1ZIAA

Oxidized pseudoazurin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PSEUDOAZURIN
publication title Crystallization and preliminary X-ray studies on pseudoazurin from Achromobacter cycloclastes IAM1013.
pubmed rcsb
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1996-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ziaA00
2PCFA 1JVLA 7PAZA 2UXFA 1X9RA 4YSOA 3T71A 1JZIA 3PAVA 2PP8A 1W8EA 5B1BB 2YAFA 4E9QA 4RH4A 2HRHA 3G5WA 2EILB 1J9QA 1V10A 2B08A 2BWIA 5B1KA 4A2EA 5I5JA 5TK4A 3X1GA 2XX0A 3FQ1A 3NSDA 2CJ3A 6PCYA 1URIA 3EH3B 4HHGA 2GIMA 4CSPA 1BAWA 2J56A 4GYBA 3N2JA 1GR7A 2GB2A 2UXVA 5D4IA 2FQDA 4YSDA 3WKPA 2N0MA 5B7MA 1ZDQA 3CZUB 1M57B 4HIPA 4TXVB 4DP1X 4DP0X 1SDDB 3NP3A 6PAZA 1OE2A 1ZPUA 5IY5B 1PZBA 9PCYA 4YL4A 2HX8A 1BQ5A 3QJVB 2CUAA 2JKWA 2FT8A 4KNUA 1YLBB 2J55A 4KO5A 4UAHA 1WA1X 4AKQA 1IKOP 1CYWA 4KOBA 2UXTA 4A67A 3CVDA 1IUZA 1KCBA 1AZRA 4YSTA 1AANA 2UX7A 2UXGA 3PLYA 1A65A 1AG0A 3FSAA 1J9RA 1NWOA 2IWKA 2HRGA 3TA4D 1MG3C 4NAJA 1A4AA 1AIZA 1KDIA 3WI9A 2UX6A 1BQRA 3EF4A 3AG3B 2CALA 3FQ2A 3WNIA 3NJHA 1CC3A 3WKQA 2GC4C 3FU9A 3QJTB 1DYZA 1PY0A 2RACA 3FPYA 5AZUA 1X9UA 1QNIA 4YSPA 2BW5A 4G70B 4CSZA 1M56B 4KO9A 1NICA 2BP0B 2FQEA 1ZV2A 1AZCA 3OM3B 4AKPA 3SBQA 3OQRA 1OE1A 2VN3A 1KBVA 2J57A 3HB3B 2CBPA 2BZ7A 3D12B 5B7FA 4HZ1A 3H4FA 2H3XC 5B1AB 3CVCA 1J9SA 4ZK8A 5A7EA 1E30A 1RZQA 4JHVA 1GW0A 4Q8BA 5D4HA 3EH4B 1AS6A 1CUOA 1AG6A 1GSKA 2WO3B 2BZCA 4KO6A 3T6WA 3V9CA 2VMJA 3SQRA 1OCCB 2DYRB 2J5WA 3IBOA 3EH5B 1EZLA 5AKRA 1BYOA 1FFTB 3KW8A 4F2EA 2LLNA 1NINA 3UABA 1MZZA 3QQXA 2FQGA 4DP2X 3ABLB 3MX0B 2YAMA 1NTDA 1V55B 2BWDA 3NSFA 2GI0A 1A4CA 2MRYA 1AS8A 1PNCA 1ET7A 2YAEA 3FQYA 5I6NA 3CG8A 3T9WA 4N4YB 1AZUA 3T6ZA 4F7KA 1ETJA 2YARA 3TBCA 1TEFA 2VW4A 4G7QB 1WA0X 5AFAA 2BP8B 3NT0A 4YVUA 1AR1B 1ADWA 3GYRA 2XUWA 1JZFA 2DWTA 4BDVB 4G71B 4W1TA 1AOZA 1NWPA 3NJMA 1NIEA 5D4JA 2XV3A 3CVBA 3TU6A 4EF3A 3OMIB 1NIDA 1DZ0A 2Q9OA 1PCSA 4BK5C 3DKHA 1JXGA 3PCYA 3GXUB 3QJQB 2VM4A 4E9VA 4NB7A 1NIFA 1GS7A 1WS8A 4FAAB 2PPCA 3NJLA 5F7BA 1JZEA 5I6LA 1HFUA 2IDFA 5LDUA 4E9RA 3CDZB 4HHWA 1HAWA 2PPAA 4DP8X 1JXDA 4KO7A 3IE9A 4FA7B 1QLEB 1L9OA 3FU7A 3NJKA 1UATA 2DY2A 2NRDA 1NZRA 2XV2A 4ENZA 2YAPA 4X4KA 1BXVA 3ERXA 2AZUA 3OMAB 1GY2A 5B1JC 3ZX1A 3S8GB 4G72B 3EHBB 2WSDA 4YSAA 2EINB 4W9ZA 2FWLB 3S8FB 4E9XA 4GXFA 1OV8A 4GP8B 1PMYA 3ZBMA 2YXVA 3L45A 1AQ8A 1ZDSA 2FTAA 4QKTA 1OE3A 2HX9A 3QJRB 2IH9A 1ILUA 1ASOA 3C75A 3UGEA 4GP5B 4KNTA 1RKRA 2H47C 1L9SA 7PCYA 3T6XA 2FQFA 1ASQA 3AG2B 4P5SA 4JKNA 2AANA 3FYIB 5I28A 1SHXA 2TSAA 2AZAA 4MFHA 1PNDA 8PAZA 2CCWA 2W88A 1R1CA 4AKOA 4YSEA 2ZWNA 2ZOOA 3S3BB 3ABKB 3IEAA 1ZIAA 3QJUB 4YSQA 2Y1AA 1J5DA 4HCFA 1T5KA 2R7EB 1BXAA 2Q5BA 2EIJB 2TSBA 1E67A 1EHKB 4YSUA 2GC7C 1ET5A 1XB6A 1SFHA 2YQBA 2FT6A 1L9PA 4AZUA 2JXMA 2CAKA 1JVOA 2B3IA 2P80A 3NJFA 3S3DB 3UADA 4PCYA 4NERA 1KYAA 4A68A 4DP4X 4AI7A 4AX3A 3UAAA 2VM3A 3V9EA 3ABGA 3X1BA 4YSSA 2H5UA 3NJGA 5I6OA 3X1EA 2X87A 5I6PA 2XVBA 1JERA 1TEGA 1KGYE 1OOWA 3ASOB 4E9YA 4UANA 4L0PB 1SNRA 1IBYA 1M9WA 3AG1B 2AVFA 1KBWA 4HALA 1WA2X 3DIVA 3AZUA 1NIBA 3HEIB 2GHZA 2FT7A 1GS8A 1FA4A 2IDSA 1V54B 4BXVA 1PLCA 1W6WA 2I85A 2P80D 2W8CA 5TK2A 2IAAC 1A4BA 4DP9X 1GY1A 2HLEB 3FS9A 1AACA 1GS6X 1RZPA 3DTUB 1PLAA 2PCYA 3BQVA 1L9TA 4QLWA 2XLLA 3GDCA 3N55A 2PPFA 1QHQA 3SBPA 1NPJA 5I6KA 1ILSA 4DPCX 4A2GA 2DWSA 1L9RA 2XX1A 4BWTA 1N68A 2XXGA 2HXAA 2IWFA 2PP9A 5B1JA 1JXFA 3PPSA 4A66A 3FSWA 3FYEB 3NYKA 3IN0A 2IDTA 1OCRB 4BWUA 2E86A 4A2FA 2YXWA 2GSMB 2A3TA 3ABMB 3CDZA 1SJMA 2PP7A 3TASA 3RYMA 1SDDA 3WIAA 4F2FA 1E5ZA 1ZIBA 2YAOA 2QT6A 1SHWA 1I53A 3OMNB 2OCCB 3PAUA 4G7RB 4Q89A 3QJSB 3ZDWA 2GBAA 1NDTA 1HAUA 3QPKA 4N8UA 4BWWA 2WO2B 3AY2A 3AG4B 3JT2A 2MTAA 3BVDB 1XB8A 1JZJA 2AFNA 4A2HA 4DPBX 1PZCA 1OCOB 5I26A 3FSVA 2QPDB 5I5IA 5PAZA 4YSRA 2IDQA 4KNSA 4DP5X 3ZIYA 2PPEA 1KV7A 4HCGA 3X1NA 5FC9A 5EHFA 4K9JA 2ZXWB 3ASNB 2QPEB 3FT0A 5ANHA 2HZHA 2XYBA 4YVNA 4E9SA 1PLBA 4P5RA 2ZONA 4G7SB 3H4HA 3FU7B 2FJSA 3SBRA 1A8ZA 2EIMB 2VW6A 4HAKA 1NIAA 2VW7A 2BO0A 4E9TA 1AAJA 2R7EA 4PAZA 2BP0A 2VSKB 4YSCA 1OF0A 1MZYA 2VSMB 4DP7X 1OCZB 1BYPA 1J9TA 2IWEA 3U25A 1F56A 3X1FA 1E65A 2YAHA 4BXSV 2PPDA 4WKXA 3TBBA 3NJNA 2IDUA 4GY4A 1KDJA 3MBWB 1W6LA 1WAEA 1XMEB 2I7SA 3FPXA 1SF5A 1JZGA 4M4RB 3S3CB 3KW7A 2XV0A 2XU9A 3T6VA 4JHUA 4HCIA 1TKWA 3PXLA 1AZBA 1ET8A 2IH8A 1E5YA 4M3HA 1ID2A 5E9NA 3H56A 3UACA 1BEXA 2Y69B 1JZHA 3IN2A 3JTBA 2FNWA 1BXUA 1PAZA 2X88A 3UAEA 4E9WA 3WNJA 4WTQA 3NSCA 3NJJA 1TU2A 1VLXA 2XXFA 3FSZA 1JOIA 3NP4A 1IBZA 1NPNA 2OJ1A 3OD3A 1CURA 2BW4A 4DP6X 1MDAA 2EIKB 1KCWA 1SF3A 2OV0A 2PLTA 1BQKA 2BHFA 1A3ZA 4KOCA 5I6MA 5B3SB 1CYXA 2QDVA 1SFDA 1PF3A 1WS7A 4UF7C 1L9QA 4A2DA 2YAQA 1GYCA 2BP8A 1AS7A 5F7AA 2I7OA 1ASPA 2DYSB 4DPAX 3NSYA 3NJIA 5I5MA 1RCYA 1MG2C 5PCYA 4BDVA 3FU8A 3WG7B 1IC0A 1AZNA 3PAZA 4GP4B 1FWXA 2JFCA 3X2QB 2XWZA 1B3IA 3AW5A 1XB3A 2QDWA 1N70A 2DV6A 5B7EA 2HX7A 1J5CA 1PZAA
chains in the Genus database with same CATH superfamily
