3UIYA

Crystal structure of sefd_dsca in h2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
131
Chain Sequence
LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIEKAVVQAAVTIAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Chimera protein of SefD and SefA
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
total genus 20
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uiyA00
2CO2A 2CO1A 2CO4A 5D55A 3UIYA 2CNYA 2IXQA 3UIZA 2AXWA 2CO6A 2CNZA 4PHXA 2CO7A 4OR1A 2CO3A 2FVNA
chains in the Genus database with same CATH superfamily
4GXUM 3SY6A 3KYOA 1H3VA 3B2PA 3PS6A 4MYWB 4PU2A 5EIIB 2WXLA 3IT8D 1P1ZB 3EJTA 4PJ6A 5HHXL 1JPST 4A1RA 3F3HA 5TTRA 3NH7L 2Y6TE 2CLRB 4B7LA 2R2CA 1M05A 1WFNA 2Y2WA 4F20A 1ZTXE 4P3CH 5JPNC 1WIUA 2Z93A 5MENB 2W88A 1A3RH 3ULVF 2DZEA 4NN6B 3HBPA 2OJEA 4GYBA 5D93C 4NZTH 4KROB 4JZNB 4LAJH 3MRDA 3FUKA 3GSNH 1LP9B 2XTSA 3E1F1 4RA0C 1HOEA 2ITCA 1MF2H 1CFBA 1AR1D 1T4KA 1WRFA 4WO4C 4PJAA 3GI8L 2IAMC 1ZLUK 2BSTB 3Q06A 5BRZD 5GGRY 2B1OA 3HPLA 2HRGA 4L8DA 2VLRE 4NWTL 1UM6H 2OZNA 3C2SA 3QXDA 1P4LB 1GGTA 2VRKA 1I7ZA 1WLHA 2BSEA 1N2RB 4O02H 2VLME 1D7FA 4JZOB 3QEQA 5CJQL 3WJMB 1DVFD 1RIVL 3MV11 3G6AB 4XNZC 3TX4A 4E41D 1UUNA 5SX4H 3FQNA 1AGEA 4U3CA 4HEME 4BQCA 2QTVA 3ES6A 1WTLA 3QUHA 1QWHA 5F0PB 3ZL4L 2XYCA 2Z65C 4P5KA 4HIHB 1BM3H 5A2LH 1GOFA 2NSMA 3O4OB 4NRYA 2I7SA 4TVSa 1IBBA 4DKTA 1ZGLB 1WVZA 4JQXC 1NGWA 1SRDA 3E38A 3IMRA 3FUHA 5SX5H 1E7VA 4JKWA 2EC9U 1Z5LB 2Y5EA 4PJCA 1HSBA 1WG3A 5K5YA 1KWGA 2E4FA 1AQDB 1I3RA 1QLRA 1N6VA 5I8KH 1JWUB 1T21A 4WAFA 3N42F 1BQLH 1OAYH 3FO0H 5J3HC 1PZ5A 1YC7A 4N8CL 5DUJA 3SCMC 1FHGA 5BZDA 3QR0A 1AOHA 1QFWM 4XZUB 4R3SA 1FH2A 2AEWA 2PWDA 3HE7C 5FHAL 5LBSH 4ODUA 4Z7WA 1LQBC 2JI2A 4H1LH 4K23L 1U8OA 3W9DA 4A68A 5FO8A 2YBGA 3FT3B 3LKSA 1KJMB 4UYPA 2XA8L 5FM4A 1R3IH 4ZFFB 5EULV 1FFOB 4Z3IA 1JXGA 1O5DT 3CG8A 3D9AH 4DT2A 3PWPD 4FNLH 1R19A 1AAJA 5IHLB 2XUWA 3O2DH 4I2XA 4BWTA 1HE7A 2AEPL 2XWJB 4U1SB 3WN5B 2EXWC 5F96L 4H8WL 4XO5A 3ARDB 4KZEL 3A6BL 1E90A 3F83A 3E2HB 1KGXA 2CO6A 2VDOB 1XF2B 1UC6A 3P3UA 3BT2H 3T0EA 1U8QA 1EGJH 2MRYA 3BRDA 2J55A 1IQDB 2P52A 2AJSH 1MHEB 5ICXA 1MW1A 3VXSB 3SE4A 5DJ0A 4C56B 3WXVL 4OUOA 32C2B 3IMVA 4H25A 2A9DA 3QXAB 3OAYH 4MAUL 2X1QA 2X1XR 4KY1L 3FQXA 1TETL 2KZBA 1SMOA 2P24A 3OPZL 1LO4L 1D5RA 1YNKH 2VITA 2ZPKH 4F7EB 4YHML 5DO2C 5DF0A 2BCKB 3TC9A 3BXNA 5EEXA 3T6WA 2VIRB 1QVOB 3FDWA 2VOTA 5I1KL 1HNGA 2CXKA 3D0LA 2FX8H 4UF7C 2JQMA 2DYPD 3WY1A 4K3EL 2TRYA 4K5OA 2P5PA 1JK9B 1Q9WA 1YNTB 1Z0NA 3H3PH 4J6IA 5EOCJ 3GSUA 1C5DA 2DBLH 1CT8A 4XO3A 2WZ6A 3WY3A 1M9WA 1N70A 1SEQH 2VDRB 2HPOA 2YFNA 3HR5A 3NP3A 4R5VA 4YUEL 3PDGA 3RY5A 1XGPA 3H2WA 4YFLF 4AQEB 3RWHB 3CK0L 4QHMB 1NUFA 5EEWA 1L9MA 1Y6MR 1XGUA 2OPCA 4I0CC 4FQHA 1G1OA 2W9DL 2B1AL 4HUXA 2EYSB 2X4NB 1AS7A 4YAQA 3HNVH 2JI3A 3UG5A 3L9RB 4FQLL 2YPVL 2F5AL 1XTLA 4HIIB 4M61A 2GEQA 4FQJH 2VDMB 4Y5VA 5EPMB 4JFSA 5F9JB 1B0RA 1DN0B 1JFQL 5D4IA 1J11A 2DIAA 2H32B 4FG0A 3QFDB 5CJ8A 3KPRE 3N41F 3LV3A 2OMWB 3JVGC 5EEYA 1HVXA 2CXGA 4NNPL 4K7PL 3CE1A 3N43B 2RAMA 5AYUH 3H1ZA 1WUNT 3MLRL 5EU3A 2HFEA 1OAUL 2CRYA 5J9PB 3ELAT 3BUBA 4JY4B 2OFQA 5HD8C 5HYSB 4G8FA 2NDGA 4GINA 1LK2A 3RUGA 5JW3H 4LRNL 3K1KC 2XV3A 3QHFH 3ZKXB 5EU4A 4LU5H 1JNJA 4KK6D 4HG4J 4WJG3 4UYQA 1E0OB 3FS9A 4GLRH 4NN7B 5FKPB 4FHJA 4WEBL 3QQ9C 4XAWH 3PLYA 3GHPA 3APMA 3NN8B 2R59A 3DV6B 5HJ3A 3UJIL 5C0RL 4Y4HA 3OD3A 1UWEL 5KVFE 5TFSL 2C34A 5DC9B 3WJJA 1DJYA 3RPIA 4XNXH 1OAKH 1L6ZA 5IJKC 3CFCL 3ZZLA 4GUPB 3S96B 2JWYA 3I9AA 5EOQL 1HEZB 2A99A 3K74B 4M5YL 5ALCH 1FN4A 4MJIA 1OE2A 5A16B 3D39D 4ZW5A 3B3IA 1MY7A 3EF4A 2QPFA 4J2QA 5E2UH 4G8GA 3D85D 5EH1A 2CQVA 4HDIA 4N6RA 4HC1H 4TQEH 4XP1L 1JZIA 1S7VA 4IOSD 2WVUA 4LE8A 2OCCB 4TOYH 4KMLB 3G5YB 2CGRH 1IFHL 2X0WA 5DC2A 5HHME 5AW2B 4KMQA 3NJMA 2R0WH 1RV6X 3S34H 4ZUWA 4JPWL 2MKWA 4RFNC 1DQIA 1B3JA 1OQOA 4RWHA 5ID1A 4YLCA 3MODL 4JCLA 4TUKL 1KLUA 4K7PX 5DVPA 3RY6A 3TCXA 1USQA 5GS1B 4Y4FB 1FL6A 3AXIA 2O6CA 4OV6F 1JGLL 3AZUA 4YXLH 4GBXD 2DL9A 1T0NB 1P7KA 5F7YC 5AWNH 4FABH 1YCSA 2GSIA 3OKLB 3GXIA 3U46B 2N0MA 5D7JD 5FWRA 3VG9B 4JM2C 4MAYB 4Y16A 2BWDA 5T3XD 4TSBH 1UD6A 1PLGL 4P5SA 5KBLA 3VFRA 3PP4L 1A2YA 5BCAA 2VABB 2WSDA 2A6DA 3VXUA 1HH9B 2IOIA 3WIHA 1F4YH 2I69A 3GBMH 2XWTA 1E9OB 2AXFB 4WI0B 5CZRA 1A9EB 4EVNA 2CCWA 2X0UA 5FGRA 4ELMA 4PN6A 4TNVF 1SVBA 4NJAH 3WO3B 1T20A 4JANA 1VB9A 1W0WA 5FYJL 1T5WA 3RY4A 5B22A 3OGCB 2G5BB 1PY9A 3DHMA 4R7NA 3D07A 2VLKB 1UADC 4DZ8A 1ZLEA 5DJZA 3T4AC 1XQ4A 4OF8A 3MR9A 4WW2C 3R0MA 3ARED 3TIDA 1P1ZA 4U1JA 4GIOA 4R8WH 1NDMB 2EH7H 2CLRA 2JF1A 1MFEH 2HX8A 5IROC 3EGDB 3TFBA 4EIGB 4HS3A 4I88A 5I6OA 5MENA 2DPKA 2QL1A 4L9LB 3D69B 3PWLB 4OSUH 3CSYA 4MS8C 2AEOA 2XN9B 4JZNA 3IE9A 1UWGL 4QRPD 1CWVA 3ZE1E 4I7ZC 5KBKA 3K2UH 1LP9A 3U83A 4PJAE 3P69A 4L1HA 1BWWA 1FZMA 3JWNH 2BIQA 4HH8A 5GGVL 2XX0A 4KHXL 1OEZW 4FKEA 4XVSL 2E7LC 1I4FA 4N0YH 2BSTA 2BSDA 1SJMA 3RILA 7PCYA 5ADPH 1G7JB 4HWEL 3C8DA 1T0MA 4Z8FH 2VZSA 3ULUD 4QYAA 1H6TA 4WUKH 1A7QL 2PP9A 3QEQE 4XE5B 3CFJB 1P4LA 1ZJAA 2F54D 3CZFA 1HYRC 4YSSA 4X7EC 1GGBH 4PIBA 2P80D 3WJMA 