3UIYA

Crystal structure of sefd_dsca in h2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
131
Chain Sequence
LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIEKAVVQAAVTIAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera protein of SefD and SefA
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar enteritidis
molecule tags Structural protein
total genus 20
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uiyA00
4PHXA 2AXWA 5D55A 3UIZA 2CNZA 2CO6A 2CNYA 2FVNA 3UIYA 2CO1A 2CO3A 2IXQA 4OR1A 2CO4A 2CO2A 2CO7A
chains in the Genus database with same CATH superfamily
5GS1A 2B15A 5JOPD 3WFCL 2NQDA 3BE1L 1T1ZB 3C8KA 4IGBB 1FG2B 4CVZA 4K7FB 4AWJC 5D71L 2JKNA 3X12B 2A5UA 1UZ6E 4QF1A 2ZE0A 5CBAB 4HIPA 2AJ3B 1AD9B 3VXOB 1XMEB 1YG9A 4GH7B 5E8OB 2FNBA 4ZNCD 2CD0A 2IIJA 1NOLA 2A0LC 1YA5A 2Q20A 3UG5A 3CGTA 3D39A 1K6QH 4KNSA 2XTJE 1KCUH 4M6OH 1AXSA 3RIAK 5T5FL 1DQDL 1NAMA 3S48A 4F7EB 2Z65C 5EO0B 4OQTL 3DPDA 1LMIA 2O5YH 4RAUA 3DOHA 4NKIL 5ISZA 1JPSH 2D7MA 1QFWH 1VFOA 2BP3A 5D1ZI 1CIUA 3O2WL 3K6NA 5CLYA 1A4JA 4KHTH 1D5ZA 1S7TA 1FLTX 3KXFE 1U8JB 3QZOA 3RIFK 3CV5A 2HSIA 3QHFH 5KVMC 2DZEA 3JT0A 2DLFH 5L2KB 4FHBD 2DKMA 2Q7YB 3MRFB 3E8UH 4XVOA 1JE6A 1UOWA 5EOTB 2ZT9C 1I8UA 3OMIB 4FI7A 4ALAH 3ETBF 4PJ8A 4CMMA 4M6NH 3C60D 4L5FH 3UTSA 1NCUA 3V7AG 2VDLH 4PTUB 2WZ5A 4PYHA 2GTWA 1G9HA 3E9UA 5IVZA 1RERA 3MJ7A 3ULUF 4L3CA 2W07A 4FF9A 4AQ8C 4GUCA 2B16A 1HHIB 2XXCB 5HDBB 1AS8A 2C7UA 5A2AA 2WXPA 5A6LA 2QPEB 3UPRA 4LHJB 4YDKL 3VYNA 3QXTA 3ZLQC 3QSKB 2OCCB 3GF8A 1ACCA 3I9IA 1ZKAA 4W4NA 5E6SB 2ZUTA 4PS7A 5DK0A 5IV2A 3V4UL 2MNWA 4IBZA 3T6VA 3FB8A 1ND0B 3UC0H 2BOLA 4GT0A 2K45A 1M7XA 1ZWIA 4O5LL 2BJMH 4QCIB 1C1EL 1HQ4B 3LH8A 4XXCA 4XWOD 1WT5C 2HG0A 3D30A 4O4YH 3R0MA 4G83A 2EDRA 2GUYA 3GQFA 4KQ3H 3ZKMD 3QA3B 4V1DB 1K2DB 3ARGC 3D51A 4EUPB 2A6DB 1DQLL 3P0YL 5IW6A 2CRIA 1CLZL 3MRLA 4OF6A 3GSQB 5JR1H 3G6DL 4KTDL 3SDXF 3QT2A 4X9HA 2FJFA 5GIRA 4DVRL 1AZZC 5AALA 3SOBL 3TBYA 3M8OL 2Y23A 5BVJB 5ICZA 3RTQD 5AZ2H 1KUMA 3IDYC 5HHNA 1A7BA 2H2PC 3RVVC 2HVJA 2VABA 1GZPB 2OYLA 3GSRB 5CGYD 4NQVB 1XZ0A 1B3JA 2EH8L 3GZQA 5K59F 2VDRL 3PWJB 4MBRA 4WI4A 2X87A 1T7WA 2WKGA 3FOLB 3L4WA 4FEIA 4Q58C 4ZUWB 4WWOA 4TKWA 1YQ2A 3UDWC 1A6TB 2N7SA 4A66A 4BSWB 2VDOB 3KDMA 5D2LA 3DXAB 1S78C 3QJZA 1FNEB 3A21A 3CUPA 4B96A 4AQOA 3HLAB 5LXGH 3MRIA 3KBPA 4R7LA 3HBQA 4G43A 2F08A 2XTJC 3AREC 2DJMA 2Z31A 3NGBB 4Q14A 3DDFA 1NZRA 3ULSA 1OKEA 3SZ6A 2AV7B 4PW3A 1P4IL 1A25A 3NFNA 4GFTB 3BISA 5CFAA 1FE8H 3P2BA 2UZXB 3LKSB 4X6DA 5F0PB 5D7IE 3PREA 4KY2A 3RGVA 3IDJB 5DD1H 4WUUB 3NQKA 3BKMH 2WLHA 5AG8A 2VXVL 1PZCA 1P4BH 3DHUA 3RVUD 2ICCA 4LVEA 3T77A 5C0IA 2VWEE 5TE6L 3V5KA 4DP1X 2Q8BH 4M8QB 3O41A 5FK9A 2I26N 5IJCC 2QZQA 5GSRA 4OCNC 3SN6N 1GY1A 1DANT 4OLWH 4YSPA 2NY3D 3KPPB 5FIEA 3N44B 1NOFA 3Q5TA 5AW5B 1DANU 1K4DA 4OZGA 3UIYA 5E56A 3WMQA 5HJDA 2G9HB 2X1XR 5D4HA 1TFHA 3AADB 4XCNA 5BXFB 1YJDC 4KX8A 5KSAA 4FFWC 2MPVA 2Y1YA 3UJJL 1T5XB 4NQTA 3TTYA 4LNRA 4OJYA 4BFIA 2X2JA 1RV6X 4XCEA 5HY9A 4H1LB 1H6UA 1N26A 1P53A 2OXHB 1WAEA 2WVVA 1QHPA 4OJDH 3QXUA 4LCYA 4M1GL 1I7TA 4CAGA 3V5DB 1NLDL 5JLZA 4ELKA 5EEYA 3ISWA 4NNPL 4JK0D 2R8SH 3MFFB 2WBWB 3HUJE 4XVTH 2N01B 4H0HB 4NKQB 3KS0H 5I19H 1ZE3C 3WNLA 2CQVA 2IBGA 3DARA 1PD6A 4PJBF 2O6EA 1U95B 1MY5A 3BI9X 3GYRA 4R2GC 2X4PA 5HJ3B 2HFFB 5IBUG 3AS1A 4B95C 2OA9A 1TPXC 3O9WA 3UBGA 2M2DA 4N8VB 5D7LE 1DSYA 5T1MA 3DX8B 3SQOH 5DQ9A 5F1OB 4YDLB 5I8OL 1K72A 2ED9A 1D2PA 4YDIH 2GAZB 2Z3FA 3QYNA 4HKJB 3ORJA 3VMNA 5BV7B 2VDNH 2Y6SC 4B5ZA 3QCUH 3WY3A 5CLTA 1DBKL 4XMUA 2F74B 2IJ0C 4PLKD 4XP1H 4IHBA 3W9EA 2XIBA 1XIWA 4NUPA 4U4BA 1LK3H 4MAUH 3VRJA 4C47A 4EBQH 3UTOA 4ZMTA 3I2CH 1CFTA 5FOJA 4G9FA 1N12A 1YNTA 2FE0A 2IGTA 2J25A 5E2VL 4ODVH 4G7VH 3A3YB 5KVEH 2ZG1A 1CS6A 4FQHA 4QAMB 5JIIA 5ADPL 4WCYH 4GRWB 1BA9A 1GYWA 3ARUA 5DUJA 5LBSL 2Z1PA 2TAAA 5CJOH 1I8IA 2BS71 3QO0A 3WFBH 1CN4A 4GKSB 2F19H 5D1ZA 4E9VA 5EUOA 4AQ1B 4JFYA 1R46A 1RK1B 3B5HA 4N90D 2ZICA 3QWOA 1FVDB 1CGUA 1WA2X 3NIDF 5EOQH 2QR0B 4IRZL 1XB6A 1Z5LA 1QLFB 3FAWA 5KYXB 4XNMA 5F3HA 1OSYA 2JELL 3FT2B 5ENWA 2YPLA 1W6WA 4N26A 1IO4C 4CNIB 3BVWA 4KRPB 3SYCA 4R0LB 4Y16C 4W81A 3QNFA 1E4KA 3WXWL 4H13C 4PGZA 5CILH 3HPJA 1FNLA 1SF5A 3EH5B 3F6JA 1PSKL 4X5QA 1ZTXH 5JDJA 1AQMA 1BVLA 2EDEA 4Y2DB 1NFAA 3MO1B 5E1IA 5HHOD 3N9GL 2E6QA 5BRQA 2OSLA 3GBDA 3Q9QA 5J06A 4FXKB 5IMKA 3SE8L 4Z7NF 3CFBA 1Q8MA 3LRKA 4I18C 3MRJB 3BP4B 1QR4A 2A4ZA 2XQYA 2XNAA 1QI4A 4PSPA 4XCFH 2D03H 2RA1A 1LO0L 3U9UA 2HT3D 4YDJA 4L8CB 1CLCA 3LB6C 1JIBA 2VL5B 2PTTB 4JZOA 2MQCA 3ZDYB 5DMJB 2YLHA 3S8GB 3TWYA 1S9VA 1KDIA 5A2IH 3X17A 4KJQC 1T83C 2VC2B 3MBWA 2LLLA 3JBG7 1PCXA 2ZF9A 5EZIH 1WFIA 3FT3B 5D7JD 3QIWB 2AKRA 5BS0A 5I1EL 5EF3A 1NBZA 1PEZA 5A43C 3GXTA 4OV5B 4UI2A 5CCGE 3EOBA 3BFQG 1RK0B 3MJ8B 3HB3C 1YEGH 1UCBL 4MGXA 4OFYD 5FUCE 1Q0YL 4CMHB 1XBRA 3K74B 2YGVA 2BSDA 4MJHA 5E5MA 3CFDB 5GRUL 1ZANL 3S98A 3DDGA 1J9CT 4POZD 4GUQA 5F0MB 1KPUB 1X4XA 2IPKA 3MUGB 1MCKA 4AQAA 1CD1B 1BVNP 1LEKB 2VUOA 2R59A 3IVKB 5L2JA 3U30B 1JNNH 3MV7D 3RVXD 4XNYL 3B9AA 1UWEH 5H37A 5JHAA 3DJSA 