA 1UB6B 3DMMB 3I50L 5EO1A 2XN9E 5F7LB 1U58B 4Q9QH 4DCQB 3KWWB 3MRBB 2Y7QB 1H3PH 2ZCLH 3TT1H 3TA3D 1N4XH 3RVUD 4FG6C 2LAGB 4LCIL 3HNSL 4XCEB 5F93C 3PWJB 2GSGA 1QACA 3I3BA 3I6KA 3CNKA 4YHNB 5C3LD 5DJDA 1OW0C 4U6HA 2K1MA 5E2WH 1G6RL 2NX5B 3HB3C 5A2IH 4CDHA 1XCTB 2G2RA 4QTIL 4PIRF 4M6AA 2L4OA 2BNQD 2P5WB 1FFPA 3RIFF 2I9TA 1FSKC 4NP4H 1NFIA 3FKUS 5DEFB 1AO7A 2V5MA 3PGDA 4PJ5A 1TPXC 5GS0C 5CP7A 2J4WL 3UTSD 3U4BH 3IF1B 2EDTA 3K80A 4HV8A 4JY4B 4NQCA 4DGYH 1LK2B 5DZNA 3PL6A 2AP2A 3O6KH 1R3IL 5GRZA 5GZND 3BW9A 1C1EL 4HFUL 4UT6H 3TBYB 3QDGD 2EZ0D 3MRCB 1W0VA 2JKXA 4LAQH 3DX7A 5JORA 1PZUB 4FTVA 1RUPL 5TE6H 5D7JD 5ABDE 4IRJB 3O6LH 3RNKA 3NA9L 3QWRD 5JMOC 5I73C 4U7MA 3GHBH 4X9BA 3QI9D 5E9DB 4K23L 5J12C 5DQ9A 5E08L 3RVWD 1L0QA 3EFDH 3SO3C 4PFEA 2EE6A 1I8MB 3I02A 4PRHD 2M8XA 2FBJH 2HJKB 4KAQL 4Y19B 4IIQC 4WEUD 3IXTB 4NSKB 4YK4C 4OZIB 4YGAB 2GKIA 2VITA 4EVNA 1MCWW 1MHPL 2HVJB 5A2JH 5IT2H 1G7LA 2M1KA 4TVPE 2KKQA 5GS3A 2VLKE 8FABB 3IKKA 1FGNH 4LEOB 3MA9L 5D7LB 3EYUL 3UYOD 4L4TD 5ESAA 4MQ7B 5KW9L 3L7FB 5EOTB 4YUEH 5F71A 2AV7A 3VI4F 3OJMB 2BP3A 3KLAA 2VXQH 3MCKB 4OFIA 1WISA 2GJ6D 5BJTA 4R4BB 5LWYH 2ICCA 2BVOB 4D0CB 5F7MC 5D71L 4G8GE 4S2SA 1AKJD 2X5PA 2DQDH 4DN3H 3FFCA 4PJ9A 4I2XB 15C8L 1MRFL 5HGBA 3O81A 1HZHL 4HLJA 1KV3A 2DQGL 4NN6C 3V5KA 4JRYA 3VWJC 2PW2A 2YPKB 3LQAC 5DLML 4PGDA 1UKTA 3LEVH 3JV0A 1RURL 3AM8A 1V3LA 2YA1A 3GMOB 1EDQA 4XPTL 4YHNA 4F9PC 2CQVA 3DROA 2I9LA 2HA1A 3LS4L 4ISVA 5F7NC 3BQUA 5ICZA 4RSVA 3WFDH 4ALAH 1IAKB 1KCKA 3S88L 1UJ3C 1Q1JL 2HYMA 3V5HA 1T6VN 1RZ8B 5KVDH 5IIEB 5DQJB 4NUGH 4LRNL 3LKNB 2LVCA 5JHLH 1RI8A 3MXWL 3I6GA 2W38A 2H8PB 1CICC 4M1CC 4JG1L 3U36B 1VKXA 2QADD 5HYJD 3WIHA 1WFOA 3IDMB 3FT3B 5J8OA 1IBGH 2CKBH 2AJSH 2Y6SD 3HR5A 4KKBD 1RZ7L 5BZWB 4LVNB 1U3HC 2ADFL 3D1MC 1S3KL 4Y5YA 4X8JA 3WNLA 3LKSA 2J7LA 3K46A 3HAEB 5C0JB 4HEPG 5GXBB 5FOBA 3P0YL 4U0RC 5CLWA 1S7WB 2PR4L 1LO3H 4HC1H 5HDQH 3S34H 3TO2A 5ERWB 1QFHA 1VESA 3RKDD 1KC5L 4KI5C 4AIXA 2HJKA 3KPMA 5FYJU 5C3TA 1H9VA 3HE6C 4AZ8A 1J1OH 3O3AB 3AMLA 4MS8C 4P2QE 4Q9BA 1G7MB 3BKMH 4M61A 4ZXBA 1PSKL 1DR9A 4M93C 2YEZB 2ICWA 5D7LA 3SJVD 4BQBA 4E9LA 3BN3B 2AKRB 1MWAH 1MVUB 3NABL 4MMXC 3NZHL 2UZYB 1I7TB 2KDGA 4I0PB 5F3BA 2AJXH 3SQBA 2OR8A 3OR6A 2E7BA 3MLUH 4OGYH 3H7BA 2ERJC 1CD0A 3VDBA 2IMMA 4LVHC 2PUQT 2BVOA 2GY7B 2DD8L 4IRZL 4X4YA 1FG2A 4ZS7L 1F97A 3SGJA 2Q8AL 2DI8A 3QUKB 3WKMH 4H88L 4WIQA 3DJ9A 2VN7A 4QY8A 3KR3H 3DUUB 1EJOH 2VDPL 2D4FA 5FK9B 1ZLUH 2AV1B 4UQ3B 3R0NA 5H35B 2YPKA 3JWDH 1LEIA 3D9AL 3CX5K 1EFXD 3EFFB 5JOPD 3P30L 4DAGL 2YBRB 3LDBC 4K7PL 1NGPL 4LLDA 4RCAA 1ITBB 4OM0H 3N9GL 2EEDA 1YA5A 4X4ZA 2RBLA 1EHXA 3QYCA 4HG4J 5HYSG 3C60B 1NFDB 2Z91B 1CZ8H 3B6SB 5EC1A 1PLGH 3V0AC 1PG7X 2EDEA 4WU5A 1MEXH 3O6FB 3ZMRA 3S9DB 1I85A 2YSSB 4L3CA 3BT2L 1KCVH 1ULVA 2DQFA 1YY9C 2R9HC 4NIKB 2OXGA 3L5WB 2HJLA 2X7LA 5JTWA 1JYNA 5D2LB 4WGVB 2DKUA 4UT9H 2HT2D 3O4OC 1TJGL 3DSNA 4JHZA 5SX4I 4JFFE 4ETQA 4NNPL 5J1AB 3VXSB 4QHUB 5DVKA 3EO9H 4MQTB 4ZAKC 4BA8A 4M03A 4PRAA 5CSBA 1KIUA 3GMPA 3SCMA 2YHGA 2XFXA 3B5TA 2O93L 5M95B 5LVEA 2FLBT 2D31B 4PJGA 4GG8B 1UB5A 4YBLC 5CEYA 2YUVA 2ZSWB 3HZVA 2VXVL 5F9DC 1AGCB 3HZMB 4NQEE 2VWEE 1A7PH 3V6FB 1TITA 1I3VA 4LSPL 3EYSH 1QSEB 3QUMB 1CT8B 5IMOB 4X5XB 5CP3A 3GJFB 1F6LL 1TCRA 4YXKL 4Y4FB 5C0RH 3QFJD 4YHLL 1NUGA 1FFNB 5DS8A 1YYLH 1XIWB 5DD0H 3HMWL 1G7MA 5GGRB 5MHSE 3BIBX 1J1PL 3LMJL 5GS1A 4JHAL 4UDTA 3SDYH 1U8MB 4BM7A 2N7AA 1EEYA 3BDXA 1OP3H 3B43A 4S11A 3DO7B 3ZYOA 1RFDL 3ARBB 1P2CA 3PV6B 1A14L 1RHHB 1YEFL 4KK5C 5I0DA 1HEZA 4NC1C 4K7FB 4RAVB 4AIZA 1T83C 2L7JA 2DICA 1EV2E 4JZOA 3ZT7A 3KXFB 1UXWA 2PXYA 3WFBH 4IRSC 4GQ9L 4BZ1H 1KN4H 3QIBD 5E95B 1NUNB 1SY6L 4PJXA 3S3SA 3VCLB 4DK6A 5IHBA 4JANB 5IMKB 1YYML 3VXRE 2XN9A 3G04A 1AE6L 1F90L 2ZUYA 4DKEL 5DSCB 4RBPH 3NAAL 3VW3H 5J13C 5GHWH 4ZYKB 4NQXB 4CRPA 2P44B 1YN7A 3MRQB 3QQ4B 3BH8B 1JGDA 4MD0A 3VFWA 1L7TL 3E6HA 1G9ML 4J4PA 2X6MA 1BD2D 4N8CH 2IFFH 2YSSA 3KYNB 3T8XB 3CH1B 1S7TA 3QPQC 1I75A 1K5NA 1JTTA 1P4LB 3OKNB 5GS2D 3VFMB 3C5SA 1FZOA 3I9GH 2EDQA 3GSVB 5EOCH 5D7KE 5J1AA 2JK5A 1N6UA 1X9QA 5FB8B 4PV9A 1N5YL 1NMCB 3P11L 2H1PL 4LSVH 4ZPVB 4PLOB 3W2DL 1AC6A 4PB0L 3QIWC 2AK4B 4XWGH 