4UM9D 3BI9X 4QXUL 2EUVA 1Q0XH 2FBOJ 1QNIA 3BLKA 3G6AA 3OLDA 2EDLA 2X2JA 3D3VD 1V27A 4ES8A 1T1ZB 1LJMA 1LDPL 1SUJA 5J13C 3E80A 3B7YA 3EAKA 1JD7A 2BP0B 4HIHA 5HYJB 5E6YA 3FZUD 4EZLA 3EBIA 1IBDA 4KRPC 5ICZB 2W0FB 5BUPA 1H8LA 2VUKA 3SGDI 4OU3A 2NPLX 3RWDB 4IBWA 1CFQA 4Q9RL 3BGMB 4XNUH 2BC4B 1A7PH 3PWPB 1JWUA 3RE0A 1IARB 4JPVH 4PRID 5JUEL 2NZ1A 1IBGL 3OXRB 2XLLA 1QW9A 1ZDQA 3N43F 5E99L 2KZWA 4MASA 3EYFA 3W38A 3ESNA 1F5WA 3P02A 4ODXA 3ABKB 2LVEA 2XTJC 3L6FA 3MOBL 4ICXA 3WHE1 4AEFA 3T0VA 1KBGL 1ZEAL 4OT1H 3RB5A 4WO4D 3FT3A 1LWHA 1ORQB 2IAMD 4I0KA 4E5XG 4W4OC 3KWWB 5E6IB 1X5YA 4JJ5A 2NTSP 1UURA 1N5AB 1JIBA 3P3RA 3IWUA 4BUGA 1UKQA 4R4NC 3RNQB 2WYHA 5KVGH 1D9KC 4DZBA 1JZ5A 5IFJA 1FPTH 5GS0H 2JKJA 3WN5A 4MA1B 4FA6A 4Z3EA 3QWOB 2MTAA 3ARDA 4MB5A 5AZ2L 2MCG1 1IVTA 2FEEL 2FX9H 1NEPA 1HWHB 5C6PB 1CLYH 4BYHA 1XF2A 2V2XB 5JZ7C 5HI3C 3Q8EA 3N0PB 2J1YA 3B56A 4P2CG 3W11C 1KEGH 1WCBB 2F19H 5J57B 1GH7A 4KJPC 4QTIH 2AS5M 1D7DA 3RZCB 3VXSA 2FEEI 4O5LL 4C56A 2VW4A 4M6ML 5KEZA 1ZPUA 32C2A 5L4MA 3KL0A 3OKNA 3QXAA 3MUGA 1T0PB 3HI6L 4GAJL 1P5VA 4AQAB 1PD6A 1FVEA 1Z3GL 2P48B 4HU2A 2EDWA 1P0SE 2A83A 5J3HD 2BCKA 3L81A 2CNYA 4IMKA 3WAJA 1QVOA 3FH8A 1SVCP 3UX9B 2BSBA 2Z91B 3SJVB 3HE7D 1H6UA 2D9CA 4A38A 1YNTA 5E2TL 2Q1EA 2ZKXA 1AQHA 3WMQA 5T8IA 5I8CB 5H94A 5LNDA 1R5WA 3LPWA 4ZAKC 4AQEA 1GSKA 3RWHA 4KVCL 1BZQK 4ODBD 4QHMA 4KXCA 1DJSA 3D4CA 3LPFA 4JZJB 2X4NA 4L5FH 4MSWB 3B9KC 3ARGC 5C70A 1IRAY 3B2MA 3L9RA 3PWVA 3ULVL 1RIUH 2EXWD 4FTVB 2C4FT 1K5NB 1UM5H 5EPMA 4PTTB 5LN8A 3QXVA 4X9YA 1ERNA 1A1MB 4J27A 3QFDA 1K4DB 3KXFD 2LGNA 4HPYH 1KDIA 2OMWA 3EYQC 3ZRCC 4OF3A 3M07A 3NIGE 4M1GH 5DEJA 2P5WD 5EIQA 5J9PA 3LEVH 4GQQA 4JRXA 2DMCA 2Y2YA 4TN9A 5E6RB 3RUGE 1BPVA 4IDLA 2VMCA 4P5RA 3D2TA 2E6JA 4DOHE 3VWKB 1DBBH 4E9QA 1ADQH 3DX4A 5CEZH 5DO2D 4NCC2 3CVIL 3PWUB 1U3NA 3QAZC 4HQQL 4TNWF 1HILA 1YEKL 4EBQH 1CQYA 1GZHC 1WBXA 3BC9A 3I84A 4KI5C 1NC2D 4UCFA 5FKPA 5J7CC 3RAJL 4FNQA 3SCMD 2YHGA 4Z5RB 3VD9A 5TDOA 1T2QH 5EZIL 3D85B 3RKPA 4XPFH 2BNRA 4GMSL 2XACC 5EU6A 1E8YA 1SY6A 2AK1H 2RBLA 4JRWA 1A7RH 2PF6A 3DV6A 3KJ6H 4CGUB 1OCWH 4D9LL 5LUMA 3NJJA 4HWBL 5D55A 2V2WA 1D6EA 3ZU8A 1BPLB 2ZXCA 4HZLA 3LEYL 3U0TA 1MXDA 3N44B 4GUPA 4KZ0A 3S96A 3VWJB 1QEWB 4ZX4A 2ITDB 1HEZA 3QG7L 3T6XA 5C6TL 1NL0H 4MMZC 1G6RB 2ALWA 3UZEA 3RI5K 5A16A 1XEDA 1KB3A 3I6KA 4GBXB 1JTOA 1C8PA 1GW6A 4F91B 4NI6A 5M95B 3KLHC 3FRPG 3RVXC 1NCIA 2YN3A 4XP4L 5D7JB 2RJMA 3U36B 4MRBA 3K8KA 5HD8D 3RHWK 5DEFA 4JR9L 3DV4A 2FL5A 4G3YH 5JNYA 4CU7A 1FVCB 1XB6A 2C1OB 4GW4B 2XZCH 2A9MH 4BZ1H 4E36A 2X1OA 1INDL 5GS2D 3O6FC 2ZP9A 2CE6A 5GS1A 4FG6C 2RCSL 5CUSH 1NFDF 1E27B 1NFIB 4EDWH 4PJ7E 4UM8B 3NCWA 1YMMB 1A6ZB 1T0NA 2AXHA 1I8LC 3SKMB 2GIYA 1GGIL 3SZ6A 3HR6A 3U46A 4QMEA 3FSZA 3QQ9D 5BO0D 1U8HB 1DSFL 4MAYA 4XCYB 4NM4H 3VXUE 2GK0B 2IQAA 3AG1B 3CWGA 3T2LA 4X7FC 5HGBB 2VABA 4LEBA 4XBPA 1H0DB 3VGHA 5BJTB 3AREB 1IU1A 3FRUA 3GUFA 2HLAB 4ELME 3BZEA 3CVHH 2AXFA 4WI0A 1A9EA 2F1AA 3OSKA 3JSSA 3CDFA 4IU2A 1M3JA 5D1QA 5I18L 1BYOA 3QORC 1RIHL 4N6QA 5E2VL 5DZNA 4GXUN 2AV1B 4J5VA 3HHSA 3LPPA 2G5BA 3BAKA 1XCQA 1X5LA 4QRPB 4WFFD 2VLKA 3GKZA 2CUIA 4Z0XB 5KS9B 4JN1L 4ENEC 1HNYA 3AM8C 1WAAE 4PJIA 4U1HB 4N1EA 1FFRA 4X7CC 4XCFL 3E8UH 2Q7NA 1MAKA 4JGJA 5BOZG 1GYUA 4FOMA 3NJGA 3BUYB 4HWZA 1AKJB 3MLUH 1NDMA 1JHTB 3FCTB 1HHIA 1XCTA 1M7UA 4UU9A 4YFLI 2H3XC 5DS8B 4L1DA 2I60L 4LDOB 4L9LA 4YZWA 1II4E 4MXQC 2YGPA 2XN9A 4UM9B 3BEVB 5IB2B 1BD2E 2ZP0T 4JHZA 5ERWB 3D3VB 5E8DH 4PIRF 1WIPA 4JM2D 5CNHA 2AHIA 4FMKA 1XF3B 2K4AA 1AGBB 2X1PA 3GTVA 1E2ZA 2PNDA 1G7JA 2KH2B 1HL9A 4QNPE 3WU1A 2NNCA 3CVDA 3ZQXA 5HGHB 1A7NH 5EF0A 4G7SB 1PBYA 2IPUK 3WGUB 5B38B 1CYWA 3MRGB 4PVBA 3BN3B 3OV6A 5CILH 5E2WL 2ENSA 4CC4C 4EZKA 4YHLL 4HH9B 1V3LA 4AIOA 1WF5A 5IT2H 2YXMA 4N8VB 1NGXA 4PWJA 4KY2A 1PS3A 5EN2B 1JPEA 2VUOA 3F64A 3B2XA 4U1KB 2F7IA 2XZAH 5IJVA 1UFUA 4PD4J 2BP0A 4YDKL 5G4NA 5HYJA 4AE0A 1M4KA 3QUMB 1DLFL 1O9WA 1G1KA 1ZLUH 2CHZA 4FYTA 2EDEA 5GXBB 4AY0A 5ICZA 3MACL 3R7RA 4WO4B 1ZLSH 4DKFL 4Z76A 2AK4B 3MRQB 3FO9B 2QVTA 5PCYA 5AQ0A 4BV1A 3BGMA 2Y36L 2FQEA 3POHA 3WNJA 5IROD 4RCAA 5GGSB 1EFXD 2EDXA 4RGNB 2YD3A 2VR4A 1KB5A 2EKSA 3UAAA 3WTSA 5DYOA 4FE9A 2AJ3B 3SE9H 1KYDA 3DVFA 2D3JA 3GEFA 4MS8D 4NWUL 3TO4A 5JQHC 3S88H 3NA9L 4WWKC 5EORL 4H5SB 4WUUD 1CMOA 4AYBA 4ZTEA 4NRXA 3W81A 2VQ1A 4RZCB 1L3NA 3SDYL 4YHOL 3DPBA 3MUZ1 4MMYA 3KWWA 5E6IA 4RSYA 1G5GA 3BP4A 4G9FD 5T5NG 1REIA 1MHHB 3ELQA 3RNQA 5IEKA 2UZYA 3BIKA 4K7FA 3F04A 3GMOA 1T03H 2FH6A 3I50H 4GSUA 5EZJA 1S7RA 3BKCL 1BJMA 5F8RC 4R26H 1JV5A 5DK0B 4F24A 2VISA 5LGHH 3SDXB 2V2XA 3P11L 4CRPA 2VM4A 3KPNA 4URKA 2K78A 2Q20A 3GXFA 3HAEB 5ITBH 2KDGA 3LH2H 4N0FB 1FJ1B 1XF5A 3U9PH 4KRPD 4Z7NB 5JOFB 2R0ZH 3HI5L 3RZCA 1HJBC 5I1DB 3ZYOA 4XMLL 3VI3E 4OGZA 4FFYA 1O7DC 4AQAA 4XX5A 2J7LA 3CNKA 4B9CA 3JQOB 3JWNC 3PAVA 1UB6B 1CBVL 1BG9A 4QI3A 1ZCRA 2X4TB 2BY1A 2KHAA 2EECA 3RJQB 2Z91A 3AADB 3SJVA 2HFGL 3NRFA 2XTJD 4LPUA 4RRPG 3NRQA 3VTTA 3WFCL 3QI9A 2A6IB 2AI0H 4ACTA 1P6FA 5FCUL 3RBSA 4ZW7A 3BLPX 4F9PC 2AJXL 3IMWA 3MDJA 1KIQB 4F58H 5CF3A 2VDOL 4OZFH 1Q1JL 