1ZIAA

Oxidized pseudoazurin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Crystallization and preliminary X-ray studies on pseudoazurin from Achromobacter cycloclastes IAM1013.
pubmed rcsb
molecule tags Electron transport
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1996-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ziaA00
2FT7A 4WTQA 1ET8A 4GP4B 4HHGA 1ZDSA 1E5YA 1RCYA 1JZJA 3T6VA 2MRYA 3UACA 4CSZA 4FA7B 1IBYA 5I6NA 4QLWA 4ENZA 3PAVA 1FA4A 1UATA 1XB8A 1GY2A 3EHBB 3FSWA 1KCBA 2JKWA 1FFTB 5I5MA 1BEXA 1PNDA 1SJMA 7PCYA 3GDCA 4HCIA 4BK5C 1A3ZA 4JHVA 1AS6A 2BO0A 1J9RA 4A2FA 2Y69B 4YSRA 4AKOA 1A8ZA 1EZLA 3ZBMA 3PLYA 4YSSA 2BZCA 3S8FB 1WA0X 2GIMA 3V9EA 4YSPA 5IY5B 1OF0A 1NINA 3UAEA 9PCYA 1R1CA 1AAJA 3CG8A 3ASNB 4KNTA 3QJQB 3X1BA 2EIKB 5PAZA 1BAWA 1WA2X 3NJMA 4DPAX 3DKHA 1PAZA 5F7BA 1ZDQA 4GP8B 2AFNA 1L9RA 1SF3A 2YAHA 3X2QB 1JZEA 2BWIA 3PCYA 4PCYA 5AFAA 2CUAA 2MTAA 4A2GA 4E9QA 2H47C 1SNRA 4DP4X 3NSCA 3IN0A 5B1JA 1PLBA 2AZUA 3AG3B 4A2HA 5TK4A 1NPNA 2EILB 2FNWA 3GXUB 3X1EA 4HHWA 2ZXWB 1GS8A 4BWUA 3FYIB 3TASA 1PZCA 3NSDA 1PCSA 1AZUA 3FYEB 2UX7A 2UXVA 2QPDB 1MDAA 1OE1A 3HEIB 1GS7A 1N68A 1OV8A 2GC7C 3KW7A 2X87A 3QQXA 1SDDB 4DP6X 3S3CB 2CAKA 1ILSA 1QNIA 3AG2B 1JXGA 2BWDA 3ZIYA 4KOCA 1MG3C 4F2EA 3AG4B 1WS8A 4YL4A 3X1FA 4KNUA 2QDWA 1BYPA 2IDQA 2JXMA 4E9WA 5LDUA 1PLAA 2HX8A 4GYBA 3IBOA 1J5DA 2PPAA 3FQYA 2YAMA 3X1NA 2I7SA 3FSZA 2YQBA 6PCYA 1AZBA 4X4KA 4AKQA 2H5UA 4HCFA 4P5RA 6PAZA 1ET5A 2PCFA 1SFHA 1GY1A 2UXFA 3WIAA 2EIJB 2AVFA 3QPKA 3CDZB 4DP8X 1J9QA 4YSOA 1WA1X 3H4FA 2CCWA 1NPJA 2W8CA 1SHXA 3FU7B 3MX0B 4E9TA 1AG6A 2IAAC 2H3XC 4E9VA 2EIMB 3RYMA 1AR1B 1HAWA 3MBWB 2YXWA 3T71A 2P80D 4BWTA 1KGYE 1JZIA 3T6XA 2PPCA 1AQ8A 2GI0A 3PPSA 2FJSA 4DP5X 5I26A 4HZ1A 4DP2X 1MZZA 1CYWA 1XB6A 3NJFA 3S3DB 1V10A 3SBRA 3ABGA 3UGEA 5B3SB 3EH4B 3OQRA 2IDSA 2HXAA 2VM3A 1VLXA 3EH3B 1DYZA 1FWXA 4NERA 3HB3B 4YSTA 4YSUA 1NIBA 2ZOOA 4G7SB 3WKPA 1PZAA 1AS7A 2IWFA 1AZNA 2GHZA 3X1GA 1PMYA 3FU8A 2I85A 2YXVA 2A3TA 4A2EA 3NP4A 4BXSV 3WG7B 1W6WA 2GC4C 3FSAA 5PCYA 4Q8BA 3CVBA 1ZPUA 4PAZA 4W9ZA 1BXAA 1ILUA 2BW4A 2OV0A 2VMJA 3L45A 3FPXA 4HIPA 3SQRA 3SBPA 2HRGA 2XU9A 1NZRA 1YLBB 1OE3A 1PF3A 2DWTA 3FSVA 5I6PA 4AZUA 4DP9X 3QJRB 1BXUA 3GYRA 1PNCA 2B3IA 1GSKA 2PPDA 4MFHA 5E9NA 1XMEB 2ZWNA 1V55B 4G71B 4P5SA 3SBQA 1JZHA 2HLEB 2XLLA 2ZONA 4KO7A 1JOIA 1L9PA 1PY0A 2HZHA 4KO6A 1JXDA 1E30A 2BHFA 1NTDA 1WAEA 1GR7A 2IDFA 2J56A 4HAKA 1E5ZA 3IN2A 3N55A 2YAPA 2HRHA 4FAAB 2IWEA 3PXLA 2HX9A 2XWZA 2GSMB 3WI9A 2WSDA 1CUOA 4G7RB 1M56B 2BP8B 2XUWA 3TBCA 4K9JA 1QHQA 1NWOA 4N8UA 1AS8A 5I28A 1T5KA 2RACA 4CSPA 4BDVB 5AZUA 3UADA 3WNIA 1ASOA 4UANA 1AZCA 1MG2C 3ABKB 1DZ0A 2CBPA 3FQ2A 5B1JC 1ET7A 3BVDB 3H4HA 5B1KA 2LLNA 3NSFA 1OCZB 2R7EB 3NP3A 4YVNA 1WS7A 4GP5B 1ZV2A 2XVBA 4TXVB 1GYCA 5EHFA 8PAZA 2Q9OA 2YAEA 3NJNA 4BXVA 4BWWA 2QDVA 1TEFA 1GS6X 3OD3A 3S8GB 2DYRB 3CDZA 2FQFA 4KNSA 4GXFA 1ETJA 1JVOA 2PLTA 3FU7A 1F56A 4RH4A 3ABLB 3NJKA 1KBWA 2XV2A 1B3IA 2FWLB 3QJVB 1RKRA 4YSQA 2X88A 1M9WA 1KV7A 3ABMB 2OJ1A 1IUZA 2CJ3A 3AW5A 3ASOB 1CURA 5D4IA 3G5WA 4UAHA 2FT8A 1J9SA 1OCRB 1HAUA 1NIEA 2IH9A 2JFCA 3IEAA 1SHWA 2YARA 5B1AB 5I5JA 1ID2A 2DV6A 2PP9A 3PAUA 5A7EA 1BXVA 2PPFA 2XV3A 1PZBA 2FQGA 3QJSB 2FTAA 2J5WA 1ASQA 1AIZA 2DY2A 4AKPA 2BP0B 4E9SA 1ASPA 4UF7C 5AKRA 1XB3A 2Y1AA 1EHKB 1URIA 2FQEA 2VSMB 1W6LA 3AG1B 2IH8A 3T9WA 4AI7A 2IDUA 4DPBX 3C75A 4W1TA 1GW0A 3UAAA 2DWSA 2DYSB 1CC3A 1ZIAA 4DPCX 5D4JA 1OCOB 3NJGA 4DP1X 2FQDA 3FPYA 1X9UA 1QLEB 1KCWA 3QJUB 4G70B 3QJTB 3CZUB 3FT0A 1TKWA 1NIAA 3OMIB 2PCYA 5I5IA 2CALA 2I7OA 2N0MA 2UXTA 2EINB 1A4BA 4YSEA 5I6LA 1HFUA 1M57B 1AOZA 2QPEB 1L9TA 4DP7X 2TSBA 4GY4A 1JXFA 2XXGA 5B1BB 3S3BB 4KOBA 3N2JA 1E65A 4YSCA 1OOWA 2HX7A 2BZ7A 3BQVA 3NJHA 4F7KA 3TA4D 1BQKA 3V9CA 3H56A 3ERXA 3T6WA 3T6ZA 2PPEA 4ZK8A 1NDTA 3FS9A 1IBZA 2J57A 4E9YA 3DIVA 1RZQA 2GB2A 3CVDA 1A4AA 3NYKA 3DTUB 5D4HA 2VW4A 2YAOA 2XYBA 2Q5BA 1BYOA 2YAFA 2BP8A 1V54B 3ZDWA 4JKNA 1X9RA 1ZIBA 4EF3A 1SDDA 4BDVA 1BQ5A 1E67A 1SFDA 1JZFA 5I6MA 1J5CA 1N70A 4M4RB 4G7QB 2TSAA 5TK2A 2GBAA 3NJIA 3PAZA 3IE9A 2P80A 1AANA 1BQRA 2R7EA 1SF5A 2OCCB 4KO5A 1W8EA 3U25A 1NIFA 2VW6A 3FU9A 5B7FA 4E9RA 4A67A 1OCCB 3EF4A 4A2DA 1OE2A 2IDTA 5ANHA 3AY2A 5F7AA 3AZUA 1NIDA 2UXGA 4YVUA 4Q89A 1JVLA 3UABA 3NJJA 3NJLA 3JTBA 3CVCA 1L9SA 2NRDA 4YSDA 1NICA 3OMNB 4N4YB 1MZYA 4E9XA 2E86A 2XV0A 1JERA 5I6OA 4YSAA 1AG0A 3OM3B 4KO9A 2VSKB 4NAJA 4NB7A 1IC0A 1AACA 1NWPA 3NT0A 4G72B 2BW5A 1KBVA 2B08A 2VM4A 5B7EA 4WKXA 3OMAB 2WO2B 2AZAA 5I6KA 1KDIA 2FT6A 4AX3A 2PP8A 4DP0X 2BP0A 1L9QA 3TBBA 1AZRA 2UX6A 4A68A 4F2FA 2J55A 4QKTA 1ADWA 3FQ1A 1A4CA 2XXFA 2XX0A 3WKQA 4A66A 1I53A 1JZGA 3WNJA 1J9TA 5FC9A 2AANA 2YAQA 4HALA 1L9OA 3NSYA 5B7MA 4HCGA 4JHUA 1TU2A 1RZPA 2WO3B 1IKOP 7PAZA 1KDJA 4M3HA 2VW7A 1KYAA 2VN3A 3EH5B 3D12B 3TU6A 3KW8A 2W88A 1TEGA 2IWKA 2PP7A 1PLCA 3ZX1A 3JT2A 1CYXA 4L0PB 1A65A 2XX1A 2QT6A
chains in the Genus database with same CATH superfamily
