1ZIAA

Oxidized pseudoazurin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Crystallization and preliminary X-ray studies on pseudoazurin from Achromobacter cycloclastes IAM1013.
pubmed rcsb
molecule tags Electron transport
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1996-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ziaA00
4AKOA 1ZIBA 1NZRA 3DTUB 3PLYA 4N4YB 5D4HA 4KOCA 1AZBA 2IWKA 2UXVA 1E5ZA 1NIEA 5ANHA 2BZCA 4YSPA 3AZUA 4AI7A 3ABGA 3WG7B 2XU9A 1J9QA 1ASQA 4E9SA 3PAZA 1AS7A 2GC7C 3X1GA 2FT6A 3TBCA 4RH4A 2VM3A 1AG6A 3T6VA 2RACA 5B3SB 3FU7B 5TK2A 1SDDA 3N2JA 2B3IA 3ZBMA 2PPDA 3QJVB 4UF7C 2CBPA 1GS6X 1E65A 4CSPA 3NSYA 5AZUA 1L9PA 1NPJA 1L9RA 2VN3A 2PP7A 1CYXA 3S3CB 3FT0A 1NIFA 4G7SB 2WO2B 1AR1B 4HCIA 2IH8A 3EH5B 3HB3B 1JZFA 1YLBB 1ZIAA 4YVNA 4BXSV 1NTDA 2TSAA 4JHVA 3H4HA 1SF3A 1OF0A 2HRHA 5AKRA 3AG1B 2QT6A 1PLBA 3QPKA 3EF4A 4QLWA 4DP9X 2EILB 2OV0A 2I85A 5I6LA 2IH9A 3KW8A 1PF3A 2BP0A 4YSQA 1HFUA 4A2DA 3S8GB 2R7EA 4HHGA 3X1NA 4G71B 5B1KA 5I28A 2PPFA 1SHWA 1A3ZA 3QJQB 3FYEB 1E67A 4KOBA 4JKNA 2FT7A 1KBWA 2FQDA 1PZAA 6PCYA 3ZIYA 1N70A 4AKQA 4BK5C 1JOIA 1J9RA 2H47C 5I6KA 1SFHA 2EIJB 4GY4A 2XV0A 4KNUA 2IDUA 4PCYA 4AKPA 4A68A 1NWOA 2BWDA 1NIDA 3CZUB 1A4AA 3IN2A 4A2GA 1I53A 4N8UA 3WKQA 1A4CA 2BW5A 1ASOA 2HLEB 3C75A 2YAHA 1AZNA 4KO6A 1PMYA 2IAAC 1GS8A 3OMIB 5B7MA 5B7FA 1XB8A 1M9WA 2HRGA 3CVCA 5B1BB 2EIKB 4GP8B 4YSAA 1IUZA 2VMJA 2MTAA 1BYPA 3D12B 2BP0B 3CG8A 3QQXA 1AANA 3CVDA 3T6ZA 1UATA 2IDQA 2QDWA 5F7BA 3SBPA 2R7EB 1BXVA 4G70B 1GY2A 3FS9A 4K9JA 2YAEA 1J5DA 5I6MA 1J9SA 1ETJA 2PPAA 3CDZA 2BZ7A 3T71A 4YSCA 2YQBA 2TSBA 2FJSA 2I7SA 1KDJA 3GDCA 3JTBA 3AG4B 1N68A 1PY0A 2OCCB 1OOWA 3FYIB 3NP4A 4F7KA 2XXFA 2AZAA 3AW5A 1NDTA 1OV8A 1KV7A 2FQGA 3OMNB 3ABKB 3OM3B 4HIPA 1OE2A 2GHZA 1JZIA 1TKWA 2VSKB 5PAZA 4A2EA 1BQKA 4E9QA 3FSWA 1ZDSA 3GYRA 4L0PB 4KO7A 1PAZA 1SF5A 3ZDWA 3NSFA 3PPSA 4HHWA 2FQFA 1KYAA 3X1EA 5I6NA 1L9SA 5TK4A 1SJMA 2UX7A 3DIVA 1ZDQA 4E9RA 2ZWNA 3WNIA 2HXAA 1AS8A 4Q89A 1MG3C 4E9TA 1AG0A 1NICA 4ENZA 4JHUA 3PAUA 4MFHA 2VM4A 1X9RA 4BWWA 4DP1X 5FC9A 2QPDB 4UAHA 3UADA 7PCYA 3TA4D 3CDZB 3NJJA 2YAMA 2HX8A 2HX7A 4DP5X 1CYWA 2OJ1A 5D4IA 4E9XA 8PAZA 1NIAA 2IDFA 2GI0A 1IC0A 2FQEA 2GSMB 2W8CA 4BWTA 2CALA 1JVLA 1RZQA 2NRDA 3NSDA 2PP8A 2YXVA 4DP7X 3S3BB 2ZONA 4HCFA 4TXVB 1A4BA 1W6LA 3ASOB 2P80A 3SBRA 1TEGA 1W8EA 1DYZA 3UGEA 5D4JA 4DP8X 3FSZA 1CUOA 3V9EA 3TU6A 7PAZA 2ZXWB 4F2EA 1JZJA 1AZRA 1JVOA 4DP4X 1OE1A 1BQRA 1KCWA 1AZCA 3ABMB 3G5WA 4WTQA 1URIA 2DWSA 1MZZA 5B1JA 5I5MA 2FTAA 2HX9A 4NB7A 1JXGA 2DYSB 2YARA 4BDVA 4E9VA 3TASA 4YSUA 2GC4C 5B1JC 1JZHA 1XMEB 3FPXA 2BP8A 2EINB 3ABLB 4HCGA 4GP4B 3QJUB 3PXLA 4E9WA 2PCYA 4HZ1A 3FSVA 3NJHA 2MRYA 2JKWA 4AZUA 3V9CA 2IWFA 1GS7A 1BQ5A 1BYOA 1F56A 2VSMB 5I5IA 2IDTA 3HEIB 3N55A 4DPAX 3UABA 1NWPA 2PPCA 3H56A 1BXAA 2X87A 2BW4A 2XVBA 2J56A 3QJTB 1OCZB 1HAWA 3CVBA 1PLAA 3IEAA 2J55A 5EHFA 1JERA 1BEXA 4YSDA 1WA1X 3PCYA 2PP9A 2VW7A 1OCCB 2IWEA 2BO0A 2QPEB 2VW6A 1CC3A 4P5SA 2JFCA 5E9NA 1ADWA 4G7QB 3WKPA 2Y69B 4BDVB 3MX0B 1E30A 1SNRA 4W1TA 3TBBA 3EH3B 3T6XA 4AX3A 4GXFA 1PNDA 2BP8B 2UXTA 2AFNA 2YAOA 3NJNA 4KNTA 5I26A 1IKOP 2PCFA 3H4FA 4KNSA 4A67A 2DV6A 2XV2A 1CURA 1KCBA 2UXGA 1MG2C 1ILUA 5A7EA 3FU8A 1WAEA 2YAPA 3QJSB 1ID2A 3BVDB 1NPNA 3DKHA 3JT2A 3NJFA 1KDIA 3X1BA 1L9TA 2CUAA 3IBOA 1E5YA 3QJRB 1AQ8A 3IE9A 1JZEA 4WKXA 2WSDA 1WA0X 2B08A 1B3IA 1MDAA 2PPEA 4BWUA 1DZ0A 2Y1AA 4G72B 2PLTA 2Q9OA 1M57B 1ET5A 3EH4B 1MZYA 4YL4A 1W6WA 3U25A 4YSOA 2QDVA 3T6WA 1WS7A 4GP5B 1GW0A 3FQYA 1BXUA 2I7OA 3RYMA 4DPBX 2J57A 1JZGA 1PNCA 1GSKA 5IY5B 2FWLB 1AZUA 2FT8A 3SBQA 4QKTA 2FNWA 3SQRA 4YSSA 2XX1A 3NT0A 4UANA 2GB2A 5F7AA 1J5CA 1JXFA 1OCOB 2N0MA 1AS6A 1WA2X 3PAVA 2BHFA 2YAQA 3WNJA 1JXDA 2GIMA 4ZK8A 2X88A 1KBVA 5PCYA 1PZCA 3EHBB 3S3DB 3FU9A 3NJGA 2DWTA 3NJMA 2DY2A 4X4KA 5I6PA 4DPCX 1V54B 4DP0X 3NJLA 3NYKA 3NP3A 2XX0A 1V55B 2H5UA 1PLCA 1ZV2A 4FAAB 4DP6X 5B1AB 1VLXA 4CSZA 9PCYA 3UAAA 4A2HA 1OE3A 1XB6A 4YSEA 2XLLA 2J5WA 3NJKA 3WIAA 3OMAB 1FWXA 2BWIA 3ZX1A 1TU2A 3BQVA 2DYRB 5I5JA 1PCSA 3WI9A 1AOZA 3UACA 3UAEA 3ASNB 1SFDA 1AACA 1IBZA 1NINA 2LLNA 3GXUB 4A66A 4G7RB 3L45A 1A8ZA 5B7EA 1XB3A 4KO5A 1EZLA 1SDDB 2EIMB 2XV3A 1QLEB 2AZUA 1OCRB 2HZHA 3X1FA 3AG2B 4A2FA 1KGYE 1NIBA 3T9WA 2VW4A 2ZOOA 1ET8A 2W88A 1RKRA 3AY2A 2YAFA 1ET7A 2AVFA 4KO9A 5AFAA 6PAZA 2P80D 3NSCA 4W9ZA 4EF3A 1L9QA 2XXGA 3KW7A 1V10A 1IBYA 2XWZA 1ILSA 1T5KA 1X9UA 1RZPA 2AANA 4FA7B 1FFTB 1AIZA 2CCWA 4M3HA 1PZBA 3OD3A 1TEFA 3MBWB 2CJ3A 2CAKA 2GBAA 4HALA 3AG3B 3FU7A 5LDUA 1FA4A 2XYBA 1GR7A 1EHKB 4F2FA 4YSRA 4NERA 1QNIA 4HAKA 3X2QB 1ASPA 1R1CA 1ZPUA 2XUWA 2H3XC 4NAJA 4YSTA 4E9YA 4GYBA 3IN0A 4DP2X 2IDSA 1QHQA 3FSAA 2WO3B 5I6OA 3FQ1A 4Q8BA 4BXVA 1AAJA 2UX6A 2JXMA 4P5RA 1BAWA 1L9OA 1J9TA 1RCYA 1HAUA 3FQ2A 3FPYA 4M4RB 1M56B 3OQRA 2A3TA 3ERXA 3S8FB 1A65A 2E86A 2Q5BA 4YVUA 4PAZA 1GYCA 1SHXA 3NJIA 2UXFA 1GY1A 1WS8A 2YXWA
chains in the Genus database with same CATH superfamily