1NAML 5EO0B 5F7NC 4JZJA 4G59C 4R4ND 4K94L 1V5JA 4BFRA 1D9KD 4E2OA 4OGYH 2P5WB 3O3DA 4MCNA 4MSWA 1A3QA 1ZVHA 2ZKYA 1H5BA 2JELH 3CZEA 3DRTB 2ZD0A 1NM4A 1J1OL 4XN9A 4FTVA 4G11A 5TE6H 4HX1B 3C2AH 1X7QB 4EIUA 3BVWA 3HZMB 5I1GH 1QFPA 5EU5A 5JIIA 1OCZB 5KVDH 4HIPA 4Y2OB 4ZXBB 5CHNB 5HI3D 5JZ7D 1K4DA 5AVZB 4BWUA 4NENA 1X5HA 2IBZX 2VC2B 4ETQB 3JBG7 3UYRL 3W11D 4P3WA 2ZSVB 3IF1B 3FCBA 4KJPD 4JRXE 5KOVC 2JB5L 3O4LE 3EYUH 1IBYA 3AAZB 4WW1B 4EN3C 1A22B 1Z9NA 2YQGA 4G7VL 3IFNH 3QJXA 1KENL 5C1MB 3C60B 4CMHC 2XWXA 4LCYA 3ZL2A 1CGWA 2VDRL 3VWKA 4K2UL 2VXVL 1ZA3B 1CGYA 1X9LA 5DJ8B 1UD4A 4MB1A 2FT8A 3STZA 2I25N 4ZMTA 3D0VB 3LRGA 4KTGA 1J5OH 1MJ7L 2W59A 3BAWA 3OPUA 3QYMA 3C87A 1RFDL 2BNRE 2XCMC 3RBGA 4IOFC 1E4KA 4ZAKD 5GPRA 5GS0C 2VDML 3RWJB 5I6XB 4NQDD 3S36L 4BFOA 3ULUF 3BRGC 1G0YR 5DRZB 4F80A 4Q74A 2OMXB 4P46C 3EH3B 4OFYA 2YWYA 5C71A 5JXAH 1S78C 3B9KD 2BOLA 3ARGD 4P9ML 4MNQD 3DJ9A 4RBPK 1NBYA 4UOW1 5JW4M 5H35A 4LEOB 3VGBA 4QRTB 1C16B 2HCZX 4HD5A 2QQQA 3DETC 2MQCA 3VWJA 3E0GA 4U1GC 3BVVA 2ITDA 2B39A 5LQBL 3COOA 3QJSB 1AMYA 1G6RA 3TBCA 1AD0B 3MOQA 5FECA 4JUTA 3EYQD 2Z7UA 1C7SA 1IC7H 2VNCA 3FQRA 3HLKA 4FFZH 1PL3A 1AACA 4KPHH 4KNQA 4QF1A 5L0QB 3UZQB 5KZCB 4BKTC 4R96A 4PGZA 3KBPA 5H2BA 3U36A 1U41A 1ZLDA 4ODSH 1O6SB 3MNMA 4I9WD 5T1DL 1FNGB 3MV9B 4GW4A 3I9GH 5C86A 4NKOB 3WNLA 4EZMA 4LO9A 4WK0B 3KWVA 3AS3A 4M6OH 4AVHA 1HOCB 3L2NA 4PS4H 1L0YA 3OKKB 1PZCA 1F6AB 1E27A 1QSEE 3MQIA 4UM8A 4JQIA 1FC2D 1YMMA 2ICEC 1SJHB 5B8CB 2JK5A 4KI5D 3EDJA 3UTPD 1S7QB 3EH4B 5KSVB 1QW8A 4E9VA 1U8HA 4LGSB 4E42A 3SBQA 1IAKB 4XCYA 5I0WA 4DHLA 5IMMB 4XR8C 4LGPB 2Q6WB 5HP5A 1D5IH 2FECL 5HGBA 2EVHA 1KBVA 2AQ1A 3FTSA 2PTUA 4ENZA 5BJTA 4WU5A 3LQAH 5AAWC 5D1QE 3VQ2C 4G7YL 1A6VH 3QRGL 4KZDH 5D4HA 2HVKB 4UANA 3S36X 3BMWA 2CBTA 4EI5C 5C0FB 4L23A 2AV1A 2FECI 4X7TA 5BUGA 3LS4H 2H6PB 4HT1H 3L3HB 4PJIE 2FB4H 4Z0XA 3RQ3A 5KS9A 3KLHD 3RVXD 3EBAA 3IKCB 4HCGA 4ODWB 4EUPG 1XH3B 3P2BA 1KB9K 2VGLM 1V3KA 2FYYB 3G6JE 4NQCA 4U1HA 3UYPB 2RR3A 4UTAL 3QC6X 2Y69B 3FBQA 1AKJA 3BAEL 1JHTA 3A6OA 4KQ3L 3O6FD 2CDGB 4FG6D 4PRHE 4Z7NF 5F7EL 2GBVA 3DI2B 1IL1A 2V4LA 4DCQA 4F7TB 3FN0H 4X6DA 1NCGA 4RMRA 3TBYB 5ERWA 5G4MA 4K8RH 1EZUA 1YEDB 4ZW8A 3OQRA 4AJVA 2HAZA 1U8LA 2NZIA 4K9EL 4OGQC 5CCHE 2F53A 1JP5A 5DU7A 1AGBA 1U58A 3MPCA 1BVLA 1TITA 5TQ0L 2W95A 5F88B 3I6GB 3QQDA 4PBVC 5F3BA 4WW2B 3N40F 1IKNA 3MRGA 2DLIA 2OSXA 3B37A 4HH9A 4DUVA 4KXZH 3LIZL 3MRCA 2X87A 4J8QA 4N8VA 1EFXB 3QORD 1WEJH 3T2NH 2GTWB 3ESVF 4M4PA 4X5PA 4PV9A 5CBEB 1ZXKA 5EN2A 5TQ2H 4U1KA 1YECL 2P7TB 1BM7A 1I53A 2F8XC 1HZHH 4DPAX 3DLQR 2XPGB 3QUMA 1WSST 4WUUB 4HSQA 1YYLH 3EYVB 4ENED 1EDHA 7CGTA 1Z5HA 5IBUG 4I5BB 1LMKA 3H0TB 5GHWL 2X4UB 3WKML 3NCJL 4JFDE 5ID0B 4G8AC 3GJFA 2AK4A 3GHBH 2LHAA 3GTNA 4G9FB 3VX1A 4HGKC 3ULSB 4FG4A 3V4VH 1CLZH 4MXQD 3LNIA 2R1YB 4N90E 3VRIA 2DIEA 3O2VH 3ETBJ 5FW8A 5I1IH 5FS5A 1CDCA 5C7XH 3SDAC 5CJBA 1RK0B 1QOKA 2ZUYA 4RZCA 5LVEA 1P7HL 1NSNL 2X28A 5BV7B 1WICA 2UZXB 4O9HL 1Z9LA 2UXGA 4F8NA 2Q87A 1XWVA 2OTWB 1Z5YD 4Y1SA 1S7UB 1W72B 3OLGA 4Y5YA 5I6KA 2GQHA 5F7UA 2J8UE 2XWBB 4GRWB 4ONFL 2I07B 2YGQA 2PN5A 4Z7QE 3W5NA 4XX1E 1A7OH 4YQXL 3OG4B 2L3BA 4LP4A 5DK0A 4K71B 3HFML 4PLOB 2FATH 1FLTX 3SDXA 1PZ2A 4RNRB 1AE6H 3BESR 3FUEA 3MLZH 4X4XB 4GI9A 5GRJL 3CU1A 3CZSA 3HAEA 3R1GL 1M3IA 3A6CL 4GAGH 1F2XK 4N0FA 2XTJB 4JVPA 4GG6F 2YK1H 2IQ9L 3P0GB 4G9DB 2J73A 4P3DA 1C08A 2OXHA 4JHBA 5CR1A 4JB9L 1NEZG 4AT6B 5INCA 1M2VB 4WLCA 1WZ1L 1E6OH 1OK8A 2ADFL 3MV7B 4E9TA 2E9IA 5C0EB 1VIWA 3K6SB 5IY5B 3LZOA 1UB6A 4YLBA 2NSQA 1ZTMA 1XGYL 1BF2A 1YSOA 5KSBF 1J05B 3GDCA 2X4TA 2PO6A 4QHNA 2KDYA 4WWKD 1I1YA 4OFQA 2ZE0A 2ID5A 4N20A 1OM9A 4OTXH 3UBFA 3DVIA 4IMLA 3BYYA 3IK2A 1Q8MA 3LQMA 2YQBA 1X3DA 4KDTA 1S9WB 4UMGA 4JEGB 5IM7B 2K3TA 2IFFL 4JHWL 1Y18B 2RQ8A 4UB0L 1E6JL 1AZNA 1L0XA 1NLDH 3EFOA 3G6DL 3BVTA 2CSPA 2J88H 3DRTA 2WTRB 3OX8B 1U30A 4KKZA 4HX1A 1X7QA 3WFBL 1SLWA 3WELA 4LSPH 5IW6B 3D12B 4A7SA 2C9UA 2WIMA 3UIZA 4XMVA 1NLBH 1NUDA 2K4WA 2ZZUT 1A6UH 5AVXB 3LJ3A 3BDYL 2GEEA 2N1KA 3G5ZB 3IF1A 1RAMA 1KT2B 2YBRB 1H3WM 4O02B 4WW1A 4ZAKB 3RX7A 5D6CB 4NQDB 4DO5A 3JYCA 2ZOKB 1RZKH 3C60A 4RFOH 1UG9A 1VHPA 5FR3A 1MQKH 4NNYA 5BXFB 3P9LB 1ZA3A 3B9KB 5DJXA 3OLIA 1D5MB 5DJ8A 3DYMA 1PEWA 1U2HA 1CBJA 4N5EC 2DMKA 2ENPA 1IT9H 2H5UA 2HRHA 3F5WB 5D72H 5HHQB 1B6DA 3UTOA 3GXDA 4JM2F 4P4KA 1UWFA 4WFHE 2WWMC 2BOBB 1KJVA 5FGCB 3PABB 3SKUD 4WU7A 5JIPA 3GSQB 1DEEB 5C0AE 2OMXA 3FFDB 1MZZA 1N18A 4AMKH 1JF1A 1FYHB 1W6WA 2EDOA 3RFZA 1H8OA 3RGVB 1HL5A 5AVUB 1UH4A 1RUKH 4LEOA 4QRTA 3DHPA 1PEZA 1UYWH 2BVQA 2YO3A 4X6BA 3UAFA 1QACA 2F61A 5I30L 1MXGA 4H1LB 4BXSV 4YXHL 1XD1A 1AI1L 4HIXH 1AD0A 5CIPB 2V5TA 3S3JA 4FG2A 4BH7A 3IPBA 2WINB 3TASA 5DFWH 5TD4A 2AABH 2LQRA 4JFYB 4IKIA 5AOIA 3WS6A 4WW2F 5E8OA 2BVTA 3AY2A 4Y9EA 3FQ1A 5D2LA 4N87A 1R0AL 4EN3D 3VQ1C 1O6SA 1FAKT 4ZOCA 3VD3A 1FNGA 3U1SL 3MV9A 4OF6A 1V10A 3VGFA 1DEDA 1TXKA 1NKGA 3VSVA 2ZF9A 1BBDH 1DJIA 4WFED 3L3OC 1IAOB 3OKKA 5CFHA 2JJWA 1X5KA 5C0CA 5B8CA 1QO3B 4ZS7L 5AZEL 4KKBC 3VB8A 3CLEH 5IVXE 4I8DA 1DQML 1S7QA 4N0RA 1LK3H 1IGIL 5F9DC 