3DUSB

Crystal structure of sag506-01, orthorhombic, twinned, crystal 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTVEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGYYVDAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fv fragment SAG506-01
publication title Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dusB00
4U7MA 5C0BB 3IDYC 4IOFC 5GS1C 3PGCB 4D9QD 2N4IA 5D70L 5FYKH 4XNMB 1YPZE 2DM2A 1NPUA 2NY6C 4MD4A 1QRKA 4WENB 5T1LD 3E8UL 1A3LH 1RZJC 3AB0C 4OKDA 4WHTA 3T0BA 5EORH 4XP5L 4XCNB 1EJ6A 1GRWA 3GMLA 4N0UB 3V7AE 3UJTH 1HNGA 3BZEA 3ZE2E 3Q6GH 1WC7B 2NTFA 3RVTD 3BP4B 4EI5A 2R29L 4FQ2L 5F9OL 4PRPD 5CEZD 1KJ2B 5MP6L 5FM5O 3O4LA 1ZHBB 4TQEH 4JANA 1WWBX 1EK3A 4L4TB 1S7WB 3MXWH 1TDQA 5IEHA 3PQYD 4MB3A 1T2QH 4HFUH 3S88H 3RVWD 1BVLB 2MOVA 3C2AH 1U8MA 4LARL 1L7IL 3LMJL 1I1RA 4PJBB 4X4ME 1OGAD 2Y1VA 5EB9A 1FVDA 5AYUL 4WI3A 1GGYA 3MV7B 2GKIA 2H8PA 3QIUD 1P5VA 2YRLA 3T4YA 1AKJB 1I3UA 1QSZA 4NKDB 2HWZL 4Y5XC 4WHDA 3DMMC 3UTZA 5HY9B 3DRTB 2IAMD 4ZUTB 2IFGA 2Q8AH 1U8JB 1NLBL 3U0PB 3MNZB 1TVBA 3QHFH 1KJ3L 5BVPH 3VXRE 3NN8A 1FFRA 5HD8C 2OI9B 4GG8B 1XH3A 3DXAB 5D2NB 4UTBL 1IC4H 4LCIL 4LAQL 4QNPE 1D9KC 4HJJL 1GPOL 2AJZA 4BQ8A 5JXAL 2MWCA 2UWEF 3NIDF 4FQHB 3VI3F 2ZNWA 3HAEB 4WFFD 2F53D 4JY5L 4Y2OA 1AFVL 3HNVL 1A9EB 2H9GA 2J8OA 2H1PH 1JPST 1KIQB 4KI5C 2OJEB 3GO1H 2ATPB 2NX5B 3PWPE 1A3QA 3NZHH 4JCMA 3SKNA 5FB8B 2K7PA 2AK4E 2PYEB 3BPCB 4PJ9A 1G7HA 4ZXBA 3DV4A 3OAYH 1P6FA 4KROD 1IZJA 3VG9C 3HRPA 1JPTL 4DVRL 5IBUB 4GAJL 4OUOA 3WIHL 1E28B 5IB4A 3ARDA 5E08H 4WU7A 2C1PA 4TVPE 4MD5B 2CRZA 2EKJA 1JZ8A 5T3XD 1ZVSB 4FXKA 1OGTA 1KNOA 5H37H 3QG7L 5IW1A 3S96B 5F88A 2MTPA 1I7TB 3FQUA 4XPHH 3WNMA 1SY6L 5C0DB 3DI2B 1A6VH 4R4ND 4QKXB 4XCFH 2Z31A 3BZDA 1E4XI 1GZPA 5ICZB 5KSBE 3KYMA 3ZE1E 3ARYA 1KIRA 3BEVA 5T5NF 3TT3L 2X70A 4EUPH 1X44A 4P9HC 3CDCA 4P46A 2J8UE 3K81A 4R96B 3TBSB 3RWHB 4ODVH 3RWEB 1CICD 3TO2A 3QNZB 2QQNH 4JHBA 2NY4B 4MNQA 1VFAA 1NMCC 3VG0L 3B4NA 3TBWB 1GGTA 3QUYB 3OHXB 5GJTH 2D03L 3JUYA 2FWOA 1B2WH 2FX9L 2HT2D 2NY7L 5SWZE 5GRJL 3CVIH 4YQXH 3UCRA 4K9EC 1KJVA 4NQVB 2VDKL 3I75B 2AJSH 1IEAA 3GJEA 2ZJSL 4KKAD 4BUGA 3MA7A 2C1OA 2EDWA 1I4FB 2CKBB 4R8WL 4PJAA 4LPVA 4DK6A 3ALXA 4XNYL 4KTEH 3BD5A 3B9KD 5KVFH 3L3GB 1Q94B 3HZMA 2K9UA 5IT2L 1F3JA 3H42L 3WLBB 1RZFL 3KPOA 5DK0A 1OAUL 5CHNA 1CFNA 3JWDH 4L3EA 2YMXH 3L7FB 2P24B 3PDOA 3PABA 3RU8H 5ERWA 1U2CA 1A9BA 1ZHLA 3QDJA 1E6JH 5D7JC 4CNIA 4FQCH 1NFDE 3QEUA 4NZDA 2UZIL 3BDYH 1EHAA 1Q9KA 3EUUA 4G6JH 4PJDF 4M6OH 3VFOA 5HDOA 3WHXB 2AS5M 4DAGL 2C26A 4C56B 5KVGL 2IEPA 1Z3GL 2ZUQB 4FP8H 2ERJB 3D39D 4HMDA 4EN3B 1K2DB 3N85H 3LRSB 3TESA 2IH1B 4NZUH 3L3DB 2VDNH 2KQNA 4QHUA 1ZANH 5ESQA 1EHNA 4HAFA 5B39G 2IWGA 1XF5B 2IANB 3GKWL 5DVMA 3MLRL 4NO5B 2GY5A 5GRVL 1YUHB 3T08A 3W2DH 3WD5L 1I8IB 4HXAH 5IW6A 5MI0C 3UO1H 1D5BB 2D7NA 4YGVB 4P0DA 2QQQA 3BYTA 4QOKA 1ZLUK 1FDLL 4XPBL 3P30L 3FN0H 3IGAA 2VDPL 1AGCA 4M9PA 4PRHA 1W0WA 3FQXA 5DJ0B 1EMTL 3SCMB 4KMTL 2VZ1A 3QDMD 1A4KB 4UT7H 3B2VL 3HC3L 2YWYA 2Y25A 1VESA 4RGNE 4UT6H 1X5AA 4ONGH 4JGMA 3L3HA 4WUKL 3ULUH 1LO3L 5TDNA 4GKNB 4ZTPH 4WHYH 3HG1E 4MJ5B 3GMOA 3LCYA 5T1LB 3V0WH 5C70A 2R9HD 1A3LL 4P57B 3CFKA 1G7QA 5E6ZA 2Y5TB 5EZLB 5EORL 5I8OH 4V2BA 1MCCA 5GGSB 4M6AA 4I2XA 1J8HA 2X4TB 3UJTL 3C6LC 5DHVB 3ULSA 3BO8A 4JG0H 2YUZA 2EDHA 4X6BA 3F7QA 3Q6GL 2R0KH 1D5XA 3RL2B 3FB5A 1R5IB 3ZHDA 2HLFD 4PRPB 4JFDE 4OZFH 4L9LC 1D5MA 1U3HA 4EDWH 2UY6A 2CLZB 4TQEL 4QTHB 1NCBH 3KYNA 3PQYB 4LLUA 3MXWL 2DWDA 1H3WM 3OQ3B 1T2QL 4HFUL 3ZKND 3NPSC 4OGYH 3S88L 4XGZA 2VLKA 3C2AL 4YNYB 1OGAB 3EBAA 4HDIA 4IRSA 3O3EA 2AI0H 2V7NA 3MR9A 4S1DD 2P5WD 3W5NA 1FH5H 3QIUB 1CT8B 1EO7A 3L3KB 4NHCH 2DN7A 5CILH 2EXYD 4EI6B 3MRLA 1NGZA 1UVQB 3MRPA 3QB7C 1S7QB 4X99A 2IAMB 4D94A 4DZ8B 5GZND 2YUXA 4XP9H 5JPMA 1JPFB 3BEWB 2UWEB 2Q8AL 3L3IA 3WFZA 1A3RH 4QHMB 1MCFA 4BSWA 3QHFL 5T1MA 4N68A 5BVPL 1T3FB 3ARBC 4I3RH 1HIMH 4MXQD 4MVBD 2R2HA 1IC4L 3DRQA 1JRHH 1T20B 3O41B 2XTJC 3I02A 4AMKH 1TITA 3K80A 5DYOB 4U6HB 1N6VA 3BP5A 3MREB 2H1PL 3GO1L 2ARJA 1MFNA 3NZHL 1HWGB 3M07A 4NKOB 3S7GA 1S9YA 4X6CE 1WVZA 5C0GA 3HUJF 3N9GH 1NDGB 1CK0H 4JQIL 1L0YA 2X1QA 3VWKA 3ECBA 4LCCC 5E08L 5FCSH 4JN2B 5HGHB 3CX2A 2GCYB 4O2FA 3NABH 4F7EB 3MRCA 5I1CH 4XPHL 3RWGB 2F5BH 3V6ZA 4OSUH 3IXTB 1A6VL 5CIPA 3KPSE 5GGTH 3MJ8A 2XNAA 4XCFL 2RR3A 4Y1AA 3ME0A 4H8WC 4M7ZB 3LQZB 3T0EA 5LVEA 1HSAA 4XNXH 2YRZA 1R24B 3SKMB 3AGVA 3L6FA 4JRYE 3TH4T 3IKKA 3K3QA 2VDQL 2MFNA 3PWJA 5DD0H 4M61B 2RFXA 3LKOA 1AH1A 3VXPB 4ODVL 5EWIH 4PP2A 2QQNL 1QHPA 1RMFH 4LCWD 2R0WH 5F6HI 4G6MH 1Z9SA 5IFHH 2IH3B 1CXEA 4TUJA 3EOAB 5IB2B 3L1OH 5GJTL 1VFUA 5C2BH 1B2WL 1MJ8H 3CVIL 4LGPB 4BSJA 4YQXL 1MJ7H 4Y5YB 5IOPA 2AJSL 2D31B 3LEYH 3OKDB 2EDEA 4M00A 1GAFH 3B9KB 4NFDA 2ED7A 3BP6A 2DJ4A 2C4FU 4HKBA 2Q7NA 3VJ6A 5KVFL 4PJDB 4JPIB 3B8SA 4B0MM 3VFWB 1T7VA 3JWDL 2YMXL 5HYEA 3RU8L 3VFMA 1FZOB 1H3VA 2EC8A 4J1UA 2GQHA 1YN7B 4QHKJ 1MCBA 5J11C 1E6JL 4NOBA 4FQCL 1B6UA 3BDYL 3OL2A 4G6JL 2GT9A 1IAIH 4LVOC 4M6OL 5L2JA 5HHPB 4U1JB 4WW2C 4ZAKD 1FPTH 3FB7A 4R0LA 4C55A 4ONOA 4FP8L 2BY2A 