4JO1L 4QRQB 1FV1B 4J3TA 5A2FA 2D31A 3B9KD 5ICYB 5F88B 1ZLSL 2JB5L 4YC2B 4UINL 1ZHBA 4JFDA 2O5ZL 2W65A 4X7EC 4X5XA 5GSRA 2VE6A 3O8XB 2VLRE 3RY6A 3QNYA 3V52L 1A7OH 1R0AH 3BIKA 3S35X 3H9SD 4KZDH 1D5ZB 1RZKL 3MUGA 1XEDA 2AXHA 4KTDL 4LARL 5GGRA 3CC5B 1CN4A 2ZKHH 2P5EE 2Z35B 4PJCB 1I8LA 1NDMB 4R90H 4PTUB 2VLKA 3FO1A 3UPRA 3H0TB 3GK8H 2F53E 3GO1L 1KEML 5A40E 4XVJL 1YEDA 1WWAX 3VXTB 1MFEL 4MHHG 1KBGL 4O4YH 3PV6A 1FRGL 5D1QC 5D7JB 2NXYD 5C07E 3GSUA 4WEBL 3NIDE 3L3KA 1FNGB 4LSRH 4F2MA 2FZ3A 5BV7C 3MCLH 3QI9B 3X14A 3BO8A 5D7IE 1TTGA 1CU4H 2MKWA 4G8GA 3VXUB 3DGGA 1TLKA 4M1GH 4PRNB 4PRHB 3OKEA 2V2TA 3U82B 2PO6A 4XC1L 2Y36H 4YLQT 3BJLA 3RUGE 5I1AA 4YO0B 4MXVF 1PVHA 2CIIA 3NGBB 4X7TB 4XT1C 4PJ7E 5D1ZD 3IDGB 1FJ1A 1GGCL 3JV4A 5JLZA 2O5XL 2Z31C 3WO3B 1AQDB 2EDRA 2D7NA 1CBVH 2IAMA 3LD8C 4HFWA 1UZ6E 2YKLH 4JFHE 5HI5D 1IT9H 1OGAE 4WY7H 3EJYD 4L4TB 2CDFB 2EDXA 3UO1L 5EBMA 2JJVA 3QQ4A 4NUJA 1MHHB 1D5XB 4H8WH 5J0BA 5L2KD 5I15H 1CD9B 1OCWL 2ZUSA 5FM5M 4PRID 1J8KA 2P7TB 3T0DA 5EU5A 3TIDB 3VFVB 1P4LA 3BE1H 2ZG2A 2JB6A 1FP5A 5J4MA 1LEGA 5CINH 2FSEA 4JO2H 4FQXA 3MBEC 2COQA 2RIKA 3PQYD 3NCCB 1UKSA 1BQHA 4NYLA 4ZPVA 3S96A 1BLNB 2ATPA 2A9NL 4ZFFB 4QRQA 4UU9B 2XXCB 3ZO0A 3U79A 4GH7B 4NZDA 4LKCA 1NBZB 1G7PA 5KSAB 4KUZH 3RWJB 1MJ7L 5SWZD 4FQ1H 3O6ML 2E7CA 5B8CB 3HAEG 3OSKA 3O8XA 4EDWL 5KSVB 2E7LA 3L3OB 5FO8A 4P2QA 2Z35A 4XC3L 3D2UD 4X99B 4P2OA 1QRND 3WUZA 2H2PD 3V6ZA 3TYGL 2EXYC 2IALB 5GRUH 2VDMH 5HHNB 3ARTA 4F57H 5GGVY 4FQQB 4PGBB 4CL7A 3HZKB 3QO0B 3VXTA 1I9IH 1QR1B 1G7QA 5FYJE 1X5YA 1NBYB 1EIBA 5FUCE 3CFJA 3MRKB 2CLRA 2NW3A 3BGAA 1MCEA 2VDNL 4RISL 1X5LA 4Z7NF 5DD1H 5EFIA 1GC1H 3MGTB 3OG6B 4KY1H 4HWEH 4ODXB 2VXTH 3MRLA 4G6FD 5BS0E 4F37K 3OKMB 4M6OL 1IZJA 4R7DB 3SDXB 4C83B 1LP9E 1KJVB 5KANG 1KELH 5LKNA 4LOUD 1P7QD 3DVNB 1YEIL 3C6LA 4X7TA 3LPFA 3RGVC 2X4SB 3ZE1E 4P3DA 1AXTH 1KN2L 1CGYA 2R0KH 3M8OH 2DLHA 5CBEA 3IDJB 2AGJL 5C0FA 2IBBA 3I85A 4Y5XA 1JI1A 1OM3L 3SJVB 1HILB 4PD4J 5F97E 5D2LF 1I9EA 1HWHB 5K9JL 1IFHL 1PD6A 4XBGA 5C0CE 5DK0A 3T04D 1HHJA 4U1JB 3OV6A 2WWKT 3DGCR 1WTGT 5FA4B 5HGAB 3FB6A 4Y4KC 4MCYB 4BSVA 4DWHA 3CLFL 3O4LD 5F1IB 1KNOA 4JFFA 1AFVH 3A67H 1R24B 5D93C 2NY5C 3T2PA 1S9YB 2ZOLB 3DV6A 1I8IA 4GOSA 3TZVC 1FYTD 4P5TC 2XRAL 2FECI 1MLBB 3VWKC 1K2DB 3BD5A 1A6UL 2W9EL 1PKQB 5INCB 1QNZH 3RTQC 1KJ2H 5I76A 4HH9A 4G8FA 4O00A 4NQEA 4MJIE 5A2KH 1JTOA 5DXWA 3V0VA 1UYWH 1P4BH 4GUPB 3BISA 4XX1E 2WP3T 4M43L 3U9UB 2KQMA 3G6JB 4NT6B 3VG0L 2P43B 4LPCA 4N0YL 4UUJB 4OT1H 4HPOH 3MRRA 5I30H 2FD6H 4LSQL 5IKCA 2VZSA 5IW6B 5F7EH 2XTJD 3WLBA 1G1YA 1CCZA 1ZSDA 3HC3H 1TENA 2IALA 2P8PB 2X1XR 43CAB 4ZTPL 5I71B 1FVEB 4R8WL 4AH2A 1IKNC 1FC1A 3FN3A 3HMXL 1UXSB 1YEGH 1TNNA 2H3NB 2NY2C 3SE9H 4R96B 4JDTL 4LDLB 1KCSH 5C07B 5D1XC 4KQ4L 3LV3B 2F19H 1FFRA 3MREA 4XI5D 4YAQA 2BJML 3OKLB 2WIIB 4JM2B 2IH1A 1CIDA 5D7IB 5I19L 4BK5A 4OCYL 5IEKB 5MENB 3OGOE 4L8CB 3OKMA 5C0EA 2VSDA 3GKZA 2J8OA 3GMLA 1SYSB 4R7DA 2NY1B 4Y88A 2DBLL 4FG6D 3MFFB 1XGQB 3MLYL 4N0FA 2EEAA 3DVNA 5K9KA 1FAIH 4Y4HA 3VXRA 4HS3B 4D0DA 3ULVE 3HAEH 2P42B 1AGEA 1F4XH 3P4OB 4RGNC 4ENEC 2I5YH 2X4SA 3QUXC 3Q6FB 3MRPA 4UV7H 1MAJA 1QBMH 3MJ9H 2D03L 4ZTOH 2WAHA 2OJEB 3RWFB 1UQSA 3QUYC 4HPYH 4KVNH 3LKRB 4I5BB 2C4FT 4Q9RL 3C8KB 5GS0D 2Z93B 2EDBA 1AI1L 2DF3A 3OKOA 3ZDZF 4XVSL 1D5IH 1F00I 3BGMA 4G43B 1R3JA 1QYGH 2E27L 3WJLC 2FJFB 1KTLB 3QWOA 4JFYB 2GTZA 2CKBA 2X10A 3AU1A 3TNMB 3ZDXF 3LN9A 4CJ0A 1S9YA 2DWDB 3KPOA 3ARUA 4DZBA 3SDAD 3H9ZA 4HWBH 5DMGC 2YMXH 3SPVA 3V7AG 4MD5A 2AAVA 1Q94B 4LLUB 1KEGH 3RIAK 2F5AH 3W0WD 5T3XD 2RCSL 4HC1A 4QT5B 5IWLA 3TVMA 4CN6A 4KRPC 5E2TH 4MNQE 3T3PE 4I3SL 4NJ9L 2VLRA 4RGOH 3ZKXB 5JR1L 3WHXB 1B3JA 1BX2A 1D9KC 4OZHB 4JPWH 1BD2B 2LU7A 2P5EA 1CK0L 1DBJH 5EUOE 5F9WC 2GT9A 1NGYB 4MLIA 2CLZB 4FXLA 3WNOA 3KPNB 4LKXA 4X5WB 1MWAA 2F53A 1U6AL 4LVOC 3BSZL 3K2UH 3O3BB 1GOGA 4HT1H 3BKJH 3FN0H 4OSUH 3T0EC 4WV1C 2H3NA 2W0LA 2DWEB 3E8UL 2I26N 4LPYA 3HI6H 2X4UB 1HSBA 4WW2C 1E4WH 3LVEA 1XH3B 3B9KB 2AEQL 3U0WH 5LAXA 5D7IA 1A2YB 2EO9A 4IOSD 4C54A 3VWJD 5E4EC 2V5TA 5KVMC 3IDIB 3ULUH 3RUGA 1LP9B 5K33A 5I0ZA 3L7EA 2Q7YB 5EU7C 3ARPA 4L8SB 1FN4A 4PJ7A 1MREL 3WO4C 3FTGA 5MEQA 3Q6FA 