1ZIAA

Oxidized pseudoazurin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
b'ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Crystallization and preliminary X-ray studies on pseudoazurin from Achromobacter cycloclastes IAM1013.
pubmed rcsb
molecule tags Electron transport
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1996-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ziaA00
4E9YA 5EHFA 4Q89A 1IBYA 4QLWA 1OE3A 2PPAA 4PCYA 1E5ZA 1DYZA 4PAZA 1M9WA 3WI9A 4YSEA 1GW0A 3IE9A 4HZ1A 1A4BA 4DP4X 2QPDB 1NIFA 3N2JA 1HAWA 1BXAA 5I5IA 4ENZA 2J57A 1J5DA 2I85A 2Q9OA 3NJFA 1OCOB 3QPKA 1SHXA 2ZOOA 5LDUA 4FA7B 3OD3A 1JXFA 4GP8B 5F7AA 1B3IA 1NICA 3FSAA 4N4YB 1OOWA 2Y1AA 4DP7X 2EILB 1J9RA 2XX0A 1WA1X 3TASA 3QJSB 3SBPA 3NYKA 3UAAA 4WKXA 1CUOA 1KBVA 4DPBX 2GI0A 3EH3B 4E9SA 4YSUA 1ASOA 4Q8BA 4BDVA 1ILSA 2PP8A 2BP8B 2HRGA 4KO7A 2YQBA 2GBAA 2DYSB 4BXVA 3NJGA 4BDVB 2RACA 5B7EA 3OMIB 3T6XA 3ERXA 2H3XC 1W6LA 4YSOA 3V9CA 3NJJA 4HHWA 4BXSV 4K9JA 1OF0A 1ETJA 1BQRA 1KGYE 1R1CA 2P80A 1NINA 1A65A 2P80D 2FQGA 4DP5X 3N55A 3T6WA 2E86A 2GC7C 3EH4B 1AACA 1BQKA 1V54B 5B1AB 2AVFA 2BP0B 3FU7B 5I6MA 3AY2A 1BEXA 1OCZB 4E9RA 1AOZA 2IAAC 3EH5B 3S3DB 4UF7C 2WO2B 2CAKA 3MBWB 4DPCX 3T6VA 1WA0X 1XB3A 1GY1A 1TEFA 3CVDA 3PAVA 4M3HA 1W8EA 5PCYA 4N8UA 3FPYA 5AFAA 2XV2A 1FA4A 3KW7A 1AAJA 1MG2C 3FU8A 1E65A 4GXFA 5D4IA 3AZUA 1OE2A 2ZONA 3JT2A 5PAZA 2CCWA 5I6NA 1PCSA 1BAWA 2MTAA 2XWZA 4W9ZA 4HCIA 2ZXWB 1PNCA 3PAZA 1GS8A 3IBOA 3UGEA 2FJSA 1A8ZA 1JERA 2IWKA 3HB3B 4KNUA 2I7SA 2PP7A 1KBWA 2EIKB 4A2GA 2FT7A 3NJKA 4L0PB 3FYEB 5I6PA 1DZ0A 2FQEA 2YXWA 2J5WA 1NDTA 2XXGA 1RZPA 1A4CA 2JKWA 2VSMB 2IDSA 2CALA 3EF4A 2IH8A 3SBRA 3UACA 1ILUA 3NSDA 2UXGA 1WS8A 1NIDA 9PCYA 1PF3A 2GSMB 3FSZA 3V9EA 3AG3B 5D4HA 1L9SA 2AFNA 4YSPA 2AZAA 1AIZA 3PPSA 1PMYA 3CVBA 3KW8A 2OCCB 1ZPUA 1KDIA 2UXVA 4DPAX 4CSZA 3T6ZA 1PLAA 3TA4D 2XLLA 3ASOB 2A3TA 4JKNA 1AS8A 3TBBA 2YARA 2TSBA 4A2FA 2HX9A 3FT0A 2JXMA 4JHUA 1AS6A 2QT6A 1SDDB 1ZDQA 2VSKB 4GY4A 2EINB 2R7EA 5FC9A 2FT6A 4A2EA 1SFHA 4MFHA 4KOBA 2X87A 5AZUA 2UXTA 4EF3A 2HX8A 4HIPA 3CG8A 2PPDA 5E9NA 1TKWA 2XV0A 3S3BB 2YAEA 1ASPA 2VN3A 3NJNA 2VM4A 1BYOA 1MG3C 1AR1B 2VW6A 5I5MA 4DP0X 4ZK8A 2DWSA 4BK5C 4KNTA 3TU6A 2OV0A 4BWUA 2YAQA 3ZX1A 3NJLA 3SBQA 1M57B 1VLXA 4W1TA 1RZQA 1WA2X 1JVOA 1JVLA 3PAUA 4RH4A 3T71A 3FQ2A 1BXVA 5B1JC 1GY2A 1JZHA 1N70A 4NB7A 4E9WA 4AI7A 2UX6A 1JXGA 1JOIA 2GHZA 1MZYA 4G7SB 4NAJA 1M56B 2H5UA 1UATA 5I5JA 4A2DA 4F2EA 3QQXA 1E30A 2OJ1A 2VW4A 1BXUA 1CYXA 1KCWA 4YVNA 2XU9A 3OQRA 3TBCA 2AANA 3SQRA 4YVUA 3GXUB 3H4FA 4YL4A 1FWXA 1AG6A 2BWIA 3AG4B 3WKQA 6PCYA 4G7QB 2BO0A 3NSCA 5I26A 4FAAB 5F7BA 1PZAA 2W88A 3GDCA 1NIEA 2TSAA 6PAZA 1AS7A 3HEIB 3IEAA 4HAKA 5TK2A 1BYPA 3NSFA 4A66A 3X1NA 2VW7A 3ABKB 5D4JA 4E9TA 2J55A 4GP4B 1KYAA 3X1EA 2Q5BA 4YSQA 1AANA 1JXDA 1MZZA 3NP4A 2FQFA 1J5CA 1I53A 2YAMA 3H4HA 3FSVA 1ET8A 1WS7A 1E67A 3PXLA 4G7RB 4HCFA 1V55B 5IY5B 5I6KA 5B3SB 2IDFA 1JZIA 2PPFA 1QLEB 2UX7A 1QHQA 2EIMB 1ZV2A 2VMJA 1JZFA 3OM3B 1CURA 4DP9X 4P5SA 1PY0A 3C75A 3PLYA 1NPNA 3ABLB 3FSWA 3IN2A 5A7EA 2H47C 1ZIBA 1RKRA 1URIA 4E9VA 1XB8A 1RCYA 2MRYA 1JZGA 1AG0A 4BWWA 4G70B 4DP8X 4AKQA 2YXVA 3WNIA 1X9UA 4NERA 1OCRB 3FS9A 3G5WA 4P5RA 4DP1X 1OCCB 2FTAA 1L9OA 2PPCA 1SFDA 2FT8A 4JHVA 3WIAA 1AZBA 3NP3A 3AW5A 4DP2X 2YAHA 4X4KA 5B1BB 1AZNA 3U25A 4F7KA 1F56A 1ID2A 2GB2A 1ET5A 2IDTA 3QJTB 3DTUB 2QPEB 3X2QB 5B1KA 2XXFA 2ZWNA 2QDWA 1OV8A 2YAPA 1NWOA 3QJUB 2GIMA 3UAEA 3QJQB 1YLBB 1HFUA 2X88A 2PCFA 4E9XA 4HHGA 1GS6X 2R7EB 2PPEA 3BQVA 4M4RB 3NJIA 7PAZA 4KO5A 4KO6A 4UAHA 1L9RA 2IWEA 2CJ3A 2I7OA 1WAEA 3X1FA 1ET7A 1J9SA 4F2FA 2BWDA 4A67A 2WO3B 1GYCA 4HALA 2HLEB 3IN0A 3QJRB 2DYRB 1V10A 1IBZA 2BHFA 1NIBA 2FWLB 2BZ7A 2BW5A 1EZLA 8PAZA 1CC3A 1FFTB 3AG2B 1XMEB 1TU2A 2HZHA 2JFCA 2J56A 3ABGA 2QDVA 3OMNB 1T5KA 3RYMA 1IC0A 1SJMA 2EIJB 4YSTA 5I6LA 2YAFA 4AX3A 2IDUA 3ABMB 1NTDA 1NZRA 1W6WA 1HAUA 2YAOA 2LLNA 1PAZA 5AKRA 1ZIAA 3T9WA 2Y69B 5TK4A 3WG7B 1PNDA 3L45A 2BP8A 2BZCA 4KO9A 4AZUA 1PLCA 3QJVB 3PCYA 4E9QA 1JZEA 2IDQA 3S3CB 5I6OA 1AZUA 1PLBA 2PLTA 4QKTA 1AZRA 3S8FB 2IWFA 2PCYA 2FNWA 3ASNB 4A2HA 4CSPA 3BVDB 3NJHA 1OE1A 1IKOP 1SF5A 4WTQA 1N68A 1NPJA 3AG1B 2BP0A 3FU7A 2UXFA 1J9QA 2HXAA 2CBPA 2IH9A 1E5YA 2AZUA 1QNIA 1ADWA 3CZUB 3NJMA 1X9RA 3S8GB 4YSDA 3DIVA 7PCYA 3FU9A 1SF3A 4GP5B 3GYRA 1KCBA 4AKPA 3OMAB 1NIAA 1AZCA 3EHBB 3NT0A 1IUZA 1SNRA 4G71B 4YSCA 2XX1A 3FQYA 4YSAA 1KV7A 3ZBMA 1JZJA 2FQDA 1GSKA 4A68A 1TEGA 3H56A 1PZBA 1A4AA 2WSDA 2DWTA 3ZIYA 2XV3A 1ZDSA 2HX7A 4KNSA 3UABA 1CYWA 5B1JA 3NSYA 1KDJA 2XVBA 2DY2A 1PZCA 1AQ8A 1J9TA 1EHKB 3CDZA 5B7MA 5I28A 1SHWA 5B7FA 3DKHA 3MX0B 2W8CA 1GR7A 3UADA 2HRHA 1GS7A 3CDZB 4G72B 2CUAA 3FYIB 4GYBA 4BWTA 3X1GA 2VM3A 1ASQA 2XUWA 3CVCA 3X1BA 1A3ZA 1MDAA 3FPXA 2PP9A 4DP6X 2GC4C 4AKOA 4HCGA 3WNJA 1NWPA 3ZDWA 5ANHA 4UANA 4KOCA 3JTBA 4YSSA 1L9PA 2B08A 3D12B 2NRDA 4TXVB 2BW4A 1L9QA 2B3IA 2DV6A 1BQ5A 2XYBA 3FQ1A 2N0MA 1L9TA 1SDDA 3WKPA 4YSRA 1XB6A
chains in the Genus database with same CATH superfamily
