3UIYA

Crystal structure of sefd_dsca in h2o
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
141
structure length
131
Chain Sequence
b'LKLMIKINEAVFYDRITSNKIIGTGHLFNREGKKILISSSLEKIKNTPGAYIIRGQNNSAHKLRIRIGGEDWQPDNSGIGMVSHSDFTNEFNIYFFGNGDIPVDTYLISIYATEIEKAVVQAAVTIAAKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chimera protein of SefD and SefA
molecule tags Structural protein
source organism Salmonella enterica subsp. enterica serovar enteritidis
publication title Promoting crystallisation of the Salmonella enteritidis fimbriae 14 pilin SefD using deuterium oxide.
pubmed doi rcsb
total genus 20
structure length 131
sequence length 141
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05775 AfaD Enterobacteria AfaD invasin protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uiyA00
3UIYA 2CO2A 2CO1A 4OR1A 3UIZA 2CO3A 2FVNA 2CO6A 4PHXA 2CNZA 2CO4A 2CO7A 5D55A 2IXQA 2AXWA 2CNYA
chains in the Genus database with same CATH superfamily
2C9QA 3ISWA 2CAKA 3TEYA 4JO1H 3SBPA 4WEUD 5IJBC 3EXJA 2ODHA 3ARBD 3DDGA 3MRCB 4F91B 2X4SB 4HK3N 2FT7A 4KDTA 3SYOA 1UZ8A 4U4BA 2NLJA 1EEYB 5EO1A 2DYPB 2P5WA 3AXHA 3L4VA 1E0OB 1XZ0B 5D2LB 5TE7H 4BZ1L 3DX6A 2VQ4A 5JZ7D 4FLSA 3QR1A 1DVFD 1J11A 3RGBA 4AQAA 3U83A 1O7VA 2CO7A 1IAIH 3SE3A 3HUJA 1CICC 1ZV9A 2GCYA 3L3HB 1XGRA 2R9HD 3WDHA 5CCKL 5IREA 3GSQB 2WLIB 2W9DL 4FFYH 1YYLH 4FLQA 2AEIT 5C09E 2OMXA 3CMOL 4D0CA 3R06A 4FTVD 5AB9A 3ZYOA 4H2AA 5CO1A 4C4KO 1JF1B 2WB7A 4AYSA 2YAQA 3PWNB 4WW2A 4F7CA 2HFGH 5EEUA 3GMQA 2ED8A 4JFFA 5AYQA 1QSEE 5GIRA 1KCVH 5D7IE 4ZSOE 1A1OA 4YJZL 4HXBH 4J3WA 1E3FA 1ZXQA 4Y9BA 1AHWB 3V2AR 4FYRA 3VFPA 2DW5A 3QUXD 3H0TB 5E2UH 1NLBH 4M5SA 3TWYA 2NY2D 1QBMH 2VZ3A 4LSTH 3OZ9L 3VGGA 5IUCA 5FA4B 5EFIB 2PXYC 2R1YA 3EF4A 2FSDA 3IJEA 2V2XB 4NNXB 3WEAA 2B16A 3G08A 4U6YA 3KNBA 4YE4H 2OMTB 2W0LA 3D1MC 5EA0H 5C09A 4JRXD 3SGEH 2AAVA 3QDJD 2NDGA 3D85A 1MCQA 4PJAF 4Y2DA 2ZKYA 3D3VA 3MODL 3SE9L 2G75A 1R17A 2AAAA 5BRPA 1O7DC 5IHZA 4WWID 4P46A 3I6LD 4KJYA 2WMPB 4Z0XA 1HAWA 4FABH 5HHXH 2R39A 4ZFZB 3W39A 4MA7L 2HFFA 2J2ZA 4YN3A 4JZJB 2UXTA 4UAOC 1UD5A 1E5YA 1XF4B 4W9CC 1CUOA 4KGJA 1KJMB 2CQVA 4UIMA 1MCFA 3BCDA 3IRPX 4FJYA 2XXFA 4QJ5B 5CHNA 2VZOA 1TG8A 3QFDB 1SY6A 1SJMA 4P9HC 1KGJA 4FHBD 2VL4A 2XQBH 3AG2B 1QFWH 5DVNA 1BW8A 2ZCHL 1MJ7L 3QDJB 2CJSA 3QUYA 4EAEA 3CZFA 4GBXA 4PGDA 3DVGB 3TWCL 2AJYL 2DMBA 3O2DH 3HFML 4JM4L 1WS8A 3IFNH 2OJEB 2YD8A 2R1YB 3BISA 5ACLA 1NCAH 1KJVA 3JVFC 2ZP9A 3GSNA 3VFRA 1WFNA 4B95C 4L8CB 1XF1A 4ODUA 4EI5A 5I0DA 3RWGB 3ZZ1A 3MRKB 4DW2L 5KJ7E 4TQIA 4Z95L 4X7DC 1C5CH 3RILA 5EBLB 1RZGA 3CVBA 2Y1VA 1GZHC 5L8LB 2V2TA 4ZODA 3WENA 4EXPX 3HR5B 3LTVA 5FUOH 5DJXB 4OLVH 3LQAC 3PWPD 5G5DB 3PQYE 5I24A 4X6CA 3IJHA 1A3RL 1SEBB 2AJXH 4GAYB 4NT6A 3T6ZA 4IBWA 1RZFL 5D2NA 1YPZB 1A6TA 1MWAH 3ZE1E 5L9DH 4E68A 5GS2H 3QXAA 2K4AA 3SKJH 3MV9D 1CE6A 4XN4A 5DVKA 1SN0A 2Y7SA 2NYKA 1MCWM 3BFWA 1CFQA 3HMXL 4QLWA 4UTBA 3SPIA 1KJ2A 1XIWB 1WITA 1L9MA 4X8JB 2Q6WB 3X1FA 4JGNA 1KTJA 1SNRA 3DXAD 1B0GA 1BJ8A 1E6OH 2WINA 3HC3L 4TUUA 4NCC1 1MFAH 1BLIA 4X5WA 5F8RC 2QELA 3MRHB 2GEEA 1IVLA 1Z0MA 1IBHA 1Y1DA 1SXBA 4LSVL 1HHJB 1G7HB 2VC2B 3EYQD 3FN3A 1Q38A 2RQEA 4Z3FA 4AI7A 2VQ1B 2WKOF 5DJZA 3WFCH 3JV5A 1AS8A 1S7TA 2NRDA 4MS8D 3PDOA 3QIUD 2FO1A 2F8IA 5DQJB 5ANHA 3TNNA 2AXFB 1JHKL 1HFUA 5D4IA 4XI5D 2QQQA 1MRCH 5AALA 1T2QL 2AQ3A 3BDYL 3ZTCC 3OKKB 1VCBC 3MJ9H 4JRXE 4L8BB 3FU0A 3H9SE 4QRSB 2EEFA 4O02B 2P5EA 4M4RB 4G71B 3ZJAA 5J8OA 5MP6L 2QSTA 1UD2A 4ZX5A 1E2ZA 1CGYA 5JHLA 4AQ8C 4ORGA 1N8ZA 3PGDB 4IOIA 4IIQC 1KJ3H 4TMPA 4X4YB 2XG4A 4P4RB 5EDSA 4XP1L 5DLML 5JHBA 2VLMD 1NBQA 3L3OC 3C5ZC 5DJCA 3BDBA 3PGCA 2DQTH 1BPLB 3ZIYA 4AGLA 1RJZA 2IXQA 4MAYB 1Q9LB 4FADA 1NFIA 4P59L 3D25B 2WQWA 4IKNA 3GBNL 1QYGH 2ICEC 2QR0A 2EICA 4X4KA 5IVXF 4YC2C 4QHLA 2NXYB 1FVEA 1EHNA 4QWWC 1DHKA 2VR5A 3HZVB 3LEVL 4HEMA 4YO0B 3N41F 4Z78B 4YBQC 2DQEL 3V6OA 2IGTA 2AS5M 2VERA 4JZNA 1JD7A 4IJ3B 4K9EC 5IVZB 1DQDH 3MREB 3TZVC 4QRTB 1E50A 1U95B 1RUAL 4JY6A 2VDML 4U6TA 1KPRA 2F5AH 3AS2A 3F58H 4GO9A 5KSBE 4ZOCA 5JOFB 2HTKD 3I3BA 2AKRB 1DO5A 5I1EL 5HHNB 3A22A 4UT7H 4Z7OE 4NBZB 1FYHB 3GMRA 1U0QA 1UJTA 5CP7A 3ECVA 1OAZL 1FYTD 3ARZA 1E4KA 4WU5A 2ZWSA 1MJUL 4MJ2A 3T2LA 4GG6F 3PWVA 1PEWA 4L9LC 2W59A 2D7TH 2A4ZA 4WWKC 4TL5A 5DDHA 3WHE0 1XCTA 3DDFA 4UQ3A 5DT1H 4ZAKD 3RY4A 1O5PA 5GGUB 5I8CB 3C5XA 3GSXB 3VFGH 5GHWH 5CP3A 2GAZA 2JJTC 2Q3ZA 2WLYA 2EECA 4OSUL 1F4AA 2R2CA 1RZJL 2OP4H 3NFSH 2PYEB 4AEIL 5DEJA 5T1MB 1EGJH 4P0DA 1BX2A 3SGKC 2IH3B 3U4EA 3UAJD 4B9CA 3TJHC 5HDRA 3SHSA 2R51A 4UTCA 3PNWA 3NQKA 1JHLH 3AB0C 4ZAKC 5IQ7H 3ATDA 3PNWB 1DO6A 3WHXA 1OW0A 4ZTOH 3US1A 1RJLB 3MXWH 5MEPB 4W9JC 2ZZUT 4I0PB 4HUWA 4M9OA 5ESQB 1U2YA 2E8ZA 2GK0B 2WWMC 3HZYA 4AVJA 4U2ZA 4XNYL 1E9PA 3FTGA 4HJIA 4YGVB 2J4WH 4JPWL 2C9XA 5FGBC 4HP5A 3V4VB 3VXSB 1PD6A 3VFOA 2E76C 4PIBA 4PJEE 4HWZA 3KWWA 2W5PA 2HTKC 4FG6C 5JHDB 3HS0C 3BCFA 4Y9CA 2YUVA 3AG3B 5J12C 3ZYIA 3BUIA 4DUVA 5C3LD 3TZVD 1M7IB 3CWGA 1E5CA 3IMBA 3SYAA 1KYFA 4KJQD 2N7SA 1U8HA 3IFNL 1MAMH 3SKMB 4ICWA 4XCCL 1INDH 1BV8A 1COBA 2XQ0A 2QQNL 3LH9A 1NINA 2DLGA 3OWRA 2IEPA 4IRJC 