3DUSB

Crystal structure of sag506-01, orthorhombic, twinned, crystal 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
b'EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTVEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGYYVDAMDYWGQGTSVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fv fragment SAG506-01
molecule tags Immune system
source organism Mus musculus
publication title Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments.
pubmed doi rcsb
total genus 24
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dusB00
3OWEA 5E0QA 4O51A 4PRHE 3VWJD 4XXCC 5I15H 1A0QH 2JJTA 3O3BB 4WV1C 3L3JB 1OD9A 1E4XH 2VABB 2DLTA 2PN5A 4U6VL 1QFWM 4GUPB 1CK0L 3IFNH 4GBXD 4XNQA 1R3LB 3BO8B 4XC3L 2WBJB 4D9LL 4QOKE 2X4TA 1EO8H 2A74B 3OGCB 2AK1L 4QF1B 5LQBL 1JPTL 2R29H 5DQJB 2PW2A 4OCRH 1KPUA 2QJDA 3FTGA 1D5ZA 3V5HB 2ORBL 4I9WD 3BIKA 4PRNB 4PJGE 1EFXA 3SE3A 4JFFB 4M6MH 3VFGL 3VI3E 1YY8A 4L4VD 4GKSA 2FEDC 2XKUA 1JTTA 3EYSH 5FYKH 2VDQH 1RU9L 1ZGLP 4ONHA 5BRZD 3O6FC 1NLDH 4ALAL 4MX7A 3WLWC 3IXTA 5ICXB 3T0BA 5IFAH 1MFAH 1P5UA 1I8LC 4FTVB 5FYJE 3AVEA 4NGHL 1U8NB 1EGJL 1QO3B 5F9OH 3LEVL 4NYLA 2C4FT 3VH8G 1FYTE 3CLEH 1FGVL 3VGHA 1BZ9A 2FHBA 5JORB 3C60B 1KN2H 5I8EA 2EE9A 1GZQB 4ZOAA 3HPLA 4Z0XB 3RHWF 4RRPA 3VFPA 1OAUH 4K23L 1INQA 4FQXC 5MERB 4WY7L 2GITB 3I75A 4XC1L 4WI9A 5DJXB 2DQDH 2VLMD 5EB9A 3CSBA 4NDMA 1HHHA 3VH8B 3L7EA 4NQSB 1ONQB 4Q9CA 1FNLA 1OB1B 4MA1B 1IC7L 2E9IA 1MRDL 5D7LB 4N68A 4QRSB 3FT3B 5CINH 2GSIA 3O9WC 1S9VA 1A6WL 2BNQB 1ZLWK 4HG4J 3VXSA 1AKJA 1XGRB 2G9HB 3KHQA 3NIGF 4LNRB 1AQDB 3L6FA 1U3HA 5ID0B 3UYRL 4PJEF 3QQNA 5CJ5A 3WLBA 4LCCA 1HINL 1SBBA 2FSEA 4ODHL 4CDHA 1KJMA 2Z4QB 4F7TB 4KGLA 4KWUA 5KSUA 3C60C 1R5WA 4QF1A 3UTOA 1MY5A 3MRPB 1D5ZB 2IPKB 3EZ8A 3FFCA 2B1HL 1DE4B 4JN2B 4PRPE 4JCMA 3SDXA 2H3NB 4RMTA 3AM8C 5GZOC 4PJ5B 5DXWA 5DI8A 4K7PL 2X4SA 3UTPE 3VXUB 1OAZL 1ZKAA 1WBYB 1FLRH 2VXTL 3RBGA 2BFVL 4JPKL 5IQ7H 3JV5A 4DQOH 1G6RA 3FCTB 3NA9L 1XGPB 1S7VB 3KXFA 4HKBB 1BJMA 2VN7A 3CJJA 4FRWA 1HKLL 5F93C 5I0ZA 4X8JA 4UT6H 1S7SB 5I9QB 4PJXB 1NCWH 3BPCB 2VC2L 1XGQB 4NHUA 4E0RA 4S10A 5FIEA 3OXRA 1X6LA 3DXAD 3V4VL 4NWTL 1RHHA 2ITCA 4HUUA 1I1AD 5GHWL 4HUXB 4EOWH 1SMAA 4X6DE 4HWBH 1K2DA 1NGZB 1R3JA 4NRXA 1IRAY 3RA7L 5BVPL 2NY6C 1FBIH 1TCRB 3WUWG 5CAYB 5FUZL 4LVOC 5T1KA 2AXFA 4PJDA 1P4LB 4X7TA 4X6BB 1OQOA 2NMSA 2HWZH 5I8KL 1T20A 2BHZA 2W9DH 1LEKA 3OSKA 3GM8A 5KZCB 4XNZC 1TZHA 5CJQH 2XFXA 3DYPA 3CGTA 1WEJH 3BDBA 1AXTH 3GM0A 1AKJB 2G9HA 4JAMA 1KIQA 3RBSA 1A3RH 2UZYB 2D9CA 2P49B 4IRJD 1H3VA 4X7SL 1MI5E 2VAAA 2CIIA 4Q9QL 1I9IH 2MTPA 4PJGA 2V9RA 1UJTA 1U95A 1ZXQA 5IBLD 1BF2A 2F19L 5FGCB 3TBWB 2YUVA 2AJYL 1A7RH 1KB9K 1S7VA 4JQIL 5HSFA 2BVPA 5IBUB 5F6HJ 2DQHL 4JRYB 1D6VL 5KOVC 1FN4B 3H9ZA 3B8YA 1T03H 4ODVH 3CXDH 5JW5B 4GG6F 1CGXA 1VACA 2NY6B 2APVA 4MA3B 1KPRB 4AG4L 5J6HB 3DHMA 5I1JH 2P5EA 3IDYB 3CDYA 4L8SA 3LKPA 1C7TA 1WCQA 2X1PA 1XGPA 4Y5YC 1S5IH 1BZ7B 1AC0A 3U46A 1ITBB 3EJZD 2VWEE 3QWQB 4EI5B 1DBKH 4GRWH 3RWFB 1QQDB 5GS1B 3QWRA 4EOWL 1BHGA 3QNXB 1C5CL 3KLHD 3C5ZD 2DWDA 3SCMC 2D03H 4XMPL 3SDDC 1ED3B 1KJ2H 1U8HA 2VC2H 5IMKB 4JY4A 2KUTA 2WINA 3VW3L 4RIRA 1ZVYA 3GBMH 1IGIL 1WF5A 3DGGA 1AO7A 3BD5A 4TTDD 1EHLH 5E8PA 4XBPA 1LO2H 4JPKH 5D1ZA 3I2CH 3FZUC 2PYEE 5JPNA 4UNTA 2IALA 4CADA 3EJJX 4YZFE 3RY4A 4RNRA 2E5EA 4LIQE 1V7ML 4UU9A 5CD5C 4M7JL 1EJOL 3UP1A 4L4TA 1Z3GL 4IHOA 5E1AB 1FL5B 1KV3A 3UJIH 3MRHB 3MX0A 1OVZA 5JPMB 1WT5A 3DVNB 5ILTL 1XIWD 1G7LB 4JAMB 1L9MA 4OZIF 2DMBA 1U8JA 4PGCB 3U0WL 1DEEB 5JZ7D 3E8UL 1J1PL 2Y1VA 4U33A 3VXRE 1JPSH 2CDEB 3MV7E 2CK0L 5B39A 2ARJQ 3M07A 4RMUA 4ODHH 5GRWA 4OI7A 1FPTH 1HILB 5GS1C 3OV6A 5LVEA 3KWWB 3PWPA 2BVPB 1ZAGA 2MKWA 1ND0B 2IG2H 4OI9A 1MQ8A 5I8OL 4W4NA 1X5ZA 5TH2B 5E5RB 2F8XC 1FV1B 5GGRB 4HK0A 2PW1A 1K9TA 5HI3C 4NFDA 4PJHA 1R0AL 3HNVH 2J4WL 3LQAC 3CFBA 4X4MA 4PB9L 4OT1H 4DEPB 3S37L 4Y2OA 4JFOB 2E7LA 2WWMC 4PGZA 5CP3H 1ZMYA 1CDJA 3TBSB 3FQRB 3NBNA 3QUYD 5F8RC 1X3DA 4P59H 5GS0C 3BRDA 2J2ZA 1F6AB 4PBXA 5CP7A 4JKPL 4HV8B 5EUOA 1FGNH 2Z31B 3KGRA 5MEOA 5F1OB 2Q6WB 3LD8C 4M9PA 1YNTA 4MJID 43C9B 2MPAH 3DV4B 3RGHA 3FFCE 3CC5B 4P5MA 3RPIB 2BMKB 4B5EA 5F9AC 4I3SH 1IKFH 3SDDB 3QCTH 4D94A 3WHXA 5MENE 1O5DT 4G3YH 4X7DC 1NCAH 4IDJH 2LU4A 3RL1A 1U8JB 1B0GB 4LLWB 1E4KA 4ZAKA 1J0JA 1FH5H 3MCKA 1MJJA 1ZVHA 3BJ91 3DVGB 2BERA 4QT5A 3VXOA 4WO4D 4NQED 3KPOA 4KHTH 1JYWA 1CDBA 2YXFA 1F6LL 4C57C 1QSVA 4KK6D 3RAJL 3WDHA 5JO5B 1RQ5A 4LVNB 3CZJA 3P4NB 2KL6A 3V5KA 4CBPA 2B2XL 5JNYA 3OKEB 3KPLB 4GAJL 3JWOH 3VXMD 4KMQA 2NY1D 3MRRA 4MAUH 3G6JF 1G7MA 4Q6IC 4QTIL 4BJLA 3N85L 3LN5B 2OZ4L 3QBTB 1CL7I 1UM6H 3PHOA 2P8PA 2UVFA 1UXSB 3ESUF 5EOCH 3F58H 3GNMH 5HHMB 4NPYB 5C7XH 1CICA 1DSFH 3P9MA 5H94A 2P24B 4G43B 4YO0B 3QG7H 4F7EB 3D25A 4FG6D 4YEFA 2JLLA 2IPTL 1RK0B 3MRLB 3MROB 5DEGA 4HPYL 4WW2C 5F7DA 4GRLC 4HJ0C 4ZYKA 3WIFA 1UENA 4YHIB 4ZS7L 1DQLL 4PJEA 3O2DA 3W2DH 1MHHB 4MNHA 3LMJL 1BM3L 4P3DA 2NXZB 1OSZA 4JRWA 3FN0L 4UT7L 5GIRB 3TO4B 3D2UA 1NC2A 1YA5A 1OHQA 3D3VA 2LAAA 5FO8A 1A7OH 5DJXA 5GRZA 1S8DA 1ZT7A 4OKDA 3B2UD 3S3JA 3VA6A 4AENB 3T2NL 