4PN6A 3L1EA 1NA8A 4BQCA 1QLEL 3T6VA 5DHYB 3WE6A 1K8DB 4WEMB 4CSZA 5EDSA 3QGVA 3BAEL 3ESNA 2AQ1A 1FG2B 1PVHA 4JCWA 3ZR6A 1CBJA 4KJYB 5H94B 1HEHC 3BVVA 4O5LH 3BUYB 4OTXH 3MV8E 3S8WA 2KLTA 3QUHA 4GH7B 5F89B 5JHMA 2BNUB 4U1LB 2UVEA 3VXME 1MFUA 1GZQA 4C59B 2ZSWA 3KYNA 1DVUA 1I7UA 3U1PA 4HOMA 1WO2A 3FOLA 1DN0B 4MAYD 3RWIA 2W60A 3JWDH 2UWEE 3LEXA 4NQDE 4XNUH 5IQLA 4UUJB 1T22B 4XRCB 1EEZB 3HC0B 2R1XB 2DI7A 3FTVA 3KWXA 1MIEL 1BVOA 4ZQKB 1PQZB 3L95A 5TFSH 2A77H 1WJ3A 4GP8B 4GO9A 2DMGA 4HFWA 4GQPH 4L05A 3RFZA 3CSBA 3UYRH 3RWCA 5EWIL 1RJYA 4LOVA 2QELA 3Q6FB 2ZF8A 2MTAA 3PWPE 5T1MA 2JE8A 4EDWL 3D9AH 1DSWA 4KI5C 4UYPA 3SDCA 2A4CA 2IWGA 3X11B 3OKDA 4U6VH 4IRSB 3VXOA 1IB5A 3IDGB 2WQUA 4K71B 2IH3B 3LB6C 1F3JB 2F53B 2KH2B 3OB0K 1ACYL 3JV0A 3WAKA 3NZ8B 1RUKH 1Z9OA 3VMPA 4WWPA 1PZCA 2QKIA 1PZUB 1QO3B 3L5WA 2RD0A 1NL0H 5KG9A 2VDKL 5T3XL 3UYRL 4FHKA 1HESA 5D5MF 4BCZA 2JJWA 2W0FB 1J1OL 2JH2A 4YS4A 3AWFA 3U9PH 1XR8B 3B5HA 3PGCA 1U8NB 5C0GB 3ML9A 3PNRB 3D4GA 4NQEA 3I3EA 5INDA 4QI3A 1DVSA 4KHTL 1L7IL 5CJOH 3LPFA 3AU0A 3FU6A 4ZTOL 2OYMA 4GRMB 4N2AA 4IRSD 2YPKA 3RDTC 3ZIYA 3DV4B 2PETA 3G6JE 1AGDB 4OFYA 5AVXB 3BXNA 3HMXA 4MB3A 4PJ8B 2ZUXA 3EDFA 4NNPL 2F53D 2Y1ZA 4YL4A 1FV1B 3CZEA 4FZ8H 3V5DB 5LDUA 1NGZB 3IMVA 12E8L 2HX8A 3TNMA 1IJNA 2ZNWA 4NIKB 2W95A 2BCKA 5TGBB 1J5DA 3BPCA 1BGXL 5AYQA 1N9PA 1SN5A 3CFDA 4HIIA 3L1OL 5J3HD 2N7AA 3QUML 3FUMA 4XMXA 4XMWA 4K07A 5JHBA 4YFLI 3UCQA 3WIAA 1NBCA 2NY4C 5KTEL 2Y5QA 4U1MB 2Y7OA 5ABZA 3TLRA 2ED7A 1E6JH 3FDWA 3H4FA 2CCWA 4ZUUB 2ZPKH 4HUWB 5I75B 4ANUA 1JGEA 1RY7B 3EFFA 1R75A 2AJSH 2NUPB 3QH3B 3TONA 4A39A 4ZFGL 4HWBL 3ZSSA 1EQWA 2ZJSL 4OCYH 5B8CC 4PJ8D 3ZT7A 1XAUA 2FBOJ 3L6FA 4I5BB 3QDJB 3E6FA 1BFOA 3WY3A 2GI0A 3U0WL 4L3CB 4X6CB 2X4UB 2YD0A 3AMLA 3OAUL 3ULAB 4EUPB 2CO3A 1D7FA 4LESA 5E5MA 4QUOA 3A5VA 2B8OT 3QPXH 5E8OA 3V55A 1J10A 4MD0A 4U7MA 1DYZA 1VFBB 3MV9A 3P40A 2XACC 1HH9A 4TM9A 3QXAB 4LU5H 3SGJA 3PJLA 4JDEA 2GHZA 1HSAA 5DHVB 3UZVA 2YPVA 3IF1A 3MUHL 2IQ9H 1M7DA 4NXSA 4RVBA 3VDAA 1G9ML 2HTKC 1E8WA 4JO2L 3OKMA 5E1GA 3QDJD 2A4ZA 5E8EB 1IQWH 1CLCA 5AYUL 4I1NB 3AU1B 5IB5B 4EQ2A 5FO8A 4AEHL 2BW4A 3IKCB 3X3GL 3IFPA 3APMA 1QLFB 2M26A 2HRGA 3P77A 2G0KA 3L3GB 3SBPA 4IBUA 5SWZE 1ZGLM 3HZYA 1UM5L 5ISZE 2DWTA 4LP8A 1QUPA 4P2QB 5D4QA 1GSKA 3H0TA 5IJDC 3GIZH 3D05A 4PV8A 2Y23A 4X0KB 1V55B 1EAJA 5D7IA 1AXSA 1WWCA 3MOAH 3U6XS 2UZXA 3EJZC 3FU5A 4U3SA 5DS1A 4A2MA 5HPMA 5IVXA 5KAQF 5A2BA 3STZA 4MSWA 4WIQA 2W80C 1F5WA 1OF2A 3CFEA 2F6AA 3E9TA 3LKOA 5FKPA 4Z7NB 4N5EC 2BHFA 3IWUA 1FHNA 1OD9A 3FH5A 4I3SL 4WFFD 3V7AG 1LO0H 3DOHA 5FA3B 2OJZH 1J8KA 2IQAB 1IE5A 5IREA 5AVSB 4ZW8A 4OBSA 1FL3B 2HRHA 4LVNC 5EOTA 5HHNA 5KJ4A 4Z3TA 3BO8B 5IBUG 1SOXA 3WIIH 2JCWA 4JKPH 5I0YA 4TSCH 2ICWI 2ZKHH 3B56A 4YR6A 1M56B 2X10A 3A24A 3MGTA 4JN1H 1HQRA 3C8DA 4OUUB 4P2QD 1QHQA 2PF6A 4ZUSA 1DHKA 1UVQB 2FEEL 4IMLA 3VI3E 3EYUL 3D3VB 4PJCE 1ASOA 4BFIA 2Y5TB 2VLMD 2CO2A 3KYMA 2CBPA 4J4PD 3UJIH 5IB3B 4P49A 4Y5XB 3IFLL 3DIFA 5J1AB 1UJ3B 1ZVNA 1IZJA 4XPGH 3NCEB 4JHZA 2K6WA 3WIIL 2KERA 4OLWH 2VDRH 4BWWA 2E75C 2FX8L 1XGTB 4I9WE 2Z4QB 3OKEB 3ESVF 3X3FL 5HGHB 3QDGA 4HIXL 3IJHB 3QARA 4UT9L 1A3RH 2DQHH 1N3NB 1NCCH 3NJKA 1FN4B 2YFOA 3SOBH 2EAEA 3VXTA 1RKRA 4NQUA 4OW6A 3D3VD 3T4AC 2DJ4A 2EEAA 3HE6C 4Z7WB 2OJ1A 1OPGH 4CMHC 1K4DB 2XTJC 4YMPA 5EH1A 5KBLA 5DMIL 1O7SA 1N59A 5DJ0B 2WVSA 2ZKXA 1EDQA 2C26A 3MLUL 3IAPA 1LE9B 5FUOH 3HAEB 3T3PB 4NKDA 4S1DC 2BFGA 1D5RA 1DO6A 4IIQA 4JE4B 5IKCA 2E9WA 4U1SB 2B7DT 2WIIB 4ELKB 5T5FH 3B2UC 4E9SA 4J3OF 2YSSB 3FW6A 4L18A 3GM0A 2HVKB 3LX9A 3QQ3A 3SGKA 1OPGL 5FYKD 1W6LA 5FYJD 1F1DA 1ML0A 3ES6A 3DURA 3FZUD 3RU8L 2ZOKA 1BM7A 1BVKA 4S2SA 4UTAA 4BZ2H 4ZX6A 3BAXA 1LE5A 3K5RA 5C2BL 3H6JA 2XN1A 3G5VA 1TTUA 1THCA 3L2NA 2ADFH 4MMXB 1SBSL 5E2WL 3PDDA 3DVNB 3UTTA 3ZUNC 5AD0B 3WU1A 1RK1A 2QQNL 2OMNA 4HGKC 2OULB 4M56A 1TZOA 3QUZC 5K59F 2MOQA 3JVGA 2PW1B 3CHOA 2J1XA 2AJ3B 3OKLA 2VLLB 4EI0A 1JZ7A 1UA3A 2UY6A 5A2KH 3RLSA 1TSRA 3K2MC 4PRNA 4C83B 4Y8AA 2H6PA 1HL5A 2FEJA 2RIKA 2I9LA 5JR1H 4DGUA 3LN5B 3WUZA 1E65A 3H9SE 4FL4B 2A1WL 3ESPA 5AVQB 5T33H 2BY3A 3HCVB 4ORGA 1IGTB 1AMYA 2LAAA 3REWA 1HS6A 4ODXA 1BREA 3CHXA 5TE6L 1OVZA 1H15B 1DJWA 2WBJB 3K6DA 5HDQH 1EGJL 1HQ4A 3NA4A 4ZK8A 1KIUA 3FS9A 4PJAF 1MFDL 1IBZA 2J57A 5DMJB 3NAAH 2WP3T 4WU5A 1RZQA 2GB2A 2WV3A 4K23H 4B41A 1BCIA 1Z9PA 3B3BA 4OB5L 5EEXA 2ZCLH 3KJ4B 4HUXA 5MP6H 1GL4B 5C8JA 1E2WA 4LSVL 2FO4A 3VTTA 5D5ME 3U4KA 1WBXA 2YPLE 1YYCA 3AXIA 3BDYH 2FLMA 1S7VB 1NCOA 4DN3H 5DJ2B 3GHBH 5FFLA 2ZYSA 1J1XL 2R1YA 1H5BB 3F58L 2ITFA 1E4KC 4DKEH 4TUOB 1JZ8A 1B2WH 3MNVA 1P6WA 2Q1EA 4IEFA 2WBJD 4NKQB 1A7OL 2QQLH 2E0PA 3WKML 4GEJA 1EERB 5A7BA 4PYGA 5FYLD 3L3HA 4JFZL 4NI6A 3SPHA 3DBXA 1A6WL 5I0WA 5DZAA 1N5YL 4X9GA 1IBGH 4NN7C 1PDKA 5FO7A 4NWTH 2L4OA 3HIZA 4ZUWB 2ZSVB 5IG7A 3DX4A 4Y16B 4UQCA 1ZA6A 2UXGA 3ZGIA 4DN3L 5KJRL 5CUSH 3QFGA 5DTFB 3U1QA 3MNZA 4EUPG 4D9LL 5L0QB 5CEXB 1A66A 4XX1E 4HJUA 4TVPE 1L0YA 3LNDA 4FXLA 4OCXH 2QADB 4RX4A 3VFSB 5ESAB 4JVUA 1JERA 4ZMYA 2P24A 1IBBA 4KTDH 3SE3C 1NANI 2NW2B 2VSKB 2B1HH 3TIEB 1XXDC 1AO7B 2YBRA 3O2VH 4A37A 2E7MA 1IBGL 1RH8A 3NABH 3BGAA 3ZQWA 2ENJA 2G3ZA 1G84A 3MDJA 4YAQA 5I6KA 1KPVA 