3F58L 3OBAA 5C3LD 4MMXB 3D39D 1HXKA 3QT2A 1HCYA 4G11A 2CPUA 3T8XA 3O4LA 4A7QA 3QIWD 5DZAA 3H9SA 3KVPA 3OL2A 3WL9A 5CZRA 5LKNA 4HQQH 3SPGA 4PJEB 3NUKA 2EJ1A 2AEPL 3IJHB 1LEGB 4ZG1A 2BSTA 3W0WD 4X6DE 2HRHA 1M1XA 2ZOUA 4H5SA 3M8OL 5FM8A 4R7VA 4CN6A 5ENWB 1JPEA 3FQ1A 3QNYA 5DMKB 4OZHF 4L4TA 3RA7H 2I9TA 1ZJAA 5IVXA 3BP5A 2WMPB 4NYLA 4KXAA 3Q6FA 3N2JA 3AY4A 1WBZA 1N2RA 3ARBD 3DRQB 4HZAA 3U6RA 1DN2A 4Y2NA 1KCVL 1G7PB 4YSDA 2QADD 1OANA 4NRXA 4NQEA 1UEYA 1K4CA 5D70L 3GS7A 3QDGA 1M57B 4HIPA 2A83B 4TXVB 3MPCA 5I8CB 2AKRB 1J1OH 3TJPA 4XHJD 1XCTA 3PFQA 3GHEL 2WXOA 2WAQA 1SBBA 3QULA 5DK2A 2FT8A 4NM8H 2XQYA 5FK9A 1PSKH 5HVFB 1IC7H 3JXAA 4FNTA 3SE6A 3MV7A 3QEQD 1UD3A 3RB5A 3SE3A 2VE6B 5F7DA 1U6AH 1G5AA 4MMZA 5SWZE 1TSHA 1E2WA 3UDWA 5DC2A 5GRJL 2OX5B 2UXGA 3BKYL 3K81A 2CRMA 3RWJB 1PAMA 3V0VB 4TSCL 3ARVA 4X0KA 5J3HC 4I4WA 1KEGH 1DQDL 1A7QH 4P3CH 1MG3C 4WO4A 5DSCB 4PRNA 2VLKB 1NKOA 4RQQA 2JELH 4WVRA 4ANXA 2K6YA 4A2MA 3VD3A 3ZQWA 3TP4A 3GSQA 5IJKA 5GS1B 1RZFL 3SPVA 4JY4B 4N22A 1S7RB 4PJIF 5D93B 5D7HA 1OAZL 5EO0B 4OJEH 3W9EB 4ISVB 5D2NC 5I18L 1QUNA 1F4XL 4FERA 4AYEC 1U8MA 1QA9B 1ZS2A 2BP0B 1GGCL 2WANA 4LASL 3VXUD 5AOLA 1T2JA 3LZPA 3DO4A 4KK9D 4ZOCA 1NC2A 2F68X 4E2OA 3IVKA 2Z9TA 4RMWA 4LDOB 3BDYL 1YY9C 2BZ7A 4ADIA 5ES4B 5CZXD 4IRZA 5MERA 4FQ2L 4OIAA 1WBYA 4LCIH 5A7EA 1RZQA 3RZCD 3OKNB 3E2HB 1TFPA 4DGIL 5D9SA 1J8HD 4ZYKB 1KY7A 4DNLA 4QRQA 3D6GA 1Q9LA 5J6HB 2VMJA 2DYRB 3NK4A 1GPOH 4G5ZL 5HYIA 3HFML 5AKRA 1T6WA 4J4PA 3P0GB 5C2BL 2MHAA 5ACLA 4F2EA 1WWAX 4IOFD 1JZ5A 2WXJA 3B9DA 4LOUC 1FZJA 2AJYH 3WY2A 1NUNB 2KPNA 1KIQB 3F62A 3VXQA 2Y2YA 1I1AD 2OCFD 2F54D 1YEFL 2NT0A 4FN0A 1IJ9A 2LGNA 4X9HA 4HUUB 1RSYA 2EXSA 3BQUD 1QRNE 4JFFA 1B88A 4UOJA 3RIAF 2ZKYA 3ZUCA 2C3HA 3BZEA 4UQDA 3TVMB 4G8IA 5MENE 2EC8A 2YARA 3D9AL 3EYOA 5F7NC 3FO1B 1WA0X 2MJWA 5CSZA 5IKCA 4MRCA 2YC1B 2P26A 2K9UA 4G42B 1CDIA 2XIBA 5DJ0A 3FUIA 4OZFA 2J88H 4UM9B 5I73C 3K5RA 2DYPD 3KPSD 3L7FA 2ZOKB 1TYRA 4HWZA 5IROC 3T2NL 4EZKA 3NJMA 3V10A 1XR9B 3KGTA 3O3DA 3MC0A 2I32A 2B9BA 2NW3A 3ESNA 3FMGH 4H44C 4JEGB 1IQWH 2YGPA 1SXNA 3H42L 3ZGHA 3BCFA 4L3FA 3JWDC 5C09D 5CGYC 4ODXA 4JG0H 3D4YA 4WKZA 2Y06L 4Y1AA 1FG2A 2OQJA 5FOBA 1KCKA 4ORZC 3T2QA 4XP6H 3HPJA 5F7BA 4A39A 3SGEH 2DMHA 5FECA 4J1UB 3REVA 2VUOA 2X7LB 2XBZA 3HR5A 3PP4H 4E41B 2WSPA 1XIWC 5GRUH 2BJML 4FA7B 3V52L 1DUZB 3L9BA 4Y2LA 3ECWA 4BZ2H 3BZ4B 3U4AA 2C5DC 5L2KA 3QORD 3EIFA 2FWOB 1MWAL 3DMMB 2NXYB 3BXNA 1MLCA 4JY5H 4NKIL 3HS8A 2K1MA 2NLJA 3KPPA 2Z65C 4OF5A 4M43L 1VZIA 3CQQA 3OXSB 4ZMLA 1BBDL 1NFDB 1NUGA 3FOLA 3NRFA 2LV4A 4MJID 1CBJA 3DVGA 1D5MB 4M00A 1YEEL 4YLBA 5EU3B 1ESOA 3BAEL 4HKBA 4L8DB 3RX7A 1S7VA 5DMIH 4QLRA 1N18A 3ARXA 4HUNB 5LBSA 5F0PB 2JK5B 1HQRB 3FYIB 2ALAA 3OAUH 4NUMA 2W9EL 3V7AG 2YK1H 4ZAKC 4LQFL 1ZLUH 2BOCA 1A1NA 2NSMA 5E94B 3WLWC 4FFZH 5IQ7H 5DD3H 5IMKA 2ZWLT 4OGXH 4AYBA 7FABL 3MRJB 2XN9D 4XNQA 1IGTB 1XXDC 5GS3A 2WLLA 5E2TL 5IB5A 1QMUA 2NYKA 3CXFA 2AV7B 2YQBA 4KROD 4Q0XL 1QLEL 3AS3A 1JYWA 4JM2D 2CAKA 4Y5YB 2YPLE 3EFFB 4PS3A 2WB7A 2Y1VA 1I7ZA 1TUPA 4EIZC 2FAUA 2JJVA 4OZGF 4URTB 2XBTA 5E2VH 4EIBA 4NQTA 1TT6A 1CR9H 3FZUC 3SKJH 4HJ0D 1CF8H 2LFEA 4YHML 3MYJB 1YNTF 1X7QA 1TKWB 1P4IL 2ZAIA 1WFIA 1LP9E 2YZ1A 2CCLA 3KR3H 3NIGE 4F7TA 4GQ9L 4APQC 1MJUH 1A6PA 3FCBA 1GA2A 2VAJA 4H8HA 2AVFA 4Y5VA 4FL4C 2IANA 1QR1B 1J5HA 1GSMA 3AZUA 5ANMA 3EZJB 2F58H 1XTMA 1JF1A 2VXVH 3VFPB 3HC3L 1Y6MR 1OQOA 4BXVA 5E8NA 3IF1B 1P9MC 2YD5A 4XN5A 5HDBF 5TK2A 1A4BA 3SE8L 3VI4B 1IAOA 5G4NA 1YAIA 3AQYA 3F7KA 4OBRA 4ILDA 1YYML 2XWJA 3IXAA 1XZ0A 2YLHA 1NGQL 3C6LB 3X14A 2J1WA 3DETD 5JYMA 4IU3B 4NQDD 2HXAA 5B1JA 5DR5L 4F33B 3FSWA 3MJ8A 4N2IA 4PJIA 4JPKH 4QRTB 3VFNB 3CDGB 1TZHB 3L1EA 1EUTA 3V0FA 3EJTA 5C6TL 4JR9H 4OLZH 2FR4B 4YDJB 5AAPA 2OMUA 3BP4A 1KIUB 4UQEA 3VH8B 4P4RB 2QT6A 1AR1C 4KJYB 4W9CC 1PEWA 1K8IA 2Y4SA 4Z6AT 1PFCA 5BMFH 1G7LA 1KB5A 3R1GH 5FF6B 2DQDH 3VXNA 2VABA 1KLGA 4WV1A 2ZT9C 1X5LA 4JFPB 1VFBB 4K5LA 2EDWA 3EFOB 2EIZA 5DD0H 4EOWH 5EF1A 4Y0GA 1D5IH 5E2WL 4BZYA 5MEOA 5D71L 4IRZL 1A3LL 4FTVB 1NMCB 2ICWB 1RAMA 4TNFA 2YSSB 1TVBB 3BWAA 3IU4H 3LCYA 5D7JB 4BH7A 1MCBA 1G7QA 3FUFA 4X4ZA 2DWDA 1UHVA 2NY3D 5L8JB 3FQUB 2JIXA 5C08E 5GPRA 2VITB 4HCGA 4H1LG 2XY2A 1G9NC 2C34A 3RIFF 3FU5A 3D30A 4PJ9B 5E8EB 1FFPA 1ZGLM 4Q4EA 5EZLA 1F1DA 4L3ED 3L6FA 4XR8C 1HOCA 3BVXA 2ZONA 2DQTH 5J13C 3E6HA 4U7MA 4YIQB 1G9EA 2WZPA 1J05A 2Z8SA 4MJ2A 2PO6D 3EHBC 2VRKA 4ODSL 1ZGLP 1IC5L 4PAZA 2AAVA 1AO7D 5EWIH 5E1AB 5DRXB 1ICTA 2JKIS 3MUZ1 2DDQL 4OLYL 1ZVHA 4DP7X 1DE4A 5ISZD 1PKQA 5T5NF 1XCQA 4L1DA 4L8SA 4HIJB 2R8SL 1QSEE 1XGTB 4FG2A 1OGAB 1GAFH 4GT0A 1UKSA 4PWJA 3NMEA 1D7FA 1UVQA 3BWUC 4X6EA 3WNPA 1J1XL 1IILE 3HG3A 3QO1B 4MGXA 5D7IF 1F42A 1P4BL 4ZMXA 3SYAA 3VRIA 4N2LA 4HXAL 5DUBB 2UWEF 2QVKA 2VLLA 1JV5B 2WVVA 1O6SA 2YBRA 5C2UB 1Y6KR 4Z7UF 3SPJA 3QYMA 4MDIA 3DX3A 2Y3NA 4YNYA 1ET8A 2H1XA 2NY2C 2A77L 2OJZH 2IV8A 4OM1L 3ZY7A 3IAQA 1BEXA 2Y69B 3I6KB 1EEZA 5I71B 1SXAA 3LZRA 5DVNA 3VAEA 5F7HA 1GZPB 2HJKB 2DBJA 1L7TH 3DXAB 1IC4L 3Q01A 2AHIA 1TEYA 4QRUB 4AEHH 1VLXA 3V9FA 3FSZA 3IRPX 2EH7L 2IV9A 2Y6SD 2ZSWA 3TO4C 1V3MA 2K45A 2YD0A 1VA9A 4MNGA 35C8L 1JNNH 5DO8A 3C2AH 4PREA 1KCWA 3EH2A 3NCEB 