2AJYL 2XICA 4FS0A 5B1KA 5J9PA 1ZLVH 4XO8A 1WFOA 2QVTA 3BDYH 3HC2A 3N43F 3OC5A 5KSUA 4YQXL 2WWKO 2HRGA 1J5CA 3GZPA 1PU0A 1HKLL 2Z91A 5IB1A 1HDMA 4F92B 5ICYA 2FIRT 2OMBA 1J1OH 2CLZA 3UADA 3RWCB 4PJDE 1JPEA 1A21A 3P9WB 3SSGA 3IJYB 3CHPA 4HGMA 2EIZA 1UYWH 1KBPA 4IU3A 4IDJL 4ES9A 3A24A 3ZZSA 5JPNC 4H8WH 4BXVA 4I8DA 4TL4A 3BP6B 1DVFB 4LB8A 3U2SA 4KKRA 5BRPA 2WLJA 4HX1B 1DP0A 4IK6A 3F12A 1DBAH 2I60L 4FQXD 4TLTA 5LXVA 1QRNB 2GIYA 3MLPA 3ZE1F 1CFSA 3MNVB 4H26B 1PZ3A 4YSAA 1UVQA 1RL1A 5IKCA 3DSFH 2GY7B 3HVDA 4JCLA 3GS0A 4ONGL 4HOMA 1PKQB 3ZBMA 3KGRA 5DJ2B 2GFBA 3SDDA 5CGMA 1TR7A 2DBLL 3ASOB 3GZKA 1XEDA 2AJXL 3X2QB 1EHLL 5DT1H 2F53E 4E41B 3LJ3A 3MBEC 2AGJL 2V3EA 1YYLH 3O4LE 1NGXB 3GSNA 2N7AA 3KPQB 5DMYA 3LMJL 3CX2A 2IPTH 1BAGA 1NAKL 3QPQD 1UH2A 2ZYSA 5TQ0H 4XNQB 2DYPB 4DAGL 3QIUD 4MMZA 5AW3B 3UCRA 3RAJH 4YIQB 1UADC 1U8MA 3LS5L 1YQVH 4YHPA 1CYGA 1SXZA 1XFPA 2EABA 4LP4A 5I5MA 3QRFM 3MRQB 3E2HC 3TEUA 4PP2A 1IUZA 1IVTA 3DRQB 4PWGA 2E7LA 4Z7UA 1G0YR 2EDNA 4HK3N 2Y07H 2XDHA 2COVD 5KBLA 5DF0A 1FGNH 4XBPB 4A7VA 2A9NL 1GPOH 2I27N 2HFEB 3MRCA 4OIIL 4KZ0A 1DBBH 4YVNA 2R51A 5EHFA 5D6CA 3AWGA 2DD8H 3IFOB 3EJCA 4L37A 4MAYB 3PQYE 4Q6IC 4DKEH 4P4KA 1LQSR 1QWNA 3VGFA 2A9BA 4JY5H 4EVNA 1UT9A 3BKJH 2EE9A 3II1A 3VXSD 1U4FA 2J8UE 4XXDA 3D3VD 4IIZA 4M5SA 4TTDD 4LLUA 4YDVA 2HRLA 5DDHB 3GEFA 4AW7A 3VSUA 3MV9D 3RFZA 4GLRH 2VL4A 2WBKA 4GBXC 4HUXA 5D2NB 1I9RL 1UD5A 3BWUF 3RHWK 3U4AA 3EDDA 3HE7A 3T1FB 5IJKC 3L16A 3KM1A 5FECA 3L4YA 5FYKH 3WMPA 5FGCE 3T3MF 3JWOH 2B1AL 3MA7A 4L9LC 4AEFA 3FT9A 1NJ9A 2XN9A 3P3UA 3VH8B 1UOLA 4GXVH 1OP9A 3N1FC 4NHCH 3V0HA 4UQ2B 3RKDC 3ARYA 2NUTA 2K78A 2XG5B 5I0ZA 2FWLB 4Y4KB 1IAKA 1E4JA 3HR5A 5AKVA 4KXCA 1GIGL 1YNLL 2C3XA 3C8DA 1DSFL 1W72B 1TJGL 1N59A 1T0NA 2HJKB 4FNLH 2V6HA 1K5NA 4K23L 5I26A 1FGVL 3TNMB 3UG3A 4AE1A 4OJFL 1N6QH 1CFQA 3VJ6B 1GCYA 5LWYH 3S36H 5AOMA 2EC8A 2YPVL 3T0BA 5T1JA 4GT7A 2BX5A 3WO4B 1CFNA 1U8KA 3D6GA 2OMWB 4JG9A 2AJZB 5BRZE 1JZ8A 4XWGH 1DJYA 5ACMA 1F8TH 3C6SB 3K5SA 2OZNA 4Y1AA 4GW4A 3FU7B 4JRYB 1NFDA 2E59A 4K71C 2BVPA 4X42A 3FW6A 2XZAL 3BWAA 2F7PA 3BAWA 5DR5L 4PS8A 4WSKA 4O58L 2MHAA 5AVYB 3Q06A 1ZPLA 4D0CB 2OI9C 3OXRB 4NUGL 4RETB 1M1XB 2YD0A 4HUKB 4JHVA 2KI6A 2JWYA 5KVFH 1A7OH 1E5CA 5T1KD 4DOHE 4FN0A 3H85A 1U8LA 2J7LA 4NO2A 5FFGA 3SDAD 1QASA 3CH1A 3MODL 3TH3T 5KS9A 4PJHA 3KPLA 1FWXA 1MVUB 3KXFD 1JGDA 4M6ML 4WFHD 1Q0EA 1R6VA 2HTKD 1Z0NA 3VFTB 3MXWL 1CFVL 4IJ3C 1YECH 3VXUE 3VWKB 4Z77B 2VTFA 3VFVA 3UTZA 1XB3A 3ZUCA 1AGDB 2EADA 1Q9LA 1JTPA 3UTQB 2ENSA 1AG6A 1I8MB 1V7NH 3HG2A 4DGIL 5EIIA 1T0PB 1TUPA 1WV7T 4OTXL 4FYRA 1OAKL 1CXLA 1DQVA 4P5MA 1JXJA 2AI0H 4GG8A 1CB4A 4GJTB 4ZO7A 2VRAA 3B2PA 2LFEA 1A1OB 4M5ZH 3MKKA 2VN5A 3BYYA 1LD9B 4BKLB 3RZCA 4JO1H 2NY0D 3L7FB 4DUVA 5I0XA 5DRZA 2VRQA 4UTBL 3L5WA 3UYRL 1VGKA 4M7JH 3DROA 3NBNA 3FC8A 2VLRB 1AZRA 4NAJA 1MJJB 3KS0J 3RDTD 3G5VA 2FB4H 3H9SA 1UACL 1CQKA 1KT2B 1XAUA 2AZAA 1H9VA 1I53A 1CD9B 1R5IA 3FO1B 4FKEA 4OBRA 4R5TA 1AOZA 1XH2A 2P8LA 4IIQC 4KOBA 1R75A 4NI6A 4BKSC 1JZ7A 3EUDA 4B27A 2LU3A 5C1MB 4ELMA 5FCUL 2MNUA 2FT6A 4JO2L 3WFEL 4J1UA 1JGLL 2Y36H 4RGOL 4N6RB 1YMME 1NGYA 1EH9A 1T1YB 1CL7I 2LQRA 1YY8B 3Q13A 5H2BB 2E27H 1IEHA 4NKOA 4U1IB 1YNKL 2B1HL 3QQDA 2NNXA 3O6LH 1I7ZB 4PJCF 5IUSA 1GJIA 3TO4B 1FNGB 1RZ7L 4EI0A 2Y06H 4HK0A 2BY3A 3GXMA 3L3DB 2Z4QB 3QUXD 2OMNA 4AYFB 3QRBA 3BQUC 1NMCC 2XFXA 4WV1A 1ONQA 2A1WH 4RFEA 5HHPB 4OQ1A 1P9MC 1ZVYA 3GSNH 2Q3AA 2WQXA 1U8IA 2YPKA 4WKZB 5EZLB 5J6SA 3WJJA 2H3NA 5FOBB 1ES0B 3KLSA 4DGUA 4Z7OE 3ARSA 2BSRA 1QFHA 5TDPA 3QDJB 1IC4H 3JWNH 4ELDA 2WHVA 4BK5A 2YEVB 5F9JA 4FA8A 1ETA1 1EEQA 4DQOH 3PWUB 2YJQA 3CE1A 2DY2A 4JAMB 5I8EA 3KYMA 4P5TD 3VM5A 1MW0A 1RIHH 1OCWH 1TYRA 3D69A 5I82A 5IEHA 3MRKB 4U0QB 4ZTOH 5KTEL 2DQFA 2BRRL 2JK5B 2W65A 3KJ6H 5JQIB 1RIUH 4OKVB 2O5ZH 1Q1JH 4L3AA 4WHCA 5TTRA 3D0LA 5L9DH 2YS4A 4B9ZA 2PNDA 2WD0A 1B3IA 2ERJC 1WZ1L 1JVLA 4UIKH 5DRWB 5IJVA 3GMOB 2EXYC 4DP4X 2WQUA 1DUYB 2BC4A 3UTTD 3B9KD 3R19A 5I66B 1VB9A 4HQQL 2WOYA 3SY6A 3WJMB 2X6UA 4PJ5A 2K1MA 1FDLL 3HAEB 5TGBB 1BVKA 2QGEA 4JN1L 1AKJA 5EORL 4WI2A 5K1JA 4P2QA 2LVCA 2V17L 1I8KA 2FR4A 3ESOA 1EFXD 4NPYB 1Y18A 5B7EA 4H8QA 4LSTL 2Z9TA 5DC2A 1KGJA 2JIXA 1ADQH 3SZKC 5GS2D 6TAAA 1F2QA 1Q9OA 2Z93B 3CFKA 3FB5B 4JRXB 4PJBB 3WSQH 2NY1B 2ZXWB 1M7DB 4P23D 5ITFB 1QBLH 3C5SB 1F6AB 1FLRL 1QW8A 4BCXA 1Z3RA 2YSSB 3VI3A 4DN4L 2OMTB 2DMHA 4YX2H 4Z7WF 1U92B 1CG9A 4NQCA 1WWWX 2EDMA 5B8CC 4L4TB 3GJFB 5DLLA 1W8NA 4JM2D 2X3BA 4PWKA 4AIZB 1IBGH 4J7RA 4NRZB 4P2CG 4FTVB 1JFQH 4HS6A 3KWXA 2QV2A 5AG9A 5IVXA 1ZGLM 4HGKC 4QMEA 4WEMB 2VM9A 4ZUUA 5C9KA 1GHFH 1U42A 5FC9A 1VKXA 5D7LD 1JV5B 4JGMA 3K1DA 4Z3JA 2ESVA 1ZHNB 2R39A 1F4YH 4FYQA 5DJ8B 1P1ZB 1S9WB 3OMZA 1IM3B 3CPUA 2O6FA 5JXED 5E6IA 3ECUA 2DWDB 2GBTA 4GRLC 2XV2A 4N8CH 5C0ND 2ZX8A 1E6OH 1KIRB 3DTXA 2BNUA 2LU5A 1WEJL 5LGYA 5JXAL 3FO9B 1MFVA 2RQEA 4A55A 2EVJA 1MQKH 1BPVA 5FHAH 1IKNA 3QUMB 5EU4B 3SYOA 4FQJL 2NSXA 3CSBA 1OOWA 4R4NC 2TRHA 4GO8A 2P7TB 4F8NA 2ICWI 3Q44A 1CGVA 3NA9H 5KANI 5FW6A 3LEVL 3NJMA 4CKQA 4E68A 4XMPH 2ID5A 3NA4A 1GAFL 3NIDB 5E4IA 5C0CA 3RNKA 