2EDKA 4AVIA 1WE5A 2X70B 1T1XB 4DP0X 4L29B 4PS4H 4BE6A 3GK8H 4LHUB 5E4EC 2OAAA 4XNQA 4U3XA 3WAJA 3NEEA 4ZW7A 3A47A 3BIKA 4Y16D 4UBDD 4EZMA 2XXFA 1CGSL 4PLOB 3VFNA 2Z8RA 4FGMA 4E41A 3Q3GB 4DW2L 4HALA 3RGVB 3NSYA 1NBZA 3VWKB 5FUCE 4PS7A 1RZPA 2F5BH 2QADD 5B3NA 2VDQL 1CXFA 1DQIA 3LRLA 2WWMD 3O45B 1BFVH 2LU5A 3HZMA 3NABL 1JN6B 3DV6A 2D4FA 4D8PB 3VSQA 1AO7D 4YFEA 2Y7QA 3PL6C 2F1BA 2Z9TA 1RSFA 4Y4FC 3BWAB 1QBAA 3VNYA 3UTQB 1G9EA 1SJVA 4PJIE 1IT9L 1XGPB 1HYSD 2CH8A 2NY3C 4Y9CA 3ZKNC 4LHUD 5EZLB 1T1YB 1XR9B 5DQDH 1IBYA 5I8CB 2Y07L 5LQBH 3EAKA 5CLXA 4R0LC 1D5ZA 1XB8A 1NCJA 2JKWA 3DHPA 3ECWA 1G7MA 3RGVD 2YUZA 4BK5C 3VWKD 5BNXD 4FFZA 4LOEA 1QYGH 4G6ML 1NMCB 1YYML 2BO0A 4JHAH 2GJ6E 1VGKA 1PG7L 2Y69B 3ARDA 3BN9D 4QRPE 3EFOA 1LWHA 2FYYB 4LAJH 5JIDA 3O6FC 1I1AC 3KPLA 1UT2A 4H25B 3E1F1 1N4XH 2JB6B 3RUGA 2CIKA 1A22B 2VLKA 5MEOA 2PXYC 5DQDL 4HLEA 1P5UC 2DQJH 4KHXL 1N0XH 4MXVF 1DQDL 4HZLA 3I6LE 3SYAA 3VFPA 4QJ4B 5IHZB 3S3SA 1PAZA 2HFTA 5HHPB 3SKOB 1QACA 2ZG3A 4RMQA 1KZYA 2WLLB 2WNXA 2ZD0A 1ETZA 2A2QT 4KK8D 4JY5L 4NN5C 5JZ7D 5B3JE 4OI7A 2VXVH 5C7XH 1TCRA 1WZ1H 4GLRH 3D08A 4R83A 4HISA 2A9NL 3FHQA 5IVOA 1IL1A 5JLZB 2A74B 5TK4A 4ATTA 1EMTH 1R3HA 3QFJA 4JO8A 4YBQD 1LP9F 4G9DA 5DFVD 4OKVA 2DQJL 1L5GB 3JWOH 4NN6C 3HI5H 3S36L 5LWYL 1BD2E 4MJ5B 2FLBT 5DHEA 1VFUA 2J8UA 1H3PH 3QIUA 3ZDZE 3EW3B 3CZSA 1HXYA 4NFCA 5HYIA 3E38A 3BP7A 3QIWA 5AYTA 1LO3H 2DWEB 4H7VA 4DAGH 2VXVL 3HAEG 2B16A 1EK3A 4JM2F 2CCLA 5D1QB 3LIZL 1QR1B 1IBHA 1TMQA 1FC1A 1M53A 3K2UH 5DD1L 2WINB 5A2IH 3HN5A 2R2EA 4OF0A 4QRSA 3S3CB 5GS0L 3TP4A 2DLGA 4M6ML 3BVWA 4UQBA 5DZLA 2GSIB 1JFQH 4HIQA 2NOYA 4XBGB 1LO2H 2IO5A 2YQ3A 1GC1C 4YHZL 4KNUA 2QDWA 4LQFH 3PFQA 4TRPL 5KYUA 3HG3A 4JPVH 1NDMA 4XNZC 1Z5LB 1CICC 3MODL 4L1LA 3T2OA 1X5JA 3KWWB 3QEQE 1CZ8L 2IBBA 4PD4K 2X2UA 3LVTA 3MLSH 4AY0A 3DMMB 2HPOA 2X3CA 3MI6A 1GYAA 1T04B 2HJLA 1FQ9C 2IGFH 4WW1A 5D1QD 1CE1H 1ET5A 2YEVB 3I74A 5GZNA 1UXWA 3F65A 4TNGA 1QSFB 1JNNL 3MLWH 4BKTC 5AW3B 2F15A 3UEZA 1CXEA 3GSVB 1P1VA 3EOYG 1ZVSB 2NX5A 4Y5YB 4R26L 5K9JH 1NEZA 3IDIA 4JG0H 4RMTA 3S5YA 4PWKA 5IEHB 4JS7A 3P02A 2EIMB 4OD1H 4MJ4A 3MBWB 5EDXA 1FAIH 1JTOA 4N22A 3V0JA 4F9LA 2HB0A 3BKCH 3N44F 1YNTA 2P9RA 4ZTEA 3WIFA 3KYKH 5EEVA 4DGYH 2GEQA 1WD9A 4GIOA 1ZSHA 1V7ML 3NJFA 1V10A 5FS5A 1LGVA 1TQSA 4X9IA 3DMMD 3SBRA 4YDZA 4W6YB 2NZ9D 1X5XA 4PJ7E 5I82A 1QSFD 2BLFA 4G6AD 2VABA 2L04A 2VXSH 3CH1A 2HFGH 4J8QA 4JFEE 4NDMA 2I07B 4IDLA 4JG0L 1Z1WA 4HXAH 4PCKA 1IGJB 2OQJA 2OX5A 1DBJH 3OAYK 5JTWA 2EYSB 5HYEA 1Y18B 1ZHBA 3FU8A 5DJ6B 1FUNA 2CGYA 4QXGH 1MELA 2B9BA 2DN7A 4URTB 5SX4H 4AIZA 5D2NA 2D7QA 4GW5A 3VFUA 1NPUA 1W2KT 4BZ2A 4MQXC 5EUKA 1DANU 1VFOA 2VXSL 1W0VA 3I50H 4Z76A 5E08L 3HI6H 2Y9RT 3LEVL 1PNCA 4YL9A 4DOHB 4G8AC 4MJIE 3HPLA 1YEGH 2IMNA 3UYPA 4C54A 4G82A 4P5SA 1G7PB 1I31A 5HBBA 2QGCA 2NTFA 2R0KH 1LNUA 3BCFA 4LCIH 2WMPA 4XP9L 3UAJC 5GZOA 3K6SB 4HSCX 2A6KB 4OLXL 1A0QH 1BZ7A 2CCVA 4KROC 2OS7A 1U8HA 4G8FB 2E8YA 2CHZA 3Q1SH 4HDIB 3B9KA 2ADJB 3LRKA 5TQ2H 4XO3A 2MPAH 4B9PA 1O9WA 1L3NA 3RB5A 2A9AA 4XHJC 1E6OH 4NKIH 3GS7A 2HKAA 4JE0A 3VFMB 4P06A 4G9FE 4IYKA 1K8IB 1YEGL 4CAGA 3G08A 2X4OA 1F45A 4LHUG 3QA3A 3L7EA 4A7GA 4JANB 1G9HA 1MCSA 4IKNA 4LCIL 5F9WB 4K94L 2VN7A 2OMWA 3KHOA 2WD0A 1AKJA 5TE4H 1FGNL 4MYPA 3WNKA 3ZO0A 4KI5D 5IGXL 1AZCA 1TTBA 2DWXA 3Q2LA 3V0HA 3WFDL 3GEFA 3RDTB 2VH5L 3LS4L 3OL2A 1UFUA 2CO7A 1I7TB 5GGSB 1J5HA 1IFGA 1KB9K 3LB6D 4LLQA 3B2DC 3NSFA 1GSMA 4EXKA 2X4NA 3N6YA 4KTEL 4RFEB 4ZRGA 2XXCB 3H7BA 2JB5H 1T0NB 2YAEA 2HCZX 1LO4H 4N3TA 5E2VH 5SV3A 1I3RB 4M7LL 3S5ZA 4RDBA 5J6GA 1MI5B 1RK0B 4P9HC 3VQLA 4CBPA 4KKLD 4R6UA 1H3UA 2NY4B 1B4LA 5EN2B 1NAKH 5FW8A 3T4YB 4EUPH 3C6SA 3NBNA 3QJVB 1HSBA 4MWFB 5H2BB 1TNMA 1ZLVK 3K0WA 3ZXAC 5IVNA 2HKFL 3EO9L 3WHE1 3Q0HA 4XH2B 4XN1A 4CU8A 3ASOB 3OKNA 4GSQA 1KJ2H 2FT8A 4ZUVB 3RDTD 4QNPF 1WEJH 4M00A 2Q76A 5B8CB 1LO4L 4F7CA 4HUUB 1XF3B 2DM2A 1NBVH 3M7FB 4W9IC 2H3NB 1RJLA 3OQ3B 4FZEH 5DHVH 1VGEL 2QVKA 3MRMA 5KS9A 1A6VH 2VITB 2QHRL 2ZXBA 3QJSB 4HD5A 2DH2A 1OT1A 4ZFZB 4DUXA 2NUTB 2HG5B 1NAKL 4YHML 2WKGA 3VXSB 3CLEL 1MI5D 1P4UA 1SLUA 4G42B 1ESOA 3HNSL 4HAFA 4I9XA 4IM8A 2Q86A 1QLRB 5DS8A 5E6YA 4UF7C 1H3WM 2NY4D 2CQVA 3T8VA 2BHUA 1GZPA 1MJUL 1E27B 3A3YB 3FU3A 1MCPH 3U2SB 1WC7B 1A1MB 3HUJA 3F7VB 5IW6A 5E1HB 5E8DL 3UAAA 5DYOA 2BSRB 1NBVL 4OIIH 1X4YA 4NP9A 1R5WB 1LWJA 1WQVT 3FPYA 4PJFF 1GIGL 3FCSA 3QJOA 4NCC1 2MCPL 3C87A 1UYWL 2BNRB 3BZFA 3GTVA 1JYNA 3MC0A 2R23B 1FFPA 1TKWA 5KYYA 1IVTA 1TEYA 2NY7L 1MFAH 3SE9L 5AW5B 1S5IL 4EIUA 4AV4A 3VXSD 3G5YB 3QUKA 1CB4A 1M57B 3ET9F 1NCNA 1IC1A 1NGPH 1JNLH 1BJ1H 2G3MA 5IQOA 5AVWB 4O4YH 3PGFL 4FQJL 1QZNA 2WY3B 3GZQA 4GBXA 3HPJA 1Z66A 2GUOA 4P23C 4WFHE 5D2LB 1AP2A 3OJMB 1Q1JL 1IKNA 5IR1B 5IFAL 2BSTB 3R4DA 3T6WA 4ZO8A 3QUYC 4IIZA 2HTKD 4XXWA 2JK5A 1A02N 3HG5A 3UEQA 3RGBA 1FYTB 1Q9WA 3MFFB 3CVDA 1A4AA 1NC2B 5IHHA 4L1DA 2BNRD 4P05A 4YNYA 4B9JA 4OLYH 1FJ1B 4O2EB 3Q06A 3CHSA 1JF1A 2ARJA 2YGQA 1NGPL 4N0UB 5BZWA 3TNNB 2XV6B 4X4YB 4LVNB 2WQVA 3EBHA 2Z31A 2HUHA 3NCYP 1SFDA 1XSJA 3QNYA 1Q9OA 5I0ZA 3HC4L 5GRVK 1VB9A 