3SQBA 3L3OA 3N85L 3QCTH 5JQHC 4OBSA 4F9LC 4CN1A 4ELME 3WJJA 3QXDA 4NZUL 3LN4B 2VDNL 1ZTXH 1LP9F 4PRAA 1ZANL 4PJ9D 4E0RA 3AXLA 4X9GA 1CIUA 3UTTA 5JA9A 3CU1A 4KKLD 3DV6A 1IRAY 2LABA 5IVXF 1Q8MA 1B0RB 1Q0XH 3ARDD 1BVKA 1X5XA 3WHE1 3FCTB 2JCCF 5F9AC 4Z7VA 1ZSDA 3W2DL 3TN0D 2E7LC 4HXAL 3RIFF 3G6AA 5DC9B 2RB8A 3UO1L 4Q6IC 3ARRA 5DJDB 1A1OA 3IS0X 1W72B 3FN0L 4F2MA 4P2YA 5KSUA 1F02I 4QXTB 3QDMB 3W9DB 1AQDB 2PW1A 3DX9B 4U4BA 3PWNA 3X13A 1EEQA 4M1DH 2H32B 2YXMA 1GZQB 5L2KA 3Q2CA 4UT7L 2NW2A 1ZS8B 3BXNB 1RZGB 2K3TA 3SO3B 2JJSA 1PQZA 1G1YA 4UT6L 3OB0K 4LNRB 2VB5A 5EUKA 4P46D 4QGTA 3SY0A 1D7FA 5EIVA 4XX1G 3ULUL 3SGKC 1HK6A 4XCYB 1KTRL 4PGEA 1U8LB 3NGBC 2BVOB 4YBQC 1T80A 4ZTPL 3DJ9A 3GSRA 3V0WL 4UI2A 4KK6C 5D72H 5KSAA 1JWSA 1UYWH 2NR6C 3ARFA 4LVEA 5I8OL 1GXEA 4PD4K 3QNXB 3FT2B 4LSVH 3R1GH 3F12B 2DKMA 4JG0L 3S3JA 3DUUA 2BNQD 4P5MA 5ACZA 3IDNB 4PGCB 2EKSB 5A43C 2R0KL 4XMPH 3GMMA 3U83A 4XVJH 1MFEH 2XY2A 2GTZA 1RI8A 2Q6WB 4EDWL 4L3ED 4DKFH 3JWOH 1Q38A 4NQSB 4TULH 1NCBL 3O6KH 1HHIA 3PP3H 3MRKB 1UJ3A 3TC9A 2YPLA 1WTLA 25C8H 3NZ8B 4PJAF 5DZNA 4Q9BA 2VITB 4TSBH 5BV7H 4OGYL 1XFPA 3RDTB 4MAYA 1XMWA 2FLBT 1SQ2N 2DBLH 2P5WB 3QJHA 5HDBF 1LK3H 1NUGA 5D1ZC 2AI0L 5ANME 5T1KD 1LE5B 3QHTC 3TH2T 1SMOA 1FH5L 1DFBH 5I30H 2PYFA 4NWUH 2FO4A 4U6YA 1TVHA 2VXQH 4NHCL 5CILL 1JJUA 1P7QA 2L7JA 4KJQC 2AP2A 2GK0B 3QNYA 4UIMA 4AEIH 1CFTA 4WDIA 3MBEC 4ZDHA 4BH7B 4OTXH 3ILPB 3S98A 4XP9L 5D1QB 4F7PB 1F97A 3RZWA 2RIKA 2P5EE 4F9PA 3LDBC 3IJHB 4PJEA 4I3RL 2BNRA 1HIML 2F5AH 3AAZA 4P2QB 2PO6D 1JRHL 4N0FA 2N1KA 4LFHG 1VGKB 3HUJB 4JRWA 2EXWD 4P2OC 2QL1A 1KULA 3MYJB 5D2LE 2N7AA 5A2FA 4AMKL 3U36A 3VFPB 3AMKA 4NCC1 4HEME 3KLAB 4K8RH 4QT5A 1G6RA 5CJQH 3H9YA 5IMKA 4G80B 4JZJA 4N5UA 2VDRH 1W0VA 1T0MA 4I4WA 5CJBA 5GRYA 5CZXD 2H2SC 3RWIA 3UEZA 1R5WB 1P6AB 5JPNA 1CK0L 5C2UB 1DLFH 2X4QB 4KAQH 4MD4B 2E7CA 1KT2B 2XPGA 4R2GC 1DQDH 3IF1A 4XPGH 1AR1D 3CFBA 4E5XA 1EEUA 4APQC 1YEHH 2A0LD 3NABL 2WAHA 2Y6SD 5E1HB 3RGVD 5I1CL 1U93A 3BWAA 2XKSA 3L9RA 3QCUH 1V3KA 3BZEB 4OSUL 1MHHA 5GGTL 4M8QA 2NTFB 3GK8H 3JV0A 4PLJD 5M7QA 4PGBB 2QR0A 1JHLH 3D6GA 4XNXL 4EI5B 3JV6B 43C9A 1NL0H 4EVNB 1CDJA 3HPJA 1LE9A 2V9QA 4JFED 3R4DA 3UROR 2HJFA 4XZUA 4P5TC 3TJHD 1PZ5A 1QA9A 5DD0L 1DQTA 4QHLA 1CLZH 5IEHB 4PJCA 1KEGH 2VN4A 5DTFA 1Z0NA 3C8HA 3OKEA 5EWIL 3FO9B 1WJ3A 4LCWB 1U8MB 2VLKD 5CUSH 1RMFL 4NO0A 2R0WL 2FJHB 2OTPA 4U6VH 4G6ML 5I8CB 1FVDB 5IFHL 2CLRA 3L1OL 5C2BL 15C8H 2H8PB 1MJ8L 2YPKA 2EDQA 1MJ7L 4NCDA 4P9MH 5I75C 3IXAA 3O8XC 3VGGA 3D2UA 3LEYL 5DUPH 2FJFA 4GRLA 3R0NA 1GAFL 3QISA 1JBJA 4PTUA 1RHHA 1IGMH 2X4PB 4F7MA 1NFKA 3KGRA 2WSKA 4MA8H 2BK8A 3TA3A 1U8KB 4LHUG 3MLYL 4R4BA 4RISH 3PHQB 4K71B 4G3YH 4ZPVB 2QHLA 2C7UA 3MFFB 4NRYB 4KUCD 5SWSA 1LP9B 1XGRA 5D7KE 2AJZB 4JO3H 1XGTB 5DA4A 4Z9KB 1N8ZB 3CCHB 4CDGC 4ZAKB 1EUTA 2X7LA 1JNHB 3B3IB 5IVXB 1IAIL 4ZMAT 3G5ZB 1FPTL 4X5XA 4JY6B 2JCCB 3SKNB 4JFYA 3G5YA 2AEQH 1A5FH 3WDIA 3QCTL 4KUCF 1VGEH 1AO7D 3BPLB 1H0DB 4PJ9B 3DSFH 1ZTXL 1PDKA 5AAMA 1CS6A 4JZOA 3N0PB 4U7SA 3G9VA 5AZEH 1NGPH 3ARDB 3L7EA 4IJ3C 3RA7H 5DD6B 2C1PB 1Q0XL 4UQ2A 1KN4H 4FXKB 1OGTB 4Z7WE 1OAXH 1HHKA 1BQHB 1RD6A 1MF2H 1A6ZA 4FHBD 3WBDA 4GRWE 3MV9A 2BHZA 5TQ2H 1I1AC 1E27B 3KYMB 1CE6A 1TLKA 1QSFE 3OG4B 4M1DL 4PJXA 1KIRB 4IMKA 1V05A 1VDGA 5DK3A 4WI6A 2BZDA 3U4BH 4PJFF 4P46B 3UP1A 4CBPA 1PY9A 2Z8RA 5K9OA 3TO2B 1YPZF 2VZTA 4N0YL 4WI7A 4ZPTA 1ACZA 4X0KA 4MNQB 1VFAB 2GEEA 2YD6A 3SDXE 2AABH 3QIWD 3NA4A 4JFOA 3U9UB 2ICWA 5D71H 5DVOA 2DBJA 2FWOB 3QZWG 3KYKH 5D72L 1UYWL 4BQBA 3V6OE 1JWUA 4JM4H 4HIHA 5GZOC 1OVZA 4DK3A 4K94C 3GJEB 5GRUH 3MA7B 3FHQA 4J3UA 12E8H 4PJAB 4LSVL 3R1GL 3QRGH 4CVUA 3VMPA 1IM3B 4YK4B 4XMPL 8FABA 1R3IH 4Y89A 4OFIA 3VWJC 4XVJL 5CHNB 1CFNB 1MFEL 4L3EB 3KPTA 3O4OB 3DX6B 5KVEH 4DKFL 3JWOL 4TULL 1FE8H 5FGBA 3O6KL 1ZHLB 4L1DA 3GBLA 4CNIB 2EDRA 3SGJA 3U0TA 4Y2DD 5DURD 25C8L 3QEUB 3ZKSD 3KLDA 4JM2D 4OQTH 5LBSH 1WAAA 4TSBL 5BV7L 1I8KA 3M8OH 4LDOB 1G7JA 5T1KB 1IEHA 3QQ3A 3N1FC 3MZGB 2DBLL 1MLBA 1YNTB 3VFTB 5CJXA 3LVEA 4ZFOA 3BW9A 1DFBL 5I30L 1VACA 2VXQL 4WRLA 4ZQKA 5TGBA 4JM2F 4RMUA 2QKIA 5IF0B 4AEIL 5F8QC 4N90E 1BJMA 4HEPG 4OTXL 3UTTD 3GIZH 5AEAA 1IKNC 4XX1E 4EXPX 2OR9H 1SJHB 5DMGD 4QNPF 3WXWH 5FO8A 5JNYB 1FFNB 1IC1A 2X4NA 2F5AL 1MQKH 5IQ9A 2PO6B 1AI1L 5GS1A 5IMMA 1IMHC 1AGCB 2ZOLA 2AERT 2OL3L 1V8HA 3FQXB 4K55A 4MLSA 2CR3A 5F3HA 4TVPD 2VSCA 2EDLA 2DQGH 4FQXC 1OB1B 2AJUH 1CFQB 2G5RA 2MHAA 2XWTB 3U79A 2VXSH 4K8RL 3IAQA 2BVQA 5CJQL 3EDJA 5BRZA 2VDRL 1EZVY 5F70A 3QQ9C 1BBJA 4XCEA 2V2TA 2EDBA 1BOGB 3GMOB 4MWFB 1DLFL 4KAQL 1OWRM 2MSPA 4CN6A 5E94A 2D7QA 1DQDL 4XPGL 1BIIA 2FSEA 5I16B 2EIZA 5C0AE 3VFSB 1YEHL 1R3LA 3WS6C 4HUWA 2XQBH 1MUJB 1QBAA 3BO8B 5IGXH 3QULA 4PTTA 1PGRB 5CFHA 3MLVH 1D5XB 3GK8L 3BRGC 1A6TA 1JHLL 3B9VA 4ONHA 5JO5A 1MCEA 4J2XA 2ZCHH 4JFEB 4M5YH 1NL0L 4P4KC 3VXQA 1S7RA 1A7OH 3RI5F 4FXGB 5GGRB 4POYA 4Y5XA 4CVZA 3DMMA 4LLUB 2DWDB 4HK0A 1CLZL 1RK0B 3ARPA 4G6AD 4PBXA 3AU1A 1KEGL 5E56A 1EJOH 2VLKB 4LVHB 2VOTA 4MAYD 2R8SH 4HDIB 5CUSL 4M03A 4U6VL 5IVZA 2V7NB 3Q3GB 1YEIH 3MR9B 4JJ5A 