4J3TA 4IOFD 3VFMA 5D5ME 3HPJB 1MIEL 3D52A 5GS0D 3G5VB 4NKDA 3VW3H 4H0GA 1F00I 4P46D 5DVNA 5C3LD 4Z7VA 1G6RL 5IMMA 1HWGB 4F8TA 1S78D 3GK8H 4UQ3B 4DQOL 1JZ7A 3VJ6B 4PLJC 1G1YA 4UQCA 1PX3A 2R2HB 3CDZB 1RJYB 2FO1A 1IC0A 3DETD 1GJIA 4BCZA 5C8JA 2HVKA 2QPDB 3QCTL 2GVYA 3WFHB 3O6FB 3QIBC 1HEJC 5T3XL 5C0FA 4UAOB 5JW5B 1MJUH 4XPGH 5EUKA 3T09A 1DQDH 3CBJB 5EZLA 1TYEB 1G9MH 2H6PA 5L9DL 1W8NA 1JNLH 1EO5A 3ZDXB 1D2PA 1L3WA 4GRWF 2J6EH 4ODWA 3HNTL 3S9DB 3GBNL 1KN4L 4JKPH 1USZA 3MRKA 1MCNA 4AYEC 3V79C 3P3YA 1RMFH 3CZNA 2J4WH 4AZ8A 5DWUH 3J27A 3GNMH 4XMPL 3F7VA 2EDFA 2DDQH 3DXAA 2CDGA 2BIHA 4UT9H 4XMZA 5H37H 3ARWA 3W82A 4UT7L 2CO4A 4F7TA 4AE1A 4XVTL 5EMYA 4ALAH 4GXFA 1B9KA 3TBYA 3HUJB 4HBCL 4K4KA 5CS7A 1GGYA 3PJNA 3ZVVA 2QHLA 2F53E 2VLJE 1S8DB 3K72B 4JLRB 6FABL 5FOJA 1TO5A 1UA6L 3MRNA 3TV3H 3KLQA 1TJGH 2DOCA 2F5BL 1CPUA 2CBOA 2NY6C 3DOIA 3US1A 4HMCA 4D94A 1FIGH 2ZXEB 2WKOF 1T6BX 3WEMA 1G84A 1X5JA 3US0A 2LLGA 3E1ZA 3RPKA 4F37K 5DZOA 4DN3L 1H3XA 4B9IA 1L6PA 2J43A 1WZKA 2Q8AH 4EI5D 3W1ZA 5EA0H 1NIFA 1ID5I 2DLHA 1E3FA 5L7XH 2O1AA 1UFGA 2KKQA 1J0KA 2P7TA 1Y07A 1TVHB 1QRNE 3MGTA 3CFNA 3U2JA 3VXME 2ENJA 4L8SA 5JQ6L 2XPGA 1DSYA 3KPQA 3EYVA 5CEZD 5L4FA 5HGAB 3HMWH 5GRVL 3H0TA 3O2WH 5LN4A 4XCNB 2IPTL 4RA3A 4XPBH 2VAJA 4ZMNA 3HG5A 1YMHA 3ULSA 1E8ZA 4OCXL 2C4XA 4P9HH 1DANU 5ABZA 5JIHA 1ANUA 1JCKA 2IAND 3OKDB 1S7SB 2F7QA 3L7FB 2PWHA 4WHTB 3GI8H 1OSEA 5CLTA 4D7PA 4LRIA 4C4KO 4OZGB 4GUQA 1QMUA 3UADA 4ANXA 1NDGA 1RK0A 4NWTH 5BVJB 2NTFB 1TOXA 3MNWB 3LQAC 4NBZB 3T6ZA 2UZXA 1V7ML 1JMXA 1C5CL 1MCCA 4BE5A 1KIRA 4KXAA 2I24N 4PGCB 1BF5A 1S7UA 4Z7OE 4FFVC 1A21A 1A1NA 3QUML 1WDAA 2XWBA 2JJTA 3U4EB 3WIIL 2I07A 3ZL4H 2XKSA 3MOAH 2QGDA 3Q5OA 2GTZB 3QEGL 4NO5B 3UJTL 1H6EA 3BO8A 5T33H 4J8RA 5DRNB 1QRKA 1BGXH 3DOSB 2EIJB 4PR5B 1YAZA 4DFHA 4RNRA 2NNFA 4X4XA 1ZTXH 4JFQB 3OC8A 2F9BT 2QQKH 4U0RC 2QELA 5FAAA 3BH4A 4M3KB 2VZOA 4CMMA 3JV4B 1KTKE 3TXAA 1J86A 4G9DA 4JFHE 4F92B 1XH1A 1EEZB 1DBMH 2WJ7A 4I4WB 3REWA 1ZMYA 4W9DC 4JM4H 3MV8D 5E00B 4AT6A 4N8CH 2SEBA 3QT2A 4UQ2B 5A7EA 4XNYL 3B7RL 2PYFB 3MV7A 3EYOA 2JCCE 1UCBL 4JY5L 4IRSA 3HG1B 4QRRE 3GSVA 2BINA 1PZDA 2P46B 1JPGA 1MHCA 3CDYA 4KI5F 4RFEA 4FL4C 3WNOA 4MCMA 5E8PA 3V9FA 3IDYB 4HOXA 4QHUA 3TV8A 3LRHA 4PGDB 1KXTA 4PAZA 4M48H 1FDLH 2M2DA 4K5LA 2QV4A 4X5RA 5C07E 5FIEA 3SDAD 1A65A 1L5GB 5IVZB 4YS4A 4ZUSB 3WIFB 3VRJB 3WMSA 1EX0A 9CGTA 4UDUB 4H8QA 1S9WA 2DLFH 2HG5B 1V8HA 4XNQB 3BVUA 5IM7A 1EJFA 3OLEA 2A5UA 2DTMH 3GXUB 1CICA 2Z8VC 3MRPB 4AEEA 1DVZA 1VLXA 2OMZA 3OX8A 1XF4B 3BFWA 4GS7C 2JJSA 4Z77B 5EUOB 1JHKL 1U21A 5CLXA 1T83C 1N6UA 5AENA 3P0YH 4K3DL 4ZFGH 1UH3A 1MFAH 1N0XH 4YOKA 3HCVA 3P73B 4GAFB 5I66B 2F1BA 2CUHA 4KKAC 3DTXB 3VDCA 3SQOH 3PJSB 1UZ6E 4E5XA 1B2YA 5K33A 3G5ZA 5KUMA 4G8EA 4HJJL 3IPFA 2R83A 1CFNB 5K69A 3NIFF 4J3BA 4W9CC 1BW8A 3CZUB 1VFAA 4YXKL 4LSSL 1VDGA 5DUBA 5D6CA 2N56A 2W65A 4MJ5B 2ZOKA 3B2UC 3QR1A 3SOBH 2A1WL 3VMOA 5I1KH 4J2XA 1WISA 2MPVA 2O5YL 3QDGE 1AY1L 3P9MB 4PJXA 3MJ8B 3HE6C 3ZDXF 1EV2E 5DJDB 3EGSB 4YDLC 3T1WA 4KO7A 4HUVB 3QXWA 1NBCA 5ESQB 4YUEH 5HHQA 4NQSB 2TSBA 3DYOA 1NCNA 5E4EB 4A39A 1KGJA 1SDYA 2BOBA 2WQUA 5J1TC 4AC2A 2EUXA 5JW4N 4D7BA 1W16A 4KOCA 2AJUL 3CFEA 3FFDA 3MBXH 4HETA 2YN5A 5SV4A 2R29H 2FHCA 2VC2L 3RGVA 4ZPVB 4EN3B 2R69A 3WXWL 4ZO6A 2YGVA 3A4FA 3FU9A 3HUJF 3FFCD 3DX7B 4JDVB 3WUWG 4CMHB 2CLZB 5LBSA 1JXFA 1NCAL 4GKLA 1N4XH 2Z1KA 2MJWA 4FCAA 4NNPH 3LYRA 3VFWB 4Z3FA 4ZD3H 4Z7UA 2P5EB 4MDIB 3DTDA 4DP8X 5CIPA 1RUQL 1N7MH 4LCWE 4IQHA 2ESVE 2WINA 1NH6A 2J25A 1MCWW 2EIZB 4IIQB 1WBZB 2J12B 4LKXB 3V8OA 5D2LE 2H1PH 5E56A 5JPMA 4HXBL 4DGYH 1CR9L 1RZGA 2C3GA 2E7CA 5E1QA 4KO9A 3BKYH 4Y0GA 3DJSA 3INOA 5EU7C 1PSKH 4RBPH 3ABMB 2EDDA 2GUOB 4P46B 4C83B 1DJGA 3EO9L 2FQGA 1ADWA 1MFBH 2K9FB 3NGBC 5F1KC 5BVPL 4LBEA 2E75C 1IAOA 4N5ED 3OF6D 1BFVH 5F21B 5GRUL 3NZ8A 3U2SA 2OYMA 5AW4B 2WXRA 4ZUVA 5E5RB 1KG0B 1QO3A 1QBMH 1M1SA 1ZSDA 4ODTL 3V0HA 3U0WL 1P4IL 3F12A 1BAGA 1ES0B 2WWMD 3H7BB 4DP1X 4JKKA 1F97A 3WG7B 4H0IA 2DQEH 4Z7VE 3LN9A 5EBGA 3G5VA 2YRLA 2BM3A 5JIDA 4OZ4A 1GGCL 4O51B 2YPKA 4PJ5A 2IALA 3IDXL 2VZ3A 1E4WH 1AS8A 1TZIB 4UQ3A 3VJ6A 4ZMPA 1GKEA 2R2HA 1HHGB 2ISDA 3ZTJG 3UBXG 1RJYA 2CIIB 5DHEA 2G3XA 3WFHA 2FT7A 4TQIA 3FTUA 1IGMH 1YJDH 1ZK9A 5ANHA 4ZUTB 5D7KE 2VL5B 4BWWA 3NFSL 5CAYB 3N04A 2ICEB 2XQBL 3ZRSA 5I1LA 1AZRA 3MYZA 1RZKC 2HZHA 3GHEH 4JPWH 2W9EL 2MCPH 4ERSH 2Z0UA 1ZHLB 4B0MM 1OB0A 4D0BA 4M8RA 4V1DE 4TUKH 2PMZA 3LRLA 4X5WB 1KGCD 3DXAE 4TUOA 4HAFA 1JGLH 1SJEB 4RAHA 3QWRD 5B3JF 1NINA 3VMPA 1IGCH 1CFSA 3DUHA 4ZOAA 1SM3L 1D5BB 3RURA 4MD0B 2VZ1A 4FNPA 2XETA 3HG4A 4YHIB 5JHDD 3N6YA 4Z3HA 5FDWB 1IGYB 5GSRB 1KJ2L 3NK4A 5DS2A 4KKBD 1J5CA 1KWKA 4GUOA 1OGAD 1UOVA 4EI5B 4I9XA 1KCRH 2WQXA 3DGGB 3K72A 4JLRA 3H9ZA 4NO0D 2NYYC 2C3WA 3PP4H 2YKLH 4TNGA 4CSPA 5J6HA 3DIDA 1L7IL 3KYNB 1MAJA 3FRPA 3L5IA 3MRRB 1RK1A 1QSFD 4O58L 4RX4A 4M3HA 4M00A 2BSSB 5C6WH 4GEIA 2WLYA 4PLJD 2W60A 1BIIB 3VM5A 1TVDA 3HLAB 2WOBA 4GXVL 1EJ6A 1GCFA 1YLBB 3I2CH 3VU2A 3D50A 5KYWB 1MLCB 2PW1B 3BDBA 4FXGB 4J3OC 5AAMC 4DETA 3QIBD 2PYED 1TTFA 1TJHH 5PAZA 2FJSA 