3DUSB

Crystal structure of sag506-01, orthorhombic, twinned, crystal 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTVEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGYYVDAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords antibody Fv fragment SAG506-01
publication title Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dusB00
4OJFH 3HMWL 5JQ6L 3CJJA 2YA2A 3UMTA 2W9DH 3GSQB 1MFBL 4RAHA 4JFZL 2IG2L 3EFDL 4FXGB 5A2LH 3KDMB 3DVFA 5JPMA 4CVXA 1Q8MA 1DBAL 2R0ZL 1CIDA 4I18B 1P4LA 5HGBB 1E4WL 2DD8H 1WBZB 2PTTA 1D3CA 1FNSL 5SWSA 4C4KT 5CCKL 1VFAA 1F58L 3MODH 4N9GB 1C5CL 1PYWA 1RUQL 4GSDL 2NY2D 1CGWA 5ALCL 5KSBB 1FFRA 1N5YH 2IADB 4OZHF 3KJ6H 1IGCL 3ARDA 4GW1B 3BZFA 2FLRT 3QHZL 5FKAA 5L6YL 5D7LD 1DN0B 1E0OB 4PLKC 5D71H 1CK0H 2OR7A 2F8XC 2H45A 5KAQG 2PW2A 2Y36H 5IBTL 4B7IA 1RIHH 3VXOB 4JO3L 4XX1E 4LASL 1E6OL 2DQTL 1I1YA 4UIKH 1KEML 3PIQA 1EFXD 1ZS8B 3O6MH 3SE9L 1TCRB 1KJ2H 2VN7A 5DTFA 3TCLB 3H9HA 4KK9C 4I4WB 5DXWA 3G08B 3KPQA 1ULVA 4G8EA 4AIOA 4HCRA 2X4TB 1F97A 4G8IB 2H2SD 4RGND 2NY1B 3QXWA 2JCCE 5DWUL 3U4BL 1GZQA 3R0MA 4H20H 4RAUB 1W0VA 4C83B 2HKFL 4MVBC 3CSBA 3S37L 5I16B 5FO9B 2A9MH 3F12A 3ROLA 1JIBA 3VWKC 2XN9E 3EO0A 4D9QD 2BFVH 5FOBB 2V7NA 3B8SA 1JPSL 2FJHA 3HPLB 3H0TA 1AXSA 3O4LE 4RFNB 3MLRL 1ZSDA 2X1OA 5T1KB 1Q38A 2VDML 1A47A 2W65A 4JB9L 1MREL 1UEYA 1NMBL 2A9NH 3QCVL 4NRZB 3TNMA 5CJQL 5ITBH 4KJWC 5KVFL 3DMMB 3M1BA 1D6VH 1NLBL 4QKXB 2UV3A 3WLBB 2KZWA 3VMPA 2VERN 1HQ4B 5EC2B 2F15A 2MQ0A 2W0FB 3CDYA 3TYFA 2XWJA 4OF5A 4LEXH 4XNUH 5BQ7B 2OJZH 2JJSC 3IT8D 3Q2CA 4HWBA 3VCLA 3MYJA 1YY8B 3U4EB 5C09D 3T0EC 1MVFA 4RRPA 1MI5E 2Y5TA 2NXYB 3RU8L 2NY1D 1WZMA 4EUPA 4P57B 1I75A 3RVXD 4P5TA 1M1SA 1PEWA 1CXIA 5HPMB 3ELAT 1LO4L 1D5ZA 2BNQE 1MCDA 2QQKL 3T0AA 3V0AC 5KW9H 3QXAA 3RL1B 4QHLA 3AB0B 5FOJA 3MV9B 1W72A 1JWUB 5GRXG 2BVUA 1ZVSA 5GSVB 5IJKA 2PCPA 3CMOH 4U6HB 1BQHB 2WWMC 3QUYC 5T1KD 4YDKH 2HJKA 3P40A 2RAMA 4M1DH 5FYJD 5HYSB 2MHAB 5EUKB 1KT2A 1UH3A 3OR6A 4N5UA 1ACZA 3I6GA 3TN0C 5D72L 2XWBB 3BFOA 3P73A 4RX4A 2NY5C 4Y16B 2FO4A 5SWQB 4N8VB 3WHXB 2B0SH 5IEHB 4RISL 5IVXB 4G9DB 1KN4H 1NGWA 4HUXA 4OI7A 3FQTA 2XZQL 5F7DB 3C5ZA 3U46B 4J6RH 3DROA 1NJ9B 4V1DB 2AJYH 5SX5K 2NXYD 5D5MA 4JQVA 4B7LA 2DM2A 2V5MA 5GGTH 4ZFOL 3TBVB 2VDNH 2YMXL 4NFBA 5E6IA 1X7QA 5F97E 4BZ1L 3OKLB 2H2PC 4O2FB 2DLGA 2BDNL 1T1ZB 2AK4A 3MV9D 1VPOH 4P3DB 4GRMB 2IAMC 4X7TB 2NTSP 1JI2A 1KCVH 2J6EH 2MQ3A 4GG8B 3P9LB 1YC8A 4TVPH 1F3RB 4BJLA 2NY6C 2GJZB 4O58H 3WO3B 4LPYA 2RIKA 1UWXK 1EHAA 4Y16D 4KKLC 1MEXL 2WIMA 2BSRB 4WWKB 4MXQD 4L8SC 4OV5B 1TZGL 3PL6A 3QNXB 2PYEA 3S5LA 2JIXA 2OJEA 1G9ML 5HPOA 1MH5A 4Z0XB 3QUMB 3IAGC 1UJ3A 4XNXL 2AW2A 1CFSA 1RZ7L 4RGOL 5TE7L 5TQ2H 2HT2C 1TZIA 4ZPVA 5MHSD 4MQXD 4YWGL 3Q5YA 5EU7E 2CJUH 3RZCD 1NAMA 1LILA 4Y1AA 5DFWH 4NGHL 4R8WH 1QUNA 1A6ZA 3ZE2F 4PJ9B 4FABL 5ID0A 3IRPX 3V6OA 1INEH 1DEDA 5FHAL 5TPWH 1NAKH 3GSQA 4WW2B 4TULH 3D69A 4F7TA 5HDOA 3X3GL 1M7DB 4NOBA 4JZNB 1G1YA 2D31B 3H8NA 5EU5A 3QEGL 2VXSL 5DMIL 4HKBB 2QQNL 4G6MH 5IKCB 2IH3B 3RWDA 5CZVL 1P7KB 2ZJSL 4N9GA 3VDAA 1FIEA 5CZKA 3NZHH 3IETB 1U8KB 4JQIL 2DM4A 3BWUC 4WWKD 2P7TA 2WWMD 4OFIA 4R6UA 4MAYA 1T80A 3TCXA 1HCVA 2IADA 2MPAH 3GMLB 3RPIB 4PRBB 2X89A 4XRCB 4GW1A 4Q0XL 3JWDL 4PGEB 3BUTA 3C08H 2IQ9L 4K7FA 1DN0A 4TUOA 1QBMH 3VXME 4UOW0 3FL7A 1BBJB 2VZ3A 5E8OB 2VDLL 3LPFA 3IJHB 4JFHE 5E4EC 1RHFA 3RWJB 1HCFX 4X4ME 3BWAA 1MY5A 1KELL 3L3GA 4I0PC 1ZS8A 2WQ8A 4PJ9D 2PKDA 3QNZA 4KK5C 4F9LC 5J9PB 1NLDH 3G08A 1DLFH 2RGSA 4YHZL 1FNEB 2OQJB 4PYHA 5GGQH 1KENH 5IM7A 4HCRL 2B4CH 3S96B 2H26B 2CIIB 1MHHB 4F58H 1G7MB 2HN7A 3NAAL 1Z9LA 5EN2B 1JUFA 1QHOA 1AXTL 2NY3D 4U33A 4RAUA 1CICB 1ZLWH 4C83A 2GSIA 4QY8B 3NIFF 5IVZB 2CKBB 5BV7H 5FO9A 3QIWB 2LV4A 4I3RH 3TEUA 1IBGL 5I18L 3MGTB 4BELD 1NBZB 4RNRB 2EH8H 3V7MA 2XQBL 4HKZB 3HPLA 4M6MH 2RFXB 1EEUA 2UZYB 1S5IH 3PDOB 2ICES 4DAGH 5A16A 1P4IL 2XACC 2YRLA 4Q6IB 5F9WB 5IOPB 4OLXL 2GTZA 3RVVD 4NRZA 4XC3L 4GQ9L 3KXFB 4IRSD 1UZ6F 5DJDA 3DMMA 3S4SG 4NO0D 3FFCA 3WLBA 1RD6A 4YHOL 4CW1B 3B9VA 4WO4A 5B8CA 5I1AB 4FG6C 1ACYH 4IJ3B 1HQ4A 5EC2A 2DTMH 5C07B 3PWPB 1FHGA 2W0FA 4PG2A 1EEYB 1OT2A 1YNKH 2GYSA 3L5IA 1YY8A 3U4EA 4PP2A 3GZKA 1D9KA 3VXNA 3CIQA 1F90H 2OZ4A 5I1DA 2JJVA 4R4BA 1TJGL 1HKLL 3IB4A 4ZTPL 1CICD 4M48H 4P57A 3QNYB 4GAYB 5CHNB 2C1OA 4KTEL 4KHXL 5HPMA 3S36L 4WEBH 3BN3B 4M8QA 4ZO8A 4PJXE 4YO0B 5E9DB 1S5HA 3C6LA 5EO9B 3RL1A 1YEJL 1ZA3B 2L7JA 2VUYA 4ODUB 3BD4A 3ABZA 5I1GH 4M6NH 3TESA 4Y5YB 4ZAKC 3QSKB 4XHJC 5GSVA 4GBXB 3EDJA 3MCLL 4JDTH 4XC1L 3RDTC 3TYGL 4NQTA 5C7XH 4KY1L 4IMLA 5HYSA 5MEQB 5EUKA 4LPCA 1KJ3L 3KXFD 3FRUB 1A1NB 1AQDB 3FMGL 3GSWB 2F54B 1S9YA 1FVDA 4UAOC 4EN3C 2YD1A 3O6FC 2DM3A 2VDKL 4O9HL 1AKJA 1BWWA 3LKRB 4WWID 5DMKA 3PWPD 3BPNC 5IVXA 1KBGL 2IBZX 1RSFA 4K9EL 1QKZH 3U46A 4NWTL 2BNUA 3UYRL 3TPUA 4K94H 1NJ9A 3NCJL 4V1DA 3WS3B 3MLXL 5HI5C 3S34L 4QT5A 1NANI 1RIUH 2CLRB 1T03H 1BJ8A 1ITCA 4KHTL 4J1UA 3JBG7 5FYKU 1BBDL 3OAYK 4XPBL 5FEBA 3D6GA 3UJTH 3HNTL 1K2DA 2HH0H 2FL5A 5E9DD 3AY4A 1T1ZA 3NCBB 4EXPX 5GZOC 1H8NA 3QXDB 4P3DA 1BHGA 4GBXD 4NQXB 