2LE9A 2BHFA 2A6JB 4WGKA 5E8PB 1QSFE 3MRBB 3N1GC 1NGXA 2YN5A 3VSVA 4QIRA 2I7OA 5E95B 4LF3A 5FO9A 2X4PA 3QDMB 1GGIH 3LH2H 1CIDA 1TO5A 5CJXA 1HX0A 3ML8A 3F7QA 3O11A 5SWZD 3WG7B 3WIFA 1IC0A 2P8MB 4BQ9A 2AI0L 4CN1A 1UT9A 4HFUH 1FWXA 2APSA 3DX2A 1DFXA 1SYVB 1FE8L 3QCUH 1N10A 4Z7VB 4WSGA 1N26A 1I85C 4LPYA 3KVDD 4JFQB 1S9YB 4P9MH 2PCFA 3IGAB 4PLNC 1OTSC 1H3UA 4W81A 2GK2A 3OKMB 4JX0A 2VZ3A 4P5TC 3LD8B 3GEFA 4N0FB 2Y23A 3BW9A 5FCSH 4NHUA 1NLDL 3UL4A 2FHBA 4E9QA 3SDXB 3MRMA 1DEEA 2IQ9L 4XPBL 4P2YA 5C0CD 4K71C 3V55A 1WCBA 3G04A 3GGWA 1P4LB 2VXSH 5B1KA 5LAXA 2L4OA 3UC0L 1BVZA 4ZTOL 5KJ4A 4AV0A 2VLKE 4DVRH 4B3EA 3FHAA 4GO9A 5I1EH 1FUNA 4W9EC 4HMDA 5JOFA 5IT2L 1T0MA 5MEPB 2V7HB 3FB5B 3M88A 5AAMC 3WY3A 1BAWA 3A4EA 4DTGH 4TNEA 2NY7H 1H3GA 1MCRA 4HX1B 1Z9SA 2WLNA 4YH6A 3QUYB 3FHEA 4GT7A 2E6QA 1IX2A 3T0EA 4J3OC 1H3WM 3V0WH 3WN5C 4EI0A 3ETBF 1MFDH 3SBWA 2P42B 1JGDB 2Q2LA 1NPUA 4D9RE 2MCPL 1N67A 4L37B 1ZHBA 3IFPA 3L3KA 1B4TA 4R97B 2HVJB 1QATA 5IUSA 4E42A 2CUAA 4NP4L 3WSQL 3CXHK 4KX8A 2R1YA 3CFCH 3PIQB 3PWJB 3QNXA 4OZFG 4U6XB 4UAHA 4L4VB 1DJGA 1KEMH 5F1NB 1IKOP 1W80A 3ARDB 1CGSL 2VH5L 2ZXBA 4BQ6A 1YN7B 5AALA 2EYRB 2XT1B 5MEND 1R0AL 2VLJA 3GBNL 1QHOA 3CZEA 3TEYA 3SDCB 2DMGA 3D08A 3PJSA 1M05B 2E47A 1IM9D 1A7NL 1BEYL 1YPZB 3QWRD 4JZNB 4NZUL 4Y88A 4UTBA 4QEGA 4FNLL 3ARYA 3UERA 3MCKA 5C0FB 3OKKA 3BUYB 4B0MB 4OAWB 2CNZA 4OQTH 3HVNA 4G6KL 4A1RA 5J1AB 1P7KB 2P1YA 4GG8A 4FEIA 1I9IL 4JG1L 1CQYA 1YMMA 4W6WB 3OX8A 1X9UA 4PJXA 1FN4A 4FULA 4XO8A 4QHMA 3DOHA 4YMPA 1A7OL 1S7WB 2NNAB 2WNWA 4JZJA 5HDRA 5I75B 1EGJH 5F8QC 2I07B 4B9IA 2AV1A 3EYVA 3KH4A 4IRSD 2R4RL 3U9PH 4Q6IA 1HXMB 2B0SH 2JVUA 1KB5L 4X7CC 2QSVA 2PR4L 5C70A 1MHHA 1E6JL 1U8OA 5B38A 1E30A 2IWGA 4YHIB 2APXA 4ABUA 4ZSOB 1FLRL 3QWQB 1S9XA 3DRTA 3P4MB 3NCCB 1A14L 4XVSL 4KO6A 5IHZB 3MA7A 2CIIA 3B7UX 3GZQA 2E9WA 2ZUTA 4P9HC 4ALAL 5C0GA 4OB5L 3EH5B 1BGXH 1FFTB 3FQXA 2PYFB 3BSGA 3O4OB 1LO2L 1UT1A 1TCRA 3IB4A 5ELIA 4W9DC 2BNQD 1V55B 3Q2NA 2BWDA 4C56B 4X6BA 3TFKD 1R4XA 3ULVH 3TEZA 4LCCC 2E6JA 3MLXH 4G3YH 4BFIA 1NCCL 5HGAB 1A4KA 5TF0A 3CG8A 4N4YB 1BFOB 1KN2H 4KVPA 4EUPG 1K8DB 4M5ZH 2VR3A 2J8UF 3BESR 4NHCH 4F2MA 4ZX4A 2NUTB 1XQ4A 4XNDA 1BCIA 1OD7A 1YEHL 3QZOA 4ZW6A 4ZOBA 3AB0C 4PP2A 4PB0H 2G9HA 3GUTA 4AY0A 2HG5B 2I27N 5FHBH 1U33A 4Z3IA 4LNVA 5A3IC 3BEWB 4GRWF 3LXUX 3P2DA 3K6OA 4JAMA 3BUQA 2Z7WA 3IDXH 2UWEA 5DQJA 1DVZA 4XMVA 4PN6A 5ID1A 3MUJA 2PN5A 4K94H 3PCYA 1CD0A 2YPLD 4U2YA 5SWQB 2F1EA 1PDKB 4XRCA 5BS0D 4PJ5B 1TF4A 4UV4L 4V1DB 2XTJE 3L4WA 4TS6A 3U0PB 1FAKT 2XSKA 2QQLH 4GKZB 4G9DB 4X99A 3P3UA 5DUPH 4FABL 1HEZB 4HIHB 5H37H 4HHWA 3TGXA 3FCTA 4XGZA 2A73B 2O5XL 3W39B 3O3AB 5CZKA 5GS0C 1UATA 2DY2A 2D7TL 2JMRA 4O5LL 2BRQA 2NUPB 1KFGA 3LX9A 2XV2A 4ENZA 4XODA 5LGKA 4HD5A 3ZX1A 2PCPB 1A66A 4S1RH 1DVFB 1JNLL 4NC1C 1MH5A 5D2NA 3V4VA 1LO5A 3ASWA 3CDFA 3RFRA 2LOEA 3DGCR 3P30L 3RAJL 3ENEA 4M62H 5J8OA 2HX9A 2V5RA 5TTRA 4WI8A 1OAYL 4IKJA 3S97C 4HPHA 1XF3A 4QXUH 1HSBB 4U2ZA 4KY1L 3BVNA 1NEZG 1T1YB 2K8MA 4QF1A 5DJAB 5TH2A 1IZJA 2A99A 2C9XA 5IW6A 1W9XA 4HBCH 4LSUH 4Z7NB 3I9GH 3V6OA 1SBSL 3SDYL 5EU5B 1KF9B 3ILQD 1R1CA 1ZA6B 4G6FB 4LRNH 3REWB 4D0DA 4L18A 1ZIAA 5HHPB 3CSYB 1DVUA 4PVLA 2R7EB 2F5AL 2YD3A 3D18A 3F04A 4JFOA 2EIJB 5LGHL 3LMJH 1IAIM 1J5OH 3NAAL 3GMNB 1GCFA 2WWKT 1U8CB 1ET5A 1F2QA 2BFVH 2W0FB 2JQAA 3BGFC 1TPXC 3S3DB 4LVEA 1KYAA 3FU6A 4XNZB 4GS7C 3IETB 4ZX6A 4JRXB 1FG9C 2OW6A 3KGRA 3UTTB 3VTAA 4KJQC 1PZ5B 2CLRA 1UM6H 1T1XB 3B9KC 3FFDA 2PR9A 3QIBA 3OPZH 4W9IC 1P2CA 5CEXA 3DVNA 3VE0A 2J21A 1RUMH 4EAEA 2XETA 3ASOB 5IROA 5C08D 4OVUA 4CC0A 3NOIA 4JKWA 3LNFA 5A6IA 4HKJA 2PW2A 4URKA 1WAAE 2HSIA 5FYLH 3DIVA 3T1FA 5BRZB 2V4LA 5GGRB 4JFZL 4LEOA 4F7CB 5CKGA 1BZ9A 4Z3EA 4Q52A 2AABL 1RFDH 2VKXA 4DW2H 2O72A 1E28A 1JK8B 5F6IB 4F58L 2SODB 5I74B 1GS8A 3EOTL 2V6HA 4FTVE 5EF0A 4QRBA 4PRBB 4QD2E 4LNRA 4WY7H 2F74A 5DI8B 1OT2A 2K78A 4L3CB 4BYHA 1XIWA 1TQSA 4RVBA 2Y2WA 3APMA 3ARGD 4WIQA 4FFVC 5I2IA 4I9WE 2E9GA 4P46D 4OKVA 4I5BB 4H8WL 4H8VA 1EJOH 1QSED 2BX5A 5CUSL 3V52H 3M45A 4YPJA 2VDMH 4XNXH 1I8IA 5I16B 2PP9A 1L9MA 5A2BA 5B3JF 5CBEB 4OY9A 4PY8I 3VQMA 4C4KT 4WAFA 3UBXA 3P0YL 1IEBB 3IDNA 4NNXA 4MNHA 4WW2C 1E5AA 3VG9C 1GZQA 2DQJH 5EO1A 4Y9CA 1CTNA 5HGBB 2IAMC 2BOLA 1TTBA 1M2VA 1IGCL 4O2FA 3WS3A 5FW8A 1OGAE 2BHZA 1ZVNA 4LPUA 4TLTA 1I7UA 5L6YH 2Z8WC 4BFNA 2YKLH 2A6IB 2WINA 2EDKA 1VGKA 2BSCA 4UI2A 3AC0A 4ZAKA 2G4EA 1HHHA 1Z9OA 3U4KA 1L7IL 3E3QC 2N3JA 4IGBC 3U46A 1N4XL 5EFIA 3N1FC 4ZXBB 1HE8A 3RB7A 3VD1A 3KYMB 1KCVH 2Y5TB 3ARUA 3CVIH 2X3BA 2X6BA 3SYPA 4RWYL 5A2IH 3KCWA 3ZIYA 1GC1H 5D70H 5F7MC 5CINL 3RTQD 5HJDA 3H2QA 2ZXWB 3G5YA 4DK6A 2E8ZA 2FO1A 2ZUQB 5C3IA 3ULUL 2RBLA 1VZHA 4NFBA 3VU2A 1CDGA 3IXTB 2HYMA 4LLQB 3MRRB 4X7TB 3APFA 3NA9L 1I8KA 3QS2A 1U8IA 1YO4A 2J8UA 4D8PA 1F5WA 1YEIH 4KK8C 5IGXH 1WUNT 5GRVL 2IBBA 3L5IA 3IDYB 2YQ2A 1G7HB 1E4WH 1AGEB 1OF0A 5T3ZL 4XVTH 5GRJH 3L5WB 1MVYA 1FORL 3BKYH 1F00I 3EZ8A 2FJFA 2WTRA 4I87A 3U0WL 4APQA 4TSCH 1NJ9A 4ZTEA 4J3OF 4B7LA 1DQDH 3HG2A 5FUCC 2BMKA 1NM9A 4BFFA 1JJUA 3CUPB 3PWLB 2ZCHL 4P2OC 1L5GB 