3UIYA

Crystal structure of sefd_dsca in h2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
131
Chain Sequence
b'LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIEKAVVQAAVTIAAKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera protein of SefD and SefA
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
molecule tags Structural protein
total genus 20
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uiyA00
2CO2A 2CO3A 2CNYA 2CO4A 2CO7A 4OR1A 4PHXA 2CNZA 5D55A 2AXWA 2FVNA 3UIYA 2CO6A 2CO1A 3UIZA 2IXQA
chains in the Genus database with same CATH superfamily
3F7YB 5CIPA 4NI3A 3TLRA 1NCWH 5CJ5A 4RGOL 3CDGB 1JGUH 4TQEH 4LIQL 3RWFB 2XLLA 4HUWB 5CUSL 4D9LH 4G8EA 3R4RA 3TS8A 1E9OB 4QHLA 5IB2B 4IJ3B 2P80A 1VKXA 5E6ID 5DJDB 4WW2C 1OCWH 3G9VA 5FYJD 1KLUB 1OKEA 4L1HA 4ONOA 5HI3C 3T9WA 5F7AA 4FDWA 4QXUL 3OKDB 3VD5A 4F9PA 5E08H 4OSUH 2Z92A 4U6XA 5ICUA 1WT5A 4N22A 3UIYA 4QRPB 1AIFA 4TNFA 3TYGL 1YCSA 2B4CC 4YXHL 2VDMB 2BVQA 1LMKA 3OX8A 4NQSA 2HJLA 2I26N 3AS3A 3LH9A 4ZBJA 1M2VA 1DANU 4BIKA 1OK8A 1KCUH 2CKBL 5EEZA 2VRAA 4JDEA 4R26H 5KBDA 2VL5B 1IQWL 1KJVA 2AQNA 3OC5A 3MMEA 4KKLC 4X80H 5EIVA 5F1IB 5JPNB 3X3FH 3OPZL 4AEHL 5F9OL 2R69L 4HGWA 5ISZB 4DETA 5GGSY 3KH4A 1B0GA 1DLHB 3KWXA 5HYJD 5DZJA 2DQUH 2BW5A 4ZI8A 2VDNB 3SYCA 5TK4A 4FFWC 4JB9H 3KLDA 1WFUA 4PRNB 3F12A 2X41A 3FOMB 4KXDA 4QRSA 5E2UL 1T1WA 3I9PA 3PWVB 2EYTB 3U25A 1QD0A 4FJZA 5DUPL 4LSUL 2PWDA 1AS6A 3ULVH 2XA8H 1KV3A 1TSRA 5I30L 3D7PA 2HMID 2X4TA 2J44A 1VGKA 2RQEA 3OKEA 4X0KB 4XXCC 1A6PA 3CN1A 2XPZA 3QDMA 4QCIA 4GI6A 3T8VA 1CK0L 3DHPA 4KFMA 2WVSA 3IWUA 4XNUH 3BGMA 1WCBB 1P4IL 5HVGB 5SWZD 4LSVH 2O5ZH 1WEJH 3QIBA 4EBQH 2WYHA 1ZLSL 2QMKA 3S96A 4LPYA 3NFPB 4NQDA 4PTTB 1A7OL 4RFNB 1HQRA 4PBVC 1DZBA 1NLDL 5G5DA 3DYPA 5C09B 1Y0LB 4AMKH 4JY4A 4FP8L 1A21A 3ARSA 4OIFA 3RX5A 1YO4A 1NDMB 3LS5L 4K23L 1ZVSB 2IGFL 3CFMA 2BINA 5E2VL 5GGTL 2E7MA 2J6EA 4FQXC 1LEGB 1JPSL 5AW8B 1QWHA 3UTOA 1DBAH 1G1YA 2WW8A 2QBWA 5LBSL 1JERA 4D7BA 2IV8A 2NQ3A 3NPSC 1JGUL 4TQEL 3Q5TA 4ANUA 5C0RL 3WS3A 2D9QB 4NKQB 1HXMA 2ATPA 2A73A 2VLMD 4PCTA 2CLRA 3UBXI 2XBZA 2IDCA 4YGVB 3Q8BA 4ZW3A 3RI5F 3MI6A 1U58A 2MHAB 4A7UA 1SMAA 1VAHA 4NEHB 4U4BA 3C8HA 3U0PB 5DMGD 1KYAA 4PRHB 5IVZA 1TVBA 2E9WA 3DSNB 3Q3GA 3DX6B 5I18L 1A9EA 3F62A 4W9CC 4BCZA 4NO2A 4OSUL 4BINA 4OCMC 5KSAD 4WWID 1NBZA 1JGLH 4WENB 4LVEA 1G7QA 3BPOC 4B9ZA 3HE7B 4WI7A 1SBSH 2CR0A 4J3SA 2AP2A 2IH3A 1FV1A 4JFXB 3KDMB 3WMPA 1CGYA 4R26L 1OP4A 1UD8A 1KJ2L 1AVAA 5JW4M 4OFYD 4Z3IA 3X3FL 4BEIA 1FG2B 5JHDE 2KDYA 3RVTD 3LQMA 4X7EC 3D39D 1R46A 4D9RE 3BD3A 4ELMB 4ZW5A 3K8KA 1EZVX 4ODUB 1K5NB 2DQUL 3ET9F 3VI3A 2BSEA 1E5ZA 3VFSB 4LLQA 5K1VA 5D1XD 4WHYG 4W9FC 4Z7WA 4DK6A 5AD0A 3EFFA 1DDTA 3BE1H 3DRQB 6PCYA 2X2JA 2GUOB 3FT2A 5F0JB 3P54A 2XA8L 2VZSA 3ZL4L 2EE3A 1T1ZB 2X2UA 3DO7B 1MKFA 1ZTMA 4H0GA 3BGFB 4RH4A 3OSVA 1EJ8A 5D93B 4IOSA 1UM4L 3B7RL 3UTSE 3ZYJA 4MLIA 4PJ7F 2E27H 2YRBA 1GTFA 4OZIF 2QKSA 1JNNL 2IAMC 3KYKH 3E6FB 1CG9B 4S1QH 5DC4B 4L9DA 5I6OA 1RFDL 3ZLQC 3BJLA 4OZFB 3DTDA 3LN4A 1ZLWK 1FNGB 1QW9A 4XMLH 4PGCA 4MNHB 5DLLA 1QSFE 3T1WA 1FGNL 1UHVA 3OMIB 3UBHA 4UT6H 2QKIA 4HXAH 4GXVH 5E0QA 3RZCB 3TH4T 2GK0B 3C8KA 2WP3O 5KVDL 3C5ZC 4LSQL 3RJDA 4QAWA 1DJHA 2CRIA 3UGXA 5CCKL 1DL7L 1QRNA 1K8IA 3DTXB 2VE6B 3NEXA 3JUYA 3U1SL 3UMNA 1J1OH 2AQ2A 5MHSD 3DKHA 5EO9A 2B15A 3ULAB 5B3NA 4AMKL 3FZUD 1TENA 4G6JH 4B9KC 1WFTA 2NXYC 3RAJH 3HRZC 5IESL 5GJTL 3MCLH 1TTUA 1DQJB 3ZSSA 1S7TA 2P5PA 2PWHA 4PAZA 2WB7A 3VFMB 1AZVA 2CALA 3C75A 3U9PH 5AB9A 4A7TA 4RSYA 4JDZB 2P5WD 4Y0GA 1V54B 1Z9LA 3U9WA 3ZJAA 5C0FA 5IKCA 1YDPB 5DD0L 2NUTB 2WXPA 4HKZB 1NFDB 2B3RA 3D3VE 1IEAA 1HEZA 1YEGH 1YY8B 3LQAC 1WGVA 3SO5A 1XF4A 1YMME 3A6BH 1ED3B 1F18A 2O6EA 4BQ8A 4LL1A 4GRWH 4KTGA 3QUYB 4LRIC 4LSDA 3HMXL 6FABH 4Z7VF 4BJLA 5IY5B 1F2QA 3DBXA 4WFHE 1MFBH 2X3CA 1TEYA 3I50H 2KZBA 5D9SB 1QSEA 1RIHH 5LN4A 3S34L 4BQ6A 2I07B 3Q0HA 2WD0A 1VFAB 1B3JA 3PE9A 3VI4F 5B4MD 4ABUA 2CBQA 1GJUA 2GC7C 3F84A 5F9DC 3LIZH 1DUZA 1XR8A 4FG6D 5I1HH 4YO0B 4RLDA 2ZNWA 4OD1H 1DSFL 3RGHA 4ZX3A 3CHOA 5LVEA 1G0DA 5CGMA 4LVNB 3MFGB 3K71B 4F3FB 4OM0H 4TUOA 1JHLH 2XVKA 4HOMA 1R5VA 4JMXA 3NK4A 1XGZA 3PLYA 3GMNA 3HS8A 4R4BA 4UYQA 5DVLA 4HJGA 5KG9B 4WW2F 4XWOC 3FK3A 1ODUA 4WTWA 3OAZH 2ICES 1DVSA 4JN2A 4TULH 3RWDA 4YEFA 3BPLB 3MRJA 2ESVA 1WZ1L 5ICZA 5DU7A 1QQDB 3OR6B 3VA2C 3M7FB 4P2RA 1SLXA 1MRFH 4C56A 5I6NA 3O9WB 1RJZA 3LNIA 4AENB 1BQHB 4FFZH 2A9MH 3FUEA 3SKNA 2UX7A 2ZXAA 4XCYA 1F02I 3MJ9H 2RA1A 2DW5A 4M1CC 3WIAA 3N43F 4PWFA 1IT9H 1S7UB 2ZUWA 2VXSL 4J28A 5DFAA 5D7IE 4DZ8A 4GXVL 5C0NC 1LMIA 2C7FA 1EEYA 2YPLD 4IKJA 4RBPK 3C6SA 1QKZH 4XPAL 3MHZA 4MQ7B 1ORQB 5J9PA 3SGEH 1J9SA 2OMZA 4FNLH 4NC1C 1F4XL 1F97A 2XZAL 5D2NB 5HVFB 1A6UH 2ZUTA 1TZOA 4X4KA 2PTTA 3UG4A 3GTVA 2FEDD 2R4RL 2WCSA 1T2QL 2AJXL 1C12A 1JNLL 4WWKA 1R24A 1LWRA 1HKLH 2EDBA 4XX1E 4AZ8A 4XMUA 4G6JL 1WAAE 1AP2A 2YD7A 1I4FB 2QSCL 1JZJA 4WO4B 1BJ8A 2JQAA 4KY2A 5I19L 3BQUB 3VDCA 5JHLL 3MCLL 3QO0B 5FR3A 3U7AA 5E9DE 4MB3A 4KUZH 1I1FB 5CJQL 4ADIA 4AM0B 2HP4A 3R06B 2OYPA 2VB5A 3OJ2C 1AXTH 2LAGB 