2VXQL 4D8PB 4LP5A 4XPHH 4JLRB 4AL8L 1J9CT 4M9OA 4OZHB 1LDPH 1DBKL 2C3HA 2QADC 3VXUB 4ONFH 2GJZA 3U2SB 4M6AA 2F54D 3UTPD 2ZSWB 1KC5H 4TSAL 5GJTL 4XVSH 3RUGF 3HN3A 5FGBA 1CGSH 4PB0H 3FRPG 3QNXA 1HWGB 3CVIL 3FN0H 4LEOB 3WL9A 2AAVA 4O5LH 5EBWB 5FDWB 5DQDL 2IWGA 3O3AB 3DX7A 4PJAA 3BP4A 3DO7A 2XZZA 4MB3A 2LVCA 4WVRA 4XXCC 1OP9A 2E7LA 3MRGB 4G6AD 3U7WH 5ILTH 4TRPH 2IPTH 1AR1C 3T0XA 4LF3B 3UPAA 3GNML 1NAML 2PXYD 3IFOB 1JYXA 2R4RH 1C08B 3K4DA 1CR9H 5C0CE 1VDGA 1N64H 4N90D 4NHCL 2PO6C 1F4YH 3PG2A 4WW2A 4X5LA 2FX7H 1EHXA 1P5VA 3UO1L 3GMNA 2LE9A 43C9B 3BD5A 4DOHE 3VXUD 1LWRA 1FAKT 4R97C 4JVWA 1L6XA 2IH3A 2J88L 1MJJB 5F9JA 5JZ7C 4C56D 2R0WH 2BXZA 1MJ7H 1GGIH 4PJFE 2F5AH 5CEZH 1T20A 5FGRA 1J0JA 2NY7H 1WBYB 4XBPA 4DKEH 4WV1B 1U8KA 1JTPA 1CL7H 4RGMB 3D9AL 4IRZL 5FK9B 4MJ2A 3S98A 5DUMH 1S78C 3RRQA 1MAKA 4R9HA 3V0VB 5HHQB 1C5DB 4I3SL 3PABB 1JP5A 4MJ4A 3VXPB 1EA9C 5D7IA 2NR6C 4HFUH 2HLFC 4LQ1A 3RHWK 4H88H 5DJZA 5E8OA 5JMOC 3RWJA 5EZOH 4JO1L 3O2DA 4HLZG 1NDGB 1LGVA 4K8RD 4FFZH 3F7PC 4QTHA 1NBQA 4UQ3B 4F7PB 2ATPB 4MQ7B 2VQ1B 5IESH 2OQJA 3U36B 4JM2D 1D7FA 5D8JH 1QFOA 1FYTB 1P2CB 2ZPKL 4XB8A 3S96A 2A0LD 3SDCB 2H26A 5I1CL 5EORH 4N8CL 1U93B 2ATKA 1G7MA 3LB6C 1EJOH 2BSTA 3G5YB 3WIFB 1JGUH 2FB4H 5FV2A 1PZUB 1YY9C 1H5BC 2Q8AL 4QY8A 1T83C 1FSKB 1NGPL 1IM3B 5IVZA 2CKBA 1Q9LA 3PJSB 3QIWA 5J3HD 1HYRC 1JGVL 4AEIH 1MAMH 3QULB 3MGTA 1U6AL 4M62H 4EI5A 2E7MA 4HX1B 3U48A 5D1XD 1CLCA 1R3JB 2BY2A 4HKZA 1HDMB 4HWEH 3WFBH 4AM0B 3D18B 2UWEF 4LHJB 3BT2H 3MLTA 3GM0A 4HF5H 3CFEB 1NEZG 4C59B 5IOPA 5KJRL 4LSTL 4RMQA 3UYPA 3MREB 5DF0A 3ZTNL 4Z6AT 3S8WA 4JN2A 4I9WD 4WIQA 4IDJL 1U8OB 2WZPD 4AG4H 2FEEL 3U79A 4CW1A 4NQDB 4ENEC 5I1AA 3TZVA 1WUNT 4PRPE 6FABL 5J0BA 5C07A 4J23A 2ZKHL 2AK1H 3SQBA 1U92B 5K9JL 1NCNA 3B9KB 1J1PL 1AD0A 4OD1L 5DEGB 4ETQB 4QGYA 2F53A 1P53A 3EAKA 3FO0L 4PBXA 3ARBA 1FYTD 1U8QB 3SDCD 5L2KE 2IBZY 1E4XL 1UZ8A 4MB4A 5CD5D 5ALBH 1A5FL 4QCIB 4QO1A 1KG0A 5DLML 3RIAK 3GMMB 4GAYA 1OP5K 1TITA 5E2TL 4U0QB 1FGVH 1FGNL 2C3XA 1EO5A 3R1GH 1X5XA 4R4FH 2Z93B 3BHBB 5IMKA 1PY4A 5KVGH 4Y88A 2VDRH 3L1OL 4FFWC 2ED7A 2ESVB 4X4YB 4G5ZL 3TJHC 3OKKA 5A3IC 2ILLA 4GAJH 4QHUA 5KTEH 1L9NA 4KJYB 2DQEH 2I60L 4JPKH 5DUBB 2OR8A 4H1LB 4IIQA 2VDOL 4XGZB 4PV8B 1Y6NR 2ITDB 2OS7A 3MLVL 5FDYA 3FRUA 1A1NA 4L4JA 3G5VB 4UMGA 3SKUD 1HQRB 4L4TA 4AEHH 3GSWA 4Z9KB 4ODHL 5HGDB 1T2QL 3JV6A 5ITFA 2ZWLT 2FDBP 5ECJE 2XKSA 3LKRA 4CL7A 4WI2A 3B9KD 1X44A 4KV5E 1OAZH 1G6RB 1A6TB 3IFNH 1TDQA 4WTWA 3FB6B 1BIIB 1F4XH 3KS0H 2VXUL 4MJIE 1ZLUK 3BQUB 4FNLH 1AO7E 4KRMB 4R7NA 4LCCB 3QEHB 3V8OA 1U3YA 2A6JB 2HTLC 4PJEF 4DKFL 4UOJA 2Z31B 5IB4B 2HT3D 2JK5A 2Z91A 1SYSB 5C0AB 1KPRA 1YN6B 3CZFA 1G9NC 1UENA 1XT5A 2EIZB 1LK2A 3FONA 4YNYA 4LRIC 3QDAA 1BAFL 1J1OL 4FQLL 4TNWK 3BKYL 1AR2A 1HI6B 2AJSL 2ESVD 4Z8FH 3DYMA 1L0YA 5TDOA 4G6JH 4JLRA 1EERB 5TE6L 3Q1SL 4OZHA 2AXHA 2YR3A 4JG0H 5CD3B 1CGYA 3U2SA 4F3FA 4ALAL 5ANMB 4WU7B 2A6KA 5IMLA 2EXYC 5F89B 2CUMA 3NPSB 4YXLH 5JUEH 1F13A 1W2KT 3QUML 1T22A 5EBWA 5FO8B 1BZ7B 3O3AA 4N0CD 3G04B 3GI9H 3NZ8B 3MRGA 4K71C 1MJ8H 3AS1A 4M93B 3Q48A 3GI8H 3BQUD 5I15L 3BH9B 1SJVA 3FO1B 2EE9A 4KRPB 3RGHA 1RZFH 2BVPA 2ZCKL 1X4XA 1IAOB 1KJ2A 5C0AD 1ZGLM 1C08A 3WJJC 4YBQD 3SGKC 2NY5H 4JFQB 2V2WB 4ONOA 1UB6B 1EDQA 4G3YH 4G8FB 2HT4D 2Q7YB 4D9RE 5E08H 2XXMB 5JR1L 1GAFH 3IF1A 5C0IB 4PUBL 4YDLC 2ZG1A 3LZFH 3CVHH 4P46C 3RI5K 4WEMB 2G75B 4HS3B 3LMJL 5GIRA 4E5XB 3FOMA 1E27B 3V9FA 2X1WL 1J05B 4FQ2H 2AV1B 2R56H 3NTCH 3IFLL 1KN2H 3MBEB 3SO3C 1V7NH 2NMSA 4YR6A 1WBYA 4DUVA 4LSQL 4X8XA 5D7JC 5FK9A 3TF7C 3F7RA 1ODAA 2FBOJ 1JF1B 1C5DA 2R23A 5EU4A 3T3ME 3RGVD 3I02A 3VXPA 4P2RD 5CLTA 2BNQD 3QUXB 4XP4L 4QNPF 1M05A 2AJUH 3PV6B 3HC4H 3SCMC 1OAUL 1HK6A 2ZUQC 4K7PX 1I1AC 1FN4B 3O2DL 4U1IB 1SY6H 1BVKB 4W6WB 3BIBX 3MJ8B 3UEZA 4MYWB 4UQ3A 5ESQB 4F7PA 2L7UA 1OT1A 4NUGL 4P3CH 1ZT4A 2ATPA 2VQ1A 1OSPH 4G8GB 5AAMA 1DEEA 5I19L 1Q0XH 1HSBB 1NL0L 4P4RB 2HJLA 1U93A 1S7VB 4OD3H 1LEGB 4E41D 4Z7OE 1KCUH 2FWOB 1OD7A 2HA1A 3RTQB 3ARGC 3MRFA 5EH1A 3G5YA 3WIFA 1YMHB 1S7WB 1BD2E 3MXWH 5HYEA 1G7IA 3V4VH 1IM3A 2VLRE 2F5BH 2CKBL 4YHYC 2ZUWA 5EPMA 2Z8SA 3L3DB 4Z77B 3MROB 4ZTOH 3QULA 3V4UH 1PAMA 2DKUA 5C0GA 3MJGX 1J11A 4HX1A 1RUMH 5FUZL 1UGNA 1YMME 1HDMA 3VFRB 4HFWB 4C54A 3HE7B 4R90H 1LEIA 4JE4B 1UADC 3QDJA 4UDUA 5TE4H 3WJLA 3VH8G 1A7QL 4LQFH 4CJ0A 4WNQB 3QUXD 3RHWF 3SE8H 3MREA 5JNYB 3IDGA 1NBVL 3GO1L 1PLGH 1FC1A 4GKZA 3OKNB 4NQDA 1ZHKB 3C6SA 4N0FA 5EG6C 4DZBB 4WI3A 2DS4A 2DM7A 3BEVB 3ZDZE 1A3RH 4OV6F 1U92A 4IM8A 3QDGB 2EIBA 4Z7WB 1RI8A 3EJYC 2MSPA 4OCRH 4ETQA 1DBJH 4G8GD 1LE5A 3QJHB 1U8QA 3AS3A 4FQIL 1QA9A 5GGTA 1MRCH 3U7YH 3L9RB 1IGML 5HHXL 2HRPL 4APQB 4QCIA 5JOPE 3SJVB 3I50H 2SEBB 3GMMA 5IW1B 5DJ0A 3G6JE 1JF5A 5KOVC 3ZKSD 5L88H 5JHLL 2BNRE 1UQSA 4JPVL 3DHJA 1F6AB 4R4ND 4ISVB 4FFYH 1FCCA 4Y89A 5KSAD 2W59A 3GMRB 3V5HB 4F15C 3GRWH 4W68A 2O93L 4LARH 2E7BA 4PD4J 5TDNA 1A3LL 4KJYA 1FO0B 4M5YL 3ILPA 1QSFA 1P6AB 4H1LA 5EULV 4NKOA 4I48B 3L7EB 4PV8A 2ITDA 3FT3B 2DN7A 3G5VA 4Y4KA 3OAUL 1WLHA 1YEGH 4YFLF 3M07A 3BW9A 1AI1L 5HGDA 4G42B 5A40E 