4NT6B 3RVWC 4UQAA 2ORBL 3DX9A 4PWEA 1HHGA 5F7LB 4D8OA 4XH2A 4Z7VE 2LVCA 4RMRA 1U3HD 1P9MA 1A6WH 1X4ZA 2EO7A 2XU9A 5AENA 1QKZL 3GC3A 1KBKA 3ME0A 1RZFH 4LHUA 4NO3A 4QT5A 4OI8A 5BV7L 2XXCB 2EYTB 2GKIA 2GSIB 2OP4L 3H1ZA 4MA7H 5G2NA 2X10A 5KVFE 1F4XH 1IBBA 1BDYA 1BXUA 1GGCH 2A9NL 4CRPA 1KWKA 4E9WA 4HWUA 4ADGA 3VB9A 1Z3GL 4BK8A 4N0RA 4NZJA 2RMNA 1UACL 5HJ3B 3RVXD 1OAJA 1E7UA 1O7SA 4FQ2H 2EEBA 1PD1A 2CDGB 1F45A 3OSVA 4V11A 4TPRL 5C7ZA 3Q1EA 4DGIH 4PJFE 3DURA 2AXFB 2D2CC 3L9RA 4YDLB 1XF2B 1R3KB 2VZUA 1PF3A 4A2DA 2X4SB 2FX8L 2EACA 1U21A 1CLCA 3DO3A 4G5ZH 4J2QA 4UT7L 3V4VL 5JNYB 3PQYE 3E80A 3LB6C 1R3LB 1XGQA 1NOAA 1A2YB 1G1OA 1RUAH 2ED8A 5CCGE 2A7BA 1U8KB 2P5EA 4F91B 5T3XH 5GGQL 5BOJA 5DZPA 1SQMA 3CFBA 4IU2A 5C9JB 3SO3B 5C0BD 1YEFH 5AW6B 5BZXA 3AWFA 3J07A 3IGLA 2HFFA 3GXPA 1QYGL 1D9KC 3RQ3A 3M17B 4UNUA 3MV8B 4XMZA 4PJGA 1QVOB 3ETSA 2DD8L 3WJLC 4KXCA 1XDTT 4L4VE 4F93B 5E8OB 3GXFA 3D9AH 3EJRA 1MCDA 5JW4R 4BQBA 3T71A 1NGYA 5EU6E 3CSBA 5B38G 1X5HA 3AAZB 3AROA 4UUJA 5FM4A 2GABA 4RH4A 1WWWX 1YPZE 3T2NH 3HUJF 3QXUA 3NEEA 3NN8B 4A2EA 5IJCC 3JV5A 1TVHB 4UM9D 4K5OA 3NJXA 3U7YL 1OARL 4NO5B 4YE0A 5LG6A 4RFOL 4R5TA 2Y06H 4GYBA 4POZC 2VL5A 3RL1A 1GOHA 3MZGB 2X2HA 4HIQA 6FABL 4G43B 4Y7MA 3IJYB 3P77A 3QRGL 4M7ZB 1URZA 3IGKA 4OIBA 5DS8B 2BJMH 4ZNEA 1F8TH 2GJ6E 3NACH 5E00B 1WBXA 3SKMB 4E41D 1OE2A 2NSXA 2Y2TA 4YL4A 2KH2B 2HX8A 3BD3A 3FT3A 1MWAH 3FB7B 1VPOH 1AHWB 2Q3AA 4HUWA 4C58B 5ILTH 3L3JB 3NZ8A 4HOXA 4NKIH 1YLBB 5DHEA 3HW7A 4AYDC 3JWDL 4ZSOE 1LE5B 4K07A 4MXVF 4N0UA 3N44F 4FLSA 4LOEA 1YNTB 1S78D 4M43H 3S2AA 3ZR6A 1BBDH 3BOVA 3ZKXB 3RBGA 3K4AA 4P2CG 4D2NA 5GGSB 2YN3A 3WNKA 2J20A 3FO9B 2YUZA 3QC6X 1YEEH 3FQNA 4HC1H 3TO4A 3BAEH 4YDKL 4UOW0 1JG9A 5LQBL 1G0DA 4KJPD 1UZ8A 4GNKB 4M7LL 3MRKB 4YXLL 1BAFH 3FRPB 2W9EH 3ZZLA 3CHPA 3RL2A 4QO1B 3RWIB 4LQFH 5IW3A 3SCMC 2LTQB 4H1LH 5IM7B 5CJ5A 3DDFA 4MA3A 5HDBB 2JTDA 3MODH 1J0ZA 3KLKA 3TL5A 5FO7A 1S46A 1K2DB 2BW5A 3QVAA 4KO9A 2NZIA 1BOGB 1FLTX 2H41A 2ICES 3DVFA 2H6UA 2UY7A 4U7KA 1OP3K 3RX5A 5I1JH 1YEJL 1ORSA 1CXFA 3LYRA 4GAAA 2Y22A 4Q0XH 1QLEH 2JLPA 5KN5A 3M1CA 5DEFA 2CUHA 2D2OA 1I85A 4X9IA 4IBQA 1QWUA 5SV3A 3ECVA 3QIUC 4H0GA 1E4HA 1FF5A 4RNRB 2F1AA 5FYJL 2NX5A 1HILA 3N50A 7CGTA 4JHVA 4AL8C 4R9HA 2XN2A 4P5TA 5F1KC 2WO3B 4Z3FA 1CWVA 1FZKB 4JRYB 1I82A 3AM8C 4PJAA 3ZZ1A 1P4IH 2EQDA 2VR7A 3RILA 5JIQA 4X6CA 2P24A 2OR7A 2EC9U 2WP3T 4UIMA 3ZHNA 3B7SA 5A40E 4LBEB 2Q86A 4Y5XB 4ZQTA 3MGTB 1MRDL 4U49A 3NCBB 2E59A 4QRPB 5I15L 3ARTA 3JWOC 3N42F 1TU2B 1SUJA 5HDQL 1NTDA 4IRJB 3P4OA 5AAMA 3HC3H 1INQB 3A4DA 4HXBH 2QHRH 4NUGL 4ZS6C 1LNUA 4AYFB 1BA9A 1HH9A 1KV3A 3MNZB 1QO3A 1U4FA 4C55A 4NBZB 4ZRGA 3WN5A 4ZW5A 5DRNB 5AOMA 1DBJL 2FSDA 3HS0C 4ENEC 1EAPA 3SY6A 2NY4D 1H5BB 3MR9A 3SOBL 3HMXH 2EDXA 5CJQH 1WG3A 3UTQA 1IKNC 3MLZH 3VYNA 5KBPA 3GMQB 4FA6A 5D2LB 1AOZA 5DR5H 5D4JA 3T3PF 3C6LD 3CVBA 5DGQA 3SDAC 3LNEA 3P9MB 3UPCA 2OMZB 2BVQA 4Z7NE 4XI5C 2A6DB 4GW1B 3H3PL 2HRLA 4MXWL 5E6IB 4HVBA 4L5FL 2VZVA 2WPGA 4ONFL 3FT2A 3MSPA 1ZKAA 2AJXL 2DMBA 1LEIB 5F7KC 2XWEA 3IFNH 5HI4C 2EUZA 3ULSB 4JO1H 4X42A 1QQDA 4CILA 1AP2A 1BBJB 3OHXB 1MJ8H 4KDTC 2O5YL 1YQ2A 4Z0BL 3QQNA 4P5MB 5I8KL 5E2WH 4RMTA 4XO4A 2UVEA 4A7UA 3UTZA 1J0IA 4QXGL 5GSRB 5DWPA 2ZF8A 3ERXA 3LS4L 4BCYA 4PY7B 4Z7UB 4BGLA 3HZVB 2HMIC 2FBJH 1OZUA 1F1AA 3G6JE 4P48A 4G6JL 3AFLA 4FTVD 4IDLA 1UXLA 5B39G 4NPYB 4X4XA 2L0DA 5IB4A 1NCDH 4TQHA 3UBXG 4I3GA 2SEBA 2CHXA 1I8LC 3CLWA 3VFSB 2YOCA 4K8RL 2OKMA 2V9QA 4GW5A 4KNTA 2P5WE 4M4RA 4MAYD 4OBSA 4OQ1A 1IFGA 2DQMA 4P3DA 5CLYA 3UZVB 2Z31C 3LPPA 3AUWB 5C0JB 2QKSA 4PJ9D 3U9UB 2FQFA 1TZGL 5IVNA 4P5SA 4LSVL 3IDIA 3OKLB 4BFBD 5EOCJ 3VXMA 5E08L 4NQVA 3EJJX 3MLTA 3C6EA 4YHKL 1IC5H 3HN3A 1CT8B 3BWZA 3O3BB 4OLYH 2DDQH 3Q05A 1A6TB 2VMCA 2N7AA 4LMQE 2Y7NA 5L4MA 3H6AA 1BXAA 2Z4QB 3ECUA 4XCFL 3CPUA 3JV4A 3MRQB 1XXFC 4X4YA 4B7IA 4K3EL 1OM3L 2J25A 2R15A 4ZPVA 3V4UL 3L54A 3ULAB 3AS0A 1J1XH 5EU4B 3TPUB 4AENB 4LCUA 4LCCA 5E6RB 4OZFH 4JJHA 4ZFFB 3KYKL 4MA1B 2JNZA 2CO6B 5DRWA 5E4AA 4FNPA 4XCYA 3W9DB 4U3SA 1IQDA 4Z7QB 4P23C 4F8QA 3FO2A 4MJ5A 3FKUS 4CADB 6CGTA 2NY0D 1WPCA 3GI8L 4OM1H 2VLRD 3HHRB 4Z7WF 1TIUA 1BIIB 1JNJA 3S2CA 1IC4H 1C16A 4GMTL 3DV4B 3L4TA 5E2UL 2IGLA 4Z0XB 4B5ZA 3HB3C 4N9GA 5GZOC 2EH7H 5E56A 3DXAD 4AM0A 3FL7A 1ZV5A 1NC4B 35C8H 5D1ZA 1N59A 5INDB 1TENA 3FUEA 3MRGB 5EUKA 4FQJH 3GSWB 5DJCB 1WZAA 2IDSA 4JFEB 1PLCA 2E9IA 2ODIA 2P80D 4JM4L 4DZ8A 2KT6A 2VZ1A 4AUJA 4F27A 3LEYL 1INDL 1FVDA 2VXTL 4QR7A 1F4AA 3LRKA 5JDSB 1UZ6E 1YY8A 3QDMD 4DZBB 5TQ0L 4YXHH 5T1KB 1Z9MA 4HS6B 2XX1A 3QZWA 4O2EB 1FE8H 4D9LH 4IW4C 5E99L 4HEPG 4KMQA 3HZYA 1UB5B 1NAKL 3PPSA 2UZXA 4NCC2 3O3EA 5I82A 1JPGA 1CFTB 3QIWC 3MOBL 2NDFA 1KJ3L 1FYTA 1HXYB 1OM9A 3D2UB 5F1OB 3GMLA 2VKWA 4JFWA 5CNHA 4WFHE 3BO8B 2JCCB 3DC0A 3DV6A 1NLDH 1WK0A 4UMSA 3PNRB 2R23A 2IQ9H 4XPBH 4EI5B 4L29B 3RWFA 4TVPL 2BY2A 4ZTOH 4G7RB 3KNBB 4IHOA 1J11A 5TF1L 1QP1A 4N9OB 4CVXA 5D96C 4UB0L 4EUPH 4QMEA 1JHKL 1N6VA 2QFRA 4PLKD 3WE6B 4JQXC 5IT2H 1JTPA 3ARBC 1CXIA 4WTZG 2EICA 1UD6A 3PDOA 2QADC 5F89A 5F3FA 3CCHA 4N6RA 4PJ7A 1ZA3A 