1D9KA 1U3YA 1ITBB 3CFJA 4J8RA 3MRPB 5L8KB 1K4CA 4P9ML 5GSVB 4NQTA 1NFIB 1OL0A 5DUPL 3LS4H 3V5KA 1P69B 3IU4H 4X6EA 5JPMB 3L3IB 4HS6A 1IGML 1FN4A 4MCYA 4MNHB 4RDQF 4Z7QF 5HI4C 3ZDYF 4MA8L 1T0PB 3FKUS 4LLQA 1RJLA 3MGOA 5C07A 3PGDB 4RISL 2L7UA 1D6EA 5B38B 4G3YL 3MV8E 4WCYH 1OD7A 3T8XB 4AY0A 1RJCA 1EFXA 4RQQA 5H8DA 1HHHA 1U8PA 4HZAA 1JTOA 4JO3L 1ETZB 1HQRA 4HS3A 3P73B 1NMAH 2PN5A 1X5ZA 4Q97A 1A14L 3BP5B 4MA1C 2ARJB 1UCTA 3C5ZD 1AO7B 3BN9C 3QDAA 4OZHA 4AENA 1PBYA 2AEQL 5JHLH 1A5FL 3W39A 1C08B 4Y5VC 1VGEL 3P4MB 4QWWC 2Y06H 3DSFL 5J1AB 3CVHA 4HWNA 4ZUUB 4M1CD 3VGBA 3TNNA 1Q9OB 3QJFA 5AZEL 1G0XA 1G7MA 1NGPL 1J7VR 1P7KB 4XC3H 2P46B 2YHGA 2HLAA 3RA7L 4WTZG 4RGND 4WFEE 2W59A 1KN4L 3FFCA 2FBJH 3O45A 4AH2A 4H0HB 4FA8A 1FL6B 1ERNA 1OAXL 2Y4SA 4PJFB 4BM7A 3NTCH 4I1NB 1MF2L 5C08E 3V6ZB 3RY6C 3EYUH 5CIPB 2NY0D 1NMBH 1YPZB 1EBPA 3HG1D 5CMAA 5TQ2L 3DGGB 5FYLE 3QFJE 1YMMD 3BHBA 3EGSA 3L6FB 4RWHA 5A2IH 3IU3B 3LN9A 3PWJB 3U4BL 1U8NB 5IG7A 4ISVA 1N6UA 5HGBB 1EAJA 2HFEA 4M7KH 1HH6B 5B8CB 1PZUB 3QAZC 3QIWB 4NO3A 4PP2B 2XWJA 2HP4A 1K5NA 2AABL 4LQ1A 5HGDA 4NO0D 4TUJB 5D71L 2VLRE 4AL8H 5EOQH 3KYKL 5DLMH 3FL7A 3MJ9H 5D7JA 1R3JA 5BMFH 3SJVE 1QRNE 4N5ED 4JM4L 4PJCF 3CLEH 5IOPB 2NLJA 3K8LA 4JCLA 5GRUL 1I9IH 12E8L 5DJCA 2MNUA 3QRGL 4LIQE 4NQEA 3T04D 2FB4H 5JOEA 2PTVA 2BVPB 5EZJA 5IEKA 2B4CC 3M1BA 4QCIB 4FFVD 1R3IL 1BBDH 5DFWH 4PRIE 1U91A 2QQLH 5KVEL 4UIKH 3HI1B 1X4XA 4PRBA 1FE8L 4LDLB 3VFMB 2QQKH 4Y2DB 5DURB 4YC2B 1M7DA 1MHCB 4FFZH 4K3HA 5F9WB 1IBGH 5E8PA 4BJLA 4OQTL 3G6JE 2GT9B 2I24N 3M8OL 3REWB 5L2JB 3FB7B 1YDPB 2I9TA 3NIGF 5D5MA 2ESVA 3ZKMD 1UZ8A 4HV8A 3WYRA 4D0BB 3L3OB 5IWLC 4OF7A 3V2AR 3IFLH 1OP3K 4PRAB 3OX8B 2ILLA 5F97E 1IGCH 4E0RB 3AXLB 4RBPK 1MCIA 3UTTB 4ELKA 3VCLA 4MS8D 5I1KH 4OZIE 2BJMH 4XH2A 2XI9A 3GIZL 5HHOD 4MCZB 2RJMA 3ES6A 1BVKB 2OR9L 4GKZB 3F7PC 2E6QA 3FT3B 1S9KC 4QRPA 1OSZB 4ZOCA 3WXWL 5L0QC 1URLA 2BSSB 3G6AB 2D7OA 4NZTH 3U30C 4ZO8A 1MQKL 5C09E 2QSQA 1WF5A 2E9BA 2VSDA 4JE4B 2WWKT 5KSUB 3WIFA 4YHNA 2PW1B 3KDMB 4G8IB 3X13B 5E1AA 4HG4K 3WNKA 2DQGL 4QHKI 2AJUL 1WWCA 3MO1A 4J3SA 1UADC 1FFOB 2J2ZA 2VXSL 3C6LA 1PQZB 5TQ0H 1N6QH 4FQQA 5DQDH 3G6DH 2YBRA 1AD0B 2HRLA 3KPSD 1I7ZA 1K8DB 3GUTA 4U1GB 4L9LA 4GW4B 1LEIB 4GG6A 3S9DB 1BQLH 4QYOA 4UBDD 1N5YH 4DEPC 5DVNA 5J12C 4WUUA 3ZSSA 4C83B 3RJDA 3ZE0F 2DLHA 3D3VE 2XQBL 3UTPE 1T1ZB 3WSQH 4KDVA 5J6HB 3TEUA 5IGXL 1NC2A 3DUUB 3BESR 4P5MB 5DFVC 5ADOH 3ZKXC 2UUDH 1YEKH 1G0DA 3RRQA 2E8YA 4LF3A 4Y4FD 2JLLA 2XTLA 4M5YL 2IADB 1KYOK 2OCFD 4LHJB 1A7OL 1DN0A 3KWWA 1CI5A 5DD1H 1UJ3B 1R5VA 4JFHE 3VGFA 1QYGH 5DS8B 4PD4J 4MAYB 1EJOL 3ARBA 3H9HA 3IDGA 5I17A 2R8SL 2YUVA 4PJIA 1YEIL 2HVJB 1G9EA 3TIDA 2OMNA 1QKZH 2Q76A 5HHQA 4U6YB 1TVHB 2FL5A 1P7QB 4KGLA 1WBZA 1MWAH 5CAYB 4ZDHB 1FC1A 3NH7H 5E2JA 3LS4L 4NJ9H 4IM8A 4IOSD 4PP1D 2HN7A 3IU4L 3IAPA 4OKVA 1HZHH 3VE0A 4CVXB 3WS3B 3MV11 4OV6F 3WE6A 2GHWB 4F15B 2BNRB 3RWDB 5IBUG 1FNGA 5HDQH 5I1JH 4WCYL 3IKCA 3U4AA 1P53A 5DJ6B 4LCCA 3AROA 5FKPA 4X7DC 2XACC 1NMAL 5I71B 2CMRH 1BD2E 3C5ZB 4PJ7F 1WCBB 1A1NB 1G6RB 3FOLB 4JFFA 5IMKB 2DRUA 1I1YA 4JZJB 5E5MA 5JHLL 4KY1H 2GAZA 4I4WB 3EYOA 5T3ZE 1YJDH 1Q72H 2Y06L 1PG7H 4WJ5A 5D7LE 4Z78A 4L8DA 4XC3L 5JW3H 3BZFA 2F15A 3IF1B 3QUZC 1HHGB 4MDJB 2FBJL 4G8GE 5GPRA 4E5XB 4IEFB 4HUUA 1YN6B 1OM3H 4X7CC 4H0GA 4YPJA 4J3XA 4OAWA 3NTCL 5E4EC 4JO4H 3BWAB 2NY0B 2WBKA 4JREB 5J1TC 3EYUL 1NMBL 4YHPA 5HHXH 5TF1H 1YMMB 3QIBC 1X7QA 4OLWL 1EEZB 4EQ3A 3T0DA 3OKKA 43C9B 3DUSB 3EW3B 3V6OC 1LE9B 4XZUB 3X11A 3BRFA 2HYMA 1PZ5B 2LU3A 1OQOA 4QHLB 1HH9B 3V9FA 4PJCB 3NIFE 3QQ4B 4M7KL 1YY8B 3JTSB 1UXSB 4CRPA 1OHQA 4EXKA 4Q9CA 4NO0B 1TJHH 3H9SE 1NCAH 5DRNA 4AL8L 4E41A 4HFWB 5J89A 5EOQL 5DLML 3MJ9L 5EUOE 1BLNA 5BMFL 5J1SC 4NM8H 3IXAB 3CLEL 2ICWI 4U31A 2NXZD 5MEND 2Z35B 1VFOA 2FHFA 4WW2A 1I9IL 5H2BB 3QHZH 5ELIA 4KI5D 2FB4L 3W0WA 4Q58C 4GXUN 4F9LA 3V6BR 3RKDC 5IIEB 2WINA 1PVHA 1BBDL 4JPVH 4I0CC 5JZ7D 4R4BB 3QO0A 3MA9H 2QQLL 1B0GA 4HQQH 4NQUA 4OZGE 5ICXB 4UIKL 5C07D 3WN5B 2C7UB 2EDDA 5CBEA 2QQKL 4U1MB 1EFXD 4FFZL 4KI5F 1I3RB 3MSPA 1IBGL 4PV9A 2X7LB 3NA9H 1BZ7A 1QEWA 2E7LA 4GLRH 5BVJA 1OPGH 2DOCA 1L4IA 5ENWB 2J1KA 1A7RH 4Q6IA 3GB7B 4JFYB 3G5YB 1WK0A 5FGSA 3IFLL 1FJ1B 4V1DA 1IGCL 3X12A 5JXED 3IVKA 5E9DD 3GNMH 5HHOB 5I1KL 1EIBA 1MI5D 1Q9WA 2XN9E 4LSTH 2BJML 4N1CA 4Q9RH 2Z8VC 4P2RD 4UQ2B 5CKGA 1YMHB 3CDGA 1FFQA 1HHKB 3SGKA 1B88A 1GGCH 3ARGD 4YFLF 1IJ9A 4NZTL 5EU4A 1IC5H 3VDAA 3OKMB 3KNBB 5DRXA 3KS0H 2P1YA 1CE6B 5ILTH 4WO4D 1NAMH 2X4UA 4PJXB 2ZPKH 4PREB 3QG6B 3JTTA 4HIXH 5EO1B 1YEDB 3EOTH 9CGTA 4Z7UE 2X89A 3B8YA 2IPUK 2VIRB 5DSCA 2X1XR 1C7TA 3QXAA 1K8IA 5TQ0L 1N6QL 5D96B 1KCLA 3TIEA 2ADFL 1HYRC 5DQDL 3G6DL 4X4MA 3G5VA 1IVLA 3WDHA 3RZCD 1S78C 2ICEA 4X0KB 2IQ9H 5JIIA 1I3VA 4N9GB 2ICWB 4UNVA 4GQ9H 1BQLL 2IMMA 5GHWH 1RULH 1QSVA 4KK5D 5HBBA 5B3NA 5CGYD 3BZ4A 1N5YL 4JVWA 5H37G 2IBGA 1GGBH 4WFHD 5D7JD 2NZIA 5LAXB 5DJAB 3AC0A 1U8QB 3FB8A 4TN9A 2XXMB 5K59F 3BT2H 1S7TA 4WGVB 3WSQL 5D1ZA 3GGWB 3VXRA 1FV1B 5B4MD 5ADOL 1YEKL 3O2DA 5E4IA 8FABB 4Y4FB 1HHJA 2Q8BH 3VDBA 2R15A 1UB5B 