4NGHH 3ZT6A 4LAQL 3T1WA 3U1PA 2PCXA 5F44A 4BBWA 2EIKB 3UEZA 5BOZG 3ECWA 1S7UB 3MCKB 4PJXA 4EI6A 3B7UX 2ESVB 1N5YH 3O6LH 5DFTA 4LSRL 1JK9B 1KN4L 1HHHA 2F19H 3VSVA 2HG0A 5JTWA 1ZXKA 1I9IL 4JUSA 4GAJL 1KT2A 1RZFH 2WYHA 1N64H 4UIKH 5EZOH 4AH2A 3P4NB 1IJNA 2WVSA 1I85C 2DKUA 2MKLC 3AQZA 1LGVA 4QHLB 4G6JH 3FSVA 1CLCA 3QUKB 4OLXH 3RWEB 4HJ1A 3VFTA 1C7SA 3V6OC 1RZJC 3FSZA 2VLKB 4F7PB 1D5MA 4GRMA 3MRFB 4RFNC 4PGBA 3MROA 4RZCB 4N4YB 3S37X 1SOXA 4KK5C 1T03H 4LDOB 3IBOA 2IDTA 4XBEH 1BWWA 4YNYB 1JZJA 5AW1B 1WD9A 2BCKA 1A7RH 4X5XB 3MRQB 4XPFH 4TTDC 3Q43A 5KBLA 5F0LB 2KLTA 4OFYD 1TEGA 2XZAL 1XTMA 2GY7B 1BXVA 2VDKH 3TJEL 3EYQC 4R7NB 1G7JB 1MW1A 2J8UF 4PTTA 4A2MA 2HT2C 2JIXA 3DHUA 1B88A 3REVA 3EYVB 5K9QI 1WAAA 2JB6B 2YD5A 5F9DC 2VDMB 4L48A 2YAOA 2DLTA 4ODXB 2WO2B 4TTGA 1E30A 3Q5OA 2HJKA 2YUWA 1DJIA 2FQEA 2DQDL 4AGPA 4L18A 2FWSA 2WCPA 2GSIA 1H15B 4MXWL 1N3NB 4JFXB 3ZTNH 4QKXB 4LVNB 2O6DA 4LARL 3RJOA 1XXDC 1TSHA 1A0QL 2W9DH 2YPLE 3DV6A 3UZQA 3VFNB 5FM5O 4HGWA 2HMIC 2LT9A 3LD8B 1EZLA 1DBKH 4POYA 3B1UA 4M03A 2DDQL 4AZ8B 5GGSY 1KG0B 4M93C 2X2JA 2BVQA 3QNZA 2WLKA 4K7FA 4HJGA 3D85D 1T0PB 2NR6D 4JANA 4PREA 1B3IA 4PRIA 3RNKA 1VCAA 4Y19B 2YIHA 4L5FL 4JX0A 4XXCC 5FAAA 2YEVB 3L3JB 3B3IB 3SO3B 1AGFA 1D5XB 4BSWB 1QNIA 4DO4A 3OL2A 4RLDA 1J7VR 2CMRL 2GK2A 1DDTA 1JGLH 1FNGB 1R3JA 1BVNT 4HCIA 4UTAA 5IWLC 1QR1B 1DE4B 3EHBD 2YEZB 3DUSA 2NW3A 4L1BA 1NANH 4GW4A 1XX9C 5AKSA 2R2HB 1BAWA 3DJ9A 2EDMA 3FT2B 3MX0A 2FSEB 4AMKL 5EORH 1DLHA 2VDQH 4LDCA 2XVLA 4L8CA 1YEEL 3QUXB 5JUEL 4P04A 5BRZA 2BVOB 2ESVD 3HNVL 3BPOC 4U1SB 4DN3H 2CR0A 3DMMB 5EZIH 2NNCA 3SKOB 1LWHA 3GRWH 5DSCB 1DBML 4S1SH 2LR4A 4K7PY 2BJML 3ZDYE 1DJGA 1Q94A 5IR1A 3UTSE 4KAQL 4MWFB 1MH5B 3H42H 1SJHA 1CL7H 5EO9B 3ULVH 5FECB 2HRPH 3IDGA 4DQAA 4XCFH 3L2LA 1A6AA 1AFVH 4D3CL 1T4KA 4GQRA 1JZIA 1BMZA 2MOGA 4BHUI 4MQTB 5ADOL 4PJBB 5FUZH 5JOPE 2EXYC 2ARJB 5I1LB 3B6SA 4IK6A 4DF9A 1XB6A 5FYLD 5JOEA 4MDRA 4B27A 1WCBA 2C8NA 5ABAA 1WUNT 1DFBH 2XA8H 1NCJA 2CZNA 3MGTB 3SO5A 2GUOB 2BHZA 4ZMYA 4HPHA 4XC3H 3D3VB 3P11H 5F7LB 4OZHA 4G6FB 3WKMH 2AP2A 3RKDD 2NX5B 1N6QL 4AEEA 3KBFA 5T5NF 4PJCF 3MNWA 1JJUA 5EF2A 3ELAT 1G7IB 3DETD 4JG9A 2GJ6B 4OFPA 3RU8L 2A9AA 1MNNA 4LSPL 1VFBB 2CNYA 4AKQA 1MWAL 5CJXA 1KCSL 1IAMA 1WP6A 5D96B 5IW3A 5CKAA 3VRIA 4KK6C 1PZ5A 3RZCC 3AGWA 4W4OC 3FTZA 4LKXB 1KBVA 3VD1A 2A83A 3EH5B 4KJWD 1TUPA 5E08H 5D1ZA 2XJLA 5FECA 5JZ7C 1FV1B 5C0CE 3MPCA 3FUNA 2EDBA 2G75B 4RWHA 1E6OL 1KWGA 4JO5A 4ILDA 3TV3H 3UMNA 5TTRA 3UBXA 3LH2H 1ZCRA 1W0WB 2Y06H 5TDNB 3LSOA 1QEWB 2CLVA 2UZXA 5CIPB 4JBSA 3Q44A 2BNRA 2I32A 3MRLA 4N8CL 4PJ5D 4OIFA 4ZNEA 3QXDB 2R56H 1L9PA 4HW6A 3VXQB 3D39D 2VRQA 2YAMA 2C1PA 2AGJH 5AVZB 5KANG 2X6VA 3AY2A 3UTTD 2GBTA 2C4FT 4NN7C 5HHOB 4KRPB 5T1KD 3VG9B 4ALAC 1TJIH 4LLVA 3RVXC 3SZ6A 5INCA 3OR6A 5HHVH 2HH0L 1DE4A 3CVHB 2HG5B 2CO6A 5ALBH 4B9PA 3VXMD 2NXYD 3CMGA 4XNQA 4XNXH 3DBXB 3MV7A 4Z5RB 2ALAA 4UV7H 1ETJA 1KFAL 4UU9A 3VXNA 3ZKMC 2OULB 3FTWA 3P0YL 5C08A 4AJWA 3VWKB 2FH8A 2VDNL 3LD8C 5DEZA 3QWRA 3MRMA 3HZMB 4JREC 1F6AB 3O3DB 3RVWD 3MBED 3DROB 3X3GL 4NZDA 4PRPA 3OC8A 1EPFA 4X7EC 3VFMA 4ANKA 5GS1A 4BFOA 2B0SH 1WFMA 2W88A 4IRZH 1A9EA 4CGUB 2DQUH 2ZF8A 4TSBL 4UINL 4XPBH 3GO1H 3JV6A 4PV8B 3S4SG 3UPRB 3GZKA 3MDJA 2UWEE 3NIFB 3HE6D 5CN3A 1CVRA 3INOA 4MJID 1T04A 2DQHH 5FF6A 4NYLB 2H6PB 5LQBL 4AY0A 3MV7D 4WTWA 3FH7A 2IADB 4U3SB 3WMSA 4DP1X 1KIRB 4K94C 3WE6B 3C60A 4XNAA 2EDWA 3GHEH 4RA0C 3SPVB 5BQDA 3RWDB 3UC0L 1L6XA 2OA9A 1YY8A 4QXUH 3REVB 4HFWA 3C6LD 4UQ9A 4B53A 4UQBA 2X6BA 3DOSB 1M42A 3OXSA 2MCMA 5KVEL 3FT0A 4CVWA 1PG7H 3OXRB 4DGYH 1BEXA 1NJ9B 4R96A 4HS6A 1FZOB 2BMKA 2WKGA 3L4UA 2B4CH 4J6IA 4NPKA 5D6DA 1BWMA 1U8OB 4Y4KA 4KHXL 2JKLA 4JAMA 2BS8A 5D1QA 3H7BB 4PQXA 4KZDL 4LL1A 5DJDA 5J1AA 1T5XA 4U1JB 1F3DH 2IV9A 3HBQA 4OCNC 5FYJD 4Z3JA 5C0CD 2AXGB 2W80C 3NPSB 3NAAH 3VG0L 2V8MA 2WXFA 4YZFF 5D72L 3CN4A 4A6YB 1EV2E 3FFDB 3BHBA 1PSKH 2WBKA 4GRLD 3WV0A 4FL4B 2PYEA 1JV2A 4GAGH 1WBZA 1F4XL 3BJ91 2VH5L 4HDIA 3BAIA 4U0QB 4W9IC 3VXOA 4Q9QH 4HPOL 3OX8B 4DVBB 5AW2B 2WK2A 3L7FB 3NABL 4IDJL 1HZKA 3KPLA 3WTXA 4OJDH 4AE0A 3LS5L 1AO7A 4OBSA 2ERJB 3FXIC 1IIIA 3H42L 2VXVL 5F7KC 1NAMH 2AQRA 1AGEA 1T83A 2A3TA 4L8SA 1T0OA 1CXLA 2R0WH 3Q6GH 3UOAB 1M2VB 4CDHA 2RFXA 1NCIA 2XWDA 3FCTA 4UDTA 2JJWA 1G7LB 4P46C 3RE0A 4FNTA 2AHIA 2DJSA 5BQ7B 5IB3A 2VDLB 1IZKA 5GS0D 5IVNA 1CICB 5GJSH 1A7PH 2IANE 1KBGL 3VI4A 1MWAA 2GI7A 1R33A 3MI6A 4DKAA 3DRTA 5F0PB 1JK8A 2WC7A 2YC1B 4Z3GA 5HYJD 3CFKB 1QSFA 1TKWA 3CXHJ 4H44C 8FABA 4PP2A 3EJTA 4BEIA 4OBRA 4K2UH 4X8JA 4E42B 1U95A 4Z7UE 3B2UC 4C8XA 1I8KB 4PJIF 5E2WH 1JPFB 1PQZB 4YIQB 1XV8A 2CRYA 5BRZE 4JQIH 1MFEL 4WY7H 5E6IA 2H1LM 5JXEC 3D7PA 4MD5A 4XBPB 4YDKH 2NCEA 4UU9B 3QRLA 4Q74A 1N5YL 2DQJH 3QIWB 5A2FA 1NC2D 2ZOKA 3KGUA 3TCXA 4U6XB 3L9RB 2VLRE 3LRGA 4XVJH 2CSPA 4MCYB 4PJAB 5D7LB 2OW7A 4X6CB 4OF7A 5SWZE 4YHYC 5HHOD 1TU2B 2UX7A 4X98B 1I9RH 1TYJA 3BVXA 3G3LA 4XP4H 1UTDA 4RMVA 1YECL 1IM3D 1N4XL 2YD6A 3CDGA 1VACB 4L3EA 2MJWA 4NENB 3ATFA 3APNA 3RGVD 1CL7I 1SEQL 3TT1H 3JBG7 2GQHA 3F05A 1Q0YL 3O6FB 3RAJH 2XWZA 3CSBA 4KBPA 4N22A 2JB5H 4ELKB 5AW0B 2UY7A 3QDHA 4OZGB 