4X0KA 3MRLA 4HHAA 3UIYA 1WQVT 4OGXH 1ZLEA 5DWPA 1QKZH 1YECH 5ENWB 1YUKB 3AZUA 4AI7A 3G5ZA 4JHWL 1N19A 4GQRA 4WUUA 4F3FB 1F42A 2F8IA 3FTWA 1X7TA 1Z5LA 3NA9L 3SKOB 3AU0A 4UZGA 3LIZA 2VLRA 3ROLB 4PV1C 5EUOE 1EGJL 3U46B 3GMRB 2VTFA 1IQWL 1EEYB 4XOBA 4QHKI 4FLRA 2CIIA 3FN0L 4WHCA 2CGZA 4CSPA 2ZF8A 5IQ9B 2D3NA 2BOCB 4N28A 2VN3A 4HT1H 2J1YA 3OG4B 3BWZA 4Z9KB 3S3CB 5A2KH 1EHNA 1NIFA 4XPHH 4DVBA 1T0MB 4FKKA 1D9KA 4JG0H 1HIMH 2PW2B 4ZPVB 2QSQA 2NY1D 1CFVL 1DBAH 1XD1A 2AJVL 5I8EB 3S35X 4RRPM 2NSQA 4Y5YC 1Q90A 4L9LA 5C08A 4M8UA 4I77L 1SF3A 3WTTA 3APFA 1VSCA 1AXSB 1TG8A 1E4WH 3V7AE 4H2CA 3W9EB 1FORL 4BM7A 5IEHA 4EIZC 2PF6A 4FQIL 4HH8A 2IANA 3P3YA 1B4JH 4NZTL 3VXUD 4DP9X 3VACA 5TD4A 3RPIB 4LLYB 2YPLE 1U8OA 3KW8A 4PGEA 3QP3A 3V5HA 1BZEA 1UWXH 3GS7A 3UTTB 3SPVB 2CGRH 1KXVC 2FJFA 4QRRD 1IGTB 1E40A 2YD5A 2NX5E 4HHGA 3PL6C 1WLHA 1WICA 2FBOJ 4GMTH 1P4UA 2WUBL 3MOAL 1KGIA 3V5KB 4GSUA 4ZI8A 3MJ6A 4N6RA 5I1LA 2ZJSH 4KRPD 2J73A 3UYRL 3QS3A 3LQZA 4JQVA 5EBLB 1N6UA 4X8GA 1E4KA 5I16B 3T0EA 1FL3B 2CR0A 2YBRA 2Z91B 1KJVA 1J9RA 2H47C 4FMVA 4OIFA 4C55A 3C6LA 2WQAA 3ZRFC 5KAQF 2K6YA 4FC3E 1CPUA 4OGYL 2BNQD 2K7PA 2R8SH 2E8ZA 3FFOA 1KT2A 1WFMA 4MMZC 2H3NB 1F11B 4OJAA 5HHMB 3FTVA 4MMYB 4WO4B 3PHAA 4PSRA 5MI0B 2Z7ZA 4XCYA 1KLGB 3C75A 2ATKA 4KDTC 1ZD6A 4M7KH 5E4EB 4HLEA 3WJJA 1YEGH 5FECB 3VXQA 1XB8A 4NSKA 4F8OA 1M7DB 1EAJA 4FFZA 1XCXA 2ROYA 1KBPA 5EUKA 2EC8A 2LHAA 1UZ8A 2XETA 4JFDB 3KXFD 2H0FA 4Q74A 4U6XB 1WZ1L 1DVUA 1SBSL 2ISDA 1AVAA 3LEXA 4NCC2 2H1XA 3BP4B 3FT2A 3UX9B 3UZQB 1CTNA 3O3UN 2NCEA 3OKYA 1ETJA 4UQ3B 3NAAH 1UJ3C 2J88H 4NRXB 1MWAL 1KV3A 2NY4C 1RY7B 2AP2A 2WXHA 1BZQK 3GDCA 2NUPA 2VLKD 3HB3C 1ZY9A 3TN0D 4NZRL 3IFOA 4NQUA 1YYMH 3OSVA 4ANWA 1FLRL 1BJ1J 1FVEA 4U6HB 3RJOA 3D2UB 4X5WB 3ULUE 4AZ8B 3G5YA 5BRZD 4D7BA 4U3CA 3VI4A 3D09A 3TO4A 1T7XA 3CE1A 5KS9A 2CPCA 1TXKA 1L7IL 3LKPA 4QEGA 5DUPH 3QBTB 3KCPB 4CVUA 3CFJA 1L9SA 4JFHE 2ZOKA 1SJMA 3DPBA 5E6ID 5FUOL 4WO0A 1F97A 3O2DL 3RWCA 1NDMA 1HH9B 2ZX7A 3LVTA 4UT9A 5LAPA 1I7RB 1JGVH 2BY3A 1M6OB 4MA1B 3ARFB 1XHHA 4BZ1H 5I18L 3TS8A 2DI8A 4P2YA 2XZQL 4JZNB 4FEMA 5E1GA 2H2SC 1RVFH 4QHMB 5H35A 1M7UA 5AW5B 1YEJL 3QIWB 3VGGA 2OJ1A 4M56A 4OD3H 2QBWA 4E9XA 4GQ9H 4JDTH 5GRJH 3KYOA 1J5IA 3ATDA 3BFOA 3MROB 2VLJA 4OLWH 3AQDA 4Y7OC 3W81A 4X4ZA 2Y7QA 3AB0B 4QOKA 5C0CA 2CNYA 3BAKA 4YXHH 3QPXH 1A6VH 5HHOD 2O5ZH 3H2QA 5AVWB 3HC4L 2DQGL 4A7UA 3SBRA 3OLGA 4OD1L 4ODTL 1CL7H 4YLCA 3M17B 4MZ2A 3TU6A 3KH3A 3UTTD 4PRPB 5GGRA 2JK5A 4J1UA 3KL0A 2O26U 1PG7W 4LKXA 1OM9A 1H3PH 4YNYB 2R23B 5DLML 2J1KA 1AZCA 2PYED 5E9DB 4TSAH 4Y19E 1X5AA 4U2YA 3LOWA 2VNCA 4P3DA 1HWGB 2DLHA 2WOYA 4HKXB 4HMDA 4LVOB 3L4VA 4J3SA 3TVMA 3TPUB 4PREA 4LF3B 2K8QA 2A73A 2A0LC 2F54D 2DRUA 2HN7B 3FBKA 2QKSA 3IDNA 2IPKB 3NCCB 5IKCA 2AEOA 3GB7A 1XMEB 2JTDA 5AW0B 5C3TA 4W9GC 3G5XA 1GAFL 1I8LA 2BVQA 5D7KD 5GGQL 3TYFB 3GBML 1QFWI 1YEEL 3WL9B 3ZT5A 1QX1A 5CO1A 1CQYA 3SCMD 1W0VB 3OKEA 4GPVA 1D6EB 3DXAD 3MUGB 3KVPA 4B3VA 4N8PA 1HHJA 3L7EA 5JZ7D 2WBWB 4R96A 4PJ8A 3QIUC 4NPKA 1P5VB 2IMNA 3L7FA 4DW2H 5HHMD 4OLYL 1MN4A 3HIZA 2IWFA 2RR3A 4HU8A 3GJEA 2ICES 2NTSP 3OAZK 4R0LA 2VSDA 5I8KH 3WUWB 3FB7A 2V7HB 3WTYA 3MNVA 2X7LB 4Y2DC 3WTUA 2X87A 4LL1A 1IU1A 3QEQB 5F3HB 1DBKH 4PRAB 35C8H 4IYKA 3B34A 3MJ8A 5JYMA 1AXIB 5KTEH 1Y0LB 4JKKA 1LD9B 2VW7A 4U1HB 2H1PL 3DURA 1KELH 3OZKA 3IXAB 2NQCA 5C09A 2I60H 2ZICA 1DBMH 2DICA 1S5HA 5DEZA 4B9PA 1EMTL 3WKPA 4NWUL 4BIKA 5CFHA 4Z3GA 2IOIA 3MCLL 5FUZL 1BBDL 4BDVB 1VCBC 2AK4B 4JGMA 4JKWA 2J71A 4FQHA 1UT2A 2GVYA 2UXTA 2X9ZA 2F15A 2GJZA 4FI6A 2G3XA 1HILB 2WXNA 3ETBJ 2XPYA 3B8YA 4IU3B 4ABVA 3FHEA 4J8QA 4PRHB 1F4HA 4FOMA 1B0GA 1MW3A 4I88A 3DKHA 3VQ2C 1VF5C 2DQCL 4PJBB 4K3JH 4WW2A 4FNPA 1Y1UA 3N41F 3L3OC 5MEND 1LLAA 4LMQI 1AQ8A 2HMID 2CKBL 1NFKA 3WLWC 3QFJA 3VRLF 3VH8B 4K5MA 4XP6L 4LBAA 4LSTH 4NNYB 3ARDA 4XVOA 4XMVA 5C0EA 5JO5A 3L1OH 3LPPA 2DM2A 3QQ9D 1V5JA 1U30A 1UD4A 4XMKL 1AQDB 2NTFA 2X4UB 4ZUTA 4NIKB 1X6LA 3VD3A 3EFDH 3HFFA 1OPOA 3NCMA 5LN4A 1WFUA 3DX9A 3C5ZC 5B8CC 4JRYB 4XC3H 5FV2A 1CVSC 4MZ3A 5BQDA 5MP6L 4YWGL 5D96B 5FA4B 1VKXB 5GGVY 1GGCH 4B9JA 2A77L 5CD3A 3F01A 2YWYA 3DDFA 3W0WA 1XFPA 4PJIA 4UOW1 4ZDHA 4ERSH 1NEUA 1HEJC 3RY4A 3R4DA 2ADGA 4HKJA 4N9OB 1S7SA 4UU9B 3V6ZB 3V7AG 3D39E 2H2PD 1J8SA 3OQ3B 5BW7C 3EYVA 2Z8VC 1S5IH 3CFDA 2JWYA 2CMRL 1T5WB 1VACB 3SHSA 4I9XA 3TNNA 2A6DA 1KY6A 1MJJA 4NBZB 1NCGA 3OJDB 1FBIL 4JB9L 5CJXA 2EIBA 1RZKC 1WT5C 4ZFOB 1CE1H 2O5YL 3ZTNL 2ADYA 2XBDA 3WIAA 5HGAB 3JWOH 2QKIC 3ZE1E 4X9FA 5SX5K 1HHGA 4QJ4B 1PPIA 4FG4A 5DEFA 5MHSE 1WFJA 3P4MA 2CZNA 1KIQA 5DA0B 1VEPA 1SMDA 2DM7A 1Y07A 4ADJA 1SFDA 5TFSH 3SYCA 5JR1H 4HIXH 1K8IB 1IBZA 3CVIL 4NZ8A 2X6UA 4TQPA 5GSVB 2DLIA 3WJLC 1VGEL 3JWNE 4G7RB 2DH3A 3NZ8A 3VI4F 3SDAC 5DK0B 1FGVH 3HN3A 1HHHA 4YFDB 1W16A 5KS9F 3E9TA 1CLVA 1SDDB 1MHCA 1L9NA 4UINH 3QUXC 4LCIL 3VFOB 1NIBA 2MEJB 3NN8A 3VI3B 3BZ5A 3F04A 2DWDA 5FK9B 1U3JA 2YMOA 4LNRA 2W9DL 3I9PA 1MELA 3EO0B 4X98B 1OTTC 2VL5B 1SJHA 4C4BA 2XQYK 4XMZA 2X41A 4OVUA 5IBLD 5JHBA 5IREA 2ALAA 1I7TA 3OWEA 1TEYA 4YLQT 3MRNB 3QEQD 1U2YA 1SJXA 2BSBA 3I6SA 3WY2A 4HIQA 1A5FL 1ILSA 2ADFL 2JLLA 3IKCA 1FJ1A 4G82A 3HA0A 4Z7NE 4L3AA 3QJXA 5BV7L 1I3VA 