1J12A 2Q3AA 2VAAB 4EUPG 2MQ3A 3MUJA 3CVHH 2CRMA 3MBEA 3DTXA 4HUXB 5DD1L 3U0TB 3HE6C 2VWEE 3DHJA 1WT5C 4P9HH 1QYGL 3PWPA 4D2NA 5C0BE 1I8KB 5HI3D 5TE7L 1FYTD 3IFOA 3QWOB 2AK4A 1JHKH 4XI5C 4NGHH 3SGEI 1CG9B 4ZFOB 3BW9B 1QKZL 1T83C 2EDOA 4P2OA 4BA8A 4HIJA 4ZQKB 4N0UE 3O2WH 3OTTA 1MWAL 4XT1C 3S4SA 3NH7L 2J8HA 4NJ9L 1NJ9A 4HGMA 3V5DA 1OAYH 1JF5A 1EH9A 1HZHL 2EH7H 3KPPA 4Z8FL 1T5XA 1JYXA 1FNEA 3H0TB 4QRTA 4EKXA 3LB6C 2EH8H 1RY7B 2ICCA 4PJ7B 4WGWB 3QEHA 3TGXA 4MYWB 1Z9MA 2X4NB 4L4TE 4RX4A 2FEDD 2JF1A 5KSBA 3IDYB 5IQ9B 5GS1B 5IMMB 5HDQL 5I1JL 1VEMA 1CFSA 1G7LA 5FGCE 1JI2A 1XR8A 2NY6B 2ZOLB 4HH8A 2X9XA 4KPHH 4XBPA 5CP7A 4UINH 1ED3A 1FYHB 4F7CB 4PJBE 4APQA 2WMPA 2J8UA 1JZ6A 3QH3B 3CUPA 2XT1B 1PW3A 3CK0H 2CMRL 4WWID 3MV7E 3BFOA 1QR1A 3SDCC 4B41A 4Y4HD 3BIAX 4KY1L 4WI8A 1HKLH 4CN4A 5EOTA 3HMXA 5I1IH 5KN5A 1Q72L 5KVDH 1KPUA 5EFIA 5SWZA 1PG7L 4RZCB 4YDKH 4Z18A 2M2DA 4M43H 3VI4F 4P5TA 4Y16C 4YFLI 5JW3L 2BVEA 5ISZD 4PGDB 1BIIB 2KKQA 4IS6A 3DXAE 1R3LB 4GRWF 1AGDB 4HUWB 5TH2A 1OM3L 4A6YB 4JO4L 3MGTB 1NCNA 4UV7H 1D5ZA 4PTTB 3D18A 3W5MA 4GG6F 1NC2D 1WBYA 5HHXL 3BGFC 2AV7A 4NZJA 3ULVE 1ZWIA 4UV4H 4ONHB 5JO5B 3LS5H 5IV2A 2NX5E 3O8XA 3RY5A 4K7PY 3VFNA 1NFDA 1J8KA 1S7RB 5BJTB 5JTWA 1QFWH 2JB5H 1RK1A 3VXMD 2AJ3B 4Y5XB 1MAJA 4NKMB 2Z93B 3O3UN 3C9NA 3AM8C 5E6ID 3GSNA 3AU1B 3BUYB 5B39B 1JP5A 4JO2H 3BUTA 5DEGA 3BSZH 1TJHL 4JKPH 5ESAA 3S3SA 1NCAL 2R56H 2OTWB 3CFJB 2YKLH 5J57B 1S5IH 1TZHB 3QFDA 4J8RB 4GO6B 1K4CB 1X6LA 2NXZB 4NM8L 5MENB 1XR9B 2N7BA 1BF8A 2XIDA 3P2TA 2RHEA 4HULB 5JDJA 3DVNA 5ANMB 4S2SB 3HE7D 4PGZA 2NNAB 4X98A 4KJWD 3U46A 3AS3A 4WEBH 3S6CA 3QWRA 3W11D 2H2PD 4MCYB 3B6SA 5F7HA 1E4WH 4LLQB 4QRSB 5C07B 2A73B 1D6EB 2YD3A 4YDLC 4HQQL 4M02A 1ZAGA 1EAPA 2LU7A 1EHLH 1EFXB 4RQQB 1BFTA 3V4UH 1U8PB 3DPBA 1WZKA 3DETC 1RV6X 1ZT7B 4YPGB 4X7EC 1RJYB 1S7VB 4M93C 1OPGL 1QFUH 5J3HC 1A7RL 4R7DA 1B3JA 1TJGH 2HTKC 2WBJC 5EOCJ 4U1HB 3W39B 3G5XA 3I3EA 5F6IC 3WJLC 1I1AA 2W65B 1KN2H 3V0VB 5E9DB 1CXHA 2YEZA 5SWQA 3TNNB 4AT6A 3SE9H 4OI9A 1MI5B 3GNML 1E4JA 4P2RB 1G7MB 4J12A 2HLAB 5IR1B 1RZKH 4JAMB 4F37F 3FFCB 2OQJA 3O45B 5FYKE 3G08A 4NZRH 5GSRA 3ARGB 3C60C 1NEZA 2WBWB 5DF0A 5CJOH 1GGCL 3RX5A 4IDJH 1J1OH 1J1PH 1PX4A 4JFDA 5MEPB 1IC5L 1UWXK 1TPXB 2AXHA 1CN4A 4WO4B 3FONA 4WIQA 5KAQG 4NPYB 5ILTL 3B43A 2UZYB 1NAML 1ZA6B 1X6NA 3BHBB 1KTKE 3EGSB 3IDMA 4OCRH 4C56E 2CDEB 2ZPKL 5FDWB 4L8CB 4MDIA 4HIXL 4B53A 5AG9A 3RPIA 2EYSA 3EOTL 3VGHA 3MCKA 3ZT5A 2MJWA 3LRGA 4UOW0 5CLTA 1M6OA 3P77A 4ISVB 2HFEB 1R0AH 3RZCB 4HGWA 1P4LA 4U1NA 3O11B 2Q1EA 4NO3B 2XWJB 3VWJA 3DO3A 1ND0A 4OIAA 1UQSA 2IANE 2IQ9L 2MKWA 1X5HA 2VRAA 2NY1D 4LQFH 1JI1A 3TZVC 3T3MF 4F58H 4GQ9L 3DX8A 2LFGA 5GHWL 1RULL 4QGYA 4ZUWB 1AGEA 5D7JB 2EDJA 3AREC 1GGBL 1EXUA 1NDMB 2NLJB 2I5YH 1O5DT 4YHMH 1OT1A 5EU3B 5EBLB 3BT2L 4HJ0C 4M48H 1DBAH 2DTMH 4MA3B 1T7XA 4ZUVA 4NSKA 1ONQA 1A1MA 2GJJA 1Y0LA 5IHZA 1U58A 3P9WB 2Q8BL 3BIBX 3S37H 5DGQA 1C12B 1JGEA 2FEEI 2VLLA 4PRBB 1MH5A 3CVHL 3B2UD 1OOAA 2WUCH 2WQRA 1M7DB 4NFCA 1IKNA 1UACL 2AJYH 3JWOC 5DR5H 5E8PB 4P9HL 5FA4B 4D9QE 1C1EH 1FYTB 1M05B 4UAOB 3SBWC 4X9IA 1AGBA 3EZJB 4ZNEE 4NO2B 2RGSA 4KFZC 1BP3B 1JHKL 1EX0A 3GSUA 3L5WA 4NGHL 1J0JA 2Z8WC 2AV1A 3CXDH 1BFVH 2WWMC 2BOBB 1VHPA 2HG5A 3O2WL 1I8MA 4FQXA 3DLQR 4EDXA 3RVVD 5CD5C 1ORQB 3VCLB 3KLSA 1OAYL 3MBXH 1A6UH 2EH7L 4PRPE 5CEZE 3QUMA 3TPKA 3RAJH 3T4AB 1YZZA 2EH8L 4QRPB 2COQA 5DUMH 3BE1H 1UEMA 1KPVA 2HJKA 3CH1A 3OG6B 3PQYE 1H8OA 5EU7E 4C57C 5DO2C 5AAWA 4U1LA 3K4ZA 4KPHL 3WIFB 5CCKH 3O3BA 4YHNB 1QLFB 4YUEH 4O02H 2EDFA 4UINL 4KK6D 4LKXA 4P4RA 4JG1H 1OGAE 3EJYC 4Y8AA 2FH6A 3MO1B 3WS6A 2CR6A 3EO9H 3CK0L 1WFOA 3MTRA 5DJZB 2V5YA 1PD6A 4QRRD 1LQSR 3C6LB 4Y4HB 2X89D 5BZWA 1JF1B 2FZ3A 5DJXB 4FQQB 1C8PA 3GZKA 5C08D 1NUNB 4GRWB 2YBRB 3WL9A 1I7ZB 4ENED 2GJZA 1HKLL 4K8RC 4JRXD 1DUZA 5I1IL 4P59H 4QRQB 1JK8B 1KCSH 5KVDL 5FYLD 3QFJD 1JF6A 4GG6B 2NTSP 2A9NH 4OGXH 4P4KA 4QYOB 2UWEE 3NIDE 2Z4QA 4YDKL 3VI3E 1BEYH 5CGTA 2HFTA 1UXWA 5ISZB 4HG4J 2VERN 3FQTA 4WUUB 2VUYA 2WUBH 4LHUD 4ODTH 4QRUB 1TJIH 5INDA 2GFBA 4UV7L 1NC2B 2PW2A 1DDHA 3TVMD 2LVCA 4WFFE 4GAGH 4I0PC 3WUWA 4CJ0A 4LF3B 1XT5A 3FT4A 4KXZH 3SJVD 3GI9H 1QRND 1K4DB 3LS5L 4ZFZB 3U1SH 4KJQD 3VXMB 1KTLA 1I7UA 3KWWB 1QFWL 2JB5L 1T6WA 1U92A 5E6IB 1NBZA 3KPMA 3HRZA 2P47B 2SEBA 5F7YC 4JO2L 3H9HB 1N5AB 4ELMA 3BSZL 4YHIA 4KVNH 4PRID 4JKPL 4PJIB 3EDDA 1XF4A 5T3XE 4GT7A 2BOCA 3OAUH 2R56L 2GW5A 2YKLL 3O6FC 3LKNA 1S5IL 1CWVA 4D8PB 1KYOJ 3C5JA 5FCUL 1TQCC 1T66C 3HC0B 1JZ7A 3HE7B 1JIBA 3B9AA 4R6UA 1DVFC 2HN7B 1WFNA 4NNXA 4OKVB 3VE0B 2EDKA 1DEEA 4U6XA 4WEBL 4P48A 1ES0A 4Y5VA 5EU6A 5CZVH 3WE6B 1E4WL 3SO5A 4YEFA 2A83B 2A6JA 1Z5LB 4HJGA 4NP4H 4TSAH 5K93A 3TH3T 3UYRH 5CEYA 5I6XC 4PGJA 1EHLL 4J4PD 3WNOA 3V4UL 1EGJH 3RFZC 4R2GD 1KIPA 5LG1A 4LEOA 3DECA 4OCNC 4HWZA 2LTQB 4RIRA 1KLUB 1BQHG 1QFUL 2E27H 4ZUSB 1TJGL 1AY1H 2O5ZH 3RY6A 2JJTC 1MVFA 5F8RC 2GAZB 3EYOB 1ZLWK 3WLWD 3LH2H 4CW1B 1KN2L 3ZTJG 1SY6A 3BKYH 4WJ5B 3SE9L 3ULUE 4L8DB 4PJDE 2OLDA 1QPXA 5LWYH 3BZFB 2QBWA 1RZKL 5CZKA 3KPNA 4NC2B 3WFCH 3KJ4B 1INDH 