3DUSB

Crystal structure of sag506-01, orthorhombic, twinned, crystal 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTVEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGYYVDAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords antibody Fv fragment SAG506-01
total genus 24
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dusB00
4N1HB 3FZUC 5I1EL 4S1SH 2ADJA 2IMMA 3AROA 3MLPA 2ZNWA 4KK5C 3IJHA 4PRDA 4LVOC 5FB8A 2VDNL 4JN1L 3MRQB 4XI5C 2OJZL 1NGYB 1HHIA 5C0BE 3O81A 5F1NA 4WNQB 5EOCH 1RUQL 4KKCD 2DQEH 5IT2L 1QLFB 5DO2D 5TH2B 4R97C 4JO2H 4BA8A 4MLSA 4EQ2A 4LVNB 4NWTL 5IBUB 3QULB 5JDSA 4GW5A 1KB9J 2WINB 1MJUH 3GMPA 4QKXB 3MV9E 5CEXB 5BMFH 5D2NC 1UCBH 4WI6A 1KJVB 2EECA 4JFQB 2APTA 3OGCB 3X3FL 4HHAB 1OF2A 2AJXH 4J3UA 4TN9A 2BSED 5KVEH 1J1XL 3IS1X 1UJ3B 5EO0B 1KTDB 1PYWB 3HPJB 5K93A 2MCPH 3DV4A 1PJ9A 2DS4A 2EKJA 4HC1A 4PGDA 4HH9A 1INDL 2UYLB 1MVUB 2LV4A 1WZLA 4GKOA 3BX7C 4AL8L 3DROB 2AK4B 4O9HL 5EU6B 3G5ZA 4WV1A 1LILA 5D1QD 3V4VH 1PEZA 2CJUL 4UQ2A 4QRPA 4XZUB 3WS6C 3ROOA 3DX6A 4ORGA 3H7BA 2YA0A 2OMBA 3T3ME 4ZUVA 4KJYA 3FCTB 1ZOXA 5BMFL 1MHPL 4O2EB 1IGTA 4CW1A 4LBEB 1T7YA 4NZTH 3VXMB 1MFDL 3VXRB 7FABH 3QHZH 3QCUH 2L0DA 2YXFA 5DJCA 1DLFL 1HHIB 2I27N 3LEVL 1WLHA 2IJ0C 2I9LA 5SWQB 1NFDA 3ZDXE 1GHFL 3DSFL 3MLUL 2V7NB 1R3JB 3MUGB 1ZLSH 2OJZH 2QKIA 1X3DA 5CD3A 2HFGL 3I6LD 3QQNA 3STZB 2SEBB 4ODUB 1ZKAA 3SEPA 2XN9B 1MIEH 3DSFH 3MLUH 1OL0A 4OZHB 4XX1E 1D5XB 2A0LC 2XY2A 3R1GH 3T0EA 1EFQA 1L0YA 4QCIB 3OR6B 3VFNB 4FFZH 1XH3A 2I26N 1JNJA 5HYJB 5DEZA 1A7PH 3QIBC 1RUKL 4X6BB 4F7TA 2JJSA 2PYFA 5DD1H 4JHAL 1ZT4B 1PD6A 3RUGE 1V8HA 3D39B 4PJCA 4Y5XC 1HYSC 3V4PH 3QXDA 2EDNA 1XF1A 3KLAA 3DX6B 4G6MH 1UM6L 3NCJH 3O3EA 35C8H 4O2FB 1XR9A 5DEGA 4E0RA 4W4OA 3VXTA 1A6TB 3WFBH 1LO4H 5DDHB 5CP3A 4WW2C 3VXRE 2X4NB 1MJ7H 1S5HB 3LSOB 2ADGB 3KPPA 1FVEA 1CXHA 4XP9L 3MRRB 4PS4H 3GSQA 1OPGL 5IB3A 4GRLC 5SWSE 5CP7A 3PGCB 2GYSA 1YNLL 4U1MB 4LCCC 4XCCL 5IROC 2ZPKL 1IZJA 3QZWA 2YK1L 3DV6B 2VH5H 1KTLB 3DI2B 4AEIH 3IYLW 1T7WA 1Q72H 4ZSOE 3IRPX 1GHFH 2DKMA 5CSZB 1KYOK 2Y4SA 2X4OB 4KZDH 1E4WL 3DV6A 2A9NH 1DBML 5IK3B 4AEIL 3V52H 3TIEA 1NMAH 1SEBA 5I19H 4GMSL 5AG9A 4OI7A 1OAKL 2OTWB 2BVOA 4WTZA 4GRLA 5JA9A 2V2WA 2AXFB 2F5BH 4OCYL 3SHSA 4QRRE 4YHLH 1W0VB 3UYRL 5IVNA 1MRDL 4TSCH 5A2FA 1BFTA 1JNHB 5M94B 1DBKH 1BAFL 4JRYB 5CD5D 1YQVH 1UVQB 2AJUH 3C2AH 3ZKNC 4UB0L 2ZSWB 3MRIA 4R96B 3QFJB 2O93L 3PXHA 2EDHA 3SDDD 3V4PL 4K23L 4Q0XL 2BNRD 1M71B 1JFQL 1C08B 1DBAL 1G9MC 4Z78B 2HJLB 3OAZK 5J06A 1D9KD 4RGNE 1EBPA 4YPGA 4HIEA 5FDYA 3ZKND 1NMAL 2YWYA 4XMPH 1EERB 5DWUL 3UTPD 1LEKA 3FRUA 1AE6L 3P4NB 2Z92B 3MMEB 3M17A 1HOCB 2B20A 3UTSA 1AGBB 5IHZA 3RGVD 4NQED 3RPIB 4NHCH 2FX8L 3WEXA 2AXGA 2IH1A 2CGRH 3P4NA 5EZIH 5C6PB 1F3JA 5ESAA 1U8MB 4Y1AA 3M17B 3B3IA 1UCTA 3UTTE 1IFHL 1I1AD 4N0YL 1JHTA 1T4KA 5JXAH 2D03H 3GNML 1J1OL 3A0OA 5IMOB 2P7TA 4PRPA 3RWDB 4AM0A 1XR8A 4D9LL 4I0PC 1KJ2A 2CK2A 4OCMC 4ETQA 5HDQL 3DURA 1N6QH 5EU4B 3CFDB 4X9IA 2ID5A 4C83A 8FABA 3P4OB 3O3DB 4KQ4L 1WV7T 4P46C 3BZEA 3H7LA 2ADIB 3N1PC 2PF6A 4YWGL 4I2XA 2BOBB 3S34H 1KENL 1U3JA 3PG2A 4TUJB 3ULSB 2VE6A 5F3HB 1A5FH 1SJXA 2WM0A 2NR6C 1OTTC 1EAPA 3MJ9H 4K3GA 2XWBB 1JZ3A 3MODH 1F02I 4ZFOA 1AY1H 2FJGB 2DQJH 3O2WH 2W9EH 1TJGL 4IOIB 4P23A 5D6CB 1JWMB 3B2VH 1RJYB 4OF8A 2XOTA 4I18C 1BZ7A 1U8NA 3NZHL 1C5DA 4NO0B 2Q6WA 4HIJB 3WV0A 4DFHA 1LEIB 5JIHA 1OT2A 1TJGH 2APBA 4RMVA 1U8PB 4PJ9C 2LFGA 4ALAH 2D9CA 4NNXA 4G7VH 1NC4D 4HPYL 3UXFA 3UBXB 5D1ZB 1YEIL 3FQNA 2APFA 1IC4H 3S97C 4P3DB 5J89A 2A73A 4PY7B 5AWNH 3SDDC 4JKPH 4FTVE 1JNLL 5HYJE 4M03A 2KPNA 5T1DH 5FOBB 4X6DF 3AXLA 3KG5A 5ANMB 2Q3ZA 4Y8DC 5DEFB 4BSWB 1NBYB 5CEYA 3WIIH 3WXVH 5T3XH 1WITA 1R5WB 5DVKA 2VDLL 3V6OC 3VH8G 5IEHA 4EI5B 2F5AH 3X3GH 3L1OH 5CEYB 4NZRH 3I2CL 3IGAA 1HNGA 4J4PD 4PGZA 3NFSL 3TN0B 1FFPA 4YGVA 5E03A 4HFUL 4UOW0 3HPLA 1Q9OA 3NA9L 3K0WA 2CUHA 1IQWH 5D7LB 3CDYA 4HUNB 4PRPE 4XNYL 5IJKC 1AQDB 4LCWB 1ZTXH 5L7XH 4KQ3H 4MGXA 1J05A 1EHXA 1WF5A 1YJDH 4WFGE 5BJTA 4KROD 4YDJB 5GGUA 4HWBH 5ECJE 3QG6A 5F7EH 3BRFA 5IHUH 2PTTA 4KVNH 1EO8L 2B0SH 3OKYA 4EI6A 2X4TB 4MNGA 4TOYH 3QDJD 4N0UE 3TV3L 3C5JB 3GM8A 1YN6B 1OW0A 1EHLL 3KYNA 3E6FB 4Y1AE 3IDMA 2VDOL 5F3BA 1AD9B 3VI3F 4PLKD 4ZXBC 1A3LH 1FYTB 1NGYA 4DZBA 2CR3A 3FFCA 1HYSD 3C5ZC 1F3RB 3F7YA 5L6YH 3TVMB 1G7LB 4IOFC 4RFOH 4JDZB 4ONHB 4EN3B 5BVPL 4JPIB 4NPYA 3GRWA 3MRMA 3BZFA 5J0BA 3MJ7A 4XPHL 1FIGL 2B5IC 3D39E 1C5CH 4FOMA 1MI5A 5INCB 1FFPB 3D6GA 1BZQK 1HH9B 4YPJA 1NJ9B 4HWZA 3MBED 1DQQA 4K2UH 4F15C 3MJ9A 1KTDA 3H9SD 4RWHA 2X05A 4YLQT 2QQNH 3U0PB 2NY6C 3DMMB 4QEGA 2H26A 1WAAF 4HH9B 3CSPA 3KDMA 5DZOA 2IQ9L 3MA9H 4GAJL 4PJBF 1H0DB 4GW4A 3U4BH 5I66A 4K3DH 2MOVA 1KG0B 5I1IL 1FZMA 1DVFB 1CGSL 1Q9WA 3UX9B 4JDVB 3CZFA 3DNKA 3IT8D 2EIBA 1LO2H 1ETZA 1I1FB 3KDMB 4LHJB 5KSAA 3RP1A 2VLLA 4HGWB 3QP3A 3GBNL 3ARFC 2CK0L 4RMWA 4B7IA 1QSVA 5IJVA 2X4TA 4MNGB 1DQTA 4J7RA 4QF1B 1HE7A 5CWSA 3SCMA 3C60D 1J12A 2CDFA 2AEWA 5TFSL 4PLKC 3KLDA 4X4MA 4DGVL 2RFXA 3F12B 1GPOH 5JW5B 1BM3L 2LVEA 1M4KA 2ADGA 3KPPB 3BT2L 1HEZA 4TOYL 2CO6B 