3K3QA 3WIIH 4TTDC 1XGQB 1YEGL 3ILPB 3G6DH 3FO9B 2Y3NA 4X2UA 3QRFM 3A6BL 3V5DA 3BRGC 2YAEA 1XGYL 3WG7B 2H4EA 1KTJA 3VXSB 6FABL 3SDAB 1JZ6A 1UD2A 1WQVT 3CIQA 5PAZA 1Y18A 2OMWB 4KHTH 5HI4D 1RIHL 3MUUA 5BJTA 2G5BB 4CKVX 4G83A 5DA4A 4WSKA 3WE6A 2C1OB 3PL6A 5EEUA 3LIZL 4KRPB 1BSIA 3MNZA 2MCMA 5JXAL 1N2RB 4OD1L 5DURB 4H88H 1OD9A 5IFHH 1T21B 3KPRE 1Z9MA 3G7TA 5HDOA 2CAKA 5H94B 4QHNB 3RLSA 1FG9C 4LFHD 4OUUA 3QS2A 2I5YH 4QLRA 3M1BA 2VO8A 1N6VA 1K8DA 4ZYKA 3GUTB 5T5FA 1JHLL 5K9KB 3FTYA 1IKFH 1I7TA 2JK5B 1RZKC 2IANB 4LP4A 4WLCA 2BY1A 1EFXB 3LZFH 5DC2A 1QLRA 2NY3C 5CFHA 2B16A 1QLFB 3AITA 3HE6B 3AWGA 3N0AA 4N8CH 1XDTT 1HAUA 1U6AH 4KGJA 4PRPE 3LPWA 2Y06H 1MCHA 3UOAB 4KMLB 3S5YA 2G2RA 4QF1B 3LPPA 1HI6B 3UTQB 1VEPA 1U36A 3SKUD 4UMSA 2FTAA 4FFZL 4IK7A 1Q94B 5FO9B 3UYRH 1IFGA 1ID2A 2GQHA 4V11A 5IJKC 5M95B 4KTEH 3B7YA 1TQCC 1EAQA 4L0ZA 4GSDH 5A3IC 1IT9L 3GB7B 1T5WA 1D5IH 5TE6L 1UASA 1KTLA 4HZLB 1RZIB 2HRPH 3CX5K 1CXEA 1QKZL 1NTDA 2C9PA 1WAEA 1TQTA 1P5VA 1X5ZA 4DGIH 3UC0H 5DJAA 2WVUA 4CN6A 4POZD 3X17A 2R2HA 3R0NA 1IBBA 5JPMA 4PJ8A 1HL8A 2W60B 2F53D 1UUSA 1NMAL 3P77B 1FFRA 3S3DB 4PJIE 4JPVH 1ND0B 2X1WL 4FNSA 5I74B 1NUGA 3UAEA 5A2JH 1U8KB 4N2DA 5T1KA 2IEPA 4XTRD 4K5MA 2CRMA 1USQA 3B3BA 1R3KA 4KUZL 4PHZA 3VWKA 4AM0Q 2JB6B 5IVXF 3QQ3B 1VENA 4D0CA 1OHZA 4YDKL 3U6RA 1SRDA 1E9QA 2AERT 3VXUB 5GS1A 1AXTL 5LGHH 3T0DA 3HRPA 4GRLA 2FWSA 3SKOB 1IVTA 1Q9LA 4W9EC 3CXDH 3O8XD 3RTQD 3BWAB 3ZZQA 3D2UD 1T2JA 3G5WA 4UNUA 3VQ1C 1XB8A 5FYKU 3KPSD 3GRWL 3L3IB 3SO3B 5BS0A 4N5ED 1PKQE 4KHTL 4DP5X 3ZY7A 5FUCE 2QELA 4U1KA 2X4PB 2O4EA 4M48L 1NCHA 4Y1AE 3BYTA 3OWRA 1UB6B 2GT9B 3VAEA 1WWAX 1GGBH 1W72B 5EU3B 5FGBC 1XH1A 3MRPB 2TRHA 1CDHA 3KGTA 2QV2A 2WXOA 1CXFA 5IFHL 1CDUA 2YAQA 3EAKA 3C09C 4NQCD 4Z77A 1ROWA 4K8RL 2CRZA 3WTYA 5ILTH 4GPVA 5KWYC 3S9DB 3H54A 1T83C 5LAXB 4MJ5B 5CCJA 2PWFA 1T3FB 1JTOA 1J12A 3QORC 1NCDH 4G7VH 1LP9B 5FYLH 2QADB 1W8OA 3ZE2B 1NEUA 1WZKA 4QT5B 3ARDB 4Y5VC 2FLMA 5CEZD 3SGJA 3UBXA 1GGIL 2CIKA 3ISYA 1NEZG 1EO7A 1P5UA 4OVUA 1ZAGA 4RDBA 4DO6A 5E00A 4EDWH 3LZFL 2GBAA 3I74A 4NERA 4N8PA 3MBEA 2DQTH 4N8CL 4PPTA 3ESPA 2C1PB 2OL3H 1KIRB 1U6AL 3TO2B 5HYFA 2Y06L 3INOA 1RURH 4XBEL 3WNJA 4P59L 3ZDXB 4WCYL 2DTSA 4DKFH 3TTYA 1DSYA 1B0RB 4PGJA 4WHDA 3EHBD 3KXFD 2GJPA 1X4YA 3DURB 2A1WH 4CVWA 5HD8D 3PAZA 3P4MA 5H8DA 4KTEL 3VG9B 3FAWA 4I18B 5CS7A 1I1AC 4UDUB 25C8H 3UJIL 1BBJA 5HJGA 3D18A 4N6QA 5T3ZL 1IBHA 1NGPL 4QXTB 5F7NC 5K39A 2VYRE 1E4KA 1ZXQA 2BJML 4OZHF 3T2NH 1J1PL 1QBLH 1FBIL 2IVFC 2J20A 2OMXA 2HVJB 3PV6B 4PBXA 3FRPG 4Y19E 1KYFA 3ES6A 2D3JA 4DGIL 3UC0L 1KBPA 2BDNH 1M71B 3T0EB 3BIAX 4M7KH 5J1AA 4JS7A 5IQLA 3CZFA 3UTPD 3OHXC 2BLFA 3U4EA 2ENPA 5FO7A 5EEVA 4JAMA 1FHGA 1UJ3C 1RZPA 4CVUA 5L88H 5JIQA 3QRLA 4ODHL 3WJMA 4HH9B 4PS3A 1GC1H 4I8DA 5HDBE 3FS9A 3GZQA 4QKXB 5AB0A 2XI9A 5DGQA 3T0BA 5HHQB 3VU1A 3ZE1E 4P23B 2YA0A 1IEBA 2NR6C 4NKOB 2BSRB 1CLZH 5AKRA 3K81A 4A7VA 1HTYA 4O00A 2EECA 2EC8A 4EVNA 1OAZH 4DP8X 3FQRB 4L3CA 2R0LL 2GFBB 1VB9A 3QUZA 4M1DL 4KJPC 4ZAKC 2HUEA 5CZXC 4DK5A 5LGHL 1P4BL 4KNUA 1PZDA 2EVJA 3L3OC 2NY6B 3OL2A 1M7IA 3ISWA 4JZJA 5F6IC 1AHMA 3CXDL 1XIWA 4I4WB 2X44D 4YSDA 2BIPA 1S9YA 4HIIA 5F3HA 1SVBA 1WIOA 4BFBD 1JGIA 1I7RA 3HLAB 4OGQC 1VF5C 2WQWA 5GS3A 3PWPA 3VFOA 4D8PB 2BIIA 1T04B 2A74B 2GBUA 4BUQA 3RFZC 1DVXA 3DJZA 2EIJB 2XACC 4NAJA 5E8DH 4O51A 1GJWA 2EUWA 3EKCA 1EMTL 3VFNA 1I8LC 4FYRA 5IUCA 5DZNA 4TTGA 4DPBX 1BZ8A 2DQDH 5AOMA 1O6SA 1T03L 1IM9D 1KT2A 3SCMA 2NTSP 5ILTL 3LAFA 1O75A 1UWXK 1BFOB 3IFOB 4OH2A 1RIUH 5DJ6A 4YE4L 4HFUH 1L0QA 4IEFA 3E8UH 1F56A 3G5VA 1JF1B 2DV6A 4H5SB 3HAEH 1NAML 1PCSA 4NGHL 3RQ3A 1LNUA 4P05A 2GBVA 1YA5A 2R83A 3NIDE 1IC4L 5F9JA 2WLNA 2FWLB 3FUIA 4EDWL 4O2EB 4LK4A 4EDXA 1I9RL 1BPLB 5CXPA 3NJJA 5FFGA 3S97C 4AGOA 5CHNA 1YEFL 1IQDA 2D2CC 1NC4B 2NW2A 1AHWA 4CILA 4DKFL 4DSYA 4NZJA 2VN7A 4AEIL 3JTTA 3AQXA 1TTRA 3QDME 1O6TA 1FFNA 3GT6A 3HUJB 2HX8A 1S6NA 2A1WL 3PABB 1JPGB 5HGAA 3T6VA 1PAMA 5BW7C 5LGJA 3AY4C 2Y23A 3G5ZB 3ZSTA 4A67A 3WUWB 4Y2NA 4RGNC 2D3VA 3AB0B 4MBOA 5BRPA 5IOPB 4G6FD 5BRQA 4NQDE 2FB4L 4ODSH 4UILH 1O5PA 2BDNL 1GOGA 1TYEB 1HN1A 2M1KA 4A1RA 3KR3L 3Q2NA 5E7BA 1EGJA 2YPKA 4S1DC 4U1MB 4I48B 4U6YB 2E7LA 3MRQA 4IK6A 3UCQA 1M6OB 4CN4A 5KYXB 1CGXA 1SFDA 2M2DA 4G7YH 4PUBL 3K6SB 2G9HA 1P7QD 4XZUB 4EUPB 2PYFA 4NWUH 3FT0A 3QUMA 4WNJA 2X4NB 4KTDH 2HTLD 4PRIA 3WAJA 3OD3A 2HWZH 4IRSB 2V6HA 3FYIB 5EA0H 3RG1C 3TU6A 3QNYA 4R0LC 2DLFH 1M7UA 3BZ4A 2XQYA 3SGKC 4MHHG 1EHKB 3PWUB 4YDLB 4HLZH 5D96B 4Q74A 4JFQB 1D5MA 4GW4A 4LPVA 4PB9H 4U1GB 4PRAA 4QXWA 5I1EL 1JG9A 3B9EA 1FE8H 1I3UA 4MS6A 5IMOB 3FUHA 3WEAA 4C4BA 5GIRA 2Z1KA 4JANA 1QVOA 2VUKA 1C8QA 4YHNB 5B38B 1MAMH 3TBYB 4N2HA 1NH6A 4BH7B 5I76A 4N0UB 4BFOA 3RWHB 4Y16C 1ZTXE 1KIPB 4X98B 4RAVA 1IU1A 1IAKB 1EIBA 3F7YA 2FO1A 5SV4A 3HBGA 3LRGA 4ZUSB 2FD6H 4L37A 4RGMC 4EXPX 4HWEL 3CDGA 1RLBA 2EDDA 3VI3E 2OQJA 3HVDA 3L95A 3PHSA 1RIUL 1T1XB 2Z0UA 4PJ5D 4HFUL 4XR8C 1VFBB 4NP4L 4Z7WE 4FCHA 4YL9A 3E8UL 4YHLH 4RIRA 2CCWA 3LKNB 4HK3J 1KLUA 2BZCA 3O6FB 2WANA 2GJ6E 1G9EA 1FFTB 1WLHA 3BAJA 4CU7A 1H15A 3EADA 3OKDA 