3JWNH 5J1TC 4AITA 4GUOA 3CDGB 4HDIB 2CAKA 2VERA 1Y7VA 3D0VA 2VXTL 2AK4D 5GGTL 5A43C 2UZPA 3QI9A 4ODXA 4PRBB 1O7DE 2KPNA 2DKSA 3MRFA 4TVPD 4X6CB 5DC4B 3DO3A 2R51A 1NLBH 3VFMA 3I6LE 4X8JA 1B90A 7FABH 4E0RB 2EUZA 3K8LA 4WU5B 4XPAL 4X7SL 3BW9A 3HG0A 4PJCB 4PRHD 1A14H 4OUOA 5D1XD 5AYQA 1J1OH 2JXMA 1WBYA 1MHHB 4KK8C 3WFCL 4YBQD 1GCYA 3QNXB 4G9DA 1NBVL 1OCWH 3CAFA 1N0LB 1FVCB 4JDEA 1H5BC 2C5DC 1BQSA 2R9HD 1CU4H 2P8PA 5M94B 1AD0A 1SHXA 5DMGD 2B4CH 4AJWA 1DLHA 3BFQG 3QT2A 2F1BA 5HJ3A 1T1XA 3L6FA 4IBUA 4D0CA 1G7MA 3K72A 3FQUA 2FJGB 3ILEA 1MH5A 5AD0B 5AOMA 4JM2C 4E9SA 3FBQA 4QRSB 4WEBH 4E42B 3U9PL 2BVPB 3D05A 2W0PA 3KS0H 4WFEE 2ZX9A 3KGRA 12E8H 5DZOA 5FHBL 5SWZD 4AEIH 4C57C 1HQ4B 2AGJH 2V7NB 2QQNL 4FFWD 4QCIA 4B27A 1DE4A 2FZ3A 5DO2C 1E65A 5C0AA 3DWTA 1DJSA 4NQXA 4O02L 1UZ6F 3ZO9A 4ZJ9A 2YOAA 4WZ9A 3II3A 4IKLA 2VGLM 2WIMA 2X4SA 4ONGH 3RTQC 1ZEAH 1QLFA 1D5XB 1ZIAA 3HN5A 3BN9D 1DBJL 1U33A 3HZMB 1A3LL 4OZGE 2VYRE 4RFEB 2APFA 3CD4A 4LSSL 4ZX6A 3NTCL 4PS7A 4XN2A 4JHAL 4MNGA 4OLUL 1FRGH 3JV5A 3EIFA 3LKQA 3D0LA 3NEOA 2OV0A 2N7SA 4KXCA 5E2UH 4F15C 4IDLA 4AVJA 1EO8L 1LWJA 4HGWA 3MA9H 2Q3ZA 4D8OA 5KYYB 1WZKA 2ZX5A 3CFBA 4KKBC 3ILQD 4AL8H 3RUGA 5HGDB 5K33A 2AKRB 2AQPA 1HJBC 4XCNB 3DOHA 3EGDA 1UFUA 4WWOA 3S37L 2EYRB 1TVHA 4ORGB 3HC2A 4TUOB 5FYKD 2QVTA 4PWGA 4WW2F 1S78C 1KSRA 4GBXD 4RFOH 3IF1A 2FT7A 5K1VA 2OXHB 4QRPA 5GGTA 1NJ9B 3H2WA 5CN2A 1Z1WA 3EGXA 5LB1A 3QNYA 3CMOL 3OB0H 1UCTA 1A6ZB 3AM8C 3MV8A 5A2CA 3LEVH 5CEZE 3JUZA 2WCPA 4YHKH 2ZIDA 4ZW6A 3WHXA 1W0WA 3IDUA 3QWRD 2BWDA 4N2KA 3MJ9H 5TJWK 1QQDB 1OB1A 2ZCHL 1T1WB 3WIIL 3LN5A 2J6EA 1EX0A 2BNUB 1W91A 3PWPE 2CO6B 3BGMB 1C5BL 4DUWA 4F7CB 2C3WA 1JGUL 1YQ2A 4JN1H 5DS8B 5EC1A 5JIMA 1F90H 4PJ9C 4AE0A 4B9IA 4PVBA 1OAZL 4H8WH 1Z5HA 4YHIA 1RZJH 3AADB 4R9HA 3SDCB 4HJJL 5LAXB 3IU3B 3B2PA 3UPAA 1XF5B 4PJIF 4UT7L 1THAA 3AAZA 3MREB 1A9BB 2ESVE 2N4IA 2ZUYA 1QG3A 3UYPA 1CBVH 3VVWA 1X7QA 1N3NA 1ZJBA 1CF1A 4J2QA 4ZTEA 2FX8L 1KFAL 1KN2H 2P7TA 4F24A 1QRNA 3X13B 1G1OA 4FQXC 5DD3L 5EOCJ 2BHZA 1UUSA 1S7TA 3T65B 5EF0A 4OZFH 1KLFB 1LDPL 2ZE0A 3CN3A 1HQRB 2XWJA 5AWNH 5IG7B 2OSYA 1NBZB 1N5AA 3QDGD 3QPQC 2XXCB 1IAIH 1XCTB 3HBQA 3MLZH 4QXGH 5EZOL 1DQDH 2C9AA 2JKRM 2VXQL 3BEWB 1F3DH 4UM8B 5EZLA 4ZW8A 2EE0A 3L8QA 1PZSA 1JWMA 2H6PB 5D7SH 3OPZL 3UGXA 1FH5L 3L3JA 3ZDWA 4R83A 4P59L 4U3HA 3MGAA 1CE6B 1FG9C 2DJSA 3DHPA 4PLJD 1T7ZA 4J6RH 1ANUA 4ZQKB 2ZUTA 3SB3A 4FFVD 3QORC 4ZSOE 4HXAH 3AY4C 4HXBL 3SDDC 3VXUA 5EN2B 4WFGE 2Y3NA 3A47A 4G6FD 1Q1JL 1NM9A 3K2MC 1UWEL 5JW4R 1JBJA 3PAUA 4G8EA 1GIGL 2EE6A 3QCVH 2BIOA 3EKCA 4QRRA 3TCTA 1JN6A 4L0YA 1KEGL 1T0OA 1PYWB 2QADB 3DROA 2CHNA 8PAZA 3EYOA 3O3BB 5JOEA 4YQXH 4ZTPH 1XGUB 5I0WA 4FP8L 5H37G 3CXDH 1RZQA 4H0GA 4NQEB 4Y1AA 4P5TC 1YEHH 4IK7A 4LEXL 4RWHA 4HCFA 3NFNA 1MHEB 1A4BA 4Z0XA 3BP7B 2VLLB 2NYYC 3U7YH 5D4JA 4PTTA 1HSAA 4HMEA 4MJIA 2IEPA 3DECA 5AZEL 3AXLA 5IMLB 4MQXD 1GOGA 3BPLB 5DUBA 1J8KA 3MKKA 2W0KA 1NGPH 2YSSB 1BQRA 1P9MA 1JRHL 3HR5B 1AI1L 3SY0A 4P0DA 3JWNG 1TYRA 3CPUA 1C1EL 3N1MC 1BG1A 4KTEH 3MLYH 1JI1A 3OXSB 2DYSB 2IH3B 1FF5A 1MCLA 4LLWA 2X0VA 2ZCZA 1U8JA 3IKKA 3HNTH 5F6IC 4LFHG 1U3HC 6FABL 4PUBH 4J4PA 4MBOA 4CMHB 3UDWA 2PTTA 2PWDA 2C7UB 3U1QA 3BJLA 1A6WH 5IVZB 1TPXC 3MLXL 1XBDA 4FZ8H 3MRIB 4L37B 3Q3GA 2BFVL 1MW1A 4Y9BA 3MV9B 3E2HC 1HT6A 4HKZB 4LDCA 4EIBA 5E6SB 4I0CC 1UB5B 1EAOA 1A3RH 3IGKA 1XGRA 2IDTA 3IWVA 1G7HA 1J0KA 3BT0A 3I3BA 1H8NA 1TZHB 3ATAA 3UABA 5FO7B 4NPYB 4XBGB 2FLRT 3SDCD 1QO3A 1J05B 4O2EB 1U8QB 3RVWC 3LV3A 5C0NC 2FCBA 4NRZA 1M2OA 1J8HA 3L4ZA 3T3ME 2NY2B 5ACZA 5IJKC 3RJQB 4JAMB 2DD8H 3RNKB 1PLAA 3DGGB 5FO9A 1ZLUH 1QACA 4IBQA 2WN3A 2F53E 1IB5A 3HBZA 2UWEE 3SGKC 3QCUL 4JE0A 1RUMH 3HE7C 4G42B 2EKSB 4G5ZH 4XR8C 3ISWA 4HUMB 1ADWA 1JPSH 4R2GB 5E6IA 4G6KH 1ZRUA 1PY9A 1UOVA 3I9IA 1KN4H 4JY5H 1CL7I 2BP8B 3ETTA 3T77B 4ELME 1JF6A 2NYZA 3C9NA 1CURA 3F7QA 1AGDA 5DXWA 1E28A 1Q0EA 5I1IL 5FFOA 4JG1L 3RRQA 1EFQA 1PKQB 2NLJA 1EEUA 1SPDA 3RDTB 4QTHA 2OJEB 5C7ZA 3G3LA 2HJFA 2BSEA 5FHAH 1E27A 5EF2A 5HHNB 1NMBH 1JZEA 3IS0X 4MCYB 2OMVA 4WI9A 4YXKH 2J5LC 1L9MA 1XR8A 2AABL 3OAYK 4UBDC 1OGTB 5EIQA 4NXKA 2H1LM 3JWOC 4FFZH 5E2VH 5GJSL 2IG2L 5HHOA 4DN4H 4Z95H 1W9XA 3ZO0A 2R83A 4OJCA 4G83A 5ERWB 5J9PB 2KBGA 3FQYA 2LU3A 1JZGA 2ID5A 5C7XL 1SDYA 1EEZB 2VO5A 4PJAA 3MRRA 2X2YA 4JHWH 1XF3B 5C6PB 2WXRA 4F7TB 3B37A 1QP1A 3NA9H 5JW4Q 1UADC 1M7XA 2PYEA 2WSPA 3PQYA 3PS6A 4X7TA 2EC9U 3UCRA 4IRZL 4DEPC 1GMIA 1EGJH 4NO3A 4Q58C 3N85L 3GMLB 5B21A 5J3HD 1IQWH 1BHGA 2F54A 4PCTA 3FN0H 4FTVE 5DJ8B 2GQHA 1Y18B 4LIQL 3FFCB 4KC3B 5DHYA 4JANB 2XX0A 1TJHL 1TVBA 5ELIA 3SCMA 2WTRB 3DVNB 5HHQA 2CDEB 3W11D 3QA3A 2Y24A 4IHOB 1ZGLM 2A2QT 1CFVH 2AJVH 2R0LL 3S4SB 1LWHA 4X0NA 3IVKB 2BWIA 4PJDB 1OP5K 4XN9A 1FORH 4NKMB 3QZNA 1JL8A 5BRQA 3ZU8A 1I4FB 2FEDD 4FQIH 1KY7A 3ZHFA 1TYJA 3GT6A 1SZNA 3JWNC 4GI8A 4KUZH 4NZTH 1KB5A 5I8OH 4J5VA 4WI0B 1PCSA 3ASNB 3MXWL 2BSRB 4OFKA 2YPKB 3EFFA 4PB0H 1FYHB 3FB5A 2Y1ZA 4JM2F 3RWEA 5IB2B 3H9SB 2JCWA 4PBWD 4PJHB 4RMBA 2A6JA 3L45A 4HCRA 4U31A 2AJXL 3O6FC 3RKDC 1XH0A 2XZAL 3MOAH 3MV9D 1OD9A 