4JFEB 1IAMA 4CKVX 3CLFL 3WFHA 4PJ9B 2EO9A 2YOCA 2CJUH 2NY5H 5TFSH 4GAJH 3FT3A 5F93C 3GIZL 1T20B 3ARFA 1HHHA 4LRNH 2HKHH 3OX8A 4QHLB 4S0SD 4XI5D 3CMGA 4ZS6D 3V4UL 2Z9TA 5DMKB 2ZOLB 1I7TB 4JPWH 4E5XB 4LVOB 4RZCB 4FFYH 1GGIL 2ZKHL 5HI5D 5CZKA 2KZ1B 4DKAA 3DX8B 4R4BB 5IFAH 3RWCA 4ZS6C 4P49A 2JJTA 3NIFE 3KPRA 2HFEB 3WJJA 4XNZC 3PP3H 5F7MC 3O45A 3QISA 1FV1A 2NYYC 1LEGA 3OBAA 4R4BA 4Q9CA 5D7JC 5FA4B 3IAGC 4FZEL 2BVTA 2FRGP 4I5BB 4PB9H 1ED3B 4WDIB 3BKYH 1A1NB 1HZHH 4G43A 4LMQI 4NQSB 1GRWA 4QXUH 1JGLH 4FFZL 2X41A 1RZGB 1QBLL 3RQ3A 3O41B 4NJ9H 3MZGB 1I7RA 2HRPH 4LEXH 5FGSA 5C0NC 3QWQB 1HXMB 3ZT7A 3G5VB 4ZTPL 1AHWC 1S7SA 4PGJA 3UP1A 1MJUL 1GOGA 1UZ8A 4GBXA 1PLGL 1J0HA 3WNKA 3OZ9L 25C8H 1NGWA 3VFMA 1A14L 3QDMB 3DXAA 3EO0B 1CWVA 3ALPA 5HGAB 4QRPE 2AK1L 4PP2B 1IC5L 4Y8AA 1P5UA 2DM4A 1DUZA 1KEGH 4YBLC 4XHQA 3H9HB 5B8CB 4KTEH 5C0DA 4I9WE 5BS0A 4NBXB 5CJQH 3RWGA 4D0CA 1HINH 3GIZH 3X11A 4YX2L 4NQCD 4KXZH 3HE6B 1ROWA 1S3KH 3NIGF 2Y6SD 2ITDB 4U1SB 2XTJD 1U36A 4JVUA 3K7UA 3UEZA 3PDOB 1WCBB 4U1GC 3PIQA 3RA7L 1LP9E 1JZ6A 1SYSA 1FV1B 2CKBL 1RY7B 3SBWA 1NCWL 4GBXD 3O3DA 4TTGA 3IKCA 3OHXA 2VR9A 1EUUA 3MV7B 4JRYA 1P4BL 3BSZL 3D85B 5HHNA 3TBVB 3MTRA 4H1LB 5K9JH 4O5LL 3QCUL 3BDYL 4ODHH 3BIKB 4G6ML 3VGAC 4CADA 1FFNB 5K9KA 4DOHB 1CE1L 2WBKA 3STZA 1UJ3A 4HQQH 4OD2B 5E1AA 3K1KC 2HT3D 3OAUL 4M3KB 1HHGA 4YNYA 3CDFA 4MNHA 2ICEA 2BNRE 3LKPB 2LTQC 1A64A 1MHCB 4XRCA 5C0GA 1YN7B 2W0FA 2YPVL 4JFFD 1LQSR 2X9YA 3VD9A 1L7IL 3A6CH 3W81A 1EEYA 5SX4H 4HBCL 2F53E 1U8KB 4QRTB 2XQYG 4I0PD 2ZCKL 4KUCD 3QXDB 3SE3A 3L3DA 3O6FC 1YN7A 5BVJB 5I66B 4GT7A 4Y4FD 3CXHK 2ZUXA 1R5VA 3DUSB 5E5MA 3FB7B 2RIKA 3UTTD 3IJSB 2GI7A 1JHLH 5B8CC 3QQ4B 5TDOA 3CK0L 2IAMA 3LKRA 2OJEB 4HZAA 4YHZL 4GG6B 4R9HA 1CQYA 3O6FA 4LQ1A 1NL0L 4HS3A 2AEIT 4Y4HB 4CJ1A 5IQ9A 1FO0L 5IV2A 1LO5B 1ZAGA 4OM1L 1OGTB 1DL7H 2AV7A 4I2XE 5AD0B 4EI5A 2HA1A 4ZUUA 3BJ91 1DQJA 4PRIE 5ALBL 3SKJL 2XRAH 4RFEA 4P2OC 3N1FC 4NM8H 4XC1H 5GGQL 3DO7B 1GSMA 4YGAB 4UT6H 1CIDA 3PP4H 2MNUA 1OPGH 2EDLA 2H6PA 1R3HA 2N4IA 2H8PB 3DUUA 4G6JL 2WWMC 5F88A 3T09A 5BV7H 4PFEA 4O02L 1MHEB 4ELME 5MERA 4E5XA 1EDQA 4WI3A 4HFWA 3MRLB 4TUKL 3MRJA 1LE9A 2JJUA 5CP3H 2VIRA 2Z35A 3SE8L 5IG7B 3O6FD 1YEFL 4LEOA 4XWOC 1W72H 4JFXA 1QSEA 4X0KA 1FNSL 4DVRL 2IANE 4P2QE 1KB5L 5CS7A 5ADOL 1A1NA 3O6KH 4G43B 2DMBA 1S5HA 1YEFH 4NQSA 4P99A 4WI8A 4RMQA 3OXSA 2JCCE 3U0WL 5F8RC 1IM3B 1DE4A 1M05A 1T1WB 3CFKA 3RDTC 3O8XC 3UMTA 2ED9A 3VFTA 2EKSA 4LCUB 5JW3H 1SMAA 5C2UB 4HV8A 5F9AC 1DQML 1GC1L 1H3UA 4Z7QE 2ERJB 3EYUH 3ZYOA 4V1DE 3SDXE 2BJMH 2RGSA 3QXAA 4LHUA 2MWCA 3F6IA 1LMKA 3GRWH 5F7HA 4IMKA 4HD9A 3CDCA 5SWZD 3ETBF 1YEGH 4BFEA 5HHPA 4L3EA 4PY8I 4M1GL 3T1FB 2NQCA 1MJ8H 1MNUL 4ZS7H 1YY8B 4PJHB 2BNQE 5DD5L 1NCAH 2WMPA 3MJ8A 1F11A 2VXQH 4LFHD 5DHVB 1E27A 4BQ6A 1T2XA 5L2KD 3MYJB 3THML 2J6EA 5MEND 1UVQA 3FB8B 4MXWH 1FCGA 3DMMC 3N85H 2C3VA 3X3GL 1D5IL 5J6HA 1FGNL 3VA6A 3VRLF 1CL7L 1YMMB 2PTTB 1FDLL 1IM9D 1K4CA 2Y36L 3BJLA 2OL3A 1LNUA 3HLAB 4HIXH 4OQTA 4RFNB 4ONFH 3SCMC 5FYLH 1RJYA 5IB1B 5CWSB 1J18A 1A4JB 4P59L 3KYMB 1ZHBA 1AGBA 5IHZB 1T80A 2JELL 4U1JA 4H5SA 4CAGA 3VMNA 2SEBA 2FIKB 1AO7E 1NC4B 4OM0L 1KJ2H 3S6CA 5LGHL 4M4RA 4OGZA 1M6OA 1WC7A 3NFNB 1Z3GH 4Y5YC 4CN6A 1XCTB 2X44D 1K6QL 4U6HA 4R7DA 4PRNA 4QT5B 5KSBB 5HVFB 4PUBL 1AGCA 1KUMA 1OWRM 3OB0H 4X6DB 3B6SB 4CU7A 1Z0NA 5F9DC 1MFNA 3Q6FB 1FO0B 1QFPA 4EIGB 4UT7H 1X44A 1RJZB 4PJ7E 4R7DB 3CFJA 4RMTA 1K8IA 5C0CB 4CVXB 4BH8B 1BVKA 1NPUA 3QULA 4P5TB 2NY3C 3NCFB 4R8WH 5SV3A 2O5ZL 3HNSL 4CVUA 4R90H 5CEXA 2FJFA 5F9OH 3M07A 3ZTNL 5BXFA 1T5WA 1KT2B 1U93A 2FHFA 5JMOC 3MGOB 3QNYB 4XNXH 5TGBB 5IJVB 4MA1B 5EO0A 3TWCH 2VQUA 1U3YA 2Z4QA 1I8KA 2BVEA 4R4ND 1HHKB 2Q8AL 5LCVL 4CU6A 4GBXC 5BW7A 5AG8A 1F4WH 1J05B 1M7IB 4QHKJ 4S1SL 4J23A 1WCQA 4LKXB 1JUFA 5TPWL 3MPCA 2W65B 4K7PY 4CMHB 2VZVA 3LN4A 1N6UA 1HNFA 4N90D 4PRNB 4QT5A 4B7LA 4KJYB 3HUJE 5KSBA 1T1ZA 1R6VA 4QHKI 2ATPB 4OZHE 2Z93B 5LGHH 4UDTA 4OCSH 1TDQA 4FQ1H 4NT6A 3U9UB 3NPSB 1RAMA 3BGFC 1WT5C 3SGJC 4D0CB 1F90L 4RIRA 1RJZA 3C09B 3BP6B 2ADJB 3VXSD 1IGCL 1ZT7A 1EIBA 3MRPB 2R0KH 1EUTA 3C6LD 3RWCB 1P2CA 2B8OT 5DQ9A 2ATKB 5C8JB 4LEXL 2EKSB 4LCUA 3VH8B 4WI2A 2XZQL 1QQDB 5C6TL 3ULUL 2VISB 1A7OL 2R2HB 4CVWA 4X7TA 5JO5A 3MRDB 25C8L 5E8EB 4KRMB 1MF2H 3GKZA 1BIIB 1L6XA 4S10A 3MRMB 1J7VR 3L3JA 1N5AA 5CGYC 4MJ5B 2G9HA 4FQJH 3SGJA 4X80L 2R1XB 5GGSY 3BEWA 1AC6A 1KPUA 2CDEB 4WY7L 4Y4KD 5JPNA 1I7RB 1RZJC 5I18H 4U1LA 1P4LB 2ILLA 2Y07H 3MLYL 4HJJH 1GXEA 4M7KL 3KLHC 1HOCA 2OL3H 2PXYC 5ESQB 4ODWA 2WUBH 5KANI 5FO7B 1OGAD 2VZSA 4LSRH 3HUJF 4V1DA 1C5BL 2IH1B 4YHMH 1YEDA 3BWAA 4LCIL 5GGRY 4FQCH 1MCCA 4EI6B 1MCSA 4ODSL 1LO3H 4LSSH 2K9UA 4M7LL 5AUMA 4NQXB 2C7UB 4OD3L 1ZGLP 3TM6A 4U1KB 4KAQL 3QDMD 1OTSC 3RU8H 1T5XB 2R39A 2VRAA 4PRIB 1KJ3L 2Y7QB 5GIRA 3T04D 4MDIB 3KLSA 1B2WH 2QV2A 3EOAA 5EA0L 3PF2A 3GFUA 2AV1B 3WL9A 1A6VL 3LKRB 4XP4L 1YNTA 4ZAKA 2YPVH 3S36L 1QA9A 2RFXB 2VE6B 3MOBH 1XGUB 2CLVA 5IQ9B 2R15A 4PJHF 5EOTA 5H37H 4NNPH 4UTBH 4TVPH 3T0AA 1P5VA 3QUYD 3DSNA 2N56A 5EORH 4XBPB 4DGVH 2YRPA 4O51B 1U8QB 