3DUSB

Crystal structure of sag506-01, orthorhombic, twinned, crystal 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTVEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDGYYVDAMDYWGQGTSVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fv fragment SAG506-01
publication title Pseudo-symmetry and twinning in crystals of homologous antibody Fv fragments.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 121
sequence length 121
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dusB00
4HJGB 1JE6A 4Z95H 4GRWE 3J8F7 3V8OA 4ODHH 5LBSH 5DHVH 2IANB 4MVBD 1SJEA 4PPTA 3IDIA 3EDEA 4N5ED 5EBWA 2ZWLT 5F9JA 1WICA 5CEYA 4NQCE 1D5MB 5BV7C 3O81A 3KNBB 4PP2B 3SPVA 3ZKXB 1S7VA 3BQUA 5CMAA 5FECA 1IARB 1KACB 5T5FL 1FV1A 4M61B 4Y2OA 3RAJH 5GS0C 3RPKA 5D4QA 1HWHB 3VFVA 4XRCA 4DZBA 3UCRA 5CUSH 1NAKH 5BW7A 1TZIA 5D1ZB 2VLJD 4OAWB 1PYWB 1TZHB 1G7MA 4E0RA 2K1MA 2EE6A 2R0KH 1V7NL 3DTXA 4GS7B 2QL1A 4XPHL 4XMPL 5D1QA 2CKBH 2LABA 1JGLL 4YZFE 2FBJL 2N56A 2E7CA 5GXBB 1WCBA 3MRNB 1A7RL 4OUOA 5D7LB 2OK0L 3MREB 3WDHA 4F9PA 1YEFL 1K8DA 1KIUA 3LKPB 2XXMB 1EO8H 3EYVA 4G6KH 4ZO8A 5DFTA 1DCLA 5TDNA 5BO1H 1JYNA 4BH7A 2AXJA 4YHMH 2G9HA 1KTDB 3ZT6A 1A6AB 1IAIL 5CJOH 5JW4M 1SYSA 1RULH 1MRFL 4Q9CA 1FO0H 3QEUA 3O45A 4LQFH 3HZKA 3EOBB 1T66D 4CJ1A 2HTLC 3CD4A 3ZDXE 4F7PB 3D1MC 2RFXA 4NO5A 1F3JA 4RFNB 3PJSA 1FAIH 3CLFH 5C0CB 1H9VA 3QDJE 4H0HB 1BVKA 3GUTB 4K7FA 4L4TD 3DX7A 3O3BB 5IK3A 1YPZA 3E6HB 4F2MA 2BNRB 5IBTH 4LCCA 4YXLH 1S7SA 4MJ6B 4JO3H 4NSKB 1FBIL 4NKIL 3GMOA 2ZCHL 1MEXL 1AGDA 2EIZB 1A22B 2DQCH 5TE7H 3HA0A 5F1NB 1AP2A 1JGEB 4KI1A 5JXAH 4KROC 3SGKC 1KGCD 5IT2H 2JF1A 1T20A 5HDQH 3N9GH 5HD8C 5CBAA 1A64A 4KUCD 1VADB 3B9KD 1MFDL 4J3WA 2VL5A 2XZZA 4LASL 1H3GA 15C8H 4X7EC 3QQ9D 2FHFA 4HHAB 5ICXA 5JHDE 3MFFA 3QPQD 1IC4L 2NY6B 3QQ3A 4R0LB 1QFPA 5EIIB 1C1EH 2P8MA 5ITBH 4FQLL 4JY5H 4NKMA 4AH2B 5JW5B 1WF5A 2BFVL 3FQUA 4MZ2A 5LKNA 5D2LE 1C5BH 4ORZC 1U3HD 4Y5YB 5GRXG 1QFUH 3CK0L 3QUYA 5C0AD 5IROC 1YEDA 2OL3B 2JIXA 1I3RA 1R3LB 4OLZH 4U1JA 2DM3A 3O2VL 1M71A 1RPQA 4M1DH 5EC2B 2AJSH 5DDHB 1T83A 1HDMB 4OF5A 1EV2E 5EU6D 1BREA 3NBNA 2ICWB 1L7TL 2QR0A 4TNWF 2APFA 2FECI 5I74C 1WK0A 1UZ6E 1J0HA 2ZOLA 4P2QD 5F6IC 1C8PA 1RK1A 1O5DT 3VWKC 3ARQA 3RZCA 4PS4H 5E2UL 2QQQA 1YQ2A 4KKCC 4MQXD 2HTKD 2MTPA 1U2HA 5MI0B 1ROWA 2VXVL 2XQYK 4OZ4A 3NTCL 5C0JA 3PHQB 2CUIA 3IVKB 1UEYA 3C08H 1X5JA 3FQRA 1MAMH 2DQJL 4JKKA 3E6FA 2X41A 2GKIA 1IAOB 1AJ7L 1F4YL 2YRZA 5FFLA 2D0FA 3MNWA 1CU4L 2C4XA 3T04D 4ODUB 2X4UA 2A77L 1BQLH 4PY7B 4M9OA 4PLKD 4OF7A 3VXRA 1A7OL 3BEWB 3G5VB 4LVNC 2ZP0T 5I8EA 1A9EB 2HJFA 5FCSH 4ZFGL 2UV3A 1CD1A 3QNZB 5H37G 5E8OB 3WFBH 4HWEH 1T5WB 3AB0B 4KJYB 1EHXA 1GIGL 3OXRB 3JVGC 1CGVA 1X5HA 3VFUB 1MJUL 1UJTA 1KTLA 1G7IA 2HJLA 5F7EL 3SY0B 1U3HC 3B5TA 4PG9B 3TWCL 3EYQD 5AUMB 3PXHA 3H7BA 3HRPA 1JZ8A 3MJ9A 5FO9A 3DYMA 1T89C 1L0QA 5BJTA 1U8PA 4OKVA 4N1HB 4NUGH 5MEOA 2PYFA 4F58H 3F5WB 3FB7B 2XFXA 1ZHLB 1DLHB 4GMTL 4XNYH 4MCZA 4YHIA 1KIRB 2VDLH 4JQIL 5IJVB 4EEEA 4DTGL 1DVFD 4U1NA 1E6JL 2YHGA 4LLDA 1P7KA 2A74A 2QSCH 4XMLH 4I3SH 4XTRC 4WHDA 2IPTL 4AT6B 4HX1A 2Z31B 5K9JH 1KPUB 1IQDB 3VD7A 4N90E 4XHJD 4ZUSA 3I50H 4Z0BL 3VI3E 5D93B 4H1LH 2XG4A 1T0NB 4ISVB 3GMLB 3BFOA 5E4IA 1N8ZB 4HUXB 4XP6L 2EKJA 4LLVA 4MCYA 5FYKH 4JZNB 2R0ZL 2BXZA 4ALAH 5JHDB 3QDAA 1MWAH 3HFML 3EYSL 2NMSA 1NCWL 3HG1D 3U1SH 4CVWA 4LARL 3HS0A 3I3DA 4P2OB 3VA2C 2NY3B 4IHOA 4QXTA 1OB1A 4HD9A 4XC1H 3U30C 2W60A 1AD9A 1I1YB 5H8DA 4IBLT 5FK9B 1MCRA 4L9LB 3D85B 4MQ7B 4QHKJ 4PYHA 5B3JF 3DPBA 5EZOH 1RFDH 1KCRH 2YD3A 3TVMA 3KPRA 4LHQB 4NRYA 4N1CA 1P6FA 3QUMH 3NABH 1NCBH 4DFHA 1AGBA 3H0TB 5D72L 2VITB 3FCTB 2FEEI 4X0KA 4PJDF 5D5ME 3HCVB 3CX5J 3RRQA 3VXOB 2E9JA 3MLYH 5HHOD 4G9DB 4LNVA 2UZYB 3D2UD 4TTGA 1XIWA 3ULVH 3DXAA 3HRZA 3SKUD 4OD2B 1DBJH 1YEGL 4QOKD 1CE6A 5GQBA 1HEZA 1XT5A 4M7LL 5HGBA 5KTEL 3O6MH 3O9WB 4PREA 3TH3T 4WI9A 4Y4HA 3RGVC 4LKXB 4LKCB 3JTSA 5I73C 1E27A 5I2IA 1T21B 1A4JB 4HCRA 4EUPA 3BKML 3VXMB 3SKOB 2EC8A 3THML 3TNMA 3MROA 1X4ZA 1H3PH 5CS7A 5IV2A 1PSKH 1EHLL 4NO3B 4U1GC 3OJDA 3MJGX 4ZYKA 4RCAA 5BZWA 5D7JA 2Z92A 4ZFFB 5DJ8B 1IGIL 4HIEA 3QCVH 1KBGL 5FO7B 3FOMA 7FABH 1WBXB 1F4XL 5IB2A 4PJIE 5IW6B 3JZ7A 4PJXE 2P8PB 1KENH 5J13C 3FQWA 4UT9L 4B53A 3NAAH 4Y1AE 3GMPA 3OPZL 4NGHH 2OTPA 3EAKA 3T2PA 3T2NL 3MYZA 2NY7H 4JZOB 1IBGL 3N85H 3QDMD 3LSOB 4UQ3B 2BY3A 4Y0GA 4YXHL 1IGML 2G5RA 2P45B 4XH2A 3W9DA 4XVSH 2ZSWB 3WS3B 3VMOA 2OMBA 3O3DA 1F3DH 2UWEF 3MA9L 3OKDA 2V5RA 4N9GB 1U42A 3HC0B 4ZNCD 1FG2A 4CNIB 5DMGD 4I0CC 5DJXA 1ZLSL 3LKRA 1VFAA 4YDJB 4KTEL 5DRNB 4XBPB 3TBSB 3VGGA 3EO9H 5TPWL 2IJ0C 5EU7C 2J12B 3BI9X 4E41E 3QIWA 3LCYA 3TZVB 3DO7B 1MHCB 3HZMB 4PJ8A 3GHEL 1FZOB 1P9MC 3GIZH 3A67L 5IIEA 3N1PC 4I77L 4NNYA 3M8OL 3OXSA 4TNVF 3DROB 4IRZH 2AXGA 2G60L 4PGEB 4XGZB 1KPVB 1JYVA 2W91A 2YK1L 5AYQA 3ZTNH 1CXLA 2R1XA 3V2AR 1MI5D 2E8ZA 4DWHA 2VN4A 3PDDA 2HVKB 4KRPB 5D96C 5TE6L 2CJUL 4F9LA 3WXWH 4JPVL 1I3UA 3Q6FB 4ZMAT 4Q6YA 1JPFA 1KELH 3UZEA 3REWA 3PWPB 4QEGA 1E4WH 3AAZB 1ZA6B 1ZGLB 2YWZA 1A21A 3PHSA 1T7YA 3G08B 1IFHH 4AG4H 1RIHL 1QRNB 3JWDC 