4OCYL 4N1CA 3GJFB 1YEJH 3DJ9A 3D9AH 2B7DT 4C83A 2CLVB 5EZJA 2Q8AH 4YHNB 3LB6D 1EO5A 3IAGC 3OKMA 3S97C 1IC7H 4R7NB 1KIRB 2WIMA 1VFBA 3BQUB 2VR9A 1LEGA 3ZHKA 1F4YH 5EORL 1MI5D 1ZEAH 4O4YH 3CUPA 4DGVH 3KPPA 1UJ3A 4NWUH 4K3HA 3CMGA 2G75A 3A6CH 2AK4E 3OB8A 5EU6D 3V8CA 4PP1C 4MX7B 1AE6H 1UGNA 3P30L 3GMMB 1OAUL 1BX2B 1NMCC 3Q2CA 3WN5B 3DSFH 2YPLD 5T5NF 2X1OA 4OGZA 3BKCH 1JPGA 2K7QA 1J1XL 1KEMH 2X89D 2EE3A 2P8PB 1ZWIB 3GHBL 4NGHH 4Y2DD 3GMOA 4MQ7B 3AC0A 1X5KA 4PLOB 3O11B 2NNAA 3G5XB 2Z4QA 4P2QE 2Q3AA 4MAYB 5B8CC 3SJVA 1T6WA 3L5WA 5CHNA 3WFZA 5HI5C 3BDYH 1PLGL 3UBXG 2OL3A 2IANB 5EA0H 4YXLL 1ONQA 3K1DA 5C0BE 1LO5A 3GB7B 3SDXB 3QXUA 4P4KC 5LGHH 4HZLA 4U3XA 3VXSB 5IFJA 1IAOA 3AS3A 3CFEB 2VDPL 2DQGH 5F6IB 4KJWC 4OTXH 4BSWA 1QFWH 4O00A 4AENA 2HT2D 4KK9D 1KFAL 1FHGA 1IAIL 5GRUH 4DCQA 4PJGF 1ETZA 1OGTB 2YPLA 5ANME 5E2TL 4LEOB 5B38G 1NBZB 2E27H 2P8LB 4M4RA 3GMMA 4E5XA 1YMMA 3OXSA 5CBAB 4C56A 1H3PL 4D0CB 4M3KB 4XPGL 4TNVK 3ULUE 2Y23A 3ARUA 1F58H 4YIQA 3N1QC 2NY6D 5MHSD 5I1CH 2EDKA 3OAZH 2K3TA 5L9DL 5EUKA 3SO3C 5ID1A 1CXLA 4FS0A 5GJSL 3MJ6A 4XCNB 4Y4FA 5EO9A 1HH9B 3BH9B 3V4PH 1JE6A 3C6LD 5DT1L 1RZKH 3KPSB 4U1JB 4WGVB 3MCLH 4G9FD 4J4PA 4KY1H 3V52H 3DX7B 4E42B 1S7XA 1BLNA 4OQTL 1JRHH 3ILPA 3JTTA 2IAMA 4JFFA 1BQLH 3KG5A 3ZDYF 3S6CA 4POZD 1I75A 2XY2A 3MACH 4M6OH 1AIFB 1FVDB 1MWAA 2VE6A 4UNVA 4PRHB 1N2RA 3WFHB 5JHDB 2D31B 2XTJD 5HY9A 2HFTA 2VXQL 4LMQI 3RWHB 1RUKH 5GSRA 5JDSB 1UM6L 1IC1A 2ZNWA 1VFAA 2X2YA 4JDVA 3E3QC 3MV9D 3FN9A 5ANMA 2IADB 4PLNC 4YXHH 3O6KH 3BGMA 4H88L 3OF6D 4JFDB 5DSCA 1D3CA 3NPSB 1MLBA 4CN6A 4LEXH 4LL9A 5D7IA 1NFKA 3JWDH 1EIBA 4HH9B 1CD9B 3RWEA 1JI2A 1CI5A 1G9MH 3TBTA 5CGMA 2YWYA 4UQ3B 3REVB 3G9VA 1I7ZB 4R4BA 1FP5A 3BEWB 4XPFH 5E8OB 4FABL 4X6CA 5C2UB 1CXIA 5DZOA 1T21B 1JGUH 1MWAL 1FG2B 3W9EA 2NY3B 3NZHL 2AJUL 2GSIB 2J6EL 2K9UA 1MHCB 5GS3A 3SJVE 4K7FB 3DO7B 2EE6A 4LARL 1PKOA 1NGPL 1D5BA 2VKXA 4JKWA 4PJ5D 3ZDYE 4R4FH 1IKFL 3O4OB 4TTDC 3HNTL 1N6VA 5F6HI 5I1EL 4CDGC 2EDFA 4L8CA 3LZFL 2NX5A 3RFZC 3MODL 3HI5H 4U1JA 3QO1B 4D0DB 1YEEH 1FGNL 3QWOB 4FP8L 1QRND 5B4MD 4H0GA 2FR4A 4P59L 3S88L 35C8H 5C0RH 1KGCD 2FRGP 3W82A 2MCG1 4IM8A 2V7HB 5D5ME 1MSPA 4KK5C 4JRXB 4K94H 1U3HD 1GIGL 4FFWD 1X5XA 2OS7A 1BPVA 3ZTJH 5T33H 4RQQA 2BNQE 4EI6B 5C0JB 3SDCA 5AYUL 1FDLH 2JCCE 2O5XH 3PDDA 2ADIA 5D7IF 4HCRH 3SKJL 1JYVA 1JPFB 1H0DB 3MRGB 3TT3H 4PG2A 4F3FB 1A6VL 1I3VA 4GXVL 2NY3C 4NQEB 3RDTA 3F12B 1I7ZA 4R4BB 4X9HA 1OWRM 2CRYA 3QUZD 4OZIE 2M1KA 3TYGH 4N0CC 3T2PA 2BJML 5SWSA 4GW4A 5DK3A 4TOYL 2V2XA 3LIZL 4WRLA 4HJGA 2L4OA 2MFNA 3MA9H 1AFVL 4LHUG 3SKOA 1MLBB 2M8XA 2OSLB 5HGHB 1MRFH 3PDOA 1KBGH 1HN1A 2NY1B 4NQCA 5EIIB 1F00I 3V95A 9CGTA 4ODXB 4JFZH 2NQCA 1CE1H 2FLBT 1CIDA 1FE8H 5FKPB 5DJYB 4N90D 1G6RL 1DR9A 3L3JA 5E6ID 3MJ7B 1MIML 5JR1L 3GI8L 3IU4L 4GUPA 1S7RB 1CG9A 5H37G 1ZANH 2X1XR 4OBSA 2Z31C 5D2NB 2NW2A 2EDJA 3QRFM 1U8QB 3EOAA 4YK4B 3GHEH 4I5BB 1LD9B 1NDMA 1ZT4A 1JIBA 5KS9A 4O2FA 5F7EH 4QT5B 4RWHA 1UKSA 5IMMA 2NTFB 3UEZA 1H3WM 1LQSR 1J88A 1ZA3B 3WKML 2H32B 3TO4D 4PGJA 5C0AE 5SWQA 1ULVA 2OMNA 5T1DL 2BY2A 5D1QD 5IIEB 3PV6A 5DK2B 3VGDA 3WNLA 3QHZH 5HDLA 4L3EE 4H25B 5JW5A 3QA3B 3FO0L 4GW4B 4OLVH 1QG3A 3X11B 4U05A 1JFQH 1ES0A 2D0GA 2ZCLH 5AZEL 5GGQH 1AO7D 3T0XA 5L88H 5FYKD 3RNKB 2VH5L 5E00B 4DKAA 3QR2A 5KN5B 1HH6A 3GMLB 4DK6A 4OFYA 3HC0B 2DQTL 4QHNA 3BQUD 3KS0J 3WL9A 4CMMB 4DKFH 4K3JL 4AIZB 2O61B 5KAQG 4HG4K 1RK0A 2F8OA 4OD1H 2VYRE 5IHZB 4AMKH 2IFFH 2F53D 1DVFD 1F8TH 3C6LC 2GJ6A 5J4MA 3KJ4C 3Q48A 4K3DH 1AXSA 3U9UB 4LSSH 2IGFH 4RAUA 3S96A 1RMFH 3PWJB 4JO3H 4XCFL 3IRPX 1JPST 5ACMA 4P5TB 1EZVY 2W65B 4V2CB 2VNCA 3TZVB 2ZOLA 3FQXB 3MC0A 5JLZA 2A9ML 3N1MC 2VIRB 5FDWB 4LLYB 3HB3D 3PABA 2IPUK 3KPMA 4G8GD 1M7IB 4OJFL 5SWZD 4ETYA 5JPMA 3SGEI 4HUKB 3O8XA 2BX5A 3IF1B 3P40A 3GIZH 5ABDE 3TA3D 2XA3A 5IHUH 3V4UL 4U1MB 2JCCB 3F7VA 1BAFL 3VWJA 5HDQL 1M05A 4J3SA 1DE4A 4WU7B 3KJ6H 5DD3L 1HKLH 3SOBH 1LE5A 4Y4HD 3ZT6A 2YRPA 4LVOB 3QUML 1MELA 3VXSD 5C09A 2EEDA 4YC2B 3MLSH 4YXKH 4X9FA 5FYJU 1HHKA 3IT8D 1RZJC 1A5FL 4JM4L 4WFEE 4ZUVB 5E9DD 3B9KC 6FABL 1SYSA 1T0MB 4KTEH 2H2PC 1RUAL 3RVXC 3FOLA 4EDWH 1NKRA 5E24E 3I9GH 3LN4A 2W65A 2R0WL 4N0RA 3IJSB 1IT9H 5KVGL 1BIIB 4PRIB 1L9NA 3CC5A 2QQKH 1S7TA 2MCPH 2UV3A 3BZDA 3OAYK 5MEPB 4Y19D 4XPBH 5E03A 4QRPA 4WI3A 5ERWA 3KPMB 4QHKJ 4FZEH 2W38A 3PWVA 2DQJL 3L9RA 1A6TA 3C6LB 3CFJA 4FQ1H 3V9FA 5EU6A 3VXMB 5C9JA 4EIZC 4D8PB 5CD5D 1B0GA 5DFVC 1JYNA 3HLAA 3B9KA 1G9MC 2XKSA 1P5VA 4AJ0A 1FJ1A 4ORGA 5I73C 1FNEA 2LU3A 3H9SB 3GBLA 4XWGH 3MGOB 1Q0YH 5DRNA 4PYGA 1A6ZA 4FQIH 4GRLD 3WIHL 2GSGA 3PNWA 3VXPB 2F54A 3BP4B 1QSEE 5B38A 1YMMB 4NC1E 3RWDA 2GTZB 4XPTL 4L9LC 1DUZA 4NKOB 3FMGH 3EFFA 2NZIA 2NXZD 4WDIA 2QSVA 3W39B 4WW2B 1J9CT 1CICD 4BQBA 4JPIA 4HZLB 4RISH 4LQFH 1NL0L 1XGYL 1OAKH 5HBBA 5CZVL 1JGVH 3QUXD 1I8IA 5FGSA 5I74C 3HE6B 4EI5A 3MRIB 5FKAB 1A9BA 4Z7UB 4K07A 5IW3A 3QUMA 4JPVH 1KPVB 3VGAB 5I1HL 5DHYA 4XP5H 4TVPE 3Q5YA 3RVUC 1ZHBB 2HJKB 4YDVA 5I1IL 4F9LA 2VZUA 5IFHL 4I77L 4DVRH 4X5WA 3BZ4A 5A2KH 4F37F 3ZKNC 5ID0A 5DD5L 1E4KC 3HS0A 4X6DA 2BNUB 4ZAKC 2DQJH 4UIMA 