3OG4B 4Y7MA 1HI6B 3VGFA 2CUHA 3R06A 3RWFA 1OGAA 5D5ME 3N85H 3LKRA 1RULH 2DLGA 2Y07H 3EO0B 5D6DC 5C09E 2FB4L 5DT1L 1NBVH 1GGUA 3DRQB 2IAND 1CICD 4M1CD 5JA9A 5GISL 1NCNA 1S7SB 3G6DH 4EXPX 3C6SB 1H3VA 4JB9H 5BVPH 1OY3B 2BVUA 4YPGA 5I17A 4XCYB 4GAYB 5HY9A 3ARFC 1U3HD 4Z7QE 1JHTA 4HCRH 1FNSL 2SEBB 4LGPB 2P8LB 4M1DL 1KB5H 3WFHA 3L95B 4FZEH 3A6OA 1KFAH 2FIKA 1KCLA 4UMGA 3HFML 1C16A 2LU3A 1FZJB 3CFBB 4QRRE 4QYOA 4X4ME 3MV7E 4KI5D 4GS7B 2IADB 1HQRA 3H8NA 3HE6D 4JFOA 2MNUA 1B2WH 4MS8D 5I9QC 3PWNB 4MJIB 4ONGL 3T4YB 5T5FH 1XF2B 2G9HB 4PS4H 3OB0H 1JPSH 5IBLC 1XR9A 4Y1AE 5FKPA 5E1HB 3IU4L 1JZ2A 4ZO8A 3MO1A 1S9VA 2R4RH 1T1WA 1G9MC 2ZUVA 3P9LB 3ESUF 2KQNA 3ROOA 2CLZA 4U7KA 3KJ4B 2NY4C 5KOVC 3OXRA 4OI8A 1DBAH 3FB5A 3ARSA 3PQYB 1J8HE 4G6MH 4I9WE 4I48B 3SDXF 4WJ5A 2CR6A 3V0WH 1NC4A 2C4XA 3TN0B 1DDHA 3OKKB 5LCVL 4M7LH 4WI7A 2OR9L 5GRYA 2YWYA 5BS0A 3M17B 3RDTA 2RB8A 1F4YL 2RFXB 4G9DA 4OCMC 1IGML 4KJYA 1TZIB 1LP9A 5CEZL 4HUKB 1PQZB 4HBCL 3U1SH 4HKXB 3BXNA 4ELKA 2AJZB 3LKOA 2NPLX 4OD2B 1DQML 1RZKC 3RA7L 4PGEB 3D39D 5ANME 5CMAA 3VH8B 5EZOH 1PW3A 4POUB 5JA8B 5T1LD 4LHUB 3WDJA 4LLQA 1YY9D 2R9HD 4BUHA 2O5YL 2OBGA 5BO1H 2YK1L 1QO3A 3F58L 4WFHE 2VH5H 5C6WH 5ESQA 5C0CA 4Q74A 2V9RA 4WNQB 4G80B 4ODTH 2NTFA 2HWZH 1ED3A 4ZAKD 4XNZB 4WEMB 3MV01 3WBDA 3MLVH 5TGBB 5HYQA 1YC7A 3PGCB 3R1GH 3WIHL 4EJ1C 3PWPE 1SM3H 3S37X 2SEBA 4N1EA 1J05A 4MDJB 1G9EA 2IMNA 5JHDB 1P7QB 2YN5A 4JVPA 3UTOA 4OIBA 3G6JF 5FYKD 3L3DA 5E8EA 4PGJA 4H1LB 2ZP0T 2R23A 2AI0H 3PJSB 5FDYA 1RZIB 3KAAA 4MDIB 4MJIA 3ABZA 2V2XB 1CFTB 4NQVA 4OLVL 2G9HA 3IFOB 4FQJH 5IGXL 1BFVH 3PGFL 2A6KB 3UTZA 5F6IC 3GBMH 2R29H 5H2BB 3ZKMC 4H20H 1EUTA 1JIBA 3FOMA 1KCUL 4N90E 3PHOB 1RK0A 3UAJC 2CRYA 3FCTB 1KF9B 3THML 4CU6A 3U7YL 3ME0A 3NIDF 3QAZC 4KK5D 3VXOA 3OAYH 1PJ9A 4JM2F 3BH9B 5E2JA 3U30B 5D7IF 1RMFL 2X9WA 2BX5A 4L8BA 1OWWA 4IRSD 1OARH 1IAOA 4EUPA 1T0MB 3IDUA 4M7ZC 4XRCB 5EO0A 2VL5B 2J8UE 3Q2CA 5CZKA 4MHHI 1BOGB 5C0BE 3K1KC 3WUWA 3WNMA 3RJQB 1KLFA 5IV2A 3T1FB 1P1ZA 4M62L 3L9RB 4EN3C 1JN6A 1NMAH 2OR7A 3ULUE 4U1IA 1UZ6F 4PREB 1F4AA 4FN0A 4UILL 3G5XA 1Q9LA 4U05A 4J3OC 1ZHLB 3TYFB 1M1SA 1MHEB 4CVXA 3C2AH 3WHE0 4YFEA 4WUKH 3BKCH 2ZJSL 4XAWL 1LE9A 4PJIB 4XB8A 1UH4A 1C5BL 3EGSB 1A0QL 1P6AB 3JV6B 1D3CA 5C8JB 5C09B 4LHUA 4JO4L 3NN8B 4JZNB 1KPVB 2H6PB 4MJ4A 2QSTA 3QPQD 4WW1A 4YX2H 5HGGS 5FO7B 1AGBB 2GFBB 5J89A 5D6CA 4WCYH 2VLMD 3LOWA 2FATH 4ODUB 3RX5A 2X1WL 1J0KA 1Z5LA 3TT3H 3UX9B 3QIWD 2K3TA 3LIZH 2FO4B 4K8RD 3VA2C 1LMKA 1T7XA 4KK6C 4MDJA 4ZO9A 3V4UL 1WIOA 1U8OB 1J12A 5JO5A 4QXWA 5L6YL 2DIAA 1EJ6A 1W8NA 3CFKA 1IM3A 4LSUH 1MFBH 4EI6A 3QDMD 1B88A 1S7RA 3T77A 1ETZA 5L0QC 3DV4A 4YHMH 1FSKB 2YC1A 2Y72A 4U6YA 1DUYB 2P49B 3E2HB 4MNQA 4HUVA 6FABH 1TPXB 4Y1AB 1ONQA 2DDQH 5FO9A 4FQCL 3UBXA 3QCVL 3WXVL 1OAKL 3IDYC 5FHBH 2MCG1 3EYOB 3VFTA 1RU9H 4U1SB 4WI4A 3E6FA 3REWA 4ACPA 1E4XH 3QJFB 4OB5L 4PG9A 5EUOA 2BSSB 2YOCA 1FAKT 4B50A 3CSBA 3VFSA 5D1QD 3RVXD 3ARYA 3CFEA 4IOIB 5I1GL 5IHUH 3OAYK 2VNCA 4YEFA 3F7VB 3CZFA 3BDBA 1NGWA 3H3PH 5J12B 1DN0A 5GRJH 3SO3B 5DI8B 5K59E 5EIQA 3FOLA 1UCBL 1KGCD 5GRWA 4JHWL 1TJIH 1NCCH 1LP9F 3O9WC 4NO0D 2G5BA 4R7NB 1UM5H 2HH0L 3AC0A 5HHVL 4IIQB 2DJUA 4BH8B 3UROR 2FH6A 2H41A 2VQ1A 4YK4B 3ZE1F 1MJUH 4UTAH 1EMTL 1CLZL 3WMSA 1FORH 3ES6B 2Z31D 4PREA 4XPAH 1IGFH 5HGDB 1P84J 5TE7L 2C4FU 2A83A 1Q9WA 5DEGA 5I8OH 5ACLA 3MCG1 5FA3A 3HI1A 5KANI 4Z7VE 3ZKSD 1JZ7A 4GAFB 4MVBC 5F7YC 5D5MA 4KPHH 2BSRB 35C8H 4JQXC 3O0RH 5F1KC 4PJEB 2BNQE 3QNXB 4X7SL 2R0ZL 4PV8B 1ZGLA 4QEGA 3E3QE 4LSSL 3FFDA 4GBXA 4FRWA 4AEIH 3RZCD 3UMTA 1GPOH 3TWCH 3UTSE 4OJFL 5LBSL 3T0BA 1FNAA 2ADGB 3S5LB 4AT6A 1XF3A 5KAQG 4U1LB 1MCJA 2DQCH 4ODUA 4MNHA 3MBED 5CILL 3QDGE 1FH5L 2VUOA 4NN6B 3VWJB 3IS1X 1JF5A 4F7CA 1OAYH 5E03A 1JFQH 1ZWIB 1A5FL 4NO2A 3EAKA 5FM8A 1U8OA 1IARB 3VD4A 1JPFA 1CGSL 1UCTA 3FO9A 3P77B 3TPUA 3F7YA 4P46C 4X4MA 4QRRA 1J10A 3MV7A 1MQKH 4JDZA 1KJ2A 4R0LC 3TO4A 4WWKC 1OSPL 2D4DA 2CDGA 3RI5K 3LKQB 4JFEE 3Q5YA 2X89D 1L6XA 1RIVH 3DVGB 4Q6IC 3UJJH 1UJ3B 1CFSA 4QOKD 4K7PY 1G7IB 4P3CL 5KJRL 4M5YL 4UT7L 5DF0A 5B39B 1CQKA 2C5DC 3VFOA 4KKLC 4KHTL 1CR9L 1H15A 4Y1AA 5TDNB 1AXIB 4I18A 5DJCB 4FMKA 1CICB 2IPKA 