5IB2A 4XXDB 2BVOB 2V2XA 1RHHB 2FYYB 1YC8A 3BN9D 3VMPA 3TT3L 5ID1A 4OGAC 5IIEB 1DEDA 1ITCA 4POZC 1DTUA 3KR3L 1OP9A 5IB5B 5KW9L 1R3IH 2BRRH 4GW1B 1BQUA 3QI9B 1NGXA 3CZFB 2CLRB 3P4MA 4M00A 3UJJL 2K3TA 2ZG2A 1YDPA 5GS0H 2X42A 5F7KC 4K8RC 5IMKA 2A73B 4PY7A 3MCLL 3MRFB 2C5DC 2UZIL 4NP4L 4ZO6A 5KBNC 3IXAA 4NN5C 3IJYA 4HIEB 2FO1A 4EXPX 5GIRB 4YC2C 2QSCH 4L3AA 3S8WA 2P47B 4TVPE 4N0UB 4KVCH 4NP4H 1LD9B 5IKCA 2VLKA 5BQ7B 4X9HA 1I8MB 3TYGH 4E42B 1EXUA 1GZPB 3UC0L 4ZMAT 2P8MB 4D9QD 1JTTA 1A7RL 2FX9L 2OZ4H 4BFGA 5GSVB 1G9EA 2X2YA 3K81A 3FHQA 4P2OB 2CSPA 4JY6B 2HH0L 4OCYH 4TSBL 5JIPA 4YAQB 1UB6B 4JHZA 4QNPF 3PJSB 4RAVA 3TO2A 3QCVH 1TZIA 3KPSA 3PWJB 4TPRH 4PJCF 1F3DH 4IRJD 5C07E 3K46A 2HT4C 1TMCB 4CN4A 5IQ7H 5JOPE 3N06B 5KG9A 1XT5A 2F8OA 5IK3A 1F2XK 1ZT1A 3GKWH 4YHOH 1X4YA 4Z7UF 2PYED 3MV8D 3QUXB 4YDKL 2YC1B 2Z35B 3HMWH 3BKML 1WBZA 4NWTH 5DJDA 3EYVB 3WO4B 5DD1L 1BECA 4G42A 4YHOL 2ESVB 2ICWJ 1AKJA 3CSGA 1CXLA 1RUMH 2IAND 4R26H 2LAAA 3S5LA 3S35X 2DD8H 4CMMA 4OFPA 2HH0H 4HHAA 4L3CA 5FYLD 3MRIB 4Y4HD 3NIFF 1CD1B 1IGYB 5DTFA 4YQXH 5EOQL 4JDZA 4FXKA 3TBWB 4G6KL 1A4JA 4JHBA 5ISZA 2YA2A 4YPGB 4RWYL 5B4MC 5A3IC 3CFEA 3INUH 1ZA6A 3RWFA 3MV8A 1MCRA 3FRUB 3MACH 1I8IB 5JORA 4XPGL 3VFSA 5ITBL 1EZVY 4MB4A 3SKOB 2Z31C 3GMLA 3V79C 2P8LB 1N6QL 4UBDD 5IHBA 3HZVA 3U2SA 1E4KA 1JGDA 3BHBA 5E5MB 5DRNA 3SOBL 4F7PB 5GPRA 3ZE1F 4TTDD 1JK8A 1WK0A 5HYSA 1F13A 1QD0A 5I17A 5E00B 3BH8B 4OZGE 1J8HB 1P7QA 3FQWA 3MRBB 1UWGL 5FYLL 1NFDB 4BZYA 1WBYB 4WU7B 4EIZC 2NY4D 3HTLX 2V7NA 4KWUA 1P9MA 1G7IA 3PGFL 2GW5A 2IALA 2UVEA 3OPZL 1C7SA 2XIDA 4APQD 3W5MA 4DW2H 1T83A 3DYOA 1OGAA 3IF1B 3I75B 4WI9A 3ZDXF 2PYEB 1IEHA 3WFBL 5DJZB 1U8IB 3GMOA 2H8PA 4YWGH 5CEZD 2HJKB 1INQA 5D2NB 4I3RH 1P1ZB 4M43H 5JPMA 2W0KA 5A2KH 3T2NL 1CVRA 2ESVD 2Y72A 5JMRA 1CICC 1XGQB 4G7VL 3WFHB 2DIAA 1CTNA 3S36X 4OZFH 1QSFA 1DQMH 1GC1H 4Z77A 4YC2B 4DJMA 5DRZA 3MLXH 2GITA 4NQCE 4FTVB 2UUDH 1K9TA 4M5ZL 4G6FD 1FZOB 4NQDD 4N5EC 1NBZB 3BN9C 3S98A 2AS5M 3SDDB 1NFKA 2X5PA 2BY0A 1Q8MA 4L8BB 2X6MA 1WWBX 2Y36H 1X5YA 3SDCD 3QR2A 2X70A 4JRXA 1ACYL 2J7LA 3F7PC 4N0FA 5TE4H 2YUZA 4FMFA 1UWXK 4GRWE 4GAGH 4M8QA 5E9DE 2VDLH 1JIBA 4G80A 4OCWL 5FYKE 3HR5A 1R5IB 4X6FA 5DJ0B 4DZBB 2QADC 1HKFA 5DFVC 3JTTB 4X4YA 1U8HB 4TSAL 4NHUB 4RQQA 4UNUA 3HG1D 4WUKH 5ADOH 3TIDB 5D1QC 3EOBB 4X5XA 5B3JE 2J8UA 5HDQH 2XG5A 3KNBB 5DEFA 1S7RB 1ZGLB 1HXYA 5A1AA 1IVLA 5GSVA 2XKSA 2CXKA 2R9HC 3D85D 1DN0A 1HI6A 2Z91B 1TNNA 4QRUB 1NANH 2VXTH 1EGJH 2XTJC 1WUNT 3NTCL 2I60L 3MBXL 5GGVH 2OR9L 3K3QA 1UZ8B 4HUUA 2CPCA 5HHQB 2JF1A 4K3HA 3VRLE 5HGHB 2HRLA 1IBGH 1JGVH 3S9DB 1HHKA 3MXWL 1XIWC 2GTZB 3ZTJH 1QSZA 2FNBA 1OTUD 3WIIL 1QO3B 3BP5A 1JCKA 4TSAH 4KQ3L 2XNAA 3FHAA 3LDBC 4ZS7L 1FSKC 3FOMB 4ELMF 4XP1L 4NZDA 5TDNB 3U7WH 5F21B 1G0XA 3P3YA 1D5ZA 1T22B 4F8TA 3KPSE 3TP4A 3BDBA 1OHQA 3PL6A 5CD5C 3VFRB 3QUMA 1VKXB 5DFWH 1Q9KB 3U7AA 4NRXA 5IMLB 5J9PB 4HV8B 2NX5D 3B9KC 5F7DA 1UACL 3HNVL 2LE9A 3F65A 4JCLA 4K94L 4AEHH 4Y2DA 5IB1A 2X7LA 3C5SB 4IRJA 5MEOA 1ZLWH 4FABL 4UUJB 4PG2C 1L0QA 1FDLH 3BO8B 1WC7B 4HJ0D 3MBEC 3HRZA 4DWHA 2QKIB 4ZOAA 3L3OB 4OV5A 4AEHL 5C0EB 5HHPB 3QDGD 5I1EH 4JVWA 2FIKA 2NY0C 3G6DH 3I6GA 2NY1B 5EOTB 1E4JA 2LQRA 3VRJA 4JRYD 4ONHA 3GSNL 1W72B 3O4LB 1M6OB 2FECI 5ICXB 5D9SA 5ICYB 2M26A 5KVDL 1OF2B 2J88L 2Z8RA 4MB3A 1LO3L 5IB4B 2IMNA 1IAKB 1F97A 1PVHA 3DBXB 5HHMD 2XWJA 4JG0H 3UDWA 5IT2H 3FN3A 4U7MA 3KPRB 4WHYG 1JV5A 2CKBB 2J88H 3BRGC 4YDVA 5HGBB 4WFED 3IDYC 1CBVL 2PW2B 4WUUB 1H8OA 1IBGL 5DI8B 4U6YA 1IZKA 1X7QB 5IESL 3GI8L 1IC4L 1ZHLA 3S36H 3UPAA 5DK2B 1AIFA 1B4JL 1YJDL 3RTQA 2VC2L 3QDGA 3VWJB 5DMIH 1D6EA 5ADPL 3EFFB 4EKXA 2BCKB 1BQHA 3ULUC 1VACA 2VDPL 4PJ5D 5E2TL 1G0YR 4I77H 5BO1H 1QRNB 2PETA 4JN1H 5IMLA 5J9PA 2B0SL 2X4UA 5JQHC 3EDDA 4JQIL 4OLYH 1H3XA 4QTIL 3KS0J 4QOKE 2OTPA 3ZO0A 3P0VL 4OBRA 4ZUSA 3A67L 3L3OA 2NXZC 3BVNB 1UXWA 5ABDE 3BT2H 3GSXA 3VCLB 1UWEH 3BH9A 3SDXB 4NYLB 3TN0D 1X5ZA 4RAUB 1UKSA 4FQQA 4E41D 2D9QB 1GAFL 4JFFE 4APQA 3TIEB 2YXMA 3H0TB 1ZA3B 5GZNC 5MHSD 4EUPH 4WY7H 2ESVE 1SY6H 3BH9B 3SDXA 4PP1D 2FSEB 1FFRA 4U1NB 5DA0B 1B0RB 1D9KB 1JGUH 5FM5O 5DLML 4XTRD 4P23D 1KJMB 1PY9A 1AXTH 3NAAL 5SWQA 5MP6H 4PP1C 3RWIA 4KJQC 2DM7A 3D85A 4G9FA 5CGYD 5FECB 2BNQA 1QFOA 4OB5L 1JYWA 5IFJA 3BPLB 4R96A 4RCAA 3QRGL 1KN4H 3QIWA 1BQHB 1T6VN 4QOKA 3TN0A 4PV9B 3B9KD 4K71B 4NZTL 6FABL 4LPWA 4TNVF 4ISVB 4P3CH 1LO0L 2FZ3A 4JGMA 1C1EH 1NKRA 3G04A 2B1AH 4O2CB 2HTKD 4XC3L 3OAYH 3H42H 4W6YB 2CKNA 4OCRH 3ZKQD 5KSAD 2IPKB 4MJ6A 2FEEL 2BY1A 2DL9A 2FZ3B 5FAAA 4PJIF 3FRPA 1QFUL 3NCBB 1BFVL 1FLRL 4M7LT 5GRVK 2L7UA 3DVIA 1JPGB 1MEXH 5IUSA 1CGYA 4DK6A 3C2SA 4PP2A 4NRZB 4PTTB 2NX5A 5ID0A 3HZMA 4POZD 2YEZA 2PN5A 3VGGA 3O2VL 5GGTL 4JKWA 1BOGA 4FFYL 2YZ1A 3CH1A 3HE6A 3KPLB 5DRXB 5C3TA 3VMOA 1G1CA 3RNQA 3VI4E 5MEOB 2YC1A 4UUJA 1U58A 2Q20A 1C16B 5CJOH 43C9A 4P46A 4JAMB 4ZUTB 3MO1A 5ALCL 4LF3B 4WU5B 1XGTA 5FCUH 3MACL 1I9EA 4WUUD 4ZFOB 4ORZC 2DQHH 3MGTA 1SMOA 4HS6B 5CUSH 4MXQD 1ZT4A 4MQXD 1S3KL 3OV6A 4IOSD 4PS4L 1ES0B 1AXSB 5CEZL 1I85C 1V7NL 3GHEL 3OJ2C 3HMWL 4P23C 3EFDH 