2XXFA 4AOFA 4MNHA 3QEQE 4QRPE 5T3XD 4DP7X 3PRZA 4W9ZA 3MRBB 4AENB 1JWUA 1T1XA 3QI9A 3MLUL 3U36A 3CPLB 4ZAKA 2PO6C 4UOW1 4MXVF 2ARJA 2YKLH 3WCYA 3TBWB 3LNIA 3EDEA 3DX6B 1T2QL 5C07B 3A67L 3D2UD 3STZB 1ML0A 3BAXA 1ZT4B 3ZTNH 1D9KA 4EF3A 2X0UA 1N0XH 2DEWX 5KAQG 2IXQB 3AQYA 5CP3H 3CJJA 3OPZH 3L54A 5LUMA 1DLHA 1MRFH 2AEQL 5LQBL 2CO3A 2CPUA 2C3VA 5BQ7B 5EBWA 3O2DA 2DLHA 1S8DA 1U3NA 2JJSA 1DQMH 4MASA 4J39A 2IQ9L 3QPKA 3NIFE 2R29L 2R2CA 3O11A 5JIHA 3H55A 5B38G 2A9MH 4MB5A 2EJ1A 5J6HA 4TS6A 1UFUA 1ZVSB 1H6TA 1UZ6F 1T3FA 3EO0A 4WTWA 3T0EC 5BZDB 5GZND 3HS0B 4ZO9A 3LNHA 1JGUH 4R26H 5CU5A 1JWMA 2WQ8A 2VDRB 4OW6A 1OGAE 1QFWM 4NKMA 3STLA 4M7LL 4WWKA 1XCXA 3N91A 3KG5A 4ZMNA 3MLYL 4L4VD 1GTFA 1F13A 3QQ4A 4X4ME 3V9FA 2AXJA 4XHJC 3HHSA 1CR9H 2AJVH 4IOIB 3G04B 5HDWA 2NY6C 2V9TA 3BPCB 2B2XH 4GAJL 2VLJB 4J3OD 4QRAA 2B59B 3NJVA 3OJMB 3WGVB 4JPIB 2FBOJ 3Q2NA 3LQMA 4UNUA 4L8DB 1T66D 3BH9B 1I1AA 4JDEA 3U46B 2EEFA 4M9PA 4CA4A 1SM3L 4XVUD 3IFNL 5DD6B 3ZGHA 4K8RH 1G43A 1F2XK 1MLBB 4NJAH 3ZW3A 4NKDB 5EZJB 3QS2A 1KIPB 2K3TA 1T2XA 3B1TA 4N0FA 4YHIA 5GS1C 5I1CL 2B8OT 3N43B 5T5NG 1OHZA 4QRBA 1G1KA 2F5AL 1Q9WA 5G55A 1A7QH 3AG1B 5IG7A 5T3XL 1UGNA 3H3PL 4TLSA 2QQNH 3TT3H 2WQVA 3ETTA 4AV4A 25C8L 5J13C 1RUPL 3K4AA 4FERA 1QR1A 1TETL 3CSTA 1Z3GH 3D4YA 5MEQB 4NC1C 1GMIA 5T3ZH 2F8XC 3MAWA 5DFWH 1BXAA 1Z32X 4R6UA 1UKTA 4M5YH 3C6EA 1FL3A 1SDAB 4WJKB 3RPIA 4HXAL 2GYSA 5AKTA 3DECA 4GB9A 1D3CA 3CZGA 4I89A 4MD4B 4A37A 4HIXL 2J6EL 4AYGA 1G7IB 4PJAE 5G5DA 3ZE1B 4ZXBD 5J8OA 1YDPB 2R9HC 3L48A 4QTIH 3CFCH 3KPSB 1HE8A 3IDXL 1YYCA 2D31B 3LRMA 2JV6A 4BFFA 1BAWA 3VI4E 2NDFA 2XA3A 4XE0A 1KGYE 4Z5RB 3QDME 4F7KA 1LK2B 5F3BB 3AU1A 2BWIA 2D3VA 1AQDB 1ITBB 1F1DA 1HCVA 1T1WA 1U93A 4UDUA 2LTQB 4PJ8C 5FO8A 5LHDA 3HZ3A 3ZSSA 1E50A 1MY7A 5F1KC 2JI1A 4OGXH 4CC0A 1W0WB 3QCVH 4QAWA 5F93C 2KZWA 5HGDA 4XPGL 2OYPA 3QIBB 4Y4HD 3V4PA 5DK2A 4G2AA 1A3ZA 3WEOA 1BD2A 1WIOA 3G6JE 4S10A 1N5AA 1IKFH 4WLCA 4JG0H 3O4LD 1OM3L 5IP4A 1EGJL 2X9XA 4G8FA 2V9RA 3KL3A 3MRRA 4OLUH 5I17A 1BZ7A 4N2GA 1PFCA 2GBUA 4OFKA 5CKAA 5F7MC 1NKGA 3VXQA 1KN4H 2FCBA 5CLXA 3E7JA 4JLRB 2CK0L 4YPGA 3ZR6A 1QFPA 1QEWA 1UQSB 3U1SH 3W38A 2EYRB 2X1PA 2FGWL 1RZGA 3VFRA 2DRUA 1OSZB 3MLXH 2H6UA 5EU3B 1BZDA 3GB7B 4XXCC 3MOAH 2CMRH 2VSCA 2X4QB 4RSVA 1T7ZA 4OUUA 2CO4A 4KK9D 5J1AA 5A16B 4ZMXA 1OPOA 2VOTA 3TFKD 1Q4NX 4I3GA 5I6NA 3FBQA 2TSBA 4UTAA 5JW4R 2NY3B 4IMKA 4WW1B 4ZS7H 4X8XA 2Q86A 4PG9A 2DN7A 2OFQA 4QRQA 1QBMH 3U7WL 2BOCB 2FECI 3K6DA 3CFJB 4LSUH 5JHDB 1NMBH 1T20B 1XGTB 4DF9A 1A7PL 2ZPKL 5A6MA 2NW3A 5F7LB 1YY9C 2MSPA 1J10A 3T3MB 4AVIA 2ICWA 4G9FE 1OALA 2GSGA 1CICB 5EZOH 1T1ZA 2OKMA 1KMGA 1Q0XL 4JFXB 3X12A 4BFJA 3A6OA 5GGTL 1ZDSA 2Z31C 3QAZC 4IBWA 5FYKE 1KGUA 2R23B 3L6FB 5GHWL 1JZJA 1RKRA 2NSQA 4NFCA 4PJIF 5C7XH 2JKWA 4O51B 3RGVC 5IJBC 2CRMA 2ZONA 2V2XB 2VKWA 3FS9A 1L9PA 3HUJF 2ZCHL 4IU2A 1E9PA 2I5YL 4WFEE 1XGYL 4HKXA 1BWWA 3Q5OA 4F7EA 4J3BA 1HH6A 2ZYIA 3JV0A 3O6FD 2YPLE 4YHOH 5D1QB 1S7UA 3WFZA 3MA9L 3O2DH 4KTEH 2HG5B 4X6BB 3TVMD 4APQD 1NC4A 4DSYA 3VWJA 4B60A 2QSTA 5JTWA 5ESQA 3S3SA 2X4SA 2ZZUT 4U6TA 3C6LD 2Q7YA 3MRFA 1UWFA 4LZKA 1OSPL 5E7BA 5LCVL 3LRGA 1PIGA 5KSAC 4J6RH 1ZOXA 4XNXL 3GMQA 4OM1L 2Z64C 3QFJB 4M4RB 4AEHL 3VX0A 4OZIA 4KFMA 1MIML 2VQ4A 3MV8B 2XV0A 3B83A 4KKAC 1N64H 1PQZA 2DQTL 1JK8B 1TTCA 2IGFL 2R7EB 4R7XA 4M7ZC 3QJOA 4PGJA 5E03A 1IGJB 3FF7A 3MRDA 4P9HH 3AQZA 1IL1B 2UX7A 1CL7H 1FAIL 4F37F 4NHUA 3T0XA 4ZW6A 5CLWA 1NBYB 2ZXQA 3F7KA 3WL9A 5KVFE 3TZVB 2BIIA 5DJXB 5E08L 5T33L 3N1MC 3LZRA 4FQ1H 1A3LL 4WHDA 4ENED 2PTVA 2XTLA 2C26A 1X9RA 2P24B 1KWGA 4FADA 3FCGA 4JFZH 3JTTA 3KR3H 3K6IA 3O9WC 2F9BT 3FUFA 3RI5K 5F8QC 1LVEA 5SX5H 2FJHA 1OAUL 1HQ4A 1NCNA 1NL0H 2DL9A 1IC1A 2QEJA 4JFFB 1KJ3H 5CCKL 4NDMB 3ZDXF 4FNQA 5HHOB 5CN3A 2DV6A 1OAXL 4DESA 4IBQA 1JZIA 3D52A 5HHQA 2A6DA 2BVOA 4PH8A 3FRUA 5CSZB 1S7QB 1AGFA 1EO5A 5EC2B 3MLZH 5EU5A 4RVBA 2BNQE 4L0PB 4ZTPH 1OLZA 3ET9F 4FLQA 3RP1A 1XIWC 5JYMA 4GQQA 3DUUB 1JPGB 4ADJA 4AKOA 5BUAA 5IWLA 2VLKB 1UB5B 4Y5XA 3TA4D 3NAAL 3FOLA 4ZD3L 4PCKA 3CN0A 3HJ0A 4ERSH 4NBYB 1KNOB 3O6KH 4FQLH 3VTMA 1A6TA 4UV7L 12E8H 1G6RA 1GVIA 5D1ZC 3ZHKA 1FNEA 4X7SH 3MI6A 5ESAA 3JWOC 4RDBA 2P4AB 2Y7MA 4PJCB 3SPCA 5I5IA 4OLXL 1LEIB 3OJDB 5CJBA 4ZS6D 1GGTA 1KJMB 3GD1C 2IOIA 3IAPA 1UG9A 1YMMD 3OLGA 4PW4A 4W9EC 4K2UH 1JXFA 2FSEA 1NIDA 4GAGH 2UZXA 4WUUA 2X6BA 2DQIH 4FRWA 3KGTA 3EZJB 1CT8B 1E4KC 3ZPDA 4P2YA 5IBUB 4JZJA 4F8QA 3G08A 5AW4B 4HZLB 1DO5A 4MJIE 3DURA 2ETWA 2V7NA 1KCUL 1WAAA 2FATH 4M8QA 3P2DA 3QWRD 5B3NA 5DU7A 2E7MA 5EO9A 1FZKB 2NY4C 4XMXA 4HEMA 1AR1D 5DEFB 2WZPD 1BBJA 1E5UI 1WBXA 2GTZA 5EA0H 3W9DB 2CHWA 2O5YL 2O72A 4FXGA 2OMXA 4XMZA 3BIBX 4LAJH 3M7FB 1JPSL 1QFWL 2ED6A 1J86A 4NCC2 4D0BB 4OCSH 1AQ8A 4ZMOA 3KBHE 4KHTL 3VXNB 3QHFL 3RWFA 1IT9H 3VGHA 4I0CC 2DLFL 4X7TA 3WTWA 1T5XA 2NNCA 2NPLX 4L9DA 4APXB 1X9LA 4R7NB 5GGUB 1INQB 2AJSH 1FCGA 4UZUA 3TPUB 3E8UL 4B3VA 3REVB 4O2FB 4PJDF 1QATA 4ALAL 3S37H 1JPTH 2ICEB 3OPUA 1GA2A 4UTAH 1NEZG 4M6NL 5HDRA 5IM7B 4WI3A 3D8MA 2VDLL 5BQDA 3V5DA 2BM3A 2NY5H 2V0AA 4PTTB 5F1NB 3WNPA 3QP3A 3SEPA 