2C4XA 4OZFB 1J5CA 2EXWC 4LDOB 3M8OL 4G7QB 1Z9MA 4GKSA 4F3FA 3OTTA 3PAZA 4IOSA 5L2KA 4XE5B 3VUAA 4PGCB 5C0CE 3RHWK 2DMCA 1BVNT 1HIML 3EJZD 1R5VB 3OJDA 1MCLA 3U25A 1I8AA 5HDBF 1QTSA 5FYKH 1S7WA 4GUOA 4PJEF 4N5ED 5FYJH 5F1NA 1ACZA 1FYTD 2OSXA 1JGLL 1B9KA 1NC2D 3B2MA 4AGPA 1LP9B 4MX7B 3GWJA 3H54A 3V4VB 4LDLB 3BUTA 1DUZB 3OGCA 4CU6A 3SDXA 2EDYA 2OMYB 1A1OB 3ZU8A 5CJ5A 3PV6B 2WM0A 4NUJB 5JPMA 1LD9A 1JHKH 3NACL 3NCJH 3I75B 1FDLL 1IQDA 1JPGB 4NM4L 1Z5HA 5HGAB 3WS6A 4Y89A 3AQYA 2NRDA 1S6NA 2ZP9A 5DRWB 5EUOF 3WV0A 3K4DA 3QBTB 4AENA 4EN3A 2Z1KA 2ADGA 1YEIL 4AQEB 5GSVA 2EE3A 2DM3A 2C9AA 1YEJH 2O1AA 3T4AB 4Y2NA 2DYPA 4UI2A 3TWCL 1GCFA 4MJ6A 4CMHB 4ETQB 15C8H 3MRIB 4GG6F 1GRWA 5I16A 4P5KA 1I1FB 4FXGC 3HJ0A 3PU7A 4M43H 3OLIA 4PMEA 2P1YA 1JK8B 3MLVH 3OPUA 1S2EA 5LCVA 3WTVA 2PO6C 4IBTA 2JKTM 1NC4A 4EBQL 2R0WH 3O3AB 4UNVA 4D7PA 4ODHH 5J6SA 1JZGA 3NCCB 1RSYA 1WTLA 4HIHB 4KRPC 1NLDL 4ALAL 4BKLA 1GOFA 4R7NA 4NNYB 2B0SL 1AQKH 4RGOH 3AAZB 4FULA 1G9NC 4Z3GA 3FRPA 3WNMA 4H2CA 3MZTA 4WDIB 2DQTH 4M4PA 3BKJL 2QVFB 1S9VB 3TU6A 5I30L 3C5JB 3G6DL 4JDTH 4LKXA 5D9SA 3ZHDA 2EDRA 2V0AA 2ZXCA 4F7TB 4EMZA 1CLVA 4R4NC 5C86A 2XX1A 1CTMA 1ET8A 1MHHB 1N26A 1QD0A 3TBSB 4H88L 4S1DD 4KX9A 1NM9A 2MH4A 3MJ8B 1A6TA 4TSAL 1O6VA 2GJRA 4B5EA 5ID1B 2OYKA 3V0IA 1AQKL 2X09A 3O3BB 4JZOA 4JPIB 3B2UD 3QHTC 4QHMB 1CF1A 1J9RA 2XWTB 5I15L 1S7RB 4NO2A 5HYQA 1D5IL 2JIXA 4L9LA 2F1AA 4M6OH 4QTHB 1HINH 4FYTA 4YE4L 4DO5A 4UM8B 5D70L 3SYPA 3JTSB 3LKQA 3UTSB 2CK2A 5I17B 1AGEA 1WBYA 1WFTA 3ASNB 4LPXA 4OVUA 5IP4A 3ZMEA 5FYLL 1SHSA 3PWJB 1HL8A 3P2BA 2IAMA 4NRZA 1QZ1A 3MACL 4XP1H 1FG9C 4X2UA 4CADB 3PCYA 1R3JA 2WXJA 3HKZA 3T2NH 1TYRA 4G8IA 1MVUB 1SDYA 4IRJC 4LLUB 4PWEA 1U3HC 1IV8A 5ILTH 1G1OA 3NSCA 3IN0A 4H1LH 3KPNB 1C9SA 4ODUB 1UB6B 3RVUC 1GPOL 4PGBB 3MGOB 2I5YL 4YDKH 4LCWB 1NPNA 4U1KB 5GJSL 5J13C 1U36A 4JJ5A 1OGAB 3PWNB 4Z7UF 3UTSD 2MNWA 4UQ3A 3MBEC 2NXZC 1HC1A 2R2BA 2JJTA 4U1HB 3OKKA 1KCVH 3PHAA 4NO5A 5D8JH 5MERB 3TVMA 2P5WE 3B3IA 4XCFH 3GUTB 3MJ7B 2UYLB 4MB1A 2ZUYA 5I1HH 3UZQB 3L2LA 2ED6A 5ILTL 1T0MA 5CBAA 3DOSA 4G6JH 4DUWA 2BXYA 3FOMB 5ADPL 1E4HA 4NO3B 4U31A 3T77A 3VGHA 2V9TA 4JFYB 4UTBA 4JL1A 3VA6A 3ZZQA 4FABH 3AG2B 4MJJA 4ZTPH 3OX8A 4FQQA 4FQLL 2WN2A 4QNPE 4LCWD 4X8JA 4F2EA 1NQBA 4PIRF 5C0AB 3KWTA 1ACCA 1L9NA 1OGAD 3CMGA 2GITB 2XZQL 4G2AA 4AC2A 1EV2E 4XVUC 4DTGH 5FA4A 4XCFL 2GY5A 3DX7B 2PPAA 3GUFA 1P53A 3SJVA 3K2KA 4HYTB 4ONGL 3SPVA 5HYJA 2BVQB 2YQBA 1EO5A 1GGCH 2NY5H 3KLQA 3F84A 3O6LH 1L0PA 3FT4A 3P4NA 5LBGA 1BHGA 4WENB 3ZL4H 1SYSA 1J05B 4K15A 4UAOC 1EJFA 2EUWA 1CK0H 4OAWB 5J8OA 5EPMB 3HR6A 1MJ7L 2XIBA 3O6KL 5CEZH 3EZ8A 3S88L 4X7TB 4BFJA 4YK4C 1CPUA 1QPPA 3TH4T 5DMGC 2BJML 1C1EL 3CXDL 2VR6A 4DTGL 1G7HB 1QBLL 2YXWA 3NCBB 1DL7H 4S1QL 1BZOA 1KT2A 5C0AD 1EJ6A 4RWYL 3PL6B 3DUUA 4K4KA 2TAAA 2G9HA 1RUQH 2NY5L 2VR8A 4Y4FB 3U0PB 1E3ZA 1KJ2A 2V3DA 5LXVA 5HY9A 2X44D 1P4IH 2EXSA 1A6PA 2ATKB 2W9EH 3HN3A 25C8H 2NY3B 1IJ9A 2DKUA 4P2RB 1DCEA 1R4XA 3FCTB 3OQRA 1J8HB 3LZRA 3QHFH 5IJCC 2AITA 4Y4HA 3MRGA 2X4PB 3R19A 4R0LB 3DI3B 5F9JB 3F7YA 3VCLA 1XWVA 3CU7A 2WLKA 5TTRA 3VXNA 1NIBA 5F3BA 2V5MA 2CRYA 3LOWA 2R69H 4H8WC 3L3DB 4OZFG 4FNTA 1UCBH 3BAJA 4L4VE 1HHGB 2YXVA 3IMUA 4IHOA 3SYQA 3VE0B 5EA0H 4WJ5A 3VFVB 1HX0A 4S0HA 4N2OA 4Z5RA 2A3TA 3QORA 4XE0A 3O6FB 4XNMA 3GO1L 1I1AB 4ZS6D 5ETUA 4JW3A 1ZLWH 2VJ0A 3VXRE 1Z9SA 5FUCC 3PL6D 5HHOB 1YRKA 2ZYIA 5I74C 1MUJA 4OZIF 4N9OB 2PXYB 4Y4FD 5IT2H 1BXAA 2VMJA 1ILUA 1P5UB 1ED3A 1KXVC 4PJFB 4QXTB 3GBNH 3WD5H 2NY3D 3ZKND 4JG9A 4P2RD 3KHQA 4R3SA 3GMMA 1OE3A 3LHPL 4EKJA 5D7IE 2XWRA 4NN5B 5EFIA 3MR9B 3ZDXE 2MOGA 3MXVL 1UKTA 1UCBL 4EPSA 3CSYB 1X5AA 1H3GA 1WGOA 2YR3A 4HF5L 3QCUL 3DK0A 3DUHA 1SXAA 4MNGA 1C08B 4E42A 1JE6A 5A6MA 4O9HL 1EHLL 4M61B 4LLYB 1IRAY 1F3DH 3CCHB 4ZMLA 2VL5B 4PG2C 5CAYB 4KK9C 3ALPA 3O6FD 1I1AD 2EIDA 2LGNA 4NN6B 2FD6H 1GR7A 5HHOD 2DTSA 4F8PA 4YDNA 5MEPB 2PXYD 1ZHKB 2KUTA 4WRLA 4XOCA 4LVOC 4XNYH 3ZE1E 1AD9B 1Q1PA 4WFEE 1JPSH 2GCYA 4GRLC 4WW2F 4X5WA 4YWGL 2P7TA 1MWAB 4CUCA 2CUHA 2FDBP 4L37B 3ARBA 2A6IB 1IC4L 3GMLA 4KXAA 1M6OB 4X4MA 2WQXA 3BSHA 4N8UA 2EE2A 2DEXX 2RACA 3AS3A 2FLRT 1X3DA 2BIMA 3VI4B 2NNCA 3TPUB 3B2VH 4AVKA 5JW5A 4XMLH 4KPHH 1DP0A 3T65B 3T5WA 1QVOA 4GG6E 2FD6L 1QFWH 1UENA 2G4EA 2ZG1A 4NO0B 5B1JC 3PP3K 5CIPB 3NIGF 5KSAA 4MMYA 1D3CA 2LLNA 5C0JA 1C16B 4XNYL 2GJZA 1NGWA 3LXUX 4JFSA 5D7LA 4F2MB 2V2WB 5BQ7A 3SYOA 4XNZB 1ZHNA 5DCCA 1U8JA 4ZD3H 3MKKA 3OD3A 4OZGF 1ETB1 2WANA 5F1IB 4O51B 3LD8C 1MXDA 2JSFA 3BZ5A 4AE1A 3HZVB 5B39B 4U33A 5BRPA 2UZIL 3K4ZA 3ABLB 3QRGH 1EFXA 2XRAH 4U2ZA 2YD1A 1NCBL 3BEVB 5A43C 4GSDH 3SKMA 3QIBB 4JJOA 2OZ4L 4KKQA 2CJ3A 4J3SA 4LCYA 5DUMH 1ZT1B 2QR0B 5DJCA 1K72A 5EUOB 5EZIH 3TIDA 2VDPH 3RPIB 4NO0D 1OIOA 3RDJA 2YARA 4XP4L 5DZVA 3EJUA 5MENB 3ZW3A 1HDMA 3RJQB 4ZD3L 3KJ6L 1N0LB 4KMTL 4Z7AA 5MI0C 4PW4A 1MCWW 2FIKA 2R0ZL 1MFEL 2AK1H 1CG9A 5GXBB 3GBMH 3TO4A 2J73A 3M07A 5F9OL 2HLFC 4JQXC 3WIHH 3TJHC 2X05A 3DDGA 4WK0B 1N12A 4KAQL 3K46A 1KTCA 4OT1L 3NG5A 1XB3A 3FB7B 3UOAB 4PVNA 1CFNB 35C8H 5BV7C 2FQEA 2IH8A 3MROA 1J18A 4NC2B 2E9BA 