4NO5A 1LK3H 3UTSE 4IJ3C 4X99B 1OSPH 3ZE0F 4PLNC 5DVNA 4L8CA 4GS7B 3HE6D 4YFLF 5DR5H 3PP3K 1TQBC 4ODTH 3OZ9H 4GAFB 2FHCA 5T1LD 3UJTH 3CH8A 2QTEA 4X4XB 4PLJD 3PGFH 5FGBC 3W0WB 2EEAA 2DI9A 3TESA 1T4KB 4G6AC 5E2UH 2OCFD 1R5VB 4PD4J 4MA8L 2MQCA 4Y2OA 5EUKB 5IFAL 3HI1B 4K8RH 4BSJA 1CF8H 2R8SL 3RVTC 3KS0H 1I85A 4M48H 1BQLH 2NY2B 1CFSA 4JZOB 4Y4KC 1YEKL 4HUKB 5E08L 2XRAL 4JO1L 2ARJA 1IRAY 2E7CA 1NAML 4KJPC 1QBBA 4YXHH 1CYGA 3PWVB 5D1QA 1AQKH 4NHUA 4RQQB 5HHOD 5CSZA 1IKFH 2IGFH 3BKYL 3OKEB 4BQ9A 4YAQA 2MJWA 3MGOA 3W11D 3MQIA 1S7RA 3WKNA 2ZOKA 5I2IB 1RMFL 2M1KA 4HS6A 1E6OH 1ORQB 3MLWL 1UGNA 3FFDA 1K8DB 4M1CC 1TFHA 2E6QA 3GSWA 5EU5A 1G9MH 1P84J 4N0CC 5FKPB 4FXLA 1K85A 5CJ8A 5DHVA 3KPSB 3FQTB 3CC5A 3GMQB 2BMKB 5FCUL 4HJ0C 2FEEI 4P9HH 1U8NB 1MLCA 4RSVA 5I8OH 2NPLX 4G9FD 1KN2H 4HMDA 1RK0A 1J0YA 3TNMB 1I4FA 2A77H 2FX7H 5DFVD 2H32A 4L8CB 1F4XH 5CZXC 4X7SH 4ONGH 1N59B 4DW2L 1FVCB 2RJMA 1X5IA 3GMMB 3RWIB 2XWTB 4KKLD 4WDIA 3WHE0 3T0ED 5DJ6B 4LEOB 4JFFA 1MCPL 3ULSA 4JHAH 2DLIA 3PABB 2JJWA 4Y5XB 1A21A 2VZUA 2R9HD 1IC7H 4ZQKB 4RAHA 3KPRE 1BD2A 2R0LH 3MMEA 1IAII 1FNGA 4OBSA 3C5ZB 2GK0A 4MD5A 4O4YH 2R2CA 1FE8L 1JHLL 3F7YB 2FCBA 3HUJA 1IM3A 2R1YA 1MJ8L 4LSDA 3CCHA 3KPRD 3E6HA 4PJHE 4Q6IB 3X13A 4P5TC 5JUEH 4LASL 2JB5H 2BSSA 5T1KB 2AQ1A 3T0DA 2ENSA 5EUOE 3WS6A 2IBZX 4Z7UE 2VLRB 2V7HA 5IGXL 2FR4B 1JPGA 3RZCC 4EBQL 2GT9B 1YA5A 4LPCA 4XMLL 2GSIA 4R97B 3KXFD 1NCBL 5DGQA 1N26A 2GHWB 2R56H 3PWUB 1CR9H 1FORL 1MFBL 1NMBL 5A16A 2FLRT 3RZCD 4Y19E 3VFUB 1KJ2B 1KTKE 3MLTA 5BZDA 5DD5H 1SYVA 1E4WH 3HC0A 5EOCJ 5L8KB 2BHZA 4P5TA 5BOPA 4JLRB 1DJSA 1T2JA 1IGIH 2Y6SC 2FJHB 1S9WB 4OGXL 1FZKB 1G7QB 3TZVA 4R3SA 5DJ8A 2XNAB 5CMAA 4WTXA 4LBEA 1BD2E 4P2OD 2Z8SA 1U92A 3QUZC 4LCCA 1JE6A 1MY7A 2VAAA 4L3CB 3D25A 4HJGA 2DJ4A 4JAMA 4ZUTA 1JHKL 4Z95L 5MEPA 1MCBA 2F19H 1S9WA 4WU5A 5M7QA 1ND0B 1ZK9A 3LS4H 3ULVE 2XA3A 3QH3A 2VDRH 3TO4D 5C0AE 3AVEA 1F4AA 5K9QG 2Z8WC 1TVHB 3MCKB 5DJAB 1IEAA 3PE9A 4JFDE 5TF1H 3MODL 5EBLB 5HYFA 2DQIL 1V5JA 3THMH 1DL7L 3E6HB 3QHTC 4Q6IA 3X13B 5IHUL 3FT3B 3F7VB 4P3DA 4P5TD 2EE6A 2G75B 3G6JF 1CICB 4JFEE 3QIUB 4XXDA 5HBBA 1A0QL 4KTDL 5HI3D 3ARDB 3VFWA 4YEEA 4V2BA 4N9GA 2OBGA 3PWPD 1YYLH 2NR6D 2F58L 1XF4B 3K8KA 4MXVE 1V3KA 3HNVH 5AEAA 2Z31D 1NBYA 2OSLA 3RUGB 3JBG7 3Q5YA 4NKOB 3LH2H 5CSGA 1I1YB 2JK5B 3FOLA 4JVPA 4OGYH 4BZ2H 5C9KA 2HFEA 4IM8A 3Q6FA 3NCMA 2E8YA 4QNPE 1G6RH 4OD1H 2EXWD 4G5ZL 5FXCH 4AIZA 1NC2B 2O61B 4XGZB 3WJJC 4BH8A 1HHJA 3OKDA 4KRLB 1CGXA 3BPCB 4NKIL 2WIIB 4XVSH 4Y4FA 3OWEA 5GRXG 3VDAA 3KPOA 5M95B 4LLVB 4KHTH 2R69L 2D3VA 4PGBB 2GJ6D 1VACB 4U1LB 3LY6A 4HXAH 5D1ZD 1HN1A 3O4LE 1IJ9A 4HWZB 3LD8C 4X4ME 3QNYA 4NZJA 5IOPA 5INDB 4JHWL 1PKQE 3U30B 5DJAA 1RV6X 3SKMB 3WHE1 4DUWA 4R0LB 1QNZH 2I9TA 4OCSL 3P0YL 1S7TA 3O3AB 4GH7B 2DQCH 3DYMA 3QQ9C 4I3SL 4QXWA 3ARFB 2ZUWA 3V8OA 1ZEAH 2HKFL 2EDFA 4X6CB 4G80B 5E5RB 4KI1A 1FYTA 3X14A 4NRZA 1JRHH 1MCOH 2EDBA 4L29A 4KUCF 3H6JA 4ZUWB 1ZEAL 3NN8B 2AI0H 3WJLA 4NO2B 2WK2A 4HIIA 5FB8B 1T0NA 3K8MA 1G7PB 4FQ1L 3L9RA 4O58L 5ITFA 4JM2B 4P3CL 2MPAL 4LCYA 4M62H 5C0BD 1CU4L 2CLVB 4I0KA 1CDBA 3MFFB 3DHMA 3RX5A 4D0BA 3IXTA 1DN2A 2IG2L 3T2OA 4BSVA 4OF7A 3BO8A 3RAJH 4UTAH 1JF5A 1JP5A 3SBWC 1Z0MA 1U3ZA 2R2BB 5AYUL 1LP9F 3QNXA 1VFMA 1IAOB 3HNSH 1S9YA 3CVHH 2FGZA 3CUPB 2EYSA 2VDKL 1U95A 4BSVB 3WNPA 3GJEB 5E2WL 3HE7C 5BZWA 4NWUL 3WFCH 5DMKA 2FD6L 4MS8C 1CXKA 1OAYL 2H9GB 3F58H 2F5AL 1S7VB 2QR0B 2GEEA 1MAML 4Z5RA 1MJJA 5GRWA 1BM3H 1GOHA 4XHJC 2DDQL 4QLRA 1KCRH 2AI0L 3AS3A 4JQIH 4N1EA 4OFVA 4OLYL 1CZ8L 4HT1L 1S9XB 4P5MA 3VFUA 4PB9L 4ZTOH 5HGAA 1S7VA 2D7QA 4UINL 4JO3L 4M5YH 3VGAB 1H3TA 1T2QL 2A83A 3IU4L 1T0MA 3EOTH 3SE3C 1I8LC 4F7EA 1ZTXL 1L0XA 4G8EB 4F37K 4D94A 4X5WB 2YPLA 4KMTH 4LLUB 4BYHA 5D7SH 3FQWB 3BGMB 1HEZB 3BE1H 3RY6C 3JWOC 2XN9D 1T0MB 3RX7A 4Y4KA 3ARGC 3MV8E 3OR7A 1NSNH 4TULH 2W91A 4B53A 3HZYB 4P59H 1CFTA 5F1OB 4BQ8A 1RU9L 3V95A 1TJHH 1F4YH 3QPXH 2O5ZH 1ULVA 4FQXC 1NBVH 2YUVA 5DD6A 4EXKA 3KPTA 5EA0H 1BFVH 1FLRH 3OMZA 1N7ML 2FH6A 3LQAH 3ZKXB 5MP6L 1EHLH 4MWFA 5T5FH 1FZJA 2VL5B 1XF3B 3IDJA 1CI5A 3QEHB 4DGYH 5C9JA 4YX2H 1P1ZA 1ZA3A 4LF3A 1UJTA 3RY6A 5JNYA 4IRSD 3TA3B 3EDFA 4Z0BL 4WWKB 4ERSH 3SKUD 2VL5A 4U2ZA 2XV6B 4FMKA 5AYUH 1DLFH 3T4YB 4M9OA 1CDHA 4LLAA 2ZWLT 2GSGA 1NC2D 2PW2A 5E94B 2DIJA 2ZUVA 3RUGF 1FC1A 4WWKA 2OL3L 5I1HH 4X6BA 4ZO9A 3UTSD 4ZXBA 1DQDH 1PX3A 4EDWL 1KJMA 4JFED 5TH2A 2NXZD 3QUYA 4WFFD 1QRNA 2GY7B 3F6LA 3LZFH 4PJFF 3WLWC 4BSWA 3HNTL 2FX9H 4GAYA 1I9RH 5JDJA 2X9WA 4NN5B 5E8OA 5I1GL 1A7PL 2HN7B 3IB4A 3DRTB 4UT9H 5IJKA 4FFWC 4XHJD 4FNLH 2VWEC 4X7FC 3KR3H 3P9MB 1OP3K 3O8XA 2ARJB 1YQ2A 3G04B 3OTTA 4QRTA 1T1YB 4NNYB 4PJFB 4C56A 1M1SA 2IPKA 4Q9RL 3S88L 4EDWH 2G2RA 2P8LA 3JWNC 5CINH 1C1EL 1C7TA 1OTTD 2YPKB 3G5ZB 4WV1B 1T03H 1KC5H 3RVUC 2NY6D 2D7TH 1ACZA 3O4LD 4F7PA 5CLTA 2I24N 3PIQB 4RAVB 3IJSA 2EEBA 1G9NL 2IQAB 4KUZH 4JDTH 5SX5K 3D1MC 4BM7A 2IEPA 3EJZC 3OKNB 1QFUH 1N8ZB 2ITDA 4TPRL 4U1SA 1MLCB 3OHXB 1X5GA 5A16B 1CGUA 2ZCKH 4QHUB 2YN3A 2BNQB 5JHDA 2VQ1A 5GRUH 4QRRD 1HINL 3GK8L 5DMGD 4DOHE 5HHMB 4HCRL 