3PGDA 2EYTA 2DBLH 1FF5A 2WUBL 4GSRA 4JHAH 4ORZC 2CKBL 3X12A 1JMXA 4LLAA 4XPFL 2WZAA 1B2WL 2FHBA 4S2SB 4PJHA 4QUOA 4ETQB 5ISZB 2WW8A 5J3HC 4MDIA 4TLKA 5JA8B 3FK3A 2MCAA 1OGAA 3SGJA 3IB4A 4H1LA 4DTGL 3DURB 3NQIA 5SV3A 1LD9A 2R2BB 2WXKA 3MYZA 5JIPA 3PL6B 4AWJC 1CZ8H 4ODBD 4E0RB 4CC0A 2VQ1A 5DJZB 2XWBA 1RHFA 1V8HA 3MRBB 4HX1B 4MA1B 3I9IA 3QE5A 4K5OA 3O3AB 3HNSL 3P30L 2NNRA 2XZCH 1WRFA 3IFLH 3L3IA 5DYOB 4F1SA 4TPRL 4OJCA 3JTSA 4HPYL 4J28A 1PF3A 1P84K 4PLKC 2BHUA 4G1EB 4XNZC 2X28A 4PRID 4BFJA 4AG4H 2FJFB 4ABWA 3ZDYB 1PZ3A 4TNWF 1KY6A 3OB8A 1YO4A 4ZO9A 2BIMA 2ZIDA 2DWEB 1NA8A 4EUPB 3ZL1A 3B7YA 4FYQA 3TH2T 4E9LA 3QQ3A 2OSWA 4H5SB 3C09B 4W93A 4KI5D 4O5LL 4BZ1H 3O11A 5B7MA 5D71H 2DPKA 1T83C 5D7EA 4F2ME 2CA4A 3LOWA 2OCJA 4X6BB 4YS4A 4AEHL 2G30A 3AXIA 5I1HH 4IBLT 3HNTL 3UBHA 2AC0A 4JFFB 1HL4A 3QJZA 5EU3B 2QGBA 1JWSA 4J3OG 4N2OA 3S0PA 4K5NA 3ESVF 1OVZA 4JCWA 1ASOA 5M95B 4W9EC 5I30L 5AOIA 5DEFB 4MXQC 5DSCA 4ANWA 4F58H 1T22A 3HZ3A 3QIWA 5HHMD 4Z0BH 3QJHA 2GJZA 4I1PA 2ZWKA 2JI2A 1NBCA 2UXFA 3BKJL 5DJYB 2IGFL 5E6IC 1A5FH 1DQJA 1CB4A 1SY6H 1KCUH 4XC1L 4AQAB 1AKJD 4UT6A 1DBMH 4LLWB 4DGYL 5BMFH 3RTQB 4FFZL 1THAA 3QXUA 2CRIA 3K6DA 5JLZA 1QD0A 2ZWNA 3UBXI 3MJ7B 3NACL 5DJ8B 3NIDE 1WUZA 2X7LA 2FIKA 5CEZE 5LAPA 4MNGE 5EEZA 1S7SB 1MF2H 3O41B 3MN8A 1EHLH 4AIXA 3AS3A 3UEQA 4AMWA 1DQLL 2FX8H 2X6UA 4J3OH 4PWKA 1CLYL 4ZUUA 3EH1A 4NEHB 4NKIL 5IESL 2W0PA 2K7QA 3QI9D 5B8CA 3SOTA 4ZUWA 4G9FE 3BZDA 3L2MA 2DL9A 1A64A 3FFCA 1HWWA 3S88H 3I2CH 4YFDB 3BP4B 3QNZB 4K7FB 1UM5H 3VMNA 3WFBH 2H1XA 4KKBC 4RSYA 3BIKB 1CBJA 3IPEA 4PGEA 2EDKA 4FQ1L 4BK5C 5CCKH 7PAZA 1LO4H 1OAYL 2DIJA 3ZRFC 3L3DB 5E24E 3REWB 4JL2A 4CC4C 2IMNA 2ZPKH 4OGZA 2O5XH 3K6NA 2YKKA 4AM0B 2EZ0C 3H7BA 4GMTH 1JAEA 4CSPA 4F8PA 2NYZA 3VXMA 5F8QC 2YQBA 1HILB 4UQDA 3SKOA 2OMBA 3W1ZA 12E8H 4AQEB 3O2DL 2BIIA 5IQ9A 2Y5TB 3RDTB 1ZAGA 3ESNA 5L2KD 1NFKA 2F9BT 3C6LC 1RZKL 1EAJA 5IW1A 2NTFB 4CW1B 3BLPX 1RPKA 4XNUH 3X17A 2WLIA 4I13B 1NGXA 1B6DA 2OW6A 4WFHE 3WN6A 3TJPA 3L5XL 4TNWK 3WEXB 2XNAA 2GIMA 4P2QB 1SF3A 2JJTA 3RWDA 3KS0H 5H35B 2ESVE 2ESVA 4PJDB 1I8UA 1U58A 3BH8A 4OGXH 3QO0A 5CIPH 3SPCA 2ATKB 3STZA 3QHFH 5CWSB 4OM1H 3ZL4L 2BIOA 3STLA 2IQ9H 3ZVVA 4MJ6B 1KV7A 1W91A 4CGTA 3EOAA 3KCPA 2GB2A 3BJLA 2Q3AA 1G9MC 4OTXH 3HS8A 2R4SL 1G0XA 5D1ZD 3KBEA 1QPXA 5IEKB 1ETA1 5JW3L 4R5XA 1MFMA 3L9BA 1J9QA 1NL0L 5F2FA 4EVNA 4EUPG 4LESA 3HG1B 1JXFA 3QK0A 4OZ4B 3ROOB 3VFWA 2HH0H 4FA7B 3QUZA 5BPPA 3RB7A 5LLIC 1BP3B 3OX8A 1RHHB 3B2MA 5HPMA 1SOKA 4BXVA 1FZKB 4KDWA 3WD5L 3AB0B 1LE9B 1I4FA 3VJ6B 1N0XL 2HKAA 1P9MC 3KXFE 2P80A 1E27B 2HUEA 3ZDXE 5ITBL 2VDOL 4WUUE 4NQCE 3RVXD 1DN2A 1LL1A 1QVOA 1XF5A 3B34A 3H2PA 3HFMH 1A3LH 4JM4H 3ML9A 1EBPA 2EYRB 4X5QA 5LKNA 4HZAA 3KPRE 1T4WA 4QYOB 4IRSD 3MCLH 4GUPB 4IRJA 2AQPA 3MUUA 4KFZC 2HCZX 4EKXA 3A4DA 3V5HA 3BRDA 2PYEE 3VH8G 1H19A 1FL3A 2JKIS 4BRVA 1J0KA 3SDAB 4FZ8L 3QR2A 3KXFD 1YJDH 5SX5H 4W6XB 3JV4B 3DOSA 3UERA 3CHXA 3LXUX 2IWFA 2NY6C 3CFKA 1PZUB 2ENYA 2Y2TA 2E59A 1MXGA 3TCTA 3TU6A 3QARA 3OAYK 3V9EA 2WSPA 5I73C 1I3RB 4GKNB 3MRFA 3GS4A 2JIXD 3O9WC 1RJLA 2DM2A 4CMHC 4QMEA 3KCWA 3VGAB 4XP6L 1NGZB 3O6ML 4NLAA 1A65A 3Q01A 5HI4C 4DPAX 3GXFA 1A7NL 4WO4C 2VB5A 3FSOA 4X7SL 3HMXH 3K80A 3NJKA 5JOFA 4L05A 3MJ6A 1FFOA 3VYNA 1LEKB 3PGFH 3BPNB 3RVUC 2J5LB 3GIVB 2NY0D 3HC3H 1NEPA 2YRLA 1LNUB 5I16A 4YK4B 1CD0A 2IOIA 3WIFB 4E41D 1WSST 2AABL 3DOHA 3U6XS 3GSNH 1MUJB 4JRYB 2OJZL 4XNBA 4WTQA 4MD4B 4C56E 1GSMA 3EH3B 1T66D 1Q1JH 3POHA 4GG6B 2EQDA 3GKZA 1BVZA 4LOEA 2GUOA 3T9WA 2ZONA 3GNMH 3R18A 1INQA 5IOPA 2W07B 1R5VB 3RLSA 2EXYD 4B97A 2YD4A 4XP5L 4M8VA 2TSAA 3LNEA 2GSGA 1UUSA 1L9RA 1U8MA 3I85A 4KMTL 1IM3A 4JE4B 1M05B 4GPVA 3CBKB 4PJDA 2R0ZH 4G42B 2R23B 5IVZA 3ISRA 3EJZC 2WQRA 3OAYH 4TM9A 1F4YH 2I24N 2ZKMX 1LO2H 4ONOA 2VO8A 1A6AB 4PWFA 2XQYA 2IPTL 3HZYB 4C59B 3CLFH 4RH4A 3GSUB 4DEPC 1JF6A 2YWYA 4JRXB 3QNFA 5TDPB 1P5UC 2A6IB 1IQWL 3TL5A 1S9WB 1F42A 3QEGL 4GSDH 4N2EA 2OSXA 3CSYA 4HS8L 4OFVA 4ODHL 5EU4B 1OTSD 5E2TH 4L2LA 1RUPL 1C5CL 1ASPA 4ZUVB 5C3IA 2M2DA 3V5DB 3UADA 4XNYH 3O2VH 1FZKA 3DO3A 5E0QA 1KDIA 4FP8L 4FXKB 2OTUB 1GS6X 5K59F 1IGIL 5FUOL 4NKQB 4RIRB 3Q2WA 2FB4H 2Z35A 3FTYA 5EBWA 1MCPH 1AZUA 1KCRL 1B0GB 2QSCH 3EKCA 3T8XB 3UO1H 1C12B 4A7GF 4GI6A 1HHIA 3L5JA 4LF3A 3SO3C 3NJFA 4Z8FH 2J88L 5D5MB 5IK3B 5K9KA 1UG9A 3CFBA 1CIDA 4U31A 5GRJL 4XMLL 1UJ3B 2J1KA 3VWKD 5HVGB 2VN4A 3QJHB 3TLRA 2O6FA 3ZPDA 4YSQA 5C0EB 4XCCH 3BSZL 1YEDA 2NY1B 1B90A 3B9KB 4R5TA 2GG1A 1QP1A 3ASWA 2QSVA 3FBKA 4P3CH 1ZE3H 2HVKB 4N6RB 1JMZA 3VW3H 3WJJA 2D31B 2R69L 3V4UH 1QBLH 4JFFE 4WSKA 3K71A 1XEDA 2G5RA 2QVMA 3EBHA 3MTXA 4RGND 5JORA 2HMID 4J3SA 4DAGL 5I19H 1AQKL 5E6YA 2D3VA 1BZ8A 4XMVA 3KWVA 5DZJA 3FOMA 1THCA 3HBPA 3VVWA 1D9KC 3PP4H 3D50A 4M6OL 1TLMA 3MRKA 4ADGA 4W4OA 2BNRB 3MRLB 4U7KA 1K8DB 2Y2WA 2F7RA 1PAZA 4NLHA 2EDOA 4PJXF 1DDHA 5JDJA 4XR8C 1HINL 3KYKH 5KVGL 5I8EA 4U1KB 4X4XB 2ZUQB 1O6TA 1KXTB 1Q9LA 3T4YA 3UTSD 2NNAB 1JXJA 2PCPB 4O4YH 3IM1A 2X89A 3IRZA 2AZAA 2E7DA 2KH2B 4N0FA 5LNGA 4M00A 2GI0A 2YOCA 2GTQA 3LKPA 2PR9A 2UZIL 4PUBL 1AR2A 4X9HA 4X4YA 5EF3A 4QNPF 3UCQA 3VWJD 4H0LC 5FFGA 4P5SA 