3Q9PA 5D5MB 2PXYA 3AADB 1WITA 3V55A 4QRPA 1YPZF 4GOSA 1ZJAA 4U3SB 2P7TB 3UC2A 4NIKB 2XTJC 2VDLL 3KCWA 3N3EA 3NN8B 4S10A 3TWCL 3BDBA 3QZWG 5CM1A 2Z7YA 4WNQA 5KUKA 3TA3A 2VLKA 1U8OB 4ODBD 5JPNA 1CE6B 1SN0A 1F4YH 3FUDA 4PJBB 1DEEA 4KK5D 5ISZA 1ONQA 2DYPA 4UB0H 5GGUA 1KBGH 3IE9A 3TYFA 1F8TL 3OF6A 5BQDA 5D1QB 4QRFA 1WBYB 2APWA 4FL4C 2CLZA 1QRNE 4IIQA 2ZJSH 3FOMA 4M7JH 4H40A 4XPHH 4JCLA 4OZGF 1LO0H 4OBRA 4ODSL 5DD5L 4UILL 5JOFA 1DJYA 1XFPA 2YD3A 5FF6B 3CHSA 5EBLB 1Q0XH 3PQYA 5EB9A 1U0QA 4F37F 2EYRA 4K55A 5KSBA 3PGDA 1XGRB 3OSKA 5K69A 5TF1H 5LBVA 3O0RL 2E47A 4DGVH 4X0KA 2FWUA 5EZJA 3H4HA 4FQLH 5CNHA 4MSWA 4NWUL 4ELKB 3VW3L 2AJSH 4HCRH 4O58H 2DWSA 5FGRA 1GA2A 1KTBA 2A6KA 4RMVA 43C9B 3ALWA 2WBJC 1XBDA 4G8FA 2HWZL 2Z7WA 3V7MA 1M7XA 1S5IH 1ERNA 3LKOB 5TE7L 2DQGH 4Y4KD 2DLFL 5LGKA 5E6SB 3IFLL 3DHJA 4ZUUB 5I0VA 2PP8A 5I6PA 5E8NB 1OAKH 3QUXC 3VD0A 4APXB 4ZT1A 4PJEB 4XXWC 5A2AA 2ENQA 4MGXA 3SE9H 2WQXA 5I71C 1E50A 3MACL 3ETTA 1P7BA 5LDSA 2XVLA 1KTCA 3TO4C 3D0VB 1JIBA 5C09A 1Y0LA 4X9GA 2AAVA 2NYZA 4ZMLA 3LSOA 4TSCH 4JG1L 1AR1D 1LDPH 1ZVSA 2WXHA 4HETA 1AD9B 3ZZLA 4L4JA 3S35H 1E3FA 4IHOB 1QPKA 4XCFH 2FD6L 4MDRA 2WZPD 4F2ME 1VZIA 3ULSB 4CNIB 4JFFB 5IHZB 1WWBX 3PPEA 4FEIA 2J5LB 4YHLL 2A83A 3APDA 2Q86B 3F6IA 2DQHH 5ESQA 5EZOH 2JB5H 5LN8A 5ID0B 3MR9A 3DSNA 2BY0A 4ZODA 1PD6A 2Y0SA 1WS7A 2P45B 2RTTA 2X4UB 2E76C 3LS4H 4AYMC 4CUCA 3AG3B 4HHWA 4TQHA 4C56E 1EEZA 4LCUB 4ZDHB 4FABH 1U21A 5I73B 3FW6A 1M56B 1M05B 1NJ9B 1SXBA 4G80B 3HE7A 3DI3B 5F9AC 5T1JA 3QEQB 5HVHC 4YSAA 1V8HA 1ZSDA 2NQCA 2YXWA 4P5KB 3ASNB 3FO2B 4TSBL 4QJ3B 3LRHA 5KVFL 3PNWA 2KZ1B 1K3ZA 4LF3B 4OB5L 4HUVA 2BNQB 2RR3A 2B5IB 1F4YL 4G6AD 4NJAH 4ZZFA 2MNUA 4UB0L 4XODA 3CVHL 4GG6A 1KBGL 3EDKA 3GLEA 2X42A 1RD6A 4ODUA 1K5NA 2W88A 4FTDA 1A14L 4Y4FB 2CKBB 1XAUA 2CDEA 3IMBA 2IMMA 4TVPH 2QPUA 4NO3B 4MVBD 5LDUA 3IGAB 1LO0L 4AQ8C 1IGFL 1WFNA 3QO1B 3B9KB 2XKNA 4I0PB 4OLXH 1HDMB 2YARA 3A22A 3IJ7A 5J11C 1DQVA 3LJ3A 4OCSL 5TDOB 4ZFZA 2AQSA 1L9TA 2B1AH 4PJFF 4B9YA 4RMRA 4PGEA 1XXFC 3SDDC 2EIZA 1RK1A 4PS8A 4ENEC 1QFHA 3MCKB 2X6BA 4HKBB 2YAMA 2GI0A 2R2CA 3RVUC 4KK8C 1A8ZA 2AJSL 5DHVH 4PJCA 2EADA 2XQYK 3GJEB 1UM6H 15C8H 4HH8A 4MNHA 3DIFB 4HIPA 2CUHA 4M7ZB 2W0KA 3GMQA 5G4NA 1BZDA 2G60H 2V33A 3ME0B 3ZBMA 5C0JA 1HCYA 2BWDA 4I1NB 3RZCA 3L7EA 2YPVH 1OAKL 3IGKA 1A66A 3MUGA 1AQ8A 3C2SA 3D4GA 3GK8L 3K6DA 3BWSA 4I9XA 5KBLA 5FEBA 3ZDYE 5DR5H 3BD5A 2WZ0A 3ABMB 3KW7A 4OT1L 3NAAH 2I27N 1XCXA 2YQGA 3I6LE 5GSRA 2VAAA 4Z3EA 4QNPE 1XSJA 2AABH 3GMOA 1NCAH 3L6FB 4HWBL 3OKKB 2Y22A 3FU7A 2UWEE 3QYCA 1SXAA 2HKFH 4WKXA 4PW3A 4FEMA 4Y2DC 4LFHG 3VFMA 3OB8A 3KLHD 5AVQB 2L0DA 3NIGB 4BFFA 3OKLB 4JDZA 4GAFB 4XCFL 2X0UA 4A6YH 2J5WA 2VR5A 3VFUB 4FXKC 3AWFA 2NUTA 1I8MB 1G94A 4GW5B 4HKZA 1R3LB 1YY8A 1DBKH 2B4CH 4UTAA 2VRKA 1TQWA 2XICA 3WY2A 2F1AA 5AVXB 3QUYA 4FNQA 5B7MA 4HUUA 2CHWA 4Z7OB 4OIIH 4GW1B 4LEBA 3LS4L 5D9SA 5IR1A 3RTLA 5GGRA 3M07A 4QJ4B 4I0CC 4U0RC 5IQ7H 2JKNA 3S0PA 5LO7A 3UAAA 1CUOA 1TZGH 2F8VA 3W39B 2Q0ZX 5ID1B 4JGMA 1HYSD 1A0QH 4UAOB 5I82A 1QSFD 3V52L 4ZOCA 5L4JA 5AVUB 5FV1L 1YEIH 2OTUB 1UCBH 1E28B 2NY4B 3Q5OA 4CC1A 5C86A 5K93A 1LD9B 2JTDA 4F58H 4F7TA 5GRXG 3D30A 3ARBA 1TMQA 1RHFA 3IAPA 2DMHA 1T4WA 3VYNA 3DSFH 4R5TA 3ZRFC 5KG9A 3ULUC 1KJ2B 4TVPL 1TVDA 3ZT6A 4DWHA 5LBGA 3UEQA 3VMPA 4YDNA 2I60H 3GXFA 1BM3H 4M5ZL 1XTLA 3JV4B 1F11B 4JG9A 2B1AL 1MOEA 1QQDA 1IE5A 1EDHA 2H26A 3KH3A 3SPHA 1KCVH 5D70L 3E9TA 3VH8B 1E4XL 3AACA 3UYPA 4AENA 1YQ2A 4LNRA 4FNRA 4JM2B 2EDLA 4HJJH 3STBA 1QO3A 3WD5L 4F7MB 4V1DB 1KWKA 1YEEL 3VD4A 3U2SB 2BNRB 2R7EA 3LMJL 1ZWIA 3CMOL 2XTSA 3QZPA 4B9PA 3G6JB 1H6FA 1S7UA 4QHPA 1HU8A 2XG5A 3WEXA 1QAWA 1D9KB 1E6JL 2XYBA 1DBML 1EHLH 2EAEA 1G4MA 2K4WA 2YPVL 1CDYA 3O3EA 3BLPX 5KN5B 1ODAA 2XWTB 3EDDA 4WFHD 5L9DH 1XSOA 1P1ZA 3REVB 5BS0E 3N44B 4DEWA 2W65B 5KVGL 3NAAL 1BLIA 2HAZA 1JRHI 4MA7H 1A4JB 4FFVC 1S8DB 2OYKA 5A6MA 1XZ0A 2WZAA 1U8NA 3ZXAC 4H8PA 1MHEA 1CD8A 4PCYA 2FECI 4R7VA 1DQDH 2AABL 2TSBA 3RWEB 3S3BB 4YDZA 1HAWA 1I4FA 1JDDA 4QRRE 4BFGA 4R97B 3E1ZA 3BQUA 5J5EA 2GTWB 3EGDB 4PJHA 5HPMB 4M8RA 2V7HB 3CFNA 3ESNA 5HDLA 2XU9A 4Z7QB 5BNXD 2ENYA 2YHGA 2N7BA 5DEFA 1GXEA 3ML8A 2VMDA 4A6YL 2G3NA 3FU0A 1GOHA 3BP4B 3H85A 3QCTH 5FKPA 1N19A 2K78A 1VCBC 1WYJA 3IPEA 1TETL 2B8OT 1XGQA 1J11A 2EH7H 2ZG3A 1DBKL 1H9VA 1ZHKB 4FHJA 1CD1B 1U93A 1FVDA 4B50A 4ZW6A 1F5WA 1VA9A 4B41A 2YZ8A 4K5OA 4URTB 3G08B 3F83A 4LBAA 2FSEB 4ALAL 4KKBC 1PSKH 3IVKB 1I7UA 4XO9A 1XCQB 3DJTA 4J4PA 1NANH 3H9ZA 3CIAA 4AJWA 1AC6A 1IFRA 2C1OA 4MS8D 2WWKT 4CMHC 3S3PA 5FDWB 3MRLB 3Q6FA 3R0MA 4GSQA 5IHUH 5GXBB 2JJVA 1UCBL 5K1JA 4MKTA 4O4YH 2HRHA 4MMZC 4OF3A 3MUHL 4MD4B 1MQ8A 4AW4A 3CFBB 3GUTA 5DFVC 2WBXA 5C8JB 1PX4A 2HJKB 2KLSA 4X9YA 2JK5A 3VGAC 2AXGA 3DX4A 2BHFA 5AKSA 5EU5A 2IANA 1OGTB 2HTKC 4LDOB 4TOYH 1A1MB 3IJHB 1BM3L 4WNSA 1W0WB 1QFWL 3HE6A 2HKHH 4XOEA 3D05A 1NFKA 4GAYB 5KAQF 3GSNA 2UZXA 4NNPH 2ZPKH 2F58H 2WM0A 5D4HA 3VTTA 5C0IA 4X4XB 1HI6A 1DVYA 3UTQA 3NCEB 3D0AA 3S37H 3GDCA 4ZUVB 3B56A 2VN3A 3BEWA 4PIBA 4Q58C 3HMWH 4HJJL 3GXPA 5J06A 2XN9A 2XWEA 5DCCA 3GUFA 4R7XA 