3ZU8A 3BGAA 3V7MA 3TO2A 2AK4B 4K7PY 4KX7A 5GJSL 4N2OA 5C8JB 1DFXA 2QGDA 4Y9GA 3V0GA 1TQCC 2WLYA 4Y2OA 3T6QC 2YD1A 3D4GA 4DP0X 1KEMH 2R1WB 1M7IB 1NIBA 2HA1A 4ZW3A 3QW9A 4UB0H 2XA8H 3MGTA 3FUJA 4YHNB 1RURH 2GAZA 2WBJD 4FQPA 3J2PA 1MWAA 2RQ8A 1F11A 1G87A 1L7TH 3SO5A 4K3HA 4PRPE 1TSHA 3UC0L 4Z7WB 5KAQF 5AOJA 2ADJA 3QIUB 2CDFB 1OW0A 2A74B 3ENEA 2YXFA 2BJML 3FTVA 4G6MH 1SMOA 4XCYB 1JHKL 1JP5A 4NCC1 2WXNA 4O4YL 1HTYA 5AB9A 1MXDA 2XN9E 4IRSC 4TMPA 3EYVA 3JYCA 4KQ3L 4HAKA 4YHML 2ALWA 5IHWA 3TP4A 1I3GH 3O45B 3ZYOA 2PN5A 5JR1L 2K9FB 4WI8A 3CNKA 2BIMA 1EAJA 1EEZA 2CDEB 4YGVB 1S5IH 4DKFH 5LGHL 3GO1H 1JYVA 1ORQB 2Z34A 5ACLA 2CLRB 5AZ2L 4QWWC 1DLFH 2DMKA 4XAWH 5IREA 4I4WB 5CN2A 1ZLSH 3MYJB 3ESUF 4GAYB 5E4EC 5EPMB 1H6EA 2PPFA 3JV5A 4I2XA 5FA4B 3ZSTA 4PN6A 4HWEH 4IEFB 4PSRA 4AQ1A 1NGQL 1XO8A 2QJDA 3WKNA 1F58H 1VSCA 1X5GA 1OHQA 2YEZA 3M45A 4KFZC 3VXSB 4W93A 1A9BB 1QLFA 1YPZE 3WYRA 4HIIA 4S2SA 3SDDC 4X4ZA 3FT2A 5LXGL 1E42A 2IANB 5GS0D 4CNIA 2RR3A 1NFIA 3LV3B 2MQ3A 1VFAA 5JW4N 3FCSA 1W80A 4OCXH 4QXUH 5T8IA 2D0HA 1FE8L 1OF2A 2J8UF 1JSYA 2FWSA 5DD1L 1TEFA 5JOFA 3BKML 3KL0A 4IBUA 3MO1A 3KLHC 1E27B 1EIBA 5TK2A 3QEQD 1CUOA 4QRPD 1F3DJ 1AE6H 1AZBA 1P4BL 2OYMA 4MMZC 4F3FB 3BP4A 5A7BA 4MWFB 3C8HA 3JWNC 4HSCX 4Y5YA 2Q8BL 3BZEB 1U6AH 5T5NF 2ZUQC 3FOMA 4YBHA 2F5BH 3SGJA 5B1BB 4L8CA 3OBAA 1RZIB 2PTTA 2E7LC 4OLWL 3PHQB 2I32A 1CFBA 2BP0B 5EWIH 3V6ZA 5JW3H 1KLFB 3KAAA 4WNSA 5KJRH 4ZT1A 2M83A 1QW9A 4J2QA 3MPCA 4CADA 5C0DB 3IXAA 4GG6A 2OLDA 1IBHA 1X4ZA 3K1KC 2FEDC 4WWPA 1J5OH 4OV5A 4KDTA 4P4KC 1OGTA 2EKSB 4S1RH 4PJ6A 2JJTA 3ARFD 4JQVA 1KIUB 1T4WA 5E2UH 2W8CA 1QQDB 5HD8C 3WFHA 1GMEA 1U8OA 3BDBA 2XTJB 3AREB 2R8SL 2XQ0A 2YMXH 2ZCLH 2CJSA 4HJIA 4XVTL 4Y8DC 3SBWA 3V4VA 1H3GA 1LEKA 3RFZC 3Q1SH 1OGAD 4I5BB 1AMXA 3H9SE 4N2NA 5I19L 2IBZX 1SXAA 3HE7C 1G6RH 5E94B 1IEAB 4KO5A 1BCIA 4N0UB 5DZVA 1BDYA 3HVNA 3GGWB 3KXFB 1SJEB 3HNTH 4DK5A 1BVOA 3C08H 2N1TE 3VAEA 2AQRA 1M3JA 1WQVT 3SQOL 2ZWSA 1OARL 1SN0A 2CNZA 3D05A 3DV4B 5FR3A 3DV6B 4MCZB 4KKBC 4WU5B 3EDKA 4YDIL 3VTTA 3UFIA 1CD0A 2QSCH 4OLXH 3PJLA 4M48H 2VDNL 5DO2C 1PZ5B 3QCUL 5GS0L 1R5WB 1UOKA 3RWCA 5JPMB 1X3DA 3HZVA 3OKMB 3W0WA 4I48B 2K4WA 4XP1L 1D5MB 2UXVA 3BWZA 2EVFA 4IKNA 1LK3L 3QQXA 4NQDA 4EBQL 3H3BC 3I2CL 3LRSA 2B9BA 5CUSH 1DVFA 5CJ8A 3C5ZD 4JEGB 4HX1A 5DGRA 2GJRA 4G7VL 3DMMC 4ODVL 3DHPA 1B4TA 1DCLA 3OSKA 4HOZA 3PXLA 2QMKA 5DFVD 4Z6AT 3MNVA 4DT2A 4FFVC 4AIEA 3RDTB 4BK4A 5CJOL 5E8PA 3WFBL 4ONFH 2BCKB 2F19L 4JFDB 1SOKA 4KHXH 5DJ2A 2XWJB 3P4OB 4EXPX 4PCTA 4A2FA 3CBJB 1UWXK 1FC2D 1M05B 3KBFA 4JFUA 1IGFH 5EOQL 5DC0A 3KLLA 5T3ZE 1VESA 4E41A 4GSXA 1K4CA 1HESA 5AW1B 3VW3H 4GIOA 4R2GB 3PYCA 2GJJA 1QEXA 4FQIH 3NJKA 3US9A 5B4MC 1LHZA 3K2IA 1G0XA 1XCTB 3II3A 4AZ8A 4C57C 2Y7SA 1S9XB 1WGOA 3MUJA 2YD4A 4XNQA 4HWZA 5CILL 1LEGA 1MSPA 4GXFA 4Y4FD 3OLEA 4YIQA 1FO0L 3KJ4B 5TH2B 1C12A 3QDMD 4Y19A 4S1DC 5IY5B 2XQYG 4MA8H 1DN0B 5FGSA 3LKNA 1D5XB 1D2OA 3DRQA 4OGAD 4NP4L 3BXNB 1C8QA 4CU7A 4XCFL 2D03L 1MWAH 1TQBC 1U8NB 3QDAA 2JCCA 2E7HA 5FV1L 4ZFQA 3RZCC 4XMWA 1N3NA 1ZV5A 3IRPX 5GJTH 3R1GH 2HFEA 2NNAB 1H0DB 3S88L 2VN4A 3GRBA 4C56E 3X13A 4UU9B 2OP4H 4OM0H 1BGXH 3UBHA 4HT1H 2NR6A 5IMLB 3EFFB 2QADC 2WXRA 4RQQA 5LAPA 5EZIL 2RH0A 2DLIA 5E00B 4A2EA 4U7SA 3SDCA 2NYYC 4BZ1A 4NN6B 4Y9CA 5E2JA 2ZKWA 3BVNA 1Q72H 3EHBD 3GPSA 5GQBA 3FYEB 3GT6A 3UJTL 1TG8A 5LNDA 1Q9KB 5DDHA 5CZXD 4NQCE 3PDOB 4PRBB 3QUZA 4LFHD 4CSZA 4JFEB 3MCG1 1KIQA 5T1LB 3QQ9D 3PWVA 1B0GB 3QQ3B 3LKQB 3EYFA 4U6HB 4Y16B 2EIEA 4GKLA 1KYUA 1JF6A 3LZPA 4HALA 4JKPH 5I23A 2E3VA 1IGCH 1IAIH 2DQJH 3LKPA 4IRJA 3TN0D 1CK0H 2GSIA 1LDSA 5IHZA 1BLNB 1JNNL 2G2NA 2XG5A 3T04D 2FUTA 1JXDA 1UWEL 2W60B 3KPOA 1X5YA 5CNHA 1W72A 4BSJA 4MS8C 3TH4T 2HJKA 4I18B 4IJTA 4AT6B 2WWMD 3H54A 1CDBA 1SUJA 1EFXB 3BDYL 5DWPA 2XCMC 4K8RC 2PETA 3L08A 4WV1C 5BZXA 1DVUA 4ETQB 3K2UH 5F7AA 4K94L 1J1OL 3SE6A 5B39G 2BLFA 4LHUG 3WJJC 4A38A 4PRAB 2WCPA 4JR9H 3ATFA 5CZRA 1QSFA 2R0KL 4HV8A 1ID2A 4PJIB 1DQKA 1KB5L 1JPFA 5C0EB 3HUJB 2XWTA 1UYWL 4LVHC 4BK5C 3C6SA 3GEWB 3OXSB 4U6XA 4H8WL 4G80B 4ODTH 4NQQA 4NXSA 5FYKD 4JRYA 4KJWD 5AB0A 3WKMH 1DBAL 1JRHH 2VLME 3HB3B 3OGCB 3OLIA 1JVOA 3J7HA 2BVYA 2R27A 1MHPH 3LN9A 3OXRA 4WFED 1M1XA 1NCHA 4ZSOE 3DSFL 2X7LB 4OIFA 2R1YB 4RA0C 2OMZB 3DOIA 1GS6X 2AEPL 2X9WA 4AL8H 1U91A 4PY7A 3K4ZA 2R2BB 1KBGH 5DT1L 2EDXA 3FQNA 4AJYV 2HJFA 2K9UA 1P1VA 4V11A 1L7IH 4WNQA 4OFDA 2EIMB 2ROYA 5LGJB 4PJFA 4B9PA 3JWNG 5GZOD 1TIUA 3CVHA 3V4VH 2IPTL 3QISA 1QA9B 5HDQH 5TQ0L 3ARZA 3P2TA 1U8PB 4WZ9A 3WDIA 4AITA 2E86A 4DPCX 1RPQA 3ABGA 4J3XA 3RAJL 4PRIB 3TJHC 3HC4H 3AG3B 1X44A 3GSOB 1P84K 3QFGA 4G72B 1YQVL 3ALXA 5DZLA 4BJLA 1IFHH 1KC5L 3G6AB 1AZCA 1A1OA 3W1ZA 3JV6B 1OB1B 1LD9A 4MNQB 1HAUA 2J8HA 3IRZA 5D5ME 4BKLA 3GC3A 2W81C 4LCUB 2IOOA 1I7UA 2Y07L 5JPNB 4IMLB 2BNRB 4ESKA 1EV2E 3P73B 3WEBA 3EOTH 3LSOA 4XPFH 3LIUA 1FGNL 3P4NA 5BJTB 1GPOL 2KLSA 2CO1A 3HNSH 1DBBL 3BZ4B 2WWKT 1GW0A 2APFA 5CGBA 4IOSD 3FB7B 1MREH 2ADGB 3K8KA 3OKKA 2H0EA 3BRFA 4H88L 1KT2A 3PHOB 4HWBA 4DKEL 4NERA 4BGLA 4KITB 5IR1A 4XB3A 1LE5A 5BCAA 4JY5L 3MRMB 4KXAA 