3U2SA 5IR1A 3QNZA 3SY0B 4QNPF 4C8XA 4FI7A 4LLMA 4LCYA 2ZXCA 5JLZB 5M7QA 1XH1A 2DN7A 5J56B 5DFVD 3D3VB 4XT1C 3FT0A 1MI5D 5E03A 5CD5D 1Z66A 4OZIF 2R56L 1DVSA 2J43A 2CR0A 3VFGL 1ZV9A 1GVIA 4PGEA 1NCGA 4YO0B 2DBLL 3WMQA 3S34L 4NP4H 2YD9A 3Q3GA 3WSQH 1TTGA 5AB9A 3TESA 3EADA 4NJAL 4J8RB 3GZPA 3GUFA 4PRDB 4KRPB 3BDBA 2VH5H 4XE0A 5SX5K 4BKLA 1MRCL 3MAWA 4L4VD 4XVOA 2IIJA 3LKQA 2PYEA 3S4SB 2FEDD 3ARDD 1UCBH 1H9DA 3X1FA 1E65A 4MBRA 5HHNB 5A6LA 4AH2A 1A7NH 1BEYH 1IFHL 1MFUA 4JDVA 4KJWD 4NZUH 3IDJB 4PJHA 3SDCD 2I7SA 1WAEA 3FPXA 4NQED 3TBVA 4DSYA 2BSRB 1ID5I 1CCZA 3Q06A 2VN4A 1A6AA 3WOVA 3WFHA 1IGMH 1T4KA 3MNVA 1ZS8A 2UY6B 3S3CB 3MV8E 2V9TA 2XV0A 3HRZC 1W8OA 4ZUTB 1D6EA 3PHOA 3VXTA 4U1IA 4JG1H 3CZLA 3INUL 3BKML 2L3BA 4LAQH 1GTNA 2R51A 2R29H 4FZEL 4KK9C 3PHSA 4JGNA 3GWJA 1A7OH 3L9YA 4MDJB 5EV7A 2X3CA 1DBBL 2DJUA 3VNYA 5CZXC 4WLCA 5BO0D 1RP8A 3SE9L 3Q8BA 2NT1A 2J2ZA 5I1LA 1KB5H 1OTTD 2PR4H 5E70A 3NEOA 4HUKB 3S3PA 5I6XC 4WW2A 2RD0A 4XPFL 1FLRH 2YMXL 3LHPL 2D3LA 5A2JH 2Y3AA 2IAMA 1A14H 3K6FA 1BVKA 4XVSH 5B3SB 3L4UA 4FTDA 1AS7A 4ALAH 2PABA 3OHMB 1O9ZA 4OB5H 4R5VA 3II2A 5FYKU 5JPMC 1NCBL 3T0BA 1KNOB 4N20A 4BDVA 5KSVA 4WHTA 2OA9A 3P02A 5LUMA 4RISL 2OYPA 4RSYA 3BQUC 3HAEA 4IGBA 1N70A 4FLQA 4U1MA 3MGOB 4C56D 4G6AD 4AUUA 2C3VA 3CFTA 1JGLL 3CZUB 4O58L 3S5YA 3RWDB 5IOKA 1X9RA 1A6ZB 1YEHH 2OMVA 3TZVD 4P9HL 3C08L 1E3XA 1FBIL 4WI3A 3I50H 1Y18A 4XAKD 2BIMA 4PR5B 5FKAB 3QEUB 3X3GH 1ACXA 3C8HA 5EEZA 3CZJA 1BF2A 1U8NB 3C9NA 5D5MF 1AD0B 4QAMB 3ZYJA 2DM3A 2WIIB 3O2DL 4HWBA 3H2WA 1CDHA 1G9MC 2IPKA 2R1WA 5F9JA 5SWSD 3UZQA 3LKSA 1NDGA 5T5FA 1XD1A 5KS9A 2H6PA 4UV4H 2NXZB 4AW4A 1T6BX 5IHHA 4TQEL 3V0DA 4MBOA 1EUUA 1I9EA 2R2EB 3ZHDA 4PJ5D 1S9VB 2XVLA 4OGZA 4V1DD 1JD9A 3HMWL 3HZ3A 4NCDA 1ZLVH 3LQMA 3V95A 4RESB 1AQKL 2OXHB 5KYNA 3PWUB 4P2OA 2O5XH 3VWJA 4YUEL 4F5CA 3QORC 5DJ6B 1WE5A 2C9QA 3P40A 1ZT7B 2WKLA 4PRIB 2D7TH 4O5LH 4B9FA 9PCYA 1KULA 5A16A 2ARJQ 2WC7A 2QPSA 4Q9CA 1FL6B 2AJZA 5KJ7E 3O0RH 5T8IA 3D0VA 3B2VL 1KCBA 4IMKC 4MNQA 1R3HB 3HLKA 3RJOA 4Q9QH 3P30H 1MAML 1IGIH 3RAJH 2UX7A 4PG2C 2CD0A 5EOTB 4A04A 2XZQL 3U7WL 1KPRA 4CDHA 2K7QA 5C0IB 3WIIL 3QQ3A 3MRLA 2JKLA 4QRPE 2IWKA 4XN2A 3ARQA 3EUDA 3UIYA 5EPMB 1U58B 5GS0L 5L8KB 3TBTB 4YHYB 1B4JL 5KYXB 2XFGB 5EUOA 2MCAA 3ZZSA 4DQOL 5LXGL 2OSLA 1M53A 1QFWM 1SBSH 1UH3A 2EYSB 3FQ2A 4OJCA 4XZUA 3SDYH 4F1ZA 4WFGD 5D4QA 5DRZB 4PJCA 1JGUL 1DHKA 1F4WL 2ESVA 2GQHA 2MFNA 4LKXA 4LGSB 2QVIA 5DJDB 2F5AH 4JLRA 2J1ZA 4ZW8A 1NICA 1KPVA 4KROC 1HEJC 6TAAA 1JD7A 4BSJA 2VWEE 4ELMF 4A55A 3CJJA 1KXHA 3QISA 1VAHA 4OU3A 5D2LE 1A1MA 1D9KA 3D12B 5IJDC 2GT9A 3WJLA 5FWRA 4LLVA 2YGQA 3PXJA 2XWXA 4MVBC 4HGWA 1Q0EA 4HJ0C 4XCEA 3BAXA 3W82A 1F4YL 4HWEL 4Y2OB 5AUMB 3OR6B 4PBVC 5D7LD 4JRXD 1JK9A 1R5WA 3UTTD 3V9CA 2JWYA 2V33A 2XA8L 3OAZK 5KVEH 2AK4B 1RSFA 2AC0A 4Z3GA 1NINA 3RUGF 2B4CC 1MZZA 3GXDA 2C7UA 3RNQA 4KGJA 2AQ2A 3CBKB 3FJTA 2B9AA 2X4UA 4JFZH 3G5XA 4K5MA 4BM7A 5EEYA 5DLMH 2AABH 2D9CA 1RUKL 5CILL 5BRZD 4F58H 3O2VL 1IAIH 3FQYA 1NLBL 1ED3A 2QMKA 3M6DA 3T9WA 4WEUD 4NN6B 2XKNA 3JTTB 4ERSH 1T1WA 2FUTA 3TEXA 3UBHA 1FAIH 2GITA 4TRPL 2BP3A 5T1JA 4NUPA 4H13C 3DETC 3GKWL 4AGLA 2XQBL 2WBJB 2XTSA 4Y8AA 1FFNA 5CWSA 1DSFH 1BD2B 3KPRB 3C09B 3O6FC 1HJCA 4YGVA 4TNVF 1R5VB 1XGUA 3DGDA 4IJ3C 5LGJA 1JYNA 1NIDA 2Q9OA 5INCB 3UTSB 4Z7OF 1CBVL 4HUXA 3VCLB 3IDGB 2EVFA 1JXKA 3QFJB 1OT4A 2G5RA 1WS8A 3MV9B 3GRGA 5E1HB 4NLAA 3MMEA 1HINL 5A6MA 1IGCH 3QJHA 4N2NA 1XR8A 4E0RB 2IDFA 3AQZA 3TIEB 2I69A 4XX1G 2CZNA 3QAQA 4P57B 1FGVH 5JUEH 1Q94A 1PGRB 2C9RA 3LQAH 5FUZL 1CO1A 5FYKE 4M6AA 3G08A 2FYYA 1KCUH 2E56A 2Y25A 2ZP8A 4LFHG 2NRDA 2Y24A 3SCMA 5DK0A 5DU7A 1VERA 3LRMA 1L7IH 3K71A 3K4ZA 4Z7QE 1RPUA 3WFBH 1FNHA 1N4XH 2VN6A 4FQLH 1OO2A 2NY3C 4PUBL 4W9ZA 4PB9H 1IGYA 3N43B 4HDIB 1ZXKA 4GP8B 2MKLC 2Y7MA 3ZBMA 4IHBA 4AVIA 4QKTA 3Q7JA 4XTRD 4QKXB 4ZXBD 1JUFB 2B3RA 2L04A 3S5LA 1ASOA 3UG5A 3SPIA 3QG6A 4PV9B 5T1LD 4FXGC 4GP5B 5H2BB 3ULUH 5TE6H 2OAAA 5KYYB 3IMSA 3QIUA 4LVOC 2EDLA 2HFEB 1A6UL 2PO6C 3NA9H 4LIQE 3T2OA 1FCCA 2OMBA 4QRAA 1TTRA 5FM5O 4JANB 4OCSL 3HNSL 2P46B 4PBWD 4G8EA 3UAFA 3AM8A 8PAZA 1T7XA 1UD5A 2X42A 2ZWNA 3ORJA 4FQ1L 2BVYA 5T3ZH 4W70A 3EH1A 5HI3D 2XIDA 4TSAL 5DQ9B 4OGAD 4EN3B 1J48A 3U0WH 2B1HH 4YAQB 4Z78A 4Z9KB 2I25N 3T0AA 4CL7A 5K9OA 2TSBA 1AR2A 2H45A 4XOBA 5JHDE 4WFHD 1ES0A 2P8LB 4JB9L 2OMXA 3LRSB 2P7TB 1TO4A 1Q9KA 1RZJC 3FT4A 2X4QB 1ORQA 2WUBL 3QXAA 4AI7A 2R4SL 2IALB 4Y2DB 5E6ZA 4HWBL 2OTWB 3SHSA 3F6IA 5G55A 3MRPA 5T5FL 1IAKB 2ZWKA 5DZJA 3MTXA 5E6SB 3RNKB 1CE6B 5BV7H 2KI6A 4CMMA 4PWFA 4HJEA 3WE1A 3HS0A 2JCCE 1LMIA 3IRCA 5FFGA 4G8FB 3APDA 3O9WB 1IKNA 1C08B 3ZDXE 5KBNC 4X7DC 4DEUA 2HT3D 3QE5A 2Y6SC 1O7DE 4UANA 3HUJB 5ESAB 5I1HL 1DBKL 1M9WA 3EFDH 1ZLDA 4X8JB 4IS6B 3SDAA 4G9FD 1WA2X 4XP9H 3TIDB 3QDJE 4ODHL 4TPRH 1LK2A 2GHZA 2XKSA 3TBWA 3PWNA 2G3XA 1HDMB 1MWAB 4Y4HD 4XBGB 5KUKA 4NRYB 1D5BA 4YBLC 2FX8H 3Q2WA 4MTMA 1A9EB 4HJGB 4DP9X 3NFPB 4HPOH 4ZPTA 4H26B 3V4VH 2YD6A 3JTSB 3MQIA 4KDTA 3D3VE 3FFCA 5IW1A 4JN1L 1IGFL 2WYZA 3BQVA 2ZNWA 3LDBB 1Y0LB 3D25A 4LHJB 4A2LA 4O51A 4FI8A 