2JIXA 2EXYD 2OM5A 3VFNB 1N8ZB 5TF1H 3SGKC 5A3ID 4OCXH 4TVPL 5B3NA 2PN5A 1JV5B 2FBOJ 4FQIL 4UZGA 5ESVA 3WE6A 3EOYG 1S7QB 3ZLQC 3P4LA 5TE4L 1R5VA 2F58H 5SWSB 1U3HB 3V4PL 3AAZA 2FGWL 4AQ1B 3HG1E 4NCC2 1LO4H 1A7RH 3N1QC 4BYHA 1BEYH 1LO0H 4NFDA 4U0RB 3VMOA 7CGTA 5EORL 1J8HA 3MOAH 5CJXA 5E6IC 2CXKA 3LEYL 4K9EH 4WTZG 1WITA 3TNNB 5DVMA 3C5JB 3HE6B 3ULVF 1V3KA 1CL7H 3CX2A 3DECA 1R5WA 4OLWH 4ZFGL 3RGVD 1T22B 4V2BA 2Y4SA 2OL3B 3MRJA 1HHHB 3MNWA 5TDPB 1SMOA 4M93B 4NJAL 3P0GB 3KLHC 2DQJH 5F9JA 3GMQA 1HKLH 4OD3H 1OTUC 5I1LA 1SBSH 1RUAL 1HH9B 4C56E 4MAYC 3P9MB 4HKJA 5ANMA 2DQTL 3BWAB 1MUJB 1WBYA 2AERT 2ERJB 3QNXA 3PF2A 4H25A 4LVHB 3STLA 2OTPA 4BKLA 1JNLL 5AUMB 3VH8G 4Y4KD 4MJ6A 1ZHKB 1KLGA 2NY0B 1WC7B 4GT7A 1NMBH 4QWWC 4XXCA 4JKWA 2C7UB 5EZJA 4OFYA 2J3SA 3H6JA 2QKIB 5CZXC 3V95A 5GS2H 5DJYA 5EOCJ 4UIMB 1J0JA 3W81A 4WHTB 4PJHE 1ZK9A 2ZUQB 2X1QA 4ZUSB 3EIFA 4P5TD 3CFIC 5GZOC 1DQJA 4MAUL 2CJUL 3PWPA 2IGFH 2NZ9C 4V1DE 1TVBB 3RTQD 1ZGLP 2B1AL 5E94B 4C59B 1F6FB 1Y0LB 4HWBA 1Q0XL 1A4JA 3T3PF 3CVIH 1DBKH 2A1WH 1MIEL 1N2RA 5IW3A 4LNVA 3QCUH 3VI3F 2H2SC 1C12A 1XCQB 2BVPA 1G9NH 2P48B 2BFVL 3GJEB 3Q1SH 5J6HA 2BNRD 1PG7H 4JCMA 3TBWA 4Y0GA 5E7FA 2EKSA 1PAMA 3BZEA 5T1LB 4NHUB 3PWVB 1PYWA 4OLZH 4EI5C 4H1LG 5IF0A 4DTGH 4NKMB 5IW1B 4HJJH 4YDVB 5DGQA 3O4OB 1I7RB 2DLEA 5I1HL 4RA0C 4CMMB 5DK2B 5IQ9A 4DEPB 1NLDH 2NY2D 4FS0A 3CCHB 2ZSVA 1AGFA 4JKMA 4FQHB 4LRIA 5D1XD 3V4VL 3PL6C 2JJWA 3N1FC 4JN2A 3I3DA 3MBXH 2MWCA 2FHBA 5I74C 4RDQG 3DRTB 4YBLB 5DUMH 2E9IA 1T6WA 1P7KA 5A2LH 1IGJA 3I6LE 3IT8D 3QZWB 4P59L 2J8UA 4RWYH 5EIIA 2OZ4A 1T21B 1U8LA 5C0BA 3O3DA 1HHKB 4M4RA 5FGCE 1U2HA 4HK3J 5IB3B 1FLTX 3HE7A 2CRIA 3Q3GA 2VDQL 4RGND 4PJIF 2OJZL 3D0VA 1EAJA 4ENED 1KPUA 2VDLL 3QUXD 1N0LA 1DUZB 2OCFD 5HVWA 4Q9QL 1QFWH 2PYED 5D5MF 3C5ZA 4FFVC 3SKJH 2ZCLL 1H3PL 5F89B 5JOPE 3QUYD 4XNUH 4YGVA 3VXME 4J1UB 2ADJB 5IP4A 1X4ZA 3MA7B 5ACZB 1WIPA 3BWAA 5GJTH 1S7VB 3TV3L 4G8EB 3QXTA 1KJMA 4G42B 3WEXA 1IILE 4HJGB 4R3SB 3CMOH 3HZYB 3FT4A 3VGAC 1DQTA 2ATKA 5ADOH 3ECBB 1UM6L 5AUMA 5GGUB 3CLEH 2DB8A 4Z7QF 2XWTA 2BK8A 4JPIB 2HMID 4IRSB 4ODVH 1R3HB 4X6FB 3U4BL 2QKIA 4PJFE 4TNWK 4BSWA 2GCYB 1QLRA 1T03H 3RIAF 4ORGB 1K4DB 4LAQL 1A1OA 4AEFA 4NM4H 5DMGD 1LILA 5TE6L 8CGTA 1P9MA 4RAUA 4JG0H 1KB5A 3O6LL 5J13B 2BHZA 5MEPB 5J57B 2V17H 1CLOH 1URLA 1MRDH 4WDIA 3GHBL 1T1YB 4HXAH 3MLRH 3ORJA 1XR8A 2AXGB 2R2BA 1W0WB 2VAAA 4G7VH 4H0IA 4JFEB 3WIIH 2FBJL 5JW4N 1YNKH 2IG2H 3QFJE 1D9KD 1ORQA 3BP5B 4CVZA 3D3VE 2I07B 3PWVA 4NKQB 2XWJB 4Z0XB 1H3XA 5HDLA 3OHXB 2AK1L 1JYXA 4L4VD 4NQUA 2B39A 4YXLL 5MERB 4P9MH 1YECL 4D0BB 1WFNA 2YPLD 3CDGB 1A64A 3T0ED 1ZEAL 1RZGA 5CJOL 1OAZL 1T89A 2CK2A 1SYVB 3BVNA 3QIWB 2FX8H 3ZT5A 4AM0B 3QEUB 2AQ1A 5IB4A 2X70A 5I2IA 1UEMA 4GRLA 4XPFL 3LSOB 3EDEA 5EWIH 1Z0MA 4A6YB 2UUDK 5LWYL 5T33L 1E6JH 4Y5YC 1AQKL 2GITB 2GJJA 2DQDL 3BOVA 1F5WA 5TPWL 4AJ0A 1BBDH 4AG4L 1GOHA 2C1OA 3ARZA 1F2XK 3LEVL 5F89A 1EERB 4OIIL 3W9EB 4YDKH 3MA7A 4ZXBC 4Z7VA 5FEBA 5CIPB 4DW2H 1RJYB 5D1QB 2GK2A 3UTPD 1AP2A 3CVHB 3IU3A 2BNQA 3WFDL 4ALAL 2YWZA 3ECBA 4M5ZH 5KVDL 1C08B 5SWQA 3ARFD 5JPMB 2HN7A 3GNML 3UTSA 1R3HA 1IC1A 1LK3H 4NO0B 4QTHA 4M48H 1DTUA 1JK8B 1QSFE 4F33B 1JGLL 3QDGA 1A9BA 3MMEB 4OLXH 3SGJC 2CKBL 5LQBH 3S5LG 2AJSL 3BAEH 2Z31B 4Z7UB 3RWDB 3QWRA 3LD8B 3ROLA 1M7IA 3AY4A 4XZUB 2DQHH 2BHYA 4GKZA 3S3JA 3OKDB 4QRTB 3VFUB 4X6EB 3T3ME 5IBLD 4HC1L 5HDQL 1P6FA 3MRFB 3RWIB 3S34L 1E27B 2QV2A 4G9FE 3GSWB 1W0WA 4JFEA 1WCBB 3O3EA 1MY7A 4JKPH 1OPGH 3W39B 1RUQH 1A6AB 4KXZH 4X4XA 4XP9H 3V7MA 5IQ7L 4ODSH 3L3HB 3BKML 1I1FA 5DYOB 1UWXK 1EAPA 4U49A 2OXHA 3QXAB 2XA8H 2NY4D 4FFYH 3D0LB 5MERA 4I4WB 2HAZA 5B39G 1IGTB 3CDGA 1I85C 1RJZA 1U92A 1ZVYA 3X12A 5EZIL 1MWAL 1OAXL 1MCBA 2XKNA 4QHMA 4LEXH 5K9QG 2J8UF 3AREB 5DRZA 5EBWB 4O9HH 1SYVA 5HHXH 2Y5TA 5CD3B 2AJXL 1U8HB 5DQDL 3HG1A 5E6ZA 2B0SH 5HYEA 3K4DA 5JMRA 5F9AC 3BHBB 1CE6A 1XGPA 2GJ6A 3LSOA 4GKSB 4XP5L 5GJSH 1I1RA 3VRJA 2DI7A 2XACC 4ZD3H 1AHWA 3F5WA 1AKJA 3MNVA 1FL3B 1TZHA 3UPAA 3DIFB 1G7JA 4YDIH 3STZB 4QF1A 1G6RB 3WKML 1KENH 4WI3A 5ID0B 4QOKB 2EE2A 4WTXA 1MJJB 3KR3L 3NFPA 4M02A 1D7FA 5DD5H 1I1YB 2YA0A 3LRHA 3JWDL 3ZSTA 4BQ9A 4BJLA 3NCBB 1IGCL 