2AEQL 3L95B 2Z4QB 3MNWB 5DJYA 4YGVA 1OE3A 4XN1A 5MERB 1I4FB 2XIDA 2ZYRA 4AUJA 3IDXL 1F3DH 3BRFA 1OL0A 5DJYB 1KTDA 5C3LD 4YGVB 4MJID 2XWTB 3OKNA 1KG0B 1FH5H 1CLZH 3C5JB 4F8PA 3IVKA 5A2FA 3LXUX 4WEMB 2PXYB 3VTAA 4NUQA 4UT6H 3H0TA 3HAEG 2WXIA 4NZRH 5I74B 2FLBT 1N10A 1INDL 1QZ1A 3GMQA 1P84J 3ZW3A 1FO0H 4IDJL 3CAFA 4LSDA 3MV7D 3B2UC 4RGMB 5HHVH 1I9EA 2IG2H 3OKLB 1GL4B 2AKRA 2BVEA 3MRDA 1QOKA 4MA8H 3TBSA 3VFRA 1ONQA 1LO3L 4OF7A 4I0KA 3A23A 5E4IA 2L7UA 3CQFA 4FFZH 1CLVA 1XZ0B 3SBPA 4NN7B 5CCKL 1Z9LA 3I6GA 4LL1A 3REWA 3R1GH 3U4KA 2WLJA 4UINL 1F3DJ 3WD5L 4AH2B 1LDPH 4H1LA 4WU7B 3QUGA 2BFGA 4DO5A 1MHPH 5CJOH 4EN2A 1NANI 4K23L 4I48B 1I1YB 3ARFA 3IYLW 3WMQA 5BMFL 4FF9A 4MASA 3P9LB 1QLFB 4O02L 4JFWA 5KTEH 3MROA 3T6XA 4IIZA 1GOGA 1KBBA 5FX3A 3U4AA 3CMGA 4XBEL 1QBMH 1BZ9A 1AC0A 4TPRH 3CSBA 1F58L 1Y18A 3K8LA 4KXZI 3SPGA 3ZJAA 4XBGB 35C8L 4Q0XL 4JHWH 1NL0H 1XGZA 4GEJA 2WBJD 1NGQL 4Y4FB 4NIKB 1NCJA 2Z31D 1I8IB 4R4BA 2H9GA 1QI3A 1F4YH 4JQVA 2DRUA 4X5QA 1U2YA 3UTPD 1LO2H 2WO2B 2HFGL 4DPCX 2FO8A 5EU5A 3VQLA 5EF3A 4PRDA 1QUNB 4WI8A 4XVOA 2RFXA 3T4AA 3B6SA 3BSZA 2BZDA 4S0TD 4PRDB 4GIOA 1MHHB 3QORC 1LLAA 1FO0A 1FORL 2K7QA 3GLAA 4G42A 2Q87A 3WEOA 4ZTEA 4MA7H 3EGSB 4LCIL 2FLMA 1FO0B 1ZTXE 1S9YA 1DFBL 3ZYIA 2ZONA 4G42B 3BPLC 1MJ7L 2OI9B 4TUJB 5IFAL 1GS8A 5LWYL 4P2AA 2CBMA 3QA3A 2OSWA 1JERA 4GG6E 4NN7C 1WPCA 4OSUH 4QOKD 3IMWA 1NPUA 3FCGA 4F7TA 3BRGC 1OAXL 2DLIA 4U6HB 4KI5E 4HG4K 1YEDB 1MW3A 4NO0B 3SOTA 2BFVH 4J6RH 4LKCA 2HWZH 2WUBH 1FV1A 3TN0D 2XXGA 5FFGA 4M02A 1UM5H 5HXMA 2EIDA 3QCVH 2V5SA 2EYSA 1E4JA 1TJIH 1RZIB 3GXTA 4M00A 3N6YA 3GFUA 2CO3A 5JUEH 4RAUB 5F0MB 4HSAC 1YYCA 3PJLA 5FHBL 2ADIA 2AV7A 1W15A 2BVTA 3DETC 2GBUA 2WLMA 4JGJA 3UTZB 3KXFE 3G9VA 3OKEB 1YQVH 2VWEE 4MMYA 2CO6A 1DJWA 1PMYA 2AV7B 3NRFA 3E6FA 2EDEA 2VLKE 4X99B 2WZPA 3ZQ9A 2O5ZH 4M9PA 1OANA 4K8RC 1OGTA 3SGJA 2BVPB 1MREL 4HD5A 4LMQI 2GI7A 5J6SA 4MSWA 3BH8A 4Y4KC 3C6SB 5GQBA 3BDYL 1SFHA 3KPLB 5DT1L 3W5NA 4PRIB 4G6JH 4QHKI 1TOXA 5DJ6B 3O0LA 4HJGA 3QXDB 3T08A 2ZP8A 5D1XE 1I1AD 2Y6SC 3QT2A 1GOFA 3LSOA 3L54A 3KM1A 1BFVL 4H13C 5IF0A 4L23A 3NOIA 2GPZA 1C8PA 3LSOB 3CDGB 1XCXA 2OP4L 3JT0A 1I7ZB 5HJ3A 2AF2A 2OV0A 4XR8C 2V37A 5K69A 3GSVA 1CFNB 1A7OL 5EIIA 1YEJH 4QTHA 5LAPA 3PAUA 1A4JB 1M42A 3GSVB 4YPGA 4DJMA 1MJJB 1U41A 1QO3A 3SIKA 2Z7YA 3IKCB 5JOPD 3W2DL 2BSED 4PVBA 4EO5A 2E8YA 2Z7ZA 3ULAB 5DO8A 2WLNA 3S96A 1UATA 2MIZA 4ELMB 1OWRM 3GKZA 2OMUB 1E30A 1QBLH 3SPVA 4PWKA 3QEQD 3NJXA 5TE7L 2XT1B 1A9BA 1FL5B 2EACA 3EBAA 2VRKA 3N9GL 5FAAA 3SPVB 4F7EB 3N43B 4MNQE 5SWZD 4WJG3 5CGTA 1FWXA 2ZXGA 4UT7L 1O7SA 1A9BB 1NOLA 2ESVA 3CIQA 3VFTB 5I1DA 3QPXH 4FMVA 3NSCA 5KJ7E 4GG6F 3KMDA 1A7PH 3V4VA 1ZANH 3L17A 4NQCE 4FYRA 4ZMXA 4Y7MA 4KI5F 1EEYA 1MXGA 1FLTX 3SKJL 4PJDA 4XPTL 2Y07L 1AMXA 1D9KD 3SDCA 2CLRB 2VR5A 4WNJA 5D4JA 5TQ2H 5IOKA 5FYJU 4PJDB 2Q5BA 5GRUL 1JXDA 4M61B 1JWSA 4ODWA 3KYMA 2YAMA 4AMWA 1OF2B 3BDXA 5EORH 5D7JC 2MQGA 4IRJA 2ADFH 2XFXA 3CPLB 3HOGA 4LLQA 2AQ1A 4FQCH 3V4UH 1LP9F 2PPFA 2BNRD 3BISA 3IRCA 4KZ0A 4CNIB 1ZWIA 1KYOJ 1RIVL 4RWYH 4LLQB 4KJPC 1QEWB 5EPMA 2E9WA 4FFWD 4U2ZA 3NESA 3TO4C 1WISA 2YRBA 3C75A 1ZWIB 3S4SG 4BK4A 4ERSH 2FH6A 1WIPA 4QKXB 1G9MC 1DSWA 2AK1H 4AQAB 5CAYB 4DUXA 2EYTB 2VLRE 4A7QA 3NCBB 2XQ0A 2IV8A 4C56A 4HBCL 2A4EA 4B9ZA 1QA9A 3HHSA 3PF2A 3HTLX 2DQCH 2AEQH 1MCPL 1QA9B 2YXVA 3OX8A 5C3TA 5DMIL 2OQJA 3IDXH 4FKKA 4KKLD 4WCYL 1MN4A 3CQQA 4I2XA 3SCMD 4XP6L 2XC8A 3B9KB 4FS0A 4PTUA 1MCHA 2WM0A 5AVZB 1UT1A 5C08E 1KELH 1EEQA 1AQDA 4PLKC 5BV7L 4L4VB 1INDH 5GGQL 4IDJH 5KVGE 3RWIA 1YYLL 1AQDB 5LGKA 1AZNA 3U30C 3N1MC 4BHUI 4Y5VC 3FHAA 5I0YA 2X4TB 3GSUA 4RFEB 3RWIB 1LO3H 2DLFH 4OLXH 4V2BA 2ZZUT 4AVHA 4GRWF 3ARYA 4UINH 3WD5H 3QJUB 4PG2C 3T0EE 4GIPD 1XGQA 4Z77B 3JWOL 3RPIB 2Y4SA 3W5MA 1BVZA 2X88A 4K23H 4HS6B 1PG7L 3PV6B 4IRZA 4MVBC 4JHAL 5D1QC 3W0WD 4CMMA 1L9RA 4N68A 4O02H 4DQAA 3X1FA 1KTJA 2DQDL 2WSPA 3BW9A 5DZLA 3QDMD 4XBEH 3TT1L 1F58H 1I8KA 3UP6A 35C8H 1ZVNA 4Q0XH 4HS3A 1UD4A 2G0LA 3LKNB 1XCTA 3W81A 1I8KB 2XQBH 1G94A 3KWWB 3UYRL 5LHDA 5ELIA 3LIZL 1A6UL 1OWWA 3LNIA 2WWMC 4PJ7E 3HE6A 1BLIA 4L37A 3HI1B 1FAIL 3LRMA 5HYJE 3QI9B 1H15B 2HFGH 4DKEL 3EYQD 2ZNXA 2HRPL 4CVUA 1OSZA 3KVQA 1HAUA 4OLWL 1RLWA 4WHYG 2XQYG 5E94B 1XXDC 1AFVL 1VESA 1S9WA 5DMGC 4G9DA 5F7FA 2E75C 3LQZB 1ZIAA 3EFFA 1B0WA 1L0YA 1P4LB 1XF1A 3FXIC 4LCIH 1UZGA 2PO6D 5IJCC 3WY2A 3S0PA 3D0LA 4JM2A 2V2XB 4P05A 2ZUWA 2R2BA 3MRJA 5DD0H 4CVWA 5LWYH 5IFAH 5HY9B 1ZHBB 5C2BH 2UY6A 3SZ6A 3M1BB 2YIHA 3T5WA 3WL9B 3PWLB 4RRPM 1DUYA 2W95A 5F88A 4U3SB 1WH0A 1OAXH 3VRLE 2WQAA 1PU0A 4HIHA 2F19H 4LEBA 5F7MC 3NJHA 4YIQA 3PU7A 3VYPA 3B2VL 3WTSA 2BP0A 5GJTL 1XR8A 5MENB 4O02B 3MLTA 3MJ9L 1T04A 3F7LA 3L6FA 3UBGA 3WJMA 1E5YA 4LGRB 5IMLB 4ZFZA 5A6IA 1XR8B 4N0CC 4V1DB 4TVPL 5MI0C 5D55A 2X1XR 4G3YL 5LO7A 5AW4B 4XNYL 5CXPA 2KLRA 4NDMB 2UV3A 4XMKL 1G1KA 4G7YH 5FHBH 4MB5A 5CD3A 4HSCX 1WIOA 4HLJA 2DOCA 4KZCA 4OJFL 1GKEA 5F44A 1WFUA 3BOVA 5KEZA 4MS8C 3QUML 4UV7L 5DXWA 1MREH 1P5VA 1GSKA 1ZLVH 5I6XB 4J12A 4RA0C 1YY9D 2PWEA 4NM8L 4Y1AA 1V3MA 3T3PE 2H1LM 1XF2A 1CR9L 4N5ED 3NCWA 5HDBB 3BDYH 3LRHA 5AAPA 1EFXB 2BPBA 