4PJ7F 5C0GA 3UC0H 2VO5A 2R9HD 4AEIH 1BIHA 4NIKB 4OBRA 3F12B 1R24A 5DRWA 3OKKB 2HFEA 5JTWA 2LVEA 3LRSA 1DQDH 3OG6B 1S5HA 4AMKL 5DFVC 2GTZB 1YNLL 2NW2A 4L1HA 1K4CB 3DNKA 2FD6H 4G9FD 3LEXB 3VGAC 1A2YB 4OCXL 5JQ6H 4XZUB 5D5MB 1R3HB 1JZ3A 1IKNC 4YPJA 2O26U 3ARRA 5FAAA 3VRIA 2W9EL 3AFLA 5GZND 2Z9TA 3ULUF 4MXQC 3GGWB 1NGZB 4ZOBA 1RVFL 1U8OA 4K07A 3TBVB 1H3UA 2A6DA 5EZIH 4YC2B 3ZL4H 1TETL 4DUWA 1D6VL 2Y06L 3SDDA 3QH3A 2CIIB 3IU3A 3SKJH 4WDIB 1S7WA 3U48A 5LXGH 3WSQL 2VSDA 3U0TA 2YC1A 1YEIL 5ICYA 2Q6WA 2NY2C 3C60D 4N68A 3T1FB 4KKLC 3LY6A 3KPQB 2OSLB 1BVZA 5I66B 4FTVA 2W9LA 5D6DC 4P3DA 3QDGA 4ZTOL 3SOBH 2A2QT 4XPTL 4HEPG 1YY8B 1NCTA 1ZOXA 4YEEA 1I7UB 1DBBH 3FTGA 5F9OL 5B38B 1OGAA 5I17B 1MREH 4TPRL 4HJJL 4WW2A 3ZE2F 1QBBA 1QSEA 1S9YA 4MB5A 1YDPA 2EDJA 5DJZB 3QUZD 1CL7H 4PJXB 1YEHH 5GJSH 1G7QB 3MUHL 4S1DD 5IWLC 5L6YH 5JQHC 5DI8A 3C5ZB 4GUPB 2P4AB 2GCYB 3RI5F 3FFDA 3C6LA 3HZYA 3EJYD 2PO6D 2KQNA 5JOPE 5EDXA 1I7TB 4OD1H 4S2SB 1QSFA 2HAZA 2R2HA 2OS7A 4IMLB 3BHBA 2GSGA 4Z7UA 4CJ0A 3GSRA 1ADQH 2HH0H 2HFGH 3RWFB 1E6OL 3ARED 3S4SA 3S88H 1UQSA 3IU4L 2PXYC 1AD0A 4HZAA 2GY5A 4JO1H 2I60L 5C0EB 1KJ2L 5T3XL 2H32H 3X11A 2D0GA 1FYHB 1QSZA 4LCYB 3L5WB 4K2UH 4Y16B 1DE4A 1SJVA 1WAAE 5D7SL 3ZZ1A 1FFOA 3RY6C 4BKLB 1HYSC 4YE4H 2VDQH 2R2BB 3BO8A 4N8CL 1T04A 5IUSA 2APBA 2J8HA 5F1IB 3H9SD 2HKFH 1WFNA 4WUUD 1E4XI 4DVBB 3HZVA 5ILTH 4X4MA 3S37H 3SDXA 4WWKC 4BQ8A 1YY9C 3E8UL 4OLEA 4NJAL 4PYGA 3VI4E 1P84J 5KSAA 4HLZG 5ITFA 2Z93A 3KPPB 3QI9C 3EYFA 1IGCH 3A6OA 4XAKD 2J5LC 4I18C 5HHXL 3O2DA 1U8QA 1ZSDB 4S1SL 5DD1H 5HXMA 1P1ZA 1YC8A 4PV8A 4OFIA 3LEYL 4P5TC 5HI4C 4G7YL 5I1KH 3KWWA 4HPYL 2A0LD 4XPBH 5IHZA 4OTXH 1CK0H 2VLJE 4UDTA 4KDTC 4PRHA 1OM3L 3I6KA 5KVDH 1RU9H 1A7NL 1NH6A 5E08L 3V0AC 1YQVH 5HY9B 3OAUL 3ROLB 1A6PA 4MNQE 2WIIA 5JPMB 3O6FB 3PL6D 1NLBH 2EXYD 2F74B 1U3YA 5FGSA 4MHHI 4R90L 3MRMA 4R3SB 2ORBL 3GSOA 4R7NA 2IFGA 3TF7C 3FRPA 5HI5D 2OM5A 3TPKA 3W81A 3T08A 5JA9A 3HNVL 3RTQD 1C5CL 5F3BA 1T3FB 1MCFA 3F6IA 4ZXBA 4UDUA 3OJMB 2VLKA 3U36B 4PJFA 4P23A 4RFEA 3TN0A 3UDWC 4Y19A 3CFKB 4LGRB 4WI5A 4NZJA 3MRFA 1CBVH 3T0EA 4I9WD 1ACZA 3D6GA 4DJMA 2WQRA 4JPWH 3IFNH 1TFHA 4YBQC 3B3IB 2AJVL 5IEKA 5ESAA 4L4TE 1AGCA 4MXVF 5EBLA 3GHBL 3QA3B 2BNUA 5MENA 4HK3J 1S7UB 4Z95L 1UWEL 4ODHL 5CZVH 2FH8A 4Y4FB 4G8EA 2AK4A 4WY7L 1GZPA 5A43C 3EYOA 4QHLA 1EAJA 2BSED 4LSSH 3D39B 3FFCA 1KGCE 5DJCA 4U1MB 1HWGB 2YEZB 2W92A 4K8RH 5ID0B 4J23A 1YA5A 1K9TA 1QNZL 3O11A 3RAJL 4PRNA 3V0VB 5M7QA 4UV4H 1XF2A 3MBEA 1J12A 4JY6B 3EO1A 5ADOL 1A3RH 3QUKB 4CRPA 1YYMH 4U0RC 3OB0K 4HLJA 1NAKL 3SDAB 1XF4B 1W0WB 4FQIH 3RWDB 2P43B 5E6YA 4G42B 4QHUA 5EWIH 5C09D 4NC2B 3PL6C 4CMMB 1FGNH 2QQKL 3MODL 4PD4J 3ULVD 5C0AE 3QUXA 1RUAH 2R2EA 3O0RH 4X80H 4OLXL 2GSIB 4LOUD 1A3LL 2EDWA 4BZYA 4JDVB 1I8KA 1LGVA 1OAXH 3RTQC 4PGBA 5EU6E 1V3KA 1EO8L 4WFHD 4G6KL 1JZ7A 3P0YL 4K71B 4JFPB 4YHML 1SBSL 2ZUQB 4P2QE 5F71A 3DMMA 3CH1A 1OTTC 3FRUB 4NZRH 1I7ZA 1U93B 2D03H 1IQWH 4X5LA 2BJML 2FX8L 3CFIC 5FKAA 3ROOA 3NZ8A 1J0YA 1Q0YH 4P2CG 1FAIL 3O4OB 4MA1C 1ZS8B 2D7NA 3ALXA 3K8KA 3FO0L 4IOFD 1B3JA 2F8XC 5D1XD 1H3VA 5L8JB 3ARWA 2NX5D 5EC1B 2R0LH 5F7UA 3EJJX 2GITB 1PJ9A 4Q9QH 4JO3L 3QNXA 2EYSA 2VLJB 2IPUG 4JFFA 4LEXH 3I02A 2MSPA 3IF1A 4EI5C 2IWGA 5T1MB 3WKNA 3ARFA 1WUNT 3V6OA 2P44B 3MBXH 2K7QA 5I75B 2O5ZL 1IZKA 1G0XA 5IB4B 1EZVY 5HDQL 3EDFA 4BYHA 4GAGL 4R26L 4BA8A 2WP3T 15C8L 3MRDB 3KPSA 3TYGH 5ADPL 3TNNA 3MSPA 2CUHA 2B20A 1C1EL 2QQNL 4EOWL 4JY5L 4ZDHA 5JOFA 4OF6A 2B1AH 3W2DL 1QFUL 1UKSA 4XBGA 3PP3K 2A9MH 4X6FB 4L3ED 4ELMF 3BGFC 4AY0A 1J8HA 3DETD 1GH7A 2AJSL 3QFDA 5JLZB 4P2RA 4L4TB 4MGXA 2JELH 2DBLL 5FKPB 4ZUWB 3C9NB 4GBXD 5KSBE 2RIKA 2FHCA 4L8SA 4WW2F 4N8PA 3VFWA 1G7PA 1X5ZA 1VPOH 1EUTA 4KK9D 1OTUC 3FB6B 4G8IA 4R97B 5A40E 4HCRH 1Z9OA 3K81A 4PS4L 4ODSL 5DK2B 4MD4A 1IGFL 4P99A 4PJEE 3MZTA 4DK3A 1QG3A 3GI8H 3B9KB 3QIUD 1F45A 1D5XB 1KTKE 2MQ3A 1PY9A 2DLIA 4FFWD 1I85C 1FIGH 1MAML 2PF6A 4U3CA 4RFOH 3BZEA 5DJ2B 1OARH 4QYOA 3HG1E 1TJIH 4MAYD 2X70A 4D8PB 5IVXF 4YNYB 2XI9A 3NIFE 1BQLL 4XPGH 3OAYK 2X05A 3STBA 1VB9A 1PBYA 1T22A 3DX8A 4P5KA 5ANME 5C0AB 4CVZA 4Q74A 1MNUH 2EDFA 2EIEA 4HZLB 4HGKC 4YHNB 1NC2D 4UNTA 4HF5H 3WFBL 5EU6B 4HWEL 4ONFH 2D0HA 1AR1D 3PGFH 2ZUYA 4LSTH 3OBAA 2IH3B 5F8QC 3BD4A 1JI1A 4APQA 3TCLA 1GRWA 4UINH 3T0WA 3UTPD 1KEGH 5E6ZA 2DQUH 4P2QB 3W9EB 43C9B 4E42B 1CFQB 2ICES 5C9KA 4OB5H 1BZQK 5E9DB 5E6IA 3KJ4C 2HVJA 4U05A 4NUGL 2JB6B 3DETC 2ZKHH 3SDXF 3RVUC 3TO2A 4OZIE 1HQ4A 2P7TB 4UILL 5HHOE 5A2KH 1Z6JT 1KCVL 3BQUD 1UXSB 5C07D 1XGPA 4DW2L 2VDLL 4EZMA 4M48L 2A1WH 1A7BA 2H3NA 4QOKE 1HH9B 2AXHA 43CAB 3IDYC 3V5DA 4XMLL 5TDPA 5J1AB 4I3SL 2IANA 3LB6D 2P5ED 4I13B 4FZ8L 5K9JL 1NUGA 4P9HC 4JLRB 1F11B 1DLFL 4KXZH 5IQ9B 2FEEL 2QTEA 1D5MA 1L0YA 3KNBA 3TBWB 4K9EL 3S8WA 2XKNB 1UACH 4JRXA 3ZKMC 3DSFH 4OZFB 1CGTA 5GISH 4J3SA 1NGPH 3KLAA 4DGVH 4ALAL 1FNSH 1MWAL 4OI8A 3ZKSD 3OMZA 5EBGA 1V3LA 3B43A 5D1ZA 1O0VA 4OAWA 3U1SL 1MJ8H 1TMCB 1TZHA 2CPCA 4Y2DC 1DQJA 3V5HB 5ESVB 1CYGA 5GGUB 2P24B 4FQPA 4C57C 3IRZA 4NQDD 2CRYA 3MJ7B 2OJEB 2J6EA 4N0FA 3QDME 3OGCB 4HIIA 2ILLA 