1PEZA 1Q9OB 5BO1H 4GG6A 2Y36H 3BESR 4YFLF 1QVOB 3AAZB 5J12C 3QPXL 4JZNA 2CO6B 2QQLH 4U49A 3WXWL 1WBZA 2J88L 4FQQB 4KRLB 1FFPB 3LSOB 4TVSa 2RBLA 1DUZB 4NKOA 5IKCB 4Y5VB 2VISA 2R4RH 3ILPB 1DBBH 3ZE0F 1PG7W 3Q1SL 2YA1A 1JRHI 3BEVA 4UV4H 1LWRA 1XF2A 3VFOB 3ZMRA 3F5WB 5I16A 2C26A 1FVCA 2APTA 4U1LA 4Y4KD 4JR9H 3NCCB 5SX4I 1P2CA 1I8KA 2G75B 5F1IB 1J11A 2VDNL 4N8CH 4NSKB 1MFCL 4ODSL 2R8SH 4MD4B 1TXKA 4UUJA 1HYSD 4PRPA 3SGEH 4HWZB 2DLFH 1UWGH 4S2SA 2YR3A 3BHBB 4KJQD 4NKDA 1CICC 4P4RA 5M94B 1IGMH 4HDIA 1WC7A 3FT4A 1LK3L 1FV1A 4UDTA 2AS5M 3J8F7 3PV7A 1QSFA 3O3EB 3O6ML 3FO2B 3WSQL 5AUMA 1UFUA 4X5XB 4LPWA 5DA4A 3S8WA 4QXUL 1JZ3A 5HHPA 5C2BH 4HXBH 4POZC 5IQ9A 4F9PC 2BOCA 4KV5F 5IK3B 5DK0B 2OP4H 2AEIT 4ZD3H 3O3AA 1QD0A 3HE6C 4OJFH 4G8EB 3K4ZA 5FHBL 3EFDH 5J1AB 15C8H 1JHKL 4LKXA 4XHQA 1U6AH 2V7HA 4JVWA 5I18H 2ZKHH 3IS1X 3WDIA 2ZSWA 3QDAA 3RQ3A 1BBJB 3H9SE 4WTWA 5IESL 2XRAL 2D7PA 4PJFF 3UTSD 2FX7H 3MLUH 4GKOA 3QDJD 1YJDL 3U46B 5FDYA 3PWUB 4OLXL 2YKLL 4WVRA 2X4TB 4KFZC 4YLQT 1A9EB 4MD4A 3TT1H 5DQJA 5ALCL 2BVYA 3QAZC 4XNUL 4TRPL 1E6OH 1A1OA 5DDHA 2DMKA 4RFOL 5CCKH 4OZIB 2Q3ZA 1A7PH 1V3LA 1RURH 2EIDA 3ECBB 4K55A 4UT9H 3ZO0A 2HJLA 1RK1A 3DX9A 4HUWB 4GAYB 4S11A 4JFQA 4U0RC 4MA3A 5J6HA 1QZ1A 4EXKA 4U4BA 4JFED 4LF3A 1HHGA 1RFDH 1WV7T 4OZFG 4JB9L 1NGWA 5ITFA 4PJ8C 1S7RA 1DTUA 2D7NA 3F7YA 3TPUA 3QI9C 4MDIB 1UH4A 3FFCB 3ULVD 4LKCB 3DURB 3F8UB 2E6JA 3QNXA 1VB9A 4AH2B 1LNUB 2ILLA 1MCWM 3VFNB 5I6XB 4M8QB 5EIQA 1INQB 2APBA 5K93A 1N6QL 1P6AB 2PO6B 5HGHA 1WZ1L 4JO4L 3ARDD 4XBEL 5FYKU 4HS6A 4MA7L 5IBUG 2HT2C 2H8PA 3T08A 4V1DA 5T1MA 1LEIA 2R2EA 3BD4A 3KYNB 5TH2A 2KZWA 3IU4H 1J18A 5DUBA 4B7LA 2GQHA 5ESVB 4FFZL 4OZHB 5IVXF 4IJ3C 1X5GA 2VLKD 2HRPH 1UH3A 4DTGL 2PKDA 1NFDA 2R23A 4FXGB 5IBLC 3TA3B 2DKUA 5KW9H 4Q7DA 1PZ5A 2P46B 3EO9H 5JA8B 2QADB 3UTSE 3UDWC 2EO9A 2AVGA 2BJMH 4Z8FH 2H32A 4UIKL 4DOHE 1J8HA 4OGYH 1U36A 1T6VN 1KCUH 4KKLD 3AUVA 1TMCB 4P3CH 5DDHB 1IEAA 5JXED 2DQCL 2QHRH 2VSDA 2NY0D 3O8XD 3D85A 5EOTA 4GMSH 1KTLB 1J5OH 5DFTA 4Q9RL 3W0WE 5BV7L 4U0RB 2IC2A 2FATH 5J11C 4JB9H 3RGVD 3WD5L 1MCDA 1QTYT 4LCUB 2FB4H 2DQFA 4XNXL 5L2KA 1UC6A 2GYSA 5D7JD 4GKZB 2VXVH 3E2HC 4GG8A 4X80L 4C4KO 1YY8B 3RIFF 1CZ8H 1TENA 1LE5B 3DIFA 5L0QB 1RJLB 5EC1A 5E6IA 3R1GH 4JG0L 3DXAA 1WICA 3FT2B 1VFMA 1QBLL 4PRID 3ARDC 3DV4A 4OD3H 5FV1L 2WSKA 4KJYA 3HE7B 2VDRL 3SGKA 2UZXB 4U3CA 1HXYA 5CMAA 4KK8C 3BMWA 4OLXH 1SYVB 2F9BT 4CVWA 4HWEH 3I84A 5F1SA 3LPWA 4KTDL 1YEGH 1FYTB 4NQEA 3QFDA 3CSPA 3EO1B 5GS1A 4NOBA 4L29B 1OARL 4CMHB 3I75B 2BVQA 3IFPA 3UTQB 5SV4A 2ZG3A 5FUCC 1NFDE 5I18L 1IILE 5C70A 1S9WB 1TJGH 1TLKA 5KANG 3RX7A 4OUUB 4PJ9D 3PWNA 3WE6A 2GI7A 1KT2B 4U2YA 3RI5F 4X83A 5C0EA 3SGKC 3T0EE 1NBYA 3MLUL 2CIIB 2XWBB 3RZWA 2YBRA 3TO4A 4G9DB 1C5DB 2OTWA 4Y4HA 2NXYB 1DL7H 3EO0A 4WTZA 4FNLL 1LO0L 1SMOA 3PWLB 4HLZG 3WIHA 4IHOB 3MV7B 4EKXA 5MENA 4OV5A 4PTUB 4H0IA 1EK3A 3J7HA 5D2NE 3UROR 4XCNA 4Y4FB 1DQJA 4P23B 2CK2A 3NCEB 4IEFB 4WW1B 4X0KB 3PXJA 4LCWA 1JNHB 4J8RA 4KGJA 2MMXA 4N9GB 1BOGB 4E42A 2IH1B 3ULUL 4R2GC 4LBEA 1BREA 5F88A 2VZ3A 2JB6A 3CH8A 1I9RH 4W4OC 3G9AB 4NN7C 4K94C 3C5JA 5GGUB 1AR2A 5DRNB 4PJFB 4XNQB 4CL7A 5C07B 4XP9L 2P7TB 5L8JB 4DTGH 4H25A 4PJHE 4D9QE 4ZDHA 1AGBA 3GKWL 3MNWB 4Y1AA 1S9WA 5ERWB 4UOJA 1GPOH 1DVFA 3CFKA 4KVNL 4PRIE 5IMKA 1VADB 3GBNL 4ESKA 4UAOB 3TO2A 3BXNA 1AH1A 4OIIH 5BQ7B 1AGFA 1FFNA 5T3ZH 2N56A 4MCZA 3WFEH 5HPMA 3GSUA 4LLDB 1OW0C 3EZJB 1Q9KB 5IMOA 3RZCC 5GGRY 1H5BB 4W4OA 2VABA 1N6QH 3EDFA 4Z7NE 3BZ4B 4FZ8H 4D9RD 3DTXB 1YN7B 2DBLH 3DX6B 1F4AA 4TNWK 5E2TH 3BO8A 5GRUL 4JDZB 2FNBA 1UJ3B 4GG6B 1EMTL 5FKAA 3MSPA 4PPTA 2FIRT 3QQ9D 4GG6E 2BRQA 4JRYE 2OR9H 5HHNB 3V5DA 3MLWH 2X4RA 3RI5K 4LP5A 4JZOA 1EX0A 4JVPA 1QYGH 1A3QA 4PJAF 5JXEC 3GSRB 2XN9A 2JELH 2A6KA 3JUZA 3REWB 5J57B 4I18C 3RL2B 1NFIA 1I1YB 2EDTA 1IEBA 4LLYA 4P46B 1JHTA 1S7UA 4HUVB 3STLA 3MBXH 4PJDF 2X4OA 4X98A 3KR3H 2N1KA 2DTMH 5JMRA 5FO7A 4HK3J 3L3OB 5D7JC 4BELD 1AGBB 4M7ZB 1XGYH 5ALCH 4RISL 2BP3A 3RVWD 5C71A 1HK6A 2YEZA 1S9VB 4HXAH 4HIHA 1T5XA 5EN2B 4OF7A 4MNQA 4JFPB 1KJ3L 3O3EA 4PB0H 3OKDB 3PQYD 1KIPB 1QKZL 4NRYA 4QRPD 1DLHB 1T1WB 1DJSA 2GITA 3LKQB 1RZIA 2EDXA 3T1FA 3MMEA 1WJ3A 1XF5B 1J8HE 2A6JB 3BPOC 2XV6B 4WUUB 4F7MB 4Z9KB 4NKIL 5FB8A 3VWKB 2I24N 4X6EB 5EZOH 1OGTA 4NYLB 5E70A 2FO4B 1HI6A 4OQTA 3QDMB 4R26H 4PJAA 2OP4L 1XR8B 1J86A 2GT9B 1PFCA 4Y5VA 4WUKH 3GMRB 5DJ8A 3CCHA 2OZ4A 3TBYA 3WSQH 2E8YA 2FECI 3ZLQC 1B9ZA 4KRNA 3BGAA 3L5IA 3QXAA 5FECB 2XZZA 5IJVB 3MNZB 1E6JL 1A1MA 1LO4L 2HFFA 4V1DE 4NFCA 1Z6JT 4KJWD 5TF1L 3TNNA 3C2AL 1OQXA 3QCVL 2YPVL 2NXZC 2W60B 3NPZB 4J4PD 2IADA 1KEGL 5ETUB 4PJDE 4HAFA 1E6JH 2XN9E 3VG9C 4MA1C 4XVUC 3BAEH 2X4UA 4P4KA 3BAEL 5IV2A 2ARJA 4J2XA 4GLRI 1CICB 4ZFFA 3OKYA 1WBYA 3CDGB 3MRJA 3BH8A 2ARWA 1IAKA 3ULUH 1WWAX 3SKMA 2BVOA 4CAGA 5IK3A 1DDHA 5BCAA 3LRSA 2J88H 5IJKC 3MRMB 3JV6A 2E8ZA 4M4PA 4TNVF 4ENED 5IVNA 2R0ZH 4P2QB 4WU5A 4MXQC 2DLIA 5DURD 3GNML 3KXFE 4XRCA 4OB5H 3DI2B 1EPFA 2XPGB 3MRDB 4H0HB 4DVRL 1RV6X 1II4E 3Q5TA 5CEYA 1BFOB 4BSVA 2DWEB 2FJFB 4GS7B 2H32H 4NIKB 2QADD 3HUJA 4PRPD 4R26L 1M7XA 3WBDA 