3AITA 3BKJL 1BF2A 2EYSB 1N4XH 1ORSB 1XV8A 3APMA 4L4JA 2QFPA 5E6IC 4PV8B 3ROLB 4MYWB 1JHTB 4TUOB 1GXEA 3F7YA 3MOQA 5FYKL 2PF6A 1PEWA 3ARBD 2BNQD 2O61A 4BWWA 1GL4B 1IKNC 3EG9A 4KXZH 3JWOL 3NJFA 3NIFF 1LGVA 3TO4A 3QJRB 4GXVL 4LMQI 2JJVA 1KN2H 4NHCL 1BBDH 5MENA 4GKNB 2Z4QA 1BPLB 1K9TA 3PGCB 5CWSB 2V4LA 3E2HB 3F6IA 2ZWKA 4CVXA 3IF1A 5HGBA 1XGRA 1RLWA 1MOEA 4FNLL 4WKZA 5CEZE 3ZRCC 4K7PL 1NTDA 1UD2A 1EHKB 1FQ9C 1RZJC 4WSGA 4LHUD 4BDVA 4DGYH 4YSEA 5LWYL 3QI9C 1JZFA 4ZAKC 3WNNA 2OR9H 1O5PA 3WY2A 1GOFA 4FP8H 5F88A 5TDOA 2Y3NA 1TU2A 1YHPA 3PWUA 5MERA 4Q6IB 2KH2B 3L5XH 4WI0A 5DMIL 1D9KC 4XWGL 5DJ6B 3MJ9H 3WV0A 4E2OA 4A04A 1F8TL 2J1XA 3O8XA 3WNOA 4BWUA 4N5EC 4TQIA 1ETZB 5KW9H 1BQKA 2JK5A 2DM7A 4MXWH 4MJID 3KWUA 4TVUA 2X89A 1T04A 2JJSC 2UXTA 3GMLA 4GBXB 2VDKH 4CC4A 1NUDA 3GMOA 5F89B 2XIDA 3KHOA 5MEPA 2ICES 5KVFL 1LO5B 3D9AH 4P2RE 1NCCH 4GKZB 4X7EC 4X6FB 3HAEA 2X4UB 3MLTB 4Y2LA 5D2LF 4PJDB 3U0WH 4YHZH 4S1QL 4UOQA 4WWKC 4ANKA 3DK2A 1Z1WA 2NYKA 5EIIG 3VU1A 1YECL 1YN7B 2CXGA 1QYGH 3AU0A 1WCBB 1SXCA 1I9IH 3SJVB 1SQ2N 1WISA 2FEEL 3RWEB 4NZUH 3GXFA 5K1VA 3HMXA 1CIDA 1V7NL 4YE4H 3CFEB 2BSTA 3FB5A 5H35B 5C08E 5ITFA 2Y5TB 1M7DA 4P9HC 1CGTA 1Z6JT 3C5SA 3CMOH 1F6AA 3B6SB 2UWEE 3LTVA 4TNGA 5TDNA 3I6GA 1GYCA 2X5PA 2OMTA 5F7KC 4M5ZL 1URZA 2YMOA 2I9LB 1U92A 1I1AC 3SCMD 3ABMB 3VI4F 4LPUA 3QNYA 4J3VA 4AIZA 5CU9A 1H3WM 4DP9X 4M7JL 4MKTA 1GGBH 3PUUA 2F53B 4PV1C 5CEYB 3C9NA 2CE6A 2J6WA 3OQ3B 3EBAA 1ZHNA 3EADA 5C09D 4UM9A 3D25B 1OTUD 2EECA 2GW5A 7FABH 1HINH 4PRPD 2V2TB 4RFNC 5LB1A 4LPCA 5GSVB 1KIRA 4U6YB 3P77B 3VGAC 5B38B 4NQEA 4P8QA 1CGXA 2CO7B 2HTLD 5F97E 4RGMC 4IJ3B 5HYSA 2BSCA 2EZ0C 2P7TA 1IIIA 2E27L 1RFDH 5H4YA 3WGUB 5L8JB 3U0TB 1UJ3A 4GI9A 1G84A 4UTCA 2VR5A 4H25B 1PGRB 4YL9A 1MKFA 1C5BH 3RVWC 3TCLB 3QYMA 4ES8A 3L3GA 1KFAH 4UM8B 3GLEA 2WZ0A 1QPXA 2Y06L 3WS6A 2V37A 4XOBA 4UNVA 3ATAA 5I1LB 1I3RB 4AX3A 3PQYB 3HMWL 1SN5A 1WUNT 4AENA 4MQSB 2A1WL 3CPLA 3GSNL 4RAVA 5C6PB 4LDOB 4N0CC 3I9GH 3TBWA 3VD2A 5L8LB 3DX6A 3CVHH 2BHUA 3FYIB 5EU6E 4HG4J 3STZA 2GT9B 1N8ZA 3KDPB 1XD1A 3ILPB 5IIEB 1ZT4A 2J8UB 1TJIH 1IC4L 2IXQA 3CSPA 3D1MC 3TTSA 1ZS8B 2G2RB 3NCWA 4D7PA 1MCSA 3MBXH 3SBQA 2NNRA 5D9SB 4DQOL 5L4IA 1FFNB 1TZIA 3VD1A 1TQSA 1CLOL 3PWLB 3VFPA 1YEFH 1S7XB 1RIHL 1OCWL 4UQCA 1UM6H 2NZIA 1J0YA 1KTJA 3SPJA 1ROWA 1YNTF 4Z3TA 4ZTOL 4JO8A 5AVSB 4HC1A 4AVJA 1H3UA 1RIUL 2O5ZL 2PW1B 1Q1JL 2VN6A 5JXEA 4KK5C 3MNDA 4X0NA 2G75A 2V8LA 3CZNA 3RWGB 5L9DL 5BZDA 4NNXB 3GSXB 5E4OA 4NGHL 4JFOB 4EOWH 3HS0A 2AEOA 2ZQKA 2HUEA 4DFIA 4GOSA 1EXUB 3H9YA 3INUL 5EUOF 1SJMA 2ADIA 5DA4A 4Q9BA 2NXZD 1IFGA 4MB4A 5DCCA 4MCYA 1OAZH 2K6ZA 4LHQB 4J5VA 2DQDH 3VFWA 3TVMB 2L0DA 4WENB 4APQB 2DWYA 4N2MA 5BRZB 4IMKC 2DI9A 1NMCB 2JE8A 1NGWB 1ET7A 4K73A 4OAWA 3W11D 1UA6H 2NY5C 4JDZB 1WA1X 2B59A 3APNA 1HC1A 1MWOA 3TA3D 2WLLB 1ADQL 5C0JB 3B1UA 3B2UC 1BZOA 3C60A 4L8DA 3WSQL 3NRQA 2WO3B 3K71A 1QBLL 1R3JA 5DD6A 4UQDA 3ZX1A 3G5ZB 3U4BH 3S3BB 3N3EA 4HUVB 2GJ6B 3NIGF 4YX2L 3DVGA 4O9HH 1PS3A 4TSAH 4DOHB 2WAHA 3CU7A 1J1XH 1IBGL 4FKKA 3OWRA 1K8IB 2HUHA 2EIDA 4L1LA 1JFQL 4U3XA 2F58H 1GHFL 3H1ZA 4HIHB 2P1YA 1V8HA 3BD4A 3VXUB 1FC1A 3AB0B 3BAEH 4L1BA 1KGXA 2ERJB 1SQMA 3ECQA 4N3UA 1F4YL 1BECA 4MX7B 1ZXKA 4EZMA 4UMSA 3BKCH 3T6XA 4DKDC 1XGQB 4DEPB 4DVBA 4N8CL 2HRPH 2WTRA 4R84A 4R5VA 1IMHC 4HHAB 2EUZA 1E6OL 3UAFA 1ZHLA 4MD4A 3DIFB 1BQHA 3BH8B 1LO4L 1YO4A 5B3SB 1MQKL 4HPYH 3MRNA 4LCWB 4WRLA 1HHHB 1FYTB 5FHAL 3WEXB 5SWSE 5E51A 3ECBA 3N0AA 3TWCH 2VDLB 3KPNA 3VWJC 2JXMA 3IDGA 2A38A 3QORD 4Z5RA 4L2LA 3RTQA 5CD5C 2FWOB 4QHUB 3N42F 2VITA 4U0RB 5F3BA 4P3WA 4XMPL 4YDZA 5HGAB 4XN8A 1AQDA 4HEME 1SVCP 3OG6B 2C1OB 4ZMAT 1KCRH 1FA4A 1FV1B 5KVGH 2JKIS 2JQZA 3T6ZA 3M07A 1KLUA 2C9UA 4EAEA 4A39A 5HHMB 2YKLL 4U2YA 1GSKA 3P0GB 1XR8A 3H7BB 2VB5A 3HMXH 4KV5E 5F1IA 5T3ZD 4BFEA 3GBLA 5F7YC 4PJEE 3CDZA 5C0FB 3ZTNL 3EH2A 1N0XL 4WDIB 4KKZA 2CWRA 3MV01 1EJOH 4GSQA 1BIIB 4P46D 3OPZL 4QHKJ 5IB5A 1GS8A 3GUTB 1AOHA 3UEZA 3SGEI 1L9TA 3T8XB 3WAJA 2VQTA 5DVPA 1Y1UA 4U1HB 4WHTB 1DQML 2F7RA 3OHXA 4JFQB 5CKGA 2ARJQ 3O3AA 2MH4A 5E0FA 1OSZA 2A9ML 4NKIH 1LJMA 1W91A 3GB7A 3NRFA 3DK0A 3RWIB 5LBSA 3L3IA 2Z7YA 3QNZB 5A16A 1EHAA 3HG0A 4R26L 1JGUL 2I9TA 3APDA 4QRTA 3P4MA 3WNIA 1AR1B 1Q94A 5K39B 1FYHB 2ZNXA 3IAQA 4D7BA 4MS6A 4P5KB 2Y2TA 4WO4D 1PDKA 4C56D 1VRSA 4JJ5A 3IYLW 3BN9C 3GWJA 5IFJB 4RZCB 4XO5A 3VYPA 3HG1E 4HZAA 3QR1A 2BOCA 4NCDA 3CFJA 3IKKA 1UATA 1XF2B 1CR9L 2AJVL 4L23A 4QHMA 5IWLC 1NC2B 4EQ2A 4Y5XC 4KKLD 2OTPA 2B2XL 2PO6B 1BIHA 2WYHA 4KX9A 3AAZA 3FUHA 4MLSA 3RWDA 1QNZH 1NDMB 1RUQH 4QGTA 2WJ7A 5AZUA 3I6LE 2GHWB 2VNCA 4K8RL 1XT5A 3GSWB 1AO7E 2CHDA 5HPMB 1AD0A 2J3SA 4I2XE 4X5RA 1NDTA 4FXLA 4Z7UF 1UM5L 4FZEH 5J1SC 4EZJA 2PP8A 5IMMB 1CGSH 3K72A 1S7SB 1B6DA 3OB0K 4MJJA 1XR9B 2QQNL 3TT3L 2L7UA 3X3GH 1GGIH 1HNGA 4K5MA 1JWSB 4F7PA 5JO5A 4UT9L 1Z3GL 3A4AA 5BUGA 1JERA 1JAEA 1P5UA 1IX2A 4JZJC 5T3ZL 3DWTA 2CR3A 4PWFA 3TIEA 3RX7A 5GRJH 4JM4H 1AR2A 1WZLA 2UXFA 1MDAA 2X4OB 4X6BA 5GGSY 1GZQB 4E0RB 1D5IH 2Z92A 4HC1H 5F7NC 2GQHA 2X70B 3ESVF 3M8OH 2WQAA 3M46A 43CAB 4AUJA 4FXGC 5EC1B 