4NHCH 5EIIA 1OB1B 2J12B 5CNHA 3LSOA 1M05A 3GKWH 1DVYA 2V7HA 3DUSB 4ELMF 3FSOA 3MUJA 4OLUH 5F3HA 3TYFB 1RHFA 4JQVC 4NJAL 2C9SA 1I7ZA 3QZWB 1RV6X 2WSPA 2ODHA 4NJ9H 2BP3A 3TC9A 2MCAA 2PWHA 1P1ZA 3GLEA 1NIAA 4LSSL 1MCDA 1Q8MA 4S10A 1PLGL 3SKUD 1YJDL 3WFHB 2N0MA 5HYSB 1J5IA 4DCQA 3LV3B 1YMHA 2X1WL 2ITDB 1M42A 4PG9B 2W9LA 1E9PA 2V5RA 2QVTA 4NHCL 4GY4A 5B1BB 3U6RB 3C9NA 3FQ4A 1NFDF 3U4EA 3NA9H 3WGVB 2QKSA 2Q8BH 3DJRA 1BQHA 2W07A 2GBUA 4GJTB 3WJLC 2HJFB 3BQVA 5JPNC 3TA4D 2FVNA 5IV2A 1SN0A 4NJ9L 4KKCC 4EO5A 2BK8A 4KROB 1HKLH 1N64H 1NCIA 3PIQB 5C9JA 4NZRH 1C7TA 1DQQA 2VW4A 5C0RH 2QFPA 3Q8BA 4MQXD 4Z0XA 2J43A 5EC1A 4OCLC 1IU1A 3FO0H 5AVVB 5MEQB 1FHGA 3L54A 1X9RA 1LK3H 2YC1A 2WXQA 1KEGH 1BQ5A 1JZFA 1JRHH 1TENA 3SQOH 4N90D 1NDGA 2UWEB 3PPEA 1JNHA 2FB4H 1N70A 3A21A 2O6EA 5EB9A 3L3OC 5ESVA 1PIFA 2GBAA 1DVFC 3NJIA 4UZSA 3BP5B 3SY0B 3R18A 4HIEB 1U3YA 4ADJA 1KELH 3Q8CA 4DO6A 5J6HA 2FE0A 3QNFA 2DKMA 1HKLL 1FNSL 4IOFC 4N8CH 3UAJD 4I0PB 3BLPX 3QQDB 4FI7A 2AQRA 1PKQE 2CXGA 2V17L 5C0RL 1B6DA 4H1LA 4KROD 4XO9A 1GZHC 4BFKA 3ARPA 3F7PC 4HKJA 1N8ZB 4MB5A 5HVHC 1KBBA 1KEGL 3CN0A 1J5OH 4XPFH 4GG8B 4Z7UB 4BIKA 1A9BA 4UU9B 2ZWKA 3QWOB 3RAJH 4XHJD 3SE4C 5CFAA 2JCCA 5IJBC 5DRXB 3CX2A 4RA3A 4RGMC 4K8RH 1RIUH 4L0ZA 2E4TA 1IC7L 4L3AA 1RZJH 2FJFA 4UQ2B 1I9IL 4P46C 3QO0A 4JRYA 3GKZA 3KPPA 3QW9A 4WWID 3H2PA 1KOAA 3OXRA 5EC2A 2ORBL 3IXAB 4FKEA 2H6UA 4NAJA 1CFQA 1DVZA 1KTDA 3C5ZC 3HR5B 4I0PD 4WU7B 1YEHL 4XBMA 1OTSD 5FHBH 5I1IH 3QEGH 1KBVA 3IU3A 3ESUF 2BVPA 3K7UA 3D30A 1JSYA 4XWGH 1DDTA 1DJGA 2CIIA 3CBJB 1M6UA 2IANB 4X80H 4JZNA 5I8OL 2ZOLB 3BP6A 3MNMA 4XR8C 2O4EA 2BRRL 4QKTA 2VZOA 3G6JB 1U8LB 2W65A 4PJXA 4DQOH 1PY4A 4OLVL 5L6YL 2QEJA 4P2OA 1YYLL 1VA9A 3CXFA 4Y0GA 2YGPA 4YZWA 3BGMA 1M2OA 3L3KA 4KVNL 5I1IL 2ILLA 2NYKA 4HH9A 2E7HA 5DLMH 2FH8A 2QHLA 4YO0B 3GMQB 2DM4A 5C0DA 1ETA1 4G7YH 2IAND 3CDGB 3RWHA 3S97C 4R2GC 3UACA 5T3ZE 3ARQA 1OTUC 1KB5A 4ZNEA 3OHXC 2WXFA 4X7CC 3D6GA 4GUPA 4ZAKB 2HLAA 5DEFA 2J8OA 3FT9A 1A6AA 4YC2C 4H0GA 2GHWB 4PB0H 3DX6A 3F7KA 3KYAA 3S96B 4R97C 7FABL 5HGBB 3NFSH 2VSCA 1AS6A 4TTGA 4OCNC 5DLML 1KXTB 2OL3B 1LEGB 1JGVH 4J8RA 4UYQA 4YSRA 5L7XH 2VLKE 4PCSA 1JAEA 4OZFH 1UEMA 1FI8C 3GS4A 4C56B 3KPSB 4ZPTA 1HOEA 3US9A 1KPRA 4DK3A 3FRUB 2AGJH 1HHKB 2AC0A 2C3XA 3ULUF 3VXUE 1JL8A 1WSST 4PJHA 4QAWA 3V0WL 2VISB 1WLHA 1NJ9B 5DZOA 5JHDB 1NAMB 4B53A 1BOYA 3GIVB 5JUEL 1I9JH 3H2QA 4ZAKD 5KVGE 3B2PA 1MRFL 3AWEA 3WTYA 3UBXA 3V4VH 1AYRA 2A6JB 1B0WA 4I1RA 2CMRH 5L7XL 2MSPA 3C2AL 5EU3A 5EF3A 1M71A 3RTQB 3HC3L 4MDJA 5DK0B 3HTLX 1F6AB 3MRKA 4BA8A 4TS6A 5CJQH 4A2HA 2FIRT 1KGWA 5ADOH 2NR6A 2J8UE 2Y2YA 5DJYA 5SWZB 4FA6A 4GKNB 5IJVA 4NNXA 4WEBL 2EILB 5GS1A 4KVCL 3GXUB 2R59A 3X1EA 1S7SB 1INEH 4C56D 3KPSD 5F6HJ 4IK6A 3FYIB 5EN3A 3UYOD 1F4XH 1GJUA 3PXHA 1ECZA 2EZ0C 1I9JL 4XXCA 3OZKA 5CHNB 3V6FA 5JHDD 4QXVA 3P4OA 2AV7A 4YX2L 3U4AA 2MNJB 4L2YA 2F8XC 3Q1EA 4WO4A 4W68A 2G2RB 5JOFB 4NSKA 4WW2B 4X8CA 1REIA 2EXWD 1B0GA 4RAVA 3RTQD 4W9FC 5DQJA 1ILSA 1MRDH 2HFEA 3AXLB 4KQ3L 3DK2A 5SWZD 1HWWA 1RURH 3HI1A 4HK0A 4QCIA 4JFXB 3P9MB 2JXMA 2B39A 1F2XK 2BC4B 1RFDL 4FXGB 4GYBA 4UOQA 4JN2B 4AL8L 3FT3B 3WYRA 4PSPA 1JXKA 5IROC 1RZ7L 5EBLA 2J2ZA 3FO9A 3E8VA 5C3TA 2PO6B 4QO1A 2ZOUA 2I7SA 2XZZA 3QZWG 3M7OA 4MLSA 6PCYA 3QAQA 4RZCA 4LP5A 2YD3A 3C8KA 1RU9H 2E6JA 3C6LB 1NFKA 4PLKC 4OZGB 4F37F 5HYSG 4KRPB 4BKSC 2KLSA 5MHSD 3F7LA 1BIHA 3NESA 2J6EH 2BNQA 1AY1H 3I2CH 1D6EB 4GXVL 4NT6A 5LDSA 3CDFA 3HG1B 1Q9LA 1OO2A 3CZGA 2V2XB 5C0BA 2O93L 3GSQA 2NCMA 2NZ1A 2PPCA 4XCEA 5DK2B 1AQ8A 2D7TH 1BW8A 4DZ8B 1UGNA 5HGGS 5D96C 3O41B 1KLUB 2GFBB 3W2DH 1DE4B 2PO6D 5D72H 1RU9L 2AW2A 2MQCA 43CAA 3DHUA 2ARJQ 1S78C 2QMKA 3DX8B 4HUNB 4CSTA 1EAOA 5CR1A 1UD2A 3JYBA 2CGRH 3C6LD 4JX0A 4OSUH 1J87A 2G2NA 3BLKA 4KRPD 4TV3A 3WO4B 3B4NA 3DYMA 4FP8H 1AXTH 4ABVA 2JQZA 3WDIA 1RPQA 2Z4TA 3D34A 3DTXA 3W39A 4N0CC 2VLRE 3QJFB 4RFNC 1YEDA 3LRSA 4JGUA 3ZGHA 1PMYA 3HG1D 1XGRB 4IOIA 3FB6A 3BT2L 3L48A 5TQ0H 5FGBA 3KWUA 4BCXA 1Q0XL 3CMOH 1YQVH 3W2DL 5JIPA 3NRQA 4ELMB 3T08A 2WCGA 4LSUH 3ZTJH 4R4ND 1G5AA 3B7SA 1RZKL 3KPOB 2C9PA 3RL1A 4NOBA 3BAIA 3GRWL 5GISH 4L3EA 1NSNH 3O0RL 4OGXL 3L5XL 3U1SL 1CLOL 4X6FB 4EI5B 2HJKA 3WLWC 4ZUTB 4J6RL 1P2CA 1UQSA 5LGHH 2B3IA 3UBHA 5CINL 4IRZL 3V0GA 3WUWB 2QZQA 3CXHJ 2RTTA 3EFDH 4IRJB 5IMKA 4YHPB 3T8XA 4CDGC 1XH0A 3LY6A 1U3HB 2OK0L 4TPRL 2XLLA 3KCWA 3BVNB 4EVNB 3VFOB 5GS2D 2K0RA 2FO8A 3EOTH 4RFOH 1U4EA 2V9QA 1NFDB 5I1EL 1PY0A 2J1YA 4W4OA 2DIBA 2GTZB 5IOPA 2VOTA 2X6VA 3IDMB 4KZDH 1PPIA 5J13B 4YDJB 4XPTH 5GISL 3EO0B 3L9RB 2NXZB 2WVUA 3TA3A 4FI6A 1BWMA 3B7YA 2ZXAA 4PIBA 4QRQA 2ZXQA 1X5YA 4GW1A 3DVGB 4F33A 4EI5D 3CFNA 4K5LA 5L4IA 1CE6B 3GMRA 2NLJB 1I3GL 3WI9A 1T21A 4P2AA 3DX9B 1O0VA 5LNGA 1K5NA 4JFHE 1D5XA 3BUDA 4XPHL 2VRQA 3ARGA 4IRJD 3RFZC 1QKZL 5IK3A 4M1GH 1U3HD 3PJNA 1WH0A 3FTWA 4JMNA 5D1ZA 3QG7H 4PV1C 3RVUD 2YPLB 4OGYH 3U4BL 3SDCC 1YMMA 3QUMA 4Q9CA 1NCWH 3DNKA 4CC1A 5JORA 1FPTL 3MREB 3U30C 1WAAF 1R3KA 1GMIA 1T20B 5JOPE 3MBED 2NXZD 1NLBH 1HHIB 3GSUA 3GLDA 3S8GB 1INQA 1R3IH 3BZ4B 3MA7A 3X12B 4FDWA 3G5ZB 2FO1A 