3OJ2C 2FATH 1KPVA 1UWGH 4QGTA 3TFKD 1KJVB 1FCGA 4NKDA 2YN5A 2GSGB 3DRQB 3QDGD 4D0BB 3QQ3A 5IHZA 2CK2A 3BN9C 2BC4A 4MWFB 5EBMA 2BJMH 1DSFH 3UTQB 3D85A 4MA1C 2DMBA 3THMH 5T3ZH 4LSVH 1NPUA 3RIAF 3QEHA 4U1SB 5HDBF 3DIFB 3BSZL 2Z31A 4YHPB 3SJVD 2E27H 2E8ZA 1OF2B 1WITA 2WBJA 2Y25A 4PJCE 4OJFL 2NY0C 4XBEH 2Q7NA 2A6IB 2KQMA 4I1NB 2EIZA 2OTUB 3TV3H 1P4BL 3GB7A 1RZKC 4H5SA 3VXMD 4BKLB 1HI6A 3TO2B 3JWOL 4KROC 1IKNC 5IQ9A 2BK8A 4UILL 3MCKB 5J8OA 2DD8L 4L3EE 4LDOB 3LIZL 1BMGA 4ODXB 2CDEB 1NCBH 4UIMB 3MXVL 1FVCA 1UVQB 4PJDB 5J7CC 3IFPA 1LO0L 2KPNA 2EDXA 2R4SH 2H3NB 3F6IA 3SGDH 2KUTA 1CLYH 4LLAA 5B39A 3LDBB 1I3GL 1X6LA 2V2TA 1UFUA 1N5YL 4QRRB 2JB5L 4GRLC 3VRJA 3QUKB 5JPNA 5FKPB 4EXKA 5F44A 4ELKA 4NQCE 3GM8A 3TVMC 2YUXA 3HE6B 1BFVL 1LQSR 5F7KC 1RIHL 1HXYB 2RJMA 1KYOK 4RFEB 1MCOH 4X4ZA 2G2RB 4R2GD 4WHYG 1FAIH 2J4WL 1IAOA 3X13A 4PLJD 1TZHA 1OPGL 4K8RL 4X6DE 3TA3C 4JFQA 4M7JL 5GGRB 1UB6A 2YPLE 4QXGH 5FGSA 5JW3H 3MV8B 1JGEA 5C2UB 2IPUK 4D9LL 2YXMA 4YGVB 3RX7A 4OLYH 4OM1H 4KI5F 3VE0B 1HH9A 4X6CF 5JXAH 1JZ3A 5T3XH 3FHAA 2G75A 1YPZF 1FZJA 5C0EB 4E5XA 3ARXA 1CD1B 2UWEB 2JJTA 3QDMB 5ENWB 2I25N 4NHUB 3OGCB 3IU3A 1J5OH 2AV1A 4ZUVB 1VFBA 3QFJA 1N3NA 4U3XA 3D3VB 5IB5B 3MBEA 3QXVA 1V7MH 4QRRD 2EDEA 2I5YL 3IVKB 4PP1C 5IG7B 4NQVB 1V3KA 1JF1A 1X5YA 5E99H 4G80B 5ITBL 1D6VL 3C60A 1FV1B 3LY6A 3T65B 1HSAA 3L6FB 3Q6FB 3DVNB 2B1AL 4QF1A 3X14B 5KG9B 3VXSA 2H9GB 4UNVA 4KKCD 4PJBF 2XY1A 3KWWA 4U1IA 5GGUB 5C6PB 3P0GB 4F37K 1BVKA 4WUUE 4XVUC 5ESQA 1I7RB 3MV8D 3VMNA 3ARFB 4YC2C 1G84A 4OZ4B 1R5WB 4PLOB 3NCYS 4NZDA 4PJIF 1S7VA 4EOWL 1Z0MA 3MJ9L 4M03A 4CKVX 2FWOA 3RTQA 1JRHL 3WE6B 1S7WA 3GSNB 5CJOL 1WFTA 4UNUA 3KYNA 4OI9A 1AFVL 1FNLA 5T5FH 4M5ZL 3ZSSA 1QPXA 1CXEA 1ZGLB 3D3VD 2NW3B 4MNHB 2Y6SD 5CZXC 1J8KA 1KB5H 3GSRB 5I8KL 3S7GA 4JFFE 2DQHH 4L29A 4YDKL 2ZOKA 3ULUE 4PYGA 3HE7A 5D1QB 4M1DL 1J8HE 1MFDH 2J5LB 3PWVA 1PKQE 1FPTH 1A1MB 4ZUWA 1DJSA 5I6XC 5DJ2B 1MFAH 4NZTH 4WNQA 2WWKT 1V05A 2Y7QB 2JLLA 5JNYA 1F6LL 1UA6H 4LCWD 2ARJB 4NPYA 3IDUA 4PJGB 5HHOE 1CQYA 3OKNA 4JO4L 3W5NA 1ZHKA 4C4KO 4OM0H 2YEZA 4NM4H 1AGCB 4KKNA 4PJEB 4CRPA 1R3LB 3QI9A 3BEVA 3FO2B 4J6RL 4HT1L 4QYOB 3ARFD 4YX2H 3KNBA 3O6KL 1JV5A 3QJHA 4P59H 5KSUA 2FEDD 5FECB 3H9SB 5CSZA 3HUJB 5L9DH 3NIGF 2OLDA 1B2WL 5FAAA 5GGTL 3L9RA 4APQA 4Z0BH 1VEMA 3QWOA 4YQXL 3U83A 4FXKA 2AXJA 3ZE1E 4GRWE 1FFQA 4NJ9L 3NFSH 3MGOA 1VPOL 2VR4A 2NZ9D 3SDYH 1IAIH 4V2CB 4HG4K 4HLJA 5EWIL 4EDWH 3AU1B 3WIHH 5D1QD 1WZKA 3T0EB 3RUGA 4HGKC 3O9WC 4YHIB 3JVGC 5GS0D 1L0QA 1FO0A 1PG7X 3QEQB 1I3VA 1YEFH 1KNOA 2GHWB 1I3UA 4O58L 1AC6A 3FT3A 5F6HJ 5C0CD 4ZXBA 1RUPL 2X5PA 2DQGL 5I1IH 4RIRB 5IROC 3U0PB 1OTSC 2YA0A 2D4DA 4YXKH 3BUYA 1R6VA 2N7BA 4G42A 1KEGH 1I9RL 4JCMA 3LHPH 1KJVA 1OGAE 3SOBH 4HBCH 5GRVK 3VXRE 3ULVE 5J56B 1LNUB 2GSGA 3DRQA 1AGDA 1LO3L 3SDAA 4RQQB 1QLEL 4BSVA 3PXHA 3ARED 1LP9A 1PEZA 5TQ2L 3H9SD 5GS1C 3UTQA 5GGSY 2CJUL 4DFHA 1WK0A 3DIFA 4R8WL 4YHPA 5B22A 1OF2A 4DEPC 1JVKA 2IEPA 2Z4QB 1NAKL 1Q9WB 4R7DA 3PQYB 1BM3H 5C0BA 1MCSA 1JZ8A 3TO2A 4HEME 5HY9A 4XAKE 5EIIB 2GK2A 3FQUB 3RVTC 1WICA 4EBQH 1JWSB 2CDEA 3CFDB 4ODBD 1UVQA 4ODVH 5E7BA 5JORB 4LU5L 1MCHA 1T7WA 2E6JA 5F88B 3ZT5A 4UQ2B 5ACZB 1ONQB 3DYOA 2H3NA 4MA3B 4BQBA 4KDTC 5MEOB 4I77L 1CT8B 2BVOB 5C0DB 4UNTA 2I07B 3LN4A 5B38G 1A4KB 2MPAL 3GIVB 3ARTA 3QUKA 3DGCR 5TF0A 4MDIB 5B4MC 4P2CG 2IAMB 3GMQB 4WHTB 5J13B 4JQXA 3NFNB 4PJHE 4ELME 2UYLB 3HE6A 1DVFB 3IAQA 4U1JB 3VGFA 2HAZA 1KUMA 1F3DH 1HHGB 4TSCL 2DBJA 5C6TH 4ETYA 1MY7A 2B4CL 4NM8L 5LBSH 3GHBL 3TIDA 3SHSA 4Y4FC 2HJFB 1G0DA 1OL0A 3UX9B 3VE0A 3VG9B 3GSUB 3T3PF 4CVUA 3ARRA 4HIXH 2DKMA 5C0EA 2UWEA 3QDMA 4NHUA 3Q3GB 4JR9L 3U0TB 1T2JA 4ZUVA 3AROA 4JFDB 3E8UL 5F7EL 4NIKB 1U3JA 2P5WB 2P5EE 1XGTA 4HPYH 4M6ML 3V5DB 3VGBA 5HHNA 5I1EH 5MENB 1G9NH 3BRGC 1FZOB 3IVKA 4DAGL 2WP3T 5MI0C 1AY1H 4NQVA 3OR7B 4OF7A 3HZMB 4AYFA 3MYZA 4HJJL 1IMHC 1FV1A 4JFPB 1DVFD 2R1WB 2O61A 3RWIA 2WSKA 2QSCH 3T65A 2VMFA 3VD9A 1G7QB 1ACYL 1IARB 2DTML 1HZHH 2YOCA 3BXNA 3ZDXE 2VUOA 1RVFL 4HH8A 4S1RL 4Y19B 4AH2A 1I7RA 5IP4A 3W9DB 4DCQB 1F90L 1CFNB 5EA0L 1UCBH 4Z76B 4PRIB 3VI4E 3ZHKA 2GJ6B 4O51B 3BIKB 3WE6A 1TLKA 2R69H 4JRWA 5E4EB 1IGYB 4OQTH 4WEBL 3HAEB 5EU6D 1P1ZB 2DICA 4JFDD 5IMMB 2P5WD 5IW3A 2CLVB 3BYYA 4M6NL 4XP5L 1C12B 5MEND 3GSRA 4WFHE 5D7SL 1QO3A 4YAQA 3VGGA 2MCG1 1QSEA 3LEYH 5GSRA 4IHOB 3LSOA 5DS8B 4ZS7L 2OXHA 1WCBB 3REVA 3GJFH 1HH6B 5ADOH 5DJAA 1ZWIB 4X8JA 5DJ2A 3W0WE 5FA4B 4OCLC 2X4UA 4N0UE 4UTAL 4LDEB 2YA1A 1OQOA 2FEEI 3CSGA 2ARJA 4BK4A 4PR5B 4GS7B 5AWNH 1RJZA 1IEBB 4OD2B 1MWAH 3VWKA 3L95A 1IL1A 1AGCA 4PJEA 3GGWB 1NSNL 1RJYA 1R3LA 4M6OL 3M45A 1IT9H 4Y19D 3FO2A 5JHDB 3EOTL 5GS2D 4GMTH 4K94L 2Y23A 4KU1A 4GMSH 4ZUSB 4ZOBA 3GSVB 1RIUL 2XQYK 4AENA 5FECA 2EDKA 1T03L 4UT7L 2X4OA 3RP1A 4MA8L 4YBLB 3MA7B 3O2VH 2XZCH 2GJ6D 3KPLA 4YHMH 2F19L 3UJTL 1AGFA 3VFPB 3KPNA 1MAJA 5BVJB 3CXDL 2BSED 5F7MC 1QVOA 4MMZC 5IQ7L 4I2XA 4F80A 2X9YA 4W4NA 4XPHL 5ACMA 2DAVA 3T0EA 2X41A 1EUUA 4RA3A 4LHQB 1R24B 2CIKB 4YHIA 1LDPL 2B20A 2WM0A 1FIGH 3KPTA 1FO0L 4DGIH 3QEQA 1J7VR 4ONFL 4HV8B 