3I3DA 1G7QA 1U8LA 1AE6H 3NACH 4M1DL 5H2BB 4RBPK 4C56D 4XVTH 1U58B 3C8DA 3MLWH 5I1HL 3S88H 3FFCB 4XCEB 2IFFH 1KELL 1N3NB 3DVNB 2DAVA 2FX8H 5JPMB 3MJ6A 1XGTB 1BHGA 1U8KA 4JQVA 1G7LA 4YNYB 1CLOH 2MCPL 1P4LA 3HG1E 4EUPA 3BKCH 4HJJL 4PGDB 1U8OA 4CMMB 4YHZH 3T0EB 1F6FB 4XP4H 2D0HA 4X8JB 2WP3T 3WBDA 3AS0A 2DLGA 5DC0A 5HHVL 3IFPA 4LP5A 2DJUA 5MHSE 4HK0B 3MCKA 4LPXA 4LLWA 2F15A 3BPNB 2C1OA 2EC9U 4L9LB 3HRPA 2E9WA 4KKBC 5ICXA 2CMRH 4LLQB 1AXIB 2X4QA 3PV7A 2VLJA 5HHVH 4OFDA 4HS8L 4OLUH 1ZHNA 2R23A 5EUOA 5AYQA 3T1FA 3VXRA 3WNLA 2EH8L 3FQUA 3MNZB 3SQOL 3M8OH 3T65A 5T3XE 3PWNB 1UCBL 3V8CA 1BVKB 2NY3B 3QEQB 1IGJA 2VZ1A 4ZYKB 4LSPL 2XG4A 3DLQR 1G6VK 4KROC 4PJ8B 4R3SB 3SGDH 3T4AA 4X6CE 3CK0H 5HTSA 4JKKA 1AC0A 3VXNA 2DQFA 4LLYB 1AP2B 3L7FA 4TUJA 2A6DA 4Z7QF 1VGKB 3C09C 2DKSA 4M5ZH 1NCWH 2D7PA 2JB6A 1IMHC 2BMKA 1KXQE 2Z4QB 1AR1C 4IS6A 4LSTH 1XGRA 4NO5B 3WS3A 3ZSTA 4NM4H 1PEWA 3FFCD 3N85L 4ODXB 1QSEB 3QDGE 4NM8L 5GGQH 4C57C 5EDXA 5FFLA 3GMQA 4IDLA 4Z7UA 4JFHE 5D7KE 4KY1H 2ZSVA 4RAUA 4OQTH 3QHZL 3QWOA 3TPUA 3C8HA 3V52L 5D96C 2OQJA 4LVEA 2ARJQ 2MKLC 2YD1A 4OIIH 3C5JA 4LCWE 1YC7A 1YY9C 3CFKB 5D2LE 3GSVA 1FC2D 3PWPE 1MRCH 5T1MA 4WUKL 4XPGH 4GMTL 4MD4B 4Q2ZB 2WZPD 4XBEL 3MBEB 3V6OE 5FYLE 1MRDH 3T65B 4RIRB 3U48A 1J0IA 5IVXE 2V2TB 4Y89A 4JY5L 4YIQA 1UJ3C 4K3EH 1CE6B 1S78C 4N1CA 3QIBB 1C08A 1R5IA 3C2AL 1IT9H 1BBJA 1Z9LA 3M8OL 4BZ1L 2NLJA 4H88L 5EO1A 5F7FA 1QG3A 3U0WH 2HWZL 3D3VD 1GGTA 1G7HB 1F4HA 2UY6A 4FFVD 1S78D 4M6MH 3MXWH 5ICYA 1DQQB 1CDIA 3KPOB 4R0LC 1QPPA 4H8WL 4PLOB 3QWRD 5FGRA 3WIFA 3HPJA 2CXGA 2V7HB 2ED7A 1OB1A 4GKNB 1I8KB 2IAMD 3AU1A 5JHDD 4G6KH 4MJ6B 3HB3C 4LASH 5D1ZC 1TJIL 1JN6B 3E3QE 3PWUA 4ZSOA 3WE6B 5B8CA 5L2JA 1Q0XH 3G5XA 3S4SA 2BFVL 5EC1A 3AREA 4NKIH 1UB5B 1IT9L 3QWOB 1P4IL 1RURL 2FEDD 4DAGL 5IVZB 2HWZH 3FB6B 4OKVB 4OKDA 5E1HB 4LOUD 2YD5A 4Y16A 4Z7NF 3ZTJG 5A3ID 2J4WH 5BS0E 3MA7A 5TDNA 1BOGB 5FV1L 4XP5L 4WENB 5B21A 5EU3A 3N9GL 1UWGH 1IGIL 2VOTA 5DSCA 5L7XL 3BMWA 5EBLA 5J57B 2P44B 1I1AC 1QOKA 1XZ0B 2Q86A 2WAHA 4BZ2L 1I1CA 4NRXB 4L8SA 3Q6GL 5K33A 1QSFE 1YNTB 4ZAKB 1ZLUK 3S34L 4F33A 2YMXH 4BK5A 3GSRB 2R2HA 1PFCA 1T20A 1K3IA 1RJLB 4XTRC 4JGJA 3I84A 2DF3A 2Y25A 2APVA 3Q2CA 5JW4R 2NW3B 1ZWIA 1Q1JL 2A6JB 4XNQB 1UZ6E 4MAYD 1PX4A 4XP1H 1I7TA 3U7WL 5MI0B 4GG8A 3IDJB 4LSQL 3D18B 3PV6B 3ARSA 3DVFA 3NGBB 1DBKL 2IBBA 3LN5B 2VR4A 4YEFA 2ATPA 4KJPD 1CFQA 4FQHA 5J7CC 5AAWA 1A7OH 4L4TE 1JJUA 1K6QH 2FLBT 2XWJB 5FO7A 1HIML 2ORBL 4WWKC 5GQBA 3RDTA 1BVLA 2JK5A 3FOLB 4RGNC 1XGPA 3P0YH 3T1WA 2A9ML 4Y4FB 4FQ2L 1F4YL 2WWMD 4I3SH 5TGBA 3QDHA 4ZD3H 2IH3A 3R0NA 3GMPB 4HKBA 1PZUB 4XPHH 5F1IA 4WTWA 5TDOB 3ALWA 3ELAT 5GJSH 1RZIA 3D0LA 4PJAA 1BIIA 1W2KT 4F7CA 1DQLH 3DOSA 4IEFB 3QFJD 1L4IA 5GZOD 5E9DA 4NZUH 4GRWF 5D7JD 4I77L 5BO1L 2ZUUA 3CFBB 1XGRB 4MJIA 4W4NA 1QSFB 3NIDE 2VMFA 1J1OH 1S7WB 2AK4A 2B4CH 3MJGX 3KJ4C 5GGRB 5I1JH 5J6GB 5ICZB 2A6IB 5B39G 1TITA 4L8BA 3MX0A 4K7FB 4XZUA 2I60H 3MBXH 4MNGE 2BHYA 5IB2B 1S7WA 4PJAF 3CPLB 2MQ3A 2N7BA 1ZT7B 3BYTA 3U82B 1G1YA 3CC5B 2WBJD 1N0LA 1EAJA 4KTYA 5DD0L 3T8XB 4NT6B 3U9UA 1CGTA 1RZJH 4HWEH 3ILQC 3QQ3A 1J0JA 4D3CH 1EPFA 4JFXB 4Z8FL 3EOAB 3TJEH 4MQTB 1G6RB 3EYSL 3MGAA 2IPUK 2ITCA 3LS5L 4MNQA 3PWLA 5DLMH 5DXWA 1AR2A 5CFHA 4J3OC 5EO1B 4IMKC 4OD3H 4NZRL 3WHXA 3NAAH 2DQEL 1DE4B 1M05B 1T1WA 2ICES 2W60B 1DEEB 4WFFE 3WO4C 3MLVL 4HKXA 4K3JL 1GIGL 1RI8A 5HGDA 1KJ3H 1Q9OB 1NLBL 1UACH 2C1PA 3ME0A 3RVVC 3JWDC 5IF0A 1VENA 2HN7A 5HDBF 1NSNL 3GJEA 3AU1B 2BC4B 5C08E 4ZNCD 4LDLB 3J7HA 1I8MA 5IIEA 4JJ5B 4HPOH 5BVPH 3BGAA 5CJQL 1RZKC 4MSWB 4Z7VB 4DKEL 5ILTH 3BPNC 3O9WB 1JNLH 4ZSOB 3WE6A 1XCQA 1RIHL 2F53A 4F7EB 3DMMA 1NGWB 3VFMB 1C12A 1EEZB 5GGTH 2COQA 1MY5A 3D2UA 3KYOB 5DVLA 4UAOC 2VTFA 4ORGB 1D5ZB 1T22A 1TZIB 3WCYA 3ULUD 3O3BB 2H3NB 3SDAD 3U2SB 2XQBH 1A6TA 5I1GH 2OX5A 4PGEB 3V4UH 4NO0D 4NO2A 3CNKA 3MA7B 2YUXA 5EZOL 5GZOC 4PGCA 1FFOB 2OZ4L 7CGTA 1UKQA 2VLRD 1U2CA 5ESVA 5D93B 5CMAB 3RU8L 4MJIE 4XNZB 4LMQE 5GS0L 2BOBA 1NEUA 3CSBA 3KPNB 1JGUL 3OKEA 1DQDL 4NQEB 3SO3C 3HLAA 3LEVH 3CX5K 3QDJE 3VXSB 1T7XA 3CFCH 1H3PH 2PO6A 5I2IA 5JW4M 3RY5A 1WQVT 1ZHBB 4YE4L 1T83C 3OR6A 2VKWA 5DS8A 4P23B 2FATL 5I74C 3TT1L 4OZHF 1MFEH 3VI3E 4AQ1B 3RL2B 1MIEL 3PL6D 1Y6MR 3EYFB 1VGEL 2H41A 1MCLA 4B50A 1EV2E 3VA2C 3U4BL 2J8OA 5A43C 1CQKA 2AQ2A 2P45B 3EYOA 1CICA 3LKSB 4RRPG 4X80H 3IFPB 5L8JB 2C3XA 2DKUA 3WEXB 5KVGH 3P40A 5JW4Q 5FYKH 1P4BH 3BSZH 4L9LA 3WD5H 4FG6C 3UJIL 1KCSH 4CRPA 4TSBH 4KU1A 4TRPH 3ZYZA 2WQ8A 5CIPA 2VUYA 1EHAA 1KXTB 4NQVB 5GXBB 2BCKA 3ZZ1A 1C5BH 5DDHA 2VZOA 4J3VA 4ZQKA 1I1YA 4HSQA 4LGPB 2CR6A 4MD4A 4Q2ZA 2VNCA 5DJ0A 3DIFA 2XXCB 4WHYH 4XMKL 5F1KC 2A6KA 1IILE 1E4XL 3TT1H 1BMGA 4OAWA 5DTFB 4HMCA 1BJMA 1A2YB 3K74B 3W39B 2NXYC 3JWDL 2VLKB 1QUNA 2UZXB 3CFBA 4MJIB 4OLZH 4ZNEA 1Z9SA 1KTLA 1RIVH 4HS3B 4KK8D 3ZT5A 1CICD 3QJHB 4FXGB 1Z9MA 4B41A 1QTYT 2UWEA 2N1KA 3TVMD 1U8IA 1KNOB 3GMOB 5EIQA 1FNFA 3QDMA 5I8OL 3U83A 3GJFK 3EDEA 1UA6L 4L8DB 3HPLB 4P2RE 4XPAH 2Q8BH 3ZE2E 2P7TB 4PRPB 3RWDA 4AM0B 4KKNA 4P9MH 3CDGB 1QEWA 2ZOKB 4PJ5B 4TVPL 3K1DA 1UM5H 