3HHMA 4A2FA 4PG9B 3WKNA 5AVYB 1WIOA 3KBEA 3N43F 5LBSA 3UYRH 1SEQL 4CSTA 2GSIA 5E4OA 1FGNL 4IRSB 4RAVA 3QUZB 1YDPB 1FZOB 3MRQB 1M1SA 3RGHA 2JJVA 2PETA 4W9ZA 4UT6L 2RBLA 4JMNA 2B4CC 4IDJL 5C9KA 4F5CE 5JHAA 2EUXA 3DBXA 2TRYA 3EDFA 4NDMA 1GGBL 3CH1A 4JPIB 5CHNA 4ZXBD 1RK0B 4QTIL 5KSBB 1GTFA 4AIEA 5MENA 1O7DC 2FO8A 1YNKL 4HK3N 3MBWB 4KK6C 4U1GB 5CIPB 2WNGA 4HALA 5GRYA 3P69A 3WCYA 3FUMA 2FECL 1E5BA 1G7QB 3KPOB 1ES0A 5CWSB 4RWYL 1R1CA 4TVPL 5GS2H 3GINA 3WGVB 3OKMA 2IDSA 4WI5A 5L9DL 1WZ1H 3VWJD 4URKA 1SBSH 1I7UA 1UA3A 4J3WA 4N2BA 4Y4FA 4ES8A 3QYMA 2MSPA 3Q9PA 4BSWB 1AAJA 4ODUA 3ZE0E 3RDTD 4M93C 3V4UL 3GXFA 1RJCA 2QTVA 3C5SB 3O3AA 1M3IA 1AR1C 1MWAH 4IRZA 3QHZL 3RGVB 2E86A 4DZ8A 3KVQA 1VEMA 3ECBB 3KDPB 5TH2A 5KVGL 4N5EC 3VG9C 4W81A 3BRFA 4TOYL 3DHJA 4LDLB 3SDYL 1HEZB 4N4YB 5CLZA 1X5MA 4LLUA 2P9RA 4YBLB 2XTJE 1JHTB 1FNGB 5ANHA 1NFDE 1A9EB 2HVJA 3MV11 1L7IH 4AL8C 1JGIA 3IXTB 1LEGA 3CFKA 3FU7B 5HD8D 5M7QA 4G6JH 4DETA 1A1NA 1KACB 4OBSA 3CDYA 4IBSA 5AYUL 3O2DH 1LDSA 2FAUA 4Q6IC 2CBPA 1G6RA 1GS6X 2VABB 3K4AA 4KV5F 5DJ6A 3GD1C 2RQEA 4QRTA 4OCLC 3DX6A 2QR0A 2BVTA 1OAYH 1M2VB 3LZQA 3VRIB 3NIDB 5DRXB 2R2CA 2YWZA 4MDIA 5I18H 2P5EE 5GRZA 2DS4A 3A4EA 3EYQC 2XZQH 1BVOA 5J6SA 3MV7B 2VWEE 5E8PA 4ZD3L 3EH1A 1NTDA 3C87A 3TONA 2WVTA 4CILA 1DQIA 1YEJH 3H4HA 3ILPA 4ZFOL 4I7ZC 1OF0A 3SYAA 3ULUF 5GRXG 4DT2A 4NM8H 5I1DB 2MQCA 3AG1B 3Q43A 1XAKA 1UENA 2V4LA 3V4LA 5C2UB 2X1WL 4YK4B 3CZKA 2QQLL 2BS8A 4TQEL 2WXJA 3X3FL 1QSEE 2EIZB 4Q2ZB 3X17A 4X4MA 3TJEH 4H8WC 3HC4H 2DQGH 3W5NA 3QFDA 4GO8A 1RZJC 1OQXA 1BG9A 1G4RA 4OD1H 4ODTH 5IUSA 1TQCB 1K5NB 4LSQL 2ERJC 4UDTB 4GG6B 3JTSB 5ES4B 4AK1A 3N9GL 3V4PA 4DO5A 5FYKL 1IE4A 3MGTB 2N7BA 3PHSA 1AGFA 2DYPD 4PEEA 4FN0A 2CM6A 2FWSA 4KBPA 4M00A 1VCAA 1XSJA 4RIRA 1CDIA 3QUZD 4WUKL 4HJ1A 3P0YL 5DGQA 4FCHA 2K78A 4ZX4A 3ZHNA 1G9NL 2VUKA 2GYSA 4GY4A 5GGQH 5IVXB 5DJAA 2VITA 3RY6C 1YEEH 3WLBA 5BO0D 4GH7B 4GUPA 2OMZA 4FXGC 5D1XA 1A02N 1L6PA 3ECQA 4A2GA 2YD1A 1C12B 3KPSB 1JD7A 4PJAF 1MSPA 2Y5QA 5J6HA 3I3DA 2IGLA 4OLYH 4G8FA 2QLYA 1S6NA 4PMEA 2IAAC 3IMRA 1YJDL 4F9LC 1TFPA 5DTFA 1M9WA 1NFIB 3D3VA 3QQ3A 1ZHNA 4YSAA 1AY1H 5CGMA 4ZOCA 1XF1A 1BYPA 2MTAA 1QR1B 2BP0B 1ZGLP 4L4VB 5F7NC 2OI9C 4XPGL 5E94A 1WE5A 5ECJE 3ZDYB 1IT9L 4EUPG 5C2BL 1RHHB 4Y2NA 2C9QA 3V10A 4KKNA 4WWKC 1JV2B 4HS3B 3K6SB 1RLBA 3CU1A 3IJ7A 3DJRA 3I3EA 4LNVA 5MERA 1J9SA 3B6SA 2H1PH 3EG9A 1ZA6B 4DQAA 5E8NA 3G04A 4FA8A 3ZK0A 1EMTH 3PUCA 4NWUH 4FS0A 2ARWA 3MCLH 5FUZH 2KH2B 1BBDH 3AG4B 3BPOC 3RGVD 3B7TA 3EJUA 4F7KA 2AJZA 5JXEC 1KJ3H 4PJFB 5ESAA 4D9RD 1R75A 3RVXC 1GJUA 3HR6A 3ZKND 4F7MA 2OTWB 3H7BA 4EI5B 3AREB 5CN3A 4KO7A 5LWYL 3MOBL 4P5MA 3BH9B 2ZWKA 2ICEB 3QO0A 1S7RB 4ZS6D 3KLSA 3D30A 2PTUA 2CKBH 3PWJA 1MJ7L 4N0FB 4PRIB 1PZ3A 2V2TA 4GW4A 1WFTA 4TL4A 4XP6H 4HH9A 2LLLA 3EHBD 4BH7A 4CADB 2KZBA 3P77A 3QXTA 1FFNB 2Q86A 1FYTE 1MAKA 1A64A 3LMJL 3NRFA 3OKNB 4XMKH 1A6TB 2OPCA 2APXA 3MLPA 2VE6B 4DP1X 1UXWA 1TCRB 2MMXA 4IBZA 4X83A 4Y4HB 4PR5A 4QRAA 2R4SL 1B6UA 7PCYA 4GW1A 5IW1B 3MRGA 5SX4H 3US0A 2HX7A 5MP6H 2XFXB 4YO0B 4YWGH 3VWKB 2GJ6E 3ZQ9A 1SYSB 2A77H 4W9JC 2XWXA 4GBXA 1IC0A 2WWKO 3ZMEA 4PJXE 2OYMA 2JIXB 5DJYA 2PP8A 3FF7A 3KWVA 4WVRA 2J2ZB 4HFUL 4MJ6A 4Q9QL 4KI1A 1E6OL 4NIYE 5IBTL 4I9WE 2J12B 3Q48A 3MRHA 1I3RA 1IE5A 4MWFA 4G7VL 1LE9A 5C0JB 1ZLWK 3OKDA 4B41A 3QWRA 4D94A 3UAFA 2ZXWB 1ETZB 2CMRH 2MHAA 4F2EA 4WHTB 4P06A 3VAEA 3REVA 1FBIH 4JB9H 2FR4B 2JI2A 4CU8A 3VGAC 4YDZA 3ABMB 3WUZA 3ZTNH 1MCRA 2CNZA 4JZJB 1WH0A 4RMRA 1IAII 4L0ZA 2QPFA 4DEUA 2FWOA 3KNBB 1P2CB 3QUYC 5BS0B 4RRPG 3TASA 3RVTC 1GRWA 5IMKB 1BZ9A 1ZV9A 2EINB 2NY6C 1S9XB 1WO2A 4A63A 2A6IB 2VIRA 4MMXA 4PHXA 4F7PA 3LNFA 4YHZL 4H25A 3CVIH 3UTSB 5HVHB 2PCYA 4JO1L 2APWA 1VGEH 1JZ3A 2W92A 2YD9A 3FSVA 3ZDZE 4CW1B 5HYIA 4MAYA 5I82A 3B1TA 3D18B 3TTYA 3UG5A 1DO5A 1LQBC 1IBGL 3U9WA 4NAQA 4C56E 4LCIH 4M5TA 4X7FC 4G80A 3WHE1 5I5IA 3HEIB 3PWLA 4NKQB 3FT1A 1QEWB 3ORJA 5F9AC 3HE6C 3QDGA 4LL4A 3EOAA 2W9DH 2Q76B 3FTYA 4APQD 2ILLA 2VDQB 5DVKA 1C5CL 1QZ1A 2J21A 1X4YA 1I3GL 3CXFA 2UY6A 1EANA 2ODHA 2QV2A 3HS0B 4NENA 5D7LE 5F9JB 4WK4B 2J55A 3BUDA 3NFPA 5DUJA 2DLFL 4LPWA 2C9XA 1A5FH 2ADFH 1NBYA 4KRLB 1HC1A 4Q6KA 2IPTL 2IWEA 3SGDH 2CG9X 1OM3L 4B53A 2VW6A 3OZ9L 1CC3A 2W0FA 2IGTA 2QZQA 4B3EA 1GZHC 5BV7H 5F96L 1HOCB 1KTLB 3BEVB 5DJCA 1I1YA 4FKHA 1TQTA 4KKPA 5KG9B 2VXTH 2A1WL 2L04A 4NZUL 5I26A 1N59B 2Z31B 1F1GA 5JOPD 3ZTJH 3QUML 3CFNA 5B4MD 4A67A 2XV2A 3IMBA 2UXGA 2P52A 4Z7WA 1MG2C 3BOVA 1D5MA 1KXTA 1DVQA 2HT2C 1YUHA 4P9HL 3WNPA 1R46A 3WE6B 4WI8A 5I17B 3K71B 4XPAH 3QDMB 4X7SH 4EI5D 2CUAA 2FB4L 4X5QA 1E5YA 4IGBC 3LRSB 1I8IA 3ELQA 5ETUA 3RZCB 1NBVH 1SXBA 5GRVK 5IWLA 4IW4C 3U4EA 1KLUA 2XVKA 3TIDB 1S7UA 3D4YA 1SHMA 2B5IC 2VZ1A 1GC1L 1D5IL 3BPNB 4LPXA 4Z7NF 1A1OA 4TPRL 2AEWA 1BVKA 2I7OA 2L7QA 3RYMA 3TH4T 3H55A 1O6SA 4TLUA 2PNDA 4P23C 5IY5B 4YDLC 2X4TB 2Y7LA 3DV4A 4ZO7A 2ZUQC 3LRLA 4K2UL 1OCOB 4IKNA 3U36B 3U9PH 1RUKL 1A4JA 2GIMA 3VXMB 5DC9B 4IJ3B 3DOSA 2BNRD 3B9KB 3G6JB 3KM2A 1CVRA 1FL6B 5CBAA 2YLKA 3F2LA 3BWAA 5F3BA 2DMCA 4NYLA 4O02H 2NZIA 2HJKB 3EDEA 