4BA8A 2E9JA 2VZVA 4DQOL 1WGOA 2XTJE 4M7KL 1EAPA 1VEPA 1TJHH 3KPOA 2FHBA 4XVSL 3U0PA 4ESKA 3OPZL 1JZ7A 1XF4B 4CVZB 4F57H 1RIVH 1ZHLA 2YPVH 4O5LL 3OX8B 4BZ2L 4NZRH 4QOKE 4RQQA 3QUYA 3HZYB 4Z7NF 2HLAA 3BZ4A 4KVNH 4MD4B 3OB0H 4LHUB 4YDJB 3TN0A 2DQIL 2YUZA 2R4RL 4GAGH 4X6CB 4EN3B 2YD3A 1R5IA 3CLFH 4NQUA 1YPZB 5ISZA 5CGYD 1MFCH 1CR9L 3B2VL 3BPNB 1QHPA 4X9IA 1F4YL 1EGJA 1MUJB 1QRNB 4QRUA 3PQYA 1DL7H 2WIIB 2AJVL 3CVHA 4LP4A 3ARSA 4HGMA 1NFDF 5EIIA 5DJCB 4BH8B 5IT2H 3VXTB 3VFGL 4XVTL 5DRWA 2QHRL 1JWSA 5JORA 3B2UC 5F88A 4NKIL 2AXFA 3ZYZA 4D3CH 2R0WL 1ONQA 5K33A 5JIPA 2AEWA 3T2QA 5MEOA 3C8KB 4LVNC 4JJHA 5C0DA 1WBXB 4EKXA 3SDXA 2I07A 1CL7L 4DVBB 4V2BA 3UZVB 4YFDB 5DUML 1TVBB 3RIFK 4OZFB 4OCXL 4PJBB 4OCYH 1T66D 1KTRL 2IAMA 1RJLB 3GMQA 2CH8A 3QZWG 4NJAH 4HJGA 4X6EB 4B0MM 3QCTH 1MCQA 4NUJA 4HFUL 1KTDB 5DSCB 4H88L 3ZE0F 4CDHA 5KVEH 4Z18A 4KI5D 3ZHLA 4HBQA 4M1CC 4XZUA 2O5ZH 3SDDC 1BREA 2JB6B 3QPQC 4ORZC 2VLKB 3KYOB 1QFWI 1U2CA 4L8SA 4POYA 2YXFA 1N26A 4LK4A 1U41A 2CK0L 4DFIA 3VFNB 4PJ5E 4U2ZA 4LLDB 5EORL 5E4IA 2VLLB 4MNQD 2HJFA 3MJ7B 4PJXF 2CPCA 5DD6B 5ESVB 2FB4L 3BH8A 4UTBH 2G9HB 2HVKA 3GSUA 4ZSOB 1XIWB 1IKFH 1GH7A 2IBGA 5F96L 4ODSH 4AK1A 4P2YA 5HYJE 3QISA 2RR3A 5JOEA 4U1HB 1GOGA 2AS5M 3EOAA 3LCYA 5F70A 2A77H 3MRQB 4R26L 1RFDH 3TO4C 1INQB 3VWJC 1X5LA 5IB1A 1YNLL 5KANI 2ARJQ 5C0NC 1FZOA 1VADB 2PO6B 4Z7UE 4HPOH 4I5BB 1MHEB 3TT3L 2YBRA 1JPST 1K5NB 4HF5L 5DGQA 1RZKH 3SE3C 2DRUA 2VLJA 4OFYD 4H26B 3HZMA 3GKWL 2ADGA 1D5BB 3OAZH 4HZAA 5I8OH 4WY7H 2XQYG 4JFPA 4L8BB 2JTDA 3BPLB 7CGTA 3RY6C 3GBLA 3WKMH 3MBXL 2NX5A 2ZZUT 3MRCB 4MMXC 3KPPA 1ED3B 1J10A 2VLKD 2UY7A 5DK0B 2D4FA 2AJXL 4GW4B 5JMRA 4P4KC 3L5JA 4P2OD 4KUCD 3I6KB 1IEAB 3W9DA 2X2YA 1QR1B 3RWCB 4DCQA 5BRZD 5ICXB 1CFNA 5IBLC 3M8OL 4Z76A 4U6YB 4PRIA 5ALBL 2ADFH 4WTZG 1XIWD 2X4NB 3N1PC 4O51A 3V4PH 3BIKA 4IRJD 2VITB 3LRHA 3K74B 1IGYA 5LQBH 3HAEA 4UB0H 3EYSH 1IQWH 2OCFD 1P1ZA 2BVEA 1EHLH 4JM4L 1OHQA 1NCCH 4I0PA 4N1HB 1MVUA 5KVGL 5JXEC 1EVTC 2VDRL 4F9LA 3KLHD 3GRWA 4FQXC 3WV0A 1MHCB 2APBA 4XMLL 5H35A 2B1HH 5KTEL 1TFHA 2WNGA 3QUZD 4N5ED 5HYQB 5IBUB 5HDLA 3EHBC 1CS6A 4LVHC 3BKCH 1ZWIA 2X42A 3HHRB 3DXAE 3KLSA 4E42A 1I4FA 2FH8A 1H5BB 3E6FB 4IOIA 4S0SD 3ZTJG 3NGBB 5GS0H 1M6OB 3KR3H 2H41A 1XGRB 1OP3K 5CJXC 4PGBB 1IEBA 3EFFA 4NKQB 3ULUC 2JJWA 3GGWA 4RA0C 3T1WA 3WFDH 5FXCH 1T0MB 4HLZH 5JHDA 3IFNL 2LTQC 1QYGL 1N8ZB 1WTGT 1A7PL 4KJPC 1QOKA 4ZUSA 3GSVA 3CK0L 4B41A 4FNLL 1T4KB 3A6OA 3HZVA 2LQRA 3MA7A 5HVGB 2D7MA 4PRDB 1WWAX 2XN9B 3QPQD 3ALPA 4HZLA 4H0HB 2EC9U 3IDXH 4L5FL 4NO2A 3MNZA 1A7RL 3MV7B 5BVJA 1NGYB 5EUOF 4I8DA 4NQCD 2YUWA 1AGEB 1B0WA 4N0YL 5E6ZA 2AABL 1VHPA 2EC8A 4G6JL 4PJFF 3VFSB 1AHWC 4J3UA 4K3EH 1KOAA 2CIKA 1IVLA 1JNJA 3N0PB 4QHMB 1U95B 3EJZD 4HV8A 4JKLA 2B8OT 3WDIA 3HKFA 4Y8DC 4GUPB 4MD5A 1B90A 2E9WA 3DX8A 4OFVA 4H25B 3MUJA 3HRZB 2CLZA 4CVZA 2YK1H 3AS2A 3KYKL 4ZAKA 2JELH 3LKQA 2XOTA 1CIUA 3HZYA 3RDTA 1MJ8L 2B7DT 3EDKA 3PGDB 2NYYD 4HS8H 4BSWB 1GGYA 1PKOA 4MD4A 3E2HB 4XCYA 4LHUA 3FQXB 4RAVB 4YHLH 3ETBF 4HXAL 1FRGH 1W0YT 4X6CA 4EN3A 3O6FA 4X7EC 3L5WB 3ULVC 1YPZA 4CADA 1KSRA 4JY4B 3IJSA 3MV7D 3HFML 5E08L 3SE4C 1EGJL 1QRNA 1T21A 3LZFL 4KPHH 3PP4L 5D7KD 5DRNB 1J87A 5MERA 2V7HB 1CZ8H 2APTA 3MRJB 3PNWB 5KN5B 4XVJL 3X11B 4U6VH 4U05A 3HI6H 2ICWA 1FZKA 43CAA 2R56L 3OF6D 3BEWA 4K55A 1CD0A 4UDTA 1JF6A 1YNTB 4L4VE 4Z78A 1M71B 1WBXA 2XA8L 4YPJA 3BO8B 2L0DA 4OZGA 4MJ5A 1TVBA 3E0GA 4OZFA 5KS9E 5BS0B 2OI9B 3WHE1 4PJBA 3F5WB 2RQ8A 1IGTA 1U8HB 4MNGB 4YUEL 1DUYA 4MDJB 4P2QA 5LXGL 3RJQB 4X6EA 1T04B 4EUPG 5DFTA 4HC1L 4LSRH 2AJUL 3MRKB 3HC4L 4MZ3A 1KTDA 4NO5B 2FZ3B 4JREB 4ZYKB 1NMAH 2EZ0D 1IM9D 2W07A 3DECA 2R2EA 4JFFD 4NYLA 4PJIA 5D2LE 2W1NA 5GHWH 2FRGP 2IANE 2JB6A 1J8HD 2C4XA 1FH5L 5D1ZB 3GKZA 4F2MB 5JO5B 1YEIH 1OTTC 4P3CL 3FKUS 4DGYL 5D2NB 2JE8A 1MHPH 4G7YH 1IGIL 3PDDA 3MACH 5IFJA 3TPKA 1K4CB 2BXYA 4LLDA 5IFAL 1IC4L 2VLLA 2W60A 1UM5L 1KCUL 4EZMA 3MJ7A 3IDJB 2ZG2A 4KRLB 4XXCA 5DD6A 4Z5RA 2A74B 3MXWL 1YQVH 2G9HA 4ZSOA 2HFFB 5AYUH 5ID1B 3VU2A 1I9JH 4KGLA 3INUL 3VFOA 4PRHD 4Y4HC 1XZ0B 1KCSH 3PUCA 4NN6B 3ZMRA 4BZYA 5HGAA 4O2EB 1KB5A 1DBMH 4PG9B 2DQCH 4JFXA 4ZQKB 3OJDA 1I3RB 3O2WL 4FTVD 1VADA 2PO6A 3IS1X 2YD5A 1A64A 4I5BA 5TE4L 3LS5L 2DLIA 4YDLB 4NC1E 4HUNB 4UU9B 4LQFL 3LOWA 4LPWA 1HYSC 1SEBB 1KJMB 2D7TL 2UUDH 4J4PC 1D5BA 1PLGL 5E2WH 5FHBH 4P5MA 4WGWB 4KV5F 1NQBA 5D7LE 1H3XA 4L8BA 3I2CH 4U1KB 5C08B 3I3BA 3I84A 2FD6L 1H8OA 2HTKC 3LEXB 4CU8A 3D87B 3G6AA 3L3KB 4OF6A 3MRCA 3RX5A 3SO3B 3MLSL 3IGAB 1ED3A 5D1ZD 2H32H 1ZT7A 5DK0A 1Q1JH 5CWSA 5D7JB 3GBNH 2A2QT 2X70A 1IEAA 3CFKA 2EXWC 4PV9A 1OARH 5IB2A 1JRHI 4FQCL 1JGLH 1ERNA 2QBWA 2HKHH 1YYLL 3ARVA 2VC2L 2HFGH 3BDYL 3NCYP 3RNQB 1TQCC 5EZJB 3ULVD 1I1AB 5F7NC 2FECL 2X4SB 4NWUL 1WAAE 5L88L 1GGCL 3S5LG 3S35X 4PBVC 5I74C 1BFOB 3HR5A 4KH2A 1FFNB 2PR4H 3FZUC 1MJUL 2C3GA 4UV7L 3GRWL 3WIHA 1GPOH 1MHCA 3QIUC 1J0YA 2XZAH 3MRLA 4D9QE 5CFHA 1B88A 4NZJA 4QLRA 5EOCH 3C2AL 3RWFA 1LO2H 5KSBE 4RWHA 3N50A 4LDLB 4WDIB 4DN3H 1NKRA 5GGSA 3RVUD 2Z8VC 2YD6A 5LJYH 1H5BA 3E6FA 1T83A 4OFPA 