5DT1H 3UPAA 4Y1AB 3WJLC 5AEAA 2XV3A 1ZHKA 1RMFL 3MRRB 4HZAA 1LO5A 4JFDA 2AJ3A 1DQLL 3MGOB 5HHNB 1O6SB 3K6NA 1LO5B 1BFVH 4YDJB 1FGVL 2VLJB 5HI3D 2XG4A 2H32H 1G9NC 1GR7A 2OP4H 3W9EA 4ZO6A 3LN4B 4X6DF 1Z5YD 1TJMA 2XG4B 2XVKA 1LTXA 3D6GA 1AZVA 4PJ7F 4HGMA 1A7OH 5CLTA 3CMOL 4JDEB 4MXQD 5F1SA 5D5MA 4QHMB 4PJ5B 1QRNE 1AC6A 1HKLL 4ZUTB 5E23A 3W2DH 1L9PA 2X40A 1AMYA 3EGDA 4GSDL 2XDHA 2QQKH 3OWRA 1BZ8A 1OP3K 2X70B 2A74A 5KOVC 3PY9A 2BIOA 3QNZB 2CUHA 2ERJB 5A3ID 3ZL4L 4P46D 1F18A 4JFZL 1XB6A 3MACH 4ODHL 4E9YA 4Q89A 5TDOB 4OLZL 3N9GH 4ZS6D 1AGEB 3WI9A 2OMTA 5ES4B 3QO0B 1DANT 4UT7H 4M3JA 5AOKA 3SDXB 3M86A 3EOBA 4DP4X 4JRWA 4ZAKC 2NLJA 4N3UA 5CEZD 3QIWD 5ERWA 3OHXB 2Q9OA 1A0QH 5BO1L 5E4EC 1OCOB 3SKJH 1KCUL 2Y7NA 3FQWA 2NY6C 3MLWH 4XPTH 1XQ4A 2Y07H 4AYBA 5C9KA 1CQYA 3PJNA 4K7PL 5I6XC 4LSUL 4N2KA 1TNMA 5CUSL 1B3IA 2PCPA 1RJZB 3FQWB 2A99A 3EYVA 2O6PA 4N4YB 5GRUH 3KPSA 5HI5C 4DP7X 3RVVD 1KN2L 3VWJA 1Z5HA 3GRWL 2VXQL 5AQ0A 4LPUA 3HG4A 4LSQL 1NGZA 1FE8L 3WHXA 4M5SA 3VWJB 1VRSA 4WJ5B 2H6PB 1QD0A 5DCCA 4E9SA 1WJ3A 3MKKA 1RZFL 3QZMA 4NXKA 1G7QA 3MXWL 1XTLA 2H32B 2XJLA 4P5KA 3FQ4A 1P4IL 2VN7A 1F0LA 4HUUB 2WYZA 2DEYX 4NUGL 1TCRA 5F21B 2Q76A 1NBYA 3ZOAA 4B9JA 3F83A 5JO5A 3NJJA 2BCKB 4HBCH 1OZTG 2R1YB 4FQ2L 4NXSA 2JI3A 3SOBL 1OGAA 1NBYB 4JJ5B 4XC1L 1MCPH 4UWQB 5BRZD 1WBZA 2BJML 5DMIH 2F1AA 1DVFB 3EH4B 3FFCD 1WBZB 3QXUA 1MCBA 2JLLA 1QNZL 3FRPA 4WCYH 4XP6H 1KEGL 1AOZA 4XO8A 1IAIH 1U4FA 2EUWA 7FABL 4YS4A 5HHXH 5FLVA 5BV7H 2CLVB 5IQ7L 1KB9J 3H6AA 4KQ4L 5GGQH 4KRLB 1FL6B 4R5VA 5K59E 5IK3B 3ATAA 4UIMB 5B3JF 4ZXBA 1CICB 4JN1L 2HVBA 2NXYD 3P9MA 4L1HA 4XNAA 3OHXC 4X8GA 3VI4E 3MO1B 1I7RB 1U6AL 3UTTA 1D5MA 2JI1A 3U9WA 2GFBA 4X5WA 2VR6A 3UTTB 4JO4L 1WUZA 1PCSA 3JWOH 3IXAA 4DWHA 1A2YA 3F3HA 4AW7A 3IBOA 4QRRB 2YBRA 2O5XL 5GPRA 1J7VR 2PP7A 5EUKA 1JPSL 1A2YB 4PJCB 5FA3A 4Y2DC 2DQDH 3NJKA 5EN3A 4AQ8C 3O3DB 3RFZA 3ULVD 1TG8A 2GJZB 4IBQA 3TT1H 4KK6D 5I8KL 1KLUA 2NR6C 3LZQA 1WBYA 1RZPA 4ZDHB 4AVJA 2CE6A 5JYLA 2IV9A 1IM9A 3FN3A 3OXRB 1YMMB 1U8HA 3UYRH 4XOEA 1Z9NA 1KLUB 1TQTA 2MH4A 5I1GL 4MA3A 2IH8A 3LIZH 5JNYA 4QWWC 2DLGA 3UACA 5J9PA 3NSDA 4P2RB 6CGTA 1WS8A 1FAIH 1RULL 4LEXL 4MA3B 2CHNA 1NAMB 4ZQKA 1NCDH 3A6BH 4BH8B 3DROA 3VB9A 2YEQA 2G75B 1CG9A 5CNHA 3ARDC 3KVPA 4UQ9A 4I9WE 4NQXB 4ZQKB 1KDIA 4OLWH 1SYSB 5JMRA 1CG9B 1AFVH 2BK8A 2XBDA 4X5LA 1AS8A 5JXAL 2DW5A 1OTSD 2DBLL 2QKIB 3FT0A 1K9TA 2X4NA 5CHNA 5EFIA 4A2MA 5BV7B 1ZDQA 1BVNP 2DQMA 1ZV9A 1OAKL 3CXHJ 3BUBA 4M4RA 5SX5H 4ES8A 4YXLL 1BV8A 4KMTL 2MCAA 1WFIA 5AVXB 3HLKA 4MX7A 3SJVD 1VGEH 4L2YA 1MCDA 3BVTA 2HX8A 1CMOA 2PPDA 3V5KB 4MX7B 2XWXA 2VQUA 4NBZB 4XHJC 4XXCA 3WLBA 4HJEA 4OCWL 2NXZC 3FZUC 5TH2B 1VPOH 2XRAL 4XNQB 1FYHB 1ZTXL 4OJYA 4DP0X 2DWSA 3OKKA 3MJ7A 4IRSD 4XBPA 3T8MA 1JNNH 3B2VH 4GO9A 3NJLA 5GJTH 2NW3A 3SBQA 2A7BA 4EJ1C 1ZT7A 1PTZA 3MJ9H 1XGRA 3TF7C 4LLDB 5GIRB 3O6FA 1E42A 4EN3B 3QJFA 4TVPH 2BM3A 2EEXA 3ARBD 1GY2A 1XGRB 1CTNA 1N70A 4G3YH 4XNYH 1WD8A 4GKZA 4XMKH 5K59F 3FO1A 1HCFX 1JXGA 1MHCB 1XCQB 4K5OA 4XPHL 4XNXH 2DM3A 3LIZA 2GHZA 3VI4F 3DHJA 3HCVA 4JZJC 1CGTA 3QQXA 2QR0A 2NY3C 3R0NA 3J8F7 4XCNA 2QR0B 4IW4C 4ABVA 1TJXA 3QUMH 4UV7H 2JELL 4V2CB 1IVTA 5AW1B 3FMGL 2ZE0A 3KPRB 3OF6D 3PQYB 4NM8H 1WTLA 1K72A 3C5ZB 1CR9H 3WHE0 4NNPL 1H8SA 3OB8A 2LFGA 3AB0B 4PGBB 2A6IA 2XV6B 2B4CL 1RMFH 2G60L 3OB0H 4PJ9A 1J18A 3HS0C 5A2JH 1DQLH 2FVNA 3P3TA 4NUMA 5IEKB 4WU5B 1IX2A 1LEIA 2AXFA 3QQ3B 3SGKC 5J8OA 1HZHL 4W9HC 1MZZA 2CRIA 3L4YA 1S7XB 4UM9A 1AHMA 4WO4B 3ULUC 4RRPG 4R26L 2AXFB 1IM3B 5AKTA 1X7QB 4QHUB 1QFUL 1F4WH 2R23B 5K9JL 3CMOH 1JZIA 3FCSA 2QZ5A 2Y9RT 1QHQA 1QMUA 3FOLB 3JV5A 4UDTB 1BA9A 1E8XA 1YYML 2NPLX 3QVAA 4TKWA 1HKLH 1NMCB 3ZRFC 3MJ9A 3H9HB 4WTWA 5IUSA 1XL4A 4GSDH 2JKJA 2FATL 3K72A 4NC1C 2P5WD 4DGVH 4KKZA 2XWCA 4HFUL 3K72B 3SGDH 3VWKA 1RCYA 1KOAA 3ZL4H 2D7QA 1N0LB 2XG5A 4JFZH 4ODHH 3RG1C 4KJWD 4OLZH 3P9WB 4PSRA 4W9FC 5IROD 2DS4A 4JO2L 4H8UA 3DARA 3GSXB 4OZGA 3LRKA 2O30A 1L6XA 3QUMA 4PJHE 2X4SA 5F96L 3GGWA 2IC2A 1L9OA 3NIFB 2CSPA 3VD0A 1BEYH 2X10A 3QUMB 4HEMA 4YBLB 1UKTA 5BO1H 2EDBA 4YHPA 3V0AC 2YD1A 1LE5B 2CU9A 3FRUA 4K7PH 1ZLSL 4FMFA 3VI3E 4EMZA 4LSUH 1S7WA 5A6MA 5DS8A 2ZWLT 4MNGE 4NENB 1E9OA 4X4YB 1O75A 1CD1A 2RIKA 3QCUL 4Z7NB 3WN5A 1KN2H 3GRWH 4CMHC 2VXQH 4X6EB 4AZ8A 4LSQH 2BSSA 4JKMA 1RD6A 3H2WA 2EZ0D 2X6MA 3WN5B 1UC6A 4KRPB 1EX0A 3PWUA 4I18C 3QUXA 3U1QA 3TESA 4JKKA 1RZFH 4XVJL 3ZDXE 3MXWH 4U7MA 4EDWL 2CDGA 1J5HA 5EBGA 1G1CA 1P4IH 4WW2F 5E2UL 1JZ8A 3JUYA 4Y4HB 2CDGB 2NUPB 3FO9A 3HIZA 4NUGH 4DVBB 5F7WC 4YC2C 5F70A 2O6DA 3EUUA 3AREB 5G2NA 5GZOD 2BRRL 4FQ2H 3RA7L 3SOBH 1JGUH 4LVHC 5I1IL 3D06A 1V10A 4XC1H 5EU7C 2BHFA 4N8CL 3STZA 5FO7A 2DIEA 3PGCA 4M4PA 1W0VA 4MDIA 2BJMH 1F42A 1IJNA 1SBSL 4J23A 3V6OA 1B9ZA 2WWKT 1X6LA 1QNZH 4ESKA 4MDIB 1DSYA 2WANA 3REVA 1N19A 1UWGL 3C87A 1G1YA 1KEGH 1DBKL 2FUTA 5DD1H 5GGSY 2ZG1A 1I7UA 1R5VA 5D7LD 3NZHL 1WK0A 2MCMA 3UZQB 4KDWA 5J12B 3REVB 3VXNB 1TQBC 5IQ7H 4QJ5B 4JFEA 2J3SA 3SKOB 1P5UA 4KQ4H 4N0YH 2FHBA 3LN5B 3BAWA 4P23C 1CLYL 2E56A 1OTUC 1T0NB 4AY0A 4AQZA 2NTSP 3RNKA 4DCQA 4G8EA 3DUSA 