3VXTA 2KC0A 2YGVA 2SEBB 3FCTB 3W37A 3CZNA 3NP3A 3BPCB 2H4EA 2AAAA 4MX7A 4X6FA 1X9QA 3OKOB 3HNVL 1MHPL 1NEZB 2ZAHA 4PTUA 2ZWSA 5CMAA 1DBJH 5ESQA 4CC0A 3SE3A 2DQDL 1XB6A 2CXKA 3U82B 3D69B 2AMUA 4LSSH 2ATPB 5C07A 3NTCH 4NN6C 1JK8B 4HJGB 4JDVB 4KVCL 4JHAH 2CR3A 3ZX1A 4OLUH 4ZMOA 4D2NA 1Q9OB 3QEHA 3WXWL 3WNOA 2EDBA 4Y1SA 2W65A 2BNQE 5C6TL 4MNQE 3GMQA 2VSCA 1BM3L 4UDUB 1XIWC 4PJ6A 1U36A 3A24A 3DHMA 4IRJD 3D0AA 1GZPA 4KAQL 4PP1C 3BAXA 3UTSD 1BFSA 2RHEA 5E6YA 4YGVA 1LO0L 4U1LB 5ICXB 2CA4A 2DWYA 3N50A 3QXVA 4Z7VE 3S37H 1CGSL 2HZHA 5B38G 2X42A 3ARBD 3T4AC 3VFWA 4OU3A 4BE5A 4AM0A 4KJPD 3VD5A 4MS6A 3KXFE 1SVCP 4PWFA 2B15A 1VFAB 3FU6A 1TR7A 5KYUB 3QUMA 5EF3A 1A2YA 4XNUL 3CMOH 1XH3B 4MJHA 4Y5YB 2VH5H 1NUGA 3EJZC 2DJUA 1PZDA 5D7JA 4PY7A 1R3KA 1UXSB 1V10A 2GW5A 5L88L 5FO8A 2H26A 3DV6A 3FOLB 4L3EE 2X6VA 1S7WB 2ZCHH 4KITB 3L48A 3WIIH 1ZAGA 2IIJA 3RY5A 3CVHH 4M3HA 1C5BH 3BAEL 1FV1A 3Q2LA 4DPRA 3JBG7 1BVLA 5C0BE 1TU2B 2GY5A 3EBHA 1OAZH 4HK0B 4JFOB 2HG0A 5T3XE 4F2FA 1M9SA 5BRZE 4M6ML 1E42A 2EEXA 5GZNC 3CGTA 3PL6B 4UT7H 4HUUB 5BNXD 4AQAB 5ABZA 2IWGA 1BD2B 2OX5B 2K1MA 1RAMA 3TURA 5EPMA 4HVBA 2FX8H 1KFAH 4XCEB 2K4WA 4XE5B 3VX0A 1S9YB 2F74A 2D03H 3BP5A 3FAXA 5DD3H 1YN7A 1W72B 1Q1PA 3PXJA 3QCTL 5EMYA 3IWUA 4QGYA 4CVZB 2Z34A 1V3KA 3WEXB 3RB7A 3RZCD 2XTJC 4NQCB 1LDPH 4ODBD 1G9ML 4DCQA 1YY8A 5F1IB 4XGZA 3WTWA 2CLVB 1DN0B 4PJ5B 5I0ZA 4A39A 4HPHA 3O0LA 5EZOH 5DJZB 2VXQH 5T3XH 3T8MA 2IWKA 2OFQA 2QVFB 1U3YA 2BPBA 5JQIB 4UWQB 5D7HA 5T1KB 2Z4QA 1XV8A 2YK1L 4MRBA 3ATEA 5DVNA 3FRUA 4M8VA 3OPZH 1P7KA 1FH5H 4GIOA 3TX4A 3VFTA 3MYJA 1AG6A 4P59H 4XVUC 5SWSA 2AQQA 4OKDA 3VXMD 3K2UL 4X6BA 2EXWD 4P49A 3R4RA 5SV3A 3DMMC 5EDXA 3QJVB 5GSRB 3LZFL 2BSCA 3FULA 4I5BA 3MZTA 2XG4B 3WS6C 4NQDD 3GTNA 5SWQA 4CN4A 4N2LA 2O6EA 5ACLA 4HXBH 2E9GA 5D7IA 1L9RA 3UTTE 1NAMB 4XHQA 1BA9A 1UJ3B 4JFXA 1UWEH 1B0RA 4AGLA 1JV5A 4YHYB 4GFXA 2C9PA 3HAEB 3HB3B 4ECNA 3HC3L 3MMEA 5CLWA 1KEGH 4WWNA 2D0HA 1F41A 2MOQA 2P49B 1IKNC 5L6YH 4XRCA 3VYNA 3BCFA 5C0DA 4ENEC 4Y1TA 1ZTXL 1CR9L 1N10A 4NO2A 4NQVA 5D7KE 4CC1A 1PIFA 2Y4SA 5LGJA 3WO4B 2CU9A 1P4BL 1TITA 2VDRL 4RRPA 4LEXH 4P3CL 4XOCA 3RVUC 3K80A 1JNNL 1U92A 3PWUB 5HJBA 2OMWA 3DXAE 3VD7A 5DHVB 2KLSA 4JE4B 3CTTA 4OZ4A 4FRWA 5IF0A 3SPIA 4ABQA 1BMWA 4Z7WF 3KGTA 1W8NA 4R90L 5HHME 2ZXEB 1DQKA 5AZEH 4Y9EA 4ZXBA 4JFED 1TNNA 3SE9L 3OC5A 2C3VA 3MJ7B 1JF1B 4KHXL 1I8KA 3MGOB 1JRHH 3V4VL 2EACA 3O41B 4CVXB 1N4XL 3B4NA 2O5XH 1MCNA 2X4OB 1C1EH 4KOBA 1KBWA 2KLTA 4GAAA 4HS6A 2WYTA 4L1TA 1RL1A 4JFDE 3F5WB 5HBBA 2ED8A 2WVUA 3BVXA 1HKLL 1Z0MA 5I6KA 3DOIA 4N26A 6FABH 1R3HB 3VWJA 4RESB 1OZUA 4Z77A 2VR6A 3M1BB 3CZUB 5ID1B 3WJMB 3MLXH 3C6SB 4JVUA 1NCDL 2BFVH 5IHBA 1D5BB 3EJSA 3UG4A 1DVFB 1H9VA 4M6AA 3KM1A 5B7FA 3WEMA 3SQBB 5CGYC 2D7MA 2RFXB 4E5XG 5AVZB 3M46A 3SE4A 3HUJA 5T1MB 3CHQA 3MUJA 3QRBA 4L4TB 2F5AL 2YC1A 4XOAA 3UIZA 1ZHLB 3EYSL 3BAWA 1EVTC 1R17A 2Z93B 3R19A 4CKQA 3QCUH 4AC2A 4HWUA 2C9VA 3KLAA 1ZPLA 2XWCA 3QG6B 5E00A 2VISB 1CI5A 2XZCL 5EO0A 1MCEA 2Q8BL 1NAKL 2NR6D 5DJDA 5DRWB 3VFUB 1BFVL 1ICTA 3TA3A 4FXKB 4L2LA 1PY0A 2OCCB 3L3GA 3UMNA 5CZKA 4PBXA 3L1FA 2DLEA 3AW5A 1BLNB 1RJLB 1J88A 4IK6A 3I6GA 3BH8A 4GQQA 4RQQA 2EYTB 5I1IH 1QUPA 1K9TA 1QBLL 1ZSDB 4KI5D 4JG1H 3H7LA 5MEPB 4NNXB 4YPGB 4GSRA 4LSVL 1G7IA 2X4NA 5IB4B 4J2XA 1LNUB 2ORBL 5LGHH 2DEWX 2VRAA 3T3MF 2E7LC 2EDQA 5FA3B 4ZS7L 3KPLB 3B3IB 5IW6A 1MFMA 3SGEH 3UXFA 1VEOA 2AABH 1TJGL 2HXAA 4U33A 2A6KA 2UWEF 5GJSH 4I48A 5T1JA 2BSSA 4Q89A 2IG2H 1MY7A 1MG3C 1BQLL 1R0AL 1V3MA 2OS7A 1BZOA 3HG4A 4PRPE 4NZJA 3JYCA 1JPGA 1BYNA 2CGYA 3WKML 4GAJL 1EQWA 3KDMB 5C7XH 3GIZH 4JPKL 5ESVA 3IAQA 5E9DE 4TSBL 3M7OA 2YAMA 1A7OH 3QZWG 1C8QA 3A4AA 2I5YL 5D4IA 3V4VA 5KANI 1Z7JA 2WQ8A 1T89A 2DYPA 4IRZH 5F7KC 2FQEA 5K39A 4KKLD 3N85H 1NGWB 4Y8DC 5AG9A 3M8OL 4H1LB 3ZUCA 4OZHA 1BQHB 1OB0A 1ZSHA 1CDCA 1EFXA 4W9HC 4HEME 4WCYH 2P80A 3KEDA 2AF2A 3EO1B 3RG1C 1E7UA 3SYPA 5E2JA 1TJHH 1CD9B 5FKAB 3DX8B 3DJZA 5E6RB 1JVOA 1GJWA 4X9IA 2IQAA 1FIGL 4TQIA 5B38A 3U9UB 2G30A 2HLFD 3SJVB 4I0PC 5EOTB 5FDYA 1EH9A 1MZZA 1HNGA 5LBGA 5T3ZD 1S9VB 1QHPA 5IROC 3T4YB 1IMHC 1UT9A 4Y4KB 3N91A 3IGUA 1A8JH 5B8CB 4U4IA 2DMHA 5BV7C 2E7CA 3QEQE 1YN6B 3N44F 4QRUA 5C0IA 2WZPA 1ECZA 3UBHA 5AB1A 5JW5B 2HKFL 4KJWC 2UZXB 4BFIB 3RWGA 3ARXA 4HZ1A 1UTDA 2PO6C 2ADJA 3GS0A 3H0TB 3ZTDC 3NJHA 1E2WA 4NPJA 1IM3D 2AJXH 1SOXA 2AK4E 4X4XA 5L2JA 3BESR 2XZAH 5TQ0H 1Z2KA 3P3UA 2XT1B 3OXRB 4OM0L 4AGOA 5DJ2A 1BSIA 1DVFD 4N1EA 3ETBF 5E99L 3VXNA 4K23H 3LEYL 2ZUXA 3D4CA 3MCKA 4PRHE 4WW1B 1F0LA 1ADQL 2G4EA 3I84A 5D7IF 2IVFC 2R39A 3LSOA 4UT6H 3TXAA 4IDJH 2NT0A 3CVBA 5D2LB 3F12B 4YGAB 4C47A 5JPMB 5EU5A 1Z3GL 4PJBE 3IGAB 1JERA 3VXSA 5JQHC 2N1TE 2WLJA 2OQJA 1LO5A 2DTSA 3BAYA 1GGBH 3LH9A 4XPTH 4L29B 2BO0A 3ET9F 4QTIH 5FF6B 5IQNA 1LILA 4UM9B 5B39B 5KVGE 1YNKH 3BDXA 1IVLA 4QHNB 2B1HL 1FG2B 3OB8A 2VUOA 4NO0D 4W1TA 3EH3B 1H0DA 4R4BB 3K46A 2DQMA 4RWYH 1RJZA 4O2CA 4HWNA 3WENA 1ILUA 1MLBB 4JRYE 1TQBC 1YMHB 4ZAKB 4KU1A 2D0GA 2A4ZA 5EZIL 5IHHA 1Z6JT 3IDMA 4RGMC 3ZLQC 3ZYJA 3WTVA 1MPAL 2ZSVB 4XP4L 3V4UH 3ZGHA 2PYFB 