5D7LA 3MREA 1UB5B 4Z78A 2NZ9D 4PJCF 1LVEA 4NJ9L 1DVFB 5D2NC 5DC9B 5KSBB 2ATPB 3DX6B 1UJ3C 1A6TB 1TVDA 5EZOL 1RFDL 1KCRL 4XXCC 4PB0H 3BE1H 4CUCA 1LNUB 4LLWB 2ZG2A 5BRZE 3QUML 2OXHA 1HOCA 3NABL 1NCBL 1DSFH 4OT1H 3R4DA 3G5XB 3HE6A 1RZIA 4O02H 3L7FB 1HIMH 4U2ZA 1N26A 2O5XH 1JK8A 5H2BA 3D3VA 5DUMH 4DKFH 3O2WH 4PJEB 5DK3A 2JJTC 3MLYL 1OP3K 1Q9OA 1IAMA 2E27H 4QRPE 5C0CA 3BN9D 2D4FA 3ULVL 1Q9LA 2VXSH 1T5XB 3HUJE 4JAMA 2BNRA 3M1BB 1MI5E 5IM7B 3LB6C 4MJ6A 1NCCH 3TJEH 2W0FB 4U0QB 2EE2A 3HG1B 3O6ML 3RBGA 3PWNA 5I6XB 2NY0D 2EIZA 3HNTH 3EOAB 1P7HL 1Q0XL 4M3JA 1BQHG 5J13B 5J56B 3LQAH 3L6FA 4XNMA 5I76A 3QUYD 1JF1A 4I4WB 5HTSA 2JIXD 3L3JB 2QBWA 3O4LA 1VADA 4LLQA 1U8HA 5JMOC 5JHLL 3EJZD 3KLHC 1WWCA 1G9MC 4ONGH 3GBLA 5MERB 7FABL 4P57B 3Q6GL 3MMEA 4ZQKB 5KANI 4LLYA 4OI9A 1MAJA 5JW5A 2E9IA 3QEQA 4J3XA 5GZOC 3NAAL 3W39B 5DJYA 4NPYB 1S7XB 4NGHL 4RGOL 5L8KB 4ODXA 2R2CA 2DQIH 4L3CA 5CD3B 5TH2A 4HUMB 3NFPB 2FBOJ 2UUDH 3ZT5A 1NBYA 2OL3A 1JPST 2MHAB 5HHOB 1XGQB 4RMWA 1U8LA 1DFBH 3L3KB 5JXED 3D2UB 3MUZ1 5FM5M 4N9OB 3ISWA 4XB7A 3T3ME 3F7QA 2F19H 4QOKB 5DD6B 4NC0B 1ZHBB 3IKCA 5C0DA 3I6GB 1GGTA 2HKHL 5HVWA 1FVEB 4QRSA 4AK1A 3UXFA 1WBZA 2HT3D 3AU1A 3GIVA 2X42A 3EO9L 5FA3B 5F72S 4LCWA 2E7MA 3DGGA 4WGWB 2N1KA 4MJIA 1FZJA 4A6YH 4NQCA 1Z5LA 2H2SD 4K8RD 3GIZL 4KUZH 1OPGH 3HE7C 4ENED 1C16A 2YD1A 1FQ9C 4IRZL 3N1QC 4LAQL 4ZS6C 3BPOB 4FG6C 3HAEH 1FFPA 4X6CE 3BT2L 3ZTNL 3PV7A 4XCYA 2IALB 3WFDH 1Y0LB 2FYYA 3RZWA 5KBNC 3RX5A 2VLLB 1QA9B 5FUOH 1T0MA 2RQ8A 4G6AC 3WXWL 2I9TA 4WJ5A 1UVQB 2HT4C 1D5ZB 3OGOE 1NCAL 3GDBA 3QDMB 1T2QH 5AWNH 1E4WL 2D7PA 4PTTB 1A9EA 1IFHL 4O2CB 5E8OA 5DRZB 1T5WA 3UC0L 3PDOB 4AEIL 4YGAB 2ZG1A 5DVKA 2MCPH 3D25B 3IJSB 2NNAB 4J6RH 4JFOB 3MV01 3SY0A 1OVZA 3K3QA 3MRCB 1DQDL 2J1KA 5F21B 3RWIA 1KF9B 4D9LL 1L7IL 1IEBB 5AUMA 3LQZB 2V6HA 3KJ6H 4KK8C 5I9QC 4C55A 5JQ6L 4LAJH 2WNGA 4JZJC 3VWJA 4GRMB 1OAYL 5DS8B 2IAMA 1U8KA 2WBJC 4JN1H 1HCVA 3QDJA 4HK3N 1IMHC 3MV7D 4EIGB 2UVEA 3NFSH 1AQDB 3BZ4B 5EZIL 5GS1B 4X4XB 1MI5B 1XGUB 1LP9E 1HINH 3SKJL 3ARGC 5LXGL 2F54D 1OTSD 1BOYA 3H9SE 1TNNA 4WHYH 4HQQH 1M6OA 3GSWA 3WO4B 2QHLA 4LCUB 5DEFA 1AI1H 2H8PB 1BQHB 4EBQL 3RNKA 3SOBL 1T0NA 2JK5A 3ZYZA 4GKZB 3GMLA 2I24N 1AHWA 2VXUH 1N8ZA 3MNZB 5E95B 4XAKE 4HUXA 2EO9A 1A7QH 4WV1C 4EJ1C 5I0DA 3T2OA 5JHDA 3UPAA 3TVMD 1YEEH 3ZTJH 2VLRE 4BSWB 1KG0B 5C9JB 1P4BH 1X4YA 1EFXA 2G75B 5IW1A 1FO0B 1F90L 5FUCE 3UJJH 1G6RH 2XZQL 1FNAA 4MLSA 2V9TA 5GJSL 4PV9A 5D2LA 4G9FB 2GFBB 4NZTH 3RVWC 5L6YL 4P2OA 1TLKA 1E4XL 5D7KE 1S9WA 2B0SH 1KB5H 3ABZA 5B21A 3L3DB 4QY8B 4YR6A 5FK9A 3CFBB 3LD8C 4PLJC 5FDYA 3GRWH 1X3DA 2W38A 3ZDYF 2P8LA 1XIWD 4OD1L 3DXAD 2XWBB 1I75A 2W65B 5DQJB 1S9XA 1J5OH 2R29H 3HPLB 3KXFA 2HH0L 3C60B 3HMWH 3QWRA 4X9IA 3UO1H 3H0TA 4LSPL 3C8KB 4H1LG 3FO9A 3RL1B 3FCTA 4GG8B 1PAMA 3H9ZA 4P46A 2BY1A 3VXSA 3HCVA 3DURA 4I9WE 4KAQH 2FB4H 4RWYH 4ETQA 1RJYA 4GXVH 4WEMB 5FYKE 4QCIA 5ID1B 5D7JD 4DAGH 4OIAA 3MV9A 3O6KL 2RCSL 2X40A 2VDQL 4MNGE 3KHOA 3QUZB 5IMKA 5CBEA 5GSRB 5DD0H 1F3DJ 2XZAL 4LKCA 2HKFL 1A4JA 3DX9A 3SKOA 2GJJA 1V7ML 3F7VA 2PR4H 4NO3A 1RJLA 5JZ7C 3JTTB 2NTFB 2PO6B 1S3KH 4HS8L 2HLAB 5DZLA 3MRKB 1IGCL 3CFCH 3GSNA 5I1GH 1BEYH 3GJFH 5DD1L 4KMTH 2FGWH 1MQKL 2CLRB 5IW6A 1UM6H 3AREB 4XPBL 4OTXL 4IIQB 1CK0L 2D2OA 3QJFB 4BZ1H 4H26B 3QIWD 1FZKA 2YXFA 1MCNA 4X4YB 3SBWA 5KVDL 5BQ7A 2VWEE 4UQ3A 3LSOA 1U91B 2YD4A 1YQVL 4LF3B 1I1FB 1TVHA 3ULVE 3MRLB 4X7CC 1JWMB 4ZG1A 1ORQB 2I25N 1LP9B 4CNIA 3RY4A 4JKLA 4WFHE 1SEQL 4LHUA 3WHE0 2PW2A 3IT8D 4ELKA 3H9SB 4F7EA 5JIKA 4WUUB 5AYUH 1SY6A 4FZEH 5KOVC 4HUKB 4HIXH 3TZVA 5TJWK 1MHCA 3VXQB 1FZOA 1HHGA 1CBVL 4RISL 3HMXH 5E1AB 3WLWC 1F6LL 3ULUL 2I9LB 2XRAH 5DD3H 1II4E 5DK0A 5KN5B 4K55A 4JPWL 4XGZA 4PGEA 5DJ6B 2AEWA 3VG9B 5J1SC 5HGAA 4M62H 1YECL 4CADB 3C5SB 5L9DL 5IEHA 2NX5E 2IG2L 5EO9A 3PV6B 2L7UA 4HKZB 3GBMH 4N1EA 4XCEA 5CZVL 5IVZB 1BZ9B 4FQ2L 1RMFH 4DN4H 5F7FA 1MCOH 1DJSA 1ZA6A 1JHTA 1EEZB 1J1XL 3IJHB 3ARBA 3GSXA 3WIFA 5TQ0L 1N0XL 3F12A 3DYPA 3B9EA 4RA0C 4Z7WA 3V7AG 3SDDD 4UV4L 3BXNA 3RTQB 3V7AE 2LFGA 2GTZA 3QJHA 5DZNA 3AROA 1K4CA 1QBMH 3MOAH 3TESA 3GSVB 3LEXA 3FT2A 3ARDC 3BIKB 3PGCA 4FQIL 1DN0B 5EUKB 5EWIL 4H1LB 2ADJA 3X14A 1KIQB 5TQ2H 1KNOA 2QKIB 3QDGD 1I7RB 2BRRH 3D18A 1W72A 2DTSA 3MJ9L 3ZSSA 4PRIE 1FGNL 5DLMH 5A2LH 4Q58C 4L3EE 3WUZA 1RUAL 4X80L 1MWAB 5ICZB 4OZGA 3EKCA 4UAOC 3U82B 1YNTB 4M7ZC 2XWJB 2YBRB 4MA1B 1YZZA 4MNGB 3RVTD 3RPIA 1YN7B 3BPCB 5K59E 3V6ZB 1AIFB 1JPSH 1EDQA 3KPQA 2OSLA 5FA4A 5F6HJ 1H0DA 3NCFB 1JNHA 1H5BA 4NZRL 5CZXC 5DUBB 1IQWL 5ESQB 1IM3B 3GI9H 1NJ9A 4JRWA 1I7UA 1DP0A 4YZFF 1Q0YL 2KZ1B 2NY4D 4HIJB 3CDGA 3QUMB 4M7JH 5KSUB 3UJTL 5IMLB 4L8CB 3D5OF 1A6ZB 1BECA 2FLRT 5DD5H 4PJIA 4KK6C 2KDGA 4PJXA 3UPRA 1RZGA 3H3PL 3OX8A 5EULV 1T03H 1G7QA 4Y1AA 5F3HB 1FC1A 3DUSB 3C5ZA 1Z9SA 4W4OC 5C09B 4N0UA 2HYMA 2Y07L 1C7TA 2Y6SD 4KI5C 1F58H 3QXAB 3G04A 4M4PA 4MD5B 1IT9H 3MBXL 2VSCA 4K3DL 1CFBA 1I7TA 4HAGA 3ZDXF 4B5EA 4D0BA 2J6EH 5CCKH 3FT4A 1A1OB 3D48R 1N6QH 5J9PB 3NGBB 1XEDA 3TIEB 3MRHA 3O8XC 5IMOA 1CF8H 4PJBB 3MRJB 3REVB 2EDRA 4IMLA 3ESVF 3BKCH 4IJ3C 4JM2C 3TYGL 