1U6AH 1OLLA 3T9WA 5IBTH 3HRZC 4YBLC 4KKQA 5FYKL 2Y69B 3EJYC 2UUDH 1XGUA 1MFAL 4HPYH 5H4YA 1MIEL 3BDBA 3FUFA 5JW4Q 5E9DD 1GXEA 3NZ8B 3GRWA 4OFYD 2VXQA 2X9WA 5HSFA 1SM3L 1KIUA 1QSZA 2VMDA 1JRHI 4MCMA 5KVGL 3RVUD 2Q20A 3F12B 4MJ2A 1U36A 2O5XH 2HG5A 4FFVD 4RNRA 3LNFA 1JPSH 4TLTA 5EZPA 4BSWA 3TFKC 3D39A 3FTUA 2FNWA 4C54A 3DURA 3BVDB 3P77A 1J5OL 5CLZA 4MQ7B 1ZJBA 2Q2LA 4WNSA 2WIIB 2VDQH 5I8KH 2B14A 4PJHF 4NT6A 1J9QA 3FB6B 1OSEA 2AEWA 4UOW1 3BIKA 4GUOA 2R69L 3F7VB 2V3DA 1X9RA 3SPIA 2LABA 3GINA 3RZCD 3VI3F 1RULH 3HBPA 4LEXH 3EO1A 3FU9A 1PQZA 3JQOB 1WT5A 2D2OA 4NPYB 1S7UA 3EZJB 4K94L 5IW1B 3EHBB 5KVFE 1AGCB 4PJ8A 4G71B 3FQNA 2GJ6A 1RH8A 4PGCB 3T0BA 3KEDA 3WTVA 4RQQA 2F9BT 1G7IB 2XTJC 5JXAH 4FD0A 5C70A 2DBLH 3ZDXF 5G55A 3N42B 2OR7A 1RUAL 3NPSB 5F9OL 3BP7A 3BGMA 1I8MB 1IL1B 4G9FE 4M1CC 1NEZG 3QUYC 4FJZA 3GK8L 3IJYA 3DGGB 4DGIL 4NUPA 2ZSVB 1PZUB 5GS2H 4HISA 3ZK0A 1O9ZA 1UXWA 1HT6A 3QJZA 4WGWB 1HILA 2RH0A 4OVVA 2AERT 1OM3H 4PIRF 1MH5A 2NY6D 4OCWH 3PWPE 4NRYB 5F9WC 2XRAH 1ZTXH 2DMHA 5CMAA 2F74A 3GSWA 5CU5A 1PBYA 5IB3B 2XUWA 2OSLA 4JFQB 3D50A 4N0UE 1SYVA 3PGDB 2OSLB 3MLPA 1SPDA 5C0CD 2J2ZB 2VDQB 3D12B 3G6AB 1EZUA 3O9WD 4XPHH 5EU6E 1UWXK 4NC0B 3U1SL 3VXRA 3FQ1A 1PD6A 1WWAX 2N0MA 2VMCA 4D9QD 3IDIA 4OFQA 3M88A 1ZVSB 1AIFA 1MI5E 2JELH 3NCFB 4WI0A 3IDIB 3FMGH 3IE9A 5GS1B 1L6ZA 3EHBC 3DX1A 5ECGA 2F8XC 4WI0B 4NNPH 3RIFK 3FT4A 1T89C 1NEZB 3P3UA 2MFNA 2PW1B 2B4CH 2DLHA 2OMYA 2G60H 4HIIA 4ZS7L 3AC0A 2ZOOA 2E47A 4XN7A 3NDZE 4M43L 3EYOB 3O4LE 2BINA 3DGCR 3EJCA 3Q5TA 3SE8L 1HZHH 3M1OA 2APSA 5KYNA 2C7UB 2O5YL 2Y1VA 2A5UA 1NLDL 4LRNL 4R26H 1W0WB 3P3RA 1KBGH 5IMMA 2OR8A 4FTVA 1TZ8A 4Y89A 5EBMB 4L1BA 1QFUH 1CFQB 1OVZA 5K9JH 1TO4A 1UD8A 1RZ7L 1MWAB 4Y5YA 3FU3A 5DFTA 2VT0A 5AVSB 1DN0B 1RUPL 3DNKA 4NIYE 1TTCA 2NDFA 2XTSA 3QNFA 3FT2B 4LLYB 3MCKA 4ADIA 5B7EA 2RBLA 4GG6A 2FATH 1OP5K 2EDDA 4N8PA 1ZGLA 1WFOA 1ZS8B 4HFUH 3DRQA 3Q7JA 4PWIA 3CN3A 4J3UA 2N1TE 2K0RA 4NRXA 5DZ9A 4LRIA 1ETJA 1I8LA 2OZ4H 1KGIA 1QR4A 4Y9FA 2EO9A 4LF3B 1CTOA 2KQMA 3IDNA 4GRWH 4OCSH 1ZA6B 4R96A 3ZKXC 4DP5X 4UT9L 3G04A 5IQMA 1IO4C 1BOYA 3QNYB 1BVLB 3GSNL 4JO2H 5T3ZD 2CK0L 2A38A 3SGEH 1O0VA 1DQDH 4PY8J 3WNMA 4E9RA 4QRSB 2DWDB 1LP9A 2CAKA 1BIIA 5KYXA 3MRHA 4OB5L 1TQWA 2VXUL 1KB3A 3BWZA 2XWEA 4MBRA 4OH2A 1GY1A 1MAKA 2YOCA 1ZLSH 3LH8A 3BI9X 3MRHB 5HGBA 5BVJB 1YN7A 3ZHNA 3TJEL 5D4QA 2N4IA 3KXFB 3QCUH 7CGTA 1K5NA 3HUJA 2ZCHL 5CJ5A 1YN7B 2VLKB 1K5NB 1LMKA 4QRTB 4HZLA 4U6YA 4FZ8L 1IILE 1BAWA 3EJQA 2HVJA 1R46A 3DVGB 4XVJH 4K7PX 2Z35B 4P9HL 2DM7A 1PNCA 1ND0A 5C0NC 1SLXA 1HSBA 1X44A 3BXNB 2HTLC 1HEZB 5E2UH 4HUVB 1EDQA 4NYLA 3IMSA 3KPNB 3DWTA 3N5AA 4J3OG 3X17A 1ZE3H 5J6GB 4RGND 5D1XB 1MAJA 3VFVB 4HIEA 2WXHA 3RA7H 1U3HA 2JKNA 4XHJD 5KANI 5I1IH 3NBNA 1EO7A 1DANU 1QX1A 2WP3T 1JK9B 2YXWA 3CHSA 5G5DB 1JHKH 4N8CH 1MKFA 1BOGA 4KRMB 3D0AA 1IC1A 4LKXB 1P6FA 4L2LA 1SBSH 2IQAA 3GI8L 3C08L 5ALCL 3QG6A 3CX5J 4YFDB 2RA1A 3SBRA 4UNIA 4XPAL 4FI6A 1T3FB 1UWGH 4L1TA 4EUPG 1DBKH 5I18L 1BGXL 1TQUA 3FQUB 4GBXD 3NZHH 4FN0A 1XSKA 2R1XA 4PRPD 3E6HA 5DJ8A 1H0DB 1MRFL 2OCCB 1FVCA 1G87A 3RJOA 1UH4A 4CSZA 1CLYH 3E6HB 2VLLA 4QR7A 4L3FA 5HVHC 5IBUB 2YARA 1PDKA 2VE6A 3MREB 1MCIA 1MIEH 3H9SE 4K5NA 2EINB 4U1MA 5FC9A 2VE6B 2AV1A 3L4ZA 1UWEL 3V8OA 2Z0BA 2NY0B 2VLME 4MNQB 3TBTA 1RURL 5BW7C 4U1MB 4XMLL 4KMLB 5KVGH 4NQCA 1NKGA 2BXYA 3CZFB 4GRLB 1EAPA 1S5IL 1AQHA 3DXAE 4NQCB 5IWLC 1JBJA 4PPTA 3UBXI 4S11A 5D9SA 4GAYA 1EAPB 5IVXE 1DL7L 2IH1B 3EJZC 1LD9A 1GIGL 1URLA 4KNTA 3VDAA 3VRJB 3ZVVA 1GH7A 1RU9H 1UD2A 4IEFA 1F4AA 4P57B 2AXGA 4BKTC 2IBBA 4MQXD 2NYYD 3WIFA 2Y36L 1BXVA 1IGJA 1J1XH 1TCMA 5KSAA 2DYPA 2Q3AA 2V5MA 5BRQA 3WIFB 1ZXQA 4K9EL 1JOIA 2NQ3A 4MCZA 3K2UL 2H5UA 1WIUA 3G5ZB 4TNVF 3Q6FA 4PSPA 1SOKA 3WUWA 5KJRL 3ECQA 1TT6A 1AHKA 4JQXA 3OQRA 4BH7B 2VLRB 4PB0L 5A2BA 5AW6B 3OSVA 1IGCL 2KH2B 1A6ZA 3UBXG 4RISH 1JFHA 1CO1A 1CE6B 3K46A 4UQ2A 2IFGA 1RUAH 4RMUA 4B6ZA 1KCVL 3II2A 3MAWA 4G7QB 5DK2A 1E2ZA 5L9DL 3II1A 3GHBL 4UQ2B 1A1NB 2HJLA 2VN4A 4P3DA 1IBDA 5JIQA 3BN9D 3RX7A 5D1ZA 5CO1A 4EI6B 3NSFA 4YHOL 2DEXX 2X4PA 4R8WL 1GAFH 2HTKD 3D0VB 3C5SA 5C08B 3TYFA 1AANA 1TTGA 1TVHA 4W4OA 3HKZA 3D4CA 3DUHA 3OJDB 1RJLB 1CD8A 4FXTA 1U58A 1U42A 5FUCC 5AYUH 3RWEB 2ZOTA 4U0RB 4DH2A 1E4KA 5DQ9B 4APQC 3L3HA 2CUIA 4HBQA 2OYMA 4U31A 3T0EA 5L7XL 5KWYC 1NUFA 4LPTA 4J3OC 3CDCA 4M56A 2OYPA 3L3HB 3RDTA 1ZMYA 3UTOA 3UG3A 1T1XB 5B8CA 4NQEE 3FSWA 1U8IB 2IOIA 3IETA 2CDEA 2R69A 4HWBL 4O2FA 5DJ2A 4HJ1A 4YWGL 5DMYA 1NC2A 1FN4A 5ICZB 2BY0A 4CVZB 4WFED 3U1SH 3UG4A 4O2FB 1QTPA 1YY8B 2ICWA 4Q4IA 1FN4B 5L2KD 1KJ2L 3GTNA 1DEEB 4Y5XC 1I75A 2ALAA 2N7BA 4LT7A 4C57C 1KIQA 4OKVA 1TFHA 1UZ6E 3M6DA 4PJEE 3QIUB 4CBZA 2X12A 2H0FA 5DO2D 3BZFA 1UENA 4P5RA 4X6DA 4OKVB 4OAWB 5GRVK 3SQBA 1SFDA 4FQHA 5C0DA 3F7YA 1AI1L 2G3XA 2Q8BL 1K2DB 3LHAA 1KGCD 3LNEA 3IJHA 4FQHB 4PJ7B 4UQCA 5AENA 2YD7A 4ZMNA 1A6TA 5HYJB 3U25A 5AZ2H 3SE8H 3VU1A 1MIMH 4TL4A 4KUCD 5KSUA 1RK0B 1ET5A 2O5YH 1M1XB 1NLDH 4LRNH 2E6PA 1CTMA 5A2CA 4QRAA 3VM7A 4DAGL 1KACB 4M8UA 4H8QA 4KRNA 4NRZB 2B2XL 4KGLA 2M1KA 4X9FA 1KSRA 3VM5A 2ZCKL 