3P4NA 5LG6A 3BJ91 3BPCA 2VZVA 1DYZA 1FYTD 2WMPB 4YVNA 5FA4B 1TVHA 4NGHL 3PXJA 2FGWL 1MREL 5TDPA 5HDBB 5T1MB 2CU9A 1M1XB 2D7TH 2IG2H 4FQQB 4MMXB 4XN1A 4I0PB 2X09A 4J3XA 1YEWA 5F1SA 2CJ3A 4JRYE 5EUOF 3I9IA 3T8VA 3OJ2C 4Y7MA 4XCNA 4WK2B 5CU9A 4Z95L 4HSAC 4FFWC 1WWWX 1UVQA 1MCRA 4YO0B 3OKDA 1S7SA 3L7FA 4LVEA 3ZHKA 4L4TD 4TF4A 3MKGA 4PUBH 2UXFA 4BDVA 3LN4A 1OAQH 5D1XC 1FC1A 3FUDA 4QRUA 2D3NA 4OZGA 4AEIL 4OB5H 4X5LA 5DJ2B 5BVJA 2F58L 1OARL 1S3KL 3MNWA 4J3SA 4RQQB 3ZKQD 3L1FA 1ZXQA 2NY6D 5MHSD 4MCZB 4BA0A 3CXHJ 2QMKA 1E5ZA 1PPIA 2MKLC 2V5SA 4LLQB 4R0LA 4DTGL 1IAIL 2DQUH 4BGLA 3SGDH 4JO2L 1G9MC 1FG2A 2VL4A 4RGMC 1I9EA 3C8HA 4NO5A 2GTZA 4P5TC 4RAVA 4W6XB 4PR5A 3B8SA 2B59B 4MD5B 4IGBC 1ASPA 4YC2C 4JFQA 1IAII 7FABH 2OKMA 1XBDA 1EHLL 1DQVA 3JV4A 5JR1L 4Q9RH 2X4QB 3RP1A 3CFIC 5T3ZL 3NOIA 1KYOJ 3SB3A 3CVHB 5E00A 1QFWL 4NQUA 4EPSA 4ALAC 2PYFA 3FQTA 4OV5B 3WO4B 4NKMB 4PGBB 1CL7I 3UO8B 3M88A 3HG1A 1YO4A 3MYJB 4UNTA 4AM0A 5C2BL 3B9AA 5ISZD 3NT0A 5FYLE 2DQDL 3TNMB 2LE9A 3QK0A 4D9RE 1RZ8B 4BZ2L 1HXMB 2EE2A 2ADGA 2R2EA 3KVQA 1QFWI 1W72L 5DDHB 3HC4H 3RG1C 1F1AA 4L3EE 5HHVL 5DTFA 1I3UA 1L5GA 5IVZA 2EIKB 3VRJA 3LZPA 4UDUA 1OO2A 3L5WB 1MI5E 1BFOB 5IBUB 5E4IA 2J1WA 4TSAL 4ZSOB 1CU4L 2BVPA 3ATAA 4NIYE 2DQCH 1WS7A 1CDJA 2WYIA 3GZKA 4FFVD 2VR5A 3QP3A 2MOVA 4P59L 2IH3B 1SOKA 2XFGB 3PPEA 1NBVL 1XF4A 3FQWB 4ONGH 4P2OC 1JGUL 1EFQA 1MRDL 1NOLA 2XV0A 4E9RA 4Y1AE 1IGTB 2XRAH 3OWRA 3IFLH 5HGGS 1Q9KA 1OAJA 3QJVB 4K9JA 5I66A 4FI7A 4JMXA 4I3RL 4M6MH 3L7EB 5D2NC 1B4RA 4XCCL 3UTSD 3HI6H 2R8SH 4GAJH 2YAEA 3CQFA 1FZKB 4P9HC 4YHNB 1G7PA 4OCRH 4XN4A 3NESA 5DGRA 1HH6A 5CGMA 2AJVL 3VGAC 4OIAA 1CF8L 1R5VB 3ILPB 4MX7B 3BZDA 5EBMB 1BWMA 5EOTB 3HN5A 3P9MA 2FJGB 5E2TH 3IWVA 4M8QB 2VXQA 4HUVA 3PUUA 2FJFB 3LXCA 1DQKA 3U1PA 4WTZG 4P3CL 2UVEA 4FQIH 3IAPA 1A3RL 4KUCF 4PMEA 2KPWA 4NZTL 2GJ6D 1UEMA 1XFPA 5AALA 2LTQC 3WD5H 1A6TA 5E2JA 3QZWG 2HKFH 3VFVB 1MF2L 4CVZA 2ZG1A 2EDMA 5CMAA 5C08A 4ZPVA 1U8NB 3ML9A 1ORSB 3HRZC 1C8QA 4ZMLA 1UM6L 3DX7A 4JDVA 2Q9OA 3FOMB 4Z7UE 2VJXA 5FM8A 3D05A 3PU7A 4NDMB 4O02L 5HJBA 1KEMH 3FB6B 3OZ9H 5F44A 2P5EA 3RJDA 4MDIA 1FL5B 4N24A 3MJ9H 5LO7A 4JN2A 4KKAD 4LKXA 5TPWH 4XO8A 2EIZA 4IIQA 1F45A 1U93B 1WBZA 1Z2KA 1G7LB 1D5ZA 3B43A 4Q89A 4H26A 2D8KA 3NZHH 2K0RA 1MCJA 1BM3L 2EYTB 2R0KH 1XR8B 4QUOA 3SGKC 1YEIH 2PR4H 4JO4H 4NQEB 1MG3C 4HA1A 1SFHA 3B2UD 3S97C 2UWEB 3WTUA 3D18B 2WLIB 3J2PA 3MRHB 4XPTH 3BPLB 3HE6D 2IWFA 5KBDA 4XXCA 2A74B 2ZXGA 1AZUA 5I8KL 5ITBL 3CUPA 1BQLL 1BHGA 1OAYL 1SXSA 3H2PA 5JW4R 3FO0L 1T7ZA 4POYA 1JZJA 4YIQB 3NJHA 1KTRL 1ES0A 1ZT1A 3H7BA 4LCIH 5DYFA 5D7IB 5ACZA 1MWOA 3E3QC 3VI4E 1BZDA 3PY9A 5LBSL 1VPOH 4PJ5E 4F7CB 5C0IA 1IE4A 2FIRT 1X4YA 2V9QA 1YEFH 2BHFA 5F93C 1NM9A 1TJMA 1TZIA 4NZFA 1R3IL 2IJ0C 3QG7H 2C3HA 2AC0A 4F5CA 1HHGA 3L5XH 5J1SC 2OI9C 3D9AL 3M1BA 3QEUA 2CIIA 4FNLL 4KJYB 2PP8A 3O2DL 2OSLB 1TVBB 4ANUA 2YPLD 3LDBB 2QKIA 12E8H 4ZUTA 4PRPE 5A2CA 1OP9A 2YEVB 3AUWB 3BRFA 3VNYA 3B5GA 4K07A 1AZCA 4JR9H 4OZFB 3BP6B 4GQ9H 5LXVA 4GKZB 1OGAB 3BT2L 2QFRA 5MI0B 2UV3A 1J1XH 1EGJL 2OLDA 4X6CB 2YGOA 1ZHLA 2VSCA 5B21A 2RHEA 4X5WA 2AJSL 3RVUC 3T6QC 1QSFB 1SJEA 4XC1H 2WW8A 3VXPA 3WE6B 2HRLA 4A7GF 2X4SA 1TKWB 2NW3B 4BFIA 4MD0A 1DJWA 4YHIA 3V9CA 5FDWA 1IGYA 3ATBA 4UNVA 3TEZA 1YNKL 2ZPKL 4OZHA 1FNSL 3QIBB 2PYEB 4A63A 3DGGA 3R06B 3TBVB 4DEPC 1VFBB 1WTGT 2KERA 4LCCA 2FX8L 3KS0H 4WY7H 4ZPTB 1ZLVK 1FYTB 2DB8A 3RWCA 1GTFA 1KBPA 3H3PL 4RMSA 3MRRA 2NZ9C 3JVFC 2DBLL 7FABL 1SEQL 2H4EA 3BISA 4QOKD 1G7MA 2BSSA 2CK2A 5C09E 3ILEA 4HXAH 1BIIA 1EK3A 4P2QB 3BVNB 3SDCC 3T2OA 3ZO0A 5KYXB 1JVKA 2M83A 1MLCA 3HNVL 3KBHE 4FXGA 1F11A 5JDJA 2Q8BH 4C4BA 2G2PA 5E9DA 4PVLA 4FQJL 2WMPA 2AQ2A 1EEQA 2YEQA 1U95B 4L4TB 4OBRA 4PJ9C 5FA4A 3V0EA 2EEXA 1OP5K 4L8CB 1K6QH 5T1MA 1M1XA 3T0DA 3UJJH 2BNUB 2UZIH 4FQQA 4MMXA 1NKOA 4KKPA 2I85A 4I0PA 4PGJA 1AOZA 4TS6A 4HCRA 1EPFA 1R34A 4G71B 5AYUL 2NY6B 2ICWB 4F33B 2QGBA 3SGJA 2ERJC 3FCGA 4XCEB 3M7OA 1JNNH 3WIHH 1S9VB 4YO0A 2YZ8A 3DX8B 5JW3L 4X7DC 3KW8A 2PCPB 4M9OA 3T71A 1IM9D 4P57B 1A8JH 1DJZA 1A25A 3QHFL 3TWCH 4PI0A 4W9IC 3EFDH 5FKAB 2ZOLA 2NYYD 3LKQB 4LU5L 5CEYB 5DQJB 4JE0A 4J39A 4EUPA 3VTMA 1CZ8H 3DX3A 2WXKA 4MCZA 3QFJD 3F8UB 4LPYA 2OMUB 2L7QA 1CI3M 2WWKO 4XAWL 5I26A 3WUZA 1DJHA 1J8HD 1YJDC 2ZT9C 5JXEA 3IU3B 3MLWH 5CU5A 5C0BB 5F0JB 5F72S 1GZQA 5F0MB 4Q0XH 2VXUH 3AG3B 4J3OD 4YDKH 4LMQI 2LAAA 2FSDA 4DVRH 2CDEB 5ISZB 1FGNH 4NUQA 1OAKL 2B59A 4XNXL 4L4VD 3MO1B 4A2LA 5TF1H 2JXMB 1C1EH 3QQ3A 5ALCL 4DKFH 3GZOA 3TURA 4F2ME 3WLWC 2C9AA 2XXCB 5E2UL 4LLYB 2X4QA 1FGVH 2Y36H 3UTQA 1T7YA 4TQEL 5E95B 2RIKA 2OA9A 2Y7OA 3CVHA 3T3MF 5KSUA 2BLFA 5BW7A 1A4JB 4TOYL 2BWQA 4FFWD 5E9NA 3FTWA 2CGRL 3ZDYF 3GPEA 3U6RB 1VGKB 1AXIB 4XBGB 1DUYA 3GJFK 2R0WL 3S34L 4NXKA 1NGQH 1QR1B 2Z35B 1CE6B 1RZ8A 1WGVA 4OLUH 1HXMA 4YHOH 3BAXA 5D1XD 4UNIA 4NT6B 3PGDB 4N8PA 3UP1A 5GGQL 4TPRL 4CVWA 1BXAA 3MUHL 4YXLL 5JQIB 5AWNL 4FABL 4NAJA 4R90L 3WAKA 1I7TA 4RWYH 4G82A 3GMMA 3L5WA 2V33A 1BFOA 4S1SH 3IMTA 3PP3H 3UTSB 2VR3A 2X38A 3QDJB 1EBAA 4P04A 5KYYB 3L3JB 2EUZA 2GI7A 2KLRA 3CN4A 4TSBL 