4KK5D 5FUCC 4K7PL 1TXKA 4GMTH 5I1CL 5J1AA 3GSOB 1UA6H 5EU5B 2VLJE 4XWGH 3WNOA 1JN6A 4GMSH 5GGUB 3T77A 4RISH 2VIRB 3FMGH 1C8PA 1QFWM 3BPLC 3OGOE 1I3VA 5L2JB 1YMMA 5F6IB 3HE7D 4QYOB 4Y16C 5T1KD 4LP4A 3DVNA 3I75A 2I5YL 4LCWD 2JTDA 5FOBA 3D9AH 5HI3C 3SY0A 4G6JH 3DRTA 1IL1A 2PW1A 4ISVA 1MCPH 2PTUA 1GZQA 4NGHH 2QHRL 2Q8BL 4XPAL 2PXYA 3MNVB 1Q94A 2IAMC 4YUEL 2C9AA 2EDTA 5IEHB 4L8SB 3L3IB 3WMSA 3KYKH 1KPRB 1IC5H 4HXBH 3STLA 4R4FH 3BQUA 1MFCL 3IAQA 2NLJB 3F7QA 1YECH 5EZLB 1S9YB 2EC9T 2PXYB 1XCQB 5DWUH 1NBZA 3H9HA 4JZJA 4Z7VF 2NXZB 3LQZA 4KTEL 3BPOC 4RDQG 3SKJH 5CBAB 3K2UH 3UC0H 3CD4A 2E9JA 1AD0A 1KLGB 3JXAA 1NAMB 1NGQL 4HUXA 5JW3L 3GSOA 1JV5B 1LK3L 2C4FU 2VSDA 4NC2B 2W1NA 4N0YH 2EYTA 2XZCL 3FONA 4NKQB 4WVRA 4YDVB 4O4YL 3BQUC 5DUPL 3W2DH 1DVFA 3RGHA 4BZ1H 5FDWA 1HCFX 2OR7A 5I75B 1FORH 1MFBH 2IBGA 4JR9H 4LIQH 4O2EA 2EEDA 2P5WE 1R5WA 1V7MH 5DZNA 4NFBA 1UADC 2IAMB 4LPYA 1G7MB 4D9RE 2GKIA 1CT8A 1ZMYA 2ZUTA 1FN4B 2VXTL 2GUOA 4XH2B 2WUCL 4MA7H 3EO1B 4DEPC 1L7TH 1U3HD 1OOAA 2X1XR 3SJVE 4IS6B 2FJGA 3SQBA 1DQJB 1ZANL 3WS3B 1QA9B 3QYCA 1A5FL 5IW1A 4Z95H 1JZ8A 1FO0H 4WI4A 1KEGL 1CR9L 2E9BA 1A0QH 1VFAB 5LJYH 4NO0A 3D0VB 2Q6WB 1Z5LB 2EDOA 4KH2A 4LLDB 4LLQA 3WFZA 3CU1A 2JIXB 4G8GB 1Y0LB 4PJXA 1LE9B 1MCWW 1A4KA 4YZFF 5TF1L 1J87A 1WBXA 1B3JA 3ULUF 2BP3A 4UDTB 4QRQB 2BVQA 5TQ0L 4F7TB 4HEME 2C4FT 4RZCA 2PYFB 3RNKA 1YECL 1PSKH 3NN8A 1CE6A 3HI5L 3SO5A 3LRSB 3V9FA 3KYNB 2O5XH 4KKLC 4MAYB 3FTGA 3JVGC 3QG7H 4WJ5A 1OCWH 1A7QH 1KFAL 1TJIH 2NXYB 4H20H 5HGBA 3BD5A 2CH8A 3RUGA 1FNSH 2NY1D 3TVMA 4CNIA 5DA4A 1H15A 3ISWA 4GRLD 5AZEL 4MXWL 3MLSH 4WWKD 4QRUA 2E27L 1LGVA 5DK2A 4WJ5B 3L3JB 3U0TB 1FVEB 1A6AA 5IBLC 1WIUA 4DUXA 3WYRA 5KZCD 3QUXD 4WO4A 1FSKB 4K23H 3RKPA 4JEGB 2R0LL 5F88B 3VD3A 2CDFB 5JLZA 4HKXB 4U1IB 1S9VA 2F58H 3OPZH 1K5NA 3N9GH 2HFFB 3TH2T 3CX2A 4LPUA 2A74B 5E8NB 1U0QA 4NRYA 2H45A 2FB4H 3DXAB 3FT2A 3QEQD 4PTUA 4QRPB 1OARL 1UB6A 2JB5L 5KSVB 4ONGL 3QDJB 3VXSE 4M43L 1WTLA 5F6HI 3WXWH 4D9QE 2DOCA 4EOWH 2XWTA 2AXFA 4QWWC 32C2A 4XBGB 3VFPA 4XNXL 5I74B 4OFIA 4UB0H 3CPLA 2YKLH 5CGTA 2JCCB 1G9NC 3QUXA 4IRJB 4WO4D 4GRMA 1EVTC 3VD4A 3MLVH 43CAB 3HZYA 3L3KB 5CD3B 3DO3A 5EWIL 2X4RB 2HT3C 2KH2B 4DFIA 3WUZA 5FECA 1DUYA 5HVHC 4E9LA 5IFHH 3L7EB 3WKML 4H20L 5C1MB 3CLEH 5GS1A 3GUTA 5I8KH 2P5WA 2Z92A 2P24B 1V3JA 1XF5A 4FQHB 1NCBH 5EG6C 1DQLL 5LVEA 4M7LH 3WN5B 3O2DA 2CDEA 3GMNB 4AIOA 5JPNB 1IAIH 4F3FB 4HUXB 3AM8C 3OKOA 4PTUB 3DXAE 4LSVH 2VL4A 4YFEA 4A6YL 4GW4B 4YHNA 3GBMH 1IEBB 3ULVH 1FZKA 4F58L 5D72L 3EYQD 3DETC 1MWAA 5IEKA 4X4XA 1ED3A 4UTAL 1GIGH 4LHQB 4GXVL 4UILL 1SEQH 4WCYH 3BOVA 3WUWG 1AIFB 2GUOB 5EU4A 4D0DA 2JIXD 5MEPB 2MKWA 3CLEL 3UPRA 2OP4H 4U1KA 3U46B 2G5RA 3CGTA 1I7ZB 2DJSA 2J5LB 1REIA 3SPVA 4GKZB 1INEH 5MENE 3KYMA 3W0WE 3R06B 5T5FL 4KVNL 3NFPA 1HQ4B 3L3HA 3LVEA 4H0GA 5D7SL 5JQ6L 1G7JB 2J5LC 4OD1L 3UTZB 3V6FB 1VFOA 2PYEA 2A6IA 4GKZA 2E8ZA 1CFNB 3EO0A 4JANB 1EJ6A 3ARWA 1AGEB 5BV7C 3MO1B 5KSBE 1DUZB 5E2VH 1KN4L 4F58H 1KB5A 3LN5A 2IG2H 4OZHA 3CXDL 1PG7W 5CJ5A 1YEIH 5KG9B 5C0AA 3UTTB 1D9KA 2J8UE 4Z77B 3EJYD 4NCC2 4UIMA 1TPXC 5DJXB 5ERWB 4Z7OF 4PJ8D 3L5IA 4Z7UB 3EYFA 1UH4A 3FQNB 1INDH 2UUDK 2EYRB 3QQ3B 3RI5K 4XCYB 1Z9OA 4AL8H 4HIXL 2ZSWA 2GSGB 4TVPD 4IBLT 1KCRL 3MV9D 4NQDB 4H1LH 3K80A 1SBSL 4XCFL 5FHAL 3I02A 3VJ6B 5KSBF 2VKXA 4PJIE 4HX1A 1MFAH 2NY7L 3MBEA 5HGDB 5CJBA 4HLJA 4QYOA 3G08B 4P57A 1KLUA 4OZ4B 5SV4A 5BOZG 4KK6C 2EIZB 4QOKB 3S96A 4N8CL 1BD2B 2EZ0C 2HJFA 3OKMA 2P42B 3GSUA 2CK0H 1P7QD 1HYRC 4KPHH 5KW9H 4N0UA 4PUBH 1AGDA 1FVDA 3CVHA 4U1MA 2BC4A 4WIQA 1A6VH 4K3JH 1S7TB 4FNLL 4TRPL 3SKOA 3WIHA 3T0XA 4QO1A 4L4TD 1J9CT 4DCQA 3ILPA 9CGTA 3U4EB 1P53A 2BSRA 2GK2A 4L3EB 4XC3H 1VCAA 3LAFA 2WWKT 5E2WH 2H1PL 1OQOA 1JPFB 1U8JB 3NIDF 4JZNA 4JFOA 1NGPH 4DGYL 2FATH 3RNQB 2YEZB 2V5MA 2YPKA 5KJRL 1XIWB 3QG6B 4AENA 4X7EC 4CW1B 1P84K 3CXDH 1IKFL 2IGFL 2XYCA 3DX7A 4C54A 3QAZC 1KTRL 4TVSa 5J56B 1RFDH 5I1KL 2B1HL 5FDWB 5DR5L 1WJ3A 2FJHA 2AJVH 5IW6B 5DJZA 4RFOL 3IFOB 4L4JA 1FP5A 1FBIH 2AGJH 4JO4L 1LO2L 4IDJH 1NGZA 3ZDYE 2ZCHH 5EO9B 5L0QB 4GLRI 2F54A 3TCLB 3VFVA 3EYVA 1OWWA 3RVXC 2HTLD 4L4TA 4OZGB 5E95B 5EZOH 3BP4A 3PABA 4Y5XA 2X7LB 4RNRA 1BX2A 1D5XA 3OB0K 3UDWC 2FD6H 4PJGE 5DVMA 3VWKD 1JGLL 2PTVA 1XH3B 1QHOA 1RJLA 2NW2B 2WUBL 4KC3B 1KIRA 3QO0A 3HCVB 4W68A 1IGFL 3BKCL 1BX2B 1Q9LA 2NY5L 1MLBB 1NJ9A 3V6ZA 3TO4B 3P9LB 2CIIB 1BQSA 4MDJA 2OK0H 2EE9A 4S1RL 1B0GB 3DUSA 4NJAH 1A1OA 3S37H 2DQUL 3QXUA 1I75A 1I8IA 1QFHA 3NCYP 4Q9RH 2KUTA 4LNRA 3ZKSD 3G6JE 2ZKHH 1FJ1A 1OAQL 3KPMA 1BVZA 5ENWA 3KLHD 4BJLA 1OAUL 4CVXA 2KQNA 3FN0H 3DXAD 3KYKL 1TJHL 1QFWL 2A77L 2FX7L 1VFUA 2ADFH 3FN9A 4KUZL 3R8QA 5FO8A 3MLZH 2Y9RT 3V0WL 3UTZA 4LGRB 4MA8H 1OTUC 3KAAA 1WZ1H 5J6HB 2JE8A 5CP7B 1VFBA 3QDME 2QJDA 3NCYS 1G7IB 5J11C 1XMWA 1FG2B 1RK1B 3O2VH 1A6WL 2DTML 3EDKA 3M1BB 4L8DA 2ADFL 3WFDL 4XH2A 4WO4C 3IDXL 1JPTL 5D7LA 4LLVA 4PJ8A 5HI4C 3BUYA 1NMBH 2XICA 4ZPTB 4N8PA 2W07A 4Q0XH 1O0VA 3JWDH 4FQCL 4KK9D 1ORQA 3W0WD 1PAMA 4P0DA 2GSIB 4MNQE 2VLMD 1CLZL 5MERB 3PHSA 1DR9A 3WFDH 2X1OA 3TO2B 4GG6F 5I0DA 