4QGYA 1T89A 5FYJL 5GZOA 43CAA 3CVBA 3A6CH 5GISH 3IXAA 2DWDB 2DEXX 3VNZA 4AJVA 4EOWL 1JWMB 2AEQL 4HZLA 1RZIA 3LNDA 5C0BA 4JRYB 2V2TA 3JWNG 4BK5A 3QZLA 4NN7C 4M7LL 5L9DL 3FUKA 3HFMH 2OMYB 4ES9A 2L3BA 1MG2C 4TNGA 5DWUH 2A99A 2APBA 4XNXH 4LOEA 3UYOD 1U91B 1CIDA 4MA7L 4KZEH 1JBJA 2WUBL 1J0YA 5E1QA 4RETB 3IMRA 2R56H 4HIQA 4GQRA 4NENA 4TVSa 2F7PA 1MFEH 1SUHA 1UEMA 3C60B 4MKMA 3RKDC 3ULVE 4RX4D 1IBFA 1XD1A 4UTBH 4OFVA 4P2AA 4AOFA 3LQAH 3BIKB 1MNNA 1CDGA 4FERA 4XO3A 4HS3B 5JZ7D 1FF5A 2PYEB 1PX3A 3ARVA 1CL7L 3GNML 3OB0H 4BA0A 2JLLA 3B2UD 4KKPA 4R6UA 3VXUA 2JTYA 1N18A 5A16B 1XT5A 2YAFA 5IZ7A 1JYVA 2RCSH 4UOZA 1J5CA 2EH7L 3OWEA 5LKNA 3QARA 5HHVH 2XV3A 3EF7A 3SKOA 4AVJA 3NJNA 5J0BA 4FQ1H 1I75A 4KRNA 2UY7B 4PRPD 3S5LB 2FNWA 3MRRA 3CFEB 1MHHB 3BD4A 4GS7C 1U3HA 5TF0A 2YAHA 2WLHA 4UZUA 3DRTB 2C7UB 4TLUA 1HC1A 3SDXB 3FB5A 1JNHB 4ODTH 2WLIA 2WXMA 2Z31B 3T2OA 3HBZA 3DOIA 4GRWB 5GGVH 5GGSA 1XL6A 2D9CA 4JKLA 3MRPA 3ZMEA 1EVTC 2CMRH 4F15C 5JIPA 1UQSB 3BUPA 3HNSL 3ASWA 2ZOLB 1NUFA 4NUJA 2P48B 4KJWC 1R9FA 4O4YL 3BN9D 4GUQA 4DF9A 1J9RA 2ZXEB 4MJ5A 2AJ3A 4NQVA 1T3FA 1N4XH 4N0CC 3SE3C 2NNCA 1LP9A 4PJXB 2E0PA 4XWGH 1XTMA 3O11B 2V2XA 3O9WD 3T1FA 3B2VL 4HXBH 4I88A 4L3AA 3JUZA 4PV8A 1RMFH 3UDWA 1DN0A 1TCRA 2N1TE 5CN2A 4J23A 4LCYB 2CQVA 3EH1A 2HKHL 3PIQB 2C1PA 4XRCB 1KIRA 3KYOA 4K3GA 4DVBA 4F9LA 2VKWA 5IEKB 3DA0A 2J1KA 3T3PF 1SOQA 4TNWF 4J2XA 4PRIE 2FLRT 1F1GA 1E9PA 2PR4L 4GKNB 4H2AA 1MCJA 1PCXA 2BOBB 2KDGA 5HXMA 3MV11 4HD9A 4DH2A 5GISL 1G6RH 1SJEB 2OSXA 5MI0C 4K71B 5IQOA 5DI8B 1BVNT 5AKVA 3T3MB 4WO4D 3MRBA 1BD2E 4ZW7A 2WXRA 4PJ9C 3WELA 3TV8A 5DWUL 7CGTA 4JKKA 4KXZH 4WFFE 1Z5LA 1G9ML 2NUPA 3AREA 5B39B 2OCJA 3DUUB 4NQXB 2R56L 4FI8A 1MFEL 4NOFA 3ETBF 3EUDA 2G3ZA 4UTBL 3S37X 5C0DB 2DMCA 4G82A 1I8IA 2AAAA 1NOLA 1E7UA 1MCDA 2O61B 4JFDE 2HMIC 3PAVA 3IPFA 3VXSD 4C57C 2FAUA 5F7YC 3SDAD 4EJ1C 4G42A 3ELQA 4R2GC 3KPTA 1UUNA 3FQRA 1I9JL 4XXDB 4AQEA 1Y1DA 2ZX6A 4I0KA 1SNRA 3STLB 2DPKA 5CP7B 3I75B 4KRPD 2XPYA 3PFUA 1FZKB 4WAFA 4XI5C 3L17A 3GO1H 3O2VH 5CN3A 3MRGB 2YOCA 3HLAA 4K5LA 1IC7H 4D8PA 3FO1B 2YGQA 5JXEC 5KYWA 1R33A 4KROC 4HCGA 3FCUB 3GSQB 4ODTL 4C55A 2H3XC 3RBSA 2YBGA 3MO1B 3QWOB 2JJSA 2VLKE 3RU8L 1T0PB 1PZSA 2R29A 4QJ5B 1HCFX 3V0IA 4X4YB 4KO5A 1RZKH 4DZBB 3IU3A 1OT2A 4TQIA 5ISZE 1ANUA 1EFXD 5EUOA 1CBVH 3D0LB 1BZ7A 1CU4L 1CQYA 1NQBA 1RJLA 4PLJC 2EH8L 3ZYOA 1TJIH 3WY3A 1N4XL 2OZNA 3DVNA 5AAWC 4AQAB 4EN3C 3D52A 1JF1A 4DK3A 3HZMB 4H5SA 2VLRA 4WI8A 3VO0A 1HVXA 4KXCA 3JWOC 4HXBL 3PQYE 5KAQG 3L1GA 1RMFL 1BGXL 2ZAGA 5KSBE 4NCC1 1MG3C 3QQDB 3A47A 4LSRH 3WBDA 3OLDA 1OGSA 2NYKA 3QCUL 5GPRA 5IMMA 5DD6A 3VX0A 5AW9B 4XMKL 2AQ1A 1ZY9A 1S5HA 3OGCB 3VGFA 1ASQA 4HG4J 1G7JA 2KS0A 3JTBA 3P9LB 2K3TA 1KELL 2VM9A 3U46B 1OM3L 3FQ4A 3VWJD 5KYYB 2C4XA 1SMDA 1HEJC 4NN6B 5D1ZC 2XA3A 3WUWA 3R8QA 4TLKA 5DJZA 5HY9A 5T3XE 1G7PB 1HJCA 1B4JH 3B5TA 1MELA 3TFKD 1KXQA 1GAFL 4YX2H 2WKOF 3BFOA 1K6QH 4RRPG 5C09E 1ACYL 3UGEA 4ZUWA 4DOHB 4KPHL 4U1MA 4I48A 2E6PA 1JWSA 3P73B 3BHBB 1M6OA 5KYXA 4PREA 4Z95H 4XZUA 4NDMB 3CG8A 3V0AC 4EUPA 3L45A 3MBXH 2JF1A 4IU2A 4XCNA 2DMKA 3WUZA 4IRSA 3DNKA 3UTTA 1N6UA 1E2WA 2OXGA 3O2WL 3CWGA 3JVFC 3WFDL 4E9QA 2K9UA 2WAHA 1JZIA 1RZQA 1HE7A 3HFFA 5JO5B 2OZ4A 2P5EE 1X5AA 4EIBA 4O2FA 3OKMB 1JZDC 4WU5A 4PG9B 2X0WA 4UQ9A 4AL8L 3GO1L 5IMOA 4H26B 4Y5YC 2YQBA 4B5ZA 3UAJA 2IV9A 1IC7L 2ENSA 4S0HA 1AKJA 4GP4B 2F0CA 4OFQA 1Q9WA 3QDMD 3PWLB 4QRUB 1ZHNB 1NGZA 5I0YA 3B2DC 1RSYA 3WJLA 4HBCH 4YHNA 1BJMA 1M2OA 3L9EA 5CJOL 3TBYA 4BH7A 2QADD 2NT0A 2OMUB 4I7ZC 3ARDD 5INDA 3RWHA 1JPEA 1S9XB 2NSQA 1WFJA 2V5TA 3FTGB 2P24B 2WOBA 1KIPA 3QBTB 4X98A 2NSMA 5T33L 2OAAA 2AJYH 2AV1B 3MNVB 4GG6E 1PYWB 5D7IF 2FATL 5ICYA 3MXVL 1RY7B 2D7TH 5DO2C 4APQD 2NTFA 5JR1L 1TJIL 1RCYA 4PMFA 1VFBA 4EZKA 3PCYA 1JYWA 4F9PC 1V05A 5JDSB 1G9NL 1WT5C 1KB5H 1CICA 4E41B 3O6FA 3I85A 2NNXA 4X99B 4HIHA 1BMWA 1ITCA 2H3NB 2RQ8A 3BKJH 4N2OA 2WQVA 3TV3L 2D3NA 4NXSA 4GSRA 4LSRL 5A2BA 2BM3A 2J88L 2V17L 2P7TA 4HOZA 4CADA 3EOYG 1N7ML 3NN8A 3OVUB 3VE0A 4RMTA 1DJGA 2GCYB 4PJCE 1MH5A 1N5AA 5EO0B 3BPCA 1E27A 1U8OA 4Y8AA 5EO1B 2OL3B 4YC2B 1JGEA 3L3HA 4PJBA 3T0ED 3JV0A 1YYML 4ILDA 3L3JB 3CE1A 2VDOL 4HS8H 1JHTA 1E43A 3E0GA 5D1QA 4I2XE 2X1QA 3ZKMC 1B4JL 4HW6A 1A64A 4LQFH 2HFGL 4GAAA 4ZSOA 5J57B 3QR2A 2NW3A 4MQXC 1KCRL 3WHXB 1KGWA 3F7RA 2EEBA 4HEPA 4P23D 5EBLA 1AR2A 1V3KA 2YQ2A 1B0IA 2X5PA 4G5ZH 1UD3A 3CFIC 3QXUA 2Z91B 3BSZH 5EF1A 4ZFGH 1TIUA 4Z95L 3EO0B 5EOQH 5CLXA 5KSUA 3P3TA 4LQ1A 2CRYA 1NSNL 4A2MA 4MAYA 5J6HB 2NY6D 4ELKA 2P4AB 4DAGH 5CEZH 3NJVA 3RUGA 3Q8AA 1FVEB 43C9A 5E2TL 1H3GA 1TKWB 4Y5XC 1AGDA 2AVGA 3LKOA 1R3IH 4HC1L 3KW8A 4X8JA 1RPUA 5L0QB 1QEWA 3UJJH 3T5WA 5E8NA 1D5ZB 2GJ6D 2J57A 2W5PA 1Z9SB 4FXTA 2EUXA 2DQFB 4BXSV 5KBPA 1GZQB 4ZO6A 5DVOA 3C6LB 5I6KA 2R23B 1G7LA 2YBRB 1PTZA 4LLUA 3H8NA 3U6XA 5FOBB 5J12B 4RMQA 3ABZA 4HBCL 1JZHA 3QC6X 3LCYA 2FJHA 4OBSA 3QJQB 1ZCRA 1E6OL 2R1YB 3QNXA 2WNGA 3TNNA 4C47A 3P9WB 1I1YA 3I2CL 2R8SL 4KO7A 2MEJB 1H9DA 1RUAL 5E6UB 4YZFF 4X6DE 1OP3H 1OVZA 1YMHB 4FYQA 4LCCB 2D7TL 3QDJA 4P0DA 4H8VA 4CNIA 1UOKA 4FOMA 