4NZRL 2G9HB 5F7NC 4HKJB 5CJOL 1D6VH 3RWCA 5FYKU 4IDJL 4FABH 1J1OL 3RTQD 1J1PL 5C0EB 5CWSA 3CPLB 3T65A 1IEBA 2BCKB 1T0NA 1TTGA 3CDFA 4LSQH 1OWWA 2CD0A 5FUOH 1X7QB 4PRDA 3ARQA 4OCRL 3MRMA 2R2BB 1WEJH 3EOBA 3BKMH 4TVPH 3VFGH 3D3VD 3AS2A 4RFOH 5D1XC 5F9DC 3X11B 2V7HA 3GIVB 1JHTB 3CFCH 4XVUC 1HSBB 3VXTB 4KKBD 5JOFA 1R0AL 1AHWB 4G8EB 2VC2H 2P42B 2NY1B 1JN6B 4L9DA 1T7YA 3CIQA 4OV5A 4Y88A 2XWBA 4LQFL 5EBMB 5F1NA 4F58L 1P2CB 1J05B 1Z9LA 3GSXA 4LKCA 5GISH 5J11B 2F74A 3FFDB 1BLNB 1XIWD 4IRJC 5C0CD 1INQA 3ET9F 2VWEC 3MLTA 4KQ3H 2UVFA 3TPUA 3UXFA 2I5YL 4YHML 3OF6D 2P5EA 1RQ5A 2P8MA 4YLQT 1WLHA 3EDFA 3MODH 1RJZB 3QDME 4M48L 1DBAL 2DTML 2GITB 4MJ6B 2WP3T 1PEZA 4W6WB 5DA0B 5IWLA 3MYZA 1EVTC 4GRMA 3HCVB 4Y4KC 4O2CA 3QO0B 3HMXH 1Z6JT 3S37L 1QSED 4TUKH 1B0GB 4N9OB 4CJ1A 1NGWB 4KI1A 5CBEB 2WUCL 1MCKA 4X6FA 4AG4H 2AJYL 1KLGB 2P7TB 5DR5L 1AIFA 4PV9B 1C1EL 2VLJD 1FL3A 3TYFB 3REVA 3FN9A 4HBCH 2AEWA 4HUVA 4GAYB 2KH2B 3WEXB 5K33A 1QBMH 4RFEA 2UYLA 4S1SH 3EO0B 1DBBH 3STLA 4MD0A 3CXDL 1BFVL 2YZ8A 3OMZA 5GS2D 1FSKB 4V1DB 3X12B 5JHDD 2GK2A 5EZOH 4WI9A 3NCMA 4KTDL 2AK1H 4O00A 1FP5A 1WZ1H 1Q9WB 5FKAA 2VZ3A 1BD2D 2G75A 4Q74A 4HZLA 3MBXL 1A6UL 3QUXC 1T2XA 3RAJL 3ZYOA 2VZSA 5DUML 2BC4A 1X5LA 3BE1L 5I1DA 5T3ZD 3NGBB 1CGXA 1NLDH 4H1LA 1Q1JL 1RU9H 4OGAC 5EU4B 2MPAH 1GOGA 5DRXB 5IMLA 5CCKL 2DIJA 4O02L 4F8QA 2XKNA 2X4UB 5IQ7H 32C2A 4JG1L 1G7PB 3JTTB 1HQ4B 2YSSA 2P5WE 2J7LA 4QRRB 5GZOD 2DQCH 4N1HB 2OI9C 4RRPA 3EO9L 5D2NC 3DROB 4RNRA 5DSCB 3ARUA 3QXAB 1K8IB 2BVYA 5C08B 2ADIA 1FBIH 3EO1B 5BCAA 3MACL 4WW1A 4JRXB 3G5VB 4L3CA 1UT9A 2OK0L 3MLUH 4M9OA 3QFJB 4P59L 1KCSL 3LKQB 2XKUA 3GMRA 5A16A 1ADQA 2A9NL 3LKPA 1KCVL 4OGXL 5ID1B 1BEYL 4QF1B 2Y36L 4YEEA 3U7WL 4U2YA 5LGJA 3VD5A 5FF6A 4TTGA 4LHUB 3IFNH 4OLXH 5SX4H 1BQSA 1FO0H 2WUBL 3IDJA 4P2QE 3FB8B 1NGXA 3IYLW 4ODTL 4POZD 4Q2ZA 5A3IC 1I7RB 4WWKD 3GRWH 4HLZH 5JW5B 1TJIL 5HPOA 1A2YA 3HUJE 3P9LB 5D9SB 1M7IB 4N8CH 3WFHB 4GAGL 1HHJB 3SJVB 4MA7H 2QSTA 4YHOH 3I2CH 4G43A 2VISB 3GI9L 3U1SL 4XB8A 1CXFA 3SPVA 4Q9QH 5TDOA 3VRIB 3NCEB 1OAKH 3EKCA 3PJSB 1SVZA 4KJYA 1M1SA 2BSTA 3X14B 4PRIB 3IFOB 5EUOF 3ZT6A 4KVNL 1FZMB 1RURH 4CU7A 2C3VA 3OAZK 3OAUL 4ORGA 3BOVA 3QP3A 5I1GH 3STZA 1UM5H 2BFVH 1MJJA 1VADA 3S4SB 1YEEH 2WK2A 3H6JA 4TNVF 4JHWH 4GMSH 4Z7WA 1FZJA 3PL6D 2HT4D 2VUOA 3KPPB 2ZCKH 4QRTB 2XZZA 5CZVL 1GJIA 4K3EH 1NBYB 1XGYH 3QQ9D 1C5DB 1IM9A 5CD3A 3RVUC 3UZQA 1I1FB 1QSFA 4BFIB 5K9KB 1CFSB 4NP4L 4GW5A 4TSAL 3UYRL 3T2PA 2ZSVA 4XBPB 5CP7B 4R2GB 2XN9D 1EGJL 1JTPA 3QUZA 4LCWE 5JW4N 2EE3A 4ALAH 2YC1A 3CUPB 4AYFA 5I76A 2VQ1B 2FATH 1F4HA 1KELH 4BSVB 1C5CH 3QZWB 1U41A 4JDZA 2E27L 1AY1L 2O5ZL 5DRZA 2X9WA 4G42B 3IDIA 3QIBA 5KN5B 5GS0D 3LH2L 3MJ7A 4K07A 5EFIB 1NCDH 1TZGH 2ZP0T 2ENYA 4PIRF 3V6OA 1DZBA 1IGIH 5LWYL 4EN3C 3AY4C 3WFCL 4TSCH 1INDL 2A9MH 4IS6B 5DHYA 1U3JA 2V6HA 4TTDD 3O9WD 2CDFB 3DIFA 1D6VL 1MY5A 1NH6A 4R7NB 5FDYA 4FABL 4FN0A 5MERA 1LP9E 1GHFH 4LLYA 3D18B 3CFEA 5DJ2A 5CEXA 4DCQA 1WBYB 2WNGA 4LSQL 1W0YT 4HH9B 4MQSB 5FUOL 2HT3C 3ZDXE 2C5DC 5IVXE 3THMH 3H7BA 2ZKHH 1NANH 3O3DB 4MQTB 5IV2B 3WHE0 1O7VA 1CYGA 2JCCE 4DZBB 1WEJL 3BKML 4TVPL 3VFGL 4RFOL 3MRRB 4L8BA 3CFCL 3M45A 1QO3A 2NY3D 3GSNB 3JV4A 3RIAK 4J3VA 3MRJB 4HIEA 1BAFH 3GJFA 3K1DA 3OXSB 2CK2A 2VC2L 3QUMH 3SCMC 1RVFH 4TRPH 3C6SB 3F7YB 5EC2A 5F9JA 2X1OA 2QSCH 4XWOC 3VFVA 2HMIC 2R4SH 1JNNH 1GOHA 1A02N 1FLRH 1XIWB 3QDGD 2CH8A 4N0RA 5GISL 5C0CB 3LV3A 2V2WA 2DQTH 2NZ9C 1DQQA 5BS0D 2Z8SA 3LAFA 4JN1H 3DVNB 1ZT4B 2FX7H 2H41A 3C87A 3U46B 4JHAH 3BH8A 3R8BB 1NGQH 5E5UB 3BN9D 2R23B 3UTQB 3B6SB 4LCUA 1QSEB 3E6HB 3HMXL 5E5RB 1ZA3A 4FZ8H 1LDSA 1EAPB 5AUMB 1EO8H 4I3SH 3K8MA 1WTGT 1ZHNB 2AJVH 2GSIA 2D9QB 4MNQE 4AG4L 2R29H 2VLJB 3RVTC 3HC4H 4R90H 2RAMA 4XMLH 1T1XB 1JE6A 4L4JA 4NT6A 2VE6B 1A47A 4HBCL 5J0BA 1U2HA 1QBML 3UPAA 3V5HA 3RVXD 4MZ3A 4S1SL 5DZLA 1DBBL 5AWNH 3ARTA 3MRFA 4KTYA 5JHDB 2DMCA 3RVWC 3LMJH 1WITA 4GBXD 4PJAE 3VD3A 2YEZB 1HEZA 1MELA 5SWQB 5EZOL 3HB3D 3NCYS 5J9PB 4XNZB 3VXSA 4GUPA 1BD2B 5F7EH 4XBGA 5JDSA 3SE3C 2GJ6D 1WZ1L 3NCYP 4PJGF 3QIUC 5HDBE 4L3EE 4U6TA 3G04A 4PB0H 3G08B 4PJ8C 5EA0H 5KSVB 1NEZB 1T1YB 1XF3B 1ZMYA 1NLDL 4XAKD 1EVUA 1RU9L 4OFVA 2IAMC 1QLRA 3SKJH 1OCWL 1WUNT 2MPAL 2WWKO 3IDMB 5IQ7L 1IQWH 2D2OA 4MDIB 2OZ4H 2F54A 5E8OA 4BK5A 4KK9C 4RAVB 3DXAD 3MCKB 2DQCL 4X6DA 3ZLQC 3WKMH 3WKNA 4DKEH 4FQLH 5IB1B 1LWRA 1FBIL 2NY2D 1P4LB 2MCPH 1TVDA 1F13A 2NXYC 3ULVD 3MLUL 3VGAB 6FABH 2CDGB 3MX0A 1GH7A 4UU9A 5C0JB 2W91A 3DX8B 1ROWA 1J0ZA 4YO0A 1UH4A 4OZFA 4CMMA 3JV5A 4EBQL 4UB0H 5DK2A 3HE6A 4D0CA 2Y72A 3LPGA 3VXNB 1WT5A 5IKCA 1JGVH 4KROC 3VD7A 3IFNL 4OLXL 1FO0L 5C0ND 3ULVF 4YXLH 4PV8A 3P4OA 4KDWA 3GRWL 1NGYA 3KLHD 3SOBH 1T83A 5IFJB 3MV8A 4N8CL 2OSLB 1U58B 5EUOB 4MA7L 1OAZH 2ZUTA 3I2CL 1JGEB 3KPLA 2VLLB 4R4NC 3KXFD 1CD1B 4Q9QL 2W9EH 1OAKL 3T77A 2B8OT 5DDHA 1AGBB 2O61A 1LD9A 4X7TB 1IAIM 5D6CA 3GSUB 4M62H 4FXLA 1RURL 3MCG1 2AV1B 1CICC 5I1GL 1JPSH 3P0VH 1J8HE 5EC1B 3ZYIA 2HG5B 4MHHI 1KPRA 2NY4D 1VKXA 1UM5L 3MUHL 2BFVL 5DMKB 4LPTA 4EDXB 5L8LB 1DLHB 1YEEL 1SEQH 1TTUA 2D03H 3PL6B 