4QHNB 5AD0B 2D7TH 4HFUH 4OSUL 4HQQL 1QEWA 1YDPA 4BA8A 3GJEA 3G6DL 2XACC 1DBAH 5E5UB 2ZPKL 3TIEB 5JOFB 1NL0H 1HSAB 2J8HA 3OG6B 1FZMA 1IAOB 3BDXA 3CFEA 2MQCA 2BSSA 4LVHC 3KR3L 2MNUA 5T3XE 1CXFA 4K3DL 3TN0C 1UADC 2B0SL 2EYRB 4TPRH 2VH5H 4HXAL 3LQZB 4O2CA 2MOVA 5IF0B 3U7YL 1N0XH 2R2EB 3D5OF 2ZUQC 2NX5B 2RCSH 3OGCA 4FQXB 3WMSA 3VI3F 1DDHB 4I3GA 4BQ6A 4D2NA 4DKFL 1TZHB 4Y88A 1S7QA 4IS6A 2Q86B 1MEXH 4MB5A 4QXTA 2XPGA 2Q7NA 1KJVA 3DGGB 4S1DD 4UZGA 5DQDH 4ONGL 3O6FB 4J3VA 1NEZG 2I9TA 1QYGL 3HNVL 4LGSB 1FNHA 2IALB 3MLXH 3MLWL 1BQHA 4J3XA 1N64L 2LV4A 1F5WA 3QHZL 2BY0A 4B7IA 5FA3A 5EZLB 3WFBH 3MLRH 4PJBB 3FRUB 5KSBF 2DQCH 2P24A 4ZTOL 1KCUL 4WGWB 1E4XI 3MRCA 3EDKA 2DBLL 5HHME 4N0YH 3GI8H 5C0AA 4FZ8L 2QQKL 4WFHE 4ZUVA 1UZ6E 2A6IA 5HYSB 2VDOH 3CX5K 1ZT4B 2DICA 1I8MA 2RFXA 1YMHB 4RMWA 3BQUC 2R0WH 1D9KC 3W81A 3HZVB 2XIDA 1FG9C 2H9GB 5IEHB 2G2RB 1R3IH 4NP4L 4FQXA 1RIHH 4JDVB 2AJ3B 5TF0A 4XH2A 4EUPG 3U4BL 1ZT7B 2JJTC 4XGZB 3I02A 5CKGA 4GXVH 1KTLA 1URLA 5HYQB 1C16B 2P44B 3SCMB 5J13C 3OKMB 5IF0A 3FO1A 5CBEA 3SQOH 5EO9B 1FJ1B 1XCTB 1D9KA 1GIGH 5I76A 1TTGA 3PWPD 5BS0A 4Z7UF 2BMKA 1BLNB 4PLKC 3TIDB 4NNXB 1A6VH 1TVHA 2C1OB 3MJGX 4ZSOB 1K5NA 4NNPL 3VXQB 4HT1H 3NFPB 5D71H 4JFXB 3BSZH 4HHAB 4JFHE 4X7EC 2UVEA 3C87A 1BOGA 2XTJE 5IGXL 2HAZA 1BWWA 1B6UA 1RIUL 1VGKA 4PJ7A 5I1JL 3ARQA 2X4NA 3T2OA 4NJ9L 1NBQA 1RMFL 1I8LA 3VXUE 2ATPA 4HKZB 3F62A 35C8L 1F8TL 2YOCA 3JWOC 2PUQT 3QP3A 43CAB 1YPZF 3OKEA 4XNUH 4F9PA 3CVHH 4HUUB 2VDRH 4FXKA 4KI5D 4UINL 2JB5L 5CILL 1IGFL 4RFNB 2FJHA 5HYQA 4X7SH 4JM2B 1V5JA 3X3GL 5JDJA 2DQTH 5T3XH 1EDQA 1AGFB 1FFNB 2OI9B 4JZJC 1Q94A 5KOMC 2XWBA 1MJJB 4DVBA 1HDMB 2VZSA 3NZHH 3ARGB 2PTTB 3VD5A 1EH9A 2B5IB 1H9VA 4NJ9H 3RIAF 1VESA 2ZCLL 3KLSA 1CFBA 1RUPH 3IVKB 3T4YA 3O6KL 2VIRA 4LAJH 2CUMA 3DTXA 4NKQB 4XAWH 5TPWH 3ROOB 4OD3L 4Q9RH 2AJSL 3O8XB 3EFDL 2BSTB 1LMKA 4F57L 3MRRB 3AY4A 4ZD3L 5JOPD 4NC2B 4UNUA 3I6GB 3NFNA 4X80H 3LSOA 2IJ0C 1OCWH 4EQ2A 5CEZL 2PF6A 5MI0C 5IBTH 1YYMH 3I50L 4WU7A 4LRNL 3SQOL 2FATL 4L4VA 4PJCB 4LOUD 1NCWL 1B90A 2GTWA 3P4NA 3ES6A 1LK3H 5ACLA 3W9DB 2Z0BA 3P0YH 5KSAB 1QPPA 5MEQB 4MWFB 4WUUD 1VACB 4JFXA 1UWGL 2WUCH 4MLSA 2YD2A 4M62H 4PJ8A 5E9DA 4YHNA 3WNPA 2VXTH 4HS8L 3ZYIA 5DJ6A 2OQJB 1JGDB 4XHJD 1L6ZA 1J0ZA 3LS4H 4OF5A 3H9SA 1A8JH 4MNHB 3QUYC 2FCBA 3HHRB 3OAYH 5EG6C 3VCLA 2FO1A 1KBGL 1MRFL 3LEYH 2EH8L 3QEUB 4JFFE 4L8SC 1WZ1H 5DJZA 1N5YH 4XPGH 2VZTA 1EVTC 4APQB 1RIVL 3DBXB 2I60L 1HINH 4N0YL 4ZG1A 4RFNC 2HJFB 3EUUA 3WIFB 5FHAH 3C8KB 5DHVA 1IAIH 1HE7A 5EUOE 5F71A 4JGMA 2EECA 1JCKA 3LQMA 5D2LA 1F58L 3FB7B 4XBPB 4MJ2A 1WIPA 1TTFA 5BW7C 4NNYB 2OR7A 5I1IH 3QIBA 2DQUL 5C0DB 1T04B 4HGWA 2AEWA 3IU3B 3L3KB 2XTJC 3T3PF 4MAYD 5IR1B 4ZSOE 4Y1AD 3L3GA 4XVUD 4IIQB 3ZYOA 2DIJA 3PWNB 5EA0L 1A7PL 3S88H 4F33B 1PLGH 1JGVL 4GSDH 5IB3A 4PJBF 1YEEL 3NN8A 4PV8A 1FG2A 5DURB 1PY9A 3A0OA 2MKLC 3V7MA 1IQWH 4HKXB 1N0XL 3BZFA 1WTLA 1MHEA 4HC1L 4NUGL 4TPRL 3HI1B 1KCSH 3TESA 4JFQB 1P7KA 2B0SH 2H41A 5D1QC 3KPPB 3HB3C 1T80A 3MOBL 1YN6B 1IFHH 5D8JH 5DC4B 3SDDD 1IBGH 3MV11 4DFHA 5EZIL 3SKMB 4I48A 4FQQA 1RU9H 2XNAB 1AGDB 5IVXE 1DBML 3RNQA 3O9WD 3K8KA 1JV5A 4M9OA 5GXBB 4HQQH 4HFUL 4OSUH 3UTTB 1CFTB 2V2TB 4DGVL 1KLFA 5CZXC 4K8RD 1OM3L 3BKCL 4XWOC 5AG8A 1HSBB 4YGVB 3CSGA 2HMID 1YNTB 4HXBL 3QIBB 4JANB 4RMVA 5I0DA 5KVEL 2ZKHL 2D7QA 5ICYA 1EO8L 3EYUL 1FO0B 5E99L 3SDDA 4NOFA 5CJXC 2YD7A 1MREH 2NX5D 5AAMA 3VH8A 4LEOA 1RULL 4Z7OE 1CK0H 1YMME 3ZDXF 1Z9SA 2R0ZL 4KK5D 3SKNA 2J1KA 2ENYA 3OBAA 3DMMD 5AEAA 5IROA 2L0DA 5KVGH 4ISVA 1OP3H 4PJAE 4X5LA 2VLRA 1GAFH 1OTTC 3NGBB 1WLHA 3MACL 3O6MH 4NT6B 2XWTA 1ITCA 3LMJH 2XTJB 2B4CC 3CU1A 5BRZA 4IOFD 4Z95H 3TO4C 4K71B 3QPQC 5C0FA 3MZGB 2WW8A 4NQSA 4Q6YA 4CW1A 4D8PA 4YBQD 5DWUL 5ISZE 4S2SB 1KEGH 1CQKA 2YPVH 3P73A 1CCZA 1GXEA 3DNKA 1HXMA 1ZVSB 3QPXH 5F44A 3REWA 3HA0A 4W6YB 2R2CA 4CKVX 1B6DA 1MH5B 3PQYB 2CDEA 2ZUTA 3KJ6L 1QNZH 2OCFD 1YN6A 3P0VL 1BFOA 4Z7VE 5DC0A 3REVA 4BSVB 4BH8A 5C08E 3U0PB 5E7BA 5F97E 4C59B 1H3PH 4WI6A 3GIZL 4JKMA 1OTSD 4RX4A 1AGCB 3RNQB 4JJ5B 1AY1H 5IIEA 3OKNA 1WITA 2Y36L 3MJ8B 3BGFB 2R1WA 4ZODA 3RAJH 2DL2A 1TTUA 1MCKA 2GKIA 5AYQA 5DEFB 1E28B 2A6IB 1HXYB 4YPGA 1OAKL 4K71C 1MWAB 2VE6B 1XGRA 5D7IB 4FFYH 1SYVA 3FCTA 1SBSH 3PGFH 4L9DA 2Z91A 2B39A 4X6EA 4YQXL 4JPVL 1T7XA 1NCAL 2BRRL 1VENA 2AERT 3ARBA 4CU7A 4CW1B 1H15B 2FH6A 4IMKC 4I3SL 1OP3K 5ESQB 4EZMA 2WAHA 4JRXD 3H9YA 4HH8A 3VJ6B 1BJ1J 1DQDL 1F02I 1SQ2N 3SDAA 2RJMA 3GMQA 4EDXA 1FH5L 3QEQD 4F8QA 4QXTB 1QA9A 1TPXC 3L5HA 4UBDC 1NGQH 2CXGA 3OR7B 4MQTB 1PW3A 5TDNB 2OTWB 4FQHB 1CLOH 4PGDB 3QDHA 4PB9H 5ENWA 4XPTH 1H3TA 4YUEL 1NMCB 2EYSA 2KDGA 2MPAL 5CGTA 5HHOB 2Y7QA 1PYWB 1M7IA 3QDGB 3ARBC 4NUJB 3CFIC 3MV9A 3SKOB 1DLFL 4YWGL 3SGJA 2VLRD 4PJ9C 3KPQA 3QPQD 3KLAA 2AABL 4OFIA 5GISL 4XPBL 1NC4B 4QKXB 3ILQD 5CIPB 1XCTA 3W5MA 3P4OA 5C0ND 4DKEL 4L8DA 3MR9B 3WFCL 1G7PA 4HWZA 3QWOA 3TVMB 3O2DL 5T1MB 1EUTA 4FQ1L 1YEIH 4H8WL 5IB2B 2AGJH 4OCYH 2EXWD 4MYWB 3OR6A 3T4AA 3HMXH 1EJOH 4M7JH 1X5HA 5C09E 3GKWH 1QPXA 1TNMA 1G7QB 2LABA 4N5ED 4PRAB 4FQLL 5C3TA 1SYSB 4NZRL 3E8UH 1BD2B 1G9NH 4JFZL 