5H2BA 2X7LB 3ESVF 5C08D 1XGRA 5F3BB 5C9JB 1SJHA 3WCYA 4OQ1A 2CMRL 2ERJC 1U3HC 3W39B 1ORQA 4JPIA 2JCCA 2BJML 3W11D 4J12A 3U9UA 3RWGA 1K8IA 1ZT1A 3HI1B 1KLGB 5I1HH 1CU4H 5E2UH 4NN5C 2E27L 3W5MA 1NFDB 1SJEB 4PRDA 1TIUA 2XN9A 1A6WH 1B0RB 3CMGA 3L3OB 4J2XA 3O4LA 1XGUA 3TV3L 4NC0B 5GISH 4RMVA 1F2QA 1YEEH 5HI4D 1G7HB 2AJ3A 2EKSA 5EOTA 2ZUUA 1OP3H 1OSZB 5D6DC 1H15B 4N1EA 5I1JH 1NCBL 1IAKB 2XG5A 2DI9A 2G5RA 3MOAL 4JZJB 1KFAL 4S1SH 4QHMA 2DDQH 2DMKA 1U95A 2CR6A 4L8DA 1TETH 5FYJE 1CCZA 4YXHH 1CLYL 2Q8BL 5FYLD 3T3MF 3ILQC 2HFEA 3LD8C 4OGYL 35C8L 2BOCB 1N6QH 5D5MF 3BGAA 1H3VA 2OP4L 1RZ8B 3BKJL 3HRZA 4K7PL 1T0PB 5FGCB 1MI5A 5BOZG 1KYOJ 1XGPA 4HMCA 4J4PD 4PJ8B 2VH5L 2XTJC 2W0PA 3PGDA 5LAXA 3BDXA 4BSWA 3BKML 2AI0L 1ORSA 4R0LC 4YHNB 1CG9B 3FQXA 4LCYB 4RAVA 2QHLA 1C5BL 1FE8H 4F8QA 2F8VA 3L5WA 5DRZB 2P49B 4PGCB 4MX7B 4KK8C 3RNKA 2VSCA 4ONGL 3EDEA 2FX8H 2GQHA 4PY7B 2A73B 2R2HB 5EFIB 4K3GA 1L4IA 3MV9E 2V7HA 5JXAL 3MRDA 1OGTB 5K9KA 3UTTD 3V52H 3K2UH 3MRJA 4YE4L 3WNMA 3PNWA 5C86A 3BGFC 5T1MA 1J5OL 1Q9OA 1RMFH 3KPSB 1VSCA 2VTFA 1HIMH 3LQAL 5MP6H 1M71A 5DJYA 3PHQB 3ES6A 3WUWB 1MQKL 2FIKB 3FO9B 1IFHL 4LRIA 3G5ZA 3PP3H 4TNVK 5BS0A 3UROR 5IVXE 2EDJA 4PJ8D 4MDJA 1YDPB 1T04A 3ZDZF 3MRKA 4NO5A 5JW4Q 1Q72H 2FZ3A 4ZYKA 1FNGB 1BQLL 3EYVA 5BJTA 5MHSE 2PTVA 4OZIF 1FLRL 3O45B 1A6AB 4KKAD 5I75B 5HXMA 1JHKL 3H7LA 1KXQE 3QIBD 1NC2B 3O41A 3UTSB 4Y2DC 4F2MA 5JO5A 2R9HD 4GJTB 4GRLB 3GUTB 2CRMA 1BQHG 4ZD3H 3OGOE 1ZLSL 4GW5A 4XTRC 3G6JF 5HYSG 2DJ4A 4OB5H 1P7QD 4EDXB 5F7UA 3NABH 5E1HB 2HFFA 3DV4A 5ID1A 5TF1L 1LE9B 4ZFZB 3T08A 5GJSL 2OL3B 3BOVA 1HILA 4FP8L 1EMTH 3KPSD 4N8VG 1A7OH 4O2EA 3QQNA 4JY6A 3TA3B 4WHDA 3SGKA 3WJJA 1W0WA 4ZQKA 1I3RA 3A67L 3IXAB 1R0AH 3CFCH 4NNPL 3TT1H 5TFSH 1FPTL 5IMOA 1FQ9C 4HIHA 4HIIB 2AQ3A 1QNZL 4UU9A 1F4WL 3D0LB 1HXMA 4WU5B 4P46A 2DF3A 3U6RA 3MRBA 3T0BA 1MF2H 4CUCA 1A21A 3ILQD 4K3DL 1PJ9A 1R5VB 2KZ1B 4U1KA 4JKWA 3TH4T 3L3KA 5DI8B 5HHVH 3VJ6B 5I1KH 3IGAA 1II4E 3D25B 4WHYH 3WUZA 1U8NB 5D7JA 1MCWW 3VA2C 1ZHNB 1WJ3A 4G9FD 4KK6C 3DRTB 3N1FC 5LGHH 1MFEH 3GDBA 5EUOB 5GZND 3HZKB 2CKNA 4UBDD 2BSSB 5HD8D 2HMIC 1KCLA 5CIPB 3SCMA 2OR9L 5I8CB 4HG4J 1OB1B 1NCUA 25C8H 1PW3A 5EZJA 4NQEB 2BVQA 1I1AA 4QOKD 1UB5B 3SDYL 1IAIL 3ZT6A 1EEZB 4LLMB 3X17A 5TJWK 1N2RB 1KPUA 3W81A 1GXEA 4YC2B 1GIGL 1KACB 3VG0H 4JEGB 1SBSH 4CMHC 4ZFFB 3BPOC 1BGXH 1YEFL 4N68A 4WDIA 5EO1A 3ARGA 4X4MA 3IYLW 1A6UL 4JFEB 3WO4B 1BX2B 2VISA 5J12C 2Z92A 1HHIA 3L7FA 3NACL 1A1OB 3S4SA 4XP9L 1VGKB 5FYKD 3HNVL 1KLFA 4XP6H 3OKMB 1ES0B 3W39A 4JHBA 1PQZB 5FM8A 3O6LL 4X5WB 5DDHB 5EOQL 3WSQH 1BOGB 4QRPB 1CE1L 4X6BA 4KMTH 3JWDC 1AJ7H 5DJ8B 4O02H 3FB5B 2P42B 5I66B 2PW1B 5I6XB 4CVWA 1MRFH 4JFOA 1BJ1J 1IC5L 1MLBA 3IJYA 5DT1H 1X6NA 3FQRA 1KLGA 5L7XH 1BLNB 2R29L 2C3VB 4HS6B 3CDCA 4P23B 4YDIL 3RQ3A 1FVEA 2V6HA 3QHFL 4NQED 3T2PA 1P9MC 1HHJB 3D48R 4TPRH 5KANG 3CFJB 1BM3L 4XTRD 5DMJB 1J88A 1NCAL 1G7HA 3IXTB 1N0XL 1WC7B 3O8XC 4X99B 2ZOLA 2J12B 1IAKA 2HVJB 5DMGC 1BJMA 2R2BB 1IE5A 1JFQL 4CAGA 32C2A 4L9LB 4YEEA 1ITBB 3GJEB 3KXFE 4Y5XB 3WFEH 2BOCA 3U0WH 4OCNC 5BVPH 4HUWA 2LABA 3LN5B 1RU9H 5FM5M 2HWZL 2Q20A 1DBBH 3SQOH 2DBLH 5C07E 4LCUB 4CVXB 3PWPE 4QRPD 5J4MA 1P4LB 3O9WB 5HDQH 2E3VA 2PTTB 4EEEA 1S7SA 4UINL 3ARQA 1I1RA 5SWSB 1NEUA 1VFAB 3DUUA 4MA7H 1PYWB 2WWKO 4LCYA 2NY4D 5HI3D 4PJXA 4P23D 3RKDD 4MJ6B 2LAAA 5DRZA 3UTOA 4PGCA 4ZS6D 3ARDB 5F9OL 3C9NB 3BZFB 2ICEA 4PY7A 3WBDA 3ULUH 2R2HA 2RCSH 5EFIA 2G5BB 3A6BL 5E9DE 4GKOA 5F6HI 3WN5C 4LLVB 2PW2B 3MCG1 1TNMA 3DHMA 3HG1B 4KVCL 4L8CA 3N1MC 3ULUF 3ZZ1A 4KQ3L 1WFUA 3PIQB 4XI5C 1CL7I 4PJAF 5DTFB 5HVHC 3H9HB 3RZWA 3TWCL 4JHWL 4DEPB 1I8IB 1G9NL 4G8EB 3WUWA 2F54E 1PD6A 4S0TD 1AY1L 4Z7QE 4KI1A 3U9PL 3B4NA 1GZQB 1IKNA 2MCPH 5BO1H 1W0VB 2E9BA 5L0QB 5FFLA 1YDPA 4XAWH 3EDFA 5SWSD 1CD9B 3N06B 1IEHA 1FNGA 5FUOH 3F12B 3CPLB 3ROLB 2O5YH 3EO0B 4GRWH 2V7NB 2FJHB 2X44D 3MJ6A 5DFVD 1NC2A 1KLUA 1RHHB 3UTSA 4GRLA 4JN1H 3ARDD 3GUTA 3MRIA 1FLTX 4MXVE 1VFMA 4LRNH 4Y8AA 4N90E 3TNMB 4FA8A 3M1BB 4RZCA 2YS4A 3TVMA 2YZ1A 4EDXA 3CXHK 4XPFH 1GHFL 3H2WA 2R69L 4F7CA 3KG5A 4HK0A 4BQ8A 1CGVA 2OL3A 2O5XL 1PG7L 3N9GH 2AKRB 4XNYH 3VXUE 1A3QA 3TYFB 2XWJB 3MMEB 3L3HA 4Q9RH 2FJGA 3TA3A 4LFHG 3CSYA 2B2XH 3B3IB 3OBAA 4HJ0C 3VCLB 3MYJB 4C56E 3ULVH 4JRYB 3IXAA 3MTRA 3LEYL 2FBJH 4OCWH 2MJWA 2Y5TB 3FT2B 3MLWL 4FZ8H 2P45B 4K3HA 5CINH 4HIIA 1RUKH 5LWYL 4WU5A 4XPAH 4GXVL 4TQEL 4RDQF 1JGDB 3BE1L 5DD0L 1SEQH 5I8EA 2F9BT 4OT1H 1JNLL 5D96C 5IEKB 1N5AA 2QTEA 3E1F1 4NP4H 1DQDH 3QXAB 1MPAL 3UJIH 2XPGA 1F5WA 1W72B 3VJ6A 1IT9L 2LAGB 4S1QL 2NY2C 2PCPB 4NC1C 3QCUH 3I3EA 1EO8L 2HJKB 1U8NA 3G9VA 3GHEL 5DUPH 5MI0B 4OLZH 4JZOB 1UJ3C 3DRTA 1X5GA 1KT2B 3OR6B 1SM3H 5EUOA 4PB9L 2QR0A 4DK6A 3FCTA 3O2VL 5SV4A 3I6GB 3VFVA 4M43L 4YHML 1DP0A 4AY0A 3P73B 4PJFA 4A6YH 1KIQA 1NFIA 3TNNB 1TTUA 5IUSA 5DR5L 1NGWB 1QFWM 4HUXB 3FQTB 4MAUL 3C5ZB 5LKNA 1F02I 5IF0B 1EEZA 3DROB 2BOBA 5IR1A 3W2DL 5J6GA 3EO1B 5D5MB 2ZCLH 1FIGL 2H2SC 4DGIL 1DANT 4RGNC 2GK0A 2VR5A 3PWJB 5E6IB 4FQJL 4I18C 4DVRL 4P5TD 2Y07H 5CBEA 4JFEA 4OLUH 1U42A 4LLWA 4I0KA 