4EDWH 5CR8A 3LRKA 4W6YB 2V3DA 2YBRB 1UWYA 3K6FA 1T7VA 4BYHA 3BPLB 2EE2A 4A2FA 5ICYB 3A0OA 9PCYA 4LKCA 4EKJA 4IBVA 2QLVB 1V3KA 4F3FA 1OT1A 2ADGA 2JKSA 4KMQA 5IJKC 3AQXA 3CFEB 2HRGA 5AKVA 1AGBB 4FG4A 4Y9FA 5FM4A 1U8PA 3JWOL 1G0DA 4JM2F 4WRLA 4ONGH 3AUVA 4JQXC 3IFOB 5C7ZA 1G7HA 3CXHK 1AY1H 4PGZA 3SYPA 5ID0B 1KLGB 2AF2A 3EHBB 4K71C 1BG1A 3OJ2C 1BIHA 2ZX9A 4FC3E 1RY7B 1CXHA 1V7NH 4R8WH 4K0OA 4FZ8H 4IBYA 2XUWA 5HHPA 1WTLA 5DHDA 2Z91B 4OZGE 1U36A 1MZZA 4WI6A 4ZW8A 4KTGA 5I6NA 3VXRB 2ZUTA 2XHNA 1VZHA 5I30H 2KHAA 3LRHA 1N2RB 1GZQB 2KUTA 4LHQB 1S7XB 2QQLL 4IKKA 1OP4A 2MNJB 3ILPA 1FCGA 4XP6H 4I85A 1PD0A 4HQQH 5D7IB 4WLCA 3V0JA 2FD6H 1ZLUK 1JFQH 1G4MA 1NPUA 4LEBA 4UDUB 3NZSA 4KXDA 3HE7A 4PJAE 4RMQA 3HI5H 2VLRB 3U0TA 5IFJA 1RIHH 3S5ZA 2XFXB 1HHGB 1K6QH 4YVNA 5LGYA 4EQ3A 2HKFL 4S2SA 3LNDA 4G72B 7FABL 2GUYA 4GKNA 3U1SH 3EDJA 3LIZL 5EU3A 3PV6B 4LNVA 3IJEB 1VZGA 1HXKA 1OTUD 2EH8L 3BVTA 4U1SA 2EDQA 1J0ZA 1UWXH 5BRZB 1XCQA 4KTEH 1KLFA 1TZOA 3F83A 2R29H 3EJJX 3KVPA 3WTUA 2P5PA 2WNXA 2WWNA 4PV1C 3AGVA 3WTVA 4JN1H 4N5EC 1HWHB 5MERB 1AS7A 3MA9H 4PTTB 5JHLL 5LGHL 2HTLC 2P5WB 4JM2B 4RAVB 2GHWB 4X98A 2CIIA 3MKGA 3JTBA 2NW2B 1B3JA 3IDNA 1OCWL 4X6DA 4Q58C 1EMTH 1NIBA 4A37A 1ZRUA 1UM5L 5DJ2A 2CCWA 1WS7A 4KMTH 5CBEA 5CKGA 3IJSB 1J18A 1AYRA 1YEIL 4XWGL 1WFOA 2G60H 1S78C 1Z9MA 1KELH 3QORD 4NIYE 3KM2A 4TLSA 2QMKA 2HRLA 1A1NA 5LVEA 3P4MA 1I8LA 1R1CA 3J07A 4F7EB 1KTBA 3P3TA 3D08A 1BQUA 4O2CA 1U8CB 4QI3A 1EXUA 1TJGL 5D2NC 1EX0A 5GGRY 1A6PA 3D2UD 3QEUB 5DTFA 2P5ED 4PJ7F 3VNZA 3QYMA 1GMIA 1LQBC 4GSDL 1MCIA 3Q9PA 4Y4HC 4OKVB 3IDUA 5FCUH 4BQBA 2QQNH 3BZ5A 3HMXA 3WE1A 5ICZB 2YPKB 2XTSA 3MNDA 3DSFL 3MLYH 3UG4A 1AYOA 4JDTH 5HHNA 5DHYA 1KN2H 3WKML 3K74B 3T3PB 5KSBF 4GQ9L 2IFFH 2XXCB 5GSRB 4PJ8C 1MRDH 1MFBH 1HJCA 5ENWB 2FWLB 1J8RA 1QHPA 2AV1A 4PM1A 4OCRL 4QRTA 3U7YH 3EIFA 4D7PA 2M83A 3MZTA 4TF4A 1F2QA 3MNZB 5T1DL 4BKTC 4KNUA 4XN2A 1PLCA 4QOKA 4QWWD 1G7PB 4PCSA 5MEND 1CYWA 3WXWH 3SOBL 1D9KB 4NUGH 4X0KA 1G7JA 5HDWA 1HIMH 1IBGH 2ZCKL 3CZEA 3L1OH 5F7FA 4KVNH 2HP4A 3S96A 1W9XA 4TS6A 2WGNB 1YSOA 2KT6A 5JXEA 4FNQA 1V7MH 2C34A 4OT1L 1CDHA 1N9PA 4J4PA 4WHTA 5F89B 5JHDD 3O3BB 3VM5A 3I84A 3CVDA 1A47A 4NCDA 1B9KA 2NQDA 4RMTA 4D0CB 5T1LD 3WFZA 1ZS8B 3SDDD 3HN8A 4QXTB 3THML 4PBDA 5E8EB 5I15H 2C4XA 5E6SB 5BVJA 5I1IL 1G94A 2FJGA 3HN3A 2NOYA 5HDBE 4R26L 1OLZA 3LDBC 1TF4A 1FRGH 3AY4A 4WUUB 4RISL 4TNVK 4KQ3L 4E42A 2AEOA 3ZDXB 2VDOH 2XN9D 4R90L 5IV2B 3P4NA 1ITCA 3CN3A 3DROA 5FUZL 2LVEA 3UXFA 3SIKA 4J7RA 3WJMA 1UQSA 3CDZA 3NEXA 4MS8C 1A3ZA 3T6WA 2O5NA 5ENWA 2OL3B 2ZYSA 3RBGA 2HZHA 4O58H 2BX5A 3LZPA 2EXWC 1T3FB 2P28B 1WBXA 3HG1E 2WWKO 5ABDE 4KKLC 5C0ND 2WJ5A 4UQCA 2C9PA 1KGWA 4XNXL 2VDLH 5INDB 2IO5A 3PWVB 2CBTA 1D2PA 5BVPH 3DX8B 1QQDB 3MVSA 2XCMC 5KYWA 2FWOA 1GKOA 2ROXA 1BYPA 1RURH 2WXRA 4P23B 3GHPA 5BJTB 2X4RB 3U0PB 4Q9CA 2O93L 4HOWA 4K3HA 1XGQB 2X3AA 3PWPA 5EU6B 3LB6C 3MLTA 2I9TB 4P06A 1GZPB 5E7FA 3JWOH 2KPNA 1J05A 1HI6A 2IOMA 4WSJA 3QORC 5DUMH 1HKLH 2PP9A 2B5IB 2IAAC 2D2OA 1TCRA 2FX7H 1YN6A 2G4GA 2QV2A 2ZOWA 1P7HL 1KENL 1CXIA 2DH3A 4DW2H 2MPVA 3UIZA 2HJLB 2WVVA 3GSOA 1U33A 3KPSB 1QA9A 4FTDA 2IJ0C 5BUGA 5E9AA 3DBXA 3WAKA 4NI3A 2R83A 3BSHA 1NFDA 5C0JA 5CEYA 2H7WA 4CVXA 4H7VA 1DVQA 1L5GB 3DLQR 5IIEB 5AB1A 3U4AA 3D4ZA 1ETZB 5A2AA 2M26A 1NKGA 3RTQD 1T1YA 4X9IA 1OIOA 4DFHA 3NESA 4CILA 4LKXA 4PJFB 4RGMB 4A7UA 1J1XH 2C1OA 3SGKA 5FYKE 1VJSA 2BINA 1WIPA 2X4QA 3CSTA 4TXVB 5DU7A 5E4EB 5EBLA 4L4VE 5C70A 3FN0H 4AYGA 2F54E 2BFVL 2KERA 3U6RA 3B9KC 2NZ1A 4KKNA 4BFGA 2UVEA 4LEOA 4N1HB 1NCBH 2BP8A 4BZ2L 3BP5B 3GFUA 4KO5A 2V5SA 2YPVL 4XVSL 3U1SL 4Z7NF 4IBUA 4QR7A 5C07D 4Y4FB 3D3VE 4JJ5B 1NAMA 5LG1A 1UB6A 2XX0A 3TYFB 4U6VL 4AT6B 4KTEL 1AC0A 2CHDA 4QRRE 3GINA 1EUUA 1TQTA 1JCKA 1P6WA 1JZ8A 2FNBA 5E51A 4BRJA 1NCUA 3MA9L 3BXNB 4EN2A 4HKBB 4OAWA 4YLCA 2G9HA 3FB8A 2FR4B 4FQXD 3CHOA 2AK4A 2IH1A 1MWOA 3GBEA 3VI3A 3QUMA 3O2VL 3MNVA 2AJSH 3PQYA 3EFFA 5HGDA 4HJTA 5DVMA 2G60L 2VXQH 1Q94B 5IR1B 2CJUH 5ID0A 5H4YA 3VCLA 2FB4L 2FEEI 2EUVA 3RWCA 2ICES 2JXMA 2OXGA 3O6FC 2NY2C 3G08B 2WO4A 4JRLA 1OF2B 1ZHKB 2SEBA 3BPLC 1N59B 3C8HA 2C5DC 2FGWL 1L0XA 1J0JA 1SEBA 4NT6B 1OSPL 4GW5A 3B6SB 5FO7B 5C6TH 2PW1A 3HUJE 1EUTA 4Q89A 1X7SA 3VWJC 3I6GB 4YVUA 1H8LA 3FU6A 3QEQA 4IOIB 4N8VA 1MKFA 3GHBH 4W9FC 4JPVL 3N40P 2XA3A 1QBLL 4AQZA 2PABA 2F1AA 5C0IA 4MLIA 3T6QC 2XFXA 1XD0A 3WLBA 5FDWA 2B4CL 4QY8A 5FDWB 4X9BA 1ACCA 4XPAH 5F70A 3X3FL 4OCRH 5AW8B 3DGDA 2R9HC 3U7YL 2QGEA 4MX7B 2RQ8A 2CU9A 2ADFH 3IGAB 4TV3A 3V4PL 3WY1A 2V7HA 2VABA 4IOSD 4JG1H 1LO3L 1HYSC 3NZHL 3Q6FA 2IDCA 5I1EH 5KSAB 3KMDA 4E9QA 3VRIB 4G6ML 4XXWA 2ZP8A 3RHWK 3UAAA 3V4VH 4MA7H 1V7ML 4XXDB 4JQXA 4XXDA 3O8XB 5HHVL 1LEIB 3RTLA 5H4ZA 3ROOA 4PH8A 5EO1B 4PUBH 5KVDL 1R5WB 1PKOA 3S2AA 3S8FB 3B83A 1HH6B 1G7QA 5TH2B 3DYOA 4X6DF 2UZYA 3VA2C 1B2WH 1HT6A 4KJPD 2PP7A 2QQKH 4L3AA 4QRRD 1CTMA 1JXGA 5LUMA 4L8SB 4QHKJ 1ZPLA 1FRGL 3KPOA 3U30C 3HB3D 3TX4A 3UTQA 4RWYH 5L0QC 2RH0A 3DSNA 3RX8A 3TM6A 1KIPA 5FYLL 5C0IB 4JG5A 3X3GH 1AIFB 2EDYA 4OGAC 4M7JL 5TGBA 3C6LA 1MRCL 4P2QA 2RTTA 5B4MD 3HR5A 1C5BH 4HBQA 3WOVA 1TZGH 1B4LA 3GO1L 4KOBA 3VU2A 