1WBZB 4RRPA 4KHXL 1U42A 3T2NH 2FX7H 3ARDD 4ZQKB 4C56A 5MEOA 1I3UA 4P5KB 4OM0L 4QHKI 4A2LA 5HGHB 4RMUA 5CIPA 3FO2A 5GS1C 4L9LA 3F6LA 1CZ8L 5GS0H 1E6OL 2JCCE 4GXUM 3U6RA 5IB1A 4YDJB 4F80A 2XZZA 2NY3B 3IAGC 1Y6MR 1OVZA 4PPTA 3F7QA 5D7SH 4PRIE 3W5NA 2RGSA 3QDJD 3IKCA 2M2DA 4HSQA 1ODAA 2HG5B 1IM9D 3X11A 3ZHDA 5HYJA 4DKAA 3D18B 1NC2D 4HIEA 4KQ3H 3MJGX 4R26H 4PJHA 3VXQA 4LF3B 3RGVB 2PXYC 2AEPH 4V1DA 5HHQA 2JJUA 2B2XL 2EYRA 1GGYA 1BVKB 4X6CB 1P5VA 4XZUA 1BQUA 2XZAH 4HZAA 3FQXA 3KPRD 1KXTB 4X6EA 1DQDH 5T3XH 3HNVL 1NAKL 1QBAA 4G3YH 3IVKA 5EPMB 3EYSL 3O11A 2X1OA 1YEKH 1CL7I 4F7TB 1T4KB 5C0RL 2WBWB 3D3VB 5H94A 1A4KA 5C0IA 4J3VA 3VD3A 3ZKMD 4NNYA 2BDNH 4NQSA 4N68A 3C60C 3UAJD 2DN7A 4Y4KB 3QHZH 4GAGH 3QXAA 4OQTA 2VC2H 3KPLB 3D0LA 1HSAA 1W8OA 4J4PC 2MJWA 3HRZA 4J6RH 3RBSA 1S8DB 5K59F 3SOBH 3B3IA 2W60B 1M7DB 1I9JL 1S7UA 3EYVB 4OZ4B 3NOIA 2BNUA 3TZVB 3PWUB 4P5TB 5CD3A 3VWKB 5I1IH 5FYJL 2ADIA 5IFJA 1KIRB 3EZ8A 2XPGA 1LO5B 3L3JB 2HTKC 3QDHA 3GBLA 3VGGA 4GMTH 4EN3D 1CLCA 4LSDA 5E8NB 5DFTA 2JELH 1FL3A 2X4NA 3IDXH 1MFAH 2E7MA 1DFBH 4G7YH 1IE5A 3LQAH 4EIGB 5AAMA 3S36X 3KPSD 4KUCF 4BZ1L 1KN4L 1MJJA 1SEBA 1QBBA 3B8YA 1EXUB 3QZWG 4Z7VF 1A6ZA 3LN4B 4N8VA 4JFZL 2JJSC 3M1BB 5ISZB 1J11A 1UWGL 2VZVA 4ONHB 1X4YA 3RY6C 1BQLL 1IL1A 4OCNC 3VXMA 5KBNC 4ZQKA 4GW5B 4HS8H 4PTTB 1I8LC 2AXJA 1LD9B 3KPPA 4HZLA 1X7QB 2ZPKH 1IQDA 3QH3B 5FFLA 4QRUB 4B7LA 3OF6D 4KJQC 1CFNA 5FYKU 4ORZC 3I2CL 2YZ8A 3MLPA 3ARBC 4RGMB 2IFFL 1KACB 3QG6B 5FV2A 1WIUA 1CDIA 3VXNA 1JPTH 1KJ3L 4F58H 2HG5A 2LAAA 1YNLH 3F12A 4KK6D 4PJFA 2ZUTA 4AIOA 3SE3A 3IJHB 3L6FB 2FJHB 5EOCL 2GTWB 2FDBP 2ZNWA 2Q76B 5AYUH 3S4SB 3QUXB 4ZPTA 3EOAA 4DKFL 2V6HA 4HKZA 1S5HB 1YY8A 2PO6C 5EO9A 1BVKA 4M3KB 2CDEB 2PYEB 1A7QH 4XWGL 2ITDA 2EH8H 4APQD 1GGBH 3HHRB 2W0FA 3MJ8A 3Q6GH 2VB5A 5DR5L 4NO5B 4QHNA 3CK0L 5IBTL 3EOTH 3QFDA 2IAMC 2VXSL 5CAYB 2OL3H 1U93A 3QFJA 5DHYA 5HPMB 4X7CC 2YD3A 4DQOH 3JUYA 1JGEA 4D8PA 1A7OL 1PFCA 1R0AL 4LHJB 3CMGA 4KZDL 1KLUB 1D5BB 3REVA 2R0LH 4LCWB 2MQCA 3VFPA 5IJKA 1D5MB 2ZKHL 3DUSA 1QFWI 4J2XA 5C9JA 4LLWB 4PR5A 1DSFH 1JGVH 1F4WL 1ZA3B 4R90L 4RZCA 1IGIH 3OX8B 3IXAA 4G8IA 4WHDA 2CUIA 3EYVA 3OJDA 4PG2A 3VRIB 5CGYC 4OZ4A 4ZSOE 5I6XC 1KXQE 3O9WD 4YFLF 1RK1A 1A9EA 1A6VL 3JZ7A 3GI8L 3HS0B 1RZFL 4O4YL 1TVHB 5L7XL 5IVNA 5CEXB 5ID1B 4FQXC 4LSTL 3L3JA 2IEPA 1I7ZA 2EDDA 4LSRL 1ORSA 3QBTB 3O2DH 4KRPB 4M6NH 1DL7L 2F54E 1CU4L 2BOBB 5C70A 1INEL 1E4KA 2Z8RA 5FGSA 5GGSB 5BRZD 3QIBA 3U9PH 1GIGH 1IQWH 2R2CA 3O8XC 1BFOB 2GJZB 3ULVL 3IAPA 2XG5A 4MVBD 2QR0A 4LLVA 4ONHA 1OB1B 2VISB 2UWEB 4L4VB 4LVOB 5DMKA 5IB2B 1PZ5A 3TGXA 1CBVL 1GZQB 3MZGB 5DD3H 2YPLB 4X7FC 2HJFA 1KPRB 2BC4B 4P2OC 4MCZA 4PJBB 1E28B 3A6CL 4JFQB 1YNTB 3QH3A 3NCYP 4LDEB 4CNIA 2WBJB 4WW2B 5D9SA 5FHAH 1I8KB 3QHTC 5HHPB 3P73B 3P4NB 4Z7UF 3RWEB 3S8WA 2NNAB 1IC5L 2EIZB 3EO1B 2VLJD 1QLFB 4YBQC 1QSFA 1F58L 1JF6A 4PRBB 2UZXB 1AY1H 2AXFA 2FJHA 2R1XB 5DMIL 4P46D 5EUKB 3WO4B 2Q76A 4Z7WB 1BZ9B 2HFGH 5DA0B 3RVTC 2C3GA 4O58H 3IJYB 5T1MB 1E0OB 4OV5A 1WK0A 2R1YB 1GCFA 5FYKH 4DVBB 4ZOAA 4ZUVB 2Z4QB 3C6LC 5HVHB 3HPJA 3W0WE 3RL1B 5T3XE 5KVEL 1UZ8A 3OL2A 1RV6X 4KUZL 2HTLC 4G9FA 5H37G 4FFZL 1U0QA 3SGDH 4Y5XC 1CGXA 1YEJL 5GPRA 1OTTC 4P48A 3OR7A 3PIQA 1OF2A 3KGRA 3U7WH 2HFEB 2WLZA 2AJ3A 1KLUA 2IPTH 2NLJA 3MV8B 4PRDA 1MPAH 1Q0YH 2DYPA 3ARFB 3T0WA 1SVZA 1OOAA 4HIHA 3CFDA 5GRUL 2R2EB 2VDML 4CVWA 4F57L 5JQ6H 1CGUA 1QVOA 5E6ID 1CQYA 2OTUA 1JVKA 5E6YA 5J06A 3LH2L 3QUZB 1INDL 5DMJB 3AGVA 2YD8A 3MRMA 4RIRA 4W4NA 5I9QB 2X1PA 4X0KA 5HVGB 5J11C 5FECA 2AW2A 2BMKB 3LEXA 2VXTL 5I8CA 2FL5B 3KLHD 5DJ2B 1MRCH 2B8OT 4YWGH 1T20B 3ZE2E 1DBBL 5J3HC 1OTUD 3GRWH 2VWEC 4MZ2A 5KSAC 2XQBL 3RWGA 3ZL4L 2X4RA 5DDHB 3PXJA 5FF6A 4HG4K 1TQCC 5D1ZA 4E41E 2FYYB 4IM8A 2ENSA 3SE8H 1I3RA 2DQEH 4RFOH 3WS3B 5KSBE 4AEHL 4IS6A 5IB2A 2R0KL 2IJ0C 4KMTH 1ES0A 1NDGA 4KH2A 4JDVB 4XVTH 1WEJH 3R8BB 2VZOA 1D6EB 2EECA 3HUJB 4TUOA 3KNBB 1EK3A 4L5FH 5K93A 5L88H 4QWWD 3GMRB 4AMKH 4X6DE 2IANE 2WBJA 2JCCA 4PJFF 1TTUA 1FL6B 5L2KA 4KXZI 5CZXD 1R3KB 4I77H 1HXMA 4PRIA 3VRLE 1Z2KA 3DWTA 3UC0H 1VGKA 2NNAA 5GZOD 4Y5VB 2OP4H 2IBZX 2NZ9D 2D0FA 4OLYH 4TRPH 1CLYL 4H5SB 3VMPA 1CYGA 1I4FA 1HXYB 