4LPVA 5FYLL 1MCRA 2WW8A 4PJHF 4ELMF 1CDCA 3GMPB 1NCTA 1CYGA 1VGKA 1WFNA 2AK4B 4F57L 2YPVL 1FJ1B 2EDDA 1ES0A 4J3OC 5DDHA 1A7NL 1BOGA 3UDWC 3AC0A 4XPTH 1BIHA 3HMXH 3S3PA 1NMCB 5DJ8A 2WP3O 4X7CC 1HE7A 1YA5A 3AAZB 5I66A 2AP2A 2VLRB 2OTWA 4KAQH 1FYTE 3EO9L 4RX4D 4RMSA 3N85L 4U0RC 3NH7L 2OJEB 3EYFB 1MH5B 1BVLB 3VD7A 3WDHA 1NKOA 4X9FA 3C5ZD 1DL7L 3CFJA 4PGDA 4WFGE 1CFSB 2VE6B 2V5SA 3IXTA 1P5UA 4KWUA 1TZIB 1WC7A 4ZPVB 5E00B 2ZUVA 5IT2L 5GRVL 4YK4B 4KQ4L 2NY1C 3K4ZA 1HHHA 5KVDL 1NAMB 2R2BA 4QRTB 4Y1AB 4PRPA 3T2NH 3RVXC 2A6DA 3E3QE 4L9LA 5GRJH 1ZHBA 5FCUH 2C9AA 4G6KL 2AK4D 5K9OB 1PGRB 2NZIA 5K93A 3TC9A 1I8KB 3LN5A 3I3DA 5INDB 4OZIB 3D69B 4JPWL 5CUSL 4F7TB 3EIFA 4RFNC 5L2KA 5JQ6H 4LCUA 4NJAL 5EU5B 1H0DB 2YRPA 3QCTL 4HXBL 4U3HA 3ZDXF 1A02N 1MFBH 3O9WA 2IG2H 3EFDH 3JVGA 4OCMC 5K9QI 4HIEA 4HMEA 5KZCB 1MCBA 4JJ5A 3GEWB 3RWDB 1S7RB 1X5FA 2J8OA 5KVEL 4FXLA 1E4WH 2DTSA 3OHXA 1RUAH 2OBGA 3WFHA 2P7TB 3PL6D 2PYED 5CCKH 3VI4F 2JIXD 1RZIA 1F58H 4MJ6A 4MAYB 1C5CH 1FL6B 1ZLWK 1AD9B 5C0RH 3C9NA 4GSDH 4WW1A 2G5BA 5BXFB 1NUGA 2IF7A 4K7FB 3OXRB 3C5SA 4TUOB 3B5GA 4LLVA 2NXYC 5GS1A 1MOEA 3QHZH 2ESVE 4YGAB 3HG1A 1MIEL 3PHSA 1BP3B 3VI3F 3BWAB 2GEEA 4Y1AD 5T33L 3NBNA 3L3GB 2A77L 3JV4A 2R1XA 3QNZB 5IBTH 2ENSA 1I7TA 4LASH 3DV6A 1CLOL 1I8IA 1E6OH 2DQTH 1KEMH 5IM7B 4N8PA 5J6HA 5BZDA 1X9QA 5E5UB 2IQAB 1RZKL 4LAQL 4MJIA 2HN7B 1AO7A 1EXUA 1JUFB 5I8OL 2GSIB 5KZCD 5DWUH 3NIDE 3U4BH 3CPLA 4QWWD 3QO1A 4KDTA 1H3PL 4Y16C 3S37H 2ZUTA 4PIRF 4MXQC 1AQKL 4MAYD 3MRHA 1RHHA 4RWYH 1EK3A 3UAJD 2X89D 5FB8A 5AUMA 5C0AE 4PBWD 5A16B 1V5JA 1JPSH 5DO2D 1UACL 4HGWB 2GTZB 3IU4L 3MLRH 5SWZB 4IOSD 1AC0A 4H1LG 4J8RB 5DJDB 2VDMH 3SPVB 3QH3A 1CF8L 1JK8A 4JB9H 4KC3B 1MREH 3FFCB 4MQXC 3MZTA 5B8CB 4WO4B 1DUZA 4LLUA 1NMBH 5LQBL 4UB0L 2OL3L 3RZCC 5CJQH 3ZKXB 1IQWL 5KVFH 1FFOA 2AKRA 5J1TC 3B6SA 1NLBH 4XCEB 3MMEA 3C8HA 3HCVA 3B3IA 5JIKA 4JRYA 4PP2B 1D9KB 1UEMA 3VXNB 2F8OA 5ANME 5BOPA 3FT2A 4MXWH 5I1DB 2BP3A 2DIJA 4LLYA 4R4BB 3BKCL 4Y4FA 2MKLC 5DD5L 1C1EL 1MNUL 2C7UB 4LOUD 2C1OB 1JGDA 3V6ZA 3KR3L 3BMVA 4P2RE 5IEKA 4M8QB 3FAXA 1SVCP 1S5HB 3C6LB 2ADIA 4TUKL 1RURH 5FYKL 2PYFB 4ZDHA 3WFDL 1LO4H 4WWKC 4G7VL 1JL8A 3DTXB 3S6CA 2QQKH 2VAAB 3VWJB 5E94A 4UZGA 2X1QA 3V0WH 4AIXA 4WCYH 2CXKA 4NDMA 4IMLB 4JZOA 3R8BB 2EYSA 2Y9RT 1A4JA 1KGCD 3DMMD 3QRGL 2FR4A 3FFCD 1S9YB 1FVDB 1UXWA 2FECI 4WO4D 3RVWD 2NW2A 4E41E 1PDKA 3IDXL 4FFVD 1AKJB 5DHVH 5DMKB 1HEZB 5D72H 1ZANL 2P24B 1OCWL 3DX6B 4LMQE 3TNNA 3L5XL 4PJ9C 5ABDE 1JNNL 4QXUH 3U1SH 3QO0A 4YFLI 2BNUB 5IF0A 5AD0B 4RISH 4P4KB 4NBZB 1D9KD 3TPUB 3EO1A 2OK0L 4ZG1A 4RMTA 3QFDA 4K3EL 5E6YA 4QT5B 1QR4A 1XAUA 3HB3D 4J1UB 3T0DA 3PWJA 4G43A 2NY3C 5IFHL 4PLNC 3ZHDA 2YWZA 1K2DB 4WUUB 2YMXH 2FL5B 3C6LD 3GMPA 3S97C 1QD0A 3MR9A 1FJ1A 2YK1L 1ZTXL 3EYUL 2JELL 2BDNH 1QLFB 1VACA 5J1AB 3WDJA 4HS8L 1BD2A 4GG6E 3AAZA 1INDL 4G8GE 3RVVC 2VLRA 4FQ1L 4IRSC 1JHTA 3A6CL 2XV6B 4WTXA 3WFCL 1YMMA 1AP2B 3EYFA 1BVLA 2EEAA 2CDFA 3WL9B 1QFHA 4R96A 5ERWA 1MEXH 1RQ5A 1A9EB 3DX7B 4PJAB 1TZGH 3BP4B 1I9IL 3DO7B 4K3JH 1G9MH 2VE6A 4V1DD 1A22B 1F4HA 1DQJA 4POZD 1CZ8L 5E00A 5BW7C 1NGXA 1AE6L 4XNXH 3HI6L 1E6JL 1RZ7H 1G7JB 2QV2A 4Z7UF 5TE7H 4QRTA 1CICC 3MNVA 3R06B 4JG1L 4WUKL 4YWGH 4UT6L 5T5NF 4HEPG 3ZSTA 2V9TA 3T4YA 4KUZH 4NGHH 5K9OA 2AERT 3ZTJH 4FABH 2H1PH 3MUZ1 1I8KA 2V9RA 5INDA 5E56A 3ZO0A 4OZIA 5FHAH 5C0JA 2VDQH 2YHGA 3GMNB 1H0DA 4LSRL 5ICYA 1QEWA 3QDGE 4Z7WE 1WWBX 5F1NB 4Q6IC 1L7IH 1S7RA 5F9JB 3G6JA 3U82B 4F7EB 2QQNH 3C87A 5T1DL 2BNRA 3AGVA 1T20B 2R1YA 1FP5A 4X9HA 4XBPB 5CZVH 1T2XA 2P8PA 4IJ3C 3SJVE 2ZJSH 3C2SA 1FL6A 1JTTA 1AD9A 4JQIH 1YUHA 2CUIA 1JYVA 3MOBL 3EJJX 5BXFA 4N1CA 5D7IB 5CKAA 1QG3A 3OXRA 4Y5XA 2OXGA 5AYUL 3JWDH 1D5MB 2ICWI 5DJZB 2ICCA 2VZSA 3UJJH 1VGEL 4U1LB 3S88L 4PRNB 3BP6A 3P3YA 4DW2L 2R0KL 4QTHB 2VDLH 2XRAL 2DQCL 4KZDL 4P5KA 4HQQH 4M00A 1KELH 1LK3L 4NSKA 3X3FH 4Y5YC 4F8TA 2IQAA 3TBTB 2P8MA 1B4JL 2ATKB 4TUJB 4GBXC 2N4IA 2BSTB 3O0RH 4HCRH 5FHBL 5E2WL 1K6QH 2G60L 3O81A 3QWRA 3MLYL 1Q9LB 4JRXB 2VXTL 3I2CL 1K85A 4EI5B 3UYOD 3BIAX 1OAXL 2VYRE 3V95A 2P44B 4K23H 5I18H 3MLTB 5ADPH 1GGTA 2XQBH 3H3KA 4L3EA 1S8DB 4GQPH 4PTUA 5E5MA 4HGWA 1VEOA 2VLMD 5SWZA 1JGLL 2EIEA 4J8RA 2HKHL 4G6AC 3SPVA 4JN2B 3CDFA 4LSPL 4OLXH 1OM3L 3BP5A 1T7XA 4GO6B 3TZVB 2YC1B 4XC3H 4GQ9H 2PXYC 4M7LL 5AZEL 3C5JB 4HMDA 4PJDE 3SDDA 4XCEA 1AD0B 2IALA 1D6EB 2F53B 3PHOB 4HWBL 1CBVL 2XZAL 1RK0B 3ARBB 5EOCL 5C71A 4NQCA 3JWOC 4QRRE 4NCC2 3H42L 4X83A 2EC9T 1UZ8B 1VESA 2YRZA 2X1XR 3O3DB 4LNRA 2GT9B 2Q86A 4QTIL 2R2CA 1KG0B 2C7UA 2LVEA 4FOMA 5IHLB 1TJGH 3QIWD 5DJ6A 1HKLH 2QKIA 3OKOB 4EUPH 2V17L 3L3JB 2YPLA 3X12A 4EI5D 4KTEH 1OVZA 4KHXH 5IMKB 2PYFA 1XGYL 1W72L 4HUMB 3TO4A 1T1WA 4HKJA 3DTXA 3VWJA 1NBYB 2VAAA 3HPJA 4LAJH 5E95B 3OKKB 3RBSA 2EDBA 1CTOA 4QHUB 5DEZA 1NGQH 4NNXA 1B3JA 5GPRA 3SE3A 1GJIA 4IIQB 4YIQB 1VFUA 3MV8E 4LGPB 1MCJA 3BAEH 3MCLH 4XC1H 5I1HL 3TYGH 4L4TB 4RMWA 1P7HL 3M17A 4KY1H 1A6WL 5EZLA 3EZ8A 3JV6B 5ITFB 3TZVD 3RY6A 5C07D 3V6FB 1HEZA 1IAII 2P24A 3DX6A 3FMGH 5E1AA 2UWEE 4K8RC 3OG6B 5GISL 1MRDL 1U2HA 3UTPE 