4JHWL 3F62A 3QUYD 4GMSL 3SDCA 2ZNXA 5DQJB 3TNMB 5J13C 2ZCKL 5I1AB 4PJ5D 4JFEE 4K3EL 4R8WH 1KIUA 1XGYL 2B4CH 4KKAC 3IDUA 4B7LA 5C9JB 4AEHH 2H45A 5HVWA 4U49A 3WUZA 1IL1A 1MCSA 3B9KC 2XN9B 4Y16A 5GGSY 1MCWW 2VLKE 4LKXB 4P4RB 3BH9A 3T1FB 1MVUB 4ALAL 2IQAA 5FYKD 2ZUUA 4FQJH 3I3BA 2EE9A 2GSGA 3NCBB 2FATL 5D4QA 1KELL 5INCA 2LAGB 1C5CL 5EBWB 5BZWB 2FZ3B 3MRHB 4LHQB 4F3FA 4XRCA 4MB5A 5ICYA 3KYAA 3SGDH 2VLME 3BWUC 2DIAA 1NCDL 1TZGL 4HPOL 5IB5B 4KV5F 2Z4QB 5GQBA 5E8DH 4YZFE 4U1SA 1IGIL 3GMQA 1XGQA 3J8F7 3B5TA 4NC1E 3AM8A 1SBSH 4ZNCD 4TSCL 1JYWA 2A9ML 4R4FH 2I60H 1PAMA 5EN2A 1NC4D 2GFBB 2HH0H 1KUMA 5F3BB 3MRDB 1GHFL 1DDHB 3FT4B 3THML 4GKSA 2ZKHL 4HSQA 1INEH 4NQCA 3KVQA 4ODXA 3F5WB 1IAOB 1KTLB 4MX7A 3K46A 1AO7E 3OKLB 2ITCB 3D48R 5HHMD 2OS7A 1NBZB 2YA2A 2JJUA 5L9DH 1BAFL 5DMYA 2SEBB 4I5BA 5IJKC 2Z91B 3QUML 1DUYB 4TRPL 1FFPB 3EYVA 1BMGA 1ZLUH 2QSCL 4ZO6A 4D0DA 4YHIB 3MOAH 3OJMB 4H1LH 2BOCB 2R4SL 3I6LD 3SO3C 4YBLC 3QDGB 1JNNL 1FLRL 3R06B 2BNUA 3KJ6H 4OCMC 4PJFE 5BS0B 3OR6A 2DQTL 2UVEA 1OTSD 3DURA 4OZIA 2NY5C 2JTDA 5HGGS 4JN1L 3WNPA 4Y1AE 4LBEA 4MA1B 1DEEB 2FX7L 2R9HC 2YD1A 1U6AH 2WBJA 4U6XB 3BMWA 3QUKB 4JHAL 5B21A 1NGQL 4Y5VB 5EU6B 2DQEH 4EZMA 3WJLA 3KPRD 2DM3A 2EZ0D 2ENSA 4TOYH 2A6JB 4FZ8L 3TO4D 1IM9D 3MRIA 3ETBF 3NACL 4LP4A 1TCRA 4NQDA 5CEYB 1ADQH 1EO8L 4I3SL 1N59B 2AJVL 3IETA 1MNUH 3VFRA 1FIEA 3HC4L 1RUKH 4R90L 1A6AB 4XMLL 3C60A 3DWTA 2R2EA 1SJEA 4N0CD 1MAKA 4PJGB 4YDJA 4CU6A 3MJ6A 5ESVA 5FHBH 5FGCB 5KBNC 1J9CT 3ESVF 5TDPA 3ZKNC 4GBXB 5AWNL 2X42A 1ZT1A 3P0YH 3N50A 3O0RH 3O6MH 5EO0B 2DQHH 4OD2A 1H5BB 5F1IA 4PJHA 1GIGH 2GJ6B 4IMLA 4Y0GA 5F7EL 4DGYH 3F7VA 4HLJA 2GYSA 1JCKA 1HINH 4KMLB 4PB0L 5JQ6H 3CX5K 5EA0L 2E9IA 1I85C 5L8JB 1IILE 4BKLA 1DE4A 1E6OH 4CU8A 5GZNC 3TZVA 3T65B 3FN3A 1OQXA 4DKAA 4UUJB 2EDNA 3FQWA 3SKJL 4JY4B 2L4OA 1JV5A 5F44A 1KB5A 3AREA 4H25A 4TUOA 1F00I 5FUZH 2V2XB 1IQWL 1P1ZB 4MXQC 2OZ4L 3U2SA 1IGFH 3VW3H 2YS4A 4ODBD 1S8DA 3K7UA 3WKML 4DKEL 2NY2B 1SYVA 4FQLL 4ACPA 5JOFB 4OM1H 4XPFH 1RZ8A 2F8VA 1J87A 4WEUD 2ARWA 3D0LB 2MCPL 3UTTE 6FABL 2PXYD 4OV5B 3LEXB 1QUNA 1VFBA 2H3NA 3GEWB 5I9QB 3W9EA 2BX5A 4JFPA 5CS7A 4ZSOB 5I1LB 4P2CG 3SKOA 2F74B 3RNKA 4UB0L 4YBHA 2HFFB 1JGVL 4CL7A 1X3DA 4XPAH 5DJ8A 3MLTB 4JQIH 3SBWA 3FRUA 4YXLL 3BVNB 4PR5A 3HKFA 2I25N 2VKWA 3WIIH 4FMFA 4O51B 4M8VA 3SOBL 4M7LT 5HHNA 1HCFX 4FZEH 2VXVH 1CL7H 3BQUD 4O2CB 1OAZL 4XP4H 4RMWA 1DN2A 3LKRA 1XCTB 3Q5TA 3RNQA 4DFHA 5T33H 3KXFB 3EYSH 3DHMA 2W9EL 4X6FB 2R0ZH 2FH8A 1AIFB 3GSWB 1CQYA 1FL3B 3NFSH 1Z0MA 1DBKH 2A6KA 2VDQH 2R69H 5E8EA 2A6DA 3GSVB 4M62L 1YQVH 2HVKA 3PV6B 4D3CH 3VGEA 4PG9A 4WU5B 1BJ8A 2AW2A 2AVGA 1FL5A 4HXBH 5ID0A 1SHMA 1JPSL 3P0VL 2DM4A 4RFNB 4X5WB 2OL3A 3B9EA 1DBMH 1SEQL 3VXSD 2G75B 5JORA 3TFKD 4HZLB 1HYSD 2FECL 1T5WA 3OJDA 4PJ5B 4YJZL 2BC4B 2DWEB 4O2EA 3GJFH 5DEZA 2B4CL 2Q7YA 4AEHL 1KEMH 1F90H 3E6FA 3ULUD 5MEOA 3NCFB 2LU4A 4XXDA 2XKNB 1HDMB 3D85D 2BSRA 3A67H 1UKSA 2HTLC 2BDNH 4Z7QE 3ZDYE 1MCQA 3EZ8A 4FQJL 4RNRB 3CC5A 3HZKA 1JGDA 2ADIB 2R1YA 3QPQD 4WW1B 1V7NH 5FO7A 2NYYD 3H9SA 4NUJB 4ODSL 3ULUF 4I0PA 1WGOA 5DEFA 3INUH 4AM0A 4CMHB 3QA3A 4HC1H 4LRIC 4ZAKC 3S3PA 3GMRB 1S9XA 4L4VA 3LKPB 2FJGB 1H15B 3RL1B 5E8DL 1TNMA 5FF6B 1SBSL 4I77H 2BNRE 5FK9B 1SBBA 1T04A 1NC4B 4R4FL 4Q2ZB 1NGXB 2I60L 4YR6B 3N06B 4KRPC 4KKLC 1A6WH 2HH0L 2OYPA 4OIIH 5IBLD 3U6RA 2VL5A 3BGMA 4OZGA 5KTEH 3O6FA 4KVCH 1F4XH 5CJ5A 4K7PH 3TN0C 4G9FD 1INEL 4R3SA 2WIIB 2X4SA 3SPVB 5TDOB 2H26B 5HHMB 1N3NA 4MMXC 1DVFA 3OSKA 2C3XA 2DJUA 1WBXB 2CKNA 1ZV5A 2J88H 5L9DL 1N64L 4A2LA 2I9LB 1OARH 3S5LA 4WI4A 3ROOA 3MOAL 3DBXA 3RUGA 4HX1A 1R6VA 1OLZA 4U1KA 4K3JH 3EFFA 4JFQA 3D0VA 3KJ6L 4C4KT 5DD5H 1GSMA 1MJJB 3M17A 4H88H 3OB0H 1FZJB 1YMME 4Z0BH 1S9VA 1U6AL 2JJTA 4U3HA 3KPRB 5D6DC 2DQEL 2VDLH 3PF2A 3HZYB 4X83A 2KL6A 3TO4B 1IM9B 4TOYL 3IJYA 1UJTA 4PJCE 3H9ZA 4GW5B 2D3VA 5HYQB 1JWMA 1ADQL 1G9NH 5I2IB 1BGXH 1L6ZA 1MNUL 5HVHB 4Z7UA 4YK4C 5KAQF 1RUKL 1A7BA 4YXHH 1QFHA 5ITFA 1XGUB 4A2MA 4JDZB 5FA3A 3KHQA 3GSOA 4XC1H 5FHBL 1HXYB 2X4RB 4Z5RA 3IDIB 4C54A 3HHRB 3RDTD 3MJ7B 3DVGA 3P0YL 1JGUH 2OXHA 1IQDB 4U1IA 3O6ML 3O0RL 3VRJA 2DQHL 1KXQE 4JZNB 2A38A 1JZ2A 1GIGL 4FQIH 4FQ1H 5D1XA 1IGJA 2DLFH 4DGYL 3RGHA 3MNVA 4OI7A 3NIGE 1HINL 3LN5A 1XAUA 4W4NA 5JQ6L 5CSGA 1DQJA 5A1AA 1DCLA 3MLSH 4EUPB 1TZIB 1MSPA 1RZKC 3DIFB 1CGWA 1E6OL 4CDHA 5HYJA 4LLYB 3CFEB 5DJ2B 4Z77A 4DCQB 4NJAH 3GMPA 5D1QD 1S7XB 1WSST 4DVBB 3H7BB 3BIKA 4IRJA 4IOIA 5FUZL 1U8IA 1S5HA 4NQCD 4NCC2 1IGFL 2F58H 4P2QD 5C0BA 3MMEB 3VW3L 2PO6C 1T21A 3PGCA 3JV4B 1OF2B 4OM1L 4XPFL 3ZDZF 4YHKH 3LD8B 2PXYB 4Y4KA 3CMGA 3FB6B 3PHOB 4M6MH 5ETUB 5HHOE 4J3WA 2Q3ZA 3O6LH 1F11B 3VFVB 4ZFGH 5IP4A 4N0UA 5FYLH 4BK4A 1PSKH 3LQMA 4MJID 2IBZX 5CZXC 1WC7A 4FS0A 3P9MA 1DQQB 3SE8H 4XPAL 5IMOA 3BP4A 3BPOC 1ZHBA 1H8SA 1UWEH 4OQTA 3WIIL 2PETA 3BH8B 4PJXE 4LCUB 1OP9A 3BQUB 5T1DH 3F8UB 2DQFB 4FZEL 2VXVL 1CL7L 1DSFH 2A0LC 2Y6SC 3V52H 1I8LC 1G84A 3RGVC 4XP4L 1BVLA 5HSFA 5T33L 2AEPH 4YAQA 3ZE0E 3K1KC 4PJBA 2C4XA 3EYSL 4EQ2A 4PLJC 2PTTB 3MV7A 2R0ZL 3QUXA 4EI5D 1CGTA 1AKJA 