4F8QA 5GIRB 4D9RD 2C9AA 1KN4H 3RWFA 2O61A 1V05A 3H9YA 4WI6A 5D2NE 1B0GB 4YHYC 1FZMB 1OP5K 2NR6C 3UTPE 4E41A 3F8UB 3KYOA 4JANB 4PY8J 2Z4QB 3SO5A 5FDWB 5C0EA 1F5WA 2FH6A 4XI5D 2D9CA 1BX2A 1NEZA 2RGSA 2Z35A 4YQXL 2A9ML 1G9NL 1CXIA 2DLEA 3VFSB 1DUZB 4F7TB 2YRPA 3JV6A 5CHNA 5C07E 3OQ3B 2CLZB 4Y89A 5D1XB 2B4CL 4HKXB 3EHBC 5DURD 4JRYA 2JELL 2NX5B 4MA8H 2R2BA 4L4VE 4MDIB 1RURH 2MJWA 2WINB 2VL4A 4TUOB 1SVZA 1C08B 1NKRA 4PRHD 2ICEB 2P5EE 1ES0A 3MUGA 4X98A 5D2LF 4HCRL 5HYQB 4KQ4H 3KPPA 4Y5VC 4DOHE 3GI8L 1IKFH 1A1MB 4M7KH 2GHWB 5JW4N 1ZSDA 5GGRA 4FS0A 2I07B 3PIQA 4UQ2A 1FIGL 1MPAH 4W4NA 4FQXD 4Q7DA 4RFOL 2Y6SC 4ZXBD 2NY1D 1BFOA 3W0WD 2DF3A 2AXFA 1ND0B 1UZ6F 2OCFD 4P23D 4Y4KA 3TN0D 4LQ1A 5IFHH 1T7VA 3LDBB 5ACZB 3NCYS 1AC0A 3T0ED 1GXEA 2BNQD 4NQDE 4XPGL 5HY9A 4ZUTA 4MHHG 3ROLA 5A3ID 1WFUA 1I4FA 2Q8BH 2VDKH 5CGYD 5DJ0B 4HF5L 4RMQA 3WV0A 3IFOA 3LEVH 4ONFL 4GBXB 2QADD 5E4EC 2WIMA 4W70A 1IAKB 3OHXB 1D9KC 2EDNA 1BBDH 3U7WH 2F5AH 4BFIB 5K9OB 5MP6H 1EMTH 4Q2ZB 4QRUB 5C3LD 3GSQB 4UINL 5GS3A 3B2VL 2AK4D 1JNNL 2WW8A 3X17A 4NNXB 1VGKA 5JPNB 4M1GH 4P3CL 2VLME 1NGWB 2W9DH 4MQSB 4OB5L 2GK0B 1VA9A 4DN3L 4JFHD 2A6JB 3FFCD 5F7MC 1G7JA 2ZKHL 5EU5A 3QIUB 3LKQA 3B3IA 1XGTA 4X9HA 3NPSC 2BVYA 2AJUH 1GGUA 2A1WL 5FOBA 1WFTA 2OQJB 5GGVH 2DICA 2F15A 3WD5H 1CVRA 2CK2A 4MAYB 4KKAC 3STZA 3LN5A 2J8UE 1RJZB 5KVGH 2X4SB 1AGFB 2X4OA 1TQCB 5CD5D 4S1RL 1VFMA 2YEZA 4DEPC 3QUXD 1WLHA 5ALCL 5ID0A 4HXAL 2EZ0C 1NC2B 3MCKB 1UACL 3TH4T 5GISL 3DHJA 5I30H 2IPKB 4FQXC 1NGPL 4JY6A 1IILE 4XNZB 5IGXH 3DECA 1T6VN 2ICWI 4Z18A 2CR6A 4P0DA 1UENA 3SDAA 4ZOEA 2QQLH 4WFED 1W0WA 1MJ8L 4PRPD 3IDIB 1INEH 4OCWL 5EBWB 2JLLA 5F9JB 4CMMA 1NUDA 3TT3H 2CKNA 5E00A 1S7VB 3RWJA 1WAAA 3BQUB 5C07B 4R96A 5IHBA 2GW5A 3WNPA 5FCUH 1FV1B 1A6VL 3H42L 1WJ3A 2XA3A 3BDXA 3MLSH 4GW5B 4M5YH 5AZ2H 5IVOA 5I8KH 1IGTA 3FAWA 3VFVB 4XRCB 4DZBB 4XCFL 3E3QE 1L9MA 2C4FU 4JFFD 4E0RB 3DTXB 1DSFL 2P5EB 2BY0A 4HGWA 1ED3A 2BHUA 2PTTA 3FRUA 3S9DB 1U93A 1AE6L 4O02L 3ARFD 4FABH 5DUML 4BUGA 4DKFL 3O2WL 5JW3H 1WCBB 1JMZA 2AW2A 2DM2A 3R8QA 1IC5L 3P4NA 4KVNH 5TE4H 3AM8C 3MLPA 1ZAGA 3EYVB 2VXSL 1BGXL 1RUQH 2CRZA 5EC1A 4BH7B 2X1WL 1H3TA 2G9HB 1NCCL 1QUNA 4O9HL 2E8YA 1URLA 4YPGB 2X4QA 4TVPH 4M9PA 3OR6A 1TIUA 3VFPB 1SYSB 4S0TD 1WZMA 3QEUB 2WZPD 2JTDA 3O45B 3HNTL 3HZKB 4NZUL 5CEZD 4Z7OE 3X3FH 2Y5TB 5DF0A 1LO3H 3LQAL 4XVUD 1KB9J 2RFXB 4MNQA 1J18A 1F3JB 5D5MF 3PJSB 2DIJA 4H5SA 1J8HD 5IROA 5DMKA 1BVKB 4K7FB 4P2RD 1WITA 5C71A 5IK3B 3GNMH 4XPAH 1YPZB 3MRDA 4F2MB 3E0GA 4LCCB 3T0VA 1S7SB 4D94A 3A6BH 5JUEH 3UTOA 3GMOB 1ZE3C 3ZT7A 1G7LA 2LE9A 4POYA 2DQIL 1RZJH 4AIOA 1H3WM 1PDKA 4P9MH 3SGDH 4UOW1 3HR5A 3QFJE 3VWKA 2PNDA 4TNWK 1KLGB 1DFBL 2NW3A 4W68A 3MV7E 2VL5B 5JLZA 2Q87A 1MQ8A 1T1XA 3OAZK 4F80A 3I85A 4Y8AA 4V2CB 1OAQL 4TSCH 3MFFB 2F19L 2GJZA 3QQ3B 3G6DH 2P8MB 2ED8A 2F54E 3SGJC 4NKMB 5LG1A 1BZ7A 2NY0B 3N50A 2DMCA 1WT5A 2IC2A 4PJXF 5L88H 3LPWA 1I8LA 4EDWH 3QUYB 5DK2A 2X1PA 2JIXB 5L2KD 2GIYA 3BZFB 4U1JB 4IOSD 2VISB 4RGND 1M71B 2WMPA 4FQJH 3WS6C 2C3XA 5E8DH 5MEPB 3ZYOA 5DEGB 3GSNH 4LPUA 1QFWM 4NHCH 3HC4L 2QR0B 5H37H 4NBXB 4POZC 3WFDL 4M5ZH 2UZXB 5ETUA 1RI8A 4XNUL 3JVGA 4X7TA 2DAVA 4GLRI 5F70A 1INDH 5FUOL 5I1LB 3BKJH 4KMLB 2OR7A 5KW9H 1U3HA 1CG9A 2NY5C 3WUWG 1Q72H 5E6ID 4RIRB 1L6XA 3EDDA 4HPOH 4LU5H 2J8OA 1IC7L 4PJ9C 1T89A 1T2QL 5AWNL 4XVJH 2BP3A 4OZ4B 5C0JB 3DXAE 4JREB 5EU6A 5K93A 1HZHH 4U1IA 3FQRB 4ODTL 3TV3L 3E6FB 2MCPL 3C2AH 3VFRA 1IL1A 3GJEA 4YIQA 2KQMA 4JCLA 4G8FB 3MNWB 1JCKA 1IGYB 1P2CA 2X4UB 3BP4A 1PEWA 3KJ6L 4FP8H 1R5WA 5J6GA 1JGUL 2FRGP 3QPXH 2JB6A 3TEUA 3D0LA 1S5IL 1CZ8L 5E70A 1S7RB 3QULA 5I8EB 2XTJD 1I9IL 1T7ZA 2HJFB 5F89B 1CD1B 1XF3B 4JRXD 5LQBH 4G5ZH 3ARXA 4HC1H 3NFSL 1YYLH 1ZVYA 1OP9A 1HH9A 5BOPA 43CAA 4X4ZA 1G7IB 3RKDD 1LO4H 3H7BB 3NOIA 3S3PA 5FO9B 1JJUA 1RZKH 4FMFA 5BJTB 4JLRA 4OKVB 5JORA 5I8CA 2V2WA 2XFXB 3HKFA 2C1OA 4KPHL 4MCZB 3UAJD 2VXUL 3VDBA 3KGRA 2ID5A 4OGYH 5A16A 4PJ5A 5I1AA 4YJZL 1CICC 4U1NB 5D6CA 3K1KC 1BLNA 1MRDL 4W6YB 1YEEL 4LLDB 4NO0D 2A74B 2NXYD 1P4BL 3UJJL 3V6FB 5FF6B 3V5HA 4OIIL 2IQ9L 3HE6D 3MRGB 4N0RA 4N0CD 3SE4A 2EDLA 5ISZD 2JJVA 2B0SL 3D3VD 3MJ7A 4ZUSB 2OJEA 1QFWH 2VJXA 2XYCA 2FL5A 1GGYA 2BC4A 4HXBL 3MV7B 3KYNA 5C0FA 1W72H 3GRWL 1UB5A 4LLVB 4MCYB 1N2RA 5KSBA 2ATPA 3TFKC 1J5OL 1BF2A 2R29L 4IDJH 4X7DC 1LNUA 1KLUA 2F54B 2DQFB 3V4VL 2XACC 3CXDH 3K2MC 4Y8DC 3HMWL 3UO1L 1NFDE 3HS0B 3ALWA 2YKLH 3S36L 4JFEE 3RGVA 4IHOB 4QXTB 1OB1B 3C09B 3CH8A 3CIQA 4O4YH 1N5YH 5FB8B 1EAPA 4PJEA 2N7AA 2EKSA 4M6NH 3FKUS 1HNGA 4KAQL 3O3AA 2FB4L 4N5UA 4RWYL 4DKDC 4N0YH 1GHFH 1MOEA 2YD6A 1SM3H 3NZHH 1RY7B 3TVMB 5IM7A 3KPRB 2YR3A 4NRYB 4I0PD 4XCNA 3HG1A 5IBUG 3V52H 3QIBC 4TULL 3NH7H 1AGBB 3QEQD 1CR9H 2VB5A 5IBLD 3EOAA 4XMKL 3VRJA 4X0KB 1QKZH 2B2XH 2H2PD 5ANMA 2PR4L 4RRPG 3WUWB 5EIVA 4HS3A 4LIQH 5FEBA 3L3JA 1B90A 1CGSH 4KI5E 1XIWB 3EDKA 3ILPB 3DXAB 3HRZB 3CFCL 4GRLC 4X5XA 4P4KD 2EDEA 1BEYL 5I1DB 1H8OA 4KMTL 1HEZB 5HGBB 5INCB 4ZQKA 4PREB 1NCDH 1UM6L 1TTGA 1E27B 3DO3A 3FHQA 4JKPH 4LCWD 3VW3L 4NPYA 4BZ1L 2OYPA 4EI6A 4LRIC 1D5IH 3U4BH 3TNMB 4MJID 