4FHJA 5C1MB 1AGBA 1NMCC 4PCKA 2EUWA 4EQ3A 2B08A 2HFFA 1T3FA 2NY1C 5I71C 2Y1AA 3BIBX 3LN4B 5EO9A 4GKNA 5HDQL 3N1GC 2WIIA 4LVHC 5KVGH 5I1CL 3U25A 4TOYH 4HAGA 3SDYH 4Z18A 1BXUA 2OR9L 4BCXA 5ILTH 5EH1A 3UTZB 3R1GL 3RL1A 4JRWA 2FNWA 2K0RA 2X0UA 4OV6F 5C9JB 4M03A 2GB2A 4Z76A 5D72L 4N9GA 1KGUA 5AYUH 4O51A 4PS3A 5EIIB 3COOA 4XMXA 3NEXA 5DT1L 2PCFB 5D1ZC 4F2MA 4L8DA 5I6PA 3KJ6L 4P2RD 3WIHA 3D06A 1JZ8A 1A6UL 1BFOA 1U8NA 2Y06L 3NH7L 2GTZA 1EDYA 4N22A 1QBBA 3SGDI 5C0RL 3HUJF 2ENQA 4GKZB 1FDLL 5F1NA 5FYKE 5JNYB 3CMGA 32C2A 4P4KB 4DNLA 4ZD3H 2L4OA 5BUPA 4Q4EA 2D31B 1UD3A 2G60L 5M95B 2EXYD 4NKDA 4DQOH 3SJVD 1HSBB 2X53A 3FQNA 4ALAL 1C5DA 2Z92B 1H8SA 3RFZA 1Q4NX 2QQLH 1DANT 1KNOB 4TQEH 4APQA 3VSQA 3X3FH 1R3JB 4X6DA 4UQ2A 1ADQA 1AQKL 2B7DT 4BYHA 2VERN 3GRGA 1AKJA 2CLZA 3CFTA 3CUPA 1UWYA 3WN5C 3GZPA 4FEIA 1WHPA 1NCUA 1KZQA 1D7FA 4LSQH 2PWEA 2KZWA 1HXYB 4XWOC 3X14B 4KMQA 2FYYB 4ZMYA 3AU1A 4KQ0A 5F21B 4M4RA 1TETL 3MBED 4AVIA 3N9GH 5FYKH 3BUIA 4UUJB 4XMWA 3ENEA 3T9WA 4DGUA 4DN3H 2VR5A 2ZOOA 2ENJA 3RTQB 2C1OB 5JPNB 3KWTA 3Q9QA 1L0YA 3CC5A 4X6CE 1TQUA 4OSUL 1WC7A 3V55A 3VFVB 4HOMA 1PZ5A 1XF2B 4MASA 4P57A 3P0YH 4Z3HA 3LKSB 2VDQL 4PJCE 4TTGA 3TN0C 3O6KH 5I23A 2L8AA 3O4LD 4L8SC 3GWJA 3AT8A 5I1JH 1XQ4A 4R7DB 4BRJA 3ULVF 3N04A 1N12A 1EV2E 2XZZA 2PWHA 4F15B 2PN5A 4UM9D 5J13B 4LBEA 3KPQB 2JMRA 1OALA 2X4QA 4OF0A 5DGRA 1YJDH 4NT6B 5IQMA 5CP3H 3CX2A 4NERA 4HAKA 3S96B 4QHUB 5E6IC 1JGDA 2I9TB 3JV6B 1MREL 3GJFA 4GLRH 3TZVA 3FJTA 2ZXGA 3TCLA 2OL3L 2H8PB 3NSXA 3MNZA 2O6FA 5KBLA 3NUKA 4XPGH 3BT2L 4YDVA 2G2RA 5I66B 1IT9H 3L9RB 4GRWE 5C2BH 4HGKC 3FO2B 4Z7OF 2UX6A 5L4FA 2OMUB 4NOFA 4ELKA 4KHTL 2RB8A 3P4NB 2BNRA 2QGBA 4PAZA 4PVLA 2GJJA 5HPMB 4HV8A 1I1FA 1RIUL 2DM3A 4I13B 2NUTA 3SGJA 5IESL 5BVPL 1TTUA 4ISVA 2J4WH 2GK0A 3LJ3A 3EDDA 5ALCH 3E8VA 2CCVA 4D0BA 3AQXA 4HKBA 3B7YA 4JL2A 3Q8BA 3SBWC 4HISA 1U8HA 3QEGL 4ZNCD 5D1ZI 1KIUB 3MCG1 3SDXA 2ICWB 1AS7A 4UI2A 3OJVC 5LWYH 2HKHL 3K91A 3MOBH 5IQOA 3QZWA 4PIRF 1PX3A 4GRWH 1QATA 1MJ7H 4X9HA 5J57B 3IDIA 4QRQA 1CBJA 3APMA 3NCFB 1OD7A 1MW0A 4G8IA 4JX0A 1H3WM 3V0VA 4M5YL 3LZOA 1YPZA 3PWVA 4PWJA 4WGWB 4PI0A 3MRJA 3LMJH 2VZVA 4IRJA 3W1ZA 3OHXC 2ITDA 1F3RB 1S8DA 2VDML 4OF6A 4IOSA 4PBDA 5HDWA 4XVSL 3CHRA 2R4SH 3H9YA 4P3WA 5I8CB 4AYFA 4ZZKA 4P4KD 1CDBA 2R0ZL 3ECUA 1NCJA 3FCBA 3QQ4B 4EN3B 1LEIA 5DK3A 1LWRA 3ARBA 1IM9B 2ZXCA 5DD6A 1SYVA 5JZ7C 4JO5A 3O8XA 2W94A 2Z7UA 4Z7VA 5KVFL 3T0AA 4DKAA 5ISZB 3MRDA 5MI0C 4HFUH 3O2VH 3HVDA 3WUWG 4Q9QH 2A7BA 3S8WA 4LCWB 5AUMB 1E6OH 5IBTH 3VXRB 1HDMB 4G7VH 4YSQA 2LV4A 2OR8A 3DJ9A 4PW3A 1RZ8A 2AEIT 1II4E 3QORB 4LCCC 2I26N 1P7HL 4MS8D 4N86A 5H2BB 2CLRB 4MCNA 1J10A 3K1DA 5D2NB 1YA5A 5HXMA 2DQFA 2VRKA 2Q6WB 4GRLB 1JCVA 4MHHG 1QFWM 4P2QA 4H13C 3GIVB 3MRBA 3K6OA 2OL3A 1A3QA 2CO4A 1QW9A 5LG1A 4A68A 2OAAA 4PJXF 4RAUB 1CK0L 2VAAA 3BHBA 1U8CB 3FONB 1V27A 3HCVA 4JO1H 2DW5A 4W9CC 1IFGA 3TEXA 4P5TB 4JFSA 2NNXA 5D71L 4LGRB 5I1HL 2WAQA 1U8PB 5GZOD 1IBGH 3EJPA 4WV1A 5FM4A 1DBBL 4AMXA 3GMRA 3P9MA 3VH8G 2HMIC 2M83A 2VQ1A 5T1DL 2VMCA 2X9XA 4HEPG 4NKOA 1I31A 4U49A 1X6NA 1C5CH 4Z23A 4DHLA 3KLHD 1I3GH 4X8XA 5EN3A 4F9PA 5I0YA 3GUTA 3HFML 1P84J 1OK8A 3ARFC 4DERA 2DLFH 3CN0A 2P8LA 1MNNA 2DWEA 1TZGL 2IPTH 1AYRA 4QWWD 3WFBL 5F6IB 1P6WA 1W72L 3FFDA 3OZ9H 2EDDA 4ZYKB 5F96H 1Z9LA 2L7EA 1OP3K 1GYAA 1QAWA 2JJSA 4HC1A 2GT9B 3LB6D 1NDTA 3HLAB 3QUMH 3ABKB 3OM3B 4ODWA 3UOAB 1OE2A 3FU5A 3VFRA 1KENL 4A7SA 4WNJA 5AOIA 1TKWA 2BFGA 2BC4B 2JKXA 3GMNB 5PAZA 1FE8L 4P9HH 1UOLA 4QAWA 1I9JL 3AB0C 4ZUSB 4B9KC 1JRHI 5I6XB 1DJIA 1WYJA 1YEWA 4JFFB 1MUJA 4FNQA 4Z1PA 5I1KL 3QR2A 5KJRL 4QHKJ 3UTQB 2FB4H 1VZIA 1ULVA 4BFEA 3GKWL 4JPQA 4NQEE 2AXWA 4ZRGA 4HLZG 3VJ6B 5E5MB 3AS3A 2VZSA 2FHCA 4ILDA 4YAQA 2ZWNA 3Q01A 1HK6A 3RI5F 3NCWA 1D5IH 1M05A 2Y7MA 4KGJA 5BQ7A 4E9TA 4LVOC 4TPRH 3QXDB 1AG0A 5I16A 1FL3A 4AXWA 2DWXA 3S36X 1E4XI 5D5MB 1HINH 2FBJL 4EZKA 1OGAB 3GZKA 4IMKC 4GW5B 1DHKA 4JFEA 3CDZB 3KWWA 1H3UA 4LPTA 3GRBA 4K2UH 3KD4A 4JFPB 2EDWA 3FQXB 4LHUG 1RUKH 2H3NA 1F11A 4GRMB 2X2HA 1Y6NR 1CO1A 1A1MB 5K59E 4WO4A 5JIPA 4AYID 2GSMB 2PCPA 1GYVA 4OQTL 1XTMA 4ZFZB 4XNMB 2WXLA 2ZYHA 2HLAB 1P7QD 3VFSB 1T83C 1G43A 2YQ2A 5CR8A 2IAMD 3QUHA 4Z7QE 5ISZD 3K6IA 4M7ZB 4XVJL 1RERA 2LW3A 4PW9A 1RK1B 3VXRD 5TF0A 5CEXB 5DA4A 4BK4A 4U6XA 2V5SA 4I18A 4DUXA 3PDOA 1DP0A 3MV9E 3MUZ1 5IBLC 4MYPA 1ZS8A 1ZVSB 2FVNA 2I24N 5C0GB 3CPLB 4JN2A 4NX0A 4NS0A 2DQDH 3NMEA 4JFZH 1QLEL 5B1JA 5T3ZL 1QPXA 2OMYB 2OSLA 1N6QL 5E1AB 4XB7A 1E9PB 1JTPA 2ZKMX 3WXWH 3BGAA 3ZL4L 4Z78A 4GRLD 5F2FA 3L3IA 4H8HA 5KYWA 4MNHB 3DK2A 2W81C 4Y2OA 1BM3H 3VD0A 1FVDA 5EEWA 3II1A 1JNJA 3QJUB 1YMMD 3N42F 4FNSA 4DEPB 3D2UA 2XY1A 5DK2A 4XX1G 3RKPA 5K9OA 2A74A 5D1QA 1BAFL 1LO0H 1A47A 4M61A 5IFHL 1AIFA 4N20A 4MSWB 4V1DB 4H4NA 3SDXF 3SGEI 1JE6A 4BKLB 3V9CA 2XOTA 2Z8RA 1CGSH 1BYOA 3V52L 2VSMB 3GKZA 1XSIA 3QZLA 5JOFB 2G3NA 3VB9A 3I85A 4Y16D 1HHKB 4YBQC 3V5DA 3O45B 4ZFGL 3IPFA 1HH9A 2OULB 2BW4A 2R9HC 4G9FD 4XNUH 1PKQE 2XVBA 1I7RA 2J56A 4HFWB 5DMGC 3SO3B 1BIIB 1YPZF 3LRGA 5T33H 2BCKB 5JMRA 5L88H 1IC4L 3FCSA 4JZNA 3PCYA 5EU6B 