1JZGA 2IH3A 1ZY9A 1JWSB 1VFOA 3P11H 3PDOB 1MPAH 2YMXH 3Q8AA 4NFCA 4EJ1C 4P5TD 5D7IF 1F4YL 3GBML 2N3JA 5LJYH 1AH1A 5IHHA 1IGTA 2VAAB 4IGBD 2YJLA 2GY5A 4FL4B 4LL1A 2GAZA 1WBYA 4KRLB 4NJAL 2XI9A 5L2KD 1DCLA 1MJ8H 1U3HC 3FU3A 5F6IB 5DD3H 3BKJL 1RZFH 2VR8A 3M45A 4G6JH 5KAQF 3VFTA 4XBEH 4X4MA 4JO5A 5F7MC 2WLNA 2RH0A 4IBQA 1ODUA 1R5VA 5EF1A 2OZ4A 3M46A 5FV1L 4H4NA 2WYZA 5EBMA 5IMKB 5LKNA 2IC2A 5E4AA 3VXQB 1UUSA 2EE6A 4GUCA 4R8WL 4M8QA 1FF5A 4TLTA 4YE4L 2EH7L 1AHWA 5FCUH 1MFEL 5T5NF 5CZXC 1NIBA 4GS7B 4ISVA 2F8IA 4X6CF 5D7LD 3VXRE 2VN3A 3AQYA 3QEHA 4OSUL 1Q1JH 4LASH 3QDME 3VGEA 5HI5C 3K2UL 4QAWA 5F9AC 3WEBA 4GP8B 1H3GA 5I1JH 4AYFA 2OMTB 2CUMA 5DHYB 2DMHA 1PLCA 5C08E 4Y19A 2WLKA 3K7UA 1YN6B 4LCVA 4UZUA 3V4VB 4N0YL 3D25A 4PG9A 3D30A 5ADPL 1NCCH 3OR7A 4B9KC 3TOPA 3KWUA 1ORSA 4WGVB 2A6KB 1T7XA 1T04B 4P2OD 4WUKL 4DKDC 1TQBB 4NDMA 1GGBL 2X89A 4EOWH 3HE6B 1JZHA 4DP4X 4YDLB 1FL5A 4FLSA 1Q0XL 2KT6A 3GLDA 3STLB 1HCZA 3FKUS 2X6VA 1U93A 5AKTA 5L2JB 3S48A 3EH1A 5ILTL 1TYRA 4FMFA 1HINH 2VM9A 2WBXA 3HC0B 1WV7T 1S46A 4KKQA 5HPOA 2DLEA 2EYTA 2VERA 4LSRH 4WNJA 3WYRA 4NQEA 3IJEB 4OGAC 4Q8BA 1ED3B 3BSZA 4FNSA 2JE8A 3K2IA 4GNKB 2UWEA 1F3DH 2WP3T 3LZFH 4N5UA 1GHFH 2C26A 2A74A 4XNUL 4QT5B 1ACYL 2VDNH 1A7PL 3CIQA 1KYAA 4S11A 5BRZE 2AJZA 4NN5C 1JK8B 5DVMA 1HAWA 3KPSB 4JPVL 3T2QA 5A43C 2DAVA 4D8PA 1QLFA 1YPZF 1F3RB 3GFUA 2IH1B 1GMIA 1WQVT 2YPLB 3JZYA 5KBNC 3C5XA 1G5AA 3MREA 4GKSB 1UOLA 4HPOL 4NC1E 3LEXB 1EZVX 2WBWB 2F54A 4E41E 5E23A 3AT9A 3PHOB 4GRMB 3ZDZF 4F5CE 1KPRB 2JLPA 2J8OA 1DVYA 2ZWNA 2AQSA 3S6CA 3T8MA 4KJYA 5KVGL 4PRAB 1FPTL 2HUEA 2E86A 3NGBB 4X9HA 5GS0L 4QTFA 2B1HL 4KJWC 5HDLA 3SQBA 3V6OA 2FX9L 3KLKA 2ZOWA 4KK8C 4B95C 4WI8A 1CLYL 4HVBA 3BP6A 3ECBA 5AUMB 4W81A 3N2JA 3K46A 3RZWA 3NJLA 1G4RA 3CHRA 1KEGL 2F19L 4N4YB 1XIWB 1QX1A 4PRIA 4JFPB 3FT4B 4QTIL 1SY6H 4P49A 1NFDE 4QEGA 1JYNA 4I1PA 3HBGA 4BHUA 1MFMA 3CD4A 1B4JH 2NW3A 3T0EC 2I26N 3B5HA 2NY4B 4FLHA 3ULVC 4XNBA 4M7JH 3L4XA 2X4RA 1MW2A 4MZIA 4FHKA 4XP5H 5H4YA 2OTUB 4M8UA 3RIFK 2PCYA 1T2JA 3S3DB 3HHRB 4KDVA 3TBVA 5B4MC 1VFBA 3SE4C 4DGIH 3GT6A 1MFNA 4PG2A 1IJNA 2Y6SC 1AO7A 5EEVA 3AFLA 4BFKA 3L9BA 1ACCA 3LRSA 3GSWB 3S3SA 3P0VL 3ETSA 4MQ7A 3BWUC 4NSKA 2NXZC 4P2QA 3HG3A 2ZNWA 5BO1H 4HGMA 4L5FL 5J12C 3RX9A 3ZTEA 1UHVA 3TJEH 4AXWB 1RIUL 4L18A 2HTKC 4YJZL 1UM5L 4OLYH 2IFGA 3VRLE 3CPLB 4OQ1A 1J8SA 3L4ZA 4PS3A 2IOMA 1G87A 4LHUG 3VYNA 3GS4A 4HPYL 4PM1A 4QY8B 3U9WA 5F1IB 2HKHH 4NC2B 2H6UA 4UUJB 4M1GL 2R2BB 3EOBB 3GMRB 1MKFA 3B4NA 3ALPA 3RVUD 2ICWA 3QFJB 5DMKB 5LHDA 2EDYA 2ZAIA 4Y5VC 2ODIA 4FMVA 3NIDB 3EDFA 2JKNA 3OR6A 1RZIA 3LEVL 4XOEA 2E7DA 2WXQA 1J8HB 3HE7A 1MHPH 1PDKB 4PJBB 2DQMA 3C9NB 2VZTA 3H9SD 1DBBL 4U05A 3KJ4B 2PCPA 3ALXA 1ADQL 3QA3A 1J5HA 2VDQB 4P57A 3S3PA 1WT5A 1KMGA 2Y72A 4LIQH 2K7PA 2HLEB 2NR6A 4DK6A 2K6YA 3H6AA 4X8JA 4EBQL 2EVIA 5CEYA 2BVUA 4JFED 3T0XA 1U8PA 2DKUA 4HKZA 2WO3B 4RGOH 3FHAA 2NZ9D 5E4OA 2XG5A 4HS6A 2WZ0A 3SY0B 2BNQB 4XXDA 4U3SA 1FH5H 1T2QL 2OMUA 2VZUA 2VN6A 4XPFL 3PQYB 2ZCZA 2JKLA 1RZPA 4J4PA 2AK1L 4JM0A 4MZRA 3IU3A 2WXGA 5C0BA 3SDCD 1A7RL 1OL0A 3KJ6L 1OCWL 4XNDA 1K4CA 4ZYKB 3KXFA 5BS0B 3P77A 4WVRA 1NC4D 1MOEA 3ASOB 2YAOA 3VX0A 2CDEA 4M4RB 2DQGH 3GBEA 4C4UA 5EWIH 2JXMA 3F00A 4PJ9D 4XI5C 1NL0L 5D1XB 3WKMH 4OIIH 3ISWA 5DI8B 2AAVA 2WCPA 3WGVB 3RWIA 4Y4HC 3MA7B 4HK0B 4TRPH 2DICA 2G2RA 2LFEA 4LNVA 3L95A 3WJJC 1A4JA 4J28A 3SYCA 3IGFA 4ZFOB 1BVZA 4NO3A 2QZQA 3QNXB 3U6RA 2QEJA 1GC1H 1N59B 2B7DT 4G3YL 3IVKA 2YSTA 1ZS2A 2XZCL 2A9ML 3PPSA 1QR1A 4BZ1L 3MX0A 4RGMB 1A4CA 1NSNH 4AVKA 2MQGA 3ZKMC 3QDHA 4NT6A 3PGDA 2IOOA 2CA3A 5F71A 3QH3A 4YHKH 4EDWL 2DI8A 4JG1H 1S5IL 3EZJB 3TH3T 4UQEA 3FONA 3O11B 3DDGA 3SO3B 4YC2B 3TBWB 5JTWA 3H9YA 3ZE2B 3IDGB 5KAQG 2FEJA 3GMLA 5L2KB 5I1HH 5KYYA 4H88H 2WN2A 3QDJA 4WDIA 1M57B 3RY6C 4NM4L 1JNHB 1MELA 5I76B 2ROYA 5EO9A 4X9GA 3D39E 1UOWA 3HN8A 4J3UA 1VZIA 4LAQH 4MCYB 5J6SA 3PDOA 4K3HA 5GRJH 1JDAA 2EO7A 3FF7A 2B77A 3GSOB 3CVHL 1KB5H 2Y7QB 1SLVA 4GP5B 2VAAA 4FQ2H 5JLZB 4Y16C 1CFMA 1WZMA 3OVUB 4L2LA 1AD9B 3ZKNC 3UG3A 3WLWD 2Y1YA 3QPXH 1UWXH 1PQZB 5HHOB 5KW9H 4AZUA 3CSFA 1HCYA 2FR4B 1YUHB 5AB0A 3BE1H 5ECJE 3N3EA 1QD0A 3QNZA 3L4CA 3L54A 3WS3B 4KX8A 3KEHA 3D4ZA 1A4KA 4W9ZA 5IMKA 3E8UL 2EIDA 3VXQA 3MLUL 3FO1B 4G1EB 3MNVA 4M29A 5KYUA 2PCFB 3CMOH 3FTZA 4NKQB 4F15C 4KAQH 4MD4A 1R3LA 4IJ3C 15C8H 3Q6GH 4Y9GA 1X6LA 2DM3A 2G30A 4CU8A 4Y19E 1GR7A 4HJEA 3G6DH 3KPPA 4LFHD 1J9RA 1MLBB 1SBSH 4UMSA 5E8DL 3R7QA 3ZGHA 3QHZH 4G8IB 2QQLH 4EQ3A 1E43A 2A4EA 5EO1A 3UTTA 3TO2B 3V4VA 3OTTA 5GJTL 3OXSB 4DEUA 4NN6C 3LPOA 1KCVH 1DVSA 4QWWC 2YAQA 4FFYH 3FO2B 2LU4A 1A7NL 1T4WA 1X6NA 3F6LA 3D1MC 4PWKA 2R1XB 3KPLA 1MDAA 4ZX5A 2YEZB 1UOKA 5CILL 4PYGA 1SZNA 3TCTA 5I28A 2GYSA 3GXPA 5IT2L 3M7FB 4HLJA 2WXPA 1KTLA 1LLAA 1U3HD 3NDYE 3O8XA 4JFFD 3IMBA 3X14B 2NT1A 3HC0A 4JMNA 5HHPB 2XZAL 5AYTA 2C3VB 2K7QA 3IJEA 1S9YB 4FXTA 5SWZD 1IQWH 1ED3A 3SN6N 4PCTA 3S0PA 3VACA 5KANG 1ZLSL 2Z7WA 1OGPA 5L8LB 1TUPA 4AL8L 1J5IA 1I9IH 2AGJH 4QT5A 5CZXD 3FQYA 3OC5A 5KUKA 1JK8A 3O4OC 3KPSA 4IJTA 4WQOA 4BSVA 1ZK5A 2PPFA 5FUZH 