1OTTC 2YO3A 4WFGE 2XFGB 5IHZA 1O7SA 1NC4D 4MMXC 4XN2A 4QUOA 3FB6B 1IO4C 1KIQB 3J8F7 1ZV2A 4UQAA 4DP2X 4R4ND 5DUBA 5BUPA 5JDJA 1QI4A 3BKJL 4QTFA 3ZMNA 2XWXA 1F13A 2X4UA 4XN4A 3UPRA 2J1YA 2JKRM 4ZDHA 1OLLA 4HZAA 4Z7NB 1M05A 2YEVB 3HAEB 3LZRA 2FJFA 4FJ6A 4DN4L 3QEQA 4MXWL 2WVVB 1LEKB 5HI4C 2AQRA 1JZGA 3T0XA 3FO2A 1HH6A 3VCLB 4LF3A 2J43A 5E0FA 4YDIH 4AQOA 1JGDA 2B2XH 4KJQD 4LLVB 3FCSB 3OV6A 5C3TA 1TJXA 1J8HB 1I1CA 2Y5QA 3IRPX 3X1GA 4M6ML 4Y4FA 1S9KC 2VZOA 3HHRB 2CKBA 1OQOA 1S4IA 5IFAL 1L9MA 3B8YA 1QTSA 4TN9A 3SOBH 5IEHB 1GCFA 1RI8A 3ESUF 4NO3A 5KS9B 1PZCA 2D4DA 3IGAA 5EV7A 2R69A 3QO1A 2NDGA 2ZP8A 4YHYB 1AO7D 1HHGB 3AAZB 3IU4L 2HT2D 4FRWA 3WU1A 1R3JB 2V4LA 1FIEA 5DLMH 2Z8VC 1X5HA 5SWSA 5L8KB 1SVCP 2MFNA 1A47A 4ZFGL 2W07B 3KCPA 4N0YH 4PJHE 1NGXA 4WUKL 5EOQL 5F71A 4B5EA 3RL1B 3VB8A 3MCKA 4HKBA 2H41A 2IPKA 2QKIC 4DAGL 4N90E 5FM4A 5C0CA 1SY6L 4LRNH 3VMNA 5CEZL 5IMKB 4F24A 1UVQA 5JIDA 1R3IL 1V7ML 3FTZA 4NKIH 4NNXB 3ME0A 4NRXB 1A6ZB 2DDQL 2IH8A 3PF2A 4ZXBB 2IQAB 4JKMA 3V4LA 5BOPA 1WC7B 2FQDA 5L8LB 4HD5A 4OJFH 2YMXH 2PF6A 3K6NA 3G04A 2KZKA 4WEUD 3HC2A 4MX7A 1S9VB 2ICEB 1IAOB 4JY5L 4LPUA 3IJSB 3TVMA 2VLJB 2HG0A 3GQFA 1HCZA 1RU9L 4OF5A 4IMLB 1F58L 3BXNB 2D31B 3DYOA 3OKKA 2B9AA 4HPOL 3ZZ1A 2JKJA 1R0AL 5H37A 2FVNA 2EQDA 3TBBA 4KK9C 3OKLA 2LGNA 1VACA 2EXTA 3EYOA 3P2BA 3U30C 3N41F 1KB9J 1T7YA 4GW5A 3L3DA 5I17B 2UZIL 1R3LA 5F2FA 2IANE 2X87A 2VM3A 4H25B 4X8XA 4WUUA 2VABB 1UA6L 1FLRL 5LBSA 3H56A 4OZFG 3CLEL 3X3GL 4Q6IB 3L4VA 1D6EB 2FWOB 3HRZA 1H8SA 1BIIA 3MLYH 4DKEH 2X70B 1JZ8A 2R4SH 3HA0A 4L0PB 4K94H 1KJ3L 3ZGHA 3BWUF 2Z1PA 4YZWA 1WA1X 3W39A 1WO2A 2XN9E 3ZE1F 2ATKB 1MY7A 4HGMA 3SDCA 1UWFA 2HT3C 2CJTA 5I1KL 3WMQA 2OFQA 5DEJA 1I85A 1M9SA 2D0GA 1TJHL 2J2ZB 3QIUA 1WTGT 3WN6A 4YDIL 1KPRB 3QUHA 1DQKA 1XZWA 4PBDA 5EIIA 4BFJA 5I23A 1LEIA 5C0BE 5DJ8B 4KZ0A 3PDOA 4AC4A 1CLYL 1ML0A 1EK3A 3SBRA 2WSDA 1AYRA 1KJ2A 3HC0A 3I3DA 2O72A 3GTTA 1HINH 5I24A 4L48A 4U3XA 3OR7B 4P4KA 1FSKC 5F7LB 3ESVF 3JV4A 3RWJB 1EV2E 4AQ1B 4YLQT 1KCSH 2Q7NA 1BBDL 2OCCB 3NDYE 3RY5A 3MLSH 1CDCA 3UO1H 3NJFA 1DO5A 1ZS8A 4JCWA 1R3HA 3CZUB 4BKSC 5D7KE 4XNBA 3FPYA 1VRSA 4BYHA 5AAMA 4HIEB 4JM2A 1T1YB 2WVTA 1MCPH 1SDYA 4IQHA 3EJTA 4OCXL 4V1DA 4F7MA 1NM4A 1A5FH 1FQ9C 1PFOA 1Z9NA 2BFVH 2LOEA 2NPLX 3FFDB 4XPTH 4OR1A 1W0VB 2KC0A 4RMWA 4UM9D 3G6JA 5EZIL 1WGOA 3GKWH 1D9KA 4HFWB 1F3JB 3CCHA 2X09A 3HG1B 4ORZC 2Q1EA 3P11H 3NIDF 1K4CB 1LO4H 2C4FT 4OJFL 5J7CC 1A8JH 2HLFD 3WFHB 4WWKC 4NLAA 5I1GL 3REVA 5HYEA 2MPAH 1HX0A 1KNOB 1UM5H 2O30A 2W65A 4OD3H 3HI5H 1Y7VA 1DP0A 2YEZB 3GSRA 1MWOA 1A4JA 4LGSB 4MXQD 4P4RB 1C7SA 1S8DA 3BUDA 2G3MA 1DVFB 5DDHB 3D08A 4PS7A 4RAUB 1X5GA 4J6RL 1OARH 3WEMA 3C5JB 4PJDF 1KMGA 3WXWH 5HPMA 3EGDA 1ROCA 1T20B 4GMSH 5F7KC 2CCLA 4EI5B 2MNWA 1J48A 4M5TA 4XPBL 1SYSB 2ED9A 1C8PA 3V4PH 2F8IA 3EUUA 4Q9QH 1JP5A 4LSSL 1LP9E 2Q7YB 1OIOA 2CBMA 4P2OA 4D0DB 1GYVA 3ZRCC 2J1ZA 3B5GA 1ZS2A 3LKPB 5GS2H 3AU1A 3ZDXF 5GS0C 3DDGA 1CD1A 3O4LA 4LDLB 4MXVE 4NHUA 5E70A 2PCPB 2XXGA 5EF3A 2FX9H 1Q0EA 4NUGL 2FSEA 1LK3L 2BNQD 3PL6C 1R47A 3WEBA 3NEEA 4Z6AT 3IVKA 1SYVA 3JWNC 2EXWC 1XCQA 2F8OA 1GIGH 3K2UL 3R18A 1BA9A 4JJOA 2R4SL 3VWKD 1P69B 4K94L 3GI9H 4PJ7B 4HWZB 3GMPB 3HNVH 4IJTA 1BAWA 4OZIB 1OD7A 1ZHBA 3RVVC 5FDWA 4MQTB 2IWEA 3HMXA 5DFWH 5IGXL 4Q0XH 4N5UA 3WO4C 3WLWC 5DC0A 2ZUYA 1YG9A 4FQPA 4HLEA 3B9KD 1AQHA 3KAAA 1T7VA 4PCSA 1IAIH 3CZLA 2CJSA 5FWQA 1SJXA 4NZTL 2J12B 1B3IA 1EVUA 4H13C 5C8JA 1RPKA 1RVFH 2HJKA 4JFTA 4LP5A 4DGWC 2QQKH 1RUKH 5E23A 3ARGB 2EZ0C 1DQLH 4JGUA 4Q14A 5JQIB 1YAZA 1A1MA 4UM8B 5IUSA 3QZMA 1W0WA 4NYLA 2DWTA 2DQJL 2BY2A 4QRRD 4LARH 4YLCA 5E99H 1UH2A 2HT4D 3DROB 4GAYA 4BKLB 3WFEL 3MODL 3UO1L 3WIFB 4DW2H 4IOIB 1R1CA 1FI8C 5CBAB 2E8YA 4ZUVA 2BS9A 1TU2B 5A43C 1TITA 1A5FL 1ZMYA 3G3LA 2BFVL 2EDXA 4YWGH 1QYGH 4JFYA 1A7NL 2QQNH 1MUJA 1NIFA 1FHNA 4JPKH 4AG4H 1V5JA 2QVTA 2EEXA 2YXFA 3X1EA 2DWDA 2FHBA 2JWYA 1F6FB 4FQQA 1R34A 1JWMA 3P11L 2MCPH 4GMTH 5JPMC 3IK2A 3Q9QA 4PJ8C 1LO4L 5C71A 3GBDA 5AOLA 4YDMA 5HDWA 2E9GA 1WIPA 4KI5E 4OD3L 1W6WA 2CGYA 2JH2A 3VXOB 1EJOH 4Z7VB 3TN0B 1GZPB 2NXZD 1SOSA 3LXAA 1NCCH 4OGYH 5JTWA 4PS4L 2YSSB 1A4KA 3C60A 1RUML 3EYQD 4XP5H 4JRFA 3VI4B 1A3QA 4NO0A 4Z5RB 5GGQL 3F7LA 3L5HA 1XL4A 2EDJA 4GMSL 3K91A 1B2WL 5GS1C 4QWWC 1DTUA 4P5SA 4L8SB 5EUOE 2PYEA 1UB5A 4M93B 4U1IB 4DESA 2AK4B 1RIVH 4GRLC 3DMMB 32C2A 4X6EB 3ILDA 2VDRH 3UJTH 5JHLA 5A7BA 2VLRE 3H9HB 3CVIH 2YZ1A 3PWNB 4YSTA 3P0YH 4WW2B 4FX5A 2QPSA 3S5LA 4ABVA 4UOW0 5KJRH 1MHHA 1NEZB 2ZNXA 3SGDI 2FX9L 4A6YB 1LK2A 3FU9A 3QIWA 1P84J 1UJTA 5EMYA 3ZTNL 4HCIA 5A2LH 4CDHA 3DRTA 1IEHA 3SDXA 3W9DA 1DO6A 4XMWA 5J3HC 4P2QB 4OLVH 1U8IB 2Z31A 1JGVH 3NZHH 3T8MA 5ETUB 3NDZE 1YEJL 3K80A 3NRQA 2H1PH 2OW7A 4Y7MA 3L3KB 4MJ6A 3OPUA 1E5UI 4Q0XL 4PG2A 4UF7C 4YLBA 3L7FB 3N43B 1QFPA 4KUCD 3N6YA 4YBQD 3RPIA 1K2DB 1M7DB 2XXFA 1P5UC 2HXAA 2PO6B 2C5DC 2C8NA 5IW6B 4X4MA 4Z7AA 2H2SD 4QHMB 3GSWA 1RVFL 2UZYB 3MLUH 2R1XB 1KXQE 4NC0B 4ENZA 2CIIA 2FQGA 3GM8A 3MBEC 2QQKL 3F58H 2VNCA 5GZND 1DQLL 2FT6A 2ZUQC 4P5TB 4UU9B 3HC4L 5CGYD 3AS1A 2W9LA 5IHHA 1CQKA 1ET8A 