2PPCA 3QG6A 5D9SA 3LKQA 2NNXA 1DBBH 2F54B 2VN5A 4ZO8A 4CW1A 3PABB 4NO5A 3AS0A 4P5TB 4HKXB 3E2HB 1OTSC 2GIYA 4YLQT 4J3XA 1AHWA 4XHJD 3R4RA 1WAAF 4OLVL 1H3WM 2GSIB 3MC0A 3VGHA 4ZI8A 2GJPA 3CFIC 1M1XA 5DK3A 4PV9A 1E8XA 3U9UB 2VLKE 3A6CH 2WLMA 2Y3NA 4D0BB 4F8OA 4WNSA 4LP8A 2RBLA 1TMQA 4RX4A 2O5ZH 3GSUA 3DA0A 5DVPA 3EJZD 2P5EE 3V79C 3MO1B 3GMLB 4XPHH 5AZ2L 4F20A 2P47B 4PRDB 5E4EC 2JKXA 1OP5H 1DJYA 4NWTH 2PUQT 3MLPA 1PZAA 5LBSH 3TH3T 5GRZA 3G5VA 1A25A 4HKJB 3VDCA 1IE5A 1T1WA 3CSPA 1KCBA 4PS3A 4Z7UB 4ODWB 1HNYA 4PB9L 3MRQA 2B20A 2HFFB 1OZTG 3DX6B 2WQVA 4XVUC 5EPMA 3ARDC 2VDPB 3S3SA 2VDMH 1T66C 2AJUH 3V6FB 2Y7MA 1I75A 4ZMOA 1FSKC 2X4PA 4OCLC 4Y0GA 5JPMC 4ZUUB 2DWTA 2IANB 4Y4FC 5CN1A 3DX7A 3NAAL 4Z7WE 3GT6A 1MAKA 4Z1PA 4ZT1A 1NAKH 3WFCL 4WWKB 3ZTJG 4XN7A 4AE1A 4H40A 2NY0C 3D09A 1A5FL 1MJUH 1S9XB 4OLZH 1FL5B 3EGSA 3N6YA 5FYKH 4HPYH 4LU5L 3F6JA 4GAAA 4PJEB 5DUBA 2LU3A 4Q2ZB 2XKNB 1QPKA 1SXCA 5DRXB 1NWPA 2DYSB 1A7RL 1NUDA 4WO4D 2C1OB 1RK0B 3APCA 5HI4D 1CDBA 3HC2A 3KLSA 2OZ4A 5IBLC 1F3RB 3O0RL 1IE4A 4M61A 1OK0A 3GI9H 5GXBB 4M43L 1HCFX 5FHBH 2J25A 3K5RA 5HDBB 4G43B 2IH8A 5LN4A 5D7SL 2NY6D 4L4VB 5LWYH 2ZJSH 3SDAC 3KGRA 2A9DA 4WO4A 1UH3A 1WTGT 4AIZA 1S5IH 3ZXAC 1CVSC 5T1MA 3PV7A 3VXQA 5FYJU 5CAYB 5I73B 3V52L 5FKAB 3CPLB 2K4WA 3BGFB 5I76B 4J3UA 2VR7A 4PBVC 4MQ7B 1BVLA 2F5BH 2FNWA 5J89A 1OTTC 3L08A 1HZLA 4WO4B 3WEOA 2D0GA 4PS4L 5JA9A 5D7LD 3D69B 2NY4B 4XT1C 3T3MF 4BQ8A 4EI0A 2OZNA 5IFJB 4IKJA 4P5TD 3IETA 2LGNA 1YEHH 3S98A 2I60L 3P40A 1MHHA 2BP0B 4DQOL 1OALA 3ZL2A 4OFDA 5L8KB 5CF3A 1E90A 3ABLB 4NQDA 1UD4A 3M1BA 3NIFE 3QORB 4XBMA 1TLKA 3ATBA 4PJEF 2VR6A 3SD5A 2WJ7A 1XF3B 3E1F1 5KVFL 2JTYA 2QPSA 3K6SA 1IV8A 1IGCH 2RIKA 3CU1A 3T0AA 3ESOA 1PDKB 4HS3B 1BF8A 3KYOB 1Q1PA 4QOKD 4B7LA 1Q9OB 4MCNA 4HT1H 1C1EH 2Y1ZA 2EKJA 3OLIA 5FX3A 4AEIH 2XWEA 2A4EA 1T5XB 4U1JA 3ULAB 4A2GA 2YSSA 4LVHB 3ZYZA 4DOHE 3MOBH 4D7BA 1Y07A 3S4SA 4QJ4B 1BOGA 4JPIB 1IUZA 1IEAB 5TK2A 1J5CA 5I9QB 5KN5A 3B7TA 2X4PB 3ZUCA 1I53A 2OL3H 3P30H 2AMGA 4EZLA 2PPAA 3OAUL 3STZB 3BWUC 3O3BA 1NOFA 1OP3H 2XXMB 3GRWA 5IEHB 3N50A 5F88B 1T03L 4DN3L 4KZCA 1M71B 4A66A 3DX0A 3LNFA 1CE1L 3O9WB 3MV8B 1MW0A 3US0A 4DEPB 2ETWA 4RBPH 3WEXA 1L9QA 3FO2B 1D9KA 4GKZB 4NENA 2HX9A 3DXAA 5KTEH 4GUPA 1L9TA 3SE6A 1C08A 5EF1A 1PEZA 2FBRA 4YDIL 5CD5C 1N10A 4KXBA 2CIKA 2WXGA 1H9VA 4WUKH 3ZR5A 4DGVH 1C16A 4QXVA 2W0FA 4IU3A 4MJJA 2WXIA 4B6ZA 5DUPL 5DQJA 3TNNB 3BPNC 5TQ0H 2TAAA 3QQ4B 2ZOKB 4O5LH 1HDMB 1C5BL 4YQXL 3QZOA 1ZANL 4APQA 1MVFA 4HHWA 1BLNB 4KKBD 4MXWH 3FPYA 4NGHL 5BXFA 2CPUA 2DI9A 3UTPE 4POUB 5DHEA 5EDXA 5FKPB 1X4YA 2X5PA 3T3PE 3NIGF 4UTAH 3O6LL 5IKCA 4G8EA 4HHAA 5F72S 5TGBB 1FVCA 4GB9A 4YE0A 3U36A 3PS6A 1FIGH 1BVKB 5E23A 2V33A 4QT5A 2NY2B 2ZYHA 4EIGB 2CD0A 2J55A 1N64L 4ADIA 3D48R 4M8QB 1Q9WB 1JTPA 5CLYA 1U6AL 1M2VA 5D7IA 4HZ1A 4UANA 3KWTA 3ZW3A 4F7MA 1ADWA 1FLRL 1JZEA 3EGDA 2CG9X 1BAFH 1KCUL 3QDMD 4XC1H 1WHPA 3CC1A 4W68A 4K23H 4YBHA 1KB5B 1RU9H 1GGBH 4MVBD 1H3UA 3OR6B 2JCCF 2VISA 4OR1A 1ZVNA 5AOZA 1C12A 3TA3B 4OY9A 2X05A 4QRPB 1IBBA 1CXFA 1II4E 3DRQB 4S11A 4YSCA 3TV3L 1KGCE 1OAXH 2JMRA 4Y7OC 2FBJH 4WV1B 2ZCLH 3OLEA 1ZE3C 5E2VH 4Y1AD 4JHZA 5HJGA 3JQOB 5EIIA 2VT0A 5DJ6A 3R8BB 2DKMA 1HDMA 3IFOA 1N3NA 1U30A 1Q1JL 4PW9A 3DVFA 5E56A 3E8UH 2Q8BH 2E75C 3VXMB 2P5WE 3P0GB 4GXUN 4XVOA 3TV8A 1NGPH 1KTDA 3A5VA 4M62H 3CK0H 1FPTL 2C26A 4N0YH 3S88L 1GH7A 3FT1A 5HYSA 5DJAB 4JRXA 3N06B 4XVTH 2AJSL 3WKQA 2E46A 3DTDA 1ZIAA 2XY1A 2YN5A 3SODB 4KI5C 3IKCB 1MG2C 2H0JA 4UIMB 1ZPUA 2O5XL 4PJ5B 2IQAA 1DLFL 1BM3H 4JZJA 3O4LA 2UY6B 5E8OA 5FYKD 5E4IA 2IAMC 5ADOH 3MV8D 3NJGA 4OKDA 3TIDB 5DO2C 5I2IA 3Q8FA 4V1DB 4PVNA 4OGAD 5HVWA 2NNAA 3UGXA 1PZDA 1FFQA 3ZN6A 1PX3A 4G80B 4HK0A 1JV5A 1DQIA 1JFHA 3MLUH 3IDIB 4A38A 1SDDB 1AIZA 4HJJH 5KVMC 1JYWA 4F5CA 5C9JA 1N12A 4ZPVB 1R5WA 2F1EA 3D51A 2VO5A 4KJPC 3EFFB 1DSYA 1VEOA 3E6HB 5HGDB 3L5XH 2P1YA 1BQLL 5F7NC 4UNUA 1CFTA 4FQHA 1G5GA 3ISYA 2YD2A 4KI1A 4ODSH 5AVVB 2H2PD 3RG1C 3HZMA 5GS0H 2O1AA 3BAEH 3TBTA 4GXFA 1MCLA 3BFQG 5D7JD 5DEGA 3FOLB 1ZTMA 1C7TA 2PNDA 2R7EB 3O6KL 5CJOL 3OAZH 4OTXL 4K3DL 3MQIA 2A74B 1CDCA 5HYEA 2XT1B 4C83A 1YEEH 3KJ6L 3CZUB 1UHVA 1UB6B 3STBA 3GEWB 3IJHB 4ZMZA 3R06B 5C09B 1H3TA 1QHQA 5IK3A 4PI0A 3QI9A 4OIAA 3P2DA 1V05A 3L7EA 5T5FH 4XTRD 1J88A 5GZNA 4LSTL 3FCSA 1HQ4B 4LPUA 4LNRB 4WHDA 1PNDA 3IXAB 2B9BA 5AWNH 2AJZA 2VYRE 2ZSWA 3LQMA 1HN1A 4FNPA 4JHWH 4WTZG 5M7QA 2R56L 3ZHKA 3AREA 4PJFF 5C2BH 1BPVA 2EJ1A 1KXQE 1WWWX 2P8PB 5CP3H 5F1SA 3VACA 3QZNA 3GM8A 5D1QD 3RPKA 3OG4B 1ZLDA 5CCJA 3HE6B 2L8AA 4YC2B 1VPOH 1EXGA 3K8MA 1P5UB 2XX1A 3PHOA 3S3CB 2AQ2A 1ZDQA 2E9JA 4PR5B 5JHMA 4QRPE 1S3RA 1T7WA 3HBZA 4WDIB 3ILQC 4YSSA 1I1FB 1OEZW 4LL9A 4C56B 4NO2A 3ARVA 5BS0B 2OMUA 5I1JH 4D9LH 2WWOA 5E99L 4K9JA 3E80A 3FCGA 1YEFH 3VFWB 3P54A 5TDOB 1KCSH 1W15A 6FABL 1IO4C 4JVPA 1X44A 3ZHNA 1CICA 2ISDA 5HY9B 3WFHB 2CRZA 3B7RL 5IB5B 3P9MB 3PHSA 4DP6X 5AG8A 1RIUH 1UJ3C 2IAND 2X9YA 4YDJA 5E03A 4WY7L 3QQ9D 3QHZH 3APDA 4LCWD 2PPFA 3MJWA 2JVUA 2ZP0T 1RZ7H 3BGFC 4ODXA 4F33B 2YGOA 1A6WL 3W9DA 5J13C 3HHRB 3V6ZB 3WJJC 3K2MC 3B9KD 4JGJA 5ICYA 2AABH 4WJ5A 4MAYD 3P77A 