2F53D 4O9HH 5BCAA 5AD0A 3FQWA 3D3VE 3ARBD 4P4KA 4JM2C 1KBGH 2D9QB 4U7KA 3VFUA 5I1JL 5F7YC 2A0LC 4R7NB 4NWTH 3UYRH 2DDQL 3RA7L 3MLXH 3S34H 5JQHC 5KS9F 2JK5B 4S1DD 3DI3B 2Z91B 1KPRB 3CZFB 2H8PB 1TQCB 2VDPL 1GRWA 4KHTH 4WUUA 5J3HC 1LK2B 1S9VB 3FONB 4YNYB 4LCWE 5IB3B 1BBDH 5I74B 2NXZB 4XPBH 3VFTA 3IDYB 5EC1A 3HNTH 5JXEA 5D1XC 4WV1C 4CNIB 4RGMC 4FQXA 4M4RA 5D70L 5TDOB 1QLFA 3CH8A 1YN7B 5D2LF 5BMFH 2EDWA 2FSEB 4BH7B 4QRQB 5J1AA 4EI6A 5F1KC 2YKLL 1MLCB 4F3FB 4L4TD 4AL8H 1DBKH 2A6KB 2YZ8A 5IMLB 5I1LB 3SEPA 4JFFA 5CJXA 1AP2A 4LFHD 5DK2A 1ZV5A 2ERJB 4TSAH 5GJTH 1T22B 1FZMB 2LFGA 1A9EA 4OTXL 3CVIH 3AMLA 2R8SL 12E8L 3SDCC 3K2UL 3AFLA 3QQ4B 4KDVA 5DQDH 4ODTL 2X10A 2R39A 5HHOA 1H3WM 1G7JA 5CD5C 2BVPB 4XNQA 1KJ2B 1B9ZA 1FSKC 3R06A 5MP6L 4WHCA 1LP9F 4TOYL 3GNMH 4YZFF 3WIIL 1Z0NA 2W92A 1U8MB 2NXZD 3IF1B 4PJGE 4B50A 1I7ZB 1F3JA 2X4PB 4PJEE 4NHCH 1AHWA 3GK8H 4LIQE 4Q7DA 4S10A 1F2XK 2GCYA 5GIRB 4OGAD 3TH2T 5F1NA 3FOMB 2IJ0C 4OF8A 3UO1H 5LGJA 4KDWA 1TNNA 3QQ9D 3H9SE 3ISWA 3QXUA 3HUJE 4F7EA 2A38A 1QFUL 1SYVB 4OI8A 4YR6B 1PX3A 2J88H 3EGSB 1CQKA 3D39B 2GITA 4XBGA 2R23B 3KHOA 5EU4B 5LCVL 3B9KC 3ZKND 1OAQL 3S35L 3I02B 1MCLA 1WAAF 3QA3A 4DTGL 3NN8A 3NABL 1M05B 1EEQA 3T04D 1D5MA 2BHUA 4I13B 3RJDA 4WFFD 1S3KL 5E2JA 4U1LA 1FG2A 4PRNA 2CDGA 2HT3C 5KSBF 1OGAA 3IDMB 3VXRA 4JO1H 2D3VA 1ZT4B 5CGMA 1DEEB 3D0VA 1LD9A 3BZEA 3SE4A 3TT1L 1YC7A 5B38A 2HJLB 3TBTA 1B0GA 3HC3H 4TUJA 1KXVC 1VENA 3DJ9A 3MRFB 3TLRA 2EYTA 2ZPKH 1G7IB 2I9LB 3CSPA 4HWUA 4N8CH 1UH2A 3BGFB 3P4MB 4U6TA 2GI7A 4JRXA 5EPMB 3LS4L 1F42A 4D94A 3PF2A 5EDXA 2XFXA 5C0GB 4OSUL 4DKDC 4EQ3A 5C3LD 1LEIB 3QDJB 1U6AH 4UDUB 2DYPA 2UZIH 3MRRB 1XFPA 4LKXA 1S8DA 2JF1A 4F9PC 4CN4A 4N0CC 3IDGB 3PQYE 2YUVA 3ROOA 4B5EA 3NOIA 3BQUC 5FYJH 4GKZB 4LCCC 4A6YA 2BERA 3C6SB 4N0FB 4LSTH 3CC5B 2YC1A 3F58L 4J3SA 3C5JA 3ZTNH 4IDJH 3P0VL 4YBQC 1TQBB 4JKMA 3KPRB 1N7ML 1D6EA 5ETUB 3PHOA 1LE5B 3BGMA 3P4NA 2HT4C 1RK0A 2ZKHH 1YECL 4PJHA 3K2MC 2VXVL 3VG0L 4ELMA 4JY5L 4PREB 1QA9B 1J1PH 4OD1H 3STLA 2OZ4L 3TJEL 2Y06H 2J8UF 1UG9A 1ETZB 3O3DA 4ODWA 2DQJH 3DVGA 2GT9A 3FO0H 3CFBA 4WENB 2UVEA 3FQNA 1E4XH 5DJ0B 4Y4HA 3OKOA 2AJZA 4WFGD 4HKXB 1UQSB 2GIYA 1D5XA 3L3JA 5DLMH 5EB9A 2GY5A 5IJVB 2I24N 3IKCB 1OLLA 2APXA 1FGNH 5IK3A 1NBYA 3NPSC 3HMXA 3QDJD 1HOCA 2FJFA 5TDNB 2BRRH 4KMTL 2KBGA 3LRGA 4RBPH 3ILPB 4KXZI 1QSFB 3RGVC 1UKSA 1IGJA 4YIQA 1FBIL 4OGXL 4NKOB 3MRPA 5LGKA 4OCSH 4Y4KB 2I60H 2XA3A 4XWGH 4NQDD 3BW9B 3P0YL 2P5EA 3PWLB 3LKNB 4W81A 4KMLB 1KPVB 3V6FA 2NQCA 4NKDB 4Z7UB 3SN6N 1YEHL 4Y5VC 3BYTA 4ODHH 1T2QH 1JBJA 1V3JA 5EU6E 3QQ3B 2BCKB 4JFDE 4YH6A 5IHZB 2BC4B 2P5WE 3ARZA 5EBMB 3VRIA 1WTLA 2QSVA 3D85B 1C8PA 5MENE 4PS4H 1IQDA 5I73C 5HBBA 4U1GC 2FIRT 5TQ0H 4AJ0A 2VXUH 4TSBL 4XMPL 2WBJB 2H8PA 1E28B 4M3KB 2AV7A 4DKFH 2WUBL 3VD5A 1S9VA 5IB3A 4HH9B 1RU9L 4X4XB 4H5SB 3GB7B 3MFFB 3CX5K 1RZJC 4PGJA 4P99A 4CNIA 5IQ9B 3QIUA 4YBHA 1YN7A 4XT1C 1BAFH 4FQLH 3RAJH 1Q0YH 4TVPD 5HDQL 3BKYH 2FSEA 4BH7A 4GKNA 4QRQA 2AJSH 4Y19E 4M8VA 1QSFD 1FVCB 3IFPB 2CUHA 2ZUYA 3PGCA 2V5TA 4BUGA 4HD9A 3QUXC 1MLCA 4Y4KD 2RB8A 2Q6WA 5B39B 1CDGA 5TE6H 1RULL 2WBKA 5J12B 4XNMA 1CXHA 2V2TB 2W91A 3BZDA 3ALXA 5I1LA 2GJ6E 3NA9L 3VRJB 1BFSA 3D2UA 1NC4A 5JPNB 4ALAH 1U3HA 2RCSL 2XKUA 3C09C 5FF6A 2IFGA 1FZMA 4XB7A 5E8PA 4ELKB 1WZ1L 5IVOA 3OKDA 5HHPA 4LKCA 3W0WA 3UPCA 2X4QB 3D85D 4N0UA 3QUMH 3DUSB 3QQ4A 1PBYA 2FYYB 4MS8D 3ULSA 2Z31D 3WHE0 3NPZB 3STZA 2ZNWA 4HW6A 3X13B 5I15H 1TZHB 2WBJD 4FMFA 4JVUA 3B83A 1JGEB 1U8MA 1QFWL 1OAYL 5I76A 3I9GL 4YHKH 4R4NC 3GIZL 4RFOL 1F11B 1UXSA 5KSAC 1I7ZA 2VZOA 2X4PA 1HH9B 5EU7C 3GBML 4C55A 5D6DA 1HHKA 1FZJB 4PUBH 4KKBD 5JHDE 4XAWL 5BV7B 4OF3A 1ZLVH 4Z7VF 2O5YL 3IU3B 4FS0A 3HAEG 1VFBB 1CXLA 1N3NB 3QFJB 5K59F 2J7LA 1KIRB 1SYVA 3GFUA 4ZFGL 3EGSA 2B5IC 4AEEA 1YEKL 1RK1A 4RCAA 2Z8WC 3IFLH 3D39A 1BZ9A 3CXHJ 3TFKC 2BMKA 4CU7A 4OLEA 5B3NA 4WFED 4LRNL 4LSQH 4DN4H 4HUVB 3C60B 4LPTA 4ORGB 3SDXF 1S9XA 1I1FA 4XPFL 5DD1L 4JDZB 1HSAB 1J0KA 1U91A 4KRPD 4U3CA 3N9GL 4JHAH 4QF1B 4R0LA 3QG7L 1JJUA 3TBYA 3VXSB 4XNYL 4XP4H 3KWWB 1OAUH 4Q9RL 5E2VH 4OFKA 1F45A 5F6IB 2EDQA 3IDMA 2GY7B 1KV3A 3O2DH 1JN6B 3BDBA 3SKOB 3K46A 2NPLX 4JO2L 1JHLL 2EDFA 4MCZA 5CMAB 5CGTA 3WXVL 1DDHA 1RUKL 1M7IA 4NUGH 3UBXA 4PTTA 2GJJA 1NL0H 1S7XA 2I9LA 3KYNB 1WF5A 3QPXH 4NO3B 5F1IA 3P4MA 2DL9A 4TN9A 3QFJD 3VW3L 2W0LA 3B43A 3MBED 5HVHB 5D6CA 5DVOA 3MV11 2DQDL 2CKBH 4L29B 4KI5E 2ZOKB 2F58L 5EU3A 4X6CE 4OKVA 1PSKH 5DUPL 4XP1H 2A1WL 3PWVB 3FB8A 3G5XB 4OLVH 1YPZE 4WI4A 3MRRA 4ZUWB 3VXQA 1WEJH 1CLZL 2APVA 1OQXA 3UPRA 4IMKC 4CDGC 3C60D 1HNGA 1QRNE 4O4YL 4Q9QH 1OLZA 4OUOA 1FYHB 1CGXA 4NPYB 2KDGA 2QSTA 4MNQE 1A7QH 1LVEA 3DGGA 5DHVA 3DURB 3VXSD 3CC5A 4R2GC 2YEZB 4W4OC 4Q6YA 3QI9B 4PLJC 5CILH 5JDSA 3WNOA 4Y2DA 3KPRA 5KSVA 5ETUA 3KNBB 3WFZA 1JV5B 5KSUB 5I71B 5JTWA 1FL5A 1N6UA 1EJ6A 5CSZB 3SKMA 5CJBA 4AZ8A 4PREA 1VERA 1JZ4A 4NKMA 4OGZA 3RTQD 1ETZA 2Y07L 4LHUG 4FQIH 3QWOB 4PJBE 5DQJB 2IGFL 2IANB 2CRIA 1IGMH 4FXKB 4HWZA 5HHXH 2HRPH 4JFYB 4EVNA 8FABB 1J0ZA 4HKXA 4TTDD 3K7UA 3MGOB 2R0LH 3VRLF 5IJVA 3IKCA 