1HNGA 4WI9A 2G2RB 2FBRA 2CKBL 2DDQL 3VGAB 2IANE 3VMPA 2EDOA 4AMXA 2QHRL 3I75A 5K9QI 2Y1YA 4LXFA 7PAZA 5JPNC 1MCNA 1VFAA 1HJCA 2AI0L 1UD5A 4Y16C 3D48R 2F58H 2X4RA 5I1JL 3IN0A 2UWEE 4X8JA 1KIPA 2FWLB 4CGUB 2X4RB 1NAKL 3WY3A 3GXMA 3HB3C 1QWHA 5GGRA 4X8JB 1JYXA 3JZYA 4Y8DC 4UT9H 5I66A 5CD5C 5TDNB 4NSKB 4HFWA 2ZKYA 3GSNH 3OMNB 2YPLA 1MDTA 5GSVB 3RWGB 3RYMA 4I1RA 2VUKA 4M6AA 3WE1A 1NCHA 2JB6A 1NMAL 4H4NA 4N2IA 2FBOJ 3ATFA 4OB5H 4J28A 2IBGA 3EG9B 2YAOA 1VSCA 2YR3A 3KL3A 3ARWA 2YN3A 3TJEH 4FHBD 2ZCHH 2BVYA 4HAGA 1SHMA 3VXUA 3MBEA 1C12B 1PVHA 2BZCA 1CFSB 1DCEA 2WWKO 2NY5C 4FZ8H 2XTJD 3AS1A 3OZ9L 4I5BA 1UGNA 4XC3L 4MJJA 2OTUA 1HI6A 1EQWA 4P9HH 2CPUA 1L9MA 3T3PB 2AK4E 2RGSA 4ABUA 2LU3A 5F1IB 3UL4A 5HPMA 2EKSB 4Z5RA 2PLTA 4AV5A 1UZ8A 2YN5A 4MAYA 4QKTA 4XE0A 3S8FB 1A6PA 3RGHA 4EI5A 5MHSD 4PBWD 4UI2A 5CCGE 5F1KC 1UZ8B 1FNSL 3OAYK 1UZ6F 5FOBA 4PJEF 1A8JH 4JFVA 4WTQA 5FXCH 2XY2A 1HS6A 3LQMA 3HJ0A 5SWSD 3E3QC 3VJ6A 4NJAL 2AZUA 5I75B 3RWJA 1WV7T 3CZUB 4N0FB 1TZIB 4HD9A 4XHQA 3SDDA 5JPMB 4XPAH 15C8L 5LGJA 2XWBA 1QRNA 3EYFB 3ARGD 4UT9A 1BGXH 4BK8A 1DDHA 4GO8A 1UVQA 2Z93A 3GSNA 4LESA 3EFOB 3FTGA 3T1FA 2XWBB 1QRNB 2ADGA 5AYTA 4JFFB 5LN8A 4KUZL 5ABDE 1MRFH 1DDHB 1Y0LA 4XP9L 1SN2A 3T4YB 1CXHA 4XX1G 2ARJA 1HXYA 3PFUA 4I0PB 3PL6A 1GJUA 2IAMA 2ARJB 5ESVA 5D7SL 5IHUL 2BC4A 3EOYG 4JVPA 4IBVA 1W72L 4L0ZA 4PS3A 2IAMB 1UWEH 3PGFL 5EIIG 5ESVB 4ONFL 1RURH 3FHEA 3JTSB 4XMLH 5HDQL 4HKBB 5ETUA 1OHQA 2ITCA 2UYLB 3QO1B 4U6TA 2NX5B 1KBKA 5DJXA 5JIPA 1S5IH 3GPEA 3MOBL 4JCWA 5DA4A 3LOWA 5DZAA 5AW2B 3SDYH 1DL7H 2F15A 2PYFA 3D3VE 1I9IL 4PWGA 4N8VA 3B7SA 2IH3A 2C9SA 5K9OB 2C3HA 3EDEA 4JFYB 4CC4A 1ZSDB 3B5GA 3KWXA 4KK5D 3VFGH 1OT2A 5HVGB 2PP9A 1ERNA 1ROCA 1TTFA 3US0A 2Y36H 2BMKB 2G5BB 4TLSA 1BQHG 2H3NA 3QR1A 5CSZA 1WWWX 4XVUD 5TF0A 4U1GC 3LRSB 4K9EH 3T4AC 2CNYA 5INDA 4ZO7A 2NCMA 4F5CE 5I75C 5AG8A 5I0VA 5KJRH 2BSRB 2C5DC 3X12B 4HG4J 2V2WA 2FB4H 3V5HA 1U8JA 1IGCH 1TFPA 4MJIA 5IV2A 2VXVH 4M7LT 3V5HB 5DK0A 4WUUD 3QUZD 2CJTA 1KCVH 2DWEA 5L9DH 1OSYA 3DJRA 3A22A 3GHBH 4ENZA 1QSED 5KVFL 1WZ1L 3QISA 4AVIA 4AM0B 1F8TL 2Q2EB 1P1VA 3MV7A 4QJ3B 3ESVF 4NNXB 4YHOH 4AYEC 2YMTA 4UQ3A 2WNXA 1MJ8H 3FSAA 4R8WH 2ZXDA 3MSPA 2B8OT 5EO1A 3JWNH 4U3CA 3DHPA 2OXHB 1DP0A 4UNTA 1ZEAL 2YXFA 4NKOA 3QDGE 4IU2A 5LN4A 5GRJL 1XF4B 5IGXL 3VI4B 1D7DA 4PS8A 1CI3M 3K91A 3BEVB 1OP4A 3MLXH 5L7XH 4L5FL 2MPAL 3LMJH 5FKAB 4TUOB 4WI5A 5FWQA 5JW5B 2CJUL 4KO7A 4X4ME 3UGUA 2YQBA 4QRFA 2H0EA 4ZUWB 1RJYB 4OF3A 4YWGH 4HWBH 4AVKA 1K4DB 3V9CA 5FO9B 1HOCB 5I8CA 3F00A 3IDGB 2D73A 25C8L 5E6IB 4S2SA 1KJ2H 5CJXA 4YH6A 1CN4A 3PHQA 4BFKA 4Z3EA 3MNZA 3N55A 3EAKA 1S78D 2NY7L 2YFNA 1IIKA 1Q72L 2WXKA 4LDCA 3LEVL 4IBZA 4QXWA 3W9DB 1GKOA 1HQRB 1SXSA 1ANUA 2Q8BH 5F7HA 2ZUUA 2CBOA 2ZOKB 4Z7VE 5C0FA 3K4DA 1OLZA 3MCLH 1WA0X 4F7CB 5C9JB 2XHNA 4BFGA 1XF5A 1CGXA 3QYNA 5A43C 1R24B 5BZXA 5AFAA 4BQ8A 5IT2L 5E6SB 3C2SA 3KW7A 1XF5B 3ELQA 4ODSH 1IC5L 2VL5B 5CS7A 4ICWA 1GJIA 1KPRA 2CR3A 3DOIA 3ALXA 3FU8A 4DAGH 3DIFA 5D4IA 4P4KD 4RAVB 3ESOA 2P5ED 1QQDB 1T22A 4P2QD 4YNYA 2MTAA 2LR4A 3GS4A 2CKBH 2IMMA 4GAFB 2HN7A 4YE4L 2CRMA 3GMOA 1J0JA 2WQUA 4PLNC 4I3RL 1XHHA 2JIXD 5EN2A 2YPKA 3PAZA 5DUJA 3Q1SL 3BPCB 3KDPB 4QOKA 2FWOA 2V9TA 4PS4L 5K1NA 3KH3A 4BE6A 5EN2B 2YPKB 2AI0H 1EHAA 4BGDA 5CGYC 2F54E 3MRBA 4EE2A 3SBWA 4LCWE 3KDMB 5A2LH 5I1JH 3TN0A 1AY1L 1WZLA 4HWBA 4HX1A 4I8DA 1R3KB 4YE0A 5HDOA 1MNNA 2NNAA 2JCCE 2WXFA 3HLAA 2V7NB 2NY1C 1XFPA 4XMUA 4OCXL 1A3RL 3HLAB 3QDJE 2UXGA 4IJ3B 1WC7A 3TBWA 4LAQL 5BZDA 1KJ2B 1L5GA 3VD7A 3ARXA 1NMAH 1DQVA 5D4HA 4W70A 3TBWB 4LLUA 3GIZL 5BZDB 2Z64C 4GAJL 4ZOCA 1IBFA 2PN5A 2ZXAA 3QP3A 5DUPL 4AGLA 4WW2A 4TRPL 3V5DB 5DEFB 3TVMB 1RZKL 4I1PA 5ABAA 2WP3O 3IFLL 3NK3A 4NZFA 4WW2B 4A2FA 5LXVA 4QLRA 1JYNA 1YO4A 3HC3L 1ROWA 2B1AH 4GY4A 3SKNA 4EVNA 5KBPA 3WNOA 4WWKB 3OZ9H 4POUB 2C34A 4XC3H 3SKNB 1EUTA 5CZXC 2GJJA 1I1AA 4KTYA 5AZUA 5JDSA 2JTDA 3BGFC 2YSSA 4YLQT 5F97E 4HIPA 3EDDA 2J12B 4E5XB 2EJ1A 2YSSB 4XNMA 4X5XA 1YUHA 1FVEB 3VH8G 4KKAD 5I2IB 2CKBB 5DURD 2HT2C 4FKEA 4XN5A 3UCRA 1FNSH 3VX1A 2GEQA 5GSRA 5E6RB 3TTYA 3ZKSD 4ORZC 1IAOA 2CQVA 2OMWA 3L3DA 5HVWA 1F3JA 4NKMB 4NJAH 4RH4A 4Z7VF 3FQ2A 3LKOB 4I77L 1SJEA 3G5VA 1B88A 2BSEA 4HUXA 1QFWM 2ITDB 3W39B 15C8H 3VFOB 4IGBA 3ZPDA 1SJEB 3DMMA 2JKTM 1L7IL 1QZNA 4MHHI 4Q9CA 4L8CB 5I5JA 2RR3A 1Z1WA 3QEQA 1I8AA 2AEPL 4KUZH 4G8FB 3DMMB 4D7PA 1T5WB 3VFSA 3OKDA 2OMZA 2EKJA 3R4DA 5SWZA 4PRAB 2ZAIA 2HA1A 3SQRA 1T5XB 3L3IA 5ISZD 2N56A 2NSQA 4IBSA 5D7SH 2JKSA 2WW8A 1W72H 4W9DC 2I9LA 3PGFH 3IJ9A 5EC2B 4FQIL 2W88A 1VADB 4ONFH 4PJHA 5K39B 1D9KA 2XA8H 3HBZA 3NN8A 3RUGE 3UERA 4EXKA 1H6UA 4PJHB 1BYPA 4X7TB 2R59A 1YNTF 4TQPA 2ZOWA 1AOHA 1D6EB 2X0UA 3NN8B 2DWXA 3VI3A 4GP4B 1KYAA 4YK4B 5HHME 2OYKA 3GQFA 3TO2A 4MNGA 5C0EB 5GS3A 5HYSA 1U9KA 1WSST 4U1HB 3LZPA 2ZQKA 4MHHG 1I9IH 3VH8B 1QEXA 1J5CA 2ZYSA 3VI3B 3RP1A 2J25A 1Z9OA 3L5WB 1WS7A 4MNGB 2DIJA 1PCXA 5HYSB 1ZHLA 1ZLUK 2BNRA 1S8DA 2AJYL 4W9KC 3ZMEA 3HE6C 3AAZB 4LCCA 3OAUH 4PREB 4RESB 4TULH 4Y9CA 2VMJA 3ARUA 3WBDA 1C08A 3TS8A 5CR8A 5FCUL 2EDFA 3FO2B 3MRCA 5BXFB 