4DJMA 2Z8VC 1D5BB 4L8BA 4W6XB 4QTIL 3CFCL 1I4FB 2NY6B 3GMPA 2XU9A 4XPTH 1BQSA 3CWGA 1T80A 4D0DB 3AGWA 4H8VA 3KLKA 2VLMD 3RY6A 2EKJA 4NO3A 3WNJA 5EG6C 4XMLH 4W6YB 1F4XH 2VDPH 3O3EB 4DW2H 1CO1A 5CEXA 2HLAA 2R7EA 3MDJA 4OGXL 3LH9A 2DPKA 3H9HB 3QCVL 1IGJA 4KROD 1PFOA 4R9HA 2CUMA 1R5VA 2YAHA 3C8KB 2ITCA 4CVZB 1SJHB 5BMFH 1P4IH 2RJMA 5AB1A 3CMGA 5DJXA 4TTGA 4QF1B 4A6YH 1IKFL 1NPNA 2LE9A 1OP5H 3PFQA 2VDNB 3MJGX 4JG0L 3LXUX 4LASH 3RJOA 2PWGA 5J13B 2DOCA 4HUUA 1O7DE 2VXVH 3DJRA 4OLUL 2CJ3A 2X41A 3VFUA 3D39B 1J9SA 5JHLH 4BE5A 4YDLC 1F42A 1E9QA 3FN0H 2H2SD 3DETC 2CIIA 1YUHA 2DYRB 4UAHA 2EAEA 1PJWA 1CXKA 5HHOA 3U1SL 1JHLL 1OE1A 5BV7C 3D2TA 1KBWA 1ADWA 1SBSH 2X09A 3QEQB 1NFDF 3EJYD 4QRPB 4GMTH 4GRMB 1OW0C 4F5CA 1LLAA 5ISZB 3H0TA 3RE0A 3MOAL 4EJ1C 1BZ8A 2JB5H 1DDHB 1S7TB 1PJ9A 4WTXA 3ZQXA 1PZ2A 2X53A 3IWVA 1MCBA 3UJJH 3WXVH 4KUCD 4CN4A 2VRKA 5AAWA 1VPOL 4N6QA 1UB5A 3F7QA 4ZS7L 2MCPH 1NM4A 1SDDA 2Z7WA 3OSVA 1OT2A 1HYSD 5M94B 5F9DC 3B2XA 5F96L 1QBML 1ZXQA 4Y0GA 5D7JA 4LSUL 3JUZA 3UTSB 1NMBL 3MLWL 2B4CC 2PR9A 3UGUA 4NIKB 4NNPH 4AQ1C 5JZ7D 5IVZB 2C3WA 4L3CB 1NEZB 2W07B 5I1HH 4OFYA 1OF0A 1AACA 3NIFB 3PP4H 3ARFB 2P48B 3OJDA 2XIIA 5EZOL 2C7UB 4M7KH 3F84A 4KH9A 2CM6A 3UPRB 2FHCA 4R0LC 1F00I 3FFDB 5GRXG 1P7QD 1Q1PA 5DK0B 3ESPA 4X6CE 5IV2B 3MV7A 4WU7A 5AL0A 2EE2A 3VG9C 4RMWA 5C7XL 4NYLA 4LCCA 1IBZA 1HOEA 2OR7A 1TTUA 9PCYA 4NUJA 5D96C 2X4RA 5CEZD 1E4XH 3ARTA 1O6SB 1B6UA 4PVBA 2EO9A 4YHOL 4Y5YC 1OQOA 3DI2B 5IW6B 3O2DL 2BCMA 3MRLB 5IZ7A 2F1AA 5E8DH 1NMAH 2YD8A 3WD5H 3SGJC 4HHGA 3X11A 5E2VH 3VXNA 4ELMF 4Z3EA 1URLA 4RWHA 5B3JE 3WUZA 5A40E 1XXDC 4Y19E 4APXA 5GGUA 1INQA 4NNYA 4D9RE 4DNLA 2HVJB 2VABB 3A23A 3TPUA 2I07B 1X5JA 3D09A 1JZHA 2FIKA 4XXWA 5F6IC 4J6RL 3FQXA 3P3SA 5DUPL 2ATPA 3TC9A 2Y1ZA 2YO3A 4FQXA 5IESH 4OD2B 5I74B 3CIQA 2WLKA 4KDTC 2FX9H 2MCAA 4AL8C 4PTTA 2YKKA 3KDMB 5D2LB 4HH9A 1EVUA 5DEZA 2JJTC 3CUPB 1N64L 3KE0A 4JQVC 4LNVA 5C8JA 3MRIB 1MHEA 4LLAA 3L81A 3R8BB 4G43B 4G8AC 4P9HL 2Z31B 4DPBX 4P2RD 3UP6A 1JCKA 3ULSB 4CSSA 3SBWC 4MCMA 3REWA 4OJCA 1J05A 1FFOB 2XBTA 3U0PB 3WE6A 3RGVB 2G3MA 4UNIA 2AANA 2YPVA 4FQ1L 1BEXA 1Y1DA 4LAQH 4YHNA 1EFQA 2OW7A 2J88H 4JFZL 2IG2H 1YZZA 2BP5M 3TBTB 5DZPA 3T77B 3REVA 1HKFA 3VI4B 2A74A 4IOFC 3NOIA 5C08D 4Y4FB 3MHZA 1LO0H 1NL0L 4NZTH 3QDMB 3SPHA 1KJ3L 1OD7A 2NXYD 4PJGA 5CFHA 4IKLA 5J12B 3M1BA 2NX5D 4U1NA 1ZEAL 4QOKD 3O45A 1K4DB 3LNGA 2XVBA 4G9DA 4YGVA 4ZTPL 4KI1A 4DO4A 5KSAB 4XCNB 3PE9A 4N2FA 2IAAC 2QSVA 3AXLA 1DVFC 3MYJA 4GAYA 2LU4A 4KRMB 4LNRB 2YRBA 2ZIDA 4K9EC 4GUPA 4XCEB 5EPMA 4BFIB 4ZI8A 3ARXA 3PFUA 5CEZL 5HY9B 2C9VA 1C8PA 3BUYA 1TZOA 5ANME 4OFPA 4GNKB 3OB8A 4ERSL 1QSFE 2PXYD 3O6KL 1ZANH 2VUKA 4FQLL 4LEOB 4M7ZB 4OCRH 4TVSa 2WVVB 3BZFA 5TQ2H 3AXIA 4LCYB 3VXSA 12E8L 1I7TB 1W6LA 3L45A 5JLZB 5I8KL 4LSPH 3D3VA 4QHPA 4X7SL 2YAFA 3K2MC 2Q3ZA 3MV9A 5FYJU 5KN5A 1MI5E 4N1EA 1IAIM 1SJVA 3OMNB 2DL2A 2X4PB 4DTGH 3VI3F 2H6OA 4GAGL 4I7ZC 3UPCA 4KMTH 3SQBB 3TN0B 2DQIL 5DQ9B 4YQXH 1E27A 3QJTB 1GJWA 4RMVA 3WELA 1HKLH 4M6AA 4MQ7B 1H3TA 5J57B 2O6CA 2FATL 5C3TA 3FCTB 4NAQA 1D6EA 3W9EB 3PXJA 1RZIA 2QVFB 3FH8A 5EU6D 1XIWB 2K4AA 1NCIA 2X9ZA 5EA0L 3VRJB 4R90H 2CKNA 2WXOA 1CFTB 2VYRE 4G9FB 1YNTB 4OCSL 3VA2C 5KOMC 3RL2A 4RMTA 3RBSA 3RIKA 1TQTA 3FSZA 3JT2A 3DTDA 3VCLA 3BRGC 4QEGA 2NR6C 1Z5YD 2AJSL 3NZSA 4BZYA 4EIBA 4Q9CA 4ENZA 4A2LA 2XJKA 1I8IB 2ATAA 4W70A 4AUYA 4TF4A 4GS7B 5EUOB 2PLTA 3ZT6A 3S37L 1JPTL 3EBHA 4KH2A 2B1OA 4LL9A 3SDCC 2FO8A 3QWOB 4PHZA 5C6TH 4DFHA 3NJJA 3TBBA 2O26U 1Z5LB 3QEUB 1NBCA 3ZKND 4I5BA 3QUZC 5A1AA 2OZ4H 3L4CA 5T1KA 4A67A 2YPLB 1ERNA 1IEAA 3SDAA 3ZK0A 3LMJH 4F9PA 1NAKH 3NSYA 1KEML 3QZPA 4TPRL 3KVPA 3KXFA 4IKKA 4B0MM 4IRJC 3WEAA 4DAGH 3HPJB 4WSJA 1X5AA 1KCWA 1BVLB 4R7VA 4UB0L 1QRKA 2XA8L 3BAYA 4N85A 1IGML 2JKJA 3GS7A 2ZXEB 1RURL 2BZCA 2WIIA 3DV6A 4WU5A 5ANHA 3VSQA 3HLKA 1JTTA 5IMKB 2NY4B 2R1XA 3CFBB 1PZ5A 3NIGB 4JFPB 5ID0A 1R5WA 5JPMA 3OKMA 1TITA 2HB0A 3ARRA 5I6PA 4I48A 4PIBA 3OGOE 4G6ML 1D5MA 3GIVA 2QPUA 3UAJD 3WKPA 2B14A 2EYTB 2D0FA 4JZOB 2H1PH 1I3GL 1S9VB 3D08A 4W9FC 1EZUA 3K8MA 3MBWB 5E1AA 1S5IL 4DKFL 2JTDA 3GO1L 4KI5E 1MQ8A 4MVBD 3BD5A 2ORBL 1DLFL 2NUPA 4K3GA 4XAWL 5BS0B 4MRCA 3VQ2C 5D5MF 1ZLSL 3LRHA 3RDTA 43C9B 4MKMA 2GITA 3H3KA 1VCBC 2CBMA 1F58L 3UMNA 5E5MB 4KUCF 5HVHC 1M05A 3WNKA 3PWNB 3BLKA 2P44B 3H42L 3UZEA 2ZSWA 3T4AA 3E3QC 2J1YA 2B1AH 1PX3A 4AQAB 3N42B 4KZEH 2DIEA 1KBKA 1F0LA 5L2JB 1IFRA 1P0SE 3FQRA 1XCTA 5SWSD 1RVFH 3GFUA 1OQXA 5DQJA 2IO5A 1S9XA 4OCXL 5LG1A 1CE1H 3FULA 1GIGH 2X2UA 3ARBB 3PPEA 3WUWA 5J9PB 4K23H 2GI0A 4LSVH 4FLOA 5EB9A 4UOJA 4RDQG 5KSUB 1FBIH 3OKNA 4OJFH 3VRIA 4U31A 4RLDA 3TBSB 4CKVX 3SGDI 2Z91B 1AE6L 1HDMB 3QUXA 5ICYB 4AC4A 2YPVH 3BC9A 1AGBA 2CLZB 3OAYK 4HWUA 2Y9RT 2HMIC 2UZYA 1MCWM 1ZV9A 4FNUA 4MZ3A 1S2EA 2F5BL 3GHEL 4QTFA 4MBOA 2NNAA 1FVCB 3BYTA 3VFGH 5B39B 4LHUB 2EIZB 2X28A 5EWIL 3EBGA 1OTSD 1SN2A 1I75A 1U2CA 3QNXA 4GI6A 5KJRL 4UF7C 3U2SB 5E4EB 3NRPA 5FUZH 4B41A 3WLWC 3F12B 5DR5H 3IMVA 1BZEA 1N5YH 2QDVA 4P5TA 3FO0H 1H3XA 4O58H 1CFSB 2MJWA 5D7IA 1J5OL 3CSFA 1Y6NR 4ADGA 4CDGC 3EZ8A 