1PGRB 4M62L 3FKUS 1WG3A 4TQEH 4DT2A 5AUMB 4NRXA 3SE8L 3MX0A 2IGLA 5J0BA 2R8SL 4QHNB 3DRQB 4M1GL 2VJXA 3VFTB 4UAOB 2XV2A 4HWBA 4MVBC 1KBGH 2L0DA 5C7ZA 1I8KA 2FWLB 3RWEB 5EEWA 3U2JA 5DD3H 1P6AB 3N85L 4YFLF 1G0DA 4YK4B 1RUMH 1NCWL 3GSXB 4BUQA 4JUSA 2YPLD 3GXIA 1HAUA 2KZKA 4GQRA 1NLBL 4L1TA 1E5AA 1QFUL 3R06A 3IJ9A 4AYEC 4WI7A 5DRNA 4XVUD 3U82B 3AS1A 1PTZA 2KBGA 2R56L 1XH1A 3JT0A 2Q87A 1C12A 4P3CH 3RA7L 2IOOA 3TT3H 4FI8A 2X4RB 5LN4A 1KBGL 1KIRB 3A23A 4D94A 5C0FB 5IQMA 4X98A 5CXPA 1I1YB 3SOTA 4PTTB 5J9PA 2CLVB 3N1QC 5I71B 2WLIB 1N7ML 4QR7A 1BX2B 5JXEA 3ESOA 1CGWA 3BUIA 3QNZA 5DMGD 3MRFB 3FJTA 4C57C 3KDMA 4LSTH 3LNGA 3T0AA 1X5IA 4PRIA 3SPCA 2LOEA 1S7QA 1HHJB 3L4ZA 1T5XA 3ULUE 5I74B 4Y2DB 3KPRE 3ZE2F 3MAWA 2X5PA 1DEEA 2I7OA 1PYWA 1FRGH 3RJDA 3RKDC 3HLAB 3S35H 1KLGA 4XNAA 2XWXA 1MF2L 1A7PL 2AXGB 4JHWH 2QPEB 2P42B 1MCKA 2XXGA 3ZZ1A 1XCQA 1LEIA 5FB8A 2LU7A 2C7FA 4YBHA 1MWAH 3D1MC 4XAKE 5FUZH 2BZ7A 4LSTL 1SDAB 4BSJA 2YD4A 4A6YL 1FNGB 5IBTL 3PWUA 2XICA 3SGJC 1FCGA 3H56A 2WWKO 3N42F 2F18A 1P0SE 4KTGA 1FE8L 3LRGA 5FX3A 4YLQT 3TF4A 1C5BH 4Z23A 2EUXA 3EADA 3MRCA 2X0WA 1B0IA 1KYOJ 3DTUB 1VFAB 2PYEB 2XYBA 3UBXI 4K3GA 1JFHA 2MEJB 4OV5B 4LVOB 5ANMA 3NCMA 4FFYL 5E9AA 2PKDA 1R5IA 5EBMA 3S37L 3PQYB 1YN6B 4GRLB 4NP4L 5LAXA 4BDVA 1EZSA 5L2KE 2CR3A 1S8DB 2Y36H 4BH8B 5DDHB 5GGRB 5DD6A 2EEXA 2Z93A 1KACB 5DSCB 4ZW5A 4BFOA 2AKRA 1TVBA 1HI6A 2R7EA 2P43B 4KO5A 4LNRB 3BI9X 1NUFA 4HULB 3T3MF 1NIFA 1EJOH 2VAAB 3UJJL 2F0CA 3IETB 2XSKA 5GJTL 4WY7L 3EF4A 3AJ7A 2WLMA 3EDJA 4KK9D 1SJHB 2OMUB 1Q0EA 3MRDA 4UOJA 5CMAA 2CM5A 4GT7A 1SN2A 3OAZK 1GC1L 4AJYV 3TBWA 2PYED 3UG4A 4KUCF 1YEFH 1NIDA 4WCYH 8FABA 3SO3C 2BHZA 3ZKMC 2DQDH 1O75A 3KXFA 5DJXB 3QRFM 1E5CA 2XZAH 1JI1A 1I82A 3PQYD 2F5AH 3PJSA 1UXSB 4GRLD 2AJZA 4YDVB 3FQTA 3HE6A 3LD8B 3IVKA 4U6YB 1BD2B 2FATH 2VR9A 3OPZH 3QS2A 3ZDZB 5F6IC 3BSZH 2ZT9C 2HFFB 3I6LD 1TPXC 1NBQA 2DJSA 4YSAA 3MQIA 5J7CC 1QFWI 5IVZA 1F11B 2PW2B 1I8IA 4UIKH 4RCAA 5HHQA 5I1CH 2PN5A 5FFGA 4WCYL 1WV7T 3B5TA 4NZTH 4PRPA 5MI0B 4LSPH 5DRZA 1OSZA 4H26A 1U8OA 2FX7L 1TCMA 3OPZL 1MPAL 5EZJA 4L8DA 5AVZB 3ULSA 1BD2D 3MRJA 4AH2B 3ARXA 4YZFF 3O4LA 4PY8J 3Q01A 2APFA 32C2B 4R7XA 1BYNA 5CS7A 7PAZA 5BV7B 3QEQB 3WUWG 5ICZA 1OHZA 2CDGB 1P4BH 4AXWA 2W88A 3DJZA 1MQKH 1FO0H 1U8MB 4OD3L 2J6EA 4K73A 2RHEA 3GSRA 3WTUA 4EKXA 4GP4B 5D7EA 3DGCR 4OF5A 2XC8A 3F64A 1SM3H 1KGCD 1Z3GH 3AQDA 3LZQA 5KSUB 1EEYB 3GZPA 5CJ8A 2G75A 3BKYL 5GRXG 3TJEH 1BSIA 3TJHD 1FFTB 1BEXA 2DLIA 4IIQC 5F2FA 2H0FA 3K6NA 1EGJA 3P2TA 2PYFA 3NIFF 2Y3NA 1HKFA 3PG2A 2VIRA 3GINA 3QEQD 2FBJL 3SGKC 5IF0A 4M7JL 4BGDA 3MNWB 3LTVA 4L8BA 3NCXA 4JO4H 2GIMA 1BQLH 3MV7A 4YSPA 4JFEB 2HVBA 4M7KH 3LQAC 5CZVL 1F1GA 5TH2B 5DGRA 4PGEA 1TZGL 1ZA3A 2PR4L 4YHIA 5FKAB 2ZWLT 4E0RA 1WA2X 3FUJA 2HKHH 1S9XB 1X9QA 2VZTA 3O9WA 5G5DB 3FN0L 4O00A 4YPJA 3WEXA 3WJMB 1MH5A 1VPOH 1IBDA 2K3HA 3N9GL 4WI0B 3RB7A 1ZY9A 3JTTA 4YGAB 3FB5B 3JVGC 2H32B 1TJGH 2H8PB 1NMBL 2MOVA 2R27A 3WTXA 5TF0A 3L3OB 1LHZA 1N6QH 3DOIA 2EXYC 4DP4X 4N8VB 1RZIA 3S4SA 3WTSA 1DVFB 2DBLH 3ETSA 2NNXA 2EC9U 4DERA 1XXFC 2C7UB 4IKKA 1YECH 1IILE 1BPLB 1OAQH 4LLDB 4MNQA 4PY8I 4ZMXA 1GS8A 4JFED 4KKCD 2CLZA 1N19A 4IBYA 2FWUA 4DZBB 2ROXA 5CP7B 1VEOA 3PXJA 1AGBB 4F8QA 3BCDA 3DRTB 2CKBH 1A5FH 1E42A 4GAJH 2F74B 5IFJB 4JKKA 4R7DA 2OTWA 3GD1C 5JO5B 3ZZLA 1CGTA 4DKAA 2KHAA 4RRPA 1TJGL 4PI0A 4POUB 3UJTH 1YG9A 4D0BA 1JRHI 3HEIB 4G7VH 1VACB 2X9WA 5D1ZI 4CW1B 3KZ8A 1AIFA 2AEQH 4RGMB 1AZZC 3QQXA 4U2YA 1EZVX 4QIRA 4P9HL 2QSCL 4JRXE 1BBJA 1AZVA 3HFMH 3AUVA 1DVFD 1GCYA 4P46B 1JGDB 5IMOA 2NW3B 3GB7B 4KOCA 1JXJA 3GI8L 1OSPH 5E5UB 2V2TB 1MG3C 1DN2A 3I6KB 3MLYH 4IOFD 3C5ZB 3K71A 4X50A 5CD5D 1BYPA 1FZMA 1YNLL 3FO1A 3RX8A 5HYJE 4MJID 1DQTA 3MJ9L 4P4RA 3RVVD 1C7SA 5E2UL 4BCYA 3H9ZA 1X6LA 4TLTA 2MHAB 4BGLA 4AKQA 1ZSDB 4APXB 4HCFA 1G6VK 3V5KB 3BE1H 4FQCH 3RY5A 3V8CA 4AZ8A 4PREA 1USQA 2IXQB 3GI9L 4UILL 4UT6L 3IGKA 3D0AA 5IESH 1NGYB 4U1JB 3SQBA 3V6BR 4YSOA 5C08A 3GMPA 3MLYL 4M7ZC 2W8CA 5E5RB 4N0FA 4P46D 5KOVC 5IB4A 4P5MB 1MXGA 3PHOB 3TO2B 3RYMA 5C09A 1MHEB 3C5ZD 2E27H 1T1WA 1Y07A 1ERNA 1QFWM 1RJZB 2SEBA 5KANI 1AKPA 3FCUB 1TJIH 2OL3H 1L7TH 4PUBL 4FFTA 2XWEA 1TVHA 1IM3B 4ODVH 3QQ4A 1P5VB 1LDPH 2EP6A 4FQCL 2QFRA 4U1IB 4WQOA 4R2GB 5E23A 5TJWK 4EDXA 3OHXB 1UKSA 4GMTH 4XC3H 1OAYH 1WBZB 2VXUL 1WZMA 4Z8FH 4LIQL 3ZN6A 2A9ML 4LAQL 4BSWB 4PP2B 4PJ9A 2CZNA 3L5JA 4R97B 4LP4A 1PZAA 1U8CB 2BFVH 2D7PA 1U93A 4PJBA 3VACA 1MIMH 3HHSA 3LH2H 1XCXA 3L9BA 4ODVL 4N9GB 5C0ND 5CP3H 2X1QA 4LF3B 1DLFH 4X8GA 4CRPA 2ZTBA 1IM3D 4HKBA 3HBPA 4HIPA 2OV0A 1S7XA 5DJDB 3W9DB 5GGQH 1H3TA 2VERN 4RAHA 3WJJA 1D7DA 4R2GD 4K0OA 1OTUD 3KYOB 4JFDE 1UWXK 1UACH 1NZRA 4ZS7H 2J71A 4DP9X 1NAML 1JMZA 3ZE2B 4MNGE 3N41F 4D0CB 5JMRA 4PY7B 5EMYA 3Q05A 5F0JB 5I73C 1ZS8A 3JQOB 4LT7A 1Q72L 4Y5VA 1ZKAA 4QY8A 5G55A 4DESA 1RERA 4N6RA 4UT7H 4RMRA 4DSYA 2TRHA 1BZ9B 3T3ME 5C70A 4YIQA 1Q9KA 4MCYB 2QGBA 2CU9A 4HMDA 1JDDA 2DLEA 4IGBA 2CPCA 3RWFB 2DIEA 3MRQA 2VXTL 3ARDC 3SIKA 4BFNA 4LMQE 3LIZA 4IMKC 3KLHD 2VR7A 2WNKA 4HAKA 1XVSA 4XGZB 2DTMH 3QR2A 5GRVL 4IHBA 