2Z91B 2WUBH 5IG7A 5E8DL 4N0UE 3FO1B 3HAEH 2QADC 3QEGH 5EC2A 3ARGA 1BGXL 3D18B 2YPLE 1Y0LA 3OAUH 2UZIL 1BIIA 4PRIA 1V7MH 4KKNA 1NUDA 3I2CL 1ED3A 3S36L 1EO7A 1EHLL 1XIWA 5I71C 1Y18A 1DBKL 2ZSVB 1R24B 1I9JH 1TPXB 3TT3L 3FO9A 3VDAA 2VLJD 3X17A 2D0HA 1RJYB 3TN0D 5DVMA 4ELMB 5DJYA 3V7AG 3FQTB 4IOIA 5GZND 1KJMB 2UWEA 2FHFA 2X70A 4MVBD 3LY6A 1TQBB 1A2YB 1QSFE 3CVIH 3DXAE 4JRXE 5E6IB 1FAIH 4ENEC 3ARGC 4RMSA 1SEQH 5F3HB 2HTLD 5K9JL 1PY4A 4UDTB 1AXIB 4Y2DC 1S5IL 4GO6B 2F74B 3B5GA 4QRQA 4L8BB 4EVNA 5GJTL 2YBRB 2F19H 3QI9B 4X9GA 4Z77B 4OCNC 1OARH 4TUKH 2V5RA 1T5XB 5EN2A 3MR9A 1F90L 1G84A 3HC0A 2EDHA 4ODVL 3W39A 1QLFA 1D6VH 1BEYL 5JW3L 4OV5B 1O0VA 4X99B 3IFPB 5DJZB 1EEUA 5KSAA 3ZHDA 1CN4A 1JNHA 3O4OC 2FWOB 3QULA 2GCYA 2XZAH 3CFBB 3P2TA 3SPVA 3QCUL 2HWZL 4OUUA 1A4KA 4YZFF 2AQ3A 4PGCA 5D96C 4JKPH 2VOTA 1FL3A 2NZ9C 3VD3A 5B39B 3KLHC 5K9JH 4QTHB 3I85A 3Q3GA 1P4LA 1QR4A 4HKJB 2BVUA 1CLYH 3WIIL 5L8KB 4QWWC 1S78D 3PWPB 3TPKA 2HT4C 4GBXB 1SVZA 2V7NB 4XNZB 2EYTB 1T0NA 3HS0B 2GTWB 4BQ8A 3VXTA 4G8IA 3V0AC 4OCMC 3ETBF 3PGCB 5BV7H 3BKJH 5I8OH 5JNYB 2FHCA 2NY2C 2YHGA 4QRQB 1I9JL 3H2WA 1RY7B 1ZANL 3NA9H 3T77A 2PW2B 1NGYB 4YE4H 3MRFA 4ZAKD 4C56B 1KG0A 3RWJB 4BH7A 2BK8A 4S1SH 2A1WH 2DL9A 4Y4FC 4ZMAT 5L2JB 4JLRB 5F7WC 3ULVC 3KPOB 2NTSP 5CWSA 3V6OA 2FX8H 4Z78B 4LNRA 4NRZA 2RAMA 1AJ7L 1S7TB 1FFOB 3F7YB 1NLBL 4QYOB 4JY6A 1AR1C 3N50A 4HEPG 2YA0A 4KI5C 4MJIA 4X6CE 3QEGL 5ISZA 4QLRA 4N8VB 1JRHL 3RWGB 2DKMA 3UJIL 3M8OH 4WHYG 2Y9RT 3V52L 1XR9B 3U48A 5C0CB 1MF2H 5F89A 4FTVD 1C8PA 1ADQH 4L8SB 1P4BL 2JJWA 1TQCB 4KRPD 2WWKO 3IS0X 3QQ9C 3C09C 3UYRH 1CVRA 4ZS6D 2EIEA 1P7KB 1Q9KA 5IMOB 4TYUA 3HCVA 3FJTA 4HCRL 4AK1A 3VW3H 4LLMB 4JGJA 4NBYB 5AYUH 4YHOH 3MLPA 5DUBB 1AC6A 3LIZH 2LFGA 1VEPA 2D03L 3SDCC 1CT8A 5DMGC 4QHLB 5LGKA 1HHHB 5EU6E 2YZ1A 3RDTC 1BVZA 4WHCA 5C9JB 3GSNL 4M48H 2E3VA 4CMHC 5HD8C 2E6QA 4ZUSB 4J12A 2OYPA 1A21A 2DIAA 3Q3GB 5HVHB 2ZSWB 3KPRA 4YGVA 1UEYA 3FQUA 3MGOA 5KVFH 5GZOD 5CS7A 4M7KH 2D4DA 1J0KA 1EBPA 1NSNH 1FGVH 3QG6A 2R1XB 5LG1A 5F9OL 1LP9E 4Y19B 1DZBA 4YAQB 5TE7H 5E6ZA 3P11H 2OTUB 3I6GA 4MSWB 1JGUL 1KCRH 4FABH 4O2FB 5J1SC 1K4CB 2XFXB 4U6XB 4ISVB 5C0IA 4YFDB 1EVUA 3ZE2F 4X4ME 1MFDH 4P3DB 4WJ5A 4EN3A 4R4FL 4MDJB 5IP4A 4OZGF 1ZV5A 3P9WB 4MD0A 3OMZA 2WWKT 5DK2A 4KKBC 3EYVB 1NDGB 2F53B 3O11A 3KJ4B 3PGFL 1SBSL 3CU7A 3G5XA 4MWFA 1XGTA 1Z0NA 3DSFL 4H88H 3SDXE 4APQD 4PY8J 2C3WA 4ALAH 2LE9A 3VRIB 2W07A 3VRLE 4Z7UA 1FC2D 4KDTC 1U6AL 3G04B 2LQRA 3MLYL 1NUNB 1YEDB 1JHKH 4NCC1 4ELMF 3IFNL 3MGTA 4DZBA 4U6VH 2ZUVA 1P69B 4PUBL 1E4XL 3MXWH 2YD5A 4JPIB 4CVZA 3MCG1 3QEQB 5GHWH 1M1SA 1IGYA 2W0FA 3EGSB 4I0CC 3V79C 3LRSB 1WCBA 4OZFB 3K74B 5BMFH 4KZDL 5I1AB 1PG7L 4QGTA 1BVKA 1JK8A 1F3DH 2IQ9L 5H2BB 3B9AA 2XZCL 5HHOD 4WHTA 4Z7VF 3MCLL 3U30B 4HPOL 3FO2A 4KDTA 2HVKA 4WWKB 1KXVC 2BFVH 2CIKA 2VQ1A 4MHHG 4CU6A 1F2QA 1FLRL 1RZGA 5EU4A 2ZOKA 2LTQC 2P4AB 4FXGA 4WJ5B 4R0LB 5BVJA 4R97B 2C7UB 4JR9L 4BKLB 3EOBA 4FA8A 4MD0B 3QRGH 2WBJD 3QRGL 4PREB 3GMNB 4PJHF 4UV4L 3TVMD 4OLWH 5E8EA 3QDGE 5HI5D 4OQ1A 1KACB 5BS0B 3GK8H 4D0CA 1NH6A 4LCIL 1S7WB 2SEBB 3B3IB 3O4LA 4QXWA 3FT3A 5JIHA 4HDIB 4L3EA 2QQLL 1QR1B 4HX1A 3QH3A 2BXYA 1DQML 4JFFD 1OGAE 2DB8A 2XZCH 3A67H 4LLQA 2IQ9H 4MDJA 2FL5A 4XZUA 3HAEG 1RULH 3I6LE 5EU3A 3TNMA 2DYPD 2EDNA 3IETB 4KZDH 3D25B 2WBWB 5HGGS 2DWEA 1BD2D 5DEZA 4MNGE 1H3GA 1MRDH 1OLZA 5IMMB 1AO7E 4Y4KB 4JFDE 4XVSH 3VE0A 4MAUL 1VKXA 3QSKB 3RUGB 3NTCH 3BFOA 4GH7B 4WHTB 5HHQA 3DUHA 3ZYZA 3R4DA 3IDJA 1YYLL 5AZ2H 2KH2B 3WUWB 4TNWF 1JN6A 4HH9A 1BIHA 1KC5L 4W6WB 1YN7A 2YRZA 3DX6A 4KKLC 4PD4J 4U6TA 3TN0B 3GSVB 2A9NH 4AM0B 5IT2L 1HDMA 2AJVL 4Z0BH 3MYJA 5TQ2H 2ICWI 1BVKB 1JK8B 3PGDA 2P48B 2A9NL 5IT2H 1GGBL 1FORL 3FMGL 1MFAL 3TVMC 3CVHB 4N0FB 2FBJH 1IQWL 3IFLL 1NLDL 5EO0B 1F11B 2CO7B 1P4IL 4NJAH 5DSCB 2VQTA 3QJFA 4K7PX 5FYKL 3ALXA 3T8XA 1BD2A 4FQIL 1ZLVH 2I9LB 5CJBA 4Y5YA 3C5ZC 2YUZA 4Z7WE 3PP4L 1FVDA 2DD8H 1SM3L 2J3SA 2HN7A 2WBJA 3D69A 1KEML 1J1XH 2YMXL 5F7FA 1SHMA 1NSNL 3TCXA 1IE5A 1W72A 3JBG7 3BZEB 4M7KL 1T2QL 2UWEB 1H3UA 3LKRB 3O81A 4XCEB 4E41A 5LQBH 3DPBA 2GW5A 4XNMA 3RUGA 3F7RA 5D1QA 4WNQB 1IGJB 1MCSA 1NANH 3CXHK 3LH2H 4XC3H 3TH2T 1OTUC 4WHDA 4A6YA 1D5MB 3NFSH 3GUTA 5ANMB 4WI4A 4Y5XB 3D6GA 1Q72H 2CMRL 3VXUD 5I75C 1G9EA 1XF4A 4QHMA 2MCPL 1T89A 5I15L 5HI4D 3BYTA 1L7TL 2VXUH 3TN0A 4PJEE 2XYCA 1TIUA 2E7MA 5CZKA 1QLFB 4EDWL 4AQ1B 2ZUYA 4MZ3A 3U0TB 1TVHB 1BZ9B 3IFOB 3ULVE 1Z3GH 1XR8A 3D85B 5EOTB 4YJZL 3HPLB 4Z0XA 1JNLH 5AWNH 4IJ3B 2I26N 3BIAX 3BN9C 3B4NA 3RGVA 5CEYB 2V9QA 5E94A 4JHAL 1YQVL 5J8OA 1CF8L 2HH0H 3HUJB 2YS4A 4XB7A 5DD3H 3MRQA 3L1OH 5BMFL 1NLBH 4F9LC 3V8OA 4RWYH 1AJ7H 3B9DA 4D0DA 4ZPTA 1CGSH 5F9JA 1V05A 2WIIB 3WFDL 1Y6MR 2VSCA 1DN2A 3WNOA 2WWMD 5CMAB 4GAJH 3ARFA 4ERSH 3PWVB 4JY4B 2B2XH 5C0CD 5A40E 5EBWA 3CLFH 1T1XB 5GS0D 1KIUA 3IKCB 2DRUA 3ARRA 3MLYH 1MHPL 3HRPA 2A9MH 3FB8B 1FYTA 5GRVL 5TE4H 1MCPH 1MRCH 1WZMA 2XQBL 4YHKL 2XQYG 2RIKA 5HD8D 3IVKA 1I1YA 3UX9B 1RUPL 2YSSB 3WXVL 3HI1A 3WIIH 4NPYA 4OIBA 3CXDL 4WNQA 2WLYA 4O9HH 1F4WH 3VWKC 4ZTPL 3GJFH 4N8VA 1ZLSH 4PJ9B 2R9HD 5L7XL 5SWSB 