1UVQB 4NJ9H 3PY9A 2LVEA 5DA0B 4OLVL 4S1RL 5E8EB 2VZ1A 3FT4A 3LPFA 2VR7A 4F7TB 5ACZA 2JKSA 4PRBA 4OVVA 1M9WA 2GFBB 2YQ3A 3GTTA 1B4LA 3HE6D 5E2UL 5GGRB 3SDDB 3HN3A 2GUOA 3MODH 3RIFF 3V0JA 1B0GA 3BFWA 3QQ3A 3UBFA 3G5YA 1QZ1A 4LOUD 2YMXL 4PJXE 1TZHB 2CUAA 3VD4A 2Y2WA 3Q1SL 3UTTA 1SRDA 3B9KA 1HL4A 2AZUA 3V5HA 1QSEE 1G6RL 3GSNB 1WUZA 1BLNA 4QGYA 3LEYH 4QRFA 2C9RA 3VU2A 4AGOA 2R69H 4H8UA 3H56A 4N87A 4DGIH 3HS8A 3ZTEA 3PNRB 1MH5B 3HG1D 5C0BE 3TO4C 3ZHDA 4OZHE 1KYOK 4ICXA 3L9BA 4MMZB 3MRHA 2HJLB 2QDWA 1EFXA 1U8MB 2ZUQB 1UWXH 2NW2B 4Q8BA 4EDXA 1RIVH 2QSCL 4Q89A 4KKCC 3Q2CA 4JKLA 4M48L 4KK8C 4BFRA 3OVUB 4PRAA 1WBYA 1ZHBB 4OIAA 4P23A 3RPBA 4HS3A 3N50A 2Z6FA 3I6LD 4DQAA 1R9FA 2R29A 1YYMH 4XB7A 5FGBA 3HUJA 3MRCB 2WSDA 1CVRA 1E8XA 5D4QA 5FM4A 4ZYKA 1AO7D 3COOA 5D6CB 4NB7A 3VFMA 5CUSL 4JM2A 5FO9B 2C4XA 4N4YB 1SOQA 3ZYZA 2XWBB 4W9JC 4U4IA 5EEUA 1N0LB 2YAQA 3O8XC 3IDMB 1C08B 1L3NA 4EVNB 2ZUXA 1OZUA 4PMEA 5D7LA 3ZO9A 5I73C 3WFEH 2JLPA 1HI6A 2X7LA 4HJ0C 4ONFL 1AI1H 3HKFA 3F7RA 4KHXL 4LLUB 2YBRA 3ILQC 2OMZA 4YDVB 1D5RA 3EJZD 4MB3A 2OBGA 3WJLA 1KGIA 1MXGA 1SYSA 2WYTA 4HUXB 3QG7H 5GXBB 1KV3A 3C75A 3FU6A 4CC4C 1IGFL 1J9QA 2R2BA 2GKIA 5FECB 1XTMA 4OVUA 1PY9A 3MA7B 3NTCH 1NJ9B 2XN9B 5LGJA 3M1CA 5KG9A 5A3IC 2K7PA 1UURA 2NUTB 3APCA 4YXLH 3NSDA 1IAKB 3HR5B 2ZNWA 1HEZB 4NEHB 1TOXA 4XN7A 3EUUA 5G2NA 5LG6A 1K5NB 3GSOA 2HT4D 4MA8L 2R0ZH 3G6AA 5JORA 4OZFA 1U3HD 3JV6A 1OB1A 1S5HA 1IJNA 1WH0A 5CLZA 2NY1C 3LXCA 3PJSB 2DTSA 3QDGE 5FWQA 1FNAA 2WINB 1U8KB 1MWAL 2OSXA 3P73A 4KVNH 4FI8A 1P4LA 3D2UA 2XZQL 1HAWA 5GJTL 3R1GL 3HI5H 4BKTC 2YRZA 4KZCA 2OP4L 3FB7A 4OM0L 5DEGA 1LL1A 1RHHA 4HT1L 1BYNA 1MW3A 2BRRH 4WGWB 4Y1AB 5TF1H 1BAFH 2BVPB 1VGEH 4A7UA 2J6EA 3AXHA 4JL1A 5DMGC 3BWAB 4K5PA 3GJEB 2MHAB 3S5YA 5I6MA 1Q72L 3KYNB 5FWRA 4KY1H 1A4KA 4DP5X 2FT7A 2D3JA 4FMKA 4WY7L 1XVSA 1EMTH 1TO5A 4PV8A 3LZFH 4A2MA 5A2BA 1U8LB 2HX8A 4JBSA 3GS4A 2BS9A 3ROLA 4NO2B 5JNYA 4P2OD 3FAXA 3K4DA 3CAFA 4LVNC 2XXGA 5GZNA 4OZIF 5EORH 1SHMA 3KPLB 4JKPL 3RKPA 3FFCD 3VE0A 2WQWA 3Q0HA 1IGCL 1IAIL 2DQJL 2V17H 4QHLA 3VFVB 3SY0A 1J0IA 2NXZB 2WW8A 4L4VA 3UTZB 1UJ3C 5JIPA 3KH4A 4GKNA 3PGCA 1RUMH 1BYOA 1E5YA 3EH4B 3CHSA 5EIIB 1SBBA 2J5LB 4F2MA 3FQTB 4BELD 4P5MB 2Y7LA 4GG8B 3WS6C 3OKDB 1EGJA 1TQBB 2GJZA 3E6HA 3FT1A 4CN1A 3D0AA 1QFWI 4ZUVB 3NEOA 2VXSL 2NY7L 2X0VA 2P5PA 2BS8A 2E7DA 4G42A 4W68A 2LHAA 3GHPA 1VGKB 1YC7A 3DROB 1XEUA 5DJ6A 3B9VA 2QADB 3VACA 1X9QA 5DURD 1EWHA 2GTQA 1OB0A 2Y22A 3G5VB 3H9SB 1JFHA 2Y4SA 4LLDA 3ZDWA 2OK0L 1F18A 5GGVY 1R5IB 3ALWA 3KPRE 1T5KA 3WKML 4HIEA 5HI3D 1HHKA 5FB8A 1JRHL 2PABA 5EN3A 1NUGA 5LJYH 4ZPTB 5C0AE 4ELMB 1MHPL 3M1OA 4N2EA 3PWPD 1WEJH 2FDBP 3L1OH 4LDCA 5F89A 1BZQK 3NZ8B 3LZNA 4IBLT 4TUKH 3IDNA 4J1UB 2ZKXA 4G7SB 2PPCA 2DMBA 3FTGA 4X0KB 2JMRA 3HS0C 4X6FA 1TZGH 5IHHA 4N9GA 3MLTA 4AL8L 3F2LA 4PGEA 4DP8X 1DEDA 4PIRF 1CD8A 4NN5B 3U4KA 3LEVH 3S5ZA 1L7IL 1GAFH 1YN7A 4ZXBA 4QNPF 3NCCB 1F45A 5ESVA 4D9RD 4HK0B 1HL8A 2Y5EA 3V4VL 3NCYP 5HDQL 2DLTA 5H35A 1DJGA 1JNHB 1ONQB 3MLUH 1QHQA 5GGTA 2Y5TA 2YPKB 1E5BA 1U8IB 2ZOUA 2ZSVB 3HC4L 4LQFH 2H3NB 1M6OA 2AQ2A 5I6LA 3KZ8A 1HZKA 2R4RH 1IFHL 4JFSA 3R18A 1D7BA 2QVKA 2WQSA 3C60C 4MDJB 5HTSA 1C16B 4PGDA 5TDPB 4WTZG 3IRCA 4LVHB 3VGDA 1WAAF 2HLEB 3UEQA 4UINH 4KWUA 5F9JB 4Y4HA 1QTPA 1D7DA 3EOTL 5GS2H 1QFOA 1MUJA 2VJXA 5CEYA 5I8EB 3KYMB 1OO2A 1G4MA 3PV6A 3O4LA 5BZWB 4JANA 1MREL 4K5LA 1GCFA 4P46B 2DQFB 2W65B 4NQSA 2IFGA 2AXHA 5CCJA 4U33A 4XN9A 1KYAA 3D0LB 2V2TA 1AYRA 2AEIT 1L3WA 2FH6A 2VM3A 3P77A 2BVQA 3IE4A 1LP9E 1N4XL 2Y69B 4BINA 3AY2A 2BC4B 4JHWL 2CO7A 2VR6A 2YGQA 4PJ5B 4XWOC 2H8PA 3NDYE 3U0TA 1BVKB 5C92A 4H25A 3ZKMC 4F15B 1AKJB 5IROD 1UD6A 2CZNA 4A1RA 2RB8A 2FSDA 4P2QB 1RZPA 1I8KB 4GAJH 4WO4B 1GOGA 1Y18B 4C56B 5HYFA 1KN2L 3A22A 4TV3A 2V7HB 1NPUA 3D85D 2WNXA 5ICXA 4S0SD 4TUJA 3RTQC 3AMKA 5FYLE 1ZSHA 2MOGA 3IDUA 4G71B 3CFKB 2A6IA 2H47C 2V2WA 1QSFD 1JGEB 5CGYC 4GAFB 5CP7A 4RIRB 1FCCA 4WVRA 3U7AA 2F54D 2GT9A 3VI3B 3VDAA 1ZS2A 1NCDL 3ILPA 5IIEA 1MNNA 3X1GA 4DGYL 1RK7A 3S3PA 3UC2A 4YXHH 4FYSA 4JB9H 1F4HA 3QIBC 3P54A 2OR9L 1JGVL 3BSZL 2HPTA 2BINA 2XOTA 4NQCB 4FP8L 4OZFH 1XGUB 1II4E 4RNRA 1MI5D 4YMPA 4LEEA 5T3XH 5D9SA 3H3PH 3R0NA 3WN5B 4DN3H 4HS6B 1UXLA 3MJ9L 2FBJH 3PWLA 4ZUUB 4QHNA 5B1JA 4DETA 1VKXB 2EXWD 1NWPA 1YN6A 2MNJB 2A3TA 5CHNA 2IDFA 1A6UH 1OGSA 1K3IA 4N90E 4HGWB 2YA0A 2QKIA 4ADIA 2IDTA 4GRWF 5TD4A 4FZ8H 5E6IB 4NNXA 3IU3A 4JFOA 4HXAH 2V3DA 3OHXC 1JCVA 2VDKL 1TJHH 2E47A 2BNUB 3DTXB 4HD9A 4PJ7E 3HC3L 4ZO8A 3S37X 3O6FA 3RVUC 2Q5BA 3MLRL 2V9QA 1USQA 1EEYA 4D9QE 2WVUA 3D9AL 2I85A 3NK3A 1PPIA 1IGIL 4EZLA 4JPQA 4ZZKA 1M71A 1J7VR 3TVMA 4APQA 4B5EA 3HRPA 5JQ6L 2NY3C 5I0DA 2ITEA 3C6LA 3OJVC 5IQMA 5C0CB 1QYGL 2EQDA 4JDZA 3RNKB 3H53A 4CUCA 4QLRA 3FH7A 1ZHKA 1I9IL 4G11A 4NZUL 5C0JA 4YE4L 4A7QA 3FU5A 3QZWA 1T1XB 3QI9B 5HYJD 1G5GA 4ZAKB 4W9LC 3CMOL 1DJIA 2ARJB 1OAQL 1EEUA 3G5ZA 3VD5A 1SZNA 1DVTA 4WEEA 4ZSOB 4PVLA 4XO3A 2X3CA 4KROB 1EGJH 4I9WD 4J3OH 3DO4A 2CDGB 2FQGA 1K8IA 3AUWB 2CJUL 1GGBL 3BRDA 2ZWLT 4CVWA 4EKXA 1G9MH 1AQHA 2C3VB 4XCCH 1YUKB 5EBWB 3TF7C 1S8DB 