1W8NA 1G94A 1WDAA 2X1PA 4ODTL 5KW9H 3ML8A 4PGZA 2F7PA 4PS3A 4OFVA 4U4BA 3PXLA 5EEYA 1I9EA 3RP1A 3BVXA 3IMWA 1QSEE 3M1BA 1HHHA 5CWSB 5L2JA 3LZPA 3I9GH 3LN4A 3NJXA 4O58L 1NWOA 1IC5L 1U95A 4UZGA 1MSPA 3S7GA 2FR4A 1ZT7B 5DEGB 3WL9A 2LV4A 4I3RH 1WCBB 4CVUA 2CO6B 4F8TA 1MG2C 3DSNA 4GSRA 5KVGL 4OJFL 5D7LE 3CN3A 4ZMVA 5JNYA 4XOAA 1XT5A 5JA8B 1UASA 5EU6B 5KYNA 2YEZA 3U7WL 4XVTL 1JHLH 1O6SB 2EE0A 1OCZB 3GLAA 1KLFA 3N1GC 2VQTA 1G9NH 1ZCRA 2AXWA 1WS7A 4NCDA 5INCB 5IUCA 4UDTA 4N2DA 4NQVB 4OM1H 5BZZA 1AGFB 1FFQA 2G5UA 5LGJB 3QIUC 4RGNC 2XHNA 1ZJAA 4NC1E 4ERSL 4OM0L 3QIWC 5DJZB 2YJLA 1MJJA 2X28A 5E9DB 2QLVB 3N40P 2BVOB 2K45A 2ESVA 2WZ0A 2WQSA 5CGBA 5IMMB 1G7LB 3UGXA 2K7QA 2DQ6A 5T1LB 2P28B 2RGSA 1JHLL 2Z1PA 3DWTA 4HOXA 5IIEB 3EOBB 3MBXL 1FNFA 2J1ZA 4Z7VF 4ANWA 2JFCA 3APCA 3BSZA 4PJ5E 5EU6D 5TPWH 3T2PA 2WQ8A 1IE4A 3B34A 4YJZL 4HUVB 1S7UB 5GS2H 1MDTA 1RD6A 3BDBA 3FQUB 5H94A 2PPFA 4AMKL 4RDQF 3P9LA 2Z7ZA 5IROD 3NGBC 1KCUL 1GGUA 2P49B 3LMJH 1NGXA 1NBYA 4WI6A 4Y1AB 2X3BA 2Z7YA 4U1LA 5LLIC 3V4PB 2GUYA 2ZE0A 1G6RB 1V3KA 1JF5A 4PLKD 4K7FA 2F19L 5E9DD 3NIFE 2A0LD 5GZNC 3APFA 2X53A 4NRYB 1VADA 2VSMB 3AG1B 2X4SB 4BFBD 4W1TA 4AV5A 4UZUA 5T1LD 4HGWA 3UDWA 1N2RB 3GSNL 4RFNB 4JGMA 3VTMA 1TU2B 3MRNA 4N8VG 4UUJA 4YXKH 5KEZA 2N3JA 2P3YA 5KVDL 3HC0A 4OCMC 1BAGA 3WNOA 1FFOB 1L6PA 3DROA 5IEKB 4HKXB 1KCWA 3S98A 2DQCH 2Q6WB 4WFGD 2FECL 3QCTH 4F9LC 2CALA 2GAZB 4JDZB 2B5IC 2E6PA 1S78D 4CJ0A 1U41A 2WZPA 4Y1AD 3WE6B 2YQ2A 2O5ZH 3LKPA 1OOAA 4JFFA 1LDSA 2EIZA 2DQFA 3MV8A 4FEIA 2CXKA 4PWIA 4XCYA 3MRPA 4B9KC 3INUH 2J1KA 5ITBH 1YEEL 4MRCA 2E5EA 2XN9A 3VXMA 1RLWA 4N0CD 4PJ6A 5DVNA 1T7ZA 2DW5A 3II2A 4NQCE 4WO0A 1GZQB 1IGCH 4HS3A 1EDYA 2ZSWB 3KYNB 1R24A 1I7UB 2IH1A 3IB4A 3T0WA 2CLRA 1PY9A 2ZUQB 4B60A 4NQDA 3REVB 3FOLB 4PWJA 1CR9H 2KLRA 4RETB 2W60B 3RWIB 3X14A 4UNUA 5D2NC 2MPVA 5E4IA 3LEXB 3LXAA 1KULA 5C0GA 3GPSA 4EEEA 3KGUA 3WLWD 2IGTA 4XVJH 3L95B 4OQTH 2O6PA 5ITBL 1BF2A 3OWRA 4LRNH 1E2ZA 4HFWB 3QXWA 3PWPA 5ES4B 5AOJA 5EO9A 3MOBH 3RWCB 3S35X 4XB7A 1RJYB 4KUZL 5I0DA 1U8PB 5T1MB 4OZHF 5GZOC 3SDCB 5HXMA 1WVZA 1QAWA 3OKDB 3U30B 1UWYA 1OTTD 2XA3A 1ZV9A 1AFVH 3B9KC 3L4UA 4W4NA 4XAWH 1I7RA 1QQDA 4TVPH 5F97E 2QKIB 2CKBA 2V5TA 4DNLA 4P59L 2OXGA 3L5WB 3A22A 4JR9H 4H20L 3VU2A 5KG9B 1BLNB 4N4YB 1F8TL 1OPOA 4ZFOB 1YNKL 2LQRA 3PGCB 2QSVA 5INDB 4NQEB 4A7UA 3AFLA 3OZ9L 4TN9A 3W37A 3DPBA 3SDCD 1AFVL 1O7VA 1MRCL 2DH3A 2AZAA 2DL2A 2YPKB 3P30H 6FABL 5KVFL 1IARB 4H8WH 2IPTL 3BXNB 3L4TA 2I32A 3D2UA 4JM4H 4TNEA 2BP0A 3ZHFA 4A63A 2X6MA 2EO7A 4WUKH 4NBZB 2J55A 3TNMB 5F7DA 3K3QA 1PD0A 2AS5M 2BCKB 3BPCB 1XZWA 3CFDB 5GRUH 4WTZA 4B0MM 1T4KA 4HCGA 1E4JA 4Y2OB 3WMQA 4ZQTA 4FFWC 1KYUA 4MVBD 3A0OA 3NSXA 1W16A 3F85A 2C3VB 4NQED 4WEUD 2WVTA 4NM8L 4X5QA 1ZT4A 4OLZH 1PLCA 5GGVL 4X7SH 2A38A 1JGEB 1SYVA 4L0PB 2YD7A 3EFFB 5K1JA 1U8KA 3FFCA 4XZUA 4OFYD 2BVTA 3L6FB 4TUKL 2HWZH 4M9PA 4NPYA 3E6FB 1BFOB 1WFUA 3RY6C 3TT1H 4QLWA 4P23A 2WUBL 3T0EA 3RI5K 1JPST 2VZUA 3TOPA 2H1PH 2VC2L 4AEEA 7PCYA 1A3ZA 3BISA 5E5MB 4FG0A 4HWEL 3QUYA 3CZKA 1TJHL 5E8OB 3CFBA 4P4KB 4MD0B 2G3XA 3FUHA 2B20A 3MV9B 2GK0A 1RUAL 1HH9B 3WSQL 2E7CA 3WDHA 3GNMH 3P3SA 1DO5A 4JDEB 5DD0L 1HSAB 1PSKH 3RUGF 3IF1B 1TJMA 3UZVB 1A8JH 4GO6B 1M7DB 2CBOA 2WLZA 1DFBH 3OKMB 3H1ZA 4OF8A 5TDPB 1ADQH 3V4UH 2PTVA 2FYVA 2YD8A 4GI8A 3SO5A 3MLZH 4BRJA 3RKDD 5FO8B 1M1XA 4R4BA 3IFPB 5ISZA 5I18H 1T4WA 3P77B 4PJGE 1YC8A 3K6OA 2CUAA 4E9QA 1MCQA 3HZYB 2ED8A 1WAPA 3N41B 1MFCH 3QDAA 3H0TB 2OSYA 4GBXC 3MV9D 1CLZH 4PV8B 1PSKL 1UJ3A 3P2DA 4NFBA 3U9UA 5D7IB 3MMEA 1IKNC 2UZXB 4U3SB 3Q2CA 5IVXB 5HPMB 3RVXC 1ADQL 1A4JA 4MSWB 1TF4A 4PHXA 1OF2B 3CFEB 3ZTNH 3LKOB 5FKPB 1A3LH 4XXWC 2HN7A 4FHBD 1MCEA 3WHXA 3QULA 4HC1H 3U6XA 4ABWA 4HP5A 1KJMA 1XL6A 3SO3B 1EFQA 3ARUA 4JREB 5EOCH 4G43A 2X87A 3EKCA 5EOTB 4Z7WA 3KH4A 1MFCL 2Z31C 3SDYH 3U79A 2FJHA 4DP6X 1K4DA 2OKMA 4JRLA 5F6IB 2NT0A 5E8NA 1U2CA 3ZE1B 5BVPL 4YR6B 3NFNA 4KZEH 3C6EA 2WTRA 1HQRB 4LEOA 4YGVB 3VI3A 3DDFA 4PJCA 3NZHH 4ZUSB 2WNWA 2N1KA 1D6VH 4KBPA 1IKFL 3ZTNL 4IMLB 4OGQC 4E9WA 3PY9A 5AOIA 5BV7H 4BFIB 1OLZA 1F02I 4L5FL 2APWA 3IGLA 2L3BA 5SWSA 4RRPM 2ICES 5DC2A 4LXFA 2DEWX 3X1NA 3KPQA 5J12C 2LABA 3RFRA 4BHUA 1CGXA 2YXMA 3DIFB 4O02H 1BM3L 6PAZA 3ZKMD 3QEUA 4HU2A 1GY1A 1IGML 1A7QL 3Q13A 4LEBA 5F7MC 4ZW6A 3ULVE 2BNQE 4F58L 2ZOWA 5ALBH 3CFUA 2FWOA 5JPMC 1V3JA 3ALXA 1JK9A 1WPCA 5DR5H 4DKFL 2WXKA 3QDGB 3F62A 2H1XA 2OXHA 3CQPA 1Q0YL 3VXTB 5FGCB 5IB2B 3P3UA 2Q7AA 4POYA 2FX9H 4JUTA 4QJ3B 2YKLL 2P47B 2PW1A 4Z7VB 4DP2X 1N59B 1S7TA 3NQKA 5SV4A 3TN0A 2F58L 1S9YA 5J06A 4TVUA 3MCLL 1KXQE 4NKDB 3H42L 3D06A 3ILQC 2TRYA 1JPFA 1W9XA 1FWXA 4LLAA 3CFMA 4NERA 4KKPA 3D09A 4IIQB 3P11H 4HQQH 3VGBA 4JO1H 1F3RB 1MNUH 3WFEH 4TNWK 3V10A 1YEKL 3QDGD 4YUEH 3MXWL 3VXPA 3QQ3B 2GQHA 2H32H 3BWUC 2O5YL 4QRRA 4YHOL 3NP4A 3ES6B 4BXSV 1NKOA 4L3EE 2ZOKB 1F90L 4S2SB 1BVKB 1JUFA 1LE5B 1E90A 1LEKA 4PAZA 1OARH 2ROYA 1XD1A 2X4QA 3G5VB 3H9YA 4Z0BH 5EO0A 4XMKL 2GBTA 1XX9C 4FNQA 1B0RA 3UTTB 1CDCA 1ZK5A 2LT9A 4LKCB 4M5ZL 3M1CA 4PR5A 4X4ZA 1RK1B 3CK0L 3VGEA 1FCCA 3WFEL 1T3FA 