3CFDA 5IV2B 3NFPA 4KVCL 4LP4A 4CBPA 4NQCD 3QDGE 4JO2H 4BQ6A 3PP4H 4OZIA 5HHOA 1NANH 1XGQA 4OFVA 4PJAE 5CEZL 2PTVA 3D2UA 4ZYKB 1P9MA 4NRXA 1P7QD 4KDVA 4R4FH 5BZWB 5D7JB 2Z92B 1MHEA 1MFNA 3OJ2C 4JDZA 3IAGC 5DD6A 1NEUA 3FOMB 3BSZH 4Y5XC 2LAGB 2QHRH 1DBKH 1AO7A 3TBYA 4TNVK 1E4JA 2E6PA 5EO0A 4F7CB 1U0QA 2R15A 3JUYA 4GH7B 4YDLC 5AYUL 4HIXL 1BJ1H 5EOQH 5BW7C 3W9DB 1NQBA 5DD3L 4BK5A 3DARA 5DR5L 1B0RA 1EO7A 5C92A 4QHNA 2YSSA 3O3DB 4PUBL 5F88A 3OKDB 5D1QC 1VENA 3ZHKA 1FG2B 3MV8A 5BVPH 3MRRA 5E2WL 1MFCH 1CCZA 4O51B 1MHPH 5EPMB 3LKRB 3WFZA 1VFAB 3FQTA 4KKNA 1QA9A 4QXGH 3QIWB 4R2GD 4QHKI 3SDYH 1KJ3L 1Z9MA 5L7XH 1RMFL 3VWJD 4DN4L 4HWBH 1DEEB 4NNYB 1MCOL 5IOPA 1MCWW 2IAMD 3UMTA 3OXSB 3MPCA 1IKNA 2AXGB 3QDJD 6FABL 4XC3H 1VEOA 4CVXA 3PDOA 2YN3A 4V2BA 2R1XB 3SE3C 5DHVA 3EBAA 5BRZA 1FL6A 3IJSA 4D9RE 4V1DA 2XNAA 2DWEA 4PG2C 1NFDB 1IEBA 4LNRA 1QBML 3LQZA 4J3VA 1MCPL 4YDIH 3QO0A 1NAMH 3BDYH 1R5IB 5C08D 1JPFB 2JCCE 4GRMA 5I0ZA 3REWB 5TQ2L 3HAEG 1HHIA 3BPNC 4NQXA 5DS8A 1QBLH 1WZ1L 5D6DA 3RDTC 4QRPA 5D8JH 5EU3A 1DL7H 5DLML 4BQBA 5T33L 5D70L 2CLVB 2A9NH 4K3HA 2X1XR 3H3BC 1JHLL 3HUJA 1AQDA 4U6VL 4X4XA 1R24B 4IDLA 1LO5A 4KUCF 5BV7H 5KVFL 4TVPD 1EFXD 2X9WA 3LRSB 5IHUL 3AY4C 2NW2B 3K4AA 2CKBA 4S10A 2IBBA 1JPSL 2AJXH 5IJKC 1H15A 2XQBH 1QEWA 4UIKH 4M4RA 5IF0A 4ZPVB 3VRIB 4TQEH 4LSDA 3GI9L 4GKZA 4KZEH 5I71B 1U8OB 4OQTH 2YMXH 3G5YB 4UTBH 1JRHH 5HDLA 4Z7VE 3SDDB 1OCWH 1GGCH 2IFFH 1AKJD 3WDJA 4BSWA 4JGMA 3RI5K 2G75A 5DD5L 1FO0A 3UTSD 2YC1B 3P40A 2V2TA 3KXFD 5J4MA 4Z8FL 3W0WE 3SEPA 4RQQA 1MY5A 4NN6C 3QB7C 4P46D 4X5WA 2MPAH 2FO1A 4NQTA 3VXSD 4P3DB 3QDGB 2ERJB 3T0EE 4QY8A 2V5MA 2BNQE 1DZBA 4PJAB 1WC7A 3CFBA 1WCQA 4KHXH 2WWMC 1MF2H 4P2YA 2OTWA 4NYLA 3R0NA 2J6EL 2ENYA 3ULUC 4KZDH 4EKXA 2W65A 1S8DA 3RZCC 1CF8L 3MV9D 4XXDA 3P2TA 4WHYG 1S9YB 1LHZA 3RWCB 3BKCL 4PJGA 5CIPH 1YDPB 3NIGE 5HHNA 3RY6A 1B4JL 5IW3A 3HC3L 3IYLW 1WWBX 3PWVB 3RL1A 5DI8B 5HYJA 5GGTA 2AK4E 5TFSH 5T3ZL 5C0NC 2XG5A 3E2HB 3FFDB 3QZWG 4LVHB 3HZYB 3BJLA 1INQB 4WWKA 4FQ1L 4JFHE 3ZTJG 4KJPD 4ZNEE 2C7UA 3L1OL 3S96A 2NY4B 4X6CA 2R2HB 3QI9A 2OR9H 3VMPA 1KTRL 3BHBB 4TOYH 2GSGB 4JHWL 4Z7UB 3D9AH 1ZGLP 3GSRB 1RURL 3LMJL 3MZGB 4YX2H 3KAAA 4P5TA 3P0GB 3TJHC 3S4SB 3PGDA 3QXWA 5SWQA 1KSRA 2X5PA 1AD0B 2X4PA 3DOSA 3TA3D 4KDTA 3JTTA 4XVTH 2NTFA 3X11B 5T1DH 2VR9A 2VKWA 1NPUA 1NMCB 1PZ5B 1DE4B 1JTPA 2VIRB 4LPVA 4FNLH 1IKFL 1A14H 3HHRB 3FQXB 1FFOB 3QEHA 3KS0H 3W11C 3W5NA 5C0IB 1KC5H 5BZDB 4U1LA 1RV6X 2J88H 4LHUD 3BO8B 3LPGA 4HMDA 1T04B 2CLRA 1RZJC 2JJSC 4L29B 1MLCA 1MPAL 4LPXA 5KSBF 3OKLA 1R6VA 3HZVB 4H26A 4WFEE 4PRPE 2WLYA 2JCCB 3BPLB 4PP1D 2DL2A 5ITFB 2Z93B 3MRLA 2L7JA 5C0BD 5CEXA 3Q5TA 1K8IA 2VAJA 1UH4A 4PJEF 4EQ2A 5HHPA 2OL3L 2VDKL 1U8QB 4Z7QE 3VFOB 1LP9A 1P1ZB 1ZTXH 1RUKL 2R4RH 3LEVL 5DURB 4OGXH 1VHPA 5HVHB 1BBDL 3KWWB 1A7PH 3U7WL 2QSTA 5IHZB 2FX9H 1LWRA 4UDTB 4U6TA 2OMNA 4PRHB 4DGYL 1OQXA 1I9JL 1VERA 1NCNA 3I6KB 1MFEL 4M1GL 5D71H 1I9EA 2J7LA 1JUFA 2W9DL 3IFLL 1FSKC 3HLAB 3NIFF 4FA8A 2HLFD 2WIIB 5KN5A 2DKMA 3ARBD 5FYKU 5ELIA 1GC1L 4G6MH 3UZQA 3K0WA 3GSOB 2OXGA 2VLRA 1U8IB 4XNXH 4CADA 3ILQC 4OGAD 1N6VA 1P5VA 4R7DA 1EJ6A 5F3BB 2H1PH 4FQXB 4HKZA 4ZXBB 1CTNA 2NY1B 3C6SA 5C6TH 3P9MA 3W0WB 3WD5L 3MV11 3HB3D 4KGLA 4PJFB 4P23B 4RFEB 3TN0B 3DHMA 4X8XA 3T0EB 4NO2B 5GRUL 5KVGL 2X4RA 1GZQB 4LGPB 4MDJA 1EEZA 3RU8L 3U9PH 5C7XL 4XP5H 4LDLB 3PL6A 2FIKA 3IJHA 4EN3C 5CKAA 3F7PC 4NDMB 1J8HE 4OZIF 4OCSL 1F8TH 3MGOA 2HRPH 1G9NC 5ESAB 1A6WH 4P2RE 1BAFH 1AGCB 4RMVA 1X5IA 2QADB 1LO2H 4YK4B 5EBLB 1L6ZA 2BNUB 3RTQA 5TF1H 5MENB 3GBNH 4AQ1B 4WO4C 1ZANL 4P5MA 2EDBA 5IMMA 4G8EB 2AK4B 3GSVA 5FHBH 3BIKA 1DN0A 2HJKA 4PP1C 5HI3D 5SX4H 1INEL 1KIQA 3EYOB 4QHLB 3VXUE 1RZ7H 1EA9C 2CDEA 3AS1A 2AEPH 3QZWB 1W2KT 5DT1L 3FFCB 4UV7H 5IESL 1HHHA 4HG4K 4Y4HC 1P5UA 4NM8H 1QTYT 1TDQA 2Q76A 1OWWA 5ICZA 1U92B 3VXTA 5GHWH 5FCUL 1MCIA 2HWZH 3O11B 4DFIA 4O2EA 5F1KC 4PRNB 3MLSL 3C87A 1F2XK 4M5YL 1G6RB 1RZKC 4MNGA 1XF2B 2BSTA 4C58B 3EO1B 3MRBA 2FSEA 3M07A 1HSAB 1PGRB 1YN7A 3U79A 1OAUH 4Y1AD 3JBG7 4IRJC 4QHUB 4QKXB 1X6LA 5DUBA 1XZ0A 4KJQD 5BXFA 3SN6N 1B9ZA 3NVQA 3VMNA 2AERT 2AV1A 3QUXB 4MSWA 2J3SA 5L2KE 4RGNE 4KVNL 5TE4L 4HIJA 1I8KB 5LGJA 3H6JA 1JWSA 4PGBB 5IMLA 1HHJA 2WUBH 1RUQL 3P73A 1VGEL 4OLWH 5DQ9A 4BQ9A 1QPPA 1NBQA 2XN9A 3OF6A 4TVPL 4PRPB 5SX4I 3CH1B 3E1F1 1I7ZB 1FGVH 5FKAB 2VDOL 1KCUL 4S11A 2IF7A 5I8OH 1MRCH 4X6BB 2HFTA 3TIEA 1MLBA 2XV6B 2XY1A 3B2UD 3OWEA 4NN7B 3QDHA 4WI2A 2ZNWA 3GNML 4PJ8C 4XPAL 4Q0XH 4JRYD 3LIZL 1CDYA 1B0GA 3X13A 1FZMA 2P5WE 3QNXB 5JUEL 1QQDB 3LPFA 4JFFB 4OCYL 2FJHA 1ACYH 3I02B 1T7WA 3VH8G 3WCYA 5B8CC 4JFQA 5EO1B 3ARFB 2ZUUA 4GQ9L 5L0QC 4P49A 3NIDE 5I1CL 2EIBA 5JW4R 1UCBH 4P9ML 1RK0A 3VFSA 3GJFB 1CN4A 4F7TA 3OZ9H 1QFOA 2CLZA 4JRXE 5GRJL 3DVGA 3SGEH 3TNNB 4TSCL 4L5FH 4ZFZA 4MDIA 3EGSA 2DJ4A 3G6DL 2D7TH 1PY4A 3MLVH 1PFCA 5F96H 3NFNB 3U0WH 1C08A 4ZDHB 5TGBB 5JOFB 2AI0H 4Y4KD 2BHZA 5L88L 2PUQT 3SDCC 4J8RB 2DWDA 1TCMA 4XBGB 5HYQA 4HJ0D 3LV3A 4NQSA 1LQSR 4G80A 1A1MA 1J8HB 3F65A 5DSCA 3ZKNC 5J06A 3OR7A 4P2RB 4YDVB 1S78C 2XICA 4H8WC 5E8DL 5FYLH 