5C70A 4OGXH 3VXQB 5JR1H 1MHPH 3MRKA 5E94A 5SX5H 1PY4A 5ICZA 1IGMH 4NYLA 4ZFGH 5B38B 5D93C 5FV2A 5FYKD 3F5WA 5I16B 3MOQA 2VLME 3MCLH 3DECA 4P46D 1Y0LA 4PJXB 1B0GA 4YXLH 4IIQC 3OKKA 3VXQA 1CCZA 5JR1L 3VU2A 1GH7A 5J3HD 1LO4L 2NY3D 5CJXA 1KN2L 5B38G 4HX1B 5ISZD 1MJ7L 1GOFA 4EN3C 2YRLA 4HG4J 4PRHD 5L9DL 4LDOB 2HYMA 3Q3GA 5EH1A 5C92A 3B9AA 4ZFFA 4ODTL 5D5ME 1XF2A 1T66D 4S1QL 3WDIA 1MQKH 3QXTA 1IQDA 4ZG1A 2RQ8A 5LWYL 1NC2A 2O61A 2FJFB 1LEKB 3UCRA 5BV7B 4GFTB 4H1LG 4POUB 1FLTX 1DBAH 1CIUA 2IPTL 4WI5A 3CSYB 5F6IC 4J2XA 2ZUQC 5GS1C 1BFOB 5B3NA 2MCG1 3EYUL 1ZHKB 2PKDA 4N5UA 1NAMH 1PSKL 3IGAB 1NCDL 3IRZA 3DJ9A 3LKNB 2AJ3A 4OV6F 5BRZA 1CFBA 4OCWH 2E7BA 2H9GA 2QR0A 3R4DA 4W70A 3TNNA 4I48A 1G6RL 35C8L 1EA9C 5T3XD 1E27B 2V5RA 1N8ZA 3BHBB 5IGXH 1MI5D 2DQIH 1V05A 3N1QC 1KCLA 4GO6B 1T21B 3VRIA 1ZHLB 3HR6A 3LN4B 2VAAB 1CLCA 1RZ7H 2QQLH 5LWYH 1U41A 2XY1A 3PQYB 1NDMA 3MRCB 2R69H 2PNDA 2EDKA 3DMMD 4OCXL 4R26L 2Z93A 3LEXB 1QKZL 4Y5VB 3IDGB 3FOMA 3VWKA 3HMXA 2EH8H 3JSSA 1XAUA 5HYQB 5D7IB 3NA9H 2IADA 1KELH 2EC8A 3QIUC 4KMLB 3LHPH 2W9LA 4Y4KB 2OS7A 1LWRA 4C55A 3QUMB 1JF6A 1UH2A 5A2IH 5D5MB 1VKXA 1AD9A 3HB3D 4JM2F 3WDJA 1T04B 1DFBH 4JM2A 4RX4D 1H5BA 4LDEB 5FUCE 3MROA 4FQPA 1HH6B 1NANI 1X5JA 1DUYB 4DKFL 2ICWI 3VG9B 4YH6A 4JANA 2KDGA 3K4DA 3VFOA 1D5BB 3BZ4B 3FRPG 5ACZB 1TCMA 3B2VL 3QIUA 1MAJA 4DGIH 1W0YT 3HG1A 4PRDB 4P2QD 4QRQA 1CLYL 8CGTA 1UT9A 5E00A 4NM4L 5ESQA 2P5EE 3EYOB 4UNVA 4XVJH 1VADA 5DO2C 3BP6A 3GMRA 3B8SA 5DJXA 4N0FB 3RVVD 5C7XL 4MCZB 2H26B 3SCMD 4F7MB 5CKGA 1YYLL 1JFQH 1IC1A 1INEL 1QLEH 4G9DA 4OQTL 4JM2D 5LGJB 1CVSC 3E3QC 1KYOJ 3QWRA 1YNKL 4U2YA 1XR9B 5DEGB 5EFIB 4X9GA 3HI5H 1MH5B 3LDBB 1N0XL 4ODBD 4YDLB 5DRWB 4YHYC 2RCSH 2I25N 5D2NA 4YK4C 2VDML 2OYPA 5JA8B 2KKQA 4XC1L 5DQDH 3QIUD 4X6CF 1H3VA 4NN6C 1RZ8B 4P2QA 1NLDL 3RZCA 4A6YH 4EUPG 1WEJL 1F42A 3O3AA 1X5KA 4F7CB 3AB0C 4PJ7B 1ZXQA 3GGWA 3O9WA 1YPZB 5L6YL 3MROB 4GRWB 5E9DB 1TLKA 1JUFB 4FN0A 4HXAL 2ZNXA 3SE4A 4UNTA 1JPST 1SM3L 2IFGA 2Q3AA 4WGVB 3O4OC 4J6RH 1X5XA 3G6DL 5C0CD 2CLZA 5I1JL 4AQOA 4O00A 4PRBA 5CKAA 4P5KB 43CAA 1HWHB 1JPSH 4E41E 4D9RD 5IG7A 4X6FB 3KHOA 3VDCA 4HWBL 1JNHA 1D7FA 2JJVA 2QQNL 1CZ8H 1P2CB 1Q9KA 2CRZA 4W4OC 4DVBB 3T8XA 2BOCA 1JYXA 2DQJL 3O2WL 4F2MB 1PG7H 1Y6NR 4D3CL 1RUPL 3CUPA 5IW6A 3S3SA 4I0PB 4KGLA 5IESH 4AG4H 3OXRA 4H8WC 5EO9A 4DEPB 3B5GA 3RTQC 3PXJA 3HAEH 3ZMRA 5C9JB 3S3PA 5ILTL 4DKEH 2Q1EA 3QEGH 4DTGH 4GOSA 4R90L 1KPVA 5J4MA 5AAMA 4PV9A 5BQ7A 3UTOA 1FL3B 1KIQB 3G6JB 5IMMB 2ZZUT 4JQVC 3RL1A 3LKSA 1QZ1A 3GJFA 3GI9H 1YPZE 5DQDL 5IF0B 5KJRH 1N7MH 3LQAL 2UWEE 4GAGL 1S7UA 3MLYH 3V5KA 3V5HB 2NY2C 3OAZH 3A67H 4J3SA 1RURH 5EN2A 4XNUH 4EDXA 4E0RB 3GB7A 4HUVA 2AGJL 4JO4H 4LSUH 3KXFB 2X1QA 5F97E 2NNAA 4MA3A 2C26A 3V7MA 3OL2A 4FQLL 4MDIA 2G5BA 2AK4D 4Y2DB 4WW2A 3EOTL 3TZVB 3HC3H 2YSSB 1UXSB 5BRZD 4KGJA 4Y19A 1NCCH 3R06A 1Q0YL 4LKCB 3BPOB 4R8WL 1YEEL 2OL3B 3T0VA 1F90H 5IVOA 1TNMA 3LIZH 3WLBA 2ZUQB 3M45A 5GS1B 3GUTB 4KHXL 5IROA 1OD9A 4KI5C 1KNOA 5H2BA 2V17H 1R3HB 2H1PH 1M71A 2OI9C 2Y23A 3VXMD 1Q0YH 1BPVA 1FYTD 5I0ZA 5C0FA 1AP2A 3L7FB 4IOIA 4LLMA 3H9YA 1OM3L 4LSQH 4JDTL 1MCNA 1RULH 1QBLH 1CD9B 3FQTA 1KPVB 4JREC 4G3YL 1FNAA 5ACLA 1UWXH 5FYJL 2GFBB 3UJIH 4JKLA 4EI5D 4YO0B 3MUY1 3UTTA 3I6KA 3RZWA 4MXVF 3T4YA 1IARB 1KBGH 4KPHL 1J1XH 1ZA6B 1K3ZA 1LDPL 3CU7A 5GZND 3FT4B 3ET9F 3TYFA 3WJLC 3WFCL 2BVQB 3LD8B 3U6RB 1BBDL 3PDGA 4O5LH 2A9MH 4IIQA 1MRFL 3QFDA 5F7UA 4JKMA 2VZ3A 1XR8B 3QSKB 3BUTA 2ZUSA 3T0WA 3DETD 4NIKB 3S5LB 3TBYA 3NFPB 1FNGB 2OMNA 1RIVL 4UINH 5C2BH 1QBMH 1FJ1B 3P9MA 4M9PA 3Q3GB 1JPTH 1B6UA 2W9DL 3EO9L 4G6FB 4KXZI 4C83B 8FABB 3O41A 2R0KL 3MFGB 3ZHLA 1RZ8A 5C08D 1HXMA 1HCVA 5FYJD 2VN4A 1S7SB 3HE6C 1G9ML 3CMOH 4L1HA 5FYJU 1HWGB 1MCJA 4PJ5E 1FBIL 4G9FE 3DHJA 5C09D 4OLZL 6FABH 3QPQD 2A6DB 3QZWG 12E8L 4XWGL 4CUCA 1M7IA 3VWJD 1PLGH 2C3HA 5E6ID 2B2XH 4PJEA 1H3PL 5HJ3A 2H6PB 2X89A 3V7AE 1JZ2A 1SYVB 1OLLA 3GHBL 3HC0B 5T3ZD 4XT1C 1W0VA 3V0VA 2GJZA 4L1DA 1OM3H 3MC0A 3ZHKA 5DVOA 2GTWB 2OXHA 2X4PA 3PGDB 5CZVL 4P9ML 4JQXC 5DJ8B 1NKOA 3IFOA 4JPKH 1FPTL 1IGJB 3MRQA 4LPVA 4R2GC 3ARPA 1VPOH 4OZGA 4NQTA 4LSSL 4ZUWA 4GSDL 1SJHB 5IVZA 3PP4L 4MX7B 4NOFA 3QUKA 2BVYA 3O6LH 3BD3A 3QEUB 3X3FH 3L3KA 3V6OA 4PRHE 5D7IA 5KVEL 4FZ8L 4XPBH 1IEAB 4J3TA 3H3KA 3IXTB 3D9AL 1IE5A 1MHCA 4K7PH 5K9JL 4KFZC 5JHLL 3LPWA 1W72L 1U6AL 4U6HB 4X7SL 4OLXL 5D7LE 3BEWB 4XP9H 2AXGB 1TTUA 3B9DA 3RI5F 5L2KA 4JFDA 2R1YB 1MI5B 4PR5A 4UV4L 5DK0A 5INCA 5GISH 1JGEA 1YMMD 1QRND 5DT1H 3D2UB 3KYOA 2XXMB 1PQZA 1E6JH 3EHBD 4QWWD 3EKCA 1NMCC 4H25B 3D18A 4JRXB 4WEUD 3DROA 5F96L 5KS9F 1U3HB 1A7RH 1GGBH 4KKAD 1T7VA 4K3EL 1MHHB 4OUUA 3WNNA 1B9ZA 5DRNB 1TZHA 4P4KB 1H0DA 5F70A 5EC2B 4RMSA 1HSBA 5F96H 4FQIH 1FE8H 5F7NC 2ARWA 3P4OA 1OAKH 3RIFK 1CFVH 2QHLA 4MCZA 4J1UA 1CS6A 2HT2C 3CX5J 5ANME 1C16A 5CJOL 5LGJA 5HYSG 3SQOH 3CVIH 5SX4I 4FQIL 3FMGL 3IETA 1A9BB 1B88A 1BAFH 2P43B 3CFCL 1CFVL 1T1XA 4L4VA 4TQEH 1BQLL 3WL9B 1DN0B 3BKMH 4XVUC 2AW2A 5E6ZA 1KEMH 2IADB 4M8VA 4P2RD 5EBGA 2HFFA 1L7TL 4LAJH 2HMID 4NC0B 3DUUB 5D7KD 1XGYL 5E8PA 