3GMOA 5JW3L 3R0NA 1L9RA 2WLHA 2XXGA 2P4AB 5CGBA 3QJXA 1QYGH 2ALWA 3VD9A 2J12B 2GBVA 1ZJBA 3ULVE 4L4JA 1I4FB 2HJLA 3C60B 3L7EA 1VENA 2VDOH 3F7LA 1C5DB 3NH7L 4KHTL 3T4AB 4P2QB 3MV8D 5E5MB 2A3TA 4H1LB 1XAKA 2GG1A 3KL0A 1DQJB 3DOSA 3RWEA 4XN9A 4DN3L 1Q0XL 5HVWA 4ODWB 2Z31A 3EJZC 3KGSA 2IADA 2EXWD 5IQLA 3V5DB 3NRQA 1NUDA 1YUHA 4WI0A 1MOEA 4N8UA 2BSTB 4GJTB 3BRFA 4FG4A 3BP7B 4IIQC 4NPJA 3U7YH 1OARH 4PRPA 3BHBA 4LARL 2A6KB 4RFOH 4M6ML 1BREA 5HJGA 4IBVA 3ARZA 4A2HA 3AJ7A 4MA8H 4GQPH 1RK0A 1REIA 4PG9A 2WN3A 2NW2B 4LOVA 3QNYB 1OQXA 1AJ7L 3TBYA 3WHXB 3CIQA 4TULL 4NYLB 3BGAA 2A0LD 6FABH 1K5NA 1EO8H 2OMYB 4KK5D 3UFIA 3ZDYF 5JMRA 3QRGH 4GSQA 2OI9C 3QUKB 4J3WA 3U6RB 1S3KL 4Q9RL 3QG7L 1ZT4B 1CXHA 2HPTA 4NRXB 5B39A 1G4RA 1G6RA 1SOKA 2WZ0A 3LTVA 2DKSA 2FEJA 4RAVB 4XBEL 4HUVB 3ABZA 4P23A 5E0FA 2BHUA 4I48B 4PI2A 1YVLA 3QCTL 4JKPL 4J3VA 3JWDH 2WLZA 2Y7OA 1XCTB 3GNML 1EPFA 3QULB 4K2UL 5FDYA 3TV8A 4RRPM 4WUUA 5FK9B 1BZDA 3HBQA 4N24A 1T5XB 1XGRB 4R0LC 1KIPA 4LAJH 3WXVH 4Z76B 2A9BA 3CIAA 5EA0L 3TCLB 1JPSL 4BA8A 5KEZA 2BRRL 1QACA 2BNUA 3U25A 4WDIB 5GZOA 4M6OL 3N42B 3X13A 2O26U 4YDKH 5D1QE 1HSAA 4M7LH 1SF5A 4ICXA 5F72S 3CFDA 5IREA 2ITEA 2UUDK 1D7CA 3VI3F 5AW2B 4HCIA 4ZMOA 3EO1A 1E5YA 5TDOA 1XH2A 1SQ2N 3UACA 2HUEA 4JL1A 2B1AL 3UAEA 1PAZA 4NN7C 2MNUA 1FVCB 2PWFA 4I18A 3C5JB 3GFUA 4Y19A 3IMTA 1N8ZB 5HXMA 3AABA 1U8MB 1RUPL 1EZVX 3H9ZA 4OM0H 4HGKC 3BPNB 3O81A 5DCCA 3D39A 1NC2B 4F3FA 3IVKB 1FL5A 3QIWA 1R33A 2H3KA 1A21A 5FYJH 1CE1H 1KIRA 1NCWL 1SF3A 1KTCA 1NA8A 4DGUA 5MERB 5I76A 4UF7C 5EU7C 3W0WA 1BM3H 3PV7A 5KBLA 5FGSA 4DPAX 2Q6WA 4BV1A 3FOMB 3QAZB 3VWKB 1Q9LB 3I6GB 4JRYD 1AY1L 5AZ2L 3BRGC 3MREB 4KX7A 1MRDH 3TFKC 3RWHB 1R5IA 1YNKH 4PHZA 5CJBA 1HQ4B 4NENB 5HDQH 4GP4B 3RPIB 2FL5B 4PRIE 2XRAL 4JQXA 3ARBA 3J7HA 5FYLE 4QRPD 1FZJB 4GKSA 4TYUA 3VXQB 4NUGH 2KC0A 1CD8A 2Z3FA 3BH4A 3FB6A 4AL8L 1SYSA 4HWNA 2W65A 1MIEH 1IMHC 2ADGA 3PGDA 5IZ7A 2BCKB 3TO2A 2IF7A 4X2UA 3HE7B 3X12A 1DBJH 4QTHB 3MNWA 2IVFC 4G8IB 3SOBH 5FB8A 4UOW1 2FEEI 5BV7B 5AL0A 3MI6A 3JWOL 1EX0A 1VJSA 5CSZB 4G1EB 3QEQA 4UQ3B 1KJ2H 2XQ0A 3EGXA 3PWVA 4M7LT 4OZFB 1KGCE 1MHEA 1MY5A 4PLOB 4PS7A 3QPXL 2EDEA 1PQZB 2YR3A 1JN6A 3H3PH 3KPOA 3ZE1F 3H9HB 4L5FH 1BV8A 3RVVD 1ZHKB 4GAJL 4XB8A 4ONFH 1OLZA 4EI6A 2AJXH 4QRSA 1HI6A 5CJOL 1U0QA 3HHSB 5E6ID 1ZGLB 1W16A 2QZ5A 4OUUA 1TYJA 2F7QA 1H15B 2OQJB 1G87A 2BXYA 2W9DL 1ETB1 2O5YH 2ZSVA 4E9LA 1EDQA 2ID5A 3QXWA 4Z0BH 1SDDB 4UNVA 6PAZA 3OB0H 2QGBA 3HR5B 4WRLA 2FWSA 3T65A 1PZBA 3BFWA 3N41F 5HBBA 5I8KH 3HRZA 3PWPE 1TCMA 3LS4H 1ULVA 4I1PA 1D6VH 4N2KA 4KNUA 1E43A 3C8KB 4DGYL 4R4BA 3VXUA 1YDPB 4QJ5B 3T77A 3KPNB 3WKML 3MRNB 1IUZA 1MHCA 1Z9NA 2QZQA 1GOGA 3DBXA 3GDBA 4F92B 3TWCH 4KKPA 5GJSL 3X11A 3OAYK 3SJVB 2KKQA 4K8RH 3R8QA 4GSUA 3VGEA 3R06B 5E9DB 3RZCA 1T6VN 2GTWA 2PWDA 1J8HA 1M3JA 1I3RA 4IK7A 3TA4D 4AE0A 2CGRL 1Y1UA 4K5NA 1TZGH 3WUZA 1LM8V 4YR6B 4LSVH 3ILQC 5E08H 2BFGA 4M56A 3B2XA 5L0QC 4HKBB 4RRPG 1UJ3C 4L8BB 1HZHL 2ZQKA 3AGWA 3L3HA 1T0NB 2H2PD 5JPMA 1PY0A 4PJDA 4QOKB 1JVKA 2BVUA 2WO4A 1D5ZA 2QQKL 1I1AA 4XCFH 5E23A 1A1NB 2F54A 1IL1A 4FRWA 1OM3H 4AKPA 1UWFA 3IGUA 2ERJB 3ZDZE 1JYVA 3BQUA 4HJIA 5DURD 1UJTA 2CDEA 1HEHC 1O5PA 2K4AA 2CRZA 2WLLB 4RETB 3A67L 4OCLC 2CR3A 1CPUA 1QBMH 1PLGH 1JZ3A 3FAXA 4EUPB 3AADB 3S5LG 1DVYA 3UTSE 5JW4Q 2WWKO 2HJFA 3QFJE 1ZLWK 3VXRB 4DFIA 3GI8H 5AW1B 3MV9E 1QTSA 3ESUF 2DYPA 3PGFL 3KPSA 1T21A 4I3SH 2ZCKH 1R47A 2NY5C 5KG9A 1RLBA 4GMTH 2QQNL 5F0LB 1COBA 5AVYB 4I0PC 5E2UH 3UABA 1JWUB 4WJ5A 4X6DF 4DP2X 5C09A 1BFVL 4BIKA 4CA4A 5BZWA 3UJJL 3V7AE 4F7TB 5KW9L 1ECYA 3OLDA 1G6RL 1IBHA 1A7PL 2IANB 1H8OA 5GHWL 3OKOA 4RFNC 1NC4D 3MUHL 2MPAH 4JM4H 1FH5L 2XJLA 2YRBA 4UQ9A 1JF1B 3V5KB 1IBGL 3ARGC 3QJFB 4IMLA 5C0EA 4JFED 3LEYH 1INDH 4BSWA 3EBAA 4P46C 3BCDA 3GSNA 1V05A 3QORA 4QRRE 5AFAA 1MCFA 2V5TA 1U8JA 3V7MA 1IAOB 5TQ0H 3B83A 3MJ7B 2NSQA 4N85A 5J5EA 1G7JA 3FUNA 5E4EB 5KJRL 3DROB 5E99H 2XWJB 3IXAB 2VN7A 1X4XA 1OGTB 1XTLA 3MKKA 3OSKA 3RKPA 3L3DA 5T1KD 3ZQ9A 5IROD 1DZ0A 4HKZB 4RMQA 3MOBH 1KJ3H 2C4XA 4IMKA 3V6ZB 5FHAH 4KXZI 4MMXC 4MJIA 4PHXA 3LKRB 3D34A 4PG2A 5J0BA 1I1FA 2GIYA 1RI8A 2DWYA 1VKXB 3BDXA 5CEYB 5KSUA 4PVMA 4RMVA 1HAWA 4Z18A 1Q4NX 2JB6B 4B95C 3C8DA 1NEZB 1N5YL 4MSWA 2OMUB 4DP8X 1AKPA 4KO7A 5TF1H 3STZA 5CGMA 1O9WA 4WWKB 5ABZA 4UB0H 2LAAA 5C1MB 3NJVA 5D6CB 2FJGA 1KB5B 4XMPL 2DAVA 2R1XA 3CMOL 3QXDA 1KLGB 4X4KA 5EC1A 2AZUA 5FW7A 5C07B 3R7QA 4LU5L 3UJIL 2DKMA 2Q2EB 5CMAA 4QHNB 1UTDA 4JM2A 1E90A 1EFXD 2AJSH 2HN7A 1FJ1A 2DF3A 1NGWA 2M26A 1CTOA 2R56H 5F88A 3GJEB 1BVLB 4R26L 3VFGH 4OT1L 1N0LB 1DDHB 4R96B 3S34H 2Q8AL 5KVGL 3F6LA 5TQ2H 1MQ8A 2XZCH 2R69A 4BD4A 3CX5J 4BHUI 2VN5A 3TT3L 2Y5QA 3HG0A 4JPVL 5E51A 3ULVD 1MRCH 4XZ4A 4U1SA 5GZND 4Z23A 3WLWD 4KRPD 4K55A 3MFGB 4O02A 4MCZA 1EHKB 4U4IA 4K3JL 4L8SB 3EYQD 1WF5A 4X5QA 4WW1B 4Y89A 3NJFA 2W07B 3P9WB 4TQ8A 2XI9A 4UDUA 3N91A 5I1GL 3V9EA 1QFOA 1VADB 1EK3A 3PP3K 2FB4L 3H53A 4UQ2A 1KYOK 4NQXA 1OPGL 2H5UA 3PL6B 4G1MB 3CN3A 3G9AB 3IBEA 4G59C 4LXFA 4P2QE 5GS1C 1MJJA 3L3GB 3VRIB 5D93C 1O6SB 5I6PA 1DBBH 4NQDA 4EMZA 