3QCTL 5DI8B 3JV4A 3UTSB 3X3GH 4AMKL 5I75B 1RJZA 1QLRA 3GSOA 1IGFH 2NY0B 2I07A 3O6FA 4LCUA 2XZAL 4NHCL 4OZ4A 4FFVC 4GG8B 4NM4H 4RFEA 4HKBA 5I1KH 4IDJL 1PSKL 4OZHE 4FQ2H 4PJBA 4MXVF 5CJQL 1F90H 3OR6B 3T4AB 1KN4L 4LSRH 1XF5A 2A6JA 4TUKL 1QHOA 1XT5A 2F58L 3HE6A 3SDCD 1HI6B 4LRIA 4GAGH 5D71L 2JB6B 5K9QI 2CLVA 3BP6A 1SY6L 4Y0GA 5EZJB 3VG9B 3RWJA 3I6LD 2P7TA 1T20B 1JUFA 3CCHB 3TBYB 5F7EL 5IFJB 2P5WE 1A7NL 3DRQA 3MOQA 1X5IA 1F13A 4M7LH 3U36A 2YPKA 4GRLA 4PV9A 1MHCA 4I4WA 4YX2L 1R3HA 1KT2A 1CFNB 1U8OA 1KIQB 2HT4D 2JIXB 3RVTC 1FNSH 3S37X 1CFSA 2QKIA 3H42H 3RUGE 5JQHC 3WS3B 4PJGB 2I27N 1JF1B 3U4BH 2X70B 2X89A 1EEZA 4Y2DB 4YIQB 2DAVA 1JP5A 3OAUL 4MB3A 3RRQA 1P53A 2NXYD 3WO3B 2V2WB 1A6UL 3DURA 4ONHB 1A6UH 2DOCA 2VLKA 2DM4A 4Z5RB 3IJYA 3PJSA 1MJ7H 5ITBL 2YUWA 1LP9B 2P5WA 4XMPH 1PAMA 4JDTH 5HYSG 5EU7C 2ADJA 4FQPA 5HHNA 4Y4FD 4JE4B 5EFIA 2X4RB 5HYSA 3JVGA 3MBEB 5TQ0L 5CUSH 4UV7L 2R1WB 4LLWA 4OGXL 4PS4H 3H42L 2BSED 4R6UA 4K8RC 3R0NA 2EICA 1UZ6F 3WFBL 1NMBH 1VPOL 2ERJC 3MV8B 4G6AD 4YX2H 3BIBX 2F53A 3UAJC 3QIWC 1FIGL 2LVCA 2R1YA 3MLXL 3LKOA 2CDGB 4K94L 2Y5TA 3TO2B 2R56H 5GSRB 3RVXD 1I3RA 4MB4A 2DQDL 2DQHH 4P3WA 1A64A 4G6FB 4GAGL 4FOMA 3MJ9L 1A7RL 4XC1H 4WO4B 1ZE3C 3S4SA 1WIUA 3QNYA 4DAGH 4NO0B 4UILL 1YC7A 4I0PD 2XWJB 5A3IC 2W9LA 4PGBA 4ZXBA 2AJZA 4YDJA 2DYPB 1JNJA 4IRSA 1IEAB 3V6ZB 2AAVA 1INEH 2NLJA 3EYVA 1T03L 3MRNB 4ZQKB 4XPAL 4LLUB 1K5NB 3QXWA 5JQ6H 2DQIL 3DGCR 2JIXA 4G42B 5FYLL 3VDBA 4C83B 2AJUH 1R5WB 4P2OA 3GFUA 1Q8MA 2D2OA 3ARPA 4RBPK 3E6FB 1JF1A 5SX5H 1OT1A 1Y6KR 3QDGA 3EFFB 4ORGB 3NPSC 1OF2A 4Y2DA 1T3FB 3T65A 1NCCL 3QYCA 4AT6A 3MTRA 4MNQB 1Z9LA 3UTZB 4BSJA 4XZUB 4KVCL 3B5HA 3UJTH 1AXTL 5DRZA 3GMPB 3RA7H 3QIBC 2HP4A 2LTQB 4HWBL 3U83A 3P4OB 3CVIL 3HZKB 2YD6A 3WJJA 2D3VA 3EJYC 3BMVA 3OJ2C 5LBSL 5I17B 5I8KH 5A2FA 2KPNA 5DLML 2OQJA 1XGQA 4K3EL 2K1MA 1EFXB 4LPTA 4H5SA 2BY1A 5IV2B 3HRZA 4IRZH 1A0QL 5IQ7L 5M95B 3KPNB 4ODBD 5CZXD 5DRXB 1G6VK 4MZ2A 1CT8B 3V4VH 5C0NC 3EOBB 3T1WA 4AM0A 4J1UA 3ULVL 1R3KA 1M4KA 1UM5L 3EJYD 4XPHL 2X9YA 4X6CB 2AP2A 2HH0L 4KXZI 4W68A 5DHYB 1DQQB 2IBZY 3CVHA 3T0DA 2AXHA 3ME0A 4M61B 3GSWB 4JHAH 4UBDD 4BUHA 1ZLVK 4TUJA 3WJLA 1XF2B 1ZGLA 4NQCB 3VRLF 1ZK9A 1FVEA 4MQXC 3OX8B 3TV3H 4MCYB 1FYHB 4Y5YB 5L9DH 1R3LA 1WFOA 3QXAB 5FECA 3QDME 7CGTA 4YBHA 2NNAB 3QUXC 3DHJA 5CJXA 4N0FA 4OZGE 3K4DA 4PV8B 1MQKL 4WFFD 4WUKL 4QRRB 5E5MB 5BZDA 1FRGH 2FBOJ 2KKQA 4HIEB 5DGQA 1KFAH 2WQRA 1Q9WB 1U3HB 5DEFA 5AUMB 4HIIA 3UTTE 2DQGL 3OKOA 1RVFL 3WUWA 2DQFB 1DUYB 5L2KB 4WY7H 4F7TA 2BNRB 2AK4A 1QBBA 2ICCA 3MNWA 2DKSA 2Q7YA 4B0MM 4KI5E 1FL6B 1HZHL 4HFWA 4G8EA 4ZYKB 3CSYB 4KTYA 3QUZB 1TITA 2IAMB 4L3ED 1OM3H 1JZ2A 2E9BA 3IFOA 1T7ZA 3PP4H 3HR5B 4U6HB 1CL7L 2H2SC 4X4YB 1TFHA 1U41A 5C9KA 4QRTA 2JK5A 1U9KA 4L9LB 1OAQL 1NCNA 5T3ZD 3NMEA 3A6BH 3ZSSA 3LKNA 1H8OA 5MEPA 3B2VL 2PTVA 4PLJC 2A0LD 5ICYB 1RUMH 2DJSA 4YGAB 5TDNA 3E6HB 1S7SA 4OCLC 2BRRH 4PGDA 2JJUA 4CADB 1KCSL 2Y6SC 4YQXH 4PRPB 3RTQA 4K9EC 4NUGH 4RZCA 4OCRL 3EOTL 4P48A 3P77B 4HS3B 1JPTH 1XCQB 2R29L 1FL5A 1JZ6A 3D1MC 4UQ2A 4I18B 3RL2A 4M5YL 4HIEA 4NWUL 4ODWA 4PJ5A 4LLAA 4Y5XA 2VZ1A 4LAQH 2YK1H 2P5ED 1L0YA 2X4OB 4QHMB 3FB6A 3G08B 3OKOB 5GSVA 4KZEH 2UY6A 4JLRA 3TH3T 3LS5L 1F4YL 4WI5A 2NTFA 2DQUH 4Q6IA 1F3RB 4EN3C 5SWQB 3GJFK 5BV7B 3W9EB 3MQIA 5EZLA 3X13B 3DMMA 3V0WL 1CLZL 3WNKA 3ARXA 1KF9B 1QNZL 1CGUA 3UTTA 3WFEL 2V2TA 5JTWA 1P6FA 3T2NH 4OIIL 5C0AB 4MJ5B 5FHAL 3S98A 5INCB 2PXYC 1GPOL 2FJGB 1F45A 2JCCA 4H8WC 4L3CA 3TZVC 4HULB 2EO1A 4FHBD 5E2WL 5HHXH 4Y8DC 4NM8H 1IM3A 2YD4A 3W0WD 1BM3H 3MRIA 4UDUA 4NKMA 1RUQH 4ZS7H 4Z95L 1AI1H 4KH2A 1TCMA 1OOAA 2QSCH 4LIQH 5IVOA 1VFUA 3P77A 1GHFH 4HS3A 1DVFB 3CFKB 1C1EH 2IBBA 5JHDE 3ZE1F 5KJRL 5C0JA 2QSQA 3H9HB 3STZA 2VXSH 4PRBA 3WV0A 4ODWB 4QHUB 1HQ4B 4OF6A 5B8CB 3F7PC 5A2LH 4F3FA 1Z9OA 1PEWA 4Y5VC 4QCIB 1D9KB 1IGCL 1VGEL 1I1FB 3BGFC 3RTQB 1DFBL 5K9KB 4BK4A 4L5FL 2XOTA 2R9HC 5GPRA 1Q1JH 2F5BL 4TSAH 3TIDA 5SWZA 4I4WB 3VFOA 3BUYB 1XEDA 4EDXB 4PUBH 5B3NA 3CFJB 5DJDB 1C16A 2WLZA 4F57H 2NYYD 4NN6B 4S0SD 1NKOA 1UA6L 2AJSH 4P9HL 1CDIA 3ARGD 1IM9B 4NSKA 5D7JA 2XN9B 5FM5O 1CXKA 4RGNE 4WIQA 3TEUA 2EYSB 4RFEB 2HTKC 2EDBA 1IEBB 5GQBA 3MPCA 3RDTD 5KG9B 4L4TD 3MV9E 3P9MB 3QHFL 5H94B 5GZNC 2C1OA 4KTDH 1LP9F 1MVUB 1NANI 5DQ9A 5TDOB 1KELH 3D85D 5FO7B 3MRLA 3MROA 4LVEA 5F7DB 4HC1H 4DJMA 3T0AA 1JWMB 5CILH 1A4JB 3SE9H 4OKVB 1B4JL 1XIWC 1EHXA 2FJGA 1K3ZA 3OZ9H 1S9XA 3CVHL 1N59A 3MLZH 1KCRL 4OFYD 4XVTL 1I3GL 4KK9C 1ZHNB 3N06B 4FXLA 3W5NA 3IJSA 1GOGA 1CZ8L 4RNRB 3RY6A 4BZ2H 3G6JE 3HC3H 2EXYC 4OT1L 2J4WH 1CDCA 5EIVA 3WN5C 1R0AH 3PP3K 1NAML 2PYFB 4KQ4H 4N5EC 3X14A 2WINB 3ARZA 3P9LB 3TBSA 4ZFGL 3QXDB 1AD9A 3BWUC 4GMSL 2D4FA 4Z7WA 1NAMB 1J5OL 4XT1C 3U7WL 4UTAL 2L7UA 4GMTL 3UC0H 3GSNH 4M48L 2CUIA 4U7KA 4R7NA 3WS3A 5I19H 3QEQE 25C8H 3C8DA 1NCDL 1EEZB 2WBKA 3H9SD 2VL5B 1FPTL 3VFUA 3WHE1 4MNQD 1RIVH 3EJZC 1FO0H 2NY2D 1ZHKB 3L7FA 3QAZB 5CD3B 1CDUA 4YHOL 4NUJA 5IJVA 3RY6C 1PQZB 1MUJA 2V9TA 5KSAC 2EZ0C 2R69L 4P2RA 1AP2A 4RBPH 5KTEH 3MUZ1 2EEBA 3V6OE 3IKCA 5SX5K 2W60A 3LS4L 3EOYG 4DEPC 1WTGT 1CD8A 3STBA 