4K8RH 1UKQA 1BGXH 4QO1A 1M71A 4GXVH 3HN3A 3VGHA 1T0NA 1BECA 2H2SD 2H32B 2BCKA 2XIDA 3IJYA 1M05B 3QJHB 3MXVH 4KI5E 3C9NA 3DO3A 3SKMB 4GSDL 1VFBA 4Y2DB 5C0DA 2Z4QA 2VL4A 4Y4HC 1KJ2L 4EXKA 2R69L 5JOFB 5JIHA 4EI5D 1Q9KA 2EIBA 3WD5H 1ZLWK 1U8NB 4XPHH 1UYWL 4PGCB 2QQLH 3HPLB 4HAGA 4M7KH 2HKHH 4OM1H 1VACB 2NY7H 4LGSB 1AO7D 4FNLH 1T2QH 1A21A 2C3VA 4PJ5D 4YNYA 3EJJX 2FD6L 4XMLH 1DVFD 3D2UA 2VAJA 3PL6D 3MRIB 5F7EL 1U8JA 4CW1A 1W72A 5LGKA 1IM9B 7FABH 1VFAA 3DNKA 2IQ9L 4DUVA 1LE5B 1OSZB 1QQDB 1XGRB 4TULH 4PRPE 4FTVD 3CXDH 1GGIH 4KVCH 1MF2H 5BV7H 3SE9L 5JPNA 1QHPA 5KS9E 3VJ6A 3QEQD 2ARWA 2F19L 3O41B 4OCRH 1ZOXA 3LN5B 2N56A 4PJAA 2OK0H 4HQQH 4PB9H 3GM0A 2BVTA 1YJDL 4NQDD 4YHOL 2XZQH 1A3LH 1F6AA 4UTBH 4N0CC 5IMMB 3MODH 1SJEB 5F6IB 5IWLC 1T1ZB 3TVMC 1A3RH 2UYLB 4DVRL 1WV7T 1FAIL 3B9AA 2O61B 1F11A 3WS3A 3D39E 3QAZB 1WZ1H 1QBML 4K3JH 4X6BA 5GGVL 1ZGLM 5F7KC 1XGTA 3RWHB 3DXAB 3U7AA 5KG9B 3WFEL 3D87B 4HPYL 2WWKO 1WBXB 1J0ZA 3ALXA 4TNWF 1P4IH 1YMMB 1YPZE 4ODWB 3TBTB 25C8L 4M7ZB 1LNUA 4ONOA 3X3GL 4HKBB 5E99L 2A6IA 4MLSA 4ONFH 2DRUA 1D5IL 4GW1A 3TLRA 3WNNA 3WN5B 5C2BH 2BY0A 5J7CC 4P3WA 5HXMA 1L7IH 1QYGL 4P4KA 4X80L 4EOWL 4OZFH 5FUZH 4JM2C 1NCWH 3I50H 2ICEB 5CEZD 1KT2B 4X5LA 3T3MF 3ULSB 4HS6A 3FB8A 1IEBA 1MFCH 2NY1C 1FYTA 3QJHA 2WP3O 4QHKJ 1A1MB 4HWBL 4LCIH 5FYKE 4MA1C 5JXAL 2DKMA 1JNHB 4HIIA 3JWDC 3MLTA 5EC2B 2QLVB 1IAIL 2N1KA 4LCUB 1CVSC 2F5AL 3MJ6A 5EZLA 3S4SG 3AS2A 4GKOA 3VFGL 2FX9L 2NX5D 3VDAA 4LPTA 2J6EL 3RX7A 1FVCA 1MI5E 2VIRB 5E2TL 1N5AA 1LDPL 3WHE1 4KGLA 3LHPH 5GGTH 3JWNC 5M94B 2VABB 1BREA 1R5IB 3LZFL 4G6AD 3QXUA 5F21B 2J4WH 5C08E 1MH5A 4GKNA 4HGWB 1QHOA 1DBJL 1HE7A 3BUYB 3MRIA 4JJ5B 1R3IH 4HFUH 2DBJA 3FHQA 5CKAA 4WFGD 1JWUB 1RUPH 3FONA 4WHCA 4ZSOA 2WINB 4HT1L 5DJZA 3BKJL 2GSIB 4OCSH 4OSUL 1B0RB 1Q9OA 2EIEA 4O5LH 3JUZA 5JDSB 2FEEL 3SY0A 3BEWA 4K23H 3KYOB 5E08H 4GRWB 4H26A 5E9DD 5IR1B 1E4WL 2DTMH 5DRNB 1YUHA 2OZ4L 3EDFA 1QFUL 4TUJA 2F54A 5HHOE 3QCTH 4XHJC 4YR6B 1MHCA 2UWEF 1TDQA 1ZAGA 1JZ3A 3A6BH 3FQUB 1ZLVH 1UGNA 3SDCB 3ULUL 3OXSB 2V7HA 2APWA 1MHPH 5I1JL 3TBSB 5F1NB 2XQYG 4PJBF 5TQ0L 5HSFA 2O61A 3V6BR 1OW0A 1HOCA 5KSBB 3MA9H 1EUUA 3EYUH 1GL4B 3G5YB 5D7LD 5IEHB 3ZTNL 5DC9B 1CDUA 4HBQA 3BZ4B 4U1HB 3N85L 1RULL 4HDIB 4LBEB 5JNYA 2Y07L 1FNHA 1NBVL 2Q6WA 5GIRA 5EA0H 5EN2A 4E5XA 3G6DL 1CGVA 3PDDA 5D71H 4JFPB 2VLME 4JB9L 4HWZB 4K3DL 1XFPA 5FUCC 3T2OA 5ETUB 3K81A 2NY5H 2ZCKH 3BYYA 4EZMA 1MRFH 2Z92B 3D25A 5IVXE 4JM4L 4TVSa 1S9KC 2RAMA 4O2EA 2ITCA 3EOBA 1HNFA 2DQGH 4F7PA 5BRZB 3HR6A 2Q86B 5DLMH 4ZFZB 3FQTB 3RDTC 1KB5L 4L4JA 4L8DA 4FZEL 4MA3B 3SDAA 3MGOA 3DX8B 3VGDA 1I1AA 1H5BA 3VE0A 3QDME 4L3EE 1TIUA 3W0WA 1NEZB 1T3FA 2HVKB 4QGTA 4ZS6D 5KN5B 3DLQR 1J87A 3TFKC 3HC0A 1FO0A 3LRSB 4D9RD 3AFLA 1Q1JH 3K4ZA 5E5MA 2V5RA 4LRNH 1DLHB 3IJSB 3L5XL 2I24N 3RU8H 1Z9SA 1I7UA 4OLEA 4XXDA 4F7MB 3DTXB 4JG1H 2CD0A 2E8YA 3OPZL 5DEZA 3JTTB 2VJXA 1FVDA 4M00A 3D69A 4JFXB 2MFNA 1JGUL 3UTTE 5EU6E 4P4RA 3UCRA 3DURA 3TH3T 1YQVL 4Z5RB 32C2A 5F3HB 2IBGA 4G6ML 4WWKB 4ZUUB 2WZPD 4WHYG 5CSZB 3P0YH 4KJPC 3UTQB 5M7QA 3V0WL 4E42B 1CFBA 5D8JH 1UVQA 5CHNA 1ZTXH 3QQ3B 1H0DA 3U46A 4GS7C 5HPOA 4QLRA 2QHLA 1N6QL 4U1MA 1L6ZA 3KYMA 4RMSA 5K9OB 3KDMA 5DHVB 1FBIL 4ZOBA 5F1NA 4E41A 1PSKH 2VRAA 1L0YA 5KSBA 5I1CH 3G5YA 3QR2A 2P24B 2YS4A 4ZUWB 3NZHH 3ZTJG 3MNZB 1INQB 3MUJA 5EU4A 3BIAX 3QO1A 1JNNL 5E6IB 3OKYA 43C9A 3SGDI 4X6DA 5BO1L 1Y18B 2IANA 1MNUL 1GGTA 3TBVA 1HYRC 2DD8H 2EYSB 4IRZH 3AVEA 4KZEH 4ZS7H 3BD3A 1EGJA 1EVTC 2A77H 2Q8AH 1MFDH 2PXYD 1QOKA 3MLVL 4NGHH 3PHSA 1BVLB 3TH2T 1NCDH 4WGWB 3WS6C 1FCGA 1SM3L 2GHWB 1D6VH 3PDOB 4N9GA 2XN9D 4XPGL 4F9LC 4ZDHA 3D9AH 4MAYB 5E0QA 1T04B 1EO7A 3PNWA 1VFUA 2VTFA 3RWCB 4R4FH 1Q38A 5E8PA 3ULVC 3N9GH 4OTXL 2AI0L 5IVZA 1OP5K 2YRZA 5KN5A 4HIXH 3C60D 3V9FA 5ICXB 4HJ0C 4HUUB 1OGTA 3BEVB 1BBJB 1PX4A 1P7HL 1EA9C 1N64L 1FNEB 1MI5B 2DIBA 4TTGA 2FNBA 2H26B 5FUOL 4J4PD 1SJHA 3SKNA 1BFVL 4HAFA 3IJSA 4XNMA 5C08B 2R29L 4LL9A 4D3CL 5HHME 5D2NE 4GAJL 4R9HA 1AXSB 3SHSA 4YHYC 5IK3A 5IHZB 1TJGH 2J88H 5I8EB 4OFPA 5F6HI 2DL2A 1CXFA 2HTKD 3GIVA 4PRPA 5IM7A 4XNZC 1EVUA 2B1HL 3HNTH 1NSNL 1FL5A 1S9WA 1GOFA 2DIJA 1QZ1A 4EBQL 4QRPE 5KS9A 