5EBLA 2HT4C 3RVXC 3O4LE 1FO0B 1P7BA 3H9SE 3ARFB 1EEZB 1KSRA 1AD9B 4G8GD 1IBYA 1KBWA 3IK2A 5JIPA 2WOBA 3VSQA 1W72H 3VJ6A 3BP6B 4UZSA 4HG4J 4E68A 4XNMA 2DIJA 3ARWA 3MFFA 4XPFH 1MNUH 2YMXH 3E2HC 3LHPH 1E9OB 4LE8A 1X5MA 1AHMA 1N0XL 1VRSA 4MKMA 3BD4A 4L4TE 4NO2A 3DX6A 5IVXE 2WQ8A 4Z7AA 4HSQA 1NCBH 1RZPA 4Z95L 2PCYA 5A7BA 3S36L 3TV3L 4X5XA 4RAUB 4ANUA 5CKAA 2XLLA 5FO9B 4LF3B 4S2SA 4RISH 1JGEB 3LRHA 3RY6A 2IC2A 1HZLA 4S11A 1ZVSB 3QDGE 1ZLEA 4N5ED 2B1OA 3KLAB 4FD0A 4FA8A 2ITCA 1RHHA 2ZP9A 4IBUA 3ZE2B 1JHTA 1QFPA 4UBDC 1HC1A 1JGLH 4O58H 4HCRA 1FGNL 2ZOLB 2E86A 4ES9A 2ZJSL 3D85B 1A6VL 3PYCA 1ACCA 4P9HH 5IHBA 3C08H 4L3EA 1FBIH 2XY1A 3SODB 4FXGA 1UB6B 2VO5A 4KXDA 4S1DD 3RYMA 1HZKA 4M61B 2FZ3B 3VGBA 5IBUG 3TFBA 2PO6A 1UQSB 2ZTBA 5DQDL 2GBAA 2O30A 3ZDWA 1AR1D 2Q8BH 2OMWB 3OGOE 2PTTA 3O2DH 4ZUWB 3WTXA 2LLLA 1DEEB 3MRMB 1AO7A 4IBYA 2WLIB 2BOBA 4AIZA 5LAXB 4N2HA 5ISZA 2EVIA 4J6RH 4DPBX 4BSVA 5KSBA 4GW4A 2EDDA 4YBQD 3GSUB 5IEHB 1HKLL 5HVGB 3VQ1C 5BXFA 5BUGA 3U36A 4OD3L 4R8WL 2P5PA 3SQOL 2OJEB 5I24A 4OZ4A 4B9CA 4ELMB 1Z9SB 4YUEH 2AP2A 3MBEB 3ZOAA 4YHOL 3VVVA 1LMKA 3WJJC 1J87A 4ECNA 1G9ML 5JPNB 5HYSA 1SVBA 5IEKA 4TQPA 3DMMC 1TQTA 2ZYHA 4HAKA 3BZFB 3RDJA 3VXPA 5C8JA 2FO4B 2F8OA 4WI6A 1U41A 1MAMH 3BE1L 4BA0A 3IDMA 4A7SA 2XZQH 3U7WH 3BN3B 4ZX3A 4TUOA 2Z92B 4XMWA 1LP9F 5ERWB 1F56A 1OAXL 1YJDL 3RUGB 3NIGF 2YAHA 4KJPC 3IKKA 2ITDA 3GSNL 4MJJA 4BXSV 4U3XA 1KDJA 4NKDA 4KZCA 1B4JH 3WGVB 1UH2A 1YN6A 4MAUL 5LXGH 1PS3A 2G3NA 1JHLL 1OPOA 3SEPA 4LT7A 5SWZA 4DO6A 1N7MH 1QPPA 4M3HA 5E9NA 3V6BR 1KLFB 5JO5B 3Q2CA 2EDNA 1P6FA 3EO9L 1WT5C 2NY2D 3L5HA 1EEUA 1VF5C 2L7UA 3NCJL 1SJXA 3GPEA 4OF8A 2QHLA 2B59A 5IJBC 5C0DA 3NP4A 4Y5YC 3OD3A 2QLYA 3VFRB 2UZIL 3D0LA 1EJFA 3MKGA 3A21A 1CL7L 4G6MH 4JREB 4RGNE 4Z7OB 2ADYA 4KRMB 1KGIA 2P44B 1MHHB 4P04A 4KDVA 2X4NA 1VHPA 4FE9A 1DQQA 5C0CA 2FE0A 3LN4B 5DWUH 2DTSA 1NM4A 1SMOA 1ASPA 4LSSH 4WI7A 4GFXA 3NSYA 4ELKA 4Y1AE 4LCWD 4JMNA 1UURA 1MG2C 3V6FA 1HNGA 1QFWH 1NCTA 2QR0B 1H0DA 4XN8A 4L23A 4PD4J 2AK4D 5C0GB 2ICWI 2M2DA 5IG7A 3KL5A 1MLBA 1W2KT 1XMWA 2HWZL 4YFLI 4AYMC 5CILH 1TCRB 3II1A 3O2VH 3EOBA 2QJDA 5L2KE 5H8DA 3U30B 1ZHNA 2L7JA 3HCVA 3TC9A 1AC6A 3GTVA 4F8LA 3QDAA 5HYJB 5KOMC 3AT9A 4OLEA 1BP3B 3GMMA 2NY4C 4TRPH 1KN4L 2GW5A 4ADJA 3GKWH 3FN0H 2ZPKL 3DX1A 4ZFOA 1VB9A 2XQBH 3D0AA 3DSNA 4RZKA 4FXKA 5HP5A 3C87A 2B4CL 5C0AB 3KJ4B 3C6LC 3GIZH 4EVNB 5A43C 5IMMA 3Q43A 4O02L 5FCUL 5M94B 2X09A 2WBJD 2NR6D 4I0KA 1BMWA 1LEKB 4AV4A 4L8CB 1MQKL 3GSRA 3X1GA 1BD2D 5AAWC 3KPRD 4WNQB 4QY8B 2BIOA 5FIEA 2EDJA 3RFZB 5MENA 5DQJB 2KL6A 4U1LB 1AE6L 4R0LA 3H6JA 2RTTA 2E74C 3A3YB 1DLHB 1B0WA 2ZD0A 3BT2L 3ML9A 4IBSA 1IM9A 1UT2A 3KLQA 3QWRA 1E9PA 2XTLA 2OFQA 3EJPA 4KKLC 4NRZB 4PP1D 2ZWSA 4RZCB 3ES6A 3T08A 4H25A 2HA1A 1JWMB 1CFQB 1CLYL 4UU9B 4KVNH 5FEBA 1X5XA 2YWZA 3BT0A 4K3DH 4NC0B 2UZPA 4J3OD 3G6AA 4R2GB 3LV3B 1ZPUA 3US1A 1F11A 1I7TA 1VACB 2GTZA 3T6QC 2IBGA 1NEUA 4FQQA 2B39A 3B2MA 3VXRE 2J55A 1NMCC 2FJHA 1WC7B 3CBJB 3T1WA 4ETQA 2V2WA 3S0PA 3EBGA 4PSRA 5DDHB 3VGGA 4APXB 4AQZA 5C7XL 1FFOA 4W9KC 1NL0H 3U1QA 5MP6L 2EH8H 1G43A 1A65A 1JYXA 1RH8A 3KXFB 4PJ9C 5D72H 3BGMA 4BGDA 3IS0X 2ZAHA 5IFJB 2W0LA 2N4IA 2CMRL 1N3NB 3B7YA 4Z5RA 1LDPL 1WTGT 2WKOA 3V0IA 4OCSH 2IANE 3HNSH 1KGXA 5T3XD 1A22B 3L2NA 4FQ1H 3U6XA 2G4GA 3HPLB 2RACA 2VDOB 4TSAH 4LB8A 2CUMA 4HCRL 2O61A 5AWNL 5IK3B 1BQHA 5EEXA 2BNQA 4FFYH 1T2QL 3HZMB 5HGDA 4AQAA 2CWRA 3FQWA 1ZSDA 2XPZA 4EN3D 1RK1B 2X6CA 3LRGA 4JB9H 4KQ4L 4I7ZC 2H8PB 5DJ2A 2XWBB 4HS3A 3VMNA 4M9OA 4BKSC 5BZDA 2F8VA 2WUBH 2DTML 2K7PA 1F6LL 1IARB 2XWTA 5A1AA 1KB9K 2A1WL 4Q56A 5DEJA 5T5FH 2VDNL 4B9JA 2VOTA 1AG6A 4Y2DD 4ONHA 3OZKA 1A9BA 2EE3A 3ZL1A 3ZKSD 2I9LA 4U1HB 4YFDB 5LLIC 2VDRL 2X6VA 1BWWA 5E1IA 3WS6C 2RR3A 3FFDB 3QIBB 3N06B 1XF5B 4PJ8B 2YPLA 4P99A 3O9WD 2VUKA 3LH8A 5BS0A 1RZJL 1NCJA 4ODHH 1MFBH 1AOHA 5AKTA 3UBFA 1TJGL 2PW2B 2EE6A 3VD5A 1HHKB 2DQFB 3UCQA 4KC3B 5AD0A 1RIUL 4XP4L 3MCLL 3QO0B 2YIHA 3AXIA 3HG1B 1DCEA 4JDEA 3ZDYB 2WQAA 4N1HB 4I2XA 4JN1H 4P3WA 5ACZB 2QSQA 4KUZL 2H32A 1N8OE 2AEOA 2Y72A 2RCSL 4I89A 4JN2B 4OLVL 2H9GB 4RBPH 2W59A 4DKFL 5JW4M 4JDZB 1XGPA 5I2IB 1HT6A 3JV6A 1ONQB 4DO5A 4Q6YA 1AGBA 3VGHA 4BK5C 3NH7H 1I8IB 2HAZA 3QJQB 1E5UI 3OVUB 2YPVH 1EFQA 3B43A 1OY3B 3GIVB 3JT0A 1R24A 3C60D 4WFFD 4LLDB 3NPZB 3SD2A 5D6DC 4ZW3A 3LD8C 5TDPB 3CC5B 1Q0XH 4DN3H 4MNHB 4MB1A 1AI1H 3BKJH 4AZ8B 5EO1B 1JF5A 2YSTA 5IMLA 1EXUA 1PKQE 2VDPL 2ZUSA 1EZSA 4PLKC 3FTUA 2AXGB 3FQRB 5KAQF 4JFUA 1QFUL 4GAGL 2VLMD 3TWYA 3GRBA 4LARH 1UJ3A 4M6MH 3VI3B 3BPCB 4ZMYA 1M4KA 3S9DB 3LZQA 2F5BH 4QXTA 1GY2A 1VEOA 3WNOA 4HFWB 4R3SB 3ZLQC 1AJ7H 2FWLB 3GM0A 5DFVC 4FKKA 4F37F 4M93B 3LKNB 3QUYC 4YE4L 5KYWA 5CD5C 4LEEA 4Q9RH 1TG8A 3QG7H 1A0QL 1JMZA 2XICA 3MBWA 1E2VA 2GY5A 5ADPL 2OR8A 3VDAA 1PL3A 1VEMA 3D4ZA 1AKJB 3J2PA 4XBEH 1ROCA 5F7UA 3KVQA 4R97C 5DD6A 4CNIA 5G5DA 5TPWL 4B9YA 4JKPH 2NYZA 5DXWA 5D7KD 1PYWA 5CF3A 5LDSA 2BY3A 2J6EA 4K2UH 1IEAB 3RWCB 5IJVB 3LXCA 2YA2A 5C08A 1KJVA 2ZOOA 2X9YA 2FEDC 3ARDC 4YSQA 5A2CA 2BRRH 5GGRY 2Q5BA 4XCCL 3UX9B 4KJWC 1HCFX 1N5AA 3SDCC 