3C8HA 4P9HC 3JZ7A 2C9AA 4ZUTB 2AQ2A 1F6AA 4G7VL 3M8OL 3QEUA 2NXYC 5DMYA 4I0PA 1U8PA 3ZKMC 2O61A 3VI4F 5FOBB 3KYKH 4YAQA 4IMLB 2ICWB 3DBXA 1MIEH 2FX8L 4U1SB 4GRWF 1G0XA 4TN9A 1YYML 3I50H 3DUUA 1T4KB 3SDCB 4HS6B 1DP0A 4XRCB 2J8OA 4RAUB 3S96B 3HG1D 1OF2B 1PKQE 3FAXA 1CD1B 1IAMA 1YNKL 1FCGA 2LAGB 5EH1A 1FFQA 3BKJL 3D48R 4NO0A 3BKML 1UZ8A 3SEPA 5TPWL 4X5WB 2FJFA 2IFGA 3CH1A 1A47A 1I4FB 5DQDL 4JQVC 4HBCH 3VGEA 4NQDB 4G42A 5T1LD 2Z92B 4F33A 4JY5H 3FO9B 2D9QB 3BP6B 1MCQA 5HYEA 1CFTA 5F3BB 4B53A 4DZBB 5FKPA 4QRRD 4H20L 3BPNC 4IOIB 5D2NC 2JCCF 2JB5H 5CP3A 3ARFC 3QCUH 4DW2H 3PL6B 3QUKB 1F4XH 1FVEB 1I7RA 5C6TH 3EKCA 1JHTB 2DBJA 4HUVA 2OI9C 4G7YH 4HIJB 1KCKA 4LHUA 3PWUA 4QEGA 1GSMA 4O58L 2BNRD 4YHYB 1A9EA 2FEEI 4Y1AB 1DBJL 1AHWC 1PVHA 3B2UC 1YPZE 3NIFF 1NDMB 1VGKB 4PJ7B 5L2JA 1A1OB 1RHFA 1RIUH 4ACPA 5D4QA 5IGXH 1DBAL 2IPUG 1JWSB 4F2MB 4POYA 3BSZL 4G6JL 2B4CH 4XTRC 1U3JA 4XXCA 2NW3B 4Q2ZA 3NACH 2D7TL 1ZT1B 2V5MA 5D9SA 1MCOL 4OM0H 2CKBL 1Q0XL 1FAIL 2J5LC 3MMEB 4GMTH 3L5XH 4XVJH 2ICWA 3UBXB 1S8DB 4LPVA 4OAWB 3SPVB 4NWTH 4Y16C 3TBVB 1OTTD 1K4DB 5FF6B 5FAAA 2Q8BL 1G0DA 3O9WA 5IB2A 1ZS8B 3ULUC 4DGYH 1NJ9A 3QQ3A 4JN1L 1T66D 2DS4A 4ORZC 1FIEA 3CZFA 1RZKC 4ONFH 5GIRA 3SY0B 2FL5B 4MQXD 1W0VB 1F97A 3RVTD 2HFEB 1KIPA 3UTTD 2ZJSH 4U2ZA 3S36H 5L8LB 4OLEA 2ICEA 2CJUL 4OLZL 2BNRA 3MNVB 4X6FB 1OAZH 1M71B 3K2UL 1N0LA 4QHLA 5BRZB 2Y07L 1RIHL 3BYYA 4PJDB 5JIIA 4Y7MA 4OGAD 1B4JH 4XCYB 2BNRE 3H0TA 4WO4C 2EC9T 3IJHA 1BJ8A 2AJ3A 1NPUA 3UCRA 3OXRB 4U6HA 3AM8A 3G5VB 2H1PL 3TC9A 3Q1SH 2HLFC 2X09A 2DM3A 2F8VA 4XGZA 4FQLH 1FC1A 1N3NB 1MPAL 2FX9L 2X4PB 5JOEA 3L3IB 2AJZB 3WXWH 4APQC 3RWIB 4ZTOH 3V0VB 3ZE0E 5EU5A 1T7YA 1VFOA 3RWGA 3BH8B 1HHGB 1CS6A 1UA6H 2P42B 4D0BA 1A6WH 5E9DE 4TTGA 1UM4H 4LLVA 3SBWA 3UBXA 1YMMD 4YHPB 3ZHLA 3TYFB 2AJXH 3V7AE 1W0WB 1EFXD 4KPHL 4YHLL 2ZG2A 1ACYH 1J8HD 1UWXK 4YC2C 5JW4M 4C4KT 1EA9C 2UYLA 1ZHBA 1REIA 1HIMH 2Z8RA 4LPCA 4O02H 1JGLH 4WWID 2QV2A 2VZOA 4QO1A 3IDMB 3K1KC 2A38A 4QOKA 4Q9BA 1UKTA 4Y16B 2O5YL 2ATPB 3MRMA 1QFUH 2VXSL 3DX7A 4MXQD 2RCSL 2H26A 1HEZB 3MYJB 5GGTH 2R2BA 3RWCB 1C7SA 3C8KA 3OKNB 3F12A 2AXJA 4LSUL 3P4MB 3CLEL 5I1LA 1NGQL 2CRZA 3FONB 4JFYB 4JZJA 1U3YA 3R8QA 2VUOA 1VCAA 4AEIL 5TFSL 5JZ7C 5D70L 4KKCD 1RUQL 5EBMA 1NC4D 4NNYA 5EUOF 1DQDH 1A4KB 2CGRH 5EIIA 1D5IL 4W6XB 2D31A 3O2VH 1LK2B 4LVNC 1M71A 5CKAA 4UOW1 3G6DH 3WIHH 3THML 4QTHA 4G9FA 2YN3A 4M6ML 3BRFA 4GW5B 5HI4C 4F58L 3OPZL 3AY4C 3L95B 3AMLA 4JRYD 3LKSA 3QNZB 2OTUA 5GGSA 5K9KA 1G7IB 4M00A 3VFVB 1UYWL 3BKYH 3WEXB 1NGXB 5DJ2A 3JTTB 3VXNA 4IOFC 3MLVH 3BUYA 2GEEA 3MUY1 3ZKND 4Y8AA 4YHMH 2Z9TA 3D0LA 3KPQB 1HQ4A 1S7UB 5DVNA 5DD6B 1EMTH 3OJDA 5CJOL 4JFEA 2QTEA 3HZYA 1BECA 5L2KD 5D7JB 3DOSA 3EO0B 4U1GB 5E8EB 4LAQL 4RA3A 4NKMB 5C86A 1P7QB 4L3EB 3QISA 1NMAH 3P0VH 3I9GL 4K7FA 4OF3A 2X9WA 4LLQB 3O2WL 4L1DA 4G6KL 5FA4B 4PGEA 4M6NH 4F58H 1OTUD 3NA4A 2JJVA 3BW9B 3IDIB 3IDXL 5D1ZC 4I1NB 2PXYD 5A2IH 1PX3A 2A2QT 3QDJA 4J6RH 4YXKL 5M7QA 3RX8A 3MLSL 1I7UB 1T1ZA 5HYJE 5HY9B 4G5ZH 3T0EB 3TBTB 3JV0A 3HI6H 4BZYA 5I1AA 1GVIA 3ZT7A 2X41A 5FO9A 3MFFB 2E7HA 4U1NA 4FTVE 1LO3H 1TETH 4EUPB 5FYJH 2WP3T 2WV3A 3BGMB 1BFVH 1S7QB 1OAYH 4ONOA 5JW4R 4LASL 2DI7A 2Q86A 1Y18B 3VMNA 1MAMH 4M02A 4K2UL 3ZYJA 4NZTL 5D1XD 4MNGA 2HTKD 4PJIF 4R90L 4ZPVB 2EDQA 3DVGA 3FB8A 1A1MB 4ZFOB 4F15C 4TSCH 1M7DA 5EZOL 3WJLC 4HK3N 1HIML 5JLZB 5E99H 5KSVB 3G5ZA 5C0DA 1QACA 2YSSA 2CXKA 1RPQA 1P7QA 4NBXB 5B22A 1DQJB 4LGPB 1MQKH 2FEEL 4JO3L 4XCFH 2O93L 2ATKA 1C5BH 2VB5A 4J8RB 3VFSB 2VAAB 2VITA 1KNOB 4JFEB 1UCBL 3K81A 4LBEB 1GYAA 4MS8C 4QRUB 3KDMA 1H3XA 3UMTA 4JREB 4EN3B 2BSRB 3F7QA 4HJ0D 4LPXA 1T0NB 2H2PD 4P2RE 5C07A 1JF5A 3GZKA 4LFHG 2X7LA 1WC7B 3FT4B 1IBGL 4ZUWB 4X99A 4ZSOA 5FYLE 3D3VD 3MOBH 1AD0A 3BVNB 4NZJA 4XH2B 3C9NB 1QSFB 4XMKL 1PG7X 4DN3H 5FXCH 5DUPH 4NCDA 2AEPL 3O2WH 1FSKB 3CD4A 5F1NA 4EI6A 3S34H 5CEXA 4Y4HC 4YHIA 1PZ5B 4GSDL 3MO1B 1K8IB 4JFPA 4P46C 4RAHA 4AEHL 1N5AB 1DLHA 3HPJA 3LKQA 1WK0A 5I76B 1VEOA 1LDPL 1JGEA 2DI8A 4PJXF 4XCCH 5DJ0A 1QSEB 2VXVL 5IMLB 4ONFL 3CFCH 4F7PA 4XNXH 3VJ6A 5EBLA 1ES0B 4KC3B 3VFTA 1X4XA 3FQWB 4LOUC 2G5BB 2ATKB 2NY5H 4LCWD 4PJEB 2QR0A 4BZ1L 3RTQC 1J05B 2EIZB 4OD2B 2RB8A 2QSTA 3V5DB 3AU1B 5T3ZL 1E27A 4ZUUA 3BP5A 3DARA 4UTBL 4KAQH 2XN9D 1MCEA 5CWSB 1RZGB 3ULUD 5E95B 3VFMA 3NIFE 4P46A 2N7BA 3BPOB 3CUPB 2WIIA 2EEAA 2CDGA 4MJIB 3M17B 1I4FA 4JG1L 4P99A 3L3DB 2EH8H 4CN1A 2QQQA 1RK1B 1F4HA 3DX9B 2A74A 4ODUB 5K9QG 1HQRA 1S9KC 2ADJB 2YD3A 1FZKB 5JQ6L 2HLAB 5D1ZD 2I9TB 1HXMB 5KBNC 5E1HB 2CLRB 5F96H 5GRYA 4JREC 4HV8A 5EUOB 2Y06L 3OAZK 5DVKA 1MH5A 4UILH 2GAZA 5TGBA 2R1XA 3MJ9H 2BC4A 1UEMA 3K3QA 3S5LA 4F7PB 4HF5L 3BN3B 4JO4H 5FF6A 1FSKC 3NVQA 2Q76B 5CEZH 4GW1A 2QQNL 4GKNB 3PG2A 2AEQH 3HKFA 1T3FA 4ZUSA 5F6IC 1TQBC 1K8IA 1FIGH 4ZOCA 3VCLB 4LSQL 1FAKT 1C5DA 5DMGD 3KYNA 4OLYL 1TJGL 4IMKA 5DA0B 2VRAA 2COQA 1MAJA 3PWLA 4X6FA 1RFDL 3EDJA 4H1LH 3K8MA 1S5HA 2OJEA 5DMKA 2IANA 3I02B 4LLUA 1ETZB 2YPLB 4P23A 2GY5A 5HI3D 3RKDC 2DJ4A 5C8JA 4E5XB 5E08L 4NC0B 4LCYB 1HYSC 3GIVA 5FV2A 2H2SD 3MOAH 3HMWH 4HMDA 5IKCA 5ITBH 5DJ6B 1CDGA 3F6LA 