3PJSA 4NAMA 5ID1B 4K3GA 1I3RA 5LBSL 3MRCB 3ZDXB 1AGFA 3ASWA 1BWMA 4XVTL 3B2PA 4CN4A 1WWCA 4AL8L 5E1GA 4FXKA 3U36B 5HYQB 4UBDD 4QY8B 1KIRA 2DEWX 4ZTPL 4FXKB 4JM2C 1K3IA 5F6HJ 3GJFK 4N5UA 4FNLL 1KIRB 2LTQC 3WFCL 4ZYKA 2XZZA 4B7LA 3RVXD 4UQEA 1M2VA 2XZCL 4ZYKB 5KVFH 1WZ1H 1V8HA 4OCYL 3T2NH 2ICEB 3NP3A 1F8TH 3BQUB 2RJMA 4ZRGA 3WCYA 3QIBD 1JK8A 3WTYA 1BMWA 3LPWA 1J11A 2NQCA 1KPUA 4F7KA 1W72B 1ID2A 1OIOA 3UIYA 1KPUB 4DZBA 1BW8A 1ZEAH 3RQ3A 5EZLA 4NHCL 3L7EB 2Q7NA 5GRJH 5H8DA 1YDPB 5IGXH 1TQSA 4ALAL 5K93A 5LUMA 2GK0A 2PW2A 5I82A 2MPAH 2PCFA 5BUGA 4HK0A 1L3WA 4JFPA 4M93C 1GS6X 3STLB 2CJUH 4AJYV 3TM6A 3NJIA 4L9DA 4UMSA 3CFKA 4NQVB 4WSKA 1ULVA 4XTRD 4PB9L 1WAEA 3QDMA 1ET7A 1Z9MA 3MRPB 1J9SA 4NEHB 2BNQD 4L3CA 5CSGA 3BAEH 3GMLB 2I25N 25C8H 5F7NC 3GMPB 1U3ZA 3H7LA 1JGDB 3KEHA 3WSQL 3GUFA 4F3FB 3CIAA 4LHUB 2NY7H 1Q72H 4G8AC 2WKGA 3O2DA 3RUGF 3LEVH 5F9DC 3BCFA 1Z9SA 2PXYD 3VNYA 5ITFB 2D31B 1T5KA 2EIJB 3CHOA 4U7SA 1H19A 1I9RL 4J5VA 4HXBL 3OLGA 5FW6A 4OF5A 3VRIA 2CM6A 2OXGA 2QBWA 4IU3B 2P24B 3FFDA 4PBVC 2LLNA 4WSGA 3HC0A 3S5LA 3DOHA 3WFBH 5IT2H 2F1BA 2OXGB 3MRKA 4YQXL 3O6LL 4XNZB 1IC5H 2IGTA 3PP3H 1QLRA 2PO6A 3S5LB 1HN1A 4B9YA 2CO7B 2OL3L 1FDLL 3R4RA 4NCDA 1PNDA 4KO9A 3O41A 1BF8A 4YE4H 4RSYA 1S7QA 2GEEA 2R9HD 3DI3B 3ECBB 5DJDA 3T3ME 5FOJA 4G9FB 3Q1SH 3WE6A 2EO1A 3ARFD 4PS4H 2OS7A 2ZX9A 5DJDB 1AZRA 1MFMA 3FJTA 4GG8A 2EXWD 4ZI8A 5L4FA 5T5NF 1QHOA 5C0GA 4ZUSA 4L8BA 5DUBB 1Q0EA 3QGVA 2VIRB 2A73B 3PWPA 3ZO0A 1AY1H 1SF5A 5EWIL 4S0HA 4Y4FD 1MQKL 3V4PB 5HJBA 3PDOB 1FFOB 1EWHA 5E7FA 3O8XB 1N26A 4N0UA 4OCXH 1A3RH 1ADWA 4U1NB 4JFHD 4CC1A 4J4PD 2ZCLL 3CNKA 4N0UB 4WDIB 3U46B 4ZMOA 4R2GB 3P11L 3FC8A 2WCPA 1KCBA 1K4CA 2FL5A 5EU6A 3GIZH 4OV5B 2YMOA 4GAJH 1BD2E 5CILH 5DJAA 4HIJA 1PEZA 4HGKC 5DUPH 4TRPH 5EU6B 1BAFL 2D9QB 2OMXB 3DX2A 1RZKH 3UC0L 1T0MA 4HVBA 5GS0H 1COBA 3IFLH 2FQDA 3OGCB 3VXME 1B4RA 1MI5A 1T0MB 4N20A 2YD8A 1AQKL 3VXOA 4D9RD 1KGJA 5I73C 1BZQK 1OT4A 4G8GE 2BXZA 1JE6A 2FO4B 3NUKA 2YC1B 1ZGLM 4M9OA 4HEPG 4NO0D 5CJBA 2R0ZL 5ESQA 5ENWA 4NQDB 3V0WL 2W8CA 1YECL 3O4LB 2HRHA 1U95A 2P8MA 1GGCL 1V05A 4NBXB 1NDGA 2XWDA 1KJVB 5E8DL 4JLRA 3X1BA 2QGBA 2R4SL 2J1YA 4GS7B 1NDGB 1C1EL 2WQRA 2ZX6A 4HCGA 4ZUUA 3CHQA 2XJKA 4TNGA 2WXOA 3BVNB 4FJ6A 4G6KL 3TBVA 3AT9A 1L7IH 4IK6A 4ZXBC 4FQLL 4H8VA 5F72S 3ZKMD 4I3SL 4YHIA 1JPTL 4P46A 2AEPH 1DLFL 3FUHA 3S48A 3SD2A 3D25B 1SDDA 3O3UN 4ZW3A 4NFDA 3QFGA 2OULB 2VJXA 3OAZK 2CGYA 4TF4A 1PY4A 3L1EA 1TPXC 3TV3L 1GZQA 1M9WA 1U93B 1AYOA 5JIDA 4GSXA 3T3MF 3QIWA 4PRID 1IC7L 2X4UA 1BXAA 5AB0A 1NJ9A 2IGLA 4FQIH 5KYUB 1JMXA 2WVVB 3C09B 2I85A 2XWJB 1ETZB 2H2SD 5CP7A 1YA5A 1FC2D 4OCLC 1MELA 1SHXA 1DHKA 5EOCL 3QXAB 4FA7B 3RFZC 5CP7B 4Z95L 3THML 2VDNH 4GFXA 2EXSA 4BIKA 3RB5A 1FIGL 3MA7B 2EILB 4C55A 3MMEA 4TSBH 4U3HA 2F7IA 1Y1DA 2AJYH 1FPTH 1KBVA 1CBVL 1LJMA 4XPGH 3A3YB 3HZMA 3CDYA 1A5FH 1FH2A 1S7TA 3LN9A 4HKJB 1ZLEA 1Q0XL 3H7BB 4KV5E 4NHUA 4N2EA 3PV7A 2YRZA 4LFHG 5BS0E 4H8WL 1SEQL 4UDUA 4AGNA 1H5BB 3QULA 4QHNA 1TVBA 4XPBH 4PYHA 2F8IA 5LBSH 5SWQB 4UDUB 4XVTH 2G3NA 4LBEB 2YD9A 1EIBA 4AL8H 2KUTA 1S9VB 1U8LA 1I3GH 1ZTMA 2Y06L 2FBJL 4MLSA 1THCA 3KJ6L 3P40A 4ZTPH 5FM8A 2WINB 3FFCA 5FYJE 3KWUA 2R2HA 3Q9QA 1LXMA 4FNLH 4PGDB 3WFCH 2ESVD 1FZKB 5IIEB 2R2HB 1HL5A 1TYRA 2IALA 4EDXB 4RMRA 2XZCH 1RERA 4OCYH 3N44B 3MBWB 4Q6YA 3SE9L 1R47A 2J1XA 1FHGA 1H9VA 3LZRA 1SXBA 3SDCD 2F8VA 1W8EA 1FZJB 5DZOA 2VQ4A 3FPYA 3L8QA 2QV4A 1HHJA 4O9HH 3C9NA 2A6DB 4C83A 1Z0MA 3O6FC 4IRJD 4UQDA 3Q05A 2WWNA 3VG9C 3DHUA 2VDNB 4ALAH 2OTWB 3HR5B 3I9GL 3H9SB 4Y9EA 1R5WA 5D6CB 1A21A 2GJPA 3CFIC 2NZ9D 2ENYA 4PB9H 1AGDA 3DXAA 4NN6B 2XZQL 1DBML 4H20H 1M9SA 1OAYL 3OSKA 3CZEA 3H55A 4FZEL 5J11B 3OC8A 2N1KA 3CZLA 5EU4B 1TZHB 3T0VA 5TE6L 2V6HA 3VO0A 3WSQH 5IB4B 5CEYA 3FDWA 5IVXB 2HT2D 4ZX4A 1EBAA 4FFTA 1HKFA 4FFYL 4AQEB 3B9KD 5IB1B 3OBAA 5DVPA 3AADB 4X9IA 1Q94A 1NFIA 5DVLA 2F7RA 1MHEB 4PJ9C 4NN5B 4JGUA 5FDYA 4L4VD 2ZKMX 5HGDB 3P54A 4OFDA 1A7RL 5BQ7A 3TYGL 2MNWA 5C0BE 1MCSA 3HZ3A 5BQ7B 1XGPB 1ACXA 3T8XA 4FQXA 2AJZB 2F5AL 2YJQA 4PJXF 4YQXH 3D52A 4WQOA 2HSIA 2PTTA 3O6LH 4JY5H 3TBBA 4FLSA 3QXWA 4KV5F 2JXMA 1IAMA 3PP4L 4WVRA 2OL3H 1FDLH 4JFOA 2IOMA 3IMUA 3LD8C 2P26A 5DMKB 4UUJA 4KU1A 1P7QA 3SJVA 4LSSL 3PNWA 1CVSC 1U92A 4Z3TA 3VSQA 4R97C 5I5RA 1P7QB 5E9AA 2LFEA 3VWKC 4GNKB 2XIBA 3QQ9C 1TKWA 3RI5K 1DQIA 3S3BB 3LCYA 2VM4A 4NZJA 1TKWB 1HHIB 3BVVA 4YDVA 3L3OB 1L0XA 4KKCC 1MQKH 2Z8WC 4HDIB 4DQOL 3TNNA 3IF1B 3BJ91 4JRXE 1MY7A 4YDVB 5K5YA 1TUPA 3UAJD 3ZTCC 4QNPE 3ZRSA 3ECVA 3TNNB 4KROB 3T71A 3QPQD 5J11C 4GKNA 4ODXB 2ZCLH 4KTGA 1WCBB 4E9WA 4EQ3A 1SQ2N 2K6WA 3BWAA 1VA9A 5B38A 3P11H 4JRYE 4XCCL 1X5HA 2YPVL 2H1XA 4HP5A 1AO7E 1HYSD 2ATKB 1HIML 3ZGIA 2BX5A 3HVNA 3K8KA 3AJ7A 3QHFL 4NQEB 4NX0A 3W1ZA 4F8OA 2AJXL 3DV4B 4PW9A 1BAFH 5HDLA 2A83A 4UNUA 3QUXC 2C9VA 1G84A 3H4FA 1AG6A 2YFOA 3AG4B 1ORSA 1HH6A 2VZ3A 1KLGB 5EDXA 4HH9B 4KBPA 1AQKH 2HFFA 4R3SA 3GDCA 2ZWZA 4PJEB 4GAGL 3K4ZA 5DGRA 2HFFB 3HC2A 1DQJA 3RKDD 2APBA 2OX5A 2OL3B 3DIDA 2R1WB 4KAQL 4L8SB 4D0BB 3N41F 4N1HB 4NZTL 1DQJB 1JPST 4JO3L 4J3TA 3V0WH 1EZSA 