3RA7H 2I07A 3GSNL 4JVPA 3T3MF 2AABH 3HR6A 1G7PB 2GI7A 4LMQE 4N8VA 5EG6C 5I1IH 3K7UA 1TTFA 4X8JB 1ZEAL 3BKJL 1KIPA 5ISZE 1Q72L 1HKLH 3NPZB 4EQ3A 4PRIA 1F6AA 1J7VR 4HPOL 4L3EA 4LU5L 4MD4B 4NP4L 5CILH 4BUHA 4UNVA 1K4DB 4YBLC 3PQYE 4HEME 4XVJL 5JW4Q 3SGEI 5DJ0A 1SJHB 4PJDE 4GKNA 1AXIB 2FHBA 1HZHL 5F1OB 2A6KA 1J0KA 2APVA 3RP1A 3C2AL 4Q2ZA 3T0BA 4QYOB 1Q9KB 3GSQA 5FYJH 2AKRA 4Z7NE 2X70B 4WW2C 4ZOAA 2QV2A 3G9VA 4JHAL 5JPNA 2X1QA 5LGHH 1NGWA 2GK0A 1NDGA 1SY6L 4CVZB 4UOJA 5L2KB 4XX1G 4RGNB 3U0PA 4HMEA 4C83B 4YUEH 2WM0A 4XX1E 3SQOH 4B41A 4G5ZL 3C6LC 1FE8L 3QAZC 4XP9L 4ZUUA 4UNUA 4IRSC 3TCLB 5DMIH 3JWDH 3JV5A 2OP4H 4NWTH 2AAVA 1RJCA 5KS9A 1LO4L 3QEQE 3WJJC 1RJZA 4Y2DA 5E6IB 1NGQH 2ZCKH 3BMWA 4CW1A 2X4SA 2HVJB 4JHBA 2CMRH 3QG6A 1RD6A 1QO3B 2HTLD 3BW9A 1OWRM 1XGPB 3BYYA 4OGYL 1RHHB 3IS1X 3BGAA 3BVNA 4GAYA 5D2NA 4NM4H 3V5DB 5J11C 5TDPB 2OJZH 1M4KA 1LP9F 3GMNA 4GW4B 2UWEE 2HFFA 1B2WH 3MJ8B 4LCWE 4X99A 3R8BB 4BZ2L 4MJIE 2AS5M 1BFSA 2IBZX 1K6QH 4KROD 2XTJB 2XZCL 5C07A 3MQIA 4JRXB 12E8L 2B7DT 5CJQL 1W72L 2JJTA 4OBSA 5HD8D 3ZDZE 4GW5A 3KLAB 4L4VA 4OD3H 3FN0H 3WNKA 5KSAC 1V8HA 4R8WH 4IDJL 3LHPH 5IFJB 2V7HA 3CXDL 1UWXK 1DQJB 1CS6A 1SYVB 2P5EA 5GGSA 4ZAKC 2YKLL 4RMTA 4FQHB 3NA9H 4O4YL 1RUMH 4XP1L 1CLOH 1N5YL 1TPXB 3SCMC 2CIKB 1T2JA 4N0FB 4MNQD 2ESVE 2VTFA 4HIIB 4OGZA 5EA0H 3CVIL 4N0YL 5E03A 3FZUC 4NCC2 4Z78B 3L95A 1GHFL 2R8SL 2CD0A 3INUH 1ADQA 1OOAA 1SM3L 3NZHL 1TQBB 3QO1A 4JPKH 5DWUL 2NXYB 5IKCA 4LSUL 3HI5L 4W6WB 4YPGA 1HOCB 1EH9A 3VFPA 3V52L 4AL8H 2LVCA 2CH8A 1CR9L 3HE6B 2H32A 1RZIB 5F7DA 4NQDA 3UTTD 5ISZB 1QKZL 2Y5TA 1JK8B 2B2XL 5H2BB 2AEIT 3D3VB 1UFUA 3VWKD 1Q9OB 4M8QA 2EH7H 4OF3A 3VFGH 4KKCD 2XA8H 1Q9LB 4I3RH 4JAMB 3ET9F 4JDTH 3FB8A 3PWNB 3DYOA 1NCDL 3K8LA 3P77B 4KU1A 1EK3A 1LDPH 1D5IL 4BFGA 3L6FB 5C08E 4XNMB 2KUTA 5GGTH 2LTQB 5I76B 5E8NA 1JF1B 4YFLI 4JVUA 4LSRH 2W0KA 1KLGA 3O4LB 1I1RA 3TYFA 4LLQB 1KYOJ 1U8HB 4HUUB 4OCRL 2WP3O 2GTWA 3BP7B 4QXWA 3TH2T 5LWYH 4YHKH 3RJDA 3BSZL 4TVPE 4I0PB 1DQQA 4F33A 3MMEB 5J12C 1ZA3B 2V17H 4JO4H 4LLYB 3I3EA 4HIHA 2QHRL 1NGXA 1DBKL 4NC1E 3QEQB 3PWJA 2J8UA 3ZE2E 5I1EH 5DJYB 3C8DA 4X7SH 2HA1A 4ODXB 4L3CB 3IAPA 4X83A 5TH2B 1JWUA 3MR9A 4HKBA 4NWUH 3T0AA 4LBEB 1CDIA 1NBYB 5EOQL 1U8LB 4QXUH 3RIAF 3BZFA 2AGJH 5FM5O 4MAUH 2VISA 3SHSA 4NQVB 2BVOA 1BWMA 2DQTH 3V79C 4P4KB 3DIFA 3ULVF 5MEPA 1CFVL 3DRQA 3MLRL 5DEGA 1P4LA 1YMHA 5BVPL 2MNUA 3IKCB 5C0DB 1MFCL 4GRWB 1EBPA 3MCLH 3V9FA 4PJBF 4QRSB 5CINH 3UTSE 1JBJA 3KXFE 3O6LL 1WBZB 3AU1B 3GIVB 4R4NC 3IDXH 4K94C 5I1LA 2IADB 4LCWB 3U6RA 3DGGB 3QXUA 1DTUA 4XTRD 3SDYL 4MQTB 4MJIB 1LO0L 1FZJB 4RIRA 5EOTB 3VXSE 4NQCB 1Z5LB 2BMKA 4HWBL 5JXEA 1C16B 4JZJA 1KFAH 5JO5A 4WTZA 1P7QB 5H35A 1I1AC 2WBJA 3DMMC 1R0AH 5DVOA 1FFPB 4JPIB 3MV9E 4NKQB 1TJHH 4FXGB 4XCYB 2FYYB 3MRIA 2ZNXA 3CXHJ 3NCJH 1S7QA 1M7DA 4G8FA 4M1CC 5GGRY 2NXZC 3ZMRA 3ARGA 1IGYA 1T0MB 2ITCB 2VE6A 3BWUC 2C1PA 2I9TB 2DDQH 4WJ5B 4YDIL 1NAML 3BDYL 3H2WA 35C8H 1PG7X 4TUJA 1S7RA 3MGAA 4YHOH 5D8JL 5F89A 1N4XH 1XF3A 4ZSOE 1PG7W 2BVEA 1W0YT 1F4WH 1ZGLM 2A9NL 4PJ5D 3BH8B 2ZCLH 3BGMA 3NACH 3V6OC 1FNGA 2Q20A 4WV1A 4DCQA 4KK5C 4JG0H 4ODVH 3RWIB 4WFGD 4CDGC 4R2GB 5GS0L 3BYTA 2B8OT 3HTLX 2AJXL 3LN4A 2XQBL 3PXJA 1N64H 4LSQH 3GM0A 3VWJB 1YEKH 2ZOKA 2K9UA 2IAMB 1U8KB 4TQEL 2B5IC 3F58H 2VH5H 3QDJB 4J3TA 4P59H 1CGWA 2Q86A 3TO4C 4OF0A 4KZEL 5CWSA 5HGDA 1CE1L 4BSJA 4NN5C 2YMXL 4Q6IC 4B50A 2AJYH 1BVLA 3PNWA 4LHUG 1JRHL 4WW1A 1OCWL 1GGCL 2IFFL 4LLUA 1RZFH 3L3OA 1W0VB 32C2A 3V6FA 3CDFA 5FF6A 1MCHA 1M6OB 3GSWB 3RGVD 1LILA 2OBGA 1EHAA 3MRGA 4Q97A 5DEFB 1GL4B 5C08B 2MPAL 3QFJA 1G7HA 1A47A 1N7ML 3JWOC 4L8SC 4BQCA 2Z0BA 1ZLVK 3RNKB 2DQGH 4F3FA 3L3IA 2JK5B 1MCCA 4JQVC 1AHWB 3MV7A 4KTYA 5C0BE 2I5YH 5A2JH 4JFDE 1F4HA 2HRLA 4TUKH 1EJOH 4GMSH 1EFXB 3SO3B 2F54A 2DQFA 4L8DA 5IW1B 4FXKA 5IR1A 5DVNA 3WEXA 1GPOH 1BFTA 1IAIM 4PJHE 4PV9B 5D2LB 4NQEA 4ODBD 1LK3H 1S9WB 4HH9B 4L3AA 5FB8A 2IH1B 5F9WC 2F5BH 1MH5A 3PUCA 2RR3A 4YR6B 2APWA 1XCTA 1RZ8A 5DVMA 1TJGH 2P8LB 5FYLD 3G6JE 4XB8A 3LKNB 2PYEA 5LCVL 2OR9L 4Z7WE 4XHQA 1S9XB 1AKJB 3Q1SH 2C3WA 4TOYL 4OLUH 2MQCA 1JI2A 3D9AL 3OB0H 3IDUA 3I9GH 4RGMB 3UTSB 1WZLA 3KXFB 5FV2A 4YX2L 2YZ8A 3I2CH 1CGYA 1YUHB 3FO9B 2R4SH 1RIVH 2H45A 4P46B 3QCTL 3VXSB 3DURB 3ZE0E 3WUWA 1YJDC 2VDRH 2P47B 2VDNH 4APQC 5E99H 5T1DL 4ETQB 1RJYB 4QRRA 2P1YA 3C2SA 3ILPA 4QCIB 4F15C 5I1DA 1BJ1J 4OZGE 3MV9B 2Y72A 1KC5L 2FDBP 5FYJD 1JZ4A 2J88L 3QXVA 5INCA 5IMKB 5CBEB 1U8NB 1J1OL 3IFPA 4UBDC 1AO7D 2YD2A 3GSUA 2WUCH 3DX9B 5T5FH 5JDSB 1CFSA 1WV7T 1EXUA 3F7VB 2H9GA 4FN0A 5CJXC 1RJLB 1TENA 3A6CL 4PGCA 4ZSOB 1FN4A 2EICA 3GSNB 1FSKB 4LPYA 4NRZB 3MV8D 1N5AA 2GUOB 5EZLA 4XMPH 1ZTXL 2R4RL 4KKBC 4ONOA 2M8XA 4YDKH 2R1WB 3GMMA 3ZKXC 2VR4A 1R3IL 1A7RH 4F7CA 1FZKB 5DFVD 1R3JA 4N0UE 1YEFH 4TN9A 1BP3B 3L5HA 3TA3B 4LIQE 5D71L 5BQ7B 4JFYA 5D1ZC 1TVHB 3LH2H 1AY1H 4GS7C 4QWWC 4O00A 1IAIH 4F57H 3CX2A 4MXQD 3BD5A 1QZ1A 4HWZB 4F37F 1YMME 4LHUB 4O51A 5EPMA 2ARJB 5BRZD 2PW2B 3D0VA 4X6DA 4ELKB 3JSSA 2ZJSL 4V1DD 1YPZF 4F7EB 5C6TL 4C59B 1M05A 2MQ0A 5DQDH 4UMGA 2NY2D 1UGNA 1NEZG 4KKLD 