3SE9L 3ULUE 3O45B 3SDDA 1E4JA 5AOMA 3S88L 1QBAA 2F54E 5HI5D 5JHLA 1JZ3A 3NIDF 4G70B 5C0GA 3LEXA 2APSA 5BOJA 3D09A 4I3SH 3MNZA 4PJBF 3QUXB 2KUTA 3D3VE 3L4UA 3PHOA 4GRMA 5F89B 5IB3A 2NW2A 2VLRB 2HP4A 5IJDC 4YXHH 2H8PB 1QI4A 2EIMB 1BOGA 2FLMA 3SKJH 4YSDA 1M71A 1KPVB 3TN0B 1KACB 4WWNA 4PRAA 4PBWD 3EYSH 2MQ0A 3MC0A 1T03L 3LAFA 3BVDB 2CKBA 3V6OE 3RGBA 4RMQA 4A7QA 3I50L 4FJ6A 1QQDB 3AG2B 4R26L 4NPKA 3LQZB 4X98B 5LGHL 4WO0A 1TZHB 4PRIE 4AKQA 1NCOA 5MERB 4PB9H 2BSED 1MUJA 2P4AB 2RTTA 3LH2L 4OGAD 3U9PL 4B0MB 3Q13A 1XIWA 3QEQD 3WN5C 3FT4A 3HBQA 2R0ZL 1GIGH 3ARDC 5F6HI 4ZUUB 3HFFA 3NFNB 3HIZA 2IXQA 3WUWA 1LD9A 3DVGB 1DQMH 3H3BC 3DWTA 4G5ZH 4K94C 3RHWF 1MVYA 4L3CA 1OHZA 1RHFA 1I8MB 2D7QA 2OTUA 3ARPA 4TVPH 3WJLA 1G6RH 3IJYA 1HFUA 4LGRB 3I3DA 2YS4A 3IFOB 4DQOH 5B1CA 3BW9B 2BSRA 3MLTB 1KBKA 3QUZB 2AI0L 3B6SA 2Q3ZA 2KZ1B 4IKNA 1XMWA 1YEJH 2J5WA 2P44B 4IBYA 5CGYC 4PJHB 4YHZH 4A67A 2BVYA 3K1DA 4XE0A 4F58L 1CFTA 4IMKC 5CP3A 3BCFA 4QXTB 3UCRA 3KE0A 1IEBA 4OGYL 2F2HA 2JELL 7PAZA 2BZDA 1M42A 3WY4A 2QJDA 5TE6L 3C2AL 4ZQTA 1RJLB 4KJWD 1SXBA 1T2XA 5EV7A 5I1GL 4JQIH 4OLVH 4WJ5A 4KK8D 3MRFB 4M03A 2FWOB 1WP6A 3FTGA 4PGEB 2X2YA 5KVDL 3NEEA 3MBEB 1JG9A 1AP2B 3JWDH 3L1OH 4QY8A 3GXMA 4JFEB 1PD1A 2EDQA 4ORGB 5DO8A 5DMKA 3ZT5A 3EYUL 4Z7NE 4LB8A 3UBXA 3W0WA 1IM3A 1I1FB 1XGQA 3IFNL 5E5MA 2R51A 1IC5L 2OR7A 3T0ED 3MRMB 2IMMA 3C9NA 3ZYIA 3SDCB 2PTTA 3WKNA 1T7WA 1UA6H 3ULVD 2CBQA 1WFMA 2F5BH 2IWKA 1NC4B 4X9IA 1JGIA 5B4MD 1FLRH 1J5OL 3ISRA 4N2HA 3V8CA 1HI6A 4PJ9B 1D9KA 1OALA 2Y6SD 2WAQA 5I6MA 4OVVA 2BNQA 1DLHA 4B9PA 3BPNC 3PQYA 5D96C 3ZKXC 1JRHI 2NXZD 3KXFE 4KGJA 1Z9OA 4KNTA 5DUPH 3UC2A 1H15A 5JXAL 5BS0A 3W2DH 1XV8A 4NQQA 2ERJB 3F7YA 4M4RA 3N1PC 2HTKD 5CZVH 4TNVK 1Q38A 3SPVB 4MKTA 4YHPB 3KPRB 1DZBA 1WD8A 2GJRA 4K7PY 1AR2A 1TEGA 3RLSA 1S3RA 3MA7A 4HK0A 4HSCX 1IC7L 1KLFB 4FFZL 4PLNC 4KPHL 5CLZA 3CFKB 3FUIA 2PLTA 3DUSB 4OJCA 2ICWI 4XNAA 4NLHA 4R7VA 2AKRA 2NY0C 4LZKA 1NANI 4ODSL 4X5XA 1JN6B 4GO8A 4L29A 3UZEC 1R17A 3FCSB 3I9GL 3AC0A 4M9PA 1DQJA 4M6OL 5LDSA 5D7SH 4PS4L 5ACLA 1C5CH 1XSJA 3GIVB 3ZQ9A 3D87B 1CF1A 1G7QA 5LB1A 2LFGA 3S5LB 5CWSA 3O11A 3I02A 2FWUA 3TBWA 5DJYB 3CBKB 1XB3A 3DHUA 2XJLA 5FO2A 5J06A 1J12A 5DRXB 3D7PA 4PJDA 4YDMA 2BHUA 5GS1C 3K5SA 5H37A 1BQUA 4GQPH 1CE1H 4W9KC 4XN8A 4QJ5B 1FI8C 2VDLH 3GJFH 4MCYA 1D5IL 2VKWA 3KEDA 1MVFA 3TEXA 2XBTA 2HN7B 1BF8A 3LQAL 4Q4IA 2H47C 1BQHB 2ED7A 5TK2A 2SODB 2Y7QA 4YPGB 3VG9C 4U1NB 1A6VL 4KZDL 5JLZA 4MAYC 1F3JB 4XI5D 1NJ9A 1EXGA 4MNHA 5EOCH 5AYQA 1AD9A 4GG6E 3RL1B 4FNRA 2WXNA 2XG4A 3G08A 1W8OA 3RNKB 4Y4HD 1TQCB 1VF5C 3LS4L 5HHOA 3KLDA 1ILUA 1UCBH 4HT1L 4JY5H 2D7PA 3SPIA 4BJLA 2VO5A 2WIIA 5DQ9A 1YUHA 2CO7B 2ZXQA 4R97B 3DA0A 2FB4L 1QFHA 4NKIL 5HHMB 3EF7A 3H7LA 5KSBE 3LMJL 1OWRM 3WS3A 1RXLA 5D1QC 2X6AA 1N3NB 4MJID 2VR6A 2XV2A 1RKRA 3AABA 3FO1A 3HS0A 4G8GD 3V5DB 2GJJA 3L4VA 3TP4A 4NLAA 3ZTNH 1D5XA 4U6HB 3ZKMD 2PCFA 3CZJA 1WJ3A 3IGKA 1DANT 4RMBA 1Z9PA 5D9SA 5AW1B 4UV4H 3P4OA 1CD1A 3QCUL 3OB0H 4NUJA 4KC3B 3EUUA 3UTTE 1MWAA 1MLBA 2P42B 2HVBA 3DIFB 4K8RL 2I9TA 2V2TB 4G8IA 1Q94B 1D7CA 1IC4H 2X1WL 3OXSA 4L9LC 2VQUA 2FRGP 5E1GA 2GTQA 3ARZA 4MMZA 4K3DH 3HG0A 4HFUH 2NRDA 3M17A 4WFFE 3WMPA 2WLHA 3CCHB 4TV3A 1ZWIB 4MHHG 2EE0A 2XTLA 4DUWA 2R1XA 5E94B 4HOZA 4WTQA 2Y5TB 2XY2A 4Y16D 3VH8B 3ZKND 1KPUB 2OP4H 5IOPA 3MLPA 3AWFA 3G9AB 3T2NL 2PETA 3SIKA 2J21A 4PJHF 2O30A 3BVXA 4WI9A 3HZVA 3X14A 5TQ2L 2WXFA 4L37B 5HHPA 1AIZA 1GC1C 2CWRA 3VXUD 3Q05A 1HZHL 2C3VA 3BOVA 3TVMB 3B9VA 4YE0A 4WCYH 4YMPA 3U25A 1YYLL 3ASWA 4LNRB 4F57H 3AWGA 5E08H 4UV7L 4J3OG 1M05B 3IN2A 1EHNA 2OV0A 4WWID 1PKQE 2Z93B 3BHBB 4U4BA 3UG4A 1OKEA 3GHBL 2OJEB 5BZXA 5ACMA 3MRDB 3C75A 3V4VL 4AGOA 3UROR 4LDLB 2NX5A 2VQ4A 2Z8SA 1CLZL 4M62L 2ZCKH 3O45A 1T4KB 1J7VR 4PJAB 3SYAA 1YNLH 2Z6FA 4LLDA 5I1IL 1B0IA 5C7XL 1ZE3H 3X1GA 3REVB 3V0GA 1KCWA 2KLTA 5JHMA 3QUXA 1CXIA 3OMAB 3QXDB 5MEND 3U79A 1I7ZB 3RX8A 4LSVH 2ODHA 3QPKA 3TO4C 3RA7H 3QEQB 4QWWD 2F8OA 1KGIA 3LPGA 1KPVA 3EGXB 3TN0A 4QHLA 3FQNB 1S6NA 2I7OA 1AGEB 1CFVH 1LNUB 1CTNA 3ES6B 3EW3B 1EEUA 1QUNA 1CR9H 3M1OA 3QZNA 4WV1B 2GB2A 1QQDA 4P5KB 1A7OL 4HEMA 4NZDA 4KKNA 5E6IC 2PXYB 4P2RA 4NN5B 4NRYB 2CJUH 3HI1A 3QZWA 4X98A 2FATL 3GINA 4JREB 1WAEA 4EI0A 1CG9B 1NGWB 4ZMXA 5L88H 1AE6L 3MLZL 1TZHA 5DA4A 5MERA 3BQUA 2UX7A 4LOUC 4GAGL 2XPZA 5I71B 2NY5H 4O2CB 4IBUA 1MJJA 1QLRB 5FUCE 1UZ8A 1JXKA 1T21B 3GPSA 3HB3B 3JWOH 1RQ5A 4WUUE 5D7HA 4Q14A 4AH2B 1PZ5B 5FGBA 4IIZA 3DVGA 1EAOA 1E6OL 1RZJH 2Z7ZA 1GS7A 1I8MA 2LOEA 4R3SB 3RIAK 4EF3A 1QZNA 3UFIA 2P3YA 4K73A 1I8UA 1OD9A 2YA0A 3MLYH 3W9DB 3P4LA 1Z3RA 3UBGA 5HYFA 3RZCC 3LKSB 1I75A 2DQFB 3K5RA 4AX3A 3IFOA 3UBHA 5EFIA 1IVLA 4OTXL 5FLUA 3VXNB 3MLTA 4ZO9A 3QUZA 2Q86A 2WQAA 4BSWA 1T7VA 3DGCR 1CYGA 4I2XB 1J5DA 2LLNA 3MXWH 2YOCA 2JKWA 1EA9C 4PWFA 4ZW6A 1ET5A 2LU3A 3NFSH 3TGXA 1D6VH 1E3ZA 2XV6B 1NLDL 4IBTA 4HULB 1WFIA 2J88L 3QI9C 5DC0A 1OTSC 3T0EB 1U8QB 1U4FA 43CAB 1RJLA 5K9KA 3U6XA 4GRWE 2WB1A 3QRLA 3IGAB 3FMGH 1VGEH 1ZHKA 2FWOA 1S7XB 2ARJB 3MRFA 1A5FH 5JIMA 4JZJC 1NLBL 4IDJH 5DJ0B 3LVEA 1A6UL 1H5BC 4BFEA 2GJPA 