3V6OE 2PW1B 4UV4L 4A7QA 1MIEL 2Y36L 4UIMB 1IC1A 5F1SA 2CJSA 5E8OB 1MFAL 2EDKA 3MX0B 5LBVA 4OFYD 4TUJA 4OCYL 3MROA 5D96C 4Y88A 4MD4A 1DQML 2Q8AL 1PQZB 2KUTA 3MZGB 4KNSA 4M6MH 4Z7VF 1BZ8A 3O6FB 3SN6N 2DV6A 5E5RB 2IOOA 1T20B 4QO1A 5JQ6L 2CK2A 4M62L 3ZKXB 1X9LA 3U6XA 3RL2B 4BA8A 3DSNB 2XKUA 1U6AL 1DQJA 3M17A 1FFPA 2XKSA 4AQ1A 2AXGA 1EAPB 2EICA 4QXTB 4PP2B 4JFFD 3H3KA 1FNSL 4AENA 1Y6MR 3QCTH 4B9CA 5MEQA 4YNYA 2AV1A 3BN9C 4ZPTB 3U0WL 1X4XA 3LS4L 5BVJB 4HX1B 3CHSA 1DLFL 5D9SA 4FZEL 1P5UA 4OQTA 4UV7L 3FFCE 3TCXA 5A7BA 1EZVY 1G9MH 2HVKA 3P73A 1A66A 1W6WA 2VZTA 3ZDXF 2QSVA 2QZ5A 2X70A 5AAMA 4Y5VA 3HPLB 2W07B 1GW0A 2DBLL 5EORL 5KUMA 4B6ZA 4PB9L 2ITEA 3HMXL 5INDA 2WSKA 5HDOA 5IR1B 1PNCA 4Y5XB 2HFGH 2FT8A 2YK1H 1D6EA 3ILQC 3PHQB 4LE8A 3WNJA 2X6BA 3BQUA 1OAXL 4ZK8A 1RPQA 4ZFQA 5KSAB 4N24A 43C9B 3K2UH 4W4NA 1PZCA 3M6DA 4XPBH 5ANMA 5I0DA 4RAHA 5E9AA 2AQ1A 4G59C 1OARL 5FM5M 2R1XA 1KG0A 1UH4A 3B56A 3NK4A 5GGSB 1ACXA 3QDHA 4JQXA 4DKTA 3H9SE 3RWHB 2E7DA 3BDBA 4PJHE 5F70A 3QJHB 3FQ4A 4NRYB 1KGWA 3GBDA 1WBZB 1CT8A 1A6AB 2IBGA 4P2OB 1Q9KA 4PRAA 2QTEA 1NGYA 3HC3H 3MNWB 4K71C 1Y0LA 4EMZA 1QA9B 4U1HA 1N7ML 1R5VB 2WQXA 1K6QH 3LNEA 3QXWA 1ZTXH 1CR9H 1S3RA 2J72A 1IAOA 3DO7B 3FW6A 4NHCL 4IOIB 4AEEA 1D2OA 4FG0A 1ZGLA 2LAAA 1P4BH 3CLEH 4P3CH 3WI9A 3ZN6A 5KN5A 3UACA 1JNNH 5JORB 5A1AA 1LK3L 1YJDC 5TDOA 1JDDA 3BVNB 2XWRA 5TDPB 1HH6A 5EO1B 1M6UA 5KSBE 4R90H 3L5WB 1XF4A 4HPOL 1HYSC 4MA8H 2W91A 4KO5A 1OTUD 3BWUF 3G9VA 3HG1B 4KHXH 5HHXL 2EUVA 3V4VH 4OZGB 1B2WH 1BDYA 2R4RL 5JIIA 2V5MA 1C8PA 1QZNA 2YEVB 4BFRA 4X99B 1N4XH 4NO0A 3V0WL 3DJSA 1ZE3H 3ZZLA 4EAEA 2W88A 4KY2A 3QJOA 4DH2A 4EOWH 1NLDL 4KH2A 3VH8A 5IEKB 3V2AR 4Z6AT 6PAZA 2C3GA 4J39A 1HKLH 4HEPA 3IMSA 4WHYH 4KTGA 1TT6A 5EB9A 3GRWL 4EXKA 5A16A 4NC0B 2UV3A 4NI6A 2P44B 3RX5A 1L0XA 2MOGA 4NJ9L 4R4NC 1HKFA 3U0TA 2XQYG 2EE2A 4M1DL 3UEQA 3HRZB 5ICUA 2X05A 1NCDH 4WSGA 4MVBD 3STZB 5FA4A 2MNWA 3QDJB 2DDQH 1KXQA 2EH7L 5H94A 3U2JA 5LHDA 1VKXA 5CIPH 4D9RE 2V5TA 1I9RL 1RZIB 4WY7L 1B2YA 1JMXA 1A7QH 5DVMA 2VCOA 4PGBB 4XTRC 4YSTA 4FFVC 4C4KO 4ZFFA 4MD0A 4LLMA 3GNMH 3L1EA 2F68X 3HMXA 3O6ML 2NNAB 2LVCA 3T0VA 2F5AH 2WBJB 2OK0L 4GB9A 3CHPA 3DUSB 5CJBA 1TLMA 4OTXL 4ZMNA 3AITA 3EYSH 3HZKB 5KSUB 1VACA 4PPTA 1RCYA 5HYEA 3FPYA 4U1SB 1SOQA 2BJML 4OZFB 4YFLF 3OJDA 1LMIA 1XEUA 2XZCH 1W8OA 3WFEL 2JB6A 1NCIA 3DX2A 4OAWA 5HDLA 1NAKH 3V0JA 3R06A 2H6OA 2JI3A 3I02B 2HAZA 2D7PA 3NIDE 4H7VA 2UXFA 1TLKA 4L05A 4FXGB 1SQ2N 3RIFK 1FZKA 1RUQL 3B2XA 4NUQA 4FHKA 3P11H 4NFDA 3MV7E 4FL4B 2E9IA 3OGOE 4BQBA 2BZCA 2Q7NA 3FU3A 1YYLL 4LCYB 4LLVB 3K81A 1JK9A 1I1AD 3STBA 1CFNB 3V0IA 3X1GA 4LSVH 1JGLL 4LHUA 5B3SB 5HYJA 4MGXA 1AHWB 1JWUA 4GKSB 5E6UB 2CQVA 4MQXC 2ORBH 2NY3B 1SDDA 4F27A 2C26A 5KJ4A 5DRNA 5IB3B 1K5WA 4ZS7H 1MFBL 1TQWA 4UZSA 5DVPA 2FK9A 3VFOA 4ETQA 1TJGH 4Q52A 3VI3A 1MI5B 3GXMA 4ZMLA 1R0AH 4R5VA 1BQLH 3C08L 1CYXA 4CMMB 2CO7B 1WD9A 2VL5A 2N1KA 4GG6E 3MFFA 4Q6YA 3ME0A 4JRXD 3WKMH 3RB5A 1YVLA 4PV8B 4JPKH 1WBXB 3UTOA 4BH8A 4BSVB 1DVSA 1EJ6A 3T3PB 2TSAA 1JHKH 3C60A 4UQBA 2N59A 3MBEA 2I5YH 5FYKU 3WKYA 3ZUNC 3NSJA 4ZMQA 1E9OB 5D6CB 1C9SA 3P2DA 3CDGA 3EF4A 3RU8L 3M8OH 4X0KB 3MRLB 5IVXE 5BZXA 2UYLA 5INCA 3LNGA 1AR2A 4KZ0A 2DLGA 3G5ZB 1N67A 5LJYH 3O4LA 4WUUB 1GJIA 3SDCC 3KPSE 3VXOA 4WENB 1Z5LB 2AQTA 5DF0A 2VLRB 5A2AA 1UWGL 4BUGA 1FIGH 4QNPE 4G1MA 3DGCR 4YC2B 2ZWYA 2CIIB 1YEIL 3LH8A 4DKDC 3JV4A 3QIBD 2X09A 4L4VE 4BCZA 5HJGA 5C8JB 3NESA 3ZDYE 1SLUA 4BK5C 2YD8A 3GHPA 3O2WL 2EIJB 2UVEA 4WK0B 3D2TA 3VG0L 1E9QA 2HKFH 1D9KB 2JJTC 2WZ5A 2M26A 4RGND 4N0RA 3FUFA 4J12A 5AOJA 1GL4B 4PW4A 5FIEA 4CC4A 2K3HA 4FADA 1JZDC 4EZLA 4P9HC 1TTRA 4E42A 5IEHB 5IHZA 1H9DA 1AZNA 2YRZA 3F6LA 1OK0A 2IANB 2WLMA 3QDJD 1Y6KR 4OM0H 4PJFE 2P4AB 1D6VL 3B9AA 1HQ4A 5E99H 5IUCA 2GEEA 4PIBA 1U8OB 4PGEB 4BV1A 2VMJA 3N1FC 1R5IA 4N68A 4Y2LA 3PG2A 3I9AA 4EI6A 4M02A 5JW3L 2QDWA 5DVOA 2WBJD 1KB3A 4ADGA 4XXDA 2PPAA 2J8HA 1QI5A 1RIVL 4N6RB 5I1LB 4PRIE 1FNEA 3VNZA 2WM0A 3LQZB 5A2JH 1XGPA 3FDWA 2HT3D 4HJTA 3T0EB 4ZX3A 1AQHA 2YBRB 1KJVB 4ZW3A 4MDJA 3C6LB 4NHUA 1QWNA 4AEHL 4B5ZA 5K9KB 5J3HC 3MTRA 1MIMH 1I75A 5BO1L 4JW3A 3FSWA 2Z35A 2VXSL 3GLZA 5EZIH 4L0PB 1PAZA 4X5XA 4BZ2L 3NSFA 3B5TA 4XCYB 5L2KD 1SXCA 2ATKB 1MPAH 3EOBA 4HJUA 4XP4H 3CFMA 1T1ZB 5TK4A 3VXQB 1E2VA 4MQ7A 3S4SG 3W11C 4PG2A 4BKSC 2XQBL 1RUPH 2NY3D 4QMEA 2XCMC 3OC8A 5EUKB 2CHDA 5HDQH 4RMQA 2V3EA 1LE5A 1UZ8B 4HSCX 3PNWA 1T1YA 5I1CH 1MI5D 3GJFH 3LEXB 4ELMB 2FEDC 2OCJA 4DIXA 5B3JE 5ABAA 3FT2B 1S7VA 3S3PA 2OR9H 3TV3L 4R84A 2AS5M 1CGXA 3WGUB 4QYOA 1WAAA 3IDGA 3TA4D 4KVPA 5DMIL 1BBJB 2B14A 4MXVE 1TCMA 5BJTA 4PGDA 5LVEA 4DP5X 5D72H 4CMHC 3GC3A 1QR4A 2CA3A 2NUPB 3MXVL 3SYOA 2B0SL 1UXMA 1RXLA 2MQ0A 2NRDA 4RZCA 2YXVA 4DP7X 1FVEB 1ZOXA 5DT1H 5GJTL 4GAFB 3UTSE 3S6CA 4G8AC 5F9WB 3IU3A 3VI4B 1A6UH 3FSZA 4B0MM 2Y06H 3NH7H 5KS9B 3VGEA 3V9EA 4XNBA 3LKPB 4WUUD 1YC8A 3ELAT 1Q38A 4M7LT 1FDLH 1OE1A 3CFJB 3ZQWA 2NY2C 4IOFD 2ZOKB 3DPBB 1XO8A 3RWCB 4WRLA 4OQ1A 2DWSA 1RP9A 4U0RC 5I5MA 1F2XK 5EEUA 4NB7A 4ALAH 1SMAA 4YDLB 4DKFH 2F7QA 2CHZA 1UB6A 2GC4C 1HQRA 2MCPL 