4GXUN 1HHGB 3ARDA 1LE9B 1DEEA 3PP3H 4U1HA 4QRPD 5C0BB 3U9PL 5DK0B 2DL9A 1KOAA 1ERNA 1UWGH 3L5XL 4QGTA 1FBIH 1MIEH 4DVRL 4CAGA 3F7RA 7CGTA 5F97E 5HYSG 1MEXH 2HRPL 2HN7A 2UYLA 5B4MC 5HGAB 4OM1L 5IEHB 4JRYE 4RFNC 1CWVA 5EO9B 5TF1L 1K5NB 3WXVH 4I8DA 4PJHB 1NFDA 2FZ3A 4XCEB 1CD0A 4DK6A 5EOCH 2A38A 4JFEA 5FHBL 1MFDH 2NCMA 4PGJA 1R5IA 5LGKA 4GKSA 5FGCE 4RAVB 1NL0H 4IOIA 2J8UF 1JHTB 2AEPL 2DLGA 1IC4H 1KCKA 2N4IA 4UV7L 3ARBB 1T4KA 3G6JB 3GSXB 4NM8L 3WIFB 2CLVA 4P9HH 3FOLB 4J4PC 5GHWL 2WANA 4Z7WB 3BN3B 2HWZL 4EVNB 4QHMA 2GJ6E 3BXNB 2X10A 4XP4H 4HUNB 1JPTL 3CK0H 4K7PH 3QJHB 3VFMA 1WTGT 1OAUL 4QO1A 3KYKL 3FT2B 3PGCB 2XXCB 3O2VH 1CDBA 2QEJA 3OAYH 2ADJB 3X14B 2NY6C 1KNOB 4R0LC 4YBHA 4ZPVA 3IDJB 1SQ2N 3D18B 1W72B 2PXYD 5HHVH 4RRPA 4A2MA 2B1HH 5IVXE 3G5YA 4Y5YC 4OZGB 2IQAA 4WU5A 3H9HA 2WUBL 3RWHB 1QVOA 3O8XA 4OFDA 3WN5B 3RPIB 5DO2D 1AFVH 4OLWL 1HYSD 4JM2A 4HFWA 4JFZH 2BSSB 1J10A 5HYJD 2VXVH 4WNQA 2XY2A 5FA4B 3NTCH 1H0DB 1X5YA 5E8EB 1JNHB 1H5BB 1P4IL 2BERA 5EORL 2CK0H 2EXWC 4PJAA 2V7NA 4I1NB 4WWKD 1NJ9B 3W5MA 1YY9D 1I8MA 1MRCL 1XMWA 2BSRA 4GT7A 4PRAA 3QI9D 3CDGB 2A77H 3RWCA 1GC1C 1JHKL 1Z0NA 4PJIB 3OB8A 1OL0A 4LVOB 3UPRB 1MCEA 1RZGB 3LQMA 1S9VA 3OX8B 1A7OH 3TPUA 5MI0C 3UPCA 4U6HA 4Y1AB 4OCNC 4P5TD 5KZCD 2OI9B 5HI4D 5FUZH 3PWVA 1ACYL 3KS0J 4ZFGH 4N0UB 2HT2C 1CIDA 2CDGB 3O41A 4G43A 3G04B 3RGHA 3RVXC 1INQA 3QHZH 1GIGH 5ABDE 1UCBL 1MJUH 3UJIL 3CFJA 3K74B 4D0BB 1UCTA 3OKYA 3FT4B 2UVFA 3MLWL 3OZ9L 4Y5VA 3MRHB 3OJVC 5IMOB 5F44A 2GQHA 4JJHA 2DKUA 5ALBH 5HYFA 4L5FL 2O61B 3DRTB 2D7TL 4UT7H 4R4BA 4E41B 4LGSB 4GMTH 5F96L 3AB0C 3MGTA 4LLMA 1G9MH 3KYOB 2J2ZA 2D7QA 3CSGA 1LK2B 2DD8L 4DTGH 1E6JH 1T1WA 4D9QD 3V7MA 1BX2B 1NEZB 2E6JA 2Z35B 3CU7A 2UY7A 1PZ5A 4LRNL 2G2RB 2VIRA 4JHZA 1KPRB 2IPTH 3JV6B 5CHNB 1WIUA 4H88H 3FQXA 5DO2C 3OTTA 4ERSL 5C0IA 5BZDA 4M6ML 4YBQD 4JRYB 5FYLL 1T6WA 1CL7I 3RA7L 4L29A 2AABL 4K3EL 4H0GA 4A6YA 5I1IL 1GGIH 5HDBE 4PBVC 1Q38A 4UB0H 4EDXA 3DV4B 1FAKT 1ES0B 2JCCA 3MUGB 4XP6H 4X98B 3RUGE 1SEBA 1BQUA 1HKLL 1F00I 1OP3H 3HFMH 3T4AA 3HAEA 4D0DA 2XIDA 1ZLUK 3MXVL 1WIOA 4MXWL 3R1GL 3CSBA 2DQEL 2Z31C 4LARH 5F6HI 5GGRB 3BRGC 3VFOA 3N0PB 2VLRD 5F8RC 2FJFB 4GG6A 3PIQB 4UQ2B 5D93C 1LEGA 3KG5A 4YWGL 5L8LB 3BKYH 3VDCA 1FYTD 1BFOB 5FYJL 1W8NA 2AXFB 2YOCA 5D7KD 4Y4KB 1Y18A 4GQPH 1BM3L 2C3GA 1NMBH 5LGHL 3LKSB 5IB3B 4MS8C 4ZUTB 4IS6A 1DN2A 3HLAA 3FL7A 3Q5YA 1I4FB 1CIUA 1QPXA 2VUYA 4HT1L 3UZVB 1PKQA 5AZEL 4LCIH 3VG0L 3S3JA 2NY3C 5D72H 4WU7A 4TSAH 4Z7VA 4KTDH 3IFOB 3SQOL 1UA6H 1U8IA 2M2DA 4UT6L 4M93B 3AUVA 5IB5A 2WBWB 4WEBH 3L3GA 1EVUA 4LL9A 4U7SA 5B39G 3DUHA 4FQXA 3C5JA 4L9LC 1NAMB 4G6JL 5DMIL 3JWDL 1X5KA 3W0WA 2OP4L 4NWTL 1FPTH 2CSPA 1VGKB 4MMZC 3DWTA 3QNYA 2DB8A 4NO2A 5T1KA 2BNQA 4HS6A 3UTTE 4DGIH 1NGQL 1GZQA 3IJYA 2ZCKL 3J7HA 1OTTD 2CMRL 4XWOC 1G7JB 2DI8A 5FYKD 4FQQA 5KTEH 5IB1A 5EU5B 4NDMA 3LKQB 4JEGB 1ULVA 5BV7B 1HI6B 1XGTB 3T3PF 4PY8I 5FOBB 4KH2A 1Q1JL 2R1YA 4NM4L 2OJZL 1QLFB 5LBSL 1FVCB 1B2WL 3STZB 3LN5B 2HMIC 1A9BA 4KV5E 5EBMA 1JP5A 3QZWA 2X4OB 3O9WC 1KBGH 3KPMA 4EI5D 1IEHA 4ZNEA 3P11H 3QYCA 5H94A 1U92A 1NBVH 1HILB 3TP4A 3OPZH 3LS5H 6CGTA 3VFTA 3CVHA 1G6RA 3AM8A 3S36X 5L2JB 3WMSA 3FN0L 1HSAA 1IBGH 4NNPH 5CUSL 3UTZA 2XN9D 4RNRA 1IGMH 1KB5A 2WQ8A 1DQMH 2E7LC 3OF6D 4JY4A 2DBJA 2R0KL 1XF1A 1U58A 2FEDD 3MA9H 1CD8A 4OF8A 2CKBL 3GRWA 5EUOE 1RUML 1CLOL 4JFXA 2DJSA 5E00B 4HK0A 4RDQG 5E2JA 4LSVH 5EA0L 3RWJB 2V2XA 4R96B 3CUPA 4OFKA 1NFIA 1Q9WB 1AC6A 1IGTB 3SBWC 3DGCR 5BO1L 4JPKL 4I77H 2X4NB 3M8OH 5CJOL 4PRPA 4U3XA 1RULL 2V9RA 4HGWB 4AL8L 1ED3B 1FO0L 2PTTB 4K3JH 4LQFL 1WEJH 1X44A 3GB7B 2XQYG 3RUGB 1FJ1A 1NFDF 1OTUD 4JB9H 4JM4H 3EZ8A 1UADC 4KROB 3RWGB 1ZVSB 3RVVC 4X6BA 3CLFL 2EH7L 3P4NB 4GSDH 1CXEA 3VFGL 3PWLA 3TZVC 1XCQA 3UTQB 4I3RL 5CSBA 2VERN 5AG8A 5IBTL 4YXLL 1X6NA 3EZJB 5E0QA 1QQDA 4LFHD 1RAMA 2X4QB 5J3HC 3OR6B 1VEMA 3SGJA 5ENWA 1LDPL 2DQCL 5EO1A 5TE7L 5JXAL 3QG7H 5GGTL 4MNQB 5IT2L 4KRPC 5SV4A 2LAAA 3GJFA 2K7PA 3N9GL 4LSRL 3SE8H 4H5SB 3MX0A 4AMKH 3RKPA 1YNLH 3FO2A 3RL2B 5DMKB 2MOVA 4PJ5E 4OCXH 1IEAB 3WS6A 1AXSB 1OGTA 5LWYL 4YHKL 2W1NA 3ZHDA 5ITBL 2FEDC 3IDGB 5B39B 3NFNA 4ZO9A 5TGBA 5I74B 4YH6A 4WFGE 1G7LB 1RVFH 1ZT4A 5SWSE 5JIIA 1C5BL 4X7SL 3UTTB 5HYEA 4QRQA 5F6IB 4J8RA 1ZLWK 4KHTH 4PRID 4NWUL 3HR5B 1IGJB 4PR5B 3VWKB 3IXTA 1CXKA 4OZFH 1FRGH 3NN8B 3WSQH 4QXUL 4OLZL 2NW3B 4MNHA 4MAUL 3B8YA 4M1DL 4PJAF 4U31A 2DQTL 3RVUD 1T1XB 4YDVA 2KKQA 4AEFA 3PABA 3QWOA 5T1LA 2GJZB 3CSYA 4ZTOH 3OKNB 5CP7A 4NKOA 1BZ7B 5CINL 1KLFA 5F9OH 1U6AH 4YC2C 4X8JA 2X9YA 3HMXA 3VXUA 4TPRH 4HJJH 3ESUF 5JDJA 2ZPKH 4UIMA 4AENA 5I16A 2X44D 1K4DA 3LAFA 5HVGB 3CDYA 4LVNB 1KFAL 3CX5K 1SJHA 3C08L 5J89A 3ZKMD 2PW1A 1TJHL 4JG1H 5CSZB 5ETUB 1Q9KA 3NCJL 4Z7UF 4X7TB 1H3XA 1U9KA 2X89A 1U3HB 1CG9B 5FGRA 3WYRA 2ITDA 2D31B 2DDQL 1HK6A 4Y2DD 1CLCA 5EUOB 35C8L 1H8SA 5L2KA 5HBBA 4YHOL 5HPOA 3C5ZC 4C83A 1N4XL 1Z3GH 4Z0XB 4J1UB 5FYLE 2C3VB 4U1IB 3FONB 3NACL 1RUPH 2WBKA 2YA0A 3VFRB 1CICA 1IL1B 1MVFA 1KJ2H 5T3XH 3L3HB 1EGJH 3GJEB 4YIQB 3SKNA 4QTIH 4JG0L 4LDEB 4ODVL 4C4KO 1P2CB 1MY7A 3BP4B 3ZLQC 1UXWB 5LAXB 