2DQEL 3JWDC 4LMQE 3ZKMD 1CIUA 4G7VH 5JO5A 1ZHKA 1HNGA 3L7FB 1MY7A 3K2UH 5SX4H 5HHOE 5F3HA 2YD9A 5D9SB 3QZWA 4DCQB 5JA9A 4JO1L 4PJ9A 5D7SH 5B3JF 4YNYB 4P9MH 5A16A 1QLRB 4LSVL 1U91A 4TVPL 3S7GA 5DZLA 1TJHL 3ARWA 3DROA 2FB4L 4M61A 2IPKA 5CSZA 1QUNA 3G6AA 1EEQA 3TJHC 5C08A 1WBXA 1IGTB 1X4ZA 4HT1L 1PKQA 5ADPH 3QIUA 4G80B 3QO0B 3IYLW 4I9WE 3WKNA 4D0BB 4HEME 4M7LT 5DRXA 3IDMA 4OGYL 1MFEL 3L3KA 3IU3A 1SY6H 1XAUA 4LSTH 5J11B 4WFED 1YECL 3B6SA 3KXFB 4YHPA 4Z8FL 5JW4Q 1IM3B 3M1BA 2XNAA 4J1UB 4C56D 1MJ8L 2IF7A 2XT1B 3O45A 2W9EL 3TF7C 2IMMA 2N7AA 2CH8A 2J8UE 3VGBA 1FZOA 3ULSB 3ZTJG 3O0RL 1BQLL 5E56A 4MHHI 3WNNA 3HC3L 1U8MA 1YUHB 2AKRB 3FOMB 3EYOB 4O5LL 4LSVH 3TNMB 4I3RH 3VG0H 4P9ML 1T1WA 1OP9A 4FQ2L 5D7SL 1PSKH 4M1CC 5DC9B 2FYYB 3HZMA 5INDA 5FO8B 1RZKL 4FFZH 1KLGA 2VDNH 5DTFA 5FB8B 5GJSH 3PGCA 1F4XL 3QIUC 4G9FB 1QRKA 3OZ9L 1A9BB 4AIOA 2JJSC 2W92A 2YZ8A 5A16B 4N0UA 3VFVA 4G8FA 2H6PB 2R4RL 4JY5L 3VXNB 1F4WL 1NCBH 2VDOL 3L3HA 2EC8A 5EU4B 3VRJA 1KUMA 1AQKH 3QIWB 4PJCE 4WDIB 3NIDF 2XWTB 4GQPH 3C08L 1WGOA 3HAEB 5EWIL 5T1KB 3IETA 2VUYA 1FFRA 1KTKE 5A3ID 2GUOA 3T1FB 1UKQA 4YHYC 1KTDB 3QFJE 4QOKB 3OKKA 1B88A 3WHE0 5GS0L 1G7IA 1FL6A 2FR4B 5E2UH 1KJ2A 3O4LB 3EAKA 5LGHL 5HVGB 5MP6L 4ZO7A 3DO7A 4KKBD 3SN6N 5F7LB 4U1IB 4JFDD 3GB7A 3HR5A 5I1HH 1I7TA 2IH3A 3VFNA 4MQ7A 5I16B 5GGVY 1MCNA 4NC1C 5LWYL 1PD6A 1JBJA 3HG1E 3QO0A 3Q6FB 3ARDA 4YDIH 1KTRL 2R1YB 5CZVH 4NBZB 3VFWA 4X6DB 3U6RA 3B6SB 1BZ7A 1E4JA 2ZWLT 2P43B 1AGCA 4R2GB 4PRDB 3S35H 4C56E 1Z0MA 4WI2A 2YKLH 5D7KD 4G8GE 4LPYA 4LIQL 2CLZA 3H7BB 4LLDA 2E7CA 1E28A 1Y6NR 3ORJA 1AI1L 3QNYB 4UQ2B 2EXWC 1F6FB 3QXDA 4P4KB 4HGWB 4ZO9A 1UWEH 4DN4H 5IWLC 5DD0L 3WS6C 3O3DB 3N9GH 5J1AA 5GRJH 4WV1A 1MNUH 5D5MB 3U0PA 5I19L 3PHQB 3RKPA 4YK4C 1OAXL 2V7NA 1IQDA 2R2HA 3EIFA 3NFSL 1BBDL 1K4CA 3VGFA 3LH2L 4XHJC 2NY5L 2J12B 2EKJA 3TM6A 3MV9B 5KVMC 5CEZD 1U8OB 1I7TB 2IH3B 1AQDA 1CU4H 3L6FB 1NAMH 5FA4A 1ROWA 5ID1B 4WCYH 2LU7A 1NEZB 1OY3B 2EDWA 3WLBB 1NUGA 4QRRE 1IGML 4KZEL 2A83B 2YMXH 1OSPH 5CIPA 3VD7A 3W0WA 4HKZA 4V2BA 4Q0XH 3I6KA 1S7XB 3FKUS 1CGWA 4NKDB 2BHUA 2YEZB 1ORQB 5GGVL 3DETD 3PIQA 3LRHA 3GJEB 4ZS6C 4KMLB 3SDAD 2NY3D 4KQ3L 1MJUL 3FFDB 5C6WH 4DN3L 3X11A 1HSBA 3AREB 1NC4A 4JFOA 1A5FH 1EXUA 5FM4A 2FECL 4Y5XC 4M7ZC 1HH6B 1RUML 2IPTH 3OTTA 3OR7A 5D2LF 4JFHD 4FQCL 2NR6C 3PL6C 1NFDF 2EZ0D 2ICWJ 1DSFL 7FABH 3U0TA 4WV1B 2FGWL 4YBLC 1QRNB 2YXMA 5ICZA 4PJ7F 3SKNB 4LQ1A 2CRIA 1CL7H 5C0GA 4TQEL 5HTSA 4K7PY 3GSOB 4I77H 3DMMC 1C5BL 1QBML 4M43H 5EBMB 4QTIH 1RZ7H 1R3JB 4R0LC 3OX8A 3T0WA 4AY0A 1J0IA 2J8UF 2EKSB 3RWEB 1B0RA 2WM0A 2BZDA 2PXYA 4PJ5E 5D7LE 2NCMA 3PUCA 5LGJA 4TSCL 3PHQA 1YJDC 3PL6A 3QUKA 4PG2C 1EHNA 3A67L 2NY7L 2X6MA 3EW3B 3VDCA 4IRSB 1P7QD 2VDKH 1NBVL 5IR1A 1FRGL 4PB0L 1WZKA 3RL1B 1CR9H 4YFEA 4WI8A 4R3SB 1GHFL 4M5ZL 4OLWL 3AU1A 2VLJA 2QSCL 2NY0C 3MCKB 2UUDH 2IH1A 3NN8B 3FTGB 2IFFL 4LGRB 1M05B 2E6PA 4XP1H 4H1LG 3H3PH 3C5JB 1K6QL 1IL1A 4JKLA 4KMTH 3N1GC 3ZDZE 1Y0LB 3GMPA 2DF3A 1R5IA 3L3DA 3IDXH 4IOSD 1R3HB 4J3WA 3O4LE 3QFJB 3AS2A 4M1GH 3S37H 5IEKA 4P5TD 3Q6GH 4HWNA 2R23B 4GKNA 2ZZUT 4AIXA 5FUOL 5JHLL 1MVFA 2HVJA 1W0VA 2V2WA 3HRZB 1GC1C 43CAA 3SQBA 4MVBC 4R8WH 1U58A 4B41A 1CD0A 1IT9L 4YHML 2F54D 4PRBB 3TA3A 4GW1B 4UMGA 3ULVF 3ISWA 3MGAA 3QUYA 1AO7B 1HHIB 3ZDZF 4JVUA 4FQHA 1EEYB 2C3VA 2HVKB 2DLGA 5DO2D 3KVQA 4BK5A 5KS9F 3UJTL 4CJ0A 3GDBA 4LCWE 1CXEA 1SY6A 5C0CE 3LQAH 5DJAB 1NCCH 2C7UA 5F7KC 5E1AA 3C5ZA 3ET9F 2GAZB 2OL3H 4LHUD 2Y5TB 2HMIC 1FQ9C 2HT3C 4OGAC 1IGIH 1UXWA 3QEHA 4BFIB 1DEEA 4QXGL 1NAKH 3UPAA 2OBGA 3P11L 5JIPA 5TE7L 1FLTX 1V7NL 1LE9A 2Q76A 4XPAH 4KRMB 4PTTB 1UB6A 4HAGA 4ZO6A 1L0XA 4L4VB 1QFUL 3AXLB 4YDJB 2C4XA 3T04D 2ZCHL 4DVBB 4MAYC 5E2VH 5DJCA 1YNLL 3TJEH 2ADFL 2VERN 5FCUH 4Z76B 2B5IC 3MV8A 4E41E 4HSQA 3QIBD 1WQVT 4O02L 3T4YB 1BVLB 1J0YA 3LDBB 4ZNEA 5DFWH 4K9EL 1TJIH 4G8IB 1LO0H 1CGVA 2BCKB 4FNLH 1G7JB 1T7WA 2AI0H 1UACH 4PRAA 2H26B 4L4TE 4OKVA 2ZP0T 1BD2E 4PJFE 3VGGA 1LGVA 4JM2D 4NN5B 1F42A 4FQJL 5E4IA 4BFBD 1HKFA 1G7HA 1ZWIA 3GRWL 2GT9A 1VFBB 1UM4L 5MHSE 5C0RL 3D18A 2NYYC 1VPOH 3QIWD 1JN6B 2AJYH 1QFWI 3ELAT 4M03A 3CX5J 4UV7H 1GGIH 3QG6B 2PO6C 3VFTB 5FGBC 4QOKD 1P4BH 2D7OA 4YNYA 1YEGL 5IW1A 2VQUA 1N4XL 3TNNB 5JORA 3PWJA 1RZFH 3TGXA 5J89A 1N7ML 2EH7L 1NGPH 1QBAA 5E9DB 2A0LC 4HWEL 3DUSA 5D7LD 5L2KE 5CBEB 4DGIL 3T3PE 1XCQA 3HFMH 5HGBA 3KPRB 5L88L 3U9PL 5MERA 1MWAH 4O2EB 3T3MF 3QDJE 2JKXA 3GMQB 5F7MC 1IZJA 3OG4B 2HRLA 2B8OT 3HR6A 1HWGB 1QBLH 1U3ZA 3HE6D 3W11C 2A1WL 2F5AL 4YHZL 4X0KA 5F70A 4YE4L 3UZVB 3HMXA 2XG4A 1CTNA 1FZKA 4M8VA 1QO3A 3EBAA 5FGBA 4D9RE 3CDFA 4NZUL 2Y7QB 4CVXA 3B8SA 1ZS8A 1TVBB 4NO5A 2X5PA 3PHOB 3AB0B 2XKNA 3MZTA 1YUHA 2AKRA 3MRDA 3NCBB 3F5WA 5EDXA 3AFLA 3BX7C 4JHZA 1MI5A 2J8UB 4XVJL 4G43A 2VXQH 4YO0A 3I3DA 1MCOH 1T2JA 4P3CL 4KRPC 2NY1C 4P4KD 5D6DA 1YY9C 4GT7A 5J3HD 5DEGB 3ZTNL 5KSBE 4UIKH 4DQOL 4KVCH 1C12A 4HW6A 2PYFA 4QGYA 4XBGB 2PETA 1WVZA 3BE1L 3JWNC 2FJHB 4AZ8A 2GK0B 1NAMA 1Q94B 3VMPA 1IVLA 4NCC2 4HC1A 3GSUB 2DN7A 2B1HH 4I2XB 3U9PH 3ALPA 3DV6B 3N1FC 5F9DC 2ESVB 4NN6C 2FD6L 2HRPL 1BEYH 5JW3H 3NZ8B