3P9MA 3ULVD 3FRPB 2EIBA 2BNRD 2UVEA 3PIQA 1N0XH 2WK2A 1ES0A 3NFSH 4LARL 4LEXH 1AGEA 1EAJA 4XVUC 4XRCA 5E99L 4ZOBA 2WP3T 1A1NB 3ZQ9A 5IEKA 2G30A 2GITA 3QW9A 1E8ZA 3MLXH 3QDGE 1IC5H 1PKOA 2DQIH 4P2CG 1MWAH 2FBOJ 3V0VB 4PLKD 1X9RA 2A9DA 3BP5B 1E4KC 1XB6A 2L4OA 1JZ7A 3LN5A 3UTTE 4YWGL 4GKNA 1QYGL 4M62H 5H35A 3ECBB 1UCTA 3NFNA 3PY9A 4Y5VA 1SJEA 4Q56A 3WJJA 5BQ7B 2G5UA 4R7DA 4TUJB 2IPUK 3ZR5A 1OGAA 1L6PA 1IAII 4B3VA 4NSKB 2IXQB 5EOTB 1JL8A 3BPNC 1KLGA 5E6IB 4U05A 5IWLA 1BQUA 4FXGB 2ALAA 4MFHA 3GINA 2OXHB 1EJOL 3FONB 3ZKND 4N0FA 3MX0A 5TE4L 2IDSA 5TPWH 1AOZA 3EGXB 3MKKA 2ZKHH 3FQNA 3SSGA 2VR9A 2X7LA 2ZKXA 4XP5L 4B7IA 5K33A 1D5XB 1UGKA 3MRNA 5C0DA 5SX5H 2WO4A 1ZLVH 3WNPA 1CGSL 3S98A 2X2IA 1UWGL 2FEEI 2V7NB 5HJ3A 3DPBB 1OLZA 3QUZC 4OIAA 3THMH 2O61A 1KG0B 5ESVB 1IMHC 1RIVL 2VKXA 2Q6WB 1TT6A 4IKLA 3D9AH 1ZANL 2F9BT 2FJUB 2VDRL 4JZJC 3VRIB 4HMDA 2ICWJ 1XIWC 3M86A 3N85L 3ARFA 2DJSA 4TV3A 2GY7B 1H3PL 3AG4B 4NP9A 4XXDA 3EO9H 5HYJB 4PJGA 1OF2B 4AMWA 3CAFA 4NRZB 5SX4I 4PVMA 3FB7B 1E2ZA 2C3VB 4Z3GA 2VIRB 1OK0A 1FYHB 2PN5A 4N1EA 4ZFQA 3MRGA 4JO1H 4YSCA 3CBJB 4NIYE 5CD3B 3ILQD 3PXHA 4I87A 4MA1C 4OF8A 4FZ8H 1FZOB 1OSYA 3A6OA 5TQ2L 7FABH 1A3RH 3MO1A 3QWOA 4OLVL 4IS6B 1TJGL 3CLFH 3SCMC 3GFUA 3MZTA 4CSPA 4LLMB 1URIA 1OSEA 5D7LA 2H1PL 2YS4A 4OTXL 3S36H 3GRWA 4LXFA 2CM5A 4A2LA 3NQKA 1KGCE 2WWMC 2KPWA 5DK0B 1YZZA 5I8KL 3WTWA 3D0LA 4YHIB 1A7RL 3D12B 1WA0X 5D1QE 3UXFA 5J1SC 1BD2D 1QP1A 2Z93B 3CNKA 2WLLA 2VMJA 3A4FA 5SWZB 1QPPA 4ZSOE 3ZDYF 5FHBL 2VW6A 3VRJB 1PBYA 5AYUL 4OCYH 3F58L 5KEZA 1ZT1A 2O5XH 1ACCA 3TT3L 4FA8A 3FC8A 4XO5A 5AZUA 3MRIB 2X05A 1AHWC 5KVEL 1NM9A 3RFZA 2GYSA 2YLHA 3RGVD 2WTRB 3FB8B 3QQDA 1CFSB 2UWEF 1OANA 3HPJB 3BUQA 1RZJH 1N6QH 4JFDD 1MRCH 2H45A 3OGCA 1Q0YL 4N6RB 3DC0A 4JRYD 3RUGE 2IAMB 2IBBA 3BDYL 1IGML 3W5MA 3TH2T 2HN7A 3DX8A 4ZW8A 5IVXB 2X3BA 5E8EA 5CLYA 5FO8A 4NZRH 5DD3L 1ZGLP 4OIBA 3QJHA 2AANA 1SDDB 4U1LB 3GHBL 2UYLB 4HKJA 2VXTL 1W15A 2WINA 4Q9RH 1SF5A 5B8CA 2E7LC 1V3MA 5FWRA 5GRZA 1OTSC 5FHAH 4LMQI 1RZ7H 2RH0A 2DB8A 3TBVA 1CXKA 4AIEA 1ZGLB 3WN5B 5CD5C 3GLZA 1T0NB 3AFLA 3M46A 1BEXA 4DPCX 3P73A 4Z7IA 4K3JH 3BRFA 2ZKHL 3APMA 3F8UB 3MLRL 4K9EH 4UQ3B 3LZLA 1VZGA 2K7PA 2XWZA 3KPNB 2DKMA 1NBYA 4UAHA 4ZO9A 4F7EB 1JTTA 2PTVA 1U2YA 4YHZH 5BW7A 4RAHA 2H8PB 5KSVB 4FG4A 5E7FA 3QDJE 1BFSA 5I9QB 1CCZA 3Q06A 4E9VA 1AD0B 3NT0A 1L9OA 2ICCA 4XMZA 1BWMA 2OK0H 3FQ1A 4XVTL 4M8QB 1AI1H 3PQYD 1WF5A 3I02B 1OM9A 4LNVA 1RL1A 5JUEH 4KRMB 3GEFA 3ELAT 4MMYA 5D1XB 5D6DA 2RMNA 4LIQE 4MCNA 2CD0A 2OV0A 5I8EB 1NMBL 4JO1L 3W0WA 3WTTA 2H32H 2IC2A 2YFOA 1BF5A 1J9CT 3GRBA 5F1OB 2NT1A 3E6HB 1P9MA 4JFED 5EH1A 2W92A 8PAZA 5FFLA 2EVHA 1IGTB 5D6CA 2LLNA 3CLFL 2DQCL 3OM3B 2Y7QA 4OZ4B 4B96A 3FTGA 2P24A 3QG6A 1PZBA 2FGWH 4HGKC 3MV9B 4QR7A 5DK2B 3V5KA 1PYWA 1WDAA 2GAZA 5ICXA 5CP3H 4JJ5B 5MERB 3JV5A 4JPIA 4ICWA 4OLWH 3BUYB 3B2MA 3IETB 2Z64C 2EKSB 1QW8A 4OD2B 4OZHB 1NBVL 4H1LG 2JJWA 2AJVH 2ATAA 1KBVA 1XEUA 3UABA 1ZPLA 4MA3B 2OMTA 3ZHNA 2DM4A 3K4ZA 4FF9A 2PXYC 3RL2B 2A9NL 2GEEA 3D69B 1GHFL 2O5XL 3N04A 3CFKB 1B9ZA 3IMWA 4JPWL 4X99A 2C9SA 3RKPA 2H3NA 1QOKA 5DRNB 5EG6C 5E4AA 5SWSE 2O6FA 3HHSA 2JKIS 2IBGA 3OAZK 3TA3C 5I1CL 4A7QA 2R1WB 5JPNC 1NAMA 1E4WH 1RZJL 5IJCC 1N6QL 3O6LL 5C0CE 1IL1B 4ERSH 2LV4A 2AITA 3FTXA 1L9PA 3VACA 1C7TA 2AC0A 2P5ED 4WY7H 1E4XI 3QNZA 3DX0A 3L3JA 4IIQC 4NZRL 4QEGA 1AGFB 2G75B 5B38G 4N2CA 5IBUB 2H7WA 3PWJA 1QLEL 4QKTA 3L9RB 3WNKA 4L2YA 1WD9A 1DBJH 4Q9RL 2YKLH 2BIHA 2ZSWB 3QC5X 1TLKA 5HHPB 5B3JF 1UXSB 3WHXA 3WTUA 1DVQA 3LRKA 1U8QB 4FQIH 1MIEH 1Z3GH 2J25A 3MRKA 4EIGB 2BC4B 3NSYA 2P8MB 1G1KA 3IDMB 3VD2A 4K9EL 4OFPA 1QHOA 4DTGL 5FM5O 3EO0A 3N5AA 4MNQB 4EKXA 4S0TD 3DHMA 4H4NA 3WNLA 4NXKA 5J6HA 4YHZL 5CR1A 2A6DA 4W9DC 4AZUA 1NZRA 1H0DB 1FVEA 1ZEAH 3D4YA 1N0LB 2OSLB 3P02A 2KI6A 4YVUA 3QWRD 4DKDC 1WE5A 3BKML 5E8OB 4H0HB 4X7TA 1MLBA 4WUUE 3U0WH 5L2KA 4RFNC 1D5ZA 3N9GL 4QOKB 1E7VA 1MCEA 3QXAB 4IKNA 3TT1L 3TZVA 3FQ2A 5I1LB 1Z9SA 4ECNA 1UT1A 3H3PH 4N26A 4JUSA 2H9GB 1KXTB 1GZQA 1INQA 1TQVA 3K4DA 2D03H 1A4AA 1BVKA 1PLBA 2YBRA 3V0WH 1QUNA 3EOBB 4KX9A 3KD4A 1CLOH 3W2DH 1QSZA 1UACH 1MQKL 4B9GA 2WBJA 5DJXA 2MOGA 2QFPA 3P2TA 4GAGH 3RDJA 2MTPA 5CEXA 3CQQA 4JRXE 2RACA 1EEQA 1YMHA 4JO2L 4LCCA 2E8ZA 3QUXA 4W81A 2CJ3A 5EFIB 4XXWA 1G0YR 3SE6A 2PLTA 4IBYA 2XV0A 2R0WH 2YWZA 5K9JL 5L4FA 1KGXA 4U4IA 2EO9A 2YPLB 3FB6A 3ZUNC 2CDGA 1AGCA 4PGDB 1AKPA 5AUMA 1P7HL 2P8PA 2NY3B 4JL2A 1QFWM 3HE7C 3ZW3A 3FUMA 2CA4A 3H6JA 3ULVF 3EJJX 5MENE 2ZCZA 4MCZB 1H5BA 3QFJE 1UA7A 5AW1B 4IM8A 1FZMB 3LRLA 5DSCA 3MRDB 2GSIB 1QFWI 1RUQH 3CDYA 4H2CA 2R2BA 2XQBH 2ZQKA 1R19A 5IG7B 3VCLA 2UV3A 4ODWB 2Q3XA 3G6JE 1TQCB 3VXQB 1T0MA 1NCJA 1FL3A 3FCSA 3N44F 3MFFB 3CU7A 3S4SG 1TSHA 3ZDWA 4E9XA 2WJ5A 1N64H 1AGBA 2GG1A 5DVPA 4M5YH 4LKXB 5CZVL 3DPDA 5KS9A 4FHBD 2RGSA 4GBXD 5D93C 3EOAA 1GGCH 3L5WB 3Q2CA 1PLAA 4CC4A 3SQOH 1GYAA 2BP0B 2VDOB 4L05A 1Z3GL 1SM3H 4I3SH 5KVDE 3F65A 2HH0H 2Y9RT 3H1ZA 4MNGA 2NQDA 1HOCB 1R3JA 1FNLA 3UGUA 5FGCB 1UFGA 4AJ0A 4B9CA 5EC1A 2BOCA 1ETZB 3GC3A 2R9HD 4H0IA 2HLAB 1AS8A 5KYNA 5IMKA 1MHCB 3BP7A 