4WCYL 3BZEB 3X11B 1ZGLP 3OZKA 3ZE2F 4QXUL 5ECGA 2JJSC 5JHDE 4PVBA 3UMTA 3TBSB 1W8NA 3Q3GA 3RWFA 4DGIL 3PXHA 2AXGA 4MYWB 5I1KL 2FD6L 5ITFA 1W0VB 1DVUA 1GGTA 1JN6A 4OD1L 1U8MB 2XXGA 1SEQH 3TT1L 5I1DA 2BSDA 3EFDH 3T4YB 1J5DA 4MAYA 4HCRL 1WJ3A 4MDJB 3OVUB 4KQ4L 2FX9L 4DT2A 4M6MH 1WC7A 1P7QA 3OPUA 4LK4A 5D8JL 2J1WA 2KLRA 4ZXBD 4P4RA 4EDWL 3QS2A 1I8MA 2DOCA 3UAJA 2DD8L 4GIAA 2V9TA 3KPQA 2N01B 3FQWB 4P9ML 3EUDA 2X4RA 1ED3A 1CZ8L 4QIRA 3SBWC 5C7XL 3SE8L 3BO8A 4S1RH 1GOFA 4HS8H 4G59C 5DD1H 4DOHB 4ZBJA 5C0RH 4UT6H 3GF8A 1AHMA 5FIEA 1D6EB 3NEOA 1AQ8A 3W38A 2XZCL 3UJIH 5K1NA 1JXDA 4P23C 3WIIH 4IMKA 1JTOA 4KX7A 2E47A 5CD3B 4UCFA 3T4AB 5GGTA 5FUCE 2NQ3A 3FH8A 4NXKA 4UWQB 3EJCA 2QJDA 2FZ3A 3MNMA 5F21B 2G3MA 5EU5B 4Z77B 5KYXB 3RNKB 1OE2A 1KJ3L 4Z7OB 3QFJE 3WLWC 1JV2B 1CU4L 1CBVL 5A16B 3QUZB 1LLAA 4PD4J 4K71B 4E9XA 1BCIA 1ILSA 2Q1EA 5GGRA 1TTRA 1WF5A 1OT2A 5I66A 2OYPA 2OMUB 1TZIA 3HR6A 2YLKA 3OKEB 4NNPL 5DA4A 3LKRB 5FCUL 3EGXA 2Z4QB 3K91A 4KITB 2I7SA 5GZOD 2YK1H 4IIZA 1VADA 1WFTA 5DS8A 1IGCL 2RALA 4B0MM 3BH8B 2RD0A 4DAGH 2E7LA 2E56A 4H2CA 2F0CA 1UOWA 1DQDL 2XKSA 3FW6A 3T2PA 1MCOH 5CZRA 2OR9H 4HT1L 2EDDA 3QUZD 2XV6B 4HIEA 2WNGA 1XIWD 1KV3A 2HX7A 4JLRB 2C1PB 1NCWL 3AAZB 1EFXD 5TF1L 5J1TC 2ADYA 2JQZA 4K3DH 1WBYA 3JT0A 1FI8C 1BZ9A 2ZAGA 1I8IB 3AMLA 3F7VA 5A6LA 1FDLH 1QLRB 5A40E 2XZQL 1L3WA 4JFHD 4DGUA 1F4XH 4I48A 2BIHA 2GITA 3D39E 1MREH 1R5VA 3AT0A 3LPPA 4PRBB 2D7TL 4RMBA 5AYTA 4DVRH 3S4SB 2CWRA 1VFMA 5CFAA 2ZSVB 2ZF9A 1FH5H 1I1AB 1NDMB 1NPJA 2GT9B 1T7ZA 4OGYH 5DUJA 3MV01 2R0KH 2QTVA 1QHOA 2VZUA 1CG9B 4XXWC 3ECBA 2F08A 3WMPA 4YDLB 4MNGB 1E40A 3KEDA 3A4FA 4BQCA 2D3LA 5JNYA 2BS9A 3P9WB 4G7YL 3NZ8A 1N5AA 1DYZA 1NCAL 1YY9D 3CFNA 2UUDH 5B8CB 3MOQA 1RZIB 1OPOA 3FAXA 2IPKB 3FUMA 4NB7A 3T65B 5HPOA 1I9JL 4KUCD 4S1DC 1IX2A 2X88A 3O3UN 3PIQA 5EUKA 5FOBB 3MBEB 4C58B 1YMMD 1MIEL 3N1QC 4FI8A 1S78D 1C9SA 3NSCA 4JFDB 5F1NB 2RHEA 2K78A 4GKOA 2FWUA 2Q7YA 2KI6A 5HDQH 3MRJA 3LZOA 2AQSA 4XVJL 3LRMA 1FIGL 4K3EH 4HG4J 5LN8A 1TNMA 2X4TB 3BUDA 1AZBA 2C7UA 2AJ3B 5F9JB 2UY7B 2VJXA 4GW1A 1U3HA 4ODVL 1RZ8B 5T1DH 3AT8A 1ES0A 3QWOA 2GIXA 4IMLA 5CJBA 5AFAA 3E6FB 5J5EA 3MACH 3VXSA 1WG3A 4N5ED 4A04A 2C3XA 3GSVA 4QXGL 1W0WA 1WGOA 4K5LA 4WEMB 3F7YB 3NFNB 1XO8A 5DHVA 3FO9B 1OK8A 2PWGA 3EYOA 4RQQB 4R4FH 1Z9PA 1OL0A 2EDRA 2OMXB 1G1YA 4U1KA 2JV6A 2Z0BA 4EDXA 1KY7A 1KBWA 3ZKXB 1WIUA 3B5HA 3ECQA 5ACZA 4XOBA 1R24A 2EEAA 3KPSD 5C0GA 1R47A 4LHJB 4A2LA 3I6GA 4CL7A 2X1XR 5FR3A 1XGRB 5IHUL 1E3ZA 4AK1A 3D2UA 1ZTXL 1V3MA 4L2YA 2MCPH 3P4OB 1ZT1B 1CD9B 4ODTH 2VJ0A 4JFHE 5EG6C 1JI2A 3ILDA 3BEVA 3QAZC 4OLXL 1J8SA 1J86A 4EN3A 1VGEL 2IALA 3DX3A 1T89A 4A6YL 4HV8B 4EEEA 2HJFA 3N55A 5JDSB 2JE8A 3ILEA 5C6WH 4HSCX 3L6FB 4YHIA 1UWXK 1IKNA 3MRCA 1FFPB 1UKSA 3ARDA 4KQ4H 1VSCA 3ZZSA 1MFCL 4DKEL 4BWTA 2Z34A 3CZLA 3WGUB 3JWOC 3FU5A 2H32A 3IDIA 4HFUH 1B0WA 5FB8A 3SQBA 5T3XH 2IALB 2VR3A 4AQ8A 3CLEH 1JZGA 2Y72A 4ZAKA 1G4RA 5FC9A 4ZW3A 2XG5A 3CDZB 4NO3B 4Y2OA 2X4NB 1F4WH 1TTCA 3G5VB 4F2MA 2CGZA 1TNNA 3Q8AA 4KZEH 3NP4A 4PLJC 1MELA 4UT9H 1RUMH 3Q5YA 1AR1C 3RPIA 2QDVA 4FRWA 4MBOA 2YUXA 2XWJB 3C87A 1P6FA 1QRKA 1UXLA 2Y5TA 4P9HL 4OW6A 1K4CA 1QAWA 2IOOA 4X6FB 3D25A 3ML8A 5F7DA 4TRPH 1E4XL 1X5HA 4PGDB 4UUJA 1OD7A 2W9EL 5CJQL 12E8L 4L1TA 2YA0A 3WXWL 4FTVA 2QTEA 4E41A 1RSYA 2YWZA 3BKCL 3G9VA 4PJGE 1OM3H 4XHQA 1DUZB 1ORSA 4KO7A 5IJVA 5JR1L 2IGFH 1OAZH 2CBMA 4WU7B 2K0RA 1UA3A 2GTWA 5I17A 2PCYA 1IZJA 4H8HA 2BFVH 4PLJD 3LMJL 2EE3A 4ZNCD 2L7JA 4HGMA 1TTGA 3DUHA 4RX4D 4PLOB 2ZOOA 5KSAD 1NCTA 4JW3A 3B9KA 3G6DH 2DI7A 2HPOA 3VXME 1EK3A 4YBLC 3FL7A 2R2BA 2YXVA 4NPJA 4XBGB 1D7BA 3EGXB 1OD9A 4NN5C 4XE0A 1NCCH 3GLZA 4JQVC 4N0UE 1FVCB 3VWKC 5EORL 2DQGL 1YZZA 4YR6B 5BV7H 1QSFE 4DN4L 5J6GA 3RIAF 3BYYA 2Z31A 5EFIA 4DH2A 3K1DA 3KS0J 1HHKB 4OM0H 1QLFA 5JIDA 4P05A 5FS5A 1USQA 5F0JB 5DD3H 4E5XG 4JFED 1TXKA 5CZVL 2YRBA 5K9QG 4IRSA 1OW0C 4L1SA 4OZGF 4B5EA 4LCVA 5F96L 1D3CA 2VDLL 4WVRA 1JZHA 3WD5H 2E9WA 1OAYH 3AABA 4HC1L 3FMGL 5LB1A 1R3LA 7CGTA 1KTLA 1RURL 3GMNA 2CIKB 3LZFL 2APSA 3D69A 3MKKA 2YGQA 3DVIA 2Z1PA 1JWSB 2YLHA 3AC0A 4LZKA 4ZW6A 5I26A 3FQUB 2GKIA 1IBZA 4ZK8A 1HKFA 2AITA 1F2XK 2R23A 1KENH 4K5PA 4HVBA 3NTCH 4PU2A 2CO2A 1E7UA 1AMYA 2O6CA 3NCCB 1ES0B 3QWOB 4MJHA 5DF0A 1OO2A 4WI0A 1WV7T 3Q9QA 3QHZL 2MPAL 3U1QA 4LLDB 3T4AC 2Y7NA 5FDYA 5I1AA 1F3DJ 4HUXB 1ZEAL 1D5MB 1AP2B 4LIQE 1IT9H 3HOGA 3VGAC 3UAJC 4NQSA 2AXHA 3ZDZB 4TUKH 4W9HC 3B56A 4M1DL 2A6JB 2J88H 3MLWL 3F6IA 3DVNA 1DL7L 1R5IA 3BSZA 1FFRA 3HCVA 1SJVA 1BX2B 1XL6A 3HW7A 5EU6E 1A7NH 3DWTA 3FO2A 3IE9A 4Y5VA 1N2RA 2A6KB 4XN1A 1JVKA 2Z1KA 3TFKC 4O2EA 2A6KA 3MV8E 4MHHG 1YY9C 4JKLA 1WE5A 4ZS7H 5F88A 4BH8B 2YHGA 4R4NC 3RVUD 3ZE0E 3EO1A 1IM9A 1BMGA 2ENSA 1R5IB 4P8QA 1LILA 5TE6L 1XGYL 3CFQA 3M1CA 3ZYJA 3MUGB 1I7ZA 3CUPB 1FLTX 3KL5A 1S8DB 4G8IB 5A2IH 4DK3A 3R1GH 2WLLB 3ZDWA 5IB4B 2ZQKA 3RUGF 4NBXB 4XO3A 5ITBH 2HB0A 3BDXA 1BQ5A 3IJ7A 3V0VB 1AZZC 2ZT9C 2ZXGA 3STLB 4NDMA 3WNNA 4ENEC 2NUTA 1N70A 3EO1B 2YOAA 1HL5A 4UT6L 4H20H 2GBAA 1OXYA 1F3JA 2QBWA 1LO0H 5IB2B 2DQDH 4HH9B 1IU1A 2AK4D 3C08L 4Y16B 4YBQD 3VFOB 1UEYA 4ZMPA 1W72H 2OMZB 5K1JA 3ATEA 