3UEQA 5D72L 4X4XA 5GGSA 5MEND 3V6OC 1GGCH 1R3LB 5AOJA 4OIBA 3HNVH 3OC5A 5E8DH 5I6KA 4KJQD 5IY5B 1E9PB 3IU3A 4V1DD 5FA4B 4AIXA 3BZEA 2F1EA 1A4KA 3BLPX 3BZDA 1C1EH 3P2TA 3S8WA 3LVEA 3CFCL 1QP1A 2CCLA 4ANWA 5I1AB 5KG9B 2I26N 2IANA 3MUHL 2HMIC 1PX8A 2EXYC 3G9AB 3I3BA 3L3OC 1P5UC 3S37L 3ZRCC 4YX2H 1NPNA 4G6KH 2HLFC 5D7KD 1G7PA 1KT2B 1UUNA 4FQLH 2EDYA 4I3SH 2CIKB 2QMKA 1JPTH 2X1OA 3DOSA 5IQLA 4OD3L 4U1JA 1MCKA 2D0HA 4UZUA 5C0IB 1HWHB 5DI8A 2PYEE 5IROA 1QR1A 2IADA 4GKLA 4U1JB 3NAAL 1FFRA 3TV3H 5K9KA 5AW5B 1MCOL 3HMWH 3QEHB 1MF2L 1EFXD 2UWEB 4Y1AD 4B9IA 5K9KB 3OPZL 1E27A 2WD0A 2P48B 4BRVA 2EDLA 2CWRA 4NZ8A 4XGZB 3CFMA 3WIHH 3L1OL 3NIGB 5EOCH 2AEIT 4R7LA 3KL5A 2MKWA 2Y1ZA 4Z95H 3THMH 4PG9B 4J1UA 1YPZE 1V7NL 1FIGH 4WF7A 5F8RC 3MOQA 4F8TA 2GB2A 2V17L 3ROOA 2PNDA 2OMVB 1XF3B 2JB5L 3PAYA 5HJDA 4PJ5D 4YHYC 1CBVH 3VA2C 3UJJL 2DQJL 2HT4C 4S1DC 1Q0XH 2KT6A 2VSCA 4AK2A 3K6SA 4Z78B 2X6AA 5F0JB 1WT5C 4EXPX 2JKIS 1ITBB 1SEQH 1TZOA 4H8WH 4L4TE 3WGUB 3QYCA 4PJ8C 4DEWA 5GZOA 2EIZA 5EOCJ 5LVEA 5AVWB 4YN3A 2AK4B 3TC9A 4DKDC 1UWXH 1L0QA 2QVTA 1H3TA 2EIZB 3NCCB 3ZE0E 3Q2VA 5TD4A 2DJUA 2Y06H 1IGIH 2FBJH 3KJ6H 4PIBA 2VR8A 3AG2B 2QGDA 4MCNA 4ZSOE 1T7VA 1D5XA 1FBIL 4JGMA 3VGDA 2D7TL 4PP1C 3T77B 2WGXA 4WUKL 3SE4A 4X83A 3NK4A 1IVLA 1G7JA 1RUMH 1LWRA 3VA6A 2DD8L 3SGEI 2F7OA 3SE9H 2BVOB 4XWOC 5LJYH 1W6WA 2HFEA 4ZZFA 1UT9A 3SO3B 4BQ9A 5CJQL 1UOLA 4W9IC 4FLQA 1PAZA 2HFEB 2UVEA 1PYWA 1R0AL 5INCB 2K6YA 3WNNA 1NM4A 3VWJD 4QO1B 5E9DA 1RV6X 5E70A 5IQNA 4LLWA 5DTFA 2ZIDA 3B9EA 5FF6B 3V55A 3RAJL 3VXTB 5F1OB 3M17B 4KNQA 4KZEH 1RZJC 5EBLB 3QAZC 2WLKA 1NKOA 2H8PB 3TA3B 3PWNB 4HCRL 5EOTB 3CC5A 4GAAA 3I9GH 4DERA 3P0GB 2PR4H 1KJMA 2A0LC 1YEIL 1A3QA 1AZUA 5C7XL 2IF7A 4OT1H 3RY6C 1HE8A 3WTXA 1CD9B 3QWOA 3DVNB 1FG2B 1JF1A 3B7YA 2E6JA 1OP5H 2XZQH 1DBMH 3KLAA 4FZEH 1OAYH 1J5IA 2VO5A 3CFNA 3TPUB 3V4LA 1IKOP 5CFHA 1OGAD 4OZFH 3ZT6A 4QGTA 3W82A 1QSVA 5TE6H 5TDPB 2I9TA 4KTDL 1DVFD 2F53E 3AWFA 3OXSB 3D3VB 2CBPA 2WXRA 3PABB 2ED8A 4E41E 2QV2A 2I9TB 2DQFA 3K6OA 5CN1A 5F3BB 3RZCA 3UCQA 4LVOB 3OR6A 3BJLA 2V8LA 1WWBX 2F0CA 4DEPC 3Q5OA 4LLVA 3RHWF 4AIZB 1YPZF 1A7RH 1A9EA 3GYRA 2V9RA 1F5WA 3OR6B 3TYGH 4AKPA 1AHWA 1GTNA 4OQTA 1CICD 4XB7A 4WTZA 1G4MA 1KXQA 4Z7AA 1AHWB 3HA0A 4NKDA 2F5AH 5F71A 4CU6A 3UTTD 1HZKA 4YOKA 4Z7WE 3PP4H 1JHTA 3JTTA 4XAKE 2UVFA 5EIQA 3GM0A 4LSSH 3JTTB 5D1ZI 3O3BA 1JDDA 4AXWB 2N59A 5F7DB 1TO5A 2B59B 3PG2A 1Z9PA 4LRIC 1I8LC 1J8HE 3K1DA 4GQPH 4DUVA 2ZAGA 5KZCB 1QW9A 1GYAA 2QSCL 5E1HB 1GS7A 3GHEL 1OPOA 3FYIB 1J8KA 1YMMD 2WHVA 3U0PA 4DQOH 4V33A 3CVCA 4JQIL 1BVNT 3EXJA 3II3A 3UYPB 5IREA 3FKUS 2X2JA 4YDLC 1SMAA 5E8EB 5C0CA 4P2RD 1NLBL 3ZHFA 3QDGB 5TTRA 3CSYA 3HE7B 4KHXL 2BOBA 3MV9E 4ZODA 1EJOL 3O9WA 4OZFB 1MVUA 1QKZH 3KJ4B 4FFYA 5HHQA 3BP4A 1BVKA 4XCCH 3KGSA 2YPVH 5ANMA 4TXVB 5DD6A 5JIKA 4ZQTA 4J27A 1EHNA 2ICWI 1QPXA 1TYJA 3CH1A 3WJJA 2G4EA 3WFHA 1FYTE 3EZ8A 3QHFH 1CYGA 4BZ1L 1D5IL 1NCUA 2AJXH 1ZT4B 2WAQA 2NSXA 3FOMB 2ZXEB 1E5ZA 1G7MB 2WQVA 3FTSA 1R5IA 4BUQA 4TNWK 5KYYA 1A4BA 1YUKB 4IOFC 2ETWA 2NOYA 1C5BL 2VDKL 1M1SA 4M62L 4B27A 1INQA 1CXFA 2JSFA 4XBMA 3LEXA 1Y07A 3X13A 5EDSA 1J87A 2VDRL 3WKNA 2X7LA 1KLFA 4JREC 1JXFA 2BNUA 4KAQH 3X13B 1HH9B 5LG6A 3KGUA 4NZTH 4AC2A 1HL9A 1M6OB 1T7WA 3QHTC 4PH8A 4W6WB 4Z7VB 4JO3H 3VD5A 4NFBA 1J9RA 2BNUB 2LOEA 3NFSH 4Q74A 2EE9A 5D72H 5EOQH 2XX0A 4QRUB 3U6XS 5HYEA 3X14B 5LNGA 3H3KA 4ZMYA 4K71C 2B5IB 3UAAA 5IFJB 3BUYA 5D2LE 2AITA 1YRKA 3J27A 3V0DA 4EN3D 4W6XB 3HG2A 2YD4A 3L4TA 5DFAA 4ZX6A 5EEXA 4TUKL 2D7PA 3CFCH 2PP8A 1G6RL 4MB4A 1JD7A 2GBAA 1S7RA 4P5TB 3S37H 5T1MB 3FT9A 1OD7A 5FGCB 1D5BA 1W6LA 3NZSA 3QZWG 3X3FL 5I15H 3G6JE 4OD3H 3FT3A 3I6SA 1IAKA 3IMRA 1OB1B 1YNTA 2F54B 2YPVA 3KPRD 3PQYD 1DBAL 4LCWB 3MLZL 3NAAH 3C5ZD 1CZ8L 1WCQA 4OZIB 3RX8A 3HN5A 1GA2A 4MCYA 1MFCL 5CIPH 1X5KA 4UTCA 1M4KA 1UACL 3FL7A 1BEXA 1OCZB 2JCCB 1F11A 1R3JA 1CWVA 3OPZH 4KKNA 2I07B 5DJZA 5B21A 4Y9BA 1OPGL 3WLWD 3ETBJ 3T6VA 3QDJB 1JJUA 3L1OH 1KTBA 3PAVA 4ANXA 1UYWH 3GSOA 4M6NL 3C60A 1V7NH 1H6FA 1IM3D 1ZE3C 4C4KT 5JZ7D 3VUAA 2V17H 3GSOB 1BFSA 3F58L 3C60B 4PV9A 3BZ4B 3F7KA 3WAKA 2PCXA 4WI2A 4RMWA 4GT0A 1SVBA 4N9GA 5KSAC 3O4OB 3UJJH 2ZP9A 2DQJH 3A4EA 3CHXA 2MPVA 3AABA 3MJ6A 1J1PL 4N9GB 4S1QH 1A8ZA 4HUWA 4FLRA 1H3WM 4U1LA 4JQXC 4QRPE 3CCHA 2EIKB 4BEIA 4LEEA 4JN2A 3ESUF 1LHZA 3FYEB 4U1LB 2FYYB 3ES6B 1EEZB 3QZWB 1SDYA 4OD2B 4U1IA 3KLDA 3L1FA 3MGTB 4BCXA 5HGAB 1NCGA 2DICA 5D93C 4FL4B 3P69A 1S7SA 1N5YH 3O3EB 5H37G 5D1ZC 3CBKB 4GBXA 4PLOB 4WUKH 1JPGB 4E42B 5EULV 1PPIA 4PRPA 2DD8H 9PCYA 3WTWA 1OQXA 2YQGA 2EE2A 1L9SA 3NFPA 4FEIA 5D1QE 5F7LB 4PI2A 2VZSA 4W4OC 4LVNB 4GSUA 2NYZA 5CJQH 4TOYL 4V11A 1N59B 5CIPB 4R7DB 1NM9A 3ZHDA 4QAMB 5D2LF 1D5ZB 3MJ8A 3L9BA 2VITA 1E4KC 4KRPD 2NDGA 5MP6L 2NNXA 4JPVL 3MJ8B 2X4QB 4N85A 5DQDL 1Q9LA 4AJVA 5IJBC 3RAJH 3S7GA 1MCFA 3IDJA 4BFIB 3IRPX 1JIBA 5LBVA 5B8CC 2WLLB 4D8PB 4HCRH 4AQ1B 5AOZA 4XN2A 3HNTL 5HD8D 1LM8V 4Y4HD 4P2OB 4E2OA 2ZOUA 1YEIH 5DJ0B 3UTQB 1FL3A 3WXWL 5C7XH 2H2PD 2X3CA 3ARED 1YJDL 3RTQA 2YAEA 4EOWL 3V95A 3RUGB 43CAA 3HG1E 1AR1B 3RTQB 1WUNT 