3DDFA 4UBDC 3RZCC 1ZEAL 1HSBA 4HJ0D 2BCKA 4M3JA 1X44A 3WFBH 1MCRA 4NNXA 3SE4A 4MA8H 1A6ZA 3K74B 4M3KB 3BAXA 4ZXBA 3RWCB 4NJ9H 3O4LE 1CL7I 4UV4H 4AQ8A 3H0TA 3U0WL 1EERB 1X7QB 4ZMXA 2BH0A 1WC7A 2P3YA 4BUHA 3N1QC 1GW0A 4P07A 5IROA 4W70A 5CIPH 1QR4A 1NKOA 1YUHB 1YYLH 4IIZA 4JHUA 2FJGA 1U3YA 3BVDB 1FIGL 1JDAA 3AROA 3H3PL 3II1A 4S11A 2RD0A 4E5XB 4FFYL 4OI9A 3RDTD 1PZUB 5D2LA 1YPZB 2VLJA 2ZKWA 2B0SH 1KN2L 4C4KT 4IMLA 2E46A 3BXNA 2D31A 4FCAA 1OEZW 2BVOB 1C5DA 5I6XB 2AJUH 2Z4QA 2OYMA 2CXGA 1MCLA 3BZFA 4MD0A 5D7JA 3Q2VA 1LO2L 4GAGL 4E41D 4EAEA 3TEYA 3GMMA 3VA6A 3FT4A 4G6KH 1PIFA 1R75A 4MDJB 5DMKB 3T4AA 1VPOH 4G8GB 5CCGE 2AEPH 4OGXH 3FQUA 5FYLD 3QUYC 3QORB 5HGBB 5CKGA 4TL5A 3JYCA 1KIUB 3ZYIA 1JD9A 1P2CB 3QZBA 3UL4A 5F7UA 3GMLB 4H25A 5IW3A 4OZGB 2NRDA 4CGTA 5DFTA 4RZCA 4QHKI 1D6EA 3APNA 4TSAH 4H8HA 1PU0A 3A4AA 1NCBL 3I6GA 4ZOEA 5LB1A 5ALCH 3W11C 5KTEL 1IC1A 4AX3A 3CN4A 1KB5B 2V5YA 4LVNC 2JVUA 2ATKA 4EKJA 2EVIA 4YSPA 3V4VA 1TYJA 4KHXL 3ARBC 2F54B 3BKYL 3GRGA 2LU3A 3EJYC 1ZGLM 1KPRA 5EBGA 3FH7A 3GBML 4JREB 2CUMA 1QR1A 2AZAA 5BZZA 4H7VA 1IAMA 3KDPB 4W9KC 1AQKH 1MJ8H 2HPOA 5ACLA 2IH1A 4HWUA 4QDGA 1PLGL 3GBNH 1IRAY 3RTQB 3O8XB 1GGCL 4YUEH 3CVHA 3OXRB 5HI5D 1QBBA 4I77H 3H7LA 3KPSB 5IBLD 1IBGL 4CAGA 1ZA3A 1T22A 3M6DA 2HH0L 2CK2A 2DH2A 3Q6GL 1UJ3B 3PGFH 4JMNA 1NC2D 2IG2H 5D1ZI 5F7EL 1CF1A 2PYEE 2Y07H 1MEXL 3L81A 4S2SB 4Y4HA 4L23A 3NABH 1GS6X 4KZCA 4PJAA 3U7YH 2ITDA 4P5RA 3FFDA 4J3OC 2BP5M 3LZPA 3WFBL 5E24E 3C6LD 2EDMA 1KJMB 3FH5A 2BRRL 4HFWA 1F3JA 3T8XA 4ZAKB 5IHWA 5I8OL 3HG1A 4P9HC 5D2NC 1OB1A 4MJIE 4P49A 5JOPD 1FYTB 3MRHB 1CF8L 2J6EH 1K4CA 3IDNA 3L3OB 1HWHB 5I2IB 4NZFA 4URKA 4WK4B 1TQUA 5J8OA 4P3WA 3E38A 4QY8A 5E03A 1G1CA 4GRWF 5KSBF 2GTZB 1FNSL 1KNOA 4WGKA 2YEZA 3LPOA 4WO4C 4P4RA 4MWFB 5F7FA 4BM7A 3BQUC 1DYZA 3EXJA 5G4MA 2XN9D 5DDHA 2ZXDA 4W6XB 4HALA 1YUKB 1OT1A 3KPMB 4LSTH 4PWEA 1DQTA 4S1SL 3VNYA 4LOVA 1MW2A 2HVKB 4OJAA 4A63A 1UADC 3EJZD 4IRJA 3LEXB 2AJUL 4PJXF 1HEHC 1OSZB 3LNFA 3V7AE 4MRCA 3EHBB 3KXFB 1KFAH 3V95A 4RA3A 3QEGL 1SYSA 4YDJB 2DI7A 1VPOL 4X4ME 3EFDH 1CBJA 1DR9A 1RERA 3IJYA 5F9WC 3TM6A 1D7DA 4OGXL 1YECH 4HWBA 3TPUB 5EF0A 3K72B 3I9GH 4OLYL 4PP1D 2JKSA 1JWUA 3NPZB 3MV8A 1IKOP 4X9FA 2NCMA 3NCCB 1SJVA 3MOAL 4J4PC 3BISA 5EU4A 3AXIA 4JFOB 4XP6H 4LLWA 2WCGA 2H0JA 2JKXA 1O9VA 1JXFA 5C08B 4PJFB 2DIEA 1PG7H 1J8HD 5I0XA 3LH2H 4J3WA 4M5SA 5ALCL 2VZ1A 4HJUA 1ZXKA 3IM1A 3DV4B 4OZIA 4HX1B 5C7XH 5C6PB 1YNLL 3T3MF 3CK0H 3VXME 3O6MH 1CWVA 5EU6E 2QPFA 1NA8A 3VX1A 5H2BA 1OGAE 3MJ8B 1L7TL 1YNKL 4YHKL 1Y6KR 2X6MA 3HS9A 4N9GA 4AYID 2X6VA 4A2HA 3O6KH 3SYQA 1AQKL 2JI2A 2WCPA 3HE6C 3FU5A 4ZMAT 2ERJC 4K7PL 3VJ6B 4KAQL 4JY6B 4ZJ9A 2EABA 4UM8A 1OAJA 2VMEA 3NK3A 1I7ZA 1CFQB 4YUEL 5E1GA 2EIEA 1MREL 1NWPA 2AF2A 4ONHB 3UG5A 2MQCA 1JK8B 1TPXB 3HPLB 1MI5A 3AS2A 3KVDD 5FA4A 1UXLA 2XPGA 2CO3A 2GHZA 1L6ZA 3ENEA 2IG2L 3CH1A 1T89C 2C9QA 3D06A 5GZOC 4KV5E 2F1EA 5CBAA 5JIMA 4GG6F 1NPJA 1RZFH 2GHWB 4K5NA 1J5HA 2GABA 1WZLA 3VB9A 3LKSA 4LCWA 5IM7A 1U95B 1YN7B 1JPTH 4DPRA 1THCA 1XF5A 2E59A 3NCXA 1P7KB 4YHPB 3SYOA 1MCOL 4BK5C 4ZMYA 5BMFH 4HHAB 4PJGE 4WW1B 4FQHA 3S88L 5CN1A 4WZ9A 2J6EL 5IOKA 3CVCA 3KS0H 3OGOE 2HLEB 3QPXH 4OJDH 4X5XB 1UOVA 3FAXA 4L29A 1MPAH 2B20A 4MJ2A 3EJCA 2KQMA 2DI9A 3VXOA 4HS6A 5I74C 3QR1A 3W38A 5D72L 2E4TA 3H9SB 3QFDA 4W4OA 4XAWH 2YSSA 2J21A 4HKXA 4LU5H 1X9LA 1AMXA 1YY9D 4PJCF 4NKMA 4R7NB 5D7LE 1DZ0A 5FW6A 3VM7A 4GO9A 4I3RH 4HVBA 2C9RA 3DX9A 4XMXA 1KFAL 1MNUL 2Z8RA 4PY7B 4BQ9A 2AK4A 2H2PC 1MW0A 4K3HA 3RVWC 1WBZB 4E2OA 2V2WA 4RGMB 1JJUA 5DXWA 3EFDL 1H3TA 4FAAB 4HT1H 4XBPB 3Q1EA 4YXKL 4YFEA 1FFPA 3I9GL 3PGCB 4FS0A 3H9HA 3KLAB 1U3HC 5FO2A 3SO3C 3VFGL 3QJSB 2F7RA 1ZTXL 5HHMB 2J56A 4G6FB 4G9FA 5C07B 3RWGB 4GO6B 4WKZA 5SWQA 3FHEA 1NEZA 4A6YA 2QGCA 3K5SA 4XP6L 1NCNA 3VFWB 4E9WA 4KGLA 1LE9A 1TQSA 2OMVB 3GM0A 4M00A 5BV7L 1BAGA 1GYUA 1KPUB 4OCNC 4D0BB 4MZIA 1MLCB 3QI9A 6CGTA 4LL4A 3LH2L 4JLRA 1ZVHA 2D73A 4P2QA 1BX2B 1VGEL 2ZD0A 5IVNA 1C16A 2DN7A 1P7QB 3LRSB 4Z3HA 2BVPB 4PGBB 2J8OA 1J0KA 1QNZL 5D7HA 3LOWA 5FYJU 3DUSB 3HZYA 3U0TB 4UTCA 4UIMB 2EXYC 1AXSA 1X5XA 4NQEA 3UROR 4ORGB 1KCBA 2JCCE 1SEBB 2WXGA 4N87A 4GRMB 1K2DA 1O9WA 3JZ7A 2PO6A 1BOGB 4WFEE 2GIYA 3U9UB 1HXYA 1S7XA 5IW6A 2WGNB 4JGJA 5LGYA 4QHMA 3FOLA 4FL4B 4Q89A 1QFUH 3O6KL 4PVNA 2R1XA 4KI5D 1ZE3C 3U2IA 1KY6A 1T66C 5E8PB 1NAKL 3WY1A 4I9WE 5AWNL 1OTUD 3J7HA 2VXQL 2ADJA 1TTFA 2HFFA 4UU9A 2WZ6A 4WWOA 4DT2A 4X4ZA 5HDQL 5FV2A 2Z8WC 3FRPA 3GGWB 4ZUTB 1EJFA 2L04A 3OMZA 3QZOA 1PG7X 5T1MB 3TONA 4GQ9H 1A1NA 4FFTA 4L3EB 3D5OF 4W4NA 4XN9A 6PAZA 4R8WH 4EPSA 5HDRA 4XHJD 2OTPA 3O81A 2FO8A 3V0VA 1BVZA 3MLZH 4HUXB 4IGBD 4DEPC 5CEYA 3BP5A 4K7FB 2YXMA 2BW4A 4NRYB 4RGNE 4X6DF 1KLFB 4NUQA 3FMGH 4LCIL 4MDIB 4L8CB 3FO0H 3ECBA 2WZ5A 2XJLA 4PYHA 5BQ7A 4YBLC 2X4QA 1CFMA 5BMFL 1DVFD 2UY6B 3VXNB 5JW4R 4TUKH 4BV1A 3SE8L 4PR5B 1CFTB 1HHIA 3BKCH 3AREC 3QPXL 5E6IA 3IDGB 3TASA 3L08A 3WGUB 3W0WE 1BQRA 4CVXB 5EBMB 4EI5D 3D48R 3MGOB 1RP8A 1H19A 4FHKA 4X5QA 3TO4B 2ZT9C 4F8QA 4XAWL 1FUNA 1Z9PA 2ISDA 2AKRB 3GXTA 1TDQA 4P23C 1D5XA 3SB3A 4JO5A 