2DD8L 5ETUA 3TYGL 3MXVL 4FFVC 4CL7A 1CN4A 3ZL4L 1P4IH 1FAKT 1D5IH 2OM5A 3QDAA 3GGWB 1QO3A 4HG4K 5D2LB 2VWEE 3KVQA 2ZSVB 1ZWIB 2A6JA 2NW3A 7FABL 4MZ3A 5HPMB 4RGNB 2BXYA 5C0BB 2Y06L 2AXJA 1OSZA 1U3HA 2JCCA 3MRPA 4ZFFB 3U0PA 4OJFL 3UBXG 3T0EC 5CGMA 2A6KB 1FZMB 1OW0C 4Z7WF 3T2PA 1JL8A 1QBAA 3FJTA 3Q48A 5IM7B 4F7MA 1VFBB 4FP8H 3QIBA 4XCCH 5HVGB 4YDIL 3TIDA 3OGCA 2BOCB 3C5ZA 2IPUG 2JJSC 2DYPD 1I9IL 4NO3A 4JY5H 3IAPA 1FGVL 4HUWB 1U3HC 3LQMA 1PKOA 3QXAB 4LHUB 2OZ4A 1LD9A 3QI9C 5IKCB 4MXQC 4BH7A 3VXRD 2YD8A 3KWWA 4QXGH 1SM3H 4UOJA 1KENH 1MCHA 2YPLD 3GSUB 3SE9H 1YY9D 4J6RL 5CCKH 4ODWB 4NO3B 5EU6E 3WSQL 2QL1A 4N8VG 4ONOA 3K8LA 4M6OL 5E8PB 5L88L 5EC1B 5IBTL 1S7QA 5J1AB 4ZUSB 4RFNC 1J8HE 4MA1C 4CU8A 3P11H 4PB0H 4QRSB 1SJVA 2HVKB 3I9GL 3WSQH 2GY5A 1ETZB 1I1FA 2F74B 2XPGA 4O58H 3QHFL 1IFHH 1Z6JT 5HYQA 2DYPA 3PQYE 3BGMA 1OSZB 2VO5A 5EN2B 4OM1H 4HK3J 4IRSA 3SCMB 3SJVD 3IDGA 3VG9C 1QR1B 3P73B 4NN7C 2GK0B 4MD5B 1N4XH 3P4LA 5EPMA 2C3WA 2D7NA 3ALXA 3D39D 5C7XH 3C5SA 4S2SB 4OCXH 4NN7B 4HZLB 1E6OL 2HJLA 5EBMB 4ELMB 3BIKA 4L4TB 3P11L 4PB0L 3WFEL 3MJ7B 1CD1A 1IGYA 5FIEA 5HVHB 3T3PF 3LKNA 1GC1C 3I50L 3TGXA 1JGEB 1AGFB 3ULVC 1QACA 4XNQA 2R2BA 4ZOCA 2YZ8A 2EH7L 1DSFL 3IFLH 3VFWB 1MIMH 4WHTA 4GQ9H 3VFSB 4IRZL 1B0RA 1EGJL 4ENEC 4NQEE 2PR4L 4XPTL 1RZFH 4NKMB 1VADB 3MRFA 4P2RB 4U6TA 5IMOA 4NKOA 3RVTD 3VGBA 1IAIL 4F3FA 1YEDB 3BWAB 3UPCA 5MEQA 1NCCL 2NX5B 3BQUD 4YHNB 2AXHA 3BH8A 3HZMB 4PJXE 5I19L 1ONQA 3CVHL 3U36B 1AO7A 3PDOA 1NUGA 4ZYKA 2EDXA 4PJIA 1MPAH 3L3GB 3ZKMC 4UU9B 1OGAB 3IF1A 3GSNA 2YN5A 2OLDA 4L5FL 3MV7A 3C6SA 5AZEH 5HVWA 4XMLH 1K2DA 1DZBA 2V6HA 4MQXC 3ARTA 1FFNA 3BVNA 3UYOD 1VGKA 1JWMA 4OZFA 1XGUA 2D03L 4CMHC 1QYGH 2R1WB 4HMEA 3RIAF 2VXUL 2XQBL 1ADQH 3MRHA 4NZUL 1AGFA 4QGYA 2W65A 1K2DB 4MWFB 1LDSA 3MCG1 4P9HC 1FYTE 2V9QA 5EU7E 3SGKA 3RVXD 2AJYL 4JCMA 1R0AH 3OKNA 4A2MA 5I18L 3C60B 4YBHA 4EJ1C 5FKAA 4P5KA 4TULL 1BF8A 4Z18A 3ROLB 1WFUA 4JQXA 1I7UA 4UQ3B 5LXGH 2OQJB 3CH1B 3KPLA 2GTWA 3BN3B 5GHWL 5HHOB 2QSQA 4UTBL 3HZKB 1F8TL 5F71A 5FUOH 1MIML 4I5BA 1G7PA 3FB7A 2IQ9H 3MA9L 1EMTH 1RIUL 2VDRL 4HF5H 1K4DB 2EYRA 4L8SC 4XVSL 3C9NA 4JRXE 1N3NA 4KHTL 3WHXB 1DANU 1U8HA 5TE6H 3HI1A 4WO4B 1GCFA 3NZHH 5CZXD 3QUYB 3RZCB 3OXRB 3GI8H 1T89C 5DFTA 1RHFA 2VDQH 5C0GB 3QXVA 1F4WL 3VWJC 5INDA 1R24A 2VC2H 5HHME 1HXYB 3ARGA 2W0PA 2AJZA 1NFDF 4M6NH 5GS0D 2DM3A 2DQTH 2BNRA 1Q9LB 3QBTB 2RBLA 4P4KD 4Z5RB 1S9KC 4UDUA 4UV7L 4JY4A 5CILH 4HULB 3NZ8A 1GJIA 5EUOB 5A2JH 2HKFH 3C6LA 2NY4B 2GJ6E 4EOWL 2WNGA 3RWHB 4ZAKC 1L6ZA 4YDLC 4Z9KB 4K9EC 1N5YL 2YPLE 4XMKH 3WLWD 3X11B 2IBZY 2A83B 3MRJB 1RULL 2C7UA 2N7AA 1I3GL 3PWJA 3LB6C 1I9RL 2OTWA 3MV11 3D69A 1VA9A 1XEDA 4U7SA 2V2WB 4MD0A 2VABA 5DURB 3L9RB 5ITFB 3ROLA 1I4FB 5T3ZE 4A6YA 1I1AA 1UH3A 2IQAA 5F3HA 2G5BB 1TQCB 1QLRB 1R0AL 15C8L 4C4KT 4KJWD 5HHNB 5I9QB 4F57L 3VD7A 5LCVH 4NQEA 3LMJL 1J88A 1B4RA 4P46B 3TH4T 2EXYC 5DD6B 4OLXH 3BE1L 5ADPH 3REWA 1C5CL 4EI5C 4HWBA 4JFZH 4PJXF 2GAZA 4Y1AD 2AEQH 5D5MA 3QEUA 2J2ZA 2W0FB 1XF5B 2PW1B 2NY7H 3HRZB 4RGND 1YEEH 1NGPL 1E4XH 2OK0L 2QSCL 3GJFB 3UROR 2BSTA 3CZJA 4PRAB 3FT4A 4QTIH 2WBWB 1QEWB 4PJ5A 2UV3A 3AB0B 1CDJA 5GRJH 4KI5D 3C8KB 4LRIA 3NFNA 4V2CB 3U30C 4GXUM 2G60H 1EEUA 3QA3B 4TYUA 1A22B 3CMOL 5EOCL 2CRMA 3ULVL 4HCRH 3MV8B 1VEPA 1RUML 3ARVA 4OCRL 5I6XC 3B6SA 5FEBA 3HR5B 3UZVB 5E4EB 4XPFH 1Z2KA 3ARFD 1Q9WB 3HZVB 2EE3A 2VXVL 3EHBC 1MUJA 1WVZA 2B2XL 2H2PC 3SGEH 2AEQL 4CN1A 3IJYB 3B9EA 3FO2B 4MCYA 3DURB 4MAUH 1NBVL 5IV2B 5EFIA 3O0RL 2OTUB 2UZIH 1Q94B 4OT1L 3ARDD 5FHAH 4CNIB 4HGMA 1J5OH 1EO8H 3ZE1E 2NXYD 1NQBA 5JW5A 3O8XB 2QADD 3LKQB 5E6IB 5K59F 2QLVB 5H8DA 2CIKB 2I5YH 2UVFA 4PJFA 1T3FA 2VDOH 5A2LH 1LVEA 1S5IH 3S35L 3U7YL 5KSAC 2K1MA 1WZMA 1YEHH 1TVHA 2DWEB 5I73B 2CIKA 1NAMA 2BXZA 1C5DB 3NH7H 4FA8A 1YMHB 3U6RA 3VXOB 1CLZH 1FRGH 3DGGB 3NCJL 3FONB 4APQB 5KSVA 3A6CL 3JV5A 3INUL 5JXEC 4ZODA 3OKLA 4M7JH 3PGDA 3VW3H 4NNXB 1SHMA 3IJHB 3LEXA 2P46B 4Y0GA 4JPVH 3GHBH 4LCCB 1FRGL 1FO0A 2KL6A 2X10A 1ZVSA 1E28A 3GKWL 5F89B 4N90E 4RISL 5F8QC 1K8IB 5C0CA 1V3MA 3AXLB 4G7YL 3WD5L 3R1GL 2DTSA 4Z7WB 1SJEA 4FRWA 3ZYJA 5DC4B 5ACMA 5CCKL 1E4KC 1NC4A 1NFIA 3NACL 1BZ9A 4AEFA 4IDJL 3Q5OA 5TQ0H 2X40A 1LP9A 2IF7A 3AMLA 4Y88A 3FQRA 3MLZL 3V0WH 3ZKXC 4POYA 5FO9B 4O9HH 1JWSB 3D3VE 4LVHC 3OAUH 1W8OA 5GSRA 1NFIB 2P5WB 4FHBD 4TQEL 1FYHB 3PNWB 4QGTA 2BY3A 5JHLH 4RDQF 1G9NH 5BCAA 1Y6KR 3RNKB 1AFVL 2W59A 3IDXH 3H2WA 3ARXA 3TCXA 3BIBX 5CEZH 4X6DE 1EJOL 4PIRF 2PCPA 4J8RB 3V5HA 4YHKL 2CMRL 2VLLB 4I3GA 1BGXH 1F2QA 4PJGF 4HCRA 3GK8H 1JF1A 4YR6A 4HH8A 5HY9A 5JXAL 1AHWA 1GVIA 1SJHA 4BQBA 4KDWA 4NUJB 1OGAE 2B39A 5C0CE 4OZIF 1J0KA 5F1IB 4X6CA 1VHPA 4X5WA 4YFDB 5I75C 3AC0A 4PRIA 1Y18A 4CVZB 5E0QA 2XZCH 5HY9B 1U42A 1EVUA 3PQYA 3BP4B 3E8UH 3MOAL 5ALCH 4D2NA 4HC1H 1YZZA 2E5EA 3OJMB 1QLFA 1OAUH 3PL6B 2RAMA 2J12B 1F3DJ 3E6FA 2EDRA 5FUZL 5D4QA 2NY1C 4KZDL 4LKCA 5ETUB 1KIUA 3HE7B 1G7JA 4YHIB 5E4IA 2D7OA 3BD4A 4NRYB 1JTPA 1BZ9B 2E6PA 4JFQA 5FUZH 1PQZB 4JPIA 4XNMA 1IKNA 3QA3A 3VFNA 4M6AA 1FCCA 4G8GA 1A02N 3QDJA 4WHCA 2FWOB 3MR9A 4YUEH