4K94C 2VERN 3ZZLA 5E00A 5JHDE 4AT6B 1PD1A 1U8PA 2YMXL 32C2B 3QB7C 5I8OL 1EK3A 2PKDA 5HHMB 1CDGA 4KTDH 3BPNC 3SY0A 1PX3A 3S3SA 4DEUA 2YUZA 4KK8D 1QACA 1OB0A 1FFNA 3DJTA 4ANUA 1MUJA 4JHBA 2ZOLB 4YHNB 1W9XA 2GAZA 1PD0A 4OLEA 1NFDA 3RVWD 1FG9C 1MUJB 4GXUN 4RETB 4AJWA 3HZKB 1HWWA 1QUPA 4FL4C 4X0KB 1O7DC 3LDBC 4U7KA 4NP9A 3SEPA 2OJ1A 1OK8A 2Y7SA 1H8OA 5BOPA 1J05A 3GC3A 2WSKA 2EUXA 3MRMB 1TMCB 1J05B 2Z34A 4LOUC 3TPKA 4N8VG 1CB4A 5KJ4A 3I85A 5I26A 4F8NA 2A9BA 5IKCA 3N43F 4R9HA 3T65A 4JG1L 1ECYA 4Q6IA 1T1WB 5TK2A 1QLEL 1IKFH 3KPMA 4I87A 4HCRA 3GRBA 1K8IB 4D0DB 1XH1A 1Q0YH 2MHAB 1JN6A 1X6NA 4AQ1C 5EV7A 1H8NA 4OZ4B 1KEMH 3OAYH 1E8YA 5DRNA 2GSGA 2NY4B 4JQIH 1X5MA 1NUNB 1YG9A 1E0OB 1LQSR 5D6DA 5KW9H 1NLBH 1HXMA 4RFNC 5DJCB 2Y7QB 1NGXA 1YSOA 4KHXH 1CURA 5HTSA 1EJOH 2OLDA 1M7XA 3GEWB 3PLYA 2VAJA 1CK0L 1SGKA 4HLZH 4M5TA 2WXLA 4NQTA 1XIWA 2Z6FA 3L3KA 3MLSL 4JKLA 3CBRA 4TLUA 3ETTA 3FQRB 3JXAA 5L2KA 3IDUA 4HKXA 4BZ1H 3LH9A 4XWGL 4KH9A 3C6LB 3TZVB 4A2LA 2JQAA 1T20B 3ULSA 2MCPL 1N2RA 2EDHA 2B7DT 4AEEA 4G8IB 3ILQC 4LCUB 4WKZB 1C5BH 2VDKH 3L9EA 4M62H 1N2RB 4PLJD 3IGFA 4ZFFA 4GT7A 4OUOA 3IAQA 3ARPA 4FG6C 4LARL 4MAYC 5AZEL 1MCLA 1GGUA 2VDRH 1ZA3A 4XXWC 3IKKA 1JP5A 1S7VB 3U2SB 4F15B 4I85A 5CP3A 4J8QA 1ETB1 1ZA3B 1LO4H 3CFBA 4PJFE 1H3XA 2P8LB 4HC1H 1CXKA 5T1KB 1Q9WB 1X5ZA 3P30L 4B7IA 5J13B 1I1RA 4UQIM 5E99H 5G4OA 5C07E 3GMRB 3SDDC 3OR7B 5I71B 3RGVB 1FJ1B 4HWZA 1C8QA 1OAZL 2RAMA 2VQTA 4TUKH 1KFAL 1AH1A 5F3HB 3I9IA 4LCYB 4X6CA 4K7PY 3MV8E 3TH3T 5LDSA 3TURA 3R0MA 2FNBA 4LOFA 3T3MB 1FZOA 3X3FH 4APXB 1BFOA 1ED3A 3BHBA 3PL6C 4BFFA 1TQCB 1RIUL 2EIEA 5C09E 2CLZA 5DSCB 2X2YA 4YAQA 5E8OB 4PJGA 1DBAH 4ODTL 3MLZH 2H6OA 5IFHL 2VN5A 1CZ8H 2CLZB 1XMEB 3BD4A 2FD6L 4YAQB 1ZLWK 2V3FA 1MFCH 4JPWL 5JHLA 2VABA 3QRGL 4PGEA 4BFBD 3ARRA 3ZMRA 3U2JA 3SYQA 1OPGH 2OJZL 3B7TA 4P9HC 4PGEB 3TZVC 3T0DA 5FYLE 4Q9QL 4CW1B 3TEUA 1PW3A 3VXPA 3JV0A 3KGRA 1KPVA 5EF0A 2VDKB 4LNVA 4NOFA 4M6NH 1YEFH 4EKXA 3GZOA 5GS2D 1E6OH 2GUOB 1OO2A 2R0LL 3ZN6A 1BD2B 1T21A 2CMRL 2DZEA 1M7DB 3Q3GB 4XRCB 5L2JB 3ZE2E 4QJ4B 2VDRB 2H26B 3VXMA 2BP8A 1U8KA 2V5RA 1FRGH 1OK0A 2WBJB 3O81A 4F37F 1NBZB 3PCYA 2WMPA 3VXMB 2K4WA 3UJTH 5L4MA 1U8KB 3UPRB 1K85A 4XMTA 1J1PH 3O2VH 2AQ3A 3Q8FA 4E68A 4L9LA 4AWJC 2CK2A 1BBDL 2NSMA 4G8GB 1G6RA 4FQQA 5AAWA 5E1AB 3X11B 1FP5A 2DMCA 4KI5D 4ZJ9A 4N2LA 3FQXA 1T2XA 2D3VA 5SWSA 3Q2CA 3U0WL 1ZV5A 4L05A 3FU7A 5TFSL 1ICTA 2UXFA 5H2BB 2M83A 3FQXB 1E6JH 1DVXA 1WHOA 3KPPA 1HHGB 1SJHB 5GGTL 3TTSA 3ARGA 4ONHB 4YHKL 5T1LB 1AE6L 3NFNA 2WBXA 1G5GA 1Z0NA 2O26U 4PJFF 4PWHA 3TEYA 1NIAA 5E5LA 3KXFD 1SNRA 4PJBE 4XODA 1QBBA 4IOSA 4TOYH 1LWJA 3T0XA 4PV8B 3KBFA 4URKA 2HAZA 3IB4A 3BKJL 5MP6H 5JA8B 4JCLA 2F7PA 4JPVH 4XP5L 3EGXA 1NCCL 1PZBA 2W60A 2COQA 43C9A 4O5LH 1E3FA 2Z92A 3HNTH 3LKRA 3UABA 3FB8B 5B1JA 1FZMA 2Y6TE 3WXWH 3D09A 1YJDH 1UURA 5D1XD 1JGEB 1XR9B 5I28A 1SHWA 3TEXA 4EOWH 5CJXC 6FABH 3MCG1 4HJUA 2CDFB 2Z31C 1X4ZA 2DF3A 3FH8A 2YMXH 1U3HD 2MNJB 4HPOL 1RJCA 2YD5A 3NDYE 5I8OH 5LGHL 4QF1B 2XXMB 1TZGL 2VKXA 4FI8A 2LU7A 4PJXA 4WV1B 2APVA 1K6QL 2UZXB 4RLDA 4YPJA 4LSVL 1NWPA 4DKAA 4JKWA 4OU3A 2IQ9L 4P3CH 2SEBA 2B08A 4P4RA 2O61A 3JVGA 4R0LA 3ILPB 5BS0B 2SEBB 2XYBA 4N3TA 2ZUTA 3ZE2F 1F6AA 1KNOA 1RSYA 4Y2OA 2EYRA 4QTIL 3IDMA 3QRBA 1JGIA 4BZYA 2JK5A 4L1DA 3JWNC 1BZ7B 3QUZA 3U9PL 1U8NB 3DSFH 4QRRE 3NH7H 4HZ1A 2NY0D 4MNQD 1RUKL 1NIFA 1C5DA 1JNHB 1HAWA 3GI9L 4YFLF 2QLYA 1IBHA 4GXVL 4GRLD 2GITA 1A47A 4NQCD 4JG1H 3SBWC 3Q5YA 1QLEH 1JTPA 4LPVA 1TR7A 3TN0C 3ZMNA 4WGVB 2VXSL 4ODUB 4LCVA 2CRYA 1AYRA 2I69A 4MDJA 3TCLB 5JIMA 3LRGA 3CFEB 4NUJB 2V9QA 2OYLA 1U8OA 1FNEA 2Q86A 3I02A 4DPBX 4MDJB 5GGUB 4YXHL 1E9QA 3L7FA 2W80C 1ASOA 5KSVA 1U8OB 4N6RB 1FNEB 5F1NA 3F64A 1CXLA 4XO4A 1E9QB 3QDAA 1UQSB 4PJBF 1CK0H 4WNQA 2QADB 4AV0A 1DLHA 3SD5A 3IJ7A 4MXWL 3GSQA 4ZX5A 3MLSH 3AACA 2VLRD 4K8RL 4I3GA 4Y2LA 1GZHA 2BP3A 2CCVA 3IRZA 5KS9E 3L2LA 5L8KB 4FXGA 1TVDA 5AVYB 1A65A 4B9CA 4XWGH 3BRDA 2VJ8A 1FVDB 3ULUE 2WXNA 2LV4A 4ZMQA 3QW9A 5FDWA 3N41B 3LKQA 4R7NB 1I1AC 3EO0B 1WP6A 4FMKA 4G6AD 4YDKH 5JOFA 1NC4A 3I6KB 4J2XA 3VTMA 1FNGA 4LARH 3JV4A 5AZEH 2WCGA 2JJTA 1AD0B 5KVEE 2VAAA 3CK0H 5C08D 4LDOB 1FNGB 3LV3A 2ZXQA 3F04A 3SE3C 3SDAA 4PRHE 4NC1E 1ES0B 3DHMA 1EBPA 4FFZL 4N2FA 3RVTD 5C0BB 2AXHA 4P4KA 3LZNA 2P5EA 4P2QA 1TZAA 3UOAB 3CQPA 1ZLUH 5C6PB 3KBEA 4J8RA 2X6CA 3QJHB 2Y5EA 1XGTB 3BP5B 3T0ED 4HCIA 5IB2B 4U1SA 2C1OA 5GRWA 3NRPA 3RDTD 3TIEA 2EEFA 2J5LC 3D30A 3SCMB 1HINH 3UGEA 5JR1L 5KTEL 5J4MA 2K45A 1SMOA 1KTLB 2Y25A 3WFEL 3GIVB 1U2CA 5LKNA 1A66A 4U0QB 3MLYL 1R6VA 1UJ3A 4TPRL 1DZ0A 4N1CA 2EEBA 1RIUH 2Y7MA 4JHWL 4C4KO 3V9FA 3Q2WA 1NL0L 1RHHA 4PJCF 3QIUD 4ODTH 2QPUA 3R7RA 5IFHH 4QYOA 2WQ8A 4JRXA 1RHHB 2FD6H 2AVGA 3MODL 4UYPA 4JPWH 1D9KC 4P06A 3NA9L 3QRGH 2ZYHA 3ME0A 4JRXB 1T4KA 4JFXB 2OBGA 4GLRI 4L18A 1M71A 3UO1L 1T4KB 5HYJD 3BD3A 3ZUCA 4Q9QH 3AT8A 3PPSA 1AO7A 5BZWA 5LAXA 5DHYB 5L4IA 3KCPB 3UDWC 3PWJB 4JRYB 4GUQA 1ZSHA 3A21A 1AO7B 5C8JB 2ATPA 2CUMA 2R0LH 2CMRH 1VF5C 4LCCC 2OM5A 5CEXB 3OKMA 4FFWC 5EU7E 5JMOC 3D05A 2VRAA 1BCIA 1G7LA 4MD4A 5C2UB