3NFSL 4X8JA 1DBKL 2R69L 3PIQA 3FQNA 4LIQH 3O4LD 4ZO7A 1HOCA 4Q7DA 2FYYA 2V17H 2OR7A 3TJHC 4UNUA 3V5HB 1YQVL 1MIEH 4D3CL 4G6KH 2Q86B 5HY9A 5I8EB 5D93B 3DRTA 4LPUA 4KK8D 4ZUTA 3U0PA 3D25B 3MNZA 2FHCA 2DICA 4HXBL 5I66B 1HEZB 4DQOH 4LVHC 1IE5A 1DBML 4GUPB 3VXSB 4GG8A 4OF3A 4XBGB 5JDSB 5D2NA 1F4YH 3EDEA 3V6FB 1JRHI 2QV2A 2A2QT 4I9WD 1QVOB 3HAEA 4MNGB 3LHPH 1KEML 1F90L 2BXYA 4LCYB 3L5XH 1KIQA 2OJEA 2ATPA 2NX5A 1BJ1J 4PJHF 1II4E 3D85B 5FB8A 3U48A 3MLYH 1ZVYA 4BH8A 3A67L 4F37K 2PYEA 1WFTA 5IK3B 1LO4H 3IFPA 2F54B 5TPWH 4JGJA 4LSSH 2BDNL 1B4RA 1YNKL 2ZOKB 4HJ0D 1V7NL 3GMNA 3BKCH 4F33B 1UM4H 5DT1H 4JB9H 4LLAA 5DGRA 3KPQB 3INUL 3WFBH 1WQVT 4HC1L 1ZVSA 5J6GA 4UU9B 5KS9A 4LDEB 4P3WA 3GHBH 3S96A 4YO0B 4OZFB 5C0DA 4D0CB 3TBVB 4PJ7E 4I77L 4ZXBD 5IKCB 2VZVA 4BFGA 3O3AB 5E8NB 5EIIA 3ZTNH 3ZDXF 1A6WL 5D7SH 3FO2A 4OIIL 1QZ1A 1KCUH 3WV0A 5KTEL 4RMTA 4G9FB 4KVCL 4R96A 1F4XL 3TBSA 3RWEA 4K7PL 1AXSA 3KR3H 3RHWF 2WWMD 4KZDH 1Q9LB 3UYPA 4MJ2A 5BRZE 3TBWA 2Z31D 5IESH 3OHXA 2CLVB 2J88L 3T77B 3I9GH 2APFA 1UENA 4X4XA 1BOYA 4NBZB 1OARL 3NFNB 4NQVA 3ZT7A 4JHZA 3I75A 1BX2B 3UBXI 1I4FA 2CKBA 1NCWH 5KG9A 4K3JL 4N0YH 3PWVB 3CZJA 1Q94A 3JWNC 5B8CC 5DD5L 4MNQD 3QIWC 1KB5H 2J5LB 4XP6H 3WLBA 4G6FD 1YC8A 3PXHA 2B39A 2P24A 3L7FA 3NAAH 1Y6NR 4H88L 2EDYA 3DOSA 4Z0BL 5I73B 2EYTB 1LEGA 1AD9B 1FNAA 4P3DB 2VDLL 3CFIC 5GIRB 4YE4H 1KTDA 5JMRA 1IAII 1K6QH 2ADGA 1G9NL 2D7PA 2E9JA 1WZLA 4EN3A 1BGXL 3AY4A 3LRSA 1NKOA 2IQAB 3L3DA 1FVEA 2A6IB 4LOUC 4YXHL 1X5IA 2GSGB 3PP4H 2MQCA 1A4JB 4FNLH 3OR7A 5I19H 1J0HA 5KANI 3QDJD 3OGCA 1XF5A 2IANA 2R1WA 4RMSA 4XC1L 2VABA 4NM4H 4Y2DC 4NO5A 3BGFB 3MRBB 1L0QA 4JM2C 5MENE 5F9WC 3LSOB 4YDVA 1YUHA 3C09C 2B20A 4ZODA 5GGRY 4KI5E 5CINH 1JGUL 1I8IA 5FAAA 1A8JH 1D5BA 4FQIL 4FQ1L 3GM8A 4YGVA 3FAXA 5DMJB 4MSWA 4HAGA 2DLFL 1ACYH 5C07E 2YZ1A 3SCMA 3MLSL 1A4KA 1VCAA 2G60H 3KYOB 2QHRH 1OTTD 3FZUD 2EYRB 2J4WH 1LMKA 5C86A 1UZ6F 3VA2C 4LLDA 4LLMA 4NJAL 5DMGC 1PYWA 4W6YB 4KKCD 4GKSB 4K23L 5H35B 3L3JB 1FRGH 4NQCB 1AI1H 3PWLA 3MJ9A 2X6MA 4QOKD 4GKNA 2F58L 2OL3H 2CGRL 1CD9B 5FECA 4PRHD 3PUCA 3UBXB 1TXKA 2AXGB 3HZVA 5E9DE 3RWFB 1X5GA 4YHKL 4I5BB 4P57A 3OB8A 1MI5E 2YD5A 3LZFH 5EZLA 5CBAB 4I0KA 4M6ML 4P2RE 4Y19A 5GGSA 1HE7A 4D0DB 4YDLB 3O6LL 2CXKA 4ZFGL 2VQTA 3FFCE 4MJIB 5DHVA 5FYLL 4QHNB 1PSKL 4KH2A 4GS7C 1KLFA 3RL2A 2FO1A 1R5IA 3SE8L 1IAMA 1MCNA 1UWEL 2ICWJ 4WHTB 2WBJB 2Y07H 2BY3A 4ETYA 1KB9K 3PQYA 3RUGF 4M3KB 2K7QA 1J0KA 5T1DL 2OJZH 3GMLB 1DSFL 1H3UA 3V52L 4HHAA 1J8HD 1OTUD 4XXCC 4YWGH 4JFZH 4YNYA 3MRIB 3ZZ1A 4AZ8A 1TCRB 2AEPL 4NQDB 1CBVH 1TQBB 1Q0YH 3SE3A 3RWJA 1WWWX 3IETB 3FRPA 5K59E 3QIUA 3VFRB 3L3KA 2YD7A 4PJ8A 4EI6A 3O4LB 3BN3B 1U3HD 4JANB 2R2EB 1SJEB 4LIQL 5HI5C 4RGMB 1S7QA 2V17L 4WFHE 3VD4A 2F8OA 5C8JA 3EYQD 2IAMA 1MIEL 4G6KL 4DZ8A 5DRWA 3BEWA 5TDPB 5E95B 4QHMA 1ZT1B 5F1IB 4OD2B 1IARB 4IRSD 1T3FA 4PJHB 4DQOL 4BUHA 4ODWA 5IVNA 4IMLB 1U8HA 1MCRA 3VH8A 4KDTC 3F7VB 3T4YB 1F4YL 4ONFH 1GVIA 1G9MH 2B0SH 2F53A 4Z0XA 3UTZB 3K4AA 1QBLH 1WZMA 2VLMD 4U6HA 3LHPL 3TZVB 3MREA 1TVBB 5HYJD 3L5XL 3S97C 4DN3H 5KJRH 5IHLB 3ROLA 1CDIA 1FYTE 4NKOA 1R3KA 3NN8B 2XFXA 1XH3B 5L88H 4IRJD 1LO4L 1X4ZA 5I8KH 5TPWL 4F15C 3U2SB 4LSSL 1S8DB 3EOYG 1GOFA 2V5MA 2W38A 3BJ91 1XF2A 1RZ8B 3BKCL 5EOCH 1UM4L 2CIIA 5DT1L 1A14H 4JB9L 4KGJA 4N8PA 4ZOBA 3F58H 3N1MC 3R8QA 3DYOA 4YZFF 2H9GB 2GCYA 3WFBL 5I71C 5GS0H 3C5ZC 4HD9A 3GHBL 3SKOB 3RWGA 4QRPE 3RNKB 1G7HB 4ZXBB 3DV4B 4D9LH 4B5EA 1MOEA 5DJ8B 3LQZA 4XVTL 4DGVH 1ITCA 3MUY1 1R24A 4AEEA 1KC5H 3ZTNL 5IB4B 4WU7B 3Q5OA 5FOJA 3VWKD 1FG2A 5BV7B 2E6JA 5D7SL 4RGNC 1N26A 4M61A 3ESUF 5HHNB 1KCUL 1KNOB 2VXTH 1CICA 3VI4E 1MCWM 1J0YA 1QQDA 5IW1B 3IRPX 1JMXA 4LVNB 5F88B 3FQUB 3KR3L 3RNQB 4KZDL 3S4SG 4OI8A 2Z31B 1AXIB 2YN3A 5EIQA 1GZPB 2IH3A 4Y1AD 4D9RD 1GC1H 4BQ9A 4QO1A 3EOAA 5IB2A 5IESL 1MWAA 3T0ED 2XQYK 3I9GL 4GG6E 3BEVB 3C5SA 2X70B 1FNFA 4ZS6C 4DJMA 2A6DB 2D31A 5ISZE 3OKDA 1N0XH 2VMFA 1NCWL 3B9KA 4PG9B 4OGAD 4WUUE 5C7XH 3KAAA 4PJDA 5ID0B 3MRNA 2BHUA 4G6FB 1KB5L 4XP6L 2ZUVA 2WLZA 4QTIH 5FIEA 3NAAL 4XPTL 2BRRH 1FZOA 1QLEL 1KJVB 1RHFA 1IEAB 3K2MC 4O2EB 3VXME 1QBBA 2C1OB 4FMKA 4PLNC 5TE6H 5HHPA 4U1JA 4YE4L 3HZMB 4UZGA 1KGCE 3D39A 1K6QL 2MQ0A 1F3JB 4XXDB 3KPOB 1RUMH 5DK0B 4POUB 3PDOB 4KKNA 3CJJA 1LO5A 3PABB 4PJIE 2DM7A 4L29A 5ERWB 1A9BB 3PP4L 3QDJB 3CC5B 4FNLL 3WN5C 1BM3H 2VH5H 5A3ID 2R1YB 5I19L 3D69A 5B3JF 1KJ2H 4X9HA 5FO7B 1FGVH 1Q9KB 4NM4L 4LU5H 4I0PB 3VFOB 5DEFB 5JOPD 1MFDH 3QA3B 3QXUA 2V5SA 5CINL 1S9XB 4KRMB 4L4VB 3ZKMC 1HNFA 5DJDA 1D3CA 3VGDA 4QHUB 3VXUA 4UDUA 1ACYL 5ESQB 2FGZA 4QXTA 5F7UA 3QDMA 3HTLX 3W9DA 1AQDA 2X40A 3DX9A 5IJKA 2G60L 4MS8C 1CR9H 2QHRL 2XQYG 5FM8A 2J4WL 5KS9F 7FABL 2UZXB 5T3ZL 2VL5B 4LNRA 1SMAA 1OP3H 5IW6B 3S8WA 2EO9A 3EHBC 1FRGL 1TQCB 4R3SB 4QOKB 4XCYA 2X4SB 1U8LA 3IGAB 5LGKA 1N3NB 4PRHB 4B50A 1W0WB 1DVFB 3H3BC 1HN1A 1NSNL 4PYGA 3P4LA 2Y9RT 1LHZA 5L2KD 4Z7VF 1P4BH 3S5LB 3LZFL 4ZTOH 1S9WA 3SDYH 3ORJA 2P8PA 3ULVH 4WV1C 3RUGB 1MAMH 3FT2A 3HAEH 4HX1B 3F12A 3RVUD 4U1KB 4OBRA 3EFFB 3L3HB 5D96C 3IDNA 5TDNB 2EKSA 2D0FA 3OV6A 