3CHQA 3D06A 3W0WE 4DVBB 2H45A 3V9EA 3ARDD 4RIRB 3FQXB 4MQTB 4N9GA 3G04A 2VITB 4QRQB 1NMBH 1I1FA 1T80A 4RDQF 3BXNB 3MRMA 4AW7A 1YC8A 2OQJB 4RFOL 1LE5A 3ML8A 4KFZC 1MQKL 3BAYA 3SE3A 2ZUSA 2UY7B 3GSUB 1C5DB 1QA9A 3HR5B 3VXSD 4C56D 1IT9L 4PJGA 3NABL 1XGPB 5D72L 1ZS8A 3EDDA 3SYQA 1IGFH 3VG0H 3U0PA 3CZGA 2DH2A 1XGUB 4FI6A 5I6PA 2Z31A 4FQHB 4KK9C 4HUXB 3V0FA 3VWKC 1RUPH 4NQTA 4Z1PA 1QTYT 3A47A 3BH9A 5CGYD 4YAQB 4GG8A 4JO1H 5I16A 4IRZH 3ERXA 4APXB 1CDGA 4M61B 4UTBA 2YD6A 1T5XA 2Z0BA 3FF8A 4Y5VB 1Z32X 2P8PA 2FGWH 1B0RB 1MREH 1RUKL 1UYWL 4WGKA 5IV2A 1E4KC 5E03A 3NCMA 3LV3B 3SPVA 4LL4A 4XMWA 2JMRA 1BMWA 5KVMC 2XQYG 3KPRA 3NJNA 4HIXL 2FYVA 3EBHA 4Z95H 1XO8A 1IC1A 2HFEB 3NIGB 1W2KT 2AABL 1KLFA 1X9QA 3F6IA 3B7TA 3OKEB 3ZR5A 4G8FB 3CFKA 1QFOA 3DTUB 4WSGA 1LK2B 3CSPA 1MFDL 2YD5A 3RUGB 3VWJC 5T1JA 3EOAA 3O9WA 1BSIA 1JN6A 4DP5X 1CD8A 1N8ZB 3BYTA 1P2CA 4DOHB 4AEIH 5ADOL 4HUUB 3FCSA 3PIQB 3IDJA 3LNDA 1OARH 2MCMA 1BBDL 3PJLA 1ILSA 3UZVA 4FQXA 3GIVA 4I1NB 4MNQE 4JRXD 1M7XA 4OLXH 3IN0A 1OW0A 4GO6B 1IAIH 3MBWA 5DRXA 1LK3L 2WK2A 2QFPA 3WTTA 1YEHH 2FO8A 5FM5M 1R46A 3VW3L 2Z8WC 1CVRA 3RPIB 5TDNB 1T1YB 1U4EA 1DFXA 1QKZH 3V0WH 3GK8L 4HUKB 4PJAF 5ICYA 2E7BA 1CL7H 5CD5C 5CLYA 4JG0H 1HNFA 5TGBB 1HTYA 4EI6A 4M7ZB 1BQHA 1PF3A 4YPGA 5HJGA 5I17B 4ZFOL 5HDRA 4HDIB 2BS9A 1F3JA 1YAIA 2XN1A 4I9WE 4U1MB 5D1ZB 5D70L 1S7VB 2BNRD 5EU6D 3RNKA 1MJUL 4XPGL 4KXBA 5JW4Q 5EBWA 4YSAA 5GZOA 1DQDL 1ACXA 1SF3A 1JNLL 1A64A 5BV7H 3QNYA 2CO7A 1QUPA 3ZE0E 2AQNA 3W9EA 3WKQA 2J6EL 4UIMA 2OJ1A 5ID1B 2NY0D 3RGHA 4KI5E 3ZHDA 4JKPL 3UTPE 4E9WA 3DUUB 2JKIS 2Y1VA 5LAPA 1RMFL 1SDDB 3KPMB 1FL6B 5HJDA 2J4WL 1BYPA 5DWUL 3V5DA 2F68X 1O6TA 4MA7H 3GNML 1P7KB 3QARA 2DDQL 4U6HA 5HI4C 3PG2A 1GMEA 1J0YA 1NCWH 4HK3N 4L8BA 3BPOB 4PJ7B 4UT9L 1WPCA 2ZWSA 4PJCF 5DJCB 2ZAGA 3N9GH 1N10A 1HWWA 4P2YA 4ALAL 4Y16B 1OQXA 3VFNB 4HFWB 3BIAX 4PWHA 5I6NA 4NPJA 4GI8A 3V6FB 1A2YB 1GS6X 3TV3L 1TJGL 2A6DB 3VXUB 3IS1X 2UX6A 3AB0B 4G43A 3THMH 4Z7WF 1FIGL 1TQTA 2X9ZA 1FNLA 4EVNB 2K9UA 4ELMB 1KCUH 5I19H 3MA9H 3J7HA 4GSRA 2PWEA 4I3RH 1ZWIA 4JANB 2JJUA 1W0WB 3GLZA 2GT9B 1ET8A 1T5WB 2YZ1A 5IKCA 4MAYD 3VH8A 3IDIB 1Z9SA 4HGWB 2EDHA 3NIFE 4R7NB 2Q8AL 5IQOA 5FYLH 4IHBA 5EA0L 4IBVA 2ALAA 4OGXH 4F15B 4DZ8B 1KYUA 4IJ3B 1CF8H 3MR9B 4L37A 5HDOA 5M7QA 1BAWA 4QKTA 3TIDB 3TVMA 4U1JB 1DVXA 1IKNC 4S0SD 2IO5A 1EMTH 4LNRA 2ZWKA 4NERA 2QLVB 4AW4A 4A2FA 2OR8A 2ZKMX 3HMWL 3R18A 4XP9H 3O2WL 4HS3B 5D1QD 4BCYA 3HZYB 4XPBL 1CXLA 2E5EA 3BHBA 3WFDH 2BO0A 3CSYB 2NX5E 1MNNA 3F7KA 3BWAB 2BVOB 4P9HL 1A1OA 2VLKD 4F27A 4OKDA 3TT1L 4B27A 1FZMB 5TJWK 3FU0A 1FQ9C 1KV7A 1LL1A 1KIUB 1I4FB 4K15A 1JZ2A 1VRSA 5T1KB 3EH5B 5T5FA 3O3AB 1A3LH 1E9PB 3REVA 1T0MB 3BWUF 4AYSA 1CVSC 3HUJE 4RGNC 2DBJA 3CZFB 2QSCH 3CSTA 2XN9D 4X50A 1U6AH 2G3MA 4N0UA 1NEUA 3EGXA 3A3YB 3TA4D 5JMOC 1LNUA 5DZAA 4CUCA 4P2RE 1P7QA 3BEWB 3MOAL 1IAIM 4WV1A 4FLQA 1U91A 5T33L 2PXYA 3FK3A 1BGXL 3S35H 1J8RA 4S2SA 1X7TA 3BZ4B 1CG9A 2OSYA 4Y7OC 2R4RH 2WSPA 3LKPA 4Y5YC 1JF6A 1ZTXL 4JHAH 4YBLC 5HVGB 4Z7AA 2QQKL 1KY6A 1X7SA 4XRCA 4CA4A 4MLSA 5DZPA 3UAJA 5KJRH 1JZ8A 1A0QL 1CC3A 4LLUB 4O2CA 4MTMA 1CFQB 5F97E 4Y89A 1SLUA 3ZYZA 1DBML 5KJ4A 4JM4L 4AH2A 2X44D 3A0OA 4W9GC 1LWJA 2R69H 3KAAA 1RZ7H 4MRCA 1AIFA 1D7BA 3EYFB 5HYJD 3NIGF 4ODXB 5C0NC 3P2DA 3SPJA 3P1VA 3L6FB 1A6AA 2DEYX 4DGWC 3ZK0A 1URLA 4ECNA 2DQFA 5CIPH 3RUGF 4M48L 1FDLL 2O72A 4JJ5B 4N2BA 2OCFD 3TU6A 3VXNA 2QVKA 3GM0A 3LHAA 2HT4C 4HIQA 5HVFB 1UD8A 4DZBB 2DLFL 4YSEA 4Y8AA 1S4IA 4X8GA 2IBZY 4M5ZH 5IFJB 3NK3A 3TO4D 3BWZA 3ESPA 2DTML 5GRVK 1CO1A 1E40A 2EXYC 4YH6A 4KDTC 43CAA 1B9ZA 3RIKA 4M6NH 5E6ID 3AS1A 4MDJA 1SMDA 3IGAA 4LFHG 4AJ0A 1S7XA 2ARJA 3U4AA 4ZMZA 2BIIA 3P0YL 2VO8A 4JHUA 3MV8A 1MFAL 1N0XL 4ZFGL 2ED9A 2CM5A 4Y4KA 2NQDA 3P2TA 1VCAA 2XICA 4LOUD 3SQOL 4W9FC 2D0HA 3QG6A 4WWOA 3OKNB 2X05A 4V33A 4X6FB 3MUGB 4JL2A 4DVBA 1P5VB 2DWXA 2ZUQB 4RIRA 3RRQA 3VI3B 4EKJA 1FVEB 5A2BA 3VD1A 4FF9A 2A83B 4QRQA 1DBKH 3VXOB 4POZC 1I9JH 2ZG3A 1CTMA 1XSOA 1FNSH 4ZXBC 3MJ9A 3SOBL 2OQJA 4X9BA 4P8QA 3WKPA 5AKVA 1ZE3C 1M7DB 2UY7A 4PJGE 1HDMA 2VT0A 1ZV2A 1XD0A 3RZCD 1W6LA 5H94B 1R5WB 5HY9B 2ZWYA 3MFGB 2ILLA 4LKCB 4PJFA 1LYQA 5CR8A 3LKOB 1AQ8A 3O6KL 4GPVA 8FABA 3C60C 3K0WA 1DFBH 5AVWB 3PWVB 5DRWA 4DW2H 1WHPA 3VD2A 1XSKA 2VDNB 3IU4L 3MBXL 3OB8A 3LNFA 4APXA 3SJVD 4I3GA 2R29L 3I74A 4OJEH 5EHFA 4P4KC 3ZTDC 5I2IA 3QI9D 3DHJA 4C4KT 1OTSD 1JPSH 4ES9A 2BK8A 4R7LA 3ZRFC 5IGXH 1N4XL 1UB5A 2NY5C 5I6XC 4LARH 2WBKA 2W0LA 4OVUA 4ZZFA 2A9CA 2V0AA 4ZD3L 5SWQA 5I15H 5IHZB 1A9VA 2F08A 3JWOC 3OL2A 3B1UA 1N7ML 2BMKB 2GY7B 4HD9A 3JWNE 4M1DH 3RFZC 2C7UA 5AVYB 3EJPA 4JRXB 4ELMF 3O4LB 3EIFA 3OKEA 1RZJC 2H1PL 5L4JA 1F4HA 4FTVD 3KHQA 2WC7A 5AW6B 4DGYL 5BMFH 1S5HA 4YL9A 3T2PA 3S37H 5JOPD 2DJMA 1CDHA 3GTTA 2P8MB 1HHJB 3BKYL 3BPNB 1RPKA 1N8ZA 3X13B 4QAMB 5D96B 1PSKL 1FFPA 4HUUA 1HILB 2VSMB 1MFBL 3PIQA 4YDIH 1WBXB 3WS6C 4G6FB 4G83A 3P4MA 5L0QC 1BFVL 2WGXA 3Q7JA 3ISYA 1HQRB 4N86A 5TDOB 3GC3A 1QBML 4LHUA 5DZLA 2BNRB 1EO7A 5EU6B 4WF7A 4KK9D 3VWKD 3HJEA 1ESOA 2DQEL 2V2WB 3C5SA 1D6EB 4F9LA 5MP6L 1NCBH