1UCBH 2QPDB 2F53D 3FT4B 3ZE0F 4HD9A 4DKEH 3UYRH 4JPQA 5CS7A 1IAOB 4MCMA 5J4MA 2NTFA 3ZO0A 2RA1A 1O75A 2N0KA 5GS2D 3ASOB 4XCYB 1CU4H 4OZFB 3UROR 1L0YA 1JN6B 3U7AA 1KIRA 2CGRL 5FHBL 3EDEA 1Z3GL 1KXTA 2B59A 5EHFA 3T0WA 5AW9B 4MLSA 5I8EB 1YEKL 3QDGA 3U9UA 1HC1A 4LHUG 3OJDA 1K4CB 2HJLA 2WVVB 4OUOA 5L88H 4NERA 3HRZB 3GB7B 1IAKB 4NKDB 5GZOC 1XWVA 1HI6B 2F7QA 4HOMA 1WZLA 2DQUL 4XPBL 5HYSG 5C08D 2COQA 1JRHH 3G5XB 4FQCL 4I3RL 3SJVA 2VMJA 3FCSB 2QKIC 1B4TA 2EC9T 2P24A 3PP3K 2YC1A 1YYML 3BT2L 1V7NL 3WY2A 4HWBH 5CJXC 4DP2X 2VERN 5TF0A 2V7NA 4OJFH 3UO1L 3SDCD 2P49B 2UWEB 2VDNB 3BYTA 4ZMAT 3NEEA 1GY2A 1PL3A 3QH3A 5JPNC 3WLWD 1AOHA 3S35L 4G6MH 1ZLWK 4YWGH 2NX5E 1XTLA 2VSMB 2FO4A 3A6BL 1DSFL 3BPCB 2I07A 5DZ9A 4Y19A 5EH1A 5IOKA 3FS9A 1WT5C 1QSEA 5HYJE 5I0ZA 5AOLA 1ACZA 2DLIA 3B2VH 1FZMA 1IC4H 1UURA 1AVAA 3PF2A 1QFOA 5AB0A 1E43A 1HOCB 4Y1AE 5B1JC 4AJYV 2DLEA 1XIWA 1CD8A 4AENB 3ZHLA 1XR9B 4R97B 5CCHE 4PJBE 4A7TA 1FH5L 4DKFH 4N0UB 4LIQL 5AUMA 4WNJA 4M3HA 1EAQA 2X3CA 1A4JA 1AMXA 3GI9L 1ZT7A 3VXSD 43C9A 2H3NB 3DXAE 4ZXBC 4TNFA 1H5BB 3GMMB 5EWIH 1SYVA 3CQPA 2CBOA 1T80A 5B38A 5BV7L 5DMKB 1MW3A 4M7JH 3BQUA 3N1MC 3GLDA 3LQZB 4PJ6A 4P4KB 3P02A 4O4YL 3WS3B 4I5BB 2N56A 5I17B 1CE1H 1TZAA 1XAUA 1KB5H 4MQXD 5CNHA 5D55A 3V52H 5BCAA 1SUHA 2G3NA 1YEIH 2CBPA 4XWGH 3E6FA 1H6UA 5G4MA 2P5EB 3M07A 2VXVH 3FUHA 4QRUB 4QRSA 1TYRA 5EOQH 4LBEB 3NCJL 1IFHH 3LQZA 2AV1B 3I50H 5DRNA 1QX1A 1E5UI 2BVUA 2ZCHH 3B9VA 3QJQB 4NRYB 5AAMC 4EZJA 4Y2DC 1KTDB 4WO0A 3E7JA 3P73A 2VLLA 4NFBA 1ZHKA 1KXVC 2AEWA 2HT3C 4N2HA 1OAQH 4R0LA 3P4LA 2KL6A 3GSWA 4JFDA 1LP9F 2VWEC 1HNFA 3F65A 1J5IA 4HA1A 4N26A 1G1KA 2OCFD 3I9AA 4X7FC 3TYGH 3SDXA 3MJ7A 1G6RB 2Z7YA 1HOCA 2EC9U 4H8PA 5AL8A 4AGNA 3DIVA 5F97E 2GEQA 4HKZA 5DLLA 3R4DA 3M88A 3MAWA 3AWFA 2R2HA 1MFEH 3E9TA 1F8TL 3HHSA 3O45A 4PRHA 2CXKA 4MXVE 5IGXH 1AIFA 3K81A 3UGUA 5KSAA 5E8NA 3CHSA 1WGVA 3D0VB 3EG9B 1FUNA 5L2KA 1SDDA 4NOFA 3KXFA 5E6ID 1EEUA 2ZYIA 5DJ0A 5DK0A 1C8QA 2W38A 1P5UA 4Y1SA 2VMFA 4NJAH 4YZFE 3AVEA 4OZFG 4PG9A 4ODTL 2FGZA 4NUGL 3TFBA 2AEPH 1IBGL 3L1OL 1O6SB 3KL3A 1G7QB 1RD6A 3VXUE 3FTSA 1I3RA 2FYVA 3D0LB 5DJXA 2APBA 5HYJA 1J9SA 2BP8B 4LBAA 4UQEA 1JP5A 4YGAB 4AKPA 4PLNC 5FFLA 5D1QC 1NMBL 3TBCA 3SY0A 1EXHA 1XGUB 6PCYA 3WDIA 3GRBA 1UOVA 3MXVL 4Y16C 5IHHA 1ZT1A 1BIIA 2EH8H 4P2QD 5T8IA 2CO1A 1S3KL 2YSTA 2UVFA 5HYSB 3NOIA 3WUWG 1BMWA 2ZOTA 3IDJB 1MHPL 2B1AL 4JGUA 2O30A 4OI7A 4WWOA 3FU9A 1DTUA 4F93B 1A6VH 1YUHA 4HCRA 4UM9D 1FVDA 4NRZB 3L3OB 1CQKA 3DYPA 3G04B 1NCNA 5TD4A 3QHTC 1E9OA 2CR6A 2V9QA 1LDSA 1HEZA 3QZLA 4M62L 3TT3L 2FJFA 1ECYA 3NA9H 3SSGA 5CJ8A 4YAQB 3S34L 1FZMB 4JPKH 4YHPA 1CICD 3VE0B 1CFVL 1DBAH 1PBYA 3QIUB 3L3GB 1GXEA 5JQIB 5F1IB 2BVTA 1TTBA 5BV7B 2WBWB 1G87A 2FQFA 1KELL 4APQC 5EC1A 3C5ZA 4L4TD 4TVPH 5DI8B 4RVBA 1S9VA 1YG9A 1SJXA 2L4OA 2R1WA 4BH7B 3CMOH 1H3XA 4Y4KD 5A43C 4W1TA 2W9EH 5CJQH 2P3YA 3SGDH 2NXZC 2J7LA 4ELMF 4LRNH 4JQVA 4DP5X 2EH7H 3E6HA 4Q0XH 4EVNB 1NMCB 2I60H 4ZMTA 4G7QB 3IU4H 2ZXQA 2EVFA 1MFUA 2ZXCA 1ZHNA 2J1XA 1L9OA 2WXNA 3Q8EA 4Y19E 3VH8B 1NLDH 4IMKC 3U2IA 3RL2A 1CDIA 4GKLA 5I0WA 3CTTA 3GS0A 1UD8A 5E1QA 1GPOL 1IC1A 2LQRA 3T8MA 4L37B 2CJTA 3OSKA 2Q8AL 1HVXA 1E2VA 4HWEL 5CZXD 3G6AB 1NLBL 2ADIB 5ESVA 4BE6A 4FLHA 4BUGA 1N5AB 2LAAA 4Z7VE 1L9NA 3RNQA 5C97A 2L0DA 2YPLB 4W9KC 1DQKA 1OARL 4ZTEA 5I0YA 4AUUA 5DO2D 3HVNA 5CJ5A 2EUZA 4YE4L 4PJ7A 3CX5K 4NOBA 4KXZI 5EB9A 1H3GA 1LWJA 4X80H 4MAZA 1I82A 4B9ZA 5D6CA 1ECZA 3L45A 3S48A 2P8LB 3D18A 4QRQA 1GTNA 1MH5A 2ZCKH 3LXBA 5JHLH 3VQ1C 3T77A 1PCXA 1ACXA 4LE8A 3C8KA 4KX8A 4I1RA 3HG4A 1PSKL 3GLEA 3LXAA 3T5WA 2Q2LA 3D39B 2H3NA 5F7HA 1Z5LB 4P49A 5T1LA 5HVHB 3QUKA 1ND0B 4J8RB 4LCWA 3FRUA 4BFIA 4DP8X 2GCYB 4MNQA 4PRPD 1VERA 3C6SA 3V4VA 1S7VB 2OPCA 3MMEA 1KYOK 4HUVA 2VM4A 2DBJA 4I88A 1MJ7H 2WKLA 2MQ0A 1FO0H 4R90H 1CF8H 5B1AB 3LRSA 2E7HA 4XNMA 5KG9B 3K71B 4KUZH 4L8BA 4HSAC 3VWJB 3CDFA 3CH1A 1VAHA 4JFSA 4ZX3A 5G4OA 3WJLA 1Z5YD 1CD1B 2R0LL 4JRYE 1AGEB 1Q9OA 1R6VA 4WHYG 2UXGA 1M7DB 2B3IA 3BWAA 4N1EA 1IGYA 3TA4D 1DZ0A 4P3DA 1KNOB 1UYWH 1NC4B 4K3JL 4JQIL 1S7SA 4HIIB 1QOKA 4MNHA 1P4IH 1TCRB 1XQ4A 4RGNB 3BH9A 3RYMA 4E5XA 2E7MA 2IFFL 4LOFA 2FL5B 3W3BA 2R4RH 1RXLA 1P4BL 3DPBA 4IOFC 5E5MA 3MLXH 4MMZC 5E5MB 4OZ4A 5TPWL 2VW4A 1G7MB 2TRHA 5KSBB 2JCCE 5JPMA 5FWQA 1JPGA 3D06A 4GRLC 4MASA 4TUKL 5T3ZH 1SVBA 4K07A 1OAKL 1SLUA 5EEVA 1X4ZA 5IQNA 1ND0A 2I26N 4J8RA 4X6CF 1G5AA 3WUWB 3DGCR 1ZJBA 2NY3C 3DX8A 4C56D 1PPIA 4LCIL 3TCLA 1XF2A 1H15A 1T22B 3BKYL 3DO7B 4F27A 2DL2A 1VRSA 5CWSA 1VFAB 2DQIL 2EKSA 2G2RB 4WI0B 1ZWIA 4OV6F 3V9CA 2PCFB 1KPRB 2ZE0A 3W57A 2UYLA 3FRPB 3MRDB 3VXSE 2FYYA 1OSZA 3EO9H 4MB3A 3MHZA 1U3HC 1NSNL 2R1XA 3PUUA 1GS7A 4U4IA 1LM8V 3GJFA 3MCG1 5D93C 1RMFH 4Y7MA 4NZTH 1UZ6F 3FQYA 1CFSB 2WZ6A 2AV7A 2ZXBA 2E7CA 4PCKA 2E6PA 2Z93A 4L1HA 2PCFA 2QGCA 1QWHA 1HNGA 4DGIH 1T21B 3CIAA 4NQCB 3PFUA 2Z4TA 4A2DA 1Y1UA 1V54B 5DDHB 3QI9B 1RP8A 1X5MA 2ZKHL 4N0YL 4YOKA 1M6OB 4DERA 5EOTA 3SDYL 2ED9A 2Q7NA 4YHNB 2F7IA 1AQMA 4I18B 2VCOA 5DURD 1NCBL 4EBQH 4XVSH 4MD4A 2MTPA 3MA7B 4GS7C 1U8KA 3ZMNA 3B2PA 2Z7WA 3FQNB 1DZBA 3VFMB 4GXVL 1J0IA 5GS1B 4ZPTA 5B8CC 2QQKL 