4XP1L 1GGIH 3M17B 3E2HB 4UBDC 5E2WH 3CFKB 1S9VB 5KSAD 1G7QB 2Y07L 3T3ME 4UILH 3ARFD 4KJPD 4XNUH 3UX9B 1CZ8H 4OF5A 1NCCH 2OJZL 4I2XB 1QNZH 1J8HB 2VITA 3ULSB 3IJYB 5DWUH 4YWGL 3RIAF 4JFZL 3ZKQD 1WWAX 4X6BB 3JBG7 1CBVL 2P5WA 1JWMB 4TNVK 1Q0YL 3UJIH 3FB5B 1PJ9A 1NBVH 4PB9H 4F57H 1D5MB 3BPNB 1ZK9A 1IC7H 1U3HB 2AXJA 4Y4FC 1NEZG 1I9RH 1MFCH 1TCMA 1I85A 2M8XA 1FGNH 1U36A 3KYNB 4WNQA 2BP3A 2GK0A 2DQUH 5DXWA 2O26U 5FA3B 4Z7NF 4BH7A 3PE9A 2YPLD 3ILPA 3QO1A 4XGZB 1P4IH 4BZ1H 4IRSB 3O3EB 5I1HH 4U1IB 3T3PF 4UOW1 4LP5A 4H26A 2HFGH 2G5BA 5D1XB 2BRQA 1IGJB 1NAMA 2CRIA 1T89C 3MRLB 1YA5A 1NGZB 3ARZA 4ONFL 3LN5B 1VGKA 1P7QD 3LY6A 3HUJA 3K74B 1DANT 5IROC 4WFGD 4X99B 1G9ML 1F3DJ 2B0SL 4W4OC 4PP1C 1QBLL 5HYJB 1KENH 3TM6A 1YY9C 3JSSA 3KLAA 3GMPB 4O58H 4DN3L 5KJRL 4BSWB 2CKBH 5T1MB 4G80A 1RSFA 4PY8I 4IRJB 4IOIB 3L95A 2R2HB 4JQXC 1S5HB 2BNRD 5GJSH 5L88L 5I8KL 3DRQB 2DDQH 3UJJH 1R5WA 1T21B 1QFWM 4BELD 2X4QA 1N0LA 5JR1H 3I02B 1KBGH 1LDPH 1KT2A 4W81A 4V1DE 5EOCL 3X17A 3P3YA 3JZ7A 4XHJD 3ILQD 3F58L 4Y4KB 1FCCA 4MLIA 3QEQA 4PJEF 4Y19D 5GS0L 3IAGC 3IB4A 4X7SH 1S9YB 5HVGB 4WTWA 3ABZA 1T4KA 1B4JH 5C0GB 4D9LL 3OZ9H 3P9MB 4PGBA 5IMOB 4DGVL 1KC5L 3JV6A 3VWKB 3VMNA 2PCPA 3ECBB 4EVNA 1ZXQA 2DKSA 4XTRD 4O2FB 2VXTL 4QRRE 3MRCB 5DVLA 3FO9A 4LCWA 4RWYH 1E4XH 4YAQB 5HVFB 5IM7A 3MJ8B 2XNAB 4Y1AB 2FJHA 4JRXE 4PLKD 5I8CA 3T0EB 1HSAB 4OLWH 1GC1L 3CH8A 3S36H 2DI8A 4NYLA 2UV3A 3QUXB 2GI7A 4X8JB 3PIQB 4PJ8D 3FQNB 1HOCB 2FYYB 5A2LH 3UTSA 2RFXB 3LKOB 4XVSH 3T09A 1N0XL 2DKUA 2B2XH 4CGTA 5C7XL 2X4PA 2V5TA 3HLAA 3DVIA 2PR4H 3UTOA 1U8KA 3B5HA 5IW3A 5F93C 3PHQA 3NPZB 4QTIL 1I1CA 4KK9D 4ZPVA 2P8LA 1ZEAH 3MFFA 4NRYA 4U0RB 2BRRL 5DFTA 1LP9A 1XF1A 3HS0A 1XGTA 3D2UD 1N8ZA 2NXZC 2NXYD 3CCHA 4LRIA 5F96H 4ZAKA 3BP6B 1JNHA 4GRLD 3B3IA 5TE6L 2IF7A 3UZEA 5F71A 5IVXA 4RGOH 3G5ZA 4HKBB 3VJ6B 4JY6A 2XYCA 2JCCA 5DHVH 5BZDA 1RUML 3PNWA 3TA3D 4BH8B 5JZ7C 5FO9A 1H0DA 3IFPB 1CDUA 2P48B 4J1UB 5CEZH 2AAVA 5CJ8A 1BM3L 1S7UA 2VH5L 4FTVA 5SWSD 1KJ2L 3GMNB 1FGVL 1ZVHA 3WUWG 5DD6A 4LU5L 3WO3B 3TN0A 4R0LB 1MFDL 2R0LH 5J6GB 1ZGLP 2CQVA 5KS9B 5ECJE 3RBSA 1VSCA 1BQHA 1MRCH 2DYPA 3QXDB 3OPZH 1X9QA 4QXGH 1E27A 5EIIB 5JXEC 4MHHG 3DV6B 1CR9L 4PS4H 3V8OA 3FO2B 4Z7VB 1ZSDB 4GOSA 2BXZA 1AXSB 3ARGC 4FFWD 1T7WA 2HKFH 4NWTH 1A1OB 1ZE3C 3Q6FA 4F2MB 2FIRT 3U9UA 2AKRA 3MV9D 1UC6A 3PWNB 3SQOH 3N1QC 1TPXC 1I3GL 5L2KB 4WO4C 3QCVH 4X4XB 4LLVA 5D6DA 2NW2B 3CZFA 1P4BL 5D7IA 4ZTOL 4J23A 3SDYL 3ULVL 1PKQA 2ADFH 5EUKB 1MAML 3MFGB 2BNQA 3SY0B 1CDBA 5KG9B 2YOCA 3EYFA 5H94A 4NN6B 3RZCC 4PGEB 5E2TH 1IM3A 5F7WC 4WY7H 2GTWA 4S1QH 4PJXF 1MCOH 3GSRB 1YECH 1GGIL 3DX6A 4KK5C 5KSAB 5E2WL 5CGYC 1JWSB 1CVRA 3ARFB 4FRWA 1LEGB 2A77H 4UILL 1BWWA 4XNUL 1CZ8L 1NCCL 1GGUA 1NKRA 3MC0A 1QNZL 5T3XH 4NRZA 1KTDB 5DWUL 5T1KA 2IGFH 5ACZB 1PG7X 5B4MC 2ADGB 1YNTA 3VFTA 1KCKA 3GMMB 3UJIL 1ZGLM 1NBVL 5GRVK 4PB9L 4F57L 2GTZB 3ZHLA 1IC7L 1I9RL 1MFCL 2YPVH 1FVEB 5DC4B 1EEYA 5EH1A 5FV2A 1HHIB 1FGNL 2XICA 3OR7B 2NCMA 2DQUL 2EICA 5IF0A 2ICES 2O5XH 2YPLB 4ORZC 5C0CE 3OGCB 2R1WB 2VABB 1SJHA 4YDVB 1P4IL 2VZUA 5TE7H 5HI3C 4PLOB 4BZ1L 3QJHB 4JJHA 5I1HL 4UAOC 5JNYA 3VD9A 1FFNA 4LSPH 2PYFB 1VEOA 2HFGL 2FO4B 2PO6A 4MSWB 4KMQA 3RX7A 5A40E 2FR4A 2QADC 1CDYA 1QSEE 1VA9A 4OCSH 5GRWA 3VXUD 2JKXA 3QNYB 4UIMB 1CFTB 4WDIB 1WAAF 1OB1A 2VDMH 1CFQA 2Y7QA 1KENL 2XWTA 4Z8FH 1OD9A 2VLJE 2MCG1 4LLDB 4LLMB 4O58L 1PYWB 3TJEH 2CKBL 2FGWH 1LILA 4PJEB 4JVUA 3AAZB 3L5JA 1BZ9A 3PWLB 4ODUA 2FEDC 5GJSL 2DDQL 1CIDA 4IOFD 4N0FB 3UJJL 4AEFA 1BOGA 5FECB 2IMNA 2NY6D 5FYKL 5JHDE 4MWFA 5JR1L 3HZVB 1KBGL 1LDPL 2DI7A 4G8FA 1MQ8A 3U36B 4N8VA 3SDAC 5I16A 4QT5B 4Y19B 1I8LA 3RGVA 3VFSA 3EJJX 1MUJA 5MEQA 1W0VB 1T0MB 4X7SL 4Y4HC 4MXWH 4YIQA 2QLVB 5BRZD 1B4JL 3LQAC 3RWIB 3OZ9L 4JKWA 5EULV 5JPNB 3EDKA 2XPGB 4GMTH 4JFEA 1EBAA 3CFBB 4FXGA 5GGRA 1C16A 1RK0A 1Y6MR 3U7AA 3MGAA 1EERB 1U3ZA 4W68A 1U93B 4S10A 4HHAB 3L9RB 1A7QH 3ISWA 4RWYL 1E4XL 1N4XH 1MHHB 4OFKA 4M8QB 3Q3GA 3RWJB 3LPWA 1XZ0A 2QR0B 5DUBA 3S36L 2OTUA 4PJ8B 1W72H 4TVSa 1FIGH 3HPJB 3UPRA 2PKDA 2HJFB 4H1LG 1QA9B 3QEGH 5GSVA 2H32H 1KB9J 5C8JB 1NFIA 4XVSL 3DMMD 4PBVC 4PRNA 5E6IC 5DTFB 3FAWA 5DRWB 3OKEB 2B2XL 2ED8A 1YEFH 2E7MA 1F2XK 3OJ2C 4MNHA 2PR4L 2DLIA 1ZGLA 5HD8D 5FYJE 4ODWB 4RRPG 3HPLA 2CLRB 4UOJA 1A22B 1U8HB 2NY5H 3PGDA 3VH8B 5B38A 3C8KA 1D9KD 2YPKB 5C0IA 1ZEAL 3T8XA 4NQXA 3D2UB 1ETZA 2NXYB 3P73A 2FJFB 2JK5A 3OAYK 4GRLB 2F53B 1MCDA 2YA0A 4M6NH 4Z0XB 5F96L 4PTUB 1JTTA 1RHHB 4RGOL 3HE7C 4F7MB 3C2SA 4KJWC 3W11C 2H2PC 3Q48A 1AO7A 3ROLB 3TA3B 1R3KB 1C08A 3P4MA 2XFXB 4KROB 4P23C 3GFUA 5BOZG 5J1AA 4ZUUA 5SWSB 4OF6A 5CEZL 1XGRB 1Q9OA 2KDGA 4IBLT 1XF2B 5FGRA 1P7KA 5E7BA 2CIIB 3WFEH 3CSGA 2EIDA 1UG9A 3CSYA 4YHZH 4X5XB 2R0LL 1BF2A 1FL6A 2YXFA 1EUUA 2LTQC 3QEQD 4PJFA 3QI9C 2A74A 4XMKH 1SEBA 2E7HA 1QFOA 1KG0A 3ZYJA 1MRCL 1YPZA 4M5ZH 5F72S 3HR5A 3OPZL 3DGGA 4QXGL 1WIOA 4JZOB 3LOWA 1L6XA 3L7EB 4ZOAA 3IU3A 3O2VH 1FG2B 4PS4L 5HYIA 1U8NA 4OZHF 3FFCD 3KJ4C 1CICB 5HGBA 1HH6A 5CGMA 1QQDB 5B8CA 3QIWA 2D4FA 1A6ZB 2HKFL 4NWTL 4G7VH 3GJFK 4AIXA 3MV9B 2ZUSA