3FAWA 2R15A 4FZ8H 4HK0A 1OARL 1GZPB 1XMWA 1CTNA 2GSGB 3I6KB 1SHMA 4LSPH 5J6GA 2OLDA 1QSED 5DJDB 4JRXE 1TXKA 3BJ91 2OQJA 4YXKH 4BZYA 2G2RB 3DX6B 1UH2A 1XIWD 5K9OA 3HMWH 1FFPB 5DHVA 2C3HA 2I9TB 2MSPA 1NFIB 3LMJH 1KSRA 3ZHLA 1AO7B 2GEEA 3PGDB 3GSQA 4TVPD 4UIKL 2P4AB 5CP7B 4JHAH 2R39A 2VKWA 3C2AL 1OQOA 4WUKL 4HV8B 3D39A 2P24A 5FKAA 4NQCB 1A7NL 3AMKA 3GMMA 3SDDB 3PL6B 4LCCA 1IEAA 3BW9B 3X3FL 1DP0A 4KJQD 3MNZA 1JL8A 1W0VB 5JORB 3IDNA 1RFDH 4POYA 2E5EA 3ARBD 4FTVB 1A14H 5I1DA 1HIMH 4I13B 1CXHA 4K55A 5ALBL 3VFRA 1YPZA 1BJMA 3RNKB 4FABL 2Y23A 3RL2A 5T1KB 4NZJA 4ZMAT 2DTSA 4PJ8A 2ZOKA 2YPVH 4NPYA 2FEDC 3U2SA 5DQ9B 5KOMC 2QEJA 4O51A 4WCYL 2FATL 3KXFD 1A1NA 1JHLL 4WHYH 3I02B 4GQ9H 3F8UB 4M3JA 3GKWL 2PO6D 2XZCL 3KPQA 2O26U 4OUUA 3TT3L 2RHEA 1YYMH 3LIZL 4H0HB 4P2RE 3RNQA 1AE6H 1C5DA 5B38A 2VITB 5DJ0B 4EVNB 1FLRL 1G7LB 3NAAH 2FWOA 1UA6L 4R2GB 1DANT 4AK1A 4YDLB 1MFBL 1ND0A 2ED8A 3B2VL 5DURD 5SV3A 1QEWA 1J0IA 2DJSA 4QXUH 1X4XA 1B0GB 2CLVA 3MV9E 4YHML 1BBJA 4DGIH 1L7TH 2AV7B 2PTUA 1MI5A 1FNEA 1G9MH 2H26A 4N8PA 3D48R 3ZTJH 5HVFB 3KLAB 5FGBC 5BJTB 4YHIA 4Y89A 1RU9L 4OQTL 5C08A 5A43C 4JZJA 3JBG7 4GBXC 1E4XL 4S2SB 1U36A 4P23A 4QXGL 3QIUA 2BXZA 3FFCB 4PJ9B 5I8EA 1WWCA 1HH6A 3O3UN 4K2UL 5IHUL 5HGBB 1N5YH 1K8IA 3V5KB 2IF7A 3W2DH 4IOFC 4JRYB 2PW2B 4HUNB 4PGDB 4JO1H 5GRJL 2AK4D 5L8LB 3ZE2F 5KZCD 3WIFA 3NZ8A 1GZPA 4UINH 5HDOA 3FQRA 2O5ZH 5C0NC 3TH4T 1MIMH 3DROB 5HHOA 5KSBF 2I9LB 3GHEH 5AAWA 3O8XD 3TO4C 4ISVB 3DX6A 1MJUL 3V52H 3RVVC 3BQUB 5ICZB 1FORL 3N1MC 1RZKH 2UY7A 2H32H 4KTDH 4LARH 4P2QD 1OLZA 3V5HB 3E2HC 4NN5C 4J12A 2PTTA 4NZUL 4P2OD 3I6GB 4I18C 1X5HA 4OBRA 4KKNA 1VKXB 3SDDA 4HH8A 2HRPH 2ZUUA 1RAMA 5C86A 1VFOA 3VRLF 1KBGH 35C8L 1FRGH 4MMZC 1A6PA 3HR5B 4DOHB 4WEBH 3NTCL 5T1KA 1U8IA 2NQCA 4Y5YB 4X8JB 4YBQD 3LKSB 4AEIL 3BPCA 3ZKNC 1LVEA 1GPOL 3TWCL 3G5VA 1M4KA 5TH2A 5FOBB 4K71C 3VXUD 2XTLA 4KTEH 1YZZA 5CJXC 3HLAA 4JFDE 3BGFC 3TO2B 1BIHA 3RVTD 3KPMB 4NFBA 5IVXA 2VZTA 3TEUA 3V5DA 2VR9A 5E2VH 4RA3A 1OAYL 1YJDC 3C6LD 4AQOA 1JFQL 5LGJA 1GGCH 5DJ0A 2O5XH 4M61B 3BP4A 4DZ8A 4ZXBB 4U1NA 2HTLD 2ICWB 3GSOA 3QDMA 1OTTD 5CLTA 3GSNH 4L3EA 1F2QA 1JWSA 3UO1H 4XNQA 1B0GA 4CAGA 4JLRA 4W81A 3UJJL 4LDOB 4WWID 1CD1A 5F3BB 2CO7B 3OR6B 4WFEE 2NCMA 1OCWH 3VG9B 1NEZG 3EZJB 5F7DA 3H7BB 3D6GA 4AENA 4X4YB 1FG2B 5HHMB 3QXVA 5KS9F 2B4CL 3T0EE 2IQAA 4XXCC 2A6JA 2UVFA 4QY8B 3UTTA 5EU6A 1Q72H 2MPAH 1MLCA 1LO4L 1BEYL 1LO0L 1LEIB 4QRPB 1F3RB 3MOAL 4GG6E 3PUCA 4S10A 1DQLH 3QXWA 3U83A 3UPCA 2F8OA 4LLDB 5E24E 1T5WA 5J3HD 5KSAD 5L2JA 5EU7E 2XY1A 3MUY1 4ZODA 3PV7A 4GXUN 2HLFD 4OLWL 1T2JA 3WL9A 5EC1B 1U8KB 4WU5B 5A16B 3FRPG 5MHSD 4NZTL 5CGTA 1I3GL 1NJ9A 1HKLL 4L3CB 4OD3L 2DQFB 2HJLB 2X7LB 4TPRL 3SE4A 4D94A 3GI9H 3WYRA 1EFQA 3UTPE 3RAJL 1PGRB 1VENA 1JUFA 4ETQB 4PRAB 4LRIC 4OKDA 4WI9A 3GMPB 3SCMB 1KCRH 2XFXB 2VDNH 3RZCA 5B21A 4RISH 4PJGB 1NKRA 1UB5B 5CEYB 3HZVB 5F72S 2E3VA 2R2HA 2XKSA 2NXZB 1NCAL 1XGUA 4M6OH 4FP8H 4OZFA 3C8HA 3P9WB 1TCRB 5DFVC 3MLSL 1YEIH 5DS8B 3VMNA 2IGFL 4Y4HD 3VXRD 4P2RB 1JZ4A 3HE7C 3RP1A 4GRWH 3CFCH 1NGQL 5KSUA 2AGJH 2IH3A 3CVIL 3NCJL 1OM3H 5GS1B 1N6VA 4UDTB 3QCUL 1PG7L 1ZE3C 3JTSA 1EEYB 3G6AA 1A6TA 5E1AA 5K9JH 1P2CB 4XCNA 4POZD 5GGTA 3O45A 3QT2A 1HEZB 3JWOC 4HJJL 4JY6A 4AIZB 3IFNH 4Z7OE 2BVQA 4JZOB 2NY0C 2GK0A 4IDJL 5D2NA 1UXWB 5ITFA 2PXYB 3CLFH 3ARXA 2Y5EA 4W6XB 4U1KA 1TMCB 5D7KD 4PJXB 1ROWA 1JZ8A 4NKDA 4UQ2A 2Z8SA 2XN9B 2ZUQC 4PUBL 3G04B 4NZRL 5JZ7C 5DUML 4MA7H 2XXMB 4QRPA 4UNVA 2W9EH 1P9MC 4N0CD 4EQ2A 5JUEL 4NBYB 1JRHL 3MROA 3TVMD 4JRXA 5JW3L 1YN7B 3VD5A 4HUWA 2BHUA 3BZFB 3CU1A 2MQ3A 3VG0H 4RMRA 1JGDB 4MD0B 3VFWB 1U8KA 5SX5H 2APXA 5A16A 2GY5A 3E6HB 4HHAA 4ZOEA 4LSQH 2QSCL 5DJ8A 2P5ED 5F70A 12E8L 2PETA 3MRGA 4XNUL 1AR1C 1S7TB 1HHIA 1K5NB 1CTOA 2F53D 3C5SB 1FZOB 3BDYH 4R8WH 4QXTA 2JK5B 5ADPH 3OGCB 3HMXH 2OSLA 4DEPC 4C4KT 1O7VA 4PV9B 4JDTH 2V2WA 2DQUH 1T89C 4KQ4H 5ADOL 3EKCA 5C07D 1RUKH 5IVXF 3CLEL 2BJMH 4OCWH 3S36H 4JM2D 2ZG1A 1JPST 1G7HA 1RUML 5I19H 4GRLC 1MCFA 4OCYH 1XF1A 3TCLA 5MEND 1FZKA 5FDWA 1ZHBB 4JFDB 1RIHH 2W65B 4W4OC 1T03L 3Q48A 5GSRB 2NY1D 2DBLH 2VE6B 3MLYH 1FZMB 3QNYB 2B5IC 3OAUL 3BIKB 3RTQA 4P2RA 4JG0L 1JWMA 