4HULB 2XKSA 3B5HA 1R5WB 4OLYH 5D7SH 5J6GB 1N64L 1ZT1A 4U6XB 2X9XA 4LSQL 5EU7E 4F58L 1YEKL 3D0LB 1QO3A 1OAKH 2JCCF 3QULB 1MCWM 4XNYL 3T77A 4CL7A 4P59L 4KJWC 1GJIA 2WSKA 2JJWA 4F7MB 1RHHA 4L4VD 2AVGA 5CSGA 5FYJE 3ALPA 2P5WA 1RZFL 2QSCL 3X12A 4Y16C 3K4ZA 3K2UH 4GW4A 3DSNA 1AO7E 5F7KC 4XPFH 1J11A 3MJ8A 3VGDA 1R5VA 3HPJB 4NUJA 1A4KB 1HKFA 5HHXH 4QNPE 3VH8A 5JORB 1BMGA 3CNKA 5I8CB 3I50L 4LVEA 2V2WB 3LEYH 1I9RH 2DQGL 2C1OB 3N06B 2AV7A 4G8GD 3U30B 2Z91A 2FLBT 5A16B 2FJGA 1FFNA 4PJ5B 5I1AB 4WUKH 5FYKL 5D6CB 3KPLA 4TUKL 1BLNB 4GMSL 3MV8E 4RSVA 1A7NH 3KLHD 5IFJA 4Z7VF 3MCG1 5SX5K 1GPOL 3D39D 1SYVA 4H25A 4IEFB 3QIBA 4R90H 2ORBH 1U8JA 4FQHA 1A6UH 1LK3L 5GZOD 2N7BA 4XC1L 2CIKA 2F5BL 5GGQH 5BCAA 2FL5B 4PJFF 4U1KB 4OCMC 2BC4B 2Q1EA 1U8MB 3BMVA 3HNVH 4FFVC 5JIHA 3KYNB 5C0FB 3ECBB 5CJ8A 1N2RB 1P6AB 3DUUB 2CGRH 4NO0A 25C8H 1U3JA 1KLUB 2GY7B 3O6FC 4V1DE 5CZKA 4DUXA 1MCLA 3NIGF 1BQSA 3I2CL 2VLMD 2YPVH 3RGVB 4KXZI 2R4SL 2ZUSA 5ISZA 2AJVH 5I73B 1OAZH 4HUWB 1EAPB 1KXTB 4LRIA 2EKSB 1C5DA 2VDRL 3O3AB 3P4MB 3PQYA 1SVCP 1JPGA 4MLIA 4U1GB 4PJDA 1UWEH 3HE7D 1DBJL 3IDNA 1T1YB 4WY7H 4HUVA 4PTUA 4ZS6D 1UYWH 1AXTH 4FG6D 3AVEA 2ADIB 4HBCH 4XCNB 3TIDA 4Y5XA 2ZG3A 3B8SA 3P77A 2WUCL 1OW0C 3BAEH 3VRJB 1HQRB 4J12A 2NYYC 1QNZH 5ANMB 1H3PL 3TCXA 1UM4H 1PSKL 4G6AD 4GW1B 4HS3B 4WFFD 2HT4D 2ZUWA 5ADOH 2RB8A 4Y4FC 3FJTA 4HUUA 2EC9U 4X5XB 1MSPA 1T1ZB 3BP7A 3MJ6A 1X5GA 1KV3A 1S9KC 1VESA 3QCVL 3I6LD 4I0PA 4YDKL 1ZA3A 3CZFB 1CDCA 2QQKH 3MODH 2EYTA 1KENL 5JIPA 1FL5B 4OLXH 1FLTX 1MELA 4EI6B 1A3LH 3CFDB 3L7EA 4LBEA 5M94B 2NY7L 1BWWA 4KK8D 4OZIB 3N85L 3P0YH 3SDAC 5DRXA 1F42A 4XVSL 4NQVA 4NRXB 3LH2L 1AY1L 3TGXA 1SBSH 3P9LA 4UOW0 3UBXG 2WBJD 4P4KA 1MHEB 4F57L 3SJVD 4JDZB 2E7BA 3VJ6B 2P46B 1FNHA 2BJMH 4PJGE 2FX8H 4Z7QF 2VXQH 1OP5H 1FORH 1AO7B 2UWEA 4RA3A 3SE3A 3TBYB 3WLBA 3GZKA 3ARPA 2IADA 3ARGD 5EO0B 5HYJE 1PLGH 5D96B 5DQDL 4PG2A 3FO0H 4JKMA 5EOTA 5C2BH 1DDHA 4K71C 5JMRA 3U46A 1K85A 4NKDA 2YD9A 2ZUQC 1V3MA 4MVBC 1P7QA 3CFEA 1B0RB 1G84A 5F1SA 4QHNB 2YSSB 1UWGL 3RDTA 1MIEL 5F88B 4N5EC 4XNQA 4JPIA 1Z0MA 3MV8B 1CI5A 3MRRB 1BF8A 3EIFA 1EHNA 4FXGA 2VQ1B 3D69A 2GT9A 3KDMA 3FQTB 4MX7A 3O4OC 3WXVL 1U3ZA 2O5ZH 1UZ8A 2ITCA 3TT1H 3AY4A 4WWID 5EOCL 1J87A 2LU4A 3QXDA 4GAGH 4R26H 1LEKA 3EFFB 2E9WA 3RVWD 1KELL 3VGAB 2ESVA 5IJKA 3EDJA 1NL0L 5IOPB 2AJZA 5ADPH 1UKTA 2AQ3A 4KQ3H 1N3NA 3GMRA 2QQNH 5DHYA 5E2VH 4AG4L 4EOWH 1P84K 4CVXB 4PLJD 3K46A 3BH8A 4P9HL 4FXLA 2PCPB 5DHVB 4E9LA 5BRZB 1FL6B 3W2DH 5I75C 4XP4L 4V1DB 3MA7A 3CJJA 1BOGA 2XNAB 4PJ7A 2DWEB 4K7PL 1R3KA 5HVFB 3H3KA 4LNRB 2FD6L 3PE9A 3QO0B 2NY2B 3O3EB 3BX7C 3QFJD 1HHIB 4NQXB 2DBLH 4D9QE 4JJ5B 1MHHB 4QRPB 5HHVL 5EU3B 4NT6B 2B1HL 3OG4B 5I18H 1WFOA 1JGVH 1T66C 3HUJB 1LO5B 3ZL4L 1FNLA 5E9DD 2DYPA 1W0VA 1Q94A 4ODSH 4RBPK 1AFVL 3CCHA 1IGFH 3TM6A 2CKBB 4JFZL 2C3HA 4K7PY 2EDKA 1H15B 4NQED 5C08A 1QEWB 4YO0A 1FDLH 5IF0B 2CK0L 5IVNA 2W0PA 1FFRA 4G7VH 1DBBL 5JZ7D 1WT5C 1C12B 1MREL 1SBBA 1RQ5A 4FFYH 2PYED 4R97C 1I8LC 2A73B 3UEZA 4KGJA 3VXME 2ZSVB 4M6OH 3CVHH 3BP6A 1CL7L 3VRLE 3B9KC 1YEHL 2IPUK 2V2TB 2PN5A 1FYTE 5FUZL 4RQQB 3LS4H 8CGTA 3QQ9C 4X5WB 1LMKA 4HH9A 3QPQC 3BUYA 4IM8A 2IH1A 3VXNB 2PXYB 1WC7B 3QHZL 4R9HA 4QRRD 1WSST 5J6HA 2OTWB 4NYLB 1ZWIA 3EO0B 3LKNA 1CFNA 1S8DB 1HH6B 3I75A 4XXDB 3UBXB 4KMQA 1AKJA 4PJGB 5FGBC 5DJDB 5ALBL 3V5KA 3UTSA 5HHNB 1ADQL 2HFGL 4UILH 2EC9T 2JJSA 1YUHA 4UT7L 1VACA 3T8XA 3WFEH 1KCVH 5HYJB 3S88L 1BHGA 2CQVA 1G9ML 1HHKA 4DW2H 4NFDA 4JO1L 4M48H 4WWKB 1ONQA 4LHJB 5GGSY 2C7UB 4K2UL 4WTWA 2WWKO 3NIDF 1Z2KA 1NC4A 1XF5A 2VYRE 1XGYH 3S96B 3WLWD 4X6CB 3QI9B 4PD4K 1QHPA 2J5LB 4H88L 3T0XA 3GMQB 2FGZA 4I18B 4YE4L 4FZ8H 4MQXC 2HTKC 4YHLH 1DLFH 1U8NA 2X6MA 4P5TB 5KZCB 2BOBA 3PGDB 4K9EH 1LDSA 4HDIA 3U7YH 4YFEA 4AYFA 5ILTL 5SWQB 1GGIL 3S37L 5B22A 2X4PB 1BIIA 4UB0L 5JDSA 3UP1A 2A6IA 4ZSOA 2DJUA 1LEIA 4U6YA 4NRZA 4PLKC 3DV6A 3QEHB 2GUOA 5T3XD 4U1LB 2R1WA 1B6DA 1MLCB 5I1KL 3RIFK 3OKLB 3BKYL 4M3KB 5D7IE 4LK4A 2XN9E 3PWPE 1N0LA 5E94B 5E8PA 1PQZA 2OR8A 4MWFA 5KOMC 2VABA 3TA3A 1QRNE 4NJ9H 1NMBL 1RU9L 3ARDD 2HG5B 1JFQH 4LPTA 5FO8A 3WHXA 5EOCJ 5CEXB 1K3ZA 4KC3B 3EYQC 1K8IB 1NLBL 2NY5H 2EE3A 2VKXA 5HHPB 4LCIL 5C8JA 5KG9A 4EN3A 1TCRB 3MO1A 4HWZA 3SE4C 4TSAL 3W82A 4KTDL 1OSZB 1UA6L 1H8NA 2ARJA 3WJLA 4WEBL 1A8JH 1QBAA 1MCDA 3EFDH 1BD2D 4JFED 1FPTL 1DVFC 3CMGA 1JTOA 2BZDA 1GOGA 4RAHA 4WO4A 3L5IA 4Z7NF 1JUFB 1LE9A 4DGIL 4UZGA 4PGZA 5C0BA 5CZXD 4HC1A 4JFDA 3IFNL 3OAZH 5DEZA 4RMSA 3NCYP 2ATKA 1PD6A 2M26A 2VLRB 4XHJC 5TDOA 1Q0XH 4LFHG 4R7DB 4AIZB 3WE6B 1K5NA 4PJHA 8FABB 1FYTB 3C6SB 5SWZD 3P9MB 5B38G 4KK6D 2WV3A 4U0RB 1QLRB 3CSPA 5DZOA 4KRMB 5JHLH 4RAVA 4HKJA 3F7YB 2X4RB 4IRJA 4LSSL 3U4EA 4MDJB 1ITBB 4XBEH 4KI5D 4U7KA 1VKXA 3PL6B 3MOQA 2FIKB 5I6XC 3Q6GH 1KXQE 2OTUA 3G6JA 4L4JA 4K8RL 3P11L 2PETA 3MGOB 2D4DA 3FOLA 1NBVL 3WDIA 3LOWA 4EVNA 1LD9A 3LS5L 4RGOH 3MC0A 1QACA 3O8XD 2EECA 4N8VG 4CU7A 1A3RL 1YYML 5T5NF 4JM2D 2FR4B 4NNPL 1FG9C 4P5MB 4YLQT 5IMMB 3R06A 1PEZA 1CQKA 1DQML 5CP3H 4GRWF 2GK2A 2HJKB 3BD3A 2NR6D 3KPNA 2YPKA 3IDJA 2CDEB 1JVKA 3LKOA 1ZK9A 1HHHB