4AW7A 1KG0A 1WLHA 2ATKB 1FC2D 4DESA 4P8QA 4ZFOL 3QZMA 1VSCA 2JXMA 3C6SA 2DQIL 2JKNA 2B20A 3ZE2E 1KJ2B 3L95B 2FO8A 2WWNA 1DQMH 1UENA 4PV8B 2YPKB 4UM8B 3UG3A 3ARGA 4GLRH 2VIRA 3X1BA 1HHGB 1J1PH 1KPUB 1Q9OB 5AVVB 4NQCB 4ZUSA 5ITFA 5AW5B 3DK0A 4P46A 3V4PA 1OAUL 2V2TA 1LVEA 1QSEA 2B1AH 2X4TA 1YYLL 4NO3B 5HYSG 3B9KD 2ZX6A 3H85A 4DKAA 1JS4A 5IBTH 3GBML 5I75C 2IOOA 4E9YA 4CJ1A 2J44A 3U1SL 5IQOA 1SNRA 1HHJB 1Z5LB 3A6CH 3SPHA 4B9PA 5F70A 3EYSH 4KQ3L 4TLUA 1JGIA 1NCWH 4HKXB 1IM3D 4WFED 2EEAA 4QAWA 1IVLA 4ZMQA 4PJEA 1I1YA 2GSGA 4U7SA 3H2PA 1HU8A 1CVSC 3IJHA 1LEGA 4JGUA 4EEEA 1EWHA 1GRWA 4LVHB 1EDYA 3EO0A 5KBDA 3PHQB 5AZ2H 1QI4A 3O4OC 5KVEE 2NNCA 1I3UA 4CSSA 5I6KA 3L5JA 4HSCX 3VWKD 4GO6B 4RFEB 4CN4A 5ENWA 3FH8A 3N41B 5DMKA 3T0EE 4GRLB 1I1CA 4G6AC 2B5IB 2FX9L 5J12B 5EOQL 1I3GL 2BY0A 4ZUUB 3DRQA 3RTQA 4AL8H 1T66D 1QHPA 5AKSA 2NQ3A 5HHOB 2A9ML 2HFFB 5CCJA 1G7PA 4PJBB 3DK2A 3DIFB 4FQXB 5IWLC 2OPCA 3DSFH 3QUHA 3S3SA 4L48A 4PRHD 2A83A 2MPVA 2CK0L 5I8CA 1TQUA 1FH2A 1JPST 2AKRA 2VXQH 1Q8MA 2OS7A 3HE7D 2GAZA 1SHWA 3VG0L 3GD1C 1KTJA 3JWOH 4LLUB 3F12B 2R2BB 3QPKA 2WO2B 1RIVL 3AY2A 2AQ3A 3QPXH 1IJNA 1UCTA 4WQOA 1RMFH 1JZJA 5F1IB 1V27A 1U36A 2CHWA 4KTDL 1N64H 1KTDA 3HLAA 4B96A 2EDYA 1WFJA 2X1XR 2DL9A 1P5VA 5CJOH 3ZMEA 3MUGB 2OX5A 2YOAA 1SOSA 3RWJA 3V0VA 4P59L 4HBQA 3DJ9A 4P0DA 3X1NA 4EIGB 1SUHA 3RL1B 1L0QA 4PJXE 5DSCA 1CYGA 1U3HA 5DMJB 3P77B 2V3FA 4HAGA 3CFJA 1ZK5A 4H8QA 4A38A 3DX7A 1SY6A 4CBZA 2R83A 1H8SA 3FU7B 4F15B 5GS1A 4DGYH 1KC5H 4ZMZA 5HTSA 1S7RA 1A8ZA 3N40P 5EO0A 3QA3B 1DJSA 2BHYA 4R7DA 3W9EA 4ISVA 3WKMH 1ND0A 1CLOL 2BP0A 2XZAL 3NZ8B 3A47A 4CSTA 4FFWD 4RAHA 5HDLA 1IE4A 1OL0A 1BYPA 1DBML 1DL7H 1QEWB 4MD4B 1EDHA 1FSKB 3SJVD 2CGRH 3FTXA 4ZOEA 1CU4L 1WAAF 3ULUE 4FGMA 2XJKA 4BCZA 5E9DD 1MIML 1WWCA 2W81C 2VYRE 2NQDA 4KVCL 4OCYL 4ZYKA 4MD5B 3RVWD 1BPLB 4N90E 1HZHH 2X4RB 5J6HA 2W92A 5CCHE 1Z3RA 1FQ9C 4PCSA 4GQQA 1NBVL 1NBYB 5HYJE 4ZD3H 1ZHLB 2RFXB 4UCFA 3Q6GL 4BHUA 3IN2A 5C0BA 5T3ZE 2Q87A 2WQSA 2FNWA 5DMGD 4Z77B 4OCWH 2WXQA 4QOKD 4W93A 1KIQA 3CBRA 3GT6A 4MNQD 1ORSB 3SGKC 4FXTA 4HUUA 5B4MD 2ENSA 3HC4L 2KLTA 2BW4A 4XNZC 5KN5B 4DEPB 3B7RL 1ZLUK 1RXLA 2EIKB 4FYTA 2J8OA 2WXIA 1SXBA 4FG6C 1GYVA 5JIHA 4YHZL 4R7LA 4XPGL 3FO1A 3GMRB 1IT9L 5K33A 2ATPB 4MX7B 3CSTA 3VXRD 5F7AA 4G42A 1SEBB 3UH8A 1KCRH 1XAUA 2QQNH 2GIXA 2Z91A 4UM9A 2IPUK 4IBWA 5BVPL 4ANKA 1DN0B 4U1KB 3BI9X 4X9GA 1XR9A 3IJ8A 3LB6D 3UJJH 4EIUA 5HYQB 3S88H 5KW9H 5F97E 1BQHG 1A7PH 2NYYD 1SZNA 1U30A 5F6IC 2CO4A 4K9EH 2VT0A 5I74C 3C12A 1BJMA 1FH5H 5IOPB 1EHLL 1JDAA 1IBGH 1JVLA 2KUTA 3VRJB 3WD5H 3L5XL 4J1UA 2J6EL 1NCIA 2X7LA 1YEDB 4E41A 1LNUB 3DLQR 1M7IA 2NY5L 2TAAA 2XN0A 3DHMA 4NJ9L 1YNLL 2FIRT 3F7PC 4AVHA 4KZDL 4LBAA 3WJJA 1TZIB 1GZHC 5KJRH 2EILB 1D5RA 5L88H 3DMMA 3VO0A 3OJMB 3H0TA 5ID0B 5TK4A 1F90L 4F24A 3QZLA 4OH2A 3S37L 1E5CA 3E8VA 5A2KH 3UIZA 4JY6B 3RWGB 4TNGA 5FWQA 1XSOA 3OXSA 1NFDA 3V6OE 2UXVA 2X53A 1D5MA 3HJEA 1KBPA 3V4PL 5DC4B 5DJXB 4NP9A 5EU3A 1N5YH 1INEL 1ZT1B 3CH8A 4L8DA 1OP3H 5HYEA 1A3RH 1E9QB 1HQRA 2JK5A 1EHAA 2CUIA 3D48R 3LVTA 4HISA 4YDNA 1B9KA 2LVEA 3D87B 3QJVB 4WWKD 1OP5K 4Z7VF 1W72B 3FCSB 5E94A 1FNGB 1QRNB 4KI5E 4LU5H 2QPFA 3QGVA 3SGEI 4KO5A 4OV6F 4FOMA 3UTZB 1WT5A 4ZXBC 2OMTB 3MRJA 3F01A 5C07D 2X6MA 1AANA 2AV7A 3RJQB 4EXPX 4AVJA 1X7SA 1I75A 3L1FA 4S1QL 2ZUQC 3EFFA 3Q1SL 4NKMA 4R26H 5HI5C 4N6QA 2VDLL 2Q8AH 4EE2A 4L1BA 4AQOA 2JTYA 3DPBB 3EG9A 1QRKA 4GW5B 3QUMB 1BQRA 3EF4A 3MACL 3KWXA 2F53D 1CDUA 1WFNA 2CO7B 4XP1H 4PJFF 4HK3J 4OGAC 2R0ZL 3MYJA 4JPVH 4I3RL 1EZUA 4NXKA 2OZ4A 3EBHA 3IDYC 4P2RD 3VXMB 1LYQA 4M5SA 4G70B 1K3ZA 5C86A 2FRGP 2XPGB 2WCGA 2EAEA 3DDGA 4FMKA 3LKPB 2CCVA 2F08A 4GAYB 1MFEL 2WD0A 3R19A 5C92A 4X4YB 3VFPA 4GSXA 4HZ1A 4XVUD 3CVCA 5I1GH 2FB4H 3IF1A 4LCUB 4LCCB 2D8KA 4G80B 4BJLA 1OPGH 1ADQA 3VI4A 4BEIA 2X9WA 4XCYB 4U3SB 2F19L 1IQDB 3AITA 3D52A 2DJMA 3PL6D 4AGMA 2OSYA 2ZOWA 1BXXA 4PMFA 4ZO8A 1B3JA 3ATEA 5HHXL 3V4LA 4AMKL 2J5WA 3C6LA 3PAYA 2A4ZA 4PGDB 3KW8A 4OF6A 4IU3A 2QTEA 2FQGA 1J8KA 1YPZF 4F33A 1RY7B 1QBLL 3MX0B 3ARFD 1DQLH 3B3IA 5SX4H 1U3ZA 1C7TA 3VYPA 3VVWA 3CVHL 3ESMA 3ZYOA 1NMAH 2CKBB 4QRTA 3CDGA 2VGLM 1TZHA 4Y4HC 5H35B 5TGBB 3VFNA 2Z0UA 1RJCA 3L1GA 1ET7A 3ZKND 1SY6L 5FYJE 1RPKA 5I6NA 1BVNT 4YDLC 5D1ZB 2FR4A 4GXUM 1NGZA 2H0JA 2V3EA 4YDJA 3T6ZA 4F7KA 3IM1A 2ED7A 4I9XA 1KIUA 3BUDA 3VH8A 2V2XB 4KJYA 3WJMB 4Z95H 5FF6A 4G8AC 5DA0B 4LP8A 3GYRA 5GJTL 4JFPA 1HWGB 1VFBA 3IFOA 1VCBC 3EFOA 3U83A 3F83A 4KU1A 3O41A 3SO3C 5TD4A 3WIHA 1NIEA 3ZR5A 3ZZQA 2GCYB 3OMZA 4QHPA 4FTVA 4Q2ZB 2YSSA 1JXGA 5JXED 4WF7A 5FV1L 1FGNH 3NEXA 2ZJSH 1Z0NA 4ZBJA 3FQUA 1GS7A 2JJUA 1U3YA 4QPEA 4X6FB 4HS8L 4QUOA 2FBOJ 4B9ZA 4MAYA 4YHLL 3NJLA 1PD0A 2BSDA 4PJ9A 1A02N 1LP9B 2EXWC 3GMLB 2GPZA 5M95B 1C1EL 5DT1H 1SVCP 2F8IA 5DQDH 3CU1A 4ZI8A 2D03L 4WWOA 3WDHA 5AB0A 1GJUA 1L9OA 4YIQA 3NJKA 4XNYL 2Z93B 2WCSA 4PWIA 3FFCD 3BUIA 3QI9B 4D3CL 5D1XB 4GBXD 5DO2D 5E1AA 4XPAL 3ZU8A 5FA3B 2A0LC 2H2SD 3QH3B 1SLVA 2ROXA 4KK5C 1YHPA 5MEQB 1HKLH 3AQXA 4L5FE 3RVUD 2D0FA 1XGTA 1J8RA 4R8WH 1AQ8A 2K70A 5EIIA 4M7ZC 1BMGA