3MUGB 1RIUL 2F5BH 1FFOB 1MRDL 5ILTL 3KPRE 2VLKB 5EU3A 3FO1B 3UPRB 3H9HA 2FRGP 1OGAD 3MLRL 3CZJA 4UNTA 2BNRA 3TP4A 4F7EA 4Q9RH 3WIIL 3MV9A 1YEDB 1K9TA 4PLKD 1QPXA 2PW1A 1AI1H 4M7LT 4JPKL 1EHAA 4XVSH 5DJ6A 3GSUB 4YQXH 2YR3A 5JW4Q 4CMHC 4HX1B 3L3KB 2FJGA 5CUSH 4F2MB 2FZ3B 3E3QC 3X14B 3BO8B 1ZKAA 2E27H 1ZT1A 4OUOA 4G8GB 4P9ML 1IKNA 2QBWA 3IFPA 3DGGB 1W72L 2HKFL 3D85A 3GBNH 3OKEB 2V2TB 3RQ3A 2PO6B 4J23A 5D1XA 1K8DA 1KIPA 5I1AB 4LASL 2GAZA 2CIIB 1C7SA 1ZLUK 4BFIA 1FJ1B 3JV4B 5JLZB 2ARJQ 4XHJD 5DRWA 2A6DA 1P84K 2RCSH 2IAMB 4HFWB 5IB5A 2APVA 5EG6C 2VN4A 5DURB 2DLTA 4FQ2L 5T1DL 3S35L 4E0RA 4PP2A 3KPSE 5EBMB 4I3SH 4KI1A 3BZFA 4L29A 4NUJB 1WSST 4DFHA 5JR1H 3C09C 1WTLA 3HTLX 3MRHA 4OGAC 3KYKH 3RHWK 3QUYA 1AD0A 2ENYA 5F6HJ 1WWBX 5EU5B 3G9VA 3QNZB 5E2UL 5I6XB 3BSZH 2JB6B 4NCDA 4TSBH 2EDHA 1IC7H 4P5MA 3CD4A 1LEGB 2FSEB 4XBPA 4S0SD 4FQXB 1CDCA 1VHPA 1NQBA 3OGCA 4KDTC 5FYJD 1QRKA 4Q7DA 3E8UH 2YUZA 1BQHB 4NYLB 3S96B 2ATPB 2J1KA 3PP4L 1M6OB 2AEQH 5KZCB 4LKCB 3FQNA 2AVGA 2IBZY 1G7PB 2WQ8A 4G6JL 5BMFL 1EZVX 1AHWC 1DANU 1OLLA 2P8MB 3BRFA 4F3FA 1FZMA 2X40A 3BAEL 1MREH 4Z8FL 2UZIH 5FO8B 4J8RA 4P2QB 5T3ZD 1FFOA 1UWEL 3PABA 3TFKD 4P2OB 4U6XA 4HGKC 2QHRH 1LEKA 3V6ZB 4TTDD 3NFSL 3L5IA 1D9KA 5DT1H 4D9LL 4JKPL 5JW4M 1G7QB 1OP3K 1RUQL 3I75A 5GISH 1VADA 3ILQC 4MA8H 1DQQA 2PYFA 3CFJB 4L9LC 5C0CD 1ZVSB 4P2YA 4HK3N 2CLRB 2NW3B 4XBEH 4NBZB 4HX1A 1BJ1H 1FCCA 1GAFH 3P3YA 4FFYL 5DHXB 5EFIB 1LWRA 3DYMA 3T0EA 2APFA 3MRLB 4WV1A 1FNSH 1WZKA 1RHFA 3C87A 4LEXL 2QADC 5I1KH 4KJPD 1NAMB 4M1DH 1SEQH 4ERSH 1MCWM 3WJJC 3C6LB 5LJYH 3HFMH 1JHKL 5IOPA 1YN6A 4YHKL 3HI5H 2AJVL 4P3DB 4GG6A 2BY1A 3P0VH 5CBEB 4Z6AT 5C0FB 4Y5XB 4RBPK 4MJID 1V5JA 4YDIL 2YD4A 5AWNL 4BZ2L 1KENL 3WDHA 1LDSA 3Q5TA 3MYZA 4WU7A 3CXHJ 4XBGB 5DD5L 5DK0B 3SQOH 1HHJB 3CPLA 2HLAA 4DFIA 5JW5A 4AL8L 5D6DA 3QQ9C 3T2NL 3FB6B 3QNZA 4BSVB 1XF4A 4PJGF 3EW3B 3OZ9H 4PBWD 1KNOB 3ARGA 4JFFB 3EDKA 5T5NF 2YXFA 4MJ5A 4WTWA 3AREC 3DV6B 3H3BC 5DJAA 1I8IB 1WVZA 5C0GA 5J11B 3TN0D 3DX9A 2NR6C 4NWUL 2Z0BA 3AROA 4MXWH 1M6OA 4U33A 5E8OA 5LCVH 4MB5A 4Q0XL 5I76B 4HH9B 5E00A 2VLJE 4LQ1A 4G8FB 4I8DA 4AEEA 4JVUA 4NQEB 4KV5E 4PP1C 3V0VB 1MOEA 1F4YH 1HQ4A 1IGMH 3QULB 1TQCB 3QXDA 4OF7A 4R26L 2P8MA 5CEZH 2W91A 2J2ZA 3GB7A 3ULVD 2EXWC 3MTRA 3T08A 3MRRB 3U0PA 3STBA 3K1DA 2EIDA 5IKCB 4HJ0D 1FE8L 5CWSA 3WLBB 1X5KA 1ZSDB 5T3XL 3TF7C 4QCIA 2Y1VA 4LHUD 1FO0L 4TQEH 2O5YH 4AH2B 3F58H 3SN6N 3ZYJA 5CJ5A 4KFZC 3CSPA 5CJQL 1ZVSA 1F3JA 4LAJH 4PJXF 1C7TA 3MREB 4YAQB 2NY3C 5EBGA 2JF1A 1QSZA 2IH1B 3S7GA 4EKXA 2F74A 4J6RL 3P4MA 5I8KH 1PDKA 1WF5A 2VDRH 5DRXA 1S78C 2VXUH 5C0EB 2BVYA 2D9QB 4XP1H 3GMLB 5E56A 1NAMA 3SE3C 4N0FB 5JHDD 5K9KB 5HBBA 4Y4HB 3VXRB 4D0DB 4TUKH 1SJXA 1AGEB 4ESKA 4RFEA 3MRPB 1QA9A 1BIIA 1NANH 3MC0A 1KTDA 5E8DL 3NBNA 1REIA 2JELL 3B9EA 4OZGE 3IDXL 3QA3B 1UQSB 3GEWB 5I18H 3LQZA 4OLVH 3LQAL 3FAXA 4MNQD 2CIKA 2PCPA 1R3LA 3PGFH 2X4TA 1Z6JT 5FYLD 5FAAA 3OKOB 1S7XA 2XY2A 1S5IL 3QPXH 2DLFL 3FQWB 3TIEA 2IPUG 1KCUH 4LLMA 1TZGH 3BGMB 1WZMA 1R3JB 3THMH 5ENWA 3ARDA 3IGAA 4W70A 4HS8L 5IJKC 1NUFA 1CI5A 3QWOB 1F4HA 5FCUL 3QISA 2B4CC 2GTZB 1RMFH 2CKBB 2FEDD 3AU1B 1UM4L 2ZPKL 4MSWA 2HFFA 3MOBL 5I75B 4PG2C 3KPOB 1N59B 4KK8C 3UJIL 4DZBB 3FZUC 4IMLA 3SPVB 5DUBA 2VDOL 4C58B 3CUPA 4MD5B 3MQIA 1EGJL 1JPTL 1HHGA 4F58L 4KRLB 3MX0A 3TVMB 1ERNA 2BY2A 3QULA 1NC2A 2WW8A 4L1DA 1E4KC 2VLRB 4ELME 4LU5L 5AYUL 2EDOA 4JREB 4DKDC 1BX2B 2X42A 4WRLA 4XAWH 2P5EB 1C5BH 4OGXH 4UBDC 1GGBL 2GT9B 3KPRA 1ZHNA 1K3ZA 3GSNA 4FA8A 4LKXB 1MWAB 2F53B 4RQQB 1RJLA 5C09D 4JO4H 3CH8A 4Y16B 1LQSR 4GBXD 4OLUL 4X8XA 1F13A 2EEBA 2L0DA 5F44A 1KYOK 1HSBB 2BOCA 5IROA 1DSFL 1T1XA 1NKOA 5LAXB 4TOYH 3NFNA 4RGMC 4IOFD 4GG6F 2VOTA 4Q2ZA 3L5HA 4P99A 4MD4A 3V4UH 3L3IB 3RUGB 3L7EB 4RMVA 4MA1B 3MYJA 1FN4B 3QEQE 4PJ7B 5C0ND 3FTGB 4QRRD 4NRXA 5MEQB 3MV7D 1QTYT 3HB3D 5HTSA 3TO4D 4EN3A 1V3MA 4JGUA 3RVVD 2R0WL 4M6NL 3R06B 4NQDE 1OGAB 3QA3A 1V7NH 3KPSA 4X9GA 2X4OA 3MR9A 4RNRA 3LPWA 4Y1AD 5TF0A 2ZCHL 3QCVH 3WXVH 1NLBL 1OAKH 2JIXD 4MXQC 3MJ7B 4S1DC 3FQWA 1JI2A 3BZDA 1YMHA 3GSRA 4OB5H 1NGXB 4H0GA 3OBAA 4YPGB 5C0AE 1YDPA 5I17B 1FGVH 2OI9B 5HY9B 5I1GH 4I0CC 2AQ2A 1JHTB 4XP