3K81A 4GRWB 2PPDA 4MFHA 3V6ZA 1JMXA 3ZLQC 3OKLB 4J2QA 4ODSL 2WLYA 4YBLB 1A6ZA 2UY6B 1DQML 4MYWB 4ES9A 5T3XE 4PRNB 1EUUA 2H6PB 4OIAA 3H9SA 5J11C 4LB8A 4WHYH 2NDGA 2I9LB 4OZHE 3SEPA 4WI3A 4PJDF 5JDSA 2WUCH 2HAZA 3ZL2A 4I87A 4B97A 5KYXA 4L9LC 1JYWA 3KL5A 3VYPA 3REWB 4ZUWA 4ODXB 1LO5B 5FV1L 1CI3M 1FFNB 1HQ4B 2P8LA 1KIUB 4JPWL 3WLBA 3OLEA 3QHZH 1WWWX 2KI6A 2OTUA 5FEBA 4WU5B 4FG6C 3UTTD 2Q3XA 2DQUL 5D5MA 4G6FB 4HUXB 3VFSA 5A40E 2WOYA 2IAMC 5C8JB 1VFMA 4NIYE 2FO4B 2C9RA 1QNZH 4P3DA 1WBXB 1GJIA 1EH9A 3F01A 4I18A 5I1JL 3ETBJ 2DBJA 1YMME 3VW3H 2EXYD 1KTKE 2D0FA 4XTRC 5CZXD 2JV6A 2LU4A 1CS6A 1CU4L 3D39A 3O3DB 4OJDH 4YXHH 2DLTA 5ACLA 3MUUA 4DN4L 4FJZA 5K33A 3H4HA 2X70A 2R1YB 4HWZA 3TH3T 4L29A 3M6DA 3CBRA 4QPEA 1CFTA 1D7CA 1RVFL 4Y9BA 4IEFB 5TDNA 4EAEA 4HG4J 4UOW0 4BXVA 3BUQA 1UH4A 1VDGA 4DZBA 2X1XR 2Z35A 3L3HB 1DDHA 3DO3A 2JJTC 3V52L 3DBXB 4F57H 5LHDA 3LPOA 3QZOA 4FQHA 3TVMC 4JG1H 4NOFA 1PDKB 3QE5A 4G6FD 4WZ9A 3FU7A 5FO7B 1F56A 1C5DA 2XA8L 5IG7B 3VMNA 1ZA6B 4JQIH 4B50A 5KBDA 3MNZB 4OFQA 5CGYC 3BD5A 2R9HC 1RMFL 5GGTH 3QYNA 4M7ZB 4WEEA 4M6NH 2DAVA 1KJ3L 4HJJL 1B4JL 1WIPA 4RIRA 6TAAA 3D2TA 3UH8A 2P24B 1XH3A 4Y8DC 1LWRA 2IG2L 1A7NH 1ZTXL 1YQ2A 4Z3HA 2YBRB 4XN2A 4TYUA 3LKSB 4HX1B 5KS9F 3IDXL 1RL1A 1EO8H 3BOVA 1ASQA 2GIYA 3E6HA 1KPVB 1DBKH 4HFUL 1QOKA 2R51A 2Y1YA 4J1UA 1E28A 4XNQB 2ZCHH 2OLDA 3BIKB 1K3IA 3S5LG 3RI5F 4KQ4L 3VFNB 4E41B 3LNHA 3EJTA 3II1A 2DWSA 5DVLA 3W11C 1NBZB 1UZ6F 1NCDH 1GKOA 1KXVA 4RX4D 3PP4H 2DQIH 1M7IA 1C5CL 2JI3A 4OCRH 2E9IA 1B90A 1BFSA 4DGVL 5JHLH 2XCMC 1WUNT 5C0EA 2Y7QB 3D85B 2PABA 4L4TE 3OMIB 4ZYKB 5KSBF 1WIOA 4PJIA 2X9XA 5M7QA 2WWOA 5DFTA 3H3PH 3B9VA 3FT2A 3UCRA 5ICUA 2PMZA 5HDOA 5E5LA 2AK4E 1U6AL 5JLZA 4Y4HC 1D5ZB 4RSYA 3BH8A 4Z95H 3VSVA 3H3BC 3IM1A 4E41D 1G7MB 2GJ6A 1A2YA 1KCSL 2XPGA 5JW4M 4TKWA 2I27N 4WHCA 1X6NA 4QRPA 5DZPA 3F7RA 3K80A 4HT1H 2OMVB 2KL6A 2AQ2A 4PBVC 5KBKA 3L7FA 2D3NA 3NYKA 4JFOA 3EFOB 4U6XA 3IGAB 3QORC 1B6UA 3KPLB 3VDCA 4BZ1H 3D85D 4ZSOE 2X9YA 1F4YL 2B1AH 5E2TL 2CIKB 3RUGB 5MEOB 1HE7A 3ZQXA 1URLA 1GAFH 2H0EA 4NI3A 3MLPA 2X6CA 5F1KC 4WHDA 4HZLB 5A2FA 5EOQH 3VFPB 1AH1A 1HXMA 5AW2B 1AJ7L 2IBGA 3VFGL 2D03L 1ETZB 1QHPA 4XMPL 4XBGA 5T3ZD 3Q8AA 4KTYA 3W56A 2KDYA 2G60H 3FONA 3N1FC 3M46A 4HT1L 3CQQA 4NZFA 4WLCA 1ZD6A 2VQ1A 4XI5C 3K72A 3BP4A 4K3EH 3TYGH 4Z78A 5AW6B 5E94A 5C0IA 1ORQA 2ALWA 3ARDD 3BPNC 4ECNA 2IDTA 1RLBA 3AY2A 3QFJB 4KRNA 1M9SA 2UVFA 3BAWA 4OKVB 1XSIA 4UNTA 1CJYA 2XPYA 3SDXF 1OAZL 1NKGA 2J8UB 3QIUB 4RGNB 1SLWA 1HXYB 1JVLA 3TXAA 2V7NA 4M1CC 4I48A 2OZ4A 2O5NA 1JDCA 1RIHL 3BP7B 3QIWB 4Z3EA 1NCAH 1L9SA 4HC1A 3HOGA 4AK1A 1FIGL 3P3YA 4ACTA 2HP4A 1XTLA 3UP6A 4RDQG 1RULH 1IGIH 4RQQA 1W15A 4L8SA 5I1LA 1G0XA 2B4CL 4KO9A 2R2EB 3V4PH 3SYCA 4LE8A 1CXKA 1FH2A 1IC0A 3R7QA 4XMUA 4QRSB 4N2LA 4QT5A 4BHUI 2ISDA 1RP9A 1FFRA 4M48L 3WFCH 3BVUA 3QFJD 3IMRA 4MA7L 5KSAC 4D9RE 5LN8A 5FM4A 2Q8AL 5KYUB 3QIUD 4RGND 4RISL 1NDMB 3WKQA 5AWNH 1ZV5A 3JYCA 2CBMA 3CHPA 5HJ3A 4Z7OE 1XGUA 3QS3A 4YN3A 3QIWD 1UD3A 2P8MA 4O02A 2HJLB 1IAOB 2COQA 4WW1B 2V8LA 1G6RL 4UWQB 2FSEA 1UXWB 4BQ9A 3QG6A 1KYAA 4DVRH 3D48R 2VDRB 1ZANH 1QI4A 3G9AB 4NUMA 4RMVA 4NC1C 1F4AA 3SDAA 4TNWF 4YHYC 2NX5B 3MLTB 5I23A 1OP5K 2YD6A 1NEZB 3IDIB 2Z91A 2CHNA 4FQIL 4GKOA 5HD8C 5JW4R 2WJ5A 1KSRA 5H37A 3ARFA 1T2QL 4FA7B 1CGVA 2CR0A 1CGUA 4J12A 4N26A 3WIFB 4X9BA 3CVIL 2XBTA 4GMSH 2B5IB 3TO4C 3DI2B 4JMXA 3ALWA 5I5MA 4YEFA 3AREA 1PNDA 2X6UA 1OAXL 4Q6IC 3IDYC 3O11A 4N2IA 2ZUTA 1SJXA 5GZND 4AGNA 1X4XA 2VABB 1T0PB 3CH1B 3HFFA 4NDMB 4Q9QH 5F7WC 4ACPA 3LPWA 3AQZA 5CU5A 2VSDA 3BUPA 2NX5D 2OQJB 2OX5B 2QGDA 2QQKH 3MV11 4PJAA 1I8LA 1ZHBB 2YK1L 3LXCA 3FBQA 1LM8V 3P4LA 4J3UA 5CN2A 5F88A 4IU3A 4C47A 4AIZB 2E7LA 1XSOA 2I60H 5D2NB 5F7BA 5F96H 1TTAA 5BZDA 4GW5B 2P5EE 2YAHA 3I85A 3VFUB 3EOAB 5EUKB 2EH8H 1MEXL 4MMZC 4TF4A 2Y25A 2YA1A 4WHTA 3S0PA 1W0VB 2H47C 4Z76B 3DX3A 3M17A 3BAKA 3HPLB 1LL1A 3PE9A 3UYPB 4NX0A 3SPGA 4RFEA 2LE9A 3SZKC 4LL9A 5JXAH 2NTFB 2ZXWB 1LNUB 2WMPB 2WXNA 3SE4A 5IJKA 3VX0A 3Q5TA 2ZCKL 1PCSA 1AZUA 1XF5A 1U8HB 2J8HA 1I3UA 4JB9H 2FCBA 2K8MA 3B9KB 1JD9A 5F7YC 2PCPA 1JHTA 3BKMH 3D69A 1R0AH 5IQ9A 1N68A 4MWFA 4G9FA 3QYCA 2O5XL 4YLCA 4NHUA 2W1NA 4AGMA 2XQYA 3G08B 2X4OB 3CPUA 3F6IA 3L7EB 3QA3B 1RZFH 4ZFOL 2EABA 3WE1A 4G3YH 1XF3A 1UT1A 2PWEA 2OMWB 4N2GA 4XC1H 1AKJB 4APQA 3B1UA 2X41A 1NM4A 3IT8D 4WSGA 2NY6C 2Y06L 4FTDA 4PGDA 1SEBB 2CDFA 2NUTA 5BW7A 2CO7B 4UMSA 2EDOA 4HCRL 4G42A 4LLQB 1EZVY 2X4NB 3B9KD 3HMXL 4UINL 3W9EA 4XN5A 3H7BB 3O2WH 1DSYA 1E27A 1MREL 4JFQA 2OMXA 2W0KA 4FRWA 1A1MA 1MCCA 3GGWB 3N50A 3RZCA 5J6GB 2ZYHA 5C09E 2X4TA 3W3BA 1NPJA 2BSRA 5AAMA 1UZ6E 4OD2A 3HBGA 4X6CF 1A9VA 3C6SB 4K9EC 1PD1A 4G6KH 4JQIA 1HSBB 3ZYJA 5J5EA 2WN3A 1AKJD 4AG4L 1CL7L 3L5HA 5A16B 4QOKE 4A38A 3CXHK 2R23A 1FORL 5H35A 3GJEA 3G5XA 3BYYA 3OKNB 4DP5X 1BF5A 1Y6NR 3KEHA 1J0JA 2Q76B 3AS0A 4F7CB 3CLFH 4MKMA 2EDJA 4XVSL 4GPVA 2CD0A 1RJLB 3ZE0E 3DA0A 5DO2C 3MRMB 5KS9B 2EUZA 3Q6GH 3HB3C 1TTFA 4AEFA 3EBGA 1V05A 3HNTH 4PJBE 4UM9A 2GSGA 3BD3A 1IIIA 1OP9A 3MSPA 5IR1A 5DS8B 5JA9A 4P2OC 2BSTA 1AZN