4QUOA 3V0GA 1NBZA 2ATAA 3R7RA 5DMKA 4AYMC 1AQKH 3SKNA 1XCTA 1PD1A 2XTSA 1D9KD 4KY1H 5CLXA 1SRDA 4MXWL 5A2IH 2FEEI 2F58H 2XQYA 4DGIL 5C08D 3RJDA 3KYOB 2X2JA 2VLJB 9CGTA 2A9DA 4P46A 1TETH 4I2XA 3WE1A 3D85B 3RDTC 2Y7QB 2NY5L 3TEWA 4QOKB 5C0CB 4GUCA 1CE6A 2R1WA 3MRKA 1J0JA 3RA7L 4OSUH 3RDJA 3V6OC 3IGFA 5EU3B 2WYHA 3CLFL 5LDSA 4F8PA 2YQ3A 3VI3F 3CFEB 3QDME 1KJMA 2EKJA 2VDQH 2JK5B 4J1UB 2JKIS 4XX5A 5GGRB 1NCCL 1QSFD 4YN3A 4OI8A 4LKXB 1PG7X 2PP9A 1M53A 3VU2A 4MAZA 5DJXA 5GS0C 4P3DB 3K6NA 2VN7A 3FC8A 3UO1H 3TVMB 4PWIA 4PREB 1R3LA 2W60A 2A73B 4LOFA 2D7QA 5IKCB 3IDNB 1AJ7L 3O3DA 3GB7B 3T6XA 1CXIA 5LUMA 2BVQB 2X4RA 4ZTOL 1F6FB 1EUTA 4X9YA 1MHEA 4A38A 3OKEB 5HY9A 5ABDE 2OL3H 3T4AB 3BT2H 1HHJB 3EYUL 3L7EB 1KTDA 4R96B 4PJ8B 3BVDB 5KW9L 2YPVA 3VXME 3L7FB 3V6BR 4HULB 1WAPA 1E5UI 5IB5A 4PD4J 3IDYC 3GJEB 4NQDE 4I0KA 4R0LB 1GGYA 4KHTH 2WSDA 4PJCF 1FAIH 3FB7B 2N7AA 1BF8A 4Z3TA 3IM1A 3MNVB 4MD5A 1P7QA 1WCBA 2BCMA 1ZLSL 4N1CA 1RIUH 2IAMA 5IESH 5BVPH 4OV5A 2QQQA 5I15L 3MJ8B 3WDHA 2J57A 2WV3A 3JTTA 4XN7A 1X5FA 3DURB 3QEGH 5C09B 2W9EL 2XX1A 4UANA 1CF8L 4CBZA 1X5JA 2EDFA 3TJHD 5DFWH 1Q8MA 4XP1L 4ANXA 2JB5H 4Z7UA 3VCLA 3WAJA 4HKZA 4FQHB 1T7YA 3I2CL 2GJZB 1UB5A 1L4IA 2AXFA 1TUPA 2CUMA 5L8KB 2DWTA 2Y5TA 4JBSA 1B88A 3S35L 1OSYA 3Q6FA 1IBFA 3TH2T 4M5YH 2CO2A 4ESKA 2AQSA 4O2EA 4FFYH 3PAYA 1B0GB 4WEUD 1YMMA 2H41A 3TO4D 4IRSC 5F3FA 3QUZC 2EDHA 43CAB 4WW2B 4X80L 3RNKA 4HWZA 2R0ZH 3VM7A 3QFJB 1GW6A 1PX4A 4O9HL 1IAKB 2EKSA 3WS3A 5C0EB 5JO5B 4Y16A 5JDSA 3BZFA 5IOPA 1FIEA 5KVFH 2NTFB 4ZUTB 3MJGX 4BUQA 1JNHA 2WAHA 4BQ8A 1BOGB 4M6NL 3DX9B 3K5SA 4P8QA 3ZGIA 1DEEA 3GXUB 1U2HA 4PJ7A 1D7BA 2ZYSA 5DUML 3OL2A 4X9GA 2O72A 5TE7L 2X28A 5CD3B 1T04B 2XN9D 3BSZA 4FQPA 5DEJA 2ZNXA 4LT7A 3W0WB 1CD1A 2VLJD 4YE4L 4PJIB 1BREA 4ZDHB 1IFRA 2XQ0A 3ZKMC 3L4WA 2ADGB 4HKJB 3D9AH 3NACL 1S7SB 1YCSA 3GSWA 4LGSB 5C0CD 2FD6L 1PZUB 1BD2E 4L8BA 2AVFA 3DVFA 5AFAA 4J3OG 3CFDB 3RGVC 1QSEB 1XH2A 2YD0A 2AJUL 3M1CA 5LCVL 3TNNB 3V0DA 1KYFA 2A6DB 3N1QC 1ZHBA 1MJJB 3ARGA 3D6GA 3TLRA 1CK0H 3ESVF 1OAKL 2QGCA 1MCWW 2EQDA 4QT5A 4FA7B 1EEZA 4YBLC 3CZGA 3H3PH 3ZKNC 1HHGB 4NQCE 5D71H 4P48A 4HK3J 1TEFA 3E8UL 3T2NL 5DEFB 5I1HH 3UBXG 1KIQB 4TNEA 4GKOA 1CLOL 3S88L 2GTWA 3OLEA 4KI5E 1ASPA 5T1DH 3CK0L 4DFHA 4BZYA 1G0YR 1WEJL 3NZ8B 2YUWA 4XZUA 3JZYA 3HFMH 3DK0A 3FTGB 4PJ8D 1BAWA 4LKCA 2CDEA 1IEAA 3IAGC 4GFTB 1TZGH 4NN5B 3D25A 3NN8B 1W72H 3VD9A 3N40P 2DWDB 5CSZB 2F19L 2HH0L 1SEBA 2XVLA 4LNRB 2YFOA 4M4PA 2ZOWA 4U1MA 3IVKA 4PJDA 1SJHB 1GY1A 3JWDL 4F33A 4UOQA 2NXYD 3RWDA 2A5UA 2WCSA 2E5EA 5T5FL 4YK4C 3IGLA 4PJGA 1I9JH 1FJ1B 3IKCB 3WEAA 3MODL 1B9ZA 2NY4D 5C09D 2ZKXA 1N2RA 1UKSA 5KJRH 3IS1X 2CKBB 3EH2A 3V8CA 4ZMVA 2VQTA 1TQCC 2BSTA 3D33A 3D0VB 3VUAA 1FN4B 3Q06A 3GPSA 3GKWH 1COBA 1NL0L 3ZBMA 3S48A 1U91A 4Z3EA 3QI9B 4OCXL 4ODXB 3RILA 1BX2A 1Z9PA 1MVYA 4GAGL 4AJ0A 3NSYA 3MRFB 5CZXD 1NPJA 2L7UA 2ZOTA 3QFGA 4X8JB 1VFBB 2C1PA 3BW9B 1NCHA 3AFLA 4PV9A 1NPUA 3DX7A 5H4YA 2FBJH 3W38A 4XO5A 3HAEH 2WWMD 3KYNA 3UGUA 1DVXA 3A21A 3O4OC 3B5GA 4M6OL 4NBXB 3C5JA 3MLSL 4HWBA 2P8PB 3QFJD 4FX5A 3FO9A 1AD0B 1WISA 3MBWA 3HMWH 1H8OA 1DLHB 3KLQA 5EZPA 1MDTA 1B6DA 2CE6A 2Z3FA 3ARDD 4QLWA 4WWID 1AGCA 1H3TA 2CUIA 2VLMD 1G7MB 3K72B 1G7QA 3FQUB 3KPOA 4D0CB 4YHLL 2VJXA 1ZVYA 4XVJH 2CJTA 4XWGL 3MLVH 1MH5B 3CIAA 3OJMB 5LCVA 1CJYA 3VMOA 1CG9A 4APQC 5AAWA 3RIAK 4XMUA 3P9LA 4AG4L 2BVOA 1IAIM 2GPZA 3FT3A 1ZLVK 25C8H 1RFDL 1D7CA 2FZ3B 3W0WD 1QLEH 5T3ZH 5KBNC 5C0AB 4NQXB 4D7PA 2AEPL 1GPOL 1S9WA 3ZL4H 3ZIYA 4L4TE 3ECBA 1E0OB 2X4SB 5J0BA 1ZT1A 3CC1A 1QLFB 3KPRA 5K59F 3U1PA 4WI3A 1W2KT 1JHTA 2B59A 3T8VA 4R3SB 5LN8A 2MNUA 2CWRA 2A0LD 4HPYL 2OP4L 4MNGB 3NOIA 2X1XR 2BS9A 5FYJD 3LKQB 4YIQA 5L4IA 4EI5C 3D0LB 3K8KA 3V52H 3TBTA 4URTB 4Z7UF 2ZUSA 3UZVA 2VKXA 4HGWB 2ICEC 3KR3L 4FMKA 2IFFL 3CFBB 3OHMB 3CG8A 1HI6B 2G5RA 3RUGB 4KNQA 5T5FA 5F7BA 1M2VA 3QIUD 5DD1L 2D0FA 4HZLA 3QW9A 1BXVA 2BY1A 3AUWB 3VRJA 1I1AA 3CFUA 1JJUA 3EGDB 2K8MA 1IC4H 1TVHB 3K6FA 2RMNA 5HHVL 3MV7A 3FO1A 4Y9GA 4UV4H 1MIEH 5EC2B 2Y36H 1WK0A 2YQBA 2KERA 5FLUA 1EDQA 3IF1B 2EDTA 1MFAH 4GXUM 4QRPB 1KEMH 3US1A 3JTBA 1E8ZA 3EGXB 3HG3A 3QNYB 3VWKC 4QGTA 1DQMH 2Q8AH 3MV8B 4OIIL 3OAWA 1JPTL 3WHXB 3V95A 1W0WB 5IVNA 5JQ6H 4CDGC 3HJ0A 4M62H 1INQA 3SYQA 4JRXA 1OB1B 3BMWA 2ITCB 4TVUA 3LN5B 2WXFA 3ZYIA 1O9ZA 3Q1SL 2DLTA 1K5NA 2VZUA 2WO4A 2YUZA 2P5WD 1NDGB 3PPSA 1AC6A 4PJ7F 5E23A 1Z9OA 5FX3A 3X1EA 4FYSA 2E9BA 4YOKA 1FNSH 1T4WA 4YHIB 2YGPA 2Q3XA 1OSEA 3LS4H 4P2RE 2X1QA 1DLFH 4FZEH 3MGTA 4UV7H 2VDKL 2YRBA 3AAZB 3MC0A 3UYPB 1SJEA 1X7QB 2WQUA 1BFTA 1N3NB 4ALAC 5EORH 4NJAL 5E2WL 3WFZA 2X4PA 4W9KC 3OR7A 4PB9H 3HMXH 1KOAA 4L23A 3IDXL 3ZHDA 5K1JA 1JYWA 6CGTA 3S5ZA 4PGCA 1FLTX 4XBEL 4BFKA 3SJVE 1UACL 4IRJC 5AG8A 1OAXH 1C12A 2RTTA 5HVHC 1MCHA 2FIRT 2XWJB 4UNTA 1TQBB 2W8CA 4S1RH 1N5AB 4O02B 1XSOA 4BFBD 4YBHA 1T21A 1OARH 2ZWLT 3F7VA 1W6LA 3I75A 4KJPC 4H1LH 5HP5A 3M1OA 3C5ZD 1DYZA 2BDNL 1JWMB 2HFTA 1HZLA 4EE2A 2NY1B 3L3JB 3R7QA 1JZJA 2Z7WA 3N43B 3DA0A 3LIZL 4A2LA 3HS0C 5HVWA 3BSGA 1N7MH 1KZYA 4Z0BL 4M1CC 3VXUB 4D3CH 2YD4