3ZLQC 3P77B 2BOLA 1J0YA 2BM3A 5BO1H 1BQSA 3MRMB 4LGPB 1UVQB 2ZXEB 3BZFB 3IS0X 5C7XH 3D5OF 4RDBA 4OLYL 1JWUB 4GQQA 5IMKB 2K8MA 1BJ1H 1QATA 1DQQB 2HLAA 2PXYB 4KROC 5KBMA 1TR7A 1JYXA 5I6XB 3ES6A 4FQLL 4YHKL 4Z7UA 4M5YH 5IM7A 2VSCA 4FI6A 2WSDA 3SE4A 3OPZL 3TF4A 1YPZE 5C2UB 3QXTA 4NRXB 2ARJA 4KXZH 1SXAA 5E5UB 4IKLA 4J27A 2EDXA 3S35H 4DEWA 5BS0E 4FQJH 1I3UA 6PAZA 3CZJA 1GGYA 4M56A 4MKTA 3P4MB 4X8CA 3LPFA 1RJYA 4WK2B 3BQUC 1WQVT 4L5FH 4ZFOA 2D7NA 4XPHL 3F12A 4LMQE 4LPYA 2NXZD 4X7SH 3EFDL 5I6LA 1VKXA 3S5LA 2BC4A 1IC7L 3AITA 2FVNA 3SDAD 3FDWA 4ZMLA 5D1ZB 3NH7L 3FHQA 3BN3B 3ESMA 3PGFL 3WNKA 1EVTC 4Z7IA 5EF0A 3U79A 2AQNA 3HBGA 4PRHE 4WTXA 4U6VH 5DO8A 5B21A 2E4FA 4D0DB 5FK9B 4NFCA 3VDAA 3QDJE 4WKZB 3Q8BA 2DD8H 5MENE 2KLSA 5J6HA 3WEBA 2BP3A 4LEEA 5KUKA 3QCUL 1KYUA 3F8UB 4G9FB 4AMKH 3RZCD 3F85A 5B38G 3UTQB 4WI5A 2NLJB 5EZJB 1X5ZA 4HIHA 4GP8B 2JXMB 3A67L 4Z9KB 4XP5H 1KYOJ 1MREL 3TIEB 3VFUA 2BSRB 4DVRL 5KVDH 3KDMB 2FBOJ 3MCYA 3HE7B 4N87A 3M86A 3ZQ9A 2W60B 3ARXA 3K46A 2X2UA 1ZA3A 4HYTB 1PCSA 3RY6A 3ILPB 3APFA 5T1KA 1D5IL 5H94B 1N6VA 2N0MA 3HAEG 3VXOB 3CFBB 1PX4A 2YQ2A 3ARDD 1F1DA 1XDTT 2XNAB 5CMAB 4B9GA 3VXRE 4M6AA 3NDZE 4PTUB 3VE0A 5MEOB 4YFEA 3W9EA 3SDCA 5E5RB 2ICWB 3CN0A 4KK8C 1F97A 1FBIL 1VZIA 1OPGH 3D0AA 3QP3A 3TO4C 1A9BA 1S5IL 4RGOL 5J1AB 4JL1A 4XMUA 4XNUL 4LAQH 2ZUXA 1RIUL 2QFRA 1IGMH 4XC3L 1SHWA 4JAMB 1X3DA 4IBSA 4PWIA 3GSWB 3BD4A 3FQ2A 4ZSOB 2YN3A 4FL4C 4PWEA 4H88H 5AZEL 3UJJH 4F8TA 4PIRF 4LSRH 2DIEA 1IGIH 4NC0B 5FA4A 4CVZB 1JZFA 1J87A 3CDCA 4LVHC 2DTMH 4V1DE 5JNYB 2OQJA 4JDZA 5TPWH 5A3ID 4EZMA 5IFAH 1XCWA 1A4BA 4NO5B 2APVA 4PJ5E 2WPGA 2AQQA 2LFEA 4NJAL 4XHJC 3V0DA 1WA2X 3VQ2C 4QF1A 4EF3A 5CEZH 1VACA 3QFDA 1YDPA 2AEPL 3G9AB 4YXKH 5IF0A 5CHNB 2CUAA 4HIPA 2G2PA 4M4RA 4P2YA 3SE4C 3PWNA 2DQFA 2FATH 5JW4M 4JO4L 4NJ9L 4XH2A 3PIQB 5EUKB 5FOBA 5BZWB 3VD9A 3IYLW 4RDQG 2NSMA 3LN5B 1N6UA 2EADA 5I71C 1DANT 2X09A 5KVFH 3H53A 2J3SA 2HFEB 5FB8B 5H2BA 4YHLH 1LMIA 1A4JB 3V7MA 5CGYD 3D0VA 3EG9A 4WFFD 3RY5A 1F1AA 3NPZB 1I8KA 3Q1SH 5FYLE 4IJTA 1QO3B 4M6OH 1HS6A 3QIWC 5DD0L 4H8WL 4Q6IC 3EOBA 5DQDL 1NAKL 2MQGA 4ZD3H 5FYLH 2WINB 2NR6C 5E8DH 3QCTH 3EJPA 4A6YH 4YHYB 5J6HB 5DMIH 4AGMA 1YYCA 3S34H 3VRLF 2H2SD 3TZVB 3ATAA 4EBQL 4ISVA 5C0BB 1I9JH 5GGVY 2W81C 1MFCH 4FFZA 3VXPB 4G7VH 4OCSL 3RWHA 1NFDE 5EU7E 1ADQA 4IQHA 5PCYA 1RLBA 1BVKA 4AM0Q 3U2SB 4EOWL 4NUPA 5BOJA 1V3LA 4Y5YB 5J06A 5ERWB 2V2WB 1UM6H 1FCCA 1MNUL 4TOYL 4C4KT 3QEQB 3LXCA 2NY1C 2XU9A 3K4DA 4AQ1B 1TSRA 4M48H 3UGEA 3O9WA 4IMLB 4WEEA 4R2GB 1KTRL 1I85A 3ZTEA 5AKRA 2Q2EB 5ESAA 3BQUB 2Q8AH 2H5UA 5B38B 1AY1L 1F45A 4M9PA 3V4PB 2VW7A 1J1OL 1JGLL 5I5IA 3BAJA 5CR1A 1JNLL 2J6WA 2DQHL 3V55A 3MLRH 3OJVC 2OXGB 3E1ZA 4XO5A 1W0VA 3PL6D 3NCYS 2KQNA 3W37A 3MUGA 1N19A 3EFOA 3CU7A 1DQQA 3LZNA 4QO1B 2A83B 2J44A 3KYOA 4ZQKA 4HU8A 5IMLB 4GBXC 5IHUH 4Y5XC 4BA8A 5GZOA 5F9WB 3V0EA 3QSKB 2ATAA 3MNZA 4LLYB 2QHRH 5KYXA 1RHHA 1DVTA 4QHUB 1VGEH 1I1YA 3F7PC 5KVEH 5ADPL 1R3KB 2ZG1A 4FQXC 2ZOLB 4U1NA 4YFLF 5D6DC 3DJRA 1GGIH 3K2UL 3T0EB 2R59A 5L7XL 2QL1A 3TBWA 2A9ML 3KLLA 1J8HA 5IB5A 1CD1A 1OLLA 2UZPA 3O81A 3POCA 2IAMB 3LPGA 1ZHNB 1RIVL 1MCJA 5LDUA 4ZOBA 1AFVL 2YPKA 4LPWA 4GG6E 4MMZA 4Q52A 1FO0L 5DFVC 4CKQA 1CF8L 3OHXA 5DZOA 1U41A 2OSLB 3VMPA 4Y1TA 2I7OA 2BNUA 3ULUC 1F02I 2A6DA 3FQWA 2IFGA 5JMRA 2ZJSL 3FT9A 3T71A 3GUTB 5CLWA 1OWWA 4MMYA 2Q8BL 3OKDA 1P7QD 1FL3B 1HAUA 3BP7A 3D52A 2X4QB 4F7EA 2JQMA 2LABA 2CK0L 3SEPA 5T1LB 3M1BB 3H9HB 4U1LB 2BZDA 1UATA 1E6JH 4LEXL 4B3VA 2FYYB 1T1YB 1RZQA 1AGCB 3LS5H 3DIFA 1SJHB 4QHPA 1F86A 1ZT4B 5LBVA 5KTEL 3HTLX 2UWEF 4JFVA 4ZYKA 5HDQL 3SJVD 5GRVL 2JLPA 4BWWA 1MI5B 3RTQC 1OGAD 5I0XA 4N90D 4PS4H 5DMGD 3CVHH 1CDJA 4YPGB 4UBDC 4D9QD 2FDBP 5D70H 2FLBT 1RK1B 5C3TA 3TJHD 1TT6A 3VD3A 1V10A 3KLAB 4PJIB 1KCVL 4N24A 4LP4A 1OWRM 1M6UA 4DO5A 5E1IA 1WT5A 2X0WA 5D9SB 3CHPA 2ZUSA 5IUSA 1P7KB 2CCLA 4XCNA 5GRWA 5J0BA 4Z95H 1A2YB 2E3VA 2V6HA 1AI1L 2BOCB 3DKHA 3F04A 2J21A 3KPRB 4E5XB 5FEBA 4J6RL 2Z6FA 4N1CA 2PN5A 2ZOUA 5C1MB 1MOEA 5MI0C 1RH8A 4IIQA 1AQKH 5IB4A 4U33A 3DX7B 1HWGB 1YPZF 2HKHH 1KTLB 3MV9B 4I2XE 5JW5B 4MFHA 2W65A 2V3FA 3KXFB 1HL8A 2VIRB 1DL7H 2WIMA 2BSBA 5DZLA 32C2B 4A63A 3FJTA 1S9VB 3A6OA 2BSCA 5F7EH 5KVGH 4JANB 2XBZA 3Q2NA 1TJIL 4ICXA 3L3GA 3T0VA 2YD9A 1BF5A 2BY3A 4OF5A 1CFNB 2B1HL 4DK6A 2EIMB 4NC1C 1E8ZA 2VM3A 4U0RC 5AVTB 3OB0K 2W0KA 4Y8DC 3AG4B 2VLJA 4NNYA 4E9YA 4OFIA 5LXGL 3QC5X 4JCLA 3P0VL 2J12B 5KSUA 2ZYRA 1AXSB 2DWDA 3IEAA 3IRCA 4Z7WB 3VFVB 1MQ8A 2RB8A 5B3JE 2GJZB 4R26H 3IKKA 3MRNA 3WIHA 5I5RA 4NC2B 3B37A 3C9NA 4WUKL 4UOW0 1QI3A 4YDNA 1F4WL 5IHLB 5K39B 1ZD6A 3BESR 2UY6A 5E8OB 3IXTA 1HK6A 3E3QC 4PY8J 3I6SA 1BBJA 2EVJA 3RPIB 3OMIB 4PJ5A 3OQRA 4P2QE 4O02L 4ONGL 4IRZL 5CSZB 2YBRA 3BD5A 1F58L 5IJVB 4PRAB 3TEZA 3HMWH 4OJYA 4OCSH 1ODUA 1PZ2A 3D6GA 4FFYL 4L3CA 4CJ0A 4O00A 4LOUD 4AG4L 2LLGA 4PG9B 5C0CB 35C8H 5CBAB 5GZND 2GABA 1PTZA 5GSVA 3K8LA 2DM3A 1R19A 1A4CA 3DMMC 1V5JA 3BKCH 3QUXA 1KOAA 3SBQA 1LEGA 4OZHE 3UDWC 4F5CE 1O6VA 4DEUA 4HIHB 5JW4N 3TC9A 4HJJL 2FEDD 3WIAA 3VD2A 1HKLL 1FC2D 3CBJB 2Z91A 1RK7A 5EBMB 1AKPA 5H37G 4Y4HD 2AK1L 2F61A 3FFCE 4Y5VC