4PJ5A 5DQ9A 2FX9H 3HE7D 4AIZA 2J6EA 4XPTL 1AIFA 3RKPA 3RUGB 4JPVH 2VLKE 1KNOB 5EBLA 5GRUL 3ZL4H 5HYJA 1A3LH 4ZXBB 5E5RB 5BRZE 4M5YH 1OAKH 3BUYB 3PWLA 1HNFA 3LKNA 4ZSOE 3DBXA 3E6HB 4Q74A 1GC1L 3S9DB 5ESAA 4P9ML 4X9BA 1KTLA 2CXGA 1Z3GL 3OAUH 3QI9D 3LKPB 4KKCC 1UM6H 4Z7UA 3SY0B 1AGDB 3CU7A 4OZFG 1AI1H 3SDAB 2NY2B 3SGEH 4IDLA 4BSVB 2BCKA 2VL5A 1LP9B 5EIVA 4BQCA 4NQSA 5JDJA 2XYCA 1CFVH 4AT6B 5F8RC 1Y18B 1Z2KA 4OAWB 1JMXA 2XKNA 3WEXA 4APQD 2W9LA 4UUJA 1MCPL 3T2NL 3QAZB 4JGUA 2E6PA 4KTDL 1I9EA 1E28A 2ZP0T 3BSZH 4R7DB 2W9DL 4JKKA 4HH9A 2Y6SC 4X4XA 4X80H 3MFFA 5C0BB 5HY9B 2W9EH 5DJXB 4KJQD 1BF8A 3HC0A 1P4BH 4KFZC 4E9LA 2DB8A 3F7VA 4FZEH 4RGNB 4HAGA 3JWOH 2ZNXA 3T1FA 1JNHA 2YPKA 3MODL 1T5WB 4UILH 4ZXBD 4X9GA 1QFPA 2K9UA 3LIZH 3MXVH 4MXVF 4Y2OA 1RUAL 1R3HB 2RHEA 1LO0H 3IDNB 3LN4B 3AS0A 3KJ6L 5C0RL 1CWVA 2MKWA 3BD3A 1I3GH 5AAWA 3SDAD 3DARA 1TVHB 3ARFC 2JB5H 5D71L 1CK0L 3JTSB 3DXAA 2FEDC 2X4QA 4XNZB 2MWCA 2Y36L 3DUSA 2FYYA 5E03A 2XTLA 4UIKL 5IGXH 3O6ML 2WQRA 3REWB 1BFVH 1KJ2L 3RL2B 4U0RB 1ZEAH 3QG6B 1P9MA 2AGJH 3ARWA 3EYQD 2D0FA 2J4WH 1FL3A 5C0BD 1QACA 1OPGH 2NZ9C 3KAAA 4K8RH 4P0DA 4YPGA 1F11A 3TIDB 4M7JH 1TXKA 4H20L 1N4XH 5C09B 4D9LH 5D1QC 3O8XA 1GGBH 3W82A 3QRFM 1CXFA 2J5LC 5JOFA 5GS0C 2A9ML 5CEZD 3ME0A 3K1DA 2BFVL 2D2OA 1XGTB 1KIRA 1IC7H 5HHNB 4JM2F 3WS6C 4K2UH 4RWYL 3QB7C 3MUGA 3IKKA 3T77A 3MZGB 2E9IA 5IBUG 1VKXB 2I5YH 3MV7E 2A9NL 4J3TA 3AREC 1S7TB 5DHYB 4XX1G 4HUVA 4ORGA 3HE6D 2O61B 5FA3B 3RWIB 4JDZA 4OZGF 3HLAA 5D7KE 4IOFD 2J8UB 1GZPB 3BXNB 3WLWD 4LEXL 3GJFK 2DWEA 4XNUL 2OJZL 3NFPB 3MNWB 2B1AH 4AH2B 3BPCA 1TTGA 4ZO6A 1UC6A 1JN6A 1XF5B 3SKOA 4Q2ZB 2CR3A 4MXWL 2I27N 5CMAA 1W8OA 3LKOB 4NCDA 4P49A 3WN5A 4ONHB 3OXSA 3ZYOA 3P4OB 3QDMD 5EIQA 3O3BB 3ALWA 2P4AB 4EOWH 3OG4B 3MJ9H 4NO3A 2NNAA 5KW9L 4TYUA 1JRHH 1N59A 1RURL 5CJOH 5KBNC 1FG9C 5DZOA 5JA9A 1AFVH 2E5EA 3CMOL 1QO3B 4M5ZH 4YAQB 3V0WL 1QSEB 5GSRB 4WCYL 3LSOB 3REVB 3T3PE 3G5XA 4A2LA 5I8KH 3QHTC 5DJAB 1WIUA 2X9XA 4X8JB 5HGGS 4XWOC 2X4UB 2ADJB 2B0SL 4L4VA 1RJZB 3DURA 3VWKB 3L95B 2X09A 2ID5A 1IL1B 1KN4L 1RJYB 4QXUL 4ZPTA 3U1SL 4PRHE 5KS9A 4JO4H 1G1CA 1P69B 1K8DB 1UT9A 3U7AA 2AJYL 2VZTA 4AENB 1UKTA 5FO7A 5KAQF 2X4OB 4FTVE 4HT1H 4PLKD 2VDNL 3O6KH 3TBWA 4MLSA 1CI5A 3KPLB 5BS0E 5TH2B 1WT5C 3PWNA 2YD8A 3CNKA 4OUUB 1RV6X 1AGFB 5D2LA 3CDGB 2IANA 1B2WH 1XH3A 4MNGE 5DQJA 1H8SA 3KPNB 3RZCB 4JFYA 4ZODA 8FABA 5T1LA 4KK9D 4YQXH 4MGXA 1TTFA 1QVOB 3CLEH 3OB0K 1LEKB 4I2XB 4NJ9H 5DYOA 5JW4R 1MELA 1QSED 1D5IH 1KCVL 2J6EL 1O7VA 4TVPL 5D2NE 5EWIH 5J13C 3B8YA 1AGBA 3H3BC 1EAPB 1DFBH 4MVBD 3VGDA 4NRXA 1DVFC 3KPOB 4F33A 4H1LH 1G7LA 3VWKD 3E6HA 1RUPH 1ZHLB 2DQGH 4CGTA 3V2AR 3LKPA 3SY0A 1I9RH 4K3JL 3QUYB 2HLAB 1OTUC 2IPUG 3BVNB 3BZ4B 3STBA 1LO3H 1QSZA 4AT6A 1UKQA 1ZVHA 1T3FA 1Y18A 1QLEH 2JKXA 4OAWA 5D7LA 4KJWD 1G6RH 3TN0B 2Q1EA 4WJ5A 5A1AA 5DVNA 3VG9C 1ZGLP 1P6FA 3OV6A 1S7QB 1R5IB 2JCCF 1INEL 5F7WC 5F1SA 5ISZB 2VQTA 4ZUTB 5TPWL 3RWEB 1BQUA 4Z7VB 2AEQH 4KUZL 4LSSH 1EFXA 2H1PL 4QRUB 4TULL 3DSFH 3NIDF 5C08E 2VDQL 3CVHB 5DJXA 3T0ED 9CGTA 5HTSA 5AYQA 4WI8A 3QEQD 5DRWB 4FXGA 1L7IL 4P9HC 4G6ML 3KDMA 2AXFB 4I18A 2NY3B 1T5WA 5HGBA 1WAAA 1WBZA 1V3LA 2FHFA 3J7HA 5DVMA 3SDXB 3NZHL 4DUXA 1R3HA 4LU5H 1PZ5B 1TPXC 1XCTB 3IDNA 1MSPA 4I77H 1CGTA 3LKSB 3EDDA 2VZUA 5JW4M 2YD9A 3P77B 5KSBA 1MCKA 3C08L 3N1QC 3QUYD 1T7VA 1TVHA 4XWOD 4HJGB 3Q0HA 3UDWA 1QBML 4NUJB 2APFA 3JTSA 1KIPB 3AM8C 1HINH 3UJJL 2NY6B 2WUCH 1SQ2N 3TN0D 2AQ2A 1ZE3C 5E8DH 4IRSB 4XZUB 3REWA 4AMKH 4NO0B 5ISZD 3VXOA 3D5OF 3RL2A 1IAIM 1NLDL 3BP7B 2GFBB 1DLFL 3QG6A 4HQQL 4L8SB 5HGHB 5GGQL 1KENL 5FYLE 3OAZK 3X3FL 4Z7NE 3PQYD 1TCRA 5HYIA 3TCLA 4I4WA 2OYPA 4F58L 1KTKE 4NFDA 3JWNC 4TSCH 3O0RL 5C09A 1GL4B 3BH8B 2X4TA 2HVKB 1T5XB 1K6QL 4NM8H 4U7SA 4G8IA 3F6LA 1R3IH 3V5KB 3GHBH 4S11A 2VWEE 1URLA 5BV7L 3DUHA 3RX8A 4I3RL 3EOAB 2VZ1A 2H2PD 5IHBA 2EH8L 5I16A 5F7LB 4GS7C 5IB1B 1Y0LB 4JR9H 4ZNEE 1S5IL 3ZDYE 1NFDE 4K23L 3CU1A 3E8UH 5F7EH 2PTUA 5ADPL 1BOYA 2YBRB 5FOBA 4UV4H 4X5XB 2Q87A 1H3GA 4FRWA 1BEYH 2VLJB 1RZJH 2IAMD 5F1OB 1VKXA 3FFDB 1J1XH 5T1KA 2ADGB 4L1HA 1S7TA 5DHYA 1WSST 1G7PB 4NCC1 3AUVA 5FA3A 2NY6D 4YBLC 2VSDA 1JPGB 4HJJH 2J8UA 3UTTE 1I8MB 2NX5B 1GZPA 3KPPB 4KKLD 4NNYB 3J8F7 1YNKL 3MNWA 3NFPA 5CGYC 1FNFA 3VGEA 3KGRA 1OTUD 1XF5A 4Q2ZA 5EZIH 5C9KA 1RVFH 5BQ7A 3OJMB 5SX4H 7FABH 4S1RH 3ZE0E 3LKOA 2AEPH 4M1GH 4Q9CA 5CAYB 2HT2D 1YJDC 4M48L 5FGCE 3KS0J 2OMBA 4ONHA 5EA0H 3P4OA 5I30H 1EO7A 4BM7A 3O3BA 4BYHA 1A14H 5I17B 4PY8J 4OIIH 4I0PB 5I1GL 1MVUB 2ED8A 4GG6F 2NLJB 1QBAA 2D7PA 1SVZA 5H35B 4JDTL 1NGQL 3DVIA 3MV9A 4XP5H 5C7XL 1JWUA 2VLJD 3F62A 5D7SH 1T66C 3BAEL 4U6HA 5SV3A 1BQHA 4JCLA 4E42B 2WLZA 1I4FB 4ZS7H 3OWEA 4IOIB 3VDCA 1Z9SA 2MHAA 2ADJA 5A2KH 2UZXB 3WYRA 2IBBA 4UTAH 4KI5C 2NX5D 2XWBA 3EFFB 3KJ4C 3HS0B 4Y16A 3EOYG 2UY6A 1QKZL 5SWQA 4N8VA 3WHXA 2N7AA 3KPSE 5IEHA 1K8DA 3WD5H 4G9DA 3ARUA 5HYFA 1NSNH 4M6OH 3VD4A 2X9WA 5F7DA 2CO7B 3EOTH 3HZVB 3TGXA 4PRID 3MSPA 5TH2A 4UT7H 4OUUA 4HZLB 4MA8H 3CDGA 3TBVA 3H9YA 2HH0L 4PJ7E 4NO2B 3JTTB 3MNZB 3RZCA 2PXYB 4I0PD 1QQDB