2H6PB 3X14B 3Q7JA 3QEUA 2KYIA 3VXPA 5HHOE 1WPCA 1WBXB 3BYYA 4R90H 4ZTOH 4GKOA 5DQ9B 1UKSA 4LZKA 5ESVA 4QD2E 3FN0L 4J3OF 4PLNC 2Q6WA 1HZKA 1L9QA 2W1NA 4WK2B 4KO9A 3N2JA 5E51A 1NFIA 3VRIA 1TQBC 2AS5M 4L4TB 4JBSA 4IBZA 3V9CA 4AC2A 1OF2A 2V5RA 2VQUA 4NRZA 5ADPL 3S8FB 2D0FA 2Z35A 4OKDA 2C3VA 4P46D 1Z9OA 2VIRA 3IJEB 4Z8FL 3MKGA 4H8WH 3E8VA 1Z32X 2JJSC 1GL4B 3QDGD 4ZD3H 3GSVB 5CD3A 4LPCA 4PJHF 1Q72L 1JPFA 4HQQH 4YIQA 4LHUB 3EYUL 2QGBA 1FZOA 1KZYA 2CO4A 2X2YA 4XHQA 3DV6B 4IS6A 1WWWX 5HVHB 3OZ9H 4XP4H 3ZKSD 3UFIA 2ZZUT 3DXAB 4LLMA 1DVUA 1BQLL 5DHEA 5FB8A 2GPZA 5JLZB 5C0AE 2RHEA 2DYSB 3F7KA 4XOCA 4ZPVA 2P49B 3NCBB 5B39G 4YHIA 3CU1A 3BX7C 2IH9A 3UERA 3N40P 2Y6SD 2Z93A 4Y4KB 1T0OA 4AV0A 5SWZA 4R96B 2Y7MA 1CJYA 3DHUA 3OLGA 4UOW1 3ZL1A 5IV2B 2YGPA 4CVZB 3H9YA 2XNAB 5L7XH 4U6VH 1F4WH 1YJDL 3P4NA 1JS4A 1DDHB 3O41B 2EE0A 4R3SB 2BSTA 4GSXA 2VMCA 3L3GA 4GQ9L 1CFSA 1NGQH 5EU7C 1UZGA 2VC2L 2VXUH 2G3XA 2WWOA 3HPJA 3UPCA 3BRDA 3NBNA 4K73A 3EOTL 4AWJC 1J9QA 3SDDB 4CA4A 2VSKB 2OX5A 2B14A 4KQ3H 1RP9A 2MH4A 3D33A 3L2MA 4O5LL 1BM7A 5D8JL 2CPCA 2KH2B 4H8UA 3VDBA 1R5WB 1A3LL 3AB0C 4GT7A 1CXIA 3CLWA 2LAAA 5L2JB 2AVFA 4XNMB 4MD5B 4P3CH 1CICD 2AV7A 2CR3A 3TP4A 1EH9A 5L2KE 1SDDA 3QDAA 2UYLA 4JN1H 1ETA1 3FT3B 2CKNA 2M8XA 3BKCL 1RPQA 4NO5A 4JO3H 5DD1L 2YN5A 4BZ2L 2ADFH 1PY9A 1ZGLA 1S9WB 3WN5A 4O2CA 2B77A 1HKFA 3DMMD 3A4EA 5KSAA 4OW6A 2YC1B 4UQ3A 2L7QA 3HG4A 3V0GA 1LWJA 4UQCA 3KGRA 3INUH 1OPGH 1KGCD 3KPNA 1Z5HA 3LV3B 4IRSC 4W9HC 3WE1A 1MFMA 5D1ZA 5DZLA 3JYBA 3V6FA 3QULB 4Y2DB 2H8PA 2R0ZH 1EAPA 3OXSB 5T1LD 5HI3D 4OFYA 4YDLC 3AS0A 3I6KB 1AD0A 3IKCB 5D96C 2IOMA 3LNGA 1TTAA 1D2PA 4U1GC 2F8XC 3D39A 4XN8A 3L9BA 4L4VE 3HG0A 3HR5A 5EN2B 3EBIA 3UAJC 3UBGA 3IFPA 1SGKA 2NLJB 5D1XA 4TPRL 1NGWB 2QVIA 1S7WB 4IMKA 5TQ0H 1AY1L 3BT0A 3MNWA 4J8RA 4H8WL 4KKLD 4O9HH 4RZKA 4TNEA 3WJLC 2VDRB 1IILE 1A02N 2X89D 5JNYA 5C0EA 4HEMA 2XZCH 3DYMA 2OP4H 4UQIM 3CD4A 3AG1B 2YD8A 4P3DB 1YLBB 2VISA 5B1KA 1IGTA 1XX9C 2PNDA 2I9LB 4OZ4A 1GTNA 4UT7H 8FABB 4ODVH 3QZWA 5DJ2B 1FGVH 1A7PL 3EG9B 4JDVB 1LWHA 1OALA 4P5TD 4JJ5A 5MERA 2AMUA 4BFEA 1LLAA 4MCYB 3IETA 4OD2A 4JG5A 4UCFA 4N2MA 4OZHA 3HI6L 3O6FC 3TEXA 2XBTA 3WO3B 4MA3A 4AY0A 5KS9E 3US0A 4X6FA 2A77H 5GJSH 4G1EA 4LESA 4AYFA 4GJTB 3WMSA 3CFKA 4P57B 2X4RB 5FYKH 3A3YB 4I85A 3QJRB 1S7RB 4U6VL 2HJFB 2GJZB 1U8MB 2WJ7A 3FHAA 4MNGE 4OV6F 5DRNA 4ZFFA 5KBKA 2HG5B 1BV8A 1NGQL 4RFEB 1JV5A 2B1OA 3EFOB 2R1WA 4EZLA 3EGSA 3BUIA 1Z2KA 3TBWA 2BNUB 5I5MA 3EZ8A 3EYVA 1TO5A 4KQ3L 3WLBB 3VGGA 2VDKH 3BH8B 5JHDB 5D1QC 4QTHA 2W9DL 5MP6H 1FFQA 2XETA 1F0LA 2P5WA 1DBBL 2H5UA 2NY0C 4MXVF 2LHAA 5KZCB 1ORSA 1MWAB 4UANA 4JN1L 1AQDA 1Q8MA 3S8GB 5GHWH 1GY2A 4HAKA 2ADFL 2H3KA 3OZKA 1FO0H 1EXHA 4FQXD 5D2LE 4MAUH 3RWIA 2KL6A 4KX7A 1C5CH 3IDXL 4HUMB 4MAYC 3UTSB 2VCOA 3LD8B 3QVAA 3EO1B 1T4KB 1V3LA 4E42B 4X5RA 4F7PA 4U1HB 3GBLA 1PAZA 1OPGL 1DANT 2J4WL 3ZL2A 5C3LD 2N01B 1QSFB 1N8ZB 1J5IA 2XY2A 5CLZA 2R0ZL 3LEYH 3K2KA 1IBYA 1MHPH 3X11A 4AGNA 5BXFB 1N0LA 1HNGA 2PCFB 4K7PY 5ENWB 3WHE0 4ANKA 4HAFA 3AZUA 5DYFA 3HHMA 1XGPA 2WMPB 5BZDB 3DVIA 3M45A 4PP2A 3BVVA 2AEWA 3QXVA 4ZS6C 4UNIA 3QJZA 4M29A 1HK6A 5EZLB 1BYOA 1J1XH 4L1LA 2H9GA 4EIUA 1KXTA 3QHZH 3LXCA 1HXKA 1RH8A 3WIHL 3ARPA 5TH2B 3DX7B 4G43B 3IBEA 2ZWZA 3UCRA 1A7QH 2IGLA 3QQNA 1QBML 4PRDA 3AXLA 1FNAA 4FKKA 4GUPB 1X5IA 1QG3A 2CJUL 3SD2A 4AGLA 4GG8B 2PWEA 1CT8B 4PVLA 2OI9C 2WQAA 4Y5XA 5DRZB 3GKZA 4ODVL 2BHYA 2DS4A 3RB5A 3HNTL 1FCCA 3LHPH 5EBWB 3D3VB 1INEL 1WA2X 2DM7A 5DYOA 1PZ2A 4MMZB 1KY7A 2KLRA 3WXVH 3QSKB 1HZHH 1YMMB 2XJKA 1E4JA 2X12A 3OAUL 5ANMA 3B34A 4YFLF 5IB5B 3VGAB 2YPLA 5TGBB 3CX2A 4KI5F 4PGDA 3K1KC 4Y2LA 5FIEA 2X1OA 3MCG1 2IAMD 3OMAB 3VQ2C 2ZTBA 1CYWA 3FJTA 4JPSA 5I73C 5JW3H 1MJJB 2ICWB 2XWJA 1L5GA 2X6CA 3NGBB 3F7VA 1FL5B 3CZEA 3E7JA 1NCWL 2EDRA 4XO4A 5E2WH 2P43B 3PRZA 2B5IC 5HGHA 2A6JB 5EUOF 4D9LL 5JHMA 1M57B 4PJAE 3C5ZD 4GB9A 4P2YA 4NB7A 3W5NA 3APCA 4HULB 3CFQA 1OCWL 3RNQA 2J8UE 4Y4FC 1DQQB 2APXA 3BFQG 3ULUE 3MFFA 3HG1E 4MMXA 3CC5B 3VGHA 5E08L 3IB4A 1EDYA 2QTVA 5CILH 3BZEB 3B9KC 4I0PC 3QUMH 4MQSB 5LCVA 2EDFA 3QK0A 2NXYD 4LKXA 4F33A 1FNEB 2CGZA 1ECYA 4LMQE 1KCUL 3L5WA 1FO0L 3MU3A 3CDCA 3D50A 2J72A 1RULH 2JKWA 2ZICA 3QISA 4MAUL 4X80L 5E2JA 5IIEB 5IT2H 3P3SA 1QLEB 2QGEA 3GIVB 4OFKA 2XFXA 4G1MB 4UIKH 1QSVA 4ZS7H 1CIUA 2MQ3A 1BZ9B 2EYSA 4MZ2A 4M7ZC 3D25B 3CFCH 4JRXD 4JB9L 1OAXH 4YHMH 2VQ4A 4KY1H 3RJQB 3SPCA 2MWCA 4M43H 2VR8A 4D3CH 2G2NA 1BVLB 5D7IB 5C9JB 4C59B 3AJ7A 2LTQB 3ULVL 2B1HH 1HH9A 1LE5B 2Y3AA 3OB0K 4FGMA 3HAEG 3JT0A 2JKTM 3MV8E 3RIKA 4PN6A 3ZOAA 3MROB 5FECB 4GNKB 1X7QA 5BPPA 3PHAA 1LO3H 1DCEA 2WQ8A 3KPPA 3QWNA 1YUHA 5IF0B 4QIRA 5MEND 3QFJD 1YEWA 4JQIA 1J1XL 1BZOA 4NBXB 4YH6A 3TVMC 4HC1A 2A2QT 3MV9D 1SXZA 4GS7B 4FLRA 4JM0A 5I5IA 4JRWA 3OJDA 3O2DH 1YPZA 4XNUL 5F44A 2I32A 3O0LA 4NNYA 3AW5A 4U2YA 3O3BB 2BVOA 2ZE0A 5E9DB 4F5CE 2C9XA 2WTOA 4LSVL 4YQXH 2F19H 2CLVB 2APVA 2O5ZL 4F15B 4XWOD 4HK3N 1WEJL 4N8VG 2H32B 4EBQL 4QRTA 3X1FA 1TUPA 2CG9X 3DGGB 4N4YB 1BREA 5DMKA 2CSPA 2VDMH 2YAPA 3WY4A 4HK0A 5DVNA 2AJZB 3TCLA 1RQ5A 5K9OB 4RRPM