2KQMA 3QFDB 2P5WE 3IETA 4AJ0A 3O11B 4KJPD 4X4YB 5CR1A 4MX7A 3BAIA 5J6HB 7FABL 4GG6F 1HINL 4RRPM 4QLWA 1T3FB 1P5UC 1SXNA 4EPSA 5HYSG 3BH8A 1JWMB 1X7SA 4NKMB 2WUBL 3L4XA 4DUWA 4Z7AA 1YEHH 3IBEA 1HCFX 5D5MB 5I2IB 2X10A 4AMXA 3EXJA 1PX8A 4PLKC 3IPEA 1RFDL 2YQ2A 4RBPH 4I1RA 1K85A 3HHSB 1BREA 3I6SA 4KI5D 2FD6H 4WO0A 3DIVA 5FKPB 2C1OA 3CDYA 4UOZA 1WK0A 2GJPA 1RCYA 1IGTB 4MQXD 4PRHE 4K3EH 1BFOA 4Y9BA 5IK3A 3RY6C 1BVZA 3E1F1 1O0VA 3BH4A 3I9GL 3H9ZA 3CVHL 3LKRA 3VVVA 1MRDH 5GGTH 1JF1B 3DX0A 1TJIL 3ZRSA 3BT0A 5DGQA 4WDIA 4N0FB 5C9JB 4ZMWA 3FONA 4Q52A 5AFAA 5GHWH 1YMMA 2IVFC 1Q9WB 5IG7B 4FAAB 3MBXL 3O3DA 2R0LL 4RA3A 2Q7AA 1J8HE 4RISH 1YEFL 3AQXA 2KUTA 4UBDD 3NCFB 1UM6L 4U1HA 2X0WA 4Z0XA 1P7QB 2DKUA 2P5EE 3B3IB 3MC0A 4JFQA 5IQNA 4J8RB 4BBWA 2VR4A 2JKXA 5AVWB 3T0DA 1NLBH 1OCRB 5E8NA 2V3FA 2VAAA 1FL3B 3PL6D 3ELQA 2N0MA 4RGMB 4C54A 4EOWL 5C6WH 4IBSA 2WZPA 1JMZA 4KDWA 4I13B 2IV9A 4X6CF 4YFLF 1PBYA 2D3NA 5G5DB 4G6FB 3GMMA 1XSKA 1JZ5A 4BFBD 1BV8A 1KZYA 2HT3C 1OAZL 3HFMH 4RZCA 1C7TA 2DYSB 2DQDL 5BNXD 1XF2A 5AAWC 4Y7OC 2PR4L 1XGPA 5D1XE 2PCFA 2HP4A 5FO7A 5CS7A 4BGDA 2XBDA 2XPGA 1MIMH 1X6LA 1UA6L 1T1WB 1U93B 2PYFA 3EO9L 4UDUB 4AZUA 4ZFOA 5HVWA 3T2PA 4X7DC 4YBQD 3N04A 5D7JC 3SE4A 2DIBA 2APXA 2WQRA 4G8GE 4D9LL 5L2KE 2DBJA 4TOYH 4EDWH 5DK2B 3Q43A 3R7QA 3QJHB 1BD2B 2NRDA 3U4BL 4L3FA 4UIMB 1N5AB 5HPMA 1DSWA 1A3LH 4RRPG 4FFVD 4H40A 1KV7A 4O9HL 4I3RH 4N24A 1RXLA 3IKCA 4TSAL 3IGKA 1J1XL 4G8FB 1QSED 3MRRB 4O02A 4POZC 3SPIA 1BZ7B 2JCCF 1S7SA 3ZGIA 1JNLH 1XR9A 1V3KA 1EQWA 1XB8A 1JWSA 5C0BD 1NDGA 4YPGB 3D3VE 4LGRB 2CM5A 4CSTA 1QEWB 2WBJA 5HDBE 3RVXC 4DK3A 3BAEL 1L6ZA 4LCCC 1IBBA 1RZGB 1BQHG 4ATWA 5J6GB 1V54B 5DJZB 4Z23A 3G9VA 2X4OA 1OM9A 2Q87A 5AW8B 4MHHG 1WFJA 4OUUB 3VSVA 5HHVH 5J1AB 3MCYA 4YN3A 1T0OA 4Z95H 4HPYL 4BD4A 2L7JA 1KELH 2XV3A 1I4FA 1MFNA 1UUSA 2EE0A 4WWID 5DQDH 3VG0H 1M53A 3NAAH 5SX4H 1MCJA 4PG9B 1S4IA 1GRWA 3O81A 2J57A 3MCLH 3OV6A 1ACYL 4E9QA 2ZKYA 5BOJA 4NX0A 1J8RA 3U1PA 4XXWC 3LNDA 1YSOA 3RX9A 2EXTA 4FQXC 3H9HA 1XL4A 1P84J 5E5LA 2GSGB 3MMEB 1TCMA 4XNBA 3UOAB 4MXQD 1DHKA 1SJHA 3NJGA 2L4OA 3HMXL 3OKOA 2WSPA 4YC2B 3RNQB 1T7XA 4KTYA 4TUUA 3RGBA 2C1PB 1EJOL 4E42A 5AVTB 5EN2A 4H20H 1X5LA 3DGGB 2KZBA 1H8OA 4L2YA 4IU2B 1E9PB 1NM9A 2Y2YA 1TO4A 5DRXB 1QAWA 4HKXB 3QPQC 2CJTA 1WF5A 1HH6B 2CHZA 1FZJB 3U2JA 3N2JA 3JVFC 3QEQA 4QRPA 1S7UB 3QIUC 4GRMA 4GLRI 2A74C 4ZUTB 1TTBA 5ALBL 5L7XH 1DDHA 2IWKA 1H5BA 4I9XA 3ERXA 3QDGD 1CTNA 3ATDA 4WFHE 2LW3A 1NC4B 2A9DA 3VWJB 2D2CC 5ESQB 2X4SB 5EU6B 4FLRA 1KULA 5D4IA 3OB0H 4I0PD 3FUNA 1J87A 3X1NA 3BP5A 1MFUA 1XSOA 2A77H 2ZP0T 4G7YH 1HJBC 1R24A 4A7GA 2WYZA 3I85A 3IS1X 3GMQB 2IQAA 1SNRA 3KD4A 3F04A 5IGXL 1ZMYA 3JV4A 1JOIA 4OZIB 4PJFF 1P7KA 1J12A 1SF3A 1L9QA 1NEZA 1PQZB 5GJSH 3WTXA 1QNZL 3ARFA 1RUQL 2BHZA 1FO0A 2D8KA 3MRDB 3NCJH 3F7PC 5J0BA 4NHUB 4TTDC 1JNJA 1AIFA 4L8SA 3WL9B 3VD7A 5LGKA 4FX5A 1QI5A 2GABA 2FJGA 1OGAA 1R34A 5JW5A 3Q6GH 3FFDA 2XZZA 1FFRA 3FUDA 4KQ4H 1FJ1B 4FG2A 3IGUA 4GW1B 4FZEL 4Z3HA 3PDGA 1CGSL 3JTTB 3LPOA 5IHUH 2GC7C 4X4MA 4F7CA 4RH4A 3X3GL 1GGIL 1AGCA 2FJHB 4LLMA 1RHFA 3W5MA 1JHKH 3L17A 1O6SA 2ZWZA 4YHMH 5HHQB 2BVOB 5GRJL 3FRUB 3L4ZA 4JM4L 2DWXA 5LKNA 4ABUA 1AGFB 1D5IL 1I9EA 5EU5B 5LGHH 4HC1L 3LN5B 3Q8FA 2CUHA 2NT1A 3N85H 2AF2A 1B0RB 3GRGA 3QJFA 2VJ0A 4XO9A 2FEEI 2I07A 4Y5XB 2YUZA 1F90H 4JKKA 4AEIH 4XPTL 3C5ZA 1NGQH 1VA9A 2P8PA 3AABA 3KPRD 4OD2A 2CIKA 2CKBL 2WP3O 5JMRA 1IQDA 1PG7H 4XMLL 5C0AD 1G6RB 2P8MA 1DL7H 1F4XL 2VDPL 4DW2L 4ZFGH 5ESAB 2YWZA 1E3XA 1THAA 5MI0C 5BW7A 2BERA 1AY1H 1AQKH 7CGTA 1YAIA 5BMFL 1WIUA 3WY1A 2FSEB 1FFOA 5DJCA 4A6YL 4LASL 3SDAC 4PJAA 4F9PC 4DH2A 3AVEA 1ZA6B 4GMSH 5SWSB 3HRZA 1CQYA 1CE6A 2C3GA 2ZOKB 4JZJB 4PBXA 3G08B 2HTKC 1KB5A 3TBTA 3VI4A 15C8H 5E5RB 2ZG2A 3DURB 5HI4D 3WHXA 5JHLL 4Y4FA 2V7NB 3FN0L 4RWYL 5EU7E 5JHBA 3QDMA 4O02H 3FZUD 2KQNA 4G5ZH 5EO9B 1AXTL 3UTTE 4XRCB 1BBJB 1SBSL 1WBXB 1VF5C 2GTZB 4L05A 5JPMC 4FXGB 2OMXB 4GMTL 3TEZA 5AOKA 3CFQA 1H8NA 4LKCA 4QJ5B 2JB5L 3CC5A 4DO6A 1T6BX 3NJXA 3RWFB 4GQRA 4PV9A 1MJUH 4HUNB 4X7TB 1FORH 3ARDD 3WXVL 4HJSA 3G6JA 4XI5D 2D7TL 4TSCH 2MCPL 4BZ2L 1JJUA 4UILH 2HFGH 1VIWA 5DJYA 1I8LA 2BH0A 3HC0B 3VRLF 3F65A 2WB7A 1GYVA 2EDJA 3VX1A 1J11A 1NGPH 4LEOA 2Y3AA 3RDTC 2K8QA 3LX9A 4DCQB 1A6ZB 4CJ0A 4F9LA 2E6PA 2P9RA 3N41F 3GZOA 2FYVA 2YD7A 2XKNA 4KRNA 5I1HL 4UAOC 3TO2B 3TU6A 2ITDB 2WLZA 4AMWA 3PP4L 5E9DE 5F71A 2EDBA 1G6VK 2PKDA 4M7KL 4Y2OB 3UZEC 3T4AC 1PTZA 3ZKXC 4FCHA 2UX6A 1JZDC 1NGZA 2XV6B 5TE7H 5EO1A 4MJ6A 1YEDA 2YAEA 1CURA 3BUIA 3SQBA 3TN0A 3MNWB 3MGTB 1OARH 3C12A 3PHSA 5LVEA 2PW2A 1MWAB 1U41A 3HI6H 1F11B 1SMAA 3QXDB 2QPFA 3CXHK 3KJ4C 1DVYA 1V05A 1J5DA 3NABH 4MQ7A 5FYLD 5GS0H 4B7LA 2ADJB 4MLIA 4PJXF 3FCTA 4Z78A 1LE9A 5IOPA 1ACXA 1BEYL 1E4XL 4AM0A 3QUXC 4EN2A 3EYVB 3QC5X 2H1LM 3V8CA 4HKBA 1J0ZA 2FK9A 4E5XA 2JF1A 5E8DL 3RWJA 1NMAL 3BVUA 3WD5L 4BA0A 1EEZB 1Q38A 5KVDE 4JHAH 1UGKA 3QXAA 3ULVH 5LO7A 3CQPA 1SHXA 4LARH 1AO7B 4KDVA 4I2XB 2P28B 2N4IA 1